data_3SMQ
# 
_entry.id   3SMQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SMQ         
RCSB  RCSB066393   
WWPDB D_1000066393 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SMQ 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dobrovetsky, E.'                      1  
'Dong, A.'                             2  
'Walker, J.R.'                         3  
'Siarheyeva, A.'                       4  
'Senisterra, G.'                       5  
'Wasney, G.A.'                         6  
'Smil, D.'                             7  
'Bolshan, Y.'                          8  
'Nguyen, K.T.'                         9  
'Allali-Hassani, A.'                   10 
'Hajian, T.'                           11 
'Poda, G.'                             12 
'Bountra, C.'                          13 
'Weigelt, J.'                          14 
'Edwards, A.M.'                        15 
'Al-Awar, R.'                          16 
'Brown, P.J.'                          17 
'Schapira, M.'                         18 
'Arrowsmith, C.H.'                     19 
'Vedadi, M.'                           20 
'Structural Genomics Consortium (SGC)' 21 
# 
_citation.id                        primary 
_citation.title                     'An allosteric inhibitor of protein arginine methyltransferase 3.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1425 
_citation.page_last                 1435 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22795084 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.06.001 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Siarheyeva, A.'     1  
primary 'Senisterra, G.'     2  
primary 'Allali-Hassani, A.' 3  
primary 'Dong, A.'           4  
primary 'Dobrovetsky, E.'    5  
primary 'Wasney, G.A.'       6  
primary 'Chau, I.'           7  
primary 'Marcellus, R.'      8  
primary 'Hajian, T.'         9  
primary 'Liu, F.'            10 
primary 'Korboukh, I.'       11 
primary 'Smil, D.'           12 
primary 'Bolshan, Y.'        13 
primary 'Min, J.'            14 
primary 'Wu, H.'             15 
primary 'Zeng, H.'           16 
primary 'Loppnau, P.'        17 
primary 'Poda, G.'           18 
primary 'Griffin, C.'        19 
primary 'Aman, A.'           20 
primary 'Brown, P.J.'        21 
primary 'Jin, J.'            22 
primary 'Al-Awar, R.'        23 
primary 'Arrowsmith, C.H.'   24 
primary 'Schapira, M.'       25 
primary 'Vedadi, M.'         26 
# 
_cell.entry_id           3SMQ 
_cell.length_a           70.649 
_cell.length_b           70.649 
_cell.length_c           171.977 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SMQ 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein arginine N-methyltransferase 3'                             38281.914 1   2.1.1.- ? 
'UNP residues 211-531' ? 
2 non-polymer syn '1-(1,2,3-benzothiadiazol-6-yl)-3-[2-(cyclohex-1-en-1-yl)ethyl]urea' 302.395   1   ?       ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                                                       35.453    1   ?       ? ? ? 
4 non-polymer syn 'UNKNOWN ATOM OR ION'                                                ?         10  ?       ? ? ? 
5 water       nat water                                                                18.015    223 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  ASP n 
1 21  LEU n 
1 22  GLN n 
1 23  GLU n 
1 24  ASP n 
1 25  GLU n 
1 26  ASP n 
1 27  GLY n 
1 28  VAL n 
1 29  TYR n 
1 30  PHE n 
1 31  SER n 
1 32  SER n 
1 33  TYR n 
1 34  GLY n 
1 35  HIS n 
1 36  TYR n 
1 37  GLY n 
1 38  ILE n 
1 39  HIS n 
1 40  GLU n 
1 41  GLU n 
1 42  MET n 
1 43  LEU n 
1 44  LYS n 
1 45  ASP n 
1 46  LYS n 
1 47  ILE n 
1 48  ARG n 
1 49  THR n 
1 50  GLU n 
1 51  SER n 
1 52  TYR n 
1 53  ARG n 
1 54  ASP n 
1 55  PHE n 
1 56  ILE n 
1 57  TYR n 
1 58  GLN n 
1 59  ASN n 
1 60  PRO n 
1 61  HIS n 
1 62  ILE n 
1 63  PHE n 
1 64  LYS n 
1 65  ASP n 
1 66  LYS n 
1 67  VAL n 
1 68  VAL n 
1 69  LEU n 
1 70  ASP n 
1 71  VAL n 
1 72  GLY n 
1 73  CYS n 
1 74  GLY n 
1 75  THR n 
1 76  GLY n 
1 77  ILE n 
1 78  LEU n 
1 79  SER n 
1 80  MET n 
1 81  PHE n 
1 82  ALA n 
1 83  ALA n 
1 84  LYS n 
1 85  ALA n 
1 86  GLY n 
1 87  ALA n 
1 88  LYS n 
1 89  LYS n 
1 90  VAL n 
1 91  LEU n 
1 92  GLY n 
1 93  VAL n 
1 94  ASP n 
1 95  GLN n 
1 96  SER n 
1 97  GLU n 
1 98  ILE n 
1 99  LEU n 
1 100 TYR n 
1 101 GLN n 
1 102 ALA n 
1 103 MET n 
1 104 ASP n 
1 105 ILE n 
1 106 ILE n 
1 107 ARG n 
1 108 LEU n 
1 109 ASN n 
1 110 LYS n 
1 111 LEU n 
1 112 GLU n 
1 113 ASP n 
1 114 THR n 
1 115 ILE n 
1 116 THR n 
1 117 LEU n 
1 118 ILE n 
1 119 LYS n 
1 120 GLY n 
1 121 LYS n 
1 122 ILE n 
1 123 GLU n 
1 124 GLU n 
1 125 VAL n 
1 126 HIS n 
1 127 LEU n 
1 128 PRO n 
1 129 VAL n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 ASP n 
1 134 VAL n 
1 135 ILE n 
1 136 ILE n 
1 137 SER n 
1 138 GLU n 
1 139 TRP n 
1 140 MET n 
1 141 GLY n 
1 142 TYR n 
1 143 PHE n 
1 144 LEU n 
1 145 LEU n 
1 146 PHE n 
1 147 GLU n 
1 148 SER n 
1 149 MET n 
1 150 LEU n 
1 151 ASP n 
1 152 SER n 
1 153 VAL n 
1 154 LEU n 
1 155 TYR n 
1 156 ALA n 
1 157 LYS n 
1 158 ASN n 
1 159 LYS n 
1 160 TYR n 
1 161 LEU n 
1 162 ALA n 
1 163 LYS n 
1 164 GLY n 
1 165 GLY n 
1 166 SER n 
1 167 VAL n 
1 168 TYR n 
1 169 PRO n 
1 170 ASP n 
1 171 ILE n 
1 172 CYS n 
1 173 THR n 
1 174 ILE n 
1 175 SER n 
1 176 LEU n 
1 177 VAL n 
1 178 ALA n 
1 179 VAL n 
1 180 SER n 
1 181 ASP n 
1 182 VAL n 
1 183 ASN n 
1 184 LYS n 
1 185 HIS n 
1 186 ALA n 
1 187 ASP n 
1 188 ARG n 
1 189 ILE n 
1 190 ALA n 
1 191 PHE n 
1 192 TRP n 
1 193 ASP n 
1 194 ASP n 
1 195 VAL n 
1 196 TYR n 
1 197 GLY n 
1 198 PHE n 
1 199 LYS n 
1 200 MET n 
1 201 SER n 
1 202 CYS n 
1 203 MET n 
1 204 LYS n 
1 205 LYS n 
1 206 ALA n 
1 207 VAL n 
1 208 ILE n 
1 209 PRO n 
1 210 GLU n 
1 211 ALA n 
1 212 VAL n 
1 213 VAL n 
1 214 GLU n 
1 215 VAL n 
1 216 LEU n 
1 217 ASP n 
1 218 PRO n 
1 219 LYS n 
1 220 THR n 
1 221 LEU n 
1 222 ILE n 
1 223 SER n 
1 224 GLU n 
1 225 PRO n 
1 226 CYS n 
1 227 GLY n 
1 228 ILE n 
1 229 LYS n 
1 230 HIS n 
1 231 ILE n 
1 232 ASP n 
1 233 CYS n 
1 234 HIS n 
1 235 THR n 
1 236 THR n 
1 237 SER n 
1 238 ILE n 
1 239 SER n 
1 240 ASP n 
1 241 LEU n 
1 242 GLU n 
1 243 PHE n 
1 244 SER n 
1 245 SER n 
1 246 ASP n 
1 247 PHE n 
1 248 THR n 
1 249 LEU n 
1 250 LYS n 
1 251 ILE n 
1 252 THR n 
1 253 ARG n 
1 254 THR n 
1 255 SER n 
1 256 MET n 
1 257 CYS n 
1 258 THR n 
1 259 ALA n 
1 260 ILE n 
1 261 ALA n 
1 262 GLY n 
1 263 TYR n 
1 264 PHE n 
1 265 ASP n 
1 266 ILE n 
1 267 TYR n 
1 268 PHE n 
1 269 GLU n 
1 270 LYS n 
1 271 ASN n 
1 272 CYS n 
1 273 HIS n 
1 274 ASN n 
1 275 ARG n 
1 276 VAL n 
1 277 VAL n 
1 278 PHE n 
1 279 SER n 
1 280 THR n 
1 281 GLY n 
1 282 PRO n 
1 283 GLN n 
1 284 SER n 
1 285 THR n 
1 286 LYS n 
1 287 THR n 
1 288 HIS n 
1 289 TRP n 
1 290 LYS n 
1 291 GLN n 
1 292 THR n 
1 293 VAL n 
1 294 PHE n 
1 295 LEU n 
1 296 LEU n 
1 297 GLU n 
1 298 LYS n 
1 299 PRO n 
1 300 PHE n 
1 301 SER n 
1 302 VAL n 
1 303 LYS n 
1 304 ALA n 
1 305 GLY n 
1 306 GLU n 
1 307 ALA n 
1 308 LEU n 
1 309 LYS n 
1 310 GLY n 
1 311 LYS n 
1 312 VAL n 
1 313 THR n 
1 314 VAL n 
1 315 HIS n 
1 316 LYS n 
1 317 ASN n 
1 318 LYS n 
1 319 LYS n 
1 320 ASP n 
1 321 PRO n 
1 322 ARG n 
1 323 SER n 
1 324 LEU n 
1 325 THR n 
1 326 VAL n 
1 327 THR n 
1 328 LEU n 
1 329 THR n 
1 330 LEU n 
1 331 ASN n 
1 332 ASN n 
1 333 SER n 
1 334 THR n 
1 335 GLN n 
1 336 THR n 
1 337 TYR n 
1 338 GLY n 
1 339 LEU n 
1 340 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PRMT3, HRMT1L3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-PRAR2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANM3_HUMAN 
_struct_ref.pdbx_db_accession          O60678 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEIL
YQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAV
SDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTA
IAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGL
Q
;
_struct_ref.pdbx_align_begin           211 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3SMQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 340 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O60678 
_struct_ref_seq.db_align_beg                  211 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  531 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       228 
_struct_ref_seq.pdbx_auth_seq_align_end       548 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SMQ MET A 1   ? UNP O60678 ?   ?   'EXPRESSION TAG' 209 1  
1 3SMQ GLY A 2   ? UNP O60678 ?   ?   'EXPRESSION TAG' 210 2  
1 3SMQ SER A 3   ? UNP O60678 ?   ?   'EXPRESSION TAG' 211 3  
1 3SMQ SER A 4   ? UNP O60678 ?   ?   'EXPRESSION TAG' 212 4  
1 3SMQ HIS A 5   ? UNP O60678 ?   ?   'EXPRESSION TAG' 213 5  
1 3SMQ HIS A 6   ? UNP O60678 ?   ?   'EXPRESSION TAG' 214 6  
1 3SMQ HIS A 7   ? UNP O60678 ?   ?   'EXPRESSION TAG' 215 7  
1 3SMQ HIS A 8   ? UNP O60678 ?   ?   'EXPRESSION TAG' 216 8  
1 3SMQ HIS A 9   ? UNP O60678 ?   ?   'EXPRESSION TAG' 217 9  
1 3SMQ HIS A 10  ? UNP O60678 ?   ?   'EXPRESSION TAG' 218 10 
1 3SMQ SER A 11  ? UNP O60678 ?   ?   'EXPRESSION TAG' 219 11 
1 3SMQ SER A 12  ? UNP O60678 ?   ?   'EXPRESSION TAG' 220 12 
1 3SMQ GLY A 13  ? UNP O60678 ?   ?   'EXPRESSION TAG' 221 13 
1 3SMQ LEU A 14  ? UNP O60678 ?   ?   'EXPRESSION TAG' 222 14 
1 3SMQ VAL A 15  ? UNP O60678 ?   ?   'EXPRESSION TAG' 223 15 
1 3SMQ PRO A 16  ? UNP O60678 ?   ?   'EXPRESSION TAG' 224 16 
1 3SMQ ARG A 17  ? UNP O60678 ?   ?   'EXPRESSION TAG' 225 17 
1 3SMQ GLY A 18  ? UNP O60678 ?   ?   'EXPRESSION TAG' 226 18 
1 3SMQ SER A 19  ? UNP O60678 ?   ?   'EXPRESSION TAG' 227 19 
1 3SMQ ASN A 317 ? UNP O60678 SER 508 VARIANT          525 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                      ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                       ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                                             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                               ? 'C3 H7 N O3'     105.093 
TDU non-polymer         . '1-(1,2,3-benzothiadiazol-6-yl)-3-[2-(cyclohex-1-en-1-yl)ethyl]urea' 
'1-(benzo[d][1,2,3]thiadiazol-6-yl)-3-(2-cyclohexenylethyl)urea' 'C15 H18 N4 O S' 302.395 
THR 'L-peptide linking' y THREONINE                                                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                             ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                                                ? ?                ?       
VAL 'L-peptide linking' y VALINE                                                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3SMQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.80 
_exptl_crystal.density_percent_sol   56.12 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'20.0% PEG 4K, 0.2M Mg OAc, 0.1M Na CaCo pH6.5, VAPOR DIFFUSION, SITTING DROP, temperature 297K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2011-05-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97949 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97949 
# 
_reflns.entry_id                     3SMQ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   29893 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_Rsym_value              0.078 
_reflns.pdbx_netI_over_sigmaI        36.6 
_reflns.B_iso_Wilson_estimate        30.3 
_reflns.pdbx_redundancy              11.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   83.4 
_reflns_shell.Rmerge_I_obs           0.558 
_reflns_shell.pdbx_Rsym_value        0.558 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        6.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1233 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SMQ 
_refine.ls_number_reflns_obs                     28754 
_refine.ls_number_reflns_all                     28754 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    97.96 
_refine.ls_R_factor_obs                          0.19065 
_refine.ls_R_factor_all                          0.19065 
_refine.ls_R_factor_R_work                       0.18984 
_refine.ls_R_factor_R_free                       0.21534 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.2 
_refine.ls_number_reflns_R_free                  954 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.B_iso_mean                               29.850 
_refine.aniso_B[1][1]                            -0.54 
_refine.aniso_B[2][2]                            -0.54 
_refine.aniso_B[3][3]                            1.08 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2FYT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.133 
_refine.overall_SU_ML                            0.089 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.030 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2330 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               2585 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.010  0.022  ? 2450 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.214  1.968  ? 3324 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.788  5.000  ? 307  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       35.162 24.787 ? 94   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       11.952 15.000 ? 434  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       18.008 15.000 ? 5    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.077  0.200  ? 386  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.021  ? 1795 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.524  1.500  ? 1514 ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.027  2.000  ? 2468 ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.750  3.000  ? 936  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 2.901  4.500  ? 856  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             1776 
_refine_ls_shell.R_factor_R_work                  0.252 
_refine_ls_shell.percent_reflns_obs               84.73 
_refine_ls_shell.R_factor_R_free                  0.318 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             66 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SMQ 
_struct.title                     'Crystal structure of protein arginine methyltransferase 3' 
_struct.pdbx_descriptor           'Protein arginine N-methyltransferase 3 (E.C.2.1.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SMQ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Structural Genomics, Structural Genomics Consortium, SGC, PRMT3, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 35  ? LYS A 44  ? HIS A 243 LYS A 252 1 ? 10 
HELX_P HELX_P2  2  ASP A 45  ? ASN A 59  ? ASP A 253 ASN A 267 1 ? 15 
HELX_P HELX_P3  3  PRO A 60  ? PHE A 63  ? PRO A 268 PHE A 271 5 ? 4  
HELX_P HELX_P4  4  GLY A 76  ? ALA A 85  ? GLY A 284 ALA A 293 1 ? 10 
HELX_P HELX_P5  5  GLU A 97  ? ASN A 109 ? GLU A 305 ASN A 317 1 ? 13 
HELX_P HELX_P6  6  MET A 149 ? TYR A 160 ? MET A 357 TYR A 368 1 ? 12 
HELX_P HELX_P7  7  ASP A 181 ? ILE A 189 ? ASP A 389 ILE A 397 1 ? 9  
HELX_P HELX_P8  8  ALA A 190 ? ASP A 194 ? ALA A 398 ASP A 402 5 ? 5  
HELX_P HELX_P9  9  MET A 200 ? CYS A 202 ? MET A 408 CYS A 410 5 ? 3  
HELX_P HELX_P10 10 MET A 203 ? ILE A 208 ? MET A 411 ILE A 416 1 ? 6  
HELX_P HELX_P11 11 ASP A 217 ? LEU A 221 ? ASP A 425 LEU A 429 5 ? 5  
HELX_P HELX_P12 12 SER A 237 ? GLU A 242 ? SER A 445 GLU A 450 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           168 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            376 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    169 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     377 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 115 ? LYS A 119 ? ILE A 323 LYS A 327 
A 2 LYS A 89  ? ASP A 94  ? LYS A 297 ASP A 302 
A 3 VAL A 67  ? VAL A 71  ? VAL A 275 VAL A 279 
A 4 VAL A 132 ? ILE A 136 ? VAL A 340 ILE A 344 
A 5 LEU A 161 ? TYR A 168 ? LEU A 369 TYR A 376 
B 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
B 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
B 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
B 4 ILE A 171 ? VAL A 179 ? ILE A 379 VAL A 387 
B 5 CYS A 226 ? ASP A 232 ? CYS A 434 ASP A 440 
C 1 VAL A 212 ? GLU A 214 ? VAL A 420 GLU A 422 
C 2 GLN A 291 ? VAL A 302 ? GLN A 499 VAL A 510 
C 3 SER A 255 ? PHE A 268 ? SER A 463 PHE A 476 
C 4 VAL A 276 ? SER A 279 ? VAL A 484 SER A 487 
D 1 PHE A 243 ? LYS A 250 ? PHE A 451 LYS A 458 
D 2 ALA A 307 ? HIS A 315 ? ALA A 515 HIS A 523 
D 3 THR A 325 ? LEU A 330 ? THR A 533 LEU A 538 
D 4 SER A 333 ? GLY A 338 ? SER A 541 GLY A 546 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 116 ? O THR A 324 N VAL A 90  ? N VAL A 298 
A 2 3 O LEU A 91  ? O LEU A 299 N ASP A 70  ? N ASP A 278 
A 3 4 N LEU A 69  ? N LEU A 277 O VAL A 134 ? O VAL A 342 
A 4 5 N VAL A 132 ? N VAL A 340 O ALA A 162 ? O ALA A 370 
B 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
B 2 3 O VAL A 302 ? O VAL A 510 N SER A 255 ? N SER A 463 
B 3 4 O ALA A 261 ? O ALA A 469 N VAL A 177 ? N VAL A 385 
B 4 5 N ILE A 174 ? N ILE A 382 O ILE A 228 ? O ILE A 436 
C 1 2 N VAL A 212 ? N VAL A 420 O VAL A 293 ? O VAL A 501 
C 2 3 O VAL A 302 ? O VAL A 510 N SER A 255 ? N SER A 463 
C 3 4 N PHE A 268 ? N PHE A 476 O VAL A 276 ? O VAL A 484 
D 1 2 N LEU A 249 ? N LEU A 457 O LEU A 308 ? O LEU A 516 
D 2 3 N THR A 313 ? N THR A 521 O THR A 327 ? O THR A 535 
D 3 4 N VAL A 326 ? N VAL A 534 O TYR A 337 ? O TYR A 545 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE TDU A 1'   
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 GLY A 37  ? GLY A 245 . ? 7_555 ? 
2  AC1 11 GLU A 40  ? GLU A 248 . ? 7_555 ? 
3  AC1 11 VAL A 179 ? VAL A 387 . ? 1_555 ? 
4  AC1 11 ASP A 181 ? ASP A 389 . ? 1_555 ? 
5  AC1 11 LYS A 184 ? LYS A 392 . ? 1_555 ? 
6  AC1 11 HIS A 185 ? HIS A 393 . ? 1_555 ? 
7  AC1 11 ARG A 188 ? ARG A 396 . ? 1_555 ? 
8  AC1 11 VAL A 212 ? VAL A 420 . ? 1_555 ? 
9  AC1 11 GLU A 214 ? GLU A 422 . ? 1_555 ? 
10 AC1 11 THR A 258 ? THR A 466 . ? 1_555 ? 
11 AC1 11 ALA A 259 ? ALA A 467 . ? 1_555 ? 
12 AC2 3  SER A 180 ? SER A 388 . ? 1_555 ? 
13 AC2 3  SER A 255 ? SER A 463 . ? 1_555 ? 
14 AC2 3  MET A 256 ? MET A 464 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SMQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SMQ 
_atom_sites.fract_transf_matrix[1][1]   0.014154 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014154 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005815 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 35  ? 2.333   11.900  -7.025  1.00 51.78 ? 243  HIS A N   1 
ATOM   2    C  CA  . HIS A 1 35  ? 2.085   13.338  -6.698  1.00 49.55 ? 243  HIS A CA  1 
ATOM   3    C  C   . HIS A 1 35  ? 0.592   13.689  -6.794  1.00 45.96 ? 243  HIS A C   1 
ATOM   4    O  O   . HIS A 1 35  ? -0.083  13.881  -5.769  1.00 45.46 ? 243  HIS A O   1 
ATOM   5    C  CB  . HIS A 1 35  ? 2.917   14.251  -7.607  1.00 50.53 ? 243  HIS A CB  1 
ATOM   6    N  N   . TYR A 1 36  ? 0.076   13.762  -8.021  1.00 43.44 ? 244  TYR A N   1 
ATOM   7    C  CA  . TYR A 1 36  ? -1.351  14.003  -8.245  1.00 40.02 ? 244  TYR A CA  1 
ATOM   8    C  C   . TYR A 1 36  ? -2.222  12.831  -7.774  1.00 39.55 ? 244  TYR A C   1 
ATOM   9    O  O   . TYR A 1 36  ? -3.353  13.032  -7.322  1.00 37.89 ? 244  TYR A O   1 
ATOM   10   C  CB  . TYR A 1 36  ? -1.604  14.352  -9.711  1.00 38.92 ? 244  TYR A CB  1 
ATOM   11   C  CG  . TYR A 1 36  ? -0.862  15.604  -10.130 1.00 38.77 ? 244  TYR A CG  1 
ATOM   12   C  CD1 . TYR A 1 36  ? 0.363   15.524  -10.802 1.00 40.06 ? 244  TYR A CD1 1 
ATOM   13   C  CD2 . TYR A 1 36  ? -1.362  16.872  -9.812  1.00 36.40 ? 244  TYR A CD2 1 
ATOM   14   C  CE1 . TYR A 1 36  ? 1.057   16.678  -11.172 1.00 40.92 ? 244  TYR A CE1 1 
ATOM   15   C  CE2 . TYR A 1 36  ? -0.678  18.033  -10.181 1.00 36.93 ? 244  TYR A CE2 1 
ATOM   16   C  CZ  . TYR A 1 36  ? 0.526   17.928  -10.863 1.00 39.38 ? 244  TYR A CZ  1 
ATOM   17   O  OH  . TYR A 1 36  ? 1.206   19.069  -11.219 1.00 41.42 ? 244  TYR A OH  1 
ATOM   18   N  N   . GLY A 1 37  ? -1.676  11.617  -7.856  1.00 40.99 ? 245  GLY A N   1 
ATOM   19   C  CA  . GLY A 1 37  ? -2.333  10.424  -7.324  1.00 40.92 ? 245  GLY A CA  1 
ATOM   20   C  C   . GLY A 1 37  ? -2.714  10.529  -5.852  1.00 39.68 ? 245  GLY A C   1 
ATOM   21   O  O   . GLY A 1 37  ? -3.753  10.004  -5.437  1.00 38.46 ? 245  GLY A O   1 
ATOM   22   N  N   . ILE A 1 38  ? -1.869  11.200  -5.064  1.00 39.62 ? 246  ILE A N   1 
ATOM   23   C  CA  . ILE A 1 38  ? -2.134  11.430  -3.639  1.00 38.63 ? 246  ILE A CA  1 
ATOM   24   C  C   . ILE A 1 38  ? -3.372  12.304  -3.432  1.00 35.50 ? 246  ILE A C   1 
ATOM   25   O  O   . ILE A 1 38  ? -4.212  12.001  -2.586  1.00 35.56 ? 246  ILE A O   1 
ATOM   26   C  CB  . ILE A 1 38  ? -0.936  12.079  -2.914  1.00 40.58 ? 246  ILE A CB  1 
ATOM   27   C  CG1 . ILE A 1 38  ? 0.340   11.253  -3.132  1.00 45.05 ? 246  ILE A CG1 1 
ATOM   28   C  CG2 . ILE A 1 38  ? -1.224  12.207  -1.416  1.00 41.06 ? 246  ILE A CG2 1 
ATOM   29   N  N   . HIS A 1 39  ? -3.475  13.389  -4.193  1.00 33.37 ? 247  HIS A N   1 
ATOM   30   C  CA  . HIS A 1 39  ? -4.659  14.246  -4.143  1.00 30.79 ? 247  HIS A CA  1 
ATOM   31   C  C   . HIS A 1 39  ? -5.908  13.468  -4.540  1.00 29.03 ? 247  HIS A C   1 
ATOM   32   O  O   . HIS A 1 39  ? -6.978  13.644  -3.939  1.00 27.99 ? 247  HIS A O   1 
ATOM   33   C  CB  . HIS A 1 39  ? -4.470  15.479  -5.025  1.00 30.60 ? 247  HIS A CB  1 
ATOM   34   C  CG  . HIS A 1 39  ? -3.438  16.421  -4.491  1.00 33.57 ? 247  HIS A CG  1 
ATOM   35   N  ND1 . HIS A 1 39  ? -3.734  17.405  -3.572  1.00 33.82 ? 247  HIS A ND1 1 
ATOM   36   C  CD2 . HIS A 1 39  ? -2.102  16.490  -4.702  1.00 35.14 ? 247  HIS A CD2 1 
ATOM   37   C  CE1 . HIS A 1 39  ? -2.630  18.065  -3.268  1.00 36.88 ? 247  HIS A CE1 1 
ATOM   38   N  NE2 . HIS A 1 39  ? -1.626  17.528  -3.937  1.00 37.66 ? 247  HIS A NE2 1 
ATOM   39   N  N   . GLU A 1 40  ? -5.761  12.604  -5.541  1.00 27.89 ? 248  GLU A N   1 
ATOM   40   C  CA  . GLU A 1 40  ? -6.850  11.736  -5.965  1.00 27.59 ? 248  GLU A CA  1 
ATOM   41   C  C   . GLU A 1 40  ? -7.298  10.825  -4.819  1.00 27.17 ? 248  GLU A C   1 
ATOM   42   O  O   . GLU A 1 40  ? -8.488  10.635  -4.604  1.00 26.48 ? 248  GLU A O   1 
ATOM   43   C  CB  . GLU A 1 40  ? -6.416  10.885  -7.152  1.00 28.82 ? 248  GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 40  ? -7.535  10.076  -7.791  1.00 30.56 ? 248  GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 40  ? -7.054  9.271   -9.003  1.00 34.09 ? 248  GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 40  ? -7.472  8.107   -9.141  1.00 36.52 ? 248  GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 40  ? -6.259  9.802   -9.808  1.00 34.45 ? 248  GLU A OE2 1 
ATOM   48   N  N   . GLU A 1 41  ? -6.335  10.269  -4.093  1.00 27.84 ? 249  GLU A N   1 
ATOM   49   C  CA  . GLU A 1 41  ? -6.627  9.379   -2.967  1.00 28.75 ? 249  GLU A CA  1 
ATOM   50   C  C   . GLU A 1 41  ? -7.412  10.105  -1.860  1.00 27.51 ? 249  GLU A C   1 
ATOM   51   O  O   . GLU A 1 41  ? -8.359  9.545   -1.300  1.00 27.34 ? 249  GLU A O   1 
ATOM   52   C  CB  . GLU A 1 41  ? -5.337  8.790   -2.392  1.00 30.70 ? 249  GLU A CB  1 
ATOM   53   C  CG  . GLU A 1 41  ? -5.591  7.713   -1.359  1.00 34.42 ? 249  GLU A CG  1 
ATOM   54   C  CD  . GLU A 1 41  ? -4.353  7.334   -0.560  1.00 40.95 ? 249  GLU A CD  1 
ATOM   55   O  OE1 . GLU A 1 41  ? -3.240  7.819   -0.875  1.00 43.68 ? 249  GLU A OE1 1 
ATOM   56   O  OE2 . GLU A 1 41  ? -4.503  6.538   0.388   1.00 43.39 ? 249  GLU A OE2 1 
ATOM   57   N  N   A MET A 1 42  ? -7.016  11.339  -1.555  0.50 27.12 ? 250  MET A N   1 
ATOM   58   N  N   B MET A 1 42  ? -6.988  11.334  -1.556  0.50 27.01 ? 250  MET A N   1 
ATOM   59   C  CA  A MET A 1 42  ? -7.685  12.132  -0.523  0.50 26.83 ? 250  MET A CA  1 
ATOM   60   C  CA  B MET A 1 42  ? -7.646  12.190  -0.569  0.50 26.65 ? 250  MET A CA  1 
ATOM   61   C  C   A MET A 1 42  ? -9.107  12.521  -0.937  0.50 26.07 ? 250  MET A C   1 
ATOM   62   C  C   B MET A 1 42  ? -9.093  12.448  -0.962  0.50 25.90 ? 250  MET A C   1 
ATOM   63   O  O   A MET A 1 42  ? -10.025 12.485  -0.114  0.50 26.35 ? 250  MET A O   1 
ATOM   64   O  O   B MET A 1 42  ? -10.005 12.264  -0.153  0.50 26.08 ? 250  MET A O   1 
ATOM   65   C  CB  A MET A 1 42  ? -6.845  13.358  -0.153  0.50 27.94 ? 250  MET A CB  1 
ATOM   66   C  CB  B MET A 1 42  ? -6.901  13.521  -0.442  0.50 27.34 ? 250  MET A CB  1 
ATOM   67   C  CG  A MET A 1 42  ? -5.455  12.983  0.375   0.50 30.42 ? 250  MET A CG  1 
ATOM   68   C  CG  B MET A 1 42  ? -5.449  13.380  -0.004  0.50 29.88 ? 250  MET A CG  1 
ATOM   69   S  SD  A MET A 1 42  ? -4.602  14.284  1.301   0.50 36.24 ? 250  MET A SD  1 
ATOM   70   S  SD  B MET A 1 42  ? -5.255  12.335  1.450   0.50 32.27 ? 250  MET A SD  1 
ATOM   71   C  CE  A MET A 1 42  ? -4.550  15.610  0.092   0.50 34.53 ? 250  MET A CE  1 
ATOM   72   C  CE  B MET A 1 42  ? -4.918  10.746  0.701   0.50 32.22 ? 250  MET A CE  1 
ATOM   73   N  N   . LEU A 1 43  ? -9.287  12.866  -2.211  1.00 25.08 ? 251  LEU A N   1 
ATOM   74   C  CA  . LEU A 1 43  ? -10.622 13.121  -2.766  1.00 25.10 ? 251  LEU A CA  1 
ATOM   75   C  C   . LEU A 1 43  ? -11.525 11.890  -2.714  1.00 25.26 ? 251  LEU A C   1 
ATOM   76   O  O   . LEU A 1 43  ? -12.722 12.012  -2.436  1.00 25.94 ? 251  LEU A O   1 
ATOM   77   C  CB  . LEU A 1 43  ? -10.542 13.654  -4.210  1.00 24.87 ? 251  LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 43  ? -10.101 15.115  -4.353  1.00 26.09 ? 251  LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 43  ? -9.793  15.447  -5.797  1.00 26.73 ? 251  LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 43  ? -11.167 16.072  -3.801  1.00 26.55 ? 251  LEU A CD2 1 
ATOM   81   N  N   . LYS A 1 44  ? -10.946 10.713  -2.956  1.00 24.02 ? 252  LYS A N   1 
ATOM   82   C  CA  . LYS A 1 44  ? -11.708 9.461   -2.962  1.00 24.89 ? 252  LYS A CA  1 
ATOM   83   C  C   . LYS A 1 44  ? -11.945 8.900   -1.563  1.00 24.83 ? 252  LYS A C   1 
ATOM   84   O  O   . LYS A 1 44  ? -12.634 7.892   -1.412  1.00 25.59 ? 252  LYS A O   1 
ATOM   85   C  CB  . LYS A 1 44  ? -11.022 8.407   -3.841  1.00 26.05 ? 252  LYS A CB  1 
ATOM   86   C  CG  . LYS A 1 44  ? -11.157 8.684   -5.342  1.00 26.87 ? 252  LYS A CG  1 
ATOM   87   C  CD  . LYS A 1 44  ? -10.512 7.577   -6.176  1.00 29.93 ? 252  LYS A CD  1 
ATOM   88   C  CE  . LYS A 1 44  ? -10.611 7.920   -7.672  1.00 31.29 ? 252  LYS A CE  1 
ATOM   89   N  NZ  . LYS A 1 44  ? -9.825  7.003   -8.520  1.00 32.59 ? 252  LYS A NZ  1 
ATOM   90   N  N   . ASP A 1 45  ? -11.348 9.529   -0.549  1.00 23.57 ? 253  ASP A N   1 
ATOM   91   C  CA  . ASP A 1 45  ? -11.637 9.186   0.835   1.00 23.90 ? 253  ASP A CA  1 
ATOM   92   C  C   . ASP A 1 45  ? -12.991 9.828   1.174   1.00 24.67 ? 253  ASP A C   1 
ATOM   93   O  O   . ASP A 1 45  ? -13.073 11.026  1.455   1.00 24.14 ? 253  ASP A O   1 
ATOM   94   C  CB  . ASP A 1 45  ? -10.501 9.666   1.749   1.00 23.22 ? 253  ASP A CB  1 
ATOM   95   C  CG  . ASP A 1 45  ? -10.725 9.324   3.219   1.00 24.55 ? 253  ASP A CG  1 
ATOM   96   O  OD1 . ASP A 1 45  ? -9.752  9.395   3.991   1.00 27.07 ? 253  ASP A OD1 1 
ATOM   97   O  OD2 . ASP A 1 45  ? -11.852 9.004   3.624   1.00 25.05 ? 253  ASP A OD2 1 
ATOM   98   N  N   . LYS A 1 46  ? -14.052 9.025   1.097   1.00 25.06 ? 254  LYS A N   1 
ATOM   99   C  CA  . LYS A 1 46  ? -15.426 9.527   1.256   1.00 26.41 ? 254  LYS A CA  1 
ATOM   100  C  C   . LYS A 1 46  ? -15.676 10.080  2.647   1.00 25.86 ? 254  LYS A C   1 
ATOM   101  O  O   . LYS A 1 46  ? -16.244 11.165  2.794   1.00 25.88 ? 254  LYS A O   1 
ATOM   102  C  CB  . LYS A 1 46  ? -16.463 8.442   0.942   1.00 27.16 ? 254  LYS A CB  1 
ATOM   103  C  CG  . LYS A 1 46  ? -16.524 8.061   -0.522  1.00 30.99 ? 254  LYS A CG  1 
ATOM   104  C  CD  . LYS A 1 46  ? -17.763 7.242   -0.828  1.00 36.93 ? 254  LYS A CD  1 
ATOM   105  C  CE  . LYS A 1 46  ? -17.755 6.788   -2.284  1.00 41.11 ? 254  LYS A CE  1 
ATOM   106  N  NZ  . LYS A 1 46  ? -16.775 5.663   -2.510  1.00 43.07 ? 254  LYS A NZ  1 
ATOM   107  N  N   . ILE A 1 47  ? -15.250 9.344   3.666   1.00 25.77 ? 255  ILE A N   1 
ATOM   108  C  CA  . ILE A 1 47  ? -15.429 9.804   5.043   1.00 26.00 ? 255  ILE A CA  1 
ATOM   109  C  C   . ILE A 1 47  ? -14.845 11.203  5.194   1.00 25.66 ? 255  ILE A C   1 
ATOM   110  O  O   . ILE A 1 47  ? -15.524 12.118  5.669   1.00 25.38 ? 255  ILE A O   1 
ATOM   111  C  CB  . ILE A 1 47  ? -14.802 8.827   6.063   1.00 26.22 ? 255  ILE A CB  1 
ATOM   112  C  CG1 . ILE A 1 47  ? -15.514 7.455   6.027   1.00 27.38 ? 255  ILE A CG1 1 
ATOM   113  C  CG2 . ILE A 1 47  ? -14.797 9.436   7.464   1.00 27.06 ? 255  ILE A CG2 1 
ATOM   114  C  CD1 . ILE A 1 47  ? -17.021 7.453   6.419   1.00 29.41 ? 255  ILE A CD1 1 
ATOM   115  N  N   . ARG A 1 48  ? -13.605 11.375  4.743   1.00 24.91 ? 256  ARG A N   1 
ATOM   116  C  CA  . ARG A 1 48  ? -12.932 12.669  4.811   1.00 25.15 ? 256  ARG A CA  1 
ATOM   117  C  C   . ARG A 1 48  ? -13.699 13.731  4.020   1.00 24.72 ? 256  ARG A C   1 
ATOM   118  O  O   . ARG A 1 48  ? -14.138 14.739  4.578   1.00 24.71 ? 256  ARG A O   1 
ATOM   119  C  CB  . ARG A 1 48  ? -11.498 12.546  4.280   1.00 25.15 ? 256  ARG A CB  1 
ATOM   120  C  CG  . ARG A 1 48  ? -10.736 13.869  4.061   1.00 26.98 ? 256  ARG A CG  1 
ATOM   121  C  CD  . ARG A 1 48  ? -9.735  13.656  2.926   1.00 29.14 ? 256  ARG A CD  1 
ATOM   122  N  NE  . ARG A 1 48  ? -8.830  14.784  2.698   1.00 31.85 ? 256  ARG A NE  1 
ATOM   123  C  CZ  . ARG A 1 48  ? -9.024  15.755  1.805   1.00 31.54 ? 256  ARG A CZ  1 
ATOM   124  N  NH1 . ARG A 1 48  ? -8.122  16.722  1.682   1.00 31.96 ? 256  ARG A NH1 1 
ATOM   125  N  NH2 . ARG A 1 48  ? -10.105 15.766  1.027   1.00 32.17 ? 256  ARG A NH2 1 
ATOM   126  N  N   . THR A 1 49  ? -13.869 13.497  2.727   1.00 24.13 ? 257  THR A N   1 
ATOM   127  C  CA  . THR A 1 49  ? -14.372 14.546  1.854   1.00 24.63 ? 257  THR A CA  1 
ATOM   128  C  C   . THR A 1 49  ? -15.859 14.829  2.047   1.00 24.51 ? 257  THR A C   1 
ATOM   129  O  O   . THR A 1 49  ? -16.259 15.984  2.039   1.00 24.75 ? 257  THR A O   1 
ATOM   130  C  CB  . THR A 1 49  ? -14.024 14.270  0.388   1.00 25.12 ? 257  THR A CB  1 
ATOM   131  O  OG1 . THR A 1 49  ? -12.631 13.979  0.314   1.00 25.68 ? 257  THR A OG1 1 
ATOM   132  C  CG2 . THR A 1 49  ? -14.306 15.497  -0.485  1.00 24.97 ? 257  THR A CG2 1 
ATOM   133  N  N   . GLU A 1 50  ? -16.660 13.785  2.237   1.00 24.87 ? 258  GLU A N   1 
ATOM   134  C  CA  . GLU A 1 50  ? -18.091 13.967  2.478   1.00 25.45 ? 258  GLU A CA  1 
ATOM   135  C  C   . GLU A 1 50  ? -18.397 14.604  3.824   1.00 24.24 ? 258  GLU A C   1 
ATOM   136  O  O   . GLU A 1 50  ? -19.378 15.334  3.935   1.00 24.12 ? 258  GLU A O   1 
ATOM   137  C  CB  . GLU A 1 50  ? -18.861 12.660  2.292   1.00 26.40 ? 258  GLU A CB  1 
ATOM   138  C  CG  . GLU A 1 50  ? -18.805 12.211  0.847   1.00 29.74 ? 258  GLU A CG  1 
ATOM   139  C  CD  . GLU A 1 50  ? -19.536 10.928  0.563   1.00 34.41 ? 258  GLU A CD  1 
ATOM   140  O  OE1 . GLU A 1 50  ? -19.426 10.470  -0.596  1.00 37.41 ? 258  GLU A OE1 1 
ATOM   141  O  OE2 . GLU A 1 50  ? -20.196 10.374  1.477   1.00 36.89 ? 258  GLU A OE2 1 
ATOM   142  N  N   . SER A 1 51  ? -17.550 14.364  4.825   1.00 22.80 ? 259  SER A N   1 
ATOM   143  C  CA  . SER A 1 51  ? -17.715 15.036  6.127   1.00 22.22 ? 259  SER A CA  1 
ATOM   144  C  C   . SER A 1 51  ? -17.612 16.556  5.979   1.00 21.23 ? 259  SER A C   1 
ATOM   145  O  O   . SER A 1 51  ? -18.445 17.295  6.522   1.00 20.01 ? 259  SER A O   1 
ATOM   146  C  CB  . SER A 1 51  ? -16.672 14.558  7.141   1.00 22.22 ? 259  SER A CB  1 
ATOM   147  O  OG  . SER A 1 51  ? -16.914 13.209  7.503   1.00 22.15 ? 259  SER A OG  1 
ATOM   148  N  N   . TYR A 1 52  ? -16.589 17.012  5.245   1.00 20.90 ? 260  TYR A N   1 
ATOM   149  C  CA  . TYR A 1 52  ? -16.395 18.444  5.003   1.00 20.92 ? 260  TYR A CA  1 
ATOM   150  C  C   . TYR A 1 52  ? -17.541 18.993  4.154   1.00 21.18 ? 260  TYR A C   1 
ATOM   151  O  O   . TYR A 1 52  ? -18.098 20.063  4.452   1.00 21.45 ? 260  TYR A O   1 
ATOM   152  C  CB  . TYR A 1 52  ? -15.041 18.700  4.314   1.00 21.22 ? 260  TYR A CB  1 
ATOM   153  C  CG  . TYR A 1 52  ? -13.860 18.813  5.260   1.00 21.18 ? 260  TYR A CG  1 
ATOM   154  C  CD1 . TYR A 1 52  ? -13.221 17.667  5.754   1.00 21.87 ? 260  TYR A CD1 1 
ATOM   155  C  CD2 . TYR A 1 52  ? -13.380 20.063  5.658   1.00 20.47 ? 260  TYR A CD2 1 
ATOM   156  C  CE1 . TYR A 1 52  ? -12.143 17.768  6.636   1.00 22.70 ? 260  TYR A CE1 1 
ATOM   157  C  CE2 . TYR A 1 52  ? -12.292 20.179  6.524   1.00 21.20 ? 260  TYR A CE2 1 
ATOM   158  C  CZ  . TYR A 1 52  ? -11.682 19.026  7.012   1.00 20.98 ? 260  TYR A CZ  1 
ATOM   159  O  OH  . TYR A 1 52  ? -10.609 19.130  7.874   1.00 21.29 ? 260  TYR A OH  1 
ATOM   160  N  N   . ARG A 1 53  ? -17.898 18.250  3.106   1.00 21.38 ? 261  ARG A N   1 
ATOM   161  C  CA  . ARG A 1 53  ? -19.017 18.628  2.245   1.00 21.97 ? 261  ARG A CA  1 
ATOM   162  C  C   . ARG A 1 53  ? -20.309 18.790  3.058   1.00 21.77 ? 261  ARG A C   1 
ATOM   163  O  O   . ARG A 1 53  ? -20.985 19.801  2.931   1.00 21.95 ? 261  ARG A O   1 
ATOM   164  C  CB  . ARG A 1 53  ? -19.245 17.611  1.127   1.00 22.35 ? 261  ARG A CB  1 
ATOM   165  C  CG  . ARG A 1 53  ? -20.270 18.125  0.105   1.00 25.13 ? 261  ARG A CG  1 
ATOM   166  C  CD  . ARG A 1 53  ? -21.056 17.024  -0.547  1.00 30.62 ? 261  ARG A CD  1 
ATOM   167  N  NE  . ARG A 1 53  ? -21.564 16.042  0.416   1.00 31.98 ? 261  ARG A NE  1 
ATOM   168  C  CZ  . ARG A 1 53  ? -21.925 14.812  0.073   1.00 31.67 ? 261  ARG A CZ  1 
ATOM   169  N  NH1 . ARG A 1 53  ? -21.859 14.456  -1.197  1.00 31.66 ? 261  ARG A NH1 1 
ATOM   170  N  NH2 . ARG A 1 53  ? -22.353 13.951  0.985   1.00 29.11 ? 261  ARG A NH2 1 
ATOM   171  N  N   . ASP A 1 54  ? -20.635 17.786  3.872   1.00 21.67 ? 262  ASP A N   1 
ATOM   172  C  CA  . ASP A 1 54  ? -21.827 17.818  4.729   1.00 22.27 ? 262  ASP A CA  1 
ATOM   173  C  C   . ASP A 1 54  ? -21.796 18.973  5.716   1.00 21.50 ? 262  ASP A C   1 
ATOM   174  O  O   . ASP A 1 54  ? -22.799 19.656  5.881   1.00 22.19 ? 262  ASP A O   1 
ATOM   175  C  CB  . ASP A 1 54  ? -22.011 16.500  5.493   1.00 22.65 ? 262  ASP A CB  1 
ATOM   176  C  CG  . ASP A 1 54  ? -22.387 15.331  4.584   1.00 24.70 ? 262  ASP A CG  1 
ATOM   177  O  OD1 . ASP A 1 54  ? -22.354 14.188  5.080   1.00 27.08 ? 262  ASP A OD1 1 
ATOM   178  O  OD2 . ASP A 1 54  ? -22.692 15.539  3.389   1.00 26.99 ? 262  ASP A OD2 1 
ATOM   179  N  N   . PHE A 1 55  ? -20.657 19.199  6.369   1.00 20.93 ? 263  PHE A N   1 
ATOM   180  C  CA  . PHE A 1 55  ? -20.540 20.320  7.307   1.00 21.13 ? 263  PHE A CA  1 
ATOM   181  C  C   . PHE A 1 55  ? -20.885 21.648  6.620   1.00 21.01 ? 263  PHE A C   1 
ATOM   182  O  O   . PHE A 1 55  ? -21.725 22.416  7.103   1.00 21.22 ? 263  PHE A O   1 
ATOM   183  C  CB  . PHE A 1 55  ? -19.129 20.402  7.928   1.00 20.53 ? 263  PHE A CB  1 
ATOM   184  C  CG  . PHE A 1 55  ? -18.795 21.772  8.459   1.00 20.98 ? 263  PHE A CG  1 
ATOM   185  C  CD1 . PHE A 1 55  ? -19.544 22.326  9.498   1.00 19.05 ? 263  PHE A CD1 1 
ATOM   186  C  CD2 . PHE A 1 55  ? -17.750 22.513  7.904   1.00 19.99 ? 263  PHE A CD2 1 
ATOM   187  C  CE1 . PHE A 1 55  ? -19.266 23.588  9.977   1.00 19.86 ? 263  PHE A CE1 1 
ATOM   188  C  CE2 . PHE A 1 55  ? -17.450 23.785  8.393   1.00 20.77 ? 263  PHE A CE2 1 
ATOM   189  C  CZ  . PHE A 1 55  ? -18.218 24.326  9.422   1.00 22.07 ? 263  PHE A CZ  1 
ATOM   190  N  N   . ILE A 1 56  ? -20.228 21.904  5.494   1.00 20.90 ? 264  ILE A N   1 
ATOM   191  C  CA  . ILE A 1 56  ? -20.393 23.162  4.763   1.00 20.69 ? 264  ILE A CA  1 
ATOM   192  C  C   . ILE A 1 56  ? -21.822 23.301  4.202   1.00 22.01 ? 264  ILE A C   1 
ATOM   193  O  O   . ILE A 1 56  ? -22.522 24.315  4.460   1.00 22.77 ? 264  ILE A O   1 
ATOM   194  C  CB  . ILE A 1 56  ? -19.312 23.299  3.663   1.00 20.21 ? 264  ILE A CB  1 
ATOM   195  C  CG1 . ILE A 1 56  ? -17.925 23.384  4.311   1.00 19.75 ? 264  ILE A CG1 1 
ATOM   196  C  CG2 . ILE A 1 56  ? -19.568 24.531  2.783   1.00 19.97 ? 264  ILE A CG2 1 
ATOM   197  C  CD1 . ILE A 1 56  ? -16.736 23.171  3.350   1.00 21.29 ? 264  ILE A CD1 1 
ATOM   198  N  N   . TYR A 1 57  ? -22.270 22.285  3.468   1.00 22.02 ? 265  TYR A N   1 
ATOM   199  C  CA  . TYR A 1 57  ? -23.601 22.333  2.846   1.00 23.00 ? 265  TYR A CA  1 
ATOM   200  C  C   . TYR A 1 57  ? -24.755 22.329  3.857   1.00 23.14 ? 265  TYR A C   1 
ATOM   201  O  O   . TYR A 1 57  ? -25.805 22.908  3.583   1.00 23.34 ? 265  TYR A O   1 
ATOM   202  C  CB  . TYR A 1 57  ? -23.772 21.181  1.857   1.00 23.26 ? 265  TYR A CB  1 
ATOM   203  C  CG  . TYR A 1 57  ? -23.037 21.377  0.545   1.00 24.73 ? 265  TYR A CG  1 
ATOM   204  C  CD1 . TYR A 1 57  ? -22.158 22.453  0.360   1.00 24.59 ? 265  TYR A CD1 1 
ATOM   205  C  CD2 . TYR A 1 57  ? -23.213 20.477  -0.513  1.00 26.68 ? 265  TYR A CD2 1 
ATOM   206  C  CE1 . TYR A 1 57  ? -21.477 22.635  -0.844  1.00 26.10 ? 265  TYR A CE1 1 
ATOM   207  C  CE2 . TYR A 1 57  ? -22.525 20.651  -1.733  1.00 26.66 ? 265  TYR A CE2 1 
ATOM   208  C  CZ  . TYR A 1 57  ? -21.669 21.729  -1.884  1.00 25.91 ? 265  TYR A CZ  1 
ATOM   209  O  OH  . TYR A 1 57  ? -21.013 21.914  -3.075  1.00 27.16 ? 265  TYR A OH  1 
ATOM   210  N  N   . GLN A 1 58  ? -24.579 21.668  5.003   1.00 22.52 ? 266  GLN A N   1 
ATOM   211  C  CA  . GLN A 1 58  ? -25.667 21.605  5.992   1.00 23.50 ? 266  GLN A CA  1 
ATOM   212  C  C   . GLN A 1 58  ? -25.658 22.739  7.001   1.00 23.02 ? 266  GLN A C   1 
ATOM   213  O  O   . GLN A 1 58  ? -26.588 22.860  7.803   1.00 23.38 ? 266  GLN A O   1 
ATOM   214  C  CB  . GLN A 1 58  ? -25.696 20.258  6.708   1.00 23.72 ? 266  GLN A CB  1 
ATOM   215  C  CG  . GLN A 1 58  ? -26.111 19.092  5.799   1.00 27.98 ? 266  GLN A CG  1 
ATOM   216  C  CD  . GLN A 1 58  ? -25.904 17.742  6.474   1.00 31.96 ? 266  GLN A CD  1 
ATOM   217  O  OE1 . GLN A 1 58  ? -25.698 17.664  7.694   1.00 34.40 ? 266  GLN A OE1 1 
ATOM   218  N  NE2 . GLN A 1 58  ? -25.947 16.672  5.683   1.00 32.11 ? 266  GLN A NE2 1 
ATOM   219  N  N   . ASN A 1 59  ? -24.616 23.563  6.955   1.00 22.52 ? 267  ASN A N   1 
ATOM   220  C  CA  . ASN A 1 59  ? -24.504 24.753  7.798   1.00 22.89 ? 267  ASN A CA  1 
ATOM   221  C  C   . ASN A 1 59  ? -24.126 26.008  6.990   1.00 23.39 ? 267  ASN A C   1 
ATOM   222  O  O   . ASN A 1 59  ? -23.158 26.701  7.328   1.00 23.09 ? 267  ASN A O   1 
ATOM   223  C  CB  . ASN A 1 59  ? -23.492 24.508  8.924   1.00 22.21 ? 267  ASN A CB  1 
ATOM   224  C  CG  . ASN A 1 59  ? -23.885 23.336  9.804   1.00 23.52 ? 267  ASN A CG  1 
ATOM   225  O  OD1 . ASN A 1 59  ? -24.723 23.474  10.704  1.00 23.58 ? 267  ASN A OD1 1 
ATOM   226  N  ND2 . ASN A 1 59  ? -23.293 22.165  9.538   1.00 20.32 ? 267  ASN A ND2 1 
ATOM   227  N  N   . PRO A 1 60  ? -24.902 26.320  5.934   1.00 23.79 ? 268  PRO A N   1 
ATOM   228  C  CA  . PRO A 1 60  ? -24.531 27.420  5.036   1.00 24.50 ? 268  PRO A CA  1 
ATOM   229  C  C   . PRO A 1 60  ? -24.560 28.798  5.720   1.00 24.79 ? 268  PRO A C   1 
ATOM   230  O  O   . PRO A 1 60  ? -23.935 29.738  5.214   1.00 25.26 ? 268  PRO A O   1 
ATOM   231  C  CB  . PRO A 1 60  ? -25.595 27.339  3.935   1.00 24.60 ? 268  PRO A CB  1 
ATOM   232  C  CG  . PRO A 1 60  ? -26.813 26.789  4.654   1.00 25.05 ? 268  PRO A CG  1 
ATOM   233  C  CD  . PRO A 1 60  ? -26.219 25.752  5.584   1.00 24.64 ? 268  PRO A CD  1 
ATOM   234  N  N   . HIS A 1 61  ? -25.254 28.897  6.858   1.00 24.73 ? 269  HIS A N   1 
ATOM   235  C  CA  . HIS A 1 61  ? -25.272 30.128  7.669   1.00 25.39 ? 269  HIS A CA  1 
ATOM   236  C  C   . HIS A 1 61  ? -23.864 30.531  8.141   1.00 24.94 ? 269  HIS A C   1 
ATOM   237  O  O   . HIS A 1 61  ? -23.585 31.697  8.365   1.00 24.62 ? 269  HIS A O   1 
ATOM   238  C  CB  . HIS A 1 61  ? -26.220 29.989  8.872   1.00 25.33 ? 269  HIS A CB  1 
ATOM   239  C  CG  . HIS A 1 61  ? -25.829 28.901  9.829   1.00 25.49 ? 269  HIS A CG  1 
ATOM   240  N  ND1 . HIS A 1 61  ? -26.015 27.564  9.552   1.00 24.48 ? 269  HIS A ND1 1 
ATOM   241  C  CD2 . HIS A 1 61  ? -25.243 28.955  11.049  1.00 24.53 ? 269  HIS A CD2 1 
ATOM   242  C  CE1 . HIS A 1 61  ? -25.564 26.840  10.560  1.00 24.96 ? 269  HIS A CE1 1 
ATOM   243  N  NE2 . HIS A 1 61  ? -25.096 27.661  11.485  1.00 25.77 ? 269  HIS A NE2 1 
ATOM   244  N  N   . ILE A 1 62  ? -22.980 29.551  8.273   1.00 24.71 ? 270  ILE A N   1 
ATOM   245  C  CA  . ILE A 1 62  ? -21.598 29.797  8.674   1.00 24.61 ? 270  ILE A CA  1 
ATOM   246  C  C   . ILE A 1 62  ? -20.802 30.478  7.554   1.00 24.71 ? 270  ILE A C   1 
ATOM   247  O  O   . ILE A 1 62  ? -19.840 31.204  7.822   1.00 24.49 ? 270  ILE A O   1 
ATOM   248  C  CB  . ILE A 1 62  ? -20.925 28.478  9.141   1.00 24.29 ? 270  ILE A CB  1 
ATOM   249  C  CG1 . ILE A 1 62  ? -21.558 28.031  10.462  1.00 24.07 ? 270  ILE A CG1 1 
ATOM   250  C  CG2 . ILE A 1 62  ? -19.400 28.634  9.272   1.00 24.48 ? 270  ILE A CG2 1 
ATOM   251  C  CD1 . ILE A 1 62  ? -21.183 26.611  10.907  1.00 23.30 ? 270  ILE A CD1 1 
ATOM   252  N  N   . PHE A 1 63  ? -21.245 30.285  6.312   1.00 24.90 ? 271  PHE A N   1 
ATOM   253  C  CA  . PHE A 1 63  ? -20.509 30.743  5.132   1.00 25.29 ? 271  PHE A CA  1 
ATOM   254  C  C   . PHE A 1 63  ? -21.165 31.904  4.370   1.00 26.26 ? 271  PHE A C   1 
ATOM   255  O  O   . PHE A 1 63  ? -20.480 32.650  3.673   1.00 26.62 ? 271  PHE A O   1 
ATOM   256  C  CB  . PHE A 1 63  ? -20.254 29.544  4.215   1.00 24.67 ? 271  PHE A CB  1 
ATOM   257  C  CG  . PHE A 1 63  ? -19.383 28.506  4.858   1.00 25.22 ? 271  PHE A CG  1 
ATOM   258  C  CD1 . PHE A 1 63  ? -19.929 27.505  5.652   1.00 23.51 ? 271  PHE A CD1 1 
ATOM   259  C  CD2 . PHE A 1 63  ? -18.004 28.581  4.734   1.00 24.79 ? 271  PHE A CD2 1 
ATOM   260  C  CE1 . PHE A 1 63  ? -19.104 26.572  6.289   1.00 21.82 ? 271  PHE A CE1 1 
ATOM   261  C  CE2 . PHE A 1 63  ? -17.181 27.655  5.366   1.00 25.28 ? 271  PHE A CE2 1 
ATOM   262  C  CZ  . PHE A 1 63  ? -17.739 26.649  6.149   1.00 24.69 ? 271  PHE A CZ  1 
ATOM   263  N  N   . LYS A 1 64  ? -22.480 32.053  4.528   1.00 26.88 ? 272  LYS A N   1 
ATOM   264  C  CA  . LYS A 1 64  ? -23.247 33.035  3.775   1.00 28.19 ? 272  LYS A CA  1 
ATOM   265  C  C   . LYS A 1 64  ? -22.659 34.439  3.922   1.00 28.34 ? 272  LYS A C   1 
ATOM   266  O  O   . LYS A 1 64  ? -22.608 34.980  5.028   1.00 27.99 ? 272  LYS A O   1 
ATOM   267  C  CB  . LYS A 1 64  ? -24.702 33.032  4.229   1.00 28.91 ? 272  LYS A CB  1 
ATOM   268  C  CG  . LYS A 1 64  ? -25.636 33.870  3.342   1.00 30.98 ? 272  LYS A CG  1 
ATOM   269  C  CD  . LYS A 1 64  ? -27.023 33.927  3.975   1.00 35.48 ? 272  LYS A CD  1 
ATOM   270  C  CE  . LYS A 1 64  ? -27.939 34.970  3.315   1.00 38.30 ? 272  LYS A CE  1 
ATOM   271  N  NZ  . LYS A 1 64  ? -29.247 34.993  4.046   1.00 39.22 ? 272  LYS A NZ  1 
ATOM   272  N  N   . ASP A 1 65  ? -22.196 34.993  2.801   1.00 28.56 ? 273  ASP A N   1 
ATOM   273  C  CA  . ASP A 1 65  ? -21.654 36.362  2.740   1.00 29.68 ? 273  ASP A CA  1 
ATOM   274  C  C   . ASP A 1 65  ? -20.403 36.565  3.597   1.00 29.48 ? 273  ASP A C   1 
ATOM   275  O  O   . ASP A 1 65  ? -20.117 37.693  4.016   1.00 30.06 ? 273  ASP A O   1 
ATOM   276  C  CB  . ASP A 1 65  ? -22.728 37.396  3.123   1.00 30.42 ? 273  ASP A CB  1 
ATOM   277  C  CG  . ASP A 1 65  ? -23.945 37.366  2.189   1.00 32.31 ? 273  ASP A CG  1 
ATOM   278  O  OD1 . ASP A 1 65  ? -23.764 37.202  0.965   1.00 34.37 ? 273  ASP A OD1 1 
ATOM   279  O  OD2 . ASP A 1 65  ? -25.087 37.516  2.677   1.00 34.43 ? 273  ASP A OD2 1 
ATOM   280  N  N   . LYS A 1 66  ? -19.664 35.479  3.855   1.00 28.67 ? 274  LYS A N   1 
ATOM   281  C  CA  . LYS A 1 66  ? -18.444 35.536  4.671   1.00 28.29 ? 274  LYS A CA  1 
ATOM   282  C  C   . LYS A 1 66  ? -17.183 35.515  3.819   1.00 28.16 ? 274  LYS A C   1 
ATOM   283  O  O   . LYS A 1 66  ? -17.202 35.038  2.677   1.00 27.64 ? 274  LYS A O   1 
ATOM   284  C  CB  . LYS A 1 66  ? -18.374 34.355  5.664   1.00 27.90 ? 274  LYS A CB  1 
ATOM   285  C  CG  . LYS A 1 66  ? -19.523 34.255  6.669   1.00 28.42 ? 274  LYS A CG  1 
ATOM   286  C  CD  . LYS A 1 66  ? -19.648 35.494  7.566   1.00 29.60 ? 274  LYS A CD  1 
ATOM   287  C  CE  . LYS A 1 66  ? -20.859 35.360  8.516   1.00 29.79 ? 274  LYS A CE  1 
ATOM   288  N  NZ  . LYS A 1 66  ? -20.998 36.577  9.358   1.00 31.74 ? 274  LYS A NZ  1 
ATOM   289  N  N   . VAL A 1 67  ? -16.086 36.006  4.402   1.00 27.63 ? 275  VAL A N   1 
ATOM   290  C  CA  . VAL A 1 67  ? -14.758 35.836  3.826   1.00 27.42 ? 275  VAL A CA  1 
ATOM   291  C  C   . VAL A 1 67  ? -14.115 34.588  4.444   1.00 26.61 ? 275  VAL A C   1 
ATOM   292  O  O   . VAL A 1 67  ? -13.949 34.498  5.667   1.00 26.40 ? 275  VAL A O   1 
ATOM   293  C  CB  . VAL A 1 67  ? -13.857 37.083  4.045   1.00 27.86 ? 275  VAL A CB  1 
ATOM   294  C  CG1 . VAL A 1 67  ? -12.503 36.886  3.383   1.00 27.67 ? 275  VAL A CG1 1 
ATOM   295  C  CG2 . VAL A 1 67  ? -14.541 38.358  3.500   1.00 29.58 ? 275  VAL A CG2 1 
ATOM   296  N  N   . VAL A 1 68  ? -13.760 33.639  3.582   1.00 26.21 ? 276  VAL A N   1 
ATOM   297  C  CA  . VAL A 1 68  ? -13.255 32.326  3.988   1.00 25.63 ? 276  VAL A CA  1 
ATOM   298  C  C   . VAL A 1 68  ? -11.805 32.134  3.533   1.00 25.90 ? 276  VAL A C   1 
ATOM   299  O  O   . VAL A 1 68  ? -11.453 32.475  2.398   1.00 26.21 ? 276  VAL A O   1 
ATOM   300  C  CB  . VAL A 1 68  ? -14.119 31.178  3.380   1.00 25.29 ? 276  VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 68  ? -13.633 29.801  3.873   1.00 24.96 ? 276  VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 68  ? -15.602 31.377  3.699   1.00 24.77 ? 276  VAL A CG2 1 
ATOM   303  N  N   . LEU A 1 69  ? -10.978 31.592  4.423   1.00 25.52 ? 277  LEU A N   1 
ATOM   304  C  CA  . LEU A 1 69  ? -9.615  31.204  4.089   1.00 25.67 ? 277  LEU A CA  1 
ATOM   305  C  C   . LEU A 1 69  ? -9.487  29.680  4.136   1.00 25.38 ? 277  LEU A C   1 
ATOM   306  O  O   . LEU A 1 69  ? -9.766  29.071  5.164   1.00 24.90 ? 277  LEU A O   1 
ATOM   307  C  CB  . LEU A 1 69  ? -8.628  31.825  5.075   1.00 25.81 ? 277  LEU A CB  1 
ATOM   308  C  CG  . LEU A 1 69  ? -7.150  31.428  4.973   1.00 26.91 ? 277  LEU A CG  1 
ATOM   309  C  CD1 . LEU A 1 69  ? -6.561  31.771  3.593   1.00 27.26 ? 277  LEU A CD1 1 
ATOM   310  C  CD2 . LEU A 1 69  ? -6.351  32.096  6.084   1.00 26.60 ? 277  LEU A CD2 1 
ATOM   311  N  N   . ASP A 1 70  ? -9.044  29.087  3.029   1.00 25.75 ? 278  ASP A N   1 
ATOM   312  C  CA  . ASP A 1 70  ? -8.829  27.634  2.934   1.00 25.94 ? 278  ASP A CA  1 
ATOM   313  C  C   . ASP A 1 70  ? -7.315  27.351  2.937   1.00 26.31 ? 278  ASP A C   1 
ATOM   314  O  O   . ASP A 1 70  ? -6.623  27.554  1.938   1.00 26.86 ? 278  ASP A O   1 
ATOM   315  C  CB  . ASP A 1 70  ? -9.545  27.093  1.688   1.00 26.01 ? 278  ASP A CB  1 
ATOM   316  C  CG  . ASP A 1 70  ? -9.318  25.588  1.443   1.00 27.28 ? 278  ASP A CG  1 
ATOM   317  O  OD1 . ASP A 1 70  ? -9.799  25.116  0.386   1.00 30.41 ? 278  ASP A OD1 1 
ATOM   318  O  OD2 . ASP A 1 70  ? -8.682  24.875  2.261   1.00 27.99 ? 278  ASP A OD2 1 
ATOM   319  N  N   . VAL A 1 71  ? -6.812  26.912  4.089   1.00 26.45 ? 279  VAL A N   1 
ATOM   320  C  CA  . VAL A 1 71  ? -5.382  26.690  4.298   1.00 26.48 ? 279  VAL A CA  1 
ATOM   321  C  C   . VAL A 1 71  ? -4.938  25.320  3.763   1.00 26.90 ? 279  VAL A C   1 
ATOM   322  O  O   . VAL A 1 71  ? -5.379  24.273  4.258   1.00 26.42 ? 279  VAL A O   1 
ATOM   323  C  CB  . VAL A 1 71  ? -5.022  26.844  5.801   1.00 26.87 ? 279  VAL A CB  1 
ATOM   324  C  CG1 . VAL A 1 71  ? -3.524  26.635  6.051   1.00 27.12 ? 279  VAL A CG1 1 
ATOM   325  C  CG2 . VAL A 1 71  ? -5.476  28.219  6.323   1.00 26.06 ? 279  VAL A CG2 1 
ATOM   326  N  N   . GLY A 1 72  ? -4.064  25.336  2.755   1.00 27.13 ? 280  GLY A N   1 
ATOM   327  C  CA  . GLY A 1 72  ? -3.645  24.110  2.067   1.00 27.24 ? 280  GLY A CA  1 
ATOM   328  C  C   . GLY A 1 72  ? -4.799  23.572  1.235   1.00 26.96 ? 280  GLY A C   1 
ATOM   329  O  O   . GLY A 1 72  ? -5.295  22.478  1.487   1.00 27.17 ? 280  GLY A O   1 
ATOM   330  N  N   . CYS A 1 73  ? -5.214  24.346  0.239   1.00 26.42 ? 281  CYS A N   1 
ATOM   331  C  CA  . CYS A 1 73  ? -6.457  24.094  -0.486  1.00 26.37 ? 281  CYS A CA  1 
ATOM   332  C  C   . CYS A 1 73  ? -6.428  22.944  -1.495  1.00 26.14 ? 281  CYS A C   1 
ATOM   333  O  O   . CYS A 1 73  ? -7.486  22.530  -1.984  1.00 26.74 ? 281  CYS A O   1 
ATOM   334  C  CB  . CYS A 1 73  ? -6.925  25.368  -1.176  1.00 25.89 ? 281  CYS A CB  1 
ATOM   335  S  SG  . CYS A 1 73  ? -5.807  25.976  -2.442  1.00 28.23 ? 281  CYS A SG  1 
ATOM   336  N  N   . GLY A 1 74  ? -5.240  22.438  -1.821  1.00 26.23 ? 282  GLY A N   1 
ATOM   337  C  CA  . GLY A 1 74  ? -5.120  21.353  -2.808  1.00 25.72 ? 282  GLY A CA  1 
ATOM   338  C  C   . GLY A 1 74  ? -5.778  21.734  -4.130  1.00 25.70 ? 282  GLY A C   1 
ATOM   339  O  O   . GLY A 1 74  ? -5.524  22.821  -4.667  1.00 25.75 ? 282  GLY A O   1 
ATOM   340  N  N   . THR A 1 75  ? -6.638  20.849  -4.634  1.00 25.65 ? 283  THR A N   1 
ATOM   341  C  CA  . THR A 1 75  ? -7.405  21.063  -5.877  1.00 25.93 ? 283  THR A CA  1 
ATOM   342  C  C   . THR A 1 75  ? -8.431  22.213  -5.791  1.00 25.60 ? 283  THR A C   1 
ATOM   343  O  O   . THR A 1 75  ? -8.959  22.674  -6.817  1.00 25.41 ? 283  THR A O   1 
ATOM   344  C  CB  . THR A 1 75  ? -8.189  19.784  -6.248  1.00 26.19 ? 283  THR A CB  1 
ATOM   345  O  OG1 . THR A 1 75  ? -9.111  19.466  -5.191  1.00 25.94 ? 283  THR A OG1 1 
ATOM   346  C  CG2 . THR A 1 75  ? -7.246  18.602  -6.472  1.00 26.95 ? 283  THR A CG2 1 
ATOM   347  N  N   . GLY A 1 76  ? -8.734  22.647  -4.569  1.00 24.80 ? 284  GLY A N   1 
ATOM   348  C  CA  . GLY A 1 76  ? -9.680  23.754  -4.341  1.00 24.34 ? 284  GLY A CA  1 
ATOM   349  C  C   . GLY A 1 76  ? -11.081 23.303  -3.957  1.00 23.97 ? 284  GLY A C   1 
ATOM   350  O  O   . GLY A 1 76  ? -12.006 24.121  -3.881  1.00 24.16 ? 284  GLY A O   1 
ATOM   351  N  N   . ILE A 1 77  ? -11.250 22.006  -3.720  1.00 23.76 ? 285  ILE A N   1 
ATOM   352  C  CA  . ILE A 1 77  ? -12.583 21.441  -3.502  1.00 24.35 ? 285  ILE A CA  1 
ATOM   353  C  C   . ILE A 1 77  ? -13.309 22.073  -2.297  1.00 23.39 ? 285  ILE A C   1 
ATOM   354  O  O   . ILE A 1 77  ? -14.483 22.390  -2.399  1.00 23.29 ? 285  ILE A O   1 
ATOM   355  C  CB  . ILE A 1 77  ? -12.575 19.873  -3.440  1.00 25.05 ? 285  ILE A CB  1 
ATOM   356  C  CG1 . ILE A 1 77  ? -14.003 19.300  -3.389  1.00 25.76 ? 285  ILE A CG1 1 
ATOM   357  C  CG2 . ILE A 1 77  ? -11.792 19.367  -2.227  1.00 26.30 ? 285  ILE A CG2 1 
ATOM   358  C  CD1 . ILE A 1 77  ? -14.770 19.462  -4.655  1.00 26.34 ? 285  ILE A CD1 1 
ATOM   359  N  N   . LEU A 1 78  ? -12.608 22.297  -1.187  1.00 22.98 ? 286  LEU A N   1 
ATOM   360  C  CA  . LEU A 1 78  ? -13.227 22.922  -0.005  1.00 22.73 ? 286  LEU A CA  1 
ATOM   361  C  C   . LEU A 1 78  ? -13.605 24.383  -0.280  1.00 22.51 ? 286  LEU A C   1 
ATOM   362  O  O   . LEU A 1 78  ? -14.625 24.873  0.207   1.00 22.07 ? 286  LEU A O   1 
ATOM   363  C  CB  . LEU A 1 78  ? -12.308 22.841  1.228   1.00 22.98 ? 286  LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 78  ? -11.867 21.464  1.744   1.00 25.25 ? 286  LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 78  ? -11.207 21.613  3.108   1.00 27.28 ? 286  LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 78  ? -13.044 20.501  1.826   1.00 27.18 ? 286  LEU A CD2 1 
ATOM   367  N  N   . SER A 1 79  ? -12.778 25.067  -1.068  1.00 22.13 ? 287  SER A N   1 
ATOM   368  C  CA  . SER A 1 79  ? -13.074 26.438  -1.490  1.00 22.41 ? 287  SER A CA  1 
ATOM   369  C  C   . SER A 1 79  ? -14.342 26.501  -2.341  1.00 21.79 ? 287  SER A C   1 
ATOM   370  O  O   . SER A 1 79  ? -15.153 27.418  -2.187  1.00 22.31 ? 287  SER A O   1 
ATOM   371  C  CB  . SER A 1 79  ? -11.883 27.043  -2.246  1.00 22.51 ? 287  SER A CB  1 
ATOM   372  O  OG  . SER A 1 79  ? -10.768 27.172  -1.371  1.00 24.42 ? 287  SER A OG  1 
ATOM   373  N  N   . MET A 1 80  ? -14.521 25.526  -3.225  1.00 21.64 ? 288  MET A N   1 
ATOM   374  C  CA  . MET A 1 80  ? -15.730 25.467  -4.049  1.00 21.82 ? 288  MET A CA  1 
ATOM   375  C  C   . MET A 1 80  ? -16.967 25.099  -3.208  1.00 21.55 ? 288  MET A C   1 
ATOM   376  O  O   . MET A 1 80  ? -18.043 25.635  -3.444  1.00 22.01 ? 288  MET A O   1 
ATOM   377  C  CB  . MET A 1 80  ? -15.543 24.529  -5.255  1.00 21.97 ? 288  MET A CB  1 
ATOM   378  C  CG  . MET A 1 80  ? -14.400 24.959  -6.189  1.00 21.94 ? 288  MET A CG  1 
ATOM   379  S  SD  . MET A 1 80  ? -14.406 24.118  -7.792  1.00 24.42 ? 288  MET A SD  1 
ATOM   380  C  CE  . MET A 1 80  ? -13.864 22.490  -7.248  1.00 23.11 ? 288  MET A CE  1 
ATOM   381  N  N   . PHE A 1 81  ? -16.815 24.219  -2.215  1.00 21.17 ? 289  PHE A N   1 
ATOM   382  C  CA  . PHE A 1 81  ? -17.936 23.939  -1.287  1.00 21.18 ? 289  PHE A CA  1 
ATOM   383  C  C   . PHE A 1 81  ? -18.383 25.247  -0.615  1.00 21.12 ? 289  PHE A C   1 
ATOM   384  O  O   . PHE A 1 81  ? -19.594 25.561  -0.534  1.00 21.22 ? 289  PHE A O   1 
ATOM   385  C  CB  . PHE A 1 81  ? -17.534 22.953  -0.181  1.00 20.57 ? 289  PHE A CB  1 
ATOM   386  C  CG  . PHE A 1 81  ? -17.335 21.522  -0.637  1.00 20.84 ? 289  PHE A CG  1 
ATOM   387  C  CD1 . PHE A 1 81  ? -16.488 20.676  0.083   1.00 20.87 ? 289  PHE A CD1 1 
ATOM   388  C  CD2 . PHE A 1 81  ? -18.009 21.003  -1.747  1.00 20.65 ? 289  PHE A CD2 1 
ATOM   389  C  CE1 . PHE A 1 81  ? -16.299 19.336  -0.314  1.00 21.76 ? 289  PHE A CE1 1 
ATOM   390  C  CE2 . PHE A 1 81  ? -17.822 19.670  -2.141  1.00 20.94 ? 289  PHE A CE2 1 
ATOM   391  C  CZ  . PHE A 1 81  ? -16.971 18.843  -1.426  1.00 21.21 ? 289  PHE A CZ  1 
ATOM   392  N  N   . ALA A 1 82  ? -17.400 25.991  -0.112  1.00 20.88 ? 290  ALA A N   1 
ATOM   393  C  CA  . ALA A 1 82  ? -17.671 27.236  0.617   1.00 21.65 ? 290  ALA A CA  1 
ATOM   394  C  C   . ALA A 1 82  ? -18.337 28.262  -0.308  1.00 21.76 ? 290  ALA A C   1 
ATOM   395  O  O   . ALA A 1 82  ? -19.269 28.956  0.107   1.00 21.85 ? 290  ALA A O   1 
ATOM   396  C  CB  . ALA A 1 82  ? -16.377 27.796  1.235   1.00 21.06 ? 290  ALA A CB  1 
ATOM   397  N  N   . ALA A 1 83  ? -17.885 28.329  -1.564  1.00 22.18 ? 291  ALA A N   1 
ATOM   398  C  CA  . ALA A 1 83  ? -18.489 29.244  -2.542  1.00 23.47 ? 291  ALA A CA  1 
ATOM   399  C  C   . ALA A 1 83  ? -19.955 28.865  -2.822  1.00 24.50 ? 291  ALA A C   1 
ATOM   400  O  O   . ALA A 1 83  ? -20.848 29.715  -2.840  1.00 24.28 ? 291  ALA A O   1 
ATOM   401  C  CB  . ALA A 1 83  ? -17.672 29.273  -3.836  1.00 24.23 ? 291  ALA A CB  1 
ATOM   402  N  N   . LYS A 1 84  ? -20.219 27.591  -2.995  1.00 25.07 ? 292  LYS A N   1 
ATOM   403  C  CA  . LYS A 1 84  ? -21.554 27.100  -3.172  1.00 26.31 ? 292  LYS A CA  1 
ATOM   404  C  C   . LYS A 1 84  ? -22.462 27.355  -1.991  1.00 26.23 ? 292  LYS A C   1 
ATOM   405  O  O   . LYS A 1 84  ? -23.603 27.567  -2.152  1.00 25.71 ? 292  LYS A O   1 
ATOM   406  C  CB  . LYS A 1 84  ? -21.536 25.631  -3.419  1.00 26.96 ? 292  LYS A CB  1 
ATOM   407  C  CG  . LYS A 1 84  ? -22.010 25.289  -4.724  1.00 31.55 ? 292  LYS A CG  1 
ATOM   408  C  CD  . LYS A 1 84  ? -20.866 25.420  -5.700  1.00 38.55 ? 292  LYS A CD  1 
ATOM   409  C  CE  . LYS A 1 84  ? -21.056 26.517  -6.677  1.00 41.63 ? 292  LYS A CE  1 
ATOM   410  N  NZ  . LYS A 1 84  ? -21.613 25.960  -7.885  1.00 46.20 ? 292  LYS A NZ  1 
ATOM   411  N  N   . ALA A 1 85  ? -21.921 27.308  -0.801  1.00 25.68 ? 293  ALA A N   1 
ATOM   412  C  CA  . ALA A 1 85  ? -22.716 27.581  0.416   1.00 26.19 ? 293  ALA A CA  1 
ATOM   413  C  C   . ALA A 1 85  ? -22.965 29.074  0.641   1.00 26.97 ? 293  ALA A C   1 
ATOM   414  O  O   . ALA A 1 85  ? -23.584 29.463  1.640   1.00 27.08 ? 293  ALA A O   1 
ATOM   415  C  CB  . ALA A 1 85  ? -22.056 26.975  1.640   1.00 25.62 ? 293  ALA A CB  1 
ATOM   416  N  N   . GLY A 1 86  ? -22.453 29.898  -0.275  1.00 27.43 ? 294  GLY A N   1 
ATOM   417  C  CA  . GLY A 1 86  ? -22.746 31.334  -0.316  1.00 28.04 ? 294  GLY A CA  1 
ATOM   418  C  C   . GLY A 1 86  ? -21.630 32.269  0.142   1.00 27.89 ? 294  GLY A C   1 
ATOM   419  O  O   . GLY A 1 86  ? -21.885 33.438  0.395   1.00 27.41 ? 294  GLY A O   1 
ATOM   420  N  N   . ALA A 1 87  ? -20.397 31.776  0.257   1.00 25.90 ? 295  ALA A N   1 
ATOM   421  C  CA  . ALA A 1 87  ? -19.290 32.660  0.644   1.00 27.01 ? 295  ALA A CA  1 
ATOM   422  C  C   . ALA A 1 87  ? -19.176 33.882  -0.284  1.00 28.45 ? 295  ALA A C   1 
ATOM   423  O  O   . ALA A 1 87  ? -19.300 33.760  -1.508  1.00 29.18 ? 295  ALA A O   1 
ATOM   424  C  CB  . ALA A 1 87  ? -17.978 31.912  0.691   1.00 25.47 ? 295  ALA A CB  1 
ATOM   425  N  N   . LYS A 1 88  ? -18.945 35.049  0.312   1.00 29.24 ? 296  LYS A N   1 
ATOM   426  C  CA  . LYS A 1 88  ? -18.721 36.280  -0.444  1.00 30.82 ? 296  LYS A CA  1 
ATOM   427  C  C   . LYS A 1 88  ? -17.366 36.196  -1.158  1.00 30.24 ? 296  LYS A C   1 
ATOM   428  O  O   . LYS A 1 88  ? -17.250 36.546  -2.330  1.00 30.62 ? 296  LYS A O   1 
ATOM   429  C  CB  . LYS A 1 88  ? -18.787 37.487  0.499   1.00 31.63 ? 296  LYS A CB  1 
ATOM   430  C  CG  . LYS A 1 88  ? -18.381 38.831  -0.114  1.00 35.20 ? 296  LYS A CG  1 
ATOM   431  C  CD  . LYS A 1 88  ? -19.170 40.007  0.478   1.00 40.58 ? 296  LYS A CD  1 
ATOM   432  C  CE  . LYS A 1 88  ? -19.011 40.170  1.997   1.00 42.60 ? 296  LYS A CE  1 
ATOM   433  N  NZ  . LYS A 1 88  ? -17.597 40.392  2.437   1.00 44.06 ? 296  LYS A NZ  1 
ATOM   434  N  N   . LYS A 1 89  ? -16.361 35.693  -0.446  1.00 29.66 ? 297  LYS A N   1 
ATOM   435  C  CA  . LYS A 1 89  ? -14.993 35.588  -0.953  1.00 29.58 ? 297  LYS A CA  1 
ATOM   436  C  C   . LYS A 1 89  ? -14.321 34.379  -0.325  1.00 28.32 ? 297  LYS A C   1 
ATOM   437  O  O   . LYS A 1 89  ? -14.440 34.163  0.887   1.00 28.08 ? 297  LYS A O   1 
ATOM   438  C  CB  . LYS A 1 89  ? -14.211 36.865  -0.606  1.00 30.51 ? 297  LYS A CB  1 
ATOM   439  C  CG  . LYS A 1 89  ? -12.791 36.977  -1.192  1.00 33.41 ? 297  LYS A CG  1 
ATOM   440  C  CD  . LYS A 1 89  ? -12.744 36.871  -2.734  1.00 37.50 ? 297  LYS A CD  1 
ATOM   441  C  CE  . LYS A 1 89  ? -13.545 37.974  -3.436  1.00 40.02 ? 297  LYS A CE  1 
ATOM   442  N  NZ  . LYS A 1 89  ? -13.600 37.774  -4.912  1.00 42.02 ? 297  LYS A NZ  1 
ATOM   443  N  N   . VAL A 1 90  ? -13.630 33.581  -1.139  1.00 27.63 ? 298  VAL A N   1 
ATOM   444  C  CA  . VAL A 1 90  ? -12.791 32.505  -0.607  1.00 26.86 ? 298  VAL A CA  1 
ATOM   445  C  C   . VAL A 1 90  ? -11.343 32.654  -1.075  1.00 27.00 ? 298  VAL A C   1 
ATOM   446  O  O   . VAL A 1 90  ? -11.081 32.869  -2.252  1.00 27.13 ? 298  VAL A O   1 
ATOM   447  C  CB  . VAL A 1 90  ? -13.294 31.081  -0.974  1.00 26.13 ? 298  VAL A CB  1 
ATOM   448  C  CG1 . VAL A 1 90  ? -12.583 30.029  -0.097  1.00 26.12 ? 298  VAL A CG1 1 
ATOM   449  C  CG2 . VAL A 1 90  ? -14.799 30.963  -0.778  1.00 25.81 ? 298  VAL A CG2 1 
ATOM   450  N  N   . LEU A 1 91  ? -10.413 32.531  -0.137  1.00 26.87 ? 299  LEU A N   1 
ATOM   451  C  CA  . LEU A 1 91  ? -8.995  32.551  -0.454  1.00 27.46 ? 299  LEU A CA  1 
ATOM   452  C  C   . LEU A 1 91  ? -8.408  31.156  -0.239  1.00 26.94 ? 299  LEU A C   1 
ATOM   453  O  O   . LEU A 1 91  ? -8.420  30.645  0.877   1.00 26.84 ? 299  LEU A O   1 
ATOM   454  C  CB  . LEU A 1 91  ? -8.280  33.591  0.418   1.00 28.18 ? 299  LEU A CB  1 
ATOM   455  C  CG  . LEU A 1 91  ? -8.896  35.005  0.391   1.00 30.99 ? 299  LEU A CG  1 
ATOM   456  C  CD1 . LEU A 1 91  ? -8.316  35.883  1.496   1.00 34.01 ? 299  LEU A CD1 1 
ATOM   457  C  CD2 . LEU A 1 91  ? -8.732  35.683  -0.967  1.00 32.31 ? 299  LEU A CD2 1 
ATOM   458  N  N   . GLY A 1 92  ? -7.924  30.535  -1.311  1.00 26.83 ? 300  GLY A N   1 
ATOM   459  C  CA  . GLY A 1 92  ? -7.306  29.221  -1.215  1.00 26.75 ? 300  GLY A CA  1 
ATOM   460  C  C   . GLY A 1 92  ? -5.809  29.356  -1.355  1.00 27.64 ? 300  GLY A C   1 
ATOM   461  O  O   . GLY A 1 92  ? -5.326  29.884  -2.355  1.00 28.49 ? 300  GLY A O   1 
ATOM   462  N  N   . VAL A 1 93  ? -5.086  28.890  -0.342  1.00 27.82 ? 301  VAL A N   1 
ATOM   463  C  CA  . VAL A 1 93  ? -3.638  28.987  -0.296  1.00 29.09 ? 301  VAL A CA  1 
ATOM   464  C  C   . VAL A 1 93  ? -3.021  27.586  -0.246  1.00 29.39 ? 301  VAL A C   1 
ATOM   465  O  O   . VAL A 1 93  ? -3.476  26.725  0.501   1.00 28.73 ? 301  VAL A O   1 
ATOM   466  C  CB  . VAL A 1 93  ? -3.150  29.831  0.913   1.00 29.28 ? 301  VAL A CB  1 
ATOM   467  C  CG1 . VAL A 1 93  ? -1.632  29.998  0.872   1.00 31.06 ? 301  VAL A CG1 1 
ATOM   468  C  CG2 . VAL A 1 93  ? -3.819  31.206  0.925   1.00 29.65 ? 301  VAL A CG2 1 
ATOM   469  N  N   . ASP A 1 94  ? -2.002  27.358  -1.071  1.00 30.44 ? 302  ASP A N   1 
ATOM   470  C  CA  . ASP A 1 94  ? -1.273  26.096  -1.057  1.00 31.26 ? 302  ASP A CA  1 
ATOM   471  C  C   . ASP A 1 94  ? 0.132   26.361  -1.575  1.00 32.76 ? 302  ASP A C   1 
ATOM   472  O  O   . ASP A 1 94  ? 0.312   27.181  -2.478  1.00 32.84 ? 302  ASP A O   1 
ATOM   473  C  CB  . ASP A 1 94  ? -1.982  25.053  -1.929  1.00 30.68 ? 302  ASP A CB  1 
ATOM   474  C  CG  . ASP A 1 94  ? -1.593  23.628  -1.569  1.00 32.35 ? 302  ASP A CG  1 
ATOM   475  O  OD1 . ASP A 1 94  ? -0.385  23.295  -1.639  1.00 32.92 ? 302  ASP A OD1 1 
ATOM   476  O  OD2 . ASP A 1 94  ? -2.495  22.841  -1.206  1.00 31.62 ? 302  ASP A OD2 1 
ATOM   477  N  N   . GLN A 1 95  ? 1.125   25.680  -1.006  1.00 34.03 ? 303  GLN A N   1 
ATOM   478  C  CA  . GLN A 1 95  ? 2.514   25.884  -1.434  1.00 36.17 ? 303  GLN A CA  1 
ATOM   479  C  C   . GLN A 1 95  ? 2.940   24.986  -2.592  1.00 36.66 ? 303  GLN A C   1 
ATOM   480  O  O   . GLN A 1 95  ? 3.985   25.211  -3.208  1.00 37.81 ? 303  GLN A O   1 
ATOM   481  C  CB  . GLN A 1 95  ? 3.484   25.746  -0.261  1.00 36.89 ? 303  GLN A CB  1 
ATOM   482  C  CG  . GLN A 1 95  ? 3.339   24.494  0.558   1.00 38.72 ? 303  GLN A CG  1 
ATOM   483  C  CD  . GLN A 1 95  ? 4.142   24.572  1.840   1.00 42.55 ? 303  GLN A CD  1 
ATOM   484  O  OE1 . GLN A 1 95  ? 5.367   24.722  1.813   1.00 42.80 ? 303  GLN A OE1 1 
ATOM   485  N  NE2 . GLN A 1 95  ? 3.454   24.474  2.975   1.00 42.75 ? 303  GLN A NE2 1 
ATOM   486  N  N   . SER A 1 96  ? 2.117   23.985  -2.887  1.00 36.15 ? 304  SER A N   1 
ATOM   487  C  CA  . SER A 1 96  ? 2.432   22.978  -3.892  1.00 36.88 ? 304  SER A CA  1 
ATOM   488  C  C   . SER A 1 96  ? 1.943   23.359  -5.292  1.00 36.55 ? 304  SER A C   1 
ATOM   489  O  O   . SER A 1 96  ? 1.026   24.182  -5.437  1.00 35.84 ? 304  SER A O   1 
ATOM   490  C  CB  . SER A 1 96  ? 1.819   21.647  -3.472  1.00 36.79 ? 304  SER A CB  1 
ATOM   491  O  OG  . SER A 1 96  ? 1.460   20.881  -4.607  1.00 38.70 ? 304  SER A OG  1 
ATOM   492  N  N   . GLU A 1 97  ? 2.542   22.722  -6.305  1.00 36.68 ? 305  GLU A N   1 
ATOM   493  C  CA  . GLU A 1 97  ? 2.188   22.909  -7.722  1.00 36.52 ? 305  GLU A CA  1 
ATOM   494  C  C   . GLU A 1 97  ? 0.729   22.581  -8.053  1.00 34.95 ? 305  GLU A C   1 
ATOM   495  O  O   . GLU A 1 97  ? 0.201   23.037  -9.073  1.00 34.59 ? 305  GLU A O   1 
ATOM   496  C  CB  . GLU A 1 97  ? 3.132   22.111  -8.639  1.00 37.33 ? 305  GLU A CB  1 
ATOM   497  C  CG  . GLU A 1 97  ? 4.428   22.840  -8.972  1.00 40.13 ? 305  GLU A CG  1 
ATOM   498  N  N   . ILE A 1 98  ? 0.085   21.793  -7.192  1.00 33.73 ? 306  ILE A N   1 
ATOM   499  C  CA  . ILE A 1 98  ? -1.355  21.523  -7.307  1.00 32.40 ? 306  ILE A CA  1 
ATOM   500  C  C   . ILE A 1 98  ? -2.165  22.821  -7.432  1.00 31.85 ? 306  ILE A C   1 
ATOM   501  O  O   . ILE A 1 98  ? -3.235  22.830  -8.052  1.00 30.99 ? 306  ILE A O   1 
ATOM   502  C  CB  . ILE A 1 98  ? -1.881  20.678  -6.111  1.00 31.78 ? 306  ILE A CB  1 
ATOM   503  C  CG1 . ILE A 1 98  ? -3.260  20.072  -6.408  1.00 31.09 ? 306  ILE A CG1 1 
ATOM   504  C  CG2 . ILE A 1 98  ? -1.897  21.509  -4.816  1.00 30.83 ? 306  ILE A CG2 1 
ATOM   505  C  CD1 . ILE A 1 98  ? -3.295  19.046  -7.542  1.00 31.55 ? 306  ILE A CD1 1 
ATOM   506  N  N   . LEU A 1 99  ? -1.643  23.907  -6.856  1.00 31.89 ? 307  LEU A N   1 
ATOM   507  C  CA  . LEU A 1 99  ? -2.314  25.206  -6.895  1.00 31.75 ? 307  LEU A CA  1 
ATOM   508  C  C   . LEU A 1 99  ? -2.615  25.643  -8.334  1.00 32.23 ? 307  LEU A C   1 
ATOM   509  O  O   . LEU A 1 99  ? -3.642  26.262  -8.578  1.00 31.98 ? 307  LEU A O   1 
ATOM   510  C  CB  . LEU A 1 99  ? -1.496  26.269  -6.148  1.00 32.57 ? 307  LEU A CB  1 
ATOM   511  C  CG  . LEU A 1 99  ? -2.150  27.546  -5.591  1.00 31.96 ? 307  LEU A CG  1 
ATOM   512  C  CD1 . LEU A 1 99  ? -2.339  28.610  -6.670  1.00 34.11 ? 307  LEU A CD1 1 
ATOM   513  C  CD2 . LEU A 1 99  ? -3.474  27.251  -4.888  1.00 30.39 ? 307  LEU A CD2 1 
ATOM   514  N  N   . TYR A 1 100 ? -1.739  25.299  -9.281  1.00 32.97 ? 308  TYR A N   1 
ATOM   515  C  CA  . TYR A 1 100 ? -1.978  25.626  -10.692 1.00 34.04 ? 308  TYR A CA  1 
ATOM   516  C  C   . TYR A 1 100 ? -3.144  24.837  -11.280 1.00 33.00 ? 308  TYR A C   1 
ATOM   517  O  O   . TYR A 1 100 ? -3.893  25.357  -12.108 1.00 33.08 ? 308  TYR A O   1 
ATOM   518  C  CB  . TYR A 1 100 ? -0.711  25.434  -11.539 1.00 35.92 ? 308  TYR A CB  1 
ATOM   519  C  CG  . TYR A 1 100 ? 0.437   26.325  -11.103 1.00 38.73 ? 308  TYR A CG  1 
ATOM   520  C  CD1 . TYR A 1 100 ? 1.727   25.817  -10.957 1.00 41.48 ? 308  TYR A CD1 1 
ATOM   521  C  CD2 . TYR A 1 100 ? 0.222   27.670  -10.812 1.00 40.29 ? 308  TYR A CD2 1 
ATOM   522  C  CE1 . TYR A 1 100 ? 2.783   26.638  -10.543 1.00 44.04 ? 308  TYR A CE1 1 
ATOM   523  C  CE2 . TYR A 1 100 ? 1.259   28.494  -10.394 1.00 44.14 ? 308  TYR A CE2 1 
ATOM   524  C  CZ  . TYR A 1 100 ? 2.536   27.975  -10.263 1.00 44.85 ? 308  TYR A CZ  1 
ATOM   525  O  OH  . TYR A 1 100 ? 3.554   28.803  -9.858  1.00 47.69 ? 308  TYR A OH  1 
ATOM   526  N  N   . GLN A 1 101 ? -3.295  23.587  -10.857 1.00 31.40 ? 309  GLN A N   1 
ATOM   527  C  CA  . GLN A 1 101 ? -4.467  22.805  -11.238 1.00 30.92 ? 309  GLN A CA  1 
ATOM   528  C  C   . GLN A 1 101 ? -5.739  23.432  -10.653 1.00 29.48 ? 309  GLN A C   1 
ATOM   529  O  O   . GLN A 1 101 ? -6.732  23.614  -11.368 1.00 28.80 ? 309  GLN A O   1 
ATOM   530  C  CB  . GLN A 1 101 ? -4.315  21.336  -10.823 1.00 31.00 ? 309  GLN A CB  1 
ATOM   531  C  CG  . GLN A 1 101 ? -3.428  20.508  -11.774 1.00 33.36 ? 309  GLN A CG  1 
ATOM   532  C  CD  . GLN A 1 101 ? -4.174  20.079  -13.041 1.00 36.61 ? 309  GLN A CD  1 
ATOM   533  O  OE1 . GLN A 1 101 ? -5.396  20.201  -13.127 1.00 37.98 ? 309  GLN A OE1 1 
ATOM   534  N  NE2 . GLN A 1 101 ? -3.443  19.562  -14.017 1.00 38.96 ? 309  GLN A NE2 1 
ATOM   535  N  N   . ALA A 1 102 ? -5.675  23.809  -9.375  1.00 28.62 ? 310  ALA A N   1 
ATOM   536  C  CA  . ALA A 1 102 ? -6.789  24.491  -8.689  1.00 28.05 ? 310  ALA A CA  1 
ATOM   537  C  C   . ALA A 1 102 ? -7.266  25.720  -9.464  1.00 28.39 ? 310  ALA A C   1 
ATOM   538  O  O   . ALA A 1 102 ? -8.471  25.953  -9.594  1.00 27.89 ? 310  ALA A O   1 
ATOM   539  C  CB  . ALA A 1 102 ? -6.392  24.879  -7.257  1.00 27.58 ? 310  ALA A CB  1 
ATOM   540  N  N   . MET A 1 103 ? -6.320  26.501  -9.983  1.00 29.07 ? 311  MET A N   1 
ATOM   541  C  CA  . MET A 1 103 ? -6.653  27.686  -10.783 1.00 30.23 ? 311  MET A CA  1 
ATOM   542  C  C   . MET A 1 103 ? -7.520  27.295  -11.976 1.00 29.89 ? 311  MET A C   1 
ATOM   543  O  O   . MET A 1 103 ? -8.555  27.919  -12.235 1.00 29.96 ? 311  MET A O   1 
ATOM   544  C  CB  . MET A 1 103 ? -5.377  28.422  -11.239 1.00 31.67 ? 311  MET A CB  1 
ATOM   545  C  CG  . MET A 1 103 ? -4.683  29.186  -10.095 1.00 33.98 ? 311  MET A CG  1 
ATOM   546  S  SD  . MET A 1 103 ? -3.053  29.840  -10.531 1.00 41.36 ? 311  MET A SD  1 
ATOM   547  C  CE  . MET A 1 103 ? -2.915  31.191  -9.342  1.00 41.55 ? 311  MET A CE  1 
ATOM   548  N  N   . ASP A 1 104 ? -7.114  26.241  -12.675 1.00 29.52 ? 312  ASP A N   1 
ATOM   549  C  CA  . ASP A 1 104 ? -7.862  25.756  -13.826 1.00 29.70 ? 312  ASP A CA  1 
ATOM   550  C  C   . ASP A 1 104 ? -9.206  25.176  -13.403 1.00 27.94 ? 312  ASP A C   1 
ATOM   551  O  O   . ASP A 1 104 ? -10.220 25.397  -14.064 1.00 28.16 ? 312  ASP A O   1 
ATOM   552  C  CB  . ASP A 1 104 ? -7.042  24.736  -14.615 1.00 30.48 ? 312  ASP A CB  1 
ATOM   553  C  CG  . ASP A 1 104 ? -5.927  25.388  -15.430 1.00 34.46 ? 312  ASP A CG  1 
ATOM   554  O  OD1 . ASP A 1 104 ? -5.945  26.628  -15.621 1.00 35.90 ? 312  ASP A OD1 1 
ATOM   555  O  OD2 . ASP A 1 104 ? -5.019  24.654  -15.880 1.00 38.20 ? 312  ASP A OD2 1 
ATOM   556  N  N   . ILE A 1 105 ? -9.212  24.447  -12.290 1.00 26.74 ? 313  ILE A N   1 
ATOM   557  C  CA  . ILE A 1 105 ? -10.446 23.867  -11.748 1.00 25.01 ? 313  ILE A CA  1 
ATOM   558  C  C   . ILE A 1 105 ? -11.449 24.970  -11.402 1.00 25.28 ? 313  ILE A C   1 
ATOM   559  O  O   . ILE A 1 105 ? -12.611 24.921  -11.823 1.00 24.95 ? 313  ILE A O   1 
ATOM   560  C  CB  . ILE A 1 105 ? -10.135 22.953  -10.527 1.00 24.40 ? 313  ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1 105 ? -9.399  21.689  -11.006 1.00 23.44 ? 313  ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1 105 ? -11.409 22.591  -9.760  1.00 23.25 ? 313  ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1 105 ? -8.808  20.814  -9.887  1.00 22.65 ? 313  ILE A CD1 1 
ATOM   564  N  N   . ILE A 1 106 ? -10.997 25.980  -10.667 1.00 25.31 ? 314  ILE A N   1 
ATOM   565  C  CA  . ILE A 1 106 ? -11.868 27.090  -10.280 1.00 26.08 ? 314  ILE A CA  1 
ATOM   566  C  C   . ILE A 1 106 ? -12.503 27.748  -11.523 1.00 27.17 ? 314  ILE A C   1 
ATOM   567  O  O   . ILE A 1 106 ? -13.695 28.064  -11.518 1.00 27.42 ? 314  ILE A O   1 
ATOM   568  C  CB  . ILE A 1 106 ? -11.129 28.101  -9.352  1.00 26.18 ? 314  ILE A CB  1 
ATOM   569  C  CG1 . ILE A 1 106 ? -11.437 27.814  -7.876  1.00 26.06 ? 314  ILE A CG1 1 
ATOM   570  C  CG2 . ILE A 1 106 ? -11.553 29.534  -9.630  1.00 27.01 ? 314  ILE A CG2 1 
ATOM   571  C  CD1 . ILE A 1 106 ? -11.059 26.414  -7.382  1.00 25.22 ? 314  ILE A CD1 1 
ATOM   572  N  N   . ARG A 1 107 ? -11.714 27.905  -12.586 1.00 27.80 ? 315  ARG A N   1 
ATOM   573  C  CA  . ARG A 1 107 ? -12.194 28.456  -13.861 1.00 29.15 ? 315  ARG A CA  1 
ATOM   574  C  C   . ARG A 1 107 ? -13.204 27.566  -14.576 1.00 28.56 ? 315  ARG A C   1 
ATOM   575  O  O   . ARG A 1 107 ? -14.202 28.069  -15.099 1.00 28.87 ? 315  ARG A O   1 
ATOM   576  C  CB  . ARG A 1 107 ? -11.034 28.775  -14.806 1.00 30.30 ? 315  ARG A CB  1 
ATOM   577  C  CG  . ARG A 1 107 ? -10.311 30.068  -14.473 1.00 33.20 ? 315  ARG A CG  1 
ATOM   578  C  CD  . ARG A 1 107 ? -9.352  30.434  -15.591 1.00 37.60 ? 315  ARG A CD  1 
ATOM   579  N  NE  . ARG A 1 107 ? -8.874  31.807  -15.448 1.00 41.69 ? 315  ARG A NE  1 
ATOM   580  N  N   . LEU A 1 108 ? -12.953 26.254  -14.590 1.00 27.72 ? 316  LEU A N   1 
ATOM   581  C  CA  . LEU A 1 108 ? -13.884 25.297  -15.190 1.00 27.29 ? 316  LEU A CA  1 
ATOM   582  C  C   . LEU A 1 108 ? -15.236 25.348  -14.503 1.00 26.78 ? 316  LEU A C   1 
ATOM   583  O  O   . LEU A 1 108 ? -16.259 25.085  -15.132 1.00 27.30 ? 316  LEU A O   1 
ATOM   584  C  CB  . LEU A 1 108 ? -13.358 23.860  -15.103 1.00 26.98 ? 316  LEU A CB  1 
ATOM   585  C  CG  . LEU A 1 108 ? -12.364 23.329  -16.134 1.00 28.89 ? 316  LEU A CG  1 
ATOM   586  C  CD1 . LEU A 1 108 ? -11.952 21.913  -15.726 1.00 29.19 ? 316  LEU A CD1 1 
ATOM   587  C  CD2 . LEU A 1 108 ? -12.957 23.331  -17.553 1.00 29.25 ? 316  LEU A CD2 1 
ATOM   588  N  N   . ASN A 1 109 ? -15.234 25.671  -13.209 1.00 25.66 ? 317  ASN A N   1 
ATOM   589  C  CA  . ASN A 1 109 ? -16.475 25.750  -12.443 1.00 25.50 ? 317  ASN A CA  1 
ATOM   590  C  C   . ASN A 1 109 ? -17.063 27.158  -12.324 1.00 25.85 ? 317  ASN A C   1 
ATOM   591  O  O   . ASN A 1 109 ? -18.054 27.360  -11.617 1.00 25.32 ? 317  ASN A O   1 
ATOM   592  C  CB  . ASN A 1 109 ? -16.295 25.085  -11.079 1.00 24.77 ? 317  ASN A CB  1 
ATOM   593  C  CG  . ASN A 1 109 ? -16.062 23.590  -11.201 1.00 25.11 ? 317  ASN A CG  1 
ATOM   594  O  OD1 . ASN A 1 109 ? -17.000 22.815  -11.440 1.00 24.23 ? 317  ASN A OD1 1 
ATOM   595  N  ND2 . ASN A 1 109 ? -14.810 23.177  -11.047 1.00 22.93 ? 317  ASN A ND2 1 
ATOM   596  N  N   . LYS A 1 110 ? -16.467 28.105  -13.057 1.00 26.83 ? 318  LYS A N   1 
ATOM   597  C  CA  . LYS A 1 110 ? -16.931 29.511  -13.145 1.00 27.87 ? 318  LYS A CA  1 
ATOM   598  C  C   . LYS A 1 110 ? -17.000 30.202  -11.776 1.00 27.74 ? 318  LYS A C   1 
ATOM   599  O  O   . LYS A 1 110 ? -17.945 30.936  -11.471 1.00 27.53 ? 318  LYS A O   1 
ATOM   600  C  CB  . LYS A 1 110 ? -18.266 29.615  -13.901 1.00 28.62 ? 318  LYS A CB  1 
ATOM   601  C  CG  . LYS A 1 110 ? -18.248 28.893  -15.256 1.00 29.83 ? 318  LYS A CG  1 
ATOM   602  C  CD  . LYS A 1 110 ? -19.457 29.239  -16.096 1.00 33.62 ? 318  LYS A CD  1 
ATOM   603  C  CE  . LYS A 1 110 ? -19.488 28.423  -17.399 1.00 35.49 ? 318  LYS A CE  1 
ATOM   604  N  NZ  . LYS A 1 110 ? -18.254 28.605  -18.200 1.00 37.17 ? 318  LYS A NZ  1 
ATOM   605  N  N   . LEU A 1 111 ? -15.973 29.979  -10.966 1.00 27.27 ? 319  LEU A N   1 
ATOM   606  C  CA  . LEU A 1 111 ? -15.968 30.487  -9.593  1.00 27.40 ? 319  LEU A CA  1 
ATOM   607  C  C   . LEU A 1 111 ? -14.850 31.489  -9.323  1.00 27.78 ? 319  LEU A C   1 
ATOM   608  O  O   . LEU A 1 111 ? -14.608 31.879  -8.176  1.00 26.66 ? 319  LEU A O   1 
ATOM   609  C  CB  . LEU A 1 111 ? -15.896 29.316  -8.607  1.00 26.08 ? 319  LEU A CB  1 
ATOM   610  C  CG  . LEU A 1 111 ? -17.163 28.460  -8.471  1.00 25.81 ? 319  LEU A CG  1 
ATOM   611  C  CD1 . LEU A 1 111 ? -16.869 27.242  -7.592  1.00 25.61 ? 319  LEU A CD1 1 
ATOM   612  C  CD2 . LEU A 1 111 ? -18.319 29.254  -7.887  1.00 27.16 ? 319  LEU A CD2 1 
ATOM   613  N  N   . GLU A 1 112 ? -14.176 31.901  -10.389 1.00 29.21 ? 320  GLU A N   1 
ATOM   614  C  CA  . GLU A 1 112 ? -13.023 32.795  -10.274 1.00 31.29 ? 320  GLU A CA  1 
ATOM   615  C  C   . GLU A 1 112 ? -13.362 34.176  -9.703  1.00 32.15 ? 320  GLU A C   1 
ATOM   616  O  O   . GLU A 1 112 ? -12.498 34.831  -9.122  1.00 32.72 ? 320  GLU A O   1 
ATOM   617  C  CB  . GLU A 1 112 ? -12.247 32.895  -11.603 1.00 32.37 ? 320  GLU A CB  1 
ATOM   618  C  CG  . GLU A 1 112 ? -12.983 33.558  -12.778 1.00 35.72 ? 320  GLU A CG  1 
ATOM   619  C  CD  . GLU A 1 112 ? -13.854 32.587  -13.585 1.00 38.29 ? 320  GLU A CD  1 
ATOM   620  O  OE1 . GLU A 1 112 ? -14.245 31.521  -13.068 1.00 38.46 ? 320  GLU A OE1 1 
ATOM   621  O  OE2 . GLU A 1 112 ? -14.160 32.898  -14.747 1.00 40.82 ? 320  GLU A OE2 1 
ATOM   622  N  N   . ASP A 1 113 ? -14.614 34.607  -9.841  1.00 32.44 ? 321  ASP A N   1 
ATOM   623  C  CA  . ASP A 1 113 ? -15.038 35.870  -9.232  1.00 33.89 ? 321  ASP A CA  1 
ATOM   624  C  C   . ASP A 1 113 ? -15.309 35.773  -7.714  1.00 32.54 ? 321  ASP A C   1 
ATOM   625  O  O   . ASP A 1 113 ? -15.428 36.801  -7.034  1.00 32.60 ? 321  ASP A O   1 
ATOM   626  C  CB  . ASP A 1 113 ? -16.233 36.467  -9.985  1.00 35.22 ? 321  ASP A CB  1 
ATOM   627  C  CG  . ASP A 1 113 ? -15.872 36.898  -11.413 1.00 39.72 ? 321  ASP A CG  1 
ATOM   628  O  OD1 . ASP A 1 113 ? -16.804 37.125  -12.220 1.00 45.11 ? 321  ASP A OD1 1 
ATOM   629  O  OD2 . ASP A 1 113 ? -14.665 37.020  -11.743 1.00 42.63 ? 321  ASP A OD2 1 
ATOM   630  N  N   . THR A 1 114 ? -15.380 34.541  -7.200  1.00 30.86 ? 322  THR A N   1 
ATOM   631  C  CA  . THR A 1 114 ? -15.552 34.271  -5.771  1.00 29.94 ? 322  THR A CA  1 
ATOM   632  C  C   . THR A 1 114 ? -14.282 33.720  -5.114  1.00 28.96 ? 322  THR A C   1 
ATOM   633  O  O   . THR A 1 114 ? -13.968 34.058  -3.970  1.00 28.87 ? 322  THR A O   1 
ATOM   634  C  CB  . THR A 1 114 ? -16.726 33.285  -5.528  1.00 29.62 ? 322  THR A CB  1 
ATOM   635  O  OG1 . THR A 1 114 ? -17.906 33.794  -6.157  1.00 29.91 ? 322  THR A OG1 1 
ATOM   636  C  CG2 . THR A 1 114 ? -17.003 33.099  -4.041  1.00 28.29 ? 322  THR A CG2 1 
ATOM   637  N  N   . ILE A 1 115 ? -13.552 32.876  -5.841  1.00 28.44 ? 323  ILE A N   1 
ATOM   638  C  CA  . ILE A 1 115 ? -12.393 32.193  -5.277  1.00 27.62 ? 323  ILE A CA  1 
ATOM   639  C  C   . ILE A 1 115 ? -11.094 32.704  -5.876  1.00 28.54 ? 323  ILE A C   1 
ATOM   640  O  O   . ILE A 1 115 ? -10.912 32.657  -7.094  1.00 28.80 ? 323  ILE A O   1 
ATOM   641  C  CB  . ILE A 1 115 ? -12.485 30.662  -5.473  1.00 26.77 ? 323  ILE A CB  1 
ATOM   642  C  CG1 . ILE A 1 115 ? -13.819 30.139  -4.928  1.00 26.53 ? 323  ILE A CG1 1 
ATOM   643  C  CG2 . ILE A 1 115 ? -11.281 29.954  -4.810  1.00 25.90 ? 323  ILE A CG2 1 
ATOM   644  C  CD1 . ILE A 1 115 ? -14.059 28.653  -5.172  1.00 24.92 ? 323  ILE A CD1 1 
ATOM   645  N  N   . THR A 1 116 ? -10.201 33.191  -5.011  1.00 28.56 ? 324  THR A N   1 
ATOM   646  C  CA  . THR A 1 116 ? -8.870  33.638  -5.406  1.00 29.66 ? 324  THR A CA  1 
ATOM   647  C  C   . THR A 1 116 ? -7.856  32.656  -4.848  1.00 29.62 ? 324  THR A C   1 
ATOM   648  O  O   . THR A 1 116 ? -7.923  32.298  -3.664  1.00 29.29 ? 324  THR A O   1 
ATOM   649  C  CB  . THR A 1 116 ? -8.563  35.050  -4.863  1.00 30.28 ? 324  THR A CB  1 
ATOM   650  O  OG1 . THR A 1 116 ? -9.540  35.972  -5.349  1.00 31.00 ? 324  THR A OG1 1 
ATOM   651  C  CG2 . THR A 1 116 ? -7.179  35.531  -5.308  1.00 31.96 ? 324  THR A CG2 1 
ATOM   652  N  N   . LEU A 1 117 ? -6.935  32.204  -5.701  1.00 30.03 ? 325  LEU A N   1 
ATOM   653  C  CA  . LEU A 1 117 ? -5.912  31.250  -5.289  1.00 30.63 ? 325  LEU A CA  1 
ATOM   654  C  C   . LEU A 1 117 ? -4.534  31.890  -5.228  1.00 31.76 ? 325  LEU A C   1 
ATOM   655  O  O   . LEU A 1 117 ? -4.178  32.710  -6.073  1.00 31.95 ? 325  LEU A O   1 
ATOM   656  C  CB  . LEU A 1 117 ? -5.901  30.023  -6.199  1.00 30.71 ? 325  LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 117 ? -7.257  29.310  -6.229  1.00 31.68 ? 325  LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 117 ? -7.387  28.497  -7.475  1.00 34.25 ? 325  LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 117 ? -7.512  28.461  -4.998  1.00 28.92 ? 325  LEU A CD2 1 
ATOM   660  N  N   . ILE A 1 118 ? -3.786  31.520  -4.193  1.00 32.03 ? 326  ILE A N   1 
ATOM   661  C  CA  . ILE A 1 118 ? -2.503  32.128  -3.901  1.00 33.56 ? 326  ILE A CA  1 
ATOM   662  C  C   . ILE A 1 118 ? -1.524  31.021  -3.572  1.00 33.96 ? 326  ILE A C   1 
ATOM   663  O  O   . ILE A 1 118 ? -1.767  30.210  -2.676  1.00 33.27 ? 326  ILE A O   1 
ATOM   664  C  CB  . ILE A 1 118 ? -2.580  33.118  -2.717  1.00 33.70 ? 326  ILE A CB  1 
ATOM   665  C  CG1 . ILE A 1 118 ? -3.646  34.194  -2.968  1.00 34.52 ? 326  ILE A CG1 1 
ATOM   666  C  CG2 . ILE A 1 118 ? -1.226  33.785  -2.492  1.00 35.21 ? 326  ILE A CG2 1 
ATOM   667  C  CD1 . ILE A 1 118 ? -3.992  35.037  -1.740  1.00 36.37 ? 326  ILE A CD1 1 
ATOM   668  N  N   . LYS A 1 119 ? -0.412  31.011  -4.302  1.00 35.37 ? 327  LYS A N   1 
ATOM   669  C  CA  . LYS A 1 119 ? 0.616   29.997  -4.154  1.00 36.19 ? 327  LYS A CA  1 
ATOM   670  C  C   . LYS A 1 119 ? 1.682   30.449  -3.158  1.00 36.87 ? 327  LYS A C   1 
ATOM   671  O  O   . LYS A 1 119 ? 2.279   31.512  -3.314  1.00 37.85 ? 327  LYS A O   1 
ATOM   672  C  CB  . LYS A 1 119 ? 1.230   29.670  -5.523  1.00 37.10 ? 327  LYS A CB  1 
ATOM   673  C  CG  . LYS A 1 119 ? 2.447   28.754  -5.467  1.00 39.07 ? 327  LYS A CG  1 
ATOM   674  C  CD  . LYS A 1 119 ? 2.349   27.629  -6.486  1.00 41.14 ? 327  LYS A CD  1 
ATOM   675  C  CE  . LYS A 1 119 ? 3.716   27.101  -6.896  1.00 43.79 ? 327  LYS A CE  1 
ATOM   676  N  NZ  . LYS A 1 119 ? 4.598   26.719  -5.746  1.00 45.11 ? 327  LYS A NZ  1 
ATOM   677  N  N   . GLY A 1 120 ? 1.900   29.637  -2.129  1.00 36.55 ? 328  GLY A N   1 
ATOM   678  C  CA  . GLY A 1 120 ? 2.936   29.903  -1.132  1.00 37.28 ? 328  GLY A CA  1 
ATOM   679  C  C   . GLY A 1 120 ? 2.554   29.411  0.252   1.00 36.78 ? 328  GLY A C   1 
ATOM   680  O  O   . GLY A 1 120 ? 1.454   28.900  0.454   1.00 35.18 ? 328  GLY A O   1 
ATOM   681  N  N   . LYS A 1 121 ? 3.480   29.556  1.197   1.00 37.66 ? 329  LYS A N   1 
ATOM   682  C  CA  . LYS A 1 121 ? 3.231   29.235  2.600   1.00 37.79 ? 329  LYS A CA  1 
ATOM   683  C  C   . LYS A 1 121 ? 2.373   30.338  3.223   1.00 37.72 ? 329  LYS A C   1 
ATOM   684  O  O   . LYS A 1 121 ? 2.587   31.527  2.955   1.00 38.21 ? 329  LYS A O   1 
ATOM   685  C  CB  . LYS A 1 121 ? 4.556   29.121  3.362   1.00 38.78 ? 329  LYS A CB  1 
ATOM   686  C  CG  . LYS A 1 121 ? 5.533   28.095  2.806   1.00 39.25 ? 329  LYS A CG  1 
ATOM   687  C  CD  . LYS A 1 121 ? 6.851   28.117  3.577   1.00 41.47 ? 329  LYS A CD  1 
ATOM   688  N  N   . ILE A 1 122 ? 1.416   29.951  4.066   1.00 37.28 ? 330  ILE A N   1 
ATOM   689  C  CA  . ILE A 1 122 ? 0.512   30.926  4.696   1.00 37.53 ? 330  ILE A CA  1 
ATOM   690  C  C   . ILE A 1 122 ? 1.259   32.012  5.498   1.00 38.93 ? 330  ILE A C   1 
ATOM   691  O  O   . ILE A 1 122 ? 0.763   33.131  5.661   1.00 38.99 ? 330  ILE A O   1 
ATOM   692  C  CB  . ILE A 1 122 ? -0.592  30.231  5.564   1.00 36.64 ? 330  ILE A CB  1 
ATOM   693  C  CG1 . ILE A 1 122 ? -1.666  31.235  6.002   1.00 36.09 ? 330  ILE A CG1 1 
ATOM   694  C  CG2 . ILE A 1 122 ? 0.008   29.517  6.782   1.00 36.64 ? 330  ILE A CG2 1 
ATOM   695  C  CD1 . ILE A 1 122 ? -2.472  31.843  4.859   1.00 34.73 ? 330  ILE A CD1 1 
ATOM   696  N  N   . GLU A 1 123 ? 2.451   31.668  5.983   1.00 40.52 ? 331  GLU A N   1 
ATOM   697  C  CA  . GLU A 1 123 ? 3.274   32.582  6.771   1.00 42.27 ? 331  GLU A CA  1 
ATOM   698  C  C   . GLU A 1 123 ? 4.079   33.557  5.909   1.00 43.38 ? 331  GLU A C   1 
ATOM   699  O  O   . GLU A 1 123 ? 4.694   34.487  6.429   1.00 44.48 ? 331  GLU A O   1 
ATOM   700  C  CB  . GLU A 1 123 ? 4.166   31.825  7.785   1.00 43.10 ? 331  GLU A CB  1 
ATOM   701  C  CG  . GLU A 1 123 ? 4.788   30.502  7.319   1.00 44.97 ? 331  GLU A CG  1 
ATOM   702  C  CD  . GLU A 1 123 ? 3.841   29.301  7.438   1.00 46.91 ? 331  GLU A CD  1 
ATOM   703  O  OE1 . GLU A 1 123 ? 3.332   28.992  8.547   1.00 46.98 ? 331  GLU A OE1 1 
ATOM   704  O  OE2 . GLU A 1 123 ? 3.614   28.647  6.403   1.00 48.22 ? 331  GLU A OE2 1 
ATOM   705  N  N   . GLU A 1 124 ? 4.041   33.374  4.592   1.00 43.55 ? 332  GLU A N   1 
ATOM   706  C  CA  . GLU A 1 124 ? 4.812   34.224  3.686   1.00 44.79 ? 332  GLU A CA  1 
ATOM   707  C  C   . GLU A 1 124 ? 3.971   35.020  2.683   1.00 44.30 ? 332  GLU A C   1 
ATOM   708  O  O   . GLU A 1 124 ? 4.376   36.104  2.259   1.00 45.25 ? 332  GLU A O   1 
ATOM   709  C  CB  . GLU A 1 124 ? 5.872   33.398  2.956   1.00 45.63 ? 332  GLU A CB  1 
ATOM   710  C  CG  . GLU A 1 124 ? 6.965   32.853  3.871   1.00 47.71 ? 332  GLU A CG  1 
ATOM   711  C  CD  . GLU A 1 124 ? 7.849   31.818  3.195   1.00 50.53 ? 332  GLU A CD  1 
ATOM   712  O  OE1 . GLU A 1 124 ? 7.660   31.552  1.987   1.00 50.60 ? 332  GLU A OE1 1 
ATOM   713  O  OE2 . GLU A 1 124 ? 8.743   31.268  3.875   1.00 53.02 ? 332  GLU A OE2 1 
ATOM   714  N  N   . VAL A 1 125 ? 2.811   34.489  2.302   1.00 42.64 ? 333  VAL A N   1 
ATOM   715  C  CA  . VAL A 1 125 ? 2.005   35.108  1.245   1.00 42.34 ? 333  VAL A CA  1 
ATOM   716  C  C   . VAL A 1 125 ? 1.314   36.392  1.683   1.00 42.55 ? 333  VAL A C   1 
ATOM   717  O  O   . VAL A 1 125 ? 1.107   36.626  2.872   1.00 42.09 ? 333  VAL A O   1 
ATOM   718  C  CB  . VAL A 1 125 ? 0.941   34.149  0.663   1.00 41.22 ? 333  VAL A CB  1 
ATOM   719  C  CG1 . VAL A 1 125 ? 1.609   32.984  -0.020  1.00 41.87 ? 333  VAL A CG1 1 
ATOM   720  C  CG2 . VAL A 1 125 ? -0.034  33.692  1.743   1.00 39.35 ? 333  VAL A CG2 1 
ATOM   721  N  N   . HIS A 1 126 ? 0.974   37.221  0.704   1.00 43.18 ? 334  HIS A N   1 
ATOM   722  C  CA  . HIS A 1 126 ? 0.190   38.412  0.953   1.00 44.05 ? 334  HIS A CA  1 
ATOM   723  C  C   . HIS A 1 126 ? -1.248  38.151  0.517   1.00 42.69 ? 334  HIS A C   1 
ATOM   724  O  O   . HIS A 1 126 ? -1.503  37.836  -0.646  1.00 42.57 ? 334  HIS A O   1 
ATOM   725  C  CB  . HIS A 1 126 ? 0.788   39.613  0.210   1.00 45.99 ? 334  HIS A CB  1 
ATOM   726  C  CG  . HIS A 1 126 ? -0.061  40.846  0.268   1.00 49.13 ? 334  HIS A CG  1 
ATOM   727  N  ND1 . HIS A 1 126 ? -0.360  41.493  1.450   1.00 51.71 ? 334  HIS A ND1 1 
ATOM   728  C  CD2 . HIS A 1 126 ? -0.676  41.553  -0.713  1.00 51.18 ? 334  HIS A CD2 1 
ATOM   729  C  CE1 . HIS A 1 126 ? -1.120  42.545  1.195   1.00 52.73 ? 334  HIS A CE1 1 
ATOM   730  N  NE2 . HIS A 1 126 ? -1.323  42.606  -0.110  1.00 52.66 ? 334  HIS A NE2 1 
ATOM   731  N  N   . LEU A 1 127 ? -2.173  38.266  1.465   1.00 41.62 ? 335  LEU A N   1 
ATOM   732  C  CA  . LEU A 1 127 ? -3.597  38.145  1.183   1.00 40.76 ? 335  LEU A CA  1 
ATOM   733  C  C   . LEU A 1 127 ? -4.187  39.518  0.824   1.00 41.64 ? 335  LEU A C   1 
ATOM   734  O  O   . LEU A 1 127 ? -3.696  40.540  1.296   1.00 42.59 ? 335  LEU A O   1 
ATOM   735  C  CB  . LEU A 1 127 ? -4.329  37.565  2.395   1.00 39.75 ? 335  LEU A CB  1 
ATOM   736  C  CG  . LEU A 1 127 ? -3.828  36.262  3.028   1.00 38.98 ? 335  LEU A CG  1 
ATOM   737  C  CD1 . LEU A 1 127 ? -4.684  35.909  4.240   1.00 38.07 ? 335  LEU A CD1 1 
ATOM   738  C  CD2 . LEU A 1 127 ? -3.845  35.122  2.029   1.00 37.74 ? 335  LEU A CD2 1 
ATOM   739  N  N   . PRO A 1 128 ? -5.246  39.543  -0.008  1.00 41.30 ? 336  PRO A N   1 
ATOM   740  C  CA  . PRO A 1 128 ? -5.873  40.810  -0.381  1.00 42.09 ? 336  PRO A CA  1 
ATOM   741  C  C   . PRO A 1 128 ? -6.867  41.335  0.664   1.00 41.83 ? 336  PRO A C   1 
ATOM   742  O  O   . PRO A 1 128 ? -7.618  42.262  0.378   1.00 42.39 ? 336  PRO A O   1 
ATOM   743  C  CB  . PRO A 1 128 ? -6.593  40.467  -1.689  1.00 41.99 ? 336  PRO A CB  1 
ATOM   744  C  CG  . PRO A 1 128 ? -6.952  39.022  -1.537  1.00 40.69 ? 336  PRO A CG  1 
ATOM   745  C  CD  . PRO A 1 128 ? -5.825  38.402  -0.747  1.00 40.34 ? 336  PRO A CD  1 
ATOM   746  N  N   . VAL A 1 129 ? -6.879  40.737  1.854   1.00 40.76 ? 337  VAL A N   1 
ATOM   747  C  CA  . VAL A 1 129 ? -7.685  41.246  2.976   1.00 40.69 ? 337  VAL A CA  1 
ATOM   748  C  C   . VAL A 1 129 ? -6.847  41.265  4.255   1.00 40.29 ? 337  VAL A C   1 
ATOM   749  O  O   . VAL A 1 129 ? -5.821  40.585  4.335   1.00 40.10 ? 337  VAL A O   1 
ATOM   750  C  CB  . VAL A 1 129 ? -8.993  40.422  3.199   1.00 39.96 ? 337  VAL A CB  1 
ATOM   751  C  CG1 . VAL A 1 129 ? -9.951  40.564  2.009   1.00 40.52 ? 337  VAL A CG1 1 
ATOM   752  C  CG2 . VAL A 1 129 ? -8.683  38.944  3.480   1.00 39.35 ? 337  VAL A CG2 1 
ATOM   753  N  N   . GLU A 1 130 ? -7.273  42.046  5.245   1.00 39.57 ? 338  GLU A N   1 
ATOM   754  C  CA  . GLU A 1 130 ? -6.588  42.081  6.541   1.00 39.89 ? 338  GLU A CA  1 
ATOM   755  C  C   . GLU A 1 130 ? -7.002  40.905  7.438   1.00 38.17 ? 338  GLU A C   1 
ATOM   756  O  O   . GLU A 1 130 ? -6.179  40.328  8.153   1.00 37.92 ? 338  GLU A O   1 
ATOM   757  C  CB  . GLU A 1 130 ? -6.870  43.403  7.269   1.00 41.13 ? 338  GLU A CB  1 
ATOM   758  C  CG  . GLU A 1 130 ? -6.396  44.675  6.540   1.00 44.36 ? 338  GLU A CG  1 
ATOM   759  C  CD  . GLU A 1 130 ? -5.112  45.265  7.122   1.00 49.73 ? 338  GLU A CD  1 
ATOM   760  O  OE1 . GLU A 1 130 ? -5.117  46.475  7.453   1.00 51.39 ? 338  GLU A OE1 1 
ATOM   761  O  OE2 . GLU A 1 130 ? -4.102  44.527  7.250   1.00 51.35 ? 338  GLU A OE2 1 
ATOM   762  N  N   . LYS A 1 131 ? -8.291  40.579  7.403   1.00 36.16 ? 339  LYS A N   1 
ATOM   763  C  CA  . LYS A 1 131 ? -8.861  39.542  8.255   1.00 34.64 ? 339  LYS A CA  1 
ATOM   764  C  C   . LYS A 1 131 ? -9.834  38.683  7.454   1.00 32.86 ? 339  LYS A C   1 
ATOM   765  O  O   . LYS A 1 131 ? -10.323 39.106  6.404   1.00 32.36 ? 339  LYS A O   1 
ATOM   766  C  CB  . LYS A 1 131 ? -9.592  40.162  9.461   1.00 35.18 ? 339  LYS A CB  1 
ATOM   767  C  CG  . LYS A 1 131 ? -8.715  40.980  10.432  1.00 36.45 ? 339  LYS A CG  1 
ATOM   768  C  CD  . LYS A 1 131 ? -7.707  40.109  11.194  1.00 36.57 ? 339  LYS A CD  1 
ATOM   769  C  CE  . LYS A 1 131 ? -6.941  40.933  12.213  1.00 38.47 ? 339  LYS A CE  1 
ATOM   770  N  NZ  . LYS A 1 131 ? -5.751  40.192  12.693  1.00 40.33 ? 339  LYS A NZ  1 
ATOM   771  N  N   . VAL A 1 132 ? -10.098 37.476  7.953   1.00 30.77 ? 340  VAL A N   1 
ATOM   772  C  CA  . VAL A 1 132 ? -11.121 36.598  7.392   1.00 29.43 ? 340  VAL A CA  1 
ATOM   773  C  C   . VAL A 1 132 ? -12.103 36.193  8.492   1.00 28.70 ? 340  VAL A C   1 
ATOM   774  O  O   . VAL A 1 132 ? -11.778 36.268  9.680   1.00 28.56 ? 340  VAL A O   1 
ATOM   775  C  CB  . VAL A 1 132 ? -10.513 35.334  6.737   1.00 29.35 ? 340  VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 132 ? -9.554  35.721  5.614   1.00 29.32 ? 340  VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 132 ? -9.833  34.444  7.792   1.00 28.96 ? 340  VAL A CG2 1 
ATOM   778  N  N   . ASP A 1 133 ? -13.296 35.773  8.087   1.00 27.78 ? 341  ASP A N   1 
ATOM   779  C  CA  . ASP A 1 133 ? -14.368 35.403  9.019   1.00 27.13 ? 341  ASP A CA  1 
ATOM   780  C  C   . ASP A 1 133 ? -14.284 33.937  9.436   1.00 26.40 ? 341  ASP A C   1 
ATOM   781  O  O   . ASP A 1 133 ? -14.662 33.570  10.555  1.00 25.49 ? 341  ASP A O   1 
ATOM   782  C  CB  . ASP A 1 133 ? -15.743 35.666  8.381   1.00 26.91 ? 341  ASP A CB  1 
ATOM   783  C  CG  . ASP A 1 133 ? -15.946 37.133  7.996   1.00 29.54 ? 341  ASP A CG  1 
ATOM   784  O  OD1 . ASP A 1 133 ? -15.732 38.016  8.865   1.00 31.40 ? 341  ASP A OD1 1 
ATOM   785  O  OD2 . ASP A 1 133 ? -16.330 37.396  6.830   1.00 29.78 ? 341  ASP A OD2 1 
ATOM   786  N  N   . VAL A 1 134 ? -13.818 33.099  8.513   1.00 25.47 ? 342  VAL A N   1 
ATOM   787  C  CA  . VAL A 1 134 ? -13.813 31.653  8.703   1.00 24.70 ? 342  VAL A CA  1 
ATOM   788  C  C   . VAL A 1 134 ? -12.559 31.058  8.087   1.00 24.87 ? 342  VAL A C   1 
ATOM   789  O  O   . VAL A 1 134 ? -12.153 31.438  6.983   1.00 24.40 ? 342  VAL A O   1 
ATOM   790  C  CB  . VAL A 1 134 ? -15.060 30.973  8.061   1.00 25.16 ? 342  VAL A CB  1 
ATOM   791  C  CG1 . VAL A 1 134 ? -15.062 29.458  8.310   1.00 24.57 ? 342  VAL A CG1 1 
ATOM   792  C  CG2 . VAL A 1 134 ? -16.360 31.596  8.580   1.00 24.43 ? 342  VAL A CG2 1 
ATOM   793  N  N   . ILE A 1 135 ? -11.943 30.138  8.824   1.00 24.29 ? 343  ILE A N   1 
ATOM   794  C  CA  . ILE A 1 135 ? -10.846 29.340  8.309   1.00 24.03 ? 343  ILE A CA  1 
ATOM   795  C  C   . ILE A 1 135 ? -11.309 27.887  8.240   1.00 23.55 ? 343  ILE A C   1 
ATOM   796  O  O   . ILE A 1 135 ? -11.901 27.355  9.195   1.00 23.28 ? 343  ILE A O   1 
ATOM   797  C  CB  . ILE A 1 135 ? -9.588  29.465  9.200   1.00 24.51 ? 343  ILE A CB  1 
ATOM   798  C  CG1 . ILE A 1 135 ? -9.010  30.880  9.097   1.00 24.87 ? 343  ILE A CG1 1 
ATOM   799  C  CG2 . ILE A 1 135 ? -8.517  28.411  8.822   1.00 23.14 ? 343  ILE A CG2 1 
ATOM   800  C  CD1 . ILE A 1 135 ? -8.008  31.213  10.189  1.00 26.75 ? 343  ILE A CD1 1 
ATOM   801  N  N   . ILE A 1 136 ? -11.082 27.272  7.089   1.00 23.38 ? 344  ILE A N   1 
ATOM   802  C  CA  . ILE A 1 136 ? -11.307 25.842  6.908   1.00 23.13 ? 344  ILE A CA  1 
ATOM   803  C  C   . ILE A 1 136 ? -10.022 25.245  6.382   1.00 23.40 ? 344  ILE A C   1 
ATOM   804  O  O   . ILE A 1 136 ? -9.272  25.903  5.657   1.00 24.07 ? 344  ILE A O   1 
ATOM   805  C  CB  . ILE A 1 136 ? -12.465 25.540  5.934   1.00 23.19 ? 344  ILE A CB  1 
ATOM   806  C  CG1 . ILE A 1 136 ? -12.211 26.201  4.566   1.00 23.98 ? 344  ILE A CG1 1 
ATOM   807  C  CG2 . ILE A 1 136 ? -13.809 25.993  6.545   1.00 23.19 ? 344  ILE A CG2 1 
ATOM   808  C  CD1 . ILE A 1 136 ? -13.254 25.881  3.475   1.00 27.93 ? 344  ILE A CD1 1 
ATOM   809  N  N   . SER A 1 137 ? -9.762  23.996  6.750   1.00 23.37 ? 345  SER A N   1 
ATOM   810  C  CA  . SER A 1 137 ? -8.549  23.333  6.326   1.00 23.81 ? 345  SER A CA  1 
ATOM   811  C  C   . SER A 1 137 ? -8.682  21.849  6.592   1.00 23.80 ? 345  SER A C   1 
ATOM   812  O  O   . SER A 1 137 ? -9.251  21.449  7.612   1.00 23.62 ? 345  SER A O   1 
ATOM   813  C  CB  . SER A 1 137 ? -7.361  23.879  7.115   1.00 23.19 ? 345  SER A CB  1 
ATOM   814  O  OG  . SER A 1 137 ? -6.176  23.220  6.724   1.00 24.45 ? 345  SER A OG  1 
ATOM   815  N  N   . GLU A 1 138 ? -8.167  21.043  5.676   1.00 24.21 ? 346  GLU A N   1 
ATOM   816  C  CA  . GLU A 1 138 ? -7.952  19.626  5.960   1.00 24.99 ? 346  GLU A CA  1 
ATOM   817  C  C   . GLU A 1 138 ? -6.450  19.464  6.199   1.00 24.86 ? 346  GLU A C   1 
ATOM   818  O  O   . GLU A 1 138 ? -5.667  19.346  5.265   1.00 25.67 ? 346  GLU A O   1 
ATOM   819  C  CB  . GLU A 1 138 ? -8.456  18.740  4.819   1.00 25.07 ? 346  GLU A CB  1 
ATOM   820  C  CG  . GLU A 1 138 ? -8.729  17.273  5.225   1.00 26.86 ? 346  GLU A CG  1 
ATOM   821  C  CD  . GLU A 1 138 ? -7.459  16.481  5.435   1.00 30.04 ? 346  GLU A CD  1 
ATOM   822  O  OE1 . GLU A 1 138 ? -6.836  16.624  6.517   1.00 31.40 ? 346  GLU A OE1 1 
ATOM   823  O  OE2 . GLU A 1 138 ? -7.077  15.712  4.519   1.00 31.30 ? 346  GLU A OE2 1 
ATOM   824  N  N   . TRP A 1 139 ? -6.060  19.476  7.464   1.00 24.81 ? 347  TRP A N   1 
ATOM   825  C  CA  . TRP A 1 139 ? -4.654  19.610  7.828   1.00 24.58 ? 347  TRP A CA  1 
ATOM   826  C  C   . TRP A 1 139 ? -4.110  18.353  8.482   1.00 24.78 ? 347  TRP A C   1 
ATOM   827  O  O   . TRP A 1 139 ? -2.898  18.220  8.669   1.00 24.32 ? 347  TRP A O   1 
ATOM   828  C  CB  . TRP A 1 139 ? -4.495  20.791  8.792   1.00 25.05 ? 347  TRP A CB  1 
ATOM   829  C  CG  . TRP A 1 139 ? -5.444  20.735  9.970   1.00 23.97 ? 347  TRP A CG  1 
ATOM   830  C  CD1 . TRP A 1 139 ? -6.658  21.345  10.070  1.00 24.07 ? 347  TRP A CD1 1 
ATOM   831  C  CD2 . TRP A 1 139 ? -5.251  20.019  11.201  1.00 25.26 ? 347  TRP A CD2 1 
ATOM   832  N  NE1 . TRP A 1 139 ? -7.234  21.065  11.290  1.00 24.52 ? 347  TRP A NE1 1 
ATOM   833  C  CE2 . TRP A 1 139 ? -6.392  20.255  12.006  1.00 25.12 ? 347  TRP A CE2 1 
ATOM   834  C  CE3 . TRP A 1 139 ? -4.219  19.213  11.709  1.00 25.01 ? 347  TRP A CE3 1 
ATOM   835  C  CZ2 . TRP A 1 139 ? -6.537  19.706  13.292  1.00 25.18 ? 347  TRP A CZ2 1 
ATOM   836  C  CZ3 . TRP A 1 139 ? -4.365  18.662  12.990  1.00 25.20 ? 347  TRP A CZ3 1 
ATOM   837  C  CH2 . TRP A 1 139 ? -5.516  18.923  13.767  1.00 25.03 ? 347  TRP A CH2 1 
ATOM   838  N  N   . MET A 1 140 ? -5.013  17.433  8.823   1.00 24.44 ? 348  MET A N   1 
ATOM   839  C  CA  . MET A 1 140 ? -4.693  16.280  9.688   1.00 24.31 ? 348  MET A CA  1 
ATOM   840  C  C   . MET A 1 140 ? -3.699  15.247  9.132   1.00 24.22 ? 348  MET A C   1 
ATOM   841  O  O   . MET A 1 140 ? -3.798  14.802  7.982   1.00 24.28 ? 348  MET A O   1 
ATOM   842  C  CB  . MET A 1 140 ? -5.983  15.573  10.150  1.00 23.42 ? 348  MET A CB  1 
ATOM   843  C  CG  . MET A 1 140 ? -6.913  16.452  10.972  1.00 24.40 ? 348  MET A CG  1 
ATOM   844  S  SD  . MET A 1 140 ? -7.977  17.515  9.966   1.00 25.59 ? 348  MET A SD  1 
ATOM   845  C  CE  . MET A 1 140 ? -8.969  16.272  9.134   1.00 24.11 ? 348  MET A CE  1 
ATOM   846  N  N   . GLY A 1 141 ? -2.751  14.849  9.980   1.00 24.40 ? 349  GLY A N   1 
ATOM   847  C  CA  . GLY A 1 141 ? -1.795  13.785  9.632   1.00 24.60 ? 349  GLY A CA  1 
ATOM   848  C  C   . GLY A 1 141 ? -2.122  12.449  10.292  1.00 24.38 ? 349  GLY A C   1 
ATOM   849  O  O   . GLY A 1 141 ? -3.092  12.340  11.049  1.00 23.81 ? 349  GLY A O   1 
ATOM   850  N  N   . TYR A 1 142 ? -1.311  11.428  10.014  1.00 24.49 ? 350  TYR A N   1 
ATOM   851  C  CA  . TYR A 1 142 ? -1.396  10.166  10.751  1.00 24.42 ? 350  TYR A CA  1 
ATOM   852  C  C   . TYR A 1 142 ? -1.258  10.412  12.243  1.00 24.28 ? 350  TYR A C   1 
ATOM   853  O  O   . TYR A 1 142 ? -0.425  11.232  12.655  1.00 24.18 ? 350  TYR A O   1 
ATOM   854  C  CB  . TYR A 1 142 ? -0.310  9.199   10.287  1.00 25.09 ? 350  TYR A CB  1 
ATOM   855  C  CG  . TYR A 1 142 ? -0.387  8.880   8.812   1.00 26.93 ? 350  TYR A CG  1 
ATOM   856  C  CD1 . TYR A 1 142 ? 0.704   9.105   7.976   1.00 30.76 ? 350  TYR A CD1 1 
ATOM   857  C  CD2 . TYR A 1 142 ? -1.556  8.365   8.255   1.00 27.98 ? 350  TYR A CD2 1 
ATOM   858  C  CE1 . TYR A 1 142 ? 0.639   8.816   6.616   1.00 33.62 ? 350  TYR A CE1 1 
ATOM   859  C  CE2 . TYR A 1 142 ? -1.645  8.082   6.893   1.00 29.71 ? 350  TYR A CE2 1 
ATOM   860  C  CZ  . TYR A 1 142 ? -0.548  8.306   6.083   1.00 33.88 ? 350  TYR A CZ  1 
ATOM   861  O  OH  . TYR A 1 142 ? -0.629  8.018   4.742   1.00 36.13 ? 350  TYR A OH  1 
ATOM   862  N  N   . PHE A 1 143 ? -2.078  9.718   13.044  1.00 23.71 ? 351  PHE A N   1 
ATOM   863  C  CA  . PHE A 1 143 ? -2.121  9.915   14.510  1.00 24.41 ? 351  PHE A CA  1 
ATOM   864  C  C   . PHE A 1 143 ? -2.347  11.416  14.819  1.00 24.52 ? 351  PHE A C   1 
ATOM   865  O  O   . PHE A 1 143 ? -1.796  11.984  15.784  1.00 24.58 ? 351  PHE A O   1 
ATOM   866  C  CB  . PHE A 1 143 ? -0.831  9.371   15.145  1.00 24.28 ? 351  PHE A CB  1 
ATOM   867  C  CG  . PHE A 1 143 ? -0.868  9.252   16.652  1.00 25.09 ? 351  PHE A CG  1 
ATOM   868  C  CD1 . PHE A 1 143 ? -1.852  8.505   17.291  1.00 24.69 ? 351  PHE A CD1 1 
ATOM   869  C  CD2 . PHE A 1 143 ? 0.116   9.860   17.427  1.00 24.97 ? 351  PHE A CD2 1 
ATOM   870  C  CE1 . PHE A 1 143 ? -1.872  8.376   18.691  1.00 25.74 ? 351  PHE A CE1 1 
ATOM   871  C  CE2 . PHE A 1 143 ? 0.115   9.733   18.828  1.00 25.69 ? 351  PHE A CE2 1 
ATOM   872  C  CZ  . PHE A 1 143 ? -0.889  8.992   19.455  1.00 26.00 ? 351  PHE A CZ  1 
ATOM   873  N  N   . LEU A 1 144 ? -3.157  12.038  13.959  1.00 24.84 ? 352  LEU A N   1 
ATOM   874  C  CA  . LEU A 1 144 ? -3.481  13.473  13.979  1.00 24.57 ? 352  LEU A CA  1 
ATOM   875  C  C   . LEU A 1 144 ? -2.306  14.389  13.637  1.00 26.08 ? 352  LEU A C   1 
ATOM   876  O  O   . LEU A 1 144 ? -2.430  15.245  12.769  1.00 25.72 ? 352  LEU A O   1 
ATOM   877  C  CB  . LEU A 1 144 ? -4.122  13.912  15.304  1.00 24.47 ? 352  LEU A CB  1 
ATOM   878  C  CG  . LEU A 1 144 ? -4.796  15.288  15.231  1.00 23.51 ? 352  LEU A CG  1 
ATOM   879  C  CD1 . LEU A 1 144 ? -6.083  15.216  14.392  1.00 22.96 ? 352  LEU A CD1 1 
ATOM   880  C  CD2 . LEU A 1 144 ? -5.098  15.843  16.615  1.00 23.59 ? 352  LEU A CD2 1 
ATOM   881  N  N   . LEU A 1 145 ? -1.174  14.205  14.313  1.00 26.98 ? 353  LEU A N   1 
ATOM   882  C  CA  . LEU A 1 145 ? -0.116  15.212  14.301  1.00 28.82 ? 353  LEU A CA  1 
ATOM   883  C  C   . LEU A 1 145 ? 1.166   14.933  13.483  1.00 29.83 ? 353  LEU A C   1 
ATOM   884  O  O   . LEU A 1 145 ? 1.992   15.836  13.336  1.00 30.45 ? 353  LEU A O   1 
ATOM   885  C  CB  . LEU A 1 145 ? 0.265   15.574  15.749  1.00 29.16 ? 353  LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 145 ? -0.815  16.061  16.718  1.00 29.19 ? 353  LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 145 ? -0.281  16.096  18.166  1.00 29.76 ? 353  LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 145 ? -1.354  17.427  16.306  1.00 28.06 ? 353  LEU A CD2 1 
ATOM   889  N  N   A PHE A 1 146 ? 1.347   13.710  12.986  0.60 30.13 ? 354  PHE A N   1 
ATOM   890  N  N   B PHE A 1 146 ? 1.339   13.706  12.986  0.40 29.88 ? 354  PHE A N   1 
ATOM   891  C  CA  A PHE A 1 146 ? 2.522   13.447  12.159  0.60 31.00 ? 354  PHE A CA  1 
ATOM   892  C  CA  B PHE A 1 146 ? 2.502   13.352  12.156  0.40 30.49 ? 354  PHE A CA  1 
ATOM   893  C  C   A PHE A 1 146 ? 2.364   14.120  10.821  0.60 31.49 ? 354  PHE A C   1 
ATOM   894  C  C   B PHE A 1 146 ? 2.407   14.048  10.797  0.40 31.21 ? 354  PHE A C   1 
ATOM   895  O  O   A PHE A 1 146 ? 1.417   13.850  10.086  0.60 31.36 ? 354  PHE A O   1 
ATOM   896  O  O   B PHE A 1 146 ? 1.513   13.726  10.017  0.40 31.02 ? 354  PHE A O   1 
ATOM   897  C  CB  A PHE A 1 146 ? 2.796   11.965  11.925  0.60 30.71 ? 354  PHE A CB  1 
ATOM   898  C  CB  B PHE A 1 146 ? 2.558   11.838  11.902  0.40 29.93 ? 354  PHE A CB  1 
ATOM   899  C  CG  A PHE A 1 146 ? 3.937   11.713  10.959  0.60 31.85 ? 354  PHE A CG  1 
ATOM   900  C  CG  B PHE A 1 146 ? 3.119   11.017  13.047  0.40 29.21 ? 354  PHE A CG  1 
ATOM   901  C  CD1 A PHE A 1 146 ? 5.255   12.010  11.322  0.60 33.31 ? 354  PHE A CD1 1 
ATOM   902  C  CD1 B PHE A 1 146 ? 4.377   11.270  13.561  0.40 29.41 ? 354  PHE A CD1 1 
ATOM   903  C  CD2 A PHE A 1 146 ? 3.699   11.190  9.687   0.60 32.77 ? 354  PHE A CD2 1 
ATOM   904  C  CD2 B PHE A 1 146 ? 2.406   9.944   13.555  0.40 28.23 ? 354  PHE A CD2 1 
ATOM   905  C  CE1 A PHE A 1 146 ? 6.311   11.779  10.441  0.60 32.61 ? 354  PHE A CE1 1 
ATOM   906  C  CE1 B PHE A 1 146 ? 4.893   10.494  14.592  0.40 28.75 ? 354  PHE A CE1 1 
ATOM   907  C  CE2 A PHE A 1 146 ? 4.755   10.943  8.801   0.60 33.08 ? 354  PHE A CE2 1 
ATOM   908  C  CE2 B PHE A 1 146 ? 2.916   9.167   14.582  0.40 28.29 ? 354  PHE A CE2 1 
ATOM   909  C  CZ  A PHE A 1 146 ? 6.060   11.246  9.180   0.60 33.67 ? 354  PHE A CZ  1 
ATOM   910  C  CZ  B PHE A 1 146 ? 4.162   9.441   15.098  0.40 28.40 ? 354  PHE A CZ  1 
ATOM   911  N  N   . GLU A 1 147 ? 3.323   14.983  10.519  1.00 32.34 ? 355  GLU A N   1 
ATOM   912  C  CA  . GLU A 1 147 ? 3.380   15.713  9.240   1.00 33.56 ? 355  GLU A CA  1 
ATOM   913  C  C   . GLU A 1 147 ? 2.080   16.466  8.949   1.00 33.43 ? 355  GLU A C   1 
ATOM   914  O  O   . GLU A 1 147 ? 1.634   16.538  7.808   1.00 34.61 ? 355  GLU A O   1 
ATOM   915  C  CB  . GLU A 1 147 ? 3.782   14.770  8.079   1.00 34.39 ? 355  GLU A CB  1 
ATOM   916  N  N   . SER A 1 148 ? 1.472   17.012  9.998   1.00 33.15 ? 356  SER A N   1 
ATOM   917  C  CA  . SER A 1 148 ? 0.218   17.738  9.868   1.00 32.40 ? 356  SER A CA  1 
ATOM   918  C  C   . SER A 1 148 ? 0.497   19.197  9.514   1.00 33.15 ? 356  SER A C   1 
ATOM   919  O  O   . SER A 1 148 ? 1.615   19.683  9.704   1.00 33.94 ? 356  SER A O   1 
ATOM   920  C  CB  . SER A 1 148 ? -0.583  17.646  11.165  1.00 32.06 ? 356  SER A CB  1 
ATOM   921  O  OG  . SER A 1 148 ? -0.308  18.743  12.022  1.00 31.18 ? 356  SER A OG  1 
ATOM   922  N  N   . MET A 1 149 ? -0.516  19.890  9.001   1.00 32.61 ? 357  MET A N   1 
ATOM   923  C  CA  . MET A 1 149 ? -0.414  21.324  8.755   1.00 33.66 ? 357  MET A CA  1 
ATOM   924  C  C   . MET A 1 149 ? -1.012  22.157  9.886   1.00 32.65 ? 357  MET A C   1 
ATOM   925  O  O   . MET A 1 149 ? -1.281  23.334  9.680   1.00 32.66 ? 357  MET A O   1 
ATOM   926  C  CB  . MET A 1 149 ? -1.131  21.715  7.457   1.00 33.72 ? 357  MET A CB  1 
ATOM   927  C  CG  . MET A 1 149 ? -0.701  20.994  6.201   1.00 38.21 ? 357  MET A CG  1 
ATOM   928  S  SD  . MET A 1 149 ? -1.404  21.842  4.753   1.00 46.56 ? 357  MET A SD  1 
ATOM   929  C  CE  . MET A 1 149 ? -3.165  21.502  4.888   1.00 43.61 ? 357  MET A CE  1 
ATOM   930  N  N   . LEU A 1 150 ? -1.250  21.568  11.063  1.00 32.07 ? 358  LEU A N   1 
ATOM   931  C  CA  . LEU A 1 150 ? -1.888  22.320  12.167  1.00 31.84 ? 358  LEU A CA  1 
ATOM   932  C  C   . LEU A 1 150 ? -1.132  23.607  12.515  1.00 32.68 ? 358  LEU A C   1 
ATOM   933  O  O   . LEU A 1 150 ? -1.743  24.637  12.796  1.00 31.96 ? 358  LEU A O   1 
ATOM   934  C  CB  . LEU A 1 150 ? -2.077  21.463  13.422  1.00 31.67 ? 358  LEU A CB  1 
ATOM   935  C  CG  . LEU A 1 150 ? -2.851  22.068  14.606  1.00 31.41 ? 358  LEU A CG  1 
ATOM   936  C  CD1 . LEU A 1 150 ? -4.195  22.679  14.198  1.00 29.70 ? 358  LEU A CD1 1 
ATOM   937  C  CD2 . LEU A 1 150 ? -3.073  21.015  15.673  1.00 31.21 ? 358  LEU A CD2 1 
ATOM   938  N  N   . ASP A 1 151 ? 0.197   23.538  12.474  1.00 33.43 ? 359  ASP A N   1 
ATOM   939  C  CA  . ASP A 1 151 ? 1.033   24.707  12.719  1.00 35.21 ? 359  ASP A CA  1 
ATOM   940  C  C   . ASP A 1 151 ? 0.650   25.884  11.801  1.00 34.60 ? 359  ASP A C   1 
ATOM   941  O  O   . ASP A 1 151 ? 0.556   27.028  12.257  1.00 34.54 ? 359  ASP A O   1 
ATOM   942  C  CB  . ASP A 1 151 ? 2.516   24.341  12.586  1.00 36.50 ? 359  ASP A CB  1 
ATOM   943  C  CG  . ASP A 1 151 ? 2.887   23.840  11.180  1.00 40.56 ? 359  ASP A CG  1 
ATOM   944  O  OD1 . ASP A 1 151 ? 2.171   22.974  10.613  1.00 43.31 ? 359  ASP A OD1 1 
ATOM   945  O  OD2 . ASP A 1 151 ? 3.921   24.299  10.645  1.00 45.76 ? 359  ASP A OD2 1 
ATOM   946  N  N   . SER A 1 152 ? 0.390   25.591  10.525  1.00 33.70 ? 360  SER A N   1 
ATOM   947  C  CA  . SER A 1 152 ? 0.036   26.625  9.552   1.00 33.44 ? 360  SER A CA  1 
ATOM   948  C  C   . SER A 1 152 ? -1.386  27.156  9.771   1.00 32.47 ? 360  SER A C   1 
ATOM   949  O  O   . SER A 1 152 ? -1.644  28.368  9.610   1.00 32.33 ? 360  SER A O   1 
ATOM   950  C  CB  . SER A 1 152 ? 0.224   26.106  8.120   1.00 33.72 ? 360  SER A CB  1 
ATOM   951  O  OG  . SER A 1 152 ? 1.604   25.867  7.865   1.00 36.12 ? 360  SER A OG  1 
ATOM   952  N  N   . VAL A 1 153 ? -2.298  26.252  10.146  1.00 30.90 ? 361  VAL A N   1 
ATOM   953  C  CA  . VAL A 1 153 ? -3.666  26.617  10.506  1.00 29.89 ? 361  VAL A CA  1 
ATOM   954  C  C   . VAL A 1 153 ? -3.682  27.567  11.710  1.00 30.46 ? 361  VAL A C   1 
ATOM   955  O  O   . VAL A 1 153 ? -4.367  28.583  11.689  1.00 30.44 ? 361  VAL A O   1 
ATOM   956  C  CB  . VAL A 1 153 ? -4.545  25.358  10.755  1.00 29.21 ? 361  VAL A CB  1 
ATOM   957  C  CG1 . VAL A 1 153 ? -5.934  25.739  11.229  1.00 28.35 ? 361  VAL A CG1 1 
ATOM   958  C  CG2 . VAL A 1 153 ? -4.629  24.516  9.476   1.00 28.24 ? 361  VAL A CG2 1 
ATOM   959  N  N   . LEU A 1 154 ? -2.908  27.248  12.740  1.00 31.04 ? 362  LEU A N   1 
ATOM   960  C  CA  . LEU A 1 154 ? -2.836  28.090  13.936  1.00 31.98 ? 362  LEU A CA  1 
ATOM   961  C  C   . LEU A 1 154 ? -2.177  29.439  13.646  1.00 32.62 ? 362  LEU A C   1 
ATOM   962  O  O   . LEU A 1 154 ? -2.594  30.465  14.186  1.00 32.85 ? 362  LEU A O   1 
ATOM   963  C  CB  . LEU A 1 154 ? -2.127  27.359  15.081  1.00 32.80 ? 362  LEU A CB  1 
ATOM   964  C  CG  . LEU A 1 154 ? -2.803  26.062  15.565  1.00 32.96 ? 362  LEU A CG  1 
ATOM   965  C  CD1 . LEU A 1 154 ? -1.946  25.328  16.597  1.00 33.72 ? 362  LEU A CD1 1 
ATOM   966  C  CD2 . LEU A 1 154 ? -4.217  26.301  16.102  1.00 33.86 ? 362  LEU A CD2 1 
ATOM   967  N  N   . TYR A 1 155 ? -1.161  29.439  12.785  1.00 33.17 ? 363  TYR A N   1 
ATOM   968  C  CA  . TYR A 1 155 ? -0.562  30.687  12.339  1.00 34.33 ? 363  TYR A CA  1 
ATOM   969  C  C   . TYR A 1 155 ? -1.632  31.563  11.656  1.00 33.97 ? 363  TYR A C   1 
ATOM   970  O  O   . TYR A 1 155 ? -1.768  32.748  11.974  1.00 33.94 ? 363  TYR A O   1 
ATOM   971  C  CB  . TYR A 1 155 ? 0.616   30.435  11.389  1.00 35.04 ? 363  TYR A CB  1 
ATOM   972  C  CG  . TYR A 1 155 ? 1.267   31.719  10.933  1.00 37.21 ? 363  TYR A CG  1 
ATOM   973  C  CD1 . TYR A 1 155 ? 2.369   32.250  11.613  1.00 39.66 ? 363  TYR A CD1 1 
ATOM   974  C  CD2 . TYR A 1 155 ? 0.764   32.422  9.838   1.00 38.08 ? 363  TYR A CD2 1 
ATOM   975  C  CE1 . TYR A 1 155 ? 2.958   33.448  11.200  1.00 41.89 ? 363  TYR A CE1 1 
ATOM   976  C  CE2 . TYR A 1 155 ? 1.340   33.614  9.420   1.00 40.95 ? 363  TYR A CE2 1 
ATOM   977  C  CZ  . TYR A 1 155 ? 2.435   34.120  10.101  1.00 42.08 ? 363  TYR A CZ  1 
ATOM   978  O  OH  . TYR A 1 155 ? 2.991   35.302  9.677   1.00 44.71 ? 363  TYR A OH  1 
ATOM   979  N  N   . ALA A 1 156 ? -2.369  30.967  10.718  1.00 33.09 ? 364  ALA A N   1 
ATOM   980  C  CA  . ALA A 1 156 ? -3.454  31.646  9.998   1.00 33.02 ? 364  ALA A CA  1 
ATOM   981  C  C   . ALA A 1 156 ? -4.513  32.177  10.965  1.00 33.07 ? 364  ALA A C   1 
ATOM   982  O  O   . ALA A 1 156 ? -4.981  33.310  10.829  1.00 33.34 ? 364  ALA A O   1 
ATOM   983  C  CB  . ALA A 1 156 ? -4.088  30.696  8.986   1.00 32.19 ? 364  ALA A CB  1 
ATOM   984  N  N   . LYS A 1 157 ? -4.874  31.356  11.946  1.00 33.15 ? 365  LYS A N   1 
ATOM   985  C  CA  . LYS A 1 157 ? -5.807  31.747  12.997  1.00 34.14 ? 365  LYS A CA  1 
ATOM   986  C  C   . LYS A 1 157 ? -5.304  32.980  13.760  1.00 35.34 ? 365  LYS A C   1 
ATOM   987  O  O   . LYS A 1 157 ? -6.055  33.937  13.955  1.00 35.59 ? 365  LYS A O   1 
ATOM   988  C  CB  . LYS A 1 157 ? -6.047  30.567  13.948  1.00 34.06 ? 365  LYS A CB  1 
ATOM   989  C  CG  . LYS A 1 157 ? -7.262  30.684  14.863  1.00 35.95 ? 365  LYS A CG  1 
ATOM   990  C  CD  . LYS A 1 157 ? -6.887  31.002  16.299  1.00 40.52 ? 365  LYS A CD  1 
ATOM   991  C  CE  . LYS A 1 157 ? -5.974  29.937  16.888  1.00 41.75 ? 365  LYS A CE  1 
ATOM   992  N  NZ  . LYS A 1 157 ? -5.355  30.400  18.164  1.00 45.91 ? 365  LYS A NZ  1 
ATOM   993  N  N   . ASN A 1 158 ? -4.036  32.960  14.170  1.00 36.49 ? 366  ASN A N   1 
ATOM   994  C  CA  . ASN A 1 158 ? -3.458  34.065  14.947  1.00 38.00 ? 366  ASN A CA  1 
ATOM   995  C  C   . ASN A 1 158 ? -3.255  35.341  14.143  1.00 38.34 ? 366  ASN A C   1 
ATOM   996  O  O   . ASN A 1 158 ? -3.494  36.438  14.656  1.00 38.99 ? 366  ASN A O   1 
ATOM   997  C  CB  . ASN A 1 158 ? -2.143  33.647  15.611  1.00 38.92 ? 366  ASN A CB  1 
ATOM   998  C  CG  . ASN A 1 158 ? -2.340  32.579  16.663  1.00 40.38 ? 366  ASN A CG  1 
ATOM   999  O  OD1 . ASN A 1 158 ? -3.357  32.551  17.357  1.00 43.20 ? 366  ASN A OD1 1 
ATOM   1000 N  ND2 . ASN A 1 158 ? -1.366  31.689  16.790  1.00 42.15 ? 366  ASN A ND2 1 
ATOM   1001 N  N   . LYS A 1 159 ? -2.817  35.210  12.892  1.00 37.61 ? 367  LYS A N   1 
ATOM   1002 C  CA  . LYS A 1 159 ? -2.601  36.401  12.075  1.00 37.88 ? 367  LYS A CA  1 
ATOM   1003 C  C   . LYS A 1 159 ? -3.892  36.947  11.446  1.00 36.81 ? 367  LYS A C   1 
ATOM   1004 O  O   . LYS A 1 159 ? -4.123  38.165  11.454  1.00 36.99 ? 367  LYS A O   1 
ATOM   1005 C  CB  . LYS A 1 159 ? -1.516  36.180  11.010  1.00 38.18 ? 367  LYS A CB  1 
ATOM   1006 C  CG  . LYS A 1 159 ? -1.099  37.474  10.287  1.00 39.36 ? 367  LYS A CG  1 
ATOM   1007 C  CD  . LYS A 1 159 ? 0.263   37.360  9.626   1.00 40.73 ? 367  LYS A CD  1 
ATOM   1008 N  N   . TYR A 1 160 ? -4.730  36.059  10.913  1.00 35.20 ? 368  TYR A N   1 
ATOM   1009 C  CA  . TYR A 1 160 ? -5.813  36.494  10.019  1.00 34.30 ? 368  TYR A CA  1 
ATOM   1010 C  C   . TYR A 1 160 ? -7.268  36.366  10.485  1.00 33.67 ? 368  TYR A C   1 
ATOM   1011 O  O   . TYR A 1 160 ? -8.154  36.985  9.895   1.00 33.46 ? 368  TYR A O   1 
ATOM   1012 C  CB  . TYR A 1 160 ? -5.664  35.838  8.645   1.00 34.05 ? 368  TYR A CB  1 
ATOM   1013 C  CG  . TYR A 1 160 ? -4.385  36.203  7.925   1.00 34.69 ? 368  TYR A CG  1 
ATOM   1014 C  CD1 . TYR A 1 160 ? -3.405  35.247  7.689   1.00 33.99 ? 368  TYR A CD1 1 
ATOM   1015 C  CD2 . TYR A 1 160 ? -4.155  37.507  7.481   1.00 36.03 ? 368  TYR A CD2 1 
ATOM   1016 C  CE1 . TYR A 1 160 ? -2.223  35.571  7.025   1.00 36.30 ? 368  TYR A CE1 1 
ATOM   1017 C  CE2 . TYR A 1 160 ? -2.970  37.845  6.813   1.00 36.72 ? 368  TYR A CE2 1 
ATOM   1018 C  CZ  . TYR A 1 160 ? -2.015  36.873  6.591   1.00 37.07 ? 368  TYR A CZ  1 
ATOM   1019 O  OH  . TYR A 1 160 ? -0.849  37.189  5.942   1.00 38.92 ? 368  TYR A OH  1 
ATOM   1020 N  N   . LEU A 1 161 ? -7.543  35.562  11.505  1.00 33.55 ? 369  LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 161 ? -8.940  35.374  11.914  1.00 33.02 ? 369  LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 161 ? -9.529  36.610  12.607  1.00 33.59 ? 369  LEU A C   1 
ATOM   1023 O  O   . LEU A 1 161 ? -9.010  37.068  13.628  1.00 34.29 ? 369  LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 161 ? -9.110  34.137  12.792  1.00 32.73 ? 369  LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 161 ? -10.558 33.704  13.017  1.00 31.99 ? 369  LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 161 ? -11.186 33.188  11.721  1.00 30.99 ? 369  LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 161 ? -10.632 32.652  14.115  1.00 31.87 ? 369  LEU A CD2 1 
ATOM   1028 N  N   . ALA A 1 162 ? -10.618 37.132  12.046  1.00 33.41 ? 370  ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 162 ? -11.324 38.274  12.628  1.00 34.38 ? 370  ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 162 ? -11.742 37.959  14.050  1.00 35.18 ? 370  ALA A C   1 
ATOM   1031 O  O   . ALA A 1 162 ? -11.971 36.796  14.394  1.00 34.47 ? 370  ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 162 ? -12.548 38.646  11.786  1.00 33.83 ? 370  ALA A CB  1 
ATOM   1033 N  N   . LYS A 1 163 ? -11.816 38.996  14.883  1.00 36.41 ? 371  LYS A N   1 
ATOM   1034 C  CA  . LYS A 1 163 ? -12.322 38.850  16.244  1.00 37.66 ? 371  LYS A CA  1 
ATOM   1035 C  C   . LYS A 1 163 ? -13.708 38.205  16.156  1.00 36.95 ? 371  LYS A C   1 
ATOM   1036 O  O   . LYS A 1 163 ? -14.560 38.660  15.392  1.00 37.38 ? 371  LYS A O   1 
ATOM   1037 C  CB  . LYS A 1 163 ? -12.387 40.223  16.937  1.00 38.58 ? 371  LYS A CB  1 
ATOM   1038 C  CG  . LYS A 1 163 ? -12.086 40.188  18.431  1.00 40.47 ? 371  LYS A CG  1 
ATOM   1039 N  N   . GLY A 1 164 ? -13.921 37.119  16.892  1.00 37.05 ? 372  GLY A N   1 
ATOM   1040 C  CA  . GLY A 1 164 ? -15.203 36.407  16.830  1.00 36.21 ? 372  GLY A CA  1 
ATOM   1041 C  C   . GLY A 1 164 ? -15.391 35.503  15.612  1.00 34.77 ? 372  GLY A C   1 
ATOM   1042 O  O   . GLY A 1 164 ? -16.479 34.962  15.399  1.00 34.43 ? 372  GLY A O   1 
ATOM   1043 N  N   . GLY A 1 165 ? -14.337 35.327  14.815  1.00 33.60 ? 373  GLY A N   1 
ATOM   1044 C  CA  . GLY A 1 165 ? -14.373 34.380  13.692  1.00 31.73 ? 373  GLY A CA  1 
ATOM   1045 C  C   . GLY A 1 165 ? -14.308 32.926  14.155  1.00 30.98 ? 373  GLY A C   1 
ATOM   1046 O  O   . GLY A 1 165 ? -14.252 32.646  15.358  1.00 31.24 ? 373  GLY A O   1 
ATOM   1047 N  N   . SER A 1 166 ? -14.315 31.997  13.202  1.00 29.28 ? 374  SER A N   1 
ATOM   1048 C  CA  . SER A 1 166 ? -14.340 30.567  13.514  1.00 28.63 ? 374  SER A CA  1 
ATOM   1049 C  C   . SER A 1 166 ? -13.391 29.747  12.641  1.00 27.30 ? 374  SER A C   1 
ATOM   1050 O  O   . SER A 1 166 ? -13.141 30.103  11.488  1.00 26.87 ? 374  SER A O   1 
ATOM   1051 C  CB  . SER A 1 166 ? -15.771 30.031  13.371  1.00 28.93 ? 374  SER A CB  1 
ATOM   1052 O  OG  . SER A 1 166 ? -16.676 30.782  14.175  1.00 30.20 ? 374  SER A OG  1 
ATOM   1053 N  N   . VAL A 1 167 ? -12.883 28.647  13.201  1.00 26.43 ? 375  VAL A N   1 
ATOM   1054 C  CA  . VAL A 1 167 ? -11.962 27.734  12.517  1.00 26.01 ? 375  VAL A CA  1 
ATOM   1055 C  C   . VAL A 1 167 ? -12.564 26.332  12.516  1.00 25.21 ? 375  VAL A C   1 
ATOM   1056 O  O   . VAL A 1 167 ? -13.015 25.846  13.563  1.00 25.15 ? 375  VAL A O   1 
ATOM   1057 C  CB  . VAL A 1 167 ? -10.591 27.619  13.245  1.00 26.72 ? 375  VAL A CB  1 
ATOM   1058 C  CG1 . VAL A 1 167 ? -9.586  26.802  12.405  1.00 25.84 ? 375  VAL A CG1 1 
ATOM   1059 C  CG2 . VAL A 1 167 ? -10.034 28.983  13.574  1.00 28.06 ? 375  VAL A CG2 1 
ATOM   1060 N  N   . TYR A 1 168 ? -12.552 25.673  11.360  1.00 23.70 ? 376  TYR A N   1 
ATOM   1061 C  CA  . TYR A 1 168 ? -13.144 24.353  11.244  1.00 23.10 ? 376  TYR A CA  1 
ATOM   1062 C  C   . TYR A 1 168 ? -12.202 23.406  10.522  1.00 23.03 ? 376  TYR A C   1 
ATOM   1063 O  O   . TYR A 1 168 ? -11.538 23.811  9.572   1.00 22.88 ? 376  TYR A O   1 
ATOM   1064 C  CB  . TYR A 1 168 ? -14.487 24.415  10.494  1.00 22.79 ? 376  TYR A CB  1 
ATOM   1065 C  CG  . TYR A 1 168 ? -15.542 25.245  11.194  1.00 23.15 ? 376  TYR A CG  1 
ATOM   1066 C  CD1 . TYR A 1 168 ? -15.782 26.567  10.808  1.00 21.60 ? 376  TYR A CD1 1 
ATOM   1067 C  CD2 . TYR A 1 168 ? -16.296 24.708  12.245  1.00 21.78 ? 376  TYR A CD2 1 
ATOM   1068 C  CE1 . TYR A 1 168 ? -16.757 27.348  11.451  1.00 20.81 ? 376  TYR A CE1 1 
ATOM   1069 C  CE2 . TYR A 1 168 ? -17.279 25.472  12.888  1.00 22.13 ? 376  TYR A CE2 1 
ATOM   1070 C  CZ  . TYR A 1 168 ? -17.498 26.792  12.484  1.00 22.22 ? 376  TYR A CZ  1 
ATOM   1071 O  OH  . TYR A 1 168 ? -18.458 27.537  13.128  1.00 22.41 ? 376  TYR A OH  1 
ATOM   1072 N  N   . PRO A 1 169 ? -12.149 22.136  10.960  1.00 23.47 ? 377  PRO A N   1 
ATOM   1073 C  CA  . PRO A 1 169 ? -12.898 21.566  12.095  1.00 23.47 ? 377  PRO A CA  1 
ATOM   1074 C  C   . PRO A 1 169 ? -12.404 22.168  13.404  1.00 23.60 ? 377  PRO A C   1 
ATOM   1075 O  O   . PRO A 1 169 ? -11.209 22.449  13.542  1.00 23.78 ? 377  PRO A O   1 
ATOM   1076 C  CB  . PRO A 1 169 ? -12.559 20.072  12.029  1.00 23.17 ? 377  PRO A CB  1 
ATOM   1077 C  CG  . PRO A 1 169 ? -11.197 20.024  11.326  1.00 22.99 ? 377  PRO A CG  1 
ATOM   1078 C  CD  . PRO A 1 169 ? -11.290 21.129  10.299  1.00 23.43 ? 377  PRO A CD  1 
ATOM   1079 N  N   . ASP A 1 170 ? -13.307 22.375  14.355  1.00 23.28 ? 378  ASP A N   1 
ATOM   1080 C  CA  . ASP A 1 170 ? -12.944 23.120  15.561  1.00 24.49 ? 378  ASP A CA  1 
ATOM   1081 C  C   . ASP A 1 170 ? -12.460 22.294  16.759  1.00 25.24 ? 378  ASP A C   1 
ATOM   1082 O  O   . ASP A 1 170 ? -11.741 22.817  17.615  1.00 27.01 ? 378  ASP A O   1 
ATOM   1083 C  CB  . ASP A 1 170 ? -14.063 24.094  15.973  1.00 24.40 ? 378  ASP A CB  1 
ATOM   1084 C  CG  . ASP A 1 170 ? -15.438 23.434  16.059  1.00 24.91 ? 378  ASP A CG  1 
ATOM   1085 O  OD1 . ASP A 1 170 ? -16.167 23.751  17.012  1.00 26.33 ? 378  ASP A OD1 1 
ATOM   1086 O  OD2 . ASP A 1 170 ? -15.806 22.628  15.178  1.00 22.60 ? 378  ASP A OD2 1 
ATOM   1087 N  N   . ILE A 1 171 ? -12.846 21.020  16.818  1.00 24.80 ? 379  ILE A N   1 
ATOM   1088 C  CA  . ILE A 1 171 ? -12.495 20.133  17.932  1.00 25.11 ? 379  ILE A CA  1 
ATOM   1089 C  C   . ILE A 1 171 ? -11.916 18.813  17.401  1.00 24.60 ? 379  ILE A C   1 
ATOM   1090 O  O   . ILE A 1 171 ? -12.492 18.199  16.504  1.00 24.00 ? 379  ILE A O   1 
ATOM   1091 C  CB  . ILE A 1 171 ? -13.725 19.826  18.838  1.00 25.83 ? 379  ILE A CB  1 
ATOM   1092 C  CG1 . ILE A 1 171 ? -14.368 21.128  19.358  1.00 27.18 ? 379  ILE A CG1 1 
ATOM   1093 C  CG2 . ILE A 1 171 ? -13.335 18.895  19.991  1.00 27.15 ? 379  ILE A CG2 1 
ATOM   1094 C  CD1 . ILE A 1 171 ? -15.595 20.927  20.255  1.00 29.94 ? 379  ILE A CD1 1 
ATOM   1095 N  N   . CYS A 1 172 ? -10.777 18.395  17.960  1.00 26.07 ? 380  CYS A N   1 
ATOM   1096 C  CA  . CYS A 1 172 ? -10.113 17.135  17.596  1.00 26.40 ? 380  CYS A CA  1 
ATOM   1097 C  C   . CYS A 1 172 ? -9.747  16.393  18.868  1.00 25.03 ? 380  CYS A C   1 
ATOM   1098 O  O   . CYS A 1 172 ? -9.429  17.019  19.882  1.00 24.96 ? 380  CYS A O   1 
ATOM   1099 C  CB  . CYS A 1 172 ? -8.826  17.407  16.799  1.00 26.09 ? 380  CYS A CB  1 
ATOM   1100 S  SG  . CYS A 1 172 ? -9.075  18.460  15.373  1.00 34.85 ? 380  CYS A SG  1 
ATOM   1101 N  N   . THR A 1 173 ? -9.796  15.066  18.830  1.00 24.35 ? 381  THR A N   1 
ATOM   1102 C  CA  . THR A 1 173 ? -9.332  14.262  19.962  1.00 23.04 ? 381  THR A CA  1 
ATOM   1103 C  C   . THR A 1 173 ? -8.408  13.177  19.448  1.00 22.62 ? 381  THR A C   1 
ATOM   1104 O  O   . THR A 1 173 ? -8.515  12.765  18.289  1.00 22.60 ? 381  THR A O   1 
ATOM   1105 C  CB  . THR A 1 173 ? -10.488 13.610  20.756  1.00 22.71 ? 381  THR A CB  1 
ATOM   1106 O  OG1 . THR A 1 173 ? -11.192 12.693  19.917  1.00 22.38 ? 381  THR A OG1 1 
ATOM   1107 C  CG2 . THR A 1 173 ? -11.453 14.665  21.311  1.00 23.35 ? 381  THR A CG2 1 
ATOM   1108 N  N   . ILE A 1 174 ? -7.491  12.734  20.305  1.00 21.60 ? 382  ILE A N   1 
ATOM   1109 C  CA  . ILE A 1 174 ? -6.646  11.580  20.003  1.00 21.26 ? 382  ILE A CA  1 
ATOM   1110 C  C   . ILE A 1 174 ? -6.949  10.522  21.057  1.00 21.57 ? 382  ILE A C   1 
ATOM   1111 O  O   . ILE A 1 174 ? -7.101  10.857  22.255  1.00 21.69 ? 382  ILE A O   1 
ATOM   1112 C  CB  . ILE A 1 174 ? -5.133  11.929  20.011  1.00 20.87 ? 382  ILE A CB  1 
ATOM   1113 C  CG1 . ILE A 1 174 ? -4.828  13.096  19.055  1.00 20.73 ? 382  ILE A CG1 1 
ATOM   1114 C  CG2 . ILE A 1 174 ? -4.301  10.677  19.693  1.00 19.37 ? 382  ILE A CG2 1 
ATOM   1115 C  CD1 . ILE A 1 174 ? -3.384  13.665  19.182  1.00 21.87 ? 382  ILE A CD1 1 
ATOM   1116 N  N   . SER A 1 175 ? -7.065  9.269   20.611  1.00 21.25 ? 383  SER A N   1 
ATOM   1117 C  CA  . SER A 1 175 ? -7.321  8.140   21.509  1.00 21.62 ? 383  SER A CA  1 
ATOM   1118 C  C   . SER A 1 175 ? -6.348  6.992   21.333  1.00 21.37 ? 383  SER A C   1 
ATOM   1119 O  O   . SER A 1 175 ? -5.791  6.798   20.251  1.00 20.93 ? 383  SER A O   1 
ATOM   1120 C  CB  . SER A 1 175 ? -8.734  7.596   21.312  1.00 21.59 ? 383  SER A CB  1 
ATOM   1121 O  OG  . SER A 1 175 ? -9.684  8.615   21.542  1.00 24.10 ? 383  SER A OG  1 
ATOM   1122 N  N   . LEU A 1 176 ? -6.157  6.232   22.415  1.00 20.99 ? 384  LEU A N   1 
ATOM   1123 C  CA  . LEU A 1 176 ? -5.381  4.989   22.385  1.00 20.87 ? 384  LEU A CA  1 
ATOM   1124 C  C   . LEU A 1 176 ? -6.274  3.784   22.681  1.00 21.09 ? 384  LEU A C   1 
ATOM   1125 O  O   . LEU A 1 176 ? -7.264  3.908   23.396  1.00 21.18 ? 384  LEU A O   1 
ATOM   1126 C  CB  . LEU A 1 176 ? -4.258  5.034   23.429  1.00 20.78 ? 384  LEU A CB  1 
ATOM   1127 C  CG  . LEU A 1 176 ? -3.156  6.081   23.227  1.00 20.14 ? 384  LEU A CG  1 
ATOM   1128 C  CD1 . LEU A 1 176 ? -2.134  5.957   24.357  1.00 21.47 ? 384  LEU A CD1 1 
ATOM   1129 C  CD2 . LEU A 1 176 ? -2.487  5.950   21.860  1.00 19.52 ? 384  LEU A CD2 1 
ATOM   1130 N  N   . VAL A 1 177 ? -5.918  2.626   22.138  1.00 21.00 ? 385  VAL A N   1 
ATOM   1131 C  CA  . VAL A 1 177 ? -6.665  1.393   22.375  1.00 21.91 ? 385  VAL A CA  1 
ATOM   1132 C  C   . VAL A 1 177 ? -5.686  0.212   22.363  1.00 21.76 ? 385  VAL A C   1 
ATOM   1133 O  O   . VAL A 1 177 ? -4.732  0.206   21.575  1.00 22.30 ? 385  VAL A O   1 
ATOM   1134 C  CB  . VAL A 1 177 ? -7.884  1.229   21.364  1.00 21.68 ? 385  VAL A CB  1 
ATOM   1135 C  CG1 . VAL A 1 177 ? -7.424  1.111   19.905  1.00 21.80 ? 385  VAL A CG1 1 
ATOM   1136 C  CG2 . VAL A 1 177 ? -8.758  0.041   21.744  1.00 23.21 ? 385  VAL A CG2 1 
ATOM   1137 N  N   . ALA A 1 178 ? -5.880  -0.755  23.258  1.00 21.70 ? 386  ALA A N   1 
ATOM   1138 C  CA  . ALA A 1 178 ? -4.991  -1.924  23.322  1.00 21.31 ? 386  ALA A CA  1 
ATOM   1139 C  C   . ALA A 1 178 ? -5.371  -2.965  22.277  1.00 21.37 ? 386  ALA A C   1 
ATOM   1140 O  O   . ALA A 1 178 ? -6.553  -3.149  21.960  1.00 20.68 ? 386  ALA A O   1 
ATOM   1141 C  CB  . ALA A 1 178 ? -4.990  -2.545  24.734  1.00 22.04 ? 386  ALA A CB  1 
ATOM   1142 N  N   . VAL A 1 179 ? -4.358  -3.668  21.772  1.00 21.18 ? 387  VAL A N   1 
ATOM   1143 C  CA  . VAL A 1 179 ? -4.519  -4.630  20.701  1.00 21.42 ? 387  VAL A CA  1 
ATOM   1144 C  C   . VAL A 1 179 ? -3.946  -5.980  21.138  1.00 21.66 ? 387  VAL A C   1 
ATOM   1145 O  O   . VAL A 1 179 ? -2.905  -6.028  21.804  1.00 21.13 ? 387  VAL A O   1 
ATOM   1146 C  CB  . VAL A 1 179 ? -3.767  -4.142  19.415  1.00 21.66 ? 387  VAL A CB  1 
ATOM   1147 C  CG1 . VAL A 1 179 ? -3.901  -5.136  18.266  1.00 22.32 ? 387  VAL A CG1 1 
ATOM   1148 C  CG2 . VAL A 1 179 ? -4.260  -2.751  18.973  1.00 21.86 ? 387  VAL A CG2 1 
ATOM   1149 N  N   . SER A 1 180 ? -4.636  -7.067  20.788  1.00 22.23 ? 388  SER A N   1 
ATOM   1150 C  CA  . SER A 1 180 ? -4.055  -8.422  20.873  1.00 23.28 ? 388  SER A CA  1 
ATOM   1151 C  C   . SER A 1 180 ? -3.976  -9.013  19.480  1.00 23.38 ? 388  SER A C   1 
ATOM   1152 O  O   . SER A 1 180 ? -4.997  -9.205  18.821  1.00 23.55 ? 388  SER A O   1 
ATOM   1153 C  CB  . SER A 1 180 ? -4.874  -9.350  21.777  1.00 24.22 ? 388  SER A CB  1 
ATOM   1154 O  OG  . SER A 1 180 ? -4.283  -10.648 21.842  1.00 25.38 ? 388  SER A OG  1 
ATOM   1155 N  N   . ASP A 1 181 ? -2.759  -9.272  19.014  1.00 23.43 ? 389  ASP A N   1 
ATOM   1156 C  CA  . ASP A 1 181 ? -2.593  -9.931  17.723  1.00 24.30 ? 389  ASP A CA  1 
ATOM   1157 C  C   . ASP A 1 181 ? -1.277  -10.673 17.727  1.00 24.40 ? 389  ASP A C   1 
ATOM   1158 O  O   . ASP A 1 181 ? -0.278  -10.218 17.159  1.00 23.58 ? 389  ASP A O   1 
ATOM   1159 C  CB  . ASP A 1 181 ? -2.692  -8.938  16.555  1.00 23.56 ? 389  ASP A CB  1 
ATOM   1160 C  CG  . ASP A 1 181 ? -3.079  -9.615  15.250  1.00 26.36 ? 389  ASP A CG  1 
ATOM   1161 O  OD1 . ASP A 1 181 ? -2.677  -10.782 15.035  1.00 25.90 ? 389  ASP A OD1 1 
ATOM   1162 O  OD2 . ASP A 1 181 ? -3.788  -8.976  14.439  1.00 28.38 ? 389  ASP A OD2 1 
ATOM   1163 N  N   . VAL A 1 182 ? -1.301  -11.821 18.402  1.00 25.35 ? 390  VAL A N   1 
ATOM   1164 C  CA  . VAL A 1 182 ? -0.146  -12.683 18.591  1.00 26.88 ? 390  VAL A CA  1 
ATOM   1165 C  C   . VAL A 1 182 ? 0.444   -13.158 17.246  1.00 27.33 ? 390  VAL A C   1 
ATOM   1166 O  O   . VAL A 1 182 ? 1.665   -13.242 17.096  1.00 26.73 ? 390  VAL A O   1 
ATOM   1167 C  CB  . VAL A 1 182 ? -0.550  -13.870 19.514  1.00 27.92 ? 390  VAL A CB  1 
ATOM   1168 C  CG1 . VAL A 1 182 ? 0.362   -15.050 19.352  1.00 30.24 ? 390  VAL A CG1 1 
ATOM   1169 C  CG2 . VAL A 1 182 ? -0.589  -13.405 20.975  1.00 28.00 ? 390  VAL A CG2 1 
ATOM   1170 N  N   . ASN A 1 183 ? -0.421  -13.459 16.278  1.00 28.06 ? 391  ASN A N   1 
ATOM   1171 C  CA  . ASN A 1 183 ? 0.045   -13.862 14.945  1.00 29.55 ? 391  ASN A CA  1 
ATOM   1172 C  C   . ASN A 1 183 ? 0.786   -12.752 14.202  1.00 28.85 ? 391  ASN A C   1 
ATOM   1173 O  O   . ASN A 1 183 ? 1.869   -12.988 13.675  1.00 29.01 ? 391  ASN A O   1 
ATOM   1174 C  CB  . ASN A 1 183 ? -1.098  -14.420 14.089  1.00 30.65 ? 391  ASN A CB  1 
ATOM   1175 C  CG  . ASN A 1 183 ? -1.638  -15.735 14.626  1.00 33.33 ? 391  ASN A CG  1 
ATOM   1176 O  OD1 . ASN A 1 183 ? -0.993  -16.413 15.425  1.00 36.15 ? 391  ASN A OD1 1 
ATOM   1177 N  ND2 . ASN A 1 183 ? -2.834  -16.096 14.192  1.00 36.69 ? 391  ASN A ND2 1 
ATOM   1178 N  N   . LYS A 1 184 ? 0.223   -11.543 14.186  1.00 28.84 ? 392  LYS A N   1 
ATOM   1179 C  CA  . LYS A 1 184 ? 0.913   -10.401 13.579  1.00 28.32 ? 392  LYS A CA  1 
ATOM   1180 C  C   . LYS A 1 184 ? 2.197   -10.020 14.311  1.00 27.21 ? 392  LYS A C   1 
ATOM   1181 O  O   . LYS A 1 184 ? 3.189   -9.647  13.678  1.00 26.73 ? 392  LYS A O   1 
ATOM   1182 C  CB  . LYS A 1 184 ? 0.006   -9.181  13.464  1.00 28.53 ? 392  LYS A CB  1 
ATOM   1183 C  CG  . LYS A 1 184 ? -0.874  -9.224  12.242  1.00 31.82 ? 392  LYS A CG  1 
ATOM   1184 C  CD  . LYS A 1 184 ? -1.719  -7.978  12.123  1.00 35.73 ? 392  LYS A CD  1 
ATOM   1185 C  CE  . LYS A 1 184 ? -2.705  -8.117  10.983  1.00 38.77 ? 392  LYS A CE  1 
ATOM   1186 N  NZ  . LYS A 1 184 ? -1.998  -7.957  9.686   1.00 41.51 ? 392  LYS A NZ  1 
ATOM   1187 N  N   . HIS A 1 185 ? 2.173   -10.078 15.635  1.00 26.49 ? 393  HIS A N   1 
ATOM   1188 C  CA  . HIS A 1 185 ? 3.388   -9.825  16.405  1.00 26.54 ? 393  HIS A CA  1 
ATOM   1189 C  C   . HIS A 1 185 ? 4.478   -10.840 16.025  1.00 26.77 ? 393  HIS A C   1 
ATOM   1190 O  O   . HIS A 1 185 ? 5.620   -10.464 15.760  1.00 25.87 ? 393  HIS A O   1 
ATOM   1191 C  CB  . HIS A 1 185 ? 3.103   -9.842  17.909  1.00 26.35 ? 393  HIS A CB  1 
ATOM   1192 C  CG  . HIS A 1 185 ? 4.228   -9.311  18.732  1.00 24.99 ? 393  HIS A CG  1 
ATOM   1193 N  ND1 . HIS A 1 185 ? 5.304   -10.088 19.103  1.00 23.14 ? 393  HIS A ND1 1 
ATOM   1194 C  CD2 . HIS A 1 185 ? 4.460   -8.075  19.239  1.00 23.42 ? 393  HIS A CD2 1 
ATOM   1195 C  CE1 . HIS A 1 185 ? 6.144   -9.361  19.817  1.00 22.24 ? 393  HIS A CE1 1 
ATOM   1196 N  NE2 . HIS A 1 185 ? 5.656   -8.135  19.913  1.00 23.08 ? 393  HIS A NE2 1 
ATOM   1197 N  N   . ALA A 1 186 ? 4.113   -12.121 15.974  1.00 27.85 ? 394  ALA A N   1 
ATOM   1198 C  CA  . ALA A 1 186 ? 5.052   -13.155 15.549  1.00 28.60 ? 394  ALA A CA  1 
ATOM   1199 C  C   . ALA A 1 186 ? 5.621   -12.886 14.143  1.00 29.06 ? 394  ALA A C   1 
ATOM   1200 O  O   . ALA A 1 186 ? 6.818   -13.127 13.905  1.00 28.87 ? 394  ALA A O   1 
ATOM   1201 C  CB  . ALA A 1 186 ? 4.413   -14.541 15.634  1.00 29.28 ? 394  ALA A CB  1 
ATOM   1202 N  N   . ASP A 1 187 ? 4.773   -12.367 13.244  1.00 29.42 ? 395  ASP A N   1 
ATOM   1203 C  CA  . ASP A 1 187 ? 5.166   -11.998 11.876  1.00 30.40 ? 395  ASP A CA  1 
ATOM   1204 C  C   . ASP A 1 187 ? 6.213   -10.890 11.853  1.00 29.25 ? 395  ASP A C   1 
ATOM   1205 O  O   . ASP A 1 187 ? 7.058   -10.864 10.958  1.00 29.38 ? 395  ASP A O   1 
ATOM   1206 C  CB  . ASP A 1 187 ? 3.976   -11.470 11.052  1.00 31.12 ? 395  ASP A CB  1 
ATOM   1207 C  CG  . ASP A 1 187 ? 2.992   -12.550 10.633  1.00 35.38 ? 395  ASP A CG  1 
ATOM   1208 O  OD1 . ASP A 1 187 ? 1.860   -12.157 10.237  1.00 38.19 ? 395  ASP A OD1 1 
ATOM   1209 O  OD2 . ASP A 1 187 ? 3.316   -13.763 10.699  1.00 37.93 ? 395  ASP A OD2 1 
ATOM   1210 N  N   . ARG A 1 188 ? 6.121   -9.951  12.799  1.00 27.96 ? 396  ARG A N   1 
ATOM   1211 C  CA  . ARG A 1 188 ? 7.023   -8.789  12.834  1.00 26.65 ? 396  ARG A CA  1 
ATOM   1212 C  C   . ARG A 1 188 ? 8.258   -9.005  13.692  1.00 26.83 ? 396  ARG A C   1 
ATOM   1213 O  O   . ARG A 1 188 ? 9.297   -8.401  13.435  1.00 26.90 ? 396  ARG A O   1 
ATOM   1214 C  CB  . ARG A 1 188 ? 6.305   -7.541  13.375  1.00 26.10 ? 396  ARG A CB  1 
ATOM   1215 C  CG  . ARG A 1 188 ? 5.062   -7.108  12.612  1.00 25.35 ? 396  ARG A CG  1 
ATOM   1216 C  CD  . ARG A 1 188 ? 5.340   -6.792  11.118  1.00 24.75 ? 396  ARG A CD  1 
ATOM   1217 N  NE  . ARG A 1 188 ? 6.614   -6.102  10.850  1.00 23.82 ? 396  ARG A NE  1 
ATOM   1218 C  CZ  . ARG A 1 188 ? 6.909   -4.847  11.187  1.00 24.43 ? 396  ARG A CZ  1 
ATOM   1219 N  NH1 . ARG A 1 188 ? 6.035   -4.091  11.854  1.00 23.35 ? 396  ARG A NH1 1 
ATOM   1220 N  NH2 . ARG A 1 188 ? 8.099   -4.347  10.863  1.00 21.97 ? 396  ARG A NH2 1 
ATOM   1221 N  N   . ILE A 1 189 ? 8.134   -9.831  14.731  1.00 26.26 ? 397  ILE A N   1 
ATOM   1222 C  CA  . ILE A 1 189 ? 9.173   -9.906  15.765  1.00 26.60 ? 397  ILE A CA  1 
ATOM   1223 C  C   . ILE A 1 189 ? 9.885   -11.249 15.784  1.00 26.12 ? 397  ILE A C   1 
ATOM   1224 O  O   . ILE A 1 189 ? 11.063  -11.318 15.461  1.00 26.22 ? 397  ILE A O   1 
ATOM   1225 C  CB  . ILE A 1 189 ? 8.637   -9.498  17.181  1.00 26.37 ? 397  ILE A CB  1 
ATOM   1226 C  CG1 . ILE A 1 189 ? 8.019   -8.090  17.149  1.00 28.24 ? 397  ILE A CG1 1 
ATOM   1227 C  CG2 . ILE A 1 189 ? 9.754   -9.563  18.234  1.00 27.55 ? 397  ILE A CG2 1 
ATOM   1228 C  CD1 . ILE A 1 189 ? 8.973   -6.984  16.650  1.00 28.02 ? 397  ILE A CD1 1 
ATOM   1229 N  N   . ALA A 1 190 ? 9.167   -12.314 16.145  1.00 26.61 ? 398  ALA A N   1 
ATOM   1230 C  CA  . ALA A 1 190 ? 9.741   -13.663 16.171  1.00 26.70 ? 398  ALA A CA  1 
ATOM   1231 C  C   . ALA A 1 190 ? 10.296  -14.074 14.801  1.00 26.76 ? 398  ALA A C   1 
ATOM   1232 O  O   . ALA A 1 190 ? 11.233  -14.873 14.732  1.00 27.03 ? 398  ALA A O   1 
ATOM   1233 C  CB  . ALA A 1 190 ? 8.708   -14.684 16.659  1.00 27.81 ? 398  ALA A CB  1 
ATOM   1234 N  N   . PHE A 1 191 ? 9.721   -13.518 13.733  1.00 25.89 ? 399  PHE A N   1 
ATOM   1235 C  CA  . PHE A 1 191 ? 10.206  -13.691 12.364  1.00 25.98 ? 399  PHE A CA  1 
ATOM   1236 C  C   . PHE A 1 191 ? 11.735  -13.580 12.256  1.00 25.60 ? 399  PHE A C   1 
ATOM   1237 O  O   . PHE A 1 191 ? 12.370  -14.370 11.554  1.00 26.01 ? 399  PHE A O   1 
ATOM   1238 C  CB  . PHE A 1 191 ? 9.547   -12.655 11.440  1.00 25.73 ? 399  PHE A CB  1 
ATOM   1239 C  CG  . PHE A 1 191 ? 10.203  -12.539 10.094  1.00 26.50 ? 399  PHE A CG  1 
ATOM   1240 C  CD1 . PHE A 1 191 ? 9.897   -13.443 9.070   1.00 27.13 ? 399  PHE A CD1 1 
ATOM   1241 C  CD2 . PHE A 1 191 ? 11.130  -11.528 9.845   1.00 26.04 ? 399  PHE A CD2 1 
ATOM   1242 C  CE1 . PHE A 1 191 ? 10.519  -13.343 7.816   1.00 28.17 ? 399  PHE A CE1 1 
ATOM   1243 C  CE2 . PHE A 1 191 ? 11.752  -11.415 8.604   1.00 26.72 ? 399  PHE A CE2 1 
ATOM   1244 C  CZ  . PHE A 1 191 ? 11.447  -12.328 7.582   1.00 26.94 ? 399  PHE A CZ  1 
ATOM   1245 N  N   . TRP A 1 192 ? 12.316  -12.614 12.966  1.00 24.60 ? 400  TRP A N   1 
ATOM   1246 C  CA  . TRP A 1 192 ? 13.749  -12.320 12.860  1.00 24.53 ? 400  TRP A CA  1 
ATOM   1247 C  C   . TRP A 1 192 ? 14.668  -13.389 13.463  1.00 25.54 ? 400  TRP A C   1 
ATOM   1248 O  O   . TRP A 1 192 ? 15.873  -13.376 13.233  1.00 25.24 ? 400  TRP A O   1 
ATOM   1249 C  CB  . TRP A 1 192 ? 14.049  -10.946 13.457  1.00 23.79 ? 400  TRP A CB  1 
ATOM   1250 C  CG  . TRP A 1 192 ? 13.364  -9.833  12.691  1.00 23.31 ? 400  TRP A CG  1 
ATOM   1251 C  CD1 . TRP A 1 192 ? 12.262  -9.118  13.080  1.00 21.20 ? 400  TRP A CD1 1 
ATOM   1252 C  CD2 . TRP A 1 192 ? 13.712  -9.355  11.387  1.00 22.32 ? 400  TRP A CD2 1 
ATOM   1253 N  NE1 . TRP A 1 192 ? 11.918  -8.207  12.108  1.00 22.35 ? 400  TRP A NE1 1 
ATOM   1254 C  CE2 . TRP A 1 192 ? 12.797  -8.325  11.060  1.00 23.21 ? 400  TRP A CE2 1 
ATOM   1255 C  CE3 . TRP A 1 192 ? 14.736  -9.664  10.480  1.00 22.94 ? 400  TRP A CE3 1 
ATOM   1256 C  CZ2 . TRP A 1 192 ? 12.872  -7.606  9.859   1.00 22.87 ? 400  TRP A CZ2 1 
ATOM   1257 C  CZ3 . TRP A 1 192 ? 14.799  -8.960  9.279   1.00 22.85 ? 400  TRP A CZ3 1 
ATOM   1258 C  CH2 . TRP A 1 192 ? 13.870  -7.945  8.979   1.00 23.52 ? 400  TRP A CH2 1 
ATOM   1259 N  N   . ASP A 1 193 ? 14.111  -14.308 14.240  1.00 26.92 ? 401  ASP A N   1 
ATOM   1260 C  CA  . ASP A 1 193 ? 14.942  -15.334 14.864  1.00 28.34 ? 401  ASP A CA  1 
ATOM   1261 C  C   . ASP A 1 193 ? 15.464  -16.392 13.894  1.00 28.63 ? 401  ASP A C   1 
ATOM   1262 O  O   . ASP A 1 193 ? 16.511  -16.980 14.139  1.00 29.23 ? 401  ASP A O   1 
ATOM   1263 C  CB  . ASP A 1 193 ? 14.223  -15.965 16.049  1.00 29.49 ? 401  ASP A CB  1 
ATOM   1264 C  CG  . ASP A 1 193 ? 14.089  -15.005 17.199  1.00 30.68 ? 401  ASP A CG  1 
ATOM   1265 O  OD1 . ASP A 1 193 ? 15.047  -14.228 17.433  1.00 33.31 ? 401  ASP A OD1 1 
ATOM   1266 O  OD2 . ASP A 1 193 ? 13.036  -15.010 17.858  1.00 33.48 ? 401  ASP A OD2 1 
ATOM   1267 N  N   . ASP A 1 194 ? 14.749  -16.605 12.789  1.00 28.36 ? 402  ASP A N   1 
ATOM   1268 C  CA  . ASP A 1 194 ? 15.128  -17.604 11.792  1.00 29.14 ? 402  ASP A CA  1 
ATOM   1269 C  C   . ASP A 1 194 ? 14.706  -17.120 10.407  1.00 27.98 ? 402  ASP A C   1 
ATOM   1270 O  O   . ASP A 1 194 ? 13.554  -17.262 10.012  1.00 27.26 ? 402  ASP A O   1 
ATOM   1271 C  CB  . ASP A 1 194 ? 14.505  -18.973 12.136  1.00 30.06 ? 402  ASP A CB  1 
ATOM   1272 C  CG  . ASP A 1 194 ? 14.832  -20.064 11.112  1.00 34.57 ? 402  ASP A CG  1 
ATOM   1273 O  OD1 . ASP A 1 194 ? 15.615  -19.833 10.155  1.00 36.82 ? 402  ASP A OD1 1 
ATOM   1274 O  OD2 . ASP A 1 194 ? 14.281  -21.179 11.271  1.00 38.04 ? 402  ASP A OD2 1 
ATOM   1275 N  N   . VAL A 1 195 ? 15.658  -16.550 9.674   1.00 27.18 ? 403  VAL A N   1 
ATOM   1276 C  CA  . VAL A 1 195 ? 15.379  -15.986 8.365   1.00 26.54 ? 403  VAL A CA  1 
ATOM   1277 C  C   . VAL A 1 195 ? 16.148  -16.820 7.343   1.00 27.03 ? 403  VAL A C   1 
ATOM   1278 O  O   . VAL A 1 195 ? 17.371  -16.686 7.202   1.00 26.65 ? 403  VAL A O   1 
ATOM   1279 C  CB  . VAL A 1 195 ? 15.756  -14.492 8.299   1.00 25.71 ? 403  VAL A CB  1 
ATOM   1280 C  CG1 . VAL A 1 195 ? 15.465  -13.914 6.910   1.00 25.28 ? 403  VAL A CG1 1 
ATOM   1281 C  CG2 . VAL A 1 195 ? 14.995  -13.704 9.380   1.00 25.87 ? 403  VAL A CG2 1 
ATOM   1282 N  N   . TYR A 1 196 ? 15.413  -17.714 6.680   1.00 27.37 ? 404  TYR A N   1 
ATOM   1283 C  CA  . TYR A 1 196 ? 15.966  -18.691 5.736   1.00 28.08 ? 404  TYR A CA  1 
ATOM   1284 C  C   . TYR A 1 196 ? 17.167  -19.424 6.329   1.00 28.12 ? 404  TYR A C   1 
ATOM   1285 O  O   . TYR A 1 196 ? 18.180  -19.624 5.656   1.00 28.31 ? 404  TYR A O   1 
ATOM   1286 C  CB  . TYR A 1 196 ? 16.303  -18.028 4.390   1.00 28.25 ? 404  TYR A CB  1 
ATOM   1287 C  CG  . TYR A 1 196 ? 15.088  -17.463 3.685   1.00 30.97 ? 404  TYR A CG  1 
ATOM   1288 C  CD1 . TYR A 1 196 ? 14.749  -16.120 3.819   1.00 32.50 ? 404  TYR A CD1 1 
ATOM   1289 C  CD2 . TYR A 1 196 ? 14.271  -18.276 2.885   1.00 33.46 ? 404  TYR A CD2 1 
ATOM   1290 C  CE1 . TYR A 1 196 ? 13.621  -15.590 3.185   1.00 35.12 ? 404  TYR A CE1 1 
ATOM   1291 C  CE2 . TYR A 1 196 ? 13.138  -17.748 2.239   1.00 35.62 ? 404  TYR A CE2 1 
ATOM   1292 C  CZ  . TYR A 1 196 ? 12.827  -16.409 2.396   1.00 36.97 ? 404  TYR A CZ  1 
ATOM   1293 O  OH  . TYR A 1 196 ? 11.719  -15.868 1.767   1.00 41.63 ? 404  TYR A OH  1 
ATOM   1294 N  N   . GLY A 1 197 ? 17.052  -19.793 7.605   1.00 27.85 ? 405  GLY A N   1 
ATOM   1295 C  CA  . GLY A 1 197 ? 18.085  -20.572 8.276   1.00 28.30 ? 405  GLY A CA  1 
ATOM   1296 C  C   . GLY A 1 197 ? 19.106  -19.763 9.072   1.00 27.79 ? 405  GLY A C   1 
ATOM   1297 O  O   . GLY A 1 197 ? 20.002  -20.341 9.681   1.00 28.33 ? 405  GLY A O   1 
ATOM   1298 N  N   . PHE A 1 198 ? 18.982  -18.437 9.065   1.00 26.67 ? 406  PHE A N   1 
ATOM   1299 C  CA  . PHE A 1 198 ? 19.952  -17.571 9.747   1.00 26.13 ? 406  PHE A CA  1 
ATOM   1300 C  C   . PHE A 1 198 ? 19.325  -16.732 10.845  1.00 26.16 ? 406  PHE A C   1 
ATOM   1301 O  O   . PHE A 1 198 ? 18.161  -16.328 10.730  1.00 25.61 ? 406  PHE A O   1 
ATOM   1302 C  CB  . PHE A 1 198 ? 20.663  -16.662 8.740   1.00 25.65 ? 406  PHE A CB  1 
ATOM   1303 C  CG  . PHE A 1 198 ? 21.414  -17.411 7.681   1.00 25.35 ? 406  PHE A CG  1 
ATOM   1304 C  CD1 . PHE A 1 198 ? 20.864  -17.588 6.422   1.00 25.66 ? 406  PHE A CD1 1 
ATOM   1305 C  CD2 . PHE A 1 198 ? 22.662  -17.956 7.951   1.00 25.16 ? 406  PHE A CD2 1 
ATOM   1306 C  CE1 . PHE A 1 198 ? 21.545  -18.293 5.436   1.00 27.34 ? 406  PHE A CE1 1 
ATOM   1307 C  CE2 . PHE A 1 198 ? 23.360  -18.659 6.975   1.00 27.11 ? 406  PHE A CE2 1 
ATOM   1308 C  CZ  . PHE A 1 198 ? 22.794  -18.829 5.708   1.00 27.54 ? 406  PHE A CZ  1 
ATOM   1309 N  N   . LYS A 1 199 ? 20.099  -16.474 11.907  1.00 25.62 ? 407  LYS A N   1 
ATOM   1310 C  CA  . LYS A 1 199 ? 19.661  -15.613 13.009  1.00 26.32 ? 407  LYS A CA  1 
ATOM   1311 C  C   . LYS A 1 199 ? 19.761  -14.149 12.612  1.00 25.70 ? 407  LYS A C   1 
ATOM   1312 O  O   . LYS A 1 199 ? 20.779  -13.717 12.064  1.00 25.43 ? 407  LYS A O   1 
ATOM   1313 C  CB  . LYS A 1 199 ? 20.523  -15.822 14.261  1.00 26.38 ? 407  LYS A CB  1 
ATOM   1314 C  CG  . LYS A 1 199 ? 20.558  -17.240 14.806  1.00 29.73 ? 407  LYS A CG  1 
ATOM   1315 C  CD  . LYS A 1 199 ? 21.428  -17.270 16.077  1.00 34.45 ? 407  LYS A CD  1 
ATOM   1316 C  CE  . LYS A 1 199 ? 21.247  -18.560 16.860  1.00 37.77 ? 407  LYS A CE  1 
ATOM   1317 N  NZ  . LYS A 1 199 ? 21.480  -19.728 15.985  1.00 39.95 ? 407  LYS A NZ  1 
ATOM   1318 N  N   . MET A 1 200 ? 18.705  -13.394 12.895  1.00 25.57 ? 408  MET A N   1 
ATOM   1319 C  CA  . MET A 1 200 ? 18.661  -11.964 12.599  1.00 25.83 ? 408  MET A CA  1 
ATOM   1320 C  C   . MET A 1 200 ? 18.022  -11.226 13.776  1.00 26.34 ? 408  MET A C   1 
ATOM   1321 O  O   . MET A 1 200 ? 17.410  -10.173 13.602  1.00 26.18 ? 408  MET A O   1 
ATOM   1322 C  CB  . MET A 1 200 ? 17.873  -11.697 11.299  1.00 25.38 ? 408  MET A CB  1 
ATOM   1323 C  CG  . MET A 1 200 ? 18.558  -12.152 10.011  1.00 25.01 ? 408  MET A CG  1 
ATOM   1324 S  SD  . MET A 1 200 ? 17.982  -11.279 8.531   1.00 24.71 ? 408  MET A SD  1 
ATOM   1325 C  CE  . MET A 1 200 ? 19.069  -11.982 7.264   1.00 24.97 ? 408  MET A CE  1 
ATOM   1326 N  N   . SER A 1 201 ? 18.162  -11.797 14.972  1.00 27.07 ? 409  SER A N   1 
ATOM   1327 C  CA  . SER A 1 201 ? 17.504  -11.275 16.189  1.00 28.27 ? 409  SER A CA  1 
ATOM   1328 C  C   . SER A 1 201 ? 17.691  -9.787  16.442  1.00 27.74 ? 409  SER A C   1 
ATOM   1329 O  O   . SER A 1 201 ? 16.794  -9.124  16.959  1.00 27.85 ? 409  SER A O   1 
ATOM   1330 C  CB  . SER A 1 201 ? 18.007  -12.034 17.416  1.00 28.82 ? 409  SER A CB  1 
ATOM   1331 O  OG  . SER A 1 201 ? 17.529  -13.352 17.357  1.00 33.15 ? 409  SER A OG  1 
ATOM   1332 N  N   . CYS A 1 202 ? 18.864  -9.271  16.098  1.00 28.04 ? 410  CYS A N   1 
ATOM   1333 C  CA  . CYS A 1 202 ? 19.191  -7.867  16.334  1.00 28.55 ? 410  CYS A CA  1 
ATOM   1334 C  C   . CYS A 1 202 ? 18.273  -6.892  15.581  1.00 27.90 ? 410  CYS A C   1 
ATOM   1335 O  O   . CYS A 1 202 ? 18.127  -5.733  15.999  1.00 27.99 ? 410  CYS A O   1 
ATOM   1336 C  CB  . CYS A 1 202 ? 20.653  -7.600  15.975  1.00 29.18 ? 410  CYS A CB  1 
ATOM   1337 S  SG  . CYS A 1 202 ? 21.137  -8.270  14.367  1.00 31.20 ? 410  CYS A SG  1 
ATOM   1338 N  N   . MET A 1 203 ? 17.652  -7.360  14.491  1.00 26.53 ? 411  MET A N   1 
ATOM   1339 C  CA  . MET A 1 203 ? 16.710  -6.542  13.713  1.00 26.16 ? 411  MET A CA  1 
ATOM   1340 C  C   . MET A 1 203 ? 15.411  -6.209  14.468  1.00 25.63 ? 411  MET A C   1 
ATOM   1341 O  O   . MET A 1 203 ? 14.726  -5.234  14.130  1.00 25.09 ? 411  MET A O   1 
ATOM   1342 C  CB  . MET A 1 203 ? 16.377  -7.215  12.378  1.00 25.38 ? 411  MET A CB  1 
ATOM   1343 C  CG  . MET A 1 203 ? 17.517  -7.180  11.377  1.00 26.87 ? 411  MET A CG  1 
ATOM   1344 S  SD  . MET A 1 203 ? 17.775  -5.545  10.649  1.00 28.51 ? 411  MET A SD  1 
ATOM   1345 C  CE  . MET A 1 203 ? 16.325  -5.439  9.611   1.00 28.27 ? 411  MET A CE  1 
ATOM   1346 N  N   . LYS A 1 204 ? 15.067  -7.018  15.469  1.00 25.53 ? 412  LYS A N   1 
ATOM   1347 C  CA  . LYS A 1 204 ? 13.928  -6.707  16.351  1.00 25.77 ? 412  LYS A CA  1 
ATOM   1348 C  C   . LYS A 1 204 ? 14.003  -5.268  16.890  1.00 26.19 ? 412  LYS A C   1 
ATOM   1349 O  O   . LYS A 1 204 ? 13.019  -4.524  16.836  1.00 26.13 ? 412  LYS A O   1 
ATOM   1350 C  CB  . LYS A 1 204 ? 13.831  -7.713  17.505  1.00 26.04 ? 412  LYS A CB  1 
ATOM   1351 C  CG  . LYS A 1 204 ? 13.453  -9.133  17.101  1.00 26.38 ? 412  LYS A CG  1 
ATOM   1352 C  CD  . LYS A 1 204 ? 13.554  -10.072 18.311  1.00 29.17 ? 412  LYS A CD  1 
ATOM   1353 C  CE  . LYS A 1 204 ? 13.205  -11.511 17.947  1.00 29.71 ? 412  LYS A CE  1 
ATOM   1354 N  NZ  . LYS A 1 204 ? 13.400  -12.443 19.104  1.00 31.39 ? 412  LYS A NZ  1 
ATOM   1355 N  N   . LYS A 1 205 ? 15.186  -4.876  17.362  1.00 28.10 ? 413  LYS A N   1 
ATOM   1356 C  CA  . LYS A 1 205 ? 15.440  -3.543  17.905  1.00 28.90 ? 413  LYS A CA  1 
ATOM   1357 C  C   . LYS A 1 205 ? 15.277  -2.436  16.874  1.00 28.91 ? 413  LYS A C   1 
ATOM   1358 O  O   . LYS A 1 205 ? 15.080  -1.272  17.229  1.00 28.64 ? 413  LYS A O   1 
ATOM   1359 C  CB  . LYS A 1 205 ? 16.872  -3.450  18.461  1.00 30.30 ? 413  LYS A CB  1 
ATOM   1360 C  CG  . LYS A 1 205 ? 17.209  -4.444  19.561  1.00 32.48 ? 413  LYS A CG  1 
ATOM   1361 C  CD  . LYS A 1 205 ? 16.324  -4.274  20.782  1.00 33.03 ? 413  LYS A CD  1 
ATOM   1362 C  CE  . LYS A 1 205 ? 16.857  -5.110  21.950  1.00 32.82 ? 413  LYS A CE  1 
ATOM   1363 N  NZ  . LYS A 1 205 ? 16.003  -4.891  23.160  1.00 32.25 ? 413  LYS A NZ  1 
ATOM   1364 N  N   . ALA A 1 206 ? 15.416  -2.788  15.600  1.00 29.12 ? 414  ALA A N   1 
ATOM   1365 C  CA  . ALA A 1 206 ? 15.292  -1.809  14.532  1.00 29.00 ? 414  ALA A CA  1 
ATOM   1366 C  C   . ALA A 1 206 ? 13.830  -1.601  14.117  1.00 28.05 ? 414  ALA A C   1 
ATOM   1367 O  O   . ALA A 1 206 ? 13.451  -0.494  13.748  1.00 28.34 ? 414  ALA A O   1 
ATOM   1368 C  CB  . ALA A 1 206 ? 16.151  -2.220  13.334  1.00 29.97 ? 414  ALA A CB  1 
ATOM   1369 N  N   . VAL A 1 207 ? 13.010  -2.649  14.181  1.00 26.78 ? 415  VAL A N   1 
ATOM   1370 C  CA  . VAL A 1 207 ? 11.621  -2.535  13.725  1.00 26.31 ? 415  VAL A CA  1 
ATOM   1371 C  C   . VAL A 1 207 ? 10.665  -2.059  14.821  1.00 25.35 ? 415  VAL A C   1 
ATOM   1372 O  O   . VAL A 1 207 ? 9.674   -1.393  14.527  1.00 24.60 ? 415  VAL A O   1 
ATOM   1373 C  CB  . VAL A 1 207 ? 11.078  -3.855  13.059  1.00 26.70 ? 415  VAL A CB  1 
ATOM   1374 C  CG1 . VAL A 1 207 ? 11.861  -4.179  11.789  1.00 26.91 ? 415  VAL A CG1 1 
ATOM   1375 C  CG2 . VAL A 1 207 ? 11.112  -5.020  14.032  1.00 26.72 ? 415  VAL A CG2 1 
ATOM   1376 N  N   . ILE A 1 208 ? 10.960  -2.388  16.080  1.00 24.51 ? 416  ILE A N   1 
ATOM   1377 C  CA  . ILE A 1 208 ? 10.090  -1.973  17.191  1.00 24.29 ? 416  ILE A CA  1 
ATOM   1378 C  C   . ILE A 1 208 ? 9.795   -0.457  17.211  1.00 23.87 ? 416  ILE A C   1 
ATOM   1379 O  O   . ILE A 1 208 ? 8.633   -0.079  17.323  1.00 23.47 ? 416  ILE A O   1 
ATOM   1380 C  CB  . ILE A 1 208 ? 10.597  -2.493  18.578  1.00 24.51 ? 416  ILE A CB  1 
ATOM   1381 C  CG1 . ILE A 1 208 ? 10.268  -3.979  18.739  1.00 25.32 ? 416  ILE A CG1 1 
ATOM   1382 C  CG2 . ILE A 1 208 ? 10.016  -1.659  19.749  1.00 23.88 ? 416  ILE A CG2 1 
ATOM   1383 C  CD1 . ILE A 1 208 ? 8.738   -4.281  18.784  1.00 27.78 ? 416  ILE A CD1 1 
ATOM   1384 N  N   . PRO A 1 209 ? 10.834  0.407   17.066  1.00 24.23 ? 417  PRO A N   1 
ATOM   1385 C  CA  . PRO A 1 209 ? 10.589  1.851   17.140  1.00 24.20 ? 417  PRO A CA  1 
ATOM   1386 C  C   . PRO A 1 209 ? 9.817   2.450   15.965  1.00 24.17 ? 417  PRO A C   1 
ATOM   1387 O  O   . PRO A 1 209 ? 9.419   3.612   16.043  1.00 24.65 ? 417  PRO A O   1 
ATOM   1388 C  CB  . PRO A 1 209 ? 12.005  2.453   17.200  1.00 25.43 ? 417  PRO A CB  1 
ATOM   1389 C  CG  . PRO A 1 209 ? 12.894  1.345   17.602  1.00 25.29 ? 417  PRO A CG  1 
ATOM   1390 C  CD  . PRO A 1 209 ? 12.278  0.119   17.003  1.00 24.87 ? 417  PRO A CD  1 
ATOM   1391 N  N   . GLU A 1 210 ? 9.611   1.686   14.894  1.00 23.81 ? 418  GLU A N   1 
ATOM   1392 C  CA  . GLU A 1 210 ? 8.882   2.194   13.733  1.00 24.19 ? 418  GLU A CA  1 
ATOM   1393 C  C   . GLU A 1 210 ? 7.382   1.995   13.932  1.00 23.28 ? 418  GLU A C   1 
ATOM   1394 O  O   . GLU A 1 210 ? 6.877   0.861   13.867  1.00 22.23 ? 418  GLU A O   1 
ATOM   1395 C  CB  . GLU A 1 210 ? 9.370   1.539   12.412  1.00 24.83 ? 418  GLU A CB  1 
ATOM   1396 C  CG  . GLU A 1 210 ? 10.884  1.692   12.122  1.00 27.62 ? 418  GLU A CG  1 
ATOM   1397 C  CD  . GLU A 1 210 ? 11.343  1.066   10.772  1.00 31.70 ? 418  GLU A CD  1 
ATOM   1398 O  OE1 . GLU A 1 210 ? 10.653  0.162   10.234  1.00 33.04 ? 418  GLU A OE1 1 
ATOM   1399 O  OE2 . GLU A 1 210 ? 12.406  1.477   10.248  1.00 31.29 ? 418  GLU A OE2 1 
ATOM   1400 N  N   . ALA A 1 211 ? 6.664   3.091   14.185  1.00 22.93 ? 419  ALA A N   1 
ATOM   1401 C  CA  . ALA A 1 211 ? 5.196   3.037   14.228  1.00 22.59 ? 419  ALA A CA  1 
ATOM   1402 C  C   . ALA A 1 211 ? 4.654   2.629   12.849  1.00 23.52 ? 419  ALA A C   1 
ATOM   1403 O  O   . ALA A 1 211 ? 5.259   2.944   11.819  1.00 23.06 ? 419  ALA A O   1 
ATOM   1404 C  CB  . ALA A 1 211 ? 4.620   4.379   14.663  1.00 23.17 ? 419  ALA A CB  1 
ATOM   1405 N  N   . VAL A 1 212 ? 3.543   1.896   12.844  1.00 23.26 ? 420  VAL A N   1 
ATOM   1406 C  CA  . VAL A 1 212 ? 3.000   1.319   11.624  1.00 24.40 ? 420  VAL A CA  1 
ATOM   1407 C  C   . VAL A 1 212 ? 1.661   1.980   11.323  1.00 24.24 ? 420  VAL A C   1 
ATOM   1408 O  O   . VAL A 1 212 ? 0.885   2.230   12.238  1.00 23.36 ? 420  VAL A O   1 
ATOM   1409 C  CB  . VAL A 1 212 ? 2.844   -0.211  11.798  1.00 24.83 ? 420  VAL A CB  1 
ATOM   1410 C  CG1 . VAL A 1 212 ? 1.926   -0.816  10.743  1.00 26.59 ? 420  VAL A CG1 1 
ATOM   1411 C  CG2 . VAL A 1 212 ? 4.212   -0.878  11.770  1.00 25.96 ? 420  VAL A CG2 1 
ATOM   1412 N  N   . VAL A 1 213 ? 1.413   2.315   10.054  1.00 24.18 ? 421  VAL A N   1 
ATOM   1413 C  CA  . VAL A 1 213 ? 0.116   2.876   9.675   1.00 24.25 ? 421  VAL A CA  1 
ATOM   1414 C  C   . VAL A 1 213 ? -0.654  1.810   8.905   1.00 24.50 ? 421  VAL A C   1 
ATOM   1415 O  O   . VAL A 1 213 ? -0.245  1.396   7.817   1.00 25.35 ? 421  VAL A O   1 
ATOM   1416 C  CB  . VAL A 1 213 ? 0.250   4.170   8.872   1.00 24.66 ? 421  VAL A CB  1 
ATOM   1417 C  CG1 . VAL A 1 213 ? -1.106  4.612   8.330   1.00 25.19 ? 421  VAL A CG1 1 
ATOM   1418 C  CG2 . VAL A 1 213 ? 0.855   5.270   9.751   1.00 25.55 ? 421  VAL A CG2 1 
ATOM   1419 N  N   . GLU A 1 214 ? -1.756  1.353   9.487   1.00 23.80 ? 422  GLU A N   1 
ATOM   1420 C  CA  . GLU A 1 214 ? -2.423  0.163   8.974   1.00 24.75 ? 422  GLU A CA  1 
ATOM   1421 C  C   . GLU A 1 214 ? -3.855  0.117   9.482   1.00 24.17 ? 422  GLU A C   1 
ATOM   1422 O  O   . GLU A 1 214 ? -4.134  0.571   10.596  1.00 23.34 ? 422  GLU A O   1 
ATOM   1423 C  CB  . GLU A 1 214 ? -1.643  -1.092  9.426   1.00 25.11 ? 422  GLU A CB  1 
ATOM   1424 C  CG  . GLU A 1 214 ? -2.270  -2.432  9.083   1.00 27.65 ? 422  GLU A CG  1 
ATOM   1425 C  CD  . GLU A 1 214 ? -1.320  -3.593  9.325   1.00 30.61 ? 422  GLU A CD  1 
ATOM   1426 O  OE1 . GLU A 1 214 ? -1.513  -4.331  10.325  1.00 30.83 ? 422  GLU A OE1 1 
ATOM   1427 O  OE2 . GLU A 1 214 ? -0.369  -3.757  8.522   1.00 32.84 ? 422  GLU A OE2 1 
ATOM   1428 N  N   . VAL A 1 215 ? -4.755  -0.432  8.669   1.00 24.27 ? 423  VAL A N   1 
ATOM   1429 C  CA  . VAL A 1 215 ? -6.124  -0.630  9.101   1.00 24.53 ? 423  VAL A CA  1 
ATOM   1430 C  C   . VAL A 1 215 ? -6.160  -1.895  9.947   1.00 24.68 ? 423  VAL A C   1 
ATOM   1431 O  O   . VAL A 1 215 ? -5.690  -2.945  9.529   1.00 24.81 ? 423  VAL A O   1 
ATOM   1432 C  CB  . VAL A 1 215 ? -7.121  -0.702  7.906   1.00 25.20 ? 423  VAL A CB  1 
ATOM   1433 C  CG1 . VAL A 1 215 ? -8.525  -1.020  8.393   1.00 25.62 ? 423  VAL A CG1 1 
ATOM   1434 C  CG2 . VAL A 1 215 ? -7.117  0.614   7.134   1.00 25.08 ? 423  VAL A CG2 1 
ATOM   1435 N  N   . LEU A 1 216 ? -6.693  -1.779  11.156  1.00 24.47 ? 424  LEU A N   1 
ATOM   1436 C  CA  . LEU A 1 216 ? -6.760  -2.909  12.065  1.00 24.94 ? 424  LEU A CA  1 
ATOM   1437 C  C   . LEU A 1 216 ? -8.107  -3.610  12.012  1.00 25.79 ? 424  LEU A C   1 
ATOM   1438 O  O   . LEU A 1 216 ? -9.144  -2.966  11.881  1.00 26.10 ? 424  LEU A O   1 
ATOM   1439 C  CB  . LEU A 1 216 ? -6.523  -2.441  13.492  1.00 24.02 ? 424  LEU A CB  1 
ATOM   1440 C  CG  . LEU A 1 216 ? -5.166  -1.812  13.775  1.00 24.35 ? 424  LEU A CG  1 
ATOM   1441 C  CD1 . LEU A 1 216 ? -5.214  -1.184  15.148  1.00 23.26 ? 424  LEU A CD1 1 
ATOM   1442 C  CD2 . LEU A 1 216 ? -4.053  -2.851  13.687  1.00 25.31 ? 424  LEU A CD2 1 
ATOM   1443 N  N   . ASP A 1 217 ? -8.068  -4.933  12.144  1.00 27.06 ? 425  ASP A N   1 
ATOM   1444 C  CA  . ASP A 1 217 ? -9.254  -5.757  12.354  1.00 28.13 ? 425  ASP A CA  1 
ATOM   1445 C  C   . ASP A 1 217 ? -9.828  -5.410  13.739  1.00 27.82 ? 425  ASP A C   1 
ATOM   1446 O  O   . ASP A 1 217 ? -9.155  -5.614  14.758  1.00 27.46 ? 425  ASP A O   1 
ATOM   1447 C  CB  . ASP A 1 217 ? -8.851  -7.242  12.250  1.00 28.71 ? 425  ASP A CB  1 
ATOM   1448 C  CG  . ASP A 1 217 ? -10.004 -8.209  12.513  1.00 31.49 ? 425  ASP A CG  1 
ATOM   1449 O  OD1 . ASP A 1 217 ? -11.136 -7.784  12.827  1.00 31.14 ? 425  ASP A OD1 1 
ATOM   1450 O  OD2 . ASP A 1 217 ? -9.762  -9.432  12.402  1.00 35.35 ? 425  ASP A OD2 1 
ATOM   1451 N  N   . PRO A 1 218 ? -11.064 -4.871  13.778  1.00 28.39 ? 426  PRO A N   1 
ATOM   1452 C  CA  . PRO A 1 218 ? -11.646 -4.386  15.036  1.00 28.25 ? 426  PRO A CA  1 
ATOM   1453 C  C   . PRO A 1 218 ? -11.829 -5.490  16.083  1.00 28.42 ? 426  PRO A C   1 
ATOM   1454 O  O   . PRO A 1 218 ? -11.956 -5.196  17.261  1.00 28.39 ? 426  PRO A O   1 
ATOM   1455 C  CB  . PRO A 1 218 ? -13.009 -3.807  14.607  1.00 28.94 ? 426  PRO A CB  1 
ATOM   1456 C  CG  . PRO A 1 218 ? -13.311 -4.423  13.284  1.00 29.86 ? 426  PRO A CG  1 
ATOM   1457 C  CD  . PRO A 1 218 ? -11.970 -4.648  12.630  1.00 29.37 ? 426  PRO A CD  1 
ATOM   1458 N  N   . LYS A 1 219 ? -11.819 -6.746  15.652  1.00 28.56 ? 427  LYS A N   1 
ATOM   1459 C  CA  . LYS A 1 219 ? -11.924 -7.883  16.568  1.00 29.46 ? 427  LYS A CA  1 
ATOM   1460 C  C   . LYS A 1 219 ? -10.659 -8.049  17.410  1.00 28.53 ? 427  LYS A C   1 
ATOM   1461 O  O   . LYS A 1 219 ? -10.684 -8.727  18.436  1.00 28.72 ? 427  LYS A O   1 
ATOM   1462 C  CB  . LYS A 1 219 ? -12.213 -9.183  15.791  1.00 30.45 ? 427  LYS A CB  1 
ATOM   1463 C  CG  . LYS A 1 219 ? -13.631 -9.261  15.193  1.00 32.67 ? 427  LYS A CG  1 
ATOM   1464 C  CD  . LYS A 1 219 ? -13.818 -10.511 14.330  1.00 36.30 ? 427  LYS A CD  1 
ATOM   1465 N  N   . THR A 1 220 ? -9.556  -7.438  16.975  1.00 27.12 ? 428  THR A N   1 
ATOM   1466 C  CA  . THR A 1 220 ? -8.289  -7.565  17.711  1.00 26.78 ? 428  THR A CA  1 
ATOM   1467 C  C   . THR A 1 220 ? -8.141  -6.525  18.827  1.00 26.18 ? 428  THR A C   1 
ATOM   1468 O  O   . THR A 1 220 ? -7.175  -6.578  19.602  1.00 25.92 ? 428  THR A O   1 
ATOM   1469 C  CB  . THR A 1 220 ? -7.039  -7.533  16.776  1.00 26.03 ? 428  THR A CB  1 
ATOM   1470 O  OG1 . THR A 1 220 ? -6.945  -6.258  16.130  1.00 25.80 ? 428  THR A OG1 1 
ATOM   1471 C  CG2 . THR A 1 220 ? -7.108  -8.660  15.725  1.00 26.94 ? 428  THR A CG2 1 
ATOM   1472 N  N   . LEU A 1 221 ? -9.096  -5.595  18.915  1.00 26.26 ? 429  LEU A N   1 
ATOM   1473 C  CA  . LEU A 1 221 ? -9.107  -4.591  19.988  1.00 26.04 ? 429  LEU A CA  1 
ATOM   1474 C  C   . LEU A 1 221 ? -9.541  -5.227  21.292  1.00 26.39 ? 429  LEU A C   1 
ATOM   1475 O  O   . LEU A 1 221 ? -10.553 -5.916  21.339  1.00 26.75 ? 429  LEU A O   1 
ATOM   1476 C  CB  . LEU A 1 221 ? -10.039 -3.417  19.664  1.00 26.61 ? 429  LEU A CB  1 
ATOM   1477 C  CG  . LEU A 1 221 ? -9.769  -2.590  18.408  1.00 27.30 ? 429  LEU A CG  1 
ATOM   1478 C  CD1 . LEU A 1 221 ? -10.617 -1.314  18.443  1.00 30.35 ? 429  LEU A CD1 1 
ATOM   1479 C  CD2 . LEU A 1 221 ? -8.290  -2.282  18.236  1.00 28.30 ? 429  LEU A CD2 1 
ATOM   1480 N  N   . ILE A 1 222 ? -8.778  -4.989  22.351  1.00 25.69 ? 430  ILE A N   1 
ATOM   1481 C  CA  . ILE A 1 222 ? -9.016  -5.671  23.628  1.00 26.10 ? 430  ILE A CA  1 
ATOM   1482 C  C   . ILE A 1 222 ? -9.203  -4.716  24.803  1.00 26.64 ? 430  ILE A C   1 
ATOM   1483 O  O   . ILE A 1 222 ? -9.114  -5.116  25.964  1.00 27.31 ? 430  ILE A O   1 
ATOM   1484 C  CB  . ILE A 1 222 ? -7.882  -6.662  23.963  1.00 25.73 ? 430  ILE A CB  1 
ATOM   1485 C  CG1 . ILE A 1 222 ? -6.535  -5.933  24.014  1.00 24.97 ? 430  ILE A CG1 1 
ATOM   1486 C  CG2 . ILE A 1 222 ? -7.867  -7.821  22.950  1.00 25.75 ? 430  ILE A CG2 1 
ATOM   1487 C  CD1 . ILE A 1 222 ? -5.518  -6.579  24.925  1.00 24.52 ? 430  ILE A CD1 1 
ATOM   1488 N  N   . SER A 1 223 ? -9.444  -3.445  24.509  1.00 26.50 ? 431  SER A N   1 
ATOM   1489 C  CA  . SER A 1 223 ? -9.814  -2.508  25.559  1.00 26.97 ? 431  SER A CA  1 
ATOM   1490 C  C   . SER A 1 223 ? -10.786 -1.491  25.007  1.00 27.28 ? 431  SER A C   1 
ATOM   1491 O  O   . SER A 1 223 ? -10.936 -1.364  23.784  1.00 26.49 ? 431  SER A O   1 
ATOM   1492 C  CB  . SER A 1 223 ? -8.585  -1.782  26.112  1.00 26.78 ? 431  SER A CB  1 
ATOM   1493 O  OG  . SER A 1 223 ? -8.239  -0.675  25.287  1.00 26.26 ? 431  SER A OG  1 
ATOM   1494 N  N   A GLU A 1 224 ? -11.446 -0.772  25.916  0.50 27.76 ? 432  GLU A N   1 
ATOM   1495 N  N   B GLU A 1 224 ? -11.465 -0.774  25.898  0.50 28.00 ? 432  GLU A N   1 
ATOM   1496 C  CA  A GLU A 1 224 ? -12.166 0.442   25.568  0.50 28.10 ? 432  GLU A CA  1 
ATOM   1497 C  CA  B GLU A 1 224 ? -12.201 0.407   25.487  0.50 28.55 ? 432  GLU A CA  1 
ATOM   1498 C  C   A GLU A 1 224 ? -11.118 1.457   25.129  0.50 27.48 ? 432  GLU A C   1 
ATOM   1499 C  C   B GLU A 1 224 ? -11.160 1.467   25.151  0.50 27.76 ? 432  GLU A C   1 
ATOM   1500 O  O   A GLU A 1 224 ? -9.975  1.397   25.600  0.50 26.92 ? 432  GLU A O   1 
ATOM   1501 O  O   B GLU A 1 224 ? -10.058 1.442   25.712  0.50 27.31 ? 432  GLU A O   1 
ATOM   1502 C  CB  A GLU A 1 224 ? -12.938 0.987   26.781  0.50 28.68 ? 432  GLU A CB  1 
ATOM   1503 C  CB  B GLU A 1 224 ? -13.147 0.885   26.595  0.50 29.48 ? 432  GLU A CB  1 
ATOM   1504 C  CG  A GLU A 1 224 ? -13.858 -0.025  27.465  0.50 30.01 ? 432  GLU A CG  1 
ATOM   1505 C  CG  B GLU A 1 224 ? -14.377 -0.002  26.771  0.50 31.83 ? 432  GLU A CG  1 
ATOM   1506 C  CD  A GLU A 1 224 ? -14.869 0.635   28.392  0.50 30.86 ? 432  GLU A CD  1 
ATOM   1507 C  CD  B GLU A 1 224 ? -15.230 -0.088  25.509  0.50 34.14 ? 432  GLU A CD  1 
ATOM   1508 O  OE1 A GLU A 1 224 ? -15.043 1.866   28.317  0.50 31.73 ? 432  GLU A OE1 1 
ATOM   1509 O  OE1 B GLU A 1 224 ? -15.809 0.943   25.089  0.50 34.72 ? 432  GLU A OE1 1 
ATOM   1510 O  OE2 A GLU A 1 224 ? -15.498 -0.078  29.191  0.50 32.62 ? 432  GLU A OE2 1 
ATOM   1511 O  OE2 B GLU A 1 224 ? -15.330 -1.195  24.940  0.50 35.12 ? 432  GLU A OE2 1 
ATOM   1512 N  N   . PRO A 1 225 ? -11.482 2.375   24.211  1.00 27.74 ? 433  PRO A N   1 
ATOM   1513 C  CA  . PRO A 1 225 ? -10.529 3.442   23.884  1.00 27.23 ? 433  PRO A CA  1 
ATOM   1514 C  C   . PRO A 1 225 ? -10.355 4.413   25.056  1.00 27.53 ? 433  PRO A C   1 
ATOM   1515 O  O   . PRO A 1 225 ? -11.253 4.529   25.898  1.00 28.74 ? 433  PRO A O   1 
ATOM   1516 C  CB  . PRO A 1 225 ? -11.182 4.152   22.698  1.00 27.22 ? 433  PRO A CB  1 
ATOM   1517 C  CG  . PRO A 1 225 ? -12.651 3.838   22.815  1.00 28.63 ? 433  PRO A CG  1 
ATOM   1518 C  CD  . PRO A 1 225 ? -12.698 2.437   23.367  1.00 27.95 ? 433  PRO A CD  1 
ATOM   1519 N  N   . CYS A 1 226 ? -9.212  5.089   25.111  1.00 26.70 ? 434  CYS A N   1 
ATOM   1520 C  CA  . CYS A 1 226 ? -8.988  6.144   26.096  1.00 27.03 ? 434  CYS A CA  1 
ATOM   1521 C  C   . CYS A 1 226 ? -8.500  7.402   25.392  1.00 26.05 ? 434  CYS A C   1 
ATOM   1522 O  O   . CYS A 1 226 ? -7.513  7.358   24.660  1.00 25.33 ? 434  CYS A O   1 
ATOM   1523 C  CB  . CYS A 1 226 ? -7.973  5.696   27.155  1.00 26.81 ? 434  CYS A CB  1 
ATOM   1524 S  SG  . CYS A 1 226 ? -7.770  6.881   28.517  1.00 31.74 ? 434  CYS A SG  1 
ATOM   1525 N  N   . GLY A 1 227 ? -9.201  8.518   25.600  1.00 26.49 ? 435  GLY A N   1 
ATOM   1526 C  CA  . GLY A 1 227 ? -8.765  9.811   25.069  1.00 26.05 ? 435  GLY A CA  1 
ATOM   1527 C  C   . GLY A 1 227 ? -7.487  10.227  25.766  1.00 26.18 ? 435  GLY A C   1 
ATOM   1528 O  O   . GLY A 1 227 ? -7.371  10.090  26.986  1.00 26.50 ? 435  GLY A O   1 
ATOM   1529 N  N   . ILE A 1 228 ? -6.515  10.704  24.992  1.00 25.43 ? 436  ILE A N   1 
ATOM   1530 C  CA  . ILE A 1 228 ? -5.266  11.210  25.548  1.00 24.71 ? 436  ILE A CA  1 
ATOM   1531 C  C   . ILE A 1 228 ? -5.045  12.688  25.231  1.00 24.87 ? 436  ILE A C   1 
ATOM   1532 O  O   . ILE A 1 228 ? -4.099  13.294  25.727  1.00 24.63 ? 436  ILE A O   1 
ATOM   1533 C  CB  . ILE A 1 228 ? -4.031  10.386  25.058  1.00 24.56 ? 436  ILE A CB  1 
ATOM   1534 C  CG1 . ILE A 1 228 ? -3.908  10.448  23.524  1.00 24.14 ? 436  ILE A CG1 1 
ATOM   1535 C  CG2 . ILE A 1 228 ? -4.113  8.939   25.570  1.00 23.27 ? 436  ILE A CG2 1 
ATOM   1536 C  CD1 . ILE A 1 228 ? -2.555  9.973   22.989  1.00 24.76 ? 436  ILE A CD1 1 
ATOM   1537 N  N   . LYS A 1 229 ? -5.910  13.262  24.397  1.00 25.09 ? 437  LYS A N   1 
ATOM   1538 C  CA  . LYS A 1 229 ? -5.728  14.636  23.940  1.00 25.50 ? 437  LYS A CA  1 
ATOM   1539 C  C   . LYS A 1 229 ? -7.018  15.194  23.356  1.00 26.33 ? 437  LYS A C   1 
ATOM   1540 O  O   . LYS A 1 229 ? -7.740  14.502  22.631  1.00 25.38 ? 437  LYS A O   1 
ATOM   1541 C  CB  . LYS A 1 229 ? -4.583  14.729  22.919  1.00 25.25 ? 437  LYS A CB  1 
ATOM   1542 C  CG  . LYS A 1 229 ? -4.226  16.148  22.445  1.00 25.98 ? 437  LYS A CG  1 
ATOM   1543 C  CD  . LYS A 1 229 ? -3.598  16.980  23.591  1.00 27.25 ? 437  LYS A CD  1 
ATOM   1544 C  CE  . LYS A 1 229 ? -3.004  18.280  23.088  1.00 27.48 ? 437  LYS A CE  1 
ATOM   1545 N  NZ  . LYS A 1 229 ? -2.575  19.159  24.231  1.00 27.92 ? 437  LYS A NZ  1 
ATOM   1546 N  N   . HIS A 1 230 ? -7.300  16.445  23.710  1.00 27.31 ? 438  HIS A N   1 
ATOM   1547 C  CA  . HIS A 1 230 ? -8.457  17.178  23.225  1.00 29.07 ? 438  HIS A CA  1 
ATOM   1548 C  C   . HIS A 1 230 ? -7.902  18.523  22.788  1.00 30.29 ? 438  HIS A C   1 
ATOM   1549 O  O   . HIS A 1 230 ? -7.147  19.169  23.535  1.00 30.32 ? 438  HIS A O   1 
ATOM   1550 C  CB  . HIS A 1 230 ? -9.483  17.341  24.357  1.00 29.84 ? 438  HIS A CB  1 
ATOM   1551 C  CG  . HIS A 1 230 ? -10.706 18.119  23.976  1.00 31.87 ? 438  HIS A CG  1 
ATOM   1552 N  ND1 . HIS A 1 230 ? -10.748 19.500  23.982  1.00 34.13 ? 438  HIS A ND1 1 
ATOM   1553 C  CD2 . HIS A 1 230 ? -11.944 17.709  23.606  1.00 33.26 ? 438  HIS A CD2 1 
ATOM   1554 C  CE1 . HIS A 1 230 ? -11.952 19.906  23.615  1.00 34.23 ? 438  HIS A CE1 1 
ATOM   1555 N  NE2 . HIS A 1 230 ? -12.698 18.839  23.387  1.00 33.94 ? 438  HIS A NE2 1 
ATOM   1556 N  N   . ILE A 1 231 ? -8.246  18.924  21.569  1.00 28.32 ? 439  ILE A N   1 
ATOM   1557 C  CA  . ILE A 1 231 ? -7.769  20.170  20.983  1.00 29.78 ? 439  ILE A CA  1 
ATOM   1558 C  C   . ILE A 1 231 ? -8.985  20.960  20.519  1.00 30.70 ? 439  ILE A C   1 
ATOM   1559 O  O   . ILE A 1 231 ? -9.841  20.406  19.844  1.00 29.87 ? 439  ILE A O   1 
ATOM   1560 C  CB  . ILE A 1 231 ? -6.830  19.878  19.787  1.00 29.83 ? 439  ILE A CB  1 
ATOM   1561 C  CG1 . ILE A 1 231 ? -5.452  19.435  20.285  1.00 30.90 ? 439  ILE A CG1 1 
ATOM   1562 C  CG2 . ILE A 1 231 ? -6.676  21.080  18.886  1.00 30.56 ? 439  ILE A CG2 1 
ATOM   1563 C  CD1 . ILE A 1 231 ? -4.648  18.673  19.215  1.00 34.12 ? 439  ILE A CD1 1 
ATOM   1564 N  N   . ASP A 1 232 ? -9.096  22.222  20.940  1.00 31.65 ? 440  ASP A N   1 
ATOM   1565 C  CA  . ASP A 1 232 ? -10.033 23.149  20.303  1.00 33.85 ? 440  ASP A CA  1 
ATOM   1566 C  C   . ASP A 1 232 ? -9.202  24.173  19.545  1.00 34.28 ? 440  ASP A C   1 
ATOM   1567 O  O   . ASP A 1 232 ? -8.404  24.921  20.143  1.00 33.63 ? 440  ASP A O   1 
ATOM   1568 C  CB  . ASP A 1 232 ? -10.999 23.827  21.298  1.00 35.09 ? 440  ASP A CB  1 
ATOM   1569 C  CG  . ASP A 1 232 ? -12.112 24.636  20.588  1.00 37.76 ? 440  ASP A CG  1 
ATOM   1570 O  OD1 . ASP A 1 232 ? -13.309 24.412  20.879  1.00 38.85 ? 440  ASP A OD1 1 
ATOM   1571 O  OD2 . ASP A 1 232 ? -11.800 25.493  19.724  1.00 39.92 ? 440  ASP A OD2 1 
ATOM   1572 N  N   . CYS A 1 233 ? -9.378  24.183  18.226  1.00 35.16 ? 441  CYS A N   1 
ATOM   1573 C  CA  . CYS A 1 233 ? -8.548  25.002  17.342  1.00 36.87 ? 441  CYS A CA  1 
ATOM   1574 C  C   . CYS A 1 233 ? -8.639  26.508  17.616  1.00 37.95 ? 441  CYS A C   1 
ATOM   1575 O  O   . CYS A 1 233 ? -7.721  27.260  17.285  1.00 38.75 ? 441  CYS A O   1 
ATOM   1576 C  CB  . CYS A 1 233 ? -8.849  24.681  15.883  1.00 36.98 ? 441  CYS A CB  1 
ATOM   1577 S  SG  . CYS A 1 233 ? -8.295  23.019  15.443  1.00 38.80 ? 441  CYS A SG  1 
ATOM   1578 N  N   . HIS A 1 234 ? -9.726  26.933  18.252  1.00 38.52 ? 442  HIS A N   1 
ATOM   1579 C  CA  . HIS A 1 234 ? -9.893  28.329  18.629  1.00 39.35 ? 442  HIS A CA  1 
ATOM   1580 C  C   . HIS A 1 234 ? -8.918  28.778  19.712  1.00 40.06 ? 442  HIS A C   1 
ATOM   1581 O  O   . HIS A 1 234 ? -8.475  29.927  19.703  1.00 40.17 ? 442  HIS A O   1 
ATOM   1582 C  CB  . HIS A 1 234 ? -11.337 28.604  19.057  1.00 39.79 ? 442  HIS A CB  1 
ATOM   1583 C  CG  . HIS A 1 234 ? -12.328 28.421  17.949  1.00 38.87 ? 442  HIS A CG  1 
ATOM   1584 N  ND1 . HIS A 1 234 ? -13.007 27.239  17.748  1.00 36.30 ? 442  HIS A ND1 1 
ATOM   1585 C  CD2 . HIS A 1 234 ? -12.728 29.260  16.963  1.00 38.19 ? 442  HIS A CD2 1 
ATOM   1586 C  CE1 . HIS A 1 234 ? -13.796 27.363  16.694  1.00 36.62 ? 442  HIS A CE1 1 
ATOM   1587 N  NE2 . HIS A 1 234 ? -13.641 28.576  16.196  1.00 36.50 ? 442  HIS A NE2 1 
ATOM   1588 N  N   . THR A 1 235 ? -8.569  27.871  20.624  1.00 40.20 ? 443  THR A N   1 
ATOM   1589 C  CA  . THR A 1 235 ? -7.753  28.237  21.793  1.00 41.58 ? 443  THR A CA  1 
ATOM   1590 C  C   . THR A 1 235 ? -6.388  27.539  21.844  1.00 41.26 ? 443  THR A C   1 
ATOM   1591 O  O   . THR A 1 235 ? -5.516  27.939  22.610  1.00 42.10 ? 443  THR A O   1 
ATOM   1592 C  CB  . THR A 1 235 ? -8.513  27.984  23.124  1.00 42.13 ? 443  THR A CB  1 
ATOM   1593 O  OG1 . THR A 1 235 ? -8.843  26.595  23.220  1.00 41.44 ? 443  THR A OG1 1 
ATOM   1594 C  CG2 . THR A 1 235 ? -9.802  28.802  23.177  1.00 43.63 ? 443  THR A CG2 1 
ATOM   1595 N  N   . THR A 1 236 ? -6.198  26.511  21.024  1.00 40.92 ? 444  THR A N   1 
ATOM   1596 C  CA  . THR A 1 236 ? -4.937  25.768  21.011  1.00 40.80 ? 444  THR A CA  1 
ATOM   1597 C  C   . THR A 1 236 ? -3.765  26.638  20.515  1.00 41.35 ? 444  THR A C   1 
ATOM   1598 O  O   . THR A 1 236 ? -3.917  27.431  19.583  1.00 41.44 ? 444  THR A O   1 
ATOM   1599 C  CB  . THR A 1 236 ? -5.069  24.475  20.180  1.00 40.19 ? 444  THR A CB  1 
ATOM   1600 O  OG1 . THR A 1 236 ? -6.088  23.651  20.761  1.00 40.54 ? 444  THR A OG1 1 
ATOM   1601 C  CG2 . THR A 1 236 ? -3.778  23.681  20.172  1.00 39.94 ? 444  THR A CG2 1 
ATOM   1602 N  N   . SER A 1 237 ? -2.613  26.508  21.171  1.00 41.53 ? 445  SER A N   1 
ATOM   1603 C  CA  . SER A 1 237 ? -1.382  27.123  20.690  1.00 42.25 ? 445  SER A CA  1 
ATOM   1604 C  C   . SER A 1 237 ? -0.464  26.025  20.150  1.00 42.03 ? 445  SER A C   1 
ATOM   1605 O  O   . SER A 1 237 ? -0.720  24.833  20.358  1.00 41.24 ? 445  SER A O   1 
ATOM   1606 C  CB  . SER A 1 237 ? -0.699  27.907  21.810  1.00 43.20 ? 445  SER A CB  1 
ATOM   1607 O  OG  . SER A 1 237 ? -0.202  27.019  22.803  1.00 43.97 ? 445  SER A OG  1 
ATOM   1608 N  N   . ILE A 1 238 ? 0.600   26.425  19.457  1.00 42.64 ? 446  ILE A N   1 
ATOM   1609 C  CA  . ILE A 1 238 ? 1.564   25.477  18.901  1.00 42.67 ? 446  ILE A CA  1 
ATOM   1610 C  C   . ILE A 1 238 ? 2.223   24.646  20.007  1.00 42.30 ? 446  ILE A C   1 
ATOM   1611 O  O   . ILE A 1 238 ? 2.444   23.446  19.836  1.00 41.85 ? 446  ILE A O   1 
ATOM   1612 C  CB  . ILE A 1 238 ? 2.636   26.190  18.033  1.00 43.82 ? 446  ILE A CB  1 
ATOM   1613 C  CG1 . ILE A 1 238 ? 1.966   26.958  16.891  1.00 44.91 ? 446  ILE A CG1 1 
ATOM   1614 C  CG2 . ILE A 1 238 ? 3.632   25.183  17.455  1.00 44.85 ? 446  ILE A CG2 1 
ATOM   1615 N  N   . SER A 1 239 ? 2.507   25.274  21.145  1.00 42.45 ? 447  SER A N   1 
ATOM   1616 C  CA  . SER A 1 239 ? 3.135   24.558  22.262  1.00 42.57 ? 447  SER A CA  1 
ATOM   1617 C  C   . SER A 1 239 ? 2.235   23.478  22.900  1.00 41.20 ? 447  SER A C   1 
ATOM   1618 O  O   . SER A 1 239 ? 2.736   22.561  23.556  1.00 41.03 ? 447  SER A O   1 
ATOM   1619 C  CB  . SER A 1 239 ? 3.671   25.535  23.321  1.00 43.63 ? 447  SER A CB  1 
ATOM   1620 O  OG  . SER A 1 239 ? 2.614   26.175  24.013  1.00 44.34 ? 447  SER A OG  1 
ATOM   1621 N  N   . ASP A 1 240 ? 0.919   23.576  22.694  1.00 40.15 ? 448  ASP A N   1 
ATOM   1622 C  CA  . ASP A 1 240 ? -0.020  22.562  23.195  1.00 39.24 ? 448  ASP A CA  1 
ATOM   1623 C  C   . ASP A 1 240 ? 0.087   21.225  22.468  1.00 37.75 ? 448  ASP A C   1 
ATOM   1624 O  O   . ASP A 1 240 ? -0.379  20.207  22.968  1.00 36.97 ? 448  ASP A O   1 
ATOM   1625 C  CB  . ASP A 1 240 ? -1.463  23.059  23.113  1.00 39.35 ? 448  ASP A CB  1 
ATOM   1626 C  CG  . ASP A 1 240 ? -1.757  24.179  24.097  1.00 41.55 ? 448  ASP A CG  1 
ATOM   1627 O  OD1 . ASP A 1 240 ? -2.547  25.085  23.741  1.00 43.52 ? 448  ASP A OD1 1 
ATOM   1628 O  OD2 . ASP A 1 240 ? -1.206  24.158  25.220  1.00 43.72 ? 448  ASP A OD2 1 
ATOM   1629 N  N   . LEU A 1 241 ? 0.706   21.236  21.294  1.00 37.37 ? 449  LEU A N   1 
ATOM   1630 C  CA  . LEU A 1 241 ? 0.848   20.033  20.473  1.00 36.65 ? 449  LEU A CA  1 
ATOM   1631 C  C   . LEU A 1 241 ? 1.950   19.090  20.957  1.00 36.53 ? 449  LEU A C   1 
ATOM   1632 O  O   . LEU A 1 241 ? 2.061   17.959  20.485  1.00 36.37 ? 449  LEU A O   1 
ATOM   1633 C  CB  . LEU A 1 241 ? 1.068   20.414  19.007  1.00 37.06 ? 449  LEU A CB  1 
ATOM   1634 C  CG  . LEU A 1 241 ? 0.098   21.450  18.414  1.00 37.95 ? 449  LEU A CG  1 
ATOM   1635 C  CD1 . LEU A 1 241 ? 0.317   21.583  16.914  1.00 38.81 ? 449  LEU A CD1 1 
ATOM   1636 C  CD2 . LEU A 1 241 ? -1.360  21.118  18.724  1.00 38.24 ? 449  LEU A CD2 1 
ATOM   1637 N  N   . GLU A 1 242 ? 2.781   19.568  21.875  1.00 36.52 ? 450  GLU A N   1 
ATOM   1638 C  CA  . GLU A 1 242 ? 3.699   18.704  22.602  1.00 36.49 ? 450  GLU A CA  1 
ATOM   1639 C  C   . GLU A 1 242 ? 3.085   18.487  23.977  1.00 35.18 ? 450  GLU A C   1 
ATOM   1640 O  O   . GLU A 1 242 ? 2.925   19.431  24.750  1.00 35.83 ? 450  GLU A O   1 
ATOM   1641 C  CB  . GLU A 1 242 ? 5.070   19.360  22.715  1.00 38.31 ? 450  GLU A CB  1 
ATOM   1642 C  CG  . GLU A 1 242 ? 5.890   19.327  21.437  1.00 41.31 ? 450  GLU A CG  1 
ATOM   1643 C  CD  . GLU A 1 242 ? 7.329   19.703  21.688  1.00 46.25 ? 450  GLU A CD  1 
ATOM   1644 O  OE1 . GLU A 1 242 ? 8.192   18.798  21.705  1.00 48.41 ? 450  GLU A OE1 1 
ATOM   1645 O  OE2 . GLU A 1 242 ? 7.597   20.908  21.892  1.00 49.75 ? 450  GLU A OE2 1 
ATOM   1646 N  N   . PHE A 1 243 ? 2.701   17.254  24.275  1.00 33.00 ? 451  PHE A N   1 
ATOM   1647 C  CA  . PHE A 1 243 ? 1.883   17.011  25.453  1.00 31.64 ? 451  PHE A CA  1 
ATOM   1648 C  C   . PHE A 1 243 ? 2.153   15.647  26.062  1.00 31.22 ? 451  PHE A C   1 
ATOM   1649 O  O   . PHE A 1 243 ? 2.734   14.770  25.416  1.00 30.54 ? 451  PHE A O   1 
ATOM   1650 C  CB  . PHE A 1 243 ? 0.400   17.126  25.089  1.00 30.52 ? 451  PHE A CB  1 
ATOM   1651 C  CG  . PHE A 1 243 ? -0.102  15.989  24.245  1.00 29.47 ? 451  PHE A CG  1 
ATOM   1652 C  CD1 . PHE A 1 243 ? -0.638  14.842  24.839  1.00 27.44 ? 451  PHE A CD1 1 
ATOM   1653 C  CD2 . PHE A 1 243 ? -0.013  16.048  22.857  1.00 28.71 ? 451  PHE A CD2 1 
ATOM   1654 C  CE1 . PHE A 1 243 ? -1.088  13.771  24.051  1.00 27.84 ? 451  PHE A CE1 1 
ATOM   1655 C  CE2 . PHE A 1 243 ? -0.467  14.991  22.065  1.00 27.01 ? 451  PHE A CE2 1 
ATOM   1656 C  CZ  . PHE A 1 243 ? -1.000  13.847  22.664  1.00 26.53 ? 451  PHE A CZ  1 
ATOM   1657 N  N   . SER A 1 244 ? 1.701   15.476  27.298  1.00 31.25 ? 452  SER A N   1 
ATOM   1658 C  CA  . SER A 1 244 ? 1.810   14.214  28.028  1.00 31.97 ? 452  SER A CA  1 
ATOM   1659 C  C   . SER A 1 244 ? 0.455   13.864  28.572  1.00 31.70 ? 452  SER A C   1 
ATOM   1660 O  O   . SER A 1 244 ? -0.329  14.754  28.890  1.00 32.40 ? 452  SER A O   1 
ATOM   1661 C  CB  . SER A 1 244 ? 2.761   14.354  29.209  1.00 33.26 ? 452  SER A CB  1 
ATOM   1662 O  OG  . SER A 1 244 ? 4.096   14.330  28.789  1.00 34.66 ? 452  SER A OG  1 
ATOM   1663 N  N   . SER A 1 245 ? 0.169   12.574  28.682  1.00 31.01 ? 453  SER A N   1 
ATOM   1664 C  CA  . SER A 1 245 ? -1.096  12.153  29.247  1.00 31.35 ? 453  SER A CA  1 
ATOM   1665 C  C   . SER A 1 245 ? -0.919  10.848  29.989  1.00 31.33 ? 453  SER A C   1 
ATOM   1666 O  O   . SER A 1 245 ? -0.308  9.914   29.467  1.00 30.66 ? 453  SER A O   1 
ATOM   1667 C  CB  . SER A 1 245 ? -2.139  11.988  28.135  1.00 30.67 ? 453  SER A CB  1 
ATOM   1668 O  OG  . SER A 1 245 ? -3.428  11.695  28.661  1.00 33.05 ? 453  SER A OG  1 
ATOM   1669 N  N   . ASP A 1 246 ? -1.430  10.788  31.213  1.00 31.98 ? 454  ASP A N   1 
ATOM   1670 C  CA  . ASP A 1 246 ? -1.601  9.500   31.874  1.00 32.80 ? 454  ASP A CA  1 
ATOM   1671 C  C   . ASP A 1 246 ? -2.876  8.915   31.308  1.00 31.98 ? 454  ASP A C   1 
ATOM   1672 O  O   . ASP A 1 246 ? -3.859  9.642   31.143  1.00 32.95 ? 454  ASP A O   1 
ATOM   1673 C  CB  . ASP A 1 246 ? -1.716  9.665   33.388  1.00 34.77 ? 454  ASP A CB  1 
ATOM   1674 C  CG  . ASP A 1 246 ? -0.412  10.113  34.021  1.00 36.81 ? 454  ASP A CG  1 
ATOM   1675 O  OD1 . ASP A 1 246 ? 0.573   9.350   33.971  1.00 39.68 ? 454  ASP A OD1 1 
ATOM   1676 O  OD2 . ASP A 1 246 ? -0.366  11.234  34.571  1.00 40.46 ? 454  ASP A OD2 1 
ATOM   1677 N  N   . PHE A 1 247 ? -2.869  7.628   30.979  1.00 30.09 ? 455  PHE A N   1 
ATOM   1678 C  CA  . PHE A 1 247 ? -4.075  6.999   30.442  1.00 29.05 ? 455  PHE A CA  1 
ATOM   1679 C  C   . PHE A 1 247 ? -4.398  5.711   31.192  1.00 29.05 ? 455  PHE A C   1 
ATOM   1680 O  O   . PHE A 1 247 ? -3.533  5.139   31.853  1.00 29.01 ? 455  PHE A O   1 
ATOM   1681 C  CB  . PHE A 1 247 ? -3.965  6.754   28.920  1.00 27.67 ? 455  PHE A CB  1 
ATOM   1682 C  CG  . PHE A 1 247 ? -2.839  5.826   28.513  1.00 27.50 ? 455  PHE A CG  1 
ATOM   1683 C  CD1 . PHE A 1 247 ? -3.021  4.440   28.491  1.00 27.23 ? 455  PHE A CD1 1 
ATOM   1684 C  CD2 . PHE A 1 247 ? -1.609  6.336   28.121  1.00 26.14 ? 455  PHE A CD2 1 
ATOM   1685 C  CE1 . PHE A 1 247 ? -1.989  3.589   28.113  1.00 27.54 ? 455  PHE A CE1 1 
ATOM   1686 C  CE2 . PHE A 1 247 ? -0.569  5.487   27.736  1.00 25.54 ? 455  PHE A CE2 1 
ATOM   1687 C  CZ  . PHE A 1 247 ? -0.758  4.112   27.732  1.00 26.33 ? 455  PHE A CZ  1 
ATOM   1688 N  N   . THR A 1 248 ? -5.647  5.278   31.076  1.00 28.73 ? 456  THR A N   1 
ATOM   1689 C  CA  . THR A 1 248 ? -6.114  4.027   31.649  1.00 29.49 ? 456  THR A CA  1 
ATOM   1690 C  C   . THR A 1 248 ? -6.924  3.265   30.601  1.00 28.87 ? 456  THR A C   1 
ATOM   1691 O  O   . THR A 1 248 ? -7.932  3.775   30.088  1.00 28.90 ? 456  THR A O   1 
ATOM   1692 C  CB  . THR A 1 248 ? -6.995  4.282   32.875  1.00 30.59 ? 456  THR A CB  1 
ATOM   1693 O  OG1 . THR A 1 248 ? -6.227  4.973   33.868  1.00 32.22 ? 456  THR A OG1 1 
ATOM   1694 C  CG2 . THR A 1 248 ? -7.510  2.972   33.451  1.00 32.04 ? 456  THR A CG2 1 
ATOM   1695 N  N   . LEU A 1 249 ? -6.473  2.059   30.269  1.00 28.10 ? 457  LEU A N   1 
ATOM   1696 C  CA  . LEU A 1 249 ? -7.179  1.245   29.293  1.00 28.00 ? 457  LEU A CA  1 
ATOM   1697 C  C   . LEU A 1 249 ? -8.038  0.217   30.012  1.00 28.88 ? 457  LEU A C   1 
ATOM   1698 O  O   . LEU A 1 249 ? -7.534  -0.627  30.752  1.00 28.54 ? 457  LEU A O   1 
ATOM   1699 C  CB  . LEU A 1 249 ? -6.204  0.590   28.308  1.00 27.29 ? 457  LEU A CB  1 
ATOM   1700 C  CG  . LEU A 1 249 ? -5.364  1.586   27.493  1.00 26.88 ? 457  LEU A CG  1 
ATOM   1701 C  CD1 . LEU A 1 249 ? -4.225  0.887   26.788  1.00 27.45 ? 457  LEU A CD1 1 
ATOM   1702 C  CD2 . LEU A 1 249 ? -6.246  2.336   26.485  1.00 28.00 ? 457  LEU A CD2 1 
ATOM   1703 N  N   . LYS A 1 250 ? -9.347  0.317   29.809  1.00 29.58 ? 458  LYS A N   1 
ATOM   1704 C  CA  . LYS A 1 250 ? -10.281 -0.613  30.434  1.00 30.73 ? 458  LYS A CA  1 
ATOM   1705 C  C   . LYS A 1 250 ? -10.308 -1.876  29.583  1.00 29.52 ? 458  LYS A C   1 
ATOM   1706 O  O   . LYS A 1 250 ? -10.921 -1.919  28.516  1.00 28.55 ? 458  LYS A O   1 
ATOM   1707 C  CB  . LYS A 1 250 ? -11.671 0.015   30.589  1.00 32.03 ? 458  LYS A CB  1 
ATOM   1708 C  CG  . LYS A 1 250 ? -11.713 1.207   31.567  1.00 36.06 ? 458  LYS A CG  1 
ATOM   1709 C  CD  . LYS A 1 250 ? -13.071 1.927   31.516  1.00 41.10 ? 458  LYS A CD  1 
ATOM   1710 C  CE  . LYS A 1 250 ? -13.229 2.952   32.640  1.00 44.00 ? 458  LYS A CE  1 
ATOM   1711 N  N   . ILE A 1 251 ? -9.592  -2.889  30.055  1.00 29.23 ? 459  ILE A N   1 
ATOM   1712 C  CA  . ILE A 1 251 ? -9.426  -4.138  29.319  1.00 28.48 ? 459  ILE A CA  1 
ATOM   1713 C  C   . ILE A 1 251 ? -10.755 -4.901  29.211  1.00 29.73 ? 459  ILE A C   1 
ATOM   1714 O  O   . ILE A 1 251 ? -11.473 -5.062  30.208  1.00 30.09 ? 459  ILE A O   1 
ATOM   1715 C  CB  . ILE A 1 251 ? -8.328  -5.011  29.974  1.00 28.60 ? 459  ILE A CB  1 
ATOM   1716 C  CG1 . ILE A 1 251 ? -6.984  -4.251  29.997  1.00 26.80 ? 459  ILE A CG1 1 
ATOM   1717 C  CG2 . ILE A 1 251 ? -8.226  -6.369  29.276  1.00 27.53 ? 459  ILE A CG2 1 
ATOM   1718 C  CD1 . ILE A 1 251 ? -6.407  -3.875  28.592  1.00 24.28 ? 459  ILE A CD1 1 
ATOM   1719 N  N   . THR A 1 252 ? -11.083 -5.344  27.997  1.00 29.42 ? 460  THR A N   1 
ATOM   1720 C  CA  . THR A 1 252 ? -12.374 -5.977  27.737  1.00 30.99 ? 460  THR A CA  1 
ATOM   1721 C  C   . THR A 1 252 ? -12.240 -7.459  27.375  1.00 31.49 ? 460  THR A C   1 
ATOM   1722 O  O   . THR A 1 252 ? -13.239 -8.172  27.297  1.00 32.37 ? 460  THR A O   1 
ATOM   1723 C  CB  . THR A 1 252 ? -13.164 -5.246  26.619  1.00 31.21 ? 460  THR A CB  1 
ATOM   1724 O  OG1 . THR A 1 252 ? -12.373 -5.205  25.420  1.00 30.45 ? 460  THR A OG1 1 
ATOM   1725 C  CG2 . THR A 1 252 ? -13.543 -3.830  27.046  1.00 30.76 ? 460  THR A CG2 1 
ATOM   1726 N  N   . ARG A 1 253 ? -11.006 -7.919  27.163  1.00 30.82 ? 461  ARG A N   1 
ATOM   1727 C  CA  . ARG A 1 253 ? -10.759 -9.316  26.831  1.00 31.02 ? 461  ARG A CA  1 
ATOM   1728 C  C   . ARG A 1 253 ? -9.481  -9.831  27.478  1.00 30.50 ? 461  ARG A C   1 
ATOM   1729 O  O   . ARG A 1 253 ? -8.408  -9.222  27.364  1.00 29.61 ? 461  ARG A O   1 
ATOM   1730 C  CB  . ARG A 1 253 ? -10.719 -9.530  25.308  1.00 31.33 ? 461  ARG A CB  1 
ATOM   1731 C  CG  . ARG A 1 253 ? -10.639 -10.998 24.867  1.00 32.89 ? 461  ARG A CG  1 
ATOM   1732 C  CD  . ARG A 1 253 ? -10.279 -11.118 23.396  1.00 34.62 ? 461  ARG A CD  1 
ATOM   1733 N  NE  . ARG A 1 253 ? -11.262 -10.427 22.566  1.00 35.48 ? 461  ARG A NE  1 
ATOM   1734 C  CZ  . ARG A 1 253 ? -11.013 -9.911  21.366  1.00 36.76 ? 461  ARG A CZ  1 
ATOM   1735 N  NH1 . ARG A 1 253 ? -9.799  -10.002 20.822  1.00 35.89 ? 461  ARG A NH1 1 
ATOM   1736 N  NH2 . ARG A 1 253 ? -11.985 -9.294  20.708  1.00 37.47 ? 461  ARG A NH2 1 
ATOM   1737 N  N   . THR A 1 254 ? -9.609  -10.960 28.165  1.00 30.83 ? 462  THR A N   1 
ATOM   1738 C  CA  . THR A 1 254 ? -8.459  -11.673 28.690  1.00 29.94 ? 462  THR A CA  1 
ATOM   1739 C  C   . THR A 1 254 ? -7.637  -12.198 27.513  1.00 29.75 ? 462  THR A C   1 
ATOM   1740 O  O   . THR A 1 254 ? -8.116  -13.013 26.712  1.00 29.95 ? 462  THR A O   1 
ATOM   1741 C  CB  . THR A 1 254 ? -8.906  -12.780 29.659  1.00 30.97 ? 462  THR A CB  1 
ATOM   1742 O  OG1 . THR A 1 254 ? -9.598  -12.157 30.747  1.00 30.23 ? 462  THR A OG1 1 
ATOM   1743 C  CG2 . THR A 1 254 ? -7.708  -13.543 30.220  1.00 30.59 ? 462  THR A CG2 1 
ATOM   1744 N  N   . SER A 1 255 ? -6.411  -11.692 27.402  1.00 28.95 ? 463  SER A N   1 
ATOM   1745 C  CA  . SER A 1 255 ? -5.574  -11.936 26.229  1.00 28.83 ? 463  SER A CA  1 
ATOM   1746 C  C   . SER A 1 255 ? -4.153  -11.427 26.433  1.00 28.31 ? 463  SER A C   1 
ATOM   1747 O  O   . SER A 1 255 ? -3.835  -10.850 27.471  1.00 28.10 ? 463  SER A O   1 
ATOM   1748 C  CB  . SER A 1 255 ? -6.178  -11.245 25.000  1.00 28.73 ? 463  SER A CB  1 
ATOM   1749 O  OG  . SER A 1 255 ? -6.360  -9.861  25.255  1.00 29.11 ? 463  SER A OG  1 
ATOM   1750 N  N   . MET A 1 256 ? -3.311  -11.665 25.426  1.00 28.16 ? 464  MET A N   1 
ATOM   1751 C  CA  . MET A 1 256 ? -1.948  -11.143 25.348  1.00 27.80 ? 464  MET A CA  1 
ATOM   1752 C  C   . MET A 1 256 ? -1.979  -9.820  24.609  1.00 26.83 ? 464  MET A C   1 
ATOM   1753 O  O   . MET A 1 256 ? -2.376  -9.790  23.451  1.00 26.90 ? 464  MET A O   1 
ATOM   1754 C  CB  . MET A 1 256 ? -1.086  -12.130 24.557  1.00 29.33 ? 464  MET A CB  1 
ATOM   1755 C  CG  . MET A 1 256 ? 0.398   -11.812 24.504  1.00 31.73 ? 464  MET A CG  1 
ATOM   1756 S  SD  . MET A 1 256 ? 1.198   -11.966 26.116  1.00 40.20 ? 464  MET A SD  1 
ATOM   1757 C  CE  . MET A 1 256 ? 0.483   -13.462 26.793  1.00 35.23 ? 464  MET A CE  1 
ATOM   1758 N  N   . CYS A 1 257 ? -1.582  -8.734  25.276  1.00 25.19 ? 465  CYS A N   1 
ATOM   1759 C  CA  . CYS A 1 257 ? -1.542  -7.414  24.657  1.00 23.78 ? 465  CYS A CA  1 
ATOM   1760 C  C   . CYS A 1 257 ? -0.229  -7.301  23.897  1.00 23.24 ? 465  CYS A C   1 
ATOM   1761 O  O   . CYS A 1 257 ? 0.841   -7.490  24.478  1.00 23.60 ? 465  CYS A O   1 
ATOM   1762 C  CB  . CYS A 1 257 ? -1.669  -6.295  25.703  1.00 23.80 ? 465  CYS A CB  1 
ATOM   1763 S  SG  . CYS A 1 257 ? -1.551  -4.607  24.997  1.00 24.04 ? 465  CYS A SG  1 
ATOM   1764 N  N   . THR A 1 258 ? -0.314  -7.037  22.598  1.00 22.85 ? 466  THR A N   1 
ATOM   1765 C  CA  . THR A 1 258 ? 0.866   -7.084  21.732  1.00 22.18 ? 466  THR A CA  1 
ATOM   1766 C  C   . THR A 1 258 ? 1.206   -5.734  21.107  1.00 21.68 ? 466  THR A C   1 
ATOM   1767 O  O   . THR A 1 258 ? 2.298   -5.555  20.574  1.00 20.97 ? 466  THR A O   1 
ATOM   1768 C  CB  . THR A 1 258 ? 0.666   -8.066  20.578  1.00 21.58 ? 466  THR A CB  1 
ATOM   1769 O  OG1 . THR A 1 258 ? -0.472  -7.650  19.819  1.00 22.81 ? 466  THR A OG1 1 
ATOM   1770 C  CG2 . THR A 1 258 ? 0.468   -9.490  21.085  1.00 21.84 ? 466  THR A CG2 1 
ATOM   1771 N  N   . ALA A 1 259 ? 0.254   -4.798  21.160  1.00 21.44 ? 467  ALA A N   1 
ATOM   1772 C  CA  . ALA A 1 259 ? 0.438   -3.457  20.604  1.00 21.26 ? 467  ALA A CA  1 
ATOM   1773 C  C   . ALA A 1 259 ? -0.555  -2.474  21.204  1.00 20.89 ? 467  ALA A C   1 
ATOM   1774 O  O   . ALA A 1 259 ? -1.576  -2.862  21.790  1.00 21.14 ? 467  ALA A O   1 
ATOM   1775 C  CB  . ALA A 1 259 ? 0.285   -3.478  19.069  1.00 20.42 ? 467  ALA A CB  1 
ATOM   1776 N  N   . ILE A 1 260 ? -0.236  -1.200  21.041  1.00 20.83 ? 468  ILE A N   1 
ATOM   1777 C  CA  . ILE A 1 260 ? -1.144  -0.118  21.358  1.00 20.90 ? 468  ILE A CA  1 
ATOM   1778 C  C   . ILE A 1 260 ? -1.415  0.627   20.060  1.00 20.74 ? 468  ILE A C   1 
ATOM   1779 O  O   . ILE A 1 260 ? -0.490  0.983   19.324  1.00 20.98 ? 468  ILE A O   1 
ATOM   1780 C  CB  . ILE A 1 260 ? -0.565  0.829   22.435  1.00 20.68 ? 468  ILE A CB  1 
ATOM   1781 C  CG1 . ILE A 1 260 ? -0.294  0.072   23.743  1.00 22.50 ? 468  ILE A CG1 1 
ATOM   1782 C  CG2 . ILE A 1 260 ? -1.487  2.057   22.660  1.00 21.45 ? 468  ILE A CG2 1 
ATOM   1783 C  CD1 . ILE A 1 260 ? -1.555  -0.516  24.471  1.00 20.78 ? 468  ILE A CD1 1 
ATOM   1784 N  N   . ALA A 1 261 ? -2.691  0.863   19.786  1.00 20.32 ? 469  ALA A N   1 
ATOM   1785 C  CA  . ALA A 1 261 ? -3.096  1.571   18.589  1.00 20.21 ? 469  ALA A CA  1 
ATOM   1786 C  C   . ALA A 1 261 ? -3.593  2.977   18.917  1.00 20.59 ? 469  ALA A C   1 
ATOM   1787 O  O   . ALA A 1 261 ? -4.179  3.222   19.981  1.00 20.09 ? 469  ALA A O   1 
ATOM   1788 C  CB  . ALA A 1 261 ? -4.157  0.793   17.865  1.00 20.03 ? 469  ALA A CB  1 
ATOM   1789 N  N   . GLY A 1 262 ? -3.349  3.902   17.996  1.00 20.40 ? 470  GLY A N   1 
ATOM   1790 C  CA  . GLY A 1 262 ? -3.836  5.263   18.145  1.00 20.68 ? 470  GLY A CA  1 
ATOM   1791 C  C   . GLY A 1 262 ? -4.662  5.701   16.947  1.00 20.44 ? 470  GLY A C   1 
ATOM   1792 O  O   . GLY A 1 262 ? -4.439  5.237   15.826  1.00 20.78 ? 470  GLY A O   1 
ATOM   1793 N  N   . TYR A 1 263 ? -5.609  6.598   17.198  1.00 20.16 ? 471  TYR A N   1 
ATOM   1794 C  CA  . TYR A 1 263 ? -6.436  7.225   16.164  1.00 19.83 ? 471  TYR A CA  1 
ATOM   1795 C  C   . TYR A 1 263 ? -6.970  8.560   16.654  1.00 20.10 ? 471  TYR A C   1 
ATOM   1796 O  O   . TYR A 1 263 ? -6.673  8.986   17.773  1.00 19.97 ? 471  TYR A O   1 
ATOM   1797 C  CB  . TYR A 1 263 ? -7.596  6.316   15.744  1.00 19.45 ? 471  TYR A CB  1 
ATOM   1798 C  CG  . TYR A 1 263 ? -8.598  5.973   16.831  1.00 20.33 ? 471  TYR A CG  1 
ATOM   1799 C  CD1 . TYR A 1 263 ? -9.760  6.727   16.999  1.00 20.27 ? 471  TYR A CD1 1 
ATOM   1800 C  CD2 . TYR A 1 263 ? -8.405  4.863   17.660  1.00 21.45 ? 471  TYR A CD2 1 
ATOM   1801 C  CE1 . TYR A 1 263 ? -10.708 6.391   17.979  1.00 22.30 ? 471  TYR A CE1 1 
ATOM   1802 C  CE2 . TYR A 1 263 ? -9.342  4.526   18.635  1.00 22.90 ? 471  TYR A CE2 1 
ATOM   1803 C  CZ  . TYR A 1 263 ? -10.481 5.296   18.783  1.00 23.50 ? 471  TYR A CZ  1 
ATOM   1804 O  OH  . TYR A 1 263 ? -11.398 4.960   19.742  1.00 25.67 ? 471  TYR A OH  1 
ATOM   1805 N  N   . PHE A 1 264 ? -7.750  9.230   15.810  1.00 20.31 ? 472  PHE A N   1 
ATOM   1806 C  CA  . PHE A 1 264 ? -8.252  10.544  16.154  1.00 20.83 ? 472  PHE A CA  1 
ATOM   1807 C  C   . PHE A 1 264 ? -9.677  10.724  15.661  1.00 21.40 ? 472  PHE A C   1 
ATOM   1808 O  O   . PHE A 1 264 ? -10.116 10.035  14.725  1.00 21.90 ? 472  PHE A O   1 
ATOM   1809 C  CB  . PHE A 1 264 ? -7.309  11.651  15.634  1.00 20.73 ? 472  PHE A CB  1 
ATOM   1810 C  CG  . PHE A 1 264 ? -7.169  11.696  14.122  1.00 22.01 ? 472  PHE A CG  1 
ATOM   1811 C  CD1 . PHE A 1 264 ? -8.041  12.469  13.353  1.00 20.63 ? 472  PHE A CD1 1 
ATOM   1812 C  CD2 . PHE A 1 264 ? -6.164  10.975  13.476  1.00 20.14 ? 472  PHE A CD2 1 
ATOM   1813 C  CE1 . PHE A 1 264 ? -7.906  12.531  11.957  1.00 22.06 ? 472  PHE A CE1 1 
ATOM   1814 C  CE2 . PHE A 1 264 ? -6.029  11.022  12.074  1.00 22.14 ? 472  PHE A CE2 1 
ATOM   1815 C  CZ  . PHE A 1 264 ? -6.897  11.800  11.321  1.00 22.09 ? 472  PHE A CZ  1 
ATOM   1816 N  N   . ASP A 1 265 ? -10.404 11.626  16.310  1.00 21.74 ? 473  ASP A N   1 
ATOM   1817 C  CA  . ASP A 1 265 ? -11.770 11.967  15.900  1.00 22.42 ? 473  ASP A CA  1 
ATOM   1818 C  C   . ASP A 1 265 ? -11.815 13.464  15.592  1.00 21.99 ? 473  ASP A C   1 
ATOM   1819 O  O   . ASP A 1 265 ? -11.111 14.257  16.224  1.00 21.95 ? 473  ASP A O   1 
ATOM   1820 C  CB  . ASP A 1 265 ? -12.790 11.637  16.997  1.00 23.18 ? 473  ASP A CB  1 
ATOM   1821 C  CG  . ASP A 1 265 ? -12.772 10.160  17.419  1.00 26.48 ? 473  ASP A CG  1 
ATOM   1822 O  OD1 . ASP A 1 265 ? -12.254 9.298   16.694  1.00 30.72 ? 473  ASP A OD1 1 
ATOM   1823 O  OD2 . ASP A 1 265 ? -13.275 9.853   18.512  1.00 33.50 ? 473  ASP A OD2 1 
ATOM   1824 N  N   . ILE A 1 266 ? -12.659 13.839  14.640  1.00 21.46 ? 474  ILE A N   1 
ATOM   1825 C  CA  . ILE A 1 266 ? -12.720 15.208  14.134  1.00 21.62 ? 474  ILE A CA  1 
ATOM   1826 C  C   . ILE A 1 266 ? -14.167 15.677  14.267  1.00 22.80 ? 474  ILE A C   1 
ATOM   1827 O  O   . ILE A 1 266 ? -15.089 14.979  13.822  1.00 22.76 ? 474  ILE A O   1 
ATOM   1828 C  CB  . ILE A 1 266 ? -12.285 15.264  12.640  1.00 21.74 ? 474  ILE A CB  1 
ATOM   1829 C  CG1 . ILE A 1 266 ? -10.827 14.783  12.447  1.00 20.78 ? 474  ILE A CG1 1 
ATOM   1830 C  CG2 . ILE A 1 266 ? -12.497 16.658  12.033  1.00 20.16 ? 474  ILE A CG2 1 
ATOM   1831 C  CD1 . ILE A 1 266 ? -9.764  15.654  13.137  1.00 22.00 ? 474  ILE A CD1 1 
ATOM   1832 N  N   . TYR A 1 267 ? -14.362 16.851  14.871  1.00 22.67 ? 475  TYR A N   1 
ATOM   1833 C  CA  . TYR A 1 267 ? -15.703 17.376  15.116  1.00 23.46 ? 475  TYR A CA  1 
ATOM   1834 C  C   . TYR A 1 267 ? -15.864 18.735  14.475  1.00 23.10 ? 475  TYR A C   1 
ATOM   1835 O  O   . TYR A 1 267 ? -14.943 19.553  14.514  1.00 23.34 ? 475  TYR A O   1 
ATOM   1836 C  CB  . TYR A 1 267 ? -15.964 17.529  16.618  1.00 23.65 ? 475  TYR A CB  1 
ATOM   1837 C  CG  . TYR A 1 267 ? -15.910 16.247  17.424  1.00 24.67 ? 475  TYR A CG  1 
ATOM   1838 C  CD1 . TYR A 1 267 ? -14.691 15.649  17.746  1.00 25.10 ? 475  TYR A CD1 1 
ATOM   1839 C  CD2 . TYR A 1 267 ? -17.081 15.659  17.904  1.00 26.21 ? 475  TYR A CD2 1 
ATOM   1840 C  CE1 . TYR A 1 267 ? -14.642 14.479  18.509  1.00 27.41 ? 475  TYR A CE1 1 
ATOM   1841 C  CE2 . TYR A 1 267 ? -17.047 14.494  18.665  1.00 27.87 ? 475  TYR A CE2 1 
ATOM   1842 C  CZ  . TYR A 1 267 ? -15.826 13.913  18.960  1.00 27.49 ? 475  TYR A CZ  1 
ATOM   1843 O  OH  . TYR A 1 267 ? -15.796 12.759  19.699  1.00 29.38 ? 475  TYR A OH  1 
ATOM   1844 N  N   . PHE A 1 268 ? -17.041 18.966  13.897  1.00 23.25 ? 476  PHE A N   1 
ATOM   1845 C  CA  . PHE A 1 268 ? -17.462 20.283  13.423  1.00 23.59 ? 476  PHE A CA  1 
ATOM   1846 C  C   . PHE A 1 268 ? -18.630 20.656  14.329  1.00 24.43 ? 476  PHE A C   1 
ATOM   1847 O  O   . PHE A 1 268 ? -19.724 20.072  14.203  1.00 24.73 ? 476  PHE A O   1 
ATOM   1848 C  CB  . PHE A 1 268 ? -17.925 20.215  11.961  1.00 22.70 ? 476  PHE A CB  1 
ATOM   1849 C  CG  . PHE A 1 268 ? -16.839 19.837  10.986  1.00 23.77 ? 476  PHE A CG  1 
ATOM   1850 C  CD1 . PHE A 1 268 ? -16.541 18.497  10.732  1.00 23.45 ? 476  PHE A CD1 1 
ATOM   1851 C  CD2 . PHE A 1 268 ? -16.127 20.818  10.308  1.00 22.72 ? 476  PHE A CD2 1 
ATOM   1852 C  CE1 . PHE A 1 268 ? -15.547 18.138  9.816   1.00 23.86 ? 476  PHE A CE1 1 
ATOM   1853 C  CE2 . PHE A 1 268 ? -15.139 20.478  9.386   1.00 23.56 ? 476  PHE A CE2 1 
ATOM   1854 C  CZ  . PHE A 1 268 ? -14.840 19.129  9.144   1.00 22.84 ? 476  PHE A CZ  1 
ATOM   1855 N  N   A GLU A 1 269 ? -18.409 21.604  15.236  0.50 24.63 ? 477  GLU A N   1 
ATOM   1856 N  N   B GLU A 1 269 ? -18.422 21.620  15.224  0.50 24.87 ? 477  GLU A N   1 
ATOM   1857 C  CA  A GLU A 1 269 ? -19.374 21.868  16.312  0.50 25.51 ? 477  GLU A CA  1 
ATOM   1858 C  CA  B GLU A 1 269 ? -19.375 21.834  16.323  0.50 26.00 ? 477  GLU A CA  1 
ATOM   1859 C  C   A GLU A 1 269 ? -19.869 23.312  16.386  0.50 25.57 ? 477  GLU A C   1 
ATOM   1860 C  C   B GLU A 1 269 ? -19.847 23.282  16.556  0.50 25.94 ? 477  GLU A C   1 
ATOM   1861 O  O   A GLU A 1 269 ? -21.079 23.560  16.355  0.50 25.73 ? 477  GLU A O   1 
ATOM   1862 O  O   B GLU A 1 269 ? -21.037 23.505  16.803  0.50 26.23 ? 477  GLU A O   1 
ATOM   1863 C  CB  A GLU A 1 269 ? -18.795 21.434  17.670  0.50 25.90 ? 477  GLU A CB  1 
ATOM   1864 C  CB  B GLU A 1 269 ? -18.825 21.222  17.624  0.50 26.58 ? 477  GLU A CB  1 
ATOM   1865 C  CG  A GLU A 1 269 ? -19.647 21.825  18.869  0.50 27.06 ? 477  GLU A CG  1 
ATOM   1866 C  CG  B GLU A 1 269 ? -19.818 20.332  18.372  0.50 28.80 ? 477  GLU A CG  1 
ATOM   1867 C  CD  A GLU A 1 269 ? -19.106 21.268  20.171  0.50 28.20 ? 477  GLU A CD  1 
ATOM   1868 C  CD  B GLU A 1 269 ? -19.701 18.852  18.016  0.50 30.67 ? 477  GLU A CD  1 
ATOM   1869 O  OE1 A GLU A 1 269 ? -18.866 20.047  20.241  0.50 27.74 ? 477  GLU A OE1 1 
ATOM   1870 O  OE1 B GLU A 1 269 ? -19.675 18.040  18.960  0.50 31.39 ? 477  GLU A OE1 1 
ATOM   1871 O  OE2 A GLU A 1 269 ? -18.920 22.052  21.125  0.50 30.11 ? 477  GLU A OE2 1 
ATOM   1872 O  OE2 B GLU A 1 269 ? -19.637 18.489  16.808  0.50 32.09 ? 477  GLU A OE2 1 
ATOM   1873 N  N   . LYS A 1 270 ? -18.935 24.257  16.485  1.00 25.52 ? 478  LYS A N   1 
ATOM   1874 C  CA  . LYS A 1 270 ? -19.280 25.658  16.807  1.00 25.89 ? 478  LYS A CA  1 
ATOM   1875 C  C   . LYS A 1 270 ? -20.361 26.218  15.880  1.00 25.22 ? 478  LYS A C   1 
ATOM   1876 O  O   . LYS A 1 270 ? -20.212 26.190  14.653  1.00 23.46 ? 478  LYS A O   1 
ATOM   1877 C  CB  . LYS A 1 270 ? -18.043 26.571  16.800  1.00 26.01 ? 478  LYS A CB  1 
ATOM   1878 C  CG  . LYS A 1 270 ? -18.329 28.014  17.258  1.00 28.20 ? 478  LYS A CG  1 
ATOM   1879 C  CD  . LYS A 1 270 ? -17.107 28.921  17.049  1.00 29.98 ? 478  LYS A CD  1 
ATOM   1880 C  CE  . LYS A 1 270 ? -17.420 30.383  17.359  1.00 31.71 ? 478  LYS A CE  1 
ATOM   1881 N  NZ  . LYS A 1 270 ? -16.189 31.201  17.162  1.00 33.29 ? 478  LYS A NZ  1 
ATOM   1882 N  N   . ASN A 1 271 ? -21.446 26.701  16.485  1.00 25.39 ? 479  ASN A N   1 
ATOM   1883 C  CA  . ASN A 1 271 ? -22.530 27.362  15.747  1.00 25.25 ? 479  ASN A CA  1 
ATOM   1884 C  C   . ASN A 1 271 ? -23.219 26.484  14.692  1.00 24.50 ? 479  ASN A C   1 
ATOM   1885 O  O   . ASN A 1 271 ? -23.890 26.999  13.793  1.00 24.03 ? 479  ASN A O   1 
ATOM   1886 C  CB  . ASN A 1 271 ? -22.013 28.653  15.085  1.00 25.14 ? 479  ASN A CB  1 
ATOM   1887 C  CG  . ASN A 1 271 ? -21.785 29.767  16.085  1.00 27.10 ? 479  ASN A CG  1 
ATOM   1888 O  OD1 . ASN A 1 271 ? -22.440 29.833  17.130  1.00 29.14 ? 479  ASN A OD1 1 
ATOM   1889 N  ND2 . ASN A 1 271 ? -20.861 30.659  15.766  1.00 27.22 ? 479  ASN A ND2 1 
ATOM   1890 N  N   . CYS A 1 272 ? -23.049 25.167  14.791  1.00 24.30 ? 480  CYS A N   1 
ATOM   1891 C  CA  . CYS A 1 272 ? -23.666 24.255  13.830  1.00 23.99 ? 480  CYS A CA  1 
ATOM   1892 C  C   . CYS A 1 272 ? -25.075 23.872  14.238  1.00 24.31 ? 480  CYS A C   1 
ATOM   1893 O  O   . CYS A 1 272 ? -25.315 23.506  15.390  1.00 24.71 ? 480  CYS A O   1 
ATOM   1894 C  CB  . CYS A 1 272 ? -22.846 22.972  13.690  1.00 24.09 ? 480  CYS A CB  1 
ATOM   1895 S  SG  . CYS A 1 272 ? -21.264 23.188  12.868  1.00 25.43 ? 480  CYS A SG  1 
ATOM   1896 N  N   . HIS A 1 273 ? -25.999 23.953  13.287  1.00 23.24 ? 481  HIS A N   1 
ATOM   1897 C  CA  . HIS A 1 273 ? -27.295 23.301  13.429  1.00 24.18 ? 481  HIS A CA  1 
ATOM   1898 C  C   . HIS A 1 273 ? -27.180 21.810  13.101  1.00 24.70 ? 481  HIS A C   1 
ATOM   1899 O  O   . HIS A 1 273 ? -27.857 20.980  13.700  1.00 26.23 ? 481  HIS A O   1 
ATOM   1900 C  CB  . HIS A 1 273 ? -28.340 23.988  12.552  1.00 23.40 ? 481  HIS A CB  1 
ATOM   1901 C  CG  . HIS A 1 273 ? -28.689 25.367  13.025  1.00 23.39 ? 481  HIS A CG  1 
ATOM   1902 N  ND1 . HIS A 1 273 ? -29.410 25.590  14.176  1.00 23.71 ? 481  HIS A ND1 1 
ATOM   1903 C  CD2 . HIS A 1 273 ? -28.389 26.590  12.524  1.00 21.95 ? 481  HIS A CD2 1 
ATOM   1904 C  CE1 . HIS A 1 273 ? -29.564 26.891  14.354  1.00 24.00 ? 481  HIS A CE1 1 
ATOM   1905 N  NE2 . HIS A 1 273 ? -28.944 27.521  13.371  1.00 23.99 ? 481  HIS A NE2 1 
ATOM   1906 N  N   . ASN A 1 274 ? -26.320 21.483  12.147  1.00 24.14 ? 482  ASN A N   1 
ATOM   1907 C  CA  . ASN A 1 274 ? -26.018 20.092  11.841  1.00 24.73 ? 482  ASN A CA  1 
ATOM   1908 C  C   . ASN A 1 274 ? -24.556 19.777  12.167  1.00 24.50 ? 482  ASN A C   1 
ATOM   1909 O  O   . ASN A 1 274 ? -23.651 20.043  11.367  1.00 23.31 ? 482  ASN A O   1 
ATOM   1910 C  CB  . ASN A 1 274 ? -26.362 19.785  10.380  1.00 24.42 ? 482  ASN A CB  1 
ATOM   1911 C  CG  . ASN A 1 274 ? -27.859 19.918  10.102  1.00 26.52 ? 482  ASN A CG  1 
ATOM   1912 O  OD1 . ASN A 1 274 ? -28.661 19.137  10.596  1.00 27.61 ? 482  ASN A OD1 1 
ATOM   1913 N  ND2 . ASN A 1 274 ? -28.230 20.911  9.316   1.00 27.49 ? 482  ASN A ND2 1 
ATOM   1914 N  N   . ARG A 1 275 ? -24.332 19.246  13.368  1.00 24.73 ? 483  ARG A N   1 
ATOM   1915 C  CA  . ARG A 1 275 ? -22.990 18.817  13.773  1.00 24.58 ? 483  ARG A CA  1 
ATOM   1916 C  C   . ARG A 1 275 ? -22.483 17.650  12.931  1.00 23.98 ? 483  ARG A C   1 
ATOM   1917 O  O   . ARG A 1 275 ? -23.249 16.788  12.508  1.00 24.32 ? 483  ARG A O   1 
ATOM   1918 C  CB  . ARG A 1 275 ? -22.971 18.434  15.240  1.00 25.65 ? 483  ARG A CB  1 
ATOM   1919 C  CG  . ARG A 1 275 ? -23.205 19.609  16.164  1.00 28.35 ? 483  ARG A CG  1 
ATOM   1920 C  CD  . ARG A 1 275 ? -23.274 19.129  17.585  1.00 34.57 ? 483  ARG A CD  1 
ATOM   1921 N  NE  . ARG A 1 275 ? -23.280 20.240  18.535  1.00 38.75 ? 483  ARG A NE  1 
ATOM   1922 C  CZ  . ARG A 1 275 ? -23.265 20.088  19.861  1.00 41.94 ? 483  ARG A CZ  1 
ATOM   1923 N  NH1 . ARG A 1 275 ? -23.250 18.870  20.405  1.00 41.88 ? 483  ARG A NH1 1 
ATOM   1924 N  NH2 . ARG A 1 275 ? -23.277 21.158  20.645  1.00 42.56 ? 483  ARG A NH2 1 
ATOM   1925 N  N   . VAL A 1 276 ? -21.185 17.631  12.677  1.00 22.51 ? 484  VAL A N   1 
ATOM   1926 C  CA  . VAL A 1 276 ? -20.606 16.556  11.902  1.00 22.07 ? 484  VAL A CA  1 
ATOM   1927 C  C   . VAL A 1 276 ? -19.412 16.019  12.685  1.00 21.97 ? 484  VAL A C   1 
ATOM   1928 O  O   . VAL A 1 276 ? -18.622 16.785  13.237  1.00 21.48 ? 484  VAL A O   1 
ATOM   1929 C  CB  . VAL A 1 276 ? -20.204 17.020  10.459  1.00 21.63 ? 484  VAL A CB  1 
ATOM   1930 C  CG1 . VAL A 1 276 ? -19.351 15.958  9.738   1.00 21.89 ? 484  VAL A CG1 1 
ATOM   1931 C  CG2 . VAL A 1 276 ? -21.449 17.372  9.624   1.00 20.58 ? 484  VAL A CG2 1 
ATOM   1932 N  N   A VAL A 1 277 ? -19.317 14.697  12.740  0.50 22.22 ? 485  VAL A N   1 
ATOM   1933 N  N   B VAL A 1 277 ? -19.293 14.700  12.755  0.50 22.11 ? 485  VAL A N   1 
ATOM   1934 C  CA  A VAL A 1 277 ? -18.206 14.016  13.374  0.50 22.58 ? 485  VAL A CA  1 
ATOM   1935 C  CA  B VAL A 1 277 ? -18.145 14.083  13.403  0.50 22.28 ? 485  VAL A CA  1 
ATOM   1936 C  C   A VAL A 1 277 ? -17.747 12.927  12.427  0.50 22.73 ? 485  VAL A C   1 
ATOM   1937 C  C   B VAL A 1 277 ? -17.754 12.835  12.636  0.50 22.67 ? 485  VAL A C   1 
ATOM   1938 O  O   A VAL A 1 277 ? -18.553 12.384  11.668  0.50 22.64 ? 485  VAL A O   1 
ATOM   1939 O  O   B VAL A 1 277 ? -18.626 12.082  12.195  0.50 22.75 ? 485  VAL A O   1 
ATOM   1940 C  CB  A VAL A 1 277 ? -18.652 13.340  14.687  0.50 23.14 ? 485  VAL A CB  1 
ATOM   1941 C  CB  B VAL A 1 277 ? -18.455 13.702  14.868  0.50 22.79 ? 485  VAL A CB  1 
ATOM   1942 C  CG1 A VAL A 1 277 ? -17.482 12.609  15.363  0.50 23.82 ? 485  VAL A CG1 1 
ATOM   1943 C  CG1 B VAL A 1 277 ? -19.693 12.806  14.944  0.50 22.52 ? 485  VAL A CG1 1 
ATOM   1944 C  CG2 A VAL A 1 277 ? -19.258 14.355  15.622  0.50 23.39 ? 485  VAL A CG2 1 
ATOM   1945 C  CG2 B VAL A 1 277 ? -17.247 13.014  15.514  0.50 23.16 ? 485  VAL A CG2 1 
ATOM   1946 N  N   . PHE A 1 278 ? -16.449 12.638  12.449  1.00 22.62 ? 486  PHE A N   1 
ATOM   1947 C  CA  . PHE A 1 278 ? -15.946 11.347  11.962  1.00 22.97 ? 486  PHE A CA  1 
ATOM   1948 C  C   . PHE A 1 278 ? -14.805 10.846  12.835  1.00 22.94 ? 486  PHE A C   1 
ATOM   1949 O  O   . PHE A 1 278 ? -14.079 11.633  13.466  1.00 22.20 ? 486  PHE A O   1 
ATOM   1950 C  CB  . PHE A 1 278 ? -15.596 11.348  10.464  1.00 22.56 ? 486  PHE A CB  1 
ATOM   1951 C  CG  . PHE A 1 278 ? -14.388 12.182  10.096  1.00 23.51 ? 486  PHE A CG  1 
ATOM   1952 C  CD1 . PHE A 1 278 ? -13.109 11.617  10.078  1.00 23.73 ? 486  PHE A CD1 1 
ATOM   1953 C  CD2 . PHE A 1 278 ? -14.534 13.507  9.712   1.00 23.24 ? 486  PHE A CD2 1 
ATOM   1954 C  CE1 . PHE A 1 278 ? -11.992 12.376  9.709   1.00 24.00 ? 486  PHE A CE1 1 
ATOM   1955 C  CE2 . PHE A 1 278 ? -13.422 14.281  9.337   1.00 23.91 ? 486  PHE A CE2 1 
ATOM   1956 C  CZ  . PHE A 1 278 ? -12.149 13.712  9.334   1.00 24.18 ? 486  PHE A CZ  1 
ATOM   1957 N  N   . SER A 1 279 ? -14.667 9.525   12.872  1.00 22.95 ? 487  SER A N   1 
ATOM   1958 C  CA  . SER A 1 279 ? -13.626 8.880   13.634  1.00 23.12 ? 487  SER A CA  1 
ATOM   1959 C  C   . SER A 1 279 ? -12.719 8.149   12.665  1.00 22.58 ? 487  SER A C   1 
ATOM   1960 O  O   . SER A 1 279 ? -13.170 7.674   11.615  1.00 22.82 ? 487  SER A O   1 
ATOM   1961 C  CB  . SER A 1 279 ? -14.242 7.886   14.624  1.00 23.53 ? 487  SER A CB  1 
ATOM   1962 O  OG  . SER A 1 279 ? -13.241 7.263   15.405  1.00 24.02 ? 487  SER A OG  1 
ATOM   1963 N  N   . THR A 1 280 ? -11.439 8.065   13.004  1.00 21.36 ? 488  THR A N   1 
ATOM   1964 C  CA  . THR A 1 280 ? -10.513 7.277   12.193  1.00 20.58 ? 488  THR A CA  1 
ATOM   1965 C  C   . THR A 1 280 ? -10.117 5.994   12.928  1.00 20.49 ? 488  THR A C   1 
ATOM   1966 O  O   . THR A 1 280 ? -9.151  5.336   12.553  1.00 19.55 ? 488  THR A O   1 
ATOM   1967 C  CB  . THR A 1 280 ? -9.263  8.067   11.793  1.00 20.24 ? 488  THR A CB  1 
ATOM   1968 O  OG1 . THR A 1 280 ? -8.572  8.494   12.975  1.00 21.48 ? 488  THR A OG1 1 
ATOM   1969 C  CG2 . THR A 1 280 ? -9.621  9.291   10.922  1.00 19.07 ? 488  THR A CG2 1 
ATOM   1970 N  N   . GLY A 1 281 ? -10.897 5.624   13.946  1.00 20.49 ? 489  GLY A N   1 
ATOM   1971 C  CA  . GLY A 1 281 ? -10.638 4.402   14.712  1.00 20.97 ? 489  GLY A CA  1 
ATOM   1972 C  C   . GLY A 1 281 ? -11.058 3.128   13.984  1.00 22.27 ? 489  GLY A C   1 
ATOM   1973 O  O   . GLY A 1 281 ? -11.758 3.185   12.965  1.00 21.58 ? 489  GLY A O   1 
ATOM   1974 N  N   . PRO A 1 282 ? -10.632 1.965   14.506  1.00 23.00 ? 490  PRO A N   1 
ATOM   1975 C  CA  . PRO A 1 282 ? -10.873 0.681   13.839  1.00 23.93 ? 490  PRO A CA  1 
ATOM   1976 C  C   . PRO A 1 282 ? -12.329 0.206   13.844  1.00 25.15 ? 490  PRO A C   1 
ATOM   1977 O  O   . PRO A 1 282 ? -12.661 -0.663  13.039  1.00 25.25 ? 490  PRO A O   1 
ATOM   1978 C  CB  . PRO A 1 282 ? -9.972  -0.311  14.598  1.00 24.11 ? 490  PRO A CB  1 
ATOM   1979 C  CG  . PRO A 1 282 ? -9.226  0.482   15.610  1.00 24.17 ? 490  PRO A CG  1 
ATOM   1980 C  CD  . PRO A 1 282 ? -9.904  1.806   15.777  1.00 23.30 ? 490  PRO A CD  1 
ATOM   1981 N  N   . GLN A 1 283 ? -13.179 0.751   14.725  1.00 26.20 ? 491  GLN A N   1 
ATOM   1982 C  CA  . GLN A 1 283 ? -14.623 0.431   14.711  1.00 28.17 ? 491  GLN A CA  1 
ATOM   1983 C  C   . GLN A 1 283 ? -15.391 1.227   13.661  1.00 28.18 ? 491  GLN A C   1 
ATOM   1984 O  O   . GLN A 1 283 ? -16.583 1.006   13.466  1.00 28.94 ? 491  GLN A O   1 
ATOM   1985 C  CB  . GLN A 1 283 ? -15.288 0.668   16.079  1.00 29.14 ? 491  GLN A CB  1 
ATOM   1986 C  CG  . GLN A 1 283 ? -14.527 0.119   17.272  1.00 33.02 ? 491  GLN A CG  1 
ATOM   1987 C  CD  . GLN A 1 283 ? -14.823 -1.331  17.565  1.00 39.21 ? 491  GLN A CD  1 
ATOM   1988 O  OE1 . GLN A 1 283 ? -15.105 -2.130  16.664  1.00 41.12 ? 491  GLN A OE1 1 
ATOM   1989 N  NE2 . GLN A 1 283 ? -14.759 -1.686  18.843  1.00 41.78 ? 491  GLN A NE2 1 
ATOM   1990 N  N   . SER A 1 284 ? -14.714 2.159   12.994  1.00 27.56 ? 492  SER A N   1 
ATOM   1991 C  CA  . SER A 1 284 ? -15.352 2.975   11.969  1.00 27.41 ? 492  SER A CA  1 
ATOM   1992 C  C   . SER A 1 284 ? -14.812 2.661   10.584  1.00 27.12 ? 492  SER A C   1 
ATOM   1993 O  O   . SER A 1 284 ? -13.699 2.134   10.434  1.00 25.91 ? 492  SER A O   1 
ATOM   1994 C  CB  . SER A 1 284 ? -15.161 4.465   12.268  1.00 27.53 ? 492  SER A CB  1 
ATOM   1995 O  OG  . SER A 1 284 ? -15.647 4.796   13.552  1.00 28.70 ? 492  SER A OG  1 
ATOM   1996 N  N   . THR A 1 285 ? -15.613 3.004   9.578   1.00 27.08 ? 493  THR A N   1 
ATOM   1997 C  CA  . THR A 1 285 ? -15.223 2.923   8.173   1.00 27.22 ? 493  THR A CA  1 
ATOM   1998 C  C   . THR A 1 285 ? -13.799 3.419   8.007   1.00 26.07 ? 493  THR A C   1 
ATOM   1999 O  O   . THR A 1 285 ? -13.434 4.477   8.524   1.00 25.54 ? 493  THR A O   1 
ATOM   2000 C  CB  . THR A 1 285 ? -16.165 3.781   7.282   1.00 27.26 ? 493  THR A CB  1 
ATOM   2001 O  OG1 . THR A 1 285 ? -17.517 3.394   7.523   1.00 29.11 ? 493  THR A OG1 1 
ATOM   2002 C  CG2 . THR A 1 285 ? -15.868 3.581   5.793   1.00 28.37 ? 493  THR A CG2 1 
ATOM   2003 N  N   . LYS A 1 286 ? -12.997 2.641   7.294   1.00 26.33 ? 494  LYS A N   1 
ATOM   2004 C  CA  . LYS A 1 286 ? -11.596 2.982   7.074   1.00 26.17 ? 494  LYS A CA  1 
ATOM   2005 C  C   . LYS A 1 286 ? -11.471 4.302   6.320   1.00 25.23 ? 494  LYS A C   1 
ATOM   2006 O  O   . LYS A 1 286 ? -12.318 4.632   5.484   1.00 25.60 ? 494  LYS A O   1 
ATOM   2007 C  CB  . LYS A 1 286 ? -10.869 1.863   6.319   1.00 27.12 ? 494  LYS A CB  1 
ATOM   2008 C  CG  . LYS A 1 286 ? -11.347 1.645   4.888   1.00 30.15 ? 494  LYS A CG  1 
ATOM   2009 C  CD  . LYS A 1 286 ? -10.633 0.458   4.262   1.00 35.56 ? 494  LYS A CD  1 
ATOM   2010 C  CE  . LYS A 1 286 ? -10.872 0.401   2.755   1.00 38.34 ? 494  LYS A CE  1 
ATOM   2011 N  NZ  . LYS A 1 286 ? -10.278 -0.857  2.211   1.00 41.40 ? 494  LYS A NZ  1 
ATOM   2012 N  N   . THR A 1 287 ? -10.422 5.053   6.650   1.00 24.06 ? 495  THR A N   1 
ATOM   2013 C  CA  . THR A 1 287 ? -10.068 6.289   5.953   1.00 23.58 ? 495  THR A CA  1 
ATOM   2014 C  C   . THR A 1 287 ? -8.617  6.148   5.496   1.00 23.83 ? 495  THR A C   1 
ATOM   2015 O  O   . THR A 1 287 ? -7.947  5.173   5.862   1.00 22.50 ? 495  THR A O   1 
ATOM   2016 C  CB  . THR A 1 287 ? -10.186 7.527   6.882   1.00 22.96 ? 495  THR A CB  1 
ATOM   2017 O  OG1 . THR A 1 287 ? -9.115  7.512   7.842   1.00 22.08 ? 495  THR A OG1 1 
ATOM   2018 C  CG2 . THR A 1 287 ? -11.525 7.532   7.622   1.00 21.41 ? 495  THR A CG2 1 
ATOM   2019 N  N   . HIS A 1 288 ? -8.115  7.115   4.730   1.00 24.27 ? 496  HIS A N   1 
ATOM   2020 C  CA  . HIS A 1 288 ? -6.702  7.067   4.321   1.00 25.06 ? 496  HIS A CA  1 
ATOM   2021 C  C   . HIS A 1 288 ? -5.732  7.232   5.512   1.00 24.24 ? 496  HIS A C   1 
ATOM   2022 O  O   . HIS A 1 288 ? -4.562  6.876   5.408   1.00 24.34 ? 496  HIS A O   1 
ATOM   2023 C  CB  . HIS A 1 288 ? -6.398  8.095   3.229   1.00 26.24 ? 496  HIS A CB  1 
ATOM   2024 C  CG  . HIS A 1 288 ? -6.204  9.479   3.754   1.00 26.97 ? 496  HIS A CG  1 
ATOM   2025 N  ND1 . HIS A 1 288 ? -7.258  10.313  4.052   1.00 28.02 ? 496  HIS A ND1 1 
ATOM   2026 C  CD2 . HIS A 1 288 ? -5.078  10.167  4.060   1.00 28.86 ? 496  HIS A CD2 1 
ATOM   2027 C  CE1 . HIS A 1 288 ? -6.791  11.466  4.499   1.00 29.31 ? 496  HIS A CE1 1 
ATOM   2028 N  NE2 . HIS A 1 288 ? -5.470  11.402  4.518   1.00 29.49 ? 496  HIS A NE2 1 
ATOM   2029 N  N   . TRP A 1 289 ? -6.212  7.755   6.641   1.00 22.94 ? 497  TRP A N   1 
ATOM   2030 C  CA  . TRP A 1 289 ? -5.368  7.853   7.847   1.00 22.51 ? 497  TRP A CA  1 
ATOM   2031 C  C   . TRP A 1 289 ? -5.208  6.498   8.546   1.00 22.17 ? 497  TRP A C   1 
ATOM   2032 O  O   . TRP A 1 289 ? -4.324  6.327   9.409   1.00 22.40 ? 497  TRP A O   1 
ATOM   2033 C  CB  . TRP A 1 289 ? -5.932  8.876   8.849   1.00 21.58 ? 497  TRP A CB  1 
ATOM   2034 C  CG  . TRP A 1 289 ? -5.850  10.286  8.385   1.00 21.48 ? 497  TRP A CG  1 
ATOM   2035 C  CD1 . TRP A 1 289 ? -4.729  11.054  8.290   1.00 22.59 ? 497  TRP A CD1 1 
ATOM   2036 C  CD2 . TRP A 1 289 ? -6.937  11.106  7.947   1.00 21.38 ? 497  TRP A CD2 1 
ATOM   2037 N  NE1 . TRP A 1 289 ? -5.045  12.304  7.813   1.00 22.68 ? 497  TRP A NE1 1 
ATOM   2038 C  CE2 . TRP A 1 289 ? -6.398  12.367  7.611   1.00 23.09 ? 497  TRP A CE2 1 
ATOM   2039 C  CE3 . TRP A 1 289 ? -8.321  10.904  7.825   1.00 21.45 ? 497  TRP A CE3 1 
ATOM   2040 C  CZ2 . TRP A 1 289 ? -7.190  13.416  7.135   1.00 22.11 ? 497  TRP A CZ2 1 
ATOM   2041 C  CZ3 . TRP A 1 289 ? -9.103  11.946  7.368   1.00 21.91 ? 497  TRP A CZ3 1 
ATOM   2042 C  CH2 . TRP A 1 289 ? -8.535  13.186  7.027   1.00 22.40 ? 497  TRP A CH2 1 
ATOM   2043 N  N   . LYS A 1 290 ? -6.061  5.539   8.186   1.00 21.69 ? 498  LYS A N   1 
ATOM   2044 C  CA  . LYS A 1 290 ? -6.022  4.201   8.799   1.00 21.81 ? 498  LYS A CA  1 
ATOM   2045 C  C   . LYS A 1 290 ? -5.951  4.317   10.338  1.00 20.90 ? 498  LYS A C   1 
ATOM   2046 O  O   . LYS A 1 290 ? -6.613  5.174   10.927  1.00 20.22 ? 498  LYS A O   1 
ATOM   2047 C  CB  . LYS A 1 290 ? -4.850  3.385   8.216   1.00 22.01 ? 498  LYS A CB  1 
ATOM   2048 C  CG  . LYS A 1 290 ? -4.808  3.425   6.670   1.00 23.40 ? 498  LYS A CG  1 
ATOM   2049 C  CD  . LYS A 1 290 ? -3.645  2.653   6.079   1.00 27.24 ? 498  LYS A CD  1 
ATOM   2050 C  CE  . LYS A 1 290 ? -3.799  2.608   4.572   1.00 30.53 ? 498  LYS A CE  1 
ATOM   2051 N  NZ  . LYS A 1 290 ? -2.521  2.404   3.866   1.00 35.64 ? 498  LYS A NZ  1 
ATOM   2052 N  N   . GLN A 1 291 ? -5.150  3.464   10.979  1.00 20.63 ? 499  GLN A N   1 
ATOM   2053 C  CA  . GLN A 1 291 ? -4.791  3.649   12.385  1.00 20.22 ? 499  GLN A CA  1 
ATOM   2054 C  C   . GLN A 1 291 ? -3.267  3.608   12.537  1.00 20.80 ? 499  GLN A C   1 
ATOM   2055 O  O   . GLN A 1 291 ? -2.559  3.133   11.641  1.00 21.01 ? 499  GLN A O   1 
ATOM   2056 C  CB  . GLN A 1 291 ? -5.435  2.581   13.265  1.00 19.62 ? 499  GLN A CB  1 
ATOM   2057 C  CG  . GLN A 1 291 ? -6.957  2.716   13.397  1.00 20.27 ? 499  GLN A CG  1 
ATOM   2058 C  CD  . GLN A 1 291 ? -7.715  1.939   12.347  1.00 20.54 ? 499  GLN A CD  1 
ATOM   2059 O  OE1 . GLN A 1 291 ? -7.462  0.750   12.144  1.00 22.05 ? 499  GLN A OE1 1 
ATOM   2060 N  NE2 . GLN A 1 291 ? -8.672  2.598   11.689  1.00 18.96 ? 499  GLN A NE2 1 
ATOM   2061 N  N   . THR A 1 292 ? -2.765  4.098   13.666  1.00 20.42 ? 500  THR A N   1 
ATOM   2062 C  CA  . THR A 1 292 ? -1.319  4.077   13.943  1.00 20.84 ? 500  THR A CA  1 
ATOM   2063 C  C   . THR A 1 292 ? -1.023  3.023   15.015  1.00 21.25 ? 500  THR A C   1 
ATOM   2064 O  O   . THR A 1 292 ? -1.700  2.975   16.043  1.00 21.65 ? 500  THR A O   1 
ATOM   2065 C  CB  . THR A 1 292 ? -0.832  5.478   14.379  1.00 20.66 ? 500  THR A CB  1 
ATOM   2066 O  OG1 . THR A 1 292 ? -1.114  6.418   13.328  1.00 21.17 ? 500  THR A OG1 1 
ATOM   2067 C  CG2 . THR A 1 292 ? 0.677   5.484   14.662  1.00 20.69 ? 500  THR A CG2 1 
ATOM   2068 N  N   . VAL A 1 293 ? -0.026  2.177   14.775  1.00 21.50 ? 501  VAL A N   1 
ATOM   2069 C  CA  . VAL A 1 293 ? 0.220   1.020   15.649  1.00 21.68 ? 501  VAL A CA  1 
ATOM   2070 C  C   . VAL A 1 293 ? 1.629   1.087   16.226  1.00 21.34 ? 501  VAL A C   1 
ATOM   2071 O  O   . VAL A 1 293 ? 2.607   1.258   15.483  1.00 21.56 ? 501  VAL A O   1 
ATOM   2072 C  CB  . VAL A 1 293 ? 0.026   -0.340  14.898  1.00 22.39 ? 501  VAL A CB  1 
ATOM   2073 C  CG1 . VAL A 1 293 ? -0.021  -1.514  15.895  1.00 23.35 ? 501  VAL A CG1 1 
ATOM   2074 C  CG2 . VAL A 1 293 ? -1.253  -0.325  14.055  1.00 23.29 ? 501  VAL A CG2 1 
ATOM   2075 N  N   . PHE A 1 294 ? 1.710   0.945   17.547  1.00 20.94 ? 502  PHE A N   1 
ATOM   2076 C  CA  . PHE A 1 294 ? 2.959   0.954   18.286  1.00 20.85 ? 502  PHE A CA  1 
ATOM   2077 C  C   . PHE A 1 294 ? 3.156   -0.448  18.845  1.00 21.36 ? 502  PHE A C   1 
ATOM   2078 O  O   . PHE A 1 294 ? 2.468   -0.852  19.788  1.00 20.33 ? 502  PHE A O   1 
ATOM   2079 C  CB  . PHE A 1 294 ? 2.898   1.985   19.433  1.00 20.82 ? 502  PHE A CB  1 
ATOM   2080 C  CG  . PHE A 1 294 ? 2.455   3.363   18.988  1.00 20.94 ? 502  PHE A CG  1 
ATOM   2081 C  CD1 . PHE A 1 294 ? 1.170   3.821   19.276  1.00 21.46 ? 502  PHE A CD1 1 
ATOM   2082 C  CD2 . PHE A 1 294 ? 3.320   4.191   18.270  1.00 21.84 ? 502  PHE A CD2 1 
ATOM   2083 C  CE1 . PHE A 1 294 ? 0.749   5.093   18.863  1.00 22.51 ? 502  PHE A CE1 1 
ATOM   2084 C  CE2 . PHE A 1 294 ? 2.913   5.466   17.853  1.00 21.25 ? 502  PHE A CE2 1 
ATOM   2085 C  CZ  . PHE A 1 294 ? 1.624   5.912   18.150  1.00 20.74 ? 502  PHE A CZ  1 
ATOM   2086 N  N   . LEU A 1 295 ? 4.079   -1.200  18.251  1.00 21.95 ? 503  LEU A N   1 
ATOM   2087 C  CA  . LEU A 1 295 ? 4.291   -2.584  18.663  1.00 23.17 ? 503  LEU A CA  1 
ATOM   2088 C  C   . LEU A 1 295 ? 5.014   -2.640  19.991  1.00 23.06 ? 503  LEU A C   1 
ATOM   2089 O  O   . LEU A 1 295 ? 5.937   -1.868  20.230  1.00 22.54 ? 503  LEU A O   1 
ATOM   2090 C  CB  . LEU A 1 295 ? 5.096   -3.344  17.613  1.00 24.16 ? 503  LEU A CB  1 
ATOM   2091 C  CG  . LEU A 1 295 ? 4.339   -3.844  16.377  1.00 27.36 ? 503  LEU A CG  1 
ATOM   2092 C  CD1 . LEU A 1 295 ? 4.007   -2.706  15.409  1.00 28.10 ? 503  LEU A CD1 1 
ATOM   2093 C  CD2 . LEU A 1 295 ? 5.200   -4.871  15.671  1.00 29.94 ? 503  LEU A CD2 1 
ATOM   2094 N  N   . LEU A 1 296 ? 4.586   -3.561  20.850  1.00 22.90 ? 504  LEU A N   1 
ATOM   2095 C  CA  . LEU A 1 296 ? 5.269   -3.815  22.106  1.00 23.57 ? 504  LEU A CA  1 
ATOM   2096 C  C   . LEU A 1 296 ? 6.376   -4.840  21.896  1.00 23.81 ? 504  LEU A C   1 
ATOM   2097 O  O   . LEU A 1 296 ? 6.145   -5.896  21.314  1.00 23.89 ? 504  LEU A O   1 
ATOM   2098 C  CB  . LEU A 1 296 ? 4.277   -4.308  23.178  1.00 23.28 ? 504  LEU A CB  1 
ATOM   2099 C  CG  . LEU A 1 296 ? 3.149   -3.323  23.516  1.00 24.20 ? 504  LEU A CG  1 
ATOM   2100 C  CD1 . LEU A 1 296 ? 2.241   -3.937  24.569  1.00 24.77 ? 504  LEU A CD1 1 
ATOM   2101 C  CD2 . LEU A 1 296 ? 3.716   -1.975  24.003  1.00 22.99 ? 504  LEU A CD2 1 
ATOM   2102 N  N   . GLU A 1 297 ? 7.573   -4.523  22.372  1.00 24.40 ? 505  GLU A N   1 
ATOM   2103 C  CA  . GLU A 1 297 ? 8.677   -5.470  22.334  1.00 25.86 ? 505  GLU A CA  1 
ATOM   2104 C  C   . GLU A 1 297 ? 8.387   -6.724  23.165  1.00 26.25 ? 505  GLU A C   1 
ATOM   2105 O  O   . GLU A 1 297 ? 8.686   -7.841  22.739  1.00 26.85 ? 505  GLU A O   1 
ATOM   2106 C  CB  . GLU A 1 297 ? 9.960   -4.810  22.807  1.00 25.89 ? 505  GLU A CB  1 
ATOM   2107 C  CG  . GLU A 1 297 ? 11.180  -5.662  22.542  1.00 29.81 ? 505  GLU A CG  1 
ATOM   2108 C  CD  . GLU A 1 297 ? 12.480  -4.944  22.830  1.00 34.29 ? 505  GLU A CD  1 
ATOM   2109 O  OE1 . GLU A 1 297 ? 12.469  -3.709  23.032  1.00 35.49 ? 505  GLU A OE1 1 
ATOM   2110 O  OE2 . GLU A 1 297 ? 13.527  -5.623  22.840  1.00 38.04 ? 505  GLU A OE2 1 
ATOM   2111 N  N   . LYS A 1 298 ? 7.784   -6.540  24.335  1.00 26.35 ? 506  LYS A N   1 
ATOM   2112 C  CA  . LYS A 1 298 ? 7.434   -7.677  25.176  1.00 27.18 ? 506  LYS A CA  1 
ATOM   2113 C  C   . LYS A 1 298 ? 5.922   -7.699  25.446  1.00 26.10 ? 506  LYS A C   1 
ATOM   2114 O  O   . LYS A 1 298 ? 5.452   -7.027  26.370  1.00 25.83 ? 506  LYS A O   1 
ATOM   2115 C  CB  . LYS A 1 298 ? 8.237   -7.646  26.484  1.00 28.34 ? 506  LYS A CB  1 
ATOM   2116 C  CG  . LYS A 1 298 ? 8.004   -8.881  27.394  1.00 32.23 ? 506  LYS A CG  1 
ATOM   2117 C  CD  . LYS A 1 298 ? 8.825   -8.834  28.714  1.00 37.70 ? 506  LYS A CD  1 
ATOM   2118 C  CE  . LYS A 1 298 ? 8.514   -7.571  29.529  1.00 39.82 ? 506  LYS A CE  1 
ATOM   2119 N  NZ  . LYS A 1 298 ? 8.658   -7.772  31.009  1.00 42.52 ? 506  LYS A NZ  1 
ATOM   2120 N  N   . PRO A 1 299 ? 5.155   -8.454  24.621  1.00 25.19 ? 507  PRO A N   1 
ATOM   2121 C  CA  . PRO A 1 299 ? 3.727   -8.621  24.865  1.00 24.61 ? 507  PRO A CA  1 
ATOM   2122 C  C   . PRO A 1 299 ? 3.489   -9.147  26.279  1.00 24.80 ? 507  PRO A C   1 
ATOM   2123 O  O   . PRO A 1 299 ? 4.345   -9.837  26.832  1.00 24.16 ? 507  PRO A O   1 
ATOM   2124 C  CB  . PRO A 1 299 ? 3.315   -9.666  23.820  1.00 24.62 ? 507  PRO A CB  1 
ATOM   2125 C  CG  . PRO A 1 299 ? 4.288   -9.437  22.692  1.00 25.13 ? 507  PRO A CG  1 
ATOM   2126 C  CD  . PRO A 1 299 ? 5.587   -9.225  23.437  1.00 25.19 ? 507  PRO A CD  1 
ATOM   2127 N  N   . PHE A 1 300 ? 2.356   -8.793  26.874  1.00 24.47 ? 508  PHE A N   1 
ATOM   2128 C  CA  . PHE A 1 300 ? 2.093   -9.193  28.258  1.00 25.69 ? 508  PHE A CA  1 
ATOM   2129 C  C   . PHE A 1 300 ? 0.616   -9.479  28.430  1.00 25.91 ? 508  PHE A C   1 
ATOM   2130 O  O   . PHE A 1 300 ? -0.240  -8.881  27.771  1.00 24.66 ? 508  PHE A O   1 
ATOM   2131 C  CB  . PHE A 1 300 ? 2.571   -8.125  29.255  1.00 25.48 ? 508  PHE A CB  1 
ATOM   2132 C  CG  . PHE A 1 300 ? 1.860   -6.803  29.112  1.00 25.66 ? 508  PHE A CG  1 
ATOM   2133 C  CD1 . PHE A 1 300 ? 0.766   -6.497  29.924  1.00 24.89 ? 508  PHE A CD1 1 
ATOM   2134 C  CD2 . PHE A 1 300 ? 2.269   -5.874  28.156  1.00 25.39 ? 508  PHE A CD2 1 
ATOM   2135 C  CE1 . PHE A 1 300 ? 0.086   -5.278  29.785  1.00 27.09 ? 508  PHE A CE1 1 
ATOM   2136 C  CE2 . PHE A 1 300 ? 1.590   -4.640  28.005  1.00 25.77 ? 508  PHE A CE2 1 
ATOM   2137 C  CZ  . PHE A 1 300 ? 0.493   -4.351  28.824  1.00 24.31 ? 508  PHE A CZ  1 
ATOM   2138 N  N   . SER A 1 301 ? 0.312   -10.410 29.315  1.00 26.64 ? 509  SER A N   1 
ATOM   2139 C  CA  . SER A 1 301 ? -1.067  -10.834 29.452  1.00 27.69 ? 509  SER A CA  1 
ATOM   2140 C  C   . SER A 1 301 ? -1.876  -9.818  30.259  1.00 27.46 ? 509  SER A C   1 
ATOM   2141 O  O   . SER A 1 301 ? -1.358  -9.164  31.174  1.00 27.17 ? 509  SER A O   1 
ATOM   2142 C  CB  . SER A 1 301 ? -1.138  -12.241 30.042  1.00 28.87 ? 509  SER A CB  1 
ATOM   2143 O  OG  . SER A 1 301 ? -0.851  -12.194 31.417  1.00 31.53 ? 509  SER A OG  1 
ATOM   2144 N  N   . VAL A 1 302 ? -3.129  -9.654  29.855  1.00 27.42 ? 510  VAL A N   1 
ATOM   2145 C  CA  . VAL A 1 302 ? -4.083  -8.783  30.535  1.00 28.12 ? 510  VAL A CA  1 
ATOM   2146 C  C   . VAL A 1 302 ? -5.372  -9.564  30.750  1.00 29.41 ? 510  VAL A C   1 
ATOM   2147 O  O   . VAL A 1 302 ? -5.609  -10.577 30.084  1.00 29.44 ? 510  VAL A O   1 
ATOM   2148 C  CB  . VAL A 1 302 ? -4.384  -7.483  29.723  1.00 27.37 ? 510  VAL A CB  1 
ATOM   2149 C  CG1 . VAL A 1 302 ? -3.159  -6.587  29.653  1.00 26.17 ? 510  VAL A CG1 1 
ATOM   2150 C  CG2 . VAL A 1 302 ? -4.907  -7.806  28.313  1.00 26.31 ? 510  VAL A CG2 1 
ATOM   2151 N  N   . LYS A 1 303 ? -6.202  -9.089  31.676  1.00 30.85 ? 511  LYS A N   1 
ATOM   2152 C  CA  . LYS A 1 303 ? -7.469  -9.735  31.995  1.00 32.36 ? 511  LYS A CA  1 
ATOM   2153 C  C   . LYS A 1 303 ? -8.627  -8.759  31.836  1.00 32.45 ? 511  LYS A C   1 
ATOM   2154 O  O   . LYS A 1 303 ? -8.495  -7.582  32.184  1.00 31.93 ? 511  LYS A O   1 
ATOM   2155 C  CB  . LYS A 1 303 ? -7.435  -10.268 33.432  1.00 33.55 ? 511  LYS A CB  1 
ATOM   2156 C  CG  . LYS A 1 303 ? -6.452  -11.445 33.639  1.00 35.72 ? 511  LYS A CG  1 
ATOM   2157 C  CD  . LYS A 1 303 ? -6.720  -12.158 34.972  1.00 39.15 ? 511  LYS A CD  1 
ATOM   2158 C  CE  . LYS A 1 303 ? -5.700  -13.254 35.271  1.00 40.09 ? 511  LYS A CE  1 
ATOM   2159 N  NZ  . LYS A 1 303 ? -5.826  -13.768 36.693  1.00 38.78 ? 511  LYS A NZ  1 
ATOM   2160 N  N   . ALA A 1 304 ? -9.754  -9.241  31.306  1.00 33.32 ? 512  ALA A N   1 
ATOM   2161 C  CA  . ALA A 1 304 ? -10.978 -8.432  31.216  1.00 34.47 ? 512  ALA A CA  1 
ATOM   2162 C  C   . ALA A 1 304 ? -11.308 -7.813  32.578  1.00 35.62 ? 512  ALA A C   1 
ATOM   2163 O  O   . ALA A 1 304 ? -11.186 -8.474  33.608  1.00 36.10 ? 512  ALA A O   1 
ATOM   2164 C  CB  . ALA A 1 304 ? -12.158 -9.269  30.705  1.00 34.86 ? 512  ALA A CB  1 
ATOM   2165 N  N   . GLY A 1 305 ? -11.697 -6.539  32.572  1.00 35.89 ? 513  GLY A N   1 
ATOM   2166 C  CA  . GLY A 1 305 ? -11.977 -5.815  33.807  1.00 36.82 ? 513  GLY A CA  1 
ATOM   2167 C  C   . GLY A 1 305 ? -10.781 -5.067  34.372  1.00 36.90 ? 513  GLY A C   1 
ATOM   2168 O  O   . GLY A 1 305 ? -10.950 -4.144  35.160  1.00 37.05 ? 513  GLY A O   1 
ATOM   2169 N  N   . GLU A 1 306 ? -9.568  -5.461  33.980  1.00 36.64 ? 514  GLU A N   1 
ATOM   2170 C  CA  . GLU A 1 306 ? -8.357  -4.772  34.421  1.00 36.68 ? 514  GLU A CA  1 
ATOM   2171 C  C   . GLU A 1 306 ? -8.318  -3.312  33.948  1.00 36.10 ? 514  GLU A C   1 
ATOM   2172 O  O   . GLU A 1 306 ? -8.690  -3.002  32.810  1.00 35.61 ? 514  GLU A O   1 
ATOM   2173 C  CB  . GLU A 1 306 ? -7.127  -5.518  33.902  1.00 36.86 ? 514  GLU A CB  1 
ATOM   2174 C  CG  . GLU A 1 306 ? -5.778  -4.945  34.315  1.00 37.73 ? 514  GLU A CG  1 
ATOM   2175 C  CD  . GLU A 1 306 ? -4.607  -5.696  33.689  1.00 39.06 ? 514  GLU A CD  1 
ATOM   2176 O  OE1 . GLU A 1 306 ? -4.738  -6.911  33.382  1.00 39.15 ? 514  GLU A OE1 1 
ATOM   2177 O  OE2 . GLU A 1 306 ? -3.549  -5.063  33.512  1.00 40.15 ? 514  GLU A OE2 1 
ATOM   2178 N  N   . ALA A 1 307 ? -7.882  -2.425  34.838  1.00 35.89 ? 515  ALA A N   1 
ATOM   2179 C  CA  . ALA A 1 307 ? -7.610  -1.036  34.493  1.00 35.16 ? 515  ALA A CA  1 
ATOM   2180 C  C   . ALA A 1 307 ? -6.108  -0.903  34.242  1.00 34.53 ? 515  ALA A C   1 
ATOM   2181 O  O   . ALA A 1 307 ? -5.319  -0.818  35.183  1.00 35.49 ? 515  ALA A O   1 
ATOM   2182 C  CB  . ALA A 1 307 ? -8.063  -0.101  35.621  1.00 35.50 ? 515  ALA A CB  1 
ATOM   2183 N  N   . LEU A 1 308 ? -5.709  -0.924  32.972  1.00 32.92 ? 516  LEU A N   1 
ATOM   2184 C  CA  . LEU A 1 308 ? -4.291  -0.880  32.614  1.00 31.87 ? 516  LEU A CA  1 
ATOM   2185 C  C   . LEU A 1 308 ? -3.800  0.558   32.473  1.00 31.14 ? 516  LEU A C   1 
ATOM   2186 O  O   . LEU A 1 308 ? -4.296  1.305   31.636  1.00 31.29 ? 516  LEU A O   1 
ATOM   2187 C  CB  . LEU A 1 308 ? -4.060  -1.660  31.317  1.00 31.53 ? 516  LEU A CB  1 
ATOM   2188 C  CG  . LEU A 1 308 ? -2.656  -1.704  30.721  1.00 30.40 ? 516  LEU A CG  1 
ATOM   2189 C  CD1 . LEU A 1 308 ? -1.716  -2.536  31.585  1.00 30.05 ? 516  LEU A CD1 1 
ATOM   2190 C  CD2 . LEU A 1 308 ? -2.722  -2.240  29.283  1.00 28.68 ? 516  LEU A CD2 1 
ATOM   2191 N  N   . LYS A 1 309 ? -2.829  0.934   33.295  1.00 30.68 ? 517  LYS A N   1 
ATOM   2192 C  CA  . LYS A 1 309 ? -2.338  2.304   33.342  1.00 30.81 ? 517  LYS A CA  1 
ATOM   2193 C  C   . LYS A 1 309 ? -1.027  2.476   32.580  1.00 29.10 ? 517  LYS A C   1 
ATOM   2194 O  O   . LYS A 1 309 ? -0.145  1.624   32.628  1.00 28.86 ? 517  LYS A O   1 
ATOM   2195 C  CB  . LYS A 1 309 ? -2.160  2.775   34.792  1.00 32.03 ? 517  LYS A CB  1 
ATOM   2196 C  CG  . LYS A 1 309 ? -3.453  2.751   35.617  1.00 35.31 ? 517  LYS A CG  1 
ATOM   2197 C  CD  . LYS A 1 309 ? -3.313  3.524   36.920  1.00 40.96 ? 517  LYS A CD  1 
ATOM   2198 C  CE  . LYS A 1 309 ? -4.647  3.566   37.665  1.00 44.83 ? 517  LYS A CE  1 
ATOM   2199 N  NZ  . LYS A 1 309 ? -5.694  4.332   36.900  1.00 45.66 ? 517  LYS A NZ  1 
ATOM   2200 N  N   . GLY A 1 310 ? -0.902  3.600   31.891  1.00 27.42 ? 518  GLY A N   1 
ATOM   2201 C  CA  . GLY A 1 310 ? 0.332   3.907   31.188  1.00 25.90 ? 518  GLY A CA  1 
ATOM   2202 C  C   . GLY A 1 310 ? 0.484   5.397   31.037  1.00 25.03 ? 518  GLY A C   1 
ATOM   2203 O  O   . GLY A 1 310 ? -0.347  6.169   31.510  1.00 24.96 ? 518  GLY A O   1 
ATOM   2204 N  N   . LYS A 1 311 ? 1.557   5.804   30.382  1.00 24.11 ? 519  LYS A N   1 
ATOM   2205 C  CA  . LYS A 1 311 ? 1.768   7.204   30.098  1.00 23.58 ? 519  LYS A CA  1 
ATOM   2206 C  C   . LYS A 1 311 ? 2.271   7.360   28.675  1.00 22.66 ? 519  LYS A C   1 
ATOM   2207 O  O   . LYS A 1 311 ? 3.015   6.515   28.172  1.00 21.40 ? 519  LYS A O   1 
ATOM   2208 C  CB  . LYS A 1 311 ? 2.740   7.815   31.100  1.00 24.49 ? 519  LYS A CB  1 
ATOM   2209 C  CG  . LYS A 1 311 ? 2.751   9.330   31.078  1.00 26.01 ? 519  LYS A CG  1 
ATOM   2210 C  CD  . LYS A 1 311 ? 3.495   9.900   32.269  1.00 28.26 ? 519  LYS A CD  1 
ATOM   2211 C  CE  . LYS A 1 311 ? 3.563   11.414  32.140  1.00 29.05 ? 519  LYS A CE  1 
ATOM   2212 N  NZ  . LYS A 1 311 ? 4.313   12.030  33.259  1.00 29.49 ? 519  LYS A NZ  1 
ATOM   2213 N  N   . VAL A 1 312 ? 1.838   8.441   28.040  1.00 21.15 ? 520  VAL A N   1 
ATOM   2214 C  CA  . VAL A 1 312 ? 2.217   8.744   26.672  1.00 21.22 ? 520  VAL A CA  1 
ATOM   2215 C  C   . VAL A 1 312 ? 2.635   10.203  26.586  1.00 22.06 ? 520  VAL A C   1 
ATOM   2216 O  O   . VAL A 1 312 ? 1.985   11.084  27.153  1.00 22.37 ? 520  VAL A O   1 
ATOM   2217 C  CB  . VAL A 1 312 ? 1.045   8.464   25.687  1.00 20.96 ? 520  VAL A CB  1 
ATOM   2218 C  CG1 . VAL A 1 312 ? -0.177  9.352   26.011  1.00 20.73 ? 520  VAL A CG1 1 
ATOM   2219 C  CG2 . VAL A 1 312 ? 1.492   8.667   24.243  1.00 21.20 ? 520  VAL A CG2 1 
ATOM   2220 N  N   . THR A 1 313 ? 3.712   10.456  25.853  1.00 22.89 ? 521  THR A N   1 
ATOM   2221 C  CA  . THR A 1 313 ? 4.162   11.809  25.572  1.00 24.01 ? 521  THR A CA  1 
ATOM   2222 C  C   . THR A 1 313 ? 4.486   11.963  24.086  1.00 24.70 ? 521  THR A C   1 
ATOM   2223 O  O   . THR A 1 313 ? 5.097   11.082  23.475  1.00 23.70 ? 521  THR A O   1 
ATOM   2224 C  CB  . THR A 1 313 ? 5.399   12.151  26.418  1.00 24.58 ? 521  THR A CB  1 
ATOM   2225 O  OG1 . THR A 1 313 ? 5.040   12.096  27.801  1.00 25.35 ? 521  THR A OG1 1 
ATOM   2226 C  CG2 . THR A 1 313 ? 5.904   13.548  26.107  1.00 25.98 ? 521  THR A CG2 1 
ATOM   2227 N  N   . VAL A 1 314 ? 4.067   13.090  23.517  1.00 26.03 ? 522  VAL A N   1 
ATOM   2228 C  CA  . VAL A 1 314 ? 4.313   13.402  22.125  1.00 27.74 ? 522  VAL A CA  1 
ATOM   2229 C  C   . VAL A 1 314 ? 5.257   14.604  22.054  1.00 30.10 ? 522  VAL A C   1 
ATOM   2230 O  O   . VAL A 1 314 ? 4.966   15.662  22.619  1.00 30.38 ? 522  VAL A O   1 
ATOM   2231 C  CB  . VAL A 1 314 ? 2.980   13.656  21.388  1.00 27.65 ? 522  VAL A CB  1 
ATOM   2232 C  CG1 . VAL A 1 314 ? 3.219   14.179  19.970  1.00 29.44 ? 522  VAL A CG1 1 
ATOM   2233 C  CG2 . VAL A 1 314 ? 2.129   12.361  21.380  1.00 26.87 ? 522  VAL A CG2 1 
ATOM   2234 N  N   . HIS A 1 315 ? 6.395   14.421  21.383  1.00 32.11 ? 523  HIS A N   1 
ATOM   2235 C  CA  . HIS A 1 315 ? 7.422   15.465  21.240  1.00 35.51 ? 523  HIS A CA  1 
ATOM   2236 C  C   . HIS A 1 315 ? 7.684   15.796  19.780  1.00 36.97 ? 523  HIS A C   1 
ATOM   2237 O  O   . HIS A 1 315 ? 7.618   14.912  18.928  1.00 36.53 ? 523  HIS A O   1 
ATOM   2238 C  CB  . HIS A 1 315 ? 8.761   14.994  21.809  1.00 36.18 ? 523  HIS A CB  1 
ATOM   2239 C  CG  . HIS A 1 315 ? 8.804   14.877  23.298  1.00 38.44 ? 523  HIS A CG  1 
ATOM   2240 N  ND1 . HIS A 1 315 ? 9.087   13.687  23.939  1.00 40.55 ? 523  HIS A ND1 1 
ATOM   2241 C  CD2 . HIS A 1 315 ? 8.656   15.807  24.274  1.00 41.30 ? 523  HIS A CD2 1 
ATOM   2242 C  CE1 . HIS A 1 315 ? 9.094   13.885  25.246  1.00 41.35 ? 523  HIS A CE1 1 
ATOM   2243 N  NE2 . HIS A 1 315 ? 8.830   15.162  25.476  1.00 41.57 ? 523  HIS A NE2 1 
ATOM   2244 N  N   . LYS A 1 316 ? 8.040   17.059  19.516  1.00 39.62 ? 524  LYS A N   1 
ATOM   2245 C  CA  . LYS A 1 316 ? 8.485   17.524  18.190  1.00 41.71 ? 524  LYS A CA  1 
ATOM   2246 C  C   . LYS A 1 316 ? 9.792   16.861  17.741  1.00 42.67 ? 524  LYS A C   1 
ATOM   2247 O  O   . LYS A 1 316 ? 10.855  17.052  18.345  1.00 44.10 ? 524  LYS A O   1 
ATOM   2248 C  CB  . LYS A 1 316 ? 8.642   19.055  18.166  1.00 43.26 ? 524  LYS A CB  1 
ATOM   2249 N  N   . SER A 1 323 ? 9.673   16.099  12.606  1.00 48.40 ? 531  SER A N   1 
ATOM   2250 C  CA  . SER A 1 323 ? 9.160   14.753  12.845  1.00 46.77 ? 531  SER A CA  1 
ATOM   2251 C  C   . SER A 1 323 ? 8.824   14.531  14.324  1.00 45.32 ? 531  SER A C   1 
ATOM   2252 O  O   . SER A 1 323 ? 9.639   14.816  15.216  1.00 46.06 ? 531  SER A O   1 
ATOM   2253 C  CB  . SER A 1 323 ? 10.163  13.701  12.358  1.00 46.83 ? 531  SER A CB  1 
ATOM   2254 N  N   . LEU A 1 324 ? 7.623   14.020  14.574  1.00 43.59 ? 532  LEU A N   1 
ATOM   2255 C  CA  . LEU A 1 324 ? 7.162   13.714  15.929  1.00 41.25 ? 532  LEU A CA  1 
ATOM   2256 C  C   . LEU A 1 324 ? 7.633   12.354  16.438  1.00 38.90 ? 532  LEU A C   1 
ATOM   2257 O  O   . LEU A 1 324 ? 7.798   11.409  15.668  1.00 39.45 ? 532  LEU A O   1 
ATOM   2258 C  CB  . LEU A 1 324 ? 5.635   13.715  15.994  1.00 41.32 ? 532  LEU A CB  1 
ATOM   2259 C  CG  . LEU A 1 324 ? 4.793   14.980  16.021  1.00 42.57 ? 532  LEU A CG  1 
ATOM   2260 C  CD1 . LEU A 1 324 ? 3.393   14.499  16.230  1.00 44.20 ? 532  LEU A CD1 1 
ATOM   2261 C  CD2 . LEU A 1 324 ? 5.176   15.961  17.130  1.00 45.20 ? 532  LEU A CD2 1 
ATOM   2262 N  N   . THR A 1 325 ? 7.831   12.268  17.747  1.00 35.93 ? 533  THR A N   1 
ATOM   2263 C  CA  . THR A 1 325 ? 8.083   10.995  18.402  1.00 32.61 ? 533  THR A CA  1 
ATOM   2264 C  C   . THR A 1 325 ? 7.040   10.802  19.498  1.00 30.16 ? 533  THR A C   1 
ATOM   2265 O  O   . THR A 1 325 ? 6.495   11.773  20.039  1.00 29.61 ? 533  THR A O   1 
ATOM   2266 C  CB  . THR A 1 325 ? 9.518   10.898  18.984  1.00 32.93 ? 533  THR A CB  1 
ATOM   2267 O  OG1 . THR A 1 325 ? 9.698   11.906  19.979  1.00 33.23 ? 533  THR A OG1 1 
ATOM   2268 C  CG2 . THR A 1 325 ? 10.576  11.079  17.896  1.00 33.65 ? 533  THR A CG2 1 
ATOM   2269 N  N   . VAL A 1 326 ? 6.763   9.543   19.812  1.00 27.52 ? 534  VAL A N   1 
ATOM   2270 C  CA  . VAL A 1 326 ? 5.742   9.177   20.783  1.00 25.43 ? 534  VAL A CA  1 
ATOM   2271 C  C   . VAL A 1 326 ? 6.421   8.261   21.786  1.00 24.61 ? 534  VAL A C   1 
ATOM   2272 O  O   . VAL A 1 326 ? 6.952   7.224   21.404  1.00 24.76 ? 534  VAL A O   1 
ATOM   2273 C  CB  . VAL A 1 326 ? 4.596   8.389   20.113  1.00 25.20 ? 534  VAL A CB  1 
ATOM   2274 C  CG1 . VAL A 1 326 ? 3.567   7.915   21.151  1.00 24.55 ? 534  VAL A CG1 1 
ATOM   2275 C  CG2 . VAL A 1 326 ? 3.920   9.215   19.028  1.00 25.68 ? 534  VAL A CG2 1 
ATOM   2276 N  N   . THR A 1 327 ? 6.417   8.645   23.054  1.00 23.39 ? 535  THR A N   1 
ATOM   2277 C  CA  . THR A 1 327 ? 7.035   7.839   24.107  1.00 22.75 ? 535  THR A CA  1 
ATOM   2278 C  C   . THR A 1 327 ? 5.926   7.178   24.902  1.00 22.61 ? 535  THR A C   1 
ATOM   2279 O  O   . THR A 1 327 ? 5.009   7.862   25.366  1.00 22.19 ? 535  THR A O   1 
ATOM   2280 C  CB  . THR A 1 327 ? 7.948   8.706   24.993  1.00 23.22 ? 535  THR A CB  1 
ATOM   2281 O  OG1 . THR A 1 327 ? 9.017   9.190   24.184  1.00 23.38 ? 535  THR A OG1 1 
ATOM   2282 C  CG2 . THR A 1 327 ? 8.543   7.903   26.174  1.00 23.12 ? 535  THR A CG2 1 
ATOM   2283 N  N   . LEU A 1 328 ? 5.985   5.847   25.008  1.00 22.38 ? 536  LEU A N   1 
ATOM   2284 C  CA  . LEU A 1 328 ? 4.977   5.074   25.734  1.00 23.28 ? 536  LEU A CA  1 
ATOM   2285 C  C   . LEU A 1 328 ? 5.587   4.350   26.908  1.00 23.37 ? 536  LEU A C   1 
ATOM   2286 O  O   . LEU A 1 328 ? 6.594   3.656   26.761  1.00 22.63 ? 536  LEU A O   1 
ATOM   2287 C  CB  . LEU A 1 328 ? 4.321   4.027   24.832  1.00 23.99 ? 536  LEU A CB  1 
ATOM   2288 C  CG  . LEU A 1 328 ? 3.152   4.433   23.943  1.00 26.95 ? 536  LEU A CG  1 
ATOM   2289 C  CD1 . LEU A 1 328 ? 2.796   3.293   22.965  1.00 29.69 ? 536  LEU A CD1 1 
ATOM   2290 C  CD2 . LEU A 1 328 ? 1.936   4.782   24.791  1.00 29.02 ? 536  LEU A CD2 1 
ATOM   2291 N  N   . THR A 1 329 ? 4.969   4.503   28.072  1.00 23.42 ? 537  THR A N   1 
ATOM   2292 C  CA  . THR A 1 329 ? 5.286   3.642   29.206  1.00 23.60 ? 537  THR A CA  1 
ATOM   2293 C  C   . THR A 1 329 ? 4.085   2.774   29.538  1.00 23.73 ? 537  THR A C   1 
ATOM   2294 O  O   . THR A 1 329 ? 2.970   3.276   29.716  1.00 23.35 ? 537  THR A O   1 
ATOM   2295 C  CB  . THR A 1 329 ? 5.691   4.438   30.448  1.00 23.98 ? 537  THR A CB  1 
ATOM   2296 O  OG1 . THR A 1 329 ? 6.857   5.211   30.149  1.00 25.17 ? 537  THR A OG1 1 
ATOM   2297 C  CG2 . THR A 1 329 ? 5.989   3.496   31.625  1.00 24.44 ? 537  THR A CG2 1 
ATOM   2298 N  N   . LEU A 1 330 ? 4.328   1.470   29.629  1.00 23.38 ? 538  LEU A N   1 
ATOM   2299 C  CA  . LEU A 1 330 ? 3.272   0.500   29.889  1.00 23.84 ? 538  LEU A CA  1 
ATOM   2300 C  C   . LEU A 1 330 ? 3.907   -0.780  30.414  1.00 24.49 ? 538  LEU A C   1 
ATOM   2301 O  O   . LEU A 1 330 ? 4.960   -1.198  29.908  1.00 24.17 ? 538  LEU A O   1 
ATOM   2302 C  CB  . LEU A 1 330 ? 2.528   0.208   28.589  1.00 23.48 ? 538  LEU A CB  1 
ATOM   2303 C  CG  . LEU A 1 330 ? 1.214   -0.546  28.677  1.00 25.44 ? 538  LEU A CG  1 
ATOM   2304 C  CD1 . LEU A 1 330 ? 0.152   0.337   29.335  1.00 24.76 ? 538  LEU A CD1 1 
ATOM   2305 C  CD2 . LEU A 1 330 ? 0.793   -0.998  27.274  1.00 25.11 ? 538  LEU A CD2 1 
ATOM   2306 N  N   . ASN A 1 331 ? 3.278   -1.408  31.412  1.00 25.37 ? 539  ASN A N   1 
ATOM   2307 C  CA  . ASN A 1 331 ? 3.820   -2.636  32.020  1.00 26.25 ? 539  ASN A CA  1 
ATOM   2308 C  C   . ASN A 1 331 ? 5.310   -2.520  32.398  1.00 26.67 ? 539  ASN A C   1 
ATOM   2309 O  O   . ASN A 1 331 ? 6.086   -3.472  32.229  1.00 26.03 ? 539  ASN A O   1 
ATOM   2310 C  CB  . ASN A 1 331 ? 3.591   -3.844  31.089  1.00 26.30 ? 539  ASN A CB  1 
ATOM   2311 C  CG  . ASN A 1 331 ? 3.772   -5.191  31.799  1.00 27.83 ? 539  ASN A CG  1 
ATOM   2312 O  OD1 . ASN A 1 331 ? 3.262   -5.395  32.896  1.00 30.19 ? 539  ASN A OD1 1 
ATOM   2313 N  ND2 . ASN A 1 331 ? 4.488   -6.112  31.159  1.00 26.73 ? 539  ASN A ND2 1 
ATOM   2314 N  N   . ASN A 1 332 ? 5.694   -1.349  32.910  1.00 27.25 ? 540  ASN A N   1 
ATOM   2315 C  CA  . ASN A 1 332 ? 7.063   -1.081  33.376  1.00 28.92 ? 540  ASN A CA  1 
ATOM   2316 C  C   . ASN A 1 332 ? 8.138   -1.134  32.297  1.00 28.71 ? 540  ASN A C   1 
ATOM   2317 O  O   . ASN A 1 332 ? 9.312   -1.372  32.609  1.00 29.73 ? 540  ASN A O   1 
ATOM   2318 C  CB  . ASN A 1 332 ? 7.456   -2.017  34.531  1.00 30.30 ? 540  ASN A CB  1 
ATOM   2319 C  CG  . ASN A 1 332 ? 6.663   -1.758  35.776  1.00 33.37 ? 540  ASN A CG  1 
ATOM   2320 O  OD1 . ASN A 1 332 ? 6.569   -0.618  36.240  1.00 36.04 ? 540  ASN A OD1 1 
ATOM   2321 N  ND2 . ASN A 1 332 ? 6.084   -2.813  36.336  1.00 36.55 ? 540  ASN A ND2 1 
ATOM   2322 N  N   . SER A 1 333 ? 7.733   -0.925  31.045  1.00 27.88 ? 541  SER A N   1 
ATOM   2323 C  CA  . SER A 1 333 ? 8.666   -0.748  29.933  1.00 27.43 ? 541  SER A CA  1 
ATOM   2324 C  C   . SER A 1 333 ? 8.365   0.569   29.256  1.00 25.29 ? 541  SER A C   1 
ATOM   2325 O  O   . SER A 1 333 ? 7.205   0.942   29.117  1.00 24.51 ? 541  SER A O   1 
ATOM   2326 C  CB  . SER A 1 333 ? 8.502   -1.858  28.898  1.00 27.92 ? 541  SER A CB  1 
ATOM   2327 O  OG  . SER A 1 333 ? 9.090   -3.049  29.371  1.00 32.79 ? 541  SER A OG  1 
ATOM   2328 N  N   . THR A 1 334 ? 9.411   1.250   28.804  1.00 23.96 ? 542  THR A N   1 
ATOM   2329 C  CA  . THR A 1 334 ? 9.256   2.486   28.058  1.00 23.24 ? 542  THR A CA  1 
ATOM   2330 C  C   . THR A 1 334 ? 9.901   2.342   26.681  1.00 23.36 ? 542  THR A C   1 
ATOM   2331 O  O   . THR A 1 334 ? 10.997  1.794   26.548  1.00 23.23 ? 542  THR A O   1 
ATOM   2332 C  CB  . THR A 1 334 ? 9.901   3.668   28.814  1.00 23.32 ? 542  THR A CB  1 
ATOM   2333 O  OG1 . THR A 1 334 ? 9.252   3.827   30.079  1.00 21.92 ? 542  THR A OG1 1 
ATOM   2334 C  CG2 . THR A 1 334 ? 9.798   4.971   28.008  1.00 22.59 ? 542  THR A CG2 1 
ATOM   2335 N  N   . GLN A 1 335 ? 9.207   2.832   25.662  1.00 22.84 ? 543  GLN A N   1 
ATOM   2336 C  CA  . GLN A 1 335 ? 9.743   2.835   24.312  1.00 22.60 ? 543  GLN A CA  1 
ATOM   2337 C  C   . GLN A 1 335 ? 9.307   4.096   23.593  1.00 22.38 ? 543  GLN A C   1 
ATOM   2338 O  O   . GLN A 1 335 ? 8.170   4.527   23.738  1.00 21.73 ? 543  GLN A O   1 
ATOM   2339 C  CB  . GLN A 1 335 ? 9.300   1.574   23.553  1.00 22.49 ? 543  GLN A CB  1 
ATOM   2340 C  CG  . GLN A 1 335 ? 9.744   1.539   22.079  1.00 21.54 ? 543  GLN A CG  1 
ATOM   2341 C  CD  . GLN A 1 335 ? 11.236  1.346   21.921  1.00 22.40 ? 543  GLN A CD  1 
ATOM   2342 O  OE1 . GLN A 1 335 ? 11.816  0.427   22.507  1.00 20.89 ? 543  GLN A OE1 1 
ATOM   2343 N  NE2 . GLN A 1 335 ? 11.868  2.200   21.107  1.00 20.21 ? 543  GLN A NE2 1 
ATOM   2344 N  N   . THR A 1 336 ? 10.233  4.693   22.842  1.00 22.85 ? 544  THR A N   1 
ATOM   2345 C  CA  . THR A 1 336 ? 9.935   5.829   21.978  1.00 24.09 ? 544  THR A CA  1 
ATOM   2346 C  C   . THR A 1 336 ? 9.803   5.384   20.528  1.00 24.34 ? 544  THR A C   1 
ATOM   2347 O  O   . THR A 1 336 ? 10.650  4.667   20.011  1.00 24.97 ? 544  THR A O   1 
ATOM   2348 C  CB  . THR A 1 336 ? 11.029  6.920   22.100  1.00 24.67 ? 544  THR A CB  1 
ATOM   2349 O  OG1 . THR A 1 336 ? 11.057  7.395   23.454  1.00 25.07 ? 544  THR A OG1 1 
ATOM   2350 C  CG2 . THR A 1 336 ? 10.767  8.095   21.150  1.00 25.89 ? 544  THR A CG2 1 
ATOM   2351 N  N   . TYR A 1 337 ? 8.742   5.838   19.878  1.00 24.59 ? 545  TYR A N   1 
ATOM   2352 C  CA  . TYR A 1 337 ? 8.410   5.428   18.527  1.00 25.13 ? 545  TYR A CA  1 
ATOM   2353 C  C   . TYR A 1 337 ? 8.403   6.634   17.592  1.00 26.51 ? 545  TYR A C   1 
ATOM   2354 O  O   . TYR A 1 337 ? 8.111   7.753   18.016  1.00 26.16 ? 545  TYR A O   1 
ATOM   2355 C  CB  . TYR A 1 337 ? 7.011   4.818   18.502  1.00 24.16 ? 545  TYR A CB  1 
ATOM   2356 C  CG  . TYR A 1 337 ? 6.814   3.610   19.387  1.00 22.35 ? 545  TYR A CG  1 
ATOM   2357 C  CD1 . TYR A 1 337 ? 6.447   3.748   20.737  1.00 21.51 ? 545  TYR A CD1 1 
ATOM   2358 C  CD2 . TYR A 1 337 ? 6.965   2.328   18.874  1.00 21.35 ? 545  TYR A CD2 1 
ATOM   2359 C  CE1 . TYR A 1 337 ? 6.250   2.628   21.543  1.00 19.85 ? 545  TYR A CE1 1 
ATOM   2360 C  CE2 . TYR A 1 337 ? 6.767   1.212   19.669  1.00 20.28 ? 545  TYR A CE2 1 
ATOM   2361 C  CZ  . TYR A 1 337 ? 6.415   1.368   20.992  1.00 22.11 ? 545  TYR A CZ  1 
ATOM   2362 O  OH  . TYR A 1 337 ? 6.241   0.249   21.758  1.00 22.79 ? 545  TYR A OH  1 
ATOM   2363 N  N   . GLY A 1 338 ? 8.691   6.399   16.318  1.00 27.81 ? 546  GLY A N   1 
ATOM   2364 C  CA  . GLY A 1 338 ? 8.555   7.449   15.307  1.00 30.46 ? 546  GLY A CA  1 
ATOM   2365 C  C   . GLY A 1 338 ? 7.815   6.965   14.085  1.00 31.94 ? 546  GLY A C   1 
ATOM   2366 O  O   . GLY A 1 338 ? 7.659   5.765   13.888  1.00 31.22 ? 546  GLY A O   1 
ATOM   2367 N  N   . LEU A 1 339 ? 7.353   7.891   13.249  1.00 34.28 ? 547  LEU A N   1 
ATOM   2368 C  CA  . LEU A 1 339 ? 6.753   7.472   11.982  1.00 36.41 ? 547  LEU A CA  1 
ATOM   2369 C  C   . LEU A 1 339 ? 7.661   7.661   10.757  1.00 38.03 ? 547  LEU A C   1 
ATOM   2370 O  O   . LEU A 1 339 ? 8.087   8.778   10.446  1.00 39.56 ? 547  LEU A O   1 
ATOM   2371 C  CB  . LEU A 1 339 ? 5.369   8.097   11.777  1.00 36.95 ? 547  LEU A CB  1 
ATOM   2372 C  CG  . LEU A 1 339 ? 4.540   7.438   10.659  1.00 39.16 ? 547  LEU A CG  1 
ATOM   2373 C  CD1 . LEU A 1 339 ? 4.437   5.919   10.836  1.00 40.10 ? 547  LEU A CD1 1 
ATOM   2374 C  CD2 . LEU A 1 339 ? 3.157   8.045   10.596  1.00 40.86 ? 547  LEU A CD2 1 
HETATM 2375 O  OAA . TDU B 2 .   ? 3.098   -4.580  12.023  1.00 28.99 ? 1    TDU A OAA 1 
HETATM 2376 C  CAB . TDU B 2 .   ? 5.063   -6.208  6.911   1.00 37.83 ? 1    TDU A CAB 1 
HETATM 2377 C  CAC . TDU B 2 .   ? -0.835  -4.829  13.566  1.00 30.71 ? 1    TDU A CAC 1 
HETATM 2378 C  CAD . TDU B 2 .   ? -1.272  -5.201  14.835  1.00 32.21 ? 1    TDU A CAD 1 
HETATM 2379 C  CAE . TDU B 2 .   ? 1.385   -5.582  14.096  1.00 30.29 ? 1    TDU A CAE 1 
HETATM 2380 C  CAF . TDU B 2 .   ? 6.264   -6.489  6.260   1.00 38.14 ? 1    TDU A CAF 1 
HETATM 2381 C  CAG . TDU B 2 .   ? 7.363   -5.444  6.567   1.00 37.30 ? 1    TDU A CAG 1 
HETATM 2382 C  CAH . TDU B 2 .   ? 6.870   -3.994  6.703   1.00 37.20 ? 1    TDU A CAH 1 
HETATM 2383 C  CAI . TDU B 2 .   ? 3.278   -3.924  9.375   1.00 31.01 ? 1    TDU A CAI 1 
HETATM 2384 C  CAJ . TDU B 2 .   ? 5.746   -3.883  7.747   1.00 36.73 ? 1    TDU A CAJ 1 
HETATM 2385 C  CAK . TDU B 2 .   ? 3.346   -4.948  8.240   1.00 33.61 ? 1    TDU A CAK 1 
HETATM 2386 N  NAL . TDU B 2 .   ? 0.325   -6.667  17.651  1.00 33.70 ? 1    TDU A NAL 1 
HETATM 2387 N  NAM . TDU B 2 .   ? -0.626  -6.184  17.010  1.00 34.83 ? 1    TDU A NAM 1 
HETATM 2388 N  NAN . TDU B 2 .   ? 2.029   -4.170  10.111  1.00 28.93 ? 1    TDU A NAN 1 
HETATM 2389 N  NAO . TDU B 2 .   ? 0.827   -4.647  11.950  1.00 29.81 ? 1    TDU A NAO 1 
HETATM 2390 S  SAP . TDU B 2 .   ? 1.663   -6.631  16.710  1.00 33.31 ? 1    TDU A SAP 1 
HETATM 2391 C  CAQ . TDU B 2 .   ? 4.738   -5.038  7.611   1.00 35.90 ? 1    TDU A CAQ 1 
HETATM 2392 C  CAR . TDU B 2 .   ? 2.039   -4.489  11.399  1.00 30.55 ? 1    TDU A CAR 1 
HETATM 2393 C  CAS . TDU B 2 .   ? 0.496   -5.008  13.192  1.00 29.92 ? 1    TDU A CAS 1 
HETATM 2394 C  CAT . TDU B 2 .   ? -0.390  -5.768  15.744  1.00 31.77 ? 1    TDU A CAT 1 
HETATM 2395 C  CAU . TDU B 2 .   ? 0.935   -5.942  15.361  1.00 31.10 ? 1    TDU A CAU 1 
HETATM 2396 CL CL  . CL  C 3 .   ? -4.208  -13.792 23.425  1.00 58.39 ? 1000 CL  A CL  1 
HETATM 2397 X  UNK . UNX D 4 .   ? -14.355 -9.250  23.490  1.00 67.67 ? 549  UNX A UNK 1 
HETATM 2398 X  UNK . UNX E 4 .   ? -7.277  18.113  -2.945  1.00 63.99 ? 2    UNX A UNK 1 
HETATM 2399 X  UNK . UNX F 4 .   ? 2.198   40.354  4.023   1.00 30.00 ? 3    UNX A UNK 1 
HETATM 2400 X  UNK . UNX G 4 .   ? -16.343 17.356  22.326  1.00 30.00 ? 4    UNX A UNK 1 
HETATM 2401 X  UNK . UNX H 4 .   ? -0.017  24.178  1.291   1.00 30.00 ? 5    UNX A UNK 1 
HETATM 2402 X  UNK . UNX I 4 .   ? -15.938 -0.886  9.832   1.00 47.82 ? 7    UNX A UNK 1 
HETATM 2403 X  UNK . UNX J 4 .   ? -7.712  5.821   -3.766  1.00 30.00 ? 8    UNX A UNK 1 
HETATM 2404 X  UNK . UNX K 4 .   ? -10.853 41.919  13.572  1.00 30.00 ? 9    UNX A UNK 1 
HETATM 2405 X  UNK . UNX L 4 .   ? 18.692  -20.642 13.954  1.00 30.00 ? 11   UNX A UNK 1 
HETATM 2406 X  UNK . UNX M 4 .   ? -25.455 23.628  -1.775  1.00 30.00 ? 12   UNX A UNK 1 
HETATM 2407 O  O   . HOH N 5 .   ? 0.557   18.694  -3.365  1.00 47.68 ? 6    HOH A O   1 
HETATM 2408 O  O   . HOH N 5 .   ? 5.914   -5.270  28.206  1.00 40.12 ? 10   HOH A O   1 
HETATM 2409 O  O   . HOH N 5 .   ? 5.696   31.174  0.262   1.00 45.06 ? 13   HOH A O   1 
HETATM 2410 O  O   . HOH N 5 .   ? -13.877 6.132   1.091   1.00 31.93 ? 14   HOH A O   1 
HETATM 2411 O  O   A HOH N 5 .   ? -16.568 37.252  11.742  0.50 24.79 ? 15   HOH A O   1 
HETATM 2412 O  O   B HOH N 5 .   ? -18.168 36.445  11.459  0.50 26.40 ? 15   HOH A O   1 
HETATM 2413 O  O   . HOH N 5 .   ? -3.869  -12.370 19.864  1.00 29.51 ? 16   HOH A O   1 
HETATM 2414 O  O   . HOH N 5 .   ? -28.268 27.013  8.173   1.00 30.61 ? 17   HOH A O   1 
HETATM 2415 O  O   . HOH N 5 .   ? -7.564  22.456  3.081   1.00 27.97 ? 19   HOH A O   1 
HETATM 2416 O  O   . HOH N 5 .   ? -6.103  17.258  26.318  1.00 29.39 ? 20   HOH A O   1 
HETATM 2417 O  O   . HOH N 5 .   ? -2.692  13.174  32.239  1.00 38.30 ? 21   HOH A O   1 
HETATM 2418 O  O   . HOH N 5 .   ? -19.319 32.218  10.339  1.00 31.86 ? 22   HOH A O   1 
HETATM 2419 O  O   . HOH N 5 .   ? 7.146   -15.667 12.658  1.00 42.52 ? 23   HOH A O   1 
HETATM 2420 O  O   . HOH N 5 .   ? -25.727 30.689  2.271   1.00 38.12 ? 24   HOH A O   1 
HETATM 2421 O  O   . HOH N 5 .   ? -4.278  -13.138 29.824  1.00 36.39 ? 25   HOH A O   1 
HETATM 2422 O  O   . HOH N 5 .   ? -13.210 6.732   3.687   1.00 28.22 ? 26   HOH A O   1 
HETATM 2423 O  O   . HOH N 5 .   ? -30.857 20.654  11.216  1.00 35.00 ? 27   HOH A O   1 
HETATM 2424 O  O   . HOH N 5 .   ? -2.647  -14.217 27.740  1.00 38.89 ? 28   HOH A O   1 
HETATM 2425 O  O   . HOH N 5 .   ? -4.505  -6.424  14.713  1.00 25.56 ? 29   HOH A O   1 
HETATM 2426 O  O   . HOH N 5 .   ? 9.514   1.984   32.003  1.00 36.59 ? 30   HOH A O   1 
HETATM 2427 O  O   . HOH N 5 .   ? -18.095 4.265   10.735  1.00 31.27 ? 31   HOH A O   1 
HETATM 2428 O  O   . HOH N 5 .   ? -3.570  -13.434 16.054  1.00 44.36 ? 32   HOH A O   1 
HETATM 2429 O  O   . HOH N 5 .   ? 8.423   11.407  22.596  1.00 37.00 ? 33   HOH A O   1 
HETATM 2430 O  O   . HOH N 5 .   ? -25.417 16.355  11.036  1.00 43.17 ? 34   HOH A O   1 
HETATM 2431 O  O   . HOH N 5 .   ? -13.674 3.425   3.511   1.00 39.12 ? 35   HOH A O   1 
HETATM 2432 O  O   . HOH N 5 .   ? -17.175 8.114   12.297  1.00 33.38 ? 36   HOH A O   1 
HETATM 2433 O  O   . HOH N 5 .   ? -8.729  30.519  -11.449 1.00 33.06 ? 37   HOH A O   1 
HETATM 2434 O  O   . HOH N 5 .   ? -21.876 26.767  19.213  1.00 30.55 ? 38   HOH A O   1 
HETATM 2435 O  O   . HOH N 5 .   ? -3.595  7.465   11.913  1.00 27.65 ? 39   HOH A O   1 
HETATM 2436 O  O   . HOH N 5 .   ? 13.054  4.283   23.562  1.00 25.82 ? 40   HOH A O   1 
HETATM 2437 O  O   . HOH N 5 .   ? -7.772  2.981   4.325   1.00 39.18 ? 41   HOH A O   1 
HETATM 2438 O  O   . HOH N 5 .   ? -11.742 8.367   27.143  1.00 38.59 ? 42   HOH A O   1 
HETATM 2439 O  O   . HOH N 5 .   ? 0.811   -9.346  32.868  1.00 34.36 ? 43   HOH A O   1 
HETATM 2440 O  O   . HOH N 5 .   ? 2.240   -15.501 12.800  1.00 44.69 ? 44   HOH A O   1 
HETATM 2441 O  O   . HOH N 5 .   ? 10.303  -4.505  26.956  1.00 47.94 ? 45   HOH A O   1 
HETATM 2442 O  O   . HOH N 5 .   ? 5.682   -11.866 25.901  1.00 35.38 ? 46   HOH A O   1 
HETATM 2443 O  O   . HOH N 5 .   ? 14.782  2.184   20.555  1.00 27.96 ? 47   HOH A O   1 
HETATM 2444 O  O   . HOH N 5 .   ? -12.002 8.059   22.605  1.00 35.87 ? 48   HOH A O   1 
HETATM 2445 O  O   . HOH N 5 .   ? 14.463  1.986   13.972  1.00 32.01 ? 49   HOH A O   1 
HETATM 2446 O  O   . HOH N 5 .   ? -1.782  6.218   34.066  1.00 42.88 ? 50   HOH A O   1 
HETATM 2447 O  O   . HOH N 5 .   ? -1.146  39.339  4.122   1.00 36.57 ? 51   HOH A O   1 
HETATM 2448 O  O   . HOH N 5 .   ? -7.129  -10.781 18.990  1.00 33.39 ? 52   HOH A O   1 
HETATM 2449 O  O   . HOH N 5 .   ? -15.466 25.015  19.166  1.00 32.45 ? 53   HOH A O   1 
HETATM 2450 O  O   . HOH N 5 .   ? 5.681   -14.729 18.799  1.00 40.31 ? 54   HOH A O   1 
HETATM 2451 O  O   . HOH N 5 .   ? -5.815  7.990   33.500  1.00 47.93 ? 55   HOH A O   1 
HETATM 2452 O  O   . HOH N 5 .   ? -2.599  18.040  26.658  1.00 31.38 ? 56   HOH A O   1 
HETATM 2453 O  O   . HOH N 5 .   ? -3.316  -8.917  34.529  1.00 48.84 ? 57   HOH A O   1 
HETATM 2454 O  O   . HOH N 5 .   ? -6.911  33.108  -8.424  1.00 39.47 ? 58   HOH A O   1 
HETATM 2455 O  O   . HOH N 5 .   ? -20.744 13.249  7.047   1.00 62.77 ? 59   HOH A O   1 
HETATM 2456 O  O   . HOH N 5 .   ? -19.326 29.998  13.111  1.00 29.55 ? 60   HOH A O   1 
HETATM 2457 O  O   . HOH N 5 .   ? -3.670  15.557  27.174  1.00 43.03 ? 61   HOH A O   1 
HETATM 2458 O  O   . HOH N 5 .   ? -4.886  20.815  24.060  1.00 40.38 ? 62   HOH A O   1 
HETATM 2459 O  O   . HOH N 5 .   ? -14.413 4.819   15.968  1.00 32.08 ? 63   HOH A O   1 
HETATM 2460 O  O   . HOH N 5 .   ? -12.172 -12.268 28.117  1.00 33.28 ? 64   HOH A O   1 
HETATM 2461 O  O   . HOH N 5 .   ? 8.323   10.555  13.157  1.00 39.16 ? 65   HOH A O   1 
HETATM 2462 O  O   . HOH N 5 .   ? 11.716  -16.995 12.848  1.00 43.97 ? 66   HOH A O   1 
HETATM 2463 O  O   . HOH N 5 .   ? -7.938  7.859   31.553  1.00 57.63 ? 67   HOH A O   1 
HETATM 2464 O  O   . HOH N 5 .   ? -2.424  12.339  35.851  1.00 54.73 ? 68   HOH A O   1 
HETATM 2465 O  O   . HOH N 5 .   ? -14.869 30.026  19.402  1.00 52.44 ? 69   HOH A O   1 
HETATM 2466 O  O   . HOH N 5 .   ? 3.418   1.887   7.998   1.00 33.83 ? 70   HOH A O   1 
HETATM 2467 O  O   . HOH N 5 .   ? 9.932   30.128  1.592   1.00 69.70 ? 71   HOH A O   1 
HETATM 2468 O  O   . HOH N 5 .   ? 8.842   -12.712 19.896  1.00 39.49 ? 72   HOH A O   1 
HETATM 2469 O  O   . HOH N 5 .   ? 7.493   -4.088  25.788  1.00 36.40 ? 73   HOH A O   1 
HETATM 2470 O  O   . HOH N 5 .   ? 1.211   35.793  5.546   1.00 34.29 ? 74   HOH A O   1 
HETATM 2471 O  O   . HOH N 5 .   ? -28.457 24.389  9.131   1.00 32.14 ? 76   HOH A O   1 
HETATM 2472 O  O   . HOH N 5 .   ? 3.269   -13.780 19.273  1.00 51.16 ? 77   HOH A O   1 
HETATM 2473 O  O   . HOH N 5 .   ? 15.308  -0.445  19.761  1.00 33.33 ? 78   HOH A O   1 
HETATM 2474 O  O   . HOH N 5 .   ? -17.382 39.641  6.145   1.00 51.42 ? 80   HOH A O   1 
HETATM 2475 O  O   . HOH N 5 .   ? 17.002  -7.839  19.305  1.00 33.55 ? 81   HOH A O   1 
HETATM 2476 O  O   . HOH N 5 .   ? 15.748  -11.782 20.465  1.00 39.12 ? 82   HOH A O   1 
HETATM 2477 O  O   . HOH N 5 .   ? -9.486  13.097  24.467  1.00 35.18 ? 83   HOH A O   1 
HETATM 2478 O  O   . HOH N 5 .   ? 5.499   -8.841  31.555  1.00 45.56 ? 84   HOH A O   1 
HETATM 2479 O  O   . HOH N 5 .   ? -8.612  20.707  1.055   1.00 35.06 ? 85   HOH A O   1 
HETATM 2480 O  O   . HOH N 5 .   ? -3.110  27.394  -13.888 1.00 36.33 ? 86   HOH A O   1 
HETATM 2481 O  O   . HOH N 5 .   ? -21.596 13.196  11.627  1.00 30.73 ? 87   HOH A O   1 
HETATM 2482 O  O   . HOH N 5 .   ? -9.977  25.807  -16.850 1.00 32.43 ? 88   HOH A O   1 
HETATM 2483 O  O   . HOH N 5 .   ? 2.465   23.302  8.073   1.00 52.66 ? 89   HOH A O   1 
HETATM 2484 O  O   . HOH N 5 .   ? 0.356   18.083  28.491  1.00 42.19 ? 90   HOH A O   1 
HETATM 2485 O  O   . HOH N 5 .   ? 11.011  -8.832  21.288  1.00 41.68 ? 91   HOH A O   1 
HETATM 2486 O  O   . HOH N 5 .   ? -15.600 -7.729  28.605  1.00 46.01 ? 92   HOH A O   1 
HETATM 2487 O  O   . HOH N 5 .   ? 5.059   -12.955 23.597  1.00 43.78 ? 93   HOH A O   1 
HETATM 2488 O  O   . HOH N 5 .   ? -14.321 -10.559 18.626  1.00 52.46 ? 94   HOH A O   1 
HETATM 2489 O  O   . HOH N 5 .   ? -7.046  -3.510  37.294  1.00 49.47 ? 95   HOH A O   1 
HETATM 2490 O  O   . HOH N 5 .   ? -1.523  -0.610  5.241   1.00 53.43 ? 97   HOH A O   1 
HETATM 2491 O  O   . HOH N 5 .   ? -8.954  23.004  12.195  1.00 36.13 ? 98   HOH A O   1 
HETATM 2492 O  O   . HOH N 5 .   ? 5.115   -10.563 29.478  1.00 41.71 ? 99   HOH A O   1 
HETATM 2493 O  O   . HOH N 5 .   ? 11.943  -0.004  29.287  1.00 33.46 ? 100  HOH A O   1 
HETATM 2494 O  O   . HOH N 5 .   ? -9.818  9.772   28.911  1.00 51.39 ? 101  HOH A O   1 
HETATM 2495 O  O   . HOH N 5 .   ? -16.782 24.667  -17.869 1.00 40.08 ? 102  HOH A O   1 
HETATM 2496 O  O   . HOH N 5 .   ? -19.106 9.175   3.677   1.00 46.91 ? 103  HOH A O   1 
HETATM 2497 O  O   . HOH N 5 .   ? -14.615 30.490  -16.064 1.00 32.06 ? 104  HOH A O   1 
HETATM 2498 O  O   . HOH N 5 .   ? -19.547 23.417  -12.338 1.00 29.59 ? 105  HOH A O   1 
HETATM 2499 O  O   . HOH N 5 .   ? -29.789 28.948  7.717   1.00 50.53 ? 106  HOH A O   1 
HETATM 2500 O  O   . HOH N 5 .   ? -6.129  19.728  0.277   1.00 44.00 ? 107  HOH A O   1 
HETATM 2501 O  O   . HOH N 5 .   ? -17.420 33.670  11.376  1.00 41.18 ? 108  HOH A O   1 
HETATM 2502 O  O   . HOH N 5 .   ? -3.299  41.087  4.768   1.00 44.57 ? 109  HOH A O   1 
HETATM 2503 O  O   . HOH N 5 .   ? -12.585 -1.043  21.885  1.00 40.64 ? 110  HOH A O   1 
HETATM 2504 O  O   . HOH N 5 .   ? 0.487   -2.328  6.418   1.00 52.23 ? 111  HOH A O   1 
HETATM 2505 O  O   . HOH N 5 .   ? -20.152 31.826  -5.798  1.00 44.90 ? 112  HOH A O   1 
HETATM 2506 O  O   . HOH N 5 .   ? -18.973 25.161  -14.970 1.00 45.80 ? 113  HOH A O   1 
HETATM 2507 O  O   . HOH N 5 .   ? -28.503 31.118  6.522   1.00 47.94 ? 114  HOH A O   1 
HETATM 2508 O  O   . HOH N 5 .   ? -21.349 19.964  -4.718  1.00 33.45 ? 115  HOH A O   1 
HETATM 2509 O  O   . HOH N 5 .   ? -18.384 6.115   3.279   1.00 46.12 ? 117  HOH A O   1 
HETATM 2510 O  O   . HOH N 5 .   ? -11.525 5.292   -0.719  1.00 51.41 ? 118  HOH A O   1 
HETATM 2511 O  O   . HOH N 5 .   ? -18.066 0.897   29.161  1.00 69.30 ? 119  HOH A O   1 
HETATM 2512 O  O   . HOH N 5 .   ? -0.434  19.017  -14.842 1.00 55.99 ? 120  HOH A O   1 
HETATM 2513 O  O   . HOH N 5 .   ? 6.432   -17.198 17.101  1.00 48.54 ? 121  HOH A O   1 
HETATM 2514 O  O   . HOH N 5 .   ? -24.019 29.149  -4.570  1.00 43.39 ? 122  HOH A O   1 
HETATM 2515 O  O   . HOH N 5 .   ? -5.667  -13.129 17.531  1.00 48.01 ? 123  HOH A O   1 
HETATM 2516 O  O   . HOH N 5 .   ? 2.356   28.065  13.803  1.00 50.28 ? 124  HOH A O   1 
HETATM 2517 O  O   . HOH N 5 .   ? 13.602  -7.965  21.777  1.00 39.92 ? 127  HOH A O   1 
HETATM 2518 O  O   . HOH N 5 .   ? 0.903   20.643  26.300  1.00 47.37 ? 128  HOH A O   1 
HETATM 2519 O  O   . HOH N 5 .   ? 0.010   -6.603  8.458   1.00 50.20 ? 130  HOH A O   1 
HETATM 2520 O  O   . HOH N 5 .   ? -13.967 5.119   26.132  1.00 45.68 ? 131  HOH A O   1 
HETATM 2521 O  O   . HOH N 5 .   ? 4.959   -2.802  27.493  1.00 33.93 ? 132  HOH A O   1 
HETATM 2522 O  O   . HOH N 5 .   ? -10.395 -14.417 26.219  1.00 47.73 ? 133  HOH A O   1 
HETATM 2523 O  O   . HOH N 5 .   ? -22.219 11.721  3.888   1.00 45.21 ? 134  HOH A O   1 
HETATM 2524 O  O   . HOH N 5 .   ? -14.056 22.687  23.095  1.00 52.89 ? 135  HOH A O   1 
HETATM 2525 O  O   . HOH N 5 .   ? -4.706  -14.453 32.047  1.00 42.66 ? 136  HOH A O   1 
HETATM 2526 O  O   . HOH N 5 .   ? -22.600 33.039  10.770  1.00 48.07 ? 137  HOH A O   1 
HETATM 2527 O  O   . HOH N 5 .   ? -3.478  15.069  30.331  1.00 46.05 ? 138  HOH A O   1 
HETATM 2528 O  O   . HOH N 5 .   ? -16.963 -5.868  27.498  1.00 50.40 ? 139  HOH A O   1 
HETATM 2529 O  O   . HOH N 5 .   ? -12.101 37.496  -11.721 1.00 56.92 ? 140  HOH A O   1 
HETATM 2530 O  O   . HOH N 5 .   ? -9.268  32.312  -9.291  1.00 42.29 ? 141  HOH A O   1 
HETATM 2531 O  O   . HOH N 5 .   ? -21.743 31.460  12.837  1.00 42.34 ? 142  HOH A O   1 
HETATM 2532 O  O   . HOH N 5 .   ? 11.363  -11.634 20.888  1.00 47.45 ? 143  HOH A O   1 
HETATM 2533 O  O   . HOH N 5 .   ? 15.843  -9.205  21.137  1.00 41.01 ? 144  HOH A O   1 
HETATM 2534 O  O   . HOH N 5 .   ? 2.588   28.313  21.579  1.00 45.56 ? 145  HOH A O   1 
HETATM 2535 O  O   . HOH N 5 .   ? -2.908  -11.270 33.439  1.00 47.78 ? 147  HOH A O   1 
HETATM 2536 O  O   . HOH N 5 .   ? -15.695 27.275  -17.733 1.00 53.58 ? 148  HOH A O   1 
HETATM 2537 O  O   . HOH N 5 .   ? -27.666 30.484  4.194   1.00 40.58 ? 149  HOH A O   1 
HETATM 2538 O  O   . HOH N 5 .   ? 10.889  -1.238  26.231  1.00 57.06 ? 150  HOH A O   1 
HETATM 2539 O  O   . HOH N 5 .   ? -11.749 27.245  -18.176 1.00 46.80 ? 151  HOH A O   1 
HETATM 2540 O  O   . HOH N 5 .   ? -9.142  -11.377 16.988  1.00 54.29 ? 153  HOH A O   1 
HETATM 2541 O  O   . HOH N 5 .   ? -7.704  -11.820 21.365  1.00 46.13 ? 157  HOH A O   1 
HETATM 2542 O  O   . HOH N 5 .   ? -0.251  21.394  -11.259 1.00 50.31 ? 158  HOH A O   1 
HETATM 2543 O  O   . HOH N 5 .   ? -28.070 33.191  8.145   1.00 35.00 ? 159  HOH A O   1 
HETATM 2544 O  O   . HOH N 5 .   ? -1.458  -6.672  32.943  1.00 35.93 ? 160  HOH A O   1 
HETATM 2545 O  O   . HOH N 5 .   ? -17.753 33.052  14.095  1.00 42.96 ? 162  HOH A O   1 
HETATM 2546 O  O   . HOH N 5 .   ? 2.903   -12.971 22.037  1.00 40.36 ? 163  HOH A O   1 
HETATM 2547 O  O   . HOH N 5 .   ? -5.808  11.103  33.383  1.00 51.35 ? 165  HOH A O   1 
HETATM 2548 O  O   . HOH N 5 .   ? 1.469   -15.471 23.362  1.00 41.70 ? 166  HOH A O   1 
HETATM 2549 O  O   . HOH N 5 .   ? -3.583  -11.821 12.670  1.00 45.47 ? 167  HOH A O   1 
HETATM 2550 O  O   . HOH N 5 .   ? -0.624  37.691  -3.161  1.00 63.42 ? 169  HOH A O   1 
HETATM 2551 O  O   . HOH N 5 .   ? -3.884  35.549  -6.092  1.00 49.58 ? 170  HOH A O   1 
HETATM 2552 O  O   . HOH N 5 .   ? -19.572 10.621  5.684   1.00 48.48 ? 171  HOH A O   1 
HETATM 2553 O  O   . HOH N 5 .   ? -11.423 -12.174 18.166  1.00 49.54 ? 173  HOH A O   1 
HETATM 2554 O  O   . HOH N 5 .   ? -10.964 -13.533 20.589  1.00 51.26 ? 174  HOH A O   1 
HETATM 2555 O  O   . HOH N 5 .   ? -24.648 17.538  2.166   1.00 39.52 ? 176  HOH A O   1 
HETATM 2556 O  O   . HOH N 5 .   ? 7.478   -1.593  12.932  1.00 22.03 ? 178  HOH A O   1 
HETATM 2557 O  O   . HOH N 5 .   ? 8.440   -1.331  10.434  1.00 26.11 ? 179  HOH A O   1 
HETATM 2558 O  O   . HOH N 5 .   ? -9.096  7.033   -0.843  1.00 28.57 ? 180  HOH A O   1 
HETATM 2559 O  O   . HOH N 5 .   ? -20.711 32.351  -3.133  1.00 27.86 ? 181  HOH A O   1 
HETATM 2560 O  O   . HOH N 5 .   ? -11.969 35.984  -6.711  1.00 36.47 ? 182  HOH A O   1 
HETATM 2561 O  O   . HOH N 5 .   ? -16.814 33.500  -11.320 1.00 37.64 ? 183  HOH A O   1 
HETATM 2562 O  O   . HOH N 5 .   ? -4.281  16.029  5.629   1.00 38.25 ? 184  HOH A O   1 
HETATM 2563 O  O   . HOH N 5 .   ? -3.977  -4.865  10.461  1.00 31.67 ? 186  HOH A O   1 
HETATM 2564 O  O   . HOH N 5 .   ? -5.411  -6.214  12.219  1.00 24.30 ? 187  HOH A O   1 
HETATM 2565 O  O   . HOH N 5 .   ? -11.479 4.538   10.507  1.00 19.72 ? 188  HOH A O   1 
HETATM 2566 O  O   . HOH N 5 .   ? -9.143  5.338   9.459   1.00 20.03 ? 189  HOH A O   1 
HETATM 2567 O  O   . HOH N 5 .   ? -12.735 2.844   16.659  1.00 27.96 ? 190  HOH A O   1 
HETATM 2568 O  O   . HOH N 5 .   ? -11.042 -1.230  10.960  1.00 23.64 ? 191  HOH A O   1 
HETATM 2569 O  O   . HOH N 5 .   ? -10.875 1.401   10.023  1.00 25.14 ? 192  HOH A O   1 
HETATM 2570 O  O   . HOH N 5 .   ? 10.761  -1.661  23.612  1.00 30.33 ? 193  HOH A O   1 
HETATM 2571 O  O   . HOH N 5 .   ? 8.088   -1.918  23.342  1.00 25.65 ? 194  HOH A O   1 
HETATM 2572 O  O   . HOH N 5 .   ? 2.552   -11.759 30.462  1.00 30.16 ? 195  HOH A O   1 
HETATM 2573 O  O   . HOH N 5 .   ? 1.276   -0.573  33.071  1.00 33.26 ? 196  HOH A O   1 
HETATM 2574 O  O   . HOH N 5 .   ? -12.212 2.260   19.236  1.00 35.88 ? 197  HOH A O   1 
HETATM 2575 O  O   . HOH N 5 .   ? -9.480  18.204  -0.276  1.00 31.04 ? 198  HOH A O   1 
HETATM 2576 O  O   . HOH N 5 .   ? -8.989  23.443  -18.083 1.00 42.89 ? 199  HOH A O   1 
HETATM 2577 O  O   . HOH N 5 .   ? -17.942 33.823  -8.807  1.00 43.02 ? 200  HOH A O   1 
HETATM 2578 O  O   . HOH N 5 .   ? -13.887 -0.075  6.617   1.00 39.79 ? 201  HOH A O   1 
HETATM 2579 O  O   . HOH N 5 .   ? 0.506   -2.648  34.500  1.00 33.78 ? 202  HOH A O   1 
HETATM 2580 O  O   . HOH N 5 .   ? -1.774  -0.839  35.290  1.00 35.88 ? 203  HOH A O   1 
HETATM 2581 O  O   . HOH N 5 .   ? 1.513   36.448  -1.990  1.00 43.12 ? 204  HOH A O   1 
HETATM 2582 O  O   . HOH N 5 .   ? -6.259  29.184  -14.956 1.00 53.31 ? 205  HOH A O   1 
HETATM 2583 O  O   . HOH N 5 .   ? -4.649  22.260  -15.363 1.00 45.62 ? 206  HOH A O   1 
HETATM 2584 O  O   . HOH N 5 .   ? -13.250 6.640   20.277  1.00 48.85 ? 207  HOH A O   1 
HETATM 2585 O  O   . HOH N 5 .   ? -3.981  13.600  4.746   1.00 58.25 ? 208  HOH A O   1 
HETATM 2586 O  O   . HOH N 5 .   ? -9.779  22.583  -0.691  1.00 30.48 ? 550  HOH A O   1 
HETATM 2587 O  O   . HOH N 5 .   ? -10.147 10.075  19.350  1.00 25.58 ? 551  HOH A O   1 
HETATM 2588 O  O   A HOH N 5 .   ? -13.504 11.582  20.471  0.50 15.07 ? 552  HOH A O   1 
HETATM 2589 O  O   B HOH N 5 .   ? -13.311 10.736  22.316  0.50 24.75 ? 552  HOH A O   1 
HETATM 2590 O  O   . HOH N 5 .   ? 6.670   -12.341 18.377  1.00 27.40 ? 553  HOH A O   1 
HETATM 2591 O  O   . HOH N 5 .   ? -14.669 6.603   9.713   1.00 24.00 ? 554  HOH A O   1 
HETATM 2592 O  O   . HOH N 5 .   ? -4.141  -1.253  5.856   1.00 27.80 ? 555  HOH A O   1 
HETATM 2593 O  O   . HOH N 5 .   ? 6.097   -0.221  16.453  1.00 21.95 ? 556  HOH A O   1 
HETATM 2594 O  O   . HOH N 5 .   ? -6.038  7.219   12.678  1.00 22.19 ? 557  HOH A O   1 
HETATM 2595 O  O   . HOH N 5 .   ? -5.077  23.126  23.250  1.00 45.37 ? 558  HOH A O   1 
HETATM 2596 O  O   . HOH N 5 .   ? -10.344 2.604   28.252  1.00 36.66 ? 559  HOH A O   1 
HETATM 2597 O  O   . HOH N 5 .   ? 4.300   0.856   33.725  1.00 40.81 ? 560  HOH A O   1 
HETATM 2598 O  O   . HOH N 5 .   ? -8.910  6.249   1.549   1.00 46.23 ? 561  HOH A O   1 
HETATM 2599 O  O   . HOH N 5 .   ? -2.591  20.235  -0.550  1.00 49.81 ? 562  HOH A O   1 
HETATM 2600 O  O   . HOH N 5 .   ? -5.574  17.921  2.731   1.00 47.30 ? 563  HOH A O   1 
HETATM 2601 O  O   . HOH N 5 .   ? -14.076 6.587   -3.156  1.00 37.90 ? 564  HOH A O   1 
HETATM 2602 O  O   . HOH N 5 .   ? -26.083 24.570  1.309   1.00 45.35 ? 565  HOH A O   1 
HETATM 2603 O  O   . HOH N 5 .   ? -19.192 12.165  8.616   1.00 43.85 ? 566  HOH A O   1 
HETATM 2604 O  O   . HOH N 5 .   ? 3.383   -8.334  33.042  1.00 43.32 ? 567  HOH A O   1 
HETATM 2605 O  O   . HOH N 5 .   ? -6.265  23.449  -18.163 1.00 48.35 ? 568  HOH A O   1 
HETATM 2606 O  O   . HOH N 5 .   ? 11.183  -16.365 9.959   1.00 49.35 ? 569  HOH A O   1 
HETATM 2607 O  O   . HOH N 5 .   ? -13.517 -3.494  22.251  1.00 55.11 ? 570  HOH A O   1 
HETATM 2608 O  O   . HOH N 5 .   ? 1.694   -14.632 8.498   1.00 54.29 ? 571  HOH A O   1 
HETATM 2609 O  O   . HOH N 5 .   ? -9.131  21.456  25.098  1.00 48.41 ? 572  HOH A O   1 
HETATM 2610 O  O   . HOH N 5 .   ? 9.735   1.648   34.549  1.00 47.36 ? 573  HOH A O   1 
HETATM 2611 O  O   . HOH N 5 .   ? 20.837  -9.829  18.736  1.00 46.64 ? 574  HOH A O   1 
HETATM 2612 O  O   . HOH N 5 .   ? -9.287  38.382  -4.162  1.00 59.88 ? 575  HOH A O   1 
HETATM 2613 O  O   . HOH N 5 .   ? 0.145   2.541   5.232   1.00 52.54 ? 576  HOH A O   1 
HETATM 2614 O  O   . HOH N 5 .   ? -0.018  32.837  -6.255  1.00 41.02 ? 577  HOH A O   1 
HETATM 2615 O  O   . HOH N 5 .   ? -14.001 -4.594  30.988  1.00 52.12 ? 578  HOH A O   1 
HETATM 2616 O  O   . HOH N 5 .   ? -5.750  4.743   1.636   1.00 51.49 ? 579  HOH A O   1 
HETATM 2617 O  O   . HOH N 5 .   ? -0.618  -12.818 10.959  1.00 55.03 ? 580  HOH A O   1 
HETATM 2618 O  O   . HOH N 5 .   ? 4.897   17.004  27.682  1.00 48.07 ? 581  HOH A O   1 
HETATM 2619 O  O   . HOH N 5 .   ? 5.980   16.988  25.091  1.00 45.69 ? 582  HOH A O   1 
HETATM 2620 O  O   . HOH N 5 .   ? 0.907   12.467  7.850   1.00 43.65 ? 583  HOH A O   1 
HETATM 2621 O  O   . HOH N 5 .   ? -7.630  23.500  22.996  1.00 52.38 ? 584  HOH A O   1 
HETATM 2622 O  O   . HOH N 5 .   ? -13.046 -6.496  23.370  1.00 53.43 ? 585  HOH A O   1 
HETATM 2623 O  O   . HOH N 5 .   ? -21.024 16.137  16.807  1.00 59.04 ? 586  HOH A O   1 
HETATM 2624 O  O   . HOH N 5 .   ? -3.281  2.255   1.199   1.00 57.47 ? 587  HOH A O   1 
HETATM 2625 O  O   A HOH N 5 .   ? 19.675  -7.618  19.987  0.50 38.43 ? 588  HOH A O   1 
HETATM 2626 O  O   B HOH N 5 .   ? 20.643  -5.914  19.444  0.50 38.43 ? 588  HOH A O   1 
HETATM 2627 O  O   . HOH N 5 .   ? 10.853  -0.583  35.871  1.00 43.47 ? 589  HOH A O   1 
HETATM 2628 O  O   . HOH N 5 .   ? 12.110  -2.982  35.573  1.00 53.49 ? 590  HOH A O   1 
HETATM 2629 O  O   . HOH N 5 .   ? -25.841 37.607  5.127   1.00 47.31 ? 591  HOH A O   1 
HETATM 2630 O  O   . HOH N 5 .   ? 0.764   21.339  -0.132  1.00 47.53 ? 592  HOH A O   1 
HETATM 2631 O  O   . HOH N 5 .   ? 11.653  5.525   14.690  1.00 44.61 ? 593  HOH A O   1 
HETATM 2632 O  O   . HOH N 5 .   ? -26.406 18.438  15.167  1.00 38.71 ? 594  HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 35  ? 0.5088 0.6457 0.8126 0.1952  0.0464  0.2879  243 HIS A N   
2    C CA  . HIS A 35  ? 0.4738 0.6372 0.7716 0.1463  0.0017  0.2646  243 HIS A CA  
3    C C   . HIS A 35  ? 0.4690 0.5605 0.7167 0.1278  -0.0050 0.2021  243 HIS A C   
4    O O   . HIS A 35  ? 0.4736 0.5549 0.6987 0.1042  -0.0234 0.1854  243 HIS A O   
5    C CB  . HIS A 35  ? 0.4648 0.6690 0.7860 0.1428  -0.0047 0.2810  243 HIS A CB  
6    N N   . TYR A 36  ? 0.4572 0.5054 0.6878 0.1382  0.0114  0.1742  244 TYR A N   
7    C CA  . TYR A 36  ? 0.4422 0.4441 0.6342 0.1233  0.0083  0.1304  244 TYR A CA  
8    C C   . TYR A 36  ? 0.4595 0.4226 0.6206 0.1253  0.0204  0.1195  244 TYR A C   
9    O O   . TYR A 36  ? 0.4491 0.4027 0.5876 0.1083  0.0089  0.0976  244 TYR A O   
10   C CB  . TYR A 36  ? 0.4380 0.4188 0.6220 0.1261  0.0202  0.1135  244 TYR A CB  
11   C CG  . TYR A 36  ? 0.4158 0.4322 0.6248 0.1201  0.0050  0.1206  244 TYR A CG  
12   C CD1 . TYR A 36  ? 0.4133 0.4565 0.6524 0.1368  0.0151  0.1484  244 TYR A CD1 
13   C CD2 . TYR A 36  ? 0.3898 0.4081 0.5849 0.0993  -0.0152 0.1041  244 TYR A CD2 
14   C CE1 . TYR A 36  ? 0.4056 0.4859 0.6633 0.1246  -0.0026 0.1572  244 TYR A CE1 
15   C CE2 . TYR A 36  ? 0.3888 0.4245 0.5898 0.0880  -0.0281 0.1095  244 TYR A CE2 
16   C CZ  . TYR A 36  ? 0.3970 0.4684 0.6307 0.0965  -0.0258 0.1350  244 TYR A CZ  
17   O OH  . TYR A 36  ? 0.4152 0.5079 0.6505 0.0790  -0.0422 0.1424  244 TYR A OH  
18   N N   . GLY A 37  ? 0.4874 0.4265 0.6433 0.1483  0.0472  0.1397  245 GLY A N   
19   C CA  . GLY A 37  ? 0.5151 0.4081 0.6316 0.1482  0.0605  0.1334  245 GLY A CA  
20   C C   . GLY A 37  ? 0.4847 0.4104 0.6125 0.1329  0.0338  0.1330  245 GLY A C   
21   O O   . GLY A 37  ? 0.4906 0.3880 0.5827 0.1185  0.0312  0.1141  245 GLY A O   
22   N N   . ILE A 38  ? 0.4498 0.4353 0.6200 0.1296  0.0133  0.1569  246 ILE A N   
23   C CA  . ILE A 38  ? 0.4289 0.4389 0.5996 0.1071  -0.0122 0.1573  246 ILE A CA  
24   C C   . ILE A 38  ? 0.4066 0.3965 0.5457 0.0845  -0.0274 0.1203  246 ILE A C   
25   O O   . ILE A 38  ? 0.4184 0.3962 0.5364 0.0748  -0.0333 0.1081  246 ILE A O   
26   C CB  . ILE A 38  ? 0.4203 0.4959 0.6255 0.0915  -0.0334 0.1949  246 ILE A CB  
27   C CG1 . ILE A 38  ? 0.4466 0.5677 0.6974 0.1225  -0.0139 0.2492  246 ILE A CG1 
28   C CG2 . ILE A 38  ? 0.4280 0.5145 0.6174 0.0600  -0.0572 0.1949  246 ILE A CG2 
29   N N   . HIS A 39  ? 0.3811 0.3692 0.5174 0.0804  -0.0299 0.1078  247 HIS A N   
30   C CA  . HIS A 39  ? 0.3642 0.3337 0.4720 0.0718  -0.0326 0.0830  247 HIS A CA  
31   C C   . HIS A 39  ? 0.3510 0.3090 0.4430 0.0764  -0.0218 0.0704  247 HIS A C   
32   O O   . HIS A 39  ? 0.3436 0.3026 0.4171 0.0719  -0.0237 0.0633  247 HIS A O   
33   C CB  . HIS A 39  ? 0.3623 0.3299 0.4703 0.0720  -0.0316 0.0776  247 HIS A CB  
34   C CG  . HIS A 39  ? 0.4013 0.3725 0.5014 0.0522  -0.0464 0.0896  247 HIS A CG  
35   N ND1 . HIS A 39  ? 0.4330 0.3686 0.4833 0.0316  -0.0511 0.0815  247 HIS A ND1 
36   C CD2 . HIS A 39  ? 0.4017 0.4066 0.5268 0.0439  -0.0564 0.1145  247 HIS A CD2 
37   C CE1 . HIS A 39  ? 0.4759 0.4153 0.5099 0.0011  -0.0671 0.0973  247 HIS A CE1 
38   N NE2 . HIS A 39  ? 0.4496 0.4443 0.5370 0.0080  -0.0735 0.1209  247 HIS A NE2 
39   N N   . GLU A 40  ? 0.3417 0.2860 0.4318 0.0816  -0.0082 0.0720  248 GLU A N   
40   C CA  . GLU A 40  ? 0.3555 0.2819 0.4109 0.0693  -0.0002 0.0643  248 GLU A CA  
41   C C   . GLU A 40  ? 0.3592 0.2774 0.3956 0.0622  -0.0050 0.0651  248 GLU A C   
42   O O   . GLU A 40  ? 0.3541 0.2839 0.3679 0.0461  -0.0105 0.0615  248 GLU A O   
43   C CB  . GLU A 40  ? 0.3942 0.2769 0.4238 0.0689  0.0210  0.0655  248 GLU A CB  
44   C CG  . GLU A 40  ? 0.4464 0.2991 0.4156 0.0374  0.0278  0.0588  248 GLU A CG  
45   C CD  . GLU A 40  ? 0.5332 0.3125 0.4494 0.0306  0.0562  0.0572  248 GLU A CD  
46   O OE1 . GLU A 40  ? 0.6116 0.3244 0.4512 0.0060  0.0715  0.0543  248 GLU A OE1 
47   O OE2 . GLU A 40  ? 0.5300 0.3084 0.4702 0.0475  0.0661  0.0592  248 GLU A OE2 
48   N N   . GLU A 41  ? 0.3665 0.2754 0.4158 0.0742  -0.0031 0.0763  249 GLU A N   
49   C CA  . GLU A 41  ? 0.3855 0.2866 0.4201 0.0688  -0.0076 0.0789  249 GLU A CA  
50   C C   . GLU A 41  ? 0.3577 0.2903 0.3971 0.0572  -0.0278 0.0715  249 GLU A C   
51   O O   . GLU A 41  ? 0.3636 0.2955 0.3796 0.0455  -0.0324 0.0665  249 GLU A O   
52   C CB  . GLU A 41  ? 0.4013 0.3039 0.4611 0.0876  -0.0005 0.1036  249 GLU A CB  
53   C CG  . GLU A 41  ? 0.4592 0.3472 0.5013 0.0845  -0.0006 0.1088  249 GLU A CG  
54   C CD  . GLU A 41  ? 0.5188 0.4361 0.6006 0.1025  0.0020  0.1448  249 GLU A CD  
55   O OE1 . GLU A 41  ? 0.5277 0.4815 0.6504 0.1169  0.0052  0.1714  249 GLU A OE1 
56   O OE2 . GLU A 41  ? 0.5536 0.4670 0.6278 0.1002  -0.0001 0.1523  249 GLU A OE2 
57   N N   A MET A 42  ? 0.3404 0.2911 0.3987 0.0587  -0.0364 0.0723  250 MET A N   
58   N N   B MET A 42  ? 0.3388 0.2895 0.3977 0.0588  -0.0364 0.0725  250 MET A N   
59   C CA  A MET A 42  ? 0.3408 0.2950 0.3836 0.0508  -0.0443 0.0657  250 MET A CA  
60   C CA  B MET A 42  ? 0.3383 0.2923 0.3817 0.0511  -0.0441 0.0658  250 MET A CA  
61   C C   A MET A 42  ? 0.3329 0.2973 0.3603 0.0565  -0.0350 0.0602  250 MET A C   
62   C C   B MET A 42  ? 0.3305 0.2951 0.3584 0.0562  -0.0353 0.0603  250 MET A C   
63   O O   A MET A 42  ? 0.3392 0.3111 0.3506 0.0556  -0.0347 0.0610  250 MET A O   
64   O O   B MET A 42  ? 0.3350 0.3081 0.3475 0.0537  -0.0361 0.0611  250 MET A O   
65   C CB  A MET A 42  ? 0.3591 0.3043 0.3979 0.0427  -0.0500 0.0688  250 MET A CB  
66   C CB  B MET A 42  ? 0.3514 0.2960 0.3911 0.0459  -0.0473 0.0673  250 MET A CB  
67   C CG  A MET A 42  ? 0.3774 0.3412 0.4372 0.0290  -0.0638 0.0898  250 MET A CG  
68   C CG  B MET A 42  ? 0.3725 0.3321 0.4305 0.0313  -0.0611 0.0867  250 MET A CG  
69   S SD  A MET A 42  ? 0.4660 0.4186 0.4922 -0.0094 -0.0802 0.0995  250 MET A SD  
70   S SD  B MET A 42  ? 0.3968 0.3714 0.4579 0.0167  -0.0740 0.1006  250 MET A SD  
71   C CE  A MET A 42  ? 0.4580 0.3853 0.4684 -0.0021 -0.0693 0.0880  250 MET A CE  
72   C CE  B MET A 42  ? 0.3808 0.3676 0.4758 0.0445  -0.0596 0.1152  250 MET A CE  
73   N N   . LEU A 43  ? 0.3142 0.2888 0.3498 0.0626  -0.0267 0.0614  251 LEU A N   
74   C CA  . LEU A 43  ? 0.3047 0.3134 0.3353 0.0651  -0.0186 0.0707  251 LEU A CA  
75   C C   . LEU A 43  ? 0.3055 0.3359 0.3182 0.0442  -0.0251 0.0778  251 LEU A C   
76   O O   . LEU A 43  ? 0.3007 0.3754 0.3095 0.0436  -0.0235 0.0946  251 LEU A O   
77   C CB  . LEU A 43  ? 0.2931 0.3147 0.3369 0.0679  -0.0116 0.0746  251 LEU A CB  
78   C CG  . LEU A 43  ? 0.3107 0.3181 0.3624 0.0881  -0.0020 0.0729  251 LEU A CG  
79   C CD1 . LEU A 43  ? 0.3096 0.3278 0.3782 0.0875  0.0009  0.0743  251 LEU A CD1 
80   C CD2 . LEU A 43  ? 0.3172 0.3354 0.3559 0.1103  0.0164  0.0874  251 LEU A CD2 
81   N N   . LYS A 44  ? 0.3070 0.3032 0.3022 0.0278  -0.0287 0.0698  252 LYS A N   
82   C CA  . LYS A 44  ? 0.3331 0.3254 0.2871 -0.0018 -0.0333 0.0739  252 LYS A CA  
83   C C   . LYS A 44  ? 0.3347 0.3262 0.2822 -0.0029 -0.0425 0.0721  252 LYS A C   
84   O O   . LYS A 44  ? 0.3585 0.3469 0.2667 -0.0302 -0.0484 0.0760  252 LYS A O   
85   C CB  . LYS A 44  ? 0.3835 0.3100 0.2962 -0.0172 -0.0219 0.0664  252 LYS A CB  
86   C CG  . LYS A 44  ? 0.3997 0.3248 0.2962 -0.0336 -0.0141 0.0696  252 LYS A CG  
87   C CD  . LYS A 44  ? 0.4907 0.3241 0.3222 -0.0495 0.0067  0.0614  252 LYS A CD  
88   C CE  . LYS A 44  ? 0.5171 0.3444 0.3271 -0.0710 0.0145  0.0632  252 LYS A CE  
89   N NZ  . LYS A 44  ? 0.5933 0.3122 0.3327 -0.0780 0.0450  0.0544  252 LYS A NZ  
90   N N   . ASP A 45  ? 0.3102 0.2990 0.2861 0.0189  -0.0448 0.0669  253 ASP A N   
91   C CA  . ASP A 45  ? 0.3149 0.3075 0.2855 0.0159  -0.0539 0.0660  253 ASP A CA  
92   C C   . ASP A 45  ? 0.3094 0.3500 0.2778 0.0201  -0.0515 0.0784  253 ASP A C   
93   O O   . ASP A 45  ? 0.2987 0.3419 0.2765 0.0423  -0.0397 0.0812  253 ASP A O   
94   C CB  . ASP A 45  ? 0.3067 0.2790 0.2964 0.0259  -0.0576 0.0613  253 ASP A CB  
95   C CG  . ASP A 45  ? 0.3265 0.2993 0.3069 0.0169  -0.0680 0.0605  253 ASP A CG  
96   O OD1 . ASP A 45  ? 0.3589 0.3206 0.3489 0.0118  -0.0756 0.0628  253 ASP A OD1 
97   O OD2 . ASP A 45  ? 0.3318 0.3238 0.2958 0.0113  -0.0701 0.0621  253 ASP A OD2 
98   N N   . LYS A 46  ? 0.3581 0.2879 0.3060 0.0282  0.0226  0.0065  254 LYS A N   
99   C CA  . LYS A 46  ? 0.3702 0.3085 0.3247 0.0212  0.0194  0.0046  254 LYS A CA  
100  C C   . LYS A 46  ? 0.3586 0.3023 0.3213 0.0210  0.0191  0.0069  254 LYS A C   
101  O O   . LYS A 46  ? 0.3517 0.3076 0.3238 0.0197  0.0164  0.0077  254 LYS A O   
102  C CB  . LYS A 46  ? 0.3852 0.3145 0.3321 0.0137  0.0200  0.0000  254 LYS A CB  
103  C CG  . LYS A 46  ? 0.4379 0.3633 0.3762 0.0125  0.0187  -0.0034 254 LYS A CG  
104  C CD  . LYS A 46  ? 0.5160 0.4367 0.4502 0.0031  0.0174  -0.0087 254 LYS A CD  
105  C CE  . LYS A 46  ? 0.5747 0.4894 0.4976 0.0022  0.0157  -0.0129 254 LYS A CE  
106  N NZ  . LYS A 46  ? 0.6113 0.5061 0.5191 0.0062  0.0209  -0.0136 254 LYS A NZ  
107  N N   . ILE A 47  ? 0.3623 0.2963 0.3203 0.0230  0.0221  0.0080  255 ILE A N   
108  C CA  . ILE A 47  ? 0.3624 0.2998 0.3257 0.0237  0.0220  0.0101  255 ILE A CA  
109  C C   . ILE A 47  ? 0.3506 0.3005 0.3236 0.0278  0.0188  0.0126  255 ILE A C   
110  O O   . ILE A 47  ? 0.3418 0.3002 0.3221 0.0259  0.0169  0.0130  255 ILE A O   
111  C CB  . ILE A 47  ? 0.3722 0.2966 0.3271 0.0275  0.0257  0.0117  255 ILE A CB  
112  C CG1 . ILE A 47  ? 0.3951 0.3050 0.3402 0.0224  0.0299  0.0093  255 ILE A CG1 
113  C CG2 . ILE A 47  ? 0.3802 0.3085 0.3391 0.0298  0.0249  0.0141  255 ILE A CG2 
114  C CD1 . ILE A 47  ? 0.4185 0.3309 0.3677 0.0141  0.0304  0.0075  255 ILE A CD1 
115  N N   . ARG A 48  ? 0.3407 0.2916 0.3140 0.0334  0.0185  0.0143  256 ARG A N   
116  C CA  . ARG A 48  ? 0.3368 0.2989 0.3199 0.0366  0.0158  0.0166  256 ARG A CA  
117  C C   . ARG A 48  ? 0.3258 0.2977 0.3155 0.0335  0.0137  0.0160  256 ARG A C   
118  O O   . ARG A 48  ? 0.3210 0.3000 0.3176 0.0325  0.0119  0.0166  256 ARG A O   
119  C CB  . ARG A 48  ? 0.3368 0.2987 0.3200 0.0425  0.0168  0.0186  256 ARG A CB  
120  C CG  . ARG A 48  ? 0.3524 0.3258 0.3468 0.0448  0.0147  0.0209  256 ARG A CG  
121  C CD  . ARG A 48  ? 0.3798 0.3534 0.3738 0.0489  0.0171  0.0225  256 ARG A CD  
122  N NE  . ARG A 48  ? 0.4070 0.3908 0.4123 0.0513  0.0162  0.0252  256 ARG A NE  
123  C CZ  . ARG A 48  ? 0.3993 0.3892 0.4096 0.0501  0.0163  0.0259  256 ARG A CZ  
124  N NH1 . ARG A 48  ? 0.3985 0.3963 0.4194 0.0520  0.0164  0.0286  256 ARG A NH1 
125  N NH2 . ARG A 48  ? 0.4096 0.3979 0.4146 0.0471  0.0164  0.0241  256 ARG A NH2 
126  N N   . THR A 49  ? 0.3195 0.2912 0.3060 0.0325  0.0142  0.0148  257 THR A N   
127  C CA  . THR A 49  ? 0.3208 0.3020 0.3127 0.0315  0.0122  0.0151  257 THR A CA  
128  C C   . THR A 49  ? 0.3167 0.3032 0.3114 0.0264  0.0104  0.0135  257 THR A C   
129  O O   . THR A 49  ? 0.3143 0.3097 0.3161 0.0267  0.0088  0.0148  257 THR A O   
130  C CB  . THR A 49  ? 0.3295 0.3090 0.3158 0.0333  0.0131  0.0147  257 THR A CB  
131  O OG1 . THR A 49  ? 0.3385 0.3137 0.3233 0.0385  0.0157  0.0168  257 THR A OG1 
132  C CG2 . THR A 49  ? 0.3226 0.3119 0.3142 0.0342  0.0115  0.0162  257 THR A CG2 
133  N N   . GLU A 50  ? 0.3249 0.3057 0.3144 0.0218  0.0110  0.0107  258 GLU A N   
134  C CA  . GLU A 50  ? 0.3285 0.3157 0.3225 0.0166  0.0097  0.0094  258 GLU A CA  
135  C C   . GLU A 50  ? 0.3101 0.3005 0.3103 0.0171  0.0103  0.0113  258 GLU A C   
136  O O   . GLU A 50  ? 0.3033 0.3028 0.3101 0.0153  0.0092  0.0117  258 GLU A O   
137  C CB  . GLU A 50  ? 0.3449 0.3252 0.3328 0.0105  0.0105  0.0058  258 GLU A CB  
138  C CG  . GLU A 50  ? 0.3901 0.3684 0.3714 0.0095  0.0089  0.0032  258 GLU A CG  
139  C CD  . GLU A 50  ? 0.4541 0.4245 0.4288 0.0026  0.0092  -0.0012 258 GLU A CD  
140  O OE1 . GLU A 50  ? 0.4960 0.4623 0.4628 0.0020  0.0078  -0.0040 258 GLU A OE1 
141  O OE2 . GLU A 50  ? 0.4860 0.4532 0.4625 -0.0020 0.0112  -0.0019 258 GLU A OE2 
142  N N   . SER A 51  ? 0.2952 0.2784 0.2926 0.0201  0.0120  0.0126  259 SER A N   
143  C CA  . SER A 51  ? 0.2859 0.2709 0.2872 0.0215  0.0124  0.0142  259 SER A CA  
144  C C   . SER A 51  ? 0.2677 0.2621 0.2766 0.0241  0.0102  0.0159  259 SER A C   
145  O O   . SER A 51  ? 0.2492 0.2486 0.2624 0.0234  0.0102  0.0165  259 SER A O   
146  C CB  . SER A 51  ? 0.2907 0.2668 0.2867 0.0252  0.0135  0.0152  259 SER A CB  
147  O OG  . SER A 51  ? 0.2959 0.2616 0.2840 0.0232  0.0166  0.0142  259 SER A OG  
148  N N   . TYR A 52  ? 0.2626 0.2586 0.2728 0.0272  0.0090  0.0168  260 TYR A N   
149  C CA  . TYR A 52  ? 0.2582 0.2613 0.2752 0.0294  0.0077  0.0186  260 TYR A CA  
150  C C   . TYR A 52  ? 0.2578 0.2688 0.2779 0.0278  0.0071  0.0187  260 TYR A C   
151  O O   . TYR A 52  ? 0.2579 0.2741 0.2828 0.0287  0.0069  0.0200  260 TYR A O   
152  C CB  . TYR A 52  ? 0.2616 0.2645 0.2799 0.0326  0.0076  0.0199  260 TYR A CB  
153  C CG  . TYR A 52  ? 0.2616 0.2617 0.2815 0.0351  0.0070  0.0206  260 TYR A CG  
154  C CD1 . TYR A 52  ? 0.2742 0.2678 0.2887 0.0364  0.0075  0.0201  260 TYR A CD1 
155  C CD2 . TYR A 52  ? 0.2492 0.2527 0.2756 0.0363  0.0057  0.0217  260 TYR A CD2 
156  C CE1 . TYR A 52  ? 0.2844 0.2771 0.3007 0.0392  0.0061  0.0207  260 TYR A CE1 
157  C CE2 . TYR A 52  ? 0.2582 0.2603 0.2867 0.0380  0.0040  0.0217  260 TYR A CE2 
158  C CZ  . TYR A 52  ? 0.2586 0.2563 0.2822 0.0396  0.0039  0.0213  260 TYR A CZ  
159  O OH  . TYR A 52  ? 0.2616 0.2596 0.2876 0.0418  0.0014  0.0215  260 TYR A OH  
160  N N   . ARG A 53  ? 0.2613 0.2730 0.2780 0.0258  0.0067  0.0173  261 ARG A N   
161  C CA  . ARG A 53  ? 0.2650 0.2854 0.2841 0.0244  0.0052  0.0171  261 ARG A CA  
162  C C   . ARG A 53  ? 0.2592 0.2849 0.2831 0.0217  0.0053  0.0169  261 ARG A C   
163  O O   . ARG A 53  ? 0.2568 0.2909 0.2860 0.0233  0.0047  0.0186  261 ARG A O   
164  C CB  . ARG A 53  ? 0.2723 0.2913 0.2854 0.0218  0.0040  0.0145  261 ARG A CB  
165  C CG  . ARG A 53  ? 0.3033 0.3328 0.3186 0.0213  0.0012  0.0144  261 ARG A CG  
166  C CD  . ARG A 53  ? 0.3741 0.4040 0.3851 0.0161  -0.0009 0.0106  261 ARG A CD  
167  N NE  . ARG A 53  ? 0.3926 0.4181 0.4043 0.0105  0.0004  0.0083  261 ARG A NE  
168  C CZ  . ARG A 53  ? 0.3921 0.4124 0.3984 0.0050  -0.0002 0.0044  261 ARG A CZ  
169  N NH1 . ARG A 53  ? 0.3946 0.4141 0.3941 0.0045  -0.0028 0.0020  261 ARG A NH1 
170  N NH2 . ARG A 53  ? 0.3614 0.3763 0.3682 0.0000  0.0020  0.0030  261 ARG A NH2 
171  N N   . ASP A 54  ? 0.2604 0.2808 0.2820 0.0181  0.0068  0.0152  262 ASP A N   
172  C CA  . ASP A 54  ? 0.2649 0.2898 0.2912 0.0154  0.0081  0.0154  262 ASP A CA  
173  C C   . ASP A 54  ? 0.2537 0.2797 0.2833 0.0194  0.0095  0.0179  262 ASP A C   
174  O O   . ASP A 54  ? 0.2578 0.2920 0.2931 0.0198  0.0100  0.0193  262 ASP A O   
175  C CB  . ASP A 54  ? 0.2741 0.2904 0.2961 0.0112  0.0107  0.0137  262 ASP A CB  
176  C CG  . ASP A 54  ? 0.3015 0.3163 0.3205 0.0057  0.0097  0.0105  262 ASP A CG  
177  O OD1 . ASP A 54  ? 0.3367 0.3416 0.3505 0.0024  0.0123  0.0091  262 ASP A OD1 
178  O OD2 . ASP A 54  ? 0.3276 0.3498 0.3481 0.0049  0.0064  0.0094  262 ASP A OD2 
179  N N   . PHE A 55  ? 0.2504 0.2684 0.2763 0.0226  0.0099  0.0185  263 PHE A N   
180  C CA  . PHE A 55  ? 0.2526 0.2699 0.2802 0.0261  0.0106  0.0200  263 PHE A CA  
181  C C   . PHE A 55  ? 0.2466 0.2718 0.2796 0.0287  0.0099  0.0219  263 PHE A C   
182  O O   . PHE A 55  ? 0.2470 0.2760 0.2830 0.0302  0.0113  0.0232  263 PHE A O   
183  C CB  . PHE A 55  ? 0.2491 0.2579 0.2726 0.0287  0.0098  0.0198  263 PHE A CB  
184  C CG  . PHE A 55  ? 0.2543 0.2628 0.2798 0.0318  0.0093  0.0207  263 PHE A CG  
185  C CD1 . PHE A 55  ? 0.2306 0.2378 0.2552 0.0330  0.0110  0.0211  263 PHE A CD1 
186  C CD2 . PHE A 55  ? 0.2408 0.2495 0.2689 0.0335  0.0076  0.0213  263 PHE A CD2 
187  C CE1 . PHE A 55  ? 0.2415 0.2464 0.2664 0.0357  0.0107  0.0215  263 PHE A CE1 
188  C CE2 . PHE A 55  ? 0.2507 0.2578 0.2806 0.0355  0.0073  0.0217  263 PHE A CE2 
189  C CZ  . PHE A 55  ? 0.2687 0.2733 0.2964 0.0365  0.0086  0.0216  263 PHE A CZ  
190  N N   . ILE A 56  ? 0.2445 0.2714 0.2780 0.0298  0.0082  0.0223  264 ILE A N   
191  C CA  . ILE A 56  ? 0.2388 0.2713 0.2760 0.0330  0.0080  0.0246  264 ILE A CA  
192  C C   . ILE A 56  ? 0.2506 0.2939 0.2916 0.0328  0.0077  0.0255  264 ILE A C   
193  O O   . ILE A 56  ? 0.2577 0.3053 0.3021 0.0358  0.0090  0.0276  264 ILE A O   
194  C CB  . ILE A 56  ? 0.2335 0.2646 0.2696 0.0345  0.0072  0.0252  264 ILE A CB  
195  C CG1 . ILE A 56  ? 0.2305 0.2538 0.2658 0.0351  0.0074  0.0249  264 ILE A CG1 
196  C CG2 . ILE A 56  ? 0.2279 0.2641 0.2666 0.0382  0.0077  0.0281  264 ILE A CG2 
197  C CD1 . ILE A 56  ? 0.2507 0.2724 0.2855 0.0361  0.0074  0.0255  264 ILE A CD1 
198  N N   . TYR A 57  ? 0.2496 0.2970 0.2898 0.0294  0.0059  0.0237  265 TYR A N   
199  C CA  . TYR A 57  ? 0.2565 0.3162 0.3013 0.0286  0.0044  0.0241  265 TYR A CA  
200  C C   . TYR A 57  ? 0.2545 0.3195 0.3049 0.0271  0.0064  0.0246  265 TYR A C   
201  O O   . TYR A 57  ? 0.2512 0.3277 0.3077 0.0289  0.0061  0.0265  265 TYR A O   
202  C CB  . TYR A 57  ? 0.2599 0.3219 0.3019 0.0243  0.0014  0.0212  265 TYR A CB  
203  C CG  . TYR A 57  ? 0.2805 0.3415 0.3175 0.0271  -0.0004 0.0215  265 TYR A CG  
204  C CD1 . TYR A 57  ? 0.2803 0.3376 0.3163 0.0325  0.0012  0.0245  265 TYR A CD1 
205  C CD2 . TYR A 57  ? 0.3063 0.3688 0.3386 0.0242  -0.0034 0.0187  265 TYR A CD2 
206  C CE1 . TYR A 57  ? 0.3015 0.3573 0.3326 0.0354  0.0006  0.0254  265 TYR A CE1 
207  C CE2 . TYR A 57  ? 0.3089 0.3693 0.3347 0.0276  -0.0045 0.0192  265 TYR A CE2 
208  C CZ  . TYR A 57  ? 0.3005 0.3578 0.3261 0.0334  -0.0021 0.0229  265 TYR A CZ  
209  O OH  . TYR A 57  ? 0.3191 0.3742 0.3384 0.0371  -0.0022 0.0240  265 TYR A OH  
210  N N   . GLN A 58  ? 0.2500 0.3071 0.2983 0.0245  0.0088  0.0234  266 GLN A N   
211  C CA  . GLN A 58  ? 0.2595 0.3207 0.3126 0.0233  0.0118  0.0243  266 GLN A CA  
212  C C   . GLN A 58  ? 0.2548 0.3124 0.3075 0.0286  0.0150  0.0267  266 GLN A C   
213  O O   . GLN A 58  ? 0.2569 0.3181 0.3132 0.0291  0.0183  0.0281  266 GLN A O   
214  C CB  . GLN A 58  ? 0.2656 0.3198 0.3158 0.0179  0.0137  0.0221  266 GLN A CB  
215  C CG  . GLN A 58  ? 0.3176 0.3761 0.3692 0.0115  0.0113  0.0193  266 GLN A CG  
216  C CD  . GLN A 58  ? 0.3733 0.4208 0.4199 0.0065  0.0139  0.0172  266 GLN A CD  
217  O OE1 . GLN A 58  ? 0.4082 0.4474 0.4514 0.0080  0.0178  0.0183  266 GLN A OE1 
218  N NE2 . GLN A 58  ? 0.3764 0.4226 0.4210 0.0010  0.0119  0.0141  266 GLN A NE2 
219  N N   . ASN A 59  ? 0.2523 0.3026 0.3007 0.0324  0.0143  0.0272  267 ASN A N   
220  C CA  . ASN A 59  ? 0.2593 0.3044 0.3060 0.0373  0.0168  0.0289  267 ASN A CA  
221  C C   . ASN A 59  ? 0.2650 0.3111 0.3125 0.0416  0.0159  0.0308  267 ASN A C   
222  O O   . ASN A 59  ? 0.2657 0.3023 0.3094 0.0434  0.0161  0.0305  267 ASN A O   
223  C CB  . ASN A 59  ? 0.2575 0.2891 0.2969 0.0369  0.0173  0.0270  267 ASN A CB  
224  C CG  . ASN A 59  ? 0.2759 0.3047 0.3129 0.0337  0.0192  0.0259  267 ASN A CG  
225  O OD1 . ASN A 59  ? 0.2767 0.3056 0.3137 0.0350  0.0229  0.0270  267 ASN A OD1 
226  N ND2 . ASN A 59  ? 0.2375 0.2628 0.2718 0.0300  0.0176  0.0239  267 ASN A ND2 
227  N N   . PRO A 60  ? 0.2646 0.3221 0.3170 0.0433  0.0150  0.0328  268 PRO A N   
228  C CA  . PRO A 60  ? 0.2737 0.3314 0.3257 0.0478  0.0147  0.0351  268 PRO A CA  
229  C C   . PRO A 60  ? 0.2801 0.3312 0.3306 0.0530  0.0183  0.0373  268 PRO A C   
230  O O   . PRO A 60  ? 0.2883 0.3344 0.3370 0.0560  0.0190  0.0388  268 PRO A O   
231  C CB  . PRO A 60  ? 0.2683 0.3409 0.3253 0.0490  0.0128  0.0369  268 PRO A CB  
232  C CG  . PRO A 60  ? 0.2694 0.3504 0.3319 0.0469  0.0139  0.0366  268 PRO A CG  
233  C CD  . PRO A 60  ? 0.2687 0.3399 0.3276 0.0415  0.0144  0.0333  268 PRO A CD  
234  N N   . HIS A 61  ? 0.2797 0.3296 0.3302 0.0539  0.0212  0.0374  269 HIS A N   
235  C CA  . HIS A 61  ? 0.2924 0.3333 0.3391 0.0588  0.0249  0.0387  269 HIS A CA  
236  C C   . HIS A 61  ? 0.2937 0.3195 0.3342 0.0574  0.0241  0.0362  269 HIS A C   
237  O O   . HIS A 61  ? 0.2936 0.3107 0.3309 0.0606  0.0263  0.0370  269 HIS A O   
238  C CB  . HIS A 61  ? 0.2916 0.3328 0.3379 0.0600  0.0285  0.0389  269 HIS A CB  
239  C CG  . HIS A 61  ? 0.2968 0.3321 0.3395 0.0552  0.0278  0.0357  269 HIS A CG  
240  N ND1 . HIS A 61  ? 0.2803 0.3227 0.3267 0.0500  0.0258  0.0344  269 HIS A ND1 
241  C CD2 . HIS A 61  ? 0.2916 0.3138 0.3264 0.0552  0.0289  0.0335  269 HIS A CD2 
242  C CE1 . HIS A 61  ? 0.2912 0.3248 0.3321 0.0474  0.0263  0.0321  269 HIS A CE1 
243  N NE2 . HIS A 61  ? 0.3079 0.3297 0.3415 0.0507  0.0278  0.0315  269 HIS A NE2 
244  N N   . ILE A 62  ? 0.2922 0.3151 0.3315 0.0524  0.0210  0.0332  270 ILE A N   
245  C CA  . ILE A 62  ? 0.2959 0.3076 0.3314 0.0506  0.0194  0.0308  270 ILE A CA  
246  C C   . ILE A 62  ? 0.2964 0.3076 0.3345 0.0510  0.0188  0.0322  270 ILE A C   
247  O O   . ILE A 62  ? 0.2972 0.2994 0.3339 0.0505  0.0187  0.0311  270 ILE A O   
248  C CB  . ILE A 62  ? 0.2930 0.3031 0.3267 0.0462  0.0165  0.0278  270 ILE A CB  
249  C CG1 . ILE A 62  ? 0.2929 0.2995 0.3219 0.0464  0.0181  0.0267  270 ILE A CG1 
250  C CG2 . ILE A 62  ? 0.2984 0.3009 0.3308 0.0443  0.0138  0.0257  270 ILE A CG2 
251  C CD1 . ILE A 62  ? 0.2845 0.2897 0.3108 0.0430  0.0164  0.0247  270 ILE A CD1 
252  N N   . PHE A 63  ? 0.2945 0.3152 0.3361 0.0521  0.0186  0.0346  271 PHE A N   
253  C CA  . PHE A 63  ? 0.2989 0.3196 0.3421 0.0529  0.0186  0.0364  271 PHE A CA  
254  C C   . PHE A 63  ? 0.3104 0.3332 0.3540 0.0585  0.0216  0.0406  271 PHE A C   
255  O O   . PHE A 63  ? 0.3166 0.3348 0.3600 0.0599  0.0233  0.0425  271 PHE A O   
256  C CB  . PHE A 63  ? 0.2883 0.3160 0.3327 0.0503  0.0158  0.0358  271 PHE A CB  
257  C CG  . PHE A 63  ? 0.2970 0.3207 0.3404 0.0458  0.0136  0.0324  271 PHE A CG  
258  C CD1 . PHE A 63  ? 0.2754 0.3005 0.3173 0.0435  0.0125  0.0302  271 PHE A CD1 
259  C CD2 . PHE A 63  ? 0.2931 0.3113 0.3372 0.0443  0.0130  0.0317  271 PHE A CD2 
260  C CE1 . PHE A 63  ? 0.2564 0.2765 0.2960 0.0405  0.0108  0.0275  271 PHE A CE1 
261  C CE2 . PHE A 63  ? 0.3006 0.3159 0.3439 0.0413  0.0109  0.0290  271 PHE A CE2 
262  C CZ  . PHE A 63  ? 0.2940 0.3097 0.3342 0.0397  0.0097  0.0270  271 PHE A CZ  
263  N N   . LYS A 64  ? 0.3158 0.3454 0.3600 0.0620  0.0228  0.0423  272 LYS A N   
264  C CA  . LYS A 64  ? 0.3310 0.3647 0.3754 0.0685  0.0254  0.0468  272 LYS A CA  
265  C C   . LYS A 64  ? 0.3385 0.3587 0.3795 0.0715  0.0296  0.0485  272 LYS A C   
266  O O   . LYS A 64  ? 0.3382 0.3487 0.3765 0.0716  0.0316  0.0469  272 LYS A O   
267  C CB  . LYS A 64  ? 0.3363 0.3791 0.3831 0.0718  0.0266  0.0482  272 LYS A CB  
268  C CG  . LYS A 64  ? 0.3593 0.4103 0.4073 0.0795  0.0284  0.0533  272 LYS A CG  
269  C CD  . LYS A 64  ? 0.4119 0.4723 0.4637 0.0831  0.0302  0.0550  272 LYS A CD  
270  C CE  . LYS A 64  ? 0.4451 0.5123 0.4977 0.0924  0.0329  0.0606  272 LYS A CE  
271  N NZ  . LYS A 64  ? 0.4519 0.5288 0.5095 0.0959  0.0352  0.0623  272 LYS A NZ  
272  N N   . ASP A 65  ? 0.3419 0.3607 0.3823 0.0739  0.0310  0.0515  273 ASP A N   
273  C CA  . ASP A 65  ? 0.3615 0.3671 0.3990 0.0767  0.0358  0.0538  273 ASP A CA  
274  C C   . ASP A 65  ? 0.3635 0.3559 0.4008 0.0707  0.0357  0.0498  273 ASP A C   
275  O O   . ASP A 65  ? 0.3760 0.3554 0.4105 0.0717  0.0394  0.0501  273 ASP A O   
276  C CB  . ASP A 65  ? 0.3729 0.3756 0.4072 0.0838  0.0400  0.0568  273 ASP A CB  
277  C CG  . ASP A 65  ? 0.3916 0.4089 0.4271 0.0909  0.0400  0.0614  273 ASP A CG  
278  O OD1 . ASP A 65  ? 0.4156 0.4388 0.4512 0.0924  0.0388  0.0639  273 ASP A OD1 
279  O OD2 . ASP A 65  ? 0.4162 0.4395 0.4524 0.0952  0.0411  0.0628  273 ASP A OD2 
280  N N   . LYS A 66  ? 0.3511 0.3466 0.3913 0.0645  0.0314  0.0461  274 LYS A N   
281  C CA  . LYS A 66  ? 0.3492 0.3351 0.3903 0.0588  0.0300  0.0421  274 LYS A CA  
282  C C   . LYS A 66  ? 0.3464 0.3315 0.3920 0.0557  0.0302  0.0430  274 LYS A C   
283  O O   . LYS A 66  ? 0.3368 0.3297 0.3836 0.0574  0.0304  0.0456  274 LYS A O   
284  C CB  . LYS A 66  ? 0.3431 0.3325 0.3842 0.0547  0.0254  0.0377  274 LYS A CB  
285  C CG  . LYS A 66  ? 0.3511 0.3408 0.3880 0.0570  0.0257  0.0366  274 LYS A CG  
286  C CD  . LYS A 66  ? 0.3721 0.3487 0.4038 0.0591  0.0288  0.0359  274 LYS A CD  
287  C CE  . LYS A 66  ? 0.3757 0.3532 0.4029 0.0625  0.0302  0.0356  274 LYS A CE  
288  N NZ  . LYS A 66  ? 0.4075 0.3707 0.4278 0.0654  0.0337  0.0348  274 LYS A NZ  
289  N N   . VAL A 67  ? 0.3419 0.3180 0.3899 0.0512  0.0301  0.0405  275 VAL A N   
290  C CA  . VAL A 67  ? 0.3368 0.3137 0.3913 0.0472  0.0300  0.0407  275 VAL A CA  
291  C C   . VAL A 67  ? 0.3237 0.3063 0.3810 0.0429  0.0244  0.0367  275 VAL A C   
292  O O   . VAL A 67  ? 0.3227 0.3015 0.3787 0.0401  0.0211  0.0325  275 VAL A O   
293  C CB  . VAL A 67  ? 0.3451 0.3102 0.4029 0.0440  0.0329  0.0404  275 VAL A CB  
294  C CG1 . VAL A 67  ? 0.3389 0.3069 0.4055 0.0400  0.0335  0.0413  275 VAL A CG1 
295  C CG2 . VAL A 67  ? 0.3713 0.3280 0.4244 0.0491  0.0393  0.0446  275 VAL A CG2 
296  N N   . VAL A 68  ? 0.3149 0.3059 0.3749 0.0430  0.0237  0.0381  276 VAL A N   
297  C CA  . VAL A 68  ? 0.3053 0.3019 0.3666 0.0403  0.0192  0.0352  276 VAL A CA  
298  C C   . VAL A 68  ? 0.3055 0.3040 0.3745 0.0376  0.0195  0.0358  276 VAL A C   
299  O O   . VAL A 68  ? 0.3081 0.3076 0.3799 0.0390  0.0235  0.0395  276 VAL A O   
300  C CB  . VAL A 68  ? 0.2997 0.3041 0.3567 0.0429  0.0183  0.0360  276 VAL A CB  
301  C CG1 . VAL A 68  ? 0.2945 0.3022 0.3514 0.0404  0.0145  0.0330  276 VAL A CG1 
302  C CG2 . VAL A 68  ? 0.2947 0.2999 0.3465 0.0457  0.0185  0.0362  276 VAL A CG2 
303  N N   . LEU A 69  ? 0.2991 0.2987 0.3716 0.0342  0.0154  0.0324  277 LEU A N   
304  C CA  . LEU A 69  ? 0.2967 0.3009 0.3777 0.0321  0.0151  0.0330  277 LEU A CA  
305  C C   . LEU A 69  ? 0.2919 0.3020 0.3703 0.0333  0.0122  0.0319  277 LEU A C   
306  O O   . LEU A 69  ? 0.2875 0.2968 0.3616 0.0328  0.0082  0.0288  277 LEU A O   
307  C CB  . LEU A 69  ? 0.2970 0.2986 0.3851 0.0273  0.0121  0.0299  277 LEU A CB  
308  C CG  . LEU A 69  ? 0.3047 0.3134 0.4041 0.0247  0.0107  0.0301  277 LEU A CG  
309  C CD1 . LEU A 69  ? 0.3058 0.3173 0.4125 0.0254  0.0170  0.0351  277 LEU A CD1 
310  C CD2 . LEU A 69  ? 0.2993 0.3061 0.4052 0.0195  0.0062  0.0262  277 LEU A CD2 
311  N N   . ASP A 70  ? 0.2945 0.3091 0.3747 0.0352  0.0149  0.0348  278 ASP A N   
312  C CA  . ASP A 70  ? 0.2968 0.3151 0.3737 0.0367  0.0133  0.0341  278 ASP A CA  
313  C C   . ASP A 70  ? 0.2967 0.3197 0.3832 0.0359  0.0132  0.0349  278 ASP A C   
314  O O   . ASP A 70  ? 0.3009 0.3266 0.3930 0.0369  0.0174  0.0383  278 ASP A O   
315  C CB  . ASP A 70  ? 0.2997 0.3188 0.3695 0.0400  0.0163  0.0363  278 ASP A CB  
316  C CG  . ASP A 70  ? 0.3168 0.3376 0.3819 0.0416  0.0155  0.0355  278 ASP A CG  
317  O OD1 . ASP A 70  ? 0.3588 0.3794 0.4173 0.0439  0.0176  0.0367  278 ASP A OD1 
318  O OD2 . ASP A 70  ? 0.3251 0.3465 0.3918 0.0408  0.0129  0.0337  278 ASP A OD2 
319  N N   . VAL A 71  ? 0.2973 0.3217 0.3858 0.0344  0.0084  0.0319  279 VAL A N   
320  C CA  . VAL A 71  ? 0.2920 0.3228 0.3911 0.0337  0.0070  0.0324  279 VAL A CA  
321  C C   . VAL A 71  ? 0.2970 0.3313 0.3936 0.0378  0.0085  0.0341  279 VAL A C   
322  O O   . VAL A 71  ? 0.2947 0.3265 0.3823 0.0397  0.0061  0.0323  279 VAL A O   
323  C CB  . VAL A 71  ? 0.2961 0.3273 0.3974 0.0311  0.0004  0.0284  279 VAL A CB  
324  C CG1 . VAL A 71  ? 0.2921 0.3323 0.4059 0.0304  -0.0019 0.0288  279 VAL A CG1 
325  C CG2 . VAL A 71  ? 0.2875 0.3129 0.3894 0.0272  -0.0005 0.0263  279 VAL A CG2 
326  N N   . GLY A 72  ? 0.2959 0.3349 0.4000 0.0393  0.0130  0.0377  280 GLY A N   
327  C CA  . GLY A 72  ? 0.2979 0.3386 0.3984 0.0439  0.0158  0.0398  280 GLY A CA  
328  C C   . GLY A 72  ? 0.3013 0.3351 0.3876 0.0463  0.0184  0.0398  280 GLY A C   
329  O O   . GLY A 72  ? 0.3086 0.3386 0.3848 0.0479  0.0168  0.0379  280 GLY A O   
330  N N   . CYS A 73  ? 0.2954 0.3275 0.3807 0.0463  0.0224  0.0421  281 CYS A N   
331  C CA  . CYS A 73  ? 0.3008 0.3277 0.3734 0.0478  0.0235  0.0416  281 CYS A CA  
332  C C   . CYS A 73  ? 0.3019 0.3263 0.3649 0.0519  0.0264  0.0425  281 CYS A C   
333  O O   . CYS A 73  ? 0.3146 0.3350 0.3664 0.0525  0.0258  0.0410  281 CYS A O   
334  C CB  . CYS A 73  ? 0.2946 0.3205 0.3684 0.0475  0.0265  0.0440  281 CYS A CB  
335  S SG  . CYS A 73  ? 0.3211 0.3491 0.4022 0.0500  0.0340  0.0496  281 CYS A SG  
336  N N   . GLY A 74  ? 0.3006 0.3276 0.3681 0.0548  0.0295  0.0448  282 GLY A N   
337  C CA  . GLY A 74  ? 0.2991 0.3219 0.3562 0.0593  0.0331  0.0456  282 GLY A CA  
338  C C   . GLY A 74  ? 0.3028 0.3221 0.3513 0.0612  0.0365  0.0472  282 GLY A C   
339  O O   . GLY A 74  ? 0.3006 0.3224 0.3552 0.0616  0.0399  0.0506  282 GLY A O   
340  N N   . THR A 75  ? 0.3091 0.3223 0.3429 0.0623  0.0353  0.0446  283 THR A N   
341  C CA  . THR A 75  ? 0.3174 0.3274 0.3404 0.0644  0.0370  0.0452  283 THR A CA  
342  C C   . THR A 75  ? 0.3116 0.3244 0.3366 0.0620  0.0344  0.0452  283 THR A C   
343  O O   . THR A 75  ? 0.3117 0.3236 0.3298 0.0645  0.0360  0.0468  283 THR A O   
344  C CB  . THR A 75  ? 0.3281 0.3313 0.3355 0.0646  0.0346  0.0410  283 THR A CB  
345  O OG1 . THR A 75  ? 0.3248 0.3282 0.3324 0.0596  0.0289  0.0368  283 THR A OG1 
346  C CG2 . THR A 75  ? 0.3412 0.3390 0.3435 0.0682  0.0381  0.0411  283 THR A CG2 
347  N N   . GLY A 76  ? 0.2977 0.3136 0.3309 0.0577  0.0306  0.0434  284 GLY A N   
348  C CA  . GLY A 76  ? 0.2905 0.3084 0.3259 0.0559  0.0287  0.0436  284 GLY A CA  
349  C C   . GLY A 76  ? 0.2880 0.3060 0.3167 0.0535  0.0236  0.0397  284 GLY A C   
350  O O   . GLY A 76  ? 0.2894 0.3098 0.3187 0.0530  0.0222  0.0400  284 GLY A O   
351  N N   . ILE A 77  ? 0.2883 0.3036 0.3108 0.0522  0.0215  0.0363  285 ILE A N   
352  C CA  . ILE A 77  ? 0.2978 0.3133 0.3141 0.0493  0.0173  0.0326  285 ILE A CA  
353  C C   . ILE A 77  ? 0.2822 0.3010 0.3052 0.0462  0.0146  0.0317  285 ILE A C   
354  O O   . ILE A 77  ? 0.2803 0.3026 0.3017 0.0453  0.0126  0.0310  285 ILE A O   
355  C CB  . ILE A 77  ? 0.3114 0.3211 0.3193 0.0479  0.0164  0.0291  285 ILE A CB  
356  C CG1 . ILE A 77  ? 0.3220 0.3324 0.3243 0.0440  0.0125  0.0253  285 ILE A CG1 
357  C CG2 . ILE A 77  ? 0.3265 0.3336 0.3392 0.0468  0.0165  0.0284  285 ILE A CG2 
358  C CD1 . ILE A 77  ? 0.3308 0.3438 0.3262 0.0452  0.0112  0.0250  285 ILE A CD1 
359  N N   . LEU A 78  ? 0.2750 0.2930 0.3050 0.0450  0.0146  0.0318  286 LEU A N   
360  C CA  . LEU A 78  ? 0.2698 0.2891 0.3044 0.0427  0.0125  0.0308  286 LEU A CA  
361  C C   . LEU A 78  ? 0.2648 0.2868 0.3034 0.0440  0.0137  0.0333  286 LEU A C   
362  O O   . LEU A 78  ? 0.2586 0.2824 0.2976 0.0433  0.0124  0.0328  286 LEU A O   
363  C CB  . LEU A 78  ? 0.2721 0.2893 0.3117 0.0415  0.0116  0.0299  286 LEU A CB  
364  C CG  . LEU A 78  ? 0.3034 0.3169 0.3389 0.0411  0.0107  0.0279  286 LEU A CG  
365  C CD1 . LEU A 78  ? 0.3278 0.3405 0.3678 0.0405  0.0087  0.0271  286 LEU A CD1 
366  C CD2 . LEU A 78  ? 0.3313 0.3425 0.3590 0.0390  0.0096  0.0253  286 LEU A CD2 
367  N N   . SER A 79  ? 0.2591 0.2809 0.3006 0.0464  0.0169  0.0365  287 SER A N   
368  C CA  . SER A 79  ? 0.2616 0.2841 0.3056 0.0484  0.0192  0.0396  287 SER A CA  
369  C C   . SER A 79  ? 0.2549 0.2808 0.2922 0.0509  0.0184  0.0403  287 SER A C   
370  O O   . SER A 79  ? 0.2606 0.2880 0.2989 0.0521  0.0185  0.0416  287 SER A O   
371  C CB  . SER A 79  ? 0.2620 0.2829 0.3102 0.0503  0.0237  0.0433  287 SER A CB  
372  O OG  . SER A 79  ? 0.2836 0.3036 0.3405 0.0475  0.0237  0.0426  287 SER A OG  
373  N N   . MET A 80  ? 0.2550 0.2820 0.2851 0.0518  0.0175  0.0394  288 MET A N   
374  C CA  . MET A 80  ? 0.2579 0.2895 0.2815 0.0537  0.0155  0.0393  288 MET A CA  
375  C C   . MET A 80  ? 0.2526 0.2887 0.2774 0.0504  0.0114  0.0362  288 MET A C   
376  O O   . MET A 80  ? 0.2564 0.2984 0.2811 0.0521  0.0101  0.0372  288 MET A O   
377  C CB  . MET A 80  ? 0.2633 0.2937 0.2775 0.0553  0.0152  0.0385  288 MET A CB  
378  C CG  . MET A 80  ? 0.2649 0.2912 0.2774 0.0596  0.0204  0.0425  288 MET A CG  
379  S SD  . MET A 80  ? 0.3019 0.3259 0.2999 0.0635  0.0206  0.0421  288 MET A SD  
380  C CE  . MET A 80  ? 0.2878 0.3068 0.2835 0.0593  0.0192  0.0373  288 MET A CE  
381  N N   . PHE A 81  ? 0.2480 0.2817 0.2744 0.0462  0.0100  0.0329  289 PHE A N   
382  C CA  . PHE A 81  ? 0.2463 0.2835 0.2747 0.0430  0.0075  0.0306  289 PHE A CA  
383  C C   . PHE A 81  ? 0.2430 0.2823 0.2770 0.0449  0.0087  0.0329  289 PHE A C   
384  O O   . PHE A 81  ? 0.2416 0.2874 0.2771 0.0455  0.0076  0.0333  289 PHE A O   
385  C CB  . PHE A 81  ? 0.2402 0.2723 0.2688 0.0392  0.0070  0.0276  289 PHE A CB  
386  C CG  . PHE A 81  ? 0.2469 0.2756 0.2691 0.0369  0.0061  0.0249  289 PHE A CG  
387  C CD1 . PHE A 81  ? 0.2502 0.2718 0.2709 0.0356  0.0069  0.0234  289 PHE A CD1 
388  C CD2 . PHE A 81  ? 0.2453 0.2771 0.2620 0.0364  0.0043  0.0235  289 PHE A CD2 
389  C CE1 . PHE A 81  ? 0.2656 0.2820 0.2791 0.0340  0.0069  0.0210  289 PHE A CE1 
390  C CE2 . PHE A 81  ? 0.2534 0.2796 0.2626 0.0341  0.0037  0.0204  289 PHE A CE2 
391  C CZ  . PHE A 81  ? 0.2601 0.2780 0.2676 0.0330  0.0055  0.0193  289 PHE A CZ  
392  N N   . ALA A 82  ? 0.2407 0.2743 0.2780 0.0457  0.0110  0.0343  290 ALA A N   
393  C CA  . ALA A 82  ? 0.2498 0.2820 0.2909 0.0471  0.0126  0.0359  290 ALA A CA  
394  C C   . ALA A 82  ? 0.2501 0.2860 0.2905 0.0518  0.0142  0.0396  290 ALA A C   
395  O O   . ALA A 82  ? 0.2501 0.2884 0.2917 0.0538  0.0147  0.0406  290 ALA A O   
396  C CB  . ALA A 82  ? 0.2435 0.2685 0.2882 0.0461  0.0142  0.0360  290 ALA A CB  
397  N N   . ALA A 83  ? 0.2563 0.2925 0.2938 0.0544  0.0155  0.0418  291 ALA A N   
398  C CA  . ALA A 83  ? 0.2724 0.3118 0.3074 0.0599  0.0171  0.0458  291 ALA A CA  
399  C C   . ALA A 83  ? 0.2826 0.3323 0.3158 0.0611  0.0135  0.0451  291 ALA A C   
400  O O   . ALA A 83  ? 0.2781 0.3320 0.3123 0.0652  0.0141  0.0477  291 ALA A O   
401  C CB  . ALA A 83  ? 0.2843 0.3213 0.3150 0.0628  0.0195  0.0484  291 ALA A CB  
402  N N   . LYS A 84  ? 0.2892 0.3429 0.3203 0.0574  0.0097  0.0415  292 LYS A N   
403  C CA  . LYS A 84  ? 0.3013 0.3658 0.3324 0.0568  0.0056  0.0400  292 LYS A CA  
404  C C   . LYS A 84  ? 0.2966 0.3654 0.3344 0.0554  0.0056  0.0396  292 LYS A C   
405  O O   . LYS A 84  ? 0.2856 0.3650 0.3261 0.0576  0.0039  0.0408  292 LYS A O   
406  C CB  . LYS A 84  ? 0.3108 0.3757 0.3376 0.0519  0.0021  0.0356  292 LYS A CB  
407  C CG  . LYS A 84  ? 0.3649 0.4406 0.3931 0.0486  -0.0026 0.0327  292 LYS A CG  
408  C CD  . LYS A 84  ? 0.4520 0.5368 0.4760 0.0528  -0.0059 0.0340  292 LYS A CD  
409  C CE  . LYS A 84  ? 0.4845 0.5835 0.5138 0.0498  -0.0109 0.0319  292 LYS A CE  
410  N NZ  . LYS A 84  ? 0.5404 0.6495 0.5652 0.0542  -0.0153 0.0330  292 LYS A NZ  
411  N N   . ALA A 85  ? 0.2913 0.3524 0.3317 0.0525  0.0076  0.0383  293 ALA A N   
412  C CA  . ALA A 85  ? 0.2957 0.3587 0.3407 0.0519  0.0086  0.0380  293 ALA A CA  
413  C C   . ALA A 85  ? 0.3058 0.3669 0.3520 0.0577  0.0120  0.0419  293 ALA A C   
414  O O   . ALA A 85  ? 0.3063 0.3674 0.3551 0.0584  0.0138  0.0422  293 ALA A O   
415  C CB  . ALA A 85  ? 0.2913 0.3457 0.3362 0.0474  0.0093  0.0350  293 ALA A CB  
416  N N   . GLY A 86  ? 0.3134 0.3716 0.3570 0.0620  0.0138  0.0450  294 GLY A N   
417  C CA  . GLY A 86  ? 0.3221 0.3777 0.3654 0.0682  0.0175  0.0493  294 GLY A CA  
418  C C   . GLY A 86  ? 0.3252 0.3667 0.3676 0.0683  0.0216  0.0500  294 GLY A C   
419  O O   . GLY A 86  ? 0.3211 0.3576 0.3628 0.0726  0.0253  0.0528  294 GLY A O   
420  N N   . ALA A 87  ? 0.2841 0.3295 0.3705 0.0433  0.0176  0.0130  295 ALA A N   
421  C CA  . ALA A 87  ? 0.3044 0.3307 0.3911 0.0429  0.0166  0.0191  295 ALA A CA  
422  C C   . ALA A 87  ? 0.3285 0.3393 0.4129 0.0533  0.0125  0.0240  295 ALA A C   
423  O O   . ALA A 87  ? 0.3399 0.3489 0.4197 0.0581  0.0118  0.0290  295 ALA A O   
424  C CB  . ALA A 87  ? 0.2884 0.3059 0.3733 0.0336  0.0201  0.0282  295 ALA A CB  
425  N N   . LYS A 88  ? 0.3422 0.3405 0.4281 0.0563  0.0093  0.0225  296 LYS A N   
426  C CA  . LYS A 88  ? 0.3706 0.3484 0.4518 0.0646  0.0049  0.0281  296 LYS A CA  
427  C C   . LYS A 88  ? 0.3698 0.3322 0.4467 0.0579  0.0083  0.0417  296 LYS A C   
428  O O   . LYS A 88  ? 0.3807 0.3323 0.4502 0.0623  0.0072  0.0494  296 LYS A O   
429  C CB  . LYS A 88  ? 0.3835 0.3506 0.4674 0.0683  0.0006  0.0219  296 LYS A CB  
430  C CG  . LYS A 88  ? 0.4402 0.3796 0.5175 0.0746  -0.0043 0.0287  296 LYS A CG  
431  C CD  . LYS A 88  ? 0.5103 0.4427 0.5888 0.0856  -0.0114 0.0183  296 LYS A CD  
432  C CE  . LYS A 88  ? 0.5316 0.4692 0.6175 0.0802  -0.0104 0.0088  296 LYS A CE  
433  N NZ  . LYS A 88  ? 0.5556 0.4769 0.6413 0.0682  -0.0078 0.0166  296 LYS A NZ  
434  N N   . LYS A 89  ? 0.3609 0.3240 0.4420 0.0471  0.0123  0.0441  297 LYS A N   
435  C CA  . LYS A 89  ? 0.3636 0.3166 0.4437 0.0399  0.0160  0.0549  297 LYS A CA  
436  C C   . LYS A 89  ? 0.3420 0.3067 0.4273 0.0308  0.0200  0.0546  297 LYS A C   
437  O O   . LYS A 89  ? 0.3355 0.3063 0.4248 0.0272  0.0192  0.0480  297 LYS A O   
438  C CB  . LYS A 89  ? 0.3819 0.3151 0.4623 0.0376  0.0140  0.0582  297 LYS A CB  
439  C CG  . LYS A 89  ? 0.4219 0.3454 0.5019 0.0294  0.0181  0.0689  297 LYS A CG  
440  C CD  . LYS A 89  ? 0.4779 0.3976 0.5491 0.0321  0.0205  0.0777  297 LYS A CD  
441  C CE  . LYS A 89  ? 0.5190 0.4219 0.5794 0.0415  0.0153  0.0797  297 LYS A CE  
442  N NZ  . LYS A 89  ? 0.5487 0.4494 0.5983 0.0444  0.0171  0.0879  297 LYS A NZ  
443  N N   . VAL A 90  ? 0.3326 0.3001 0.4168 0.0276  0.0239  0.0612  298 VAL A N   
444  C CA  . VAL A 90  ? 0.3189 0.2938 0.4077 0.0202  0.0265  0.0617  298 VAL A CA  
445  C C   . VAL A 90  ? 0.3214 0.2907 0.4136 0.0154  0.0295  0.0695  298 VAL A C   
446  O O   . VAL A 90  ? 0.3256 0.2913 0.4139 0.0171  0.0321  0.0756  298 VAL A O   
447  C CB  . VAL A 90  ? 0.3066 0.2937 0.3925 0.0205  0.0283  0.0597  298 VAL A CB  
448  C CG1 . VAL A 90  ? 0.3040 0.2952 0.3931 0.0137  0.0288  0.0587  298 VAL A CG1 
449  C CG2 . VAL A 90  ? 0.3006 0.2962 0.3835 0.0246  0.0262  0.0520  298 VAL A CG2 
450  N N   . LEU A 91  ? 0.3172 0.2873 0.4163 0.0092  0.0292  0.0687  299 LEU A N   
451  C CA  . LEU A 91  ? 0.3227 0.2926 0.4278 0.0041  0.0321  0.0741  299 LEU A CA  
452  C C   . LEU A 91  ? 0.3111 0.2922 0.4201 0.0024  0.0328  0.0729  299 LEU A C   
453  O O   . LEU A 91  ? 0.3084 0.2921 0.4191 0.0005  0.0295  0.0685  299 LEU A O   
454  C CB  . LEU A 91  ? 0.3324 0.2947 0.4436 -0.0013 0.0300  0.0735  299 LEU A CB  
455  C CG  . LEU A 91  ? 0.3745 0.3218 0.4809 0.0008  0.0277  0.0735  299 LEU A CG  
456  C CD1 . LEU A 91  ? 0.4133 0.3532 0.5254 -0.0046 0.0246  0.0705  299 LEU A CD1 
457  C CD2 . LEU A 91  ? 0.3967 0.3340 0.4970 0.0016  0.0307  0.0815  299 LEU A CD2 
458  N N   . GLY A 92  ? 0.3079 0.2946 0.4170 0.0036  0.0367  0.0764  300 GLY A N   
459  C CA  . GLY A 92  ? 0.3026 0.2981 0.4153 0.0037  0.0367  0.0748  300 GLY A CA  
460  C C   . GLY A 92  ? 0.3084 0.3098 0.4317 0.0001  0.0389  0.0770  300 GLY A C   
461  O O   . GLY A 92  ? 0.3182 0.3214 0.4429 -0.0011 0.0439  0.0813  300 GLY A O   
462  N N   . VAL A 93  ? 0.3070 0.3124 0.4375 -0.0016 0.0350  0.0738  301 VAL A N   
463  C CA  . VAL A 93  ? 0.3158 0.3303 0.4591 -0.0048 0.0360  0.0740  301 VAL A CA  
464  C C   . VAL A 93  ? 0.3153 0.3388 0.4626 -0.0003 0.0336  0.0708  301 VAL A C   
465  O O   . VAL A 93  ? 0.3105 0.3292 0.4518 0.0023  0.0282  0.0682  301 VAL A O   
466  C CB  . VAL A 93  ? 0.3167 0.3286 0.4669 -0.0105 0.0318  0.0722  301 VAL A CB  
467  C CG1 . VAL A 93  ? 0.3300 0.3546 0.4954 -0.0146 0.0331  0.0716  301 VAL A CG1 
468  C CG2 . VAL A 93  ? 0.3272 0.3269 0.4724 -0.0138 0.0330  0.0743  301 VAL A CG2 
469  N N   . ASP A 94  ? 0.3213 0.3574 0.4776 0.0004  0.0378  0.0709  302 ASP A N   
470  C CA  . ASP A 94  ? 0.3267 0.3721 0.4887 0.0063  0.0349  0.0667  302 ASP A CA  
471  C C   . ASP A 94  ? 0.3343 0.3979 0.5123 0.0045  0.0392  0.0653  302 ASP A C   
472  O O   . ASP A 94  ? 0.3332 0.4017 0.5129 -0.0004 0.0470  0.0687  302 ASP A O   
473  C CB  . ASP A 94  ? 0.3238 0.3662 0.4754 0.0127  0.0365  0.0662  302 ASP A CB  
474  C CG  . ASP A 94  ? 0.3446 0.3875 0.4966 0.0197  0.0303  0.0614  302 ASP A CG  
475  O OD1 . ASP A 94  ? 0.3433 0.3993 0.5080 0.0230  0.0294  0.0578  302 ASP A OD1 
476  O OD2 . ASP A 94  ? 0.3439 0.3739 0.4833 0.0218  0.0260  0.0608  302 ASP A OD2 
477  N N   . GLN A 95  ? 0.3430 0.4173 0.5324 0.0082  0.0339  0.0601  303 GLN A N   
478  C CA  . GLN A 95  ? 0.3567 0.4532 0.5642 0.0066  0.0378  0.0568  303 GLN A CA  
479  C C   . GLN A 95  ? 0.3572 0.4674 0.5680 0.0137  0.0425  0.0533  303 GLN A C   
480  O O   . GLN A 95  ? 0.3599 0.4915 0.5850 0.0116  0.0484  0.0505  303 GLN A O   
481  C CB  . GLN A 95  ? 0.3585 0.4636 0.5794 0.0074  0.0294  0.0516  303 GLN A CB  
482  C CG  . GLN A 95  ? 0.3864 0.4831 0.6015 0.0172  0.0186  0.0481  303 GLN A CG  
483  C CD  . GLN A 95  ? 0.4300 0.5317 0.6549 0.0171  0.0091  0.0443  303 GLN A CD  
484  O OE1 . GLN A 95  ? 0.4197 0.5430 0.6635 0.0172  0.0088  0.0392  303 GLN A OE1 
485  N NE2 . GLN A 95  ? 0.4430 0.5263 0.6549 0.0165  0.0013  0.0461  303 GLN A NE2 
486  N N   . SER A 96  ? 0.3590 0.4577 0.5566 0.0214  0.0402  0.0530  304 SER A N   
487  C CA  . SER A 96  ? 0.3645 0.4733 0.5634 0.0298  0.0430  0.0483  304 SER A CA  
488  C C   . SER A 96  ? 0.3622 0.4734 0.5530 0.0269  0.0536  0.0520  304 SER A C   
489  O O   . SER A 96  ? 0.3612 0.4596 0.5406 0.0206  0.0566  0.0588  304 SER A O   
490  C CB  . SER A 96  ? 0.3725 0.4653 0.5600 0.0390  0.0342  0.0455  304 SER A CB  
491  O OG  . SER A 96  ? 0.3991 0.4921 0.5792 0.0449  0.0383  0.0434  304 SER A OG  
492  N N   . GLU A 97  ? 0.3568 0.4841 0.5526 0.0325  0.0585  0.0469  305 GLU A N   
493  C CA  . GLU A 97  ? 0.3563 0.4880 0.5433 0.0309  0.0684  0.0494  305 GLU A CA  
494  C C   . GLU A 97  ? 0.3501 0.4611 0.5167 0.0333  0.0668  0.0531  305 GLU A C   
495  O O   . GLU A 97  ? 0.3493 0.4593 0.5055 0.0303  0.0737  0.0574  305 GLU A O   
496  C CB  . GLU A 97  ? 0.3558 0.5101 0.5522 0.0379  0.0731  0.0410  305 GLU A CB  
497  C CG  . GLU A 97  ? 0.3764 0.5578 0.5904 0.0311  0.0813  0.0390  305 GLU A CG  
498  N N   . ILE A 98  ? 0.3420 0.4368 0.5025 0.0382  0.0574  0.0513  306 ILE A N   
499  C CA  . ILE A 98  ? 0.3372 0.4136 0.4800 0.0386  0.0553  0.0541  306 ILE A CA  
500  C C   . ILE A 98  ? 0.3352 0.4045 0.4704 0.0307  0.0591  0.0620  306 ILE A C   
501  O O   . ILE A 98  ? 0.3312 0.3929 0.4532 0.0312  0.0605  0.0642  306 ILE A O   
502  C CB  . ILE A 98  ? 0.3368 0.3964 0.4742 0.0414  0.0449  0.0521  306 ILE A CB  
503  C CG1 . ILE A 98  ? 0.3385 0.3836 0.4591 0.0423  0.0433  0.0523  306 ILE A CG1 
504  C CG2 . ILE A 98  ? 0.3256 0.3792 0.4667 0.0350  0.0408  0.0558  306 ILE A CG2 
505  C CD1 . ILE A 98  ? 0.3450 0.3931 0.4605 0.0491  0.0453  0.0471  306 ILE A CD1 
506  N N   . LEU A 99  ? 0.3320 0.4038 0.4756 0.0239  0.0601  0.0656  307 LEU A N   
507  C CA  . LEU A 99  ? 0.3356 0.3983 0.4724 0.0171  0.0626  0.0726  307 LEU A CA  
508  C C   . LEU A 99  ? 0.3441 0.4091 0.4711 0.0163  0.0703  0.0768  307 LEU A C   
509  O O   . LEU A 99  ? 0.3489 0.4021 0.4640 0.0152  0.0700  0.0815  307 LEU A O   
510  C CB  . LEU A 99  ? 0.3412 0.4067 0.4894 0.0095  0.0628  0.0748  307 LEU A CB  
511  C CG  . LEU A 99  ? 0.3402 0.3911 0.4831 0.0033  0.0613  0.0802  307 LEU A CG  
512  C CD1 . LEU A 99  ? 0.3714 0.4184 0.5061 -0.0013 0.0682  0.0871  307 LEU A CD1 
513  C CD2 . LEU A 99  ? 0.3284 0.3649 0.4611 0.0070  0.0547  0.0791  307 LEU A CD2 
514  N N   . TYR A 100 ? 0.3467 0.4276 0.4782 0.0173  0.0767  0.0747  308 TYR A N   
515  C CA  . TYR A 100 ? 0.3632 0.4469 0.4830 0.0163  0.0843  0.0786  308 TYR A CA  
516  C C   . TYR A 100 ? 0.3572 0.4336 0.4628 0.0235  0.0817  0.0767  308 TYR A C   
517  O O   . TYR A 100 ? 0.3650 0.4351 0.4565 0.0229  0.0841  0.0817  308 TYR A O   
518  C CB  . TYR A 100 ? 0.3768 0.4824 0.5053 0.0148  0.0928  0.0757  308 TYR A CB  
519  C CG  . TYR A 100 ? 0.4043 0.5199 0.5470 0.0055  0.0966  0.0775  308 TYR A CG  
520  C CD1 . TYR A 100 ? 0.4256 0.5637 0.5867 0.0063  0.0988  0.0700  308 TYR A CD1 
521  C CD2 . TYR A 100 ? 0.4300 0.5326 0.5683 -0.0038 0.0973  0.0859  308 TYR A CD2 
522  C CE1 . TYR A 100 ? 0.4492 0.5991 0.6250 -0.0032 0.1021  0.0708  308 TYR A CE1 
523  C CE2 . TYR A 100 ? 0.4718 0.5824 0.6229 -0.0138 0.1005  0.0872  308 TYR A CE2 
524  C CZ  . TYR A 100 ? 0.4661 0.6015 0.6363 -0.0140 0.1032  0.0796  308 TYR A CZ  
525  O OH  . TYR A 100 ? 0.4940 0.6397 0.6781 -0.0250 0.1064  0.0801  308 TYR A OH  
526  N N   . GLN A 101 ? 0.3362 0.4123 0.4444 0.0302  0.0763  0.0695  309 GLN A N   
527  C CA  . GLN A 101 ? 0.3372 0.4050 0.4326 0.0355  0.0729  0.0669  309 GLN A CA  
528  C C   . GLN A 101 ? 0.3267 0.3796 0.4139 0.0330  0.0681  0.0711  309 GLN A C   
529  O O   . GLN A 101 ? 0.3235 0.3723 0.3985 0.0344  0.0684  0.0729  309 GLN A O   
530  C CB  . GLN A 101 ? 0.3372 0.4043 0.4361 0.0418  0.0675  0.0585  309 GLN A CB  
531  C CG  . GLN A 101 ? 0.3611 0.4425 0.4637 0.0477  0.0718  0.0519  309 GLN A CG  
532  C CD  . GLN A 101 ? 0.4069 0.4887 0.4953 0.0511  0.0747  0.0501  309 GLN A CD  
533  O OE1 . GLN A 101 ? 0.4318 0.5028 0.5084 0.0499  0.0720  0.0526  309 GLN A OE1 
534  N NE2 . GLN A 101 ? 0.4315 0.5274 0.5214 0.0555  0.0800  0.0446  309 GLN A NE2 
535  N N   . ALA A 102 ? 0.3155 0.3620 0.4098 0.0296  0.0637  0.0720  310 ALA A N   
536  C CA  . ALA A 102 ? 0.3140 0.3488 0.4027 0.0273  0.0594  0.0747  310 ALA A CA  
537  C C   . ALA A 102 ? 0.3222 0.3535 0.4028 0.0258  0.0626  0.0811  310 ALA A C   
538  O O   . ALA A 102 ? 0.3211 0.3461 0.3925 0.0280  0.0597  0.0814  310 ALA A O   
539  C CB  . ALA A 102 ? 0.3063 0.3369 0.4045 0.0233  0.0554  0.0748  310 ALA A CB  
540  N N   . MET A 103 ? 0.3285 0.3638 0.4119 0.0220  0.0683  0.0860  311 MET A N   
541  C CA  . MET A 103 ? 0.3491 0.3774 0.4218 0.0200  0.0712  0.0935  311 MET A CA  
542  C C   . MET A 103 ? 0.3495 0.3785 0.4077 0.0256  0.0718  0.0935  311 MET A C   
543  O O   . MET A 103 ? 0.3570 0.3766 0.4044 0.0282  0.0685  0.0964  311 MET A O   
544  C CB  . MET A 103 ? 0.3643 0.3978 0.4410 0.0129  0.0785  0.0987  311 MET A CB  
545  C CG  . MET A 103 ? 0.3907 0.4206 0.4797 0.0061  0.0771  0.0999  311 MET A CG  
546  S SD  . MET A 103 ? 0.4774 0.5187 0.5752 -0.0043 0.0861  0.1037  311 MET A SD  
547  C CE  . MET A 103 ? 0.4829 0.5092 0.5863 -0.0123 0.0821  0.1072  311 MET A CE  
548  N N   . ASP A 104 ? 0.3409 0.3815 0.3992 0.0284  0.0752  0.0891  312 ASP A N   
549  C CA  . ASP A 104 ? 0.3468 0.3898 0.3916 0.0336  0.0757  0.0877  312 ASP A CA  
550  C C   . ASP A 104 ? 0.3275 0.3654 0.3688 0.0382  0.0683  0.0825  312 ASP A C   
551  O O   . ASP A 104 ? 0.3350 0.3702 0.3645 0.0417  0.0660  0.0834  312 ASP A O   
552  C CB  . ASP A 104 ? 0.3515 0.4084 0.3981 0.0357  0.0810  0.0827  312 ASP A CB  
553  C CG  . ASP A 104 ? 0.3993 0.4648 0.4450 0.0308  0.0900  0.0878  312 ASP A CG  
554  O OD1 . ASP A 104 ? 0.4226 0.4799 0.4614 0.0256  0.0920  0.0967  312 ASP A OD1 
555  O OD2 . ASP A 104 ? 0.4398 0.5201 0.4914 0.0318  0.0952  0.0826  312 ASP A OD2 
556  N N   . ILE A 105 ? 0.3092 0.3464 0.3602 0.0376  0.0644  0.0770  313 ILE A N   
557  C CA  . ILE A 105 ? 0.2895 0.3228 0.3378 0.0393  0.0582  0.0718  313 ILE A CA  
558  C C   . ILE A 105 ? 0.2963 0.3232 0.3410 0.0393  0.0546  0.0748  313 ILE A C   
559  O O   . ILE A 105 ? 0.2942 0.3223 0.3313 0.0427  0.0515  0.0724  313 ILE A O   
560  C CB  . ILE A 105 ? 0.2795 0.3107 0.3369 0.0371  0.0550  0.0667  313 ILE A CB  
561  C CG1 . ILE A 105 ? 0.2654 0.3013 0.3240 0.0398  0.0565  0.0618  313 ILE A CG1 
562  C CG2 . ILE A 105 ? 0.2674 0.2940 0.3217 0.0357  0.0494  0.0625  313 ILE A CG2 
563  C CD1 . ILE A 105 ? 0.2542 0.2857 0.3207 0.0389  0.0527  0.0579  313 ILE A CD1 
564  N N   . ILE A 106 ? 0.2966 0.3177 0.3472 0.0360  0.0547  0.0794  314 ILE A N   
565  C CA  . ILE A 106 ? 0.3098 0.3234 0.3576 0.0371  0.0507  0.0814  314 ILE A CA  
566  C C   . ILE A 106 ? 0.3288 0.3400 0.3635 0.0422  0.0504  0.0855  314 ILE A C   
567  O O   . ILE A 106 ? 0.3338 0.3439 0.3640 0.0469  0.0453  0.0830  314 ILE A O   
568  C CB  . ILE A 106 ? 0.3109 0.3169 0.3665 0.0324  0.0509  0.0854  314 ILE A CB  
569  C CG1 . ILE A 106 ? 0.3068 0.3125 0.3708 0.0301  0.0469  0.0799  314 ILE A CG1 
570  C CG2 . ILE A 106 ? 0.3275 0.3224 0.3761 0.0343  0.0491  0.0910  314 ILE A CG2 
571  C CD1 . ILE A 106 ? 0.2925 0.3042 0.3614 0.0280  0.0469  0.0748  314 ILE A CD1 
572  N N   . ARG A 107 ? 0.3388 0.3504 0.3671 0.0414  0.0557  0.0911  315 ARG A N   
573  C CA  . ARG A 107 ? 0.3622 0.3705 0.3748 0.0458  0.0555  0.0960  315 ARG A CA  
574  C C   . ARG A 107 ? 0.3542 0.3712 0.3597 0.0519  0.0525  0.0899  315 ARG A C   
575  O O   . ARG A 107 ? 0.3624 0.3764 0.3578 0.0578  0.0476  0.0907  315 ARG A O   
576  C CB  . ARG A 107 ? 0.3789 0.3870 0.3852 0.0416  0.0631  0.1034  315 ARG A CB  
577  C CG  . ARG A 107 ? 0.4196 0.4152 0.4265 0.0355  0.0651  0.1119  315 ARG A CG  
578  C CD  . ARG A 107 ? 0.4784 0.4745 0.4754 0.0303  0.0731  0.1196  315 ARG A CD  
579  N NE  . ARG A 107 ? 0.5371 0.5171 0.5297 0.0237  0.0742  0.1289  315 ARG A NE  
580  N N   . LEU A 108 ? 0.3384 0.3655 0.3489 0.0508  0.0547  0.0832  316 LEU A N   
581  C CA  . LEU A 108 ? 0.3324 0.3675 0.3370 0.0550  0.0519  0.0760  316 LEU A CA  
582  C C   . LEU A 108 ? 0.3246 0.3607 0.3320 0.0571  0.0448  0.0705  316 LEU A C   
583  O O   . LEU A 108 ? 0.3314 0.3737 0.3319 0.0615  0.0410  0.0661  316 LEU A O   
584  C CB  . LEU A 108 ? 0.3243 0.3661 0.3346 0.0528  0.0545  0.0691  316 LEU A CB  
585  C CG  . LEU A 108 ? 0.3479 0.3956 0.3540 0.0535  0.0608  0.0694  316 LEU A CG  
586  C CD1 . LEU A 108 ? 0.3480 0.3990 0.3619 0.0527  0.0609  0.0611  316 LEU A CD1 
587  C CD2 . LEU A 108 ? 0.3563 0.4084 0.3466 0.0582  0.0607  0.0694  316 LEU A CD2 
588  N N   . ASN A 109 ? 0.3084 0.3404 0.3262 0.0537  0.0432  0.0698  317 ASN A N   
589  C CA  . ASN A 109 ? 0.3038 0.3394 0.3256 0.0548  0.0376  0.0635  317 ASN A CA  
590  C C   . ASN A 109 ? 0.3108 0.3408 0.3305 0.0600  0.0333  0.0667  317 ASN A C   
591  O O   . ASN A 109 ? 0.3008 0.3355 0.3255 0.0617  0.0288  0.0607  317 ASN A O   
592  C CB  . ASN A 109 ? 0.2909 0.3269 0.3234 0.0480  0.0380  0.0590  317 ASN A CB  
593  C CG  . ASN A 109 ? 0.2939 0.3336 0.3262 0.0444  0.0397  0.0540  317 ASN A CG  
594  O OD1 . ASN A 109 ? 0.2815 0.3281 0.3107 0.0441  0.0374  0.0472  317 ASN A OD1 
595  N ND2 . ASN A 109 ? 0.2668 0.3018 0.3025 0.0419  0.0433  0.0569  317 ASN A ND2 
596  N N   . LYS A 110 ? 0.3293 0.3491 0.3407 0.0625  0.0346  0.0758  318 LYS A N   
597  C CA  . LYS A 110 ? 0.3482 0.3570 0.3537 0.0685  0.0297  0.0804  318 LYS A CA  
598  C C   . LYS A 110 ? 0.3449 0.3479 0.3610 0.0667  0.0274  0.0784  318 LYS A C   
599  O O   . LYS A 110 ? 0.3427 0.3442 0.3589 0.0733  0.0211  0.0750  318 LYS A O   
600  C CB  . LYS A 110 ? 0.3583 0.3735 0.3555 0.0781  0.0227  0.0762  318 LYS A CB  
601  C CG  . LYS A 110 ? 0.3752 0.3971 0.3609 0.0798  0.0244  0.0771  318 LYS A CG  
602  C CD  . LYS A 110 ? 0.4254 0.4513 0.4008 0.0903  0.0164  0.0746  318 LYS A CD  
603  C CE  . LYS A 110 ? 0.4501 0.4844 0.4139 0.0916  0.0179  0.0740  318 LYS A CE  
604  N NZ  . LYS A 110 ? 0.4787 0.5026 0.4309 0.0878  0.0248  0.0844  318 LYS A NZ  
605  N N   . LEU A 111 ? 0.3368 0.3373 0.3617 0.0586  0.0322  0.0799  319 LEU A N   
606  C CA  . LEU A 111 ? 0.3365 0.3331 0.3715 0.0558  0.0304  0.0771  319 LEU A CA  
607  C C   . LEU A 111 ? 0.3460 0.3274 0.3818 0.0515  0.0327  0.0851  319 LEU A C   
608  O O   . LEU A 111 ? 0.3303 0.3079 0.3745 0.0480  0.0318  0.0830  319 LEU A O   
609  C CB  . LEU A 111 ? 0.3128 0.3201 0.3578 0.0495  0.0323  0.0702  319 LEU A CB  
610  C CG  . LEU A 111 ? 0.3044 0.3258 0.3504 0.0512  0.0295  0.0606  319 LEU A CG  
611  C CD1 . LEU A 111 ? 0.2981 0.3248 0.3501 0.0430  0.0320  0.0563  319 LEU A CD1 
612  C CD2 . LEU A 111 ? 0.3194 0.3442 0.3680 0.0563  0.0242  0.0546  319 LEU A CD2 
613  N N   . GLU A 112 ? 0.3701 0.3435 0.3963 0.0509  0.0358  0.0939  320 GLU A N   
614  C CA  . GLU A 112 ? 0.4007 0.3608 0.4271 0.0443  0.0392  0.1019  320 GLU A CA  
615  C C   . GLU A 112 ? 0.4181 0.3607 0.4425 0.0467  0.0337  0.1035  320 GLU A C   
616  O O   . GLU A 112 ? 0.4271 0.3599 0.4562 0.0398  0.0355  0.1069  320 GLU A O   
617  C CB  . GLU A 112 ? 0.4193 0.3762 0.4344 0.0415  0.0449  0.1108  320 GLU A CB  
618  C CG  . GLU A 112 ? 0.4715 0.4178 0.4678 0.0487  0.0412  0.1165  320 GLU A CG  
619  C CD  . GLU A 112 ? 0.5013 0.4617 0.4919 0.0559  0.0395  0.1115  320 GLU A CD  
620  O OE1 . GLU A 112 ? 0.4947 0.4706 0.4959 0.0566  0.0391  0.1023  320 GLU A OE1 
621  O OE2 . GLU A 112 ? 0.5406 0.4956 0.5147 0.0605  0.0381  0.1168  320 GLU A OE2 
622  N N   . ASP A 113 ? 0.4250 0.3642 0.4434 0.0567  0.0265  0.1001  321 ASP A N   
623  C CA  . ASP A 113 ? 0.4492 0.3719 0.4664 0.0611  0.0201  0.0994  321 ASP A CA  
624  C C   . ASP A 113 ? 0.4247 0.3549 0.4568 0.0598  0.0182  0.0895  321 ASP A C   
625  O O   . ASP A 113 ? 0.4295 0.3462 0.4627 0.0618  0.0139  0.0880  321 ASP A O   
626  C CB  . ASP A 113 ? 0.4725 0.3882 0.4774 0.0741  0.0120  0.0991  321 ASP A CB  
627  C CG  . ASP A 113 ? 0.5407 0.4419 0.5266 0.0748  0.0128  0.1110  321 ASP A CG  
628  O OD1 . ASP A 113 ? 0.6138 0.5122 0.5878 0.0857  0.0063  0.1112  321 ASP A OD1 
629  O OD2 . ASP A 113 ? 0.5814 0.4746 0.5635 0.0644  0.0199  0.1200  321 ASP A OD2 
630  N N   . THR A 114 ? 0.3936 0.3436 0.4354 0.0561  0.0214  0.0829  322 THR A N   
631  C CA  . THR A 114 ? 0.3751 0.3334 0.4288 0.0529  0.0207  0.0743  322 THR A CA  
632  C C   . THR A 114 ? 0.3593 0.3198 0.4209 0.0420  0.0261  0.0765  322 THR A C   
633  O O   . THR A 114 ? 0.3568 0.3145 0.4254 0.0380  0.0251  0.0734  322 THR A O   
634  C CB  . THR A 114 ? 0.3633 0.3416 0.4205 0.0562  0.0193  0.0643  322 THR A CB  
635  O OG1 . THR A 114 ? 0.3684 0.3479 0.4199 0.0671  0.0137  0.0611  322 THR A OG1 
636  C CG2 . THR A 114 ? 0.3406 0.3268 0.4072 0.0522  0.0188  0.0556  322 THR A CG2 
637  N N   . ILE A 115 ? 0.3513 0.3174 0.4118 0.0381  0.0311  0.0811  323 ILE A N   
638  C CA  . ILE A 115 ? 0.3364 0.3076 0.4054 0.0298  0.0352  0.0817  323 ILE A CA  
639  C C   . ILE A 115 ? 0.3505 0.3146 0.4193 0.0245  0.0396  0.0902  323 ILE A C   
640  O O   . ILE A 115 ? 0.3564 0.3201 0.4175 0.0257  0.0428  0.0956  323 ILE A O   
641  C CB  . ILE A 115 ? 0.3205 0.3058 0.3907 0.0292  0.0373  0.0782  323 ILE A CB  
642  C CG1 . ILE A 115 ? 0.3150 0.3083 0.3846 0.0322  0.0337  0.0698  323 ILE A CG1 
643  C CG2 . ILE A 115 ? 0.3054 0.2946 0.3842 0.0226  0.0398  0.0782  323 ILE A CG2 
644  C CD1 . ILE A 115 ? 0.2915 0.2953 0.3598 0.0310  0.0351  0.0662  323 ILE A CD1 
645  N N   . THR A 116 ? 0.3495 0.3092 0.4264 0.0179  0.0400  0.0907  324 THR A N   
646  C CA  . THR A 116 ? 0.3636 0.3200 0.4431 0.0105  0.0448  0.0973  324 THR A CA  
647  C C   . THR A 116 ? 0.3544 0.3250 0.4461 0.0056  0.0472  0.0942  324 THR A C   
648  O O   . THR A 116 ? 0.3468 0.3206 0.4454 0.0050  0.0436  0.0885  324 THR A O   
649  C CB  . THR A 116 ? 0.3768 0.3168 0.4569 0.0061  0.0426  0.0998  324 THR A CB  
650  O OG1 . THR A 116 ? 0.3952 0.3194 0.4630 0.0125  0.0387  0.1022  324 THR A OG1 
651  C CG2 . THR A 116 ? 0.3977 0.3356 0.4808 -0.0038 0.0483  0.1065  324 THR A CG2 
652  N N   . LEU A 117 ? 0.3559 0.3353 0.4496 0.0028  0.0530  0.0976  325 LEU A N   
653  C CA  . LEU A 117 ? 0.3547 0.3485 0.4604 0.0001  0.0547  0.0940  325 LEU A CA  
654  C C   . LEU A 117 ? 0.3646 0.3619 0.4801 -0.0084 0.0585  0.0968  325 LEU A C   
655  O O   . LEU A 117 ? 0.3702 0.3628 0.4809 -0.0131 0.0634  0.1030  325 LEU A O   
656  C CB  . LEU A 117 ? 0.3527 0.3581 0.4559 0.0048  0.0578  0.0925  325 LEU A CB  
657  C CG  . LEU A 117 ? 0.3686 0.3719 0.4630 0.0118  0.0539  0.0889  325 LEU A CG  
658  C CD1 . LEU A 117 ? 0.4010 0.4115 0.4888 0.0160  0.0575  0.0890  325 LEU A CD1 
659  C CD2 . LEU A 117 ? 0.3314 0.3365 0.4307 0.0125  0.0487  0.0826  325 LEU A CD2 
660  N N   . ILE A 118 ? 0.3611 0.3664 0.4895 -0.0109 0.0559  0.0920  326 ILE A N   
661  C CA  . ILE A 118 ? 0.3745 0.3855 0.5149 -0.0196 0.0582  0.0927  326 ILE A CA  
662  C C   . ILE A 118 ? 0.3687 0.3988 0.5226 -0.0181 0.0578  0.0871  326 ILE A C   
663  O O   . ILE A 118 ? 0.3589 0.3900 0.5149 -0.0132 0.0516  0.0821  326 ILE A O   
664  C CB  . ILE A 118 ? 0.3793 0.3784 0.5225 -0.0243 0.0530  0.0914  326 ILE A CB  
665  C CG1 . ILE A 118 ? 0.4012 0.3796 0.5307 -0.0233 0.0517  0.0956  326 ILE A CG1 
666  C CG2 . ILE A 118 ? 0.3919 0.3977 0.5479 -0.0347 0.0556  0.0918  326 ILE A CG2 
667  C CD1 . ILE A 118 ? 0.4285 0.3942 0.5591 -0.0250 0.0455  0.0922  326 ILE A CD1 
668  N N   . LYS A 119 ? 0.3788 0.4238 0.5413 -0.0225 0.0643  0.0878  327 LYS A N   
669  C CA  . LYS A 119 ? 0.3775 0.4431 0.5542 -0.0197 0.0640  0.0816  327 LYS A CA  
670  C C   . LYS A 119 ? 0.3778 0.4521 0.5709 -0.0263 0.0611  0.0781  327 LYS A C   
671  O O   . LYS A 119 ? 0.3881 0.4638 0.5861 -0.0367 0.0655  0.0809  327 LYS A O   
672  C CB  . LYS A 119 ? 0.3832 0.4647 0.5616 -0.0199 0.0730  0.0823  327 LYS A CB  
673  C CG  . LYS A 119 ? 0.3941 0.5002 0.5899 -0.0167 0.0734  0.0746  327 LYS A CG  
674  C CD  . LYS A 119 ? 0.4186 0.5341 0.6101 -0.0078 0.0768  0.0716  327 LYS A CD  
675  C CE  . LYS A 119 ? 0.4370 0.5808 0.6459 -0.0068 0.0812  0.0645  327 LYS A CE  
676  N NZ  . LYS A 119 ? 0.4438 0.5990 0.6709 -0.0041 0.0735  0.0572  327 LYS A NZ  
677  N N   . GLY A 120 ? 0.3699 0.4488 0.5700 -0.0206 0.0531  0.0720  328 GLY A N   
678  C CA  . GLY A 120 ? 0.3703 0.4598 0.5864 -0.0251 0.0486  0.0674  328 GLY A CA  
679  C C   . GLY A 120 ? 0.3678 0.4484 0.5812 -0.0200 0.0378  0.0638  328 GLY A C   
680  O O   . GLY A 120 ? 0.3570 0.4232 0.5562 -0.0143 0.0346  0.0650  328 GLY A O   
681  N N   . LYS A 121 ? 0.3711 0.4617 0.5980 -0.0228 0.0323  0.0590  329 LYS A N   
682  C CA  . LYS A 121 ? 0.3768 0.4589 0.6001 -0.0196 0.0218  0.0559  329 LYS A CA  
683  C C   . LYS A 121 ? 0.3853 0.4489 0.5987 -0.0262 0.0209  0.0587  329 LYS A C   
684  O O   . LYS A 121 ? 0.3909 0.4526 0.6081 -0.0351 0.0256  0.0608  329 LYS A O   
685  C CB  . LYS A 121 ? 0.3773 0.4775 0.6184 -0.0204 0.0157  0.0495  329 LYS A CB  
686  C CG  . LYS A 121 ? 0.3718 0.4935 0.6259 -0.0127 0.0155  0.0447  329 LYS A CG  
687  C CD  . LYS A 121 ? 0.3865 0.5286 0.6602 -0.0133 0.0088  0.0374  329 LYS A CD  
688  N N   . ILE A 122 ? 0.3889 0.4384 0.5890 -0.0221 0.0149  0.0583  330 ILE A N   
689  C CA  . ILE A 122 ? 0.4007 0.4341 0.5912 -0.0265 0.0139  0.0591  330 ILE A CA  
690  C C   . ILE A 122 ? 0.4144 0.4497 0.6148 -0.0349 0.0110  0.0561  330 ILE A C   
691  O O   . ILE A 122 ? 0.4208 0.4437 0.6167 -0.0400 0.0123  0.0569  330 ILE A O   
692  C CB  . ILE A 122 ? 0.3982 0.4203 0.5734 -0.0216 0.0082  0.0578  330 ILE A CB  
693  C CG1 . ILE A 122 ? 0.3991 0.4072 0.5647 -0.0248 0.0087  0.0576  330 ILE A CG1 
694  C CG2 . ILE A 122 ? 0.3963 0.4226 0.5730 -0.0199 -0.0008 0.0537  330 ILE A CG2 
695  C CD1 . ILE A 122 ? 0.3862 0.3869 0.5464 -0.0242 0.0158  0.0618  330 ILE A CD1 
696  N N   . GLU A 123 ? 0.4249 0.4758 0.6389 -0.0356 0.0065  0.0519  331 GLU A N   
697  C CA  . GLU A 123 ? 0.4416 0.4975 0.6669 -0.0438 0.0029  0.0478  331 GLU A CA  
698  C C   . GLU A 123 ? 0.4487 0.5126 0.6868 -0.0536 0.0106  0.0493  331 GLU A C   
699  O O   . GLU A 123 ? 0.4590 0.5248 0.7060 -0.0628 0.0089  0.0462  331 GLU A O   
700  C CB  . GLU A 123 ? 0.4447 0.5143 0.6784 -0.0402 -0.0068 0.0418  331 GLU A CB  
701  C CG  . GLU A 123 ? 0.4611 0.5459 0.7014 -0.0310 -0.0084 0.0407  331 GLU A CG  
702  C CD  . GLU A 123 ? 0.4960 0.5678 0.7186 -0.0211 -0.0118 0.0432  331 GLU A CD  
703  O OE1 . GLU A 123 ? 0.5048 0.5652 0.7148 -0.0192 -0.0195 0.0423  331 GLU A OE1 
704  O OE2 . GLU A 123 ? 0.5128 0.5859 0.7333 -0.0160 -0.0065 0.0459  331 GLU A OE2 
705  N N   . GLU A 124 ? 0.4497 0.5173 0.6876 -0.0528 0.0192  0.0540  332 GLU A N   
706  C CA  . GLU A 124 ? 0.4595 0.5349 0.7072 -0.0634 0.0277  0.0564  332 GLU A CA  
707  C C   . GLU A 124 ? 0.4645 0.5207 0.6981 -0.0671 0.0355  0.0643  332 GLU A C   
708  O O   . GLU A 124 ? 0.4770 0.5289 0.7130 -0.0785 0.0406  0.0672  332 GLU A O   
709  C CB  . GLU A 124 ? 0.4561 0.5587 0.7189 -0.0613 0.0316  0.0539  332 GLU A CB  
710  C CG  . GLU A 124 ? 0.4692 0.5935 0.7497 -0.0591 0.0236  0.0453  332 GLU A CG  
711  C CD  . GLU A 124 ? 0.4914 0.6424 0.7858 -0.0524 0.0258  0.0412  332 GLU A CD  
712  O OE1 . GLU A 124 ? 0.4928 0.6464 0.7832 -0.0508 0.0346  0.0450  332 GLU A OE1 
713  O OE2 . GLU A 124 ? 0.5118 0.6817 0.8209 -0.0480 0.0182  0.0336  332 GLU A OE2 
714  N N   . VAL A 125 ? 0.4526 0.4967 0.6708 -0.0577 0.0358  0.0678  333 VAL A N   
715  C CA  . VAL A 125 ? 0.4588 0.4866 0.6631 -0.0588 0.0423  0.0752  333 VAL A CA  
716  C C   . VAL A 125 ? 0.4727 0.4763 0.6674 -0.0632 0.0398  0.0769  333 VAL A C   
717  O O   . VAL A 125 ? 0.4686 0.4664 0.6640 -0.0628 0.0328  0.0718  333 VAL A O   
718  C CB  . VAL A 125 ? 0.4501 0.4742 0.6417 -0.0472 0.0430  0.0774  333 VAL A CB  
719  C CG1 . VAL A 125 ? 0.4488 0.4937 0.6481 -0.0428 0.0464  0.0760  333 VAL A CG1 
720  C CG2 . VAL A 125 ? 0.4320 0.4471 0.6159 -0.0397 0.0350  0.0735  333 VAL A CG2 
721  N N   . HIS A 126 ? 0.4891 0.4778 0.6737 -0.0672 0.0453  0.0839  334 HIS A N   
722  C CA  . HIS A 126 ? 0.5127 0.4750 0.6856 -0.0688 0.0423  0.0858  334 HIS A CA  
723  C C   . HIS A 126 ? 0.5051 0.4549 0.6620 -0.0570 0.0411  0.0883  334 HIS A C   
724  O O   . HIS A 126 ? 0.5057 0.4565 0.6552 -0.0540 0.0463  0.0940  334 HIS A O   
725  C CB  . HIS A 126 ? 0.5423 0.4923 0.7127 -0.0816 0.0477  0.0923  334 HIS A CB  
726  C CG  . HIS A 126 ? 0.5975 0.5158 0.7531 -0.0817 0.0442  0.0952  334 HIS A CG  
727  N ND1 . HIS A 126 ? 0.6343 0.5398 0.7905 -0.0815 0.0367  0.0888  334 HIS A ND1 
728  C CD2 . HIS A 126 ? 0.6366 0.5325 0.7752 -0.0811 0.0465  0.1034  334 HIS A CD2 
729  C CE1 . HIS A 126 ? 0.6616 0.5384 0.8032 -0.0801 0.0344  0.0922  334 HIS A CE1 
730  N NE2 . HIS A 126 ? 0.6669 0.5365 0.7972 -0.0797 0.0398  0.1015  334 HIS A NE2 
731  N N   . LEU A 127 ? 0.4963 0.4367 0.6483 -0.0505 0.0344  0.0831  335 LEU A N   
732  C CA  . LEU A 127 ? 0.4932 0.4235 0.6318 -0.0398 0.0326  0.0835  335 LEU A CA  
733  C C   . LEU A 127 ? 0.5167 0.4212 0.6440 -0.0399 0.0311  0.0869  335 LEU A C   
734  O O   . LEU A 127 ? 0.5323 0.4242 0.6618 -0.0475 0.0291  0.0861  335 LEU A O   
735  C CB  . LEU A 127 ? 0.4785 0.4139 0.6176 -0.0332 0.0266  0.0753  335 LEU A CB  
736  C CG  . LEU A 127 ? 0.4595 0.4148 0.6068 -0.0326 0.0255  0.0714  335 LEU A CG  
737  C CD1 . LEU A 127 ? 0.4492 0.4046 0.5923 -0.0279 0.0198  0.0642  335 LEU A CD1 
738  C CD2 . LEU A 127 ? 0.4403 0.4072 0.5863 -0.0281 0.0299  0.0751  335 LEU A CD2 
739  N N   . PRO A 128 ? 0.5196 0.4152 0.6341 -0.0312 0.0312  0.0904  336 PRO A N   
740  C CA  . PRO A 128 ? 0.5426 0.4118 0.6447 -0.0289 0.0282  0.0936  336 PRO A CA  
741  C C   . PRO A 128 ? 0.5434 0.4025 0.6433 -0.0211 0.0205  0.0848  336 PRO A C   
742  O O   . PRO A 128 ? 0.5611 0.3991 0.6503 -0.0151 0.0165  0.0856  336 PRO A O   
743  C CB  . PRO A 128 ? 0.5458 0.4137 0.6358 -0.0212 0.0306  0.0999  336 PRO A CB  
744  C CG  . PRO A 128 ? 0.5192 0.4115 0.6151 -0.0151 0.0319  0.0952  336 PRO A CG  
745  C CD  . PRO A 128 ? 0.5042 0.4134 0.6149 -0.0233 0.0339  0.0918  336 PRO A CD  
746  N N   . VAL A 129 ? 0.5217 0.3959 0.6309 -0.0207 0.0183  0.0760  337 VAL A N   
747  C CA  . VAL A 129 ? 0.5232 0.3911 0.6315 -0.0151 0.0119  0.0662  337 VAL A CA  
748  C C   . VAL A 129 ? 0.5125 0.3870 0.6311 -0.0233 0.0100  0.0600  337 VAL A C   
749  O O   . VAL A 129 ? 0.5023 0.3914 0.6297 -0.0308 0.0130  0.0623  337 VAL A O   
750  C CB  . VAL A 129 ? 0.5104 0.3919 0.6158 -0.0039 0.0104  0.0600  337 VAL A CB  
751  C CG1 . VAL A 129 ? 0.5233 0.3976 0.6185 0.0055  0.0104  0.0642  337 VAL A CG1 
752  C CG2 . VAL A 129 ? 0.4927 0.3980 0.6044 -0.0065 0.0137  0.0593  337 VAL A CG2 
753  N N   . GLU A 130 ? 0.4834 0.4286 0.5912 -0.0146 -0.0168 -0.0043 338 GLU A N   
754  C CA  . GLU A 130 ? 0.4871 0.4280 0.6003 -0.0189 -0.0279 -0.0073 338 GLU A CA  
755  C C   . GLU A 130 ? 0.4714 0.4107 0.5680 -0.0169 -0.0297 -0.0143 338 GLU A C   
756  O O   . GLU A 130 ? 0.4661 0.4067 0.5678 -0.0186 -0.0354 -0.0143 338 GLU A O   
757  C CB  . GLU A 130 ? 0.5077 0.4357 0.6193 -0.0219 -0.0374 -0.0117 338 GLU A CB  
758  C CG  . GLU A 130 ? 0.5419 0.4704 0.6732 -0.0248 -0.0375 -0.0046 338 GLU A CG  
759  C CD  . GLU A 130 ? 0.6028 0.5288 0.7579 -0.0305 -0.0496 -0.0005 338 GLU A CD  
760  O OE1 . GLU A 130 ? 0.6254 0.5410 0.7860 -0.0336 -0.0585 -0.0018 338 GLU A OE1 
761  O OE2 . GLU A 130 ? 0.6160 0.5497 0.7854 -0.0320 -0.0512 0.0041  338 GLU A OE2 
762  N N   . LYS A 131 ? 0.4529 0.3892 0.5316 -0.0131 -0.0250 -0.0194 339 LYS A N   
763  C CA  . LYS A 131 ? 0.4390 0.3734 0.5034 -0.0105 -0.0254 -0.0249 339 LYS A CA  
764  C C   . LYS A 131 ? 0.4171 0.3568 0.4746 -0.0064 -0.0170 -0.0250 339 LYS A C   
765  O O   . LYS A 131 ? 0.4101 0.3509 0.4684 -0.0050 -0.0125 -0.0229 339 LYS A O   
766  C CB  . LYS A 131 ? 0.4553 0.3760 0.5051 -0.0092 -0.0306 -0.0314 339 LYS A CB  
767  C CG  . LYS A 131 ? 0.4743 0.3844 0.5261 -0.0121 -0.0426 -0.0334 339 LYS A CG  
768  C CD  . LYS A 131 ? 0.4744 0.3859 0.5289 -0.0131 -0.0489 -0.0336 339 LYS A CD  
769  C CE  . LYS A 131 ? 0.5032 0.4005 0.5578 -0.0151 -0.0638 -0.0366 339 LYS A CE  
770  N NZ  . LYS A 131 ? 0.5224 0.4232 0.5868 -0.0174 -0.0712 -0.0350 339 LYS A NZ  
771  N N   . VAL A 132 ? 0.3921 0.3340 0.4431 -0.0043 -0.0160 -0.0272 340 VAL A N   
772  C CA  . VAL A 132 ? 0.3759 0.3205 0.4217 -0.0006 -0.0109 -0.0279 340 VAL A CA  
773  C C   . VAL A 132 ? 0.3713 0.3109 0.4082 0.0016  -0.0108 -0.0316 340 VAL A C   
774  O O   . VAL A 132 ? 0.3731 0.3075 0.4045 0.0015  -0.0140 -0.0338 340 VAL A O   
775  C CB  . VAL A 132 ? 0.3709 0.3237 0.4202 0.0009  -0.0087 -0.0252 340 VAL A CB  
776  C CG1 . VAL A 132 ? 0.3666 0.3236 0.4237 0.0009  -0.0061 -0.0197 340 VAL A CG1 
777  C CG2 . VAL A 132 ? 0.3652 0.3204 0.4146 -0.0001 -0.0114 -0.0263 340 VAL A CG2 
778  N N   . ASP A 133 ? 0.3597 0.2998 0.3958 0.0045  -0.0072 -0.0317 341 ASP A N   
779  C CA  . ASP A 133 ? 0.3542 0.2905 0.3860 0.0077  -0.0047 -0.0328 341 ASP A CA  
780  C C   . ASP A 133 ? 0.3427 0.2840 0.3761 0.0092  -0.0038 -0.0321 341 ASP A C   
781  O O   . ASP A 133 ? 0.3339 0.2718 0.3626 0.0121  -0.0016 -0.0320 341 ASP A O   
782  C CB  . ASP A 133 ? 0.3504 0.2855 0.3863 0.0097  -0.0020 -0.0317 341 ASP A CB  
783  C CG  . ASP A 133 ? 0.3862 0.3160 0.4201 0.0087  -0.0023 -0.0323 341 ASP A CG  
784  O OD1 . ASP A 133 ? 0.4145 0.3372 0.4411 0.0086  -0.0030 -0.0340 341 ASP A OD1 
785  O OD2 . ASP A 133 ? 0.3873 0.3185 0.4255 0.0085  -0.0026 -0.0314 341 ASP A OD2 
786  N N   . VAL A 134 ? 0.3269 0.2749 0.3658 0.0084  -0.0050 -0.0310 342 VAL A N   
787  C CA  . VAL A 134 ? 0.3146 0.2672 0.3564 0.0098  -0.0048 -0.0303 342 VAL A CA  
788  C C   . VAL A 134 ? 0.3147 0.2726 0.3574 0.0086  -0.0067 -0.0297 342 VAL A C   
789  O O   . VAL A 134 ? 0.3083 0.2671 0.3517 0.0085  -0.0069 -0.0287 342 VAL A O   
790  C CB  . VAL A 134 ? 0.3178 0.2709 0.3670 0.0122  -0.0046 -0.0291 342 VAL A CB  
791  C CG1 . VAL A 134 ? 0.3074 0.2645 0.3615 0.0136  -0.0053 -0.0281 342 VAL A CG1 
792  C CG2 . VAL A 134 ? 0.3091 0.2578 0.3613 0.0140  -0.0014 -0.0279 342 VAL A CG2 
793  N N   . ILE A 135 ? 0.3064 0.2675 0.3488 0.0085  -0.0071 -0.0296 343 ILE A N   
794  C CA  . ILE A 135 ? 0.3006 0.2673 0.3450 0.0083  -0.0080 -0.0283 343 ILE A CA  
795  C C   . ILE A 135 ? 0.2931 0.2620 0.3394 0.0109  -0.0081 -0.0283 343 ILE A C   
796  O O   . ILE A 135 ? 0.2896 0.2580 0.3369 0.0116  -0.0072 -0.0285 343 ILE A O   
797  C CB  . ILE A 135 ? 0.3059 0.2745 0.3507 0.0057  -0.0100 -0.0279 343 ILE A CB  
798  C CG1 . ILE A 135 ? 0.3106 0.2767 0.3576 0.0028  -0.0118 -0.0271 343 ILE A CG1 
799  C CG2 . ILE A 135 ? 0.2850 0.2604 0.3338 0.0062  -0.0098 -0.0256 343 ILE A CG2 
800  C CD1 . ILE A 135 ? 0.3347 0.2987 0.3827 0.0001  -0.0171 -0.0276 343 ILE A CD1 
801  N N   . ILE A 136 ? 0.2907 0.2605 0.3368 0.0132  -0.0090 -0.0277 344 ILE A N   
802  C CA  . ILE A 136 ? 0.2869 0.2575 0.3344 0.0158  -0.0109 -0.0280 344 ILE A CA  
803  C C   . ILE A 136 ? 0.2903 0.2641 0.3346 0.0175  -0.0102 -0.0266 344 ILE A C   
804  O O   . ILE A 136 ? 0.2996 0.2735 0.3412 0.0185  -0.0080 -0.0245 344 ILE A O   
805  C CB  . ILE A 136 ? 0.2893 0.2539 0.3379 0.0190  -0.0149 -0.0292 344 ILE A CB  
806  C CG1 . ILE A 136 ? 0.3037 0.2632 0.3441 0.0221  -0.0155 -0.0293 344 ILE A CG1 
807  C CG2 . ILE A 136 ? 0.2872 0.2500 0.3438 0.0175  -0.0148 -0.0289 344 ILE A CG2 
808  C CD1 . ILE A 136 ? 0.3577 0.3078 0.3955 0.0265  -0.0221 -0.0312 344 ILE A CD1 
809  N N   . SER A 137 ? 0.2885 0.2650 0.3342 0.0185  -0.0112 -0.0266 345 SER A N   
810  C CA  . SER A 137 ? 0.2940 0.2735 0.3370 0.0208  -0.0098 -0.0247 345 SER A CA  
811  C C   . SER A 137 ? 0.2933 0.2734 0.3374 0.0226  -0.0123 -0.0256 345 SER A C   
812  O O   . SER A 137 ? 0.2886 0.2704 0.3382 0.0203  -0.0132 -0.0263 345 SER A O   
813  C CB  . SER A 137 ? 0.2824 0.2684 0.3300 0.0170  -0.0074 -0.0221 345 SER A CB  
814  O OG  . SER A 137 ? 0.2968 0.2870 0.3452 0.0194  -0.0052 -0.0189 345 SER A OG  
815  N N   . GLU A 138 ? 0.3014 0.2789 0.3394 0.0278  -0.0128 -0.0251 346 GLU A N   
816  C CA  . GLU A 138 ? 0.3106 0.2892 0.3496 0.0295  -0.0148 -0.0255 346 GLU A CA  
817  C C   . GLU A 138 ? 0.3063 0.2922 0.3457 0.0294  -0.0100 -0.0220 346 GLU A C   
818  O O   . GLU A 138 ? 0.3194 0.3035 0.3525 0.0347  -0.0070 -0.0195 346 GLU A O   
819  C CB  . GLU A 138 ? 0.3178 0.2859 0.3487 0.0362  -0.0204 -0.0279 346 GLU A CB  
820  C CG  . GLU A 138 ? 0.3392 0.3066 0.3747 0.0369  -0.0252 -0.0292 346 GLU A CG  
821  C CD  . GLU A 138 ? 0.3787 0.3513 0.4114 0.0387  -0.0214 -0.0271 346 GLU A CD  
822  O OE1 . GLU A 138 ? 0.3901 0.3729 0.4301 0.0337  -0.0171 -0.0249 346 GLU A OE1 
823  O OE2 . GLU A 138 ? 0.4006 0.3657 0.4225 0.0458  -0.0233 -0.0277 346 GLU A OE2 
824  N N   . TRP A 139 ? 0.3009 0.2939 0.3477 0.0244  -0.0093 -0.0213 347 TRP A N   
825  C CA  . TRP A 139 ? 0.2941 0.2943 0.3454 0.0228  -0.0064 -0.0175 347 TRP A CA  
826  C C   . TRP A 139 ? 0.2944 0.2988 0.3480 0.0232  -0.0072 -0.0170 347 TRP A C   
827  O O   . TRP A 139 ? 0.2849 0.2952 0.3436 0.0228  -0.0054 -0.0134 347 TRP A O   
828  C CB  . TRP A 139 ? 0.2974 0.3000 0.3542 0.0170  -0.0074 -0.0174 347 TRP A CB  
829  C CG  . TRP A 139 ? 0.2851 0.2851 0.3403 0.0146  -0.0100 -0.0209 347 TRP A CG  
830  C CD1 . TRP A 139 ? 0.2889 0.2838 0.3417 0.0141  -0.0103 -0.0231 347 TRP A CD1 
831  C CD2 . TRP A 139 ? 0.3008 0.3025 0.3562 0.0137  -0.0114 -0.0213 347 TRP A CD2 
832  N NE1 . TRP A 139 ? 0.2955 0.2889 0.3472 0.0137  -0.0105 -0.0242 347 TRP A NE1 
833  C CE2 . TRP A 139 ? 0.3018 0.2986 0.3538 0.0137  -0.0113 -0.0233 347 TRP A CE2 
834  C CE3 . TRP A 139 ? 0.2953 0.3017 0.3533 0.0136  -0.0123 -0.0197 347 TRP A CE3 
835  C CZ2 . TRP A 139 ? 0.3039 0.2995 0.3530 0.0146  -0.0112 -0.0233 347 TRP A CZ2 
836  C CZ3 . TRP A 139 ? 0.2990 0.3043 0.3541 0.0135  -0.0138 -0.0207 347 TRP A CZ3 
837  C CH2 . TRP A 139 ? 0.3005 0.3000 0.3502 0.0145  -0.0128 -0.0224 347 TRP A CH2 
838  N N   . MET A 140 ? 0.2915 0.2931 0.3438 0.0239  -0.0100 -0.0200 348 MET A N   
839  C CA  . MET A 140 ? 0.2877 0.2929 0.3428 0.0235  -0.0108 -0.0197 348 MET A CA  
840  C C   . MET A 140 ? 0.2864 0.2937 0.3400 0.0276  -0.0096 -0.0176 348 MET A C   
841  O O   . MET A 140 ? 0.2913 0.2930 0.3383 0.0331  -0.0097 -0.0180 348 MET A O   
842  C CB  . MET A 140 ? 0.2768 0.2786 0.3343 0.0237  -0.0133 -0.0217 348 MET A CB  
843  C CG  . MET A 140 ? 0.2891 0.2893 0.3485 0.0208  -0.0125 -0.0222 348 MET A CG  
844  S SD  . MET A 140 ? 0.3064 0.3006 0.3651 0.0211  -0.0136 -0.0238 348 MET A SD  
845  C CE  . MET A 140 ? 0.2881 0.2766 0.3514 0.0247  -0.0189 -0.0248 348 MET A CE  
846  N N   . GLY A 141 ? 0.2849 0.2988 0.3434 0.0257  -0.0089 -0.0154 349 GLY A N   
847  C CA  . GLY A 141 ? 0.2864 0.3032 0.3450 0.0295  -0.0073 -0.0129 349 GLY A CA  
848  C C   . GLY A 141 ? 0.2835 0.3003 0.3425 0.0300  -0.0098 -0.0146 349 GLY A C   
849  O O   . GLY A 141 ? 0.2764 0.2913 0.3369 0.0276  -0.0120 -0.0168 349 GLY A O   
850  N N   . TYR A 142 ? 0.2845 0.3031 0.3429 0.0337  -0.0086 -0.0127 350 TYR A N   
851  C CA  . TYR A 142 ? 0.2824 0.3023 0.3430 0.0337  -0.0107 -0.0134 350 TYR A CA  
852  C C   . TYR A 142 ? 0.2771 0.3023 0.3429 0.0286  -0.0114 -0.0128 350 TYR A C   
853  O O   . TYR A 142 ? 0.2735 0.3029 0.3424 0.0258  -0.0111 -0.0109 350 TYR A O   
854  C CB  . TYR A 142 ? 0.2907 0.3125 0.3499 0.0385  -0.0085 -0.0106 350 TYR A CB  
855  C CG  . TYR A 142 ? 0.3205 0.3335 0.3691 0.0463  -0.0077 -0.0112 350 TYR A CG  
856  C CD1 . TYR A 142 ? 0.3698 0.3838 0.4150 0.0517  -0.0016 -0.0066 350 TYR A CD1 
857  C CD2 . TYR A 142 ? 0.3397 0.3417 0.3817 0.0492  -0.0134 -0.0159 350 TYR A CD2 
858  C CE1 . TYR A 142 ? 0.4148 0.4174 0.4451 0.0614  -0.0001 -0.0069 350 TYR A CE1 
859  C CE2 . TYR A 142 ? 0.3703 0.3600 0.3983 0.0578  -0.0147 -0.0174 350 TYR A CE2 
860  C CZ  . TYR A 142 ? 0.4261 0.4153 0.4457 0.0646  -0.0076 -0.0131 350 TYR A CZ  
861  O OH  . TYR A 142 ? 0.4659 0.4401 0.4669 0.0755  -0.0082 -0.0144 350 TYR A OH  
862  N N   . PHE A 143 ? 0.2702 0.2937 0.3371 0.0282  -0.0128 -0.0139 351 PHE A N   
863  C CA  . PHE A 143 ? 0.2785 0.3034 0.3455 0.0257  -0.0128 -0.0133 351 PHE A CA  
864  C C   . PHE A 143 ? 0.2817 0.3043 0.3455 0.0230  -0.0131 -0.0144 351 PHE A C   
865  O O   . PHE A 143 ? 0.2835 0.3058 0.3443 0.0214  -0.0150 -0.0143 351 PHE A O   
866  C CB  . PHE A 143 ? 0.2747 0.3048 0.3429 0.0256  -0.0137 -0.0113 351 PHE A CB  
867  C CG  . PHE A 143 ? 0.2866 0.3153 0.3512 0.0253  -0.0147 -0.0110 351 PHE A CG  
868  C CD1 . PHE A 143 ? 0.2829 0.3086 0.3464 0.0276  -0.0124 -0.0103 351 PHE A CD1 
869  C CD2 . PHE A 143 ? 0.2857 0.3147 0.3481 0.0236  -0.0185 -0.0107 351 PHE A CD2 
870  C CE1 . PHE A 143 ? 0.2995 0.3220 0.3563 0.0295  -0.0118 -0.0091 351 PHE A CE1 
871  C CE2 . PHE A 143 ? 0.2991 0.3233 0.3534 0.0252  -0.0206 -0.0109 351 PHE A CE2 
872  C CZ  . PHE A 143 ? 0.3059 0.3265 0.3555 0.0288  -0.0162 -0.0100 351 PHE A CZ  
873  N N   . LEU A 144 ? 0.2869 0.3062 0.3506 0.0230  -0.0125 -0.0158 352 LEU A N   
874  C CA  . LEU A 144 ? 0.2854 0.3018 0.3464 0.0208  -0.0125 -0.0170 352 LEU A CA  
875  C C   . LEU A 144 ? 0.3030 0.3224 0.3655 0.0186  -0.0137 -0.0160 352 LEU A C   
876  O O   . LEU A 144 ? 0.2987 0.3170 0.3617 0.0182  -0.0128 -0.0160 352 LEU A O   
877  C CB  . LEU A 144 ? 0.2872 0.2992 0.3433 0.0207  -0.0120 -0.0174 352 LEU A CB  
878  C CG  . LEU A 144 ? 0.2778 0.2850 0.3304 0.0195  -0.0116 -0.0189 352 LEU A CG  
879  C CD1 . LEU A 144 ? 0.2698 0.2752 0.3272 0.0205  -0.0096 -0.0190 352 LEU A CD1 
880  C CD2 . LEU A 144 ? 0.2842 0.2846 0.3273 0.0211  -0.0113 -0.0192 352 LEU A CD2 
881  N N   . LEU A 145 ? 0.3122 0.3352 0.3774 0.0175  -0.0160 -0.0142 353 LEU A N   
882  C CA  . LEU A 145 ? 0.3327 0.3581 0.4041 0.0145  -0.0188 -0.0122 353 LEU A CA  
883  C C   . LEU A 145 ? 0.3392 0.3722 0.4217 0.0151  -0.0169 -0.0071 353 LEU A C   
884  O O   . LEU A 145 ? 0.3429 0.3786 0.4353 0.0126  -0.0186 -0.0037 353 LEU A O   
885  C CB  . LEU A 145 ? 0.3395 0.3608 0.4076 0.0126  -0.0254 -0.0136 353 LEU A CB  
886  C CG  . LEU A 145 ? 0.3476 0.3591 0.4023 0.0138  -0.0265 -0.0174 353 LEU A CG  
887  C CD1 . LEU A 145 ? 0.3598 0.3644 0.4064 0.0147  -0.0335 -0.0188 353 LEU A CD1 
888  C CD2 . LEU A 145 ? 0.3351 0.3422 0.3884 0.0121  -0.0267 -0.0190 353 LEU A CD2 
889  N N   A PHE A 146 ? 0.3422 0.3782 0.4242 0.0189  -0.0133 -0.0057 354 PHE A N   
890  N N   B PHE A 146 ? 0.3390 0.3750 0.4210 0.0189  -0.0133 -0.0057 354 PHE A N   
891  C CA  A PHE A 146 ? 0.3481 0.3903 0.4392 0.0214  -0.0094 0.0002  354 PHE A CA  
892  C CA  B PHE A 146 ? 0.3419 0.3840 0.4325 0.0217  -0.0093 0.0001  354 PHE A CA  
893  C C   A PHE A 146 ? 0.3554 0.3958 0.4452 0.0245  -0.0040 0.0024  354 PHE A C   
894  C C   B PHE A 146 ? 0.3517 0.3924 0.4416 0.0248  -0.0038 0.0026  354 PHE A C   
895  O O   A PHE A 146 ? 0.3597 0.3938 0.4380 0.0282  -0.0021 -0.0008 354 PHE A O   
896  O O   B PHE A 146 ? 0.3552 0.3896 0.4336 0.0289  -0.0016 -0.0004 354 PHE A O   
897  C CB  A PHE A 146 ? 0.3447 0.3887 0.4332 0.0260  -0.0068 0.0012  354 PHE A CB  
898  C CB  B PHE A 146 ? 0.3361 0.3788 0.4222 0.0265  -0.0068 0.0001  354 PHE A CB  
899  C CG  A PHE A 146 ? 0.3551 0.4040 0.4508 0.0308  -0.0005 0.0083  354 PHE A CG  
900  C CG  B PHE A 146 ? 0.3244 0.3709 0.4143 0.0247  -0.0104 0.0004  354 PHE A CG  
901  C CD1 A PHE A 146 ? 0.3651 0.4224 0.4779 0.0285  -0.0008 0.0151  354 PHE A CD1 
902  C CD1 B PHE A 146 ? 0.3206 0.3734 0.4233 0.0222  -0.0130 0.0050  354 PHE A CD1 
903  C CD2 A PHE A 146 ? 0.3720 0.4158 0.4573 0.0386  0.0052  0.0089  354 PHE A CD2 
904  C CD2 B PHE A 146 ? 0.3155 0.3590 0.3980 0.0261  -0.0116 -0.0030 354 PHE A CD2 
905  C CE1 A PHE A 146 ? 0.3515 0.4140 0.4735 0.0339  0.0069  0.0237  354 PHE A CE1 
906  C CE1 B PHE A 146 ? 0.3107 0.3657 0.4157 0.0212  -0.0172 0.0051  354 PHE A CE1 
907  C CE2 A PHE A 146 ? 0.3737 0.4204 0.4627 0.0454  0.0130  0.0165  354 PHE A CE2 
908  C CE2 B PHE A 146 ? 0.3146 0.3608 0.3993 0.0253  -0.0143 -0.0024 354 PHE A CE2 
909  C CZ  A PHE A 146 ? 0.3711 0.4282 0.4798 0.0430  0.0149  0.0247  354 PHE A CZ  
910  C CZ  B PHE A 146 ? 0.3110 0.3626 0.4055 0.0231  -0.0173 0.0012  354 PHE A CZ  
911  N N   . GLU A 147 ? 0.3601 0.4055 0.4629 0.0234  -0.0020 0.0087  355 GLU A N   
912  C CA  . GLU A 147 ? 0.3759 0.4202 0.4791 0.0273  0.0047  0.0130  355 GLU A CA  
913  C C   . GLU A 147 ? 0.3808 0.4172 0.4721 0.0264  0.0032  0.0071  355 GLU A C   
914  O O   . GLU A 147 ? 0.4008 0.4317 0.4823 0.0321  0.0080  0.0073  355 GLU A O   
915  C CB  . GLU A 147 ? 0.3889 0.4321 0.4854 0.0370  0.0132  0.0174  355 GLU A CB  
916  N N   . SER A 148 ? 0.3781 0.4124 0.4689 0.0202  -0.0035 0.0019  356 SER A N   
917  C CA  . SER A 148 ? 0.3740 0.4014 0.4556 0.0190  -0.0048 -0.0031 356 SER A CA  
918  C C   . SER A 148 ? 0.3808 0.4086 0.4700 0.0165  -0.0041 0.0000  356 SER A C   
919  O O   . SER A 148 ? 0.3839 0.4173 0.4881 0.0141  -0.0049 0.0056  356 SER A O   
920  C CB  . SER A 148 ? 0.3727 0.3965 0.4489 0.0154  -0.0105 -0.0089 356 SER A CB  
921  O OG  . SER A 148 ? 0.3604 0.3831 0.4410 0.0106  -0.0155 -0.0093 356 SER A OG  
922  N N   . MET A 149 ? 0.3786 0.4004 0.4598 0.0171  -0.0033 -0.0031 357 MET A N   
923  C CA  . MET A 149 ? 0.3900 0.4113 0.4776 0.0144  -0.0032 -0.0009 357 MET A CA  
924  C C   . MET A 149 ? 0.3792 0.3960 0.4651 0.0087  -0.0102 -0.0060 357 MET A C   
925  O O   . MET A 149 ? 0.3798 0.3937 0.4674 0.0067  -0.0109 -0.0060 357 MET A O   
926  C CB  . MET A 149 ? 0.3954 0.4115 0.4740 0.0191  0.0018  -0.0008 357 MET A CB  
927  C CG  . MET A 149 ? 0.4544 0.4698 0.5275 0.0276  0.0090  0.0036  357 MET A CG  
928  S SD  . MET A 149 ? 0.5669 0.5736 0.6285 0.0337  0.0137  0.0043  357 MET A SD  
929  C CE  . MET A 149 ? 0.5375 0.5347 0.5846 0.0329  0.0064  -0.0060 357 MET A CE  
930  N N   . LEU A 150 ? 0.3742 0.3891 0.4551 0.0072  -0.0149 -0.0101 358 LEU A N   
931  C CA  . LEU A 150 ? 0.3759 0.3835 0.4501 0.0044  -0.0205 -0.0149 358 LEU A CA  
932  C C   . LEU A 150 ? 0.3843 0.3899 0.4674 0.0003  -0.0266 -0.0133 358 LEU A C   
933  O O   . LEU A 150 ? 0.3794 0.3777 0.4571 -0.0009 -0.0294 -0.0164 358 LEU A O   
934  C CB  . LEU A 150 ? 0.3775 0.3821 0.4436 0.0054  -0.0236 -0.0180 358 LEU A CB  
935  C CG  . LEU A 150 ? 0.3818 0.3760 0.4355 0.0058  -0.0273 -0.0225 358 LEU A CG  
936  C CD1 . LEU A 150 ? 0.3636 0.3534 0.4111 0.0070  -0.0229 -0.0244 358 LEU A CD1 
937  C CD2 . LEU A 150 ? 0.3831 0.3747 0.4278 0.0089  -0.0274 -0.0239 358 LEU A CD2 
938  N N   . ASP A 151 ? 0.3865 0.3983 0.4852 -0.0015 -0.0292 -0.0080 359 ASP A N   
939  C CA  . ASP A 151 ? 0.4046 0.4150 0.5180 -0.0059 -0.0366 -0.0050 359 ASP A CA  
940  C C   . ASP A 151 ? 0.3958 0.4054 0.5133 -0.0067 -0.0327 -0.0030 359 ASP A C   
941  O O   . ASP A 151 ? 0.3970 0.3994 0.5158 -0.0099 -0.0399 -0.0051 359 ASP A O   
942  C CB  . ASP A 151 ? 0.4105 0.4302 0.5461 -0.0074 -0.0381 0.0028  359 ASP A CB  
943  C CG  . ASP A 151 ? 0.4555 0.4855 0.5999 -0.0034 -0.0254 0.0107  359 ASP A CG  
944  O OD1 . ASP A 151 ? 0.4953 0.5254 0.6245 0.0014  -0.0177 0.0082  359 ASP A OD1 
945  O OD2 . ASP A 151 ? 0.5116 0.5484 0.6786 -0.0043 -0.0234 0.0200  359 ASP A OD2 
946  N N   . SER A 152 ? 0.3828 0.3976 0.4997 -0.0029 -0.0221 0.0004  360 SER A N   
947  C CA  . SER A 152 ? 0.3792 0.3929 0.4984 -0.0023 -0.0173 0.0029  360 SER A CA  
948  C C   . SER A 152 ? 0.3757 0.3803 0.4776 -0.0024 -0.0187 -0.0048 360 SER A C   
949  O O   . SER A 152 ? 0.3745 0.3750 0.4789 -0.0045 -0.0202 -0.0048 360 SER A O   
950  C CB  . SER A 152 ? 0.3808 0.3999 0.5005 0.0038  -0.0059 0.0091  360 SER A CB  
951  O OG  . SER A 152 ? 0.4017 0.4294 0.5409 0.0045  -0.0028 0.0187  360 SER A OG  
952  N N   . VAL A 153 ? 0.3619 0.3636 0.4485 0.0000  -0.0179 -0.0104 361 VAL A N   
953  C CA  . VAL A 153 ? 0.3563 0.3500 0.4292 0.0005  -0.0185 -0.0165 361 VAL A CA  
954  C C   . VAL A 153 ? 0.3673 0.3528 0.4372 -0.0024 -0.0263 -0.0199 361 VAL A C   
955  O O   . VAL A 153 ? 0.3707 0.3499 0.4360 -0.0030 -0.0269 -0.0221 361 VAL A O   
956  C CB  . VAL A 153 ? 0.3512 0.3444 0.4139 0.0038  -0.0160 -0.0198 361 VAL A CB  
957  C CG1 . VAL A 153 ? 0.3461 0.3319 0.3989 0.0048  -0.0158 -0.0241 361 VAL A CG1 
958  C CG2 . VAL A 153 ? 0.3376 0.3349 0.4005 0.0077  -0.0107 -0.0176 361 VAL A CG2 
959  N N   . LEU A 154 ? 0.3747 0.3588 0.4458 -0.0037 -0.0330 -0.0206 362 LEU A N   
960  C CA  . LEU A 154 ? 0.3928 0.3651 0.4570 -0.0049 -0.0427 -0.0245 362 LEU A CA  
961  C C   . LEU A 154 ? 0.3971 0.3673 0.4747 -0.0092 -0.0489 -0.0221 362 LEU A C   
962  O O   . LEU A 154 ? 0.4067 0.3652 0.4760 -0.0094 -0.0547 -0.0261 362 LEU A O   
963  C CB  . LEU A 154 ? 0.4054 0.3746 0.4660 -0.0042 -0.0499 -0.0259 362 LEU A CB  
964  C CG  . LEU A 154 ? 0.4118 0.3815 0.4588 0.0003  -0.0441 -0.0279 362 LEU A CG  
965  C CD1 . LEU A 154 ? 0.4231 0.3905 0.4677 0.0011  -0.0512 -0.0285 362 LEU A CD1 
966  C CD2 . LEU A 154 ? 0.4327 0.3925 0.4611 0.0049  -0.0400 -0.0319 362 LEU A CD2 
967  N N   . TYR A 155 ? 0.3935 0.3743 0.4925 -0.0119 -0.0471 -0.0149 363 TYR A N   
968  C CA  . TYR A 155 ? 0.4022 0.3831 0.5190 -0.0158 -0.0510 -0.0104 363 TYR A CA  
969  C C   . TYR A 155 ? 0.4015 0.3788 0.5101 -0.0147 -0.0451 -0.0122 363 TYR A C   
970  O O   . TYR A 155 ? 0.4040 0.3724 0.5130 -0.0170 -0.0519 -0.0142 363 TYR A O   
971  C CB  . TYR A 155 ? 0.3981 0.3925 0.5405 -0.0169 -0.0459 0.0000  363 TYR A CB  
972  C CG  . TYR A 155 ? 0.4177 0.4131 0.5830 -0.0208 -0.0490 0.0068  363 TYR A CG  
973  C CD1 . TYR A 155 ? 0.4421 0.4354 0.6293 -0.0258 -0.0623 0.0102  363 TYR A CD1 
974  C CD2 . TYR A 155 ? 0.4277 0.4249 0.5939 -0.0193 -0.0398 0.0101  363 TYR A CD2 
975  C CE1 . TYR A 155 ? 0.4617 0.4558 0.6741 -0.0298 -0.0659 0.0174  363 TYR A CE1 
976  C CE2 . TYR A 155 ? 0.4563 0.4545 0.6450 -0.0226 -0.0419 0.0172  363 TYR A CE2 
977  C CZ  . TYR A 155 ? 0.4628 0.4599 0.6760 -0.0281 -0.0548 0.0212  363 TYR A CZ  
978  O OH  . TYR A 155 ? 0.4870 0.4853 0.7263 -0.0316 -0.0573 0.0293  363 TYR A OH  
979  N N   . ALA A 156 ? 0.3911 0.3739 0.4922 -0.0110 -0.0338 -0.0115 364 ALA A N   
980  C CA  . ALA A 156 ? 0.3939 0.3735 0.4869 -0.0094 -0.0282 -0.0132 364 ALA A CA  
981  C C   . ALA A 156 ? 0.4042 0.3718 0.4804 -0.0090 -0.0328 -0.0208 364 ALA A C   
982  O O   . ALA A 156 ? 0.4101 0.3717 0.4848 -0.0099 -0.0339 -0.0220 364 ALA A O   
983  C CB  . ALA A 156 ? 0.3842 0.3691 0.4698 -0.0046 -0.0184 -0.0124 364 ALA A CB  
984  N N   . LYS A 157 ? 0.4107 0.3744 0.4742 -0.0067 -0.0345 -0.0251 365 LYS A N   
985  C CA  . LYS A 157 ? 0.4334 0.3845 0.4792 -0.0041 -0.0372 -0.0310 365 LYS A CA  
986  C C   . LYS A 157 ? 0.4531 0.3921 0.4976 -0.0061 -0.0482 -0.0333 365 LYS A C   
987  O O   . LYS A 157 ? 0.4627 0.3918 0.4976 -0.0047 -0.0489 -0.0363 365 LYS A O   
988  C CB  . LYS A 157 ? 0.4368 0.3861 0.4710 -0.0003 -0.0363 -0.0332 365 LYS A CB  
989  C CG  . LYS A 157 ? 0.4709 0.4088 0.4861 0.0051  -0.0337 -0.0370 365 LYS A CG  
990  C CD  . LYS A 157 ? 0.5391 0.4619 0.5386 0.0083  -0.0424 -0.0407 365 LYS A CD  
991  C CE  . LYS A 157 ? 0.5535 0.4790 0.5537 0.0085  -0.0465 -0.0403 365 LYS A CE  
992  N NZ  . LYS A 157 ? 0.6167 0.5253 0.6024 0.0111  -0.0588 -0.0443 365 LYS A NZ  
993  N N   . ASN A 158 ? 0.4641 0.4031 0.5192 -0.0093 -0.0576 -0.0318 366 ASN A N   
994  C CA  . ASN A 158 ? 0.4876 0.4129 0.5431 -0.0113 -0.0717 -0.0343 366 ASN A CA  
995  C C   . ASN A 158 ? 0.4862 0.4125 0.5580 -0.0157 -0.0735 -0.0310 366 ASN A C   
996  O O   . ASN A 158 ? 0.5017 0.4135 0.5659 -0.0156 -0.0818 -0.0350 366 ASN A O   
997  C CB  . ASN A 158 ? 0.4960 0.4206 0.5619 -0.0137 -0.0835 -0.0331 366 ASN A CB  
998  C CG  . ASN A 158 ? 0.5233 0.4420 0.5689 -0.0084 -0.0843 -0.0375 366 ASN A CG  
999  O OD1 . ASN A 158 ? 0.5712 0.4783 0.5915 -0.0022 -0.0814 -0.0426 366 ASN A OD1 
1000 N ND2 . ASN A 158 ? 0.5391 0.4657 0.5964 -0.0102 -0.0875 -0.0344 366 ASN A ND2 
1001 N N   . LYS A 159 ? 0.4646 0.4066 0.5576 -0.0186 -0.0654 -0.0234 367 LYS A N   
1002 C CA  . LYS A 159 ? 0.4619 0.4055 0.5716 -0.0221 -0.0654 -0.0186 367 LYS A CA  
1003 C C   . LYS A 159 ? 0.4535 0.3949 0.5502 -0.0195 -0.0564 -0.0210 367 LYS A C   
1004 O O   . LYS A 159 ? 0.4582 0.3913 0.5558 -0.0210 -0.0608 -0.0222 367 LYS A O   
1005 C CB  . LYS A 159 ? 0.4510 0.4104 0.5891 -0.0246 -0.0597 -0.0077 367 LYS A CB  
1006 C CG  . LYS A 159 ? 0.4583 0.4189 0.6181 -0.0281 -0.0605 -0.0008 367 LYS A CG  
1007 C CD  . LYS A 159 ? 0.4602 0.4339 0.6531 -0.0305 -0.0581 0.0117  367 LYS A CD  
1008 N N   . TYR A 160 ? 0.4346 0.3825 0.5202 -0.0156 -0.0450 -0.0217 368 TYR A N   
1009 C CA  . TYR A 160 ? 0.4251 0.3735 0.5045 -0.0135 -0.0364 -0.0219 368 TYR A CA  
1010 C C   . TYR A 160 ? 0.4265 0.3674 0.4851 -0.0094 -0.0333 -0.0282 368 TYR A C   
1011 O O   . TYR A 160 ? 0.4256 0.3646 0.4808 -0.0083 -0.0289 -0.0286 368 TYR A O   
1012 C CB  . TYR A 160 ? 0.4152 0.3759 0.5024 -0.0116 -0.0262 -0.0158 368 TYR A CB  
1013 C CG  . TYR A 160 ? 0.4133 0.3817 0.5228 -0.0138 -0.0251 -0.0068 368 TYR A CG  
1014 C CD1 . TYR A 160 ? 0.3980 0.3756 0.5179 -0.0130 -0.0223 -0.0013 368 TYR A CD1 
1015 C CD2 . TYR A 160 ? 0.4269 0.3933 0.5486 -0.0163 -0.0262 -0.0027 368 TYR A CD2 
1016 C CE1 . TYR A 160 ? 0.4169 0.4022 0.5600 -0.0140 -0.0195 0.0090  368 TYR A CE1 
1017 C CE2 . TYR A 160 ? 0.4248 0.3990 0.5710 -0.0177 -0.0237 0.0078  368 TYR A CE2 
1018 C CZ  . TYR A 160 ? 0.4224 0.4062 0.5796 -0.0163 -0.0199 0.0140  368 TYR A CZ  
1019 O OH  . TYR A 160 ? 0.4343 0.4264 0.6180 -0.0168 -0.0158 0.0263  368 TYR A OH  
1020 N N   . LEU A 161 ? 0.4305 0.3673 0.4767 -0.0067 -0.0348 -0.0321 369 LEU A N   
1021 C CA  . LEU A 161 ? 0.4311 0.3621 0.4614 -0.0019 -0.0296 -0.0356 369 LEU A CA  
1022 C C   . LEU A 161 ? 0.4471 0.3635 0.4656 -0.0001 -0.0331 -0.0394 369 LEU A C   
1023 O O   . LEU A 161 ? 0.4626 0.3672 0.4730 0.0005  -0.0420 -0.0425 369 LEU A O   
1024 C CB  . LEU A 161 ? 0.4305 0.3613 0.4518 0.0017  -0.0281 -0.0371 369 LEU A CB  
1025 C CG  . LEU A 161 ? 0.4248 0.3535 0.4369 0.0069  -0.0202 -0.0376 369 LEU A CG  
1026 C CD1 . LEU A 161 ? 0.4051 0.3444 0.4278 0.0061  -0.0139 -0.0348 369 LEU A CD1 
1027 C CD2 . LEU A 161 ? 0.4273 0.3534 0.4300 0.0113  -0.0189 -0.0382 369 LEU A CD2 
1028 N N   . ALA A 162 ? 0.4457 0.3614 0.4622 0.0014  -0.0271 -0.0392 370 ALA A N   
1029 C CA  . ALA A 162 ? 0.4667 0.3685 0.4711 0.0042  -0.0286 -0.0422 370 ALA A CA  
1030 C C   . ALA A 162 ? 0.4875 0.3767 0.4721 0.0110  -0.0288 -0.0454 370 ALA A C   
1031 O O   . ALA A 162 ? 0.4778 0.3717 0.4599 0.0140  -0.0240 -0.0442 370 ALA A O   
1032 C CB  . ALA A 162 ? 0.4578 0.3627 0.4647 0.0055  -0.0206 -0.0407 370 ALA A CB  
1033 N N   . LYS A 163 ? 0.5140 0.3857 0.4834 0.0144  -0.0346 -0.0492 371 LYS A N   
1034 C CA  . LYS A 163 ? 0.5434 0.3989 0.4883 0.0238  -0.0335 -0.0518 371 LYS A CA  
1035 C C   . LYS A 163 ? 0.5327 0.3942 0.4767 0.0294  -0.0188 -0.0478 371 LYS A C   
1036 O O   . LYS A 163 ? 0.5337 0.4002 0.4862 0.0284  -0.0128 -0.0456 371 LYS A O   
1037 C CB  . LYS A 163 ? 0.5684 0.4020 0.4952 0.0280  -0.0412 -0.0565 371 LYS A CB  
1038 C CG  . LYS A 163 ? 0.6092 0.4205 0.5080 0.0369  -0.0485 -0.0611 371 LYS A CG  
1039 N N   . GLY A 164 ? 0.5365 0.3979 0.4730 0.0351  -0.0135 -0.0460 372 GLY A N   
1040 C CA  . GLY A 164 ? 0.5220 0.3903 0.4635 0.0401  0.0000  -0.0404 372 GLY A CA  
1041 C C   . GLY A 164 ? 0.4884 0.3773 0.4552 0.0332  0.0034  -0.0367 372 GLY A C   
1042 O O   . GLY A 164 ? 0.4789 0.3739 0.4552 0.0360  0.0124  -0.0318 372 GLY A O   
1043 N N   . GLY A 165 ? 0.4667 0.3650 0.4447 0.0251  -0.0038 -0.0385 373 GLY A N   
1044 C CA  . GLY A 165 ? 0.4314 0.3458 0.4281 0.0204  -0.0017 -0.0356 373 GLY A CA  
1045 C C   . GLY A 165 ? 0.4194 0.3394 0.4181 0.0226  0.0011  -0.0334 373 GLY A C   
1046 O O   . GLY A 165 ? 0.4298 0.3417 0.4152 0.0281  0.0025  -0.0336 373 GLY A O   
1047 N N   . SER A 166 ? 0.3889 0.3211 0.4023 0.0193  0.0016  -0.0315 374 SER A N   
1048 C CA  . SER A 166 ? 0.3771 0.3152 0.3952 0.0210  0.0041  -0.0290 374 SER A CA  
1049 C C   . SER A 166 ? 0.3542 0.3021 0.3809 0.0163  -0.0003 -0.0297 374 SER A C   
1050 O O   . SER A 166 ? 0.3456 0.2972 0.3781 0.0129  -0.0029 -0.0303 374 SER A O   
1051 C CB  . SER A 166 ? 0.3763 0.3171 0.4057 0.0244  0.0108  -0.0243 374 SER A CB  
1052 O OG  . SER A 166 ? 0.3977 0.3296 0.4200 0.0302  0.0171  -0.0221 374 SER A OG  
1053 N N   . VAL A 167 ? 0.3424 0.2933 0.3684 0.0173  -0.0004 -0.0290 375 VAL A N   
1054 C CA  . VAL A 167 ? 0.3320 0.2913 0.3647 0.0142  -0.0037 -0.0291 375 VAL A CA  
1055 C C   . VAL A 167 ? 0.3178 0.2818 0.3583 0.0165  -0.0009 -0.0265 375 VAL A C   
1056 O O   . VAL A 167 ? 0.3186 0.2802 0.3567 0.0202  0.0029  -0.0243 375 VAL A O   
1057 C CB  . VAL A 167 ? 0.3432 0.3019 0.3698 0.0129  -0.0080 -0.0305 375 VAL A CB  
1058 C CG1 . VAL A 167 ? 0.3263 0.2942 0.3612 0.0101  -0.0102 -0.0295 375 VAL A CG1 
1059 C CG2 . VAL A 167 ? 0.3648 0.3162 0.3848 0.0111  -0.0126 -0.0328 375 VAL A CG2 
1060 N N   . TYR A 168 ? 0.2941 0.2633 0.3431 0.0151  -0.0032 -0.0263 376 TYR A N   
1061 C CA  . TYR A 168 ? 0.2823 0.2546 0.3407 0.0169  -0.0030 -0.0241 376 TYR A CA  
1062 C C   . TYR A 168 ? 0.2798 0.2564 0.3387 0.0161  -0.0068 -0.0252 376 TYR A C   
1063 O O   . TYR A 168 ? 0.2790 0.2558 0.3343 0.0151  -0.0090 -0.0267 376 TYR A O   
1064 C CB  . TYR A 168 ? 0.2753 0.2458 0.3446 0.0179  -0.0038 -0.0226 376 TYR A CB  
1065 C CG  . TYR A 168 ? 0.2803 0.2471 0.3518 0.0197  0.0013  -0.0199 376 TYR A CG  
1066 C CD1 . TYR A 168 ? 0.2635 0.2265 0.3304 0.0188  0.0013  -0.0216 376 TYR A CD1 
1067 C CD2 . TYR A 168 ? 0.2608 0.2276 0.3390 0.0233  0.0074  -0.0149 376 TYR A CD2 
1068 C CE1 . TYR A 168 ? 0.2547 0.2134 0.3225 0.0214  0.0068  -0.0189 376 TYR A CE1 
1069 C CE2 . TYR A 168 ? 0.2663 0.2288 0.3457 0.0268  0.0141  -0.0111 376 TYR A CE2 
1070 C CZ  . TYR A 168 ? 0.2708 0.2291 0.3444 0.0258  0.0136  -0.0135 376 TYR A CZ  
1071 O OH  . TYR A 168 ? 0.2747 0.2280 0.3485 0.0301  0.0208  -0.0096 376 TYR A OH  
1072 N N   . PRO A 169 ? 0.2830 0.2625 0.3463 0.0174  -0.0067 -0.0237 377 PRO A N   
1073 C CA  . PRO A 169 ? 0.2812 0.2606 0.3499 0.0197  -0.0025 -0.0202 377 PRO A CA  
1074 C C   . PRO A 169 ? 0.2879 0.2644 0.3444 0.0208  0.0013  -0.0203 377 PRO A C   
1075 O O   . PRO A 169 ? 0.2929 0.2699 0.3406 0.0189  -0.0014 -0.0229 377 PRO A O   
1076 C CB  . PRO A 169 ? 0.2742 0.2574 0.3488 0.0203  -0.0046 -0.0192 377 PRO A CB  
1077 C CG  . PRO A 169 ? 0.2739 0.2593 0.3402 0.0186  -0.0083 -0.0226 377 PRO A CG  
1078 C CD  . PRO A 169 ? 0.2816 0.2641 0.3446 0.0176  -0.0100 -0.0246 377 PRO A CD  
1079 N N   . ASP A 170 ? 0.2853 0.2577 0.3413 0.0247  0.0073  -0.0169 378 ASP A N   
1080 C CA  . ASP A 170 ? 0.3088 0.2737 0.3478 0.0278  0.0099  -0.0178 378 ASP A CA  
1081 C C   . ASP A 170 ? 0.3218 0.2847 0.3523 0.0319  0.0122  -0.0161 378 ASP A C   
1082 O O   . ASP A 170 ? 0.3525 0.3077 0.3659 0.0339  0.0102  -0.0188 378 ASP A O   
1083 C CB  . ASP A 170 ? 0.3111 0.2688 0.3470 0.0320  0.0159  -0.0154 378 ASP A CB  
1084 C CG  . ASP A 170 ? 0.3111 0.2714 0.3637 0.0358  0.0233  -0.0081 378 ASP A CG  
1085 O OD1 . ASP A 170 ? 0.3331 0.2869 0.3804 0.0426  0.0318  -0.0033 378 ASP A OD1 
1086 O OD2 . ASP A 170 ? 0.2732 0.2408 0.3444 0.0326  0.0202  -0.0064 378 ASP A OD2 
1087 N N   . ILE A 171 ? 0.3104 0.2789 0.3529 0.0334  0.0154  -0.0118 379 ILE A N   
1088 C CA  . ILE A 171 ? 0.3171 0.2839 0.3528 0.0379  0.0187  -0.0092 379 ILE A CA  
1089 C C   . ILE A 171 ? 0.3037 0.2797 0.3510 0.0344  0.0147  -0.0092 379 ILE A C   
1090 O O   . ILE A 171 ? 0.2884 0.2702 0.3532 0.0320  0.0135  -0.0075 379 ILE A O   
1091 C CB  . ILE A 171 ? 0.3263 0.2893 0.3657 0.0460  0.0300  -0.0009 379 ILE A CB  
1092 C CG1 . ILE A 171 ? 0.3513 0.3038 0.3775 0.0513  0.0352  -0.0003 379 ILE A CG1 
1093 C CG2 . ILE A 171 ? 0.3469 0.3073 0.3773 0.0519  0.0342  0.0023  379 ILE A CG2 
1094 C CD1 . ILE A 171 ? 0.3867 0.3346 0.4161 0.0611  0.0489  0.0096  379 ILE A CD1 
1095 N N   . CYS A 172 ? 0.3128 0.2948 0.3829 0.0343  0.0256  0.0214  380 CYS A N   
1096 C CA  . CYS A 172 ? 0.3213 0.3032 0.3786 0.0334  0.0236  0.0223  380 CYS A CA  
1097 C C   . CYS A 172 ? 0.3025 0.2877 0.3607 0.0259  0.0213  0.0148  380 CYS A C   
1098 O O   . CYS A 172 ? 0.2973 0.2837 0.3671 0.0223  0.0230  0.0102  380 CYS A O   
1099 C CB  . CYS A 172 ? 0.3195 0.2948 0.3769 0.0365  0.0295  0.0296  380 CYS A CB  
1100 S SG  . CYS A 172 ? 0.4327 0.4022 0.4890 0.0470  0.0350  0.0407  380 CYS A SG  
1101 N N   . THR A 173 ? 0.2973 0.2843 0.3435 0.0243  0.0176  0.0132  381 THR A N   
1102 C CA  . THR A 173 ? 0.2807 0.2695 0.3250 0.0189  0.0163  0.0078  381 THR A CA  
1103 C C   . THR A 173 ? 0.2797 0.2659 0.3137 0.0192  0.0158  0.0104  381 THR A C   
1104 O O   . THR A 173 ? 0.2824 0.2673 0.3089 0.0228  0.0150  0.0146  381 THR A O   
1105 C CB  . THR A 173 ? 0.2761 0.2691 0.3175 0.0157  0.0133  0.0023  381 THR A CB  
1106 O OG1 . THR A 173 ? 0.2745 0.2682 0.3075 0.0173  0.0107  0.0032  381 THR A OG1 
1107 C CG2 . THR A 173 ? 0.2795 0.2759 0.3315 0.0152  0.0135  -0.0009 381 THR A CG2 
1108 N N   . ILE A 174 ? 0.2670 0.2532 0.3004 0.0162  0.0161  0.0073  382 ILE A N   
1109 C CA  . ILE A 174 ? 0.2667 0.2507 0.2902 0.0161  0.0152  0.0088  382 ILE A CA  
1110 C C   . ILE A 174 ? 0.2723 0.2580 0.2892 0.0131  0.0132  0.0046  382 ILE A C   
1111 O O   . ILE A 174 ? 0.2715 0.2600 0.2925 0.0115  0.0134  0.0002  382 ILE A O   
1112 C CB  . ILE A 174 ? 0.2607 0.2429 0.2891 0.0165  0.0177  0.0092  382 ILE A CB  
1113 C CG1 . ILE A 174 ? 0.2570 0.2362 0.2943 0.0195  0.0222  0.0141  382 ILE A CG1 
1114 C CG2 . ILE A 174 ? 0.2460 0.2262 0.2636 0.0166  0.0163  0.0104  382 ILE A CG2 
1115 C CD1 . ILE A 174 ? 0.2684 0.2460 0.3164 0.0191  0.0264  0.0129  382 ILE A CD1 
1116 N N   . SER A 175 ? 0.2721 0.2559 0.2792 0.0130  0.0118  0.0059  383 SER A N   
1117 C CA  . SER A 175 ? 0.2791 0.2624 0.2797 0.0107  0.0117  0.0035  383 SER A CA  
1118 C C   . SER A 175 ? 0.2801 0.2599 0.2720 0.0112  0.0114  0.0051  383 SER A C   
1119 O O   . SER A 175 ? 0.2755 0.2540 0.2654 0.0128  0.0105  0.0079  383 SER A O   
1120 C CB  . SER A 175 ? 0.2786 0.2628 0.2789 0.0093  0.0114  0.0020  383 SER A CB  
1121 O OG  . SER A 175 ? 0.3065 0.2943 0.3148 0.0089  0.0114  0.0000  383 SER A OG  
1122 N N   . LEU A 176 ? 0.2776 0.2561 0.2638 0.0105  0.0123  0.0037  384 LEU A N   
1123 C CA  . LEU A 176 ? 0.2804 0.2548 0.2577 0.0113  0.0124  0.0053  384 LEU A CA  
1124 C C   . LEU A 176 ? 0.2858 0.2567 0.2586 0.0096  0.0148  0.0056  384 LEU A C   
1125 O O   . LEU A 176 ? 0.2860 0.2577 0.2610 0.0082  0.0171  0.0041  384 LEU A O   
1126 C CB  . LEU A 176 ? 0.2802 0.2554 0.2538 0.0137  0.0122  0.0038  384 LEU A CB  
1127 C CG  . LEU A 176 ? 0.2685 0.2472 0.2494 0.0152  0.0107  0.0018  384 LEU A CG  
1128 C CD1 . LEU A 176 ? 0.2856 0.2669 0.2632 0.0184  0.0097  -0.0019 384 LEU A CD1 
1129 C CD2 . LEU A 176 ? 0.2612 0.2375 0.2428 0.0153  0.0102  0.0049  384 LEU A CD2 
1130 N N   . VAL A 177 ? 0.2876 0.2546 0.2556 0.0097  0.0150  0.0072  385 VAL A N   
1131 C CA  . VAL A 177 ? 0.3011 0.2637 0.2674 0.0080  0.0186  0.0072  385 VAL A CA  
1132 C C   . VAL A 177 ? 0.3037 0.2607 0.2622 0.0096  0.0193  0.0096  385 VAL A C   
1133 O O   . VAL A 177 ? 0.3108 0.2687 0.2677 0.0110  0.0160  0.0102  385 VAL A O   
1134 C CB  . VAL A 177 ? 0.2944 0.2596 0.2694 0.0055  0.0181  0.0041  385 VAL A CB  
1135 C CG1 . VAL A 177 ? 0.2950 0.2628 0.2705 0.0071  0.0139  0.0038  385 VAL A CG1 
1136 C CG2 . VAL A 177 ? 0.3143 0.2753 0.2921 0.0028  0.0233  0.0026  385 VAL A CG2 
1137 N N   . ALA A 178 ? 0.3066 0.2576 0.2602 0.0100  0.0243  0.0114  386 ALA A N   
1138 C CA  . ALA A 178 ? 0.3063 0.2510 0.2523 0.0122  0.0257  0.0142  386 ALA A CA  
1139 C C   . ALA A 178 ? 0.3059 0.2479 0.2579 0.0095  0.0266  0.0129  386 ALA A C   
1140 O O   . ALA A 178 ? 0.2939 0.2368 0.2551 0.0061  0.0290  0.0099  386 ALA A O   
1141 C CB  . ALA A 178 ? 0.3206 0.2591 0.2576 0.0154  0.0316  0.0178  386 ALA A CB  
1142 N N   . VAL A 179 ? 0.3058 0.2453 0.2535 0.0113  0.0247  0.0140  387 VAL A N   
1143 C CA  . VAL A 179 ? 0.3071 0.2457 0.2610 0.0094  0.0246  0.0116  387 VAL A CA  
1144 C C   . VAL A 179 ? 0.3149 0.2443 0.2636 0.0110  0.0289  0.0147  387 VAL A C   
1145 O O   . VAL A 179 ? 0.3128 0.2392 0.2508 0.0151  0.0284  0.0184  387 VAL A O   
1146 C CB  . VAL A 179 ? 0.3078 0.2530 0.2620 0.0105  0.0177  0.0098  387 VAL A CB  
1147 C CG1 . VAL A 179 ? 0.3138 0.2600 0.2739 0.0096  0.0166  0.0061  387 VAL A CG1 
1148 C CG2 . VAL A 179 ? 0.3064 0.2594 0.2647 0.0102  0.0143  0.0082  387 VAL A CG2 
1149 N N   . SER A 180 ? 0.3206 0.2460 0.2781 0.0083  0.0333  0.0125  388 SER A N   
1150 C CA  . SER A 180 ? 0.3374 0.2540 0.2929 0.0097  0.0372  0.0148  388 SER A CA  
1151 C C   . SER A 180 ? 0.3341 0.2550 0.2990 0.0078  0.0334  0.0089  388 SER A C   
1152 O O   . SER A 180 ? 0.3302 0.2555 0.3088 0.0043  0.0341  0.0025  388 SER A O   
1153 C CB  . SER A 180 ? 0.3515 0.2578 0.3109 0.0086  0.0481  0.0176  388 SER A CB  
1154 O OG  . SER A 180 ? 0.3698 0.2666 0.3277 0.0105  0.0525  0.0205  388 SER A OG  
1155 N N   . ASP A 181 ? 0.3368 0.2580 0.2952 0.0106  0.0290  0.0100  389 ASP A N   
1156 C CA  . ASP A 181 ? 0.3437 0.2693 0.3100 0.0096  0.0256  0.0043  389 ASP A CA  
1157 C C   . ASP A 181 ? 0.3494 0.2698 0.3080 0.0127  0.0247  0.0074  389 ASP A C   
1158 O O   . ASP A 181 ? 0.3393 0.2649 0.2916 0.0150  0.0186  0.0073  389 ASP A O   
1159 C CB  . ASP A 181 ? 0.3296 0.2676 0.2980 0.0098  0.0180  -0.0001 389 ASP A CB  
1160 C CG  . ASP A 181 ? 0.3590 0.3038 0.3386 0.0091  0.0153  -0.0082 389 ASP A CG  
1161 O OD1 . ASP A 181 ? 0.3533 0.2941 0.3367 0.0090  0.0170  -0.0100 389 ASP A OD1 
1162 O OD2 . ASP A 181 ? 0.3795 0.3344 0.3643 0.0095  0.0114  -0.0133 389 ASP A OD2 
1163 N N   . VAL A 182 ? 0.3647 0.2742 0.3243 0.0131  0.0317  0.0102  390 VAL A N   
1164 C CA  . VAL A 182 ? 0.3888 0.2914 0.3411 0.0168  0.0322  0.0137  390 VAL A CA  
1165 C C   . VAL A 182 ? 0.3905 0.2991 0.3486 0.0162  0.0265  0.0078  390 VAL A C   
1166 O O   . VAL A 182 ? 0.3856 0.2945 0.3353 0.0195  0.0225  0.0094  390 VAL A O   
1167 C CB  . VAL A 182 ? 0.4059 0.2945 0.3604 0.0175  0.0428  0.0183  390 VAL A CB  
1168 C CG1 . VAL A 182 ? 0.4380 0.3195 0.3913 0.0203  0.0440  0.0197  390 VAL A CG1 
1169 C CG2 . VAL A 182 ? 0.4135 0.2958 0.3546 0.0215  0.0474  0.0263  390 VAL A CG2 
1170 N N   . ASN A 183 ? 0.3928 0.3075 0.3657 0.0126  0.0260  0.0000  391 ASN A N   
1171 C CA  . ASN A 183 ? 0.4072 0.3299 0.3856 0.0129  0.0202  -0.0066 391 ASN A CA  
1172 C C   . ASN A 183 ? 0.3979 0.3310 0.3670 0.0153  0.0120  -0.0065 391 ASN A C   
1173 O O   . ASN A 183 ? 0.4010 0.3358 0.3653 0.0176  0.0084  -0.0067 391 ASN A O   
1174 C CB  . ASN A 183 ? 0.4127 0.3418 0.4100 0.0097  0.0210  -0.0167 391 ASN A CB  
1175 C CG  . ASN A 183 ? 0.4458 0.3640 0.4565 0.0070  0.0302  -0.0180 391 ASN A CG  
1176 O OD1 . ASN A 183 ? 0.4877 0.3935 0.4923 0.0086  0.0355  -0.0109 391 ASN A OD1 
1177 N ND2 . ASN A 183 ? 0.4803 0.4034 0.5102 0.0035  0.0327  -0.0272 391 ASN A ND2 
1178 N N   . LYS A 184 ? 0.3965 0.3357 0.3636 0.0149  0.0100  -0.0060 392 LYS A N   
1179 C CA  . LYS A 184 ? 0.3900 0.3370 0.3488 0.0175  0.0044  -0.0045 392 LYS A CA  
1180 C C   . LYS A 184 ? 0.3815 0.3235 0.3288 0.0197  0.0040  0.0015  392 LYS A C   
1181 O O   . LYS A 184 ? 0.3753 0.3217 0.3183 0.0218  0.0004  0.0017  392 LYS A O   
1182 C CB  . LYS A 184 ? 0.3902 0.3435 0.3502 0.0170  0.0032  -0.0048 392 LYS A CB  
1183 C CG  . LYS A 184 ? 0.4256 0.3893 0.3941 0.0177  0.0001  -0.0122 392 LYS A CG  
1184 C CD  . LYS A 184 ? 0.4730 0.4428 0.4415 0.0184  -0.0012 -0.0119 392 LYS A CD  
1185 C CE  . LYS A 184 ? 0.5049 0.4860 0.4820 0.0205  -0.0047 -0.0205 392 LYS A CE  
1186 N NZ  . LYS A 184 ? 0.5388 0.5284 0.5101 0.0259  -0.0096 -0.0216 392 LYS A NZ  
1187 N N   . HIS A 185 ? 0.3765 0.3104 0.3194 0.0198  0.0079  0.0060  393 HIS A N   
1188 C CA  . HIS A 185 ? 0.3817 0.3123 0.3145 0.0231  0.0070  0.0099  393 HIS A CA  
1189 C C   . HIS A 185 ? 0.3860 0.3141 0.3168 0.0253  0.0055  0.0091  393 HIS A C   
1190 O O   . HIS A 185 ? 0.3749 0.3065 0.3014 0.0275  0.0018  0.0087  393 HIS A O   
1191 C CB  . HIS A 185 ? 0.3836 0.3067 0.3107 0.0246  0.0114  0.0144  393 HIS A CB  
1192 C CG  . HIS A 185 ? 0.3695 0.2928 0.2869 0.0291  0.0091  0.0165  393 HIS A CG  
1193 N ND1 . HIS A 185 ? 0.3498 0.2688 0.2605 0.0336  0.0085  0.0177  393 HIS A ND1 
1194 C CD2 . HIS A 185 ? 0.3488 0.2773 0.2636 0.0303  0.0071  0.0164  393 HIS A CD2 
1195 C CE1 . HIS A 185 ? 0.3394 0.2617 0.2437 0.0377  0.0057  0.0175  393 HIS A CE1 
1196 N NE2 . HIS A 185 ? 0.3470 0.2752 0.2546 0.0355  0.0050  0.0164  393 HIS A NE2 
1197 N N   . ALA A 186 ? 0.4001 0.3221 0.3359 0.0245  0.0088  0.0081  394 ALA A N   
1198 C CA  . ALA A 186 ? 0.4105 0.3301 0.3461 0.0264  0.0075  0.0067  394 ALA A CA  
1199 C C   . ALA A 186 ? 0.4120 0.3417 0.3503 0.0261  0.0018  0.0018  394 ALA A C   
1200 O O   . ALA A 186 ? 0.4107 0.3411 0.3448 0.0286  -0.0008 0.0015  394 ALA A O   
1201 C CB  . ALA A 186 ? 0.4189 0.3303 0.3630 0.0249  0.0131  0.0057  394 ALA A CB  
1202 N N   . ASP A 187 ? 0.4116 0.3497 0.3562 0.0239  0.0003  -0.0018 395 ASP A N   
1203 C CA  . ASP A 187 ? 0.4203 0.3688 0.3657 0.0251  -0.0042 -0.0056 395 ASP A CA  
1204 C C   . ASP A 187 ? 0.4074 0.3589 0.3448 0.0272  -0.0062 -0.0021 395 ASP A C   
1205 O O   . ASP A 187 ? 0.4078 0.3644 0.3438 0.0290  -0.0087 -0.0037 395 ASP A O   
1206 C CB  . ASP A 187 ? 0.4245 0.3818 0.3758 0.0244  -0.0055 -0.0094 395 ASP A CB  
1207 C CG  . ASP A 187 ? 0.4738 0.4328 0.4373 0.0227  -0.0046 -0.0166 395 ASP A CG  
1208 O OD1 . ASP A 187 ? 0.5053 0.4710 0.4748 0.0222  -0.0053 -0.0206 395 ASP A OD1 
1209 O OD2 . ASP A 187 ? 0.5062 0.4602 0.4746 0.0221  -0.0031 -0.0190 395 ASP A OD2 
1210 N N   . ARG A 188 ? 0.3932 0.3421 0.3268 0.0268  -0.0048 0.0018  396 ARG A N   
1211 C CA  . ARG A 188 ? 0.3768 0.3289 0.3067 0.0283  -0.0057 0.0039  396 ARG A CA  
1212 C C   . ARG A 188 ? 0.3819 0.3298 0.3075 0.0303  -0.0062 0.0045  396 ARG A C   
1213 O O   . ARG A 188 ? 0.3817 0.3332 0.3071 0.0316  -0.0073 0.0038  396 ARG A O   
1214 C CB  . ARG A 188 ? 0.3694 0.3225 0.2998 0.0272  -0.0042 0.0064  396 ARG A CB  
1215 C CG  . ARG A 188 ? 0.3569 0.3150 0.2911 0.0261  -0.0041 0.0057  396 ARG A CG  
1216 C CD  . ARG A 188 ? 0.3468 0.3125 0.2810 0.0286  -0.0057 0.0047  396 ARG A CD  
1217 N NE  . ARG A 188 ? 0.3354 0.3022 0.2674 0.0303  -0.0050 0.0069  396 ARG A NE  
1218 C CZ  . ARG A 188 ? 0.3427 0.3095 0.2758 0.0303  -0.0028 0.0098  396 ARG A CZ  
1219 N NH1 . ARG A 188 ? 0.3288 0.2945 0.2636 0.0289  -0.0016 0.0114  396 ARG A NH1 
1220 N NH2 . ARG A 188 ? 0.3109 0.2788 0.2448 0.0315  -0.0012 0.0106  396 ARG A NH2 
1221 N N   . ILE A 189 ? 0.3782 0.3188 0.3007 0.0313  -0.0050 0.0057  397 ILE A N   
1222 C CA  . ILE A 189 ? 0.3855 0.3230 0.3022 0.0351  -0.0059 0.0063  397 ILE A CA  
1223 C C   . ILE A 189 ? 0.3820 0.3145 0.2960 0.0378  -0.0065 0.0056  397 ILE A C   
1224 O O   . ILE A 189 ? 0.3825 0.3179 0.2959 0.0398  -0.0094 0.0030  397 ILE A O   
1225 C CB  . ILE A 189 ? 0.3853 0.3192 0.2974 0.0367  -0.0038 0.0091  397 ILE A CB  
1226 C CG1 . ILE A 189 ? 0.4057 0.3452 0.3219 0.0340  -0.0034 0.0090  397 ILE A CG1 
1227 C CG2 . ILE A 189 ? 0.4028 0.3358 0.3080 0.0427  -0.0057 0.0083  397 ILE A CG2 
1228 C CD1 . ILE A 189 ? 0.3991 0.3459 0.3195 0.0341  -0.0056 0.0062  397 ILE A CD1 
1229 N N   . ALA A 190 ? 0.3909 0.3155 0.3044 0.0378  -0.0033 0.0078  398 ALA A N   
1230 C CA  . ALA A 190 ? 0.3947 0.3129 0.3069 0.0405  -0.0028 0.0078  398 ALA A CA  
1231 C C   . ALA A 190 ? 0.3915 0.3152 0.3097 0.0387  -0.0059 0.0030  398 ALA A C   
1232 O O   . ALA A 190 ? 0.3963 0.3178 0.3129 0.0416  -0.0075 0.0017  398 ALA A O   
1233 C CB  . ALA A 190 ? 0.4113 0.3195 0.3257 0.0398  0.0032  0.0111  398 ALA A CB  
1234 N N   . PHE A 191 ? 0.3760 0.3074 0.3003 0.0350  -0.0069 0.0004  399 PHE A N   
1235 C CA  . PHE A 191 ? 0.3732 0.3121 0.3017 0.0343  -0.0099 -0.0041 399 PHE A CA  
1236 C C   . PHE A 191 ? 0.3688 0.3101 0.2936 0.0372  -0.0128 -0.0054 399 PHE A C   
1237 O O   . PHE A 191 ? 0.3727 0.3156 0.2997 0.0380  -0.0145 -0.0087 399 PHE A O   
1238 C CB  . PHE A 191 ? 0.3662 0.3140 0.2974 0.0324  -0.0105 -0.0051 399 PHE A CB  
1239 C CG  . PHE A 191 ? 0.3727 0.3291 0.3049 0.0335  -0.0130 -0.0083 399 PHE A CG  
1240 C CD1 . PHE A 191 ? 0.3774 0.3383 0.3148 0.0337  -0.0145 -0.0134 399 PHE A CD1 
1241 C CD2 . PHE A 191 ? 0.3665 0.3271 0.2957 0.0348  -0.0133 -0.0069 399 PHE A CD2 
1242 C CE1 . PHE A 191 ? 0.3878 0.3576 0.3247 0.0358  -0.0166 -0.0163 399 PHE A CE1 
1243 C CE2 . PHE A 191 ? 0.3726 0.3405 0.3021 0.0364  -0.0141 -0.0090 399 PHE A CE2 
1244 C CZ  . PHE A 191 ? 0.3729 0.3456 0.3049 0.0373  -0.0160 -0.0134 399 PHE A CZ  
1245 N N   . TRP A 192 ? 0.3571 0.2994 0.2779 0.0387  -0.0132 -0.0038 400 TRP A N   
1246 C CA  . TRP A 192 ? 0.3551 0.3013 0.2753 0.0410  -0.0156 -0.0066 400 TRP A CA  
1247 C C   . TRP A 192 ? 0.3708 0.3121 0.2874 0.0452  -0.0176 -0.0081 400 TRP A C   
1248 O O   . TRP A 192 ? 0.3654 0.3105 0.2830 0.0473  -0.0200 -0.0118 400 TRP A O   
1249 C CB  . TRP A 192 ? 0.3445 0.2942 0.2649 0.0414  -0.0152 -0.0064 400 TRP A CB  
1250 C CG  . TRP A 192 ? 0.3354 0.2901 0.2599 0.0380  -0.0129 -0.0048 400 TRP A CG  
1251 C CD1 . TRP A 192 ? 0.3089 0.2628 0.2335 0.0362  -0.0111 -0.0017 400 TRP A CD1 
1252 C CD2 . TRP A 192 ? 0.3196 0.2805 0.2478 0.0370  -0.0119 -0.0055 400 TRP A CD2 
1253 N NE1 . TRP A 192 ? 0.3206 0.2797 0.2487 0.0345  -0.0092 -0.0005 400 TRP A NE1 
1254 C CE2 . TRP A 192 ? 0.3296 0.2928 0.2593 0.0353  -0.0093 -0.0024 400 TRP A CE2 
1255 C CE3 . TRP A 192 ? 0.3256 0.2903 0.2556 0.0380  -0.0124 -0.0083 400 TRP A CE3 
1256 C CZ2 . TRP A 192 ? 0.3230 0.2914 0.2546 0.0355  -0.0068 -0.0010 400 TRP A CZ2 
1257 C CZ3 . TRP A 192 ? 0.3220 0.2922 0.2540 0.0378  -0.0096 -0.0071 400 TRP A CZ3 
1258 C CH2 . TRP A 192 ? 0.3299 0.3016 0.2621 0.0370  -0.0066 -0.0031 400 TRP A CH2 
1259 N N   . ASP A 193 ? 0.3925 0.3250 0.3054 0.0470  -0.0159 -0.0050 401 ASP A N   
1260 C CA  . ASP A 193 ? 0.4139 0.3405 0.3220 0.0525  -0.0172 -0.0052 401 ASP A CA  
1261 C C   . ASP A 193 ? 0.4160 0.3428 0.3288 0.0520  -0.0186 -0.0086 401 ASP A C   
1262 O O   . ASP A 193 ? 0.4251 0.3503 0.3352 0.0565  -0.0210 -0.0105 401 ASP A O   
1263 C CB  . ASP A 193 ? 0.4342 0.3500 0.3359 0.0558  -0.0134 0.0005  401 ASP A CB  
1264 C CG  . ASP A 193 ? 0.4513 0.3681 0.3462 0.0588  -0.0133 0.0027  401 ASP A CG  
1265 O OD1 . ASP A 193 ? 0.4826 0.4067 0.3763 0.0616  -0.0173 -0.0012 401 ASP A OD1 
1266 O OD2 . ASP A 193 ? 0.4896 0.4006 0.3817 0.0584  -0.0089 0.0076  401 ASP A OD2 
1267 N N   . ASP A 194 ? 0.4093 0.3390 0.3293 0.0472  -0.0175 -0.0102 402 ASP A N   
1268 C CA  . ASP A 194 ? 0.4166 0.3481 0.3425 0.0467  -0.0189 -0.0146 402 ASP A CA  
1269 C C   . ASP A 194 ? 0.3965 0.3383 0.3282 0.0428  -0.0197 -0.0183 402 ASP A C   
1270 O O   . ASP A 194 ? 0.3854 0.3281 0.3222 0.0401  -0.0180 -0.0188 402 ASP A O   
1271 C CB  . ASP A 194 ? 0.4304 0.3516 0.3598 0.0472  -0.0155 -0.0132 402 ASP A CB  
1272 C CG  . ASP A 194 ? 0.4840 0.4074 0.4219 0.0465  -0.0169 -0.0190 402 ASP A CG  
1273 O OD1 . ASP A 194 ? 0.5089 0.4417 0.4481 0.0463  -0.0208 -0.0239 402 ASP A OD1 
1274 O OD2 . ASP A 194 ? 0.5285 0.4438 0.4730 0.0463  -0.0134 -0.0189 402 ASP A OD2 
1275 N N   . VAL A 195 ? 0.3838 0.3337 0.3150 0.0434  -0.0220 -0.0210 403 VAL A N   
1276 C CA  . VAL A 195 ? 0.3715 0.3314 0.3055 0.0417  -0.0222 -0.0232 403 VAL A CA  
1277 C C   . VAL A 195 ? 0.3747 0.3399 0.3122 0.0430  -0.0245 -0.0288 403 VAL A C   
1278 O O   . VAL A 195 ? 0.3695 0.3371 0.3057 0.0446  -0.0256 -0.0304 403 VAL A O   
1279 C CB  . VAL A 195 ? 0.3603 0.3251 0.2915 0.0416  -0.0209 -0.0207 403 VAL A CB  
1280 C CG1 . VAL A 195 ? 0.3514 0.3256 0.2833 0.0415  -0.0199 -0.0213 403 VAL A CG1 
1281 C CG2 . VAL A 195 ? 0.3647 0.3247 0.2935 0.0404  -0.0190 -0.0160 403 VAL A CG2 
1282 N N   . TYR A 196 ? 0.3764 0.3436 0.3196 0.0424  -0.0251 -0.0327 404 TYR A N   
1283 C CA  . TYR A 196 ? 0.3820 0.3545 0.3302 0.0437  -0.0275 -0.0393 404 TYR A CA  
1284 C C   . TYR A 196 ? 0.3849 0.3509 0.3325 0.0454  -0.0288 -0.0400 404 TYR A C   
1285 O O   . TYR A 196 ? 0.3853 0.3570 0.3334 0.0469  -0.0308 -0.0440 404 TYR A O   
1286 C CB  . TYR A 196 ? 0.3806 0.3659 0.3267 0.0453  -0.0284 -0.0418 404 TYR A CB  
1287 C CG  . TYR A 196 ? 0.4125 0.4054 0.3586 0.0455  -0.0279 -0.0421 404 TYR A CG  
1288 C CD1 . TYR A 196 ? 0.4337 0.4273 0.3737 0.0455  -0.0255 -0.0360 404 TYR A CD1 
1289 C CD2 . TYR A 196 ? 0.4394 0.4392 0.3927 0.0464  -0.0302 -0.0493 404 TYR A CD2 
1290 C CE1 . TYR A 196 ? 0.4648 0.4653 0.4040 0.0468  -0.0254 -0.0361 404 TYR A CE1 
1291 C CE2 . TYR A 196 ? 0.4639 0.4722 0.4171 0.0479  -0.0306 -0.0508 404 TYR A CE2 
1292 C CZ  . TYR A 196 ? 0.4836 0.4920 0.4289 0.0484  -0.0283 -0.0437 404 TYR A CZ  
1293 O OH  . TYR A 196 ? 0.5401 0.5569 0.4845 0.0510  -0.0289 -0.0450 404 TYR A OH  
1294 N N   . GLY A 197 ? 0.3860 0.3405 0.3316 0.0459  -0.0274 -0.0359 405 GLY A N   
1295 C CA  . GLY A 197 ? 0.3946 0.3422 0.3385 0.0492  -0.0286 -0.0362 405 GLY A CA  
1296 C C   . GLY A 197 ? 0.3908 0.3379 0.3271 0.0520  -0.0300 -0.0339 405 GLY A C   
1297 O O   . GLY A 197 ? 0.3999 0.3425 0.3339 0.0561  -0.0318 -0.0347 405 GLY A O   
1298 N N   . PHE A 198 ? 0.3757 0.3280 0.3093 0.0504  -0.0291 -0.0320 406 PHE A N   
1299 C CA  . PHE A 198 ? 0.3695 0.3234 0.2996 0.0527  -0.0302 -0.0320 406 PHE A CA  
1300 C C   . PHE A 198 ? 0.3727 0.3228 0.2983 0.0529  -0.0285 -0.0272 406 PHE A C   
1301 O O   . PHE A 198 ? 0.3659 0.3154 0.2916 0.0497  -0.0259 -0.0236 406 PHE A O   
1302 C CB  . PHE A 198 ? 0.3587 0.3230 0.2927 0.0509  -0.0297 -0.0353 406 PHE A CB  
1303 C CG  . PHE A 198 ? 0.3519 0.3213 0.2898 0.0514  -0.0312 -0.0405 406 PHE A CG  
1304 C CD1 . PHE A 198 ? 0.3532 0.3283 0.2932 0.0495  -0.0303 -0.0415 406 PHE A CD1 
1305 C CD2 . PHE A 198 ? 0.3491 0.3184 0.2883 0.0545  -0.0341 -0.0451 406 PHE A CD2 
1306 C CE1 . PHE A 198 ? 0.3715 0.3523 0.3149 0.0505  -0.0318 -0.0470 406 PHE A CE1 
1307 C CE2 . PHE A 198 ? 0.3708 0.3450 0.3140 0.0548  -0.0356 -0.0504 406 PHE A CE2 
1308 C CZ  . PHE A 198 ? 0.3737 0.3537 0.3190 0.0527  -0.0343 -0.0512 406 PHE A CZ  
1309 N N   . LYS A 199 ? 0.3675 0.3163 0.2894 0.0572  -0.0304 -0.0281 407 LYS A N   
1310 C CA  . LYS A 199 ? 0.3784 0.3254 0.2961 0.0584  -0.0294 -0.0250 407 LYS A CA  
1311 C C   . LYS A 199 ? 0.3660 0.3213 0.2892 0.0548  -0.0279 -0.0265 407 LYS A C   
1312 O O   . LYS A 199 ? 0.3582 0.3203 0.2874 0.0545  -0.0285 -0.0315 407 LYS A O   
1313 C CB  . LYS A 199 ? 0.3817 0.3268 0.2937 0.0660  -0.0327 -0.0270 407 LYS A CB  
1314 C CG  . LYS A 199 ? 0.4295 0.3651 0.3347 0.0715  -0.0334 -0.0243 407 LYS A CG  
1315 C CD  . LYS A 199 ? 0.4918 0.4274 0.3894 0.0811  -0.0371 -0.0265 407 LYS A CD  
1316 C CE  . LYS A 199 ? 0.5412 0.4649 0.4289 0.0884  -0.0360 -0.0208 407 LYS A CE  
1317 N NZ  . LYS A 199 ? 0.5686 0.4881 0.4611 0.0867  -0.0356 -0.0215 407 LYS A NZ  
1318 N N   . MET A 200 ? 0.3651 0.3193 0.2872 0.0523  -0.0253 -0.0222 408 MET A N   
1319 C CA  . MET A 200 ? 0.3644 0.3248 0.2921 0.0492  -0.0229 -0.0226 408 MET A CA  
1320 C C   . MET A 200 ? 0.3724 0.3308 0.2974 0.0500  -0.0223 -0.0203 408 MET A C   
1321 O O   . MET A 200 ? 0.3685 0.3292 0.2970 0.0468  -0.0194 -0.0182 408 MET A O   
1322 C CB  . MET A 200 ? 0.3572 0.3198 0.2870 0.0447  -0.0197 -0.0195 408 MET A CB  
1323 C CG  . MET A 200 ? 0.3500 0.3172 0.2828 0.0444  -0.0198 -0.0224 408 MET A CG  
1324 S SD  . MET A 200 ? 0.3436 0.3170 0.2784 0.0419  -0.0153 -0.0193 408 MET A SD  
1325 C CE  . MET A 200 ? 0.3443 0.3233 0.2811 0.0433  -0.0158 -0.0237 408 MET A CE  
1326 N N   . SER A 201 ? 0.3852 0.3394 0.3036 0.0552  -0.0248 -0.0205 409 SER A N   
1327 C CA  . SER A 201 ? 0.4027 0.3549 0.3163 0.0574  -0.0243 -0.0181 409 SER A CA  
1328 C C   . SER A 201 ? 0.3910 0.3508 0.3122 0.0560  -0.0237 -0.0218 409 SER A C   
1329 O O   . SER A 201 ? 0.3929 0.3520 0.3131 0.0547  -0.0219 -0.0188 409 SER A O   
1330 C CB  . SER A 201 ? 0.4139 0.3627 0.3184 0.0659  -0.0274 -0.0190 409 SER A CB  
1331 O OG  . SER A 201 ? 0.4741 0.4133 0.3719 0.0670  -0.0259 -0.0136 409 SER A OG  
1332 N N   . CYS A 202 ? 0.3892 0.3563 0.3196 0.0562  -0.0248 -0.0287 410 CYS A N   
1333 C CA  . CYS A 202 ? 0.3896 0.3640 0.3311 0.0548  -0.0233 -0.0337 410 CYS A CA  
1334 C C   . CYS A 202 ? 0.3798 0.3536 0.3266 0.0484  -0.0179 -0.0285 410 CYS A C   
1335 O O   . CYS A 202 ? 0.3771 0.3546 0.3317 0.0472  -0.0159 -0.0306 410 CYS A O   
1336 C CB  . CYS A 202 ? 0.3912 0.3729 0.3444 0.0556  -0.0241 -0.0427 410 CYS A CB  
1337 S SG  . CYS A 202 ? 0.4166 0.3969 0.3716 0.0520  -0.0218 -0.0408 410 CYS A SG  
1338 N N   . MET A 203 ? 0.3649 0.3349 0.3080 0.0450  -0.0156 -0.0225 411 MET A N   
1339 C CA  . MET A 203 ? 0.3595 0.3292 0.3052 0.0406  -0.0110 -0.0171 411 MET A CA  
1340 C C   . MET A 203 ? 0.3553 0.3218 0.2966 0.0398  -0.0107 -0.0129 411 MET A C   
1341 O O   . MET A 203 ? 0.3468 0.3143 0.2921 0.0371  -0.0072 -0.0099 411 MET A O   
1342 C CB  . MET A 203 ? 0.3513 0.3197 0.2932 0.0390  -0.0098 -0.0132 411 MET A CB  
1343 C CG  . MET A 203 ? 0.3669 0.3394 0.3145 0.0390  -0.0080 -0.0161 411 MET A CG  
1344 S SD  . MET A 203 ? 0.3827 0.3589 0.3413 0.0368  -0.0002 -0.0146 411 MET A SD  
1345 C CE  . MET A 203 ? 0.3829 0.3577 0.3335 0.0362  0.0020  -0.0062 411 MET A CE  
1346 N N   . LYS A 204 ? 0.3581 0.3206 0.2910 0.0427  -0.0137 -0.0123 412 LYS A N   
1347 C CA  . LYS A 204 ? 0.3634 0.3231 0.2923 0.0425  -0.0129 -0.0090 412 LYS A CA  
1348 C C   . LYS A 204 ? 0.3643 0.3294 0.3014 0.0420  -0.0117 -0.0121 412 LYS A C   
1349 O O   . LYS A 204 ? 0.3630 0.3277 0.3021 0.0391  -0.0092 -0.0088 412 LYS A O   
1350 C CB  . LYS A 204 ? 0.3721 0.3267 0.2907 0.0475  -0.0152 -0.0082 412 LYS A CB  
1351 C CG  . LYS A 204 ? 0.3808 0.3282 0.2932 0.0475  -0.0148 -0.0043 412 LYS A CG  
1352 C CD  . LYS A 204 ? 0.4215 0.3627 0.3238 0.0539  -0.0156 -0.0027 412 LYS A CD  
1353 C CE  . LYS A 204 ? 0.4325 0.3651 0.3311 0.0538  -0.0138 0.0010  412 LYS A CE  
1354 N NZ  . LYS A 204 ? 0.4597 0.3849 0.3479 0.0612  -0.0133 0.0039  412 LYS A NZ  
1355 N N   . LYS A 205 ? 0.3407 0.3669 0.3599 0.0442  -0.0051 -0.0312 413 LYS A N   
1356 C CA  . LYS A 205 ? 0.3436 0.3750 0.3793 0.0379  -0.0022 -0.0281 413 LYS A CA  
1357 C C   . LYS A 205 ? 0.3377 0.3788 0.3817 0.0340  0.0064  -0.0202 413 LYS A C   
1358 O O   . LYS A 205 ? 0.3306 0.3719 0.3854 0.0278  0.0080  -0.0164 413 LYS A O   
1359 C CB  . LYS A 205 ? 0.3528 0.3939 0.4043 0.0401  -0.0041 -0.0329 413 LYS A CB  
1360 C CG  . LYS A 205 ? 0.3863 0.4175 0.4303 0.0447  -0.0133 -0.0411 413 LYS A CG  
1361 C CD  . LYS A 205 ? 0.4013 0.4164 0.4372 0.0414  -0.0185 -0.0415 413 LYS A CD  
1362 C CE  . LYS A 205 ? 0.4038 0.4098 0.4335 0.0466  -0.0273 -0.0491 413 LYS A CE  
1363 N NZ  . LYS A 205 ? 0.4045 0.3957 0.4250 0.0445  -0.0312 -0.0485 413 LYS A NZ  
1364 N N   . ALA A 206 ? 0.3395 0.3885 0.3781 0.0385  0.0116  -0.0179 414 ALA A N   
1365 C CA  . ALA A 206 ? 0.3333 0.3911 0.3771 0.0361  0.0204  -0.0096 414 ALA A CA  
1366 C C   . ALA A 206 ? 0.3298 0.3760 0.3599 0.0338  0.0202  -0.0060 414 ALA A C   
1367 O O   . ALA A 206 ? 0.3313 0.3789 0.3666 0.0289  0.0250  0.0006  414 ALA A O   
1368 C CB  . ALA A 206 ? 0.3409 0.4137 0.3842 0.0434  0.0269  -0.0083 414 ALA A CB  
1369 N N   . VAL A 207 ? 0.3231 0.3575 0.3367 0.0371  0.0142  -0.0103 415 VAL A N   
1370 C CA  . VAL A 207 ? 0.3242 0.3487 0.3266 0.0355  0.0133  -0.0076 415 VAL A CA  
1371 C C   . VAL A 207 ? 0.3150 0.3287 0.3194 0.0284  0.0096  -0.0073 415 VAL A C   
1372 O O   . VAL A 207 ? 0.3076 0.3171 0.3098 0.0250  0.0110  -0.0035 415 VAL A O   
1373 C CB  . VAL A 207 ? 0.3373 0.3545 0.3226 0.0426  0.0083  -0.0117 415 VAL A CB  
1374 C CG1 . VAL A 207 ? 0.3378 0.3660 0.3184 0.0515  0.0125  -0.0116 415 VAL A CG1 
1375 C CG2 . VAL A 207 ? 0.3420 0.3500 0.3230 0.0439  0.0000  -0.0183 415 VAL A CG2 
1376 N N   . ILE A 208 ? 0.3046 0.3141 0.3122 0.0271  0.0049  -0.0115 416 ILE A N   
1377 C CA  . ILE A 208 ? 0.3049 0.3051 0.3127 0.0219  0.0019  -0.0113 416 ILE A CA  
1378 C C   . ILE A 208 ? 0.2953 0.2985 0.3131 0.0165  0.0055  -0.0066 416 ILE A C   
1379 O O   . ILE A 208 ? 0.2937 0.2905 0.3074 0.0137  0.0049  -0.0047 416 ILE A O   
1380 C CB  . ILE A 208 ? 0.3091 0.3044 0.3175 0.0229  -0.0034 -0.0164 416 ILE A CB  
1381 C CG1 . ILE A 208 ? 0.3270 0.3130 0.3220 0.0265  -0.0084 -0.0198 416 ILE A CG1 
1382 C CG2 . ILE A 208 ? 0.3019 0.2917 0.3135 0.0187  -0.0049 -0.0157 416 ILE A CG2 
1383 C CD1 . ILE A 208 ? 0.3644 0.3402 0.3507 0.0236  -0.0097 -0.0171 416 ILE A CD1 
1384 N N   . PRO A 209 ? 0.2919 0.3049 0.3237 0.0152  0.0088  -0.0046 417 PRO A N   
1385 C CA  . PRO A 209 ? 0.2877 0.3016 0.3299 0.0099  0.0107  -0.0002 417 PRO A CA  
1386 C C   . PRO A 209 ? 0.2887 0.3028 0.3266 0.0085  0.0153  0.0059  417 PRO A C   
1387 O O   . PRO A 209 ? 0.2933 0.3056 0.3376 0.0043  0.0157  0.0093  417 PRO A O   
1388 C CB  . PRO A 209 ? 0.2936 0.3183 0.3542 0.0088  0.0126  0.0006  417 PRO A CB  
1389 C CG  . PRO A 209 ? 0.2912 0.3189 0.3507 0.0136  0.0099  -0.0053 417 PRO A CG  
1390 C CD  . PRO A 209 ? 0.2935 0.3167 0.3347 0.0181  0.0099  -0.0068 417 PRO A CD  
1391 N N   . GLU A 210 ? 0.2875 0.3027 0.3141 0.0128  0.0178  0.0067  418 GLU A N   
1392 C CA  . GLU A 210 ? 0.2948 0.3091 0.3150 0.0131  0.0215  0.0120  418 GLU A CA  
1393 C C   . GLU A 210 ? 0.2905 0.2935 0.3005 0.0122  0.0169  0.0100  418 GLU A C   
1394 O O   . GLU A 210 ? 0.2822 0.2803 0.2821 0.0156  0.0133  0.0061  418 GLU A O   
1395 C CB  . GLU A 210 ? 0.3036 0.3244 0.3153 0.0198  0.0260  0.0136  418 GLU A CB  
1396 C CG  . GLU A 210 ? 0.3304 0.3653 0.3535 0.0213  0.0320  0.0162  418 GLU A CG  
1397 C CD  . GLU A 210 ? 0.3829 0.4258 0.3957 0.0297  0.0374  0.0180  418 GLU A CD  
1398 O OE1 . GLU A 210 ? 0.4077 0.4439 0.4037 0.0359  0.0337  0.0143  418 GLU A OE1 
1399 O OE2 . GLU A 210 ? 0.3702 0.4264 0.3923 0.0307  0.0450  0.0231  418 GLU A OE2 
1400 N N   . ALA A 211 ? 0.2859 0.2852 0.3001 0.0078  0.0165  0.0125  419 ALA A N   
1401 C CA  . ALA A 211 ? 0.2869 0.2779 0.2934 0.0072  0.0130  0.0111  419 ALA A CA  
1402 C C   . ALA A 211 ? 0.3031 0.2922 0.2981 0.0117  0.0138  0.0125  419 ALA A C   
1403 O O   . ALA A 211 ? 0.2963 0.2903 0.2894 0.0144  0.0185  0.0166  419 ALA A O   
1404 C CB  . ALA A 211 ? 0.2929 0.2812 0.3060 0.0028  0.0122  0.0132  419 ALA A CB  
1405 N N   . VAL A 212 ? 0.3045 0.2869 0.2923 0.0130  0.0092  0.0090  420 VAL A N   
1406 C CA  . VAL A 212 ? 0.3236 0.3028 0.3005 0.0185  0.0075  0.0083  420 VAL A CA  
1407 C C   . VAL A 212 ? 0.3241 0.2975 0.2994 0.0172  0.0051  0.0088  420 VAL A C   
1408 O O   . VAL A 212 ? 0.3116 0.2827 0.2930 0.0126  0.0028  0.0074  420 VAL A O   
1409 C CB  . VAL A 212 ? 0.3320 0.3073 0.3038 0.0215  0.0022  0.0030  420 VAL A CB  
1410 C CG1 . VAL A 212 ? 0.3595 0.3286 0.3219 0.0268  -0.0027 0.0006  420 VAL A CG1 
1411 C CG2 . VAL A 212 ? 0.3448 0.3258 0.3155 0.0252  0.0042  0.0019  420 VAL A CG2 
1412 N N   . VAL A 213 ? 0.3266 0.2983 0.2936 0.0218  0.0057  0.0109  421 VAL A N   
1413 C CA  . VAL A 213 ? 0.3304 0.2958 0.2950 0.0217  0.0022  0.0104  421 VAL A CA  
1414 C C   . VAL A 213 ? 0.3384 0.2981 0.2943 0.0277  -0.0041 0.0056  421 VAL A C   
1415 O O   . VAL A 213 ? 0.3530 0.3121 0.2977 0.0353  -0.0041 0.0056  421 VAL A O   
1416 C CB  . VAL A 213 ? 0.3367 0.3019 0.2981 0.0226  0.0061  0.0162  421 VAL A CB  
1417 C CG1 . VAL A 213 ? 0.3476 0.3052 0.3041 0.0245  0.0011  0.0145  421 VAL A CG1 
1418 C CG2 . VAL A 213 ? 0.3427 0.3118 0.3160 0.0158  0.0100  0.0203  421 VAL A CG2 
1419 N N   . GLU A 214 ? 0.3289 0.2848 0.2904 0.0248  -0.0098 0.0015  422 GLU A N   
1420 C CA  . GLU A 214 ? 0.3441 0.2943 0.3017 0.0292  -0.0173 -0.0035 422 GLU A CA  
1421 C C   . GLU A 214 ? 0.3346 0.2818 0.3018 0.0250  -0.0225 -0.0062 422 GLU A C   
1422 O O   . GLU A 214 ? 0.3196 0.2704 0.2966 0.0183  -0.0197 -0.0047 422 GLU A O   
1423 C CB  . GLU A 214 ? 0.3483 0.2995 0.3060 0.0298  -0.0184 -0.0055 422 GLU A CB  
1424 C CG  . GLU A 214 ? 0.3834 0.3276 0.3395 0.0334  -0.0276 -0.0109 422 GLU A CG  
1425 C CD  . GLU A 214 ? 0.4219 0.3659 0.3750 0.0357  -0.0290 -0.0129 422 GLU A CD  
1426 O OE1 . GLU A 214 ? 0.4228 0.3647 0.3837 0.0305  -0.0314 -0.0136 422 GLU A OE1 
1427 O OE2 . GLU A 214 ? 0.4530 0.3992 0.3955 0.0433  -0.0275 -0.0134 422 GLU A OE2 
1428 N N   . VAL A 215 ? 0.3387 0.2797 0.3034 0.0295  -0.0304 -0.0105 423 VAL A N   
1429 C CA  . VAL A 215 ? 0.3385 0.2779 0.3153 0.0254  -0.0357 -0.0133 423 VAL A CA  
1430 C C   . VAL A 215 ? 0.3377 0.2769 0.3231 0.0212  -0.0381 -0.0143 423 VAL A C   
1431 O O   . VAL A 215 ? 0.3425 0.2773 0.3226 0.0253  -0.0425 -0.0167 423 VAL A O   
1432 C CB  . VAL A 215 ? 0.3505 0.2831 0.3238 0.0320  -0.0446 -0.0181 423 VAL A CB  
1433 C CG1 . VAL A 215 ? 0.3502 0.2829 0.3401 0.0272  -0.0504 -0.0212 423 VAL A CG1 
1434 C CG2 . VAL A 215 ? 0.3525 0.2842 0.3160 0.0361  -0.0420 -0.0162 423 VAL A CG2 
1435 N N   . LEU A 216 ? 0.3294 0.2731 0.3272 0.0136  -0.0350 -0.0122 424 LEU A N   
1436 C CA  . LEU A 216 ? 0.3328 0.2759 0.3387 0.0089  -0.0361 -0.0114 424 LEU A CA  
1437 C C   . LEU A 216 ? 0.3400 0.2805 0.3591 0.0065  -0.0432 -0.0135 424 LEU A C   
1438 O O   . LEU A 216 ? 0.3404 0.2838 0.3673 0.0054  -0.0442 -0.0145 424 LEU A O   
1439 C CB  . LEU A 216 ? 0.3174 0.2671 0.3281 0.0029  -0.0279 -0.0071 424 LEU A CB  
1440 C CG  . LEU A 216 ? 0.3236 0.2761 0.3253 0.0042  -0.0217 -0.0051 424 LEU A CG  
1441 C CD1 . LEU A 216 ? 0.3061 0.2642 0.3133 -0.0004 -0.0156 -0.0022 424 LEU A CD1 
1442 C CD2 . LEU A 216 ? 0.3392 0.2883 0.3339 0.0068  -0.0230 -0.0058 424 LEU A CD2 
1443 N N   . ASP A 217 ? 0.3567 0.2918 0.3795 0.0054  -0.0484 -0.0141 425 ASP A N   
1444 C CA  . ASP A 217 ? 0.3653 0.2984 0.4049 0.0008  -0.0546 -0.0145 425 ASP A CA  
1445 C C   . ASP A 217 ? 0.3543 0.2963 0.4062 -0.0074 -0.0460 -0.0086 425 ASP A C   
1446 O O   . ASP A 217 ? 0.3504 0.2940 0.3989 -0.0104 -0.0396 -0.0042 425 ASP A O   
1447 C CB  . ASP A 217 ? 0.3760 0.2998 0.4150 0.0017  -0.0622 -0.0157 425 ASP A CB  
1448 C CG  . ASP A 217 ? 0.4056 0.3262 0.4646 -0.0041 -0.0692 -0.0149 425 ASP A CG  
1449 O OD1 . ASP A 217 ? 0.3937 0.3209 0.4683 -0.0091 -0.0673 -0.0131 425 ASP A OD1 
1450 O OD2 . ASP A 217 ? 0.4572 0.3685 0.5172 -0.0037 -0.0770 -0.0159 425 ASP A OD2 
1451 N N   . PRO A 218 ? 0.3550 0.3031 0.4205 -0.0100 -0.0461 -0.0089 426 PRO A N   
1452 C CA  . PRO A 218 ? 0.3463 0.3048 0.4220 -0.0160 -0.0371 -0.0038 426 PRO A CA  
1453 C C   . PRO A 218 ? 0.3450 0.3039 0.4309 -0.0226 -0.0345 0.0022  426 PRO A C   
1454 O O   . PRO A 218 ? 0.3411 0.3077 0.4297 -0.0261 -0.0255 0.0075  426 PRO A O   
1455 C CB  . PRO A 218 ? 0.3484 0.3127 0.4384 -0.0162 -0.0403 -0.0068 426 PRO A CB  
1456 C CG  . PRO A 218 ? 0.3625 0.3175 0.4543 -0.0122 -0.0526 -0.0128 426 PRO A CG  
1457 C CD  . PRO A 218 ? 0.3664 0.3121 0.4374 -0.0061 -0.0548 -0.0148 426 PRO A CD  
1458 N N   . LYS A 219 ? 0.3484 0.2980 0.4387 -0.0235 -0.0429 0.0014  427 LYS A N   
1459 C CA  . LYS A 219 ? 0.3577 0.3049 0.4568 -0.0299 -0.0415 0.0080  427 LYS A CA  
1460 C C   . LYS A 219 ? 0.3524 0.2966 0.4350 -0.0290 -0.0352 0.0115  427 LYS A C   
1461 O O   . LYS A 219 ? 0.3538 0.2973 0.4402 -0.0339 -0.0310 0.0183  427 LYS A O   
1462 C CB  . LYS A 219 ? 0.3709 0.3067 0.4794 -0.0305 -0.0545 0.0053  427 LYS A CB  
1463 C CG  . LYS A 219 ? 0.3906 0.3292 0.5215 -0.0329 -0.0617 0.0028  427 LYS A CG  
1464 C CD  . LYS A 219 ? 0.4382 0.3635 0.5773 -0.0320 -0.0771 -0.0013 427 LYS A CD  
1465 N N   . THR A 220 ? 0.3411 0.2835 0.4059 -0.0227 -0.0346 0.0072  428 THR A N   
1466 C CA  . THR A 220 ? 0.3423 0.2822 0.3927 -0.0212 -0.0298 0.0093  428 THR A CA  
1467 C C   . THR A 220 ? 0.3329 0.2821 0.3794 -0.0220 -0.0190 0.0128  428 THR A C   
1468 O O   . THR A 220 ? 0.3338 0.2813 0.3697 -0.0207 -0.0151 0.0145  428 THR A O   
1469 C CB  . THR A 220 ? 0.3400 0.2742 0.3747 -0.0141 -0.0342 0.0035  428 THR A CB  
1470 O OG1 . THR A 220 ? 0.3367 0.2769 0.3666 -0.0103 -0.0318 0.0003  428 THR A OG1 
1471 C CG2 . THR A 220 ? 0.3545 0.2785 0.3903 -0.0113 -0.0460 -0.0007 428 THR A CG2 
1472 N N   . LEU A 221 ? 0.3280 0.2865 0.3831 -0.0233 -0.0153 0.0131  429 LEU A N   
1473 C CA  . LEU A 221 ? 0.3232 0.2906 0.3754 -0.0230 -0.0063 0.0156  429 LEU A CA  
1474 C C   . LEU A 221 ? 0.3250 0.2951 0.3822 -0.0270 -0.0001 0.0229  429 LEU A C   
1475 O O   . LEU A 221 ? 0.3243 0.2961 0.3960 -0.0319 -0.0007 0.0267  429 LEU A O   
1476 C CB  . LEU A 221 ? 0.3250 0.3013 0.3846 -0.0221 -0.0050 0.0131  429 LEU A CB  
1477 C CG  . LEU A 221 ? 0.3364 0.3104 0.3905 -0.0178 -0.0101 0.0070  429 LEU A CG  
1478 C CD1 . LEU A 221 ? 0.3703 0.3529 0.4298 -0.0167 -0.0078 0.0052  429 LEU A CD1 
1479 C CD2 . LEU A 221 ? 0.3558 0.3249 0.3944 -0.0140 -0.0097 0.0054  429 LEU A CD2 
1480 N N   . ILE A 222 ? 0.3201 0.2905 0.3655 -0.0247 0.0055  0.0252  430 ILE A N   
1481 C CA  . ILE A 222 ? 0.3250 0.2960 0.3706 -0.0271 0.0116  0.0329  430 ILE A CA  
1482 C C   . ILE A 222 ? 0.3304 0.3109 0.3709 -0.0237 0.0204  0.0349  430 ILE A C   
1483 O O   . ILE A 222 ? 0.3410 0.3212 0.3754 -0.0231 0.0262  0.0408  430 ILE A O   
1484 C CB  . ILE A 222 ? 0.3283 0.2873 0.3617 -0.0262 0.0091  0.0342  430 ILE A CB  
1485 C CG1 . ILE A 222 ? 0.3246 0.2814 0.3427 -0.0201 0.0082  0.0285  430 ILE A CG1 
1486 C CG2 . ILE A 222 ? 0.3298 0.2791 0.3693 -0.0293 0.0000  0.0330  430 ILE A CG2 
1487 C CD1 . ILE A 222 ? 0.3259 0.2748 0.3309 -0.0176 0.0088  0.0305  430 ILE A CD1 
1488 N N   . SER A 223 ? 0.3256 0.3137 0.3673 -0.0206 0.0208  0.0300  431 SER A N   
1489 C CA  . SER A 223 ? 0.3294 0.3271 0.3679 -0.0165 0.0278  0.0310  431 SER A CA  
1490 C C   . SER A 223 ? 0.3266 0.3341 0.3757 -0.0160 0.0273  0.0272  431 SER A C   
1491 O O   . SER A 223 ? 0.3153 0.3202 0.3707 -0.0178 0.0210  0.0230  431 SER A O   
1492 C CB  . SER A 223 ? 0.3339 0.3276 0.3560 -0.0100 0.0273  0.0271  431 SER A CB  
1493 O OG  . SER A 223 ? 0.3272 0.3212 0.3491 -0.0078 0.0225  0.0201  431 SER A OG  
1494 N N   A GLU A 224 ? 0.3288 0.3471 0.3786 -0.0124 0.0336  0.0285  432 GLU A N   
1495 N N   B GLU A 224 ? 0.3318 0.3501 0.3819 -0.0125 0.0336  0.0285  432 GLU A N   
1496 C CA  A GLU A 224 ? 0.3282 0.3552 0.3841 -0.0095 0.0325  0.0233  432 GLU A CA  
1497 C CA  B GLU A 224 ? 0.3336 0.3605 0.3904 -0.0099 0.0322  0.0233  432 GLU A CA  
1498 C C   A GLU A 224 ? 0.3266 0.3464 0.3711 -0.0052 0.0266  0.0164  432 GLU A C   
1499 C C   B GLU A 224 ? 0.3299 0.3501 0.3746 -0.0051 0.0268  0.0165  432 GLU A C   
1500 O O   A GLU A 224 ? 0.3260 0.3387 0.3580 -0.0027 0.0261  0.0161  432 GLU A O   
1501 O O   B GLU A 224 ? 0.3306 0.3443 0.3626 -0.0023 0.0268  0.0163  432 GLU A O   
1502 C CB  A GLU A 224 ? 0.3311 0.3712 0.3873 -0.0047 0.0406  0.0257  432 GLU A CB  
1503 C CB  B GLU A 224 ? 0.3396 0.3806 0.3996 -0.0060 0.0403  0.0260  432 GLU A CB  
1504 C CG  A GLU A 224 ? 0.3417 0.3903 0.4082 -0.0086 0.0491  0.0349  432 GLU A CG  
1505 C CG  B GLU A 224 ? 0.3603 0.4111 0.4377 -0.0116 0.0462  0.0332  432 GLU A CG  
1506 C CD  A GLU A 224 ? 0.3456 0.4109 0.4160 -0.0034 0.0573  0.0366  432 GLU A CD  
1507 C CD  B GLU A 224 ? 0.3827 0.4356 0.4786 -0.0169 0.0402  0.0301  432 GLU A CD  
1508 O OE1 A GLU A 224 ? 0.3558 0.4260 0.4237 0.0027  0.0548  0.0295  432 GLU A OE1 
1509 O OE1 B GLU A 224 ? 0.3862 0.4457 0.4870 -0.0136 0.0376  0.0240  432 GLU A OE1 
1510 O OE2 A GLU A 224 ? 0.3632 0.4368 0.4392 -0.0051 0.0665  0.0454  432 GLU A OE2 
1511 O OE2 B GLU A 224 ? 0.3939 0.4410 0.4994 -0.0236 0.0372  0.0333  432 GLU A OE2 
1512 N N   . PRO A 225 ? 0.3278 0.3489 0.3771 -0.0044 0.0217  0.0110  433 PRO A N   
1513 C CA  . PRO A 225 ? 0.3266 0.3414 0.3664 -0.0006 0.0169  0.0058  433 PRO A CA  
1514 C C   . PRO A 225 ? 0.3315 0.3504 0.3639 0.0061  0.0189  0.0039  433 PRO A C   
1515 O O   . PRO A 225 ? 0.3425 0.3714 0.3778 0.0090  0.0239  0.0052  433 PRO A O   
1516 C CB  . PRO A 225 ? 0.3239 0.3393 0.3710 -0.0011 0.0117  0.0018  433 PRO A CB  
1517 C CG  . PRO A 225 ? 0.3337 0.3596 0.3943 -0.0027 0.0145  0.0031  433 PRO A CG  
1518 C CD  . PRO A 225 ? 0.3237 0.3505 0.3876 -0.0070 0.0195  0.0096  433 PRO A CD  
1519 N N   . CYS A 226 ? 0.3264 0.3381 0.3500 0.0090  0.0149  0.0006  434 CYS A N   
1520 C CA  . CYS A 226 ? 0.3321 0.3456 0.3492 0.0164  0.0139  -0.0028 434 CYS A CA  
1521 C C   . CYS A 226 ? 0.3214 0.3293 0.3388 0.0176  0.0066  -0.0078 434 CYS A C   
1522 O O   . CYS A 226 ? 0.3152 0.3153 0.3318 0.0144  0.0033  -0.0077 434 CYS A O   
1523 C CB  . CYS A 226 ? 0.3344 0.3434 0.3407 0.0197  0.0154  -0.0017 434 CYS A CB  
1524 S SG  . CYS A 226 ? 0.3994 0.4100 0.3963 0.0309  0.0131  -0.0069 434 CYS A SG  
1525 N N   . GLY A 227 ? 0.3249 0.3372 0.3441 0.0225  0.0040  -0.0119 435 GLY A N   
1526 C CA  . GLY A 227 ? 0.3214 0.3272 0.3409 0.0241  -0.0036 -0.0162 435 GLY A CA  
1527 C C   . GLY A 227 ? 0.3273 0.3264 0.3407 0.0274  -0.0073 -0.0182 435 GLY A C   
1528 O O   . GLY A 227 ? 0.3327 0.3342 0.3398 0.0332  -0.0057 -0.0193 435 GLY A O   
1529 N N   . ILE A 228 ? 0.3199 0.3106 0.3356 0.0240  -0.0123 -0.0183 436 ILE A N   
1530 C CA  . ILE A 228 ? 0.3135 0.2979 0.3274 0.0265  -0.0172 -0.0205 436 ILE A CA  
1531 C C   . ILE A 228 ? 0.3159 0.2944 0.3345 0.0280  -0.0257 -0.0239 436 ILE A C   
1532 O O   . ILE A 228 ? 0.3143 0.2873 0.3342 0.0304  -0.0317 -0.0265 436 ILE A O   
1533 C CB  . ILE A 228 ? 0.3128 0.2929 0.3275 0.0209  -0.0154 -0.0170 436 ILE A CB  
1534 C CG1 . ILE A 228 ? 0.3065 0.2840 0.3265 0.0143  -0.0152 -0.0134 436 ILE A CG1 
1535 C CG2 . ILE A 228 ? 0.2971 0.2807 0.3062 0.0204  -0.0088 -0.0142 436 ILE A CG2 
1536 C CD1 . ILE A 228 ? 0.3148 0.2889 0.3367 0.0102  -0.0144 -0.0106 436 ILE A CD1 
1537 N N   . LYS A 229 ? 0.3175 0.2963 0.3392 0.0266  -0.0271 -0.0238 437 LYS A N   
1538 C CA  . LYS A 229 ? 0.3237 0.2951 0.3498 0.0271  -0.0354 -0.0258 437 LYS A CA  
1539 C C   . LYS A 229 ? 0.3335 0.3066 0.3602 0.0285  -0.0370 -0.0274 437 LYS A C   
1540 O O   . LYS A 229 ? 0.3200 0.2974 0.3468 0.0253  -0.0319 -0.0249 437 LYS A O   
1541 C CB  . LYS A 229 ? 0.3213 0.2855 0.3524 0.0200  -0.0361 -0.0208 437 LYS A CB  
1542 C CG  . LYS A 229 ? 0.3315 0.2867 0.3687 0.0193  -0.0445 -0.0210 437 LYS A CG  
1543 C CD  . LYS A 229 ? 0.3478 0.2989 0.3884 0.0244  -0.0531 -0.0263 437 LYS A CD  
1544 C CE  . LYS A 229 ? 0.3512 0.2919 0.4008 0.0219  -0.0618 -0.0250 437 LYS A CE  
1545 N NZ  . LYS A 229 ? 0.3571 0.2927 0.4107 0.0282  -0.0727 -0.0319 437 LYS A NZ  
1546 N N   . HIS A 230 ? 0.3468 0.3162 0.3743 0.0340  -0.0454 -0.0325 438 HIS A N   
1547 C CA  . HIS A 230 ? 0.3688 0.3386 0.3970 0.0367  -0.0491 -0.0353 438 HIS A CA  
1548 C C   . HIS A 230 ? 0.3875 0.3445 0.4189 0.0364  -0.0593 -0.0360 438 HIS A C   
1549 O O   . HIS A 230 ? 0.3891 0.3408 0.4222 0.0394  -0.0660 -0.0389 438 HIS A O   
1550 C CB  . HIS A 230 ? 0.3763 0.3558 0.4015 0.0461  -0.0494 -0.0418 438 HIS A CB  
1551 C CG  . HIS A 230 ? 0.4010 0.3823 0.4275 0.0502  -0.0539 -0.0461 438 HIS A CG  
1552 N ND1 . HIS A 230 ? 0.4324 0.4051 0.4591 0.0552  -0.0652 -0.0512 438 HIS A ND1 
1553 C CD2 . HIS A 230 ? 0.4147 0.4055 0.4435 0.0505  -0.0495 -0.0467 438 HIS A CD2 
1554 C CE1 . HIS A 230 ? 0.4321 0.4087 0.4597 0.0587  -0.0674 -0.0549 438 HIS A CE1 
1555 N NE2 . HIS A 230 ? 0.4238 0.4121 0.4535 0.0560  -0.0579 -0.0524 438 HIS A NE2 
1556 N N   . ILE A 231 ? 0.3241 0.3335 0.4183 0.0406  -0.0401 -0.0522 439 ILE A N   
1557 C CA  . ILE A 231 ? 0.3468 0.3438 0.4407 0.0406  -0.0484 -0.0544 439 ILE A CA  
1558 C C   . ILE A 231 ? 0.3568 0.3525 0.4570 0.0438  -0.0541 -0.0583 439 ILE A C   
1559 O O   . ILE A 231 ? 0.3444 0.3414 0.4490 0.0416  -0.0541 -0.0555 439 ILE A O   
1560 C CB  . ILE A 231 ? 0.3533 0.3371 0.4430 0.0337  -0.0475 -0.0476 439 ILE A CB  
1561 C CG1 . ILE A 231 ? 0.3663 0.3511 0.4567 0.0315  -0.0433 -0.0437 439 ILE A CG1 
1562 C CG2 . ILE A 231 ? 0.3677 0.3368 0.4566 0.0328  -0.0548 -0.0484 439 ILE A CG2 
1563 C CD1 . ILE A 231 ? 0.4114 0.3862 0.4988 0.0258  -0.0361 -0.0355 439 ILE A CD1 
1564 N N   . ASP A 232 ? 0.3693 0.3620 0.4712 0.0493  -0.0602 -0.0647 440 ASP A N   
1565 C CA  . ASP A 232 ? 0.3963 0.3842 0.5055 0.0520  -0.0678 -0.0678 440 ASP A CA  
1566 C C   . ASP A 232 ? 0.4092 0.3800 0.5130 0.0490  -0.0764 -0.0675 440 ASP A C   
1567 O O   . ASP A 232 ? 0.4035 0.3700 0.5043 0.0509  -0.0796 -0.0706 440 ASP A O   
1568 C CB  . ASP A 232 ? 0.4065 0.4031 0.5235 0.0618  -0.0668 -0.0751 440 ASP A CB  
1569 C CG  . ASP A 232 ? 0.4366 0.4306 0.5674 0.0648  -0.0746 -0.0771 440 ASP A CG  
1570 O OD1 . ASP A 232 ? 0.4409 0.4473 0.5877 0.0697  -0.0704 -0.0777 440 ASP A OD1 
1571 O OD2 . ASP A 232 ? 0.4699 0.4491 0.5974 0.0623  -0.0850 -0.0773 440 ASP A OD2 
1572 N N   . CYS A 233 ? 0.4253 0.3839 0.5265 0.0440  -0.0808 -0.0632 441 CYS A N   
1573 C CA  . CYS A 233 ? 0.4558 0.3954 0.5494 0.0402  -0.0862 -0.0607 441 CYS A CA  
1574 C C   . CYS A 233 ? 0.4698 0.4040 0.5680 0.0449  -0.0959 -0.0668 441 CYS A C   
1575 O O   . CYS A 233 ? 0.4852 0.4068 0.5802 0.0421  -0.0996 -0.0650 441 CYS A O   
1576 C CB  . CYS A 233 ? 0.4665 0.3889 0.5496 0.0348  -0.0887 -0.0550 441 CYS A CB  
1577 S SG  . CYS A 233 ? 0.4942 0.4144 0.5655 0.0287  -0.0767 -0.0472 441 CYS A SG  
1578 N N   . HIS A 234 ? 0.4709 0.4143 0.5781 0.0523  -0.0992 -0.0736 442 HIS A N   
1579 C CA  . HIS A 234 ? 0.4824 0.4198 0.5929 0.0584  -0.1079 -0.0805 442 HIS A CA  
1580 C C   . HIS A 234 ? 0.4932 0.4299 0.5987 0.0608  -0.1081 -0.0843 442 HIS A C   
1581 O O   . HIS A 234 ? 0.4992 0.4234 0.6033 0.0617  -0.1173 -0.0872 442 HIS A O   
1582 C CB  . HIS A 234 ? 0.4804 0.4277 0.6035 0.0671  -0.1088 -0.0863 442 HIS A CB  
1583 C CG  . HIS A 234 ? 0.4666 0.4112 0.5987 0.0646  -0.1146 -0.0825 442 HIS A CG  
1584 N ND1 . HIS A 234 ? 0.4281 0.3835 0.5676 0.0622  -0.1096 -0.0780 442 HIS A ND1 
1585 C CD2 . HIS A 234 ? 0.4625 0.3920 0.5963 0.0637  -0.1272 -0.0821 442 HIS A CD2 
1586 C CE1 . HIS A 234 ? 0.4330 0.3794 0.5788 0.0597  -0.1203 -0.0751 442 HIS A CE1 
1587 N NE2 . HIS A 234 ? 0.4383 0.3687 0.5798 0.0607  -0.1309 -0.0775 442 HIS A NE2 
1588 N N   . THR A 235 ? 0.4925 0.4402 0.5946 0.0613  -0.0997 -0.0840 443 THR A N   
1589 C CA  . THR A 235 ? 0.5136 0.4579 0.6084 0.0643  -0.1025 -0.0882 443 THR A CA  
1590 C C   . THR A 235 ? 0.5098 0.4539 0.6038 0.0567  -0.1006 -0.0812 443 THR A C   
1591 O O   . THR A 235 ? 0.5237 0.4613 0.6146 0.0570  -0.1074 -0.0829 443 THR A O   
1592 C CB  . THR A 235 ? 0.5202 0.4725 0.6080 0.0738  -0.0959 -0.0951 443 THR A CB  
1593 O OG1 . THR A 235 ? 0.5058 0.4731 0.5956 0.0717  -0.0839 -0.0904 443 THR A OG1 
1594 C CG2 . THR A 235 ? 0.5374 0.4896 0.6304 0.0830  -0.0965 -0.1019 443 THR A CG2 
1595 N N   . THR A 236 ? 0.5026 0.4521 0.6000 0.0501  -0.0924 -0.0732 444 THR A N   
1596 C CA  . THR A 236 ? 0.4998 0.4501 0.6000 0.0437  -0.0884 -0.0657 444 THR A CA  
1597 C C   . THR A 236 ? 0.5082 0.4460 0.6168 0.0388  -0.0954 -0.0613 444 THR A C   
1598 O O   . THR A 236 ? 0.5125 0.4397 0.6220 0.0372  -0.0988 -0.0602 444 THR A O   
1599 C CB  . THR A 236 ? 0.4906 0.4462 0.5901 0.0389  -0.0769 -0.0586 444 THR A CB  
1600 O OG1 . THR A 236 ? 0.4920 0.4604 0.5879 0.0428  -0.0713 -0.0617 444 THR A OG1 
1601 C CG2 . THR A 236 ? 0.4853 0.4421 0.5900 0.0336  -0.0710 -0.0507 444 THR A CG2 
1602 N N   . SER A 237 ? 0.5079 0.4461 0.6239 0.0363  -0.0985 -0.0581 445 SER A N   
1603 C CA  . SER A 237 ? 0.5149 0.4441 0.6464 0.0304  -0.1031 -0.0509 445 SER A CA  
1604 C C   . SER A 237 ? 0.5065 0.4409 0.6492 0.0245  -0.0906 -0.0398 445 SER A C   
1605 O O   . SER A 237 ? 0.4952 0.4394 0.6320 0.0253  -0.0816 -0.0391 445 SER A O   
1606 C CB  . SER A 237 ? 0.5269 0.4504 0.6638 0.0316  -0.1190 -0.0546 445 SER A CB  
1607 O OG  . SER A 237 ? 0.5344 0.4648 0.6714 0.0318  -0.1194 -0.0537 445 SER A OG  
1608 N N   . ILE A 238 ? 0.5109 0.4382 0.6710 0.0190  -0.0889 -0.0307 446 ILE A N   
1609 C CA  . ILE A 238 ? 0.5057 0.4361 0.6795 0.0145  -0.0747 -0.0192 446 ILE A CA  
1610 C C   . ILE A 238 ? 0.4931 0.4354 0.6786 0.0145  -0.0775 -0.0178 446 ILE A C   
1611 O O   . ILE A 238 ? 0.4847 0.4338 0.6713 0.0138  -0.0650 -0.0127 446 ILE A O   
1612 C CB  . ILE A 238 ? 0.5165 0.4368 0.7113 0.0092  -0.0710 -0.0085 446 ILE A CB  
1613 C CG1 . ILE A 238 ? 0.5411 0.4460 0.7191 0.0091  -0.0682 -0.0094 446 ILE A CG1 
1614 C CG2 . ILE A 238 ? 0.5235 0.4465 0.7339 0.0060  -0.0528 0.0039  446 ILE A CG2 
1615 N N   . SER A 239 ? 0.4932 0.4351 0.6844 0.0157  -0.0951 -0.0226 447 SER A N   
1616 C CA  . SER A 239 ? 0.4898 0.4385 0.6888 0.0157  -0.1015 -0.0214 447 SER A CA  
1617 C C   . SER A 239 ? 0.4778 0.4347 0.6528 0.0203  -0.0958 -0.0278 447 SER A C   
1618 O O   . SER A 239 ? 0.4721 0.4349 0.6517 0.0197  -0.0959 -0.0246 447 SER A O   
1619 C CB  . SER A 239 ? 0.5039 0.4438 0.7099 0.0157  -0.1247 -0.0250 447 SER A CB  
1620 O OG  . SER A 239 ? 0.5251 0.4574 0.7021 0.0221  -0.1341 -0.0381 447 SER A OG  
1621 N N   . ASP A 240 ? 0.4721 0.4292 0.6242 0.0247  -0.0910 -0.0358 448 ASP A N   
1622 C CA  . ASP A 240 ? 0.4640 0.4297 0.5971 0.0286  -0.0836 -0.0404 448 ASP A CA  
1623 C C   . ASP A 240 ? 0.4414 0.4148 0.5780 0.0255  -0.0677 -0.0328 448 ASP A C   
1624 O O   . ASP A 240 ? 0.4323 0.4134 0.5587 0.0272  -0.0624 -0.0340 448 ASP A O   
1625 C CB  . ASP A 240 ? 0.4715 0.4365 0.5869 0.0340  -0.0827 -0.0494 448 ASP A CB  
1626 C CG  . ASP A 240 ? 0.5056 0.4620 0.6109 0.0397  -0.0963 -0.0588 448 ASP A CG  
1627 O OD1 . ASP A 240 ? 0.5337 0.4855 0.6343 0.0430  -0.0987 -0.0644 448 ASP A OD1 
1628 O OD2 . ASP A 240 ? 0.5363 0.4881 0.6365 0.0411  -0.1054 -0.0606 448 ASP A OD2 
1629 N N   . LEU A 241 ? 0.4339 0.4029 0.5830 0.0212  -0.0597 -0.0247 449 LEU A N   
1630 C CA  . LEU A 241 ? 0.4244 0.3951 0.5729 0.0189  -0.0437 -0.0176 449 LEU A CA  
1631 C C   . LEU A 241 ? 0.4151 0.3924 0.5803 0.0171  -0.0403 -0.0102 449 LEU A C   
1632 O O   . LEU A 241 ? 0.4133 0.3920 0.5765 0.0163  -0.0273 -0.0051 449 LEU A O   
1633 C CB  . LEU A 241 ? 0.4336 0.3916 0.5829 0.0163  -0.0343 -0.0117 449 LEU A CB  
1634 C CG  . LEU A 241 ? 0.4529 0.4012 0.5878 0.0175  -0.0398 -0.0178 449 LEU A CG  
1635 C CD1 . LEU A 241 ? 0.4716 0.4029 0.6001 0.0148  -0.0289 -0.0109 449 LEU A CD1 
1636 C CD2 . LEU A 241 ? 0.4608 0.4147 0.5772 0.0210  -0.0429 -0.0263 449 LEU A CD2 
1637 N N   . GLU A 242 ? 0.4088 0.3879 0.5908 0.0165  -0.0532 -0.0094 450 GLU A N   
1638 C CA  . GLU A 242 ? 0.4011 0.3865 0.5987 0.0153  -0.0552 -0.0036 450 GLU A CA  
1639 C C   . GLU A 242 ? 0.3904 0.3782 0.5680 0.0188  -0.0669 -0.0121 450 GLU A C   
1640 O O   . GLU A 242 ? 0.4033 0.3848 0.5734 0.0207  -0.0821 -0.0188 450 GLU A O   
1641 C CB  . GLU A 242 ? 0.4134 0.3968 0.6452 0.0118  -0.0643 0.0041  450 GLU A CB  
1642 C CG  . GLU A 242 ? 0.4439 0.4256 0.7001 0.0088  -0.0480 0.0156  450 GLU A CG  
1643 C CD  . GLU A 242 ? 0.4915 0.4751 0.7905 0.0051  -0.0558 0.0258  450 GLU A CD  
1644 O OE1 . GLU A 242 ? 0.5086 0.4988 0.8317 0.0043  -0.0485 0.0351  450 GLU A OE1 
1645 O OE2 . GLU A 242 ? 0.5336 0.5120 0.8444 0.0030  -0.0704 0.0250  450 GLU A OE2 
1646 N N   . PHE A 243 ? 0.3647 0.3587 0.5303 0.0199  -0.0591 -0.0119 451 PHE A N   
1647 C CA  . PHE A 243 ? 0.3554 0.3501 0.4964 0.0239  -0.0653 -0.0197 451 PHE A CA  
1648 C C   . PHE A 243 ? 0.3493 0.3489 0.4880 0.0234  -0.0620 -0.0155 451 PHE A C   
1649 O O   . PHE A 243 ? 0.3340 0.3382 0.4881 0.0207  -0.0521 -0.0074 451 PHE A O   
1650 C CB  . PHE A 243 ? 0.3475 0.3445 0.4675 0.0271  -0.0569 -0.0269 451 PHE A CB  
1651 C CG  . PHE A 243 ? 0.3330 0.3362 0.4503 0.0254  -0.0415 -0.0229 451 PHE A CG  
1652 C CD1 . PHE A 243 ? 0.3092 0.3187 0.4146 0.0264  -0.0361 -0.0230 451 PHE A CD1 
1653 C CD2 . PHE A 243 ? 0.3223 0.3218 0.4466 0.0227  -0.0327 -0.0187 451 PHE A CD2 
1654 C CE1 . PHE A 243 ? 0.3140 0.3269 0.4168 0.0244  -0.0239 -0.0191 451 PHE A CE1 
1655 C CE2 . PHE A 243 ? 0.3032 0.3029 0.4201 0.0213  -0.0205 -0.0155 451 PHE A CE2 
1656 C CZ  . PHE A 243 ? 0.2978 0.3048 0.4054 0.0219  -0.0170 -0.0158 451 PHE A CZ  
1657 N N   . SER A 244 ? 0.3579 0.3544 0.4749 0.0268  -0.0693 -0.0209 452 SER A N   
1658 C CA  . SER A 244 ? 0.3689 0.3678 0.4779 0.0268  -0.0674 -0.0176 452 SER A CA  
1659 C C   . SER A 244 ? 0.3746 0.3751 0.4546 0.0309  -0.0598 -0.0240 452 SER A C   
1660 O O   . SER A 244 ? 0.3901 0.3862 0.4546 0.0351  -0.0620 -0.0318 452 SER A O   
1661 C CB  . SER A 244 ? 0.3887 0.3768 0.4978 0.0267  -0.0863 -0.0164 452 SER A CB  
1662 O OG  . SER A 244 ? 0.3945 0.3842 0.5382 0.0223  -0.0921 -0.0076 452 SER A OG  
1663 N N   . SER A 245 ? 0.3657 0.3724 0.4401 0.0300  -0.0502 -0.0201 453 SER A N   
1664 C CA  . SER A 245 ? 0.3768 0.3862 0.4280 0.0335  -0.0418 -0.0242 453 SER A CA  
1665 C C   . SER A 245 ? 0.3797 0.3890 0.4217 0.0325  -0.0395 -0.0192 453 SER A C   
1666 O O   . SER A 245 ? 0.3645 0.3786 0.4217 0.0285  -0.0361 -0.0121 453 SER A O   
1667 C CB  . SER A 245 ? 0.3627 0.3825 0.4198 0.0325  -0.0284 -0.0246 453 SER A CB  
1668 O OG  . SER A 245 ? 0.3965 0.4208 0.4383 0.0358  -0.0201 -0.0277 453 SER A OG  
1669 N N   . ASP A 246 ? 0.3994 0.4008 0.4147 0.0367  -0.0408 -0.0227 454 ASP A N   
1670 C CA  . ASP A 246 ? 0.4141 0.4157 0.4164 0.0360  -0.0350 -0.0180 454 ASP A CA  
1671 C C   . ASP A 246 ? 0.3984 0.4138 0.4029 0.0356  -0.0177 -0.0172 454 ASP A C   
1672 O O   . ASP A 246 ? 0.4102 0.4294 0.4122 0.0390  -0.0118 -0.0224 454 ASP A O   
1673 C CB  . ASP A 246 ? 0.4562 0.4402 0.4244 0.0411  -0.0413 -0.0214 454 ASP A CB  
1674 C CG  . ASP A 246 ? 0.4890 0.4555 0.4541 0.0406  -0.0629 -0.0212 454 ASP A CG  
1675 O OD1 . ASP A 246 ? 0.5201 0.4872 0.5004 0.0362  -0.0703 -0.0141 454 ASP A OD1 
1676 O OD2 . ASP A 246 ? 0.5458 0.4969 0.4946 0.0447  -0.0736 -0.0280 454 ASP A OD2 
1677 N N   . PHE A 247 ? 0.3697 0.3919 0.3814 0.0314  -0.0108 -0.0104 455 PHE A N   
1678 C CA  . PHE A 247 ? 0.3513 0.3851 0.3673 0.0299  0.0028  -0.0086 455 PHE A CA  
1679 C C   . PHE A 247 ? 0.3552 0.3892 0.3593 0.0287  0.0095  -0.0029 455 PHE A C   
1680 O O   . PHE A 247 ? 0.3602 0.3859 0.3559 0.0280  0.0032  0.0005  455 PHE A O   
1681 C CB  . PHE A 247 ? 0.3246 0.3646 0.3621 0.0252  0.0053  -0.0060 455 PHE A CB  
1682 C CG  . PHE A 247 ? 0.3205 0.3573 0.3671 0.0214  0.0033  0.0004  455 PHE A CG  
1683 C CD1 . PHE A 247 ? 0.3170 0.3554 0.3621 0.0183  0.0094  0.0063  455 PHE A CD1 
1684 C CD2 . PHE A 247 ? 0.3006 0.3325 0.3601 0.0210  -0.0037 0.0011  455 PHE A CD2 
1685 C CE1 . PHE A 247 ? 0.3193 0.3537 0.3733 0.0159  0.0085  0.0121  455 PHE A CE1 
1686 C CE2 . PHE A 247 ? 0.2896 0.3191 0.3616 0.0186  -0.0033 0.0078  455 PHE A CE2 
1687 C CZ  . PHE A 247 ? 0.3005 0.3308 0.3688 0.0165  0.0030  0.0129  455 PHE A CZ  
1688 N N   . THR A 248 ? 0.3474 0.3907 0.3533 0.0283  0.0214  -0.0014 456 THR A N   
1689 C CA  . THR A 248 ? 0.3590 0.4041 0.3575 0.0263  0.0296  0.0051  456 THR A CA  
1690 C C   . THR A 248 ? 0.3407 0.3972 0.3590 0.0210  0.0364  0.0095  456 THR A C   
1691 O O   . THR A 248 ? 0.3342 0.3991 0.3646 0.0216  0.0407  0.0074  456 THR A O   
1692 C CB  . THR A 248 ? 0.3805 0.4227 0.3588 0.0320  0.0390  0.0038  456 THR A CB  
1693 O OG1 . THR A 248 ? 0.4152 0.4405 0.3685 0.0371  0.0304  -0.0007 456 THR A OG1 
1694 C CG2 . THR A 248 ? 0.4004 0.4444 0.3723 0.0294  0.0492  0.0119  456 THR A CG2 
1695 N N   . LEU A 249 ? 0.3303 0.3851 0.3522 0.0159  0.0355  0.0157  457 LEU A N   
1696 C CA  . LEU A 249 ? 0.3223 0.3826 0.3588 0.0104  0.0392  0.0200  457 LEU A CA  
1697 C C   . LEU A 249 ? 0.3327 0.3977 0.3667 0.0082  0.0478  0.0268  457 LEU A C   
1698 O O   . LEU A 249 ? 0.3343 0.3936 0.3561 0.0074  0.0484  0.0313  457 LEU A O   
1699 C CB  . LEU A 249 ? 0.3143 0.3667 0.3556 0.0067  0.0339  0.0224  457 LEU A CB  
1700 C CG  . LEU A 249 ? 0.3092 0.3565 0.3556 0.0087  0.0281  0.0173  457 LEU A CG  
1701 C CD1 . LEU A 249 ? 0.3184 0.3563 0.3681 0.0068  0.0265  0.0208  457 LEU A CD1 
1702 C CD2 . LEU A 249 ? 0.3198 0.3695 0.3744 0.0081  0.0280  0.0135  457 LEU A CD2 
1703 N N   . LYS A 250 ? 0.3336 0.4088 0.3813 0.0073  0.0543  0.0281  458 LYS A N   
1704 C CA  . LYS A 250 ? 0.3448 0.4264 0.3963 0.0048  0.0641  0.0360  458 LYS A CA  
1705 C C   . LYS A 250 ? 0.3270 0.4060 0.3887 -0.0031 0.0596  0.0423  458 LYS A C   
1706 O O   . LYS A 250 ? 0.3081 0.3893 0.3871 -0.0071 0.0551  0.0428  458 LYS A O   
1707 C CB  . LYS A 250 ? 0.3512 0.4459 0.4196 0.0073  0.0735  0.0363  458 LYS A CB  
1708 C CG  . LYS A 250 ? 0.4077 0.5013 0.4611 0.0166  0.0804  0.0301  458 LYS A CG  
1709 C CD  . LYS A 250 ? 0.4595 0.5666 0.5353 0.0201  0.0900  0.0298  458 LYS A CD  
1710 C CE  . LYS A 250 ? 0.5039 0.6069 0.5608 0.0305  0.1007  0.0246  458 LYS A CE  
1711 N N   . ILE A 251 ? 0.3303 0.4014 0.3789 -0.0051 0.0592  0.0469  459 ILE A N   
1712 C CA  . ILE A 251 ? 0.3214 0.3858 0.3748 -0.0117 0.0544  0.0523  459 ILE A CA  
1713 C C   . ILE A 251 ? 0.3288 0.4009 0.3997 -0.0176 0.0587  0.0600  459 ILE A C   
1714 O O   . ILE A 251 ? 0.3297 0.4104 0.4028 -0.0170 0.0692  0.0653  459 ILE A O   
1715 C CB  . ILE A 251 ? 0.3320 0.3863 0.3685 -0.0115 0.0529  0.0557  459 ILE A CB  
1716 C CG1 . ILE A 251 ? 0.3146 0.3620 0.3415 -0.0064 0.0464  0.0493  459 ILE A CG1 
1717 C CG2 . ILE A 251 ? 0.3199 0.3657 0.3603 -0.0177 0.0492  0.0615  459 ILE A CG2 
1718 C CD1 . ILE A 251 ? 0.2815 0.3235 0.3173 -0.0066 0.0404  0.0447  459 ILE A CD1 
1719 N N   . THR A 252 ? 0.3227 0.3894 0.4054 -0.0232 0.0505  0.0612  460 THR A N   
1720 C CA  . THR A 252 ? 0.3332 0.4062 0.4379 -0.0298 0.0503  0.0686  460 THR A CA  
1721 C C   . THR A 252 ? 0.3447 0.4051 0.4465 -0.0369 0.0446  0.0755  460 THR A C   
1722 O O   . THR A 252 ? 0.3484 0.4127 0.4688 -0.0434 0.0435  0.0834  460 THR A O   
1723 C CB  . THR A 252 ? 0.3293 0.4039 0.4526 -0.0315 0.0418  0.0653  460 THR A CB  
1724 O OG1 . THR A 252 ? 0.3310 0.3864 0.4396 -0.0320 0.0305  0.0595  460 THR A OG1 
1725 C CG2 . THR A 252 ? 0.3162 0.4050 0.4473 -0.0247 0.0483  0.0598  460 THR A CG2 
1726 N N   . ARG A 253 ? 0.3482 0.3935 0.4293 -0.0353 0.0409  0.0729  461 ARG A N   
1727 C CA  . ARG A 253 ? 0.3576 0.3880 0.4327 -0.0407 0.0359  0.0785  461 ARG A CA  
1728 C C   . ARG A 253 ? 0.3599 0.3828 0.4161 -0.0370 0.0389  0.0788  461 ARG A C   
1729 O O   . ARG A 253 ? 0.3534 0.3721 0.3994 -0.0312 0.0384  0.0725  461 ARG A O   
1730 C CB  . ARG A 253 ? 0.3693 0.3799 0.4410 -0.0435 0.0241  0.0753  461 ARG A CB  
1731 C CG  . ARG A 253 ? 0.3979 0.3892 0.4623 -0.0492 0.0177  0.0809  461 ARG A CG  
1732 C CD  . ARG A 253 ? 0.4340 0.3981 0.4829 -0.0491 0.0078  0.0759  461 ARG A CD  
1733 N NE  . ARG A 253 ? 0.4421 0.4047 0.5011 -0.0522 -0.0011 0.0736  461 ARG A NE  
1734 C CZ  . ARG A 253 ? 0.4703 0.4124 0.5140 -0.0500 -0.0080 0.0671  461 ARG A CZ  
1735 N NH1 . ARG A 253 ? 0.4742 0.3962 0.4930 -0.0444 -0.0042 0.0624  461 ARG A NH1 
1736 N NH2 . ARG A 253 ? 0.4762 0.4171 0.5304 -0.0533 -0.0182 0.0659  461 ARG A NH2 
1737 N N   . THR A 254 ? 0.3651 0.3865 0.4196 -0.0409 0.0412  0.0870  462 THR A N   
1738 C CA  . THR A 254 ? 0.3625 0.3739 0.4010 -0.0385 0.0412  0.0887  462 THR A CA  
1739 C C   . THR A 254 ? 0.3688 0.3605 0.4007 -0.0380 0.0340  0.0857  462 THR A C   
1740 O O   . THR A 254 ? 0.3750 0.3543 0.4085 -0.0432 0.0286  0.0885  462 THR A O   
1741 C CB  . THR A 254 ? 0.3755 0.3880 0.4130 -0.0433 0.0452  0.0990  462 THR A CB  
1742 O OG1 . THR A 254 ? 0.3603 0.3882 0.3998 -0.0418 0.0553  0.1013  462 THR A OG1 
1743 C CG2 . THR A 254 ? 0.3801 0.3807 0.4013 -0.0408 0.0432  0.1012  462 THR A CG2 
1744 N N   . SER A 255 ? 0.3626 0.3500 0.3874 -0.0314 0.0342  0.0803  463 SER A N   
1745 C CA  . SER A 255 ? 0.3692 0.3379 0.3882 -0.0287 0.0315  0.0768  463 SER A CA  
1746 C C   . SER A 255 ? 0.3629 0.3314 0.3812 -0.0213 0.0338  0.0735  463 SER A C   
1747 O O   . SER A 255 ? 0.3553 0.3365 0.3758 -0.0188 0.0343  0.0734  463 SER A O   
1748 C CB  . SER A 255 ? 0.3696 0.3326 0.3893 -0.0296 0.0288  0.0713  463 SER A CB  
1749 O OG  . SER A 255 ? 0.3667 0.3460 0.3934 -0.0267 0.0309  0.0663  463 SER A OG  
1750 N N   . MET A 256 ? 0.3678 0.3194 0.3827 -0.0176 0.0350  0.0715  464 MET A N   
1751 C CA  . MET A 256 ? 0.3615 0.3121 0.3824 -0.0105 0.0382  0.0693  464 MET A CA  
1752 C C   . MET A 256 ? 0.3475 0.3010 0.3708 -0.0080 0.0404  0.0628  464 MET A C   
1753 O O   . MET A 256 ? 0.3562 0.2954 0.3705 -0.0087 0.0416  0.0601  464 MET A O   
1754 C CB  . MET A 256 ? 0.3893 0.3185 0.4065 -0.0070 0.0420  0.0716  464 MET A CB  
1755 C CG  . MET A 256 ? 0.4155 0.3440 0.4460 0.0005  0.0470  0.0719  464 MET A CG  
1756 S SD  . MET A 256 ? 0.5127 0.4565 0.5581 0.0015  0.0401  0.0772  464 MET A SD  
1757 C CE  . MET A 256 ? 0.4560 0.3939 0.4885 -0.0042 0.0354  0.0833  464 MET A CE  
1758 N N   . CYS A 257 ? 0.3185 0.2873 0.3512 -0.0053 0.0394  0.0603  465 CYS A N   
1759 C CA  . CYS A 257 ? 0.2984 0.2703 0.3347 -0.0029 0.0409  0.0544  465 CYS A CA  
1760 C C   . CYS A 257 ? 0.2929 0.2537 0.3362 0.0027  0.0469  0.0547  465 CYS A C   
1761 O O   . CYS A 257 ? 0.2920 0.2563 0.3483 0.0059  0.0467  0.0583  465 CYS A O   
1762 C CB  . CYS A 257 ? 0.2905 0.2808 0.3329 -0.0021 0.0369  0.0517  465 CYS A CB  
1763 S SG  . CYS A 257 ? 0.2904 0.2843 0.3387 0.0008  0.0375  0.0446  465 CYS A SG  
1764 N N   . THR A 258 ? 0.3160 0.2775 0.2747 0.0093  0.0012  0.0100  466 THR A N   
1765 C CA  . THR A 258 ? 0.3085 0.2673 0.2669 0.0074  -0.0015 0.0086  466 THR A CA  
1766 C C   . THR A 258 ? 0.3019 0.2599 0.2617 0.0084  -0.0030 0.0074  466 THR A C   
1767 O O   . THR A 258 ? 0.2930 0.2492 0.2542 0.0081  -0.0044 0.0078  466 THR A O   
1768 C CB  . THR A 258 ? 0.2995 0.2593 0.2608 0.0054  -0.0026 0.0094  466 THR A CB  
1769 O OG1 . THR A 258 ? 0.3130 0.2751 0.2784 0.0056  -0.0031 0.0097  466 THR A OG1 
1770 C CG2 . THR A 258 ? 0.3023 0.2627 0.2647 0.0039  -0.0024 0.0109  466 THR A CG2 
1771 N N   . ALA A 259 ? 0.2979 0.2578 0.2589 0.0097  -0.0022 0.0071  467 ALA A N   
1772 C CA  . ALA A 259 ? 0.2948 0.2545 0.2585 0.0107  -0.0037 0.0063  467 ALA A CA  
1773 C C   . ALA A 259 ? 0.2903 0.2508 0.2527 0.0130  -0.0031 0.0053  467 ALA A C   
1774 O O   . ALA A 259 ? 0.2934 0.2559 0.2539 0.0141  -0.0003 0.0064  467 ALA A O   
1775 C CB  . ALA A 259 ? 0.2823 0.2441 0.2495 0.0099  -0.0034 0.0075  467 ALA A CB  
1776 N N   . ILE A 260 ? 0.2892 0.2483 0.2538 0.0142  -0.0054 0.0041  468 ILE A N   
1777 C CA  . ILE A 260 ? 0.2903 0.2500 0.2538 0.0166  -0.0053 0.0030  468 ILE A CA  
1778 C C   . ILE A 260 ? 0.2849 0.2480 0.2550 0.0151  -0.0052 0.0037  468 ILE A C   
1779 O O   . ILE A 260 ? 0.2863 0.2489 0.2617 0.0144  -0.0068 0.0047  468 ILE A O   
1780 C CB  . ILE A 260 ? 0.2909 0.2442 0.2504 0.0205  -0.0100 0.0002  468 ILE A CB  
1781 C CG1 . ILE A 260 ? 0.3185 0.2673 0.2690 0.0236  -0.0102 -0.0007 468 ILE A CG1 
1782 C CG2 . ILE A 260 ? 0.3014 0.2546 0.2589 0.0238  -0.0105 -0.0012 468 ILE A CG2 
1783 C CD1 . ILE A 260 ? 0.2982 0.2497 0.2417 0.0269  -0.0044 0.0011  468 ILE A CD1 
1784 N N   . ALA A 261 ? 0.2784 0.2449 0.2487 0.0153  -0.0028 0.0041  469 ALA A N   
1785 C CA  . ALA A 261 ? 0.2744 0.2438 0.2496 0.0145  -0.0025 0.0045  469 ALA A CA  
1786 C C   . ALA A 261 ? 0.2790 0.2485 0.2547 0.0165  -0.0034 0.0031  469 ALA A C   
1787 O O   . ALA A 261 ? 0.2748 0.2430 0.2454 0.0191  -0.0029 0.0022  469 ALA A O   
1788 C CB  . ALA A 261 ? 0.2706 0.2430 0.2472 0.0131  -0.0007 0.0057  469 ALA A CB  
1789 N N   . GLY A 262 ? 0.2742 0.2451 0.2556 0.0163  -0.0044 0.0034  470 GLY A N   
1790 C CA  . GLY A 262 ? 0.2771 0.2483 0.2602 0.0178  -0.0057 0.0021  470 GLY A CA  
1791 C C   . GLY A 262 ? 0.2712 0.2469 0.2582 0.0170  -0.0035 0.0031  470 GLY A C   
1792 O O   . GLY A 262 ? 0.2743 0.2517 0.2636 0.0162  -0.0022 0.0048  470 GLY A O   
1793 N N   . TYR A 263 ? 0.2675 0.2444 0.2538 0.0181  -0.0032 0.0019  471 TYR A N   
1794 C CA  . TYR A 263 ? 0.2609 0.2416 0.2510 0.0175  -0.0016 0.0024  471 TYR A CA  
1795 C C   . TYR A 263 ? 0.2641 0.2449 0.2544 0.0193  -0.0027 0.0008  471 TYR A C   
1796 O O   . TYR A 263 ? 0.2652 0.2419 0.2516 0.0217  -0.0055 -0.0008 471 TYR A O   
1797 C CB  . TYR A 263 ? 0.2556 0.2387 0.2446 0.0162  0.0008  0.0033  471 TYR A CB  
1798 C CG  . TYR A 263 ? 0.2675 0.2511 0.2538 0.0169  0.0028  0.0041  471 TYR A CG  
1799 C CD1 . TYR A 263 ? 0.2656 0.2517 0.2528 0.0180  0.0047  0.0046  471 TYR A CD1 
1800 C CD2 . TYR A 263 ? 0.2831 0.2653 0.2664 0.0170  0.0037  0.0053  471 TYR A CD2 
1801 C CE1 . TYR A 263 ? 0.2913 0.2787 0.2770 0.0200  0.0080  0.0073  471 TYR A CE1 
1802 C CE2 . TYR A 263 ? 0.3014 0.2850 0.2835 0.0190  0.0070  0.0079  471 TYR A CE2 
1803 C CZ  . TYR A 263 ? 0.3076 0.2939 0.2911 0.0208  0.0094  0.0094  471 TYR A CZ  
1804 O OH  . TYR A 263 ? 0.3347 0.3229 0.3178 0.0240  0.0139  0.0137  471 TYR A OH  
1805 N N   . PHE A 264 ? 0.2645 0.2488 0.2581 0.0188  -0.0013 0.0011  472 PHE A N   
1806 C CA  . PHE A 264 ? 0.2709 0.2554 0.2650 0.0204  -0.0025 -0.0003 472 PHE A CA  
1807 C C   . PHE A 264 ? 0.2767 0.2651 0.2710 0.0198  0.0006  0.0002  472 PHE A C   
1808 O O   . PHE A 264 ? 0.2816 0.2723 0.2781 0.0179  0.0024  0.0014  472 PHE A O   
1809 C CB  . PHE A 264 ? 0.2669 0.2512 0.2693 0.0207  -0.0059 -0.0001 472 PHE A CB  
1810 C CG  . PHE A 264 ? 0.2795 0.2681 0.2885 0.0196  -0.0034 0.0026  472 PHE A CG  
1811 C CD1 . PHE A 264 ? 0.2601 0.2522 0.2713 0.0197  -0.0016 0.0026  472 PHE A CD1 
1812 C CD2 . PHE A 264 ? 0.2549 0.2435 0.2666 0.0197  -0.0024 0.0054  472 PHE A CD2 
1813 C CE1 . PHE A 264 ? 0.2760 0.2711 0.2911 0.0205  0.0007  0.0052  472 PHE A CE1 
1814 C CE2 . PHE A 264 ? 0.2782 0.2697 0.2931 0.0213  0.0004  0.0085  472 PHE A CE2 
1815 C CZ  . PHE A 264 ? 0.2762 0.2708 0.2924 0.0220  0.0019  0.0082  472 PHE A CZ  
1816 N N   . ASP A 265 ? 0.2821 0.2703 0.2737 0.0220  0.0007  -0.0008 473 ASP A N   
1817 C CA  . ASP A 265 ? 0.2888 0.2810 0.2820 0.0215  0.0038  0.0001  473 ASP A CA  
1818 C C   . ASP A 265 ? 0.2823 0.2751 0.2781 0.0224  0.0018  -0.0015 473 ASP A C   
1819 O O   . ASP A 265 ? 0.2835 0.2726 0.2779 0.0248  -0.0021 -0.0036 473 ASP A O   
1820 C CB  . ASP A 265 ? 0.3001 0.2924 0.2881 0.0244  0.0072  0.0022  473 ASP A CB  
1821 C CG  . ASP A 265 ? 0.3421 0.3342 0.3295 0.0238  0.0093  0.0049  473 ASP A CG  
1822 O OD1 . ASP A 265 ? 0.3945 0.3868 0.3857 0.0204  0.0080  0.0049  473 ASP A OD1 
1823 O OD2 . ASP A 265 ? 0.4327 0.4244 0.4154 0.0277  0.0125  0.0076  473 ASP A OD2 
1824 N N   . ILE A 266 ? 0.2728 0.2696 0.2730 0.0207  0.0037  -0.0009 474 ILE A N   
1825 C CA  . ILE A 266 ? 0.2729 0.2714 0.2771 0.0211  0.0024  -0.0021 474 ILE A CA  
1826 C C   . ILE A 266 ? 0.2874 0.2884 0.2902 0.0216  0.0051  -0.0017 474 ILE A C   
1827 O O   . ILE A 266 ? 0.2855 0.2890 0.2902 0.0199  0.0079  0.0001  474 ILE A O   
1828 C CB  . ILE A 266 ? 0.2713 0.2725 0.2823 0.0194  0.0026  -0.0010 474 ILE A CB  
1829 C CG1 . ILE A 266 ? 0.2588 0.2583 0.2724 0.0196  0.0011  0.0002  474 ILE A CG1 
1830 C CG2 . ILE A 266 ? 0.2485 0.2525 0.2650 0.0198  0.0022  -0.0013 474 ILE A CG2 
1831 C CD1 . ILE A 266 ? 0.2735 0.2705 0.2919 0.0208  -0.0031 -0.0001 474 ILE A CD1 
1832 N N   . TYR A 267 ? 0.2870 0.2868 0.2873 0.0244  0.0036  -0.0034 475 TYR A N   
1833 C CA  . TYR A 267 ? 0.2970 0.2990 0.2951 0.0260  0.0067  -0.0025 475 TYR A CA  
1834 C C   . TYR A 267 ? 0.2905 0.2943 0.2929 0.0255  0.0049  -0.0043 475 TYR A C   
1835 O O   . TYR A 267 ? 0.2935 0.2949 0.2982 0.0263  0.0002  -0.0066 475 TYR A O   
1836 C CB  . TYR A 267 ? 0.3045 0.3022 0.2918 0.0322  0.0072  -0.0025 475 TYR A CB  
1837 C CG  . TYR A 267 ? 0.3196 0.3157 0.3020 0.0340  0.0099  0.0001  475 TYR A CG  
1838 C CD1 . TYR A 267 ? 0.3271 0.3191 0.3072 0.0339  0.0065  -0.0015 475 TYR A CD1 
1839 C CD2 . TYR A 267 ? 0.3384 0.3374 0.3198 0.0362  0.0162  0.0052  475 TYR A CD2 
1840 C CE1 . TYR A 267 ? 0.3584 0.3490 0.3339 0.0358  0.0092  0.0009  475 TYR A CE1 
1841 C CE2 . TYR A 267 ? 0.3606 0.3589 0.3392 0.0384  0.0193  0.0089  475 TYR A CE2 
1842 C CZ  . TYR A 267 ? 0.3585 0.3525 0.3333 0.0381  0.0157  0.0062  475 TYR A CZ  
1843 O OH  . TYR A 267 ? 0.3834 0.3769 0.3557 0.0403  0.0189  0.0099  475 TYR A OH  
1844 N N   . PHE A 268 ? 0.2899 0.2980 0.2953 0.0240  0.0083  -0.0029 476 PHE A N   
1845 C CA  . PHE A 268 ? 0.2925 0.3028 0.3009 0.0240  0.0076  -0.0044 476 PHE A CA  
1846 C C   . PHE A 268 ? 0.3053 0.3155 0.3074 0.0276  0.0106  -0.0031 476 PHE A C   
1847 O O   . PHE A 268 ? 0.3072 0.3207 0.3116 0.0266  0.0152  0.0004  476 PHE A O   
1848 C CB  . PHE A 268 ? 0.2772 0.2920 0.2931 0.0202  0.0093  -0.0035 476 PHE A CB  
1849 C CG  . PHE A 268 ? 0.2893 0.3041 0.3095 0.0188  0.0077  -0.0035 476 PHE A CG  
1850 C CD1 . PHE A 268 ? 0.2862 0.2994 0.3052 0.0179  0.0081  -0.0024 476 PHE A CD1 
1851 C CD2 . PHE A 268 ? 0.2736 0.2899 0.2996 0.0192  0.0061  -0.0039 476 PHE A CD2 
1852 C CE1 . PHE A 268 ? 0.2908 0.3036 0.3119 0.0182  0.0073  -0.0019 476 PHE A CE1 
1853 C CE2 . PHE A 268 ? 0.2826 0.2995 0.3128 0.0196  0.0061  -0.0021 476 PHE A CE2 
1854 C CZ  . PHE A 268 ? 0.2754 0.2902 0.3019 0.0195  0.0069  -0.0013 476 PHE A CZ  
1855 N N   A GLU A 269 ? 0.3116 0.3175 0.3065 0.0327  0.0075  -0.0056 477 GLU A N   
1856 N N   B GLU A 269 ? 0.3146 0.3206 0.3097 0.0326  0.0075  -0.0056 477 GLU A N   
1857 C CA  A GLU A 269 ? 0.3267 0.3308 0.3117 0.0390  0.0108  -0.0040 477 GLU A CA  
1858 C CA  B GLU A 269 ? 0.3329 0.3370 0.3178 0.0390  0.0109  -0.0039 477 GLU A CA  
1859 C C   A GLU A 269 ? 0.3286 0.3319 0.3108 0.0421  0.0089  -0.0063 477 GLU A C   
1860 C C   B GLU A 269 ? 0.3341 0.3366 0.3146 0.0430  0.0088  -0.0063 477 GLU A C   
1861 O O   A GLU A 269 ? 0.3295 0.3366 0.3114 0.0432  0.0142  -0.0032 477 GLU A O   
1862 O O   B GLU A 269 ? 0.3380 0.3430 0.3155 0.0459  0.0141  -0.0031 477 GLU A O   
1863 C CB  A GLU A 269 ? 0.3382 0.3351 0.3108 0.0460  0.0091  -0.0046 477 GLU A CB  
1864 C CB  B GLU A 269 ? 0.3462 0.3438 0.3196 0.0453  0.0099  -0.0039 477 GLU A CB  
1865 C CG  A GLU A 269 ? 0.3587 0.3520 0.3174 0.0558  0.0123  -0.0027 477 GLU A CG  
1866 C CG  B GLU A 269 ? 0.3754 0.3748 0.3438 0.0496  0.0179  0.0023  477 GLU A CG  
1867 C CD  A GLU A 269 ? 0.3804 0.3659 0.3250 0.0640  0.0113  -0.0029 477 GLU A CD  
1868 C CD  B GLU A 269 ? 0.3952 0.3983 0.3717 0.0444  0.0209  0.0061  477 GLU A CD  
1869 O OE1 A GLU A 269 ? 0.3729 0.3604 0.3203 0.0617  0.0145  0.0001  477 GLU A OE1 
1870 O OE1 B GLU A 269 ? 0.4071 0.4082 0.3773 0.0491  0.0240  0.0094  477 GLU A OE1 
1871 O OE2 A GLU A 269 ? 0.4124 0.3891 0.3424 0.0735  0.0066  -0.0065 477 GLU A OE2 
1872 O OE2 B GLU A 269 ? 0.4078 0.4151 0.3961 0.0365  0.0200  0.0058  477 GLU A OE2 
1873 N N   . LYS A 270 ? 0.3298 0.3282 0.3116 0.0434  0.0010  -0.0112 478 LYS A N   
1874 C CA  . LYS A 270 ? 0.3370 0.3323 0.3144 0.0479  -0.0027 -0.0142 478 LYS A CA  
1875 C C   . LYS A 270 ? 0.3235 0.3265 0.3081 0.0440  0.0021  -0.0123 478 LYS A C   
1876 O O   . LYS A 270 ? 0.2950 0.3039 0.2922 0.0369  0.0028  -0.0117 478 LYS A O   
1877 C CB  . LYS A 270 ? 0.3387 0.3283 0.3211 0.0481  -0.0136 -0.0191 478 LYS A CB  
1878 C CG  . LYS A 270 ? 0.3699 0.3542 0.3472 0.0538  -0.0199 -0.0230 478 LYS A CG  
1879 C CD  . LYS A 270 ? 0.3900 0.3699 0.3791 0.0524  -0.0316 -0.0267 478 LYS A CD  
1880 C CE  . LYS A 270 ? 0.4144 0.3892 0.4011 0.0572  -0.0390 -0.0307 478 LYS A CE  
1881 N NZ  . LYS A 270 ? 0.4305 0.4011 0.4332 0.0555  -0.0515 -0.0331 478 LYS A NZ  
1882 N N   . ASN A 271 ? 0.3288 0.3312 0.3044 0.0496  0.0056  -0.0109 479 ASN A N   
1883 C CA  . ASN A 271 ? 0.3230 0.3317 0.3045 0.0467  0.0097  -0.0093 479 ASN A CA  
1884 C C   . ASN A 271 ? 0.3068 0.3238 0.3000 0.0392  0.0162  -0.0047 479 ASN A C   
1885 O O   . ASN A 271 ? 0.2966 0.3187 0.2974 0.0352  0.0179  -0.0043 479 ASN A O   
1886 C CB  . ASN A 271 ? 0.3192 0.3279 0.3079 0.0441  0.0029  -0.0139 479 ASN A CB  
1887 C CG  . ASN A 271 ? 0.3506 0.3505 0.3283 0.0522  -0.0043 -0.0184 479 ASN A CG  
1888 O OD1 . ASN A 271 ? 0.3831 0.3782 0.3456 0.0609  -0.0022 -0.0176 479 ASN A OD1 
1889 N ND2 . ASN A 271 ? 0.3503 0.3476 0.3363 0.0505  -0.0134 -0.0225 479 ASN A ND2 
1890 N N   . CYS A 272 ? 0.3037 0.3213 0.2983 0.0377  0.0188  -0.0017 480 CYS A N   
1891 C CA  . CYS A 272 ? 0.2941 0.3174 0.2999 0.0314  0.0227  0.0019  480 CYS A CA  
1892 C C   . CYS A 272 ? 0.2964 0.3231 0.3040 0.0334  0.0295  0.0087  480 CYS A C   
1893 O O   . CYS A 272 ? 0.3045 0.3293 0.3047 0.0398  0.0333  0.0127  480 CYS A O   
1894 C CB  . CYS A 272 ? 0.2950 0.3170 0.3032 0.0288  0.0214  0.0023  480 CYS A CB  
1895 S SG  . CYS A 272 ? 0.3116 0.3317 0.3229 0.0254  0.0150  -0.0028 480 CYS A SG  
1896 N N   . HIS A 273 ? 0.2777 0.3091 0.2960 0.0287  0.0311  0.0107  481 HIS A N   
1897 C CA  . HIS A 273 ? 0.2855 0.3208 0.3124 0.0287  0.0367  0.0186  481 HIS A CA  
1898 C C   . HIS A 273 ? 0.2888 0.3244 0.3251 0.0247  0.0357  0.0216  481 HIS A C   
1899 O O   . HIS A 273 ? 0.3055 0.3430 0.3480 0.0265  0.0401  0.0293  481 HIS A O   
1900 C CB  . HIS A 273 ? 0.2713 0.3107 0.3071 0.0253  0.0373  0.0194  481 HIS A CB  
1901 C CG  . HIS A 273 ? 0.2739 0.3135 0.3013 0.0299  0.0393  0.0181  481 HIS A CG  
1902 N ND1 . HIS A 273 ? 0.2799 0.3198 0.3009 0.0376  0.0455  0.0241  481 HIS A ND1 
1903 C CD2 . HIS A 273 ? 0.2569 0.2960 0.2807 0.0290  0.0358  0.0120  481 HIS A CD2 
1904 C CE1 . HIS A 273 ? 0.2867 0.3256 0.2993 0.0412  0.0451  0.0208  481 HIS A CE1 
1905 N NE2 . HIS A 273 ? 0.2859 0.3245 0.3011 0.0355  0.0389  0.0134  481 HIS A NE2 
1906 N N   . ASN A 274 ? 0.2818 0.3153 0.3197 0.0201  0.0300  0.0161  482 ASN A N   
1907 C CA  . ASN A 274 ? 0.2878 0.3198 0.3318 0.0172  0.0277  0.0174  482 ASN A CA  
1908 C C   . ASN A 274 ? 0.2894 0.3176 0.3238 0.0184  0.0253  0.0132  482 ASN A C   
1909 O O   . ASN A 274 ? 0.2757 0.3021 0.3078 0.0166  0.0212  0.0078  482 ASN A O   
1910 C CB  . ASN A 274 ? 0.2809 0.3124 0.3344 0.0122  0.0228  0.0154  482 ASN A CB  
1911 C CG  . ASN A 274 ? 0.3023 0.3368 0.3682 0.0107  0.0241  0.0203  482 ASN A CG  
1912 O OD1 . ASN A 274 ? 0.3120 0.3482 0.3886 0.0107  0.0262  0.0277  482 ASN A OD1 
1913 N ND2 . ASN A 274 ? 0.3142 0.3497 0.3802 0.0095  0.0229  0.0170  482 ASN A ND2 
1914 N N   . ARG A 275 ? 0.2944 0.3214 0.3236 0.0223  0.0282  0.0164  483 ARG A N   
1915 C CA  . ARG A 275 ? 0.2965 0.3195 0.3177 0.0234  0.0256  0.0130  483 ARG A CA  
1916 C C   . ARG A 275 ? 0.2872 0.3091 0.3145 0.0189  0.0221  0.0121  483 ARG A C   
1917 O O   . ARG A 275 ? 0.2878 0.3109 0.3251 0.0163  0.0219  0.0158  483 ARG A O   
1918 C CB  . ARG A 275 ? 0.3132 0.3346 0.3267 0.0296  0.0296  0.0169  483 ARG A CB  
1919 C CG  . ARG A 275 ? 0.3517 0.3714 0.3539 0.0367  0.0317  0.0164  483 ARG A CG  
1920 C CD  . ARG A 275 ? 0.4344 0.4517 0.4271 0.0449  0.0363  0.0210  483 ARG A CD  
1921 N NE  . ARG A 275 ? 0.4942 0.5068 0.4713 0.0540  0.0365  0.0190  483 ARG A NE  
1922 C CZ  . ARG A 275 ? 0.5406 0.5488 0.5039 0.0644  0.0398  0.0218  483 ARG A CZ  
1923 N NH1 . ARG A 275 ? 0.5390 0.5483 0.5037 0.0662  0.0442  0.0276  483 ARG A NH1 
1924 N NH2 . ARG A 275 ? 0.5558 0.5579 0.5031 0.0738  0.0383  0.0189  483 ARG A NH2 
1925 N N   . VAL A 276 ? 0.2714 0.2902 0.2934 0.0184  0.0186  0.0075  484 VAL A N   
1926 C CA  . VAL A 276 ? 0.2654 0.2823 0.2905 0.0156  0.0154  0.0065  484 VAL A CA  
1927 C C   . VAL A 276 ? 0.2674 0.2813 0.2859 0.0173  0.0148  0.0057  484 VAL A C   
1928 O O   . VAL A 276 ? 0.2639 0.2762 0.2761 0.0196  0.0141  0.0032  484 VAL A O   
1929 C CB  . VAL A 276 ? 0.2597 0.2761 0.2860 0.0141  0.0121  0.0027  484 VAL A CB  
1930 C CG1 . VAL A 276 ? 0.2645 0.2774 0.2898 0.0137  0.0089  0.0014  484 VAL A CG1 
1931 C CG2 . VAL A 276 ? 0.2437 0.2619 0.2763 0.0126  0.0117  0.0033  484 VAL A CG2 
1932 N N   A VAL A 277 ? 0.2702 0.2829 0.2912 0.0161  0.0143  0.0077  485 VAL A N   
1933 N N   B VAL A 277 ? 0.2688 0.2814 0.2896 0.0161  0.0143  0.0077  485 VAL A N   
1934 C CA  A VAL A 277 ? 0.2774 0.2872 0.2929 0.0171  0.0136  0.0070  485 VAL A CA  
1935 C CA  B VAL A 277 ? 0.2739 0.2836 0.2889 0.0173  0.0136  0.0068  485 VAL A CA  
1936 C C   A VAL A 277 ? 0.2791 0.2868 0.2975 0.0146  0.0102  0.0062  485 VAL A C   
1937 C C   B VAL A 277 ? 0.2784 0.2861 0.2966 0.0148  0.0107  0.0067  485 VAL A C   
1938 O O   A VAL A 277 ? 0.2757 0.2834 0.3009 0.0127  0.0084  0.0073  485 VAL A O   
1939 O O   B VAL A 277 ? 0.2768 0.2849 0.3025 0.0130  0.0096  0.0090  485 VAL A O   
1940 C CB  A VAL A 277 ? 0.2848 0.2950 0.2991 0.0197  0.0174  0.0117  485 VAL A CB  
1941 C CB  B VAL A 277 ? 0.2816 0.2913 0.2930 0.0207  0.0174  0.0107  485 VAL A CB  
1942 C CG1 A VAL A 277 ? 0.2967 0.3035 0.3046 0.0209  0.0164  0.0107  485 VAL A CG1 
1943 C CG1 B VAL A 277 ? 0.2737 0.2866 0.2950 0.0197  0.0203  0.0170  485 VAL A CG1 
1944 C CG2 A VAL A 277 ? 0.2893 0.3006 0.2984 0.0244  0.0212  0.0132  485 VAL A CG2 
1945 C CG2 B VAL A 277 ? 0.2896 0.2957 0.2946 0.0220  0.0161  0.0094  485 VAL A CG2 
1946 N N   . PHE A 278 ? 0.2803 0.2853 0.2938 0.0151  0.0087  0.0041  486 PHE A N   
1947 C CA  . PHE A 278 ? 0.2854 0.2877 0.2994 0.0141  0.0062  0.0041  486 PHE A CA  
1948 C C   . PHE A 278 ? 0.2874 0.2877 0.2963 0.0149  0.0065  0.0040  486 PHE A C   
1949 O O   . PHE A 278 ? 0.2796 0.2794 0.2845 0.0165  0.0070  0.0028  486 PHE A O   
1950 C CB  . PHE A 278 ? 0.2811 0.2813 0.2945 0.0146  0.0031  0.0018  486 PHE A CB  
1951 C CG  . PHE A 278 ? 0.2942 0.2947 0.3042 0.0166  0.0038  0.0005  486 PHE A CG  
1952 C CD1 . PHE A 278 ? 0.2988 0.2970 0.3057 0.0178  0.0033  0.0008  486 PHE A CD1 
1953 C CD2 . PHE A 278 ? 0.2892 0.2924 0.3011 0.0174  0.0049  0.0000  486 PHE A CD2 
1954 C CE1 . PHE A 278 ? 0.3016 0.3006 0.3093 0.0199  0.0042  0.0015  486 PHE A CE1 
1955 C CE2 . PHE A 278 ? 0.2972 0.3013 0.3100 0.0194  0.0054  0.0004  486 PHE A CE2 
1956 C CZ  . PHE A 278 ? 0.3015 0.3037 0.3132 0.0207  0.0051  0.0017  486 PHE A CZ  
1957 N N   . SER A 279 ? 0.2879 0.2863 0.2977 0.0139  0.0054  0.0053  487 SER A N   
1958 C CA  . SER A 279 ? 0.2922 0.2886 0.2976 0.0145  0.0055  0.0053  487 SER A CA  
1959 C C   . SER A 279 ? 0.2869 0.2802 0.2906 0.0143  0.0026  0.0038  487 SER A C   
1960 O O   . SER A 279 ? 0.2899 0.2816 0.2955 0.0142  0.0000  0.0033  487 SER A O   
1961 C CB  . SER A 279 ? 0.2963 0.2934 0.3041 0.0143  0.0075  0.0090  487 SER A CB  
1962 O OG  . SER A 279 ? 0.3051 0.2999 0.3077 0.0152  0.0077  0.0088  487 SER A OG  
1963 N N   . THR A 280 ? 0.2733 0.2649 0.2731 0.0151  0.0026  0.0032  488 THR A N   
1964 C CA  . THR A 280 ? 0.2652 0.2540 0.2627 0.0159  0.0008  0.0030  488 THR A CA  
1965 C C   . THR A 280 ? 0.2653 0.2520 0.2610 0.0148  0.0003  0.0037  488 THR A C   
1966 O O   . THR A 280 ? 0.2553 0.2394 0.2480 0.0158  -0.0007 0.0037  488 THR A O   
1967 C CB  . THR A 280 ? 0.2610 0.2499 0.2580 0.0180  0.0014  0.0033  488 THR A CB  
1968 O OG1 . THR A 280 ? 0.2765 0.2654 0.2742 0.0174  0.0015  0.0033  488 THR A OG1 
1969 C CG2 . THR A 280 ? 0.2444 0.2357 0.2443 0.0195  0.0022  0.0032  488 THR A CG2 
1970 N N   . GLY A 281 ? 0.2642 0.2523 0.2620 0.0136  0.0016  0.0052  489 GLY A N   
1971 C CA  . GLY A 281 ? 0.2709 0.2577 0.2681 0.0128  0.0017  0.0067  489 GLY A CA  
1972 C C   . GLY A 281 ? 0.2867 0.2715 0.2880 0.0115  -0.0017 0.0074  489 GLY A C   
1973 O O   . GLY A 281 ? 0.2772 0.2610 0.2817 0.0115  -0.0048 0.0066  489 GLY A O   
1974 N N   . PRO A 282 ? 0.2964 0.2798 0.2976 0.0107  -0.0023 0.0086  490 PRO A N   
1975 C CA  . PRO A 282 ? 0.3081 0.2881 0.3130 0.0098  -0.0073 0.0087  490 PRO A CA  
1976 C C   . PRO A 282 ? 0.3188 0.3003 0.3365 0.0080  -0.0096 0.0120  490 PRO A C   
1977 O O   . PRO A 282 ? 0.3200 0.2971 0.3422 0.0077  -0.0163 0.0111  490 PRO A O   
1978 C CB  . PRO A 282 ? 0.3117 0.2906 0.3137 0.0093  -0.0065 0.0095  490 PRO A CB  
1979 C CG  . PRO A 282 ? 0.3137 0.2946 0.3098 0.0102  -0.0016 0.0094  490 PRO A CG  
1980 C CD  . PRO A 282 ? 0.3014 0.2854 0.2985 0.0111  0.0008  0.0096  490 PRO A CD  
1981 N N   . GLN A 283 ? 0.3282 0.3151 0.3522 0.0077  -0.0047 0.0160  491 GLN A N   
1982 C CA  . GLN A 283 ? 0.3471 0.3364 0.3866 0.0062  -0.0061 0.0210  491 GLN A CA  
1983 C C   . GLN A 283 ? 0.3466 0.3349 0.3889 0.0061  -0.0095 0.0188  491 GLN A C   
1984 O O   . GLN A 283 ? 0.3512 0.3406 0.4078 0.0047  -0.0122 0.0225  491 GLN A O   
1985 C CB  . GLN A 283 ? 0.3553 0.3512 0.4006 0.0075  0.0018  0.0280  491 GLN A CB  
1986 C CG  . GLN A 283 ? 0.4061 0.4030 0.4455 0.0093  0.0065  0.0301  491 GLN A CG  
1987 C CD  . GLN A 283 ? 0.4798 0.4776 0.5321 0.0077  0.0049  0.0356  491 GLN A CD  
1988 O OE1 . GLN A 283 ? 0.5018 0.4965 0.5640 0.0047  -0.0027 0.0349  491 GLN A OE1 
1989 N NE2 . GLN A 283 ? 0.5113 0.5125 0.5634 0.0105  0.0116  0.0412  491 GLN A NE2 
1990 N N   . SER A 284 ? 0.3435 0.3299 0.3738 0.0078  -0.0094 0.0134  492 SER A N   
1991 C CA  . SER A 284 ? 0.3417 0.3269 0.3728 0.0084  -0.0121 0.0111  492 SER A CA  
1992 C C   . SER A 284 ? 0.3431 0.3209 0.3664 0.0110  -0.0189 0.0059  492 SER A C   
1993 O O   . SER A 284 ? 0.3318 0.3063 0.3462 0.0127  -0.0195 0.0039  492 SER A O   
1994 C CB  . SER A 284 ? 0.3440 0.3333 0.3685 0.0095  -0.0061 0.0101  492 SER A CB  
1995 O OG  . SER A 284 ? 0.3558 0.3504 0.3840 0.0093  -0.0001 0.0144  492 SER A OG  
1996 N N   . THR A 285 ? 0.3427 0.3176 0.3685 0.0121  -0.0237 0.0040  493 THR A N   
1997 C CA  . THR A 285 ? 0.3505 0.3175 0.3661 0.0171  -0.0298 -0.0008 493 THR A CA  
1998 C C   . THR A 285 ? 0.3404 0.3080 0.3421 0.0205  -0.0243 -0.0023 493 THR A C   
1999 O O   . THR A 285 ? 0.3318 0.3057 0.3327 0.0194  -0.0173 -0.0010 493 THR A O   
2000 C CB  . THR A 285 ? 0.3510 0.3165 0.3683 0.0186  -0.0326 -0.0026 493 THR A CB  
2001 O OG1 . THR A 285 ? 0.3688 0.3347 0.4025 0.0149  -0.0373 0.0000  493 THR A OG1 
2002 C CG2 . THR A 285 ? 0.3724 0.3280 0.3773 0.0259  -0.0396 -0.0076 493 THR A CG2 
2003 N N   . LYS A 286 ? 0.3491 0.3098 0.3411 0.0252  -0.0281 -0.0044 494 LYS A N   
2004 C CA  . LYS A 286 ? 0.3506 0.3119 0.3317 0.0292  -0.0228 -0.0041 494 LYS A CA  
2005 C C   . LYS A 286 ? 0.3393 0.3029 0.3163 0.0331  -0.0189 -0.0041 494 LYS A C   
2006 O O   . LYS A 286 ? 0.3454 0.3058 0.3215 0.0357  -0.0226 -0.0061 494 LYS A O   
2007 C CB  . LYS A 286 ? 0.3690 0.3217 0.3395 0.0352  -0.0276 -0.0059 494 LYS A CB  
2008 C CG  . LYS A 286 ? 0.4137 0.3566 0.3752 0.0431  -0.0353 -0.0095 494 LYS A CG  
2009 C CD  . LYS A 286 ? 0.4896 0.4226 0.4387 0.0502  -0.0407 -0.0114 494 LYS A CD  
2010 C CE  . LYS A 286 ? 0.5334 0.4549 0.4681 0.0616  -0.0476 -0.0152 494 LYS A CE  
2011 N NZ  . LYS A 286 ? 0.5805 0.4906 0.5018 0.0695  -0.0544 -0.0176 494 LYS A NZ  
2012 N N   . THR A 287 ? 0.3418 0.2811 0.2909 0.0480  -0.0159 -0.0085 495 THR A N   
2013 C CA  . THR A 287 ? 0.3398 0.2801 0.2758 0.0494  -0.0127 -0.0029 495 THR A CA  
2014 C C   . THR A 287 ? 0.3436 0.2933 0.2685 0.0536  -0.0065 0.0037  495 THR A C   
2015 O O   . THR A 287 ? 0.3238 0.2787 0.2523 0.0542  -0.0050 0.0034  495 THR A O   
2016 C CB  . THR A 287 ? 0.3295 0.2707 0.2719 0.0382  -0.0082 0.0026  495 THR A CB  
2017 O OG1 . THR A 287 ? 0.3142 0.2638 0.2609 0.0312  -0.0013 0.0091  495 THR A OG1 
2018 C CG2 . THR A 287 ? 0.3077 0.2419 0.2639 0.0330  -0.0125 -0.0033 495 THR A CG2 
2019 N N   . HIS A 288 ? 0.3524 0.3045 0.2651 0.0564  -0.0026 0.0104  496 HIS A N   
2020 C CA  . HIS A 288 ? 0.3617 0.3242 0.2660 0.0601  0.0047  0.0182  496 HIS A CA  
2021 C C   . HIS A 288 ? 0.3447 0.3158 0.2604 0.0494  0.0115  0.0252  496 HIS A C   
2022 O O   . HIS A 288 ? 0.3436 0.3239 0.2573 0.0516  0.0169  0.0302  496 HIS A O   
2023 C CB  . HIS A 288 ? 0.3811 0.3446 0.2711 0.0655  0.0082  0.0254  496 HIS A CB  
2024 C CG  . HIS A 288 ? 0.3877 0.3530 0.2839 0.0552  0.0128  0.0342  496 HIS A CG  
2025 N ND1 . HIS A 288 ? 0.4022 0.3590 0.3032 0.0496  0.0084  0.0316  496 HIS A ND1 
2026 C CD2 . HIS A 288 ? 0.4072 0.3816 0.3076 0.0495  0.0208  0.0452  496 HIS A CD2 
2027 C CE1 . HIS A 288 ? 0.4156 0.3757 0.3222 0.0413  0.0129  0.0404  496 HIS A CE1 
2028 N NE2 . HIS A 288 ? 0.4142 0.3848 0.3212 0.0409  0.0202  0.0488  496 HIS A NE2 
2029 N N   . TRP A 289 ? 0.3252 0.2934 0.2528 0.0387  0.0109  0.0251  497 TRP A N   
2030 C CA  . TRP A 289 ? 0.3142 0.2889 0.2520 0.0294  0.0157  0.0302  497 TRP A CA  
2031 C C   . TRP A 289 ? 0.3072 0.2836 0.2515 0.0293  0.0144  0.0255  497 TRP A C   
2032 O O   . TRP A 289 ? 0.3061 0.2884 0.2565 0.0240  0.0180  0.0294  497 TRP A O   
2033 C CB  . TRP A 289 ? 0.3009 0.2715 0.2474 0.0194  0.0150  0.0312  497 TRP A CB  
2034 C CG  . TRP A 289 ? 0.3009 0.2710 0.2441 0.0176  0.0166  0.0375  497 TRP A CG  
2035 C CD1 . TRP A 289 ? 0.3123 0.2895 0.2563 0.0150  0.0217  0.0471  497 TRP A CD1 
2036 C CD2 . TRP A 289 ? 0.3033 0.2652 0.2437 0.0180  0.0125  0.0349  497 TRP A CD2 
2037 N NE1 . TRP A 289 ? 0.3154 0.2892 0.2572 0.0138  0.0211  0.0513  497 TRP A NE1 
2038 C CE2 . TRP A 289 ? 0.3247 0.2889 0.2636 0.0156  0.0154  0.0436  497 TRP A CE2 
2039 C CE3 . TRP A 289 ? 0.3071 0.2599 0.2479 0.0201  0.0063  0.0262  497 TRP A CE3 
2040 C CZ2 . TRP A 289 ? 0.3156 0.2728 0.2516 0.0155  0.0122  0.0438  497 TRP A CZ2 
2041 C CZ3 . TRP A 289 ? 0.3160 0.2622 0.2542 0.0200  0.0032  0.0259  497 TRP A CZ3 
2042 C CH2 . TRP A 289 ? 0.3225 0.2707 0.2575 0.0178  0.0060  0.0345  497 TRP A CH2 
2043 N N   . LYS A 290 ? 0.3032 0.2736 0.2471 0.0351  0.0085  0.0172  498 LYS A N   
2044 C CA  . LYS A 290 ? 0.3020 0.2729 0.2536 0.0352  0.0063  0.0127  498 LYS A CA  
2045 C C   . LYS A 290 ? 0.2864 0.2583 0.2492 0.0245  0.0091  0.0153  498 LYS A C   
2046 O O   . LYS A 290 ? 0.2777 0.2458 0.2445 0.0183  0.0093  0.0159  498 LYS A O   
2047 C CB  . LYS A 290 ? 0.3041 0.2825 0.2495 0.0425  0.0083  0.0141  498 LYS A CB  
2048 C CG  . LYS A 290 ? 0.3266 0.3049 0.2574 0.0545  0.0068  0.0126  498 LYS A CG  
2049 C CD  . LYS A 290 ? 0.3748 0.3614 0.2987 0.0627  0.0096  0.0139  498 LYS A CD  
2050 C CE  . LYS A 290 ? 0.4224 0.4072 0.3301 0.0763  0.0072  0.0110  498 LYS A CE  
2051 N NZ  . LYS A 290 ? 0.4870 0.4823 0.3848 0.0843  0.0134  0.0161  498 LYS A NZ  
2052 N N   . GLN A 291 ? 0.2800 0.2568 0.2470 0.0232  0.0108  0.0166  499 GLN A N   
2053 C CA  . GLN A 291 ? 0.2718 0.2505 0.2460 0.0143  0.0139  0.0203  499 GLN A CA  
2054 C C   . GLN A 291 ? 0.2766 0.2642 0.2492 0.0137  0.0181  0.0260  499 GLN A C   
2055 O O   . GLN A 291 ? 0.2793 0.2719 0.2469 0.0204  0.0188  0.0265  499 GLN A O   
2056 C CB  . GLN A 291 ? 0.2625 0.2371 0.2457 0.0124  0.0114  0.0163  499 GLN A CB  
2057 C CG  . GLN A 291 ? 0.2715 0.2381 0.2605 0.0112  0.0083  0.0118  499 GLN A CG  
2058 C CD  . GLN A 291 ? 0.2760 0.2380 0.2663 0.0189  0.0022  0.0052  499 GLN A CD  
2059 O OE1 . GLN A 291 ? 0.2939 0.2566 0.2871 0.0233  -0.0007 0.0025  499 GLN A OE1 
2060 N NE2 . GLN A 291 ? 0.2582 0.2149 0.2471 0.0208  -0.0007 0.0019  499 GLN A NE2 
2061 N N   . THR A 292 ? 0.2697 0.2591 0.2469 0.0063  0.0204  0.0301  500 THR A N   
2062 C CA  . THR A 292 ? 0.2719 0.2693 0.2505 0.0050  0.0235  0.0354  500 THR A CA  
2063 C C   . THR A 292 ? 0.2756 0.2728 0.2591 0.0029  0.0224  0.0339  500 THR A C   
2064 O O   . THR A 292 ? 0.2814 0.2731 0.2679 -0.0014 0.0212  0.0323  500 THR A O   
2065 C CB  . THR A 292 ? 0.2683 0.2675 0.2491 -0.0011 0.0256  0.0413  500 THR A CB  
2066 O OG1 . THR A 292 ? 0.2762 0.2753 0.2526 0.0010  0.0266  0.0434  500 THR A OG1 
2067 C CG2 . THR A 292 ? 0.2643 0.2718 0.2497 -0.0026 0.0281  0.0469  500 THR A CG2 
2068 N N   . VAL A 293 ? 0.2765 0.2796 0.2605 0.0066  0.0230  0.0347  501 VAL A N   
2069 C CA  . VAL A 293 ? 0.2776 0.2800 0.2660 0.0058  0.0212  0.0330  501 VAL A CA  
2070 C C   . VAL A 293 ? 0.2701 0.2791 0.2616 0.0032  0.0229  0.0376  501 VAL A C   
2071 O O   . VAL A 293 ? 0.2703 0.2871 0.2616 0.0063  0.0254  0.0406  501 VAL A O   
2072 C CB  . VAL A 293 ? 0.2868 0.2889 0.2750 0.0133  0.0181  0.0279  501 VAL A CB  
2073 C CG1 . VAL A 293 ? 0.2980 0.2970 0.2922 0.0115  0.0154  0.0262  501 VAL A CG1 
2074 C CG2 . VAL A 293 ? 0.3010 0.2970 0.2866 0.0173  0.0153  0.0230  501 VAL A CG2 
2075 N N   . PHE A 294 ? 0.2651 0.2707 0.2595 -0.0017 0.0217  0.0381  502 PHE A N   
2076 C CA  . PHE A 294 ? 0.2614 0.2713 0.2594 -0.0043 0.0217  0.0415  502 PHE A CA  
2077 C C   . PHE A 294 ? 0.2677 0.2763 0.2674 -0.0025 0.0194  0.0393  502 PHE A C   
2078 O O   . PHE A 294 ? 0.2571 0.2589 0.2564 -0.0048 0.0179  0.0380  502 PHE A O   
2079 C CB  . PHE A 294 ? 0.2621 0.2680 0.2606 -0.0106 0.0209  0.0436  502 PHE A CB  
2080 C CG  . PHE A 294 ? 0.2642 0.2694 0.2617 -0.0127 0.0222  0.0451  502 PHE A CG  
2081 C CD1 . PHE A 294 ? 0.2744 0.2724 0.2684 -0.0144 0.0217  0.0425  502 PHE A CD1 
2082 C CD2 . PHE A 294 ? 0.2721 0.2841 0.2733 -0.0128 0.0240  0.0496  502 PHE A CD2 
2083 C CE1 . PHE A 294 ? 0.2883 0.2851 0.2817 -0.0163 0.0221  0.0436  502 PHE A CE1 
2084 C CE2 . PHE A 294 ? 0.2650 0.2759 0.2662 -0.0149 0.0247  0.0517  502 PHE A CE2 
2085 C CZ  . PHE A 294 ? 0.2628 0.2657 0.2596 -0.0166 0.0233  0.0482  502 PHE A CZ  
2086 N N   . LEU A 295 ? 0.2722 0.2873 0.2742 0.0018  0.0193  0.0392  503 LEU A N   
2087 C CA  . LEU A 295 ? 0.2873 0.3011 0.2917 0.0040  0.0162  0.0369  503 LEU A CA  
2088 C C   . LEU A 295 ? 0.2856 0.2980 0.2923 -0.0003 0.0147  0.0394  503 LEU A C   
2089 O O   . LEU A 295 ? 0.2769 0.2936 0.2858 -0.0027 0.0154  0.0426  503 LEU A O   
2090 C CB  . LEU A 295 ? 0.2969 0.3182 0.3027 0.0110  0.0162  0.0353  503 LEU A CB  
2091 C CG  . LEU A 295 ? 0.3388 0.3594 0.3413 0.0180  0.0152  0.0307  503 LEU A CG  
2092 C CD1 . LEU A 295 ? 0.3491 0.3720 0.3462 0.0194  0.0188  0.0321  503 LEU A CD1 
2093 C CD2 . LEU A 295 ? 0.3688 0.3959 0.3725 0.0256  0.0138  0.0282  503 LEU A CD2 
2094 N N   . LEU A 296 ? 0.2857 0.2918 0.2923 -0.0010 0.0121  0.0381  504 LEU A N   
2095 C CA  . LEU A 296 ? 0.2949 0.2987 0.3018 -0.0036 0.0100  0.0402  504 LEU A CA  
2096 C C   . LEU A 296 ? 0.2947 0.3035 0.3063 -0.0001 0.0074  0.0395  504 LEU A C   
2097 O O   . LEU A 296 ? 0.2948 0.3039 0.3088 0.0039  0.0059  0.0367  504 LEU A O   
2098 C CB  . LEU A 296 ? 0.2953 0.2899 0.2991 -0.0056 0.0093  0.0405  504 LEU A CB  
2099 C CG  . LEU A 296 ? 0.3102 0.2999 0.3094 -0.0086 0.0120  0.0410  504 LEU A CG  
2100 C CD1 . LEU A 296 ? 0.3205 0.3026 0.3177 -0.0096 0.0126  0.0424  504 LEU A CD1 
2101 C CD2 . LEU A 296 ? 0.2957 0.2863 0.2914 -0.0117 0.0121  0.0427  504 LEU A CD2 
2102 N N   . GLU A 297 ? 0.3001 0.3126 0.3143 -0.0016 0.0062  0.0416  505 GLU A N   
2103 C CA  . GLU A 297 ? 0.3152 0.3324 0.3349 0.0013  0.0035  0.0409  505 GLU A CA  
2104 C C   . GLU A 297 ? 0.3230 0.3328 0.3414 0.0019  -0.0004 0.0399  505 GLU A C   
2105 O O   . GLU A 297 ? 0.3285 0.3404 0.3510 0.0060  -0.0027 0.0376  505 GLU A O   
2106 C CB  . GLU A 297 ? 0.3124 0.3341 0.3370 -0.0008 0.0022  0.0435  505 GLU A CB  
2107 C CG  . GLU A 297 ? 0.3573 0.3859 0.3894 0.0027  0.0001  0.0428  505 GLU A CG  
2108 C CD  . GLU A 297 ? 0.4091 0.4438 0.4498 0.0007  -0.0009 0.0456  505 GLU A CD  
2109 O OE1 . GLU A 297 ? 0.4241 0.4586 0.4658 -0.0031 0.0001  0.0481  505 GLU A OE1 
2110 O OE2 . GLU A 297 ? 0.4526 0.4923 0.5005 0.0031  -0.0033 0.0450  505 GLU A OE2 
2111 N N   . LYS A 298 ? 0.3290 0.3302 0.3418 -0.0015 -0.0010 0.0417  506 LYS A N   
2112 C CA  . LYS A 298 ? 0.3424 0.3363 0.3538 -0.0011 -0.0037 0.0424  506 LYS A CA  
2113 C C   . LYS A 298 ? 0.3322 0.3190 0.3401 -0.0026 -0.0009 0.0435  506 LYS A C   
2114 O O   . LYS A 298 ? 0.3329 0.3146 0.3339 -0.0053 0.0009  0.0459  506 LYS A O   
2115 C CB  . LYS A 298 ? 0.3598 0.3496 0.3673 -0.0026 -0.0071 0.0447  506 LYS A CB  
2116 C CG  . LYS A 298 ? 0.4122 0.3944 0.4177 -0.0017 -0.0099 0.0466  506 LYS A CG  
2117 C CD  . LYS A 298 ? 0.4852 0.4624 0.4845 -0.0021 -0.0140 0.0486  506 LYS A CD  
2118 C CE  . LYS A 298 ? 0.5168 0.4898 0.5061 -0.0043 -0.0124 0.0500  506 LYS A CE  
2119 N NZ  . LYS A 298 ? 0.5577 0.5216 0.5362 -0.0034 -0.0155 0.0526  506 LYS A NZ  
2120 N N   . PRO A 299 ? 0.3189 0.3056 0.3324 -0.0001 -0.0009 0.0413  507 PRO A N   
2121 C CA  . PRO A 299 ? 0.3136 0.2939 0.3276 -0.0015 0.0012  0.0426  507 PRO A CA  
2122 C C   . PRO A 299 ? 0.3194 0.2924 0.3304 -0.0033 0.0013  0.0474  507 PRO A C   
2123 O O   . PRO A 299 ? 0.3116 0.2837 0.3223 -0.0024 -0.0020 0.0487  507 PRO A O   
2124 C CB  . PRO A 299 ? 0.3103 0.2915 0.3337 0.0024  -0.0017 0.0389  507 PRO A CB  
2125 C CG  . PRO A 299 ? 0.3138 0.3034 0.3373 0.0061  -0.0030 0.0349  507 PRO A CG  
2126 C CD  . PRO A 299 ? 0.3147 0.3070 0.3350 0.0046  -0.0036 0.0373  507 PRO A CD  
2127 N N   . PHE A 300 ? 0.3177 0.2858 0.3259 -0.0054 0.0055  0.0504  508 PHE A N   
2128 C CA  . PHE A 300 ? 0.3371 0.2986 0.3403 -0.0063 0.0071  0.0562  508 PHE A CA  
2129 C C   . PHE A 300 ? 0.3394 0.2969 0.3481 -0.0072 0.0115  0.0594  508 PHE A C   
2130 O O   . PHE A 300 ? 0.3219 0.2809 0.3341 -0.0081 0.0141  0.0571  508 PHE A O   
2131 C CB  . PHE A 300 ? 0.3396 0.2994 0.3290 -0.0073 0.0084  0.0576  508 PHE A CB  
2132 C CG  . PHE A 300 ? 0.3431 0.3037 0.3279 -0.0090 0.0125  0.0561  508 PHE A CG  
2133 C CD1 . PHE A 300 ? 0.3367 0.2927 0.3162 -0.0094 0.0176  0.0596  508 PHE A CD1 
2134 C CD2 . PHE A 300 ? 0.3372 0.3036 0.3236 -0.0097 0.0114  0.0518  508 PHE A CD2 
2135 C CE1 . PHE A 300 ? 0.3655 0.3222 0.3414 -0.0106 0.0209  0.0577  508 PHE A CE1 
2136 C CE2 . PHE A 300 ? 0.3432 0.3098 0.3261 -0.0113 0.0145  0.0505  508 PHE A CE2 
2137 C CZ  . PHE A 300 ? 0.3281 0.2896 0.3057 -0.0118 0.0188  0.0530  508 PHE A CZ  
2138 N N   . SER A 301 ? 0.3496 0.3021 0.3602 -0.0070 0.0125  0.0653  509 SER A N   
2139 C CA  . SER A 301 ? 0.3607 0.3102 0.3809 -0.0079 0.0168  0.0695  509 SER A CA  
2140 C C   . SER A 301 ? 0.3616 0.3095 0.3721 -0.0090 0.0243  0.0729  509 SER A C   
2141 O O   . SER A 301 ? 0.3637 0.3100 0.3586 -0.0084 0.0258  0.0744  509 SER A O   
2142 C CB  . SER A 301 ? 0.3745 0.3196 0.4029 -0.0073 0.0155  0.0758  509 SER A CB  
2143 O OG  . SER A 301 ? 0.4140 0.3550 0.4289 -0.0068 0.0188  0.0824  509 SER A OG  
2144 N N   . VAL A 302 ? 0.3577 0.3059 0.3780 -0.0101 0.0281  0.0732  510 VAL A N   
2145 C CA  . VAL A 302 ? 0.3690 0.3161 0.3831 -0.0108 0.0357  0.0763  510 VAL A CA  
2146 C C   . VAL A 302 ? 0.3807 0.3260 0.4105 -0.0114 0.0405  0.0827  510 VAL A C   
2147 O O   . VAL A 302 ? 0.3754 0.3204 0.4226 -0.0118 0.0366  0.0825  510 VAL A O   
2148 C CB  . VAL A 302 ? 0.3592 0.3097 0.3709 -0.0117 0.0358  0.0694  510 VAL A CB  
2149 C CG1 . VAL A 302 ? 0.3480 0.3005 0.3457 -0.0114 0.0320  0.0648  510 VAL A CG1 
2150 C CG2 . VAL A 302 ? 0.3397 0.2923 0.3676 -0.0122 0.0321  0.0644  510 VAL A CG2 
2151 N N   . LYS A 303 ? 0.4011 0.3453 0.4256 -0.0111 0.0489  0.0883  511 LYS A N   
2152 C CA  . LYS A 303 ? 0.4152 0.3586 0.4557 -0.0117 0.0553  0.0960  511 LYS A CA  
2153 C C   . LYS A 303 ? 0.4145 0.3602 0.4581 -0.0123 0.0611  0.0944  511 LYS A C   
2154 O O   . LYS A 303 ? 0.4133 0.3598 0.4400 -0.0112 0.0636  0.0913  511 LYS A O   
2155 C CB  . LYS A 303 ? 0.4341 0.3745 0.4661 -0.0096 0.0618  0.1069  511 LYS A CB  
2156 C CG  . LYS A 303 ? 0.4623 0.3996 0.4950 -0.0091 0.0561  0.1100  511 LYS A CG  
2157 C CD  . LYS A 303 ? 0.5082 0.4419 0.5373 -0.0071 0.0634  0.1228  511 LYS A CD  
2158 C CE  . LYS A 303 ? 0.5219 0.4517 0.5496 -0.0063 0.0573  0.1260  511 LYS A CE  
2159 N NZ  . LYS A 303 ? 0.5099 0.4355 0.5278 -0.0033 0.0647  0.1388  511 LYS A NZ  
2160 N N   . ALA A 304 ? 0.4176 0.3641 0.4841 -0.0139 0.0624  0.0960  512 ALA A N   
2161 C CA  . ALA A 304 ? 0.4294 0.3780 0.5021 -0.0144 0.0684  0.0954  512 ALA A CA  
2162 C C   . ALA A 304 ? 0.4490 0.3981 0.5062 -0.0121 0.0791  0.1023  512 ALA A C   
2163 O O   . ALA A 304 ? 0.4570 0.4046 0.5100 -0.0104 0.0843  0.1116  512 ALA A O   
2164 C CB  . ALA A 304 ? 0.4243 0.3731 0.5270 -0.0161 0.0687  0.0985  512 ALA A CB  
2165 N N   . GLY A 305 ? 0.4550 0.4059 0.5026 -0.0114 0.0819  0.0974  513 GLY A N   
2166 C CA  . GLY A 305 ? 0.4725 0.4238 0.5028 -0.0078 0.0910  0.1019  513 GLY A CA  
2167 C C   . GLY A 305 ? 0.4835 0.4325 0.4860 -0.0051 0.0875  0.0979  513 GLY A C   
2168 O O   . GLY A 305 ? 0.4910 0.4398 0.4769 -0.0015 0.0922  0.0976  513 GLY A O   
2169 N N   . GLU A 306 ? 0.4823 0.4294 0.4804 -0.0063 0.0788  0.0944  514 GLU A N   
2170 C CA  . GLU A 306 ? 0.4910 0.4359 0.4664 -0.0041 0.0739  0.0901  514 GLU A CA  
2171 C C   . GLU A 306 ? 0.4858 0.4320 0.4538 -0.0045 0.0707  0.0811  514 GLU A C   
2172 O O   . GLU A 306 ? 0.4745 0.4232 0.4551 -0.0077 0.0678  0.0757  514 GLU A O   
2173 C CB  . GLU A 306 ? 0.4930 0.4369 0.4703 -0.0058 0.0652  0.0879  514 GLU A CB  
2174 C CG  . GLU A 306 ? 0.5113 0.4531 0.4692 -0.0039 0.0591  0.0838  514 GLU A CG  
2175 C CD  . GLU A 306 ? 0.5264 0.4684 0.4893 -0.0057 0.0508  0.0814  514 GLU A CD  
2176 O OE1 . GLU A 306 ? 0.5228 0.4649 0.4995 -0.0068 0.0504  0.0851  514 GLU A OE1 
2177 O OE2 . GLU A 306 ? 0.5429 0.4854 0.4972 -0.0056 0.0446  0.0758  514 GLU A OE2 
2178 N N   . ALA A 307 ? 0.4906 0.4346 0.4381 -0.0008 0.0707  0.0794  515 ALA A N   
2179 C CA  . ALA A 307 ? 0.4839 0.4281 0.4236 -0.0011 0.0659  0.0710  515 ALA A CA  
2180 C C   . ALA A 307 ? 0.4786 0.4216 0.4115 -0.0021 0.0563  0.0667  515 ALA A C   
2181 O O   . ALA A 307 ? 0.4971 0.4365 0.4146 0.0014  0.0539  0.0674  515 ALA A O   
2182 C CB  . ALA A 307 ? 0.4946 0.4367 0.4174 0.0042  0.0705  0.0710  515 ALA A CB  
2183 N N   . LEU A 308 ? 0.4533 0.3993 0.3981 -0.0063 0.0509  0.0624  516 LEU A N   
2184 C CA  . LEU A 308 ? 0.4409 0.3872 0.3828 -0.0074 0.0428  0.0591  516 LEU A CA  
2185 C C   . LEU A 308 ? 0.4338 0.3802 0.3689 -0.0077 0.0378  0.0532  516 LEU A C   
2186 O O   . LEU A 308 ? 0.4329 0.3815 0.3745 -0.0100 0.0377  0.0496  516 LEU A O   
2187 C CB  . LEU A 308 ? 0.4300 0.3801 0.3875 -0.0106 0.0400  0.0581  516 LEU A CB  
2188 C CG  . LEU A 308 ? 0.4148 0.3673 0.3730 -0.0117 0.0328  0.0550  516 LEU A CG  
2189 C CD1 . LEU A 308 ? 0.4133 0.3631 0.3650 -0.0098 0.0305  0.0583  516 LEU A CD1 
2190 C CD2 . LEU A 308 ? 0.3868 0.3435 0.3593 -0.0136 0.0312  0.0529  516 LEU A CD2 
2191 N N   . LYS A 309 ? 0.4331 0.3764 0.3559 -0.0053 0.0330  0.0521  517 LYS A N   
2192 C CA  . LYS A 309 ? 0.4370 0.3792 0.3543 -0.0051 0.0272  0.0468  517 LYS A CA  
2193 C C   . LYS A 309 ? 0.4119 0.3571 0.3364 -0.0081 0.0198  0.0444  517 LYS A C   
2194 O O   . LYS A 309 ? 0.4082 0.3540 0.3343 -0.0081 0.0173  0.0462  517 LYS A O   
2195 C CB  . LYS A 309 ? 0.4604 0.3965 0.3599 0.0005  0.0254  0.0462  517 LYS A CB  
2196 C CG  . LYS A 309 ? 0.5057 0.4395 0.3964 0.0048  0.0339  0.0489  517 LYS A CG  
2197 C CD  . LYS A 309 ? 0.5858 0.5136 0.4569 0.0118  0.0312  0.0464  517 LYS A CD  
2198 C CE  . LYS A 309 ? 0.6378 0.5648 0.5005 0.0167  0.0409  0.0494  517 LYS A CE  
2199 N NZ  . LYS A 309 ? 0.6436 0.5744 0.5169 0.0136  0.0444  0.0464  517 LYS A NZ  
2200 N N   . GLY A 310 ? 0.3883 0.3356 0.3178 -0.0106 0.0165  0.0407  518 GLY A N   
2201 C CA  . GLY A 310 ? 0.3652 0.3161 0.3028 -0.0133 0.0103  0.0394  518 GLY A CA  
2202 C C   . GLY A 310 ? 0.3539 0.3042 0.2929 -0.0145 0.0055  0.0359  518 GLY A C   
2203 O O   . GLY A 310 ? 0.3564 0.3030 0.2889 -0.0129 0.0064  0.0337  518 GLY A O   
2204 N N   . LYS A 311 ? 0.3378 0.2920 0.2862 -0.0172 0.0006  0.0358  519 LYS A N   
2205 C CA  . LYS A 311 ? 0.3294 0.2835 0.2829 -0.0191 -0.0041 0.0336  519 LYS A CA  
2206 C C   . LYS A 311 ? 0.3105 0.2722 0.2780 -0.0230 -0.0033 0.0360  519 LYS A C   
2207 O O   . LYS A 311 ? 0.2909 0.2577 0.2642 -0.0235 -0.0022 0.0386  519 LYS A O   
2208 C CB  . LYS A 311 ? 0.3434 0.2930 0.2940 -0.0172 -0.0132 0.0314  519 LYS A CB  
2209 C CG  . LYS A 311 ? 0.3620 0.3093 0.3169 -0.0183 -0.0194 0.0284  519 LYS A CG  
2210 C CD  . LYS A 311 ? 0.3944 0.3349 0.3444 -0.0148 -0.0296 0.0246  519 LYS A CD  
2211 C CE  . LYS A 311 ? 0.4025 0.3408 0.3604 -0.0162 -0.0369 0.0217  519 LYS A CE  
2212 N NZ  . LYS A 311 ? 0.4115 0.3424 0.3664 -0.0123 -0.0489 0.0170  519 LYS A NZ  
2213 N N   . VAL A 312 ? 0.2791 0.2760 0.2483 -0.0013 -0.0180 0.0081  520 VAL A N   
2214 C CA  . VAL A 312 ? 0.2771 0.2749 0.2543 -0.0048 -0.0164 0.0100  520 VAL A CA  
2215 C C   . VAL A 312 ? 0.2907 0.2789 0.2685 -0.0030 -0.0212 0.0096  520 VAL A C   
2216 O O   . VAL A 312 ? 0.2987 0.2822 0.2687 0.0026  -0.0244 0.0072  520 VAL A O   
2217 C CB  . VAL A 312 ? 0.2706 0.2790 0.2468 -0.0047 -0.0110 0.0107  520 VAL A CB  
2218 C CG1 . VAL A 312 ? 0.2698 0.2805 0.2374 0.0016  -0.0116 0.0088  520 VAL A CG1 
2219 C CG2 . VAL A 312 ? 0.2707 0.2812 0.2534 -0.0070 -0.0090 0.0130  520 VAL A CG2 
2220 N N   . THR A 313 ? 0.2989 0.2843 0.2863 -0.0077 -0.0216 0.0123  521 THR A N   
2221 C CA  . THR A 313 ? 0.3155 0.2908 0.3059 -0.0083 -0.0254 0.0137  521 THR A CA  
2222 C C   . THR A 313 ? 0.3206 0.3001 0.3176 -0.0122 -0.0203 0.0197  521 THR A C   
2223 O O   . THR A 313 ? 0.3024 0.2913 0.3065 -0.0159 -0.0163 0.0216  521 THR A O   
2224 C CB  . THR A 313 ? 0.3231 0.2902 0.3206 -0.0111 -0.0322 0.0114  521 THR A CB  
2225 O OG1 . THR A 313 ? 0.3370 0.3004 0.3256 -0.0054 -0.0373 0.0057  521 THR A OG1 
2226 C CG2 . THR A 313 ? 0.3430 0.2980 0.3460 -0.0138 -0.0364 0.0133  521 THR A CG2 
2227 N N   . VAL A 314 ? 0.3411 0.3134 0.3345 -0.0102 -0.0207 0.0227  522 VAL A N   
2228 C CA  . VAL A 314 ? 0.3606 0.3358 0.3576 -0.0125 -0.0157 0.0297  522 VAL A CA  
2229 C C   . VAL A 314 ? 0.3925 0.3542 0.3968 -0.0175 -0.0190 0.0345  522 VAL A C   
2230 O O   . VAL A 314 ? 0.4028 0.3489 0.4025 -0.0150 -0.0251 0.0329  522 VAL A O   
2231 C CB  . VAL A 314 ? 0.3621 0.3406 0.3479 -0.0056 -0.0127 0.0306  522 VAL A CB  
2232 C CG1 . VAL A 314 ? 0.3841 0.3636 0.3706 -0.0062 -0.0081 0.0388  522 VAL A CG1 
2233 C CG2 . VAL A 314 ? 0.3480 0.3421 0.3306 -0.0031 -0.0093 0.0259  522 VAL A CG2 
2234 N N   . HIS A 315 ? 0.4117 0.3799 0.4283 -0.0245 -0.0154 0.0400  523 HIS A N   
2235 C CA  . HIS A 315 ? 0.4543 0.4127 0.4820 -0.0319 -0.0175 0.0458  523 HIS A CA  
2236 C C   . HIS A 315 ? 0.4702 0.4340 0.5005 -0.0346 -0.0096 0.0568  523 HIS A C   
2237 O O   . HIS A 315 ? 0.4594 0.4401 0.4883 -0.0325 -0.0027 0.0586  523 HIS A O   
2238 C CB  . HIS A 315 ? 0.4552 0.4203 0.4988 -0.0391 -0.0199 0.0434  523 HIS A CB  
2239 C CG  . HIS A 315 ? 0.4866 0.4446 0.5290 -0.0371 -0.0288 0.0336  523 HIS A CG  
2240 N ND1 . HIS A 315 ? 0.5094 0.4783 0.5530 -0.0354 -0.0294 0.0278  523 HIS A ND1 
2241 C CD2 . HIS A 315 ? 0.5295 0.4704 0.5691 -0.0357 -0.0378 0.0287  523 HIS A CD2 
2242 C CE1 . HIS A 315 ? 0.5235 0.4834 0.5642 -0.0328 -0.0378 0.0204  523 HIS A CE1 
2243 N NE2 . HIS A 315 ? 0.5324 0.4761 0.5708 -0.0327 -0.0433 0.0201  523 HIS A NE2 
2244 N N   . LYS A 316 ? 0.5074 0.4564 0.5415 -0.0393 -0.0110 0.0642  524 LYS A N   
2245 C CA  . LYS A 316 ? 0.5314 0.4841 0.5692 -0.0433 -0.0031 0.0773  524 LYS A CA  
2246 C C   . LYS A 316 ? 0.5312 0.5041 0.5859 -0.0512 0.0027  0.0813  524 LYS A C   
2247 O O   . LYS A 316 ? 0.5439 0.5163 0.6151 -0.0600 -0.0009 0.0804  524 LYS A O   
2248 C CB  . LYS A 316 ? 0.5586 0.4871 0.5980 -0.0481 -0.0068 0.0849  524 LYS A CB  
2249 N N   . SER A 323 ? 0.5922 0.6204 0.6263 -0.0368 0.0386  0.1141  531 SER A N   
2250 C CA  . SER A 323 ? 0.5689 0.6099 0.5980 -0.0294 0.0363  0.1005  531 SER A CA  
2251 C C   . SER A 323 ? 0.5542 0.5820 0.5858 -0.0313 0.0266  0.0885  531 SER A C   
2252 O O   . SER A 323 ? 0.5612 0.5825 0.6062 -0.0397 0.0223  0.0874  531 SER A O   
2253 C CB  . SER A 323 ? 0.5578 0.6242 0.5971 -0.0300 0.0419  0.0995  531 SER A CB  
2254 N N   . LEU A 324 ? 0.5372 0.5629 0.5561 -0.0232 0.0232  0.0795  532 LEU A N   
2255 C CA  . LEU A 324 ? 0.5109 0.5269 0.5294 -0.0234 0.0152  0.0687  532 LEU A CA  
2256 C C   . LEU A 324 ? 0.4746 0.5030 0.5004 -0.0244 0.0143  0.0603  532 LEU A C   
2257 O O   . LEU A 324 ? 0.4760 0.5207 0.5019 -0.0213 0.0188  0.0591  532 LEU A O   
2258 C CB  . LEU A 324 ? 0.5185 0.5297 0.5216 -0.0147 0.0127  0.0634  532 LEU A CB  
2259 C CG  . LEU A 324 ? 0.5436 0.5377 0.5361 -0.0105 0.0098  0.0668  532 LEU A CG  
2260 C CD1 . LEU A 324 ? 0.5665 0.5649 0.5477 -0.0020 0.0075  0.0581  532 LEU A CD1 
2261 C CD2 . LEU A 324 ? 0.5821 0.5557 0.5794 -0.0157 0.0029  0.0666  532 LEU A CD2 
2262 N N   . THR A 325 ? 0.4383 0.4579 0.4687 -0.0276 0.0078  0.0541  533 THR A N   
2263 C CA  . THR A 325 ? 0.3927 0.4197 0.4265 -0.0272 0.0057  0.0459  533 THR A CA  
2264 C C   . THR A 325 ? 0.3680 0.3850 0.3926 -0.0238 0.0003  0.0386  533 THR A C   
2265 O O   . THR A 325 ? 0.3672 0.3711 0.3865 -0.0230 -0.0034 0.0388  533 THR A O   
2266 C CB  . THR A 325 ? 0.3907 0.4207 0.4397 -0.0335 0.0034  0.0457  533 THR A CB  
2267 O OG1 . THR A 325 ? 0.3984 0.4131 0.4508 -0.0376 -0.0031 0.0453  533 THR A OG1 
2268 C CG2 . THR A 325 ? 0.3915 0.4356 0.4514 -0.0371 0.0098  0.0536  533 THR A CG2 
2269 N N   . VAL A 326 ? 0.3333 0.3565 0.3557 -0.0216 0.0002  0.0325  534 VAL A N   
2270 C CA  . VAL A 326 ? 0.3115 0.3289 0.3256 -0.0188 -0.0031 0.0268  534 VAL A CA  
2271 C C   . VAL A 326 ? 0.3000 0.3167 0.3183 -0.0204 -0.0062 0.0227  534 VAL A C   
2272 O O   . VAL A 326 ? 0.2979 0.3223 0.3204 -0.0206 -0.0044 0.0214  534 VAL A O   
2273 C CB  . VAL A 326 ? 0.3082 0.3340 0.3153 -0.0150 0.0002  0.0242  534 VAL A CB  
2274 C CG1 . VAL A 326 ? 0.3031 0.3258 0.3039 -0.0136 -0.0020 0.0193  534 VAL A CG1 
2275 C CG2 . VAL A 326 ? 0.3152 0.3437 0.3168 -0.0115 0.0031  0.0278  534 VAL A CG2 
2276 N N   . THR A 327 ? 0.2886 0.2956 0.3046 -0.0203 -0.0115 0.0203  535 THR A N   
2277 C CA  . THR A 327 ? 0.2804 0.2858 0.2981 -0.0203 -0.0152 0.0167  535 THR A CA  
2278 C C   . THR A 327 ? 0.2831 0.2859 0.2900 -0.0172 -0.0152 0.0140  535 THR A C   
2279 O O   . THR A 327 ? 0.2817 0.2803 0.2810 -0.0146 -0.0163 0.0134  535 THR A O   
2280 C CB  . THR A 327 ? 0.2869 0.2850 0.3101 -0.0219 -0.0216 0.0156  535 THR A CB  
2281 O OG1 . THR A 327 ? 0.2830 0.2863 0.3191 -0.0267 -0.0205 0.0191  535 THR A OG1 
2282 C CG2 . THR A 327 ? 0.2863 0.2830 0.3090 -0.0199 -0.0263 0.0114  535 THR A CG2 
2283 N N   . LEU A 328 ? 0.2794 0.2849 0.2858 -0.0171 -0.0138 0.0128  536 LEU A N   
2284 C CA  . LEU A 328 ? 0.2944 0.2979 0.2921 -0.0158 -0.0128 0.0119  536 LEU A CA  
2285 C C   . LEU A 328 ? 0.2985 0.2960 0.2934 -0.0143 -0.0162 0.0112  536 LEU A C   
2286 O O   . LEU A 328 ? 0.2874 0.2848 0.2875 -0.0145 -0.0176 0.0106  536 LEU A O   
2287 C CB  . LEU A 328 ? 0.3012 0.3106 0.2996 -0.0175 -0.0083 0.0115  536 LEU A CB  
2288 C CG  . LEU A 328 ? 0.3367 0.3534 0.3337 -0.0175 -0.0049 0.0113  536 LEU A CG  
2289 C CD1 . LEU A 328 ? 0.3683 0.3911 0.3684 -0.0191 -0.0022 0.0092  536 LEU A CD1 
2290 C CD2 . LEU A 328 ? 0.3653 0.3822 0.3550 -0.0161 -0.0044 0.0113  536 LEU A CD2 
2291 N N   . THR A 329 ? 0.3035 0.2968 0.2892 -0.0116 -0.0176 0.0113  537 THR A N   
2292 C CA  . THR A 329 ? 0.3098 0.2974 0.2892 -0.0092 -0.0196 0.0119  537 THR A CA  
2293 C C   . THR A 329 ? 0.3137 0.3019 0.2858 -0.0104 -0.0147 0.0150  537 THR A C   
2294 O O   . THR A 329 ? 0.3089 0.3019 0.2764 -0.0100 -0.0120 0.0156  537 THR A O   
2295 C CB  . THR A 329 ? 0.3181 0.3013 0.2917 -0.0041 -0.0256 0.0099  537 THR A CB  
2296 O OG1 . THR A 329 ? 0.3300 0.3129 0.3134 -0.0048 -0.0306 0.0069  537 THR A OG1 
2297 C CG2 . THR A 329 ? 0.3286 0.3064 0.2933 0.0000  -0.0275 0.0113  537 THR A CG2 
2298 N N   . LEU A 330 ? 0.3112 0.2944 0.2826 -0.0119 -0.0137 0.0170  538 LEU A N   
2299 C CA  . LEU A 330 ? 0.3189 0.3010 0.2856 -0.0152 -0.0089 0.0210  538 LEU A CA  
2300 C C   . LEU A 330 ? 0.3322 0.3028 0.2951 -0.0145 -0.0103 0.0239  538 LEU A C   
2301 O O   . LEU A 330 ? 0.3278 0.2944 0.2959 -0.0132 -0.0137 0.0212  538 LEU A O   
2302 C CB  . LEU A 330 ? 0.3094 0.2981 0.2844 -0.0208 -0.0051 0.0194  538 LEU A CB  
2303 C CG  . LEU A 330 ? 0.3335 0.3251 0.3078 -0.0262 -0.0001 0.0224  538 LEU A CG  
2304 C CD1 . LEU A 330 ? 0.3234 0.3250 0.2924 -0.0246 0.0027  0.0239  538 LEU A CD1 
2305 C CD2 . LEU A 330 ? 0.3243 0.3212 0.3083 -0.0310 0.0011  0.0185  538 LEU A CD2 
2306 N N   . ASN A 331 ? 0.3481 0.3140 0.3017 -0.0148 -0.0075 0.0297  539 ASN A N   
2307 C CA  . ASN A 331 ? 0.3660 0.3179 0.3133 -0.0134 -0.0089 0.0340  539 ASN A CA  
2308 C C   . ASN A 331 ? 0.3739 0.3203 0.3191 -0.0055 -0.0160 0.0309  539 ASN A C   
2309 O O   . ASN A 331 ? 0.3688 0.3055 0.3145 -0.0037 -0.0189 0.0307  539 ASN A O   
2310 C CB  . ASN A 331 ? 0.3665 0.3116 0.3209 -0.0200 -0.0071 0.0342  539 ASN A CB  
2311 C CG  . ASN A 331 ? 0.3944 0.3221 0.3407 -0.0198 -0.0073 0.0407  539 ASN A CG  
2312 O OD1 . ASN A 331 ? 0.4289 0.3530 0.3648 -0.0196 -0.0041 0.0485  539 ASN A OD1 
2313 N ND2 . ASN A 331 ? 0.3829 0.2995 0.3329 -0.0192 -0.0110 0.0379  539 ASN A ND2 
2314 N N   . ASN A 332 ? 0.3797 0.3326 0.3231 -0.0004 -0.0196 0.0276  540 ASN A N   
2315 C CA  . ASN A 332 ? 0.4015 0.3524 0.3446 0.0067  -0.0272 0.0236  540 ASN A CA  
2316 C C   . ASN A 332 ? 0.3933 0.3473 0.3501 0.0057  -0.0304 0.0183  540 ASN A C   
2317 O O   . ASN A 332 ? 0.4065 0.3587 0.3643 0.0112  -0.0362 0.0157  540 ASN A O   
2318 C CB  . ASN A 332 ? 0.4272 0.3669 0.3569 0.0133  -0.0296 0.0282  540 ASN A CB  
2319 C CG  . ASN A 332 ? 0.4711 0.4108 0.3858 0.0171  -0.0274 0.0331  540 ASN A CG  
2320 O OD1 . ASN A 332 ? 0.5031 0.4505 0.4156 0.0208  -0.0299 0.0293  540 ASN A OD1 
2321 N ND2 . ASN A 332 ? 0.5179 0.4487 0.4218 0.0164  -0.0226 0.0420  540 ASN A ND2 
2322 N N   . SER A 333 ? 0.3772 0.3377 0.3442 -0.0004 -0.0265 0.0167  541 SER A N   
2323 C CA  . SER A 333 ? 0.3648 0.3325 0.3448 -0.0012 -0.0282 0.0122  541 SER A CA  
2324 C C   . SER A 333 ? 0.3318 0.3095 0.3194 -0.0050 -0.0264 0.0105  541 SER A C   
2325 O O   . SER A 333 ? 0.3226 0.3017 0.3069 -0.0081 -0.0224 0.0123  541 SER A O   
2326 C CB  . SER A 333 ? 0.3705 0.3360 0.3542 -0.0036 -0.0253 0.0119  541 SER A CB  
2327 O OG  . SER A 333 ? 0.4377 0.3922 0.4159 0.0009  -0.0284 0.0126  541 SER A OG  
2328 N N   . THR A 334 ? 0.3090 0.2941 0.3072 -0.0048 -0.0293 0.0075  542 THR A N   
2329 C CA  . THR A 334 ? 0.2948 0.2873 0.3006 -0.0087 -0.0276 0.0072  542 THR A CA  
2330 C C   . THR A 334 ? 0.2893 0.2916 0.3065 -0.0107 -0.0249 0.0066  542 THR A C   
2331 O O   . THR A 334 ? 0.2841 0.2906 0.3076 -0.0083 -0.0271 0.0047  542 THR A O   
2332 C CB  . THR A 334 ? 0.2948 0.2873 0.3039 -0.0077 -0.0335 0.0050  542 THR A CB  
2333 O OG1 . THR A 334 ? 0.2838 0.2686 0.2802 -0.0040 -0.0360 0.0049  542 THR A OG1 
2334 C CG2 . THR A 334 ? 0.2813 0.2782 0.2984 -0.0123 -0.0320 0.0058  542 THR A CG2 
2335 N N   . GLN A 335 ? 0.2804 0.2876 0.2996 -0.0139 -0.0201 0.0082  543 GLN A N   
2336 C CA  . GLN A 335 ? 0.2707 0.2889 0.2989 -0.0149 -0.0168 0.0084  543 GLN A CA  
2337 C C   . GLN A 335 ? 0.2658 0.2881 0.2965 -0.0181 -0.0136 0.0115  543 GLN A C   
2338 O O   . GLN A 335 ? 0.2616 0.2791 0.2848 -0.0186 -0.0125 0.0124  543 GLN A O   
2339 C CB  . GLN A 335 ? 0.2700 0.2892 0.2951 -0.0131 -0.0139 0.0066  543 GLN A CB  
2340 C CG  . GLN A 335 ? 0.2513 0.2837 0.2833 -0.0121 -0.0102 0.0061  543 GLN A CG  
2341 C CD  . GLN A 335 ? 0.2560 0.2976 0.2974 -0.0094 -0.0117 0.0050  543 GLN A CD  
2342 O OE1 . GLN A 335 ? 0.2384 0.2760 0.2791 -0.0056 -0.0156 0.0018  543 GLN A OE1 
2343 N NE2 . GLN A 335 ? 0.2206 0.2757 0.2713 -0.0111 -0.0085 0.0079  543 GLN A NE2 
2344 N N   . THR A 336 ? 0.2651 0.2968 0.3063 -0.0199 -0.0122 0.0136  544 THR A N   
2345 C CA  . THR A 336 ? 0.2789 0.3140 0.3222 -0.0227 -0.0085 0.0182  544 THR A CA  
2346 C C   . THR A 336 ? 0.2782 0.3248 0.3216 -0.0207 -0.0024 0.0196  544 THR A C   
2347 O O   . THR A 336 ? 0.2808 0.3378 0.3301 -0.0187 -0.0011 0.0183  544 THR A O   
2348 C CB  . THR A 336 ? 0.2815 0.3188 0.3369 -0.0273 -0.0104 0.0213  544 THR A CB  
2349 O OG1 . THR A 336 ? 0.2909 0.3168 0.3448 -0.0280 -0.0173 0.0183  544 THR A OG1 
2350 C CG2 . THR A 336 ? 0.2961 0.3344 0.3531 -0.0305 -0.0061 0.0279  544 THR A CG2 
2351 N N   . TYR A 337 ? 0.2840 0.3298 0.3204 -0.0200 0.0006  0.0216  545 TYR A N   
2352 C CA  . TYR A 337 ? 0.2881 0.3446 0.3218 -0.0166 0.0055  0.0219  545 TYR A CA  
2353 C C   . TYR A 337 ? 0.3040 0.3650 0.3381 -0.0173 0.0098  0.0291  545 TYR A C   
2354 O O   . TYR A 337 ? 0.3032 0.3546 0.3359 -0.0200 0.0084  0.0328  545 TYR A O   
2355 C CB  . TYR A 337 ? 0.2804 0.3331 0.3044 -0.0142 0.0050  0.0174  545 TYR A CB  
2356 C CG  . TYR A 337 ? 0.2603 0.3063 0.2826 -0.0143 0.0015  0.0120  545 TYR A CG  
2357 C CD1 . TYR A 337 ? 0.2543 0.2892 0.2734 -0.0165 -0.0017 0.0118  545 TYR A CD1 
2358 C CD2 . TYR A 337 ? 0.2462 0.2960 0.2690 -0.0116 0.0014  0.0071  545 TYR A CD2 
2359 C CE1 . TYR A 337 ? 0.2366 0.2646 0.2529 -0.0167 -0.0040 0.0087  545 TYR A CE1 
2360 C CE2 . TYR A 337 ? 0.2364 0.2769 0.2571 -0.0121 -0.0018 0.0033  545 TYR A CE2 
2361 C CZ  . TYR A 337 ? 0.2642 0.2940 0.2816 -0.0150 -0.0040 0.0050  545 TYR A CZ  
2362 O OH  . TYR A 337 ? 0.2771 0.2972 0.2914 -0.0156 -0.0064 0.0030  545 TYR A OH  
2363 N N   . GLY A 338 ? 0.3157 0.3905 0.3503 -0.0139 0.0148  0.0311  546 GLY A N   
2364 C CA  . GLY A 338 ? 0.3487 0.4279 0.3807 -0.0132 0.0199  0.0392  546 GLY A CA  
2365 C C   . GLY A 338 ? 0.3671 0.4567 0.3897 -0.0057 0.0232  0.0372  546 GLY A C   
2366 O O   . GLY A 338 ? 0.3566 0.4519 0.3776 -0.0017 0.0218  0.0293  546 GLY A O   
2367 N N   . LEU A 339 ? 0.3984 0.4895 0.4143 -0.0032 0.0269  0.0440  547 LEU A N   
2368 C CA  . LEU A 339 ? 0.4244 0.5279 0.4309 0.0053  0.0298  0.0419  547 LEU A CA  
2369 C C   . LEU A 339 ? 0.4391 0.5592 0.4464 0.0090  0.0370  0.0494  547 LEU A C   
2370 O O   . LEU A 339 ? 0.4585 0.5775 0.4669 0.0062  0.0416  0.0611  547 LEU A O   
2371 C CB  . LEU A 339 ? 0.4373 0.5344 0.4322 0.0092  0.0284  0.0420  547 LEU A CB  
2372 C CG  . LEU A 339 ? 0.4640 0.5742 0.4496 0.0187  0.0287  0.0358  547 LEU A CG  
2373 C CD1 . LEU A 339 ? 0.4730 0.5881 0.4623 0.0195  0.0248  0.0235  547 LEU A CD1 
2374 C CD2 . LEU A 339 ? 0.4904 0.5957 0.4661 0.0226  0.0263  0.0347  547 LEU A CD2 
2407 O O   . HOH N .   ? 0.5663 0.6146 0.6307 -0.0660 -0.1138 0.1750  6   HOH A O   
2408 O O   . HOH N .   ? 0.5208 0.4964 0.5070 -0.0088 0.0002  0.0486  10  HOH A O   
2409 O O   . HOH N .   ? 0.4434 0.5676 0.7008 -0.0431 0.0454  0.0576  13  HOH A O   
2410 O O   . HOH N .   ? 0.4505 0.4499 0.3128 -0.0620 -0.0744 0.0789  14  HOH A O   
2411 O O   A HOH N .   ? 0.3416 0.2511 0.3489 0.0188  0.0032  -0.0344 15  HOH A O   
2412 O O   B HOH N .   ? 0.3493 0.2902 0.3635 0.0520  0.0240  0.0221  15  HOH A O   
2413 O O   . HOH N .   ? 0.4157 0.3133 0.3922 0.0072  0.0498  0.0112  16  HOH A O   
2414 O O   . HOH N .   ? 0.3420 0.4153 0.4057 0.0491  0.0254  0.0382  17  HOH A O   
2415 O O   . HOH N .   ? 0.3263 0.3477 0.3885 0.0435  0.0100  0.0317  19  HOH A O   
2416 O O   . HOH N .   ? 0.3759 0.3419 0.3989 0.0483  -0.0563 -0.0427 20  HOH A O   
2417 O O   . HOH N .   ? 0.4973 0.4806 0.4770 0.0492  -0.0459 -0.0400 21  HOH A O   
2418 O O   . HOH N .   ? 0.4012 0.3821 0.4271 0.0504  0.0188  0.0259  22  HOH A O   
2419 O O   . HOH N .   ? 0.5802 0.5077 0.5277 0.0283  -0.0006 -0.0065 23  HOH A O   
2420 O O   . HOH N .   ? 0.4402 0.5133 0.4947 0.0664  0.0172  0.0469  24  HOH A O   
2421 O O   . HOH N .   ? 0.4651 0.4452 0.4724 -0.0262 0.0332  0.0907  25  HOH A O   
2422 O O   . HOH N .   ? 0.3834 0.3889 0.2997 -0.0262 -0.0844 0.0680  26  HOH A O   
2423 O O   . HOH N .   ? 0.3995 0.4442 0.4860 0.0138  0.0361  0.0378  27  HOH A O   
2424 O O   . HOH N .   ? 0.5058 0.4550 0.5169 -0.0211 0.0306  0.0881  28  HOH A O   
2425 O O   . HOH N .   ? 0.3435 0.3066 0.3211 0.0110  0.0077  -0.0090 29  HOH A O   
2426 O O   . HOH N .   ? 0.4800 0.4529 0.4570 0.0061  -0.0402 0.0065  30  HOH A O   
2427 O O   . HOH N .   ? 0.3836 0.3706 0.4338 0.0070  -0.0170 0.0129  31  HOH A O   
2428 O O   . HOH N .   ? 0.5864 0.5077 0.5914 0.0039  0.0337  -0.0123 32  HOH A O   
2429 O O   . HOH N .   ? 0.4578 0.4535 0.4942 -0.0302 -0.0160 0.0295  33  HOH A O   
2430 O O   . HOH N .   ? 0.5334 0.5449 0.5617 0.0091  0.0297  0.0204  34  HOH A O   
2431 O O   . HOH N .   ? 0.5260 0.4671 0.4932 0.0453  -0.0410 -0.0133 35  HOH A O   
2432 O O   . HOH N .   ? 0.4135 0.4131 0.4416 0.0106  0.0024  0.0109  36  HOH A O   
2433 O O   . HOH N .   ? 0.4063 0.3996 0.4500 0.0223  0.0648  0.1077  37  HOH A O   
2434 O O   . HOH N .   ? 0.4108 0.3981 0.3516 0.0714  0.0060  -0.0105 38  HOH A O   
2435 O O   . HOH N .   ? 0.3225 0.3355 0.3925 0.0346  -0.0184 -0.0163 39  HOH A O   
2436 O O   . HOH N .   ? 0.2911 0.3363 0.3536 -0.0189 -0.0193 0.0099  40  HOH A O   
2437 O O   . HOH N .   ? 0.5464 0.4640 0.4781 0.0538  -0.0458 -0.0152 41  HOH A O   
2438 O O   . HOH N .   ? 0.4677 0.5054 0.4929 0.0305  0.0152  -0.0107 42  HOH A O   
2439 O O   . HOH N .   ? 0.4645 0.4055 0.4354 -0.0049 0.0193  0.0770  43  HOH A O   
2440 O O   . HOH N .   ? 0.5955 0.5259 0.5764 0.0171  0.0106  -0.0154 44  HOH A O   
2441 O O   . HOH N .   ? 0.6043 0.6024 0.6146 -0.0079 -0.0098 0.0459  45  HOH A O   
2442 O O   . HOH N .   ? 0.4476 0.4243 0.4722 0.0036  -0.0114 0.0442  46  HOH A O   
2443 O O   . HOH N .   ? 0.3152 0.3419 0.4053 0.0132  -0.0048 -0.0178 47  HOH A O   
2444 O O   . HOH N .   ? 0.4528 0.4439 0.4661 0.0043  0.0136  -0.0067 48  HOH A O   
2445 O O   . HOH N .   ? 0.3610 0.4226 0.4325 0.0171  0.0331  0.0115  49  HOH A O   
2446 O O   . HOH N .   ? 0.5601 0.5507 0.5185 0.0343  -0.0258 -0.0041 50  HOH A O   
2447 O O   . HOH N .   ? 0.4274 0.3656 0.5961 -0.0623 0.0231  0.0692  51  HOH A O   
2448 O O   . HOH N .   ? 0.4472 0.3659 0.4554 -0.0028 0.0481  -0.0060 52  HOH A O   
2449 O O   . HOH N .   ? 0.4342 0.3645 0.4342 0.0546  0.0365  -0.0065 53  HOH A O   
2450 O O   . HOH N .   ? 0.5749 0.4665 0.4902 0.0372  0.0196  0.0215  54  HOH A O   
2451 O O   . HOH N .   ? 0.6173 0.6328 0.5710 0.0460  0.0141  -0.0181 55  HOH A O   
2452 O O   . HOH N .   ? 0.4023 0.3478 0.4421 0.0425  -0.0712 -0.0423 56  HOH A O   
2453 O O   . HOH N .   ? 0.6494 0.5853 0.6209 -0.0041 0.0458  0.0945  57  HOH A O   
2454 O O   . HOH N .   ? 0.4863 0.4565 0.5568 0.0026  0.0618  0.1117  58  HOH A O   
2455 O O   . HOH N .   ? 0.8009 0.7824 0.8016 0.0079  0.0181  0.0111  59  HOH A O   
2456 O O   . HOH N .   ? 0.3728 0.3148 0.4351 0.0324  0.0251  -0.0108 60  HOH A O   
2457 O O   . HOH N .   ? 0.5498 0.5135 0.5717 0.0436  -0.0504 -0.0383 61  HOH A O   
2458 O O   . HOH N .   ? 0.5188 0.4502 0.5651 0.0382  -0.0834 -0.0399 62  HOH A O   
2459 O O   . HOH N .   ? 0.4020 0.3987 0.4179 0.0130  0.0086  0.0169  63  HOH A O   
2460 O O   . HOH N .   ? 0.3800 0.4120 0.4725 -0.0565 0.0404  0.1040  64  HOH A O   
2461 O O   . HOH N .   ? 0.4202 0.4967 0.5708 0.0248  -0.0083 0.0276  65  HOH A O   
2462 O O   . HOH N .   ? 0.6062 0.5286 0.5357 0.0401  -0.0092 -0.0062 66  HOH A O   
2463 O O   . HOH N .   ? 0.7330 0.7502 0.7065 0.0546  0.0147  -0.0126 67  HOH A O   
2464 O O   . HOH N .   ? 0.7528 0.6849 0.6418 0.0594  -0.0573 -0.0422 68  HOH A O   
2465 O O   . HOH N .   ? 0.6192 0.5822 0.7909 0.0894  -0.1156 -0.0972 69  HOH A O   
2466 O O   . HOH N .   ? 0.4507 0.4326 0.4019 0.0349  0.0149  0.0162  70  HOH A O   
2467 O O   . HOH N .   ? 0.7019 0.9153 1.0309 -0.0416 0.0335  0.0296  71  HOH A O   
2468 O O   . HOH N .   ? 0.5676 0.4745 0.4583 0.0503  0.0042  0.0192  72  HOH A O   
2469 O O   . HOH N .   ? 0.4620 0.4567 0.4643 -0.0088 0.0004  0.0452  73  HOH A O   
2470 O O   . HOH N .   ? 0.3645 0.3715 0.5666 -0.0573 0.0166  0.0581  74  HOH A O   
2471 O O   . HOH N .   ? 0.3620 0.4330 0.4261 0.0368  0.0261  0.0337  76  HOH A O   
2472 O O   . HOH N .   ? 0.7087 0.6012 0.6337 0.0299  0.0269  0.0222  77  HOH A O   
2473 O O   . HOH N .   ? 0.3895 0.4192 0.4574 0.0235  -0.0034 -0.0233 78  HOH A O   
2474 O O   . HOH N .   ? 0.6607 0.5999 0.6928 0.0585  0.0410  0.0406  80  HOH A O   
2475 O O   . HOH N .   ? 0.4629 0.4298 0.3820 0.0632  -0.0253 -0.0258 81  HOH A O   
2476 O O   . HOH N .   ? 0.5557 0.4931 0.4376 0.0751  -0.0226 -0.0068 82  HOH A O   
2477 O O   . HOH N .   ? 0.4312 0.4311 0.4741 0.0084  0.0142  -0.0109 83  HOH A O   
2478 O O   . HOH N .   ? 0.6019 0.5549 0.5741 -0.0037 -0.0032 0.0608  84  HOH A O   
2479 O O   . HOH N .   ? 0.4246 0.4393 0.4683 0.0471  0.0151  0.0321  85  HOH A O   
2480 O O   . HOH N .   ? 0.4098 0.4833 0.4872 0.0098  0.0991  0.0965  86  HOH A O   
2481 O O   . HOH N .   ? 0.3699 0.3844 0.4130 0.0112  0.0118  0.0145  87  HOH A O   
2482 O O   . HOH N .   ? 0.3959 0.4378 0.3985 0.0449  0.0747  0.0909  88  HOH A O   
2483 O O   . HOH N .   ? 0.6099 0.6456 0.7451 0.0106  0.0012  0.0204  89  HOH A O   
2484 O O   . HOH N .   ? 0.5162 0.4920 0.5947 0.0368  -0.0887 -0.0415 90  HOH A O   
2485 O O   . HOH N .   ? 0.5860 0.5224 0.4752 0.0580  -0.0094 0.0055  91  HOH A O   
2486 O O   . HOH N .   ? 0.4920 0.5936 0.6626 -0.0449 0.0635  0.0962  92  HOH A O   
2487 O O   . HOH N .   ? 0.5472 0.5291 0.5870 0.0111  -0.0160 0.0350  93  HOH A O   
2488 O O   . HOH N .   ? 0.6289 0.5796 0.7848 -0.0536 -0.0386 0.0298  94  HOH A O   
2489 O O   . HOH N .   ? 0.6748 0.6113 0.5934 0.0082  0.0759  0.0923  95  HOH A O   
2490 O O   . HOH N .   ? 0.7234 0.6664 0.6401 0.0577  -0.0218 -0.0063 97  HOH A O   
2491 O O   . HOH N .   ? 0.4481 0.4309 0.4938 0.0132  -0.0086 -0.0261 98  HOH A O   
2492 O O   . HOH N .   ? 0.5423 0.5028 0.5397 -0.0030 -0.0046 0.0574  99  HOH A O   
2493 O O   . HOH N .   ? 0.4262 0.4132 0.4318 0.0048  -0.0389 0.0025  100 HOH A O   
2494 O O   . HOH N .   ? 0.6414 0.6669 0.6439 0.0455  0.0064  -0.0188 101 HOH A O   
2495 O O   . HOH N .   ? 0.4991 0.5509 0.4728 0.0708  0.0405  0.0660  102 HOH A O   
2496 O O   . HOH N .   ? 0.6231 0.5680 0.5912 0.0019  0.0198  0.0013  103 HOH A O   
2497 O O   . HOH N .   ? 0.4194 0.4076 0.3910 0.0641  0.0422  0.1062  104 HOH A O   
2498 O O   . HOH N .   ? 0.3452 0.4108 0.3682 0.0525  0.0291  0.0380  105 HOH A O   
2499 O O   . HOH N .   ? 0.5869 0.6747 0.6581 0.0610  0.0295  0.0452  106 HOH A O   
2500 O O   . HOH N .   ? 0.5347 0.5524 0.5846 0.0541  0.0205  0.0366  107 HOH A O   
2501 O O   . HOH N .   ? 0.5334 0.4647 0.5666 0.0209  0.0097  -0.0267 108 HOH A O   
2502 O O   . HOH N .   ? 0.5506 0.4459 0.6969 -0.0526 0.0151  0.0643  109 HOH A O   
2503 O O   . HOH N .   ? 0.4851 0.4951 0.5637 -0.0213 0.0125  0.0172  110 HOH A O   
2504 O O   . HOH N .   ? 0.7031 0.6558 0.6254 0.0561  -0.0185 -0.0083 111 HOH A O   
2505 O O   . HOH N .   ? 0.5455 0.5933 0.5669 0.0812  0.0223  0.0599  112 HOH A O   
2506 O O   . HOH N .   ? 0.5609 0.6180 0.5613 0.0690  0.0284  0.0532  113 HOH A O   
2507 O O   . HOH N .   ? 0.5618 0.6359 0.6235 0.0704  0.0290  0.0480  114 HOH A O   
2508 O O   . HOH N .   ? 0.4043 0.4573 0.4092 0.0323  -0.0075 0.0173  115 HOH A O   
2509 O O   . HOH N .   ? 0.6353 0.5411 0.5759 -0.0009 0.0279  -0.0033 117 HOH A O   
2510 O O   . HOH N .   ? 0.7568 0.6115 0.5847 -0.0459 -0.0363 0.0618  118 HOH A O   
2511 O O   . HOH N .   ? 0.8054 0.9133 0.9142 -0.0035 0.0743  0.0445  119 HOH A O   
2512 O O   . HOH N .   ? 0.6223 0.7639 0.7410 0.0622  0.0919  0.0312  120 HOH A O   
2513 O O   . HOH N .   ? 0.6755 0.5616 0.6071 0.0356  0.0199  0.0148  121 HOH A O   
2514 O O   . HOH N .   ? 0.5099 0.5964 0.5420 0.0713  0.0041  0.0487  122 HOH A O   
2515 O O   . HOH N .   ? 0.6309 0.5449 0.6482 -0.0014 0.0468  -0.0113 123 HOH A O   
2516 O O   . HOH N .   ? 0.5906 0.5854 0.7343 -0.0176 -0.0640 -0.0030 124 HOH A O   
2517 O O   . HOH N .   ? 0.4745 0.5185 0.5235 0.0133  -0.0048 0.0389  127 HOH A O   
2518 O O   . HOH N .   ? 0.5707 0.5409 0.6882 0.0318  -0.0960 -0.0408 128 HOH A O   
2519 O O   . HOH N .   ? 0.6541 0.6478 0.6052 0.0340  -0.0123 -0.0113 130 HOH A O   
2520 O O   . HOH N .   ? 0.5415 0.5955 0.5984 0.0114  0.0300  0.0048  131 HOH A O   
2521 O O   . HOH N .   ? 0.4424 0.4206 0.4259 -0.0126 0.0050  0.0467  132 HOH A O   
2522 O O   . HOH N .   ? 0.5938 0.5695 0.6500 -0.0596 0.0188  0.1013  133 HOH A O   
2523 O O   . HOH N .   ? 0.5767 0.5643 0.5766 -0.0062 0.0130  0.0026  134 HOH A O   
2524 O O   . HOH N .   ? 0.7194 0.6252 0.6649 0.0801  0.0468  -0.0001 135 HOH A O   
2525 O O   . HOH N .   ? 0.5510 0.5297 0.5401 -0.0310 0.0349  0.1048  136 HOH A O   
2526 O O   . HOH N .   ? 0.6054 0.5932 0.6279 0.0618  0.0288  0.0321  137 HOH A O   
2527 O O   . HOH N .   ? 0.5811 0.5767 0.5918 0.0498  -0.0434 -0.0473 138 HOH A O   
2528 O O   . HOH N .   ? 0.5282 0.6460 0.7405 -0.0421 0.0557  0.0896  139 HOH A O   
2529 O O   . HOH N .   ? 0.7658 0.6465 0.7502 0.0403  0.0342  0.1339  140 HOH A O   
2530 O O   . HOH N .   ? 0.5282 0.4980 0.5806 0.0196  0.0550  0.1075  141 HOH A O   
2531 O O   . HOH N .   ? 0.5253 0.5426 0.5406 0.0351  -0.0050 -0.0186 142 HOH A O   
2532 O O   . HOH N .   ? 0.6677 0.5874 0.5475 0.0622  -0.0064 0.0120  143 HOH A O   
2533 O O   . HOH N .   ? 0.5698 0.5245 0.4637 0.0733  -0.0252 -0.0163 144 HOH A O   
2534 O O   . HOH N .   ? 0.5390 0.4562 0.7357 0.0162  -0.1296 -0.0318 145 HOH A O   
2535 O O   . HOH N .   ? 0.6260 0.5618 0.6275 -0.0066 0.0372  0.0965  147 HOH A O   
2536 O O   . HOH N .   ? 0.6807 0.7078 0.6471 0.0704  0.0431  0.0868  148 HOH A O   
2537 O O   . HOH N .   ? 0.4654 0.5482 0.5280 0.0668  0.0209  0.0472  149 HOH A O   
2538 O O   . HOH N .   ? 0.7201 0.7145 0.7333 -0.0014 -0.0266 0.0025  150 HOH A O   
2539 O O   . HOH N .   ? 0.5928 0.6202 0.5652 0.0522  0.0674  0.1002  151 HOH A O   
2540 O O   . HOH N .   ? 0.6925 0.6043 0.7656 -0.0278 -0.0554 0.0107  153 HOH A O   
2541 O O   . HOH N .   ? 0.6177 0.5122 0.6227 -0.0030 0.0698  0.0066  157 HOH A O   
2542 O O   . HOH N .   ? 0.5822 0.5929 0.7363 0.0503  -0.0512 0.0923  158 HOH A O   
2543 O O   . HOH N .   ? 0.4112 0.4586 0.4599 0.0792  0.0376  0.0494  159 HOH A O   
2544 O O   . HOH N .   ? 0.4871 0.4300 0.4482 -0.0063 0.0325  0.0746  160 HOH A O   
2545 O O   . HOH N .   ? 0.5666 0.4855 0.5801 0.0331  0.0204  -0.0230 162 HOH A O   
2546 O O   . HOH N .   ? 0.5822 0.4658 0.4854 0.0386  0.0346  0.0339  163 HOH A O   
2547 O O   . HOH N .   ? 0.6673 0.6684 0.6154 0.0566  -0.0001 -0.0359 165 HOH A O   
2548 O O   . HOH N .   ? 0.6078 0.4613 0.5152 0.0411  0.0594  0.0463  166 HOH A O   
2549 O O   . HOH N .   ? 0.5871 0.5462 0.5943 0.0091  0.0106  -0.0293 167 HOH A O   
2550 O O   . HOH N .   ? 0.7684 0.7296 0.9115 -0.0615 0.0617  0.1069  169 HOH A O   
2551 O O   . HOH N .   ? 0.6079 0.5668 0.7090 -0.0271 0.0639  0.1142  170 HOH A O   
2552 O O   . HOH N .   ? 0.6344 0.5917 0.6157 0.0050  0.0204  0.0065  171 HOH A O   
2553 O O   . HOH N .   ? 0.6169 0.5351 0.7303 -0.0441 -0.0518 0.0242  173 HOH A O   
2554 O O   . HOH N .   ? 0.6830 0.5671 0.6975 -0.0619 -0.0248 0.0795  174 HOH A O   
2555 O O   . HOH N .   ? 0.4702 0.5239 0.5072 0.0069  0.0008  0.0121  176 HOH A O   
2556 O O   . HOH N .   ? 0.3090 0.2744 0.2535 0.0284  0.0037  0.0135  178 HOH A O   
2557 O O   . HOH N .   ? 0.3596 0.3295 0.3028 0.0330  0.0080  0.0176  179 HOH A O   
2558 O O   . HOH N .   ? 0.4220 0.2971 0.3663 0.0227  -0.0247 0.0664  180 HOH A O   
2559 O O   . HOH N .   ? 0.3269 0.3713 0.3603 0.0753  0.0227  0.0563  181 HOH A O   
2560 O O   . HOH N .   ? 0.4727 0.3929 0.5198 0.0325  0.0314  0.1007  182 HOH A O   
2561 O O   . HOH N .   ? 0.4872 0.4490 0.4939 0.0737  0.0193  0.0912  183 HOH A O   
2562 O O   . HOH N .   ? 0.4783 0.4659 0.5090 0.0418  -0.0081 -0.0183 184 HOH A O   
2563 O O   . HOH N .   ? 0.4135 0.4075 0.3823 0.0272  -0.0089 -0.0150 186 HOH A O   
2564 O O   . HOH N .   ? 0.3174 0.3016 0.3040 0.0170  -0.0017 -0.0214 187 HOH A O   
2565 O O   . HOH N .   ? 0.2573 0.2375 0.2542 0.0167  -0.0079 0.0019  188 HOH A O   
2566 O O   . HOH N .   ? 0.2652 0.2441 0.2515 0.0234  -0.0041 0.0024  189 HOH A O   
2567 O O   . HOH N .   ? 0.3532 0.3455 0.3636 0.0122  0.0069  0.0166  190 HOH A O   
2568 O O   . HOH N .   ? 0.3052 0.2523 0.3406 0.0083  -0.0486 -0.0194 191 HOH A O   
2569 O O   . HOH N .   ? 0.3302 0.2773 0.3477 0.0154  -0.0446 -0.0196 192 HOH A O   
2570 O O   . HOH N .   ? 0.3663 0.3895 0.3966 -0.0101 0.0020  0.0496  193 HOH A O   
2571 O O   . HOH N .   ? 0.3163 0.3282 0.3299 -0.0097 0.0066  0.0463  194 HOH A O   
2572 O O   . HOH N .   ? 0.3980 0.3471 0.4009 -0.0042 0.0034  0.0682  195 HOH A O   
2573 O O   . HOH N .   ? 0.4637 0.4089 0.3909 -0.0065 0.0141  0.0515  196 HOH A O   
2574 O O   . HOH N .   ? 0.4562 0.4491 0.4577 0.0181  0.0147  0.0217  197 HOH A O   
2575 O O   . HOH N .   ? 0.3854 0.3881 0.4058 0.0491  0.0177  0.0291  198 HOH A O   
2576 O O   . HOH N .   ? 0.5196 0.5858 0.5239 0.0494  0.0822  0.0765  199 HOH A O   
2577 O O   . HOH N .   ? 0.5443 0.5159 0.5742 0.0757  0.0128  0.0737  200 HOH A O   
2578 O O   . HOH N .   ? 0.5232 0.4673 0.5214 0.0268  -0.0484 -0.0077 201 HOH A O   
2579 O O   . HOH N .   ? 0.4755 0.4139 0.3937 -0.0018 0.0216  0.0615  202 HOH A O   
2580 O O   . HOH N .   ? 0.5076 0.4432 0.4124 0.0014  0.0325  0.0606  203 HOH A O   
2581 O O   . HOH N .   ? 0.4837 0.4911 0.6636 -0.0680 0.0619  0.0945  204 HOH A O   
2582 O O   . HOH N .   ? 0.6551 0.6841 0.6862 0.0159  0.0891  0.1126  205 HOH A O   
2583 O O   . HOH N .   ? 0.5255 0.6163 0.5915 0.0427  0.0899  0.0649  206 HOH A O   
2584 O O   . HOH N .   ? 0.5925 0.6103 0.6532 0.0033  -0.0021 -0.0105 207 HOH A O   
2585 O O   . HOH N .   ? 0.7545 0.7231 0.7355 -0.0911 -0.1203 0.1314  208 HOH A O   
2586 O O   . HOH N .   ? 0.3654 0.3833 0.4093 0.0472  0.0184  0.0353  550 HOH A O   
2587 O O   . HOH N .   ? 0.3224 0.3126 0.3368 0.0157  0.0090  0.0045  551 HOH A O   
2588 O O   A HOH N .   ? 0.1795 0.1801 0.2128 0.0134  0.0076  -0.0058 552 HOH A O   
2589 O O   B HOH N .   ? 0.3032 0.3025 0.3343 0.0068  0.0109  -0.0096 552 HOH A O   
2590 O O   . HOH N .   ? 0.4069 0.3175 0.3165 0.0371  0.0080  0.0169  553 HOH A O   
2591 O O   . HOH N .   ? 0.3626 0.2540 0.2950 0.0341  0.0364  0.0168  554 HOH A O   
2592 O O   . HOH N .   ? 0.3970 0.3281 0.3311 0.0513  -0.0386 -0.0156 555 HOH A O   
2593 O O   . HOH N .   ? 0.2830 0.2686 0.2822 0.0118  0.0040  -0.0016 556 HOH A O   
2594 O O   . HOH N .   ? 0.2871 0.2719 0.2839 0.0191  0.0009  0.0064  557 HOH A O   
2595 O O   . HOH N .   ? 0.5530 0.5294 0.6411 0.0477  -0.0722 -0.0657 558 HOH A O   
2596 O O   . HOH N .   ? 0.4498 0.4759 0.4672 0.0113  0.0361  0.0167  559 HOH A O   
2597 O O   . HOH N .   ? 0.5486 0.5173 0.4846 0.0027  -0.0178 0.0255  560 HOH A O   
2598 O O   . HOH N .   ? 0.6354 0.5256 0.5952 0.0223  -0.0436 0.0744  561 HOH A O   
2599 O O   . HOH N .   ? 0.7611 0.5460 0.5852 -0.0998 -0.0760 0.0878  562 HOH A O   
2600 O O   . HOH N .   ? 0.7476 0.4983 0.5511 -0.0638 -0.0508 0.0603  563 HOH A O   
2601 O O   . HOH N .   ? 0.5510 0.5368 0.3523 -0.1146 -0.0522 0.0954  564 HOH A O   
2602 O O   . HOH N .   ? 0.5250 0.6158 0.5823 0.0382  0.0020  0.0309  565 HOH A O   
2603 O O   . HOH N .   ? 0.5731 0.5335 0.5594 0.0142  0.0223  0.0130  566 HOH A O   
2604 O O   . HOH N .   ? 0.5820 0.5252 0.5387 -0.0034 0.0075  0.0687  567 HOH A O   
2605 O O   . HOH N .   ? 0.5759 0.6622 0.5987 0.0426  0.0967  0.0766  568 HOH A O   
2606 O O   . HOH N .   ? 0.6627 0.6078 0.6043 0.0353  -0.0143 -0.0168 569 HOH A O   
2607 O O   . HOH N .   ? 0.6618 0.6701 0.7619 -0.0321 0.0137  0.0282  570 HOH A O   
2608 O O   . HOH N .   ? 0.6982 0.6740 0.6905 0.0231  -0.0084 -0.0394 571 HOH A O   
2609 O O   . HOH N .   ? 0.6198 0.5722 0.6473 0.0629  -0.0858 -0.0583 572 HOH A O   
2610 O O   . HOH N .   ? 0.6278 0.5906 0.5810 0.0199  -0.0483 0.0067  573 HOH A O   
2611 O O   . HOH N .   ? 0.6247 0.5998 0.5473 0.0754  -0.0363 -0.0435 574 HOH A O   
2612 O O   . HOH N .   ? 0.7730 0.6622 0.8400 0.0072  0.0318  0.1029  575 HOH A O   
2613 O O   . HOH N .   ? 0.7064 0.6635 0.6260 0.0494  0.0018  0.0133  576 HOH A O   
2614 O O   . HOH N .   ? 0.4572 0.4942 0.6071 -0.0370 0.0785  0.1012  577 HOH A O   
2615 O O   . HOH N .   ? 0.5866 0.6951 0.6983 -0.0165 0.0904  0.0743  578 HOH A O   
2616 O O   . HOH N .   ? 0.6968 0.5536 0.7059 0.0843  0.0010  0.1383  579 HOH A O   
2617 O O   . HOH N .   ? 0.7118 0.6751 0.7038 0.0163  0.0011  -0.0286 580 HOH A O   
2618 O O   . HOH N .   ? 0.5547 0.5368 0.7348 0.0191  -0.1061 -0.0084 581 HOH A O   
2619 O O   . HOH N .   ? 0.5015 0.4964 0.7380 0.0129  -0.0782 0.0083  582 HOH A O   
2620 O O   . HOH N .   ? 0.5265 0.5481 0.5836 0.0432  0.0038  -0.0016 583 HOH A O   
2621 O O   . HOH N .   ? 0.6387 0.6241 0.7274 0.0569  -0.0667 -0.0737 584 HOH A O   
2622 O O   . HOH N .   ? 0.6445 0.6373 0.7481 -0.0425 0.0155  0.0442  585 HOH A O   
2623 O O   . HOH N .   ? 0.7420 0.7564 0.7448 0.0333  0.0288  0.0179  586 HOH A O   
2624 O O   . HOH N .   ? 0.7776 0.7646 0.6414 0.1121  0.0060  0.0076  587 HOH A O   
2625 O O   A HOH N .   ? 0.5158 0.4985 0.4458 0.0735  -0.0337 -0.0454 588 HOH A O   
2626 O O   B HOH N .   ? 0.5158 0.4985 0.4458 0.0735  -0.0337 -0.0454 588 HOH A O   
2627 O O   . HOH N .   ? 0.5892 0.5378 0.5247 0.0330  -0.0535 0.0113  589 HOH A O   
2628 O O   . HOH N .   ? 0.7218 0.6561 0.6544 0.0401  -0.0561 0.0145  590 HOH A O   
2629 O O   . HOH N .   ? 0.5830 0.5976 0.6170 0.0944  0.0442  0.0587  591 HOH A O   
2630 O O   . HOH N .   ? 0.5279 0.5806 0.6972 0.0356  0.0116  0.0494  592 HOH A O   
2631 O O   . HOH N .   ? 0.5276 0.5619 0.6054 -0.0011 0.0277  0.0230  593 HOH A O   
2632 O O   . HOH N .   ? 0.4666 0.4996 0.5045 0.0301  0.0412  0.0340  594 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   209 ?   ?   ?   A . n 
A 1 2   GLY 2   210 ?   ?   ?   A . n 
A 1 3   SER 3   211 ?   ?   ?   A . n 
A 1 4   SER 4   212 ?   ?   ?   A . n 
A 1 5   HIS 5   213 ?   ?   ?   A . n 
A 1 6   HIS 6   214 ?   ?   ?   A . n 
A 1 7   HIS 7   215 ?   ?   ?   A . n 
A 1 8   HIS 8   216 ?   ?   ?   A . n 
A 1 9   HIS 9   217 ?   ?   ?   A . n 
A 1 10  HIS 10  218 ?   ?   ?   A . n 
A 1 11  SER 11  219 ?   ?   ?   A . n 
A 1 12  SER 12  220 ?   ?   ?   A . n 
A 1 13  GLY 13  221 ?   ?   ?   A . n 
A 1 14  LEU 14  222 ?   ?   ?   A . n 
A 1 15  VAL 15  223 ?   ?   ?   A . n 
A 1 16  PRO 16  224 ?   ?   ?   A . n 
A 1 17  ARG 17  225 ?   ?   ?   A . n 
A 1 18  GLY 18  226 ?   ?   ?   A . n 
A 1 19  SER 19  227 ?   ?   ?   A . n 
A 1 20  ASP 20  228 ?   ?   ?   A . n 
A 1 21  LEU 21  229 ?   ?   ?   A . n 
A 1 22  GLN 22  230 ?   ?   ?   A . n 
A 1 23  GLU 23  231 ?   ?   ?   A . n 
A 1 24  ASP 24  232 ?   ?   ?   A . n 
A 1 25  GLU 25  233 ?   ?   ?   A . n 
A 1 26  ASP 26  234 ?   ?   ?   A . n 
A 1 27  GLY 27  235 ?   ?   ?   A . n 
A 1 28  VAL 28  236 ?   ?   ?   A . n 
A 1 29  TYR 29  237 ?   ?   ?   A . n 
A 1 30  PHE 30  238 ?   ?   ?   A . n 
A 1 31  SER 31  239 ?   ?   ?   A . n 
A 1 32  SER 32  240 ?   ?   ?   A . n 
A 1 33  TYR 33  241 ?   ?   ?   A . n 
A 1 34  GLY 34  242 ?   ?   ?   A . n 
A 1 35  HIS 35  243 243 HIS HIS A . n 
A 1 36  TYR 36  244 244 TYR TYR A . n 
A 1 37  GLY 37  245 245 GLY GLY A . n 
A 1 38  ILE 38  246 246 ILE ILE A . n 
A 1 39  HIS 39  247 247 HIS HIS A . n 
A 1 40  GLU 40  248 248 GLU GLU A . n 
A 1 41  GLU 41  249 249 GLU GLU A . n 
A 1 42  MET 42  250 250 MET MET A . n 
A 1 43  LEU 43  251 251 LEU LEU A . n 
A 1 44  LYS 44  252 252 LYS LYS A . n 
A 1 45  ASP 45  253 253 ASP ASP A . n 
A 1 46  LYS 46  254 254 LYS LYS A . n 
A 1 47  ILE 47  255 255 ILE ILE A . n 
A 1 48  ARG 48  256 256 ARG ARG A . n 
A 1 49  THR 49  257 257 THR THR A . n 
A 1 50  GLU 50  258 258 GLU GLU A . n 
A 1 51  SER 51  259 259 SER SER A . n 
A 1 52  TYR 52  260 260 TYR TYR A . n 
A 1 53  ARG 53  261 261 ARG ARG A . n 
A 1 54  ASP 54  262 262 ASP ASP A . n 
A 1 55  PHE 55  263 263 PHE PHE A . n 
A 1 56  ILE 56  264 264 ILE ILE A . n 
A 1 57  TYR 57  265 265 TYR TYR A . n 
A 1 58  GLN 58  266 266 GLN GLN A . n 
A 1 59  ASN 59  267 267 ASN ASN A . n 
A 1 60  PRO 60  268 268 PRO PRO A . n 
A 1 61  HIS 61  269 269 HIS HIS A . n 
A 1 62  ILE 62  270 270 ILE ILE A . n 
A 1 63  PHE 63  271 271 PHE PHE A . n 
A 1 64  LYS 64  272 272 LYS LYS A . n 
A 1 65  ASP 65  273 273 ASP ASP A . n 
A 1 66  LYS 66  274 274 LYS LYS A . n 
A 1 67  VAL 67  275 275 VAL VAL A . n 
A 1 68  VAL 68  276 276 VAL VAL A . n 
A 1 69  LEU 69  277 277 LEU LEU A . n 
A 1 70  ASP 70  278 278 ASP ASP A . n 
A 1 71  VAL 71  279 279 VAL VAL A . n 
A 1 72  GLY 72  280 280 GLY GLY A . n 
A 1 73  CYS 73  281 281 CYS CYS A . n 
A 1 74  GLY 74  282 282 GLY GLY A . n 
A 1 75  THR 75  283 283 THR THR A . n 
A 1 76  GLY 76  284 284 GLY GLY A . n 
A 1 77  ILE 77  285 285 ILE ILE A . n 
A 1 78  LEU 78  286 286 LEU LEU A . n 
A 1 79  SER 79  287 287 SER SER A . n 
A 1 80  MET 80  288 288 MET MET A . n 
A 1 81  PHE 81  289 289 PHE PHE A . n 
A 1 82  ALA 82  290 290 ALA ALA A . n 
A 1 83  ALA 83  291 291 ALA ALA A . n 
A 1 84  LYS 84  292 292 LYS LYS A . n 
A 1 85  ALA 85  293 293 ALA ALA A . n 
A 1 86  GLY 86  294 294 GLY GLY A . n 
A 1 87  ALA 87  295 295 ALA ALA A . n 
A 1 88  LYS 88  296 296 LYS LYS A . n 
A 1 89  LYS 89  297 297 LYS LYS A . n 
A 1 90  VAL 90  298 298 VAL VAL A . n 
A 1 91  LEU 91  299 299 LEU LEU A . n 
A 1 92  GLY 92  300 300 GLY GLY A . n 
A 1 93  VAL 93  301 301 VAL VAL A . n 
A 1 94  ASP 94  302 302 ASP ASP A . n 
A 1 95  GLN 95  303 303 GLN GLN A . n 
A 1 96  SER 96  304 304 SER SER A . n 
A 1 97  GLU 97  305 305 GLU GLU A . n 
A 1 98  ILE 98  306 306 ILE ILE A . n 
A 1 99  LEU 99  307 307 LEU LEU A . n 
A 1 100 TYR 100 308 308 TYR TYR A . n 
A 1 101 GLN 101 309 309 GLN GLN A . n 
A 1 102 ALA 102 310 310 ALA ALA A . n 
A 1 103 MET 103 311 311 MET MET A . n 
A 1 104 ASP 104 312 312 ASP ASP A . n 
A 1 105 ILE 105 313 313 ILE ILE A . n 
A 1 106 ILE 106 314 314 ILE ILE A . n 
A 1 107 ARG 107 315 315 ARG ARG A . n 
A 1 108 LEU 108 316 316 LEU LEU A . n 
A 1 109 ASN 109 317 317 ASN ASN A . n 
A 1 110 LYS 110 318 318 LYS LYS A . n 
A 1 111 LEU 111 319 319 LEU LEU A . n 
A 1 112 GLU 112 320 320 GLU GLU A . n 
A 1 113 ASP 113 321 321 ASP ASP A . n 
A 1 114 THR 114 322 322 THR THR A . n 
A 1 115 ILE 115 323 323 ILE ILE A . n 
A 1 116 THR 116 324 324 THR THR A . n 
A 1 117 LEU 117 325 325 LEU LEU A . n 
A 1 118 ILE 118 326 326 ILE ILE A . n 
A 1 119 LYS 119 327 327 LYS LYS A . n 
A 1 120 GLY 120 328 328 GLY GLY A . n 
A 1 121 LYS 121 329 329 LYS LYS A . n 
A 1 122 ILE 122 330 330 ILE ILE A . n 
A 1 123 GLU 123 331 331 GLU GLU A . n 
A 1 124 GLU 124 332 332 GLU GLU A . n 
A 1 125 VAL 125 333 333 VAL VAL A . n 
A 1 126 HIS 126 334 334 HIS HIS A . n 
A 1 127 LEU 127 335 335 LEU LEU A . n 
A 1 128 PRO 128 336 336 PRO PRO A . n 
A 1 129 VAL 129 337 337 VAL VAL A . n 
A 1 130 GLU 130 338 338 GLU GLU A . n 
A 1 131 LYS 131 339 339 LYS LYS A . n 
A 1 132 VAL 132 340 340 VAL VAL A . n 
A 1 133 ASP 133 341 341 ASP ASP A . n 
A 1 134 VAL 134 342 342 VAL VAL A . n 
A 1 135 ILE 135 343 343 ILE ILE A . n 
A 1 136 ILE 136 344 344 ILE ILE A . n 
A 1 137 SER 137 345 345 SER SER A . n 
A 1 138 GLU 138 346 346 GLU GLU A . n 
A 1 139 TRP 139 347 347 TRP TRP A . n 
A 1 140 MET 140 348 348 MET MET A . n 
A 1 141 GLY 141 349 349 GLY GLY A . n 
A 1 142 TYR 142 350 350 TYR TYR A . n 
A 1 143 PHE 143 351 351 PHE PHE A . n 
A 1 144 LEU 144 352 352 LEU LEU A . n 
A 1 145 LEU 145 353 353 LEU LEU A . n 
A 1 146 PHE 146 354 354 PHE PHE A . n 
A 1 147 GLU 147 355 355 GLU GLU A . n 
A 1 148 SER 148 356 356 SER SER A . n 
A 1 149 MET 149 357 357 MET MET A . n 
A 1 150 LEU 150 358 358 LEU LEU A . n 
A 1 151 ASP 151 359 359 ASP ASP A . n 
A 1 152 SER 152 360 360 SER SER A . n 
A 1 153 VAL 153 361 361 VAL VAL A . n 
A 1 154 LEU 154 362 362 LEU LEU A . n 
A 1 155 TYR 155 363 363 TYR TYR A . n 
A 1 156 ALA 156 364 364 ALA ALA A . n 
A 1 157 LYS 157 365 365 LYS LYS A . n 
A 1 158 ASN 158 366 366 ASN ASN A . n 
A 1 159 LYS 159 367 367 LYS LYS A . n 
A 1 160 TYR 160 368 368 TYR TYR A . n 
A 1 161 LEU 161 369 369 LEU LEU A . n 
A 1 162 ALA 162 370 370 ALA ALA A . n 
A 1 163 LYS 163 371 371 LYS LYS A . n 
A 1 164 GLY 164 372 372 GLY GLY A . n 
A 1 165 GLY 165 373 373 GLY GLY A . n 
A 1 166 SER 166 374 374 SER SER A . n 
A 1 167 VAL 167 375 375 VAL VAL A . n 
A 1 168 TYR 168 376 376 TYR TYR A . n 
A 1 169 PRO 169 377 377 PRO PRO A . n 
A 1 170 ASP 170 378 378 ASP ASP A . n 
A 1 171 ILE 171 379 379 ILE ILE A . n 
A 1 172 CYS 172 380 380 CYS CYS A . n 
A 1 173 THR 173 381 381 THR THR A . n 
A 1 174 ILE 174 382 382 ILE ILE A . n 
A 1 175 SER 175 383 383 SER SER A . n 
A 1 176 LEU 176 384 384 LEU LEU A . n 
A 1 177 VAL 177 385 385 VAL VAL A . n 
A 1 178 ALA 178 386 386 ALA ALA A . n 
A 1 179 VAL 179 387 387 VAL VAL A . n 
A 1 180 SER 180 388 388 SER SER A . n 
A 1 181 ASP 181 389 389 ASP ASP A . n 
A 1 182 VAL 182 390 390 VAL VAL A . n 
A 1 183 ASN 183 391 391 ASN ASN A . n 
A 1 184 LYS 184 392 392 LYS LYS A . n 
A 1 185 HIS 185 393 393 HIS HIS A . n 
A 1 186 ALA 186 394 394 ALA ALA A . n 
A 1 187 ASP 187 395 395 ASP ASP A . n 
A 1 188 ARG 188 396 396 ARG ARG A . n 
A 1 189 ILE 189 397 397 ILE ILE A . n 
A 1 190 ALA 190 398 398 ALA ALA A . n 
A 1 191 PHE 191 399 399 PHE PHE A . n 
A 1 192 TRP 192 400 400 TRP TRP A . n 
A 1 193 ASP 193 401 401 ASP ASP A . n 
A 1 194 ASP 194 402 402 ASP ASP A . n 
A 1 195 VAL 195 403 403 VAL VAL A . n 
A 1 196 TYR 196 404 404 TYR TYR A . n 
A 1 197 GLY 197 405 405 GLY GLY A . n 
A 1 198 PHE 198 406 406 PHE PHE A . n 
A 1 199 LYS 199 407 407 LYS LYS A . n 
A 1 200 MET 200 408 408 MET MET A . n 
A 1 201 SER 201 409 409 SER SER A . n 
A 1 202 CYS 202 410 410 CYS CYS A . n 
A 1 203 MET 203 411 411 MET MET A . n 
A 1 204 LYS 204 412 412 LYS LYS A . n 
A 1 205 LYS 205 413 413 LYS LYS A . n 
A 1 206 ALA 206 414 414 ALA ALA A . n 
A 1 207 VAL 207 415 415 VAL VAL A . n 
A 1 208 ILE 208 416 416 ILE ILE A . n 
A 1 209 PRO 209 417 417 PRO PRO A . n 
A 1 210 GLU 210 418 418 GLU GLU A . n 
A 1 211 ALA 211 419 419 ALA ALA A . n 
A 1 212 VAL 212 420 420 VAL VAL A . n 
A 1 213 VAL 213 421 421 VAL VAL A . n 
A 1 214 GLU 214 422 422 GLU GLU A . n 
A 1 215 VAL 215 423 423 VAL VAL A . n 
A 1 216 LEU 216 424 424 LEU LEU A . n 
A 1 217 ASP 217 425 425 ASP ASP A . n 
A 1 218 PRO 218 426 426 PRO PRO A . n 
A 1 219 LYS 219 427 427 LYS LYS A . n 
A 1 220 THR 220 428 428 THR THR A . n 
A 1 221 LEU 221 429 429 LEU LEU A . n 
A 1 222 ILE 222 430 430 ILE ILE A . n 
A 1 223 SER 223 431 431 SER SER A . n 
A 1 224 GLU 224 432 432 GLU GLU A . n 
A 1 225 PRO 225 433 433 PRO PRO A . n 
A 1 226 CYS 226 434 434 CYS CYS A . n 
A 1 227 GLY 227 435 435 GLY GLY A . n 
A 1 228 ILE 228 436 436 ILE ILE A . n 
A 1 229 LYS 229 437 437 LYS LYS A . n 
A 1 230 HIS 230 438 438 HIS HIS A . n 
A 1 231 ILE 231 439 439 ILE ILE A . n 
A 1 232 ASP 232 440 440 ASP ASP A . n 
A 1 233 CYS 233 441 441 CYS CYS A . n 
A 1 234 HIS 234 442 442 HIS HIS A . n 
A 1 235 THR 235 443 443 THR THR A . n 
A 1 236 THR 236 444 444 THR THR A . n 
A 1 237 SER 237 445 445 SER SER A . n 
A 1 238 ILE 238 446 446 ILE ILE A . n 
A 1 239 SER 239 447 447 SER SER A . n 
A 1 240 ASP 240 448 448 ASP ASP A . n 
A 1 241 LEU 241 449 449 LEU LEU A . n 
A 1 242 GLU 242 450 450 GLU GLU A . n 
A 1 243 PHE 243 451 451 PHE PHE A . n 
A 1 244 SER 244 452 452 SER SER A . n 
A 1 245 SER 245 453 453 SER SER A . n 
A 1 246 ASP 246 454 454 ASP ASP A . n 
A 1 247 PHE 247 455 455 PHE PHE A . n 
A 1 248 THR 248 456 456 THR THR A . n 
A 1 249 LEU 249 457 457 LEU LEU A . n 
A 1 250 LYS 250 458 458 LYS LYS A . n 
A 1 251 ILE 251 459 459 ILE ILE A . n 
A 1 252 THR 252 460 460 THR THR A . n 
A 1 253 ARG 253 461 461 ARG ARG A . n 
A 1 254 THR 254 462 462 THR THR A . n 
A 1 255 SER 255 463 463 SER SER A . n 
A 1 256 MET 256 464 464 MET MET A . n 
A 1 257 CYS 257 465 465 CYS CYS A . n 
A 1 258 THR 258 466 466 THR THR A . n 
A 1 259 ALA 259 467 467 ALA ALA A . n 
A 1 260 ILE 260 468 468 ILE ILE A . n 
A 1 261 ALA 261 469 469 ALA ALA A . n 
A 1 262 GLY 262 470 470 GLY GLY A . n 
A 1 263 TYR 263 471 471 TYR TYR A . n 
A 1 264 PHE 264 472 472 PHE PHE A . n 
A 1 265 ASP 265 473 473 ASP ASP A . n 
A 1 266 ILE 266 474 474 ILE ILE A . n 
A 1 267 TYR 267 475 475 TYR TYR A . n 
A 1 268 PHE 268 476 476 PHE PHE A . n 
A 1 269 GLU 269 477 477 GLU GLU A . n 
A 1 270 LYS 270 478 478 LYS LYS A . n 
A 1 271 ASN 271 479 479 ASN ASN A . n 
A 1 272 CYS 272 480 480 CYS CYS A . n 
A 1 273 HIS 273 481 481 HIS HIS A . n 
A 1 274 ASN 274 482 482 ASN ASN A . n 
A 1 275 ARG 275 483 483 ARG ARG A . n 
A 1 276 VAL 276 484 484 VAL VAL A . n 
A 1 277 VAL 277 485 485 VAL VAL A . n 
A 1 278 PHE 278 486 486 PHE PHE A . n 
A 1 279 SER 279 487 487 SER SER A . n 
A 1 280 THR 280 488 488 THR THR A . n 
A 1 281 GLY 281 489 489 GLY GLY A . n 
A 1 282 PRO 282 490 490 PRO PRO A . n 
A 1 283 GLN 283 491 491 GLN GLN A . n 
A 1 284 SER 284 492 492 SER SER A . n 
A 1 285 THR 285 493 493 THR THR A . n 
A 1 286 LYS 286 494 494 LYS LYS A . n 
A 1 287 THR 287 495 495 THR THR A . n 
A 1 288 HIS 288 496 496 HIS HIS A . n 
A 1 289 TRP 289 497 497 TRP TRP A . n 
A 1 290 LYS 290 498 498 LYS LYS A . n 
A 1 291 GLN 291 499 499 GLN GLN A . n 
A 1 292 THR 292 500 500 THR THR A . n 
A 1 293 VAL 293 501 501 VAL VAL A . n 
A 1 294 PHE 294 502 502 PHE PHE A . n 
A 1 295 LEU 295 503 503 LEU LEU A . n 
A 1 296 LEU 296 504 504 LEU LEU A . n 
A 1 297 GLU 297 505 505 GLU GLU A . n 
A 1 298 LYS 298 506 506 LYS LYS A . n 
A 1 299 PRO 299 507 507 PRO PRO A . n 
A 1 300 PHE 300 508 508 PHE PHE A . n 
A 1 301 SER 301 509 509 SER SER A . n 
A 1 302 VAL 302 510 510 VAL VAL A . n 
A 1 303 LYS 303 511 511 LYS LYS A . n 
A 1 304 ALA 304 512 512 ALA ALA A . n 
A 1 305 GLY 305 513 513 GLY GLY A . n 
A 1 306 GLU 306 514 514 GLU GLU A . n 
A 1 307 ALA 307 515 515 ALA ALA A . n 
A 1 308 LEU 308 516 516 LEU LEU A . n 
A 1 309 LYS 309 517 517 LYS LYS A . n 
A 1 310 GLY 310 518 518 GLY GLY A . n 
A 1 311 LYS 311 519 519 LYS LYS A . n 
A 1 312 VAL 312 520 520 VAL VAL A . n 
A 1 313 THR 313 521 521 THR THR A . n 
A 1 314 VAL 314 522 522 VAL VAL A . n 
A 1 315 HIS 315 523 523 HIS HIS A . n 
A 1 316 LYS 316 524 524 LYS LYS A . n 
A 1 317 ASN 317 525 ?   ?   ?   A . n 
A 1 318 LYS 318 526 ?   ?   ?   A . n 
A 1 319 LYS 319 527 ?   ?   ?   A . n 
A 1 320 ASP 320 528 ?   ?   ?   A . n 
A 1 321 PRO 321 529 ?   ?   ?   A . n 
A 1 322 ARG 322 530 ?   ?   ?   A . n 
A 1 323 SER 323 531 531 SER SER A . n 
A 1 324 LEU 324 532 532 LEU LEU A . n 
A 1 325 THR 325 533 533 THR THR A . n 
A 1 326 VAL 326 534 534 VAL VAL A . n 
A 1 327 THR 327 535 535 THR THR A . n 
A 1 328 LEU 328 536 536 LEU LEU A . n 
A 1 329 THR 329 537 537 THR THR A . n 
A 1 330 LEU 330 538 538 LEU LEU A . n 
A 1 331 ASN 331 539 539 ASN ASN A . n 
A 1 332 ASN 332 540 540 ASN ASN A . n 
A 1 333 SER 333 541 541 SER SER A . n 
A 1 334 THR 334 542 542 THR THR A . n 
A 1 335 GLN 335 543 543 GLN GLN A . n 
A 1 336 THR 336 544 544 THR THR A . n 
A 1 337 TYR 337 545 545 TYR TYR A . n 
A 1 338 GLY 338 546 546 GLY GLY A . n 
A 1 339 LEU 339 547 547 LEU LEU A . n 
A 1 340 GLN 340 548 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3690  ? 
1 MORE         -45   ? 
1 'SSA (A^2)'  25210 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-08-31 
2 'Structure model' 1 1 2013-07-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined -5.8556  12.0996 -3.8731 0.1414 0.0900 0.2269 0.0760  -0.0199 0.0769  1.5507 3.8413 11.9432 
3.2745  -3.7164 -7.2377 -0.0409 -0.1931 -0.1542 -0.0070 -0.3129 -0.5362 0.3613  0.1300  0.3538  
'X-RAY DIFFRACTION' 2  ? refined -17.1681 23.6402 2.5944  0.1127 0.1384 0.1483 0.0373  0.0078  0.0269  0.5825 1.0477 1.1270  
-0.3720 -0.3571 -0.1512 0.0334  0.0957  0.0525  -0.0236 -0.0233 -0.0091 0.0300  -0.1015 -0.0100 
'X-RAY DIFFRACTION' 3  ? refined -6.4118  30.2660 -4.8683 0.0966 0.0951 0.2026 0.0046  0.0516  0.0890  1.1349 1.0556 1.9990  
0.1513  0.4248  0.7290  0.0299  0.1815  0.1750  -0.1401 -0.0416 -0.2084 -0.2149 0.1530  0.0117  
'X-RAY DIFFRACTION' 4  ? refined -5.8974  25.1563 11.3920 0.1294 0.1166 0.1817 0.0056  -0.0155 -0.0241 0.7247 2.3688 0.3990  
-1.1110 0.3530  -0.7901 -0.0171 -0.0188 0.0915  0.1052  -0.0443 -0.1427 -0.0861 0.0938  0.0614  
'X-RAY DIFFRACTION' 5  ? refined 7.0877   -8.4137 14.7124 0.1783 0.1235 0.1038 0.0289  -0.0038 0.0072  1.4808 0.9301 0.4431  
-0.8606 -0.5045 0.6727  -0.0173 0.0327  -0.0812 0.0792  0.0252  0.0581  0.1006  0.0165  -0.0078 
'X-RAY DIFFRACTION' 6  ? refined -3.0130  0.9207  18.2255 0.1271 0.0956 0.1319 -0.0029 -0.0023 0.0018  1.0655 1.3349 0.8388  
-0.8622 0.6796  0.1143  0.0351  -0.0061 -0.0273 -0.0308 -0.0137 0.0926  0.0644  -0.0174 -0.0214 
'X-RAY DIFFRACTION' 7  ? refined -4.4378  10.6707 24.7069 0.0773 0.1106 0.1503 0.0246  -0.0030 -0.0190 0.6020 3.7098 0.8206  
-0.2728 0.4162  -0.7315 -0.1293 -0.2294 0.0859  0.1230  0.0055  -0.0751 -0.0492 -0.1209 0.1238  
'X-RAY DIFFRACTION' 8  ? refined -14.6711 12.2243 14.6784 0.1490 0.1495 0.1510 0.0189  0.0093  0.0038  0.7779 1.4566 0.1692  
-1.1329 0.4670  -0.6484 -0.0476 -0.0841 -0.0395 0.1127  0.0751  0.0677  0.0098  -0.0619 -0.0275 
'X-RAY DIFFRACTION' 9  ? refined -1.9063  -0.5274 22.1766 0.1356 0.1133 0.1324 -0.0124 0.0208  0.0355  1.0590 1.2791 0.2727  
-0.7388 0.4967  -0.0796 0.0516  0.0098  -0.1056 0.0568  -0.0565 0.0523  0.0098  0.0940  0.0049  
'X-RAY DIFFRACTION' 10 ? refined 6.6695   6.8105  23.2092 0.1229 0.1368 0.1398 -0.0198 -0.0102 0.0169  1.6415 1.0050 1.8020  
-0.8364 0.4379  0.2191  -0.0277 0.1018  0.1018  0.0721  -0.0006 -0.1973 -0.0875 0.0341  0.0283  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 243 ? ? A 253 ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 254 ? ? A 294 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 295 ? ? A 337 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 338 ? ? A 379 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 380 ? ? A 412 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 413 ? ? A 438 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 439 ? ? A 465 ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 466 ? ? A 494 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 495 ? ? A 519 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 520 ? ? A 547 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP   phasing          .        ? 1 
REFMAC   refinement       5.5.0109 ? 2 
Coot     'model building' 0.6      ? 3 
HKL-2000 'data reduction' .        ? 4 
HKL-2000 'data scaling'   .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 352 ? ? 67.70   -51.58  
2 1 ASP A 389 ? ? -153.37 77.21   
3 1 GLU A 477 ? A -124.12 -55.08  
4 1 GLU A 477 ? B -131.13 -42.13  
5 1 LYS A 498 ? ? 47.94   -139.92 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 243 ? CG  ? A HIS 35  CG  
2  1 Y 1 A HIS 243 ? ND1 ? A HIS 35  ND1 
3  1 Y 1 A HIS 243 ? CD2 ? A HIS 35  CD2 
4  1 Y 1 A HIS 243 ? CE1 ? A HIS 35  CE1 
5  1 Y 1 A HIS 243 ? NE2 ? A HIS 35  NE2 
6  1 Y 1 A ILE 246 ? CD1 ? A ILE 38  CD1 
7  1 Y 1 A GLU 305 ? CD  ? A GLU 97  CD  
8  1 Y 1 A GLU 305 ? OE1 ? A GLU 97  OE1 
9  1 Y 1 A GLU 305 ? OE2 ? A GLU 97  OE2 
10 1 Y 1 A ARG 315 ? CZ  ? A ARG 107 CZ  
11 1 Y 1 A ARG 315 ? NH1 ? A ARG 107 NH1 
12 1 Y 1 A ARG 315 ? NH2 ? A ARG 107 NH2 
13 1 Y 1 A LYS 329 ? CE  ? A LYS 121 CE  
14 1 Y 1 A LYS 329 ? NZ  ? A LYS 121 NZ  
15 1 Y 1 A GLU 355 ? CG  ? A GLU 147 CG  
16 1 Y 1 A GLU 355 ? CD  ? A GLU 147 CD  
17 1 Y 1 A GLU 355 ? OE1 ? A GLU 147 OE1 
18 1 Y 1 A GLU 355 ? OE2 ? A GLU 147 OE2 
19 1 Y 1 A LYS 367 ? CE  ? A LYS 159 CE  
20 1 Y 1 A LYS 367 ? NZ  ? A LYS 159 NZ  
21 1 Y 1 A LYS 371 ? CD  ? A LYS 163 CD  
22 1 Y 1 A LYS 371 ? CE  ? A LYS 163 CE  
23 1 Y 1 A LYS 371 ? NZ  ? A LYS 163 NZ  
24 1 Y 1 A LYS 427 ? CE  ? A LYS 219 CE  
25 1 Y 1 A LYS 427 ? NZ  ? A LYS 219 NZ  
26 1 Y 1 A ILE 446 ? CD1 ? A ILE 238 CD1 
27 1 Y 1 A LYS 458 ? NZ  ? A LYS 250 NZ  
28 1 Y 1 A LYS 524 ? CG  ? A LYS 316 CG  
29 1 Y 1 A LYS 524 ? CD  ? A LYS 316 CD  
30 1 Y 1 A LYS 524 ? CE  ? A LYS 316 CE  
31 1 Y 1 A LYS 524 ? NZ  ? A LYS 316 NZ  
32 1 Y 1 A SER 531 ? OG  ? A SER 323 OG  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 209 ? A MET 1   
2  1 Y 1 A GLY 210 ? A GLY 2   
3  1 Y 1 A SER 211 ? A SER 3   
4  1 Y 1 A SER 212 ? A SER 4   
5  1 Y 1 A HIS 213 ? A HIS 5   
6  1 Y 1 A HIS 214 ? A HIS 6   
7  1 Y 1 A HIS 215 ? A HIS 7   
8  1 Y 1 A HIS 216 ? A HIS 8   
9  1 Y 1 A HIS 217 ? A HIS 9   
10 1 Y 1 A HIS 218 ? A HIS 10  
11 1 Y 1 A SER 219 ? A SER 11  
12 1 Y 1 A SER 220 ? A SER 12  
13 1 Y 1 A GLY 221 ? A GLY 13  
14 1 Y 1 A LEU 222 ? A LEU 14  
15 1 Y 1 A VAL 223 ? A VAL 15  
16 1 Y 1 A PRO 224 ? A PRO 16  
17 1 Y 1 A ARG 225 ? A ARG 17  
18 1 Y 1 A GLY 226 ? A GLY 18  
19 1 Y 1 A SER 227 ? A SER 19  
20 1 Y 1 A ASP 228 ? A ASP 20  
21 1 Y 1 A LEU 229 ? A LEU 21  
22 1 Y 1 A GLN 230 ? A GLN 22  
23 1 Y 1 A GLU 231 ? A GLU 23  
24 1 Y 1 A ASP 232 ? A ASP 24  
25 1 Y 1 A GLU 233 ? A GLU 25  
26 1 Y 1 A ASP 234 ? A ASP 26  
27 1 Y 1 A GLY 235 ? A GLY 27  
28 1 Y 1 A VAL 236 ? A VAL 28  
29 1 Y 1 A TYR 237 ? A TYR 29  
30 1 Y 1 A PHE 238 ? A PHE 30  
31 1 Y 1 A SER 239 ? A SER 31  
32 1 Y 1 A SER 240 ? A SER 32  
33 1 Y 1 A TYR 241 ? A TYR 33  
34 1 Y 1 A GLY 242 ? A GLY 34  
35 1 Y 1 A ASN 525 ? A ASN 317 
36 1 Y 1 A LYS 526 ? A LYS 318 
37 1 Y 1 A LYS 527 ? A LYS 319 
38 1 Y 1 A ASP 528 ? A ASP 320 
39 1 Y 1 A PRO 529 ? A PRO 321 
40 1 Y 1 A ARG 530 ? A ARG 322 
41 1 Y 1 A GLN 548 ? A GLN 340 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1-(1,2,3-benzothiadiazol-6-yl)-3-[2-(cyclohex-1-en-1-yl)ethyl]urea' TDU 
3 'CHLORIDE ION'                                                       CL  
4 'UNKNOWN ATOM OR ION'                                                UNX 
5 water                                                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 TDU 1   1    1    TDU TDU A . 
C 3 CL  1   1000 1000 CL  CL  A . 
D 4 UNX 1   549  1    UNX UNX A . 
E 4 UNX 1   2    2    UNX UNX A . 
F 4 UNX 1   3    3    UNX UNX A . 
G 4 UNX 1   4    4    UNX UNX A . 
H 4 UNX 1   5    5    UNX UNX A . 
I 4 UNX 1   7    7    UNX UNX A . 
J 4 UNX 1   8    8    UNX UNX A . 
K 4 UNX 1   9    9    UNX UNX A . 
L 4 UNX 1   11   11   UNX UNX A . 
M 4 UNX 1   12   12   UNX UNX A . 
N 5 HOH 1   6    6    HOH HOH A . 
N 5 HOH 2   10   10   HOH HOH A . 
N 5 HOH 3   13   13   HOH HOH A . 
N 5 HOH 4   14   14   HOH HOH A . 
N 5 HOH 5   15   15   HOH HOH A . 
N 5 HOH 6   16   16   HOH HOH A . 
N 5 HOH 7   17   17   HOH HOH A . 
N 5 HOH 8   19   19   HOH HOH A . 
N 5 HOH 9   20   20   HOH HOH A . 
N 5 HOH 10  21   21   HOH HOH A . 
N 5 HOH 11  22   22   HOH HOH A . 
N 5 HOH 12  23   23   HOH HOH A . 
N 5 HOH 13  24   24   HOH HOH A . 
N 5 HOH 14  25   25   HOH HOH A . 
N 5 HOH 15  26   26   HOH HOH A . 
N 5 HOH 16  27   27   HOH HOH A . 
N 5 HOH 17  28   28   HOH HOH A . 
N 5 HOH 18  29   29   HOH HOH A . 
N 5 HOH 19  30   30   HOH HOH A . 
N 5 HOH 20  31   31   HOH HOH A . 
N 5 HOH 21  32   32   HOH HOH A . 
N 5 HOH 22  33   33   HOH HOH A . 
N 5 HOH 23  34   34   HOH HOH A . 
N 5 HOH 24  35   35   HOH HOH A . 
N 5 HOH 25  36   36   HOH HOH A . 
N 5 HOH 26  37   37   HOH HOH A . 
N 5 HOH 27  38   38   HOH HOH A . 
N 5 HOH 28  39   39   HOH HOH A . 
N 5 HOH 29  40   40   HOH HOH A . 
N 5 HOH 30  41   41   HOH HOH A . 
N 5 HOH 31  42   42   HOH HOH A . 
N 5 HOH 32  43   43   HOH HOH A . 
N 5 HOH 33  44   44   HOH HOH A . 
N 5 HOH 34  45   45   HOH HOH A . 
N 5 HOH 35  46   46   HOH HOH A . 
N 5 HOH 36  47   47   HOH HOH A . 
N 5 HOH 37  48   48   HOH HOH A . 
N 5 HOH 38  49   49   HOH HOH A . 
N 5 HOH 39  50   50   HOH HOH A . 
N 5 HOH 40  51   51   HOH HOH A . 
N 5 HOH 41  52   52   HOH HOH A . 
N 5 HOH 42  53   53   HOH HOH A . 
N 5 HOH 43  54   54   HOH HOH A . 
N 5 HOH 44  55   55   HOH HOH A . 
N 5 HOH 45  56   56   HOH HOH A . 
N 5 HOH 46  57   57   HOH HOH A . 
N 5 HOH 47  58   58   HOH HOH A . 
N 5 HOH 48  59   59   HOH HOH A . 
N 5 HOH 49  60   60   HOH HOH A . 
N 5 HOH 50  61   61   HOH HOH A . 
N 5 HOH 51  62   62   HOH HOH A . 
N 5 HOH 52  63   63   HOH HOH A . 
N 5 HOH 53  64   64   HOH HOH A . 
N 5 HOH 54  65   65   HOH HOH A . 
N 5 HOH 55  66   66   HOH HOH A . 
N 5 HOH 56  67   67   HOH HOH A . 
N 5 HOH 57  68   68   HOH HOH A . 
N 5 HOH 58  69   69   HOH HOH A . 
N 5 HOH 59  70   70   HOH HOH A . 
N 5 HOH 60  71   71   HOH HOH A . 
N 5 HOH 61  72   72   HOH HOH A . 
N 5 HOH 62  73   73   HOH HOH A . 
N 5 HOH 63  74   74   HOH HOH A . 
N 5 HOH 64  76   76   HOH HOH A . 
N 5 HOH 65  77   77   HOH HOH A . 
N 5 HOH 66  78   78   HOH HOH A . 
N 5 HOH 67  80   80   HOH HOH A . 
N 5 HOH 68  81   81   HOH HOH A . 
N 5 HOH 69  82   82   HOH HOH A . 
N 5 HOH 70  83   83   HOH HOH A . 
N 5 HOH 71  84   84   HOH HOH A . 
N 5 HOH 72  85   85   HOH HOH A . 
N 5 HOH 73  86   86   HOH HOH A . 
N 5 HOH 74  87   87   HOH HOH A . 
N 5 HOH 75  88   88   HOH HOH A . 
N 5 HOH 76  89   89   HOH HOH A . 
N 5 HOH 77  90   90   HOH HOH A . 
N 5 HOH 78  91   91   HOH HOH A . 
N 5 HOH 79  92   92   HOH HOH A . 
N 5 HOH 80  93   93   HOH HOH A . 
N 5 HOH 81  94   94   HOH HOH A . 
N 5 HOH 82  95   95   HOH HOH A . 
N 5 HOH 83  97   97   HOH HOH A . 
N 5 HOH 84  98   98   HOH HOH A . 
N 5 HOH 85  99   99   HOH HOH A . 
N 5 HOH 86  100  100  HOH HOH A . 
N 5 HOH 87  101  101  HOH HOH A . 
N 5 HOH 88  102  102  HOH HOH A . 
N 5 HOH 89  103  103  HOH HOH A . 
N 5 HOH 90  104  104  HOH HOH A . 
N 5 HOH 91  105  105  HOH HOH A . 
N 5 HOH 92  106  106  HOH HOH A . 
N 5 HOH 93  107  107  HOH HOH A . 
N 5 HOH 94  108  108  HOH HOH A . 
N 5 HOH 95  109  109  HOH HOH A . 
N 5 HOH 96  110  110  HOH HOH A . 
N 5 HOH 97  111  111  HOH HOH A . 
N 5 HOH 98  112  112  HOH HOH A . 
N 5 HOH 99  113  113  HOH HOH A . 
N 5 HOH 100 114  114  HOH HOH A . 
N 5 HOH 101 115  115  HOH HOH A . 
N 5 HOH 102 117  117  HOH HOH A . 
N 5 HOH 103 118  118  HOH HOH A . 
N 5 HOH 104 119  119  HOH HOH A . 
N 5 HOH 105 120  120  HOH HOH A . 
N 5 HOH 106 121  121  HOH HOH A . 
N 5 HOH 107 122  122  HOH HOH A . 
N 5 HOH 108 123  123  HOH HOH A . 
N 5 HOH 109 124  124  HOH HOH A . 
N 5 HOH 110 127  127  HOH HOH A . 
N 5 HOH 111 128  128  HOH HOH A . 
N 5 HOH 112 130  130  HOH HOH A . 
N 5 HOH 113 131  131  HOH HOH A . 
N 5 HOH 114 132  132  HOH HOH A . 
N 5 HOH 115 133  133  HOH HOH A . 
N 5 HOH 116 134  134  HOH HOH A . 
N 5 HOH 117 135  135  HOH HOH A . 
N 5 HOH 118 136  136  HOH HOH A . 
N 5 HOH 119 137  137  HOH HOH A . 
N 5 HOH 120 138  138  HOH HOH A . 
N 5 HOH 121 139  139  HOH HOH A . 
N 5 HOH 122 140  140  HOH HOH A . 
N 5 HOH 123 141  141  HOH HOH A . 
N 5 HOH 124 142  142  HOH HOH A . 
N 5 HOH 125 143  143  HOH HOH A . 
N 5 HOH 126 144  144  HOH HOH A . 
N 5 HOH 127 145  145  HOH HOH A . 
N 5 HOH 128 147  147  HOH HOH A . 
N 5 HOH 129 148  148  HOH HOH A . 
N 5 HOH 130 149  149  HOH HOH A . 
N 5 HOH 131 150  150  HOH HOH A . 
N 5 HOH 132 151  151  HOH HOH A . 
N 5 HOH 133 153  153  HOH HOH A . 
N 5 HOH 134 157  157  HOH HOH A . 
N 5 HOH 135 158  158  HOH HOH A . 
N 5 HOH 136 159  159  HOH HOH A . 
N 5 HOH 137 160  160  HOH HOH A . 
N 5 HOH 138 162  162  HOH HOH A . 
N 5 HOH 139 163  163  HOH HOH A . 
N 5 HOH 140 165  165  HOH HOH A . 
N 5 HOH 141 166  166  HOH HOH A . 
N 5 HOH 142 167  167  HOH HOH A . 
N 5 HOH 143 169  169  HOH HOH A . 
N 5 HOH 144 170  170  HOH HOH A . 
N 5 HOH 145 171  171  HOH HOH A . 
N 5 HOH 146 173  173  HOH HOH A . 
N 5 HOH 147 174  174  HOH HOH A . 
N 5 HOH 148 176  176  HOH HOH A . 
N 5 HOH 149 178  178  HOH HOH A . 
N 5 HOH 150 179  179  HOH HOH A . 
N 5 HOH 151 180  180  HOH HOH A . 
N 5 HOH 152 181  181  HOH HOH A . 
N 5 HOH 153 182  182  HOH HOH A . 
N 5 HOH 154 183  183  HOH HOH A . 
N 5 HOH 155 184  184  HOH HOH A . 
N 5 HOH 156 186  186  HOH HOH A . 
N 5 HOH 157 187  187  HOH HOH A . 
N 5 HOH 158 188  188  HOH HOH A . 
N 5 HOH 159 189  189  HOH HOH A . 
N 5 HOH 160 190  190  HOH HOH A . 
N 5 HOH 161 191  191  HOH HOH A . 
N 5 HOH 162 192  192  HOH HOH A . 
N 5 HOH 163 193  193  HOH HOH A . 
N 5 HOH 164 194  194  HOH HOH A . 
N 5 HOH 165 195  195  HOH HOH A . 
N 5 HOH 166 196  196  HOH HOH A . 
N 5 HOH 167 197  197  HOH HOH A . 
N 5 HOH 168 198  198  HOH HOH A . 
N 5 HOH 169 199  199  HOH HOH A . 
N 5 HOH 170 200  200  HOH HOH A . 
N 5 HOH 171 201  201  HOH HOH A . 
N 5 HOH 172 202  202  HOH HOH A . 
N 5 HOH 173 203  203  HOH HOH A . 
N 5 HOH 174 204  204  HOH HOH A . 
N 5 HOH 175 205  205  HOH HOH A . 
N 5 HOH 176 206  206  HOH HOH A . 
N 5 HOH 177 207  207  HOH HOH A . 
N 5 HOH 178 208  208  HOH HOH A . 
N 5 HOH 179 550  1    HOH HOH A . 
N 5 HOH 180 551  2    HOH HOH A . 
N 5 HOH 181 552  3    HOH HOH A . 
N 5 HOH 182 553  4    HOH HOH A . 
N 5 HOH 183 554  5    HOH HOH A . 
N 5 HOH 184 555  7    HOH HOH A . 
N 5 HOH 185 556  8    HOH HOH A . 
N 5 HOH 186 557  9    HOH HOH A . 
N 5 HOH 187 558  11   HOH HOH A . 
N 5 HOH 188 559  12   HOH HOH A . 
N 5 HOH 189 560  209  HOH HOH A . 
N 5 HOH 190 561  210  HOH HOH A . 
N 5 HOH 191 562  211  HOH HOH A . 
N 5 HOH 192 563  212  HOH HOH A . 
N 5 HOH 193 564  214  HOH HOH A . 
N 5 HOH 194 565  215  HOH HOH A . 
N 5 HOH 195 566  216  HOH HOH A . 
N 5 HOH 196 567  220  HOH HOH A . 
N 5 HOH 197 568  221  HOH HOH A . 
N 5 HOH 198 569  222  HOH HOH A . 
N 5 HOH 199 570  223  HOH HOH A . 
N 5 HOH 200 571  227  HOH HOH A . 
N 5 HOH 201 572  230  HOH HOH A . 
N 5 HOH 202 573  231  HOH HOH A . 
N 5 HOH 203 574  232  HOH HOH A . 
N 5 HOH 204 575  236  HOH HOH A . 
N 5 HOH 205 576  237  HOH HOH A . 
N 5 HOH 206 577  240  HOH HOH A . 
N 5 HOH 207 578  241  HOH HOH A . 
N 5 HOH 208 579  242  HOH HOH A . 
N 5 HOH 209 580  243  HOH HOH A . 
N 5 HOH 210 581  251  HOH HOH A . 
N 5 HOH 211 582  252  HOH HOH A . 
N 5 HOH 212 583  253  HOH HOH A . 
N 5 HOH 213 584  255  HOH HOH A . 
N 5 HOH 214 585  256  HOH HOH A . 
N 5 HOH 215 586  257  HOH HOH A . 
N 5 HOH 216 587  267  HOH HOH A . 
N 5 HOH 217 588  269  HOH HOH A . 
N 5 HOH 218 589  271  HOH HOH A . 
N 5 HOH 219 590  272  HOH HOH A . 
N 5 HOH 220 591  274  HOH HOH A . 
N 5 HOH 221 592  275  HOH HOH A . 
N 5 HOH 222 593  276  HOH HOH A . 
N 5 HOH 223 594  277  HOH HOH A . 
#