data_3T2D
# 
_entry.id   3T2D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3T2D         
RCSB  RCSB066949   
WWPDB D_1000066949 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3T2B 'Fructose-1,6-bisphosphate aldolase/phosphatase from Thermoproteus neutrophilus, ligand free'               unspecified 
PDB 3T2C 'Fructose-1,6-bisphosphate aldolase/phosphatase from Thermoproteus neutrophilus, DHAP-bound form'           unspecified 
PDB 3T2E 'Fructose-1,6-bisphosphate aldolase/phosphatase from Thermoproteus neutrophilus, F6P-bound form'            unspecified 
PDB 3T2F 'Fructose-1,6-bisphosphate aldolase/phosphatase from Thermoproteus neutrophilus, soaked with EDTA and DHAP' unspecified 
PDB 3T2G 'Fructose-1,6-bisphosphate aldolase/phosphatase from Thermoproteus neutrophilus, Y229F variant with DHAP'   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3T2D 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Du, J.'     1 
'Say, R.'    2 
'Lue, W.'    3 
'Fuchs, G.'  4 
'Einsle, O.' 5 
# 
_citation.id                        primary 
_citation.title                     'Active-site remodelling in the bifunctional fructose-1,6-bisphosphate aldolase/phosphatase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            478 
_citation.page_first                534 
_citation.page_last                 537 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21983965 
_citation.pdbx_database_id_DOI      10.1038/nature10458 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Du, J.'     1 
primary 'Say, R.F.'  2 
primary 'Lu, W.'     3 
primary 'Fuchs, G.'  4 
primary 'Einsle, O.' 5 
# 
_cell.entry_id           3T2D 
_cell.length_a           112.291 
_cell.length_b           112.291 
_cell.length_c           151.348 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3T2D 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Fructose-1,6-bisphosphate aldolase/phosphatase' 45461.031 1   '4.1.2.13, 3.1.3.11' ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                                  24.305    4   ?                    ? ? ? 
3 non-polymer syn 1,6-di-O-phosphono-D-fructose                    340.116   1   ?                    ? ? ? 
4 water       nat water                                            18.015    362 ?                    ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEV
TDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDP
SMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDL
FDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHDL
EHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEV
TDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDP
SMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDL
FDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHDL
EHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   VAL n 
1 4   THR n 
1 5   VAL n 
1 6   SER n 
1 7   ILE n 
1 8   ILE n 
1 9   LYS n 
1 10  ALA n 
1 11  ASP n 
1 12  VAL n 
1 13  GLY n 
1 14  GLY n 
1 15  PHE n 
1 16  PRO n 
1 17  GLY n 
1 18  HIS n 
1 19  ALA n 
1 20  HIS n 
1 21  VAL n 
1 22  HIS n 
1 23  PRO n 
1 24  LYS n 
1 25  MET n 
1 26  LEU n 
1 27  GLU n 
1 28  TYR n 
1 29  ALA n 
1 30  ALA n 
1 31  ALA n 
1 32  LYS n 
1 33  LEU n 
1 34  LYS n 
1 35  GLU n 
1 36  ALA n 
1 37  GLN n 
1 38  LYS n 
1 39  ARG n 
1 40  GLY n 
1 41  VAL n 
1 42  ILE n 
1 43  ILE n 
1 44  ASP n 
1 45  TYR n 
1 46  PHE n 
1 47  VAL n 
1 48  TYR n 
1 49  ASN n 
1 50  VAL n 
1 51  GLY n 
1 52  ASP n 
1 53  ASP n 
1 54  ILE n 
1 55  SER n 
1 56  LEU n 
1 57  LEU n 
1 58  MET n 
1 59  THR n 
1 60  HIS n 
1 61  THR n 
1 62  LYS n 
1 63  GLY n 
1 64  GLU n 
1 65  ASP n 
1 66  ASN n 
1 67  LYS n 
1 68  ASP n 
1 69  ILE n 
1 70  HIS n 
1 71  GLY n 
1 72  LEU n 
1 73  ALA n 
1 74  TRP n 
1 75  GLU n 
1 76  THR n 
1 77  PHE n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  THR n 
1 82  ASP n 
1 83  GLN n 
1 84  ILE n 
1 85  ALA n 
1 86  LYS n 
1 87  ARG n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  TYR n 
1 92  GLY n 
1 93  ALA n 
1 94  GLY n 
1 95  GLN n 
1 96  ASP n 
1 97  LEU n 
1 98  LEU n 
1 99  LYS n 
1 100 ASP n 
1 101 ALA n 
1 102 PHE n 
1 103 SER n 
1 104 GLY n 
1 105 ASN n 
1 106 ILE n 
1 107 ARG n 
1 108 GLY n 
1 109 MET n 
1 110 GLY n 
1 111 PRO n 
1 112 GLN n 
1 113 VAL n 
1 114 ALA n 
1 115 GLU n 
1 116 MET n 
1 117 GLU n 
1 118 PHE n 
1 119 GLU n 
1 120 GLU n 
1 121 ARG n 
1 122 PRO n 
1 123 SER n 
1 124 GLU n 
1 125 PRO n 
1 126 ILE n 
1 127 ILE n 
1 128 ALA n 
1 129 PHE n 
1 130 ALA n 
1 131 ALA n 
1 132 ASP n 
1 133 LYS n 
1 134 THR n 
1 135 GLU n 
1 136 PRO n 
1 137 GLY n 
1 138 ALA n 
1 139 PHE n 
1 140 ASN n 
1 141 LEU n 
1 142 PRO n 
1 143 LEU n 
1 144 TYR n 
1 145 LYS n 
1 146 MET n 
1 147 PHE n 
1 148 ALA n 
1 149 ASP n 
1 150 PRO n 
1 151 PHE n 
1 152 THR n 
1 153 THR n 
1 154 ALA n 
1 155 GLY n 
1 156 LEU n 
1 157 VAL n 
1 158 ILE n 
1 159 ASP n 
1 160 PRO n 
1 161 SER n 
1 162 MET n 
1 163 HIS n 
1 164 GLU n 
1 165 GLY n 
1 166 PHE n 
1 167 ILE n 
1 168 PHE n 
1 169 GLU n 
1 170 VAL n 
1 171 LEU n 
1 172 ASP n 
1 173 VAL n 
1 174 VAL n 
1 175 GLU n 
1 176 HIS n 
1 177 LYS n 
1 178 VAL n 
1 179 TYR n 
1 180 LEU n 
1 181 LEU n 
1 182 LYS n 
1 183 THR n 
1 184 PRO n 
1 185 GLU n 
1 186 ASP n 
1 187 ALA n 
1 188 TYR n 
1 189 SER n 
1 190 LEU n 
1 191 LEU n 
1 192 GLY n 
1 193 LEU n 
1 194 ILE n 
1 195 GLY n 
1 196 THR n 
1 197 THR n 
1 198 GLY n 
1 199 ARG n 
1 200 TYR n 
1 201 ILE n 
1 202 ILE n 
1 203 ARG n 
1 204 LYS n 
1 205 VAL n 
1 206 PHE n 
1 207 ARG n 
1 208 ARG n 
1 209 ALA n 
1 210 ASP n 
1 211 GLY n 
1 212 ALA n 
1 213 PRO n 
1 214 ALA n 
1 215 ALA n 
1 216 ALA n 
1 217 ASN n 
1 218 SER n 
1 219 VAL n 
1 220 GLU n 
1 221 ARG n 
1 222 LEU n 
1 223 SER n 
1 224 LEU n 
1 225 ILE n 
1 226 ALA n 
1 227 GLY n 
1 228 ARG n 
1 229 TYR n 
1 230 VAL n 
1 231 GLY n 
1 232 LYS n 
1 233 ASP n 
1 234 ASP n 
1 235 PRO n 
1 236 VAL n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 ARG n 
1 241 ALA n 
1 242 GLN n 
1 243 SER n 
1 244 GLY n 
1 245 LEU n 
1 246 PRO n 
1 247 ALA n 
1 248 VAL n 
1 249 GLY n 
1 250 GLU n 
1 251 VAL n 
1 252 LEU n 
1 253 GLU n 
1 254 ALA n 
1 255 PHE n 
1 256 ALA n 
1 257 HIS n 
1 258 PRO n 
1 259 HIS n 
1 260 LEU n 
1 261 VAL n 
1 262 HIS n 
1 263 GLY n 
1 264 TRP n 
1 265 MET n 
1 266 ARG n 
1 267 GLY n 
1 268 SER n 
1 269 HIS n 
1 270 ALA n 
1 271 GLY n 
1 272 PRO n 
1 273 LEU n 
1 274 MET n 
1 275 PRO n 
1 276 ALA n 
1 277 ARG n 
1 278 PHE n 
1 279 ILE n 
1 280 SER n 
1 281 VAL n 
1 282 ASP n 
1 283 PRO n 
1 284 GLU n 
1 285 ARG n 
1 286 ARG n 
1 287 ILE n 
1 288 ALA n 
1 289 ILE n 
1 290 GLY n 
1 291 PRO n 
1 292 LYS n 
1 293 MET n 
1 294 THR n 
1 295 ARG n 
1 296 PHE n 
1 297 ASP n 
1 298 GLY n 
1 299 PRO n 
1 300 PRO n 
1 301 LYS n 
1 302 VAL n 
1 303 GLY n 
1 304 ALA n 
1 305 LEU n 
1 306 GLY n 
1 307 PHE n 
1 308 GLN n 
1 309 LEU n 
1 310 HIS n 
1 311 GLU n 
1 312 GLY n 
1 313 TYR n 
1 314 LEU n 
1 315 GLU n 
1 316 GLY n 
1 317 GLY n 
1 318 VAL n 
1 319 ASP n 
1 320 LEU n 
1 321 PHE n 
1 322 ASP n 
1 323 ASP n 
1 324 PRO n 
1 325 ALA n 
1 326 PHE n 
1 327 ASP n 
1 328 TYR n 
1 329 VAL n 
1 330 ARG n 
1 331 GLN n 
1 332 THR n 
1 333 ALA n 
1 334 ALA n 
1 335 GLN n 
1 336 ILE n 
1 337 ALA n 
1 338 ASP n 
1 339 TYR n 
1 340 ILE n 
1 341 ARG n 
1 342 ARG n 
1 343 MET n 
1 344 GLY n 
1 345 PRO n 
1 346 PHE n 
1 347 GLN n 
1 348 PRO n 
1 349 HIS n 
1 350 ARG n 
1 351 LEU n 
1 352 PRO n 
1 353 PRO n 
1 354 GLU n 
1 355 GLU n 
1 356 MET n 
1 357 GLU n 
1 358 TYR n 
1 359 THR n 
1 360 ALA n 
1 361 LEU n 
1 362 PRO n 
1 363 LYS n 
1 364 ILE n 
1 365 LEU n 
1 366 ALA n 
1 367 LYS n 
1 368 VAL n 
1 369 LYS n 
1 370 PRO n 
1 371 TYR n 
1 372 PRO n 
1 373 ALA n 
1 374 ASP n 
1 375 GLN n 
1 376 TYR n 
1 377 GLU n 
1 378 LYS n 
1 379 ASP n 
1 380 ARG n 
1 381 LYS n 
1 382 LYS n 
1 383 TYR n 
1 384 ILE n 
1 385 GLU n 
1 386 ALA n 
1 387 VAL n 
1 388 VAL n 
1 389 LYS n 
1 390 GLY n 
1 391 ALA n 
1 392 LYS n 
1 393 VAL n 
1 394 GLU n 
1 395 GLU n 
1 396 SER n 
1 397 GLN n 
1 398 HIS n 
1 399 ASP n 
1 400 LEU n 
1 401 GLU n 
1 402 HIS n 
1 403 HIS n 
1 404 HIS n 
1 405 HIS n 
1 406 HIS n 
1 407 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Tneu_0133 
_entity_src_gen.gene_src_species                   'Thermoproteus neutrophilus' 
_entity_src_gen.gene_src_strain                    'DSM 2338 / JCM 9278 / V24Sta' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermoproteus neutrophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     444157 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET23b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B1YAL1_THENV 
_struct_ref.pdbx_db_accession          B1YAL1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEV
TDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDP
SMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDL
FDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3T2D 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 399 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             B1YAL1 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  399 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       399 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3T2D LEU A 400 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 400 1 
1 3T2D GLU A 401 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 401 2 
1 3T2D HIS A 402 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 402 3 
1 3T2D HIS A 403 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 403 4 
1 3T2D HIS A 404 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 404 5 
1 3T2D HIS A 405 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 405 6 
1 3T2D HIS A 406 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 406 7 
1 3T2D HIS A 407 ? UNP B1YAL1 ? ? 'EXPRESSION TAG' 407 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                         ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'               ? 'Mg 2'           24.305  
P6F non-polymer         . 1,6-di-O-phosphono-D-fructose ? 'C6 H14 O12 P2'  340.116 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3T2D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   53.12 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '8% PEG3350, 0.1 M HEPES/NaOH, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-08-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Fixed-exit LN2 cooled Double Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.00000 1.0 
2 1       1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.00000 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     3T2D 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             54.780 
_reflns.d_resolution_high            1.36 
_reflns.number_obs                   102981 
_reflns.number_all                   103107 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              0.073 
_reflns.pdbx_netI_over_sigmaI        18.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.36 
_reflns_shell.d_res_low              1.39 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.424 
_reflns_shell.pdbx_Rsym_value        0.424 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_redundancy        8.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3T2D 
_refine.ls_number_reflns_obs                     97834 
_refine.ls_number_reflns_all                     97834 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.780 
_refine.ls_d_res_high                            1.36 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_R_factor_obs                          0.10475 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.10364 
_refine.ls_R_factor_R_free                       0.12590 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5147 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.983 
_refine.correlation_coeff_Fo_to_Fc_free          0.977 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.08 
_refine.aniso_B[2][2]                            0.08 
_refine.aniso_B[3][3]                            -0.16 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS   
U VALUES      : REFINED INDIVIDUALLY
;
_refine.pdbx_starting_model                      'PDB ENTRY 3T2B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.033 
_refine.overall_SU_ML                            0.017 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.033 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3057 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             362 
_refine_hist.number_atoms_total               3443 
_refine_hist.d_res_high                       1.36 
_refine_hist.d_res_low                        54.780 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.031  0.022  ? 3279 ? 'X-RAY DIFFRACTION' 
r_bond_other_d         0.004  0.020  ? 2283 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2.365  1.981  ? 4470 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      1.178  3.000  ? 5578 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 6.644  5.000  ? 424  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 35.014 23.264 ? 144  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 14.154 15.000 ? 557  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 17.468 15.000 ? 22   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.159  0.200  ? 481  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.013  0.021  ? 3665 ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     0.001  0.020  ? 678  ? 'X-RAY DIFFRACTION' 
r_mcbond_it            2.560  1.500  ? 2004 ? 'X-RAY DIFFRACTION' 
r_mcbond_other         0.908  1.500  ? 807  ? 'X-RAY DIFFRACTION' 
r_mcangle_it           3.695  2.000  ? 3245 ? 'X-RAY DIFFRACTION' 
r_scbond_it            5.677  3.000  ? 1275 ? 'X-RAY DIFFRACTION' 
r_scangle_it           8.104  4.500  ? 1210 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr     2.512  3.000  ? 5562 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.360 
_refine_ls_shell.d_res_low                        1.395 
_refine_ls_shell.number_reflns_R_work             7157 
_refine_ls_shell.R_factor_R_work                  0.160 
_refine_ls_shell.percent_reflns_obs               99.91 
_refine_ls_shell.R_factor_R_free                  0.204 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             377 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3T2D 
_struct.title                     'Fructose-1,6-bisphosphate aldolase/phosphatase from Thermoproteus neutrophilus, FBP-bound form' 
_struct.pdbx_descriptor           'Fructose-1,6-bisphosphate aldolase/phosphatase (E.C.4.1.2.13, 3.1.3.11)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3T2D 
_struct_keywords.pdbx_keywords   'LYASE, HYDROLASE' 
_struct_keywords.text            '(beta/alpha)8 TIM barrel, FBP, F6P, DHAP, GAP, phosphorylation, LYASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 22  ? ARG A 39  ? HIS A 22  ARG A 39  1 ? 18 
HELX_P HELX_P2  2  ASN A 66  ? ILE A 84  ? ASN A 66  ILE A 84  1 ? 19 
HELX_P HELX_P3  3  GLU A 135 ? ALA A 138 ? GLU A 135 ALA A 138 5 ? 4  
HELX_P HELX_P4  4  PHE A 139 ? ASP A 149 ? PHE A 139 ASP A 149 1 ? 11 
HELX_P HELX_P5  5  ALA A 154 ? ASP A 159 ? ALA A 154 ASP A 159 1 ? 6  
HELX_P HELX_P6  6  PRO A 160 ? HIS A 163 ? PRO A 160 HIS A 163 5 ? 4  
HELX_P HELX_P7  7  ASP A 186 ? GLY A 195 ? ASP A 186 GLY A 195 1 ? 10 
HELX_P HELX_P8  8  ALA A 247 ? ALA A 254 ? ALA A 247 ALA A 254 1 ? 8  
HELX_P HELX_P9  9  TRP A 264 ? SER A 268 ? TRP A 264 SER A 268 5 ? 5  
HELX_P HELX_P10 10 THR A 294 ? GLY A 298 ? THR A 294 GLY A 298 5 ? 5  
HELX_P HELX_P11 11 ASP A 323 ? ARG A 342 ? ASP A 323 ARG A 342 1 ? 20 
HELX_P HELX_P12 12 PRO A 352 ? MET A 356 ? PRO A 352 MET A 356 5 ? 5  
HELX_P HELX_P13 13 ALA A 360 ? VAL A 368 ? ALA A 360 VAL A 368 1 ? 9  
HELX_P HELX_P14 14 PRO A 372 ? GLY A 390 ? PRO A 372 GLY A 390 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 233 OD2 ? ? ? 1_555 E MG  . MG  ? ? A ASP 233 A MG  411 1_555 ? ? ? ? ? ? ? 1.925 ? 
metalc2  metalc ? ? E MG  .   MG  ? ? ? 1_555 F P6F . O1P ? ? A MG  411 A P6F 412 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc3  metalc ? ? C MG  .   MG  ? ? ? 1_555 F P6F . O2P ? ? A MG  409 A P6F 412 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc4  metalc ? ? E MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  411 A HOH 510 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc5  metalc ? ? A ASP 52  OD2 ? ? ? 1_555 C MG  . MG  ? ? A ASP 52  A MG  409 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc6  metalc ? ? A ASP 132 OD1 ? ? ? 1_555 B MG  . MG  ? ? A ASP 132 A MG  408 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc7  metalc ? ? E MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  411 A HOH 483 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc8  metalc ? ? B MG  .   MG  ? ? ? 1_555 F P6F . O3P ? ? A MG  408 A P6F 412 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc9  metalc ? ? B MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  408 A HOH 474 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc10 metalc ? ? A ASP 52  OD1 ? ? ? 1_555 B MG  . MG  ? ? A ASP 52  A MG  408 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc11 metalc ? ? A ASP 53  OD2 ? ? ? 1_555 B MG  . MG  ? ? A ASP 53  A MG  408 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc12 metalc ? ? A ASP 11  OD2 ? ? ? 1_555 C MG  . MG  ? ? A ASP 11  A MG  409 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc13 metalc ? ? A ASP 234 OD2 ? ? ? 1_555 B MG  . MG  ? ? A ASP 234 A MG  408 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc14 metalc ? ? C MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  409 A HOH 506 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc15 metalc ? ? E MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  411 A HOH 482 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc16 metalc ? ? A GLN 95  OE1 ? ? ? 1_555 C MG  . MG  ? ? A GLN 95  A MG  409 1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc17 metalc ? ? A ASP 233 OD1 ? ? ? 1_555 D MG  . MG  ? ? A ASP 233 A MG  410 1_555 ? ? ? ? ? ? ? 2.263 ? 
metalc18 metalc ? ? A ASP 234 OD2 ? ? ? 1_555 D MG  . MG  ? ? A ASP 234 A MG  410 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc19 metalc ? ? D MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  410 A HOH 478 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc20 metalc ? ? D MG  .   MG  ? ? ? 1_555 F P6F . O1P ? ? A MG  410 A P6F 412 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc21 metalc ? ? D MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  410 A HOH 474 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc22 metalc ? ? E MG  .   MG  ? ? ? 1_555 F P6F . O1  ? ? A MG  411 A P6F 412 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc23 metalc ? ? D MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  410 A HOH 484 1_555 ? ? ? ? ? ? ? 2.618 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 15  A . ? PHE 15  A PRO 16  A ? PRO 16  A 1 -10.33 
2 THR 183 A . ? THR 183 A PRO 184 A ? PRO 184 A 1 16.60  
3 GLY 298 A . ? GLY 298 A PRO 299 A ? PRO 299 A 1 -11.92 
4 GLY 316 A . ? GLY 316 A GLY 317 A ? GLY 317 A 1 -4.40  
5 GLN 347 A . ? GLN 347 A PRO 348 A ? PRO 348 A 1 4.24   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 8 ? 
D ? 2 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 112 ? GLU A 119 ? GLN A 112 GLU A 119 
A 2 ARG A 2   ? ALA A 10  ? ARG A 2   ALA A 10  
A 3 ASP A 53  ? HIS A 60  ? ASP A 53  HIS A 60  
A 4 ASP A 44  ? VAL A 50  ? ASP A 44  VAL A 50  
A 5 ILE A 287 ? ILE A 289 ? ILE A 287 ILE A 289 
A 6 SER A 280 ? ASP A 282 ? SER A 280 ASP A 282 
B 1 LYS A 177 ? THR A 183 ? LYS A 177 THR A 183 
B 2 PHE A 166 ? ASP A 172 ? PHE A 166 ASP A 172 
B 3 TYR A 200 ? ARG A 207 ? TYR A 200 ARG A 207 
B 4 PRO A 213 ? ASN A 217 ? PRO A 213 ASN A 217 
B 5 VAL A 236 ? ARG A 240 ? VAL A 236 ARG A 240 
B 6 GLU A 124 ? ASP A 132 ? GLU A 124 ASP A 132 
B 7 LYS A 301 ? HIS A 310 ? LYS A 301 HIS A 310 
B 8 MET A 274 ? PRO A 275 ? MET A 274 PRO A 275 
C 1 LYS A 177 ? THR A 183 ? LYS A 177 THR A 183 
C 2 PHE A 166 ? ASP A 172 ? PHE A 166 ASP A 172 
C 3 TYR A 200 ? ARG A 207 ? TYR A 200 ARG A 207 
C 4 PRO A 213 ? ASN A 217 ? PRO A 213 ASN A 217 
C 5 VAL A 236 ? ARG A 240 ? VAL A 236 ARG A 240 
C 6 GLU A 124 ? ASP A 132 ? GLU A 124 ASP A 132 
C 7 LYS A 301 ? HIS A 310 ? LYS A 301 HIS A 310 
C 8 TYR A 313 ? ASP A 319 ? TYR A 313 ASP A 319 
D 1 SER A 223 ? ILE A 225 ? SER A 223 ILE A 225 
D 2 ARG A 228 ? VAL A 230 ? ARG A 228 VAL A 230 
E 1 LEU A 260 ? GLY A 263 ? LEU A 260 GLY A 263 
E 2 HIS A 269 ? PRO A 272 ? HIS A 269 PRO A 272 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 114 ? O ALA A 114 N ILE A 7   ? N ILE A 7   
A 2 3 N THR A 4   ? N THR A 4   O HIS A 60  ? O HIS A 60  
A 3 4 O SER A 55  ? O SER A 55  N TYR A 48  ? N TYR A 48  
A 4 5 N VAL A 47  ? N VAL A 47  O ALA A 288 ? O ALA A 288 
A 5 6 O ILE A 287 ? O ILE A 287 N ASP A 282 ? N ASP A 282 
B 1 2 O LEU A 181 ? O LEU A 181 N PHE A 168 ? N PHE A 168 
B 2 3 N GLU A 169 ? N GLU A 169 O LYS A 204 ? O LYS A 204 
B 3 4 N VAL A 205 ? N VAL A 205 O ALA A 214 ? O ALA A 214 
B 4 5 N ALA A 214 ? N ALA A 214 O ARG A 240 ? O ARG A 240 
B 5 6 O LEU A 237 ? O LEU A 237 N PHE A 129 ? N PHE A 129 
B 6 7 N ALA A 128 ? N ALA A 128 O LEU A 305 ? O LEU A 305 
B 7 8 O VAL A 302 ? O VAL A 302 N MET A 274 ? N MET A 274 
C 1 2 O LEU A 181 ? O LEU A 181 N PHE A 168 ? N PHE A 168 
C 2 3 N GLU A 169 ? N GLU A 169 O LYS A 204 ? O LYS A 204 
C 3 4 N VAL A 205 ? N VAL A 205 O ALA A 214 ? O ALA A 214 
C 4 5 N ALA A 214 ? N ALA A 214 O ARG A 240 ? O ARG A 240 
C 5 6 O LEU A 237 ? O LEU A 237 N PHE A 129 ? N PHE A 129 
C 6 7 N ALA A 128 ? N ALA A 128 O LEU A 305 ? O LEU A 305 
C 7 8 N GLY A 306 ? N GLY A 306 O VAL A 318 ? O VAL A 318 
D 1 2 N SER A 223 ? N SER A 223 O VAL A 230 ? O VAL A 230 
E 1 2 N GLY A 263 ? N GLY A 263 O HIS A 269 ? O HIS A 269 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 408'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 409'  
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG A 410'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 411'  
AC5 Software ? ? ? ? 32 'BINDING SITE FOR RESIDUE P6F A 412' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  ASP A 52  ? ASP A 52  . ? 1_555 ? 
2  AC1 8  ASP A 53  ? ASP A 53  . ? 1_555 ? 
3  AC1 8  ASP A 132 ? ASP A 132 . ? 1_555 ? 
4  AC1 8  LYS A 133 ? LYS A 133 . ? 1_555 ? 
5  AC1 8  ASP A 234 ? ASP A 234 . ? 1_555 ? 
6  AC1 8  MG  D .   ? MG  A 410 . ? 1_555 ? 
7  AC1 8  P6F F .   ? P6F A 412 . ? 1_555 ? 
8  AC1 8  HOH G .   ? HOH A 474 . ? 1_555 ? 
9  AC2 6  ASP A 11  ? ASP A 11  . ? 1_555 ? 
10 AC2 6  HIS A 18  ? HIS A 18  . ? 1_555 ? 
11 AC2 6  ASP A 52  ? ASP A 52  . ? 1_555 ? 
12 AC2 6  GLN A 95  ? GLN A 95  . ? 1_555 ? 
13 AC2 6  P6F F .   ? P6F A 412 . ? 1_555 ? 
14 AC2 6  HOH G .   ? HOH A 506 . ? 1_555 ? 
15 AC3 8  ASP A 233 ? ASP A 233 . ? 1_555 ? 
16 AC3 8  ASP A 234 ? ASP A 234 . ? 1_555 ? 
17 AC3 8  MG  B .   ? MG  A 408 . ? 1_555 ? 
18 AC3 8  MG  E .   ? MG  A 411 . ? 1_555 ? 
19 AC3 8  P6F F .   ? P6F A 412 . ? 1_555 ? 
20 AC3 8  HOH G .   ? HOH A 474 . ? 1_555 ? 
21 AC3 8  HOH G .   ? HOH A 478 . ? 1_555 ? 
22 AC3 8  HOH G .   ? HOH A 484 . ? 1_555 ? 
23 AC4 6  ASP A 233 ? ASP A 233 . ? 1_555 ? 
24 AC4 6  MG  D .   ? MG  A 410 . ? 1_555 ? 
25 AC4 6  P6F F .   ? P6F A 412 . ? 1_555 ? 
26 AC4 6  HOH G .   ? HOH A 482 . ? 1_555 ? 
27 AC4 6  HOH G .   ? HOH A 483 . ? 1_555 ? 
28 AC4 6  HOH G .   ? HOH A 510 . ? 1_555 ? 
29 AC5 32 ASP A 11  ? ASP A 11  . ? 1_555 ? 
30 AC5 32 HIS A 18  ? HIS A 18  . ? 1_555 ? 
31 AC5 32 ASP A 52  ? ASP A 52  . ? 1_555 ? 
32 AC5 32 TYR A 91  ? TYR A 91  . ? 1_555 ? 
33 AC5 32 GLN A 95  ? GLN A 95  . ? 1_555 ? 
34 AC5 32 SER A 103 ? SER A 103 . ? 1_555 ? 
35 AC5 32 GLY A 104 ? GLY A 104 . ? 1_555 ? 
36 AC5 32 ASN A 105 ? ASN A 105 . ? 1_555 ? 
37 AC5 32 ASP A 132 ? ASP A 132 . ? 1_555 ? 
38 AC5 32 LYS A 133 ? LYS A 133 . ? 1_555 ? 
39 AC5 32 ASP A 233 ? ASP A 233 . ? 1_555 ? 
40 AC5 32 ASP A 234 ? ASP A 234 . ? 1_555 ? 
41 AC5 32 GLN A 242 ? GLN A 242 . ? 4_455 ? 
42 AC5 32 SER A 243 ? SER A 243 . ? 4_455 ? 
43 AC5 32 ALA A 247 ? ALA A 247 . ? 4_455 ? 
44 AC5 32 TRP A 264 ? TRP A 264 . ? 1_555 ? 
45 AC5 32 MET A 265 ? MET A 265 . ? 1_555 ? 
46 AC5 32 ARG A 266 ? ARG A 266 . ? 1_555 ? 
47 AC5 32 GLY A 267 ? GLY A 267 . ? 1_555 ? 
48 AC5 32 ASP A 297 ? ASP A 297 . ? 1_555 ? 
49 AC5 32 TYR A 358 ? TYR A 358 . ? 1_555 ? 
50 AC5 32 MG  B .   ? MG  A 408 . ? 1_555 ? 
51 AC5 32 MG  C .   ? MG  A 409 . ? 1_555 ? 
52 AC5 32 MG  D .   ? MG  A 410 . ? 1_555 ? 
53 AC5 32 MG  E .   ? MG  A 411 . ? 1_555 ? 
54 AC5 32 HOH G .   ? HOH A 465 . ? 4_455 ? 
55 AC5 32 HOH G .   ? HOH A 474 . ? 1_555 ? 
56 AC5 32 HOH G .   ? HOH A 482 . ? 1_555 ? 
57 AC5 32 HOH G .   ? HOH A 483 . ? 1_555 ? 
58 AC5 32 HOH G .   ? HOH A 487 . ? 1_555 ? 
59 AC5 32 HOH G .   ? HOH A 510 . ? 1_555 ? 
60 AC5 32 HOH G .   ? HOH A 660 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3T2D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3T2D 
_atom_sites.fract_transf_matrix[1][1]   0.008905 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008905 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006607 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? -25.639 29.767 34.341  1.00 25.81  ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? -26.644 28.803 34.814  1.00 21.95  ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? -27.508 28.486 33.638  1.00 17.59  ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? -27.761 29.363 32.788  1.00 18.66  ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? -27.388 29.352 35.966  1.00 22.94  ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? -28.363 30.340 35.785  1.00 24.98  ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? -29.485 30.545 37.221  1.00 31.29  ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? -31.265 29.766 36.789  1.00 20.23  ? 1   MET A CE  1 
ATOM   9    N  N   . ARG A 1 2   ? -27.986 27.271 33.634  1.00 16.53  ? 2   ARG A N   1 
ATOM   10   C  CA  . ARG A 1 2   ? -28.926 26.814 32.633  1.00 15.53  ? 2   ARG A CA  1 
ATOM   11   C  C   . ARG A 1 2   ? -30.308 27.057 33.128  1.00 14.54  ? 2   ARG A C   1 
ATOM   12   O  O   . ARG A 1 2   ? -30.642 26.884 34.317  1.00 17.93  ? 2   ARG A O   1 
ATOM   13   C  CB  . ARG A 1 2   ? -28.762 25.359 32.366  1.00 16.89  ? 2   ARG A CB  1 
ATOM   14   C  CG  . ARG A 1 2   ? -27.318 25.067 31.950  1.00 21.53  ? 2   ARG A CG  1 
ATOM   15   C  CD  . ARG A 1 2   ? -27.153 23.626 31.338  1.00 25.52  ? 2   ARG A CD  1 
ATOM   16   N  NE  . ARG A 1 2   ? -27.980 23.369 30.179  1.00 28.22  ? 2   ARG A NE  1 
ATOM   17   C  CZ  . ARG A 1 2   ? -27.598 23.624 28.902  1.00 28.82  ? 2   ARG A CZ  1 
ATOM   18   N  NH1 . ARG A 1 2   ? -26.420 24.160 28.629  1.00 34.25  ? 2   ARG A NH1 1 
ATOM   19   N  NH2 . ARG A 1 2   ? -28.420 23.372 27.899  1.00 29.95  ? 2   ARG A NH2 1 
ATOM   20   N  N   . VAL A 1 3   ? -31.130 27.503 32.220  1.00 12.88  ? 3   VAL A N   1 
ATOM   21   C  CA  A VAL A 1 3   ? -32.517 27.816 32.501  0.50 11.90  ? 3   VAL A CA  1 
ATOM   22   C  CA  B VAL A 1 3   ? -32.524 27.794 32.509  0.50 12.48  ? 3   VAL A CA  1 
ATOM   23   C  C   . VAL A 1 3   ? -33.406 27.160 31.419  1.00 9.47   ? 3   VAL A C   1 
ATOM   24   O  O   . VAL A 1 3   ? -32.963 27.014 30.284  1.00 11.29  ? 3   VAL A O   1 
ATOM   25   C  CB  A VAL A 1 3   ? -32.734 29.337 32.600  0.50 12.19  ? 3   VAL A CB  1 
ATOM   26   C  CB  B VAL A 1 3   ? -32.802 29.303 32.617  0.50 13.08  ? 3   VAL A CB  1 
ATOM   27   C  CG1 A VAL A 1 3   ? -32.551 30.010 31.253  0.50 15.03  ? 3   VAL A CG1 1 
ATOM   28   C  CG1 B VAL A 1 3   ? -31.971 29.961 33.737  0.50 18.20  ? 3   VAL A CG1 1 
ATOM   29   C  CG2 A VAL A 1 3   ? -34.118 29.653 33.179  0.50 13.60  ? 3   VAL A CG2 1 
ATOM   30   C  CG2 B VAL A 1 3   ? -32.543 29.981 31.292  0.50 15.61  ? 3   VAL A CG2 1 
ATOM   31   N  N   . THR A 1 4   ? -34.625 26.844 31.837  1.00 10.31  ? 4   THR A N   1 
ATOM   32   C  CA  . THR A 1 4   ? -35.654 26.416 30.892  1.00 10.65  ? 4   THR A CA  1 
ATOM   33   C  C   . THR A 1 4   ? -36.746 27.504 30.926  1.00 9.44   ? 4   THR A C   1 
ATOM   34   O  O   . THR A 1 4   ? -37.182 27.956 31.962  1.00 10.11  ? 4   THR A O   1 
ATOM   35   C  CB  . THR A 1 4   ? -36.285 25.048 31.307  1.00 11.85  ? 4   THR A CB  1 
ATOM   36   O  OG1 . THR A 1 4   ? -35.231 24.101 31.463  1.00 14.18  ? 4   THR A OG1 1 
ATOM   37   C  CG2 . THR A 1 4   ? -37.210 24.525 30.220  1.00 12.85  ? 4   THR A CG2 1 
ATOM   38   N  N   . VAL A 1 5   ? -37.163 27.836 29.685  1.00 9.43   ? 5   VAL A N   1 
ATOM   39   C  CA  . VAL A 1 5   ? -38.309 28.720 29.511  1.00 9.14   ? 5   VAL A CA  1 
ATOM   40   C  C   . VAL A 1 5   ? -39.412 27.882 28.871  1.00 8.52   ? 5   VAL A C   1 
ATOM   41   O  O   . VAL A 1 5   ? -39.156 27.312 27.807  1.00 9.68   ? 5   VAL A O   1 
ATOM   42   C  CB  . VAL A 1 5   ? -37.958 29.956 28.641  1.00 10.35  ? 5   VAL A CB  1 
ATOM   43   C  CG1 . VAL A 1 5   ? -39.161 30.881 28.564  1.00 11.57  ? 5   VAL A CG1 1 
ATOM   44   C  CG2 . VAL A 1 5   ? -36.715 30.648 29.157  1.00 12.23  ? 5   VAL A CG2 1 
ATOM   45   N  N   . SER A 1 6   ? -40.571 27.818 29.503  1.00 8.94   ? 6   SER A N   1 
ATOM   46   C  CA  . SER A 1 6   ? -41.677 27.004 29.039  1.00 9.56   ? 6   SER A CA  1 
ATOM   47   C  C   . SER A 1 6   ? -42.893 27.899 28.898  1.00 9.62   ? 6   SER A C   1 
ATOM   48   O  O   . SER A 1 6   ? -43.341 28.484 29.872  1.00 11.46  ? 6   SER A O   1 
ATOM   49   C  CB  . SER A 1 6   ? -41.962 25.908 30.029  1.00 10.31  ? 6   SER A CB  1 
ATOM   50   O  OG  . SER A 1 6   ? -40.857 25.026 30.224  1.00 10.76  ? 6   SER A OG  1 
ATOM   51   N  N   . ILE A 1 7   ? -43.550 27.861 27.746  1.00 8.71   ? 7   ILE A N   1 
ATOM   52   C  CA  . ILE A 1 7   ? -44.906 28.389 27.602  1.00 8.78   ? 7   ILE A CA  1 
ATOM   53   C  C   . ILE A 1 7   ? -45.857 27.207 27.494  1.00 9.05   ? 7   ILE A C   1 
ATOM   54   O  O   . ILE A 1 7   ? -45.674 26.387 26.564  1.00 9.68   ? 7   ILE A O   1 
ATOM   55   C  CB  . ILE A 1 7   ? -45.078 29.280 26.334  1.00 8.72   ? 7   ILE A CB  1 
ATOM   56   C  CG1 . ILE A 1 7   ? -44.047 30.353 26.234  1.00 10.11  ? 7   ILE A CG1 1 
ATOM   57   C  CG2 . ILE A 1 7   ? -46.517 29.830 26.328  1.00 10.45  ? 7   ILE A CG2 1 
ATOM   58   C  CD1 . ILE A 1 7   ? -44.041 31.022 24.787  1.00 11.71  ? 7   ILE A CD1 1 
ATOM   59   N  N   . ILE A 1 8   ? -46.813 27.113 28.397  1.00 9.32   ? 8   ILE A N   1 
ATOM   60   C  CA  . ILE A 1 8   ? -47.817 26.057 28.306  1.00 9.32   ? 8   ILE A CA  1 
ATOM   61   C  C   . ILE A 1 8   ? -49.163 26.800 28.266  1.00 9.28   ? 8   ILE A C   1 
ATOM   62   O  O   . ILE A 1 8   ? -49.479 27.646 29.069  1.00 9.18   ? 8   ILE A O   1 
ATOM   63   C  CB  . ILE A 1 8   ? -47.739 25.080 29.482  1.00 10.23  ? 8   ILE A CB  1 
ATOM   64   C  CG1 . ILE A 1 8   ? -46.296 24.481 29.513  1.00 12.72  ? 8   ILE A CG1 1 
ATOM   65   C  CG2 . ILE A 1 8   ? -48.736 23.947 29.241  1.00 12.12  ? 8   ILE A CG2 1 
ATOM   66   C  CD1 . ILE A 1 8   ? -46.087 23.293 30.485  1.00 15.44  ? 8   ILE A CD1 1 
ATOM   67   N  N   . LYS A 1 9   ? -49.882 26.510 27.166  1.00 9.11   ? 9   LYS A N   1 
ATOM   68   C  CA  A LYS A 1 9   ? -51.071 27.265 26.805  0.50 8.73   ? 9   LYS A CA  1 
ATOM   69   C  CA  B LYS A 1 9   ? -51.068 27.260 26.762  0.50 8.61   ? 9   LYS A CA  1 
ATOM   70   C  C   . LYS A 1 9   ? -52.277 26.405 26.646  1.00 8.18   ? 9   LYS A C   1 
ATOM   71   O  O   . LYS A 1 9   ? -52.194 25.259 26.150  1.00 9.78   ? 9   LYS A O   1 
ATOM   72   C  CB  A LYS A 1 9   ? -50.756 28.046 25.526  0.50 9.02   ? 9   LYS A CB  1 
ATOM   73   C  CB  B LYS A 1 9   ? -50.766 27.914 25.405  0.50 8.67   ? 9   LYS A CB  1 
ATOM   74   C  CG  A LYS A 1 9   ? -51.865 28.754 24.816  0.50 10.82  ? 9   LYS A CG  1 
ATOM   75   C  CG  B LYS A 1 9   ? -51.849 28.668 24.689  0.50 8.95   ? 9   LYS A CG  1 
ATOM   76   C  CD  A LYS A 1 9   ? -52.231 28.034 23.566  0.50 15.27  ? 9   LYS A CD  1 
ATOM   77   C  CD  B LYS A 1 9   ? -52.813 27.770 23.901  0.50 9.18   ? 9   LYS A CD  1 
ATOM   78   C  CE  A LYS A 1 9   ? -53.542 27.423 23.498  0.50 15.38  ? 9   LYS A CE  1 
ATOM   79   C  CE  B LYS A 1 9   ? -52.144 26.770 23.059  0.50 9.36   ? 9   LYS A CE  1 
ATOM   80   N  NZ  A LYS A 1 9   ? -53.936 26.722 22.246  0.50 12.38  ? 9   LYS A NZ  1 
ATOM   81   N  NZ  B LYS A 1 9   ? -52.965 26.260 21.896  0.50 10.04  ? 9   LYS A NZ  1 
ATOM   82   N  N   . ALA A 1 10  ? -53.443 26.920 26.992  1.00 7.87   ? 10  ALA A N   1 
ATOM   83   C  CA  . ALA A 1 10  ? -54.702 26.210 26.821  1.00 8.71   ? 10  ALA A CA  1 
ATOM   84   C  C   . ALA A 1 10  ? -55.832 27.217 26.793  1.00 8.16   ? 10  ALA A C   1 
ATOM   85   O  O   . ALA A 1 10  ? -55.766 28.281 27.398  1.00 9.30   ? 10  ALA A O   1 
ATOM   86   C  CB  . ALA A 1 10  ? -54.957 25.179 27.961  1.00 11.90  ? 10  ALA A CB  1 
ATOM   87   N  N   . ASP A 1 11  ? -56.900 26.805 26.146  1.00 8.67   ? 11  ASP A N   1 
ATOM   88   C  CA  . ASP A 1 11  ? -58.216 27.476 26.237  1.00 8.98   ? 11  ASP A CA  1 
ATOM   89   C  C   . ASP A 1 11  ? -59.084 26.654 27.189  1.00 8.36   ? 11  ASP A C   1 
ATOM   90   O  O   . ASP A 1 11  ? -59.285 25.445 26.939  1.00 10.71  ? 11  ASP A O   1 
ATOM   91   C  CB  . ASP A 1 11  ? -58.806 27.517 24.863  1.00 9.15   ? 11  ASP A CB  1 
ATOM   92   C  CG  . ASP A 1 11  ? -60.210 28.040 24.731  1.00 9.67   ? 11  ASP A CG  1 
ATOM   93   O  OD1 . ASP A 1 11  ? -60.985 28.187 25.666  1.00 9.98   ? 11  ASP A OD1 1 
ATOM   94   O  OD2 . ASP A 1 11  ? -60.558 28.293 23.536  1.00 9.37   ? 11  ASP A OD2 1 
ATOM   95   N  N   . VAL A 1 12  ? -59.513 27.235 28.259  1.00 9.43   ? 12  VAL A N   1 
ATOM   96   C  CA  . VAL A 1 12  ? -60.418 26.608 29.214  1.00 9.58   ? 12  VAL A CA  1 
ATOM   97   C  C   . VAL A 1 12  ? -61.680 27.409 29.415  1.00 10.46  ? 12  VAL A C   1 
ATOM   98   O  O   . VAL A 1 12  ? -62.356 27.273 30.415  1.00 11.47  ? 12  VAL A O   1 
ATOM   99   C  CB  . VAL A 1 12  ? -59.688 26.229 30.535  1.00 11.66  ? 12  VAL A CB  1 
ATOM   100  C  CG1 . VAL A 1 12  ? -58.712 25.072 30.282  1.00 13.36  ? 12  VAL A CG1 1 
ATOM   101  C  CG2 . VAL A 1 12  ? -59.084 27.458 31.173  1.00 14.37  ? 12  VAL A CG2 1 
ATOM   102  N  N   . GLY A 1 13  ? -62.026 28.209 28.423  1.00 10.06  ? 13  GLY A N   1 
ATOM   103  C  CA  . GLY A 1 13  ? -63.275 28.952 28.426  1.00 10.68  ? 13  GLY A CA  1 
ATOM   104  C  C   . GLY A 1 13  ? -63.161 30.338 27.878  1.00 9.09   ? 13  GLY A C   1 
ATOM   105  O  O   . GLY A 1 13  ? -62.190 31.032 28.143  1.00 10.30  ? 13  GLY A O   1 
ATOM   106  N  N   . GLY A 1 14  ? -64.216 30.758 27.196  1.00 9.51   ? 14  GLY A N   1 
ATOM   107  C  CA  . GLY A 1 14  ? -64.242 32.083 26.590  1.00 9.47   ? 14  GLY A CA  1 
ATOM   108  C  C   . GLY A 1 14  ? -65.330 32.970 27.112  1.00 8.98   ? 14  GLY A C   1 
ATOM   109  O  O   . GLY A 1 14  ? -66.294 32.543 27.743  1.00 10.27  ? 14  GLY A O   1 
ATOM   110  N  N   . PHE A 1 15  ? -65.192 34.250 26.795  1.00 9.82   ? 15  PHE A N   1 
ATOM   111  C  CA  . PHE A 1 15  ? -65.933 35.294 27.458  1.00 9.28   ? 15  PHE A CA  1 
ATOM   112  C  C   . PHE A 1 15  ? -66.120 36.531 26.527  1.00 8.78   ? 15  PHE A C   1 
ATOM   113  O  O   . PHE A 1 15  ? -65.268 37.418 26.555  1.00 10.62  ? 15  PHE A O   1 
ATOM   114  C  CB  . PHE A 1 15  ? -65.184 35.727 28.734  1.00 10.19  ? 15  PHE A CB  1 
ATOM   115  C  CG  . PHE A 1 15  ? -65.877 36.805 29.547  1.00 9.83   ? 15  PHE A CG  1 
ATOM   116  C  CD1 . PHE A 1 15  ? -67.201 36.635 29.924  1.00 10.83  ? 15  PHE A CD1 1 
ATOM   117  C  CD2 . PHE A 1 15  ? -65.256 37.976 29.951  1.00 9.94   ? 15  PHE A CD2 1 
ATOM   118  C  CE1 . PHE A 1 15  ? -67.854 37.619 30.672  1.00 11.55  ? 15  PHE A CE1 1 
ATOM   119  C  CE2 . PHE A 1 15  ? -65.867 38.911 30.681  1.00 10.86  ? 15  PHE A CE2 1 
ATOM   120  C  CZ  . PHE A 1 15  ? -67.189 38.727 31.033  1.00 11.61  ? 15  PHE A CZ  1 
ATOM   121  N  N   . PRO A 1 16  ? -67.185 36.575 25.751  1.00 8.86   ? 16  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 16  ? -68.160 35.544 25.457  1.00 8.14   ? 16  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 16  ? -67.723 34.658 24.314  1.00 8.19   ? 16  PRO A C   1 
ATOM   124  O  O   . PRO A 1 16  ? -66.846 35.065 23.492  1.00 9.03   ? 16  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 16  ? -69.363 36.374 25.046  1.00 10.28  ? 16  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 16  ? -68.728 37.482 24.275  1.00 10.56  ? 16  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 16  ? -67.454 37.794 24.982  1.00 10.13  ? 16  PRO A CD  1 
ATOM   128  N  N   . GLY A 1 17  ? -68.353 33.489 24.164  1.00 8.74   ? 17  GLY A N   1 
ATOM   129  C  CA  . GLY A 1 17  ? -68.039 32.612 23.025  1.00 8.26   ? 17  GLY A CA  1 
ATOM   130  C  C   . GLY A 1 17  ? -66.574 32.271 23.037  1.00 7.94   ? 17  GLY A C   1 
ATOM   131  O  O   . GLY A 1 17  ? -66.008 31.898 24.044  1.00 9.71   ? 17  GLY A O   1 
ATOM   132  N  N   . HIS A 1 18  ? -65.926 32.376 21.871  1.00 7.47   ? 18  HIS A N   1 
ATOM   133  C  CA  . HIS A 1 18  ? -64.518 32.139 21.712  1.00 8.01   ? 18  HIS A CA  1 
ATOM   134  C  C   . HIS A 1 18  ? -63.739 33.478 21.551  1.00 7.54   ? 18  HIS A C   1 
ATOM   135  O  O   . HIS A 1 18  ? -62.655 33.470 20.955  1.00 8.62   ? 18  HIS A O   1 
ATOM   136  C  CB  . HIS A 1 18  ? -64.230 31.193 20.559  1.00 7.80   ? 18  HIS A CB  1 
ATOM   137  C  CG  . HIS A 1 18  ? -64.847 29.830 20.688  1.00 7.84   ? 18  HIS A CG  1 
ATOM   138  N  ND1 . HIS A 1 18  ? -64.283 28.824 21.448  1.00 8.60   ? 18  HIS A ND1 1 
ATOM   139  C  CD2 . HIS A 1 18  ? -65.971 29.320 20.107  1.00 8.43   ? 18  HIS A CD2 1 
ATOM   140  C  CE1 . HIS A 1 18  ? -65.026 27.744 21.268  1.00 8.87   ? 18  HIS A CE1 1 
ATOM   141  N  NE2 . HIS A 1 18  ? -66.069 28.006 20.472  1.00 9.43   ? 18  HIS A NE2 1 
ATOM   142  N  N   . ALA A 1 19  ? -64.310 34.576 21.994  1.00 7.27   ? 19  ALA A N   1 
ATOM   143  C  CA  . ALA A 1 19  ? -63.739 35.904 21.691  1.00 7.62   ? 19  ALA A CA  1 
ATOM   144  C  C   . ALA A 1 19  ? -62.623 36.359 22.558  1.00 7.88   ? 19  ALA A C   1 
ATOM   145  O  O   . ALA A 1 19  ? -61.830 37.215 22.162  1.00 8.56   ? 19  ALA A O   1 
ATOM   146  C  CB  . ALA A 1 19  ? -64.902 36.965 21.761  1.00 9.34   ? 19  ALA A CB  1 
ATOM   147  N  N   . HIS A 1 20  ? -62.555 35.890 23.811  1.00 8.30   ? 20  HIS A N   1 
ATOM   148  C  CA  . HIS A 1 20  ? -61.689 36.500 24.805  1.00 8.19   ? 20  HIS A CA  1 
ATOM   149  C  C   . HIS A 1 20  ? -61.715 35.567 26.033  1.00 8.04   ? 20  HIS A C   1 
ATOM   150  O  O   . HIS A 1 20  ? -62.401 34.563 26.014  1.00 8.86   ? 20  HIS A O   1 
ATOM   151  C  CB  . HIS A 1 20  ? -62.180 37.891 25.164  1.00 8.40   ? 20  HIS A CB  1 
ATOM   152  C  CG  . HIS A 1 20  ? -61.100 38.839 25.557  1.00 8.30   ? 20  HIS A CG  1 
ATOM   153  N  ND1 . HIS A 1 20  ? -61.291 39.820 26.488  1.00 9.75   ? 20  HIS A ND1 1 
ATOM   154  C  CD2 . HIS A 1 20  ? -59.858 39.016 25.033  1.00 7.95   ? 20  HIS A CD2 1 
ATOM   155  C  CE1 . HIS A 1 20  ? -60.173 40.573 26.540  1.00 10.38  ? 20  HIS A CE1 1 
ATOM   156  N  NE2 . HIS A 1 20  ? -59.292 40.108 25.640  1.00 9.18   ? 20  HIS A NE2 1 
ATOM   157  N  N   . VAL A 1 21  ? -60.976 35.960 27.035  1.00 9.84   ? 21  VAL A N   1 
ATOM   158  C  CA  . VAL A 1 21  ? -61.005 35.245 28.345  1.00 10.54  ? 21  VAL A CA  1 
ATOM   159  C  C   . VAL A 1 21  ? -61.576 36.177 29.396  1.00 11.11  ? 21  VAL A C   1 
ATOM   160  O  O   . VAL A 1 21  ? -61.633 37.380 29.243  1.00 12.68  ? 21  VAL A O   1 
ATOM   161  C  CB  . VAL A 1 21  ? -59.645 34.710 28.773  1.00 11.54  ? 21  VAL A CB  1 
ATOM   162  C  CG1 . VAL A 1 21  ? -59.023 33.803 27.690  1.00 13.18  ? 21  VAL A CG1 1 
ATOM   163  C  CG2 . VAL A 1 21  ? -58.719 35.768 29.224  1.00 12.86  ? 21  VAL A CG2 1 
ATOM   164  N  N   . HIS A 1 22  ? -62.049 35.595 30.493  1.00 10.76  ? 22  HIS A N   1 
ATOM   165  C  CA  . HIS A 1 22  ? -62.504 36.334 31.655  1.00 11.66  ? 22  HIS A CA  1 
ATOM   166  C  C   . HIS A 1 22  ? -61.280 36.760 32.476  1.00 11.23  ? 22  HIS A C   1 
ATOM   167  O  O   . HIS A 1 22  ? -60.403 35.887 32.725  1.00 11.80  ? 22  HIS A O   1 
ATOM   168  C  CB  . HIS A 1 22  ? -63.501 35.496 32.452  1.00 12.36  ? 22  HIS A CB  1 
ATOM   169  C  CG  . HIS A 1 22  ? -64.226 36.268 33.492  1.00 12.75  ? 22  HIS A CG  1 
ATOM   170  N  ND1 . HIS A 1 22  ? -63.605 36.793 34.621  1.00 13.99  ? 22  HIS A ND1 1 
ATOM   171  C  CD2 . HIS A 1 22  ? -65.545 36.582 33.548  1.00 14.12  ? 22  HIS A CD2 1 
ATOM   172  C  CE1 . HIS A 1 22  ? -64.546 37.461 35.290  1.00 15.65  ? 22  HIS A CE1 1 
ATOM   173  N  NE2 . HIS A 1 22  ? -65.734 37.353 34.663  1.00 15.25  ? 22  HIS A NE2 1 
ATOM   174  N  N   . PRO A 1 23  ? -61.191 38.000 32.944  1.00 12.22  ? 23  PRO A N   1 
ATOM   175  C  CA  . PRO A 1 23  ? -59.962 38.428 33.643  1.00 13.69  ? 23  PRO A CA  1 
ATOM   176  C  C   . PRO A 1 23  ? -59.710 37.643 34.946  1.00 12.93  ? 23  PRO A C   1 
ATOM   177  O  O   . PRO A 1 23  ? -58.538 37.492 35.300  1.00 13.73  ? 23  PRO A O   1 
ATOM   178  C  CB  . PRO A 1 23  ? -60.170 39.929 33.914  1.00 17.06  ? 23  PRO A CB  1 
ATOM   179  C  CG  . PRO A 1 23  ? -61.651 40.093 33.762  1.00 18.31  ? 23  PRO A CG  1 
ATOM   180  C  CD  . PRO A 1 23  ? -62.136 39.114 32.767  1.00 13.34  ? 23  PRO A CD  1 
ATOM   181  N  N   . LYS A 1 24  ? -60.762 37.133 35.566  1.00 12.86  ? 24  LYS A N   1 
ATOM   182  C  CA  . LYS A 1 24  ? -60.519 36.342 36.777  1.00 12.93  ? 24  LYS A CA  1 
ATOM   183  C  C   . LYS A 1 24  ? -59.781 35.065 36.447  1.00 12.55  ? 24  LYS A C   1 
ATOM   184  O  O   . LYS A 1 24  ? -59.144 34.455 37.351  1.00 13.60  ? 24  LYS A O   1 
ATOM   185  C  CB  . LYS A 1 24  ? -61.822 36.038 37.546  1.00 15.03  ? 24  LYS A CB  1 
ATOM   186  C  CG  . LYS A 1 24  ? -62.383 37.319 38.224  1.00 20.16  ? 24  LYS A CG  1 
ATOM   187  C  CD  . LYS A 1 24  ? -63.567 37.023 39.067  1.00 26.42  ? 24  LYS A CD  1 
ATOM   188  C  CE  . LYS A 1 24  ? -64.017 38.294 39.910  1.00 32.72  ? 24  LYS A CE  1 
ATOM   189  N  NZ  . LYS A 1 24  ? -62.877 38.854 40.738  1.00 40.05  ? 24  LYS A NZ  1 
ATOM   190  N  N   . MET A 1 25  ? -59.822 34.548 35.211  1.00 11.33  ? 25  MET A N   1 
ATOM   191  C  CA  . MET A 1 25  ? -59.059 33.369 34.869  1.00 11.34  ? 25  MET A CA  1 
ATOM   192  C  C   . MET A 1 25  ? -57.599 33.674 34.934  1.00 11.54  ? 25  MET A C   1 
ATOM   193  O  O   . MET A 1 25  ? -56.800 32.845 35.447  1.00 11.88  ? 25  MET A O   1 
ATOM   194  C  CB  . MET A 1 25  ? -59.433 32.914 33.450  1.00 11.15  ? 25  MET A CB  1 
ATOM   195  C  CG  . MET A 1 25  ? -60.855 32.499 33.318  1.00 12.84  ? 25  MET A CG  1 
ATOM   196  S  SD  . MET A 1 25  ? -61.457 32.272 31.624  1.00 14.22  ? 25  MET A SD  1 
ATOM   197  C  CE  . MET A 1 25  ? -60.833 30.634 31.285  1.00 13.87  ? 25  MET A CE  1 
ATOM   198  N  N   . LEU A 1 26  ? -57.172 34.830 34.422  1.00 10.56  ? 26  LEU A N   1 
ATOM   199  C  CA  . LEU A 1 26  ? -55.800 35.228 34.463  1.00 11.07  ? 26  LEU A CA  1 
ATOM   200  C  C   . LEU A 1 26  ? -55.352 35.460 35.914  1.00 11.38  ? 26  LEU A C   1 
ATOM   201  O  O   . LEU A 1 26  ? -54.237 35.104 36.286  1.00 11.74  ? 26  LEU A O   1 
ATOM   202  C  CB  . LEU A 1 26  ? -55.580 36.492 33.612  1.00 11.80  ? 26  LEU A CB  1 
ATOM   203  C  CG  . LEU A 1 26  ? -55.951 36.343 32.106  1.00 12.44  ? 26  LEU A CG  1 
ATOM   204  C  CD1 . LEU A 1 26  ? -55.902 37.764 31.495  1.00 15.51  ? 26  LEU A CD1 1 
ATOM   205  C  CD2 . LEU A 1 26  ? -55.093 35.340 31.438  1.00 14.58  ? 26  LEU A CD2 1 
ATOM   206  N  N   . GLU A 1 27  ? -56.200 36.116 36.668  1.00 11.52  ? 27  GLU A N   1 
ATOM   207  C  CA  . GLU A 1 27  ? -55.872 36.418 38.073  1.00 11.91  ? 27  GLU A CA  1 
ATOM   208  C  C   . GLU A 1 27  ? -55.684 35.141 38.873  1.00 12.38  ? 27  GLU A C   1 
ATOM   209  O  O   . GLU A 1 27  ? -54.713 35.013 39.665  1.00 14.02  ? 27  GLU A O   1 
ATOM   210  C  CB  . GLU A 1 27  ? -56.945 37.297 38.682  1.00 13.92  ? 27  GLU A CB  1 
ATOM   211  C  CG  . GLU A 1 27  ? -56.986 38.718 38.152  1.00 16.08  ? 27  GLU A CG  1 
ATOM   212  C  CD  . GLU A 1 27  ? -58.119 39.550 38.589  1.00 27.16  ? 27  GLU A CD  1 
ATOM   213  O  OE1 . GLU A 1 27  ? -59.096 38.991 39.088  1.00 33.19  ? 27  GLU A OE1 1 
ATOM   214  O  OE2 . GLU A 1 27  ? -58.062 40.797 38.328  1.00 38.37  ? 27  GLU A OE2 1 
ATOM   215  N  N   . TYR A 1 28  ? -56.526 34.143 38.627  1.00 12.09  ? 28  TYR A N   1 
ATOM   216  C  CA  . TYR A 1 28  ? -56.472 32.838 39.330  1.00 12.24  ? 28  TYR A CA  1 
ATOM   217  C  C   . TYR A 1 28  ? -55.182 32.163 38.945  1.00 12.69  ? 28  TYR A C   1 
ATOM   218  O  O   . TYR A 1 28  ? -54.404 31.660 39.795  1.00 14.45  ? 28  TYR A O   1 
ATOM   219  C  CB  . TYR A 1 28  ? -57.691 31.994 39.024  1.00 13.36  ? 28  TYR A CB  1 
ATOM   220  C  CG  . TYR A 1 28  ? -57.722 30.723 39.866  1.00 15.66  ? 28  TYR A CG  1 
ATOM   221  C  CD1 . TYR A 1 28  ? -56.907 29.646 39.608  1.00 16.24  ? 28  TYR A CD1 1 
ATOM   222  C  CD2 . TYR A 1 28  ? -58.538 30.623 40.984  1.00 19.83  ? 28  TYR A CD2 1 
ATOM   223  C  CE1 . TYR A 1 28  ? -56.879 28.501 40.408  1.00 21.11  ? 28  TYR A CE1 1 
ATOM   224  C  CE2 . TYR A 1 28  ? -58.498 29.472 41.796  1.00 19.30  ? 28  TYR A CE2 1 
ATOM   225  C  CZ  . TYR A 1 28  ? -57.685 28.418 41.511  1.00 21.36  ? 28  TYR A CZ  1 
ATOM   226  O  OH  . TYR A 1 28  ? -57.693 27.331 42.352  1.00 26.05  ? 28  TYR A OH  1 
ATOM   227  N  N   . ALA A 1 29  ? -54.869 32.107 37.666  1.00 12.37  ? 29  ALA A N   1 
ATOM   228  C  CA  . ALA A 1 29  ? -53.661 31.454 37.208  1.00 12.69  ? 29  ALA A CA  1 
ATOM   229  C  C   . ALA A 1 29  ? -52.438 32.112 37.794  1.00 12.34  ? 29  ALA A C   1 
ATOM   230  O  O   . ALA A 1 29  ? -51.484 31.421 38.237  1.00 13.74  ? 29  ALA A O   1 
ATOM   231  C  CB  . ALA A 1 29  ? -53.624 31.399 35.677  1.00 13.00  ? 29  ALA A CB  1 
ATOM   232  N  N   . ALA A 1 30  ? -52.347 33.425 37.805  1.00 11.50  ? 30  ALA A N   1 
ATOM   233  C  CA  . ALA A 1 30  ? -51.210 34.147 38.324  1.00 11.60  ? 30  ALA A CA  1 
ATOM   234  C  C   . ALA A 1 30  ? -51.011 33.839 39.822  1.00 13.36  ? 30  ALA A C   1 
ATOM   235  O  O   . ALA A 1 30  ? -49.915 33.632 40.286  1.00 14.08  ? 30  ALA A O   1 
ATOM   236  C  CB  . ALA A 1 30  ? -51.337 35.669 38.100  1.00 13.36  ? 30  ALA A CB  1 
ATOM   237  N  N   . ALA A 1 31  ? -52.100 33.776 40.567  1.00 12.97  ? 31  ALA A N   1 
ATOM   238  C  CA  . ALA A 1 31  ? -52.061 33.484 41.991  1.00 13.90  ? 31  ALA A CA  1 
ATOM   239  C  C   . ALA A 1 31  ? -51.554 32.074 42.232  1.00 14.35  ? 31  ALA A C   1 
ATOM   240  O  O   . ALA A 1 31  ? -50.730 31.796 43.137  1.00 15.69  ? 31  ALA A O   1 
ATOM   241  C  CB  . ALA A 1 31  ? -53.378 33.768 42.674  1.00 16.35  ? 31  ALA A CB  1 
ATOM   242  N  N   . LYS A 1 32  ? -51.935 31.126 41.405  1.00 13.80  ? 32  LYS A N   1 
ATOM   243  C  CA  . LYS A 1 32  ? -51.521 29.737 41.523  1.00 14.81  ? 32  LYS A CA  1 
ATOM   244  C  C   . LYS A 1 32  ? -50.016 29.632 41.203  1.00 13.96  ? 32  LYS A C   1 
ATOM   245  O  O   . LYS A 1 32  ? -49.245 28.927 41.904  1.00 15.22  ? 32  LYS A O   1 
ATOM   246  C  CB  . LYS A 1 32  ? -52.321 28.791 40.620  1.00 17.35  ? 32  LYS A CB  1 
ATOM   247  C  CG  . LYS A 1 32  ? -51.953 27.427 40.902  1.00 24.02  ? 32  LYS A CG  1 
ATOM   248  C  CD  . LYS A 1 32  ? -52.917 26.395 40.723  1.00 30.28  ? 32  LYS A CD  1 
ATOM   249  C  CE  . LYS A 1 32  ? -52.217 25.055 40.645  1.00 27.22  ? 32  LYS A CE  1 
ATOM   250  N  NZ  . LYS A 1 32  ? -52.445 24.419 42.019  1.00 31.91  ? 32  LYS A NZ  1 
ATOM   251  N  N   . LEU A 1 33  ? -49.527 30.295 40.165  1.00 12.61  ? 33  LEU A N   1 
ATOM   252  C  CA  . LEU A 1 33  ? -48.139 30.288 39.834  1.00 11.77  ? 33  LEU A CA  1 
ATOM   253  C  C   . LEU A 1 33  ? -47.300 31.020 40.881  1.00 13.51  ? 33  LEU A C   1 
ATOM   254  O  O   . LEU A 1 33  ? -46.152 30.608 41.131  1.00 14.36  ? 33  LEU A O   1 
ATOM   255  C  CB  . LEU A 1 33  ? -47.920 30.835 38.403  1.00 11.92  ? 33  LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 33  ? -48.534 29.988 37.300  1.00 11.72  ? 33  LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 33  ? -48.122 30.576 35.921  1.00 12.25  ? 33  LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 33  ? -48.155 28.537 37.392  1.00 13.71  ? 33  LEU A CD2 1 
ATOM   259  N  N   . LYS A 1 34  ? -47.827 32.043 41.503  1.00 13.28  ? 34  LYS A N   1 
ATOM   260  C  CA  . LYS A 1 34  ? -47.137 32.704 42.597  1.00 14.73  ? 34  LYS A CA  1 
ATOM   261  C  C   . LYS A 1 34  ? -46.915 31.731 43.782  1.00 15.23  ? 34  LYS A C   1 
ATOM   262  O  O   . LYS A 1 34  ? -45.827 31.727 44.366  1.00 15.79  ? 34  LYS A O   1 
ATOM   263  C  CB  . LYS A 1 34  ? -47.930 33.898 43.022  1.00 14.98  ? 34  LYS A CB  1 
ATOM   264  C  CG  . LYS A 1 34  ? -47.125 34.799 44.013  1.00 19.63  ? 34  LYS A CG  1 
ATOM   265  C  CD  . LYS A 1 34  ? -47.861 36.101 44.294  1.00 25.46  ? 34  LYS A CD  1 
ATOM   266  C  CE  . LYS A 1 34  ? -47.036 37.111 45.119  1.00 32.92  ? 34  LYS A CE  1 
ATOM   267  N  NZ  . LYS A 1 34  ? -47.877 38.322 45.374  1.00 40.14  ? 34  LYS A NZ  1 
ATOM   268  N  N   . GLU A 1 35  ? -47.887 30.892 44.031  1.00 14.52  ? 35  GLU A N   1 
ATOM   269  C  CA  . GLU A 1 35  ? -47.742 29.864 45.074  1.00 16.11  ? 35  GLU A CA  1 
ATOM   270  C  C   . GLU A 1 35  ? -46.666 28.867 44.667  1.00 16.69  ? 35  GLU A C   1 
ATOM   271  O  O   . GLU A 1 35  ? -45.840 28.410 45.493  1.00 17.91  ? 35  GLU A O   1 
ATOM   272  C  CB  . GLU A 1 35  ? -49.053 29.154 45.406  1.00 18.62  ? 35  GLU A CB  1 
ATOM   273  C  CG  . GLU A 1 35  ? -48.914 28.232 46.517  1.00 26.25  ? 35  GLU A CG  1 
ATOM   274  C  CD  . GLU A 1 35  ? -48.391 28.885 47.909  1.00 34.20  ? 35  GLU A CD  1 
ATOM   275  O  OE1 . GLU A 1 35  ? -48.657 30.112 48.287  1.00 40.26  ? 35  GLU A OE1 1 
ATOM   276  O  OE2 . GLU A 1 35  ? -47.656 28.107 48.605  1.00 45.44  ? 35  GLU A OE2 1 
ATOM   277  N  N   . ALA A 1 36  ? -46.643 28.434 43.412  1.00 16.07  ? 36  ALA A N   1 
ATOM   278  C  CA  . ALA A 1 36  ? -45.611 27.514 42.932  1.00 15.26  ? 36  ALA A CA  1 
ATOM   279  C  C   . ALA A 1 36  ? -44.247 28.126 43.023  1.00 15.51  ? 36  ALA A C   1 
ATOM   280  O  O   . ALA A 1 36  ? -43.267 27.454 43.389  1.00 16.55  ? 36  ALA A O   1 
ATOM   281  C  CB  . ALA A 1 36  ? -45.944 27.133 41.507  1.00 16.27  ? 36  ALA A CB  1 
ATOM   282  N  N   . GLN A 1 37  ? -44.133 29.412 42.733  1.00 13.89  ? 37  GLN A N   1 
ATOM   283  C  CA  . GLN A 1 37  ? -42.884 30.146 42.855  1.00 13.73  ? 37  GLN A CA  1 
ATOM   284  C  C   . GLN A 1 37  ? -42.412 30.151 44.345  1.00 15.79  ? 37  GLN A C   1 
ATOM   285  O  O   . GLN A 1 37  ? -41.212 29.902 44.644  1.00 16.46  ? 37  GLN A O   1 
ATOM   286  C  CB  . GLN A 1 37  ? -43.057 31.586 42.356  1.00 13.72  ? 37  GLN A CB  1 
ATOM   287  C  CG  . GLN A 1 37  ? -41.874 32.443 42.495  1.00 13.73  ? 37  GLN A CG  1 
ATOM   288  C  CD  . GLN A 1 37  ? -42.177 33.886 42.150  1.00 16.45  ? 37  GLN A CD  1 
ATOM   289  O  OE1 . GLN A 1 37  ? -43.110 34.505 42.741  1.00 16.74  ? 37  GLN A OE1 1 
ATOM   290  N  NE2 . GLN A 1 37  ? -41.401 34.457 41.185  1.00 15.33  ? 37  GLN A NE2 1 
ATOM   291  N  N   . LYS A 1 38  ? -43.331 30.429 45.225  1.00 15.19  ? 38  LYS A N   1 
ATOM   292  C  CA  . LYS A 1 38  ? -42.974 30.470 46.680  1.00 18.16  ? 38  LYS A CA  1 
ATOM   293  C  C   . LYS A 1 38  ? -42.452 29.102 47.136  1.00 17.66  ? 38  LYS A C   1 
ATOM   294  O  O   . LYS A 1 38  ? -41.559 29.023 47.995  1.00 21.83  ? 38  LYS A O   1 
ATOM   295  C  CB  . LYS A 1 38  ? -44.275 30.856 47.465  1.00 20.12  ? 38  LYS A CB  1 
ATOM   296  C  CG  . LYS A 1 38  ? -44.087 30.996 48.920  1.00 28.76  ? 38  LYS A CG  1 
ATOM   297  C  CD  . LYS A 1 38  ? -45.283 31.744 49.629  1.00 35.75  ? 38  LYS A CD  1 
ATOM   298  C  CE  . LYS A 1 38  ? -45.129 31.761 51.168  1.00 43.87  ? 38  LYS A CE  1 
ATOM   299  N  NZ  . LYS A 1 38  ? -45.944 30.673 51.855  1.00 52.33  ? 38  LYS A NZ  1 
ATOM   300  N  N   . ARG A 1 39  ? -43.016 28.027 46.615  1.00 18.51  ? 39  ARG A N   1 
ATOM   301  C  CA  . ARG A 1 39  ? -42.556 26.685 46.916  1.00 20.23  ? 39  ARG A CA  1 
ATOM   302  C  C   . ARG A 1 39  ? -41.324 26.209 46.190  1.00 19.32  ? 39  ARG A C   1 
ATOM   303  O  O   . ARG A 1 39  ? -40.845 25.115 46.407  1.00 21.58  ? 39  ARG A O   1 
ATOM   304  C  CB  . ARG A 1 39  ? -43.697 25.730 46.683  1.00 22.43  ? 39  ARG A CB  1 
ATOM   305  C  CG  . ARG A 1 39  ? -44.869 26.030 47.663  1.00 31.05  ? 39  ARG A CG  1 
ATOM   306  C  CD  . ARG A 1 39  ? -46.151 25.266 47.327  1.00 45.18  ? 39  ARG A CD  1 
ATOM   307  N  NE  . ARG A 1 39  ? -46.033 24.077 46.447  1.00 52.11  ? 39  ARG A NE  1 
ATOM   308  C  CZ  . ARG A 1 39  ? -46.576 23.875 45.217  1.00 53.65  ? 39  ARG A CZ  1 
ATOM   309  N  NH1 . ARG A 1 39  ? -47.324 24.785 44.532  1.00 51.75  ? 39  ARG A NH1 1 
ATOM   310  N  NH2 . ARG A 1 39  ? -46.344 22.677 44.640  1.00 56.04  ? 39  ARG A NH2 1 
ATOM   311  N  N   . GLY A 1 40  ? -40.809 27.012 45.280  1.00 17.79  ? 40  GLY A N   1 
ATOM   312  C  CA  . GLY A 1 40  ? -39.643 26.652 44.497  1.00 16.60  ? 40  GLY A CA  1 
ATOM   313  C  C   . GLY A 1 40  ? -39.836 25.751 43.297  1.00 16.08  ? 40  GLY A C   1 
ATOM   314  O  O   . GLY A 1 40  ? -38.874 25.289 42.730  1.00 17.99  ? 40  GLY A O   1 
ATOM   315  N  N   . VAL A 1 41  ? -41.083 25.544 42.864  1.00 15.29  ? 41  VAL A N   1 
ATOM   316  C  CA  . VAL A 1 41  ? -41.362 24.720 41.701  1.00 14.19  ? 41  VAL A CA  1 
ATOM   317  C  C   . VAL A 1 41  ? -40.834 25.418 40.432  1.00 13.04  ? 41  VAL A C   1 
ATOM   318  O  O   . VAL A 1 41  ? -40.280 24.749 39.574  1.00 13.46  ? 41  VAL A O   1 
ATOM   319  C  CB  . VAL A 1 41  ? -42.842 24.379 41.579  1.00 14.44  ? 41  VAL A CB  1 
ATOM   320  C  CG1 . VAL A 1 41  ? -43.134 23.475 40.350  1.00 15.95  ? 41  VAL A CG1 1 
ATOM   321  C  CG2 . VAL A 1 41  ? -43.408 23.742 42.889  1.00 18.07  ? 41  VAL A CG2 1 
ATOM   322  N  N   . ILE A 1 42  ? -41.067 26.747 40.384  1.00 12.56  ? 42  ILE A N   1 
ATOM   323  C  CA  . ILE A 1 42  ? -40.647 27.600 39.281  1.00 11.56  ? 42  ILE A CA  1 
ATOM   324  C  C   . ILE A 1 42  ? -39.889 28.773 39.789  1.00 10.89  ? 42  ILE A C   1 
ATOM   325  O  O   . ILE A 1 42  ? -40.064 29.114 41.015  1.00 13.41  ? 42  ILE A O   1 
ATOM   326  C  CB  . ILE A 1 42  ? -41.842 28.023 38.398  1.00 10.53  ? 42  ILE A CB  1 
ATOM   327  C  CG1 . ILE A 1 42  ? -42.830 28.894 39.187  1.00 12.18  ? 42  ILE A CG1 1 
ATOM   328  C  CG2 . ILE A 1 42  ? -42.466 26.791 37.775  1.00 13.10  ? 42  ILE A CG2 1 
ATOM   329  C  CD1 . ILE A 1 42  ? -43.991 29.412 38.341  1.00 13.15  ? 42  ILE A CD1 1 
ATOM   330  N  N   . ILE A 1 43  ? -39.098 29.439 38.999  1.00 11.05  ? 43  ILE A N   1 
ATOM   331  C  CA  . ILE A 1 43  ? -38.429 30.662 39.304  1.00 10.69  ? 43  ILE A CA  1 
ATOM   332  C  C   . ILE A 1 43  ? -39.324 31.843 39.146  1.00 10.84  ? 43  ILE A C   1 
ATOM   333  O  O   . ILE A 1 43  ? -39.448 32.710 40.018  1.00 12.36  ? 43  ILE A O   1 
ATOM   334  C  CB  . ILE A 1 43  ? -37.115 30.812 38.540  1.00 11.45  ? 43  ILE A CB  1 
ATOM   335  C  CG1 . ILE A 1 43  ? -36.120 29.677 38.884  1.00 13.50  ? 43  ILE A CG1 1 
ATOM   336  C  CG2 . ILE A 1 43  ? -36.453 32.200 38.769  1.00 13.39  ? 43  ILE A CG2 1 
ATOM   337  C  CD1 . ILE A 1 43  ? -34.955 29.607 37.959  1.00 15.86  ? 43  ILE A CD1 1 
ATOM   338  N  N   . ASP A 1 44  ? -40.001 31.953 37.969  1.00 11.23  ? 44  ASP A N   1 
ATOM   339  C  CA  . ASP A 1 44  ? -40.801 33.133 37.652  1.00 10.94  ? 44  ASP A CA  1 
ATOM   340  C  C   . ASP A 1 44  ? -41.824 32.752 36.603  1.00 9.90   ? 44  ASP A C   1 
ATOM   341  O  O   . ASP A 1 44  ? -41.838 31.648 36.110  1.00 10.54  ? 44  ASP A O   1 
ATOM   342  C  CB  . ASP A 1 44  ? -39.877 34.334 37.244  1.00 10.80  ? 44  ASP A CB  1 
ATOM   343  C  CG  . ASP A 1 44  ? -40.454 35.693 37.482  1.00 11.28  ? 44  ASP A CG  1 
ATOM   344  O  OD1 . ASP A 1 44  ? -41.629 35.834 37.887  1.00 12.70  ? 44  ASP A OD1 1 
ATOM   345  O  OD2 . ASP A 1 44  ? -39.707 36.665 37.281  1.00 13.32  ? 44  ASP A OD2 1 
ATOM   346  N  N   . TYR A 1 45  ? -42.682 33.747 36.316  1.00 10.62  ? 45  TYR A N   1 
ATOM   347  C  CA  . TYR A 1 45  ? -43.837 33.443 35.434  1.00 10.26  ? 45  TYR A CA  1 
ATOM   348  C  C   . TYR A 1 45  ? -44.417 34.733 34.914  1.00 10.01  ? 45  TYR A C   1 
ATOM   349  O  O   . TYR A 1 45  ? -44.164 35.818 35.407  1.00 10.44  ? 45  TYR A O   1 
ATOM   350  C  CB  . TYR A 1 45  ? -44.952 32.645 36.191  1.00 10.69  ? 45  TYR A CB  1 
ATOM   351  C  CG  . TYR A 1 45  ? -45.476 33.405 37.350  1.00 11.46  ? 45  TYR A CG  1 
ATOM   352  C  CD1 . TYR A 1 45  ? -44.793 33.383 38.579  1.00 13.37  ? 45  TYR A CD1 1 
ATOM   353  C  CD2 . TYR A 1 45  ? -46.598 34.143 37.256  1.00 12.07  ? 45  TYR A CD2 1 
ATOM   354  C  CE1 . TYR A 1 45  ? -45.216 34.170 39.612  1.00 13.60  ? 45  TYR A CE1 1 
ATOM   355  C  CE2 . TYR A 1 45  ? -47.079 34.920 38.260  1.00 12.97  ? 45  TYR A CE2 1 
ATOM   356  C  CZ  . TYR A 1 45  ? -46.386 34.912 39.490  1.00 14.47  ? 45  TYR A CZ  1 
ATOM   357  O  OH  . TYR A 1 45  ? -46.819 35.742 40.544  1.00 16.12  ? 45  TYR A OH  1 
ATOM   358  N  N   . PHE A 1 46  ? -45.217 34.579 33.863  1.00 9.52   ? 46  PHE A N   1 
ATOM   359  C  CA  . PHE A 1 46  ? -46.061 35.636 33.320  1.00 9.25   ? 46  PHE A CA  1 
ATOM   360  C  C   . PHE A 1 46  ? -47.299 34.970 32.702  1.00 9.21   ? 46  PHE A C   1 
ATOM   361  O  O   . PHE A 1 46  ? -47.196 33.980 32.085  1.00 10.87  ? 46  PHE A O   1 
ATOM   362  C  CB  . PHE A 1 46  ? -45.252 36.494 32.321  1.00 10.73  ? 46  PHE A CB  1 
ATOM   363  C  CG  . PHE A 1 46  ? -45.730 37.934 32.239  1.00 9.84   ? 46  PHE A CG  1 
ATOM   364  C  CD1 . PHE A 1 46  ? -45.302 38.874 33.136  1.00 11.77  ? 46  PHE A CD1 1 
ATOM   365  C  CD2 . PHE A 1 46  ? -46.647 38.322 31.287  1.00 13.63  ? 46  PHE A CD2 1 
ATOM   366  C  CE1 . PHE A 1 46  ? -45.767 40.148 33.061  1.00 14.89  ? 46  PHE A CE1 1 
ATOM   367  C  CE2 . PHE A 1 46  ? -47.044 39.646 31.239  1.00 15.53  ? 46  PHE A CE2 1 
ATOM   368  C  CZ  . PHE A 1 46  ? -46.632 40.486 32.162  1.00 15.80  ? 46  PHE A CZ  1 
ATOM   369  N  N   . VAL A 1 47  ? -48.439 35.571 32.918  1.00 8.53   ? 47  VAL A N   1 
ATOM   370  C  CA  . VAL A 1 47  ? -49.721 35.019 32.494  1.00 7.25   ? 47  VAL A CA  1 
ATOM   371  C  C   . VAL A 1 47  ? -50.415 36.022 31.562  1.00 8.51   ? 47  VAL A C   1 
ATOM   372  O  O   . VAL A 1 47  ? -50.508 37.124 31.864  1.00 9.85   ? 47  VAL A O   1 
ATOM   373  C  CB  . VAL A 1 47  ? -50.648 34.738 33.736  1.00 6.19   ? 47  VAL A CB  1 
ATOM   374  C  CG1 . VAL A 1 47  ? -51.997 34.250 33.328  1.00 4.80   ? 47  VAL A CG1 1 
ATOM   375  C  CG2 . VAL A 1 47  ? -49.962 33.709 34.686  1.00 8.55   ? 47  VAL A CG2 1 
ATOM   376  N  N   . TYR A 1 48  ? -50.882 35.520 30.440  1.00 8.44   ? 48  TYR A N   1 
ATOM   377  C  CA  . TYR A 1 48  ? -51.478 36.406 29.426  1.00 8.36   ? 48  TYR A CA  1 
ATOM   378  C  C   . TYR A 1 48  ? -52.350 35.615 28.473  1.00 7.67   ? 48  TYR A C   1 
ATOM   379  O  O   . TYR A 1 48  ? -52.227 34.450 28.366  1.00 9.71   ? 48  TYR A O   1 
ATOM   380  C  CB  . TYR A 1 48  ? -50.389 37.201 28.670  1.00 8.70   ? 48  TYR A CB  1 
ATOM   381  C  CG  . TYR A 1 48  ? -49.307 36.343 28.051  1.00 8.33   ? 48  TYR A CG  1 
ATOM   382  C  CD1 . TYR A 1 48  ? -48.279 35.862 28.838  1.00 9.34   ? 48  TYR A CD1 1 
ATOM   383  C  CD2 . TYR A 1 48  ? -49.316 35.988 26.705  1.00 8.99   ? 48  TYR A CD2 1 
ATOM   384  C  CE1 . TYR A 1 48  ? -47.331 35.085 28.337  1.00 9.15   ? 48  TYR A CE1 1 
ATOM   385  C  CE2 . TYR A 1 48  ? -48.324 35.202 26.184  1.00 9.06   ? 48  TYR A CE2 1 
ATOM   386  C  CZ  . TYR A 1 48  ? -47.337 34.748 27.031  1.00 9.43   ? 48  TYR A CZ  1 
ATOM   387  O  OH  . TYR A 1 48  ? -46.380 33.946 26.526  1.00 10.04  ? 48  TYR A OH  1 
ATOM   388  N  N   . ASN A 1 49  ? -53.274 36.323 27.814  1.00 7.99   ? 49  ASN A N   1 
ATOM   389  C  CA  . ASN A 1 49  ? -54.083 35.709 26.801  1.00 7.97   ? 49  ASN A CA  1 
ATOM   390  C  C   . ASN A 1 49  ? -53.930 36.431 25.463  1.00 7.05   ? 49  ASN A C   1 
ATOM   391  O  O   . ASN A 1 49  ? -53.614 37.617 25.428  1.00 8.31   ? 49  ASN A O   1 
ATOM   392  C  CB  . ASN A 1 49  ? -55.578 35.710 27.115  1.00 9.10   ? 49  ASN A CB  1 
ATOM   393  C  CG  . ASN A 1 49  ? -56.185 37.103 27.082  1.00 8.48   ? 49  ASN A CG  1 
ATOM   394  O  OD1 . ASN A 1 49  ? -57.131 37.353 26.165  1.00 12.26  ? 49  ASN A OD1 1 
ATOM   395  N  ND2 . ASN A 1 49  ? -55.749 37.976 27.851  1.00 6.38   ? 49  ASN A ND2 1 
ATOM   396  N  N   . VAL A 1 50  ? -54.224 35.726 24.401  1.00 7.49   ? 50  VAL A N   1 
ATOM   397  C  CA  . VAL A 1 50  ? -54.551 36.315 23.076  1.00 7.10   ? 50  VAL A CA  1 
ATOM   398  C  C   . VAL A 1 50  ? -55.835 35.639 22.699  1.00 5.88   ? 50  VAL A C   1 
ATOM   399  O  O   . VAL A 1 50  ? -55.950 34.408 22.671  1.00 7.48   ? 50  VAL A O   1 
ATOM   400  C  CB  . VAL A 1 50  ? -53.444 36.148 22.043  1.00 7.35   ? 50  VAL A CB  1 
ATOM   401  C  CG1 . VAL A 1 50  ? -53.945 36.540 20.631  1.00 8.64   ? 50  VAL A CG1 1 
ATOM   402  C  CG2 . VAL A 1 50  ? -52.210 36.924 22.453  1.00 9.47   ? 50  VAL A CG2 1 
ATOM   403  N  N   . GLY A 1 51  ? -56.920 36.408 22.470  1.00 7.41   ? 51  GLY A N   1 
ATOM   404  C  CA  . GLY A 1 51  ? -58.200 35.795 22.228  1.00 7.74   ? 51  GLY A CA  1 
ATOM   405  C  C   . GLY A 1 51  ? -58.613 34.907 23.408  1.00 6.90   ? 51  GLY A C   1 
ATOM   406  O  O   . GLY A 1 51  ? -58.524 35.358 24.557  1.00 8.27   ? 51  GLY A O   1 
ATOM   407  N  N   . ASP A 1 52  ? -59.084 33.710 23.124  1.00 7.14   ? 52  ASP A N   1 
ATOM   408  C  CA  . ASP A 1 52  ? -59.549 32.779 24.137  1.00 7.92   ? 52  ASP A CA  1 
ATOM   409  C  C   . ASP A 1 52  ? -58.449 31.847 24.655  1.00 7.84   ? 52  ASP A C   1 
ATOM   410  O  O   . ASP A 1 52  ? -58.813 30.897 25.365  1.00 9.40   ? 52  ASP A O   1 
ATOM   411  C  CB  . ASP A 1 52  ? -60.805 32.018 23.683  1.00 7.90   ? 52  ASP A CB  1 
ATOM   412  C  CG  . ASP A 1 52  ? -60.582 31.170 22.456  1.00 8.03   ? 52  ASP A CG  1 
ATOM   413  O  OD1 . ASP A 1 52  ? -59.485 31.134 21.921  1.00 8.48   ? 52  ASP A OD1 1 
ATOM   414  O  OD2 . ASP A 1 52  ? -61.634 30.485 22.097  1.00 9.40   ? 52  ASP A OD2 1 
ATOM   415  N  N   . ASP A 1 53  ? -57.205 32.113 24.401  1.00 7.44   ? 53  ASP A N   1 
ATOM   416  C  CA  . ASP A 1 53  ? -56.078 31.248 24.788  1.00 8.25   ? 53  ASP A CA  1 
ATOM   417  C  C   . ASP A 1 53  ? -55.264 31.835 25.873  1.00 7.82   ? 53  ASP A C   1 
ATOM   418  O  O   . ASP A 1 53  ? -54.697 32.923 25.691  1.00 8.57   ? 53  ASP A O   1 
ATOM   419  C  CB  . ASP A 1 53  ? -55.259 30.873 23.572  1.00 9.27   ? 53  ASP A CB  1 
ATOM   420  C  CG  . ASP A 1 53  ? -56.109 30.025 22.730  1.00 10.42  ? 53  ASP A CG  1 
ATOM   421  O  OD1 . ASP A 1 53  ? -56.268 28.811 23.007  1.00 11.60  ? 53  ASP A OD1 1 
ATOM   422  O  OD2 . ASP A 1 53  ? -56.685 30.564 21.778  1.00 10.36  ? 53  ASP A OD2 1 
ATOM   423  N  N   . ILE A 1 54  ? -55.070 31.100 26.981  1.00 8.10   ? 54  ILE A N   1 
ATOM   424  C  CA  . ILE A 1 54  ? -54.224 31.550 28.097  1.00 9.32   ? 54  ILE A CA  1 
ATOM   425  C  C   . ILE A 1 54  ? -52.856 30.884 28.024  1.00 7.78   ? 54  ILE A C   1 
ATOM   426  O  O   . ILE A 1 54  ? -52.764 29.642 27.977  1.00 9.30   ? 54  ILE A O   1 
ATOM   427  C  CB  . ILE A 1 54  ? -54.878 31.213 29.451  1.00 9.52   ? 54  ILE A CB  1 
ATOM   428  C  CG1 . ILE A 1 54  ? -56.227 31.900 29.565  1.00 11.94  ? 54  ILE A CG1 1 
ATOM   429  C  CG2 . ILE A 1 54  ? -53.925 31.528 30.598  1.00 11.11  ? 54  ILE A CG2 1 
ATOM   430  C  CD1 . ILE A 1 54  ? -57.051 31.546 30.765  1.00 15.44  ? 54  ILE A CD1 1 
ATOM   431  N  N   . SER A 1 55  ? -51.825 31.675 27.953  1.00 7.37   ? 55  SER A N   1 
ATOM   432  C  CA  . SER A 1 55  ? -50.448 31.265 28.038  1.00 7.65   ? 55  SER A CA  1 
ATOM   433  C  C   . SER A 1 55  ? -49.938 31.424 29.451  1.00 8.01   ? 55  SER A C   1 
ATOM   434  O  O   . SER A 1 55  ? -50.026 32.493 30.050  1.00 8.60   ? 55  SER A O   1 
ATOM   435  C  CB  . SER A 1 55  ? -49.559 32.097 27.116  1.00 7.76   ? 55  SER A CB  1 
ATOM   436  O  OG  . SER A 1 55  ? -49.714 31.772 25.756  1.00 8.35   ? 55  SER A OG  1 
ATOM   437  N  N   . LEU A 1 56  ? -49.330 30.326 29.936  1.00 8.33   ? 56  LEU A N   1 
ATOM   438  C  CA  . LEU A 1 56  ? -48.566 30.357 31.220  1.00 9.21   ? 56  LEU A CA  1 
ATOM   439  C  C   . LEU A 1 56  ? -47.100 30.289 30.824  1.00 8.33   ? 56  LEU A C   1 
ATOM   440  O  O   . LEU A 1 56  ? -46.584 29.210 30.428  1.00 9.49   ? 56  LEU A O   1 
ATOM   441  C  CB  . LEU A 1 56  ? -48.926 29.179 32.078  1.00 9.38   ? 56  LEU A CB  1 
ATOM   442  C  CG  . LEU A 1 56  ? -50.410 28.936 32.347  1.00 9.99   ? 56  LEU A CG  1 
ATOM   443  C  CD1 . LEU A 1 56  ? -50.639 27.664 33.209  1.00 11.74  ? 56  LEU A CD1 1 
ATOM   444  C  CD2 . LEU A 1 56  ? -51.097 30.137 32.948  1.00 11.51  ? 56  LEU A CD2 1 
ATOM   445  N  N   . LEU A 1 57  ? -46.402 31.384 30.891  1.00 8.91   ? 57  LEU A N   1 
ATOM   446  C  CA  . LEU A 1 57  ? -44.996 31.451 30.638  1.00 9.17   ? 57  LEU A CA  1 
ATOM   447  C  C   . LEU A 1 57  ? -44.311 31.208 31.985  1.00 9.34   ? 57  LEU A C   1 
ATOM   448  O  O   . LEU A 1 57  ? -44.568 31.925 32.930  1.00 10.50  ? 57  LEU A O   1 
ATOM   449  C  CB  . LEU A 1 57  ? -44.589 32.774 30.059  1.00 10.00  ? 57  LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 57  ? -43.116 33.041 29.915  1.00 11.14  ? 57  LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 57  ? -42.379 32.198 29.038  1.00 13.68  ? 57  LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 57  ? -42.867 34.562 29.505  1.00 14.05  ? 57  LEU A CD2 1 
ATOM   453  N  N   . MET A 1 58  ? -43.425 30.225 32.060  1.00 9.31   ? 58  MET A N   1 
ATOM   454  C  CA  . MET A 1 58  ? -42.755 29.860 33.324  1.00 10.40  ? 58  MET A CA  1 
ATOM   455  C  C   . MET A 1 58  ? -41.253 29.659 33.073  1.00 10.00  ? 58  MET A C   1 
ATOM   456  O  O   . MET A 1 58  ? -40.882 29.002 32.127  1.00 11.24  ? 58  MET A O   1 
ATOM   457  C  CB  . MET A 1 58  ? -43.317 28.543 33.876  1.00 11.83  ? 58  MET A CB  1 
ATOM   458  C  CG  . MET A 1 58  ? -44.792 28.609 34.241  1.00 12.03  ? 58  MET A CG  1 
ATOM   459  S  SD  . MET A 1 58  ? -45.520 27.001 34.618  1.00 15.11  ? 58  MET A SD  1 
ATOM   460  C  CE  . MET A 1 58  ? -45.654 26.280 32.977  1.00 15.35  ? 58  MET A CE  1 
ATOM   461  N  N   . THR A 1 59  ? -40.424 30.165 33.974  1.00 9.32   ? 59  THR A N   1 
ATOM   462  C  CA  . THR A 1 59  ? -39.038 29.879 33.971  1.00 9.31   ? 59  THR A CA  1 
ATOM   463  C  C   . THR A 1 59  ? -38.694 28.971 35.175  1.00 9.50   ? 59  THR A C   1 
ATOM   464  O  O   . THR A 1 59  ? -39.334 29.102 36.218  1.00 10.55  ? 59  THR A O   1 
ATOM   465  C  CB  . THR A 1 59  ? -38.202 31.137 33.994  1.00 9.71   ? 59  THR A CB  1 
ATOM   466  O  OG1 . THR A 1 59  ? -38.589 31.879 35.154  1.00 11.44  ? 59  THR A OG1 1 
ATOM   467  C  CG2 . THR A 1 59  ? -38.337 31.939 32.700  1.00 11.39  ? 59  THR A CG2 1 
ATOM   468  N  N   . HIS A 1 60  ? -37.747 28.077 34.928  1.00 9.66   ? 60  HIS A N   1 
ATOM   469  C  CA  . HIS A 1 60  ? -37.468 27.056 35.941  1.00 9.60   ? 60  HIS A CA  1 
ATOM   470  C  C   . HIS A 1 60  ? -36.175 26.394 35.509  1.00 10.71  ? 60  HIS A C   1 
ATOM   471  O  O   . HIS A 1 60  ? -35.589 26.688 34.498  1.00 10.18  ? 60  HIS A O   1 
ATOM   472  C  CB  . HIS A 1 60  ? -38.659 26.081 36.028  1.00 9.26   ? 60  HIS A CB  1 
ATOM   473  C  CG  . HIS A 1 60  ? -38.918 25.340 34.761  1.00 9.60   ? 60  HIS A CG  1 
ATOM   474  N  ND1 . HIS A 1 60  ? -38.277 24.162 34.433  1.00 10.06  ? 60  HIS A ND1 1 
ATOM   475  C  CD2 . HIS A 1 60  ? -39.709 25.680 33.688  1.00 10.27  ? 60  HIS A CD2 1 
ATOM   476  C  CE1 . HIS A 1 60  ? -38.693 23.787 33.213  1.00 10.39  ? 60  HIS A CE1 1 
ATOM   477  N  NE2 . HIS A 1 60  ? -39.568 24.715 32.751  1.00 10.40  ? 60  HIS A NE2 1 
ATOM   478  N  N   . THR A 1 61  ? -35.762 25.418 36.357  1.00 10.09  ? 61  THR A N   1 
ATOM   479  C  CA  . THR A 1 61  ? -34.545 24.689 36.082  1.00 10.18  ? 61  THR A CA  1 
ATOM   480  C  C   . THR A 1 61  ? -34.767 23.182 36.007  1.00 10.94  ? 61  THR A C   1 
ATOM   481  O  O   . THR A 1 61  ? -33.831 22.385 36.269  1.00 11.45  ? 61  THR A O   1 
ATOM   482  C  CB  . THR A 1 61  ? -33.448 25.083 37.079  1.00 10.91  ? 61  THR A CB  1 
ATOM   483  O  OG1 . THR A 1 61  ? -33.874 24.834 38.423  1.00 11.49  ? 61  THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 61  ? -33.028 26.565 36.931  1.00 12.62  ? 61  THR A CG2 1 
ATOM   485  N  N   . LYS A 1 62  ? -35.957 22.751 35.640  1.00 10.34  ? 62  LYS A N   1 
ATOM   486  C  CA  . LYS A 1 62  ? -36.329 21.351 35.586  1.00 11.46  ? 62  LYS A CA  1 
ATOM   487  C  C   . LYS A 1 62  ? -36.179 20.712 34.208  1.00 11.95  ? 62  LYS A C   1 
ATOM   488  O  O   . LYS A 1 62  ? -36.408 19.508 34.087  1.00 13.00  ? 62  LYS A O   1 
ATOM   489  C  CB  . LYS A 1 62  ? -37.691 21.114 36.191  1.00 11.56  ? 62  LYS A CB  1 
ATOM   490  C  CG  . LYS A 1 62  ? -37.801 21.405 37.663  1.00 11.86  ? 62  LYS A CG  1 
ATOM   491  C  CD  . LYS A 1 62  ? -39.179 21.206 38.219  1.00 13.83  ? 62  LYS A CD  1 
ATOM   492  C  CE  . LYS A 1 62  ? -39.316 21.183 39.704  1.00 15.47  ? 62  LYS A CE  1 
ATOM   493  N  NZ  . LYS A 1 62  ? -38.783 22.371 40.409  1.00 14.51  ? 62  LYS A NZ  1 
ATOM   494  N  N   . GLY A 1 63  ? -35.745 21.473 33.209  1.00 12.18  ? 63  GLY A N   1 
ATOM   495  C  CA  . GLY A 1 63  ? -35.531 20.936 31.868  1.00 12.52  ? 63  GLY A CA  1 
ATOM   496  C  C   . GLY A 1 63  ? -36.852 20.824 31.079  1.00 11.94  ? 63  GLY A C   1 
ATOM   497  O  O   . GLY A 1 63  ? -37.908 21.094 31.590  1.00 11.79  ? 63  GLY A O   1 
ATOM   498  N  N   . GLU A 1 64  ? -36.633 20.456 29.812  1.00 13.34  ? 64  GLU A N   1 
ATOM   499  C  CA  . GLU A 1 64  ? -37.772 20.280 28.884  1.00 13.83  ? 64  GLU A CA  1 
ATOM   500  C  C   . GLU A 1 64  ? -38.545 18.998 29.233  1.00 14.22  ? 64  GLU A C   1 
ATOM   501  O  O   . GLU A 1 64  ? -37.978 18.022 29.795  1.00 14.62  ? 64  GLU A O   1 
ATOM   502  C  CB  . GLU A 1 64  ? -37.289 20.249 27.436  1.00 14.80  ? 64  GLU A CB  1 
ATOM   503  C  CG  . GLU A 1 64  ? -36.569 21.511 26.977  1.00 16.07  ? 64  GLU A CG  1 
ATOM   504  C  CD  . GLU A 1 64  ? -36.263 21.444 25.521  1.00 22.39  ? 64  GLU A CD  1 
ATOM   505  O  OE1 . GLU A 1 64  ? -37.219 21.301 24.699  1.00 25.54  ? 64  GLU A OE1 1 
ATOM   506  O  OE2 . GLU A 1 64  ? -35.153 21.726 25.180  1.00 29.91  ? 64  GLU A OE2 1 
ATOM   507  N  N   . ASP A 1 65  ? -39.818 18.960 28.856  1.00 13.04  ? 65  ASP A N   1 
ATOM   508  C  CA  . ASP A 1 65  ? -40.618 17.761 28.985  1.00 14.97  ? 65  ASP A CA  1 
ATOM   509  C  C   . ASP A 1 65  ? -40.631 17.309 30.424  1.00 13.82  ? 65  ASP A C   1 
ATOM   510  O  O   . ASP A 1 65  ? -40.660 16.073 30.709  1.00 17.80  ? 65  ASP A O   1 
ATOM   511  C  CB  . ASP A 1 65  ? -40.158 16.658 28.061  1.00 16.44  ? 65  ASP A CB  1 
ATOM   512  C  CG  . ASP A 1 65  ? -40.301 17.012 26.611  1.00 22.81  ? 65  ASP A CG  1 
ATOM   513  O  OD1 . ASP A 1 65  ? -41.442 17.359 26.263  1.00 30.40  ? 65  ASP A OD1 1 
ATOM   514  O  OD2 . ASP A 1 65  ? -39.261 16.974 25.903  1.00 34.71  ? 65  ASP A OD2 1 
ATOM   515  N  N   . ASN A 1 66  ? -40.713 18.234 31.370  1.00 13.13  ? 66  ASN A N   1 
ATOM   516  C  CA  . ASN A 1 66  ? -40.716 17.877 32.758  1.00 11.71  ? 66  ASN A CA  1 
ATOM   517  C  C   . ASN A 1 66  ? -42.147 17.684 33.302  1.00 12.76  ? 66  ASN A C   1 
ATOM   518  O  O   . ASN A 1 66  ? -43.007 18.550 33.195  1.00 13.73  ? 66  ASN A O   1 
ATOM   519  C  CB  . ASN A 1 66  ? -40.020 18.958 33.589  1.00 12.72  ? 66  ASN A CB  1 
ATOM   520  C  CG  . ASN A 1 66  ? -40.053 18.594 35.073  1.00 12.89  ? 66  ASN A CG  1 
ATOM   521  O  OD1 . ASN A 1 66  ? -40.903 19.061 35.817  1.00 13.47  ? 66  ASN A OD1 1 
ATOM   522  N  ND2 . ASN A 1 66  ? -39.122 17.697 35.487  1.00 14.84  ? 66  ASN A ND2 1 
ATOM   523  N  N   . LYS A 1 67  ? -42.369 16.554 33.930  1.00 13.49  ? 67  LYS A N   1 
ATOM   524  C  CA  . LYS A 1 67  ? -43.643 16.221 34.416  1.00 15.91  ? 67  LYS A CA  1 
ATOM   525  C  C   . LYS A 1 67  ? -44.197 17.164 35.474  1.00 14.60  ? 67  LYS A C   1 
ATOM   526  O  O   . LYS A 1 67  ? -45.458 17.374 35.581  1.00 15.84  ? 67  LYS A O   1 
ATOM   527  C  CB  . LYS A 1 67  ? -43.761 14.735 34.895  1.00 19.60  ? 67  LYS A CB  1 
ATOM   528  C  CG  . LYS A 1 67  ? -43.734 13.772 33.699  1.00 28.46  ? 67  LYS A CG  1 
ATOM   529  C  CD  . LYS A 1 67  ? -44.030 12.286 34.135  1.00 39.95  ? 67  LYS A CD  1 
ATOM   530  C  CE  . LYS A 1 67  ? -42.819 11.461 34.448  1.00 46.12  ? 67  LYS A CE  1 
ATOM   531  N  NZ  . LYS A 1 67  ? -41.917 12.132 35.439  1.00 48.82  ? 67  LYS A NZ  1 
ATOM   532  N  N   A ASP A 1 68  ? -43.320 17.721 36.323  0.50 13.96  ? 68  ASP A N   1 
ATOM   533  N  N   B ASP A 1 68  ? -43.350 17.734 36.324  0.50 14.14  ? 68  ASP A N   1 
ATOM   534  C  CA  A ASP A 1 68  ? -43.737 18.628 37.372  0.50 14.59  ? 68  ASP A CA  1 
ATOM   535  C  CA  B ASP A 1 68  ? -43.868 18.619 37.322  0.50 15.29  ? 68  ASP A CA  1 
ATOM   536  C  C   A ASP A 1 68  ? -44.253 19.957 36.751  0.50 12.84  ? 68  ASP A C   1 
ATOM   537  C  C   B ASP A 1 68  ? -44.248 19.993 36.761  0.50 13.26  ? 68  ASP A C   1 
ATOM   538  O  O   A ASP A 1 68  ? -45.290 20.503 37.201  0.50 13.85  ? 68  ASP A O   1 
ATOM   539  O  O   B ASP A 1 68  ? -45.238 20.581 37.223  0.50 14.28  ? 68  ASP A O   1 
ATOM   540  C  CB  A ASP A 1 68  ? -42.629 18.961 38.392  0.50 15.12  ? 68  ASP A CB  1 
ATOM   541  C  CB  B ASP A 1 68  ? -42.994 18.674 38.534  0.50 16.98  ? 68  ASP A CB  1 
ATOM   542  C  CG  A ASP A 1 68  ? -42.201 17.742 39.267  0.50 20.83  ? 68  ASP A CG  1 
ATOM   543  C  CG  B ASP A 1 68  ? -43.065 17.346 39.306  0.50 22.45  ? 68  ASP A CG  1 
ATOM   544  O  OD1 A ASP A 1 68  ? -42.589 16.572 39.024  0.50 22.30  ? 68  ASP A OD1 1 
ATOM   545  O  OD1 B ASP A 1 68  ? -44.157 16.921 39.787  0.50 26.50  ? 68  ASP A OD1 1 
ATOM   546  O  OD2 A ASP A 1 68  ? -41.514 18.029 40.255  0.50 25.26  ? 68  ASP A OD2 1 
ATOM   547  O  OD2 B ASP A 1 68  ? -42.012 16.705 39.310  0.50 27.61  ? 68  ASP A OD2 1 
ATOM   548  N  N   . ILE A 1 69  ? -43.499 20.474 35.789  1.00 12.25  ? 69  ILE A N   1 
ATOM   549  C  CA  . ILE A 1 69  ? -43.878 21.727 35.145  1.00 11.58  ? 69  ILE A CA  1 
ATOM   550  C  C   . ILE A 1 69  ? -45.128 21.524 34.293  1.00 11.08  ? 69  ILE A C   1 
ATOM   551  O  O   . ILE A 1 69  ? -46.071 22.345 34.375  1.00 11.90  ? 69  ILE A O   1 
ATOM   552  C  CB  . ILE A 1 69  ? -42.735 22.262 34.283  1.00 11.61  ? 69  ILE A CB  1 
ATOM   553  C  CG1 . ILE A 1 69  ? -41.514 22.542 35.156  1.00 11.80  ? 69  ILE A CG1 1 
ATOM   554  C  CG2 . ILE A 1 69  ? -43.137 23.531 33.493  1.00 12.54  ? 69  ILE A CG2 1 
ATOM   555  C  CD1 . ILE A 1 69  ? -41.711 23.512 36.332  1.00 14.28  ? 69  ILE A CD1 1 
ATOM   556  N  N   . HIS A 1 70  ? -45.155 20.487 33.477  1.00 12.08  ? 70  HIS A N   1 
ATOM   557  C  CA  . HIS A 1 70  ? -46.341 20.205 32.671  1.00 12.04  ? 70  HIS A CA  1 
ATOM   558  C  C   . HIS A 1 70  ? -47.551 19.954 33.570  1.00 12.32  ? 70  HIS A C   1 
ATOM   559  O  O   . HIS A 1 70  ? -48.673 20.395 33.309  1.00 14.41  ? 70  HIS A O   1 
ATOM   560  C  CB  . HIS A 1 70  ? -46.070 19.070 31.736  1.00 12.66  ? 70  HIS A CB  1 
ATOM   561  C  CG  . HIS A 1 70  ? -45.181 19.341 30.573  1.00 13.50  ? 70  HIS A CG  1 
ATOM   562  N  ND1 . HIS A 1 70  ? -44.044 20.134 30.531  1.00 18.06  ? 70  HIS A ND1 1 
ATOM   563  C  CD2 . HIS A 1 70  ? -45.290 18.821 29.339  1.00 16.87  ? 70  HIS A CD2 1 
ATOM   564  C  CE1 . HIS A 1 70  ? -43.526 20.114 29.299  1.00 12.52  ? 70  HIS A CE1 1 
ATOM   565  N  NE2 . HIS A 1 70  ? -44.270 19.312 28.578  1.00 22.82  ? 70  HIS A NE2 1 
ATOM   566  N  N   . GLY A 1 71  ? -47.356 19.261 34.677  1.00 13.61  ? 71  GLY A N   1 
ATOM   567  C  CA  . GLY A 1 71  ? -48.409 18.978 35.639  1.00 14.03  ? 71  GLY A CA  1 
ATOM   568  C  C   . GLY A 1 71  ? -48.891 20.196 36.378  1.00 12.78  ? 71  GLY A C   1 
ATOM   569  O  O   . GLY A 1 71  ? -50.097 20.372 36.635  1.00 14.76  ? 71  GLY A O   1 
ATOM   570  N  N   . LEU A 1 72  ? -47.996 21.145 36.720  1.00 13.42  ? 72  LEU A N   1 
ATOM   571  C  CA  . LEU A 1 72  ? -48.364 22.416 37.324  1.00 12.75  ? 72  LEU A CA  1 
ATOM   572  C  C   . LEU A 1 72  ? -49.316 23.186 36.347  1.00 11.85  ? 72  LEU A C   1 
ATOM   573  O  O   . LEU A 1 72  ? -50.341 23.709 36.777  1.00 12.11  ? 72  LEU A O   1 
ATOM   574  C  CB  . LEU A 1 72  ? -47.144 23.225 37.621  1.00 12.61  ? 72  LEU A CB  1 
ATOM   575  C  CG  . LEU A 1 72  ? -47.420 24.658 38.107  1.00 13.14  ? 72  LEU A CG  1 
ATOM   576  C  CD1 . LEU A 1 72  ? -48.230 24.803 39.326  1.00 15.36  ? 72  LEU A CD1 1 
ATOM   577  C  CD2 . LEU A 1 72  ? -46.078 25.468 38.283  1.00 13.92  ? 72  LEU A CD2 1 
ATOM   578  N  N   . ALA A 1 73  ? -48.937 23.199 35.099  1.00 12.07  ? 73  ALA A N   1 
ATOM   579  C  CA  . ALA A 1 73  ? -49.803 23.878 34.120  1.00 11.27  ? 73  ALA A CA  1 
ATOM   580  C  C   . ALA A 1 73  ? -51.144 23.223 34.000  1.00 11.34  ? 73  ALA A C   1 
ATOM   581  O  O   . ALA A 1 73  ? -52.194 23.872 34.022  1.00 12.73  ? 73  ALA A O   1 
ATOM   582  C  CB  . ALA A 1 73  ? -49.071 23.940 32.771  1.00 12.94  ? 73  ALA A CB  1 
ATOM   583  N  N   . TRP A 1 74  ? -51.151 21.891 33.890  1.00 12.07  ? 74  TRP A N   1 
ATOM   584  C  CA  A TRP A 1 74  ? -52.417 21.165 33.754  0.50 13.62  ? 74  TRP A CA  1 
ATOM   585  C  CA  B TRP A 1 74  ? -52.402 21.179 33.737  0.50 13.49  ? 74  TRP A CA  1 
ATOM   586  C  C   . TRP A 1 74  ? -53.283 21.447 34.945  1.00 14.13  ? 74  TRP A C   1 
ATOM   587  O  O   . TRP A 1 74  ? -54.503 21.712 34.794  1.00 14.61  ? 74  TRP A O   1 
ATOM   588  C  CB  A TRP A 1 74  ? -52.209 19.657 33.595  0.50 14.86  ? 74  TRP A CB  1 
ATOM   589  C  CB  B TRP A 1 74  ? -52.155 19.692 33.495  0.50 14.52  ? 74  TRP A CB  1 
ATOM   590  C  CG  A TRP A 1 74  ? -53.528 18.845 33.539  0.50 17.88  ? 74  TRP A CG  1 
ATOM   591  C  CG  B TRP A 1 74  ? -53.376 18.981 33.040  0.50 16.96  ? 74  TRP A CG  1 
ATOM   592  C  CD1 A TRP A 1 74  ? -54.334 18.461 34.606  0.50 22.38  ? 74  TRP A CD1 1 
ATOM   593  C  CD1 B TRP A 1 74  ? -53.735 18.710 31.742  0.50 15.56  ? 74  TRP A CD1 1 
ATOM   594  C  CD2 A TRP A 1 74  ? -54.203 18.387 32.345  0.50 20.46  ? 74  TRP A CD2 1 
ATOM   595  C  CD2 B TRP A 1 74  ? -54.469 18.520 33.862  0.50 19.41  ? 74  TRP A CD2 1 
ATOM   596  N  NE1 A TRP A 1 74  ? -55.433 17.796 34.129  0.50 25.07  ? 74  TRP A NE1 1 
ATOM   597  N  NE1 B TRP A 1 74  ? -54.939 18.099 31.717  0.50 17.88  ? 74  TRP A NE1 1 
ATOM   598  C  CE2 A TRP A 1 74  ? -55.368 17.725 32.762  0.50 21.97  ? 74  TRP A CE2 1 
ATOM   599  C  CE2 B TRP A 1 74  ? -55.421 17.969 32.993  0.50 17.17  ? 74  TRP A CE2 1 
ATOM   600  C  CE3 A TRP A 1 74  ? -53.909 18.441 30.968  0.50 21.90  ? 74  TRP A CE3 1 
ATOM   601  C  CE3 B TRP A 1 74  ? -54.702 18.468 35.258  0.50 20.90  ? 74  TRP A CE3 1 
ATOM   602  C  CZ2 A TRP A 1 74  ? -56.273 17.166 31.857  0.50 23.40  ? 74  TRP A CZ2 1 
ATOM   603  C  CZ2 B TRP A 1 74  ? -56.625 17.399 33.453  0.50 19.15  ? 74  TRP A CZ2 1 
ATOM   604  C  CZ3 A TRP A 1 74  ? -54.805 17.884 30.056  0.50 26.37  ? 74  TRP A CZ3 1 
ATOM   605  C  CZ3 B TRP A 1 74  ? -55.880 17.891 35.718  0.50 22.19  ? 74  TRP A CZ3 1 
ATOM   606  C  CH2 A TRP A 1 74  ? -55.961 17.258 30.500  0.50 23.19  ? 74  TRP A CH2 1 
ATOM   607  C  CH2 B TRP A 1 74  ? -56.819 17.364 34.807  0.50 22.57  ? 74  TRP A CH2 1 
ATOM   608  N  N   . GLU A 1 75  ? -52.729 21.357 36.150  1.00 13.99  ? 75  GLU A N   1 
ATOM   609  C  CA  . GLU A 1 75  ? -53.489 21.595 37.339  1.00 14.74  ? 75  GLU A CA  1 
ATOM   610  C  C   . GLU A 1 75  ? -54.048 23.025 37.413  1.00 13.47  ? 75  GLU A C   1 
ATOM   611  O  O   . GLU A 1 75  ? -55.174 23.274 37.874  1.00 15.19  ? 75  GLU A O   1 
ATOM   612  C  CB  . GLU A 1 75  ? -52.598 21.347 38.564  1.00 16.67  ? 75  GLU A CB  1 
ATOM   613  C  CG  . GLU A 1 75  ? -53.210 21.469 39.878  1.00 25.74  ? 75  GLU A CG  1 
ATOM   614  C  CD  . GLU A 1 75  ? -52.267 21.008 41.061  1.00 34.26  ? 75  GLU A CD  1 
ATOM   615  O  OE1 . GLU A 1 75  ? -51.656 21.908 41.764  1.00 39.46  ? 75  GLU A OE1 1 
ATOM   616  O  OE2 . GLU A 1 75  ? -52.129 19.766 41.212  1.00 43.76  ? 75  GLU A OE2 1 
ATOM   617  N  N   . THR A 1 76  ? -53.242 23.998 36.969  1.00 12.59  ? 76  THR A N   1 
ATOM   618  C  CA  . THR A 1 76  ? -53.688 25.368 36.914  1.00 12.80  ? 76  THR A CA  1 
ATOM   619  C  C   . THR A 1 76  ? -54.833 25.519 35.967  1.00 12.80  ? 76  THR A C   1 
ATOM   620  O  O   . THR A 1 76  ? -55.883 26.104 36.348  1.00 12.95  ? 76  THR A O   1 
ATOM   621  C  CB  . THR A 1 76  ? -52.508 26.291 36.497  1.00 13.42  ? 76  THR A CB  1 
ATOM   622  O  OG1 . THR A 1 76  ? -51.424 26.184 37.427  1.00 14.94  ? 76  THR A OG1 1 
ATOM   623  C  CG2 . THR A 1 76  ? -52.969 27.741 36.428  1.00 14.61  ? 76  THR A CG2 1 
ATOM   624  N  N   . PHE A 1 77  ? -54.769 24.913 34.787  1.00 11.89  ? 77  PHE A N   1 
ATOM   625  C  CA  . PHE A 1 77  ? -55.881 24.975 33.857  1.00 12.36  ? 77  PHE A CA  1 
ATOM   626  C  C   . PHE A 1 77  ? -57.135 24.250 34.387  1.00 12.68  ? 77  PHE A C   1 
ATOM   627  O  O   . PHE A 1 77  ? -58.250 24.700 34.150  1.00 12.66  ? 77  PHE A O   1 
ATOM   628  C  CB  . PHE A 1 77  ? -55.457 24.453 32.470  1.00 12.34  ? 77  PHE A CB  1 
ATOM   629  C  CG  . PHE A 1 77  ? -54.464 25.362 31.725  1.00 11.25  ? 77  PHE A CG  1 
ATOM   630  C  CD1 . PHE A 1 77  ? -54.754 26.656 31.470  1.00 13.49  ? 77  PHE A CD1 1 
ATOM   631  C  CD2 . PHE A 1 77  ? -53.313 24.834 31.257  1.00 13.27  ? 77  PHE A CD2 1 
ATOM   632  C  CE1 . PHE A 1 77  ? -53.836 27.470 30.776  1.00 13.67  ? 77  PHE A CE1 1 
ATOM   633  C  CE2 . PHE A 1 77  ? -52.427 25.649 30.510  1.00 12.73  ? 77  PHE A CE2 1 
ATOM   634  C  CZ  . PHE A 1 77  ? -52.710 26.904 30.328  1.00 14.12  ? 77  PHE A CZ  1 
ATOM   635  N  N   . LYS A 1 78  ? -56.934 23.135 35.068  1.00 13.01  ? 78  LYS A N   1 
ATOM   636  C  CA  . LYS A 1 78  ? -58.085 22.371 35.615  1.00 13.81  ? 78  LYS A CA  1 
ATOM   637  C  C   . LYS A 1 78  ? -58.712 23.198 36.707  1.00 13.56  ? 78  LYS A C   1 
ATOM   638  O  O   . LYS A 1 78  ? -59.991 23.268 36.805  1.00 14.00  ? 78  LYS A O   1 
ATOM   639  C  CB  . LYS A 1 78  ? -57.621 21.041 36.147  1.00 15.27  ? 78  LYS A CB  1 
ATOM   640  C  CG  . LYS A 1 78  ? -58.773 20.252 36.678  1.00 21.53  ? 78  LYS A CG  1 
ATOM   641  C  CD  . LYS A 1 78  ? -59.790 19.826 35.508  1.00 29.74  ? 78  LYS A CD  1 
ATOM   642  C  CE  . LYS A 1 78  ? -60.750 18.513 35.759  1.00 35.04  ? 78  LYS A CE  1 
ATOM   643  N  NZ  . LYS A 1 78  ? -61.381 18.489 37.171  1.00 38.22  ? 78  LYS A NZ  1 
ATOM   644  N  N   . GLU A 1 79  ? -57.936 23.837 37.557  1.00 13.45  ? 79  GLU A N   1 
ATOM   645  C  CA  . GLU A 1 79  ? -58.526 24.671 38.613  1.00 14.47  ? 79  GLU A CA  1 
ATOM   646  C  C   . GLU A 1 79  ? -59.185 25.931 38.064  1.00 14.00  ? 79  GLU A C   1 
ATOM   647  O  O   . GLU A 1 79  ? -60.246 26.331 38.569  1.00 14.32  ? 79  GLU A O   1 
ATOM   648  C  CB  . GLU A 1 79  ? -57.510 25.071 39.670  1.00 16.60  ? 79  GLU A CB  1 
ATOM   649  C  CG  . GLU A 1 79  ? -56.972 23.868 40.512  1.00 18.00  ? 79  GLU A CG  1 
ATOM   650  C  CD  . GLU A 1 79  ? -55.916 24.234 41.536  1.00 23.34  ? 79  GLU A CD  1 
ATOM   651  O  OE1 . GLU A 1 79  ? -55.902 25.416 41.919  1.00 24.25  ? 79  GLU A OE1 1 
ATOM   652  O  OE2 . GLU A 1 79  ? -55.195 23.318 41.985  1.00 28.06  ? 79  GLU A OE2 1 
ATOM   653  N  N   . VAL A 1 80  ? -58.597 26.562 37.020  1.00 13.58  ? 80  VAL A N   1 
ATOM   654  C  CA  . VAL A 1 80  ? -59.306 27.645 36.398  1.00 12.93  ? 80  VAL A CA  1 
ATOM   655  C  C   . VAL A 1 80  ? -60.642 27.169 35.842  1.00 12.24  ? 80  VAL A C   1 
ATOM   656  O  O   . VAL A 1 80  ? -61.663 27.881 35.952  1.00 13.27  ? 80  VAL A O   1 
ATOM   657  C  CB  . VAL A 1 80  ? -58.413 28.299 35.305  1.00 13.27  ? 80  VAL A CB  1 
ATOM   658  C  CG1 . VAL A 1 80  ? -59.238 29.292 34.430  1.00 13.39  ? 80  VAL A CG1 1 
ATOM   659  C  CG2 . VAL A 1 80  ? -57.210 29.052 35.962  1.00 14.75  ? 80  VAL A CG2 1 
ATOM   660  N  N   . THR A 1 81  ? -60.660 26.030 35.208  1.00 12.16  ? 81  THR A N   1 
ATOM   661  C  CA  . THR A 1 81  ? -61.857 25.429 34.699  1.00 12.76  ? 81  THR A CA  1 
ATOM   662  C  C   . THR A 1 81  ? -62.936 25.303 35.778  1.00 13.92  ? 81  THR A C   1 
ATOM   663  O  O   . THR A 1 81  ? -64.075 25.722 35.641  1.00 15.26  ? 81  THR A O   1 
ATOM   664  C  CB  . THR A 1 81  ? -61.609 24.067 34.012  1.00 12.78  ? 81  THR A CB  1 
ATOM   665  O  OG1 . THR A 1 81  ? -60.740 24.216 32.913  1.00 12.82  ? 81  THR A OG1 1 
ATOM   666  C  CG2 . THR A 1 81  ? -62.906 23.372 33.542  1.00 13.83  ? 81  THR A CG2 1 
ATOM   667  N  N   . ASP A 1 82  ? -62.551 24.656 36.876  1.00 14.50  ? 82  ASP A N   1 
ATOM   668  C  CA  . ASP A 1 82  ? -63.534 24.334 37.914  1.00 16.14  ? 82  ASP A CA  1 
ATOM   669  C  C   . ASP A 1 82  ? -63.909 25.514 38.785  1.00 16.95  ? 82  ASP A C   1 
ATOM   670  O  O   . ASP A 1 82  ? -65.129 25.601 39.144  1.00 22.38  ? 82  ASP A O   1 
ATOM   671  C  CB  . ASP A 1 82  ? -62.946 23.234 38.794  1.00 18.54  ? 82  ASP A CB  1 
ATOM   672  C  CG  . ASP A 1 82  ? -62.824 21.898 38.048  1.00 19.29  ? 82  ASP A CG  1 
ATOM   673  O  OD1 . ASP A 1 82  ? -63.528 21.629 37.009  1.00 27.06  ? 82  ASP A OD1 1 
ATOM   674  O  OD2 . ASP A 1 82  ? -61.994 21.058 38.508  1.00 27.07  ? 82  ASP A OD2 1 
ATOM   675  N  N   . GLN A 1 83  ? -63.020 26.415 39.085  1.00 15.89  ? 83  GLN A N   1 
ATOM   676  C  CA  . GLN A 1 83  ? -63.271 27.503 39.957  1.00 18.03  ? 83  GLN A CA  1 
ATOM   677  C  C   . GLN A 1 83  ? -63.828 28.759 39.284  1.00 17.10  ? 83  GLN A C   1 
ATOM   678  O  O   . GLN A 1 83  ? -64.495 29.535 39.938  1.00 19.00  ? 83  GLN A O   1 
ATOM   679  C  CB  . GLN A 1 83  ? -62.005 27.848 40.731  1.00 19.69  ? 83  GLN A CB  1 
ATOM   680  C  CG  . GLN A 1 83  ? -61.491 26.739 41.658  1.00 23.94  ? 83  GLN A CG  1 
ATOM   681  C  CD  . GLN A 1 83  ? -62.466 26.405 42.694  1.00 30.57  ? 83  GLN A CD  1 
ATOM   682  O  OE1 . GLN A 1 83  ? -62.729 25.228 42.898  1.00 40.21  ? 83  GLN A OE1 1 
ATOM   683  N  NE2 . GLN A 1 83  ? -63.029 27.407 43.370  1.00 30.97  ? 83  GLN A NE2 1 
ATOM   684  N  N   . ILE A 1 84  ? -63.466 28.972 38.012  1.00 15.31  ? 84  ILE A N   1 
ATOM   685  C  CA  . ILE A 1 84  ? -63.836 30.146 37.315  1.00 15.65  ? 84  ILE A CA  1 
ATOM   686  C  C   . ILE A 1 84  ? -64.740 29.828 36.124  1.00 15.33  ? 84  ILE A C   1 
ATOM   687  O  O   . ILE A 1 84  ? -65.875 30.377 36.021  1.00 15.88  ? 84  ILE A O   1 
ATOM   688  C  CB  . ILE A 1 84  ? -62.602 31.025 36.884  1.00 15.30  ? 84  ILE A CB  1 
ATOM   689  C  CG1 . ILE A 1 84  ? -61.568 31.316 38.043  1.00 19.42  ? 84  ILE A CG1 1 
ATOM   690  C  CG2 . ILE A 1 84  ? -63.106 32.333 36.195  1.00 16.33  ? 84  ILE A CG2 1 
ATOM   691  C  CD1 . ILE A 1 84  ? -62.126 32.152 39.189  1.00 24.00  ? 84  ILE A CD1 1 
ATOM   692  N  N   . ALA A 1 85  ? -64.290 29.047 35.188  1.00 13.40  ? 85  ALA A N   1 
ATOM   693  C  CA  . ALA A 1 85  ? -65.030 28.893 33.939  1.00 13.07  ? 85  ALA A CA  1 
ATOM   694  C  C   . ALA A 1 85  ? -66.363 28.206 34.189  1.00 14.29  ? 85  ALA A C   1 
ATOM   695  O  O   . ALA A 1 85  ? -67.397 28.612 33.663  1.00 15.58  ? 85  ALA A O   1 
ATOM   696  C  CB  . ALA A 1 85  ? -64.192 28.096 32.902  1.00 14.25  ? 85  ALA A CB  1 
ATOM   697  N  N   . LYS A 1 86  ? -66.399 27.184 35.020  1.00 15.82  ? 86  LYS A N   1 
ATOM   698  C  CA  . LYS A 1 86  ? -67.652 26.409 35.247  1.00 18.59  ? 86  LYS A CA  1 
ATOM   699  C  C   . LYS A 1 86  ? -68.529 27.258 36.127  1.00 18.25  ? 86  LYS A C   1 
ATOM   700  O  O   . LYS A 1 86  ? -69.773 27.266 35.908  1.00 21.88  ? 86  LYS A O   1 
ATOM   701  C  CB  . LYS A 1 86  ? -67.337 25.001 35.846  1.00 18.59  ? 86  LYS A CB  1 
ATOM   702  C  CG  . LYS A 1 86  ? -66.941 24.015 34.678  1.00 26.05  ? 86  LYS A CG  1 
ATOM   703  C  CD  . LYS A 1 86  ? -66.710 22.513 35.103  1.00 32.48  ? 86  LYS A CD  1 
ATOM   704  C  CE  . LYS A 1 86  ? -66.599 21.724 33.742  1.00 37.92  ? 86  LYS A CE  1 
ATOM   705  N  NZ  . LYS A 1 86  ? -66.839 20.260 33.874  1.00 45.06  ? 86  LYS A NZ  1 
ATOM   706  N  N   . ARG A 1 87  ? -67.974 28.083 37.019  1.00 18.37  ? 87  ARG A N   1 
ATOM   707  C  CA  . ARG A 1 87  ? -68.752 28.901 37.877  1.00 22.33  ? 87  ARG A CA  1 
ATOM   708  C  C   . ARG A 1 87  ? -69.562 29.927 37.084  1.00 18.69  ? 87  ARG A C   1 
ATOM   709  O  O   . ARG A 1 87  ? -70.732 30.224 37.405  1.00 21.97  ? 87  ARG A O   1 
ATOM   710  C  CB  . ARG A 1 87  ? -67.834 29.686 38.810  1.00 25.03  ? 87  ARG A CB  1 
ATOM   711  C  CG  . ARG A 1 87  ? -68.602 30.496 39.859  1.00 32.53  ? 87  ARG A CG  1 
ATOM   712  C  CD  . ARG A 1 87  ? -67.885 31.775 40.411  1.00 46.17  ? 87  ARG A CD  1 
ATOM   713  N  NE  . ARG A 1 87  ? -66.514 31.546 40.852  1.00 52.50  ? 87  ARG A NE  1 
ATOM   714  C  CZ  . ARG A 1 87  ? -66.140 30.927 41.994  1.00 61.66  ? 87  ARG A CZ  1 
ATOM   715  N  NH1 . ARG A 1 87  ? -64.802 30.774 42.257  1.00 61.75  ? 87  ARG A NH1 1 
ATOM   716  N  NH2 . ARG A 1 87  ? -67.063 30.452 42.883  1.00 64.35  ? 87  ARG A NH2 1 
ATOM   717  N  N   . PHE A 1 88  ? -68.916 30.531 36.074  1.00 16.38  ? 88  PHE A N   1 
ATOM   718  C  CA  . PHE A 1 88  ? -69.573 31.593 35.292  1.00 15.80  ? 88  PHE A CA  1 
ATOM   719  C  C   . PHE A 1 88  ? -70.147 30.982 34.020  1.00 12.09  ? 88  PHE A C   1 
ATOM   720  O  O   . PHE A 1 88  ? -70.639 31.744 33.134  1.00 13.76  ? 88  PHE A O   1 
ATOM   721  C  CB  . PHE A 1 88  ? -68.559 32.659 34.956  1.00 15.47  ? 88  PHE A CB  1 
ATOM   722  C  CG  . PHE A 1 88  ? -68.025 33.413 36.096  1.00 16.56  ? 88  PHE A CG  1 
ATOM   723  C  CD1 . PHE A 1 88  ? -68.758 33.704 37.216  1.00 25.59  ? 88  PHE A CD1 1 
ATOM   724  C  CD2 . PHE A 1 88  ? -66.738 33.893 36.041  1.00 16.08  ? 88  PHE A CD2 1 
ATOM   725  C  CE1 . PHE A 1 88  ? -68.193 34.438 38.191  1.00 27.04  ? 88  PHE A CE1 1 
ATOM   726  C  CE2 . PHE A 1 88  ? -66.240 34.640 37.010  1.00 20.14  ? 88  PHE A CE2 1 
ATOM   727  C  CZ  . PHE A 1 88  ? -66.937 34.914 38.071  1.00 23.10  ? 88  PHE A CZ  1 
ATOM   728  N  N   . LYS A 1 89  ? -70.141 29.679 33.860  1.00 13.38  ? 89  LYS A N   1 
ATOM   729  C  CA  . LYS A 1 89  ? -70.605 28.978 32.682  1.00 13.23  ? 89  LYS A CA  1 
ATOM   730  C  C   . LYS A 1 89  ? -70.059 29.583 31.390  1.00 12.52  ? 89  LYS A C   1 
ATOM   731  O  O   . LYS A 1 89  ? -70.756 29.823 30.432  1.00 12.20  ? 89  LYS A O   1 
ATOM   732  C  CB  . LYS A 1 89  ? -72.170 28.911 32.691  1.00 13.83  ? 89  LYS A CB  1 
ATOM   733  C  CG  . LYS A 1 89  ? -72.719 28.053 33.841  1.00 15.42  ? 89  LYS A CG  1 
ATOM   734  C  CD  . LYS A 1 89  ? -74.189 28.008 33.940  1.00 16.96  ? 89  LYS A CD  1 
ATOM   735  C  CE  . LYS A 1 89  ? -74.884 27.538 32.698  1.00 20.27  ? 89  LYS A CE  1 
ATOM   736  N  NZ  . LYS A 1 89  ? -76.380 27.208 32.845  1.00 17.60  ? 89  LYS A NZ  1 
ATOM   737  N  N   . LEU A 1 90  ? -68.730 29.761 31.393  1.00 11.43  ? 90  LEU A N   1 
ATOM   738  C  CA  . LEU A 1 90  ? -68.050 30.309 30.241  1.00 10.99  ? 90  LEU A CA  1 
ATOM   739  C  C   . LEU A 1 90  ? -68.157 29.381 29.096  1.00 10.10  ? 90  LEU A C   1 
ATOM   740  O  O   . LEU A 1 90  ? -68.411 28.166 29.182  1.00 11.49  ? 90  LEU A O   1 
ATOM   741  C  CB  . LEU A 1 90  ? -66.634 30.694 30.594  1.00 11.72  ? 90  LEU A CB  1 
ATOM   742  C  CG  . LEU A 1 90  ? -66.448 31.743 31.693  1.00 12.18  ? 90  LEU A CG  1 
ATOM   743  C  CD1 . LEU A 1 90  ? -64.985 32.056 31.913  1.00 14.53  ? 90  LEU A CD1 1 
ATOM   744  C  CD2 . LEU A 1 90  ? -67.311 33.015 31.444  1.00 13.16  ? 90  LEU A CD2 1 
ATOM   745  N  N   . TYR A 1 91  ? -67.951 29.935 27.882  1.00 11.03  ? 91  TYR A N   1 
ATOM   746  C  CA  . TYR A 1 91  ? -68.196 29.178 26.688  1.00 10.71  ? 91  TYR A CA  1 
ATOM   747  C  C   . TYR A 1 91  ? -67.059 28.236 26.367  1.00 10.45  ? 91  TYR A C   1 
ATOM   748  O  O   . TYR A 1 91  ? -65.880 28.637 26.335  1.00 11.98  ? 91  TYR A O   1 
ATOM   749  C  CB  . TYR A 1 91  ? -68.507 30.097 25.466  1.00 10.12  ? 91  TYR A CB  1 
ATOM   750  C  CG  . TYR A 1 91  ? -69.110 29.308 24.361  1.00 9.98   ? 91  TYR A CG  1 
ATOM   751  C  CD1 . TYR A 1 91  ? -70.411 28.863 24.479  1.00 10.62  ? 91  TYR A CD1 1 
ATOM   752  C  CD2 . TYR A 1 91  ? -68.362 28.874 23.281  1.00 10.72  ? 91  TYR A CD2 1 
ATOM   753  C  CE1 . TYR A 1 91  ? -70.930 27.999 23.547  1.00 10.28  ? 91  TYR A CE1 1 
ATOM   754  C  CE2 . TYR A 1 91  ? -68.863 28.007 22.348  1.00 10.46  ? 91  TYR A CE2 1 
ATOM   755  C  CZ  . TYR A 1 91  ? -70.173 27.533 22.471  1.00 10.73  ? 91  TYR A CZ  1 
ATOM   756  O  OH  . TYR A 1 91  ? -70.659 26.653 21.546  1.00 11.05  ? 91  TYR A OH  1 
ATOM   757  N  N   . GLY A 1 92  ? -67.337 26.961 26.179  1.00 11.50  ? 92  GLY A N   1 
ATOM   758  C  CA  . GLY A 1 92  ? -66.253 26.025 26.054  1.00 12.51  ? 92  GLY A CA  1 
ATOM   759  C  C   . GLY A 1 92  ? -65.463 25.896 27.355  1.00 11.68  ? 92  GLY A C   1 
ATOM   760  O  O   . GLY A 1 92  ? -64.237 25.756 27.328  1.00 13.15  ? 92  GLY A O   1 
ATOM   761  N  N   . ALA A 1 93  ? -66.120 25.958 28.507  1.00 12.43  ? 93  ALA A N   1 
ATOM   762  C  CA  . ALA A 1 93  ? -65.428 25.764 29.815  1.00 12.78  ? 93  ALA A CA  1 
ATOM   763  C  C   . ALA A 1 93  ? -64.673 24.460 29.786  1.00 12.12  ? 93  ALA A C   1 
ATOM   764  O  O   . ALA A 1 93  ? -65.190 23.424 29.442  1.00 15.28  ? 93  ALA A O   1 
ATOM   765  C  CB  . ALA A 1 93  ? -66.490 25.812 30.949  1.00 14.79  ? 93  ALA A CB  1 
ATOM   766  N  N   . GLY A 1 94  ? -63.365 24.572 30.086  1.00 12.46  ? 94  GLY A N   1 
ATOM   767  C  CA  . GLY A 1 94  ? -62.503 23.407 30.051  1.00 12.75  ? 94  GLY A CA  1 
ATOM   768  C  C   . GLY A 1 94  ? -62.192 22.893 28.684  1.00 11.86  ? 94  GLY A C   1 
ATOM   769  O  O   . GLY A 1 94  ? -61.667 21.793 28.517  1.00 14.20  ? 94  GLY A O   1 
ATOM   770  N  N   . GLN A 1 95  ? -62.368 23.740 27.634  1.00 12.34  ? 95  GLN A N   1 
ATOM   771  C  CA  . GLN A 1 95  ? -62.297 23.342 26.202  1.00 12.17  ? 95  GLN A CA  1 
ATOM   772  C  C   . GLN A 1 95  ? -61.175 22.366 25.871  1.00 11.90  ? 95  GLN A C   1 
ATOM   773  O  O   . GLN A 1 95  ? -61.456 21.296 25.372  1.00 13.39  ? 95  GLN A O   1 
ATOM   774  C  CB  . GLN A 1 95  ? -62.170 24.618 25.280  1.00 11.89  ? 95  GLN A CB  1 
ATOM   775  C  CG  . GLN A 1 95  ? -62.359 24.287 23.860  1.00 12.89  ? 95  GLN A CG  1 
ATOM   776  C  CD  . GLN A 1 95  ? -62.024 25.486 22.999  1.00 12.78  ? 95  GLN A CD  1 
ATOM   777  O  OE1 . GLN A 1 95  ? -62.781 26.513 22.936  1.00 9.89   ? 95  GLN A OE1 1 
ATOM   778  N  NE2 . GLN A 1 95  ? -60.804 25.445 22.411  1.00 12.87  ? 95  GLN A NE2 1 
ATOM   779  N  N   . ASP A 1 96  ? -59.922 22.721 26.147  1.00 11.67  ? 96  ASP A N   1 
ATOM   780  C  CA  . ASP A 1 96  ? -58.812 21.923 25.721  1.00 12.57  ? 96  ASP A CA  1 
ATOM   781  C  C   . ASP A 1 96  ? -58.531 20.738 26.659  1.00 12.60  ? 96  ASP A C   1 
ATOM   782  O  O   . ASP A 1 96  ? -57.743 19.894 26.325  1.00 16.21  ? 96  ASP A O   1 
ATOM   783  C  CB  . ASP A 1 96  ? -57.583 22.816 25.528  1.00 13.23  ? 96  ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 96  ? -57.636 23.733 24.403  1.00 14.04  ? 96  ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 96  ? -58.550 23.621 23.533  1.00 13.86  ? 96  ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 96  ? -56.719 24.597 24.299  1.00 12.72  ? 96  ASP A OD2 1 
ATOM   787  N  N   . LEU A 1 97  ? -59.145 20.692 27.829  1.00 13.46  ? 97  LEU A N   1 
ATOM   788  C  CA  . LEU A 1 97  ? -58.950 19.613 28.802  1.00 14.44  ? 97  LEU A CA  1 
ATOM   789  C  C   . LEU A 1 97  ? -60.084 18.558 28.784  1.00 17.74  ? 97  LEU A C   1 
ATOM   790  O  O   . LEU A 1 97  ? -59.875 17.467 29.231  1.00 20.31  ? 97  LEU A O   1 
ATOM   791  C  CB  . LEU A 1 97  ? -58.857 20.169 30.201  1.00 16.11  ? 97  LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 97  ? -57.495 20.791 30.618  1.00 22.77  ? 97  LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 97  ? -56.673 21.617 29.775  1.00 22.14  ? 97  LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 97  ? -57.649 21.277 32.093  1.00 23.05  ? 97  LEU A CD2 1 
ATOM   795  N  N   . LEU A 1 98  ? -61.291 18.960 28.398  1.00 17.41  ? 98  LEU A N   1 
ATOM   796  C  CA  . LEU A 1 98  ? -62.505 18.141 28.526  1.00 17.33  ? 98  LEU A CA  1 
ATOM   797  C  C   . LEU A 1 98  ? -63.094 17.814 27.170  1.00 18.29  ? 98  LEU A C   1 
ATOM   798  O  O   . LEU A 1 98  ? -63.574 18.748 26.487  1.00 19.00  ? 98  LEU A O   1 
ATOM   799  C  CB  . LEU A 1 98  ? -63.522 18.876 29.394  1.00 18.97  ? 98  LEU A CB  1 
ATOM   800  C  CG  . LEU A 1 98  ? -63.088 19.314 30.830  1.00 20.51  ? 98  LEU A CG  1 
ATOM   801  C  CD1 . LEU A 1 98  ? -64.222 20.059 31.528  1.00 23.51  ? 98  LEU A CD1 1 
ATOM   802  C  CD2 . LEU A 1 98  ? -62.509 18.148 31.681  1.00 25.43  ? 98  LEU A CD2 1 
ATOM   803  N  N   . LYS A 1 99  ? -63.138 16.532 26.755  1.00 19.81  ? 99  LYS A N   1 
ATOM   804  C  CA  . LYS A 1 99  ? -63.727 16.160 25.459  1.00 21.33  ? 99  LYS A CA  1 
ATOM   805  C  C   . LYS A 1 99  ? -65.193 16.533 25.330  1.00 21.50  ? 99  LYS A C   1 
ATOM   806  O  O   . LYS A 1 99  ? -65.685 16.770 24.192  1.00 23.97  ? 99  LYS A O   1 
ATOM   807  C  CB  . LYS A 1 99  ? -63.556 14.641 25.184  1.00 25.83  ? 99  LYS A CB  1 
ATOM   808  C  CG  . LYS A 1 99  ? -62.059 14.283 24.856  1.00 33.57  ? 99  LYS A CG  1 
ATOM   809  C  CD  . LYS A 1 99  ? -61.840 13.406 23.593  1.00 47.02  ? 99  LYS A CD  1 
ATOM   810  C  CE  . LYS A 1 99  ? -60.293 13.407 23.171  1.00 51.30  ? 99  LYS A CE  1 
ATOM   811  N  NZ  . LYS A 1 99  ? -60.036 12.800 21.784  1.00 56.11  ? 99  LYS A NZ  1 
ATOM   812  N  N   . ASP A 1 100 ? -65.891 16.648 26.463  1.00 22.92  ? 100 ASP A N   1 
ATOM   813  C  CA  . ASP A 1 100 ? -67.308 17.046 26.524  1.00 23.38  ? 100 ASP A CA  1 
ATOM   814  C  C   . ASP A 1 100 ? -67.603 18.467 26.928  1.00 23.12  ? 100 ASP A C   1 
ATOM   815  O  O   . ASP A 1 100 ? -68.728 18.787 27.335  1.00 23.08  ? 100 ASP A O   1 
ATOM   816  C  CB  . ASP A 1 100 ? -67.882 16.124 27.629  1.00 25.78  ? 100 ASP A CB  1 
ATOM   817  C  CG  . ASP A 1 100 ? -66.837 16.243 28.976  1.00 32.17  ? 100 ASP A CG  1 
ATOM   818  O  OD1 . ASP A 1 100 ? -67.059 17.184 29.830  1.00 47.14  ? 100 ASP A OD1 1 
ATOM   819  O  OD2 . ASP A 1 100 ? -65.689 15.545 29.104  1.00 42.42  ? 100 ASP A OD2 1 
ATOM   820  N  N   . ALA A 1 101 ? -66.589 19.329 26.787  1.00 18.70  ? 101 ALA A N   1 
ATOM   821  C  CA  . ALA A 1 101 ? -66.840 20.748 27.005  1.00 18.06  ? 101 ALA A CA  1 
ATOM   822  C  C   . ALA A 1 101 ? -68.032 21.217 26.171  1.00 16.84  ? 101 ALA A C   1 
ATOM   823  O  O   . ALA A 1 101 ? -68.238 20.741 25.058  1.00 17.62  ? 101 ALA A O   1 
ATOM   824  C  CB  . ALA A 1 101 ? -65.534 21.599 26.716  1.00 18.36  ? 101 ALA A CB  1 
ATOM   825  N  N   . PHE A 1 102 ? -68.725 22.264 26.648  1.00 17.41  ? 102 PHE A N   1 
ATOM   826  C  CA  . PHE A 1 102 ? -69.837 22.854 25.900  1.00 17.13  ? 102 PHE A CA  1 
ATOM   827  C  C   . PHE A 1 102 ? -69.350 23.902 24.881  1.00 16.70  ? 102 PHE A C   1 
ATOM   828  O  O   . PHE A 1 102 ? -69.363 25.136 25.156  1.00 16.00  ? 102 PHE A O   1 
ATOM   829  C  CB  . PHE A 1 102 ? -70.870 23.426 26.815  1.00 18.65  ? 102 PHE A CB  1 
ATOM   830  C  CG  . PHE A 1 102 ? -72.171 23.752 26.054  1.00 19.64  ? 102 PHE A CG  1 
ATOM   831  C  CD1 . PHE A 1 102 ? -73.063 22.710 25.752  1.00 20.68  ? 102 PHE A CD1 1 
ATOM   832  C  CD2 . PHE A 1 102 ? -72.518 25.053 25.628  1.00 19.77  ? 102 PHE A CD2 1 
ATOM   833  C  CE1 . PHE A 1 102 ? -74.233 22.986 25.045  1.00 22.62  ? 102 PHE A CE1 1 
ATOM   834  C  CE2 . PHE A 1 102 ? -73.816 25.403 25.029  1.00 19.14  ? 102 PHE A CE2 1 
ATOM   835  C  CZ  . PHE A 1 102 ? -74.551 24.372 24.664  1.00 20.07  ? 102 PHE A CZ  1 
ATOM   836  N  N   . SER A 1 103 ? -68.868 23.345 23.754  1.00 15.54  ? 103 SER A N   1 
ATOM   837  C  CA  . SER A 1 103 ? -68.562 24.065 22.550  1.00 14.97  ? 103 SER A CA  1 
ATOM   838  C  C   . SER A 1 103 ? -68.600 23.052 21.420  1.00 14.41  ? 103 SER A C   1 
ATOM   839  O  O   . SER A 1 103 ? -68.646 21.836 21.652  1.00 16.63  ? 103 SER A O   1 
ATOM   840  C  CB  . SER A 1 103 ? -67.202 24.826 22.613  1.00 14.30  ? 103 SER A CB  1 
ATOM   841  O  OG  . SER A 1 103 ? -66.138 23.951 22.805  1.00 15.76  ? 103 SER A OG  1 
ATOM   842  N  N   . GLY A 1 104 ? -68.563 23.512 20.190  1.00 15.16  ? 104 GLY A N   1 
ATOM   843  C  CA  . GLY A 1 104 ? -68.714 22.659 19.020  1.00 14.70  ? 104 GLY A CA  1 
ATOM   844  C  C   . GLY A 1 104 ? -67.452 22.411 18.255  1.00 14.71  ? 104 GLY A C   1 
ATOM   845  O  O   . GLY A 1 104 ? -67.461 21.719 17.235  1.00 16.28  ? 104 GLY A O   1 
ATOM   846  N  N   . ASN A 1 105 ? -66.299 22.938 18.726  1.00 14.19  ? 105 ASN A N   1 
ATOM   847  C  CA  . ASN A 1 105 ? -65.007 22.816 18.080  1.00 14.53  ? 105 ASN A CA  1 
ATOM   848  C  C   . ASN A 1 105 ? -64.223 21.670 18.668  1.00 14.04  ? 105 ASN A C   1 
ATOM   849  O  O   . ASN A 1 105 ? -64.770 20.868 19.462  1.00 15.70  ? 105 ASN A O   1 
ATOM   850  C  CB  . ASN A 1 105 ? -64.252 24.154 18.099  1.00 14.01  ? 105 ASN A CB  1 
ATOM   851  C  CG  . ASN A 1 105 ? -63.934 24.684 19.496  1.00 13.03  ? 105 ASN A CG  1 
ATOM   852  O  OD1 . ASN A 1 105 ? -62.861 25.385 19.671  1.00 16.15  ? 105 ASN A OD1 1 
ATOM   853  N  ND2 . ASN A 1 105 ? -64.769 24.461 20.443  1.00 12.54  ? 105 ASN A ND2 1 
ATOM   854  N  N   . ILE A 1 106 ? -62.951 21.521 18.283  1.00 13.17  ? 106 ILE A N   1 
ATOM   855  C  CA  . ILE A 1 106 ? -62.128 20.421 18.765  1.00 15.04  ? 106 ILE A CA  1 
ATOM   856  C  C   . ILE A 1 106 ? -61.774 20.610 20.236  1.00 15.48  ? 106 ILE A C   1 
ATOM   857  O  O   . ILE A 1 106 ? -61.189 21.628 20.646  1.00 16.37  ? 106 ILE A O   1 
ATOM   858  C  CB  . ILE A 1 106 ? -60.805 20.321 17.914  1.00 15.87  ? 106 ILE A CB  1 
ATOM   859  C  CG1 . ILE A 1 106 ? -61.124 19.818 16.460  1.00 17.17  ? 106 ILE A CG1 1 
ATOM   860  C  CG2 . ILE A 1 106 ? -59.763 19.411 18.598  1.00 18.46  ? 106 ILE A CG2 1 
ATOM   861  C  CD1 . ILE A 1 106 ? -59.976 20.292 15.486  1.00 21.31  ? 106 ILE A CD1 1 
ATOM   862  N  N   . ARG A 1 107 ? -62.161 19.618 21.040  1.00 15.18  ? 107 ARG A N   1 
ATOM   863  C  CA  . ARG A 1 107 ? -62.051 19.662 22.482  1.00 14.17  ? 107 ARG A CA  1 
ATOM   864  C  C   . ARG A 1 107 ? -61.216 18.547 23.038  1.00 14.76  ? 107 ARG A C   1 
ATOM   865  O  O   . ARG A 1 107 ? -61.101 17.446 22.429  1.00 16.17  ? 107 ARG A O   1 
ATOM   866  C  CB  . ARG A 1 107 ? -63.462 19.655 23.120  1.00 14.15  ? 107 ARG A CB  1 
ATOM   867  C  CG  . ARG A 1 107 ? -64.280 20.842 22.858  1.00 14.21  ? 107 ARG A CG  1 
ATOM   868  C  CD  . ARG A 1 107 ? -65.797 20.542 22.971  1.00 15.84  ? 107 ARG A CD  1 
ATOM   869  N  NE  . ARG A 1 107 ? -66.225 19.844 21.773  1.00 16.89  ? 107 ARG A NE  1 
ATOM   870  C  CZ  . ARG A 1 107 ? -67.314 19.102 21.711  1.00 20.38  ? 107 ARG A CZ  1 
ATOM   871  N  NH1 . ARG A 1 107 ? -67.642 18.481 20.570  1.00 21.40  ? 107 ARG A NH1 1 
ATOM   872  N  NH2 . ARG A 1 107 ? -68.017 18.915 22.800  1.00 19.00  ? 107 ARG A NH2 1 
ATOM   873  N  N   . GLY A 1 108 ? -60.646 18.790 24.218  1.00 14.16  ? 108 GLY A N   1 
ATOM   874  C  CA  . GLY A 1 108 ? -60.005 17.735 24.985  1.00 15.08  ? 108 GLY A CA  1 
ATOM   875  C  C   . GLY A 1 108 ? -58.676 17.247 24.500  1.00 17.09  ? 108 GLY A C   1 
ATOM   876  O  O   . GLY A 1 108 ? -58.180 16.231 25.008  1.00 18.61  ? 108 GLY A O   1 
ATOM   877  N  N   . MET A 1 109 ? -58.032 17.974 23.595  1.00 16.23  ? 109 MET A N   1 
ATOM   878  C  CA  . MET A 1 109 ? -56.735 17.540 23.010  1.00 15.64  ? 109 MET A CA  1 
ATOM   879  C  C   . MET A 1 109 ? -55.552 17.904 23.859  1.00 16.06  ? 109 MET A C   1 
ATOM   880  O  O   . MET A 1 109 ? -54.438 17.410 23.624  1.00 18.81  ? 109 MET A O   1 
ATOM   881  C  CB  . MET A 1 109 ? -56.569 18.026 21.568  1.00 17.87  ? 109 MET A CB  1 
ATOM   882  C  CG  . MET A 1 109 ? -57.712 17.458 20.667  1.00 18.12  ? 109 MET A CG  1 
ATOM   883  S  SD  . MET A 1 109 ? -57.882 15.711 20.557  1.00 28.50  ? 109 MET A SD  1 
ATOM   884  C  CE  . MET A 1 109 ? -56.241 15.429 19.622  1.00 33.32  ? 109 MET A CE  1 
ATOM   885  N  N   . GLY A 1 110 ? -55.723 18.808 24.822  1.00 15.70  ? 110 GLY A N   1 
ATOM   886  C  CA  . GLY A 1 110 ? -54.709 19.130 25.810  1.00 15.40  ? 110 GLY A CA  1 
ATOM   887  C  C   . GLY A 1 110 ? -53.999 20.475 25.536  1.00 15.85  ? 110 GLY A C   1 
ATOM   888  O  O   . GLY A 1 110 ? -54.148 21.071 24.432  1.00 14.48  ? 110 GLY A O   1 
ATOM   889  N  N   . PRO A 1 111 ? -53.288 20.926 26.505  1.00 15.31  ? 111 PRO A N   1 
ATOM   890  C  CA  . PRO A 1 111 ? -52.462 22.146 26.319  1.00 14.21  ? 111 PRO A CA  1 
ATOM   891  C  C   . PRO A 1 111 ? -51.398 22.023 25.230  1.00 14.96  ? 111 PRO A C   1 
ATOM   892  O  O   . PRO A 1 111 ? -50.994 20.879 24.868  1.00 17.59  ? 111 PRO A O   1 
ATOM   893  C  CB  . PRO A 1 111 ? -51.874 22.362 27.669  1.00 16.00  ? 111 PRO A CB  1 
ATOM   894  C  CG  . PRO A 1 111 ? -52.676 21.505 28.652  1.00 21.81  ? 111 PRO A CG  1 
ATOM   895  C  CD  . PRO A 1 111 ? -53.124 20.349 27.847  1.00 17.16  ? 111 PRO A CD  1 
ATOM   896  N  N   . GLN A 1 112 ? -50.859 23.131 24.795  1.00 15.43  ? 112 GLN A N   1 
ATOM   897  C  CA  . GLN A 1 112 ? -49.647 23.119 24.038  1.00 17.50  ? 112 GLN A CA  1 
ATOM   898  C  C   . GLN A 1 112 ? -48.470 23.701 24.687  1.00 13.12  ? 112 GLN A C   1 
ATOM   899  O  O   . GLN A 1 112 ? -48.650 24.464 25.593  1.00 12.99  ? 112 GLN A O   1 
ATOM   900  C  CB  . GLN A 1 112 ? -49.822 23.758 22.856  1.00 17.16  ? 112 GLN A CB  1 
ATOM   901  C  CG  . GLN A 1 112 ? -50.849 23.051 21.972  1.00 21.77  ? 112 GLN A CG  1 
ATOM   902  C  CD  . GLN A 1 112 ? -50.646 23.534 20.614  1.00 17.55  ? 112 GLN A CD  1 
ATOM   903  O  OE1 . GLN A 1 112 ? -49.763 23.047 19.973  1.00 25.41  ? 112 GLN A OE1 1 
ATOM   904  N  NE2 . GLN A 1 112 ? -51.234 24.528 20.289  1.00 25.01  ? 112 GLN A NE2 1 
ATOM   905  N  N   . VAL A 1 113 ? -47.307 23.283 24.228  1.00 11.55  ? 113 VAL A N   1 
ATOM   906  C  CA  A VAL A 1 113 ? -46.079 23.621 24.849  0.50 10.68  ? 113 VAL A CA  1 
ATOM   907  C  CA  B VAL A 1 113 ? -46.065 23.703 24.871  0.50 11.43  ? 113 VAL A CA  1 
ATOM   908  C  C   . VAL A 1 113 ? -45.055 24.124 23.865  1.00 10.35  ? 113 VAL A C   1 
ATOM   909  O  O   . VAL A 1 113 ? -44.850 23.496 22.837  1.00 10.91  ? 113 VAL A O   1 
ATOM   910  C  CB  A VAL A 1 113 ? -45.566 22.292 25.488  0.50 12.72  ? 113 VAL A CB  1 
ATOM   911  C  CB  B VAL A 1 113 ? -45.389 22.637 25.918  0.50 13.75  ? 113 VAL A CB  1 
ATOM   912  C  CG1 A VAL A 1 113 ? -44.273 22.571 26.131  0.50 15.83  ? 113 VAL A CG1 1 
ATOM   913  C  CG1 B VAL A 1 113 ? -44.883 21.433 25.248  0.50 18.74  ? 113 VAL A CG1 1 
ATOM   914  C  CG2 A VAL A 1 113 ? -46.623 21.676 26.435  0.50 14.38  ? 113 VAL A CG2 1 
ATOM   915  C  CG2 B VAL A 1 113 ? -44.188 23.308 26.545  0.50 16.80  ? 113 VAL A CG2 1 
ATOM   916  N  N   . ALA A 1 114 ? -44.374 25.227 24.168  1.00 9.73   ? 114 ALA A N   1 
ATOM   917  C  CA  . ALA A 1 114 ? -43.171 25.663 23.466  1.00 9.57   ? 114 ALA A CA  1 
ATOM   918  C  C   . ALA A 1 114 ? -42.121 25.848 24.572  1.00 10.35  ? 114 ALA A C   1 
ATOM   919  O  O   . ALA A 1 114 ? -42.387 26.642 25.482  1.00 10.95  ? 114 ALA A O   1 
ATOM   920  C  CB  . ALA A 1 114 ? -43.365 26.966 22.695  1.00 11.22  ? 114 ALA A CB  1 
ATOM   921  N  N   . GLU A 1 115 ? -40.978 25.147 24.513  1.00 9.22   ? 115 GLU A N   1 
ATOM   922  C  CA  . GLU A 1 115 ? -40.014 25.279 25.566  1.00 10.07  ? 115 GLU A CA  1 
ATOM   923  C  C   . GLU A 1 115 ? -38.623 25.142 25.025  1.00 10.37  ? 115 GLU A C   1 
ATOM   924  O  O   . GLU A 1 115 ? -38.371 24.494 24.020  1.00 11.74  ? 115 GLU A O   1 
ATOM   925  C  CB  . GLU A 1 115 ? -40.257 24.345 26.703  1.00 14.35  ? 115 GLU A CB  1 
ATOM   926  C  CG  . GLU A 1 115 ? -40.482 23.048 26.551  1.00 19.02  ? 115 GLU A CG  1 
ATOM   927  C  CD  . GLU A 1 115 ? -41.008 22.240 27.814  1.00 14.36  ? 115 GLU A CD  1 
ATOM   928  O  OE1 . GLU A 1 115 ? -41.173 22.696 28.989  1.00 15.16  ? 115 GLU A OE1 1 
ATOM   929  O  OE2 . GLU A 1 115 ? -41.215 21.052 27.578  1.00 14.81  ? 115 GLU A OE2 1 
ATOM   930  N  N   A MET A 1 116 ? -37.656 25.785 25.717  0.50 10.60  ? 116 MET A N   1 
ATOM   931  N  N   B MET A 1 116 ? -37.662 25.763 25.714  0.50 11.10  ? 116 MET A N   1 
ATOM   932  C  CA  A MET A 1 116 ? -36.216 25.749 25.360  0.50 10.82  ? 116 MET A CA  1 
ATOM   933  C  CA  B MET A 1 116 ? -36.266 25.508 25.416  0.50 12.50  ? 116 MET A CA  1 
ATOM   934  C  C   A MET A 1 116 ? -35.441 25.731 26.667  0.50 9.83   ? 116 MET A C   1 
ATOM   935  C  C   B MET A 1 116 ? -35.441 25.661 26.665  0.50 10.54  ? 116 MET A C   1 
ATOM   936  O  O   A MET A 1 116 ? -35.783 26.423 27.596  0.50 11.36  ? 116 MET A O   1 
ATOM   937  O  O   B MET A 1 116 ? -35.765 26.395 27.550  0.50 11.55  ? 116 MET A O   1 
ATOM   938  C  CB  A MET A 1 116 ? -35.698 26.927 24.506  0.50 10.10  ? 116 MET A CB  1 
ATOM   939  C  CB  B MET A 1 116 ? -35.711 26.450 24.389  0.50 13.29  ? 116 MET A CB  1 
ATOM   940  C  CG  A MET A 1 116 ? -36.273 26.859 23.107  0.50 10.11  ? 116 MET A CG  1 
ATOM   941  C  CG  B MET A 1 116 ? -36.073 27.769 24.730  0.50 16.46  ? 116 MET A CG  1 
ATOM   942  S  SD  A MET A 1 116 ? -35.469 27.949 21.914  0.50 10.09  ? 116 MET A SD  1 
ATOM   943  S  SD  B MET A 1 116 ? -35.392 28.968 23.583  0.50 27.66  ? 116 MET A SD  1 
ATOM   944  C  CE  A MET A 1 116 ? -36.275 29.321 22.475  0.50 9.44   ? 116 MET A CE  1 
ATOM   945  C  CE  B MET A 1 116 ? -36.440 29.131 22.363  0.50 9.70   ? 116 MET A CE  1 
ATOM   946  N  N   A GLU A 1 117 ? -34.360 24.961 26.704  0.50 11.45  ? 117 GLU A N   1 
ATOM   947  N  N   B GLU A 1 117 ? -34.317 24.968 26.680  0.50 11.85  ? 117 GLU A N   1 
ATOM   948  C  CA  A GLU A 1 117 ? -33.373 24.968 27.795  0.50 10.76  ? 117 GLU A CA  1 
ATOM   949  C  CA  B GLU A 1 117 ? -33.357 24.971 27.784  0.50 11.15  ? 117 GLU A CA  1 
ATOM   950  C  C   A GLU A 1 117 ? -32.028 25.412 27.230  0.50 10.37  ? 117 GLU A C   1 
ATOM   951  C  C   B GLU A 1 117 ? -32.019 25.421 27.230  0.50 10.49  ? 117 GLU A C   1 
ATOM   952  O  O   A GLU A 1 117 ? -31.635 24.934 26.160  0.50 11.86  ? 117 GLU A O   1 
ATOM   953  O  O   B GLU A 1 117 ? -31.613 24.960 26.173  0.50 12.00  ? 117 GLU A O   1 
ATOM   954  C  CB  A GLU A 1 117 ? -33.258 23.595 28.449  0.50 11.80  ? 117 GLU A CB  1 
ATOM   955  C  CB  B GLU A 1 117 ? -33.247 23.587 28.434  0.50 12.35  ? 117 GLU A CB  1 
ATOM   956  C  CG  A GLU A 1 117 ? -32.213 23.519 29.530  0.50 10.80  ? 117 GLU A CG  1 
ATOM   957  C  CG  B GLU A 1 117 ? -32.437 23.555 29.730  0.50 13.65  ? 117 GLU A CG  1 
ATOM   958  C  CD  A GLU A 1 117 ? -32.023 22.142 30.002  0.50 14.02  ? 117 GLU A CD  1 
ATOM   959  C  CD  B GLU A 1 117 ? -31.045 23.062 29.542  0.50 20.82  ? 117 GLU A CD  1 
ATOM   960  O  OE1 A GLU A 1 117 ? -31.413 21.372 29.279  0.50 26.09  ? 117 GLU A OE1 1 
ATOM   961  O  OE1 B GLU A 1 117 ? -30.612 22.813 28.399  0.50 21.52  ? 117 GLU A OE1 1 
ATOM   962  O  OE2 A GLU A 1 117 ? -32.382 21.865 31.049  0.50 14.18  ? 117 GLU A OE2 1 
ATOM   963  O  OE2 B GLU A 1 117 ? -30.388 22.816 30.548  0.50 25.44  ? 117 GLU A OE2 1 
ATOM   964  N  N   . PHE A 1 118 ? -31.320 26.260 27.975  1.00 10.16  ? 118 PHE A N   1 
ATOM   965  C  CA  . PHE A 1 118 ? -30.094 26.823 27.481  1.00 10.78  ? 118 PHE A CA  1 
ATOM   966  C  C   . PHE A 1 118 ? -29.325 27.467 28.659  1.00 11.16  ? 118 PHE A C   1 
ATOM   967  O  O   . PHE A 1 118 ? -29.856 27.809 29.660  1.00 11.56  ? 118 PHE A O   1 
ATOM   968  C  CB  . PHE A 1 118 ? -30.354 27.881 26.356  1.00 10.97  ? 118 PHE A CB  1 
ATOM   969  C  CG  . PHE A 1 118 ? -31.412 28.901 26.731  1.00 10.27  ? 118 PHE A CG  1 
ATOM   970  C  CD1 . PHE A 1 118 ? -31.068 30.021 27.463  1.00 11.32  ? 118 PHE A CD1 1 
ATOM   971  C  CD2 . PHE A 1 118 ? -32.738 28.694 26.442  1.00 11.78  ? 118 PHE A CD2 1 
ATOM   972  C  CE1 . PHE A 1 118 ? -32.033 30.950 27.865  1.00 11.77  ? 118 PHE A CE1 1 
ATOM   973  C  CE2 . PHE A 1 118 ? -33.715 29.583 26.885  1.00 12.06  ? 118 PHE A CE2 1 
ATOM   974  C  CZ  . PHE A 1 118 ? -33.358 30.714 27.563  1.00 12.43  ? 118 PHE A CZ  1 
ATOM   975  N  N   . GLU A 1 119 ? -28.041 27.679 28.381  1.00 12.44  ? 119 GLU A N   1 
ATOM   976  C  CA  . GLU A 1 119 ? -27.218 28.504 29.296  1.00 13.20  ? 119 GLU A CA  1 
ATOM   977  C  C   . GLU A 1 119 ? -27.647 29.974 29.111  1.00 11.80  ? 119 GLU A C   1 
ATOM   978  O  O   . GLU A 1 119 ? -27.549 30.502 28.003  1.00 13.27  ? 119 GLU A O   1 
ATOM   979  C  CB  . GLU A 1 119 ? -25.728 28.339 28.991  1.00 15.33  ? 119 GLU A CB  1 
ATOM   980  C  CG  . GLU A 1 119 ? -24.829 29.126 29.933  1.00 22.17  ? 119 GLU A CG  1 
ATOM   981  C  CD  . GLU A 1 119 ? -24.735 28.567 31.367  1.00 25.41  ? 119 GLU A CD  1 
ATOM   982  O  OE1 . GLU A 1 119 ? -25.000 27.352 31.585  1.00 30.31  ? 119 GLU A OE1 1 
ATOM   983  O  OE2 . GLU A 1 119 ? -24.354 29.446 32.212  1.00 39.11  ? 119 GLU A OE2 1 
ATOM   984  N  N   . GLU A 1 120 ? -28.049 30.629 30.184  1.00 12.02  ? 120 GLU A N   1 
ATOM   985  C  CA  . GLU A 1 120 ? -28.493 32.016 30.141  1.00 11.34  ? 120 GLU A CA  1 
ATOM   986  C  C   . GLU A 1 120 ? -27.322 32.881 29.769  1.00 12.31  ? 120 GLU A C   1 
ATOM   987  O  O   . GLU A 1 120 ? -26.236 32.820 30.412  1.00 14.82  ? 120 GLU A O   1 
ATOM   988  C  CB  . GLU A 1 120 ? -29.128 32.413 31.475  1.00 12.99  ? 120 GLU A CB  1 
ATOM   989  C  CG  . GLU A 1 120 ? -29.861 33.719 31.492  1.00 13.42  ? 120 GLU A CG  1 
ATOM   990  C  CD  . GLU A 1 120 ? -30.331 34.060 32.837  1.00 13.99  ? 120 GLU A CD  1 
ATOM   991  O  OE1 . GLU A 1 120 ? -29.506 34.684 33.620  1.00 14.55  ? 120 GLU A OE1 1 
ATOM   992  O  OE2 . GLU A 1 120 ? -31.477 33.764 33.188  1.00 13.55  ? 120 GLU A OE2 1 
ATOM   993  N  N   . ARG A 1 121 ? -27.440 33.671 28.717  1.00 12.12  ? 121 ARG A N   1 
ATOM   994  C  CA  . ARG A 1 121 ? -26.383 34.515 28.188  1.00 12.19  ? 121 ARG A CA  1 
ATOM   995  C  C   . ARG A 1 121 ? -26.159 35.728 29.112  1.00 11.52  ? 121 ARG A C   1 
ATOM   996  O  O   . ARG A 1 121 ? -26.967 36.025 29.983  1.00 12.08  ? 121 ARG A O   1 
ATOM   997  C  CB  . ARG A 1 121 ? -26.749 34.940 26.763  1.00 12.27  ? 121 ARG A CB  1 
ATOM   998  C  CG  . ARG A 1 121 ? -26.673 33.844 25.743  1.00 12.18  ? 121 ARG A CG  1 
ATOM   999  C  CD  . ARG A 1 121 ? -27.150 34.231 24.355  1.00 12.12  ? 121 ARG A CD  1 
ATOM   1000 N  NE  . ARG A 1 121 ? -28.582 34.584 24.405  1.00 10.58  ? 121 ARG A NE  1 
ATOM   1001 C  CZ  . ARG A 1 121 ? -29.233 35.315 23.501  1.00 11.83  ? 121 ARG A CZ  1 
ATOM   1002 N  NH1 . ARG A 1 121 ? -28.533 35.859 22.496  1.00 12.32  ? 121 ARG A NH1 1 
ATOM   1003 N  NH2 . ARG A 1 121 ? -30.534 35.613 23.640  1.00 10.65  ? 121 ARG A NH2 1 
ATOM   1004 N  N   . PRO A 1 122 ? -25.050 36.472 28.839  1.00 12.56  ? 122 PRO A N   1 
ATOM   1005 C  CA  . PRO A 1 122 ? -24.815 37.659 29.645  1.00 12.93  ? 122 PRO A CA  1 
ATOM   1006 C  C   . PRO A 1 122 ? -25.880 38.708 29.596  1.00 12.13  ? 122 PRO A C   1 
ATOM   1007 O  O   . PRO A 1 122 ? -26.120 39.450 30.570  1.00 13.53  ? 122 PRO A O   1 
ATOM   1008 C  CB  . PRO A 1 122 ? -23.438 38.140 29.167  1.00 15.13  ? 122 PRO A CB  1 
ATOM   1009 C  CG  . PRO A 1 122 ? -22.768 36.945 28.669  1.00 16.35  ? 122 PRO A CG  1 
ATOM   1010 C  CD  . PRO A 1 122 ? -23.877 36.069 28.069  1.00 13.94  ? 122 PRO A CD  1 
ATOM   1011 N  N   . SER A 1 123 ? -26.597 38.732 28.455  1.00 11.74  ? 123 SER A N   1 
ATOM   1012 C  CA  . SER A 1 123 ? -27.936 39.291 28.388  1.00 11.13  ? 123 SER A CA  1 
ATOM   1013 C  C   . SER A 1 123 ? -28.768 38.271 27.578  1.00 10.65  ? 123 SER A C   1 
ATOM   1014 O  O   . SER A 1 123 ? -28.267 37.763 26.590  1.00 10.74  ? 123 SER A O   1 
ATOM   1015 C  CB  . SER A 1 123 ? -28.000 40.644 27.762  1.00 12.08  ? 123 SER A CB  1 
ATOM   1016 O  OG  . SER A 1 123 ? -29.307 41.158 27.747  1.00 10.96  ? 123 SER A OG  1 
ATOM   1017 N  N   . GLU A 1 124 ? -29.984 38.045 28.065  1.00 9.61   ? 124 GLU A N   1 
ATOM   1018 C  CA  . GLU A 1 124 ? -30.831 37.002 27.512  1.00 9.51   ? 124 GLU A CA  1 
ATOM   1019 C  C   . GLU A 1 124 ? -32.232 37.583 27.140  1.00 8.02   ? 124 GLU A C   1 
ATOM   1020 O  O   . GLU A 1 124 ? -33.194 37.399 27.882  1.00 9.08   ? 124 GLU A O   1 
ATOM   1021 C  CB  . GLU A 1 124 ? -30.898 35.861 28.496  1.00 10.39  ? 124 GLU A CB  1 
ATOM   1022 C  CG  . GLU A 1 124 ? -31.655 34.619 27.968  1.00 10.51  ? 124 GLU A CG  1 
ATOM   1023 C  CD  . GLU A 1 124 ? -30.969 33.987 26.803  1.00 10.39  ? 124 GLU A CD  1 
ATOM   1024 O  OE1 . GLU A 1 124 ? -29.810 33.508 26.938  1.00 11.23  ? 124 GLU A OE1 1 
ATOM   1025 O  OE2 . GLU A 1 124 ? -31.555 33.949 25.694  1.00 10.57  ? 124 GLU A OE2 1 
ATOM   1026 N  N   . PRO A 1 125 ? -32.291 38.278 25.981  1.00 8.91   ? 125 PRO A N   1 
ATOM   1027 C  CA  . PRO A 1 125 ? -33.606 38.798 25.501  1.00 8.78   ? 125 PRO A CA  1 
ATOM   1028 C  C   . PRO A 1 125 ? -34.324 37.665 24.779  1.00 7.85   ? 125 PRO A C   1 
ATOM   1029 O  O   . PRO A 1 125 ? -33.760 36.976 23.937  1.00 9.16   ? 125 PRO A O   1 
ATOM   1030 C  CB  . PRO A 1 125 ? -33.175 39.889 24.556  1.00 9.55   ? 125 PRO A CB  1 
ATOM   1031 C  CG  . PRO A 1 125 ? -31.821 39.465 24.061  1.00 8.89   ? 125 PRO A CG  1 
ATOM   1032 C  CD  . PRO A 1 125 ? -31.192 38.726 25.162  1.00 9.03   ? 125 PRO A CD  1 
ATOM   1033 N  N   . ILE A 1 126 ? -35.609 37.548 25.123  1.00 7.64   ? 126 ILE A N   1 
ATOM   1034 C  CA  . ILE A 1 126 ? -36.477 36.539 24.557  1.00 8.26   ? 126 ILE A CA  1 
ATOM   1035 C  C   . ILE A 1 126 ? -37.802 37.210 24.195  1.00 9.37   ? 126 ILE A C   1 
ATOM   1036 O  O   . ILE A 1 126 ? -38.203 38.236 24.782  1.00 10.73  ? 126 ILE A O   1 
ATOM   1037 C  CB  . ILE A 1 126 ? -36.727 35.369 25.462  1.00 10.24  ? 126 ILE A CB  1 
ATOM   1038 C  CG1 . ILE A 1 126 ? -37.536 35.743 26.699  1.00 13.36  ? 126 ILE A CG1 1 
ATOM   1039 C  CG2 . ILE A 1 126 ? -35.534 34.664 25.791  1.00 15.15  ? 126 ILE A CG2 1 
ATOM   1040 C  CD1 . ILE A 1 126 ? -38.262 34.649 27.441  1.00 18.24  ? 126 ILE A CD1 1 
ATOM   1041 N  N   . ILE A 1 127 ? -38.462 36.644 23.200  1.00 7.46   ? 127 ILE A N   1 
ATOM   1042 C  CA  . ILE A 1 127 ? -39.831 37.082 22.829  1.00 7.63   ? 127 ILE A CA  1 
ATOM   1043 C  C   . ILE A 1 127 ? -40.742 35.902 22.877  1.00 6.77   ? 127 ILE A C   1 
ATOM   1044 O  O   . ILE A 1 127 ? -40.438 34.843 22.310  1.00 8.13   ? 127 ILE A O   1 
ATOM   1045 C  CB  . ILE A 1 127 ? -39.873 37.771 21.427  1.00 7.32   ? 127 ILE A CB  1 
ATOM   1046 C  CG1 . ILE A 1 127 ? -38.827 38.866 21.282  1.00 8.57   ? 127 ILE A CG1 1 
ATOM   1047 C  CG2 . ILE A 1 127 ? -41.298 38.342 21.196  1.00 8.80   ? 127 ILE A CG2 1 
ATOM   1048 C  CD1 . ILE A 1 127 ? -38.682 39.373 19.881  1.00 11.09  ? 127 ILE A CD1 1 
ATOM   1049 N  N   . ALA A 1 128 ? -41.869 36.065 23.543  1.00 6.95   ? 128 ALA A N   1 
ATOM   1050 C  CA  . ALA A 1 128 ? -42.959 35.093 23.596  1.00 7.13   ? 128 ALA A CA  1 
ATOM   1051 C  C   . ALA A 1 128 ? -44.102 35.557 22.712  1.00 8.01   ? 128 ALA A C   1 
ATOM   1052 O  O   . ALA A 1 128 ? -44.521 36.714 22.865  1.00 8.86   ? 128 ALA A O   1 
ATOM   1053 C  CB  . ALA A 1 128 ? -43.468 34.915 25.044  1.00 9.36   ? 128 ALA A CB  1 
ATOM   1054 N  N   . PHE A 1 129 ? -44.536 34.725 21.789  1.00 8.23   ? 129 PHE A N   1 
ATOM   1055 C  CA  . PHE A 1 129 ? -45.654 35.004 20.941  1.00 7.37   ? 129 PHE A CA  1 
ATOM   1056 C  C   . PHE A 1 129 ? -46.827 34.105 21.271  1.00 7.90   ? 129 PHE A C   1 
ATOM   1057 O  O   . PHE A 1 129 ? -46.627 32.937 21.624  1.00 8.27   ? 129 PHE A O   1 
ATOM   1058 C  CB  . PHE A 1 129 ? -45.312 34.808 19.468  1.00 8.05   ? 129 PHE A CB  1 
ATOM   1059 C  CG  . PHE A 1 129 ? -44.212 35.703 18.938  1.00 7.61   ? 129 PHE A CG  1 
ATOM   1060 C  CD1 . PHE A 1 129 ? -44.497 36.899 18.369  1.00 8.29   ? 129 PHE A CD1 1 
ATOM   1061 C  CD2 . PHE A 1 129 ? -42.880 35.304 19.021  1.00 8.81   ? 129 PHE A CD2 1 
ATOM   1062 C  CE1 . PHE A 1 129 ? -43.545 37.748 17.856  1.00 8.02   ? 129 PHE A CE1 1 
ATOM   1063 C  CE2 . PHE A 1 129 ? -41.913 36.148 18.521  1.00 9.23   ? 129 PHE A CE2 1 
ATOM   1064 C  CZ  . PHE A 1 129 ? -42.220 37.374 17.939  1.00 9.56   ? 129 PHE A CZ  1 
ATOM   1065 N  N   . ALA A 1 130 ? -48.038 34.591 21.067  1.00 7.07   ? 130 ALA A N   1 
ATOM   1066 C  CA  . ALA A 1 130 ? -49.238 33.787 21.162  1.00 7.09   ? 130 ALA A CA  1 
ATOM   1067 C  C   . ALA A 1 130 ? -50.171 34.184 20.033  1.00 6.96   ? 130 ALA A C   1 
ATOM   1068 O  O   . ALA A 1 130 ? -50.358 35.401 19.846  1.00 7.55   ? 130 ALA A O   1 
ATOM   1069 C  CB  . ALA A 1 130 ? -49.948 34.000 22.525  1.00 10.08  ? 130 ALA A CB  1 
ATOM   1070 N  N   . ALA A 1 131 ? -50.724 33.238 19.336  1.00 7.35   ? 131 ALA A N   1 
ATOM   1071 C  CA  . ALA A 1 131 ? -51.736 33.526 18.293  1.00 6.98   ? 131 ALA A CA  1 
ATOM   1072 C  C   . ALA A 1 131 ? -53.005 32.857 18.633  1.00 7.40   ? 131 ALA A C   1 
ATOM   1073 O  O   . ALA A 1 131 ? -53.057 31.810 19.302  1.00 10.06  ? 131 ALA A O   1 
ATOM   1074 C  CB  . ALA A 1 131 ? -51.245 33.063 16.926  1.00 9.00   ? 131 ALA A CB  1 
ATOM   1075 N  N   . ASP A 1 132 ? -54.139 33.434 18.242  1.00 6.53   ? 132 ASP A N   1 
ATOM   1076 C  CA  . ASP A 1 132 ? -55.431 32.801 18.324  1.00 5.80   ? 132 ASP A CA  1 
ATOM   1077 C  C   . ASP A 1 132 ? -56.074 32.795 16.965  1.00 5.82   ? 132 ASP A C   1 
ATOM   1078 O  O   . ASP A 1 132 ? -55.804 33.649 16.088  1.00 6.70   ? 132 ASP A O   1 
ATOM   1079 C  CB  . ASP A 1 132 ? -56.341 33.512 19.366  1.00 7.83   ? 132 ASP A CB  1 
ATOM   1080 C  CG  . ASP A 1 132 ? -57.668 32.812 19.631  1.00 6.97   ? 132 ASP A CG  1 
ATOM   1081 O  OD1 . ASP A 1 132 ? -57.732 31.570 19.473  1.00 8.57   ? 132 ASP A OD1 1 
ATOM   1082 O  OD2 . ASP A 1 132 ? -58.621 33.529 19.990  1.00 7.94   ? 132 ASP A OD2 1 
ATOM   1083 N  N   . LYS A 1 133 ? -56.911 31.808 16.786  1.00 6.05   ? 133 LYS A N   1 
ATOM   1084 C  CA  . LYS A 1 133 ? -57.685 31.557 15.573  1.00 5.86   ? 133 LYS A CA  1 
ATOM   1085 C  C   . LYS A 1 133 ? -56.802 31.206 14.437  1.00 6.02   ? 133 LYS A C   1 
ATOM   1086 O  O   . LYS A 1 133 ? -57.023 31.584 13.265  1.00 7.42   ? 133 LYS A O   1 
ATOM   1087 C  CB  . LYS A 1 133 ? -58.651 32.674 15.309  1.00 7.35   ? 133 LYS A CB  1 
ATOM   1088 C  CG  . LYS A 1 133 ? -59.571 33.023 16.480  1.00 7.15   ? 133 LYS A CG  1 
ATOM   1089 C  CD  . LYS A 1 133 ? -60.649 31.979 16.739  1.00 8.06   ? 133 LYS A CD  1 
ATOM   1090 C  CE  . LYS A 1 133 ? -61.547 32.327 17.905  1.00 8.62   ? 133 LYS A CE  1 
ATOM   1091 N  NZ  . LYS A 1 133 ? -60.928 32.104 19.264  1.00 8.53   ? 133 LYS A NZ  1 
ATOM   1092 N  N   . THR A 1 134 ? -55.765 30.402 14.684  1.00 6.81   ? 134 THR A N   1 
ATOM   1093 C  CA  A THR A 1 134 ? -54.918 29.874 13.647  0.50 6.54   ? 134 THR A CA  1 
ATOM   1094 C  CA  B THR A 1 134 ? -54.769 30.034 13.715  0.50 9.25   ? 134 THR A CA  1 
ATOM   1095 C  C   . THR A 1 134 ? -54.191 28.626 14.026  1.00 8.67   ? 134 THR A C   1 
ATOM   1096 O  O   . THR A 1 134 ? -54.263 28.182 15.119  1.00 11.53  ? 134 THR A O   1 
ATOM   1097 C  CB  A THR A 1 134 ? -54.041 30.922 13.037  0.50 6.18   ? 134 THR A CB  1 
ATOM   1098 C  CB  B THR A 1 134 ? -53.629 31.137 13.497  0.50 13.50  ? 134 THR A CB  1 
ATOM   1099 O  OG1 A THR A 1 134 ? -53.389 30.510 11.829  0.50 3.73   ? 134 THR A OG1 1 
ATOM   1100 O  OG1 B THR A 1 134 ? -52.452 30.716 14.086  0.50 18.21  ? 134 THR A OG1 1 
ATOM   1101 C  CG2 A THR A 1 134 ? -52.975 31.456 14.129  0.50 7.10   ? 134 THR A CG2 1 
ATOM   1102 C  CG2 B THR A 1 134 ? -53.901 32.564 14.143  0.50 13.63  ? 134 THR A CG2 1 
ATOM   1103 N  N   . GLU A 1 135 ? -53.598 28.014 13.047  1.00 12.57  ? 135 GLU A N   1 
ATOM   1104 C  CA  . GLU A 1 135 ? -52.824 26.729 13.206  1.00 13.50  ? 135 GLU A CA  1 
ATOM   1105 C  C   . GLU A 1 135 ? -51.389 26.983 13.495  1.00 12.63  ? 135 GLU A C   1 
ATOM   1106 O  O   . GLU A 1 135 ? -50.847 28.045 13.252  1.00 11.55  ? 135 GLU A O   1 
ATOM   1107 C  CB  . GLU A 1 135 ? -52.933 25.905 11.949  1.00 14.20  ? 135 GLU A CB  1 
ATOM   1108 C  CG  . GLU A 1 135 ? -52.309 26.571 10.655  1.00 16.08  ? 135 GLU A CG  1 
ATOM   1109 C  CD  . GLU A 1 135 ? -52.365 25.809 9.255   1.00 15.32  ? 135 GLU A CD  1 
ATOM   1110 O  OE1 . GLU A 1 135 ? -53.082 24.727 9.271   1.00 24.38  ? 135 GLU A OE1 1 
ATOM   1111 O  OE2 . GLU A 1 135 ? -51.795 26.291 8.348   1.00 15.43  ? 135 GLU A OE2 1 
ATOM   1112 N  N   . PRO A 1 136 ? -50.564 25.942 14.022  1.00 12.18  ? 136 PRO A N   1 
ATOM   1113 C  CA  . PRO A 1 136 ? -49.156 26.180 14.267  1.00 12.60  ? 136 PRO A CA  1 
ATOM   1114 C  C   . PRO A 1 136 ? -48.357 26.517 13.077  1.00 9.85   ? 136 PRO A C   1 
ATOM   1115 O  O   . PRO A 1 136 ? -47.375 27.335 13.166  1.00 11.45  ? 136 PRO A O   1 
ATOM   1116 C  CB  . PRO A 1 136 ? -48.707 24.858 14.870  1.00 12.16  ? 136 PRO A CB  1 
ATOM   1117 C  CG  . PRO A 1 136 ? -49.860 24.261 15.332  1.00 18.46  ? 136 PRO A CG  1 
ATOM   1118 C  CD  . PRO A 1 136 ? -51.005 24.683 14.563  1.00 15.82  ? 136 PRO A CD  1 
ATOM   1119 N  N   . GLY A 1 137 ? -48.820 26.112 11.860  1.00 9.23   ? 137 GLY A N   1 
ATOM   1120 C  CA  . GLY A 1 137 ? -48.140 26.481 10.644  1.00 8.46   ? 137 GLY A CA  1 
ATOM   1121 C  C   . GLY A 1 137 ? -48.256 27.986 10.281  1.00 6.19   ? 137 GLY A C   1 
ATOM   1122 O  O   . GLY A 1 137 ? -47.581 28.403 9.361   1.00 7.22   ? 137 GLY A O   1 
ATOM   1123 N  N   . ALA A 1 138 ? -49.113 28.708 10.997  1.00 6.71   ? 138 ALA A N   1 
ATOM   1124 C  CA  . ALA A 1 138 ? -49.157 30.159 10.818  1.00 6.75   ? 138 ALA A CA  1 
ATOM   1125 C  C   . ALA A 1 138 ? -47.817 30.825 11.052  1.00 6.87   ? 138 ALA A C   1 
ATOM   1126 O  O   . ALA A 1 138 ? -47.531 31.900 10.536  1.00 7.55   ? 138 ALA A O   1 
ATOM   1127 C  CB  . ALA A 1 138 ? -50.191 30.790 11.763  1.00 8.80   ? 138 ALA A CB  1 
ATOM   1128 N  N   . PHE A 1 139 ? -46.988 30.210 11.915  1.00 6.00   ? 139 PHE A N   1 
ATOM   1129 C  CA  . PHE A 1 139 ? -45.671 30.694 12.176  1.00 5.81   ? 139 PHE A CA  1 
ATOM   1130 C  C   . PHE A 1 139 ? -44.606 30.233 11.210  1.00 5.68   ? 139 PHE A C   1 
ATOM   1131 O  O   . PHE A 1 139 ? -43.467 30.665 11.318  1.00 6.59   ? 139 PHE A O   1 
ATOM   1132 C  CB  . PHE A 1 139 ? -45.259 30.434 13.640  1.00 6.70   ? 139 PHE A CB  1 
ATOM   1133 C  CG  . PHE A 1 139 ? -46.063 31.112 14.692  1.00 7.20   ? 139 PHE A CG  1 
ATOM   1134 C  CD1 . PHE A 1 139 ? -46.611 32.359 14.533  1.00 13.87  ? 139 PHE A CD1 1 
ATOM   1135 C  CD2 . PHE A 1 139 ? -46.305 30.550 15.902  1.00 8.17   ? 139 PHE A CD2 1 
ATOM   1136 C  CE1 . PHE A 1 139 ? -47.274 33.002 15.540  1.00 15.48  ? 139 PHE A CE1 1 
ATOM   1137 C  CE2 . PHE A 1 139 ? -46.973 31.174 16.911  1.00 8.40   ? 139 PHE A CE2 1 
ATOM   1138 C  CZ  . PHE A 1 139 ? -47.398 32.438 16.768  1.00 10.58  ? 139 PHE A CZ  1 
ATOM   1139 N  N   . ASN A 1 140 ? -44.973 29.412 10.226  1.00 5.98   ? 140 ASN A N   1 
ATOM   1140 C  CA  . ASN A 1 140 ? -43.952 28.972 9.287   1.00 6.34   ? 140 ASN A CA  1 
ATOM   1141 C  C   . ASN A 1 140 ? -43.320 30.099 8.495   1.00 5.45   ? 140 ASN A C   1 
ATOM   1142 O  O   . ASN A 1 140 ? -42.130 30.184 8.332   1.00 6.28   ? 140 ASN A O   1 
ATOM   1143 C  CB  . ASN A 1 140 ? -44.512 27.926 8.296   1.00 6.35   ? 140 ASN A CB  1 
ATOM   1144 C  CG  . ASN A 1 140 ? -44.588 26.509 8.841   1.00 6.87   ? 140 ASN A CG  1 
ATOM   1145 O  OD1 . ASN A 1 140 ? -44.217 26.234 9.987   1.00 7.67   ? 140 ASN A OD1 1 
ATOM   1146 N  ND2 . ASN A 1 140 ? -45.065 25.611 7.954   1.00 7.66   ? 140 ASN A ND2 1 
ATOM   1147 N  N   . LEU A 1 141 ? -44.175 30.996 7.967   1.00 6.07   ? 141 LEU A N   1 
ATOM   1148 C  CA  A LEU A 1 141 ? -43.675 32.132 7.186   0.50 5.20   ? 141 LEU A CA  1 
ATOM   1149 C  CA  B LEU A 1 141 ? -43.663 32.109 7.177   0.50 5.63   ? 141 LEU A CA  1 
ATOM   1150 C  C   . LEU A 1 141 ? -42.790 33.067 8.039   1.00 5.70   ? 141 LEU A C   1 
ATOM   1151 O  O   . LEU A 1 141 ? -41.678 33.354 7.641   1.00 5.93   ? 141 LEU A O   1 
ATOM   1152 C  CB  A LEU A 1 141 ? -44.816 32.822 6.408   0.50 6.15   ? 141 LEU A CB  1 
ATOM   1153 C  CB  B LEU A 1 141 ? -44.803 32.723 6.341   0.50 6.76   ? 141 LEU A CB  1 
ATOM   1154 C  CG  A LEU A 1 141 ? -44.443 34.100 5.654   0.50 6.22   ? 141 LEU A CG  1 
ATOM   1155 C  CG  B LEU A 1 141 ? -44.584 34.026 5.597   0.50 8.96   ? 141 LEU A CG  1 
ATOM   1156 C  CD1 A LEU A 1 141 ? -45.313 34.280 4.344   0.50 7.07   ? 141 LEU A CD1 1 
ATOM   1157 C  CD1 B LEU A 1 141 ? -43.418 33.971 4.792   0.50 14.71  ? 141 LEU A CD1 1 
ATOM   1158 C  CD2 A LEU A 1 141 ? -44.645 35.341 6.611   0.50 4.23   ? 141 LEU A CD2 1 
ATOM   1159 C  CD2 B LEU A 1 141 ? -45.787 34.294 4.637   0.50 7.25   ? 141 LEU A CD2 1 
ATOM   1160 N  N   . PRO A 1 142 ? -43.281 33.494 9.223   1.00 5.04   ? 142 PRO A N   1 
ATOM   1161 C  CA  . PRO A 1 142 ? -42.413 34.324 10.044  1.00 5.82   ? 142 PRO A CA  1 
ATOM   1162 C  C   . PRO A 1 142 ? -41.112 33.645 10.455  1.00 5.69   ? 142 PRO A C   1 
ATOM   1163 O  O   . PRO A 1 142 ? -40.057 34.311 10.434  1.00 6.07   ? 142 PRO A O   1 
ATOM   1164 C  CB  . PRO A 1 142 ? -43.288 34.692 11.210  1.00 7.15   ? 142 PRO A CB  1 
ATOM   1165 C  CG  . PRO A 1 142 ? -44.720 34.651 10.661  1.00 7.96   ? 142 PRO A CG  1 
ATOM   1166 C  CD  . PRO A 1 142 ? -44.673 33.492 9.711   1.00 5.44   ? 142 PRO A CD  1 
ATOM   1167 N  N   . LEU A 1 143 ? -41.189 32.383 10.840  1.00 5.73   ? 143 LEU A N   1 
ATOM   1168 C  CA  . LEU A 1 143 ? -39.927 31.713 11.266  1.00 6.04   ? 143 LEU A CA  1 
ATOM   1169 C  C   . LEU A 1 143 ? -38.943 31.568 10.125  1.00 6.05   ? 143 LEU A C   1 
ATOM   1170 O  O   . LEU A 1 143 ? -37.743 31.781 10.269  1.00 7.06   ? 143 LEU A O   1 
ATOM   1171 C  CB  . LEU A 1 143 ? -40.267 30.374 11.881  1.00 7.02   ? 143 LEU A CB  1 
ATOM   1172 C  CG  . LEU A 1 143 ? -40.821 30.372 13.290  1.00 7.20   ? 143 LEU A CG  1 
ATOM   1173 C  CD1 . LEU A 1 143 ? -41.457 29.057 13.683  1.00 8.34   ? 143 LEU A CD1 1 
ATOM   1174 C  CD2 . LEU A 1 143 ? -39.699 30.756 14.306  1.00 9.60   ? 143 LEU A CD2 1 
ATOM   1175 N  N   . TYR A 1 144 ? -39.430 31.204 8.922   1.00 5.99   ? 144 TYR A N   1 
ATOM   1176 C  CA  . TYR A 1 144 ? -38.598 31.194 7.792   1.00 5.98   ? 144 TYR A CA  1 
ATOM   1177 C  C   . TYR A 1 144 ? -37.961 32.553 7.548   1.00 5.78   ? 144 TYR A C   1 
ATOM   1178 O  O   . TYR A 1 144 ? -36.766 32.684 7.301   1.00 7.37   ? 144 TYR A O   1 
ATOM   1179 C  CB  . TYR A 1 144 ? -39.321 30.740 6.507   1.00 7.15   ? 144 TYR A CB  1 
ATOM   1180 C  CG  . TYR A 1 144 ? -38.443 30.758 5.295   1.00 7.11   ? 144 TYR A CG  1 
ATOM   1181 C  CD1 . TYR A 1 144 ? -37.603 29.676 5.018   1.00 8.29   ? 144 TYR A CD1 1 
ATOM   1182 C  CD2 . TYR A 1 144 ? -38.401 31.863 4.481   1.00 9.47   ? 144 TYR A CD2 1 
ATOM   1183 C  CE1 . TYR A 1 144 ? -36.731 29.713 3.969   1.00 9.85   ? 144 TYR A CE1 1 
ATOM   1184 C  CE2 . TYR A 1 144 ? -37.477 31.903 3.411   1.00 10.13  ? 144 TYR A CE2 1 
ATOM   1185 C  CZ  . TYR A 1 144 ? -36.637 30.776 3.216   1.00 10.09  ? 144 TYR A CZ  1 
ATOM   1186 O  OH  . TYR A 1 144 ? -35.724 30.793 2.145   1.00 13.31  ? 144 TYR A OH  1 
ATOM   1187 N  N   . LYS A 1 145 ? -38.788 33.609 7.601   1.00 6.05   ? 145 LYS A N   1 
ATOM   1188 C  CA  . LYS A 1 145 ? -38.265 34.933 7.302   1.00 6.88   ? 145 LYS A CA  1 
ATOM   1189 C  C   . LYS A 1 145 ? -37.154 35.339 8.267   1.00 6.12   ? 145 LYS A C   1 
ATOM   1190 O  O   . LYS A 1 145 ? -36.121 35.839 7.848   1.00 7.10   ? 145 LYS A O   1 
ATOM   1191 C  CB  . LYS A 1 145 ? -39.369 35.980 7.246   1.00 7.05   ? 145 LYS A CB  1 
ATOM   1192 C  CG  . LYS A 1 145 ? -40.229 35.906 5.977   1.00 8.92   ? 145 LYS A CG  1 
ATOM   1193 C  CD  . LYS A 1 145 ? -41.328 37.084 6.095   1.00 15.00  ? 145 LYS A CD  1 
ATOM   1194 C  CE  . LYS A 1 145 ? -42.163 37.344 5.023   1.00 21.72  ? 145 LYS A CE  1 
ATOM   1195 N  NZ  . LYS A 1 145 ? -43.045 38.598 5.466   1.00 16.85  ? 145 LYS A NZ  1 
ATOM   1196 N  N   . MET A 1 146 ? -37.442 35.203 9.564   1.00 6.28   ? 146 MET A N   1 
ATOM   1197 C  CA  . MET A 1 146 ? -36.494 35.710 10.534  1.00 6.45   ? 146 MET A CA  1 
ATOM   1198 C  C   . MET A 1 146 ? -35.186 34.952 10.559  1.00 6.71   ? 146 MET A C   1 
ATOM   1199 O  O   . MET A 1 146 ? -34.173 35.547 10.954  1.00 7.76   ? 146 MET A O   1 
ATOM   1200 C  CB  . MET A 1 146 ? -37.097 35.789 11.937  1.00 7.01   ? 146 MET A CB  1 
ATOM   1201 C  CG  . MET A 1 146 ? -37.302 34.472 12.623  1.00 7.70   ? 146 MET A CG  1 
ATOM   1202 S  SD  . MET A 1 146 ? -38.107 34.499 14.236  1.00 8.15   ? 146 MET A SD  1 
ATOM   1203 C  CE  . MET A 1 146 ? -39.800 35.001 13.853  1.00 8.90   ? 146 MET A CE  1 
ATOM   1204 N  N   . PHE A 1 147 ? -35.186 33.676 10.203  1.00 7.50   ? 147 PHE A N   1 
ATOM   1205 C  CA  . PHE A 1 147 ? -33.983 32.890 10.229  1.00 7.12   ? 147 PHE A CA  1 
ATOM   1206 C  C   . PHE A 1 147 ? -33.358 32.695 8.883   1.00 6.86   ? 147 PHE A C   1 
ATOM   1207 O  O   . PHE A 1 147 ? -32.175 32.280 8.848   1.00 9.01   ? 147 PHE A O   1 
ATOM   1208 C  CB  . PHE A 1 147 ? -34.218 31.571 10.922  1.00 7.81   ? 147 PHE A CB  1 
ATOM   1209 C  CG  . PHE A 1 147 ? -34.461 31.684 12.404  1.00 7.06   ? 147 PHE A CG  1 
ATOM   1210 C  CD1 . PHE A 1 147 ? -33.420 32.100 13.248  1.00 7.77   ? 147 PHE A CD1 1 
ATOM   1211 C  CD2 . PHE A 1 147 ? -35.663 31.456 12.973  1.00 7.70   ? 147 PHE A CD2 1 
ATOM   1212 C  CE1 . PHE A 1 147 ? -33.627 32.213 14.584  1.00 7.80   ? 147 PHE A CE1 1 
ATOM   1213 C  CE2 . PHE A 1 147 ? -35.911 31.563 14.324  1.00 7.89   ? 147 PHE A CE2 1 
ATOM   1214 C  CZ  . PHE A 1 147 ? -34.812 31.973 15.144  1.00 8.54   ? 147 PHE A CZ  1 
ATOM   1215 N  N   . ALA A 1 148 ? -34.033 32.938 7.771   1.00 7.29   ? 148 ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 148 ? -33.538 32.569 6.467   1.00 7.05   ? 148 ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 148 ? -33.745 33.556 5.343   1.00 8.19   ? 148 ALA A C   1 
ATOM   1218 O  O   . ALA A 1 148 ? -33.163 33.391 4.277   1.00 12.57  ? 148 ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 148 ? -34.025 31.194 6.015   1.00 8.92   ? 148 ALA A CB  1 
ATOM   1220 N  N   . ASP A 1 149 ? -34.544 34.600 5.547   1.00 7.62   ? 149 ASP A N   1 
ATOM   1221 C  CA  . ASP A 1 149 ? -34.834 35.548 4.467   1.00 8.71   ? 149 ASP A CA  1 
ATOM   1222 C  C   . ASP A 1 149 ? -33.992 36.787 4.580   1.00 7.51   ? 149 ASP A C   1 
ATOM   1223 O  O   . ASP A 1 149 ? -34.155 37.567 5.535   1.00 7.83   ? 149 ASP A O   1 
ATOM   1224 C  CB  . ASP A 1 149 ? -36.311 35.956 4.484   1.00 8.58   ? 149 ASP A CB  1 
ATOM   1225 C  CG  . ASP A 1 149 ? -36.641 37.060 3.502   1.00 12.40  ? 149 ASP A CG  1 
ATOM   1226 O  OD1 . ASP A 1 149 ? -35.956 37.205 2.465   1.00 10.56  ? 149 ASP A OD1 1 
ATOM   1227 O  OD2 . ASP A 1 149 ? -37.699 37.876 3.780   1.00 12.47  ? 149 ASP A OD2 1 
ATOM   1228 N  N   . PRO A 1 150 ? -33.036 37.008 3.670   1.00 8.37   ? 150 PRO A N   1 
ATOM   1229 C  CA  . PRO A 1 150 ? -32.175 38.196 3.787   1.00 9.77   ? 150 PRO A CA  1 
ATOM   1230 C  C   . PRO A 1 150 ? -32.940 39.526 3.584   1.00 8.91   ? 150 PRO A C   1 
ATOM   1231 O  O   . PRO A 1 150 ? -32.351 40.576 3.870   1.00 11.04  ? 150 PRO A O   1 
ATOM   1232 C  CB  . PRO A 1 150 ? -31.133 37.962 2.706   1.00 11.69  ? 150 PRO A CB  1 
ATOM   1233 C  CG  . PRO A 1 150 ? -31.775 37.066 1.728   1.00 15.67  ? 150 PRO A CG  1 
ATOM   1234 C  CD  . PRO A 1 150 ? -32.711 36.207 2.492   1.00 10.53  ? 150 PRO A CD  1 
ATOM   1235 N  N   . PHE A 1 151 ? -34.138 39.494 3.089   1.00 8.10   ? 151 PHE A N   1 
ATOM   1236 C  CA  . PHE A 1 151 ? -34.969 40.683 3.027   1.00 8.81   ? 151 PHE A CA  1 
ATOM   1237 C  C   . PHE A 1 151 ? -35.607 41.014 4.353   1.00 7.11   ? 151 PHE A C   1 
ATOM   1238 O  O   . PHE A 1 151 ? -36.149 42.150 4.455   1.00 8.32   ? 151 PHE A O   1 
ATOM   1239 C  CB  . PHE A 1 151 ? -36.019 40.598 1.908   1.00 9.13   ? 151 PHE A CB  1 
ATOM   1240 C  CG  . PHE A 1 151 ? -35.467 40.715 0.520   1.00 9.08   ? 151 PHE A CG  1 
ATOM   1241 C  CD1 . PHE A 1 151 ? -34.870 39.688 -0.108  1.00 16.01  ? 151 PHE A CD1 1 
ATOM   1242 C  CD2 . PHE A 1 151 ? -35.644 41.828 -0.186  1.00 9.00   ? 151 PHE A CD2 1 
ATOM   1243 C  CE1 . PHE A 1 151 ? -34.367 39.832 -1.422  1.00 19.44  ? 151 PHE A CE1 1 
ATOM   1244 C  CE2 . PHE A 1 151 ? -35.188 42.013 -1.470  1.00 11.76  ? 151 PHE A CE2 1 
ATOM   1245 C  CZ  . PHE A 1 151 ? -34.470 41.047 -2.078  1.00 14.78  ? 151 PHE A CZ  1 
ATOM   1246 N  N   . THR A 1 152 ? -35.553 40.168 5.345   1.00 7.17   ? 152 THR A N   1 
ATOM   1247 C  CA  . THR A 1 152 ? -36.062 40.349 6.688   1.00 6.68   ? 152 THR A CA  1 
ATOM   1248 C  C   . THR A 1 152 ? -34.924 40.597 7.668   1.00 7.82   ? 152 THR A C   1 
ATOM   1249 O  O   . THR A 1 152 ? -34.934 41.551 8.406   1.00 8.96   ? 152 THR A O   1 
ATOM   1250 C  CB  . THR A 1 152 ? -36.944 39.197 7.081   1.00 7.08   ? 152 THR A CB  1 
ATOM   1251 O  OG1 . THR A 1 152 ? -38.075 39.076 6.207   1.00 9.20   ? 152 THR A OG1 1 
ATOM   1252 C  CG2 . THR A 1 152 ? -37.463 39.300 8.536   1.00 7.79   ? 152 THR A CG2 1 
ATOM   1253 N  N   . THR A 1 153 ? -34.018 39.630 7.717   1.00 7.31   ? 153 THR A N   1 
ATOM   1254 C  CA  . THR A 1 153 ? -32.934 39.603 8.695   1.00 7.09   ? 153 THR A CA  1 
ATOM   1255 C  C   . THR A 1 153 ? -31.660 40.040 8.025   1.00 7.58   ? 153 THR A C   1 
ATOM   1256 O  O   . THR A 1 153 ? -30.966 39.251 7.387   1.00 9.14   ? 153 THR A O   1 
ATOM   1257 C  CB  . THR A 1 153 ? -32.870 38.248 9.394   1.00 7.67   ? 153 THR A CB  1 
ATOM   1258 O  OG1 . THR A 1 153 ? -34.088 38.105 10.113  1.00 8.76   ? 153 THR A OG1 1 
ATOM   1259 C  CG2 . THR A 1 153 ? -31.643 38.095 10.340  1.00 9.36   ? 153 THR A CG2 1 
ATOM   1260 N  N   . ALA A 1 154 ? -31.357 41.328 8.110   1.00 7.41   ? 154 ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 154 ? -30.175 41.906 7.572   1.00 7.59   ? 154 ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 154 ? -28.925 41.233 8.046   1.00 6.93   ? 154 ALA A C   1 
ATOM   1263 O  O   . ALA A 1 154 ? -27.916 41.152 7.313   1.00 7.93   ? 154 ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 154 ? -30.099 43.424 7.805   1.00 10.45  ? 154 ALA A CB  1 
ATOM   1265 N  N   . GLY A 1 155 ? -28.938 40.783 9.271   1.00 7.30   ? 155 GLY A N   1 
ATOM   1266 C  CA  . GLY A 1 155 ? -27.747 40.122 9.852   1.00 8.35   ? 155 GLY A CA  1 
ATOM   1267 C  C   . GLY A 1 155 ? -27.271 38.943 9.093   1.00 6.89   ? 155 GLY A C   1 
ATOM   1268 O  O   . GLY A 1 155 ? -26.069 38.651 9.119   1.00 8.99   ? 155 GLY A O   1 
ATOM   1269 N  N   . LEU A 1 156 ? -28.122 38.238 8.369   1.00 7.57   ? 156 LEU A N   1 
ATOM   1270 C  CA  . LEU A 1 156 ? -27.666 37.118 7.573   1.00 8.48   ? 156 LEU A CA  1 
ATOM   1271 C  C   . LEU A 1 156 ? -26.608 37.553 6.571   1.00 8.64   ? 156 LEU A C   1 
ATOM   1272 O  O   . LEU A 1 156 ? -25.723 36.751 6.211   1.00 9.36   ? 156 LEU A O   1 
ATOM   1273 C  CB  . LEU A 1 156 ? -28.843 36.469 6.805   1.00 8.79   ? 156 LEU A CB  1 
ATOM   1274 C  CG  . LEU A 1 156 ? -29.878 35.786 7.698   1.00 9.27   ? 156 LEU A CG  1 
ATOM   1275 C  CD1 . LEU A 1 156 ? -31.136 35.442 6.884   1.00 10.92  ? 156 LEU A CD1 1 
ATOM   1276 C  CD2 . LEU A 1 156 ? -29.329 34.528 8.416   1.00 11.23  ? 156 LEU A CD2 1 
ATOM   1277 N  N   . VAL A 1 157 ? -26.681 38.782 6.058   1.00 8.15   ? 157 VAL A N   1 
ATOM   1278 C  CA  . VAL A 1 157 ? -25.779 39.311 5.092   1.00 8.13   ? 157 VAL A CA  1 
ATOM   1279 C  C   . VAL A 1 157 ? -24.707 40.163 5.677   1.00 9.60   ? 157 VAL A C   1 
ATOM   1280 O  O   . VAL A 1 157 ? -23.581 40.168 5.173   1.00 11.23  ? 157 VAL A O   1 
ATOM   1281 C  CB  . VAL A 1 157 ? -26.584 40.117 3.992   1.00 8.33   ? 157 VAL A CB  1 
ATOM   1282 C  CG1 . VAL A 1 157 ? -25.665 40.823 3.014   1.00 10.74  ? 157 VAL A CG1 1 
ATOM   1283 C  CG2 . VAL A 1 157 ? -27.540 39.211 3.277   1.00 11.04  ? 157 VAL A CG2 1 
ATOM   1284 N  N   . ILE A 1 158 ? -25.004 40.968 6.705   1.00 9.75   ? 158 ILE A N   1 
ATOM   1285 C  CA  . ILE A 1 158 ? -24.071 41.994 7.203   1.00 9.33   ? 158 ILE A CA  1 
ATOM   1286 C  C   . ILE A 1 158 ? -23.481 41.701 8.540   1.00 9.87   ? 158 ILE A C   1 
ATOM   1287 O  O   . ILE A 1 158 ? -22.564 42.495 8.942   1.00 10.54  ? 158 ILE A O   1 
ATOM   1288 C  CB  . ILE A 1 158 ? -24.686 43.430 7.047   1.00 9.32   ? 158 ILE A CB  1 
ATOM   1289 C  CG1 . ILE A 1 158 ? -25.719 43.721 8.143   1.00 10.22  ? 158 ILE A CG1 1 
ATOM   1290 C  CG2 . ILE A 1 158 ? -25.169 43.704 5.638   1.00 11.19  ? 158 ILE A CG2 1 
ATOM   1291 C  CD1 . ILE A 1 158 ? -26.211 45.176 8.174   1.00 10.95  ? 158 ILE A CD1 1 
ATOM   1292 N  N   . ASP A 1 159 ? -23.871 40.672 9.263   1.00 10.65  ? 159 ASP A N   1 
ATOM   1293 C  CA  . ASP A 1 159 ? -23.359 40.325 10.568  1.00 11.77  ? 159 ASP A CA  1 
ATOM   1294 C  C   . ASP A 1 159 ? -22.576 39.056 10.357  1.00 12.07  ? 159 ASP A C   1 
ATOM   1295 O  O   . ASP A 1 159 ? -23.111 37.965 10.140  1.00 12.53  ? 159 ASP A O   1 
ATOM   1296 C  CB  . ASP A 1 159 ? -24.455 40.151 11.586  1.00 10.84  ? 159 ASP A CB  1 
ATOM   1297 C  CG  . ASP A 1 159 ? -23.890 39.938 12.996  1.00 12.01  ? 159 ASP A CG  1 
ATOM   1298 O  OD1 . ASP A 1 159 ? -22.731 39.445 13.129  1.00 14.31  ? 159 ASP A OD1 1 
ATOM   1299 O  OD2 . ASP A 1 159 ? -24.638 40.173 13.967  1.00 13.51  ? 159 ASP A OD2 1 
ATOM   1300 N  N   . PRO A 1 160 ? -21.207 39.145 10.377  1.00 13.53  ? 160 PRO A N   1 
ATOM   1301 C  CA  . PRO A 1 160 ? -20.437 37.928 10.103  1.00 14.08  ? 160 PRO A CA  1 
ATOM   1302 C  C   . PRO A 1 160 ? -20.739 36.792 11.042  1.00 14.58  ? 160 PRO A C   1 
ATOM   1303 O  O   . PRO A 1 160 ? -20.575 35.639 10.673  1.00 16.62  ? 160 PRO A O   1 
ATOM   1304 C  CB  . PRO A 1 160 ? -19.000 38.422 10.203  1.00 17.18  ? 160 PRO A CB  1 
ATOM   1305 C  CG  . PRO A 1 160 ? -19.029 39.653 10.921  1.00 17.74  ? 160 PRO A CG  1 
ATOM   1306 C  CD  . PRO A 1 160 ? -20.359 40.291 10.712  1.00 13.12  ? 160 PRO A CD  1 
ATOM   1307 N  N   . SER A 1 161 ? -21.206 37.066 12.239  1.00 13.63  ? 161 SER A N   1 
ATOM   1308 C  CA  . SER A 1 161 ? -21.553 35.985 13.153  1.00 14.80  ? 161 SER A CA  1 
ATOM   1309 C  C   . SER A 1 161 ? -22.717 35.159 12.780  1.00 14.88  ? 161 SER A C   1 
ATOM   1310 O  O   . SER A 1 161 ? -22.939 34.118 13.366  1.00 17.08  ? 161 SER A O   1 
ATOM   1311 C  CB  . SER A 1 161 ? -21.721 36.542 14.606  1.00 15.50  ? 161 SER A CB  1 
ATOM   1312 O  OG  . SER A 1 161 ? -22.906 37.248 14.771  1.00 16.56  ? 161 SER A OG  1 
ATOM   1313 N  N   . MET A 1 162 ? -23.540 35.615 11.796  1.00 13.31  ? 162 MET A N   1 
ATOM   1314 C  CA  . MET A 1 162 ? -24.741 34.921 11.350  1.00 13.36  ? 162 MET A CA  1 
ATOM   1315 C  C   . MET A 1 162 ? -24.605 34.257 9.971   1.00 14.98  ? 162 MET A C   1 
ATOM   1316 O  O   . MET A 1 162 ? -25.555 33.666 9.473   1.00 14.03  ? 162 MET A O   1 
ATOM   1317 C  CB  . MET A 1 162 ? -25.939 35.931 11.255  1.00 12.01  ? 162 MET A CB  1 
ATOM   1318 C  CG  . MET A 1 162 ? -26.236 36.539 12.598  1.00 15.07  ? 162 MET A CG  1 
ATOM   1319 S  SD  . MET A 1 162 ? -27.665 37.608 12.718  1.00 16.11  ? 162 MET A SD  1 
ATOM   1320 C  CE  . MET A 1 162 ? -28.985 36.465 12.404  1.00 15.22  ? 162 MET A CE  1 
ATOM   1321 N  N   . HIS A 1 163 ? -23.428 34.343 9.401   1.00 14.53  ? 163 HIS A N   1 
ATOM   1322 C  CA  . HIS A 1 163 ? -23.264 34.050 8.005   1.00 16.07  ? 163 HIS A CA  1 
ATOM   1323 C  C   . HIS A 1 163 ? -23.564 32.554 7.757   1.00 14.78  ? 163 HIS A C   1 
ATOM   1324 O  O   . HIS A 1 163 ? -23.903 32.159 6.630   1.00 16.23  ? 163 HIS A O   1 
ATOM   1325 C  CB  . HIS A 1 163 ? -21.794 34.320 7.628   1.00 19.46  ? 163 HIS A CB  1 
ATOM   1326 C  CG  . HIS A 1 163 ? -21.545 34.385 6.158   1.00 28.33  ? 163 HIS A CG  1 
ATOM   1327 N  ND1 . HIS A 1 163 ? -20.971 33.333 5.486   1.00 33.87  ? 163 HIS A ND1 1 
ATOM   1328 C  CD2 . HIS A 1 163 ? -21.768 35.366 5.240   1.00 29.70  ? 163 HIS A CD2 1 
ATOM   1329 C  CE1 . HIS A 1 163 ? -20.906 33.635 4.193   1.00 29.96  ? 163 HIS A CE1 1 
ATOM   1330 N  NE2 . HIS A 1 163 ? -21.403 34.860 4.022   1.00 30.68  ? 163 HIS A NE2 1 
ATOM   1331 N  N   . GLU A 1 164 ? -23.328 31.702 8.754   1.00 13.55  ? 164 GLU A N   1 
ATOM   1332 C  CA  . GLU A 1 164 ? -23.500 30.283 8.564   1.00 14.80  ? 164 GLU A CA  1 
ATOM   1333 C  C   . GLU A 1 164 ? -24.909 29.749 8.609   1.00 12.83  ? 164 GLU A C   1 
ATOM   1334 O  O   . GLU A 1 164 ? -25.170 28.604 8.258   1.00 15.69  ? 164 GLU A O   1 
ATOM   1335 C  CB  . GLU A 1 164 ? -22.661 29.479 9.536   1.00 16.64  ? 164 GLU A CB  1 
ATOM   1336 C  CG  . GLU A 1 164 ? -21.117 29.658 9.238   1.00 24.83  ? 164 GLU A CG  1 
ATOM   1337 C  CD  . GLU A 1 164 ? -20.451 30.973 9.690   1.00 31.36  ? 164 GLU A CD  1 
ATOM   1338 O  OE1 . GLU A 1 164 ? -19.482 31.481 8.915   1.00 40.25  ? 164 GLU A OE1 1 
ATOM   1339 O  OE2 . GLU A 1 164 ? -20.809 31.435 10.846  1.00 41.22  ? 164 GLU A OE2 1 
ATOM   1340 N  N   . GLY A 1 165 ? -25.844 30.593 9.024   1.00 12.01  ? 165 GLY A N   1 
ATOM   1341 C  CA  . GLY A 1 165 ? -27.234 30.218 8.925   1.00 11.63  ? 165 GLY A CA  1 
ATOM   1342 C  C   . GLY A 1 165 ? -27.762 29.383 10.052  1.00 11.28  ? 165 GLY A C   1 
ATOM   1343 O  O   . GLY A 1 165 ? -27.273 29.375 11.206  1.00 11.56  ? 165 GLY A O   1 
ATOM   1344 N  N   . PHE A 1 166 ? -28.867 28.703 9.779   1.00 10.35  ? 166 PHE A N   1 
ATOM   1345 C  CA  . PHE A 1 166 ? -29.680 28.095 10.771  1.00 9.79   ? 166 PHE A CA  1 
ATOM   1346 C  C   . PHE A 1 166 ? -30.118 26.664 10.389  1.00 9.63   ? 166 PHE A C   1 
ATOM   1347 O  O   . PHE A 1 166 ? -30.135 26.314 9.194   1.00 11.52  ? 166 PHE A O   1 
ATOM   1348 C  CB  . PHE A 1 166 ? -30.934 28.981 11.134  1.00 9.83   ? 166 PHE A CB  1 
ATOM   1349 C  CG  . PHE A 1 166 ? -30.493 30.202 11.889  1.00 9.23   ? 166 PHE A CG  1 
ATOM   1350 C  CD1 . PHE A 1 166 ? -30.101 31.345 11.253  1.00 10.72  ? 166 PHE A CD1 1 
ATOM   1351 C  CD2 . PHE A 1 166 ? -30.455 30.183 13.302  1.00 9.78   ? 166 PHE A CD2 1 
ATOM   1352 C  CE1 . PHE A 1 166 ? -29.616 32.432 11.938  1.00 10.22  ? 166 PHE A CE1 1 
ATOM   1353 C  CE2 . PHE A 1 166 ? -29.973 31.260 13.986  1.00 10.02  ? 166 PHE A CE2 1 
ATOM   1354 C  CZ  . PHE A 1 166 ? -29.526 32.387 13.291  1.00 10.72  ? 166 PHE A CZ  1 
ATOM   1355 N  N   . ILE A 1 167 ? -30.513 25.892 11.390  1.00 10.02  ? 167 ILE A N   1 
ATOM   1356 C  CA  . ILE A 1 167 ? -31.012 24.546 11.235  1.00 10.16  ? 167 ILE A CA  1 
ATOM   1357 C  C   . ILE A 1 167 ? -32.445 24.515 11.668  1.00 10.23  ? 167 ILE A C   1 
ATOM   1358 O  O   . ILE A 1 167 ? -32.829 24.918 12.754  1.00 10.10  ? 167 ILE A O   1 
ATOM   1359 C  CB  . ILE A 1 167 ? -30.240 23.541 12.133  1.00 12.03  ? 167 ILE A CB  1 
ATOM   1360 C  CG1 . ILE A 1 167 ? -28.712 23.639 11.931  1.00 14.81  ? 167 ILE A CG1 1 
ATOM   1361 C  CG2 . ILE A 1 167 ? -30.755 22.155 11.858  1.00 14.27  ? 167 ILE A CG2 1 
ATOM   1362 C  CD1 . ILE A 1 167 ? -27.855 22.908 13.029  1.00 17.85  ? 167 ILE A CD1 1 
ATOM   1363 N  N   . PHE A 1 168 ? -33.300 24.102 10.726  1.00 9.63   ? 168 PHE A N   1 
ATOM   1364 C  CA  . PHE A 1 168 ? -34.776 23.991 10.945  1.00 8.72   ? 168 PHE A CA  1 
ATOM   1365 C  C   . PHE A 1 168 ? -35.164 22.539 11.236  1.00 8.40   ? 168 PHE A C   1 
ATOM   1366 O  O   . PHE A 1 168 ? -34.848 21.692 10.344  1.00 10.18  ? 168 PHE A O   1 
ATOM   1367 C  CB  . PHE A 1 168 ? -35.526 24.504 9.736   1.00 8.65   ? 168 PHE A CB  1 
ATOM   1368 C  CG  . PHE A 1 168 ? -35.405 25.975 9.478   1.00 8.38   ? 168 PHE A CG  1 
ATOM   1369 C  CD1 . PHE A 1 168 ? -34.266 26.564 8.911   1.00 9.95   ? 168 PHE A CD1 1 
ATOM   1370 C  CD2 . PHE A 1 168 ? -36.455 26.832 9.791   1.00 8.67   ? 168 PHE A CD2 1 
ATOM   1371 C  CE1 . PHE A 1 168 ? -34.235 27.931 8.664   1.00 9.06   ? 168 PHE A CE1 1 
ATOM   1372 C  CE2 . PHE A 1 168 ? -36.391 28.193 9.510   1.00 9.87   ? 168 PHE A CE2 1 
ATOM   1373 C  CZ  . PHE A 1 168 ? -35.306 28.725 8.941   1.00 9.43   ? 168 PHE A CZ  1 
ATOM   1374 N  N   . GLU A 1 169 ? -35.829 22.288 12.342  1.00 8.64   ? 169 GLU A N   1 
ATOM   1375 C  CA  . GLU A 1 169 ? -36.437 20.977 12.648  1.00 9.33   ? 169 GLU A CA  1 
ATOM   1376 C  C   . GLU A 1 169 ? -37.881 21.071 12.263  1.00 8.36   ? 169 GLU A C   1 
ATOM   1377 O  O   . GLU A 1 169 ? -38.654 21.803 12.904  1.00 9.37   ? 169 GLU A O   1 
ATOM   1378 C  CB  . GLU A 1 169 ? -36.266 20.687 14.118  1.00 9.20   ? 169 GLU A CB  1 
ATOM   1379 C  CG  . GLU A 1 169 ? -36.899 19.448 14.620  1.00 11.19  ? 169 GLU A CG  1 
ATOM   1380 C  CD  . GLU A 1 169 ? -36.784 19.230 16.105  1.00 11.60  ? 169 GLU A CD  1 
ATOM   1381 O  OE1 . GLU A 1 169 ? -37.817 18.971 16.727  1.00 13.46  ? 169 GLU A OE1 1 
ATOM   1382 O  OE2 . GLU A 1 169 ? -35.614 19.322 16.578  1.00 14.22  ? 169 GLU A OE2 1 
ATOM   1383 N  N   . VAL A 1 170 ? -38.240 20.350 11.205  1.00 8.94   ? 170 VAL A N   1 
ATOM   1384 C  CA  . VAL A 1 170 ? -39.582 20.406 10.612  1.00 8.55   ? 170 VAL A CA  1 
ATOM   1385 C  C   . VAL A 1 170 ? -40.294 19.088 10.931  1.00 9.83   ? 170 VAL A C   1 
ATOM   1386 O  O   . VAL A 1 170 ? -39.743 17.986 10.685  1.00 10.54  ? 170 VAL A O   1 
ATOM   1387 C  CB  . VAL A 1 170 ? -39.466 20.570 9.077   1.00 9.81   ? 170 VAL A CB  1 
ATOM   1388 C  CG1 . VAL A 1 170 ? -40.858 20.469 8.430   1.00 10.48  ? 170 VAL A CG1 1 
ATOM   1389 C  CG2 . VAL A 1 170 ? -38.776 21.899 8.760   1.00 10.85  ? 170 VAL A CG2 1 
ATOM   1390 N  N   . LEU A 1 171 ? -41.491 19.161 11.496  1.00 9.18   ? 171 LEU A N   1 
ATOM   1391 C  CA  . LEU A 1 171 ? -42.338 18.044 11.811  1.00 9.67   ? 171 LEU A CA  1 
ATOM   1392 C  C   . LEU A 1 171 ? -43.390 17.845 10.762  1.00 9.97   ? 171 LEU A C   1 
ATOM   1393 O  O   . LEU A 1 171 ? -44.188 18.762 10.495  1.00 9.87   ? 171 LEU A O   1 
ATOM   1394 C  CB  . LEU A 1 171 ? -42.940 18.215 13.195  1.00 10.48  ? 171 LEU A CB  1 
ATOM   1395 C  CG  . LEU A 1 171 ? -43.862 17.077 13.688  1.00 11.11  ? 171 LEU A CG  1 
ATOM   1396 C  CD1 . LEU A 1 171 ? -43.052 15.744 13.849  1.00 13.72  ? 171 LEU A CD1 1 
ATOM   1397 C  CD2 . LEU A 1 171 ? -44.520 17.475 15.001  1.00 13.33  ? 171 LEU A CD2 1 
ATOM   1398 N  N   . ASP A 1 172 ? -43.437 16.647 10.129  1.00 9.89   ? 172 ASP A N   1 
ATOM   1399 C  CA  . ASP A 1 172 ? -44.570 16.188 9.344   1.00 10.40  ? 172 ASP A CA  1 
ATOM   1400 C  C   . ASP A 1 172 ? -45.603 15.671 10.317  1.00 10.56  ? 172 ASP A C   1 
ATOM   1401 O  O   . ASP A 1 172 ? -45.418 14.583 10.936  1.00 11.96  ? 172 ASP A O   1 
ATOM   1402 C  CB  . ASP A 1 172 ? -44.107 15.120 8.338   1.00 11.77  ? 172 ASP A CB  1 
ATOM   1403 C  CG  . ASP A 1 172 ? -45.249 14.468 7.578   1.00 12.82  ? 172 ASP A CG  1 
ATOM   1404 O  OD1 . ASP A 1 172 ? -46.400 14.635 7.913   1.00 12.19  ? 172 ASP A OD1 1 
ATOM   1405 O  OD2 . ASP A 1 172 ? -44.874 13.707 6.650   1.00 15.42  ? 172 ASP A OD2 1 
ATOM   1406 N  N   . VAL A 1 173 ? -46.674 16.401 10.569  1.00 10.96  ? 173 VAL A N   1 
ATOM   1407 C  CA  . VAL A 1 173 ? -47.636 16.087 11.563  1.00 10.94  ? 173 VAL A CA  1 
ATOM   1408 C  C   . VAL A 1 173 ? -48.623 14.968 11.080  1.00 12.41  ? 173 VAL A C   1 
ATOM   1409 O  O   . VAL A 1 173 ? -49.350 14.468 11.950  1.00 13.67  ? 173 VAL A O   1 
ATOM   1410 C  CB  . VAL A 1 173 ? -48.445 17.315 12.049  1.00 11.55  ? 173 VAL A CB  1 
ATOM   1411 C  CG1 . VAL A 1 173 ? -47.488 18.321 12.717  1.00 12.73  ? 173 VAL A CG1 1 
ATOM   1412 C  CG2 . VAL A 1 173 ? -49.201 18.002 10.892  1.00 12.93  ? 173 VAL A CG2 1 
ATOM   1413 N  N   . VAL A 1 174 ? -48.571 14.603 9.812   1.00 13.17  ? 174 VAL A N   1 
ATOM   1414 C  CA  . VAL A 1 174 ? -49.452 13.521 9.295   1.00 15.40  ? 174 VAL A CA  1 
ATOM   1415 C  C   . VAL A 1 174 ? -48.719 12.175 9.533   1.00 15.67  ? 174 VAL A C   1 
ATOM   1416 O  O   . VAL A 1 174 ? -49.314 11.284 10.158  1.00 19.73  ? 174 VAL A O   1 
ATOM   1417 C  CB  . VAL A 1 174 ? -49.784 13.748 7.856   1.00 16.21  ? 174 VAL A CB  1 
ATOM   1418 C  CG1 . VAL A 1 174 ? -50.533 12.552 7.221   1.00 19.67  ? 174 VAL A CG1 1 
ATOM   1419 C  CG2 . VAL A 1 174 ? -50.618 15.053 7.731   1.00 19.14  ? 174 VAL A CG2 1 
ATOM   1420 N  N   . GLU A 1 175 ? -47.489 12.065 9.037   1.00 15.03  ? 175 GLU A N   1 
ATOM   1421 C  CA  . GLU A 1 175 ? -46.720 10.815 9.142   1.00 17.70  ? 175 GLU A CA  1 
ATOM   1422 C  C   . GLU A 1 175 ? -45.794 10.703 10.298  1.00 19.83  ? 175 GLU A C   1 
ATOM   1423 O  O   . GLU A 1 175 ? -45.147 9.670  10.507  1.00 21.70  ? 175 GLU A O   1 
ATOM   1424 C  CB  . GLU A 1 175 ? -46.032 10.507 7.816   1.00 18.91  ? 175 GLU A CB  1 
ATOM   1425 C  CG  . GLU A 1 175 ? -46.910 10.305 6.640   1.00 21.08  ? 175 GLU A CG  1 
ATOM   1426 C  CD  . GLU A 1 175 ? -46.174 10.001 5.301   1.00 26.47  ? 175 GLU A CD  1 
ATOM   1427 O  OE1 . GLU A 1 175 ? -44.914 9.948  5.176   1.00 31.16  ? 175 GLU A OE1 1 
ATOM   1428 O  OE2 . GLU A 1 175 ? -46.893 9.978  4.312   1.00 35.24  ? 175 GLU A OE2 1 
ATOM   1429 N  N   . HIS A 1 176 ? -45.718 11.738 11.125  1.00 17.60  ? 176 HIS A N   1 
ATOM   1430 C  CA  . HIS A 1 176 ? -44.924 11.715 12.315  1.00 17.44  ? 176 HIS A CA  1 
ATOM   1431 C  C   . HIS A 1 176 ? -43.422 11.471 11.967  1.00 16.37  ? 176 HIS A C   1 
ATOM   1432 O  O   . HIS A 1 176 ? -42.783 10.527 12.481  1.00 18.67  ? 176 HIS A O   1 
ATOM   1433 C  CB  . HIS A 1 176 ? -45.453 10.711 13.422  1.00 20.71  ? 176 HIS A CB  1 
ATOM   1434 C  CG  . HIS A 1 176 ? -45.136 11.172 14.862  1.00 31.78  ? 176 HIS A CG  1 
ATOM   1435 N  ND1 . HIS A 1 176 ? -44.883 10.292 15.935  1.00 40.42  ? 176 HIS A ND1 1 
ATOM   1436 C  CD2 . HIS A 1 176 ? -45.098 12.443 15.411  1.00 35.80  ? 176 HIS A CD2 1 
ATOM   1437 C  CE1 . HIS A 1 176 ? -44.674 11.000 17.045  1.00 40.74  ? 176 HIS A CE1 1 
ATOM   1438 N  NE2 . HIS A 1 176 ? -44.806 12.304 16.752  1.00 43.25  ? 176 HIS A NE2 1 
ATOM   1439 N  N   . LYS A 1 177 ? -42.887 12.296 11.082  1.00 14.44  ? 177 LYS A N   1 
ATOM   1440 C  CA  . LYS A 1 177 ? -41.526 12.239 10.599  1.00 14.22  ? 177 LYS A CA  1 
ATOM   1441 C  C   . LYS A 1 177 ? -40.883 13.616 10.810  1.00 12.30  ? 177 LYS A C   1 
ATOM   1442 O  O   . LYS A 1 177 ? -41.567 14.630 10.659  1.00 13.61  ? 177 LYS A O   1 
ATOM   1443 C  CB  . LYS A 1 177 ? -41.503 11.885 9.126   1.00 15.54  ? 177 LYS A CB  1 
ATOM   1444 C  CG  . LYS A 1 177 ? -41.949 10.445 8.863   1.00 19.28  ? 177 LYS A CG  1 
ATOM   1445 C  CD  . LYS A 1 177 ? -42.083 10.136 7.379   1.00 21.55  ? 177 LYS A CD  1 
ATOM   1446 C  CE  . LYS A 1 177 ? -42.590 8.683  7.258   1.00 24.52  ? 177 LYS A CE  1 
ATOM   1447 N  NZ  . LYS A 1 177 ? -42.778 8.404  5.774   1.00 29.21  ? 177 LYS A NZ  1 
ATOM   1448 N  N   . VAL A 1 178 ? -39.618 13.654 11.107  1.00 13.17  ? 178 VAL A N   1 
ATOM   1449 C  CA  . VAL A 1 178 ? -38.870 14.861 11.359  1.00 11.89  ? 178 VAL A CA  1 
ATOM   1450 C  C   . VAL A 1 178 ? -37.834 15.026 10.247  1.00 12.76  ? 178 VAL A C   1 
ATOM   1451 O  O   . VAL A 1 178 ? -37.138 14.080 9.841   1.00 14.55  ? 178 VAL A O   1 
ATOM   1452 C  CB  . VAL A 1 178 ? -38.211 14.884 12.722  1.00 12.84  ? 178 VAL A CB  1 
ATOM   1453 C  CG1 . VAL A 1 178 ? -37.280 16.144 12.911  1.00 15.43  ? 178 VAL A CG1 1 
ATOM   1454 C  CG2 . VAL A 1 178 ? -39.286 14.778 13.825  1.00 15.55  ? 178 VAL A CG2 1 
ATOM   1455 N  N   . TYR A 1 179 ? -37.663 16.264 9.743   1.00 11.75  ? 179 TYR A N   1 
ATOM   1456 C  CA  . TYR A 1 179 ? -36.678 16.602 8.811   1.00 12.19  ? 179 TYR A CA  1 
ATOM   1457 C  C   . TYR A 1 179 ? -35.804 17.701 9.382   1.00 12.44  ? 179 TYR A C   1 
ATOM   1458 O  O   . TYR A 1 179 ? -36.305 18.618 10.034  1.00 13.61  ? 179 TYR A O   1 
ATOM   1459 C  CB  . TYR A 1 179 ? -37.332 17.109 7.510   1.00 15.28  ? 179 TYR A CB  1 
ATOM   1460 C  CG  . TYR A 1 179 ? -38.245 16.040 6.903   1.00 14.71  ? 179 TYR A CG  1 
ATOM   1461 C  CD1 . TYR A 1 179 ? -37.723 15.129 5.975   1.00 18.57  ? 179 TYR A CD1 1 
ATOM   1462 C  CD2 . TYR A 1 179 ? -39.521 15.875 7.279   1.00 14.73  ? 179 TYR A CD2 1 
ATOM   1463 C  CE1 . TYR A 1 179 ? -38.478 14.085 5.459   1.00 17.62  ? 179 TYR A CE1 1 
ATOM   1464 C  CE2 . TYR A 1 179 ? -40.309 14.864 6.767   1.00 16.92  ? 179 TYR A CE2 1 
ATOM   1465 C  CZ  . TYR A 1 179 ? -39.777 13.926 5.867   1.00 17.03  ? 179 TYR A CZ  1 
ATOM   1466 O  OH  . TYR A 1 179 ? -40.609 12.941 5.320   1.00 19.28  ? 179 TYR A OH  1 
ATOM   1467 N  N   . LEU A 1 180 ? -34.491 17.682 9.106   1.00 12.03  ? 180 LEU A N   1 
ATOM   1468 C  CA  . LEU A 1 180 ? -33.566 18.690 9.495   1.00 13.03  ? 180 LEU A CA  1 
ATOM   1469 C  C   . LEU A 1 180 ? -33.002 19.345 8.270   1.00 13.64  ? 180 LEU A C   1 
ATOM   1470 O  O   . LEU A 1 180 ? -32.394 18.705 7.363   1.00 18.03  ? 180 LEU A O   1 
ATOM   1471 C  CB  . LEU A 1 180 ? -32.412 18.100 10.263  1.00 15.18  ? 180 LEU A CB  1 
ATOM   1472 C  CG  . LEU A 1 180 ? -32.719 17.717 11.612  1.00 17.68  ? 180 LEU A CG  1 
ATOM   1473 C  CD1 . LEU A 1 180 ? -31.401 17.068 12.252  1.00 21.24  ? 180 LEU A CD1 1 
ATOM   1474 C  CD2 . LEU A 1 180 ? -33.155 18.937 12.559  1.00 22.20  ? 180 LEU A CD2 1 
ATOM   1475 N  N   . LEU A 1 181 ? -33.258 20.626 8.102   1.00 11.23  ? 181 LEU A N   1 
ATOM   1476 C  CA  . LEU A 1 181 ? -32.851 21.373 6.931   1.00 12.94  ? 181 LEU A CA  1 
ATOM   1477 C  C   . LEU A 1 181 ? -32.000 22.554 7.318   1.00 11.06  ? 181 LEU A C   1 
ATOM   1478 O  O   . LEU A 1 181 ? -32.286 23.221 8.312   1.00 13.63  ? 181 LEU A O   1 
ATOM   1479 C  CB  . LEU A 1 181 ? -34.117 21.855 6.165   1.00 15.21  ? 181 LEU A CB  1 
ATOM   1480 C  CG  . LEU A 1 181 ? -34.885 20.664 5.517   1.00 23.43  ? 181 LEU A CG  1 
ATOM   1481 C  CD1 . LEU A 1 181 ? -36.052 20.287 6.286   1.00 22.73  ? 181 LEU A CD1 1 
ATOM   1482 C  CD2 . LEU A 1 181 ? -34.997 20.648 4.142   1.00 23.11  ? 181 LEU A CD2 1 
ATOM   1483 N  N   . LYS A 1 182 ? -30.976 22.851 6.541   1.00 10.35  ? 182 LYS A N   1 
ATOM   1484 C  CA  . LYS A 1 182 ? -30.050 23.894 6.845   1.00 11.62  ? 182 LYS A CA  1 
ATOM   1485 C  C   . LYS A 1 182 ? -30.092 25.004 5.835   1.00 11.43  ? 182 LYS A C   1 
ATOM   1486 O  O   . LYS A 1 182 ? -29.936 24.716 4.648   1.00 13.99  ? 182 LYS A O   1 
ATOM   1487 C  CB  . LYS A 1 182 ? -28.604 23.318 6.879   1.00 16.85  ? 182 LYS A CB  1 
ATOM   1488 C  CG  . LYS A 1 182 ? -28.439 22.228 7.862   1.00 22.54  ? 182 LYS A CG  1 
ATOM   1489 C  CD  . LYS A 1 182 ? -28.184 20.931 7.211   1.00 34.02  ? 182 LYS A CD  1 
ATOM   1490 C  CE  . LYS A 1 182 ? -26.874 21.064 6.489   1.00 32.94  ? 182 LYS A CE  1 
ATOM   1491 N  NZ  . LYS A 1 182 ? -26.296 19.863 5.777   1.00 42.57  ? 182 LYS A NZ  1 
ATOM   1492 N  N   . THR A 1 183 ? -30.239 26.230 6.237   1.00 10.43  ? 183 THR A N   1 
ATOM   1493 C  CA  . THR A 1 183 ? -30.209 27.365 5.354   1.00 10.76  ? 183 THR A CA  1 
ATOM   1494 C  C   . THR A 1 183 ? -28.867 28.065 5.464   1.00 12.55  ? 183 THR A C   1 
ATOM   1495 O  O   . THR A 1 183 ? -28.261 28.076 6.530   1.00 14.23  ? 183 THR A O   1 
ATOM   1496 C  CB  . THR A 1 183 ? -31.390 28.324 5.644   1.00 10.34  ? 183 THR A CB  1 
ATOM   1497 O  OG1 . THR A 1 183 ? -31.378 28.640 7.053   1.00 11.29  ? 183 THR A OG1 1 
ATOM   1498 C  CG2 . THR A 1 183 ? -32.676 27.650 5.294   1.00 11.49  ? 183 THR A CG2 1 
ATOM   1499 N  N   . PRO A 1 184 ? -28.314 28.587 4.358   1.00 12.42  ? 184 PRO A N   1 
ATOM   1500 C  CA  . PRO A 1 184 ? -29.026 28.856 3.097   1.00 12.79  ? 184 PRO A CA  1 
ATOM   1501 C  C   . PRO A 1 184 ? -29.182 27.710 2.126   1.00 10.46  ? 184 PRO A C   1 
ATOM   1502 O  O   . PRO A 1 184 ? -30.033 27.771 1.259   1.00 11.20  ? 184 PRO A O   1 
ATOM   1503 C  CB  . PRO A 1 184 ? -28.161 29.990 2.483   1.00 14.13  ? 184 PRO A CB  1 
ATOM   1504 C  CG  . PRO A 1 184 ? -26.803 29.742 3.005   1.00 18.06  ? 184 PRO A CG  1 
ATOM   1505 C  CD  . PRO A 1 184 ? -26.980 29.275 4.382   1.00 15.31  ? 184 PRO A CD  1 
ATOM   1506 N  N   . GLU A 1 185 ? -28.327 26.678 2.187   1.00 11.66  ? 185 GLU A N   1 
ATOM   1507 C  CA  . GLU A 1 185 ? -28.246 25.766 1.089   1.00 11.73  ? 185 GLU A CA  1 
ATOM   1508 C  C   . GLU A 1 185 ? -29.523 24.937 0.815   1.00 10.93  ? 185 GLU A C   1 
ATOM   1509 O  O   . GLU A 1 185 ? -29.773 24.589 -0.333  1.00 12.39  ? 185 GLU A O   1 
ATOM   1510 C  CB  . GLU A 1 185 ? -27.099 24.852 1.163   1.00 15.13  ? 185 GLU A CB  1 
ATOM   1511 C  CG  . GLU A 1 185 ? -27.018 23.981 2.277   1.00 17.74  ? 185 GLU A CG  1 
ATOM   1512 C  CD  . GLU A 1 185 ? -26.265 24.517 3.502   1.00 23.82  ? 185 GLU A CD  1 
ATOM   1513 O  OE1 . GLU A 1 185 ? -26.266 25.783 3.780   1.00 20.51  ? 185 GLU A OE1 1 
ATOM   1514 O  OE2 . GLU A 1 185 ? -25.745 23.612 4.252   1.00 29.22  ? 185 GLU A OE2 1 
ATOM   1515 N  N   . ASP A 1 186 ? -30.293 24.640 1.855   1.00 10.19  ? 186 ASP A N   1 
ATOM   1516 C  CA  . ASP A 1 186 ? -31.472 23.790 1.721   1.00 10.57  ? 186 ASP A CA  1 
ATOM   1517 C  C   . ASP A 1 186 ? -32.751 24.656 1.628   1.00 10.81  ? 186 ASP A C   1 
ATOM   1518 O  O   . ASP A 1 186 ? -33.851 24.119 1.804   1.00 11.09  ? 186 ASP A O   1 
ATOM   1519 C  CB  . ASP A 1 186 ? -31.659 22.823 2.888   1.00 11.30  ? 186 ASP A CB  1 
ATOM   1520 C  CG  . ASP A 1 186 ? -30.509 21.839 3.039   1.00 14.47  ? 186 ASP A CG  1 
ATOM   1521 O  OD1 . ASP A 1 186 ? -29.843 21.543 2.035   1.00 16.76  ? 186 ASP A OD1 1 
ATOM   1522 O  OD2 . ASP A 1 186 ? -30.440 21.316 4.210   1.00 13.77  ? 186 ASP A OD2 1 
ATOM   1523 N  N   . ALA A 1 187 ? -32.637 25.970 1.372   1.00 9.97   ? 187 ALA A N   1 
ATOM   1524 C  CA  . ALA A 1 187 ? -33.786 26.866 1.412   1.00 9.49   ? 187 ALA A CA  1 
ATOM   1525 C  C   . ALA A 1 187 ? -34.900 26.364 0.510   1.00 9.59   ? 187 ALA A C   1 
ATOM   1526 O  O   . ALA A 1 187 ? -36.087 26.446 0.913   1.00 9.81   ? 187 ALA A O   1 
ATOM   1527 C  CB  . ALA A 1 187 ? -33.390 28.325 1.071   1.00 11.63  ? 187 ALA A CB  1 
ATOM   1528 N  N   . TYR A 1 188 ? -34.617 25.932 -0.686  1.00 9.63   ? 188 TYR A N   1 
ATOM   1529 C  CA  . TYR A 1 188 ? -35.681 25.573 -1.599  1.00 9.66   ? 188 TYR A CA  1 
ATOM   1530 C  C   . TYR A 1 188 ? -36.413 24.339 -1.196  1.00 10.01  ? 188 TYR A C   1 
ATOM   1531 O  O   . TYR A 1 188 ? -37.638 24.245 -1.277  1.00 10.85  ? 188 TYR A O   1 
ATOM   1532 C  CB  . TYR A 1 188 ? -35.208 25.505 -3.087  1.00 10.81  ? 188 TYR A CB  1 
ATOM   1533 C  CG  . TYR A 1 188 ? -34.503 26.724 -3.575  1.00 11.85  ? 188 TYR A CG  1 
ATOM   1534 C  CD1 . TYR A 1 188 ? -34.646 27.963 -3.040  1.00 12.14  ? 188 TYR A CD1 1 
ATOM   1535 C  CD2 . TYR A 1 188 ? -33.677 26.593 -4.699  1.00 12.09  ? 188 TYR A CD2 1 
ATOM   1536 C  CE1 . TYR A 1 188 ? -33.924 29.048 -3.524  1.00 13.49  ? 188 TYR A CE1 1 
ATOM   1537 C  CE2 . TYR A 1 188 ? -32.971 27.647 -5.153  1.00 14.49  ? 188 TYR A CE2 1 
ATOM   1538 C  CZ  . TYR A 1 188 ? -33.014 28.843 -4.573  1.00 14.27  ? 188 TYR A CZ  1 
ATOM   1539 O  OH  . TYR A 1 188 ? -32.312 29.999 -5.022  1.00 18.33  ? 188 TYR A OH  1 
ATOM   1540 N  N   . SER A 1 189 ? -35.656 23.337 -0.744  1.00 10.97  ? 189 SER A N   1 
ATOM   1541 C  CA  . SER A 1 189 ? -36.264 22.132 -0.184  1.00 10.87  ? 189 SER A CA  1 
ATOM   1542 C  C   . SER A 1 189 ? -37.092 22.447 1.066   1.00 10.19  ? 189 SER A C   1 
ATOM   1543 O  O   . SER A 1 189 ? -38.208 21.921 1.229   1.00 10.59  ? 189 SER A O   1 
ATOM   1544 C  CB  . SER A 1 189 ? -35.189 21.117 0.171   1.00 13.78  ? 189 SER A CB  1 
ATOM   1545 O  OG  . SER A 1 189 ? -34.496 20.657 -0.969  1.00 19.70  ? 189 SER A OG  1 
ATOM   1546 N  N   . LEU A 1 190 ? -36.537 23.256 1.973   1.00 9.51   ? 190 LEU A N   1 
ATOM   1547 C  CA  . LEU A 1 190 ? -37.290 23.653 3.148   1.00 8.93   ? 190 LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 190 ? -38.646 24.263 2.769   1.00 8.92   ? 190 LEU A C   1 
ATOM   1549 O  O   . LEU A 1 190 ? -39.661 23.832 3.311   1.00 8.73   ? 190 LEU A O   1 
ATOM   1550 C  CB  . LEU A 1 190 ? -36.449 24.602 3.979   1.00 8.60   ? 190 LEU A CB  1 
ATOM   1551 C  CG  . LEU A 1 190 ? -37.087 25.256 5.194   1.00 9.02   ? 190 LEU A CG  1 
ATOM   1552 C  CD1 . LEU A 1 190 ? -37.564 24.198 6.218   1.00 10.19  ? 190 LEU A CD1 1 
ATOM   1553 C  CD2 . LEU A 1 190 ? -36.117 26.284 5.794   1.00 9.51   ? 190 LEU A CD2 1 
ATOM   1554 N  N   . LEU A 1 191 ? -38.610 25.238 1.860   1.00 8.57   ? 191 LEU A N   1 
ATOM   1555 C  CA  . LEU A 1 191 ? -39.832 25.891 1.442   1.00 8.14   ? 191 LEU A CA  1 
ATOM   1556 C  C   . LEU A 1 191 ? -40.842 24.952 0.735   1.00 8.50   ? 191 LEU A C   1 
ATOM   1557 O  O   . LEU A 1 191 ? -42.057 25.078 0.894   1.00 9.07   ? 191 LEU A O   1 
ATOM   1558 C  CB  . LEU A 1 191 ? -39.504 27.080 0.542   1.00 7.96   ? 191 LEU A CB  1 
ATOM   1559 C  CG  . LEU A 1 191 ? -38.879 28.285 1.254   1.00 8.31   ? 191 LEU A CG  1 
ATOM   1560 C  CD1 . LEU A 1 191 ? -38.273 29.234 0.256   1.00 9.95   ? 191 LEU A CD1 1 
ATOM   1561 C  CD2 . LEU A 1 191 ? -39.833 28.946 2.224   1.00 9.29   ? 191 LEU A CD2 1 
ATOM   1562 N  N   . GLY A 1 192 ? -40.313 23.953 0.033   1.00 9.08   ? 192 GLY A N   1 
ATOM   1563 C  CA  . GLY A 1 192 ? -41.164 22.946 -0.590  1.00 9.81   ? 192 GLY A CA  1 
ATOM   1564 C  C   . GLY A 1 192 ? -41.953 22.190 0.414   1.00 10.42  ? 192 GLY A C   1 
ATOM   1565 O  O   . GLY A 1 192 ? -43.038 21.686 0.102   1.00 14.86  ? 192 GLY A O   1 
ATOM   1566 N  N   . LEU A 1 193 ? -41.420 22.014 1.617   1.00 9.20   ? 193 LEU A N   1 
ATOM   1567 C  CA  . LEU A 1 193 ? -42.139 21.386 2.734   1.00 9.02   ? 193 LEU A CA  1 
ATOM   1568 C  C   . LEU A 1 193 ? -43.039 22.390 3.447   1.00 8.41   ? 193 LEU A C   1 
ATOM   1569 O  O   . LEU A 1 193 ? -44.257 22.225 3.521   1.00 8.77   ? 193 LEU A O   1 
ATOM   1570 C  CB  . LEU A 1 193 ? -41.157 20.733 3.687   1.00 9.69   ? 193 LEU A CB  1 
ATOM   1571 C  CG  . LEU A 1 193 ? -40.272 19.627 3.091   1.00 11.64  ? 193 LEU A CG  1 
ATOM   1572 C  CD1 . LEU A 1 193 ? -39.372 19.077 4.228   1.00 15.78  ? 193 LEU A CD1 1 
ATOM   1573 C  CD2 . LEU A 1 193 ? -41.084 18.517 2.492   1.00 14.44  ? 193 LEU A CD2 1 
ATOM   1574 N  N   . ILE A 1 194 ? -42.445 23.449 4.024   1.00 7.93   ? 194 ILE A N   1 
ATOM   1575 C  CA  . ILE A 1 194 ? -43.134 24.284 5.006   1.00 8.28   ? 194 ILE A CA  1 
ATOM   1576 C  C   . ILE A 1 194 ? -44.164 25.241 4.344   1.00 7.57   ? 194 ILE A C   1 
ATOM   1577 O  O   . ILE A 1 194 ? -44.975 25.802 5.060   1.00 7.94   ? 194 ILE A O   1 
ATOM   1578 C  CB  . ILE A 1 194 ? -42.173 25.069 5.879   1.00 7.79   ? 194 ILE A CB  1 
ATOM   1579 C  CG1 . ILE A 1 194 ? -41.314 26.072 5.128   1.00 8.92   ? 194 ILE A CG1 1 
ATOM   1580 C  CG2 . ILE A 1 194 ? -41.327 24.060 6.738   1.00 9.36   ? 194 ILE A CG2 1 
ATOM   1581 C  CD1 . ILE A 1 194 ? -40.580 27.059 6.008   1.00 8.57   ? 194 ILE A CD1 1 
ATOM   1582 N  N   . GLY A 1 195 ? -44.122 25.338 3.011   1.00 7.73   ? 195 GLY A N   1 
ATOM   1583 C  CA  . GLY A 1 195 ? -45.253 26.019 2.381   1.00 7.87   ? 195 GLY A CA  1 
ATOM   1584 C  C   . GLY A 1 195 ? -46.569 25.331 2.549   1.00 7.52   ? 195 GLY A C   1 
ATOM   1585 O  O   . GLY A 1 195 ? -47.626 25.947 2.449   1.00 8.44   ? 195 GLY A O   1 
ATOM   1586 N  N   . THR A 1 196 ? -46.533 24.009 2.820   1.00 7.83   ? 196 THR A N   1 
ATOM   1587 C  CA  . THR A 1 196 ? -47.736 23.210 3.121   1.00 7.62   ? 196 THR A CA  1 
ATOM   1588 C  C   . THR A 1 196 ? -47.944 23.335 4.610   1.00 8.19   ? 196 THR A C   1 
ATOM   1589 O  O   . THR A 1 196 ? -47.542 22.477 5.437   1.00 8.90   ? 196 THR A O   1 
ATOM   1590 C  CB  . THR A 1 196 ? -47.599 21.790 2.660   1.00 8.93   ? 196 THR A CB  1 
ATOM   1591 O  OG1 . THR A 1 196 ? -47.271 21.796 1.285   1.00 9.86   ? 196 THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1 196 ? -48.871 20.991 2.945   1.00 10.74  ? 196 THR A CG2 1 
ATOM   1593 N  N   . THR A 1 197 ? -48.576 24.444 5.055   1.00 7.83   ? 197 THR A N   1 
ATOM   1594 C  CA  . THR A 1 197 ? -48.561 24.875 6.416   1.00 8.45   ? 197 THR A CA  1 
ATOM   1595 C  C   . THR A 1 197 ? -49.296 23.968 7.384   1.00 8.53   ? 197 THR A C   1 
ATOM   1596 O  O   . THR A 1 197 ? -49.039 23.999 8.596   1.00 9.37   ? 197 THR A O   1 
ATOM   1597 C  CB  . THR A 1 197 ? -49.032 26.353 6.604   1.00 9.26   ? 197 THR A CB  1 
ATOM   1598 O  OG1 . THR A 1 197 ? -50.361 26.419 6.071   1.00 11.31  ? 197 THR A OG1 1 
ATOM   1599 C  CG2 . THR A 1 197 ? -48.158 27.324 5.823   1.00 9.86   ? 197 THR A CG2 1 
ATOM   1600 N  N   . GLY A 1 198 ? -50.255 23.217 6.882   1.00 9.23   ? 198 GLY A N   1 
ATOM   1601 C  CA  . GLY A 1 198 ? -51.015 22.267 7.663   1.00 10.07  ? 198 GLY A CA  1 
ATOM   1602 C  C   . GLY A 1 198 ? -50.340 20.933 7.919   1.00 10.67  ? 198 GLY A C   1 
ATOM   1603 O  O   . GLY A 1 198 ? -50.846 20.155 8.749   1.00 13.92  ? 198 GLY A O   1 
ATOM   1604 N  N   . ARG A 1 199 ? -49.238 20.663 7.189   1.00 9.84   ? 199 ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 199 ? -48.568 19.351 7.257   1.00 9.76   ? 199 ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 199 ? -47.182 19.429 7.778   1.00 9.54   ? 199 ARG A C   1 
ATOM   1607 O  O   . ARG A 1 199 ? -46.784 18.602 8.598   1.00 10.65  ? 199 ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 199 ? -48.658 18.625 5.938   1.00 11.91  ? 199 ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 199 ? -47.893 17.297 6.073   1.00 15.27  ? 199 ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 199 ? -48.231 16.420 4.957   1.00 17.49  ? 199 ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 199 ? -47.504 15.182 5.169   1.00 18.96  ? 199 ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 199 ? -47.671 14.129 4.455   1.00 21.57  ? 199 ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 199 ? -48.588 14.143 3.485   1.00 28.26  ? 199 ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 199 ? -46.892 13.122 4.678   1.00 21.17  ? 199 ARG A NH2 1 
ATOM   1615 N  N   . TYR A 1 200 ? -46.328 20.336 7.251   1.00 9.07   ? 200 TYR A N   1 
ATOM   1616 C  CA  . TYR A 1 200 ? -44.927 20.422 7.590   1.00 8.18   ? 200 TYR A CA  1 
ATOM   1617 C  C   . TYR A 1 200 ? -44.735 21.705 8.375   1.00 8.46   ? 200 TYR A C   1 
ATOM   1618 O  O   . TYR A 1 200 ? -44.801 22.796 7.785   1.00 9.57   ? 200 TYR A O   1 
ATOM   1619 C  CB  . TYR A 1 200 ? -44.092 20.405 6.368   1.00 8.90   ? 200 TYR A CB  1 
ATOM   1620 C  CG  . TYR A 1 200 ? -44.113 19.160 5.570   1.00 10.00  ? 200 TYR A CG  1 
ATOM   1621 C  CD1 . TYR A 1 200 ? -43.409 18.063 5.950   1.00 11.23  ? 200 TYR A CD1 1 
ATOM   1622 C  CD2 . TYR A 1 200 ? -44.817 19.047 4.379   1.00 11.63  ? 200 TYR A CD2 1 
ATOM   1623 C  CE1 . TYR A 1 200 ? -43.393 16.888 5.213   1.00 13.70  ? 200 TYR A CE1 1 
ATOM   1624 C  CE2 . TYR A 1 200 ? -44.856 17.868 3.589   1.00 12.54  ? 200 TYR A CE2 1 
ATOM   1625 C  CZ  . TYR A 1 200 ? -44.081 16.790 4.084   1.00 12.76  ? 200 TYR A CZ  1 
ATOM   1626 O  OH  . TYR A 1 200 ? -44.041 15.614 3.290   1.00 15.49  ? 200 TYR A OH  1 
ATOM   1627 N  N   . ILE A 1 201 ? -44.488 21.609 9.663   1.00 8.40   ? 201 ILE A N   1 
ATOM   1628 C  CA  . ILE A 1 201 ? -44.462 22.742 10.550  1.00 8.30   ? 201 ILE A CA  1 
ATOM   1629 C  C   . ILE A 1 201 ? -43.089 22.868 11.176  1.00 8.42   ? 201 ILE A C   1 
ATOM   1630 O  O   . ILE A 1 201 ? -42.507 21.874 11.682  1.00 9.04   ? 201 ILE A O   1 
ATOM   1631 C  CB  . ILE A 1 201 ? -45.554 22.728 11.605  1.00 9.41   ? 201 ILE A CB  1 
ATOM   1632 C  CG1 . ILE A 1 201 ? -46.926 22.728 10.896  1.00 12.88  ? 201 ILE A CG1 1 
ATOM   1633 C  CG2 . ILE A 1 201 ? -45.478 23.890 12.577  1.00 10.46  ? 201 ILE A CG2 1 
ATOM   1634 C  CD1 . ILE A 1 201 ? -47.636 21.565 10.778  1.00 15.88  ? 201 ILE A CD1 1 
ATOM   1635 N  N   . ILE A 1 202 ? -42.497 24.066 11.176  1.00 7.71   ? 202 ILE A N   1 
ATOM   1636 C  CA  . ILE A 1 202 ? -41.260 24.314 11.913  1.00 7.63   ? 202 ILE A CA  1 
ATOM   1637 C  C   . ILE A 1 202 ? -41.528 24.163 13.371  1.00 7.53   ? 202 ILE A C   1 
ATOM   1638 O  O   . ILE A 1 202 ? -42.314 24.891 13.950  1.00 8.97   ? 202 ILE A O   1 
ATOM   1639 C  CB  . ILE A 1 202 ? -40.672 25.695 11.611  1.00 7.77   ? 202 ILE A CB  1 
ATOM   1640 C  CG1 . ILE A 1 202 ? -40.367 25.877 10.117  1.00 8.00   ? 202 ILE A CG1 1 
ATOM   1641 C  CG2 . ILE A 1 202 ? -39.414 25.954 12.524  1.00 9.54   ? 202 ILE A CG2 1 
ATOM   1642 C  CD1 . ILE A 1 202 ? -40.099 27.318 9.662   1.00 8.41   ? 202 ILE A CD1 1 
ATOM   1643 N  N   . ARG A 1 203 ? -40.845 23.187 14.031  1.00 8.23   ? 203 ARG A N   1 
ATOM   1644 C  CA  . ARG A 1 203 ? -40.992 22.984 15.433  1.00 8.40   ? 203 ARG A CA  1 
ATOM   1645 C  C   . ARG A 1 203 ? -39.842 23.632 16.265  1.00 8.03   ? 203 ARG A C   1 
ATOM   1646 O  O   . ARG A 1 203 ? -40.134 24.177 17.347  1.00 8.83   ? 203 ARG A O   1 
ATOM   1647 C  CB  . ARG A 1 203 ? -41.049 21.443 15.734  1.00 9.78   ? 203 ARG A CB  1 
ATOM   1648 C  CG  . ARG A 1 203 ? -41.317 21.160 17.195  1.00 10.49  ? 203 ARG A CG  1 
ATOM   1649 C  CD  . ARG A 1 203 ? -41.722 19.710 17.425  1.00 12.38  ? 203 ARG A CD  1 
ATOM   1650 N  NE  . ARG A 1 203 ? -40.653 18.787 17.052  1.00 13.71  ? 203 ARG A NE  1 
ATOM   1651 C  CZ  . ARG A 1 203 ? -40.710 17.448 17.135  1.00 14.53  ? 203 ARG A CZ  1 
ATOM   1652 N  NH1 . ARG A 1 203 ? -41.842 16.892 17.528  1.00 15.96  ? 203 ARG A NH1 1 
ATOM   1653 N  NH2 . ARG A 1 203 ? -39.674 16.749 16.741  1.00 16.75  ? 203 ARG A NH2 1 
ATOM   1654 N  N   . LYS A 1 204 ? -38.638 23.534 15.762  1.00 7.83   ? 204 LYS A N   1 
ATOM   1655 C  CA  A LYS A 1 204 ? -37.512 24.145 16.457  0.50 8.58   ? 204 LYS A CA  1 
ATOM   1656 C  CA  B LYS A 1 204 ? -37.486 24.161 16.426  0.50 8.24   ? 204 LYS A CA  1 
ATOM   1657 C  C   . LYS A 1 204 ? -36.540 24.722 15.435  1.00 8.33   ? 204 LYS A C   1 
ATOM   1658 O  O   . LYS A 1 204 ? -36.481 24.246 14.290  1.00 9.17   ? 204 LYS A O   1 
ATOM   1659 C  CB  A LYS A 1 204 ? -36.822 23.120 17.432  0.50 9.34   ? 204 LYS A CB  1 
ATOM   1660 C  CB  B LYS A 1 204 ? -36.665 23.152 17.252  0.50 8.95   ? 204 LYS A CB  1 
ATOM   1661 C  CG  A LYS A 1 204 ? -37.620 22.822 18.841  0.50 11.13  ? 204 LYS A CG  1 
ATOM   1662 C  CG  B LYS A 1 204 ? -37.514 22.274 18.123  0.50 8.54   ? 204 LYS A CG  1 
ATOM   1663 C  CD  A LYS A 1 204 ? -37.055 21.802 19.675  0.50 13.96  ? 204 LYS A CD  1 
ATOM   1664 C  CD  B LYS A 1 204 ? -36.798 21.449 19.014  0.50 12.74  ? 204 LYS A CD  1 
ATOM   1665 C  CE  A LYS A 1 204 ? -37.765 21.806 21.023  0.50 10.93  ? 204 LYS A CE  1 
ATOM   1666 C  CE  B LYS A 1 204 ? -37.704 20.644 20.042  0.50 12.67  ? 204 LYS A CE  1 
ATOM   1667 N  NZ  A LYS A 1 204 ? -37.488 22.745 22.206  0.50 11.92  ? 204 LYS A NZ  1 
ATOM   1668 N  NZ  B LYS A 1 204 ? -38.688 21.333 20.818  0.50 14.36  ? 204 LYS A NZ  1 
ATOM   1669 N  N   . VAL A 1 205 ? -35.770 25.725 15.859  1.00 8.43   ? 205 VAL A N   1 
ATOM   1670 C  CA  . VAL A 1 205 ? -34.696 26.261 15.046  1.00 7.27   ? 205 VAL A CA  1 
ATOM   1671 C  C   . VAL A 1 205 ? -33.440 26.321 15.935  1.00 8.44   ? 205 VAL A C   1 
ATOM   1672 O  O   . VAL A 1 205 ? -33.550 26.641 17.120  1.00 8.68   ? 205 VAL A O   1 
ATOM   1673 C  CB  . VAL A 1 205 ? -35.006 27.671 14.514  1.00 7.73   ? 205 VAL A CB  1 
ATOM   1674 C  CG1 . VAL A 1 205 ? -33.863 28.218 13.639  1.00 9.49   ? 205 VAL A CG1 1 
ATOM   1675 C  CG2 . VAL A 1 205 ? -36.327 27.654 13.723  1.00 8.60   ? 205 VAL A CG2 1 
ATOM   1676 N  N   . PHE A 1 206 ? -32.267 26.017 15.378  1.00 8.72   ? 206 PHE A N   1 
ATOM   1677 C  CA  . PHE A 1 206 ? -30.994 26.048 16.076  1.00 9.60   ? 206 PHE A CA  1 
ATOM   1678 C  C   . PHE A 1 206 ? -30.002 26.839 15.235  1.00 10.32  ? 206 PHE A C   1 
ATOM   1679 O  O   . PHE A 1 206 ? -30.016 26.814 14.000  1.00 10.54  ? 206 PHE A O   1 
ATOM   1680 C  CB  . PHE A 1 206 ? -30.461 24.577 16.291  1.00 10.64  ? 206 PHE A CB  1 
ATOM   1681 C  CG  . PHE A 1 206 ? -31.366 23.721 17.036  1.00 10.92  ? 206 PHE A CG  1 
ATOM   1682 C  CD1 . PHE A 1 206 ? -31.332 23.657 18.390  1.00 11.00  ? 206 PHE A CD1 1 
ATOM   1683 C  CD2 . PHE A 1 206 ? -32.334 22.958 16.360  1.00 11.14  ? 206 PHE A CD2 1 
ATOM   1684 C  CE1 . PHE A 1 206 ? -32.218 22.845 19.104  1.00 13.92  ? 206 PHE A CE1 1 
ATOM   1685 C  CE2 . PHE A 1 206 ? -33.225 22.193 17.055  1.00 13.24  ? 206 PHE A CE2 1 
ATOM   1686 C  CZ  . PHE A 1 206 ? -33.201 22.118 18.394  1.00 14.27  ? 206 PHE A CZ  1 
ATOM   1687 N  N   . ARG A 1 207 ? -29.098 27.529 15.918  1.00 11.10  ? 207 ARG A N   1 
ATOM   1688 C  CA  . ARG A 1 207 ? -28.037 28.199 15.246  1.00 12.30  ? 207 ARG A CA  1 
ATOM   1689 C  C   . ARG A 1 207 ? -27.051 27.152 14.667  1.00 12.18  ? 207 ARG A C   1 
ATOM   1690 O  O   . ARG A 1 207 ? -26.634 26.218 15.347  1.00 15.35  ? 207 ARG A O   1 
ATOM   1691 C  CB  . ARG A 1 207 ? -27.320 29.129 16.255  1.00 14.26  ? 207 ARG A CB  1 
ATOM   1692 C  CG  . ARG A 1 207 ? -26.286 29.761 15.587  1.00 19.54  ? 207 ARG A CG  1 
ATOM   1693 C  CD  . ARG A 1 207 ? -26.084 30.921 15.993  1.00 25.87  ? 207 ARG A CD  1 
ATOM   1694 N  NE  . ARG A 1 207 ? -25.593 31.159 17.164  1.00 28.32  ? 207 ARG A NE  1 
ATOM   1695 C  CZ  . ARG A 1 207 ? -24.553 32.086 17.280  1.00 35.75  ? 207 ARG A CZ  1 
ATOM   1696 N  NH1 . ARG A 1 207 ? -24.002 32.391 18.435  1.00 34.20  ? 207 ARG A NH1 1 
ATOM   1697 N  NH2 . ARG A 1 207 ? -23.936 32.691 16.246  1.00 38.55  ? 207 ARG A NH2 1 
ATOM   1698 N  N   . ARG A 1 208 ? -26.654 27.302 13.405  1.00 12.90  ? 208 ARG A N   1 
ATOM   1699 C  CA  . ARG A 1 208 ? -25.744 26.380 12.800  1.00 14.87  ? 208 ARG A CA  1 
ATOM   1700 C  C   . ARG A 1 208 ? -24.309 26.469 13.392  1.00 16.90  ? 208 ARG A C   1 
ATOM   1701 O  O   . ARG A 1 208 ? -23.633 25.396 13.471  1.00 20.89  ? 208 ARG A O   1 
ATOM   1702 C  CB  . ARG A 1 208 ? -25.659 26.541 11.286  1.00 17.73  ? 208 ARG A CB  1 
ATOM   1703 C  CG  . ARG A 1 208 ? -24.674 25.700 10.707  1.00 26.66  ? 208 ARG A CG  1 
ATOM   1704 C  CD  . ARG A 1 208 ? -24.965 24.722 9.801   1.00 30.05  ? 208 ARG A CD  1 
ATOM   1705 N  NE  . ARG A 1 208 ? -25.421 25.409 8.625   1.00 24.06  ? 208 ARG A NE  1 
ATOM   1706 C  CZ  . ARG A 1 208 ? -25.393 25.156 7.312   1.00 20.39  ? 208 ARG A CZ  1 
ATOM   1707 N  NH1 . ARG A 1 208 ? -24.669 24.276 6.775   1.00 25.32  ? 208 ARG A NH1 1 
ATOM   1708 N  NH2 . ARG A 1 208 ? -26.089 25.996 6.500   1.00 19.69  ? 208 ARG A NH2 1 
ATOM   1709 N  N   . ALA A 1 209 ? -23.877 27.626 13.815  1.00 16.27  ? 209 ALA A N   1 
ATOM   1710 C  CA  . ALA A 1 209 ? -22.469 27.810 14.236  1.00 19.04  ? 209 ALA A CA  1 
ATOM   1711 C  C   . ALA A 1 209 ? -22.161 26.948 15.430  1.00 18.30  ? 209 ALA A C   1 
ATOM   1712 O  O   . ALA A 1 209 ? -21.053 26.401 15.541  1.00 22.98  ? 209 ALA A O   1 
ATOM   1713 C  CB  . ALA A 1 209 ? -22.228 29.240 14.574  1.00 20.75  ? 209 ALA A CB  1 
ATOM   1714 N  N   . ASP A 1 210 ? -23.101 26.811 16.349  1.00 17.00  ? 210 ASP A N   1 
ATOM   1715 C  CA  . ASP A 1 210 ? -22.857 26.119 17.607  1.00 16.09  ? 210 ASP A CA  1 
ATOM   1716 C  C   . ASP A 1 210 ? -23.984 25.211 18.074  1.00 16.52  ? 210 ASP A C   1 
ATOM   1717 O  O   . ASP A 1 210 ? -23.907 24.609 19.163  1.00 18.44  ? 210 ASP A O   1 
ATOM   1718 C  CB  . ASP A 1 210 ? -22.535 27.091 18.706  1.00 17.90  ? 210 ASP A CB  1 
ATOM   1719 C  CG  . ASP A 1 210 ? -23.655 28.049 19.080  1.00 19.68  ? 210 ASP A CG  1 
ATOM   1720 O  OD1 . ASP A 1 210 ? -24.694 28.060 18.385  1.00 17.40  ? 210 ASP A OD1 1 
ATOM   1721 O  OD2 . ASP A 1 210 ? -23.500 28.814 20.090  1.00 23.20  ? 210 ASP A OD2 1 
ATOM   1722 N  N   . GLY A 1 211 ? -25.098 25.116 17.324  1.00 15.90  ? 211 GLY A N   1 
ATOM   1723 C  CA  . GLY A 1 211 ? -26.204 24.355 17.737  1.00 15.16  ? 211 GLY A CA  1 
ATOM   1724 C  C   . GLY A 1 211 ? -27.127 24.972 18.790  1.00 13.99  ? 211 GLY A C   1 
ATOM   1725 O  O   . GLY A 1 211 ? -28.014 24.267 19.298  1.00 15.60  ? 211 GLY A O   1 
ATOM   1726 N  N   . ALA A 1 212 ? -26.925 26.241 19.145  1.00 13.36  ? 212 ALA A N   1 
ATOM   1727 C  CA  . ALA A 1 212 ? -27.711 26.896 20.197  1.00 13.06  ? 212 ALA A CA  1 
ATOM   1728 C  C   . ALA A 1 212 ? -29.217 26.907 19.828  1.00 12.04  ? 212 ALA A C   1 
ATOM   1729 O  O   . ALA A 1 212 ? -29.583 27.191 18.683  1.00 12.12  ? 212 ALA A O   1 
ATOM   1730 C  CB  . ALA A 1 212 ? -27.305 28.350 20.373  1.00 16.33  ? 212 ALA A CB  1 
ATOM   1731 N  N   . PRO A 1 213 ? -30.067 26.598 20.785  1.00 10.22  ? 213 PRO A N   1 
ATOM   1732 C  CA  . PRO A 1 213 ? -31.487 26.734 20.527  1.00 11.12  ? 213 PRO A CA  1 
ATOM   1733 C  C   . PRO A 1 213 ? -31.860 28.188 20.258  1.00 10.35  ? 213 PRO A C   1 
ATOM   1734 O  O   . PRO A 1 213 ? -31.474 29.089 21.010  1.00 11.06  ? 213 PRO A O   1 
ATOM   1735 C  CB  . PRO A 1 213 ? -32.167 26.258 21.817  1.00 13.02  ? 213 PRO A CB  1 
ATOM   1736 C  CG  . PRO A 1 213 ? -31.125 25.990 22.713  1.00 17.75  ? 213 PRO A CG  1 
ATOM   1737 C  CD  . PRO A 1 213 ? -29.811 26.116 22.114  1.00 11.86  ? 213 PRO A CD  1 
ATOM   1738 N  N   . ALA A 1 214 ? -32.618 28.388 19.180  1.00 9.26   ? 214 ALA A N   1 
ATOM   1739 C  CA  . ALA A 1 214 ? -32.967 29.733 18.747  1.00 9.26   ? 214 ALA A CA  1 
ATOM   1740 C  C   . ALA A 1 214 ? -34.493 29.959 18.838  1.00 8.14   ? 214 ALA A C   1 
ATOM   1741 O  O   . ALA A 1 214 ? -34.920 31.071 19.153  1.00 9.73   ? 214 ALA A O   1 
ATOM   1742 C  CB  . ALA A 1 214 ? -32.494 29.977 17.319  1.00 10.29  ? 214 ALA A CB  1 
ATOM   1743 N  N   . ALA A 1 215 ? -35.328 28.998 18.527  1.00 7.86   ? 215 ALA A N   1 
ATOM   1744 C  CA  . ALA A 1 215 ? -36.782 29.135 18.610  1.00 8.15   ? 215 ALA A CA  1 
ATOM   1745 C  C   . ALA A 1 215 ? -37.417 27.793 18.868  1.00 7.11   ? 215 ALA A C   1 
ATOM   1746 O  O   . ALA A 1 215 ? -36.866 26.742 18.468  1.00 8.28   ? 215 ALA A O   1 
ATOM   1747 C  CB  . ALA A 1 215 ? -37.364 29.720 17.297  1.00 9.47   ? 215 ALA A CB  1 
ATOM   1748 N  N   . ALA A 1 216 ? -38.590 27.820 19.475  1.00 7.26   ? 216 ALA A N   1 
ATOM   1749 C  CA  . ALA A 1 216 ? -39.413 26.654 19.704  1.00 7.50   ? 216 ALA A CA  1 
ATOM   1750 C  C   . ALA A 1 216 ? -40.869 27.028 19.501  1.00 8.12   ? 216 ALA A C   1 
ATOM   1751 O  O   . ALA A 1 216 ? -41.359 27.963 20.146  1.00 8.02   ? 216 ALA A O   1 
ATOM   1752 C  CB  . ALA A 1 216 ? -39.193 26.128 21.159  1.00 9.28   ? 216 ALA A CB  1 
ATOM   1753 N  N   . ASN A 1 217 ? -41.528 26.311 18.595  1.00 8.31   ? 217 ASN A N   1 
ATOM   1754 C  CA  . ASN A 1 217 ? -42.929 26.507 18.236  1.00 8.57   ? 217 ASN A CA  1 
ATOM   1755 C  C   . ASN A 1 217 ? -43.757 25.354 18.788  1.00 8.88   ? 217 ASN A C   1 
ATOM   1756 O  O   . ASN A 1 217 ? -43.243 24.210 18.739  1.00 11.79  ? 217 ASN A O   1 
ATOM   1757 C  CB  . ASN A 1 217 ? -43.030 26.520 16.713  1.00 8.96   ? 217 ASN A CB  1 
ATOM   1758 C  CG  . ASN A 1 217 ? -44.415 26.925 16.170  1.00 9.61   ? 217 ASN A CG  1 
ATOM   1759 O  OD1 . ASN A 1 217 ? -45.237 27.501 16.868  1.00 10.75  ? 217 ASN A OD1 1 
ATOM   1760 N  ND2 . ASN A 1 217 ? -44.610 26.617 14.871  1.00 10.84  ? 217 ASN A ND2 1 
ATOM   1761 N  N   . SER A 1 218 ? -44.961 25.565 19.198  1.00 8.33   ? 218 SER A N   1 
ATOM   1762 C  CA  . SER A 1 218 ? -45.820 24.527 19.749  1.00 8.96   ? 218 SER A CA  1 
ATOM   1763 C  C   . SER A 1 218 ? -46.512 23.815 18.609  1.00 12.50  ? 218 SER A C   1 
ATOM   1764 O  O   . SER A 1 218 ? -47.483 24.384 17.950  1.00 15.25  ? 218 SER A O   1 
ATOM   1765 C  CB  . SER A 1 218 ? -46.830 25.130 20.669  1.00 9.44   ? 218 SER A CB  1 
ATOM   1766 O  OG  . SER A 1 218 ? -47.759 25.949 19.996  1.00 9.57   ? 218 SER A OG  1 
ATOM   1767 N  N   . VAL A 1 219 ? -46.135 22.678 18.281  1.00 12.64  ? 219 VAL A N   1 
ATOM   1768 C  CA  . VAL A 1 219 ? -46.796 21.837 17.281  1.00 11.84  ? 219 VAL A CA  1 
ATOM   1769 C  C   . VAL A 1 219 ? -46.655 20.389 17.702  1.00 13.75  ? 219 VAL A C   1 
ATOM   1770 O  O   . VAL A 1 219 ? -45.582 19.974 18.127  1.00 13.39  ? 219 VAL A O   1 
ATOM   1771 C  CB  . VAL A 1 219 ? -46.234 22.066 15.863  1.00 12.79  ? 219 VAL A CB  1 
ATOM   1772 C  CG1 . VAL A 1 219 ? -44.669 21.845 15.778  1.00 12.78  ? 219 VAL A CG1 1 
ATOM   1773 C  CG2 . VAL A 1 219 ? -47.027 21.314 14.814  1.00 12.90  ? 219 VAL A CG2 1 
ATOM   1774 N  N   . GLU A 1 220 ? -47.711 19.634 17.501  1.00 13.94  ? 220 GLU A N   1 
ATOM   1775 C  CA  . GLU A 1 220 ? -47.751 18.211 17.707  1.00 15.14  ? 220 GLU A CA  1 
ATOM   1776 C  C   . GLU A 1 220 ? -48.359 17.485 16.551  1.00 13.58  ? 220 GLU A C   1 
ATOM   1777 O  O   . GLU A 1 220 ? -49.094 18.055 15.764  1.00 14.50  ? 220 GLU A O   1 
ATOM   1778 C  CB  . GLU A 1 220 ? -48.638 17.918 18.942  1.00 17.66  ? 220 GLU A CB  1 
ATOM   1779 C  CG  . GLU A 1 220 ? -48.067 18.499 20.237  1.00 22.14  ? 220 GLU A CG  1 
ATOM   1780 C  CD  . GLU A 1 220 ? -49.105 18.540 21.409  1.00 27.17  ? 220 GLU A CD  1 
ATOM   1781 O  OE1 . GLU A 1 220 ? -49.764 17.528 21.573  1.00 30.64  ? 220 GLU A OE1 1 
ATOM   1782 O  OE2 . GLU A 1 220 ? -49.310 19.685 21.948  1.00 36.04  ? 220 GLU A OE2 1 
ATOM   1783 N  N   . ARG A 1 221 ? -48.092 16.183 16.443  1.00 15.64  ? 221 ARG A N   1 
ATOM   1784 C  CA  . ARG A 1 221 ? -48.669 15.346 15.416  1.00 16.27  ? 221 ARG A CA  1 
ATOM   1785 C  C   . ARG A 1 221 ? -50.184 15.367 15.469  1.00 17.01  ? 221 ARG A C   1 
ATOM   1786 O  O   . ARG A 1 221 ? -50.821 15.582 16.544  1.00 18.35  ? 221 ARG A O   1 
ATOM   1787 C  CB  . ARG A 1 221 ? -48.133 13.924 15.555  1.00 20.40  ? 221 ARG A CB  1 
ATOM   1788 C  CG  . ARG A 1 221 ? -48.769 13.230 16.699  1.00 26.52  ? 221 ARG A CG  1 
ATOM   1789 C  CD  . ARG A 1 221 ? -48.351 11.737 16.813  1.00 35.99  ? 221 ARG A CD  1 
ATOM   1790 N  NE  . ARG A 1 221 ? -48.389 10.757 15.683  1.00 43.21  ? 221 ARG A NE  1 
ATOM   1791 C  CZ  . ARG A 1 221 ? -48.827 10.692 14.382  1.00 47.03  ? 221 ARG A CZ  1 
ATOM   1792 N  NH1 . ARG A 1 221 ? -48.603 9.494  13.820  1.00 51.59  ? 221 ARG A NH1 1 
ATOM   1793 N  NH2 . ARG A 1 221 ? -49.409 11.635 13.564  1.00 42.79  ? 221 ARG A NH2 1 
ATOM   1794 N  N   . LEU A 1 222 ? -50.813 15.155 14.331  1.00 16.33  ? 222 LEU A N   1 
ATOM   1795 C  CA  . LEU A 1 222 ? -52.262 15.036 14.297  1.00 18.18  ? 222 LEU A CA  1 
ATOM   1796 C  C   . LEU A 1 222 ? -52.699 13.644 14.764  1.00 21.76  ? 222 LEU A C   1 
ATOM   1797 O  O   . LEU A 1 222 ? -51.933 12.659 14.743  1.00 22.65  ? 222 LEU A O   1 
ATOM   1798 C  CB  . LEU A 1 222 ? -52.727 15.199 12.875  1.00 19.51  ? 222 LEU A CB  1 
ATOM   1799 C  CG  . LEU A 1 222 ? -52.316 16.456 12.148  1.00 19.81  ? 222 LEU A CG  1 
ATOM   1800 C  CD1 . LEU A 1 222 ? -52.748 16.429 10.627  1.00 25.21  ? 222 LEU A CD1 1 
ATOM   1801 C  CD2 . LEU A 1 222 ? -52.805 17.710 12.862  1.00 25.91  ? 222 LEU A CD2 1 
ATOM   1802 N  N   . SER A 1 223 ? -53.910 13.695 15.262  1.00 24.06  ? 223 SER A N   1 
ATOM   1803 C  CA  . SER A 1 223 ? -54.706 12.470 15.590  1.00 28.34  ? 223 SER A CA  1 
ATOM   1804 C  C   . SER A 1 223 ? -55.769 12.201 14.506  1.00 28.54  ? 223 SER A C   1 
ATOM   1805 O  O   . SER A 1 223 ? -56.412 13.102 13.946  1.00 32.34  ? 223 SER A O   1 
ATOM   1806 C  CB  . SER A 1 223 ? -55.365 12.750 16.928  1.00 30.44  ? 223 SER A CB  1 
ATOM   1807 O  OG  . SER A 1 223 ? -54.354 12.769 17.961  1.00 33.58  ? 223 SER A OG  1 
ATOM   1808 N  N   . LEU A 1 224 ? -55.938 10.928 14.083  1.00 34.43  ? 224 LEU A N   1 
ATOM   1809 C  CA  . LEU A 1 224 ? -56.949 10.549 13.082  1.00 38.42  ? 224 LEU A CA  1 
ATOM   1810 C  C   . LEU A 1 224 ? -58.153 10.054 13.904  1.00 39.82  ? 224 LEU A C   1 
ATOM   1811 O  O   . LEU A 1 224 ? -58.051 9.033  14.606  1.00 43.07  ? 224 LEU A O   1 
ATOM   1812 C  CB  . LEU A 1 224 ? -56.413 9.419  12.150  1.00 40.34  ? 224 LEU A CB  1 
ATOM   1813 C  CG  . LEU A 1 224 ? -57.292 9.095  10.945  1.00 43.02  ? 224 LEU A CG  1 
ATOM   1814 C  CD1 . LEU A 1 224 ? -57.508 10.319 9.959   1.00 44.17  ? 224 LEU A CD1 1 
ATOM   1815 C  CD2 . LEU A 1 224 ? -56.709 7.821  10.206  1.00 50.45  ? 224 LEU A CD2 1 
ATOM   1816 N  N   . ILE A 1 225 ? -59.219 10.869 13.937  1.00 41.64  ? 225 ILE A N   1 
ATOM   1817 C  CA  . ILE A 1 225 ? -60.466 10.592 14.727  1.00 42.61  ? 225 ILE A CA  1 
ATOM   1818 C  C   . ILE A 1 225 ? -61.762 10.629 13.853  1.00 42.66  ? 225 ILE A C   1 
ATOM   1819 O  O   . ILE A 1 225 ? -62.022 11.629 13.102  1.00 45.82  ? 225 ILE A O   1 
ATOM   1820 C  CB  . ILE A 1 225 ? -60.529 11.603 15.898  1.00 43.17  ? 225 ILE A CB  1 
ATOM   1821 C  CG1 . ILE A 1 225 ? -59.274 11.449 16.811  1.00 42.59  ? 225 ILE A CG1 1 
ATOM   1822 C  CG2 . ILE A 1 225 ? -61.771 11.361 16.729  1.00 44.25  ? 225 ILE A CG2 1 
ATOM   1823 C  CD1 . ILE A 1 225 ? -59.115 12.602 17.892  1.00 45.42  ? 225 ILE A CD1 1 
ATOM   1824 N  N   . ALA A 1 226 ? -62.568 9.536  13.877  1.00 44.30  ? 226 ALA A N   1 
ATOM   1825 C  CA  . ALA A 1 226 ? -63.749 9.418  12.934  1.00 43.97  ? 226 ALA A CA  1 
ATOM   1826 C  C   . ALA A 1 226 ? -63.393 9.926  11.484  1.00 44.06  ? 226 ALA A C   1 
ATOM   1827 O  O   . ALA A 1 226 ? -64.085 10.820 10.910  1.00 47.57  ? 226 ALA A O   1 
ATOM   1828 C  CB  . ALA A 1 226 ? -64.964 10.194 13.543  1.00 45.78  ? 226 ALA A CB  1 
ATOM   1829 N  N   . GLY A 1 227 ? -62.261 9.407  10.958  1.00 43.15  ? 227 GLY A N   1 
ATOM   1830 C  CA  . GLY A 1 227 ? -61.777 9.627  9.579   1.00 41.48  ? 227 GLY A CA  1 
ATOM   1831 C  C   . GLY A 1 227 ? -61.329 11.034 9.200   1.00 41.63  ? 227 GLY A C   1 
ATOM   1832 O  O   . GLY A 1 227 ? -61.118 11.313 7.997   1.00 44.25  ? 227 GLY A O   1 
ATOM   1833 N  N   . ARG A 1 228 ? -61.186 11.919 10.196  1.00 40.57  ? 228 ARG A N   1 
ATOM   1834 C  CA  . ARG A 1 228 ? -60.652 13.243 9.963   1.00 38.80  ? 228 ARG A CA  1 
ATOM   1835 C  C   . ARG A 1 228 ? -59.339 13.411 10.785  1.00 36.67  ? 228 ARG A C   1 
ATOM   1836 O  O   . ARG A 1 228 ? -59.187 12.867 11.944  1.00 34.37  ? 228 ARG A O   1 
ATOM   1837 C  CB  . ARG A 1 228 ? -61.669 14.383 10.340  1.00 39.68  ? 228 ARG A CB  1 
ATOM   1838 C  CG  . ARG A 1 228 ? -62.995 14.396 9.537   1.00 41.84  ? 228 ARG A CG  1 
ATOM   1839 C  CD  . ARG A 1 228 ? -63.714 15.810 9.645   1.00 39.79  ? 228 ARG A CD  1 
ATOM   1840 N  NE  . ARG A 1 228 ? -63.117 17.001 8.995   1.00 36.40  ? 228 ARG A NE  1 
ATOM   1841 C  CZ  . ARG A 1 228 ? -63.070 17.187 7.681   1.00 31.59  ? 228 ARG A CZ  1 
ATOM   1842 N  NH1 . ARG A 1 228 ? -63.486 16.189 6.854   1.00 35.11  ? 228 ARG A NH1 1 
ATOM   1843 N  NH2 . ARG A 1 228 ? -62.639 18.335 7.133   1.00 29.79  ? 228 ARG A NH2 1 
ATOM   1844 N  N   . TYR A 1 229 ? -58.396 14.177 10.193  1.00 34.51  ? 229 TYR A N   1 
ATOM   1845 C  CA  . TYR A 1 229 ? -57.207 14.553 10.973  1.00 33.22  ? 229 TYR A CA  1 
ATOM   1846 C  C   . TYR A 1 229 ? -57.620 15.651 11.951  1.00 32.59  ? 229 TYR A C   1 
ATOM   1847 O  O   . TYR A 1 229 ? -58.342 16.641 11.549  1.00 36.58  ? 229 TYR A O   1 
ATOM   1848 C  CB  . TYR A 1 229 ? -56.094 14.977 10.040  1.00 34.07  ? 229 TYR A CB  1 
ATOM   1849 C  CG  . TYR A 1 229 ? -55.381 13.749 9.443   1.00 37.83  ? 229 TYR A CG  1 
ATOM   1850 C  CD1 . TYR A 1 229 ? -54.685 12.811 10.265  1.00 39.02  ? 229 TYR A CD1 1 
ATOM   1851 C  CD2 . TYR A 1 229 ? -55.426 13.516 8.065   1.00 45.97  ? 229 TYR A CD2 1 
ATOM   1852 C  CE1 . TYR A 1 229 ? -54.021 11.665 9.685   1.00 47.31  ? 229 TYR A CE1 1 
ATOM   1853 C  CE2 . TYR A 1 229 ? -54.801 12.434 7.491   1.00 49.64  ? 229 TYR A CE2 1 
ATOM   1854 C  CZ  . TYR A 1 229 ? -54.100 11.491 8.274   1.00 49.61  ? 229 TYR A CZ  1 
ATOM   1855 O  OH  . TYR A 1 229 ? -53.494 10.409 7.600   1.00 51.11  ? 229 TYR A OH  1 
ATOM   1856 N  N   . VAL A 1 230 ? -57.184 15.485 13.213  1.00 28.90  ? 230 VAL A N   1 
ATOM   1857 C  CA  . VAL A 1 230 ? -57.507 16.454 14.290  1.00 25.77  ? 230 VAL A CA  1 
ATOM   1858 C  C   . VAL A 1 230 ? -56.170 16.917 14.881  1.00 23.52  ? 230 VAL A C   1 
ATOM   1859 O  O   . VAL A 1 230 ? -55.360 16.158 15.354  1.00 22.51  ? 230 VAL A O   1 
ATOM   1860 C  CB  . VAL A 1 230 ? -58.349 15.773 15.420  1.00 27.15  ? 230 VAL A CB  1 
ATOM   1861 C  CG1 . VAL A 1 230 ? -58.587 16.669 16.564  1.00 26.70  ? 230 VAL A CG1 1 
ATOM   1862 C  CG2 . VAL A 1 230 ? -59.677 15.204 14.846  1.00 31.26  ? 230 VAL A CG2 1 
ATOM   1863 N  N   . GLY A 1 231 ? -55.987 18.221 14.806  1.00 21.67  ? 231 GLY A N   1 
ATOM   1864 C  CA  . GLY A 1 231 ? -54.802 18.959 15.228  1.00 20.58  ? 231 GLY A CA  1 
ATOM   1865 C  C   . GLY A 1 231 ? -55.117 19.784 16.477  1.00 18.80  ? 231 GLY A C   1 
ATOM   1866 O  O   . GLY A 1 231 ? -56.216 19.758 17.046  1.00 21.43  ? 231 GLY A O   1 
ATOM   1867 N  N   . LYS A 1 232 ? -54.100 20.461 16.970  1.00 18.10  ? 232 LYS A N   1 
ATOM   1868 C  CA  . LYS A 1 232 ? -54.128 21.397 18.140  1.00 15.91  ? 232 LYS A CA  1 
ATOM   1869 C  C   . LYS A 1 232 ? -53.659 22.721 17.597  1.00 13.16  ? 232 LYS A C   1 
ATOM   1870 O  O   . LYS A 1 232 ? -52.564 22.870 17.120  1.00 16.50  ? 232 LYS A O   1 
ATOM   1871 C  CB  . LYS A 1 232 ? -53.222 20.933 19.251  1.00 16.17  ? 232 LYS A CB  1 
ATOM   1872 C  CG  . LYS A 1 232 ? -53.752 19.523 19.757  1.00 19.17  ? 232 LYS A CG  1 
ATOM   1873 C  CD  . LYS A 1 232 ? -52.924 18.789 20.775  1.00 21.98  ? 232 LYS A CD  1 
ATOM   1874 C  CE  . LYS A 1 232 ? -52.547 19.716 21.909  1.00 22.71  ? 232 LYS A CE  1 
ATOM   1875 N  NZ  . LYS A 1 232 ? -51.894 18.805 23.058  1.00 18.84  ? 232 LYS A NZ  1 
ATOM   1876 N  N   . ASP A 1 233 ? -54.547 23.668 17.688  1.00 13.04  ? 233 ASP A N   1 
ATOM   1877 C  CA  . ASP A 1 233 ? -54.390 24.981 17.106  1.00 12.22  ? 233 ASP A CA  1 
ATOM   1878 C  C   . ASP A 1 233 ? -54.021 26.021 18.173  1.00 10.11  ? 233 ASP A C   1 
ATOM   1879 O  O   . ASP A 1 233 ? -53.809 25.756 19.314  1.00 13.71  ? 233 ASP A O   1 
ATOM   1880 C  CB  . ASP A 1 233 ? -55.623 25.330 16.250  1.00 12.44  ? 233 ASP A CB  1 
ATOM   1881 C  CG  . ASP A 1 233 ? -56.898 25.649 17.082  1.00 12.56  ? 233 ASP A CG  1 
ATOM   1882 O  OD1 . ASP A 1 233 ? -56.867 25.676 18.303  1.00 13.64  ? 233 ASP A OD1 1 
ATOM   1883 O  OD2 . ASP A 1 233 ? -57.955 25.902 16.390  1.00 16.50  ? 233 ASP A OD2 1 
ATOM   1884 N  N   . ASP A 1 234 ? -53.852 27.261 17.710  1.00 10.33  ? 234 ASP A N   1 
ATOM   1885 C  CA  . ASP A 1 234 ? -53.622 28.443 18.493  1.00 9.05   ? 234 ASP A CA  1 
ATOM   1886 C  C   . ASP A 1 234 ? -52.223 28.354 19.093  1.00 8.35   ? 234 ASP A C   1 
ATOM   1887 O  O   . ASP A 1 234 ? -52.062 28.236 20.312  1.00 11.61  ? 234 ASP A O   1 
ATOM   1888 C  CB  . ASP A 1 234 ? -54.712 28.771 19.443  1.00 8.46   ? 234 ASP A CB  1 
ATOM   1889 C  CG  . ASP A 1 234 ? -56.081 28.886 18.812  1.00 8.42   ? 234 ASP A CG  1 
ATOM   1890 O  OD1 . ASP A 1 234 ? -56.171 29.137 17.592  1.00 8.99   ? 234 ASP A OD1 1 
ATOM   1891 O  OD2 . ASP A 1 234 ? -57.069 28.693 19.527  1.00 9.20   ? 234 ASP A OD2 1 
ATOM   1892 N  N   . PRO A 1 235 ? -51.217 28.521 18.305  1.00 7.89   ? 235 PRO A N   1 
ATOM   1893 C  CA  . PRO A 1 235 ? -49.867 28.222 18.740  1.00 7.87   ? 235 PRO A CA  1 
ATOM   1894 C  C   . PRO A 1 235 ? -49.233 29.288 19.584  1.00 7.73   ? 235 PRO A C   1 
ATOM   1895 O  O   . PRO A 1 235 ? -49.644 30.475 19.621  1.00 8.82   ? 235 PRO A O   1 
ATOM   1896 C  CB  . PRO A 1 235 ? -49.104 28.087 17.409  1.00 8.30   ? 235 PRO A CB  1 
ATOM   1897 C  CG  . PRO A 1 235 ? -49.828 29.066 16.492  1.00 8.88   ? 235 PRO A CG  1 
ATOM   1898 C  CD  . PRO A 1 235 ? -51.257 28.816 16.844  1.00 9.17   ? 235 PRO A CD  1 
ATOM   1899 N  N   . VAL A 1 236 ? -48.180 28.835 20.281  1.00 8.03   ? 236 VAL A N   1 
ATOM   1900 C  CA  . VAL A 1 236 ? -47.269 29.709 21.026  1.00 7.80   ? 236 VAL A CA  1 
ATOM   1901 C  C   . VAL A 1 236 ? -45.888 29.422 20.560  1.00 7.58   ? 236 VAL A C   1 
ATOM   1902 O  O   . VAL A 1 236 ? -45.528 28.353 20.085  1.00 8.45   ? 236 VAL A O   1 
ATOM   1903 C  CB  . VAL A 1 236 ? -47.450 29.515 22.579  1.00 7.56   ? 236 VAL A CB  1 
ATOM   1904 C  CG1 . VAL A 1 236 ? -48.845 29.958 23.002  1.00 8.46   ? 236 VAL A CG1 1 
ATOM   1905 C  CG2 . VAL A 1 236 ? -47.151 28.070 23.006  1.00 8.89   ? 236 VAL A CG2 1 
ATOM   1906 N  N   . LEU A 1 237 ? -45.044 30.466 20.691  1.00 8.44   ? 237 LEU A N   1 
ATOM   1907 C  CA  . LEU A 1 237 ? -43.713 30.474 20.135  1.00 7.94   ? 237 LEU A CA  1 
ATOM   1908 C  C   . LEU A 1 237 ? -42.740 31.241 20.988  1.00 7.01   ? 237 LEU A C   1 
ATOM   1909 O  O   . LEU A 1 237 ? -43.055 32.347 21.429  1.00 8.30   ? 237 LEU A O   1 
ATOM   1910 C  CB  . LEU A 1 237 ? -43.773 31.096 18.703  1.00 8.92   ? 237 LEU A CB  1 
ATOM   1911 C  CG  . LEU A 1 237 ? -42.460 31.393 17.988  1.00 8.28   ? 237 LEU A CG  1 
ATOM   1912 C  CD1 . LEU A 1 237 ? -41.680 30.160 17.643  1.00 11.03  ? 237 LEU A CD1 1 
ATOM   1913 C  CD2 . LEU A 1 237 ? -42.708 32.288 16.748  1.00 9.29   ? 237 LEU A CD2 1 
ATOM   1914 N  N   . LEU A 1 238 ? -41.558 30.679 21.237  1.00 7.23   ? 238 LEU A N   1 
ATOM   1915 C  CA  A LEU A 1 238 ? -40.461 31.341 21.952  0.50 7.10   ? 238 LEU A CA  1 
ATOM   1916 C  CA  B LEU A 1 238 ? -40.529 31.324 21.960  0.50 7.33   ? 238 LEU A CA  1 
ATOM   1917 C  C   . LEU A 1 238 ? -39.338 31.562 20.995  1.00 7.50   ? 238 LEU A C   1 
ATOM   1918 O  O   . LEU A 1 238 ? -38.916 30.656 20.281  1.00 8.14   ? 238 LEU A O   1 
ATOM   1919 C  CB  A LEU A 1 238 ? -39.820 30.488 23.059  0.50 8.12   ? 238 LEU A CB  1 
ATOM   1920 C  CB  B LEU A 1 238 ? -40.176 30.404 23.123  0.50 8.41   ? 238 LEU A CB  1 
ATOM   1921 C  CG  A LEU A 1 238 ? -40.660 30.347 24.298  0.50 7.18   ? 238 LEU A CG  1 
ATOM   1922 C  CG  B LEU A 1 238 ? -39.109 30.880 24.065  0.50 10.42  ? 238 LEU A CG  1 
ATOM   1923 C  CD1 A LEU A 1 238 ? -40.155 29.200 25.166  0.50 10.14  ? 238 LEU A CD1 1 
ATOM   1924 C  CD1 B LEU A 1 238 ? -39.564 32.089 24.853  0.50 12.46  ? 238 LEU A CD1 1 
ATOM   1925 C  CD2 A LEU A 1 238 ? -40.693 31.662 25.076  0.50 8.52   ? 238 LEU A CD2 1 
ATOM   1926 C  CD2 B LEU A 1 238 ? -38.774 29.745 25.114  0.50 11.12  ? 238 LEU A CD2 1 
ATOM   1927 N  N   . VAL A 1 239 ? -38.787 32.786 20.986  1.00 6.81   ? 239 VAL A N   1 
ATOM   1928 C  CA  . VAL A 1 239 ? -37.618 33.119 20.152  1.00 7.28   ? 239 VAL A CA  1 
ATOM   1929 C  C   . VAL A 1 239 ? -36.563 33.799 21.062  1.00 7.78   ? 239 VAL A C   1 
ATOM   1930 O  O   . VAL A 1 239 ? -36.897 34.751 21.748  1.00 9.47   ? 239 VAL A O   1 
ATOM   1931 C  CB  . VAL A 1 239 ? -37.990 34.035 18.944  1.00 7.47   ? 239 VAL A CB  1 
ATOM   1932 C  CG1 . VAL A 1 239 ? -36.746 34.340 18.115  1.00 9.07   ? 239 VAL A CG1 1 
ATOM   1933 C  CG2 . VAL A 1 239 ? -39.095 33.416 18.111  1.00 9.21   ? 239 VAL A CG2 1 
ATOM   1934 N  N   . ARG A 1 240 ? -35.351 33.327 21.001  1.00 7.82   ? 240 ARG A N   1 
ATOM   1935 C  CA  . ARG A 1 240 ? -34.208 34.038 21.603  1.00 7.94   ? 240 ARG A CA  1 
ATOM   1936 C  C   . ARG A 1 240 ? -33.632 34.992 20.588  1.00 7.53   ? 240 ARG A C   1 
ATOM   1937 O  O   . ARG A 1 240 ? -33.499 34.657 19.419  1.00 9.10   ? 240 ARG A O   1 
ATOM   1938 C  CB  . ARG A 1 240 ? -33.158 33.036 22.087  1.00 8.75   ? 240 ARG A CB  1 
ATOM   1939 C  CG  . ARG A 1 240 ? -33.635 32.131 23.237  1.00 9.09   ? 240 ARG A CG  1 
ATOM   1940 C  CD  . ARG A 1 240 ? -32.620 31.030 23.509  1.00 9.70   ? 240 ARG A CD  1 
ATOM   1941 N  NE  . ARG A 1 240 ? -31.399 31.556 24.108  1.00 9.16   ? 240 ARG A NE  1 
ATOM   1942 C  CZ  . ARG A 1 240 ? -30.239 30.889 24.138  1.00 10.22  ? 240 ARG A CZ  1 
ATOM   1943 N  NH1 . ARG A 1 240 ? -29.996 29.863 23.373  1.00 10.64  ? 240 ARG A NH1 1 
ATOM   1944 N  NH2 . ARG A 1 240 ? -29.286 31.361 24.956  1.00 10.60  ? 240 ARG A NH2 1 
ATOM   1945 N  N   . ALA A 1 241 ? -33.237 36.191 21.039  1.00 7.96   ? 241 ALA A N   1 
ATOM   1946 C  CA  . ALA A 1 241 ? -32.801 37.252 20.137  1.00 7.34   ? 241 ALA A CA  1 
ATOM   1947 C  C   . ALA A 1 241 ? -31.366 37.699 20.398  1.00 8.14   ? 241 ALA A C   1 
ATOM   1948 O  O   . ALA A 1 241 ? -30.828 37.500 21.512  1.00 9.47   ? 241 ALA A O   1 
ATOM   1949 C  CB  . ALA A 1 241 ? -33.727 38.463 20.249  1.00 8.58   ? 241 ALA A CB  1 
ATOM   1950 N  N   . GLN A 1 242 ? -30.774 38.378 19.437  1.00 7.80   ? 242 GLN A N   1 
ATOM   1951 C  CA  . GLN A 1 242 ? -29.532 39.161 19.498  1.00 7.83   ? 242 GLN A CA  1 
ATOM   1952 C  C   . GLN A 1 242 ? -28.264 38.296 19.527  1.00 8.78   ? 242 GLN A C   1 
ATOM   1953 O  O   . GLN A 1 242 ? -28.296 37.064 19.739  1.00 9.81   ? 242 GLN A O   1 
ATOM   1954 C  CB  . GLN A 1 242 ? -29.525 40.092 20.702  1.00 8.29   ? 242 GLN A CB  1 
ATOM   1955 C  CG  . GLN A 1 242 ? -30.733 41.036 20.877  1.00 8.81   ? 242 GLN A CG  1 
ATOM   1956 C  CD  . GLN A 1 242 ? -30.984 42.115 19.797  1.00 7.98   ? 242 GLN A CD  1 
ATOM   1957 O  OE1 . GLN A 1 242 ? -32.125 42.624 19.777  1.00 8.21   ? 242 GLN A OE1 1 
ATOM   1958 N  NE2 . GLN A 1 242 ? -29.995 42.480 19.064  1.00 8.41   ? 242 GLN A NE2 1 
ATOM   1959 N  N   . SER A 1 243 ? -27.146 38.969 19.288  1.00 9.44   ? 243 SER A N   1 
ATOM   1960 C  CA  A SER A 1 243 ? -25.803 38.366 19.451  0.50 10.60  ? 243 SER A CA  1 
ATOM   1961 C  CA  B SER A 1 243 ? -25.790 38.435 19.386  0.50 9.30   ? 243 SER A CA  1 
ATOM   1962 C  C   . SER A 1 243 ? -25.631 37.138 18.629  1.00 10.58  ? 243 SER A C   1 
ATOM   1963 O  O   . SER A 1 243 ? -25.277 36.058 19.156  1.00 12.23  ? 243 SER A O   1 
ATOM   1964 C  CB  A SER A 1 243 ? -25.547 38.086 20.943  0.50 12.75  ? 243 SER A CB  1 
ATOM   1965 C  CB  B SER A 1 243 ? -25.408 38.371 20.866  0.50 10.78  ? 243 SER A CB  1 
ATOM   1966 O  OG  A SER A 1 243 ? -24.197 37.687 21.227  0.50 20.03  ? 243 SER A OG  1 
ATOM   1967 O  OG  B SER A 1 243 ? -25.006 39.598 21.471  0.50 9.14   ? 243 SER A OG  1 
ATOM   1968 N  N   . GLY A 1 244 ? -25.888 37.242 17.321  1.00 10.89  ? 244 GLY A N   1 
ATOM   1969 C  CA  . GLY A 1 244 ? -25.823 36.125 16.415  1.00 11.20  ? 244 GLY A CA  1 
ATOM   1970 C  C   . GLY A 1 244 ? -27.131 35.419 16.190  1.00 10.40  ? 244 GLY A C   1 
ATOM   1971 O  O   . GLY A 1 244 ? -27.257 34.611 15.250  1.00 13.40  ? 244 GLY A O   1 
ATOM   1972 N  N   . LEU A 1 245 ? -28.083 35.656 17.013  1.00 9.94   ? 245 LEU A N   1 
ATOM   1973 C  CA  . LEU A 1 245 ? -29.461 35.332 16.756  1.00 9.27   ? 245 LEU A CA  1 
ATOM   1974 C  C   . LEU A 1 245 ? -30.108 36.621 16.188  1.00 9.06   ? 245 LEU A C   1 
ATOM   1975 O  O   . LEU A 1 245 ? -29.608 37.729 16.412  1.00 9.01   ? 245 LEU A O   1 
ATOM   1976 C  CB  . LEU A 1 245 ? -30.165 34.922 18.032  1.00 9.21   ? 245 LEU A CB  1 
ATOM   1977 C  CG  . LEU A 1 245 ? -29.521 33.695 18.726  1.00 9.75   ? 245 LEU A CG  1 
ATOM   1978 C  CD1 . LEU A 1 245 ? -30.223 33.415 20.043  1.00 12.35  ? 245 LEU A CD1 1 
ATOM   1979 C  CD2 . LEU A 1 245 ? -29.497 32.506 17.756  1.00 15.31  ? 245 LEU A CD2 1 
ATOM   1980 N  N   . PRO A 1 246 ? -31.218 36.489 15.440  1.00 8.18   ? 246 PRO A N   1 
ATOM   1981 C  CA  . PRO A 1 246 ? -31.843 37.705 14.903  1.00 7.63   ? 246 PRO A CA  1 
ATOM   1982 C  C   . PRO A 1 246 ? -32.088 38.718 15.991  1.00 7.45   ? 246 PRO A C   1 
ATOM   1983 O  O   . PRO A 1 246 ? -32.495 38.418 17.117  1.00 7.80   ? 246 PRO A O   1 
ATOM   1984 C  CB  . PRO A 1 246 ? -33.145 37.155 14.269  1.00 8.12   ? 246 PRO A CB  1 
ATOM   1985 C  CG  . PRO A 1 246 ? -32.907 35.741 14.051  1.00 13.11  ? 246 PRO A CG  1 
ATOM   1986 C  CD  . PRO A 1 246 ? -31.981 35.275 15.152  1.00 9.08   ? 246 PRO A CD  1 
ATOM   1987 N  N   . ALA A 1 247 ? -31.935 39.996 15.632  1.00 7.27   ? 247 ALA A N   1 
ATOM   1988 C  CA  . ALA A 1 247 ? -32.255 41.088 16.496  1.00 6.88   ? 247 ALA A CA  1 
ATOM   1989 C  C   . ALA A 1 247 ? -33.714 41.029 16.886  1.00 6.99   ? 247 ALA A C   1 
ATOM   1990 O  O   . ALA A 1 247 ? -34.547 40.562 16.063  1.00 6.60   ? 247 ALA A O   1 
ATOM   1991 C  CB  . ALA A 1 247 ? -31.954 42.420 15.848  1.00 7.80   ? 247 ALA A CB  1 
ATOM   1992 N  N   . VAL A 1 248 ? -34.112 41.609 18.018  1.00 6.71   ? 248 VAL A N   1 
ATOM   1993 C  CA  . VAL A 1 248 ? -35.526 41.765 18.320  1.00 6.52   ? 248 VAL A CA  1 
ATOM   1994 C  C   . VAL A 1 248 ? -36.251 42.357 17.093  1.00 6.46   ? 248 VAL A C   1 
ATOM   1995 O  O   . VAL A 1 248 ? -37.339 41.847 16.724  1.00 6.33   ? 248 VAL A O   1 
ATOM   1996 C  CB  . VAL A 1 248 ? -35.696 42.682 19.559  1.00 7.04   ? 248 VAL A CB  1 
ATOM   1997 C  CG1 . VAL A 1 248 ? -37.139 43.183 19.713  1.00 9.25   ? 248 VAL A CG1 1 
ATOM   1998 C  CG2 . VAL A 1 248 ? -35.206 41.957 20.835  1.00 9.39   ? 248 VAL A CG2 1 
ATOM   1999 N  N   . GLY A 1 249 ? -35.678 43.359 16.449  1.00 5.85   ? 249 GLY A N   1 
ATOM   2000 C  CA  . GLY A 1 249 ? -36.385 43.984 15.349  1.00 5.68   ? 249 GLY A CA  1 
ATOM   2001 C  C   . GLY A 1 249 ? -36.435 43.146 14.093  1.00 6.00   ? 249 GLY A C   1 
ATOM   2002 O  O   . GLY A 1 249 ? -37.343 43.369 13.266  1.00 6.23   ? 249 GLY A O   1 
ATOM   2003 N  N   . GLU A 1 250 ? -35.496 42.242 13.889  1.00 6.19   ? 250 GLU A N   1 
ATOM   2004 C  CA  . GLU A 1 250 ? -35.557 41.311 12.766  1.00 5.78   ? 250 GLU A CA  1 
ATOM   2005 C  C   . GLU A 1 250 ? -36.641 40.273 13.028  1.00 6.00   ? 250 GLU A C   1 
ATOM   2006 O  O   . GLU A 1 250 ? -37.391 39.911 12.090  1.00 6.60   ? 250 GLU A O   1 
ATOM   2007 C  CB  . GLU A 1 250 ? -34.197 40.662 12.513  1.00 6.52   ? 250 GLU A CB  1 
ATOM   2008 C  CG  . GLU A 1 250 ? -33.174 41.666 11.992  1.00 6.22   ? 250 GLU A CG  1 
ATOM   2009 C  CD  . GLU A 1 250 ? -31.715 41.297 11.946  1.00 6.66   ? 250 GLU A CD  1 
ATOM   2010 O  OE1 . GLU A 1 250 ? -31.292 40.564 12.908  1.00 7.50   ? 250 GLU A OE1 1 
ATOM   2011 O  OE2 . GLU A 1 250 ? -30.984 41.763 11.041  1.00 7.61   ? 250 GLU A OE2 1 
ATOM   2012 N  N   . VAL A 1 251 ? -36.768 39.765 14.234  1.00 6.25   ? 251 VAL A N   1 
ATOM   2013 C  CA  . VAL A 1 251 ? -37.864 38.890 14.605  1.00 5.61   ? 251 VAL A CA  1 
ATOM   2014 C  C   . VAL A 1 251 ? -39.185 39.605 14.334  1.00 6.06   ? 251 VAL A C   1 
ATOM   2015 O  O   . VAL A 1 251 ? -40.130 39.024 13.742  1.00 6.69   ? 251 VAL A O   1 
ATOM   2016 C  CB  . VAL A 1 251 ? -37.763 38.450 16.067  1.00 5.59   ? 251 VAL A CB  1 
ATOM   2017 C  CG1 . VAL A 1 251 ? -38.935 37.571 16.463  1.00 7.79   ? 251 VAL A CG1 1 
ATOM   2018 C  CG2 . VAL A 1 251 ? -36.422 37.735 16.356  1.00 8.18   ? 251 VAL A CG2 1 
ATOM   2019 N  N   . LEU A 1 252 ? -39.336 40.850 14.766  1.00 5.70   ? 252 LEU A N   1 
ATOM   2020 C  CA  . LEU A 1 252 ? -40.573 41.555 14.604  1.00 5.78   ? 252 LEU A CA  1 
ATOM   2021 C  C   . LEU A 1 252 ? -40.842 41.873 13.114  1.00 5.69   ? 252 LEU A C   1 
ATOM   2022 O  O   . LEU A 1 252 ? -42.033 41.872 12.677  1.00 5.96   ? 252 LEU A O   1 
ATOM   2023 C  CB  . LEU A 1 252 ? -40.586 42.859 15.418  1.00 6.57   ? 252 LEU A CB  1 
ATOM   2024 C  CG  . LEU A 1 252 ? -40.486 42.665 16.959  1.00 6.58   ? 252 LEU A CG  1 
ATOM   2025 C  CD1 . LEU A 1 252 ? -40.260 44.000 17.612  1.00 8.34   ? 252 LEU A CD1 1 
ATOM   2026 C  CD2 . LEU A 1 252 ? -41.699 41.900 17.483  1.00 7.99   ? 252 LEU A CD2 1 
ATOM   2027 N  N   . GLU A 1 253 ? -39.838 42.184 12.332  1.00 5.47   ? 253 GLU A N   1 
ATOM   2028 C  CA  . GLU A 1 253 ? -39.967 42.426 10.885  1.00 5.55   ? 253 GLU A CA  1 
ATOM   2029 C  C   . GLU A 1 253 ? -40.615 41.224 10.239  1.00 5.65   ? 253 GLU A C   1 
ATOM   2030 O  O   . GLU A 1 253 ? -41.340 41.414 9.231   1.00 6.09   ? 253 GLU A O   1 
ATOM   2031 C  CB  . GLU A 1 253 ? -38.595 42.765 10.283  1.00 5.23   ? 253 GLU A CB  1 
ATOM   2032 C  CG  . GLU A 1 253 ? -38.614 43.077 8.825   1.00 6.14   ? 253 GLU A CG  1 
ATOM   2033 C  CD  . GLU A 1 253 ? -39.315 44.384 8.464   1.00 6.72   ? 253 GLU A CD  1 
ATOM   2034 O  OE1 . GLU A 1 253 ? -39.609 45.200 9.349   1.00 7.75   ? 253 GLU A OE1 1 
ATOM   2035 O  OE2 . GLU A 1 253 ? -39.529 44.586 7.234   1.00 8.43   ? 253 GLU A OE2 1 
ATOM   2036 N  N   . ALA A 1 254 ? -40.375 40.015 10.716  1.00 5.78   ? 254 ALA A N   1 
ATOM   2037 C  CA  . ALA A 1 254 ? -40.915 38.824 10.149  1.00 5.71   ? 254 ALA A CA  1 
ATOM   2038 C  C   . ALA A 1 254 ? -42.445 38.759 10.291  1.00 6.66   ? 254 ALA A C   1 
ATOM   2039 O  O   . ALA A 1 254 ? -43.050 37.894 9.623   1.00 6.98   ? 254 ALA A O   1 
ATOM   2040 C  CB  . ALA A 1 254 ? -40.283 37.588 10.780  1.00 6.88   ? 254 ALA A CB  1 
ATOM   2041 N  N   . PHE A 1 255 ? -43.054 39.595 11.105  1.00 5.74   ? 255 PHE A N   1 
ATOM   2042 C  CA  . PHE A 1 255 ? -44.486 39.720 11.296  1.00 5.87   ? 255 PHE A CA  1 
ATOM   2043 C  C   . PHE A 1 255 ? -45.073 40.966 10.682  1.00 6.15   ? 255 PHE A C   1 
ATOM   2044 O  O   . PHE A 1 255 ? -46.270 41.268 10.864  1.00 7.13   ? 255 PHE A O   1 
ATOM   2045 C  CB  . PHE A 1 255 ? -44.863 39.654 12.779  1.00 6.16   ? 255 PHE A CB  1 
ATOM   2046 C  CG  . PHE A 1 255 ? -44.644 38.313 13.389  1.00 5.73   ? 255 PHE A CG  1 
ATOM   2047 C  CD1 . PHE A 1 255 ? -45.639 37.367 13.390  1.00 6.59   ? 255 PHE A CD1 1 
ATOM   2048 C  CD2 . PHE A 1 255 ? -43.416 37.937 13.994  1.00 7.95   ? 255 PHE A CD2 1 
ATOM   2049 C  CE1 . PHE A 1 255 ? -45.463 36.085 13.951  1.00 7.70   ? 255 PHE A CE1 1 
ATOM   2050 C  CE2 . PHE A 1 255 ? -43.238 36.689 14.559  1.00 7.91   ? 255 PHE A CE2 1 
ATOM   2051 C  CZ  . PHE A 1 255 ? -44.244 35.803 14.548  1.00 7.92   ? 255 PHE A CZ  1 
ATOM   2052 N  N   . ALA A 1 256 ? -44.269 41.764 9.968   1.00 5.48   ? 256 ALA A N   1 
ATOM   2053 C  CA  . ALA A 1 256 ? -44.705 43.060 9.477   1.00 5.46   ? 256 ALA A CA  1 
ATOM   2054 C  C   . ALA A 1 256 ? -45.531 42.966 8.210   1.00 6.12   ? 256 ALA A C   1 
ATOM   2055 O  O   . ALA A 1 256 ? -46.181 43.945 7.862   1.00 8.51   ? 256 ALA A O   1 
ATOM   2056 C  CB  . ALA A 1 256 ? -43.526 44.011 9.272   1.00 8.02   ? 256 ALA A CB  1 
ATOM   2057 N  N   . HIS A 1 257 ? -45.610 41.846 7.548   1.00 6.70   ? 257 HIS A N   1 
ATOM   2058 C  CA  . HIS A 1 257 ? -46.579 41.574 6.483   1.00 6.22   ? 257 HIS A CA  1 
ATOM   2059 C  C   . HIS A 1 257 ? -47.630 40.669 7.078   1.00 5.33   ? 257 HIS A C   1 
ATOM   2060 O  O   . HIS A 1 257 ? -47.333 39.572 7.555   1.00 6.87   ? 257 HIS A O   1 
ATOM   2061 C  CB  . HIS A 1 257 ? -45.920 40.946 5.246   1.00 8.08   ? 257 HIS A CB  1 
ATOM   2062 C  CG  . HIS A 1 257 ? -46.931 40.658 4.160   1.00 9.08   ? 257 HIS A CG  1 
ATOM   2063 N  ND1 . HIS A 1 257 ? -47.276 39.373 3.847   1.00 11.82  ? 257 HIS A ND1 1 
ATOM   2064 C  CD2 . HIS A 1 257 ? -47.646 41.506 3.381   1.00 14.57  ? 257 HIS A CD2 1 
ATOM   2065 C  CE1 . HIS A 1 257 ? -48.161 39.441 2.890   1.00 14.65  ? 257 HIS A CE1 1 
ATOM   2066 N  NE2 . HIS A 1 257 ? -48.427 40.692 2.610   1.00 13.23  ? 257 HIS A NE2 1 
ATOM   2067 N  N   . PRO A 1 258 ? -48.909 41.097 7.117   1.00 5.20   ? 258 PRO A N   1 
ATOM   2068 C  CA  . PRO A 1 258 ? -49.935 40.311 7.800   1.00 5.27   ? 258 PRO A CA  1 
ATOM   2069 C  C   . PRO A 1 258 ? -50.457 39.235 6.857   1.00 5.70   ? 258 PRO A C   1 
ATOM   2070 O  O   . PRO A 1 258 ? -51.511 39.394 6.221   1.00 5.93   ? 258 PRO A O   1 
ATOM   2071 C  CB  . PRO A 1 258 ? -50.993 41.347 8.205   1.00 6.32   ? 258 PRO A CB  1 
ATOM   2072 C  CG  . PRO A 1 258 ? -50.927 42.381 7.019   1.00 6.52   ? 258 PRO A CG  1 
ATOM   2073 C  CD  . PRO A 1 258 ? -49.466 42.367 6.596   1.00 5.57   ? 258 PRO A CD  1 
ATOM   2074 N  N   . HIS A 1 259 ? -49.707 38.169 6.722   1.00 5.50   ? 259 HIS A N   1 
ATOM   2075 C  CA  . HIS A 1 259 ? -49.941 37.154 5.725   1.00 5.56   ? 259 HIS A CA  1 
ATOM   2076 C  C   . HIS A 1 259 ? -51.198 36.383 6.044   1.00 5.34   ? 259 HIS A C   1 
ATOM   2077 O  O   . HIS A 1 259 ? -51.659 36.307 7.187   1.00 5.73   ? 259 HIS A O   1 
ATOM   2078 C  CB  . HIS A 1 259 ? -48.715 36.203 5.618   1.00 6.07   ? 259 HIS A CB  1 
ATOM   2079 C  CG  . HIS A 1 259 ? -48.448 35.380 6.840   1.00 6.12   ? 259 HIS A CG  1 
ATOM   2080 N  ND1 . HIS A 1 259 ? -48.081 35.919 8.041   1.00 7.06   ? 259 HIS A ND1 1 
ATOM   2081 C  CD2 . HIS A 1 259 ? -48.487 34.002 6.998   1.00 7.05   ? 259 HIS A CD2 1 
ATOM   2082 C  CE1 . HIS A 1 259 ? -47.864 34.917 8.889   1.00 7.35   ? 259 HIS A CE1 1 
ATOM   2083 N  NE2 . HIS A 1 259 ? -48.104 33.731 8.300   1.00 8.19   ? 259 HIS A NE2 1 
ATOM   2084 N  N   . LEU A 1 260 ? -51.760 35.753 5.015   1.00 4.95   ? 260 LEU A N   1 
ATOM   2085 C  CA  . LEU A 1 260 ? -52.940 34.908 5.212   1.00 5.42   ? 260 LEU A CA  1 
ATOM   2086 C  C   . LEU A 1 260 ? -52.547 33.635 5.975   1.00 5.48   ? 260 LEU A C   1 
ATOM   2087 O  O   . LEU A 1 260 ? -51.534 33.006 5.574   1.00 5.98   ? 260 LEU A O   1 
ATOM   2088 C  CB  . LEU A 1 260 ? -53.589 34.582 3.878   1.00 5.99   ? 260 LEU A CB  1 
ATOM   2089 C  CG  . LEU A 1 260 ? -54.118 35.753 3.054   1.00 5.04   ? 260 LEU A CG  1 
ATOM   2090 C  CD1 . LEU A 1 260 ? -54.566 35.288 1.699   1.00 7.71   ? 260 LEU A CD1 1 
ATOM   2091 C  CD2 . LEU A 1 260 ? -55.264 36.477 3.794   1.00 6.81   ? 260 LEU A CD2 1 
ATOM   2092 N  N   . VAL A 1 261 ? -53.334 33.261 6.933   1.00 5.26   ? 261 VAL A N   1 
ATOM   2093 C  CA  . VAL A 1 261 ? -53.155 32.036 7.715   1.00 4.92   ? 261 VAL A CA  1 
ATOM   2094 C  C   . VAL A 1 261 ? -54.452 31.297 7.749   1.00 6.02   ? 261 VAL A C   1 
ATOM   2095 O  O   . VAL A 1 261 ? -55.544 31.860 7.610   1.00 6.63   ? 261 VAL A O   1 
ATOM   2096 C  CB  . VAL A 1 261 ? -52.599 32.388 9.093   1.00 5.25   ? 261 VAL A CB  1 
ATOM   2097 C  CG1 . VAL A 1 261 ? -51.204 32.997 8.993   1.00 6.83   ? 261 VAL A CG1 1 
ATOM   2098 C  CG2 . VAL A 1 261 ? -53.576 33.201 9.920   1.00 6.55   ? 261 VAL A CG2 1 
ATOM   2099 N  N   . HIS A 1 262 ? -54.352 30.013 8.037   1.00 6.65   ? 262 HIS A N   1 
ATOM   2100 C  CA  . HIS A 1 262 ? -55.497 29.143 8.152   1.00 6.03   ? 262 HIS A CA  1 
ATOM   2101 C  C   . HIS A 1 262 ? -56.052 29.155 9.514   1.00 6.22   ? 262 HIS A C   1 
ATOM   2102 O  O   . HIS A 1 262 ? -55.310 29.082 10.508  1.00 9.54   ? 262 HIS A O   1 
ATOM   2103 C  CB  . HIS A 1 262 ? -55.095 27.723 7.817   1.00 7.55   ? 262 HIS A CB  1 
ATOM   2104 C  CG  . HIS A 1 262 ? -54.663 27.470 6.444   1.00 10.06  ? 262 HIS A CG  1 
ATOM   2105 N  ND1 . HIS A 1 262 ? -54.669 28.255 5.348   1.00 14.99  ? 262 HIS A ND1 1 
ATOM   2106 C  CD2 . HIS A 1 262 ? -54.363 26.231 6.015   1.00 15.79  ? 262 HIS A CD2 1 
ATOM   2107 C  CE1 . HIS A 1 262 ? -54.165 27.536 4.301   1.00 13.09  ? 262 HIS A CE1 1 
ATOM   2108 N  NE2 . HIS A 1 262 ? -54.105 26.296 4.694   1.00 23.39  ? 262 HIS A NE2 1 
ATOM   2109 N  N   . GLY A 1 263 ? -57.346 29.258 9.659   1.00 6.36   ? 263 GLY A N   1 
ATOM   2110 C  CA  . GLY A 1 263 ? -58.060 29.279 10.922  1.00 6.97   ? 263 GLY A CA  1 
ATOM   2111 C  C   . GLY A 1 263 ? -59.274 30.132 10.890  1.00 6.80   ? 263 GLY A C   1 
ATOM   2112 O  O   . GLY A 1 263 ? -60.243 29.848 10.156  1.00 7.89   ? 263 GLY A O   1 
ATOM   2113 N  N   . TRP A 1 264 ? -59.251 31.230 11.623  1.00 6.38   ? 264 TRP A N   1 
ATOM   2114 C  CA  . TRP A 1 264 ? -60.366 32.193 11.683  1.00 6.62   ? 264 TRP A CA  1 
ATOM   2115 C  C   . TRP A 1 264 ? -61.649 31.418 11.992  1.00 7.02   ? 264 TRP A C   1 
ATOM   2116 O  O   . TRP A 1 264 ? -61.628 30.456 12.787  1.00 7.63   ? 264 TRP A O   1 
ATOM   2117 C  CB  . TRP A 1 264 ? -60.407 33.022 10.375  1.00 5.91   ? 264 TRP A CB  1 
ATOM   2118 C  CG  . TRP A 1 264 ? -61.033 34.364 10.512  1.00 5.60   ? 264 TRP A CG  1 
ATOM   2119 C  CD1 . TRP A 1 264 ? -61.608 34.954 11.607  1.00 6.12   ? 264 TRP A CD1 1 
ATOM   2120 C  CD2 . TRP A 1 264 ? -61.079 35.373 9.465   1.00 5.29   ? 264 TRP A CD2 1 
ATOM   2121 N  NE1 . TRP A 1 264 ? -62.007 36.243 11.315  1.00 5.56   ? 264 TRP A NE1 1 
ATOM   2122 C  CE2 . TRP A 1 264 ? -61.700 36.516 10.004  1.00 5.15   ? 264 TRP A CE2 1 
ATOM   2123 C  CE3 . TRP A 1 264 ? -60.689 35.393 8.128   1.00 5.67   ? 264 TRP A CE3 1 
ATOM   2124 C  CZ2 . TRP A 1 264 ? -61.890 37.672 9.241   1.00 6.07   ? 264 TRP A CZ2 1 
ATOM   2125 C  CZ3 . TRP A 1 264 ? -60.854 36.550 7.398   1.00 5.63   ? 264 TRP A CZ3 1 
ATOM   2126 C  CH2 . TRP A 1 264 ? -61.465 37.638 7.926   1.00 5.63   ? 264 TRP A CH2 1 
ATOM   2127 N  N   . MET A 1 265 ? -62.802 31.843 11.511  1.00 6.58   ? 265 MET A N   1 
ATOM   2128 C  CA  . MET A 1 265 ? -64.090 31.251 11.886  1.00 6.35   ? 265 MET A CA  1 
ATOM   2129 C  C   . MET A 1 265 ? -64.081 29.735 11.707  1.00 6.85   ? 265 MET A C   1 
ATOM   2130 O  O   . MET A 1 265 ? -63.789 29.221 10.618  1.00 6.82   ? 265 MET A O   1 
ATOM   2131 C  CB  . MET A 1 265 ? -65.191 31.859 11.048  1.00 6.73   ? 265 MET A CB  1 
ATOM   2132 C  CG  . MET A 1 265 ? -66.574 31.275 11.248  1.00 7.32   ? 265 MET A CG  1 
ATOM   2133 S  SD  . MET A 1 265 ? -67.252 31.417 12.910  1.00 7.78   ? 265 MET A SD  1 
ATOM   2134 C  CE  . MET A 1 265 ? -67.234 33.211 13.114  1.00 8.67   ? 265 MET A CE  1 
ATOM   2135 N  N   . ARG A 1 266 ? -64.449 29.032 12.771  1.00 6.88   ? 266 ARG A N   1 
ATOM   2136 C  CA  . ARG A 1 266 ? -64.697 27.598 12.694  1.00 7.49   ? 266 ARG A CA  1 
ATOM   2137 C  C   . ARG A 1 266 ? -63.458 26.810 12.244  1.00 7.59   ? 266 ARG A C   1 
ATOM   2138 O  O   . ARG A 1 266 ? -63.550 25.680 11.767  1.00 8.85   ? 266 ARG A O   1 
ATOM   2139 C  CB  . ARG A 1 266 ? -65.924 27.270 11.880  1.00 7.70   ? 266 ARG A CB  1 
ATOM   2140 C  CG  . ARG A 1 266 ? -67.188 27.768 12.532  1.00 7.45   ? 266 ARG A CG  1 
ATOM   2141 C  CD  . ARG A 1 266 ? -68.412 27.789 11.636  1.00 8.07   ? 266 ARG A CD  1 
ATOM   2142 N  NE  . ARG A 1 266 ? -69.577 28.419 12.195  1.00 8.16   ? 266 ARG A NE  1 
ATOM   2143 C  CZ  . ARG A 1 266 ? -70.375 27.863 13.090  1.00 8.48   ? 266 ARG A CZ  1 
ATOM   2144 N  NH1 . ARG A 1 266 ? -70.148 26.621 13.491  1.00 9.28   ? 266 ARG A NH1 1 
ATOM   2145 N  NH2 . ARG A 1 266 ? -71.417 28.526 13.538  1.00 8.97   ? 266 ARG A NH2 1 
ATOM   2146 N  N   . GLY A 1 267 ? -62.252 27.381 12.425  1.00 7.43   ? 267 GLY A N   1 
ATOM   2147 C  CA  . GLY A 1 267 ? -61.070 26.684 12.014  1.00 7.83   ? 267 GLY A CA  1 
ATOM   2148 C  C   . GLY A 1 267 ? -61.053 26.309 10.550  1.00 8.40   ? 267 GLY A C   1 
ATOM   2149 O  O   . GLY A 1 267 ? -60.439 25.309 10.158  1.00 10.76  ? 267 GLY A O   1 
ATOM   2150 N  N   . SER A 1 268 ? -61.823 27.066 9.734   1.00 7.14   ? 268 SER A N   1 
ATOM   2151 C  CA  . SER A 1 268 ? -62.148 26.628 8.372   1.00 7.41   ? 268 SER A CA  1 
ATOM   2152 C  C   . SER A 1 268 ? -61.975 27.698 7.308   1.00 6.84   ? 268 SER A C   1 
ATOM   2153 O  O   . SER A 1 268 ? -62.432 27.532 6.193   1.00 7.37   ? 268 SER A O   1 
ATOM   2154 C  CB  . SER A 1 268 ? -63.587 26.106 8.339   1.00 8.70   ? 268 SER A CB  1 
ATOM   2155 O  OG  . SER A 1 268 ? -63.758 24.965 9.197   1.00 9.60   ? 268 SER A OG  1 
ATOM   2156 N  N   . HIS A 1 269 ? -61.282 28.782 7.648   1.00 6.63   ? 269 HIS A N   1 
ATOM   2157 C  CA  . HIS A 1 269 ? -61.046 29.885 6.716   1.00 6.23   ? 269 HIS A CA  1 
ATOM   2158 C  C   . HIS A 1 269 ? -59.635 30.359 6.677   1.00 7.02   ? 269 HIS A C   1 
ATOM   2159 O  O   . HIS A 1 269 ? -58.786 29.920 7.457   1.00 11.89  ? 269 HIS A O   1 
ATOM   2160 C  CB  . HIS A 1 269 ? -62.024 31.054 7.019   1.00 6.53   ? 269 HIS A CB  1 
ATOM   2161 C  CG  . HIS A 1 269 ? -63.435 30.647 6.935   1.00 7.14   ? 269 HIS A CG  1 
ATOM   2162 N  ND1 . HIS A 1 269 ? -64.115 30.007 7.948   1.00 7.52   ? 269 HIS A ND1 1 
ATOM   2163 C  CD2 . HIS A 1 269 ? -64.300 30.759 5.902   1.00 7.36   ? 269 HIS A CD2 1 
ATOM   2164 C  CE1 . HIS A 1 269 ? -65.347 29.736 7.507   1.00 8.13   ? 269 HIS A CE1 1 
ATOM   2165 N  NE2 . HIS A 1 269 ? -65.508 30.170 6.272   1.00 8.22   ? 269 HIS A NE2 1 
ATOM   2166 N  N   . ALA A 1 270 ? -59.305 31.217 5.753   1.00 6.47   ? 270 ALA A N   1 
ATOM   2167 C  CA  . ALA A 1 270 ? -58.036 31.902 5.639   1.00 6.74   ? 270 ALA A CA  1 
ATOM   2168 C  C   . ALA A 1 270 ? -58.273 33.394 5.820   1.00 5.63   ? 270 ALA A C   1 
ATOM   2169 O  O   . ALA A 1 270 ? -59.206 33.979 5.264   1.00 6.12   ? 270 ALA A O   1 
ATOM   2170 C  CB  . ALA A 1 270 ? -57.386 31.659 4.220   1.00 8.58   ? 270 ALA A CB  1 
ATOM   2171 N  N   . GLY A 1 271 ? -57.406 34.005 6.632   1.00 5.58   ? 271 GLY A N   1 
ATOM   2172 C  CA  . GLY A 1 271 ? -57.465 35.452 6.832   1.00 6.07   ? 271 GLY A CA  1 
ATOM   2173 C  C   . GLY A 1 271 ? -56.130 35.986 7.291   1.00 4.91   ? 271 GLY A C   1 
ATOM   2174 O  O   . GLY A 1 271 ? -55.232 35.224 7.628   1.00 5.69   ? 271 GLY A O   1 
ATOM   2175 N  N   . PRO A 1 272 ? -55.955 37.299 7.292   1.00 5.05   ? 272 PRO A N   1 
ATOM   2176 C  CA  . PRO A 1 272 ? -54.679 37.905 7.589   1.00 4.54   ? 272 PRO A CA  1 
ATOM   2177 C  C   . PRO A 1 272 ? -54.360 37.819 9.100   1.00 4.93   ? 272 PRO A C   1 
ATOM   2178 O  O   . PRO A 1 272 ? -55.206 38.032 9.935   1.00 6.34   ? 272 PRO A O   1 
ATOM   2179 C  CB  . PRO A 1 272 ? -54.896 39.377 7.154   1.00 5.68   ? 272 PRO A CB  1 
ATOM   2180 C  CG  . PRO A 1 272 ? -56.361 39.608 7.396   1.00 5.79   ? 272 PRO A CG  1 
ATOM   2181 C  CD  . PRO A 1 272 ? -57.004 38.317 6.942   1.00 5.97   ? 272 PRO A CD  1 
ATOM   2182 N  N   . LEU A 1 273 ? -53.058 37.557 9.345   1.00 5.13   ? 273 LEU A N   1 
ATOM   2183 C  CA  . LEU A 1 273 ? -52.577 37.498 10.732  1.00 5.46   ? 273 LEU A CA  1 
ATOM   2184 C  C   . LEU A 1 273 ? -52.246 38.912 11.227  1.00 5.49   ? 273 LEU A C   1 
ATOM   2185 O  O   . LEU A 1 273 ? -51.216 39.484 10.810  1.00 6.70   ? 273 LEU A O   1 
ATOM   2186 C  CB  . LEU A 1 273 ? -51.348 36.566 10.844  1.00 5.81   ? 273 LEU A CB  1 
ATOM   2187 C  CG  . LEU A 1 273 ? -50.843 36.373 12.270  1.00 5.99   ? 273 LEU A CG  1 
ATOM   2188 C  CD1 . LEU A 1 273 ? -51.895 35.673 13.155  1.00 8.15   ? 273 LEU A CD1 1 
ATOM   2189 C  CD2 . LEU A 1 273 ? -49.505 35.614 12.237  1.00 7.47   ? 273 LEU A CD2 1 
ATOM   2190 N  N   . MET A 1 274 ? -53.080 39.443 12.074  1.00 5.21   ? 274 MET A N   1 
ATOM   2191 C  CA  . MET A 1 274 ? -52.906 40.812 12.536  1.00 5.38   ? 274 MET A CA  1 
ATOM   2192 C  C   . MET A 1 274 ? -51.964 40.855 13.761  1.00 5.55   ? 274 MET A C   1 
ATOM   2193 O  O   . MET A 1 274 ? -52.300 40.210 14.776  1.00 7.07   ? 274 MET A O   1 
ATOM   2194 C  CB  . MET A 1 274 ? -54.287 41.341 12.922  1.00 6.34   ? 274 MET A CB  1 
ATOM   2195 C  CG  . MET A 1 274 ? -54.256 42.769 13.405  1.00 8.70   ? 274 MET A CG  1 
ATOM   2196 S  SD  . MET A 1 274 ? -55.831 43.451 13.963  1.00 10.74  ? 274 MET A SD  1 
ATOM   2197 C  CE  . MET A 1 274 ? -56.624 43.792 12.373  1.00 10.85  ? 274 MET A CE  1 
ATOM   2198 N  N   . PRO A 1 275 ? -50.857 41.616 13.696  1.00 5.09   ? 275 PRO A N   1 
ATOM   2199 C  CA  . PRO A 1 275 ? -49.998 41.787 14.883  1.00 5.44   ? 275 PRO A CA  1 
ATOM   2200 C  C   . PRO A 1 275 ? -50.665 42.769 15.807  1.00 6.57   ? 275 PRO A C   1 
ATOM   2201 O  O   . PRO A 1 275 ? -50.784 43.957 15.432  1.00 8.57   ? 275 PRO A O   1 
ATOM   2202 C  CB  . PRO A 1 275 ? -48.692 42.255 14.299  1.00 6.95   ? 275 PRO A CB  1 
ATOM   2203 C  CG  . PRO A 1 275 ? -49.041 42.998 13.024  1.00 9.12   ? 275 PRO A CG  1 
ATOM   2204 C  CD  . PRO A 1 275 ? -50.340 42.340 12.541  1.00 6.17   ? 275 PRO A CD  1 
ATOM   2205 N  N   . ALA A 1 276 ? -51.148 42.354 16.949  1.00 6.40   ? 276 ALA A N   1 
ATOM   2206 C  CA  . ALA A 1 276 ? -52.053 43.110 17.766  1.00 7.01   ? 276 ALA A CA  1 
ATOM   2207 C  C   . ALA A 1 276 ? -51.401 43.611 19.060  1.00 8.69   ? 276 ALA A C   1 
ATOM   2208 O  O   . ALA A 1 276 ? -50.525 42.914 19.597  1.00 9.45   ? 276 ALA A O   1 
ATOM   2209 C  CB  . ALA A 1 276 ? -53.294 42.263 18.135  1.00 9.63   ? 276 ALA A CB  1 
ATOM   2210 N  N   . ARG A 1 277 ? -51.793 44.773 19.540  1.00 8.06   ? 277 ARG A N   1 
ATOM   2211 C  CA  . ARG A 1 277 ? -51.454 45.227 20.870  1.00 8.15   ? 277 ARG A CA  1 
ATOM   2212 C  C   . ARG A 1 277 ? -52.156 44.435 21.931  1.00 8.88   ? 277 ARG A C   1 
ATOM   2213 O  O   . ARG A 1 277 ? -53.263 43.940 21.756  1.00 9.59   ? 277 ARG A O   1 
ATOM   2214 C  CB  . ARG A 1 277 ? -51.800 46.703 21.079  1.00 9.60   ? 277 ARG A CB  1 
ATOM   2215 C  CG  . ARG A 1 277 ? -50.934 47.686 20.215  1.00 12.63  ? 277 ARG A CG  1 
ATOM   2216 C  CD  . ARG A 1 277 ? -51.311 49.149 20.608  1.00 15.64  ? 277 ARG A CD  1 
ATOM   2217 N  NE  . ARG A 1 277 ? -50.373 50.154 20.070  1.00 17.82  ? 277 ARG A NE  1 
ATOM   2218 C  CZ  . ARG A 1 277 ? -50.666 50.818 18.967  1.00 16.01  ? 277 ARG A CZ  1 
ATOM   2219 N  NH1 . ARG A 1 277 ? -51.816 50.500 18.328  1.00 17.18  ? 277 ARG A NH1 1 
ATOM   2220 N  NH2 . ARG A 1 277 ? -49.721 51.527 18.417  1.00 18.17  ? 277 ARG A NH2 1 
ATOM   2221 N  N   . PHE A 1 278 ? -51.506 44.352 23.111  1.00 7.71   ? 278 PHE A N   1 
ATOM   2222 C  CA  . PHE A 1 278 ? -52.210 43.981 24.315  1.00 7.99   ? 278 PHE A CA  1 
ATOM   2223 C  C   . PHE A 1 278 ? -53.102 45.119 24.802  1.00 8.93   ? 278 PHE A C   1 
ATOM   2224 O  O   . PHE A 1 278 ? -52.756 46.301 24.647  1.00 11.70  ? 278 PHE A O   1 
ATOM   2225 C  CB  . PHE A 1 278 ? -51.193 43.548 25.407  1.00 8.38   ? 278 PHE A CB  1 
ATOM   2226 C  CG  . PHE A 1 278 ? -50.619 42.201 25.153  1.00 6.96   ? 278 PHE A CG  1 
ATOM   2227 C  CD1 . PHE A 1 278 ? -49.595 41.996 24.242  1.00 8.17   ? 278 PHE A CD1 1 
ATOM   2228 C  CD2 . PHE A 1 278 ? -51.189 41.084 25.715  1.00 7.59   ? 278 PHE A CD2 1 
ATOM   2229 C  CE1 . PHE A 1 278 ? -49.127 40.733 23.937  1.00 8.78   ? 278 PHE A CE1 1 
ATOM   2230 C  CE2 . PHE A 1 278 ? -50.752 39.789 25.358  1.00 7.92   ? 278 PHE A CE2 1 
ATOM   2231 C  CZ  . PHE A 1 278 ? -49.741 39.638 24.490  1.00 7.68   ? 278 PHE A CZ  1 
ATOM   2232 N  N   . ILE A 1 279 ? -54.263 44.785 25.347  1.00 8.37   ? 279 ILE A N   1 
ATOM   2233 C  CA  . ILE A 1 279 ? -55.125 45.755 26.006  1.00 9.18   ? 279 ILE A CA  1 
ATOM   2234 C  C   . ILE A 1 279 ? -54.422 46.343 27.219  1.00 9.93   ? 279 ILE A C   1 
ATOM   2235 O  O   . ILE A 1 279 ? -54.492 47.578 27.430  1.00 12.06  ? 279 ILE A O   1 
ATOM   2236 C  CB  . ILE A 1 279 ? -56.492 45.121 26.360  1.00 10.44  ? 279 ILE A CB  1 
ATOM   2237 C  CG1 . ILE A 1 279 ? -57.218 44.694 25.058  1.00 10.71  ? 279 ILE A CG1 1 
ATOM   2238 C  CG2 . ILE A 1 279 ? -57.333 46.038 27.303  1.00 13.79  ? 279 ILE A CG2 1 
ATOM   2239 C  CD1 . ILE A 1 279 ? -58.567 43.938 25.292  1.00 13.38  ? 279 ILE A CD1 1 
ATOM   2240 N  N   . SER A 1 280 ? -53.758 45.523 28.001  1.00 9.87   ? 280 SER A N   1 
ATOM   2241 C  CA  . SER A 1 280 ? -53.031 45.961 29.159  1.00 11.19  ? 280 SER A CA  1 
ATOM   2242 C  C   . SER A 1 280 ? -51.890 45.021 29.498  1.00 11.28  ? 280 SER A C   1 
ATOM   2243 O  O   . SER A 1 280 ? -51.970 43.828 29.215  1.00 11.38  ? 280 SER A O   1 
ATOM   2244 C  CB  . SER A 1 280 ? -53.917 46.108 30.346  1.00 14.17  ? 280 SER A CB  1 
ATOM   2245 O  OG  . SER A 1 280 ? -54.509 44.934 30.714  1.00 16.36  ? 280 SER A OG  1 
ATOM   2246 N  N   . VAL A 1 281 ? -50.823 45.585 30.047  1.00 12.38  ? 281 VAL A N   1 
ATOM   2247 C  CA  . VAL A 1 281 ? -49.653 44.832 30.494  1.00 12.78  ? 281 VAL A CA  1 
ATOM   2248 C  C   . VAL A 1 281 ? -49.359 45.287 31.906  1.00 15.16  ? 281 VAL A C   1 
ATOM   2249 O  O   . VAL A 1 281 ? -49.074 46.496 32.074  1.00 16.93  ? 281 VAL A O   1 
ATOM   2250 C  CB  . VAL A 1 281 ? -48.434 44.911 29.560  1.00 14.10  ? 281 VAL A CB  1 
ATOM   2251 C  CG1 . VAL A 1 281 ? -47.281 44.002 30.038  1.00 17.40  ? 281 VAL A CG1 1 
ATOM   2252 C  CG2 . VAL A 1 281 ? -48.778 44.555 28.117  1.00 14.33  ? 281 VAL A CG2 1 
ATOM   2253 N  N   . ASP A 1 282 ? -49.346 44.385 32.893  1.00 14.64  ? 282 ASP A N   1 
ATOM   2254 C  CA  . ASP A 1 282 ? -49.073 44.767 34.281  1.00 15.91  ? 282 ASP A CA  1 
ATOM   2255 C  C   . ASP A 1 282 ? -47.859 43.901 34.757  1.00 16.57  ? 282 ASP A C   1 
ATOM   2256 O  O   . ASP A 1 282 ? -48.063 42.768 35.238  1.00 15.24  ? 282 ASP A O   1 
ATOM   2257 C  CB  . ASP A 1 282 ? -50.259 44.486 35.141  1.00 17.26  ? 282 ASP A CB  1 
ATOM   2258 C  CG  . ASP A 1 282 ? -50.069 45.009 36.581  1.00 22.04  ? 282 ASP A CG  1 
ATOM   2259 O  OD1 . ASP A 1 282 ? -48.902 45.116 37.016  1.00 20.80  ? 282 ASP A OD1 1 
ATOM   2260 O  OD2 . ASP A 1 282 ? -51.126 45.374 37.128  1.00 27.99  ? 282 ASP A OD2 1 
ATOM   2261 N  N   . PRO A 1 283 ? -46.638 44.400 34.651  1.00 16.38  ? 283 PRO A N   1 
ATOM   2262 C  CA  . PRO A 1 283 ? -45.464 43.631 35.029  1.00 16.26  ? 283 PRO A CA  1 
ATOM   2263 C  C   . PRO A 1 283 ? -45.440 43.251 36.486  1.00 17.36  ? 283 PRO A C   1 
ATOM   2264 O  O   . PRO A 1 283 ? -44.974 42.169 36.784  1.00 21.35  ? 283 PRO A O   1 
ATOM   2265 C  CB  . PRO A 1 283 ? -44.285 44.517 34.635  1.00 17.24  ? 283 PRO A CB  1 
ATOM   2266 C  CG  . PRO A 1 283 ? -44.756 45.409 33.524  1.00 21.25  ? 283 PRO A CG  1 
ATOM   2267 C  CD  . PRO A 1 283 ? -46.258 45.657 33.933  1.00 19.79  ? 283 PRO A CD  1 
ATOM   2268 N  N   . GLU A 1 284 ? -45.968 44.056 37.359  1.00 19.15  ? 284 GLU A N   1 
ATOM   2269 C  CA  . GLU A 1 284 ? -45.912 43.738 38.789  1.00 21.51  ? 284 GLU A CA  1 
ATOM   2270 C  C   . GLU A 1 284 ? -46.881 42.593 39.140  1.00 20.58  ? 284 GLU A C   1 
ATOM   2271 O  O   . GLU A 1 284 ? -46.568 41.687 39.949  1.00 21.08  ? 284 GLU A O   1 
ATOM   2272 C  CB  . GLU A 1 284 ? -46.364 45.046 39.588  1.00 26.69  ? 284 GLU A CB  1 
ATOM   2273 C  CG  . GLU A 1 284 ? -46.888 44.795 41.039  1.00 38.64  ? 284 GLU A CG  1 
ATOM   2274 C  CD  . GLU A 1 284 ? -45.834 45.089 42.112  1.00 51.07  ? 284 GLU A CD  1 
ATOM   2275 O  OE1 . GLU A 1 284 ? -44.699 44.516 41.973  1.00 60.89  ? 284 GLU A OE1 1 
ATOM   2276 O  OE2 . GLU A 1 284 ? -46.139 45.890 43.068  1.00 56.16  ? 284 GLU A OE2 1 
ATOM   2277 N  N   . ARG A 1 285 ? -48.095 42.635 38.559  1.00 18.14  ? 285 ARG A N   1 
ATOM   2278 C  CA  . ARG A 1 285 ? -49.060 41.604 38.823  1.00 17.48  ? 285 ARG A CA  1 
ATOM   2279 C  C   . ARG A 1 285 ? -48.809 40.322 37.955  1.00 14.45  ? 285 ARG A C   1 
ATOM   2280 O  O   . ARG A 1 285 ? -49.395 39.299 38.174  1.00 15.58  ? 285 ARG A O   1 
ATOM   2281 C  CB  . ARG A 1 285 ? -50.508 42.026 38.618  1.00 22.36  ? 285 ARG A CB  1 
ATOM   2282 C  CG  . ARG A 1 285 ? -51.020 42.969 39.748  1.00 29.13  ? 285 ARG A CG  1 
ATOM   2283 C  CD  . ARG A 1 285 ? -52.532 42.959 39.983  1.00 38.05  ? 285 ARG A CD  1 
ATOM   2284 N  NE  . ARG A 1 285 ? -53.030 41.610 40.337  1.00 44.96  ? 285 ARG A NE  1 
ATOM   2285 C  CZ  . ARG A 1 285 ? -54.295 41.178 40.189  1.00 50.29  ? 285 ARG A CZ  1 
ATOM   2286 N  NH1 . ARG A 1 285 ? -55.223 41.994 39.670  1.00 53.76  ? 285 ARG A NH1 1 
ATOM   2287 N  NH2 . ARG A 1 285 ? -54.646 39.904 40.520  1.00 50.25  ? 285 ARG A NH2 1 
ATOM   2288 N  N   . ARG A 1 286 ? -47.932 40.453 36.977  1.00 13.29  ? 286 ARG A N   1 
ATOM   2289 C  CA  . ARG A 1 286 ? -47.497 39.386 36.100  1.00 11.84  ? 286 ARG A CA  1 
ATOM   2290 C  C   . ARG A 1 286 ? -48.593 38.925 35.121  1.00 10.59  ? 286 ARG A C   1 
ATOM   2291 O  O   . ARG A 1 286 ? -48.689 37.772 34.803  1.00 10.67  ? 286 ARG A O   1 
ATOM   2292 C  CB  . ARG A 1 286 ? -46.974 38.145 36.891  1.00 12.91  ? 286 ARG A CB  1 
ATOM   2293 C  CG  . ARG A 1 286 ? -45.971 38.453 38.040  1.00 15.86  ? 286 ARG A CG  1 
ATOM   2294 C  CD  . ARG A 1 286 ? -44.462 38.183 37.544  1.00 20.64  ? 286 ARG A CD  1 
ATOM   2295 N  NE  . ARG A 1 286 ? -44.071 39.199 36.760  1.00 22.35  ? 286 ARG A NE  1 
ATOM   2296 C  CZ  . ARG A 1 286 ? -42.908 39.323 36.230  1.00 19.49  ? 286 ARG A CZ  1 
ATOM   2297 N  NH1 . ARG A 1 286 ? -42.617 40.454 35.617  1.00 20.26  ? 286 ARG A NH1 1 
ATOM   2298 N  NH2 . ARG A 1 286 ? -42.116 38.312 36.062  1.00 23.20  ? 286 ARG A NH2 1 
ATOM   2299 N  N   . ILE A 1 287 ? -49.422 39.879 34.684  1.00 10.33  ? 287 ILE A N   1 
ATOM   2300 C  CA  . ILE A 1 287 ? -50.580 39.590 33.837  1.00 9.89   ? 287 ILE A CA  1 
ATOM   2301 C  C   . ILE A 1 287 ? -50.629 40.573 32.701  1.00 10.30  ? 287 ILE A C   1 
ATOM   2302 O  O   . ILE A 1 287 ? -50.489 41.796 32.884  1.00 11.84  ? 287 ILE A O   1 
ATOM   2303 C  CB  . ILE A 1 287 ? -51.900 39.701 34.619  1.00 11.39  ? 287 ILE A CB  1 
ATOM   2304 C  CG1 . ILE A 1 287 ? -51.939 38.640 35.732  1.00 12.72  ? 287 ILE A CG1 1 
ATOM   2305 C  CG2 . ILE A 1 287 ? -53.128 39.579 33.673  1.00 13.64  ? 287 ILE A CG2 1 
ATOM   2306 C  CD1 . ILE A 1 287 ? -53.104 38.856 36.715  1.00 15.78  ? 287 ILE A CD1 1 
ATOM   2307 N  N   . ALA A 1 288 ? -50.878 40.095 31.478  1.00 9.39   ? 288 ALA A N   1 
ATOM   2308 C  CA  . ALA A 1 288 ? -51.244 40.925 30.316  1.00 8.73   ? 288 ALA A CA  1 
ATOM   2309 C  C   . ALA A 1 288 ? -52.557 40.423 29.769  1.00 8.61   ? 288 ALA A C   1 
ATOM   2310 O  O   . ALA A 1 288 ? -52.795 39.248 29.670  1.00 10.76  ? 288 ALA A O   1 
ATOM   2311 C  CB  . ALA A 1 288 ? -50.188 40.926 29.280  1.00 9.09   ? 288 ALA A CB  1 
ATOM   2312 N  N   . ILE A 1 289 ? -53.465 41.374 29.391  1.00 9.58   ? 289 ILE A N   1 
ATOM   2313 C  CA  . ILE A 1 289 ? -54.732 41.050 28.765  1.00 9.59   ? 289 ILE A CA  1 
ATOM   2314 C  C   . ILE A 1 289 ? -54.563 41.373 27.282  1.00 8.00   ? 289 ILE A C   1 
ATOM   2315 O  O   . ILE A 1 289 ? -54.271 42.512 26.935  1.00 8.75   ? 289 ILE A O   1 
ATOM   2316 C  CB  . ILE A 1 289 ? -55.875 41.860 29.366  1.00 9.30   ? 289 ILE A CB  1 
ATOM   2317 C  CG1 . ILE A 1 289 ? -55.998 41.578 30.842  1.00 12.73  ? 289 ILE A CG1 1 
ATOM   2318 C  CG2 . ILE A 1 289 ? -57.193 41.538 28.590  1.00 11.03  ? 289 ILE A CG2 1 
ATOM   2319 C  CD1 . ILE A 1 289 ? -57.132 42.325 31.533  1.00 17.08  ? 289 ILE A CD1 1 
ATOM   2320 N  N   . GLY A 1 290 ? -54.701 40.325 26.467  1.00 7.80   ? 290 GLY A N   1 
ATOM   2321 C  CA  . GLY A 1 290 ? -54.546 40.462 25.056  1.00 7.73   ? 290 GLY A CA  1 
ATOM   2322 C  C   . GLY A 1 290 ? -55.825 40.838 24.317  1.00 7.58   ? 290 GLY A C   1 
ATOM   2323 O  O   . GLY A 1 290 ? -56.826 41.120 24.907  1.00 7.97   ? 290 GLY A O   1 
ATOM   2324 N  N   . PRO A 1 291 ? -55.722 40.846 22.981  1.00 7.58   ? 291 PRO A N   1 
ATOM   2325 C  CA  . PRO A 1 291 ? -56.861 41.338 22.154  1.00 7.57   ? 291 PRO A CA  1 
ATOM   2326 C  C   . PRO A 1 291 ? -58.023 40.391 22.111  1.00 6.62   ? 291 PRO A C   1 
ATOM   2327 O  O   . PRO A 1 291 ? -57.875 39.165 22.320  1.00 7.67   ? 291 PRO A O   1 
ATOM   2328 C  CB  . PRO A 1 291 ? -56.252 41.495 20.787  1.00 8.50   ? 291 PRO A CB  1 
ATOM   2329 C  CG  . PRO A 1 291 ? -55.196 40.428 20.744  1.00 9.75   ? 291 PRO A CG  1 
ATOM   2330 C  CD  . PRO A 1 291 ? -54.582 40.511 22.148  1.00 8.59   ? 291 PRO A CD  1 
ATOM   2331 N  N   . LYS A 1 292 ? -59.198 40.947 21.802  1.00 7.21   ? 292 LYS A N   1 
ATOM   2332 C  CA  . LYS A 1 292 ? -60.400 40.211 21.502  1.00 7.20   ? 292 LYS A CA  1 
ATOM   2333 C  C   . LYS A 1 292 ? -60.459 39.781 20.065  1.00 6.66   ? 292 LYS A C   1 
ATOM   2334 O  O   . LYS A 1 292 ? -59.850 40.392 19.154  1.00 9.40   ? 292 LYS A O   1 
ATOM   2335 C  CB  . LYS A 1 292 ? -61.607 41.111 21.764  1.00 9.72   ? 292 LYS A CB  1 
ATOM   2336 C  CG  . LYS A 1 292 ? -61.742 41.564 23.198  1.00 9.85   ? 292 LYS A CG  1 
ATOM   2337 C  CD  . LYS A 1 292 ? -62.729 42.778 23.291  1.00 13.33  ? 292 LYS A CD  1 
ATOM   2338 C  CE  . LYS A 1 292 ? -62.804 43.323 24.597  1.00 15.32  ? 292 LYS A CE  1 
ATOM   2339 N  NZ  . LYS A 1 292 ? -63.627 44.606 24.647  1.00 14.62  ? 292 LYS A NZ  1 
ATOM   2340 N  N   . MET A 1 293 ? -61.210 38.710 19.812  1.00 7.06   ? 293 MET A N   1 
ATOM   2341 C  CA  A MET A 1 293 ? -61.576 38.239 18.481  0.50 7.03   ? 293 MET A CA  1 
ATOM   2342 C  CA  B MET A 1 293 ? -61.548 38.275 18.482  0.50 7.13   ? 293 MET A CA  1 
ATOM   2343 C  C   . MET A 1 293 ? -62.983 38.676 18.216  1.00 8.57   ? 293 MET A C   1 
ATOM   2344 O  O   . MET A 1 293 ? -63.864 38.354 19.026  1.00 11.97  ? 293 MET A O   1 
ATOM   2345 C  CB  A MET A 1 293 ? -61.520 36.740 18.367  0.50 7.64   ? 293 MET A CB  1 
ATOM   2346 C  CB  B MET A 1 293 ? -61.303 36.800 18.354  0.50 7.50   ? 293 MET A CB  1 
ATOM   2347 C  CG  A MET A 1 293 ? -60.183 36.128 18.585  0.50 8.33   ? 293 MET A CG  1 
ATOM   2348 C  CG  B MET A 1 293 ? -60.043 36.384 19.061  0.50 5.95   ? 293 MET A CG  1 
ATOM   2349 S  SD  A MET A 1 293 ? -58.769 36.826 17.663  0.50 9.75   ? 293 MET A SD  1 
ATOM   2350 S  SD  B MET A 1 293 ? -58.560 37.119 18.491  0.50 7.47   ? 293 MET A SD  1 
ATOM   2351 C  CE  A MET A 1 293 ? -57.758 37.376 19.041  0.50 11.57  ? 293 MET A CE  1 
ATOM   2352 C  CE  B MET A 1 293 ? -58.122 36.076 17.026  0.50 6.52   ? 293 MET A CE  1 
ATOM   2353 N  N   . THR A 1 294 ? -63.251 39.413 17.168  1.00 7.22   ? 294 THR A N   1 
ATOM   2354 C  CA  . THR A 1 294 ? -64.539 40.022 16.947  1.00 8.50   ? 294 THR A CA  1 
ATOM   2355 C  C   . THR A 1 294 ? -65.101 39.579 15.597  1.00 7.56   ? 294 THR A C   1 
ATOM   2356 O  O   . THR A 1 294 ? -65.737 38.520 15.531  1.00 7.76   ? 294 THR A O   1 
ATOM   2357 C  CB  . THR A 1 294 ? -64.523 41.535 17.130  1.00 10.08  ? 294 THR A CB  1 
ATOM   2358 O  OG1 . THR A 1 294 ? -63.698 42.150 16.117  1.00 10.34  ? 294 THR A OG1 1 
ATOM   2359 C  CG2 . THR A 1 294 ? -64.062 41.895 18.555  1.00 12.91  ? 294 THR A CG2 1 
ATOM   2360 N  N   . ARG A 1 295 ? -64.967 40.364 14.523  1.00 7.56   ? 295 ARG A N   1 
ATOM   2361 C  CA  . ARG A 1 295 ? -65.615 40.043 13.256  1.00 7.91   ? 295 ARG A CA  1 
ATOM   2362 C  C   . ARG A 1 295 ? -65.211 38.671 12.795  1.00 6.42   ? 295 ARG A C   1 
ATOM   2363 O  O   . ARG A 1 295 ? -64.019 38.352 12.600  1.00 6.45   ? 295 ARG A O   1 
ATOM   2364 C  CB  . ARG A 1 295 ? -65.554 41.066 12.105  1.00 14.22  ? 295 ARG A CB  1 
ATOM   2365 C  CG  . ARG A 1 295 ? -64.364 41.178 11.447  1.00 16.43  ? 295 ARG A CG  1 
ATOM   2366 C  CD  . ARG A 1 295 ? -64.445 42.137 10.162  1.00 9.38   ? 295 ARG A CD  1 
ATOM   2367 N  NE  . ARG A 1 295 ? -65.152 41.637 9.015   1.00 7.94   ? 295 ARG A NE  1 
ATOM   2368 C  CZ  . ARG A 1 295 ? -65.319 42.317 7.858   1.00 7.61   ? 295 ARG A CZ  1 
ATOM   2369 N  NH1 . ARG A 1 295 ? -66.039 41.883 6.916   1.00 8.39   ? 295 ARG A NH1 1 
ATOM   2370 N  NH2 . ARG A 1 295 ? -64.669 43.487 7.706   1.00 7.62   ? 295 ARG A NH2 1 
ATOM   2371 N  N   . PHE A 1 296 ? -66.203 37.808 12.547  1.00 6.30   ? 296 PHE A N   1 
ATOM   2372 C  CA  . PHE A 1 296 ? -65.978 36.491 12.052  1.00 6.08   ? 296 PHE A CA  1 
ATOM   2373 C  C   . PHE A 1 296 ? -65.048 35.703 12.980  1.00 5.96   ? 296 PHE A C   1 
ATOM   2374 O  O   . PHE A 1 296 ? -64.343 34.816 12.504  1.00 5.85   ? 296 PHE A O   1 
ATOM   2375 C  CB  . PHE A 1 296 ? -65.506 36.564 10.576  1.00 6.46   ? 296 PHE A CB  1 
ATOM   2376 C  CG  . PHE A 1 296 ? -65.823 35.368 9.722   1.00 5.86   ? 296 PHE A CG  1 
ATOM   2377 C  CD1 . PHE A 1 296 ? -67.165 35.007 9.457   1.00 7.35   ? 296 PHE A CD1 1 
ATOM   2378 C  CD2 . PHE A 1 296 ? -64.860 34.650 9.077   1.00 6.37   ? 296 PHE A CD2 1 
ATOM   2379 C  CE1 . PHE A 1 296 ? -67.449 33.976 8.578   1.00 7.63   ? 296 PHE A CE1 1 
ATOM   2380 C  CE2 . PHE A 1 296 ? -65.173 33.661 8.172   1.00 7.28   ? 296 PHE A CE2 1 
ATOM   2381 C  CZ  . PHE A 1 296 ? -66.485 33.313 7.953   1.00 8.23   ? 296 PHE A CZ  1 
ATOM   2382 N  N   . ASP A 1 297 ? -65.119 35.975 14.298  1.00 5.92   ? 297 ASP A N   1 
ATOM   2383 C  CA  . ASP A 1 297 ? -64.257 35.309 15.287  1.00 6.60   ? 297 ASP A CA  1 
ATOM   2384 C  C   . ASP A 1 297 ? -62.793 35.586 14.981  1.00 6.66   ? 297 ASP A C   1 
ATOM   2385 O  O   . ASP A 1 297 ? -61.935 34.727 15.191  1.00 8.07   ? 297 ASP A O   1 
ATOM   2386 C  CB  . ASP A 1 297 ? -64.554 33.811 15.477  1.00 6.51   ? 297 ASP A CB  1 
ATOM   2387 C  CG  . ASP A 1 297 ? -65.815 33.503 16.203  1.00 7.36   ? 297 ASP A CG  1 
ATOM   2388 O  OD1 . ASP A 1 297 ? -66.433 34.328 16.860  1.00 7.35   ? 297 ASP A OD1 1 
ATOM   2389 O  OD2 . ASP A 1 297 ? -66.215 32.308 16.075  1.00 9.03   ? 297 ASP A OD2 1 
ATOM   2390 N  N   . GLY A 1 298 ? -62.442 36.802 14.583  1.00 5.99   ? 298 GLY A N   1 
ATOM   2391 C  CA  . GLY A 1 298 ? -61.060 37.177 14.380  1.00 5.79   ? 298 GLY A CA  1 
ATOM   2392 C  C   . GLY A 1 298 ? -60.975 38.639 14.017  1.00 6.30   ? 298 GLY A C   1 
ATOM   2393 O  O   . GLY A 1 298 ? -61.589 39.458 14.714  1.00 7.37   ? 298 GLY A O   1 
ATOM   2394 N  N   . PRO A 1 299 ? -60.237 38.992 12.949  1.00 6.04   ? 299 PRO A N   1 
ATOM   2395 C  CA  . PRO A 1 299 ? -59.296 38.145 12.218  1.00 6.21   ? 299 PRO A CA  1 
ATOM   2396 C  C   . PRO A 1 299 ? -58.271 37.491 13.183  1.00 5.74   ? 299 PRO A C   1 
ATOM   2397 O  O   . PRO A 1 299 ? -58.165 37.904 14.338  1.00 6.50   ? 299 PRO A O   1 
ATOM   2398 C  CB  . PRO A 1 299 ? -58.607 39.083 11.241  1.00 7.50   ? 299 PRO A CB  1 
ATOM   2399 C  CG  . PRO A 1 299 ? -58.811 40.402 11.824  1.00 13.80  ? 299 PRO A CG  1 
ATOM   2400 C  CD  . PRO A 1 299 ? -60.092 40.430 12.639  1.00 7.76   ? 299 PRO A CD  1 
ATOM   2401 N  N   . PRO A 1 300 ? -57.570 36.486 12.669  1.00 5.54   ? 300 PRO A N   1 
ATOM   2402 C  CA  . PRO A 1 300 ? -56.466 35.895 13.483  1.00 6.32   ? 300 PRO A CA  1 
ATOM   2403 C  C   . PRO A 1 300 ? -55.521 36.948 13.970  1.00 5.68   ? 300 PRO A C   1 
ATOM   2404 O  O   . PRO A 1 300 ? -55.281 37.929 13.266  1.00 5.79   ? 300 PRO A O   1 
ATOM   2405 C  CB  . PRO A 1 300 ? -55.793 34.935 12.509  1.00 7.26   ? 300 PRO A CB  1 
ATOM   2406 C  CG  . PRO A 1 300 ? -56.863 34.604 11.457  1.00 7.61   ? 300 PRO A CG  1 
ATOM   2407 C  CD  . PRO A 1 300 ? -57.577 35.940 11.321  1.00 5.98   ? 300 PRO A CD  1 
ATOM   2408 N  N   . LYS A 1 301 ? -55.054 36.797 15.217  1.00 5.57   ? 301 LYS A N   1 
ATOM   2409 C  CA  A LYS A 1 301 ? -54.170 37.800 15.825  0.50 5.51   ? 301 LYS A CA  1 
ATOM   2410 C  CA  B LYS A 1 301 ? -54.109 37.779 15.749  0.50 5.51   ? 301 LYS A CA  1 
ATOM   2411 C  C   . LYS A 1 301 ? -52.958 37.103 16.476  1.00 5.29   ? 301 LYS A C   1 
ATOM   2412 O  O   . LYS A 1 301 ? -53.106 35.984 16.984  1.00 6.93   ? 301 LYS A O   1 
ATOM   2413 C  CB  A LYS A 1 301 ? -54.938 38.613 16.881  0.50 5.96   ? 301 LYS A CB  1 
ATOM   2414 C  CB  B LYS A 1 301 ? -54.792 38.722 16.730  0.50 6.00   ? 301 LYS A CB  1 
ATOM   2415 C  CG  A LYS A 1 301 ? -56.124 39.375 16.322  0.50 4.49   ? 301 LYS A CG  1 
ATOM   2416 C  CG  B LYS A 1 301 ? -55.834 39.539 16.121  0.50 6.20   ? 301 LYS A CG  1 
ATOM   2417 C  CD  A LYS A 1 301 ? -56.845 40.289 17.259  0.50 6.36   ? 301 LYS A CD  1 
ATOM   2418 C  CD  B LYS A 1 301 ? -56.598 40.481 17.002  0.50 6.06   ? 301 LYS A CD  1 
ATOM   2419 C  CE  A LYS A 1 301 ? -57.904 41.145 16.576  0.50 5.01   ? 301 LYS A CE  1 
ATOM   2420 C  CE  B LYS A 1 301 ? -57.791 41.044 16.289  0.50 11.62  ? 301 LYS A CE  1 
ATOM   2421 N  NZ  A LYS A 1 301 ? -59.021 40.274 16.290  0.50 3.76   ? 301 LYS A NZ  1 
ATOM   2422 N  NZ  B LYS A 1 301 ? -58.576 41.754 17.221  0.50 16.12  ? 301 LYS A NZ  1 
ATOM   2423 N  N   . VAL A 1 302 ? -51.859 37.813 16.512  1.00 5.62   ? 302 VAL A N   1 
ATOM   2424 C  CA  . VAL A 1 302 ? -50.648 37.413 17.248  1.00 5.54   ? 302 VAL A CA  1 
ATOM   2425 C  C   . VAL A 1 302 ? -50.252 38.560 18.152  1.00 5.76   ? 302 VAL A C   1 
ATOM   2426 O  O   . VAL A 1 302 ? -50.260 39.736 17.728  1.00 6.06   ? 302 VAL A O   1 
ATOM   2427 C  CB  . VAL A 1 302 ? -49.550 36.964 16.308  1.00 6.06   ? 302 VAL A CB  1 
ATOM   2428 C  CG1 . VAL A 1 302 ? -49.118 38.011 15.289  1.00 6.97   ? 302 VAL A CG1 1 
ATOM   2429 C  CG2 . VAL A 1 302 ? -48.283 36.452 17.115  1.00 7.60   ? 302 VAL A CG2 1 
ATOM   2430 N  N   . GLY A 1 303 ? -49.878 38.247 19.392  1.00 5.60   ? 303 GLY A N   1 
ATOM   2431 C  CA  . GLY A 1 303 ? -49.294 39.176 20.323  1.00 5.96   ? 303 GLY A CA  1 
ATOM   2432 C  C   . GLY A 1 303 ? -47.847 38.806 20.598  1.00 5.91   ? 303 GLY A C   1 
ATOM   2433 O  O   . GLY A 1 303 ? -47.488 37.622 20.522  1.00 7.31   ? 303 GLY A O   1 
ATOM   2434 N  N   . ALA A 1 304 ? -47.038 39.815 20.941  1.00 6.15   ? 304 ALA A N   1 
ATOM   2435 C  CA  . ALA A 1 304 ? -45.577 39.632 21.152  1.00 6.21   ? 304 ALA A CA  1 
ATOM   2436 C  C   . ALA A 1 304 ? -45.209 40.334 22.478  1.00 6.86   ? 304 ALA A C   1 
ATOM   2437 O  O   . ALA A 1 304 ? -45.400 41.553 22.606  1.00 7.09   ? 304 ALA A O   1 
ATOM   2438 C  CB  . ALA A 1 304 ? -44.812 40.289 20.026  1.00 8.23   ? 304 ALA A CB  1 
ATOM   2439 N  N   . LEU A 1 305 ? -44.657 39.555 23.418  1.00 6.68   ? 305 LEU A N   1 
ATOM   2440 C  CA  . LEU A 1 305 ? -44.124 40.098 24.663  1.00 6.95   ? 305 LEU A CA  1 
ATOM   2441 C  C   . LEU A 1 305 ? -42.641 39.819 24.780  1.00 6.85   ? 305 LEU A C   1 
ATOM   2442 O  O   . LEU A 1 305 ? -42.225 38.678 24.758  1.00 7.81   ? 305 LEU A O   1 
ATOM   2443 C  CB  . LEU A 1 305 ? -44.851 39.490 25.869  1.00 7.62   ? 305 LEU A CB  1 
ATOM   2444 C  CG  . LEU A 1 305 ? -46.303 39.870 26.061  1.00 7.75   ? 305 LEU A CG  1 
ATOM   2445 C  CD1 . LEU A 1 305 ? -46.970 39.008 27.104  1.00 10.00  ? 305 LEU A CD1 1 
ATOM   2446 C  CD2 . LEU A 1 305 ? -46.487 41.386 26.375  1.00 9.96   ? 305 LEU A CD2 1 
ATOM   2447 N  N   . GLY A 1 306 ? -41.878 40.869 24.954  1.00 7.14   ? 306 GLY A N   1 
ATOM   2448 C  CA  . GLY A 1 306 ? -40.464 40.741 25.155  1.00 7.67   ? 306 GLY A CA  1 
ATOM   2449 C  C   . GLY A 1 306 ? -40.069 40.717 26.637  1.00 7.56   ? 306 GLY A C   1 
ATOM   2450 O  O   . GLY A 1 306 ? -40.734 41.359 27.469  1.00 8.27   ? 306 GLY A O   1 
ATOM   2451 N  N   . PHE A 1 307 ? -38.991 39.983 26.916  1.00 7.72   ? 307 PHE A N   1 
ATOM   2452 C  CA  . PHE A 1 307 ? -38.491 39.872 28.285  1.00 7.88   ? 307 PHE A CA  1 
ATOM   2453 C  C   . PHE A 1 307 ? -36.985 39.879 28.227  1.00 8.37   ? 307 PHE A C   1 
ATOM   2454 O  O   . PHE A 1 307 ? -36.346 39.546 27.254  1.00 8.81   ? 307 PHE A O   1 
ATOM   2455 C  CB  . PHE A 1 307 ? -38.925 38.540 28.930  1.00 8.59   ? 307 PHE A CB  1 
ATOM   2456 C  CG  . PHE A 1 307 ? -40.403 38.363 29.076  1.00 8.47   ? 307 PHE A CG  1 
ATOM   2457 C  CD1 . PHE A 1 307 ? -41.194 37.870 28.023  1.00 8.94   ? 307 PHE A CD1 1 
ATOM   2458 C  CD2 . PHE A 1 307 ? -41.046 38.671 30.252  1.00 9.50   ? 307 PHE A CD2 1 
ATOM   2459 C  CE1 . PHE A 1 307 ? -42.542 37.746 28.203  1.00 10.81  ? 307 PHE A CE1 1 
ATOM   2460 C  CE2 . PHE A 1 307 ? -42.429 38.521 30.372  1.00 10.34  ? 307 PHE A CE2 1 
ATOM   2461 C  CZ  . PHE A 1 307 ? -43.166 38.072 29.352  1.00 10.41  ? 307 PHE A CZ  1 
ATOM   2462 N  N   . GLN A 1 308 ? -36.395 40.200 29.433  1.00 8.97   ? 308 GLN A N   1 
ATOM   2463 C  CA  . GLN A 1 308 ? -34.968 39.968 29.700  1.00 9.24   ? 308 GLN A CA  1 
ATOM   2464 C  C   . GLN A 1 308 ? -34.902 39.028 30.903  1.00 8.82   ? 308 GLN A C   1 
ATOM   2465 O  O   . GLN A 1 308 ? -35.506 39.283 31.934  1.00 10.99  ? 308 GLN A O   1 
ATOM   2466 C  CB  . GLN A 1 308 ? -34.280 41.302 30.035  1.00 9.30   ? 308 GLN A CB  1 
ATOM   2467 C  CG  . GLN A 1 308 ? -34.170 42.194 28.825  1.00 9.57   ? 308 GLN A CG  1 
ATOM   2468 C  CD  . GLN A 1 308 ? -33.125 41.934 27.810  1.00 9.62   ? 308 GLN A CD  1 
ATOM   2469 O  OE1 . GLN A 1 308 ? -33.132 42.555 26.727  1.00 10.61  ? 308 GLN A OE1 1 
ATOM   2470 N  NE2 . GLN A 1 308 ? -32.214 40.938 28.017  1.00 9.51   ? 308 GLN A NE2 1 
ATOM   2471 N  N   . LEU A 1 309 ? -34.172 37.928 30.731  1.00 10.03  ? 309 LEU A N   1 
ATOM   2472 C  CA  A LEU A 1 309 ? -33.985 36.927 31.808  0.50 11.64  ? 309 LEU A CA  1 
ATOM   2473 C  CA  B LEU A 1 309 ? -33.982 36.959 31.827  0.50 11.34  ? 309 LEU A CA  1 
ATOM   2474 C  C   . LEU A 1 309 ? -32.774 37.258 32.681  1.00 12.21  ? 309 LEU A C   1 
ATOM   2475 O  O   . LEU A 1 309 ? -31.745 37.588 32.179  1.00 12.79  ? 309 LEU A O   1 
ATOM   2476 C  CB  A LEU A 1 309 ? -33.809 35.533 31.215  0.50 12.80  ? 309 LEU A CB  1 
ATOM   2477 C  CB  B LEU A 1 309 ? -33.816 35.574 31.284  0.50 11.96  ? 309 LEU A CB  1 
ATOM   2478 C  CG  A LEU A 1 309 ? -34.957 34.820 30.505  0.50 15.83  ? 309 LEU A CG  1 
ATOM   2479 C  CG  B LEU A 1 309 ? -35.097 34.828 31.081  0.50 13.62  ? 309 LEU A CG  1 
ATOM   2480 C  CD1 A LEU A 1 309 ? -34.550 33.503 29.783  0.50 14.63  ? 309 LEU A CD1 1 
ATOM   2481 C  CD1 B LEU A 1 309 ? -35.953 35.478 29.949  0.50 14.37  ? 309 LEU A CD1 1 
ATOM   2482 C  CD2 A LEU A 1 309 ? -36.031 34.394 31.564  0.50 20.93  ? 309 LEU A CD2 1 
ATOM   2483 C  CD2 B LEU A 1 309 ? -34.772 33.313 30.789  0.50 12.96  ? 309 LEU A CD2 1 
ATOM   2484 N  N   . HIS A 1 310 ? -32.918 37.071 33.977  1.00 11.91  ? 310 HIS A N   1 
ATOM   2485 C  CA  . HIS A 1 310 ? -31.752 37.196 34.869  1.00 12.47  ? 310 HIS A CA  1 
ATOM   2486 C  C   . HIS A 1 310 ? -31.863 36.182 35.999  1.00 11.59  ? 310 HIS A C   1 
ATOM   2487 O  O   . HIS A 1 310 ? -32.728 36.250 36.812  1.00 12.64  ? 310 HIS A O   1 
ATOM   2488 C  CB  . HIS A 1 310 ? -31.539 38.627 35.394  1.00 13.99  ? 310 HIS A CB  1 
ATOM   2489 C  CG  . HIS A 1 310 ? -32.692 39.180 36.156  1.00 17.79  ? 310 HIS A CG  1 
ATOM   2490 N  ND1 . HIS A 1 310 ? -32.739 39.180 37.530  1.00 23.14  ? 310 HIS A ND1 1 
ATOM   2491 C  CD2 . HIS A 1 310 ? -33.904 39.655 35.722  1.00 23.00  ? 310 HIS A CD2 1 
ATOM   2492 C  CE1 . HIS A 1 310 ? -33.914 39.756 37.889  1.00 21.76  ? 310 HIS A CE1 1 
ATOM   2493 N  NE2 . HIS A 1 310 ? -34.625 40.033 36.812  1.00 27.30  ? 310 HIS A NE2 1 
ATOM   2494 N  N   . GLU A 1 311 ? -30.948 35.229 35.935  1.00 12.97  ? 311 GLU A N   1 
ATOM   2495 C  CA  . GLU A 1 311 ? -31.019 34.057 36.848  1.00 14.34  ? 311 GLU A CA  1 
ATOM   2496 C  C   . GLU A 1 311 ? -32.401 33.403 36.792  1.00 14.01  ? 311 GLU A C   1 
ATOM   2497 O  O   . GLU A 1 311 ? -32.954 32.888 37.797  1.00 15.32  ? 311 GLU A O   1 
ATOM   2498 C  CB  . GLU A 1 311 ? -30.672 34.436 38.316  1.00 16.90  ? 311 GLU A CB  1 
ATOM   2499 C  CG  . GLU A 1 311 ? -29.477 35.328 38.507  1.00 23.34  ? 311 GLU A CG  1 
ATOM   2500 C  CD  . GLU A 1 311 ? -28.332 35.160 37.704  1.00 37.22  ? 311 GLU A CD  1 
ATOM   2501 O  OE1 . GLU A 1 311 ? -27.902 33.916 37.670  1.00 44.20  ? 311 GLU A OE1 1 
ATOM   2502 O  OE2 . GLU A 1 311 ? -27.855 36.297 37.159  1.00 45.92  ? 311 GLU A OE2 1 
ATOM   2503 N  N   . GLY A 1 312 ? -32.954 33.411 35.587  1.00 12.43  ? 312 GLY A N   1 
ATOM   2504 C  CA  . GLY A 1 312 ? -34.304 32.897 35.353  1.00 14.19  ? 312 GLY A CA  1 
ATOM   2505 C  C   . GLY A 1 312 ? -35.457 33.798 35.676  1.00 12.88  ? 312 GLY A C   1 
ATOM   2506 O  O   . GLY A 1 312 ? -36.603 33.520 35.301  1.00 15.66  ? 312 GLY A O   1 
ATOM   2507 N  N   . TYR A 1 313 ? -35.240 34.908 36.341  1.00 11.82  ? 313 TYR A N   1 
ATOM   2508 C  CA  . TYR A 1 313 ? -36.320 35.850 36.598  1.00 13.12  ? 313 TYR A CA  1 
ATOM   2509 C  C   . TYR A 1 313 ? -36.634 36.554 35.284  1.00 13.12  ? 313 TYR A C   1 
ATOM   2510 O  O   . TYR A 1 313 ? -35.763 36.811 34.430  1.00 13.31  ? 313 TYR A O   1 
ATOM   2511 C  CB  . TYR A 1 313 ? -35.878 36.827 37.714  1.00 15.45  ? 313 TYR A CB  1 
ATOM   2512 C  CG  . TYR A 1 313 ? -35.872 36.138 39.071  1.00 15.55  ? 313 TYR A CG  1 
ATOM   2513 C  CD1 . TYR A 1 313 ? -37.025 35.938 39.769  1.00 16.13  ? 313 TYR A CD1 1 
ATOM   2514 C  CD2 . TYR A 1 313 ? -34.715 35.550 39.544  1.00 16.57  ? 313 TYR A CD2 1 
ATOM   2515 C  CE1 . TYR A 1 313 ? -37.069 35.208 40.968  1.00 17.14  ? 313 TYR A CE1 1 
ATOM   2516 C  CE2 . TYR A 1 313 ? -34.731 34.843 40.750  1.00 16.83  ? 313 TYR A CE2 1 
ATOM   2517 C  CZ  . TYR A 1 313 ? -35.884 34.656 41.447  1.00 17.22  ? 313 TYR A CZ  1 
ATOM   2518 O  OH  . TYR A 1 313 ? -35.882 33.862 42.585  1.00 20.41  ? 313 TYR A OH  1 
ATOM   2519 N  N   . LEU A 1 314 ? -37.908 36.878 35.128  1.00 12.69  ? 314 LEU A N   1 
ATOM   2520 C  CA  . LEU A 1 314 ? -38.413 37.488 33.916  1.00 13.08  ? 314 LEU A CA  1 
ATOM   2521 C  C   . LEU A 1 314 ? -38.716 38.970 34.141  1.00 14.70  ? 314 LEU A C   1 
ATOM   2522 O  O   . LEU A 1 314 ? -39.682 39.329 34.862  1.00 19.50  ? 314 LEU A O   1 
ATOM   2523 C  CB  . LEU A 1 314 ? -39.710 36.813 33.552  1.00 14.08  ? 314 LEU A CB  1 
ATOM   2524 C  CG  . LEU A 1 314 ? -39.682 35.441 32.972  1.00 14.06  ? 314 LEU A CG  1 
ATOM   2525 C  CD1 . LEU A 1 314 ? -41.017 34.695 33.061  1.00 16.19  ? 314 LEU A CD1 1 
ATOM   2526 C  CD2 . LEU A 1 314 ? -39.110 35.474 31.537  1.00 16.91  ? 314 LEU A CD2 1 
ATOM   2527 N  N   . GLU A 1 315 ? -37.911 39.874 33.603  1.00 12.21  ? 315 GLU A N   1 
ATOM   2528 C  CA  . GLU A 1 315 ? -38.253 41.255 33.583  1.00 12.50  ? 315 GLU A CA  1 
ATOM   2529 C  C   . GLU A 1 315 ? -39.024 41.495 32.277  1.00 9.78   ? 315 GLU A C   1 
ATOM   2530 O  O   . GLU A 1 315 ? -38.503 41.166 31.222  1.00 11.64  ? 315 GLU A O   1 
ATOM   2531 C  CB  . GLU A 1 315 ? -37.009 42.086 33.579  1.00 18.04  ? 315 GLU A CB  1 
ATOM   2532 C  CG  . GLU A 1 315 ? -37.077 43.203 34.233  1.00 25.47  ? 315 GLU A CG  1 
ATOM   2533 C  CD  . GLU A 1 315 ? -37.525 43.341 35.761  1.00 20.50  ? 315 GLU A CD  1 
ATOM   2534 O  OE1 . GLU A 1 315 ? -37.404 42.473 36.705  1.00 35.36  ? 315 GLU A OE1 1 
ATOM   2535 O  OE2 . GLU A 1 315 ? -38.272 44.323 35.843  1.00 23.20  ? 315 GLU A OE2 1 
ATOM   2536 N  N   . GLY A 1 316 ? -40.213 42.054 32.392  1.00 11.10  ? 316 GLY A N   1 
ATOM   2537 C  CA  . GLY A 1 316 ? -41.157 42.172 31.276  1.00 12.52  ? 316 GLY A CA  1 
ATOM   2538 C  C   . GLY A 1 316 ? -42.562 41.909 31.786  1.00 13.85  ? 316 GLY A C   1 
ATOM   2539 O  O   . GLY A 1 316 ? -42.834 41.885 33.022  1.00 14.49  ? 316 GLY A O   1 
ATOM   2540 N  N   . GLY A 1 317 ? -43.511 41.656 30.912  1.00 13.51  ? 317 GLY A N   1 
ATOM   2541 C  CA  . GLY A 1 317 ? -43.292 41.709 29.470  1.00 11.73  ? 317 GLY A CA  1 
ATOM   2542 C  C   . GLY A 1 317 ? -43.489 43.088 28.861  1.00 11.62  ? 317 GLY A C   1 
ATOM   2543 O  O   . GLY A 1 317 ? -43.956 44.004 29.485  1.00 15.34  ? 317 GLY A O   1 
ATOM   2544 N  N   . VAL A 1 318 ? -42.932 43.258 27.680  1.00 8.98   ? 318 VAL A N   1 
ATOM   2545 C  CA  . VAL A 1 318 ? -42.976 44.486 26.891  1.00 8.65   ? 318 VAL A CA  1 
ATOM   2546 C  C   . VAL A 1 318 ? -43.744 44.172 25.561  1.00 7.56   ? 318 VAL A C   1 
ATOM   2547 O  O   . VAL A 1 318 ? -43.375 43.291 24.839  1.00 7.67   ? 318 VAL A O   1 
ATOM   2548 C  CB  . VAL A 1 318 ? -41.560 44.951 26.567  1.00 9.09   ? 318 VAL A CB  1 
ATOM   2549 C  CG1 . VAL A 1 318 ? -41.579 46.186 25.648  1.00 10.67  ? 318 VAL A CG1 1 
ATOM   2550 C  CG2 . VAL A 1 318 ? -40.748 45.187 27.858  1.00 10.87  ? 318 VAL A CG2 1 
ATOM   2551 N  N   . ASP A 1 319 ? -44.834 44.916 25.324  1.00 7.19   ? 319 ASP A N   1 
ATOM   2552 C  CA  . ASP A 1 319 ? -45.627 44.736 24.082  1.00 6.65   ? 319 ASP A CA  1 
ATOM   2553 C  C   . ASP A 1 319 ? -44.855 45.235 22.900  1.00 7.64   ? 319 ASP A C   1 
ATOM   2554 O  O   . ASP A 1 319 ? -44.583 46.438 22.803  1.00 9.98   ? 319 ASP A O   1 
ATOM   2555 C  CB  . ASP A 1 319 ? -46.949 45.456 24.234  1.00 8.27   ? 319 ASP A CB  1 
ATOM   2556 C  CG  . ASP A 1 319 ? -47.854 45.377 23.015  1.00 8.17   ? 319 ASP A CG  1 
ATOM   2557 O  OD1 . ASP A 1 319 ? -47.425 44.895 21.971  1.00 8.50   ? 319 ASP A OD1 1 
ATOM   2558 O  OD2 . ASP A 1 319 ? -49.026 45.825 23.195  1.00 9.61   ? 319 ASP A OD2 1 
ATOM   2559 N  N   . LEU A 1 320 ? -44.404 44.365 22.009  1.00 6.88   ? 320 LEU A N   1 
ATOM   2560 C  CA  . LEU A 1 320 ? -43.549 44.714 20.942  1.00 6.96   ? 320 LEU A CA  1 
ATOM   2561 C  C   . LEU A 1 320 ? -44.241 45.060 19.611  1.00 7.50   ? 320 LEU A C   1 
ATOM   2562 O  O   . LEU A 1 320 ? -43.531 45.349 18.638  1.00 8.57   ? 320 LEU A O   1 
ATOM   2563 C  CB  . LEU A 1 320 ? -42.492 43.637 20.731  1.00 7.92   ? 320 LEU A CB  1 
ATOM   2564 C  CG  . LEU A 1 320 ? -41.422 43.514 21.884  1.00 8.52   ? 320 LEU A CG  1 
ATOM   2565 C  CD1 . LEU A 1 320 ? -40.579 42.288 21.686  1.00 9.99   ? 320 LEU A CD1 1 
ATOM   2566 C  CD2 . LEU A 1 320 ? -40.588 44.782 21.929  1.00 12.17  ? 320 LEU A CD2 1 
ATOM   2567 N  N   . PHE A 1 321 ? -45.567 45.031 19.588  1.00 7.06   ? 321 PHE A N   1 
ATOM   2568 C  CA  . PHE A 1 321 ? -46.308 45.478 18.422  1.00 7.03   ? 321 PHE A CA  1 
ATOM   2569 C  C   . PHE A 1 321 ? -46.896 46.851 18.623  1.00 8.49   ? 321 PHE A C   1 
ATOM   2570 O  O   . PHE A 1 321 ? -47.714 47.339 17.843  1.00 8.63   ? 321 PHE A O   1 
ATOM   2571 C  CB  . PHE A 1 321 ? -47.350 44.462 17.966  1.00 7.03   ? 321 PHE A CB  1 
ATOM   2572 C  CG  . PHE A 1 321 ? -46.780 43.155 17.449  1.00 6.06   ? 321 PHE A CG  1 
ATOM   2573 C  CD1 . PHE A 1 321 ? -45.695 43.141 16.605  1.00 6.68   ? 321 PHE A CD1 1 
ATOM   2574 C  CD2 . PHE A 1 321 ? -47.455 41.964 17.724  1.00 6.39   ? 321 PHE A CD2 1 
ATOM   2575 C  CE1 . PHE A 1 321 ? -45.283 41.927 16.077  1.00 6.74   ? 321 PHE A CE1 1 
ATOM   2576 C  CE2 . PHE A 1 321 ? -46.998 40.771 17.193  1.00 6.56   ? 321 PHE A CE2 1 
ATOM   2577 C  CZ  . PHE A 1 321 ? -45.934 40.762 16.337  1.00 6.31   ? 321 PHE A CZ  1 
ATOM   2578 N  N   . ASP A 1 322 ? -46.440 47.530 19.702  1.00 10.25  ? 322 ASP A N   1 
ATOM   2579 C  CA  . ASP A 1 322 ? -46.944 48.834 20.097  1.00 12.13  ? 322 ASP A CA  1 
ATOM   2580 C  C   . ASP A 1 322 ? -46.079 49.946 19.496  1.00 13.25  ? 322 ASP A C   1 
ATOM   2581 O  O   . ASP A 1 322 ? -45.084 50.405 20.139  1.00 18.18  ? 322 ASP A O   1 
ATOM   2582 C  CB  . ASP A 1 322 ? -46.967 48.825 21.656  1.00 15.67  ? 322 ASP A CB  1 
ATOM   2583 C  CG  . ASP A 1 322 ? -47.377 50.047 22.282  1.00 20.40  ? 322 ASP A CG  1 
ATOM   2584 O  OD1 . ASP A 1 322 ? -48.165 50.785 21.666  1.00 22.07  ? 322 ASP A OD1 1 
ATOM   2585 O  OD2 . ASP A 1 322 ? -46.928 50.248 23.495  1.00 21.61  ? 322 ASP A OD2 1 
ATOM   2586 N  N   . ASP A 1 323 ? -46.387 50.371 18.277  1.00 12.25  ? 323 ASP A N   1 
ATOM   2587 C  CA  . ASP A 1 323 ? -45.585 51.384 17.526  1.00 12.32  ? 323 ASP A CA  1 
ATOM   2588 C  C   . ASP A 1 323 ? -46.574 51.807 16.367  1.00 12.42  ? 323 ASP A C   1 
ATOM   2589 O  O   . ASP A 1 323 ? -47.288 50.961 15.773  1.00 12.01  ? 323 ASP A O   1 
ATOM   2590 C  CB  . ASP A 1 323 ? -44.387 50.667 16.881  1.00 14.46  ? 323 ASP A CB  1 
ATOM   2591 C  CG  . ASP A 1 323 ? -43.395 51.513 16.157  1.00 12.45  ? 323 ASP A CG  1 
ATOM   2592 O  OD1 . ASP A 1 323 ? -42.125 51.215 16.268  1.00 13.22  ? 323 ASP A OD1 1 
ATOM   2593 O  OD2 . ASP A 1 323 ? -43.669 52.426 15.430  1.00 13.85  ? 323 ASP A OD2 1 
ATOM   2594 N  N   . PRO A 1 324 ? -46.626 53.091 15.985  1.00 11.34  ? 324 PRO A N   1 
ATOM   2595 C  CA  . PRO A 1 324 ? -47.321 53.476 14.796  1.00 10.37  ? 324 PRO A CA  1 
ATOM   2596 C  C   . PRO A 1 324 ? -46.926 52.755 13.549  1.00 9.14   ? 324 PRO A C   1 
ATOM   2597 O  O   . PRO A 1 324 ? -47.713 52.610 12.615  1.00 9.95   ? 324 PRO A O   1 
ATOM   2598 C  CB  . PRO A 1 324 ? -47.022 55.016 14.675  1.00 13.81  ? 324 PRO A CB  1 
ATOM   2599 C  CG  . PRO A 1 324 ? -46.722 55.351 16.001  1.00 15.70  ? 324 PRO A CG  1 
ATOM   2600 C  CD  . PRO A 1 324 ? -45.953 54.238 16.658  1.00 14.48  ? 324 PRO A CD  1 
ATOM   2601 N  N   . ALA A 1 325 ? -45.678 52.270 13.452  1.00 9.40   ? 325 ALA A N   1 
ATOM   2602 C  CA  . ALA A 1 325 ? -45.294 51.457 12.319  1.00 9.00   ? 325 ALA A CA  1 
ATOM   2603 C  C   . ALA A 1 325 ? -46.137 50.258 12.194  1.00 7.56   ? 325 ALA A C   1 
ATOM   2604 O  O   . ALA A 1 325 ? -46.506 49.821 11.059  1.00 9.43   ? 325 ALA A O   1 
ATOM   2605 C  CB  . ALA A 1 325 ? -43.807 51.077 12.325  1.00 11.07  ? 325 ALA A CB  1 
ATOM   2606 N  N   . PHE A 1 326 ? -46.556 49.611 13.282  1.00 7.10   ? 326 PHE A N   1 
ATOM   2607 C  CA  . PHE A 1 326 ? -47.414 48.472 13.258  1.00 6.47   ? 326 PHE A CA  1 
ATOM   2608 C  C   . PHE A 1 326 ? -48.867 48.892 13.116  1.00 6.76   ? 326 PHE A C   1 
ATOM   2609 O  O   . PHE A 1 326 ? -49.677 48.026 12.749  1.00 7.06   ? 326 PHE A O   1 
ATOM   2610 C  CB  . PHE A 1 326 ? -47.181 47.552 14.441  1.00 6.82   ? 326 PHE A CB  1 
ATOM   2611 C  CG  . PHE A 1 326 ? -46.077 46.560 14.239  1.00 5.82   ? 326 PHE A CG  1 
ATOM   2612 C  CD1 . PHE A 1 326 ? -46.277 45.444 13.444  1.00 7.09   ? 326 PHE A CD1 1 
ATOM   2613 C  CD2 . PHE A 1 326 ? -44.823 46.712 14.779  1.00 6.78   ? 326 PHE A CD2 1 
ATOM   2614 C  CE1 . PHE A 1 326 ? -45.323 44.521 13.188  1.00 6.98   ? 326 PHE A CE1 1 
ATOM   2615 C  CE2 . PHE A 1 326 ? -43.836 45.766 14.533  1.00 6.90   ? 326 PHE A CE2 1 
ATOM   2616 C  CZ  . PHE A 1 326 ? -44.092 44.682 13.686  1.00 7.86   ? 326 PHE A CZ  1 
ATOM   2617 N  N   . ASP A 1 327 ? -49.266 50.111 13.355  1.00 7.70   ? 327 ASP A N   1 
ATOM   2618 C  CA  . ASP A 1 327 ? -50.633 50.541 13.036  1.00 7.83   ? 327 ASP A CA  1 
ATOM   2619 C  C   . ASP A 1 327 ? -50.880 50.372 11.585  1.00 8.08   ? 327 ASP A C   1 
ATOM   2620 O  O   . ASP A 1 327 ? -52.012 49.953 11.174  1.00 8.74   ? 327 ASP A O   1 
ATOM   2621 C  CB  . ASP A 1 327 ? -50.916 51.966 13.446  1.00 8.86   ? 327 ASP A CB  1 
ATOM   2622 C  CG  . ASP A 1 327 ? -50.938 52.232 14.902  1.00 12.41  ? 327 ASP A CG  1 
ATOM   2623 O  OD1 . ASP A 1 327 ? -51.049 51.365 15.700  1.00 16.97  ? 327 ASP A OD1 1 
ATOM   2624 O  OD2 . ASP A 1 327 ? -50.863 53.451 15.265  1.00 18.53  ? 327 ASP A OD2 1 
ATOM   2625 N  N   . TYR A 1 328 ? -49.938 50.670 10.724  1.00 8.46   ? 328 TYR A N   1 
ATOM   2626 C  CA  A TYR A 1 328 ? -50.103 50.484 9.289   0.50 8.22   ? 328 TYR A CA  1 
ATOM   2627 C  CA  B TYR A 1 328 ? -50.071 50.501 9.289   0.50 7.88   ? 328 TYR A CA  1 
ATOM   2628 C  C   . TYR A 1 328 ? -50.359 49.018 8.972   1.00 7.66   ? 328 TYR A C   1 
ATOM   2629 O  O   . TYR A 1 328 ? -51.158 48.684 8.083   1.00 8.45   ? 328 TYR A O   1 
ATOM   2630 C  CB  A TYR A 1 328 ? -48.892 50.965 8.531   0.50 10.58  ? 328 TYR A CB  1 
ATOM   2631 C  CB  B TYR A 1 328 ? -48.805 51.023 8.576   0.50 10.31  ? 328 TYR A CB  1 
ATOM   2632 C  CG  A TYR A 1 328 ? -48.982 50.848 7.055   0.50 11.38  ? 328 TYR A CG  1 
ATOM   2633 C  CG  B TYR A 1 328 ? -48.602 50.517 7.191   0.50 9.46   ? 328 TYR A CG  1 
ATOM   2634 C  CD1 A TYR A 1 328 ? -50.005 51.458 6.344   0.50 14.82  ? 328 TYR A CD1 1 
ATOM   2635 C  CD1 B TYR A 1 328 ? -49.122 51.216 6.112   0.50 14.49  ? 328 TYR A CD1 1 
ATOM   2636 C  CD2 A TYR A 1 328 ? -48.075 50.077 6.351   0.50 11.10  ? 328 TYR A CD2 1 
ATOM   2637 C  CD2 B TYR A 1 328 ? -47.989 49.287 6.939   0.50 11.36  ? 328 TYR A CD2 1 
ATOM   2638 C  CE1 A TYR A 1 328 ? -50.094 51.284 4.987   0.50 16.91  ? 328 TYR A CE1 1 
ATOM   2639 C  CE1 B TYR A 1 328 ? -48.998 50.724 4.820   0.50 16.75  ? 328 TYR A CE1 1 
ATOM   2640 C  CE2 A TYR A 1 328 ? -48.133 49.914 5.034   0.50 16.04  ? 328 TYR A CE2 1 
ATOM   2641 C  CE2 B TYR A 1 328 ? -47.898 48.801 5.683   0.50 13.52  ? 328 TYR A CE2 1 
ATOM   2642 C  CZ  A TYR A 1 328 ? -49.113 50.536 4.316   0.50 16.37  ? 328 TYR A CZ  1 
ATOM   2643 C  CZ  B TYR A 1 328 ? -48.406 49.484 4.633   0.50 16.89  ? 328 TYR A CZ  1 
ATOM   2644 O  OH  A TYR A 1 328 ? -49.096 50.355 2.953   0.50 19.04  ? 328 TYR A OH  1 
ATOM   2645 O  OH  B TYR A 1 328 ? -48.262 48.962 3.367   0.50 24.75  ? 328 TYR A OH  1 
ATOM   2646 N  N   . VAL A 1 329 ? -49.614 48.111 9.617   1.00 6.40   ? 329 VAL A N   1 
ATOM   2647 C  CA  . VAL A 1 329 ? -49.778 46.699 9.401   1.00 6.41   ? 329 VAL A CA  1 
ATOM   2648 C  C   . VAL A 1 329 ? -51.176 46.267 9.827   1.00 6.12   ? 329 VAL A C   1 
ATOM   2649 O  O   . VAL A 1 329 ? -51.827 45.483 9.112   1.00 6.57   ? 329 VAL A O   1 
ATOM   2650 C  CB  . VAL A 1 329 ? -48.659 45.904 10.109  1.00 6.02   ? 329 VAL A CB  1 
ATOM   2651 C  CG1 . VAL A 1 329 ? -48.820 44.414 9.854   1.00 7.67   ? 329 VAL A CG1 1 
ATOM   2652 C  CG2 . VAL A 1 329 ? -47.271 46.380 9.708   1.00 8.28   ? 329 VAL A CG2 1 
ATOM   2653 N  N   . ARG A 1 330 ? -51.647 46.719 10.962  1.00 6.20   ? 330 ARG A N   1 
ATOM   2654 C  CA  . ARG A 1 330 ? -52.988 46.407 11.404  1.00 5.67   ? 330 ARG A CA  1 
ATOM   2655 C  C   . ARG A 1 330 ? -54.031 46.932 10.429  1.00 5.99   ? 330 ARG A C   1 
ATOM   2656 O  O   . ARG A 1 330 ? -55.036 46.244 10.175  1.00 6.53   ? 330 ARG A O   1 
ATOM   2657 C  CB  . ARG A 1 330 ? -53.209 46.954 12.812  1.00 6.53   ? 330 ARG A CB  1 
ATOM   2658 C  CG  . ARG A 1 330 ? -52.524 46.122 13.886  1.00 6.88   ? 330 ARG A CG  1 
ATOM   2659 C  CD  . ARG A 1 330 ? -52.723 46.671 15.285  1.00 8.19   ? 330 ARG A CD  1 
ATOM   2660 N  NE  . ARG A 1 330 ? -51.882 47.820 15.593  1.00 8.39   ? 330 ARG A NE  1 
ATOM   2661 C  CZ  . ARG A 1 330 ? -50.671 47.730 16.139  1.00 8.50   ? 330 ARG A CZ  1 
ATOM   2662 N  NH1 . ARG A 1 330 ? -50.147 46.550 16.419  1.00 8.67   ? 330 ARG A NH1 1 
ATOM   2663 N  NH2 . ARG A 1 330 ? -49.977 48.814 16.401  1.00 10.17  ? 330 ARG A NH2 1 
ATOM   2664 N  N   . GLN A 1 331 ? -53.862 48.134 9.940   1.00 6.60   ? 331 GLN A N   1 
ATOM   2665 C  CA  . GLN A 1 331 ? -54.823 48.690 8.960   1.00 7.02   ? 331 GLN A CA  1 
ATOM   2666 C  C   . GLN A 1 331 ? -54.824 47.858 7.709   1.00 7.01   ? 331 GLN A C   1 
ATOM   2667 O  O   . GLN A 1 331 ? -55.936 47.580 7.166   1.00 7.79   ? 331 GLN A O   1 
ATOM   2668 C  CB  . GLN A 1 331 ? -54.424 50.122 8.634   1.00 10.22  ? 331 GLN A CB  1 
ATOM   2669 C  CG  . GLN A 1 331 ? -54.633 51.073 9.820   1.00 14.50  ? 331 GLN A CG  1 
ATOM   2670 C  CD  . GLN A 1 331 ? -53.742 52.353 9.760   1.00 21.15  ? 331 GLN A CD  1 
ATOM   2671 O  OE1 . GLN A 1 331 ? -53.024 52.569 8.752   1.00 25.32  ? 331 GLN A OE1 1 
ATOM   2672 N  NE2 . GLN A 1 331 ? -53.782 53.138 10.843  1.00 28.99  ? 331 GLN A NE2 1 
ATOM   2673 N  N   . THR A 1 332 ? -53.718 47.404 7.204   1.00 7.11   ? 332 THR A N   1 
ATOM   2674 C  CA  . THR A 1 332 ? -53.645 46.534 6.079   1.00 7.67   ? 332 THR A CA  1 
ATOM   2675 C  C   . THR A 1 332 ? -54.421 45.270 6.410   1.00 6.17   ? 332 THR A C   1 
ATOM   2676 O  O   . THR A 1 332 ? -55.241 44.797 5.581   1.00 7.04   ? 332 THR A O   1 
ATOM   2677 C  CB  . THR A 1 332 ? -52.183 46.145 5.673   1.00 9.18   ? 332 THR A CB  1 
ATOM   2678 O  OG1 . THR A 1 332 ? -51.522 47.349 5.308   1.00 11.88  ? 332 THR A OG1 1 
ATOM   2679 C  CG2 . THR A 1 332 ? -52.148 45.109 4.538   1.00 10.60  ? 332 THR A CG2 1 
ATOM   2680 N  N   . ALA A 1 333 ? -54.185 44.652 7.552   1.00 5.72   ? 333 ALA A N   1 
ATOM   2681 C  CA  . ALA A 1 333 ? -54.896 43.433 7.896   1.00 5.59   ? 333 ALA A CA  1 
ATOM   2682 C  C   . ALA A 1 333 ? -56.398 43.684 7.939   1.00 5.37   ? 333 ALA A C   1 
ATOM   2683 O  O   . ALA A 1 333 ? -57.171 42.829 7.483   1.00 5.60   ? 333 ALA A O   1 
ATOM   2684 C  CB  . ALA A 1 333 ? -54.387 42.883 9.240   1.00 6.95   ? 333 ALA A CB  1 
ATOM   2685 N  N   . ALA A 1 334 ? -56.847 44.811 8.474   1.00 4.86   ? 334 ALA A N   1 
ATOM   2686 C  CA  . ALA A 1 334 ? -58.265 45.095 8.557   1.00 4.92   ? 334 ALA A CA  1 
ATOM   2687 C  C   . ALA A 1 334 ? -58.878 45.200 7.167   1.00 5.10   ? 334 ALA A C   1 
ATOM   2688 O  O   . ALA A 1 334 ? -60.019 44.728 6.946   1.00 5.66   ? 334 ALA A O   1 
ATOM   2689 C  CB  . ALA A 1 334 ? -58.505 46.380 9.354   1.00 6.62   ? 334 ALA A CB  1 
ATOM   2690 N  N   . GLN A 1 335 ? -58.186 45.811 6.227   1.00 5.24   ? 335 GLN A N   1 
ATOM   2691 C  CA  . GLN A 1 335 ? -58.676 45.951 4.865   1.00 5.00   ? 335 GLN A CA  1 
ATOM   2692 C  C   . GLN A 1 335 ? -58.687 44.652 4.155   1.00 5.04   ? 335 GLN A C   1 
ATOM   2693 O  O   . GLN A 1 335 ? -59.647 44.325 3.426   1.00 5.95   ? 335 GLN A O   1 
ATOM   2694 C  CB  . GLN A 1 335 ? -57.793 46.944 4.161   1.00 7.70   ? 335 GLN A CB  1 
ATOM   2695 C  CG  . GLN A 1 335 ? -57.934 48.358 4.625   1.00 14.25  ? 335 GLN A CG  1 
ATOM   2696 C  CD  . GLN A 1 335 ? -56.822 49.321 4.214   1.00 29.73  ? 335 GLN A CD  1 
ATOM   2697 O  OE1 . GLN A 1 335 ? -55.763 48.922 3.669   1.00 32.84  ? 335 GLN A OE1 1 
ATOM   2698 N  NE2 . GLN A 1 335 ? -56.987 50.582 4.642   1.00 32.14  ? 335 GLN A NE2 1 
ATOM   2699 N  N   . ILE A 1 336 ? -57.644 43.830 4.284   1.00 4.85   ? 336 ILE A N   1 
ATOM   2700 C  CA  . ILE A 1 336 ? -57.623 42.519 3.689   1.00 4.86   ? 336 ILE A CA  1 
ATOM   2701 C  C   . ILE A 1 336 ? -58.708 41.634 4.259   1.00 4.59   ? 336 ILE A C   1 
ATOM   2702 O  O   . ILE A 1 336 ? -59.346 40.854 3.508   1.00 5.48   ? 336 ILE A O   1 
ATOM   2703 C  CB  . ILE A 1 336 ? -56.226 41.857 3.820   1.00 6.10   ? 336 ILE A CB  1 
ATOM   2704 C  CG1 . ILE A 1 336 ? -55.165 42.660 3.063   1.00 6.86   ? 336 ILE A CG1 1 
ATOM   2705 C  CG2 . ILE A 1 336 ? -56.235 40.385 3.425   1.00 6.73   ? 336 ILE A CG2 1 
ATOM   2706 C  CD1 . ILE A 1 336 ? -55.412 42.752 1.537   1.00 9.05   ? 336 ILE A CD1 1 
ATOM   2707 N  N   . ALA A 1 337 ? -58.950 41.716 5.556   1.00 4.87   ? 337 ALA A N   1 
ATOM   2708 C  CA  . ALA A 1 337 ? -60.032 40.950 6.159   1.00 4.87   ? 337 ALA A CA  1 
ATOM   2709 C  C   . ALA A 1 337 ? -61.351 41.314 5.485   1.00 5.26   ? 337 ALA A C   1 
ATOM   2710 O  O   . ALA A 1 337 ? -62.153 40.390 5.177   1.00 5.91   ? 337 ALA A O   1 
ATOM   2711 C  CB  . ALA A 1 337 ? -60.095 41.212 7.670   1.00 6.01   ? 337 ALA A CB  1 
ATOM   2712 N  N   . ASP A 1 338 ? -61.631 42.579 5.237   1.00 4.90   ? 338 ASP A N   1 
ATOM   2713 C  CA  . ASP A 1 338 ? -62.894 42.967 4.624   1.00 5.01   ? 338 ASP A CA  1 
ATOM   2714 C  C   . ASP A 1 338 ? -62.953 42.446 3.188   1.00 5.32   ? 338 ASP A C   1 
ATOM   2715 O  O   . ASP A 1 338 ? -64.003 41.918 2.761   1.00 6.44   ? 338 ASP A O   1 
ATOM   2716 C  CB  . ASP A 1 338 ? -63.023 44.483 4.659   1.00 5.86   ? 338 ASP A CB  1 
ATOM   2717 C  CG  . ASP A 1 338 ? -64.416 44.896 4.310   1.00 8.48   ? 338 ASP A CG  1 
ATOM   2718 O  OD1 . ASP A 1 338 ? -65.363 44.626 5.085   1.00 10.74  ? 338 ASP A OD1 1 
ATOM   2719 O  OD2 . ASP A 1 338 ? -64.643 45.425 3.242   1.00 9.32   ? 338 ASP A OD2 1 
ATOM   2720 N  N   . TYR A 1 339 ? -61.883 42.586 2.426   1.00 4.90   ? 339 TYR A N   1 
ATOM   2721 C  CA  . TYR A 1 339 ? -61.845 42.092 1.047   1.00 4.15   ? 339 TYR A CA  1 
ATOM   2722 C  C   . TYR A 1 339 ? -62.153 40.597 1.004   1.00 5.01   ? 339 TYR A C   1 
ATOM   2723 O  O   . TYR A 1 339 ? -63.002 40.136 0.208   1.00 5.32   ? 339 TYR A O   1 
ATOM   2724 C  CB  . TYR A 1 339 ? -60.473 42.375 0.419   1.00 5.23   ? 339 TYR A CB  1 
ATOM   2725 C  CG  . TYR A 1 339 ? -60.194 41.481 -0.767  1.00 4.82   ? 339 TYR A CG  1 
ATOM   2726 C  CD1 . TYR A 1 339 ? -60.716 41.729 -2.022  1.00 5.37   ? 339 TYR A CD1 1 
ATOM   2727 C  CD2 . TYR A 1 339 ? -59.421 40.336 -0.622  1.00 5.64   ? 339 TYR A CD2 1 
ATOM   2728 C  CE1 . TYR A 1 339 ? -60.513 40.851 -3.078  1.00 5.52   ? 339 TYR A CE1 1 
ATOM   2729 C  CE2 . TYR A 1 339 ? -59.223 39.464 -1.653  1.00 5.50   ? 339 TYR A CE2 1 
ATOM   2730 C  CZ  . TYR A 1 339 ? -59.778 39.698 -2.881  1.00 5.26   ? 339 TYR A CZ  1 
ATOM   2731 O  OH  . TYR A 1 339 ? -59.571 38.807 -3.902  1.00 6.32   ? 339 TYR A OH  1 
ATOM   2732 N  N   . ILE A 1 340 ? -61.442 39.800 1.792   1.00 4.79   ? 340 ILE A N   1 
ATOM   2733 C  CA  . ILE A 1 340 ? -61.520 38.357 1.615   1.00 4.58   ? 340 ILE A CA  1 
ATOM   2734 C  C   . ILE A 1 340 ? -62.852 37.852 2.078   1.00 4.71   ? 340 ILE A C   1 
ATOM   2735 O  O   . ILE A 1 340 ? -63.369 36.842 1.552   1.00 5.38   ? 340 ILE A O   1 
ATOM   2736 C  CB  . ILE A 1 340 ? -60.314 37.630 2.219   1.00 5.04   ? 340 ILE A CB  1 
ATOM   2737 C  CG1 . ILE A 1 340 ? -60.102 36.242 1.581   1.00 6.24   ? 340 ILE A CG1 1 
ATOM   2738 C  CG2 . ILE A 1 340 ? -60.388 37.558 3.747   1.00 5.80   ? 340 ILE A CG2 1 
ATOM   2739 C  CD1 . ILE A 1 340 ? -58.832 35.494 1.994   1.00 7.17   ? 340 ILE A CD1 1 
ATOM   2740 N  N   . ARG A 1 341 ? -63.446 38.485 3.086   1.00 4.64   ? 341 ARG A N   1 
ATOM   2741 C  CA  . ARG A 1 341 ? -64.729 38.058 3.593   1.00 4.86   ? 341 ARG A CA  1 
ATOM   2742 C  C   . ARG A 1 341 ? -65.837 38.134 2.572   1.00 4.73   ? 341 ARG A C   1 
ATOM   2743 O  O   . ARG A 1 341 ? -66.830 37.378 2.692   1.00 5.69   ? 341 ARG A O   1 
ATOM   2744 C  CB  . ARG A 1 341 ? -65.100 38.835 4.857   1.00 4.96   ? 341 ARG A CB  1 
ATOM   2745 C  CG  . ARG A 1 341 ? -64.374 38.398 6.116   1.00 5.72   ? 341 ARG A CG  1 
ATOM   2746 C  CD  . ARG A 1 341 ? -65.145 37.373 6.896   1.00 6.34   ? 341 ARG A CD  1 
ATOM   2747 N  NE  . ARG A 1 341 ? -65.608 36.244 6.103   1.00 6.10   ? 341 ARG A NE  1 
ATOM   2748 C  CZ  . ARG A 1 341 ? -66.890 35.995 5.751   1.00 5.91   ? 341 ARG A CZ  1 
ATOM   2749 N  NH1 . ARG A 1 341 ? -67.867 36.843 6.029   1.00 5.98   ? 341 ARG A NH1 1 
ATOM   2750 N  NH2 . ARG A 1 341 ? -67.129 34.868 5.073   1.00 7.03   ? 341 ARG A NH2 1 
ATOM   2751 N  N   . ARG A 1 342 ? -65.705 38.967 1.556   1.00 5.24   ? 342 ARG A N   1 
ATOM   2752 C  CA  . ARG A 1 342 ? -66.721 39.028 0.534   1.00 5.31   ? 342 ARG A CA  1 
ATOM   2753 C  C   . ARG A 1 342 ? -66.766 37.767 -0.295  1.00 6.03   ? 342 ARG A C   1 
ATOM   2754 O  O   . ARG A 1 342 ? -67.716 37.559 -1.074  1.00 7.46   ? 342 ARG A O   1 
ATOM   2755 C  CB  . ARG A 1 342 ? -66.492 40.274 -0.345  1.00 6.68   ? 342 ARG A CB  1 
ATOM   2756 C  CG  . ARG A 1 342 ? -66.677 41.546 0.447   1.00 7.65   ? 342 ARG A CG  1 
ATOM   2757 C  CD  . ARG A 1 342 ? -66.355 42.840 -0.281  1.00 9.64   ? 342 ARG A CD  1 
ATOM   2758 N  NE  . ARG A 1 342 ? -67.238 43.094 -1.353  1.00 10.53  ? 342 ARG A NE  1 
ATOM   2759 C  CZ  . ARG A 1 342 ? -67.184 44.207 -2.082  1.00 10.94  ? 342 ARG A CZ  1 
ATOM   2760 N  NH1 . ARG A 1 342 ? -66.266 45.119 -1.903  1.00 11.09  ? 342 ARG A NH1 1 
ATOM   2761 N  NH2 . ARG A 1 342 ? -68.085 44.397 -3.028  1.00 14.13  ? 342 ARG A NH2 1 
ATOM   2762 N  N   . MET A 1 343 ? -65.811 36.858 -0.160  1.00 5.73   ? 343 MET A N   1 
ATOM   2763 C  CA  . MET A 1 343 ? -65.862 35.569 -0.797  1.00 6.36   ? 343 MET A CA  1 
ATOM   2764 C  C   . MET A 1 343 ? -66.801 34.581 -0.140  1.00 6.16   ? 343 MET A C   1 
ATOM   2765 O  O   . MET A 1 343 ? -67.112 33.553 -0.768  1.00 7.95   ? 343 MET A O   1 
ATOM   2766 C  CB  . MET A 1 343 ? -64.432 34.887 -0.803  1.00 7.30   ? 343 MET A CB  1 
ATOM   2767 C  CG  . MET A 1 343 ? -63.467 35.672 -1.642  1.00 8.04   ? 343 MET A CG  1 
ATOM   2768 S  SD  . MET A 1 343 ? -62.008 34.709 -2.075  1.00 7.61   ? 343 MET A SD  1 
ATOM   2769 C  CE  . MET A 1 343 ? -62.787 33.279 -2.956  1.00 9.21   ? 343 MET A CE  1 
ATOM   2770 N  N   . GLY A 1 344 ? -67.162 34.792 1.089   1.00 5.87   ? 344 GLY A N   1 
ATOM   2771 C  CA  . GLY A 1 344 ? -68.084 33.856 1.735   1.00 7.85   ? 344 GLY A CA  1 
ATOM   2772 C  C   . GLY A 1 344 ? -67.586 32.493 1.774   1.00 8.85   ? 344 GLY A C   1 
ATOM   2773 O  O   . GLY A 1 344 ? -66.479 32.209 2.113   1.00 13.47  ? 344 GLY A O   1 
ATOM   2774 N  N   . PRO A 1 345 ? -68.373 31.495 1.391   1.00 9.39   ? 345 PRO A N   1 
ATOM   2775 C  CA  . PRO A 1 345 ? -68.064 30.111 1.518   1.00 12.09  ? 345 PRO A CA  1 
ATOM   2776 C  C   . PRO A 1 345 ? -67.162 29.401 0.545   1.00 7.55   ? 345 PRO A C   1 
ATOM   2777 O  O   . PRO A 1 345 ? -67.192 28.207 0.443   1.00 8.80   ? 345 PRO A O   1 
ATOM   2778 C  CB  . PRO A 1 345 ? -69.695 29.614 1.434   1.00 13.05  ? 345 PRO A CB  1 
ATOM   2779 C  CG  . PRO A 1 345 ? -70.224 30.436 0.353   1.00 19.33  ? 345 PRO A CG  1 
ATOM   2780 C  CD  . PRO A 1 345 ? -69.765 31.716 0.872   1.00 14.05  ? 345 PRO A CD  1 
ATOM   2781 N  N   . PHE A 1 346 ? -66.428 30.177 -0.237  1.00 10.06  ? 346 PHE A N   1 
ATOM   2782 C  CA  . PHE A 1 346 ? -65.612 29.636 -1.350  1.00 8.09   ? 346 PHE A CA  1 
ATOM   2783 C  C   . PHE A 1 346 ? -64.146 29.529 -1.067  1.00 7.18   ? 346 PHE A C   1 
ATOM   2784 O  O   . PHE A 1 346 ? -63.549 30.515 -0.524  1.00 7.70   ? 346 PHE A O   1 
ATOM   2785 C  CB  . PHE A 1 346 ? -65.828 30.507 -2.623  1.00 7.45   ? 346 PHE A CB  1 
ATOM   2786 C  CG  . PHE A 1 346 ? -67.195 30.342 -3.192  1.00 7.06   ? 346 PHE A CG  1 
ATOM   2787 C  CD1 . PHE A 1 346 ? -67.445 29.365 -4.175  1.00 6.87   ? 346 PHE A CD1 1 
ATOM   2788 C  CD2 . PHE A 1 346 ? -68.275 31.143 -2.809  1.00 9.56   ? 346 PHE A CD2 1 
ATOM   2789 C  CE1 . PHE A 1 346 ? -68.730 29.217 -4.679  1.00 7.34   ? 346 PHE A CE1 1 
ATOM   2790 C  CE2 . PHE A 1 346 ? -69.540 30.961 -3.328  1.00 9.73   ? 346 PHE A CE2 1 
ATOM   2791 C  CZ  . PHE A 1 346 ? -69.762 29.997 -4.260  1.00 7.59   ? 346 PHE A CZ  1 
ATOM   2792 N  N   . GLN A 1 347 ? -63.467 28.458 -1.452  1.00 7.65   ? 347 GLN A N   1 
ATOM   2793 C  CA  . GLN A 1 347 ? -62.033 28.407 -1.444  1.00 7.78   ? 347 GLN A CA  1 
ATOM   2794 C  C   . GLN A 1 347 ? -61.541 29.524 -2.367  1.00 7.83   ? 347 GLN A C   1 
ATOM   2795 O  O   . GLN A 1 347 ? -62.161 29.778 -3.411  1.00 8.58   ? 347 GLN A O   1 
ATOM   2796 C  CB  . GLN A 1 347 ? -61.499 27.106 -2.036  1.00 9.39   ? 347 GLN A CB  1 
ATOM   2797 C  CG  . GLN A 1 347 ? -61.579 25.870 -1.133  1.00 11.26  ? 347 GLN A CG  1 
ATOM   2798 C  CD  . GLN A 1 347 ? -60.842 24.689 -1.678  1.00 10.51  ? 347 GLN A CD  1 
ATOM   2799 O  OE1 . GLN A 1 347 ? -61.512 23.851 -2.187  1.00 15.38  ? 347 GLN A OE1 1 
ATOM   2800 N  NE2 . GLN A 1 347 ? -59.491 24.605 -1.685  1.00 12.12  ? 347 GLN A NE2 1 
ATOM   2801 N  N   . PRO A 1 348 ? -60.377 30.136 -2.055  1.00 6.85   ? 348 PRO A N   1 
ATOM   2802 C  CA  . PRO A 1 348 ? -59.461 29.800 -0.962  1.00 7.24   ? 348 PRO A CA  1 
ATOM   2803 C  C   . PRO A 1 348 ? -59.732 30.562 0.324   1.00 7.02   ? 348 PRO A C   1 
ATOM   2804 O  O   . PRO A 1 348 ? -58.969 30.396 1.306   1.00 8.62   ? 348 PRO A O   1 
ATOM   2805 C  CB  . PRO A 1 348 ? -58.096 30.189 -1.507  1.00 8.23   ? 348 PRO A CB  1 
ATOM   2806 C  CG  . PRO A 1 348 ? -58.443 31.332 -2.431  1.00 9.73   ? 348 PRO A CG  1 
ATOM   2807 C  CD  . PRO A 1 348 ? -59.726 30.995 -3.063  1.00 8.18   ? 348 PRO A CD  1 
ATOM   2808 N  N   . HIS A 1 349 ? -60.821 31.363 0.428   1.00 6.21   ? 349 HIS A N   1 
ATOM   2809 C  CA  . HIS A 1 349 ? -61.185 31.891 1.738   1.00 5.64   ? 349 HIS A CA  1 
ATOM   2810 C  C   . HIS A 1 349 ? -61.649 30.800 2.665   1.00 5.99   ? 349 HIS A C   1 
ATOM   2811 O  O   . HIS A 1 349 ? -61.233 30.751 3.829   1.00 7.31   ? 349 HIS A O   1 
ATOM   2812 C  CB  . HIS A 1 349 ? -62.233 33.007 1.601   1.00 6.11   ? 349 HIS A CB  1 
ATOM   2813 C  CG  . HIS A 1 349 ? -62.688 33.555 2.928   1.00 5.78   ? 349 HIS A CG  1 
ATOM   2814 N  ND1 . HIS A 1 349 ? -61.829 33.909 3.969   1.00 5.63   ? 349 HIS A ND1 1 
ATOM   2815 C  CD2 . HIS A 1 349 ? -63.910 33.827 3.406   1.00 6.17   ? 349 HIS A CD2 1 
ATOM   2816 C  CE1 . HIS A 1 349 ? -62.564 34.352 4.977   1.00 5.88   ? 349 HIS A CE1 1 
ATOM   2817 N  NE2 . HIS A 1 349 ? -63.866 34.320 4.680   1.00 6.42   ? 349 HIS A NE2 1 
ATOM   2818 N  N   . ARG A 1 350 ? -62.528 29.936 2.214   1.00 6.73   ? 350 ARG A N   1 
ATOM   2819 C  CA  . ARG A 1 350 ? -62.798 28.698 2.937   1.00 6.13   ? 350 ARG A CA  1 
ATOM   2820 C  C   . ARG A 1 350 ? -61.623 27.763 2.646   1.00 7.20   ? 350 ARG A C   1 
ATOM   2821 O  O   . ARG A 1 350 ? -61.069 27.751 1.554   1.00 8.30   ? 350 ARG A O   1 
ATOM   2822 C  CB  . ARG A 1 350 ? -64.094 28.105 2.433   1.00 7.34   ? 350 ARG A CB  1 
ATOM   2823 C  CG  . ARG A 1 350 ? -64.704 27.067 3.326   1.00 6.92   ? 350 ARG A CG  1 
ATOM   2824 C  CD  . ARG A 1 350 ? -65.341 25.942 2.567   1.00 7.63   ? 350 ARG A CD  1 
ATOM   2825 N  NE  . ARG A 1 350 ? -64.363 25.128 1.941   1.00 8.02   ? 350 ARG A NE  1 
ATOM   2826 C  CZ  . ARG A 1 350 ? -64.589 24.169 1.019   1.00 7.74   ? 350 ARG A CZ  1 
ATOM   2827 N  NH1 . ARG A 1 350 ? -63.583 23.412 0.636   1.00 9.05   ? 350 ARG A NH1 1 
ATOM   2828 N  NH2 . ARG A 1 350 ? -65.818 23.972 0.529   1.00 8.61   ? 350 ARG A NH2 1 
ATOM   2829 N  N   . LEU A 1 351 ? -61.257 26.923 3.644   1.00 6.97   ? 351 LEU A N   1 
ATOM   2830 C  CA  . LEU A 1 351 ? -60.124 26.053 3.477   1.00 8.12   ? 351 LEU A CA  1 
ATOM   2831 C  C   . LEU A 1 351 ? -60.411 24.813 2.622   1.00 8.40   ? 351 LEU A C   1 
ATOM   2832 O  O   . LEU A 1 351 ? -61.569 24.476 2.380   1.00 7.94   ? 351 LEU A O   1 
ATOM   2833 C  CB  . LEU A 1 351 ? -59.668 25.614 4.851   1.00 9.21   ? 351 LEU A CB  1 
ATOM   2834 C  CG  . LEU A 1 351 ? -59.010 26.730 5.718   1.00 10.83  ? 351 LEU A CG  1 
ATOM   2835 C  CD1 . LEU A 1 351 ? -58.576 26.087 7.071   1.00 13.16  ? 351 LEU A CD1 1 
ATOM   2836 C  CD2 . LEU A 1 351 ? -57.944 27.499 5.033   1.00 13.66  ? 351 LEU A CD2 1 
ATOM   2837 N  N   . PRO A 1 352 ? -59.344 24.154 2.176   1.00 10.13  ? 352 PRO A N   1 
ATOM   2838 C  CA  . PRO A 1 352 ? -59.530 22.905 1.451   1.00 11.48  ? 352 PRO A CA  1 
ATOM   2839 C  C   . PRO A 1 352 ? -60.271 21.917 2.306   1.00 10.87  ? 352 PRO A C   1 
ATOM   2840 O  O   . PRO A 1 352 ? -60.230 21.956 3.537   1.00 11.36  ? 352 PRO A O   1 
ATOM   2841 C  CB  . PRO A 1 352 ? -58.056 22.481 1.164   1.00 13.45  ? 352 PRO A CB  1 
ATOM   2842 C  CG  . PRO A 1 352 ? -57.252 23.690 1.316   1.00 13.59  ? 352 PRO A CG  1 
ATOM   2843 C  CD  . PRO A 1 352 ? -57.925 24.506 2.330   1.00 11.43  ? 352 PRO A CD  1 
ATOM   2844 N  N   . PRO A 1 353 ? -61.008 21.006 1.709   1.00 12.93  ? 353 PRO A N   1 
ATOM   2845 C  CA  . PRO A 1 353 ? -61.953 20.230 2.457   1.00 15.76  ? 353 PRO A CA  1 
ATOM   2846 C  C   . PRO A 1 353 ? -61.362 19.395 3.603   1.00 18.04  ? 353 PRO A C   1 
ATOM   2847 O  O   . PRO A 1 353 ? -61.991 19.323 4.660   1.00 21.23  ? 353 PRO A O   1 
ATOM   2848 C  CB  . PRO A 1 353 ? -62.643 19.315 1.420   1.00 19.57  ? 353 PRO A CB  1 
ATOM   2849 C  CG  . PRO A 1 353 ? -62.089 19.598 0.226   1.00 19.17  ? 353 PRO A CG  1 
ATOM   2850 C  CD  . PRO A 1 353 ? -61.122 20.773 0.283   1.00 13.14  ? 353 PRO A CD  1 
ATOM   2851 N  N   . GLU A 1 354 ? -60.147 18.882 3.399   1.00 18.13  ? 354 GLU A N   1 
ATOM   2852 C  CA  . GLU A 1 354 ? -59.469 18.067 4.365   1.00 22.91  ? 354 GLU A CA  1 
ATOM   2853 C  C   . GLU A 1 354 ? -58.911 18.879 5.514   1.00 19.64  ? 354 GLU A C   1 
ATOM   2854 O  O   . GLU A 1 354 ? -58.654 18.327 6.608   1.00 24.71  ? 354 GLU A O   1 
ATOM   2855 C  CB  . GLU A 1 354 ? -58.301 17.307 3.689   1.00 27.98  ? 354 GLU A CB  1 
ATOM   2856 C  CG  . GLU A 1 354 ? -56.912 18.261 3.146   1.00 31.37  ? 354 GLU A CG  1 
ATOM   2857 C  CD  . GLU A 1 354 ? -57.043 19.133 1.745   1.00 35.45  ? 354 GLU A CD  1 
ATOM   2858 O  OE1 . GLU A 1 354 ? -58.306 19.020 1.177   1.00 23.87  ? 354 GLU A OE1 1 
ATOM   2859 O  OE2 . GLU A 1 354 ? -55.854 19.903 1.329   1.00 33.26  ? 354 GLU A OE2 1 
ATOM   2860 N  N   . GLU A 1 355 ? -58.793 20.197 5.349   1.00 16.05  ? 355 GLU A N   1 
ATOM   2861 C  CA  . GLU A 1 355 ? -58.270 21.178 6.311   1.00 16.77  ? 355 GLU A CA  1 
ATOM   2862 C  C   . GLU A 1 355 ? -59.305 21.860 7.134   1.00 16.24  ? 355 GLU A C   1 
ATOM   2863 O  O   . GLU A 1 355 ? -58.994 22.553 8.125   1.00 21.74  ? 355 GLU A O   1 
ATOM   2864 C  CB  . GLU A 1 355 ? -57.268 22.164 5.633   1.00 19.04  ? 355 GLU A CB  1 
ATOM   2865 C  CG  . GLU A 1 355 ? -56.103 21.421 4.763   1.00 22.72  ? 355 GLU A CG  1 
ATOM   2866 C  CD  . GLU A 1 355 ? -54.840 22.272 4.105   1.00 29.30  ? 355 GLU A CD  1 
ATOM   2867 O  OE1 . GLU A 1 355 ? -54.212 22.873 5.075   1.00 29.68  ? 355 GLU A OE1 1 
ATOM   2868 O  OE2 . GLU A 1 355 ? -54.416 22.268 2.740   1.00 22.02  ? 355 GLU A OE2 1 
ATOM   2869 N  N   . MET A 1 356 ? -60.585 21.668 6.821   1.00 14.87  ? 356 MET A N   1 
ATOM   2870 C  CA  A MET A 1 356 ? -61.721 22.277 7.548   0.50 14.73  ? 356 MET A CA  1 
ATOM   2871 C  CA  B MET A 1 356 ? -61.729 22.306 7.539   0.50 13.24  ? 356 MET A CA  1 
ATOM   2872 C  C   . MET A 1 356 ? -61.991 21.607 8.878   1.00 13.69  ? 356 MET A C   1 
ATOM   2873 O  O   . MET A 1 356 ? -62.137 20.392 8.901   1.00 16.73  ? 356 MET A O   1 
ATOM   2874 C  CB  A MET A 1 356 ? -62.978 22.165 6.712   0.50 16.24  ? 356 MET A CB  1 
ATOM   2875 C  CB  B MET A 1 356 ? -63.030 22.292 6.701   0.50 13.49  ? 356 MET A CB  1 
ATOM   2876 C  CG  A MET A 1 356 ? -62.858 22.907 5.398   0.50 18.47  ? 356 MET A CG  1 
ATOM   2877 C  CG  B MET A 1 356 ? -63.204 23.399 5.530   0.50 8.99   ? 356 MET A CG  1 
ATOM   2878 S  SD  A MET A 1 356 ? -64.411 23.789 5.202   0.50 31.20  ? 356 MET A SD  1 
ATOM   2879 S  SD  B MET A 1 356 ? -64.231 22.625 4.258   0.50 8.20   ? 356 MET A SD  1 
ATOM   2880 C  CE  A MET A 1 356 ? -65.323 22.445 4.619   0.50 26.20  ? 356 MET A CE  1 
ATOM   2881 C  CE  B MET A 1 356 ? -65.746 23.128 5.227   0.50 11.49  ? 356 MET A CE  1 
ATOM   2882 N  N   . GLU A 1 357 ? -62.067 22.366 9.953   1.00 12.07  ? 357 GLU A N   1 
ATOM   2883 C  CA  . GLU A 1 357 ? -62.422 21.818 11.229  1.00 12.13  ? 357 GLU A CA  1 
ATOM   2884 C  C   . GLU A 1 357 ? -63.888 21.476 11.316  1.00 12.22  ? 357 GLU A C   1 
ATOM   2885 O  O   . GLU A 1 357 ? -64.301 20.559 12.080  1.00 15.19  ? 357 GLU A O   1 
ATOM   2886 C  CB  . GLU A 1 357 ? -61.997 22.814 12.331  1.00 12.06  ? 357 GLU A CB  1 
ATOM   2887 C  CG  . GLU A 1 357 ? -62.308 22.423 13.769  1.00 12.54  ? 357 GLU A CG  1 
ATOM   2888 C  CD  . GLU A 1 357 ? -61.781 23.386 14.794  1.00 12.57  ? 357 GLU A CD  1 
ATOM   2889 O  OE1 . GLU A 1 357 ? -61.116 24.365 14.418  1.00 17.03  ? 357 GLU A OE1 1 
ATOM   2890 O  OE2 . GLU A 1 357 ? -61.945 23.158 16.011  1.00 14.55  ? 357 GLU A OE2 1 
ATOM   2891 N  N   . TYR A 1 358 ? -64.753 22.228 10.639  1.00 11.73  ? 358 TYR A N   1 
ATOM   2892 C  CA  . TYR A 1 358 ? -66.195 21.960 10.584  1.00 12.31  ? 358 TYR A CA  1 
ATOM   2893 C  C   . TYR A 1 358 ? -66.493 21.593 9.145   1.00 12.42  ? 358 TYR A C   1 
ATOM   2894 O  O   . TYR A 1 358 ? -66.083 22.294 8.204   1.00 13.32  ? 358 TYR A O   1 
ATOM   2895 C  CB  . TYR A 1 358 ? -67.024 23.193 10.944  1.00 12.75  ? 358 TYR A CB  1 
ATOM   2896 C  CG  . TYR A 1 358 ? -67.082 23.564 12.412  1.00 11.51  ? 358 TYR A CG  1 
ATOM   2897 C  CD1 . TYR A 1 358 ? -65.921 23.985 13.080  1.00 11.37  ? 358 TYR A CD1 1 
ATOM   2898 C  CD2 . TYR A 1 358 ? -68.262 23.671 13.116  1.00 12.66  ? 358 TYR A CD2 1 
ATOM   2899 C  CE1 . TYR A 1 358 ? -65.924 24.436 14.422  1.00 12.71  ? 358 TYR A CE1 1 
ATOM   2900 C  CE2 . TYR A 1 358 ? -68.235 24.040 14.469  1.00 12.22  ? 358 TYR A CE2 1 
ATOM   2901 C  CZ  . TYR A 1 358 ? -67.079 24.484 15.082  1.00 11.86  ? 358 TYR A CZ  1 
ATOM   2902 O  OH  . TYR A 1 358 ? -67.077 25.033 16.350  1.00 12.52  ? 358 TYR A OH  1 
ATOM   2903 N  N   . THR A 1 359 ? -67.351 20.606 8.934   1.00 12.74  ? 359 THR A N   1 
ATOM   2904 C  CA  . THR A 1 359 ? -67.924 20.310 7.622   1.00 12.14  ? 359 THR A CA  1 
ATOM   2905 C  C   . THR A 1 359 ? -69.291 19.667 7.736   1.00 12.57  ? 359 THR A C   1 
ATOM   2906 O  O   . THR A 1 359 ? -69.612 19.006 8.712   1.00 13.75  ? 359 THR A O   1 
ATOM   2907 C  CB  . THR A 1 359 ? -67.019 19.371 6.847   1.00 12.98  ? 359 THR A CB  1 
ATOM   2908 O  OG1 . THR A 1 359 ? -67.554 19.271 5.510   1.00 14.90  ? 359 THR A OG1 1 
ATOM   2909 C  CG2 . THR A 1 359 ? -66.873 17.992 7.469   1.00 18.05  ? 359 THR A CG2 1 
ATOM   2910 N  N   . ALA A 1 360 ? -70.140 19.950 6.751   1.00 12.68  ? 360 ALA A N   1 
ATOM   2911 C  CA  . ALA A 1 360 ? -71.424 19.353 6.631   1.00 13.28  ? 360 ALA A CA  1 
ATOM   2912 C  C   . ALA A 1 360 ? -71.414 18.429 5.364   1.00 13.91  ? 360 ALA A C   1 
ATOM   2913 O  O   . ALA A 1 360 ? -72.519 18.003 4.980   1.00 16.44  ? 360 ALA A O   1 
ATOM   2914 C  CB  . ALA A 1 360 ? -72.582 20.397 6.583   1.00 15.37  ? 360 ALA A CB  1 
ATOM   2915 N  N   . LEU A 1 361 ? -70.282 18.129 4.782   1.00 13.37  ? 361 LEU A N   1 
ATOM   2916 C  CA  . LEU A 1 361 ? -70.256 17.409 3.521   1.00 16.61  ? 361 LEU A CA  1 
ATOM   2917 C  C   . LEU A 1 361 ? -70.893 16.045 3.721   1.00 18.29  ? 361 LEU A C   1 
ATOM   2918 O  O   . LEU A 1 361 ? -71.632 15.631 2.835   1.00 18.76  ? 361 LEU A O   1 
ATOM   2919 C  CB  . LEU A 1 361 ? -68.846 17.301 2.942   1.00 17.41  ? 361 LEU A CB  1 
ATOM   2920 C  CG  . LEU A 1 361 ? -68.638 16.650 1.548   1.00 18.02  ? 361 LEU A CG  1 
ATOM   2921 C  CD1 . LEU A 1 361 ? -69.465 17.401 0.403   1.00 18.52  ? 361 LEU A CD1 1 
ATOM   2922 C  CD2 . LEU A 1 361 ? -67.145 16.576 1.234   1.00 20.89  ? 361 LEU A CD2 1 
ATOM   2923 N  N   . PRO A 1 362 ? -70.615 15.252 4.802   1.00 18.15  ? 362 PRO A N   1 
ATOM   2924 C  CA  . PRO A 1 362 ? -71.335 14.006 4.890   1.00 19.63  ? 362 PRO A CA  1 
ATOM   2925 C  C   . PRO A 1 362 ? -72.842 14.120 4.921   1.00 20.76  ? 362 PRO A C   1 
ATOM   2926 O  O   . PRO A 1 362 ? -73.549 13.303 4.283   1.00 21.86  ? 362 PRO A O   1 
ATOM   2927 C  CB  . PRO A 1 362 ? -70.819 13.422 6.227   1.00 21.98  ? 362 PRO A CB  1 
ATOM   2928 C  CG  . PRO A 1 362 ? -69.467 14.082 6.442   1.00 20.95  ? 362 PRO A CG  1 
ATOM   2929 C  CD  . PRO A 1 362 ? -69.710 15.402 5.917   1.00 17.60  ? 362 PRO A CD  1 
ATOM   2930 N  N   . LYS A 1 363 ? -73.380 15.058 5.675   1.00 20.19  ? 363 LYS A N   1 
ATOM   2931 C  CA  . LYS A 1 363 ? -74.829 15.357 5.671   1.00 20.16  ? 363 LYS A CA  1 
ATOM   2932 C  C   . LYS A 1 363 ? -75.369 15.681 4.265   1.00 20.45  ? 363 LYS A C   1 
ATOM   2933 O  O   . LYS A 1 363 ? -76.421 15.198 3.852   1.00 21.87  ? 363 LYS A O   1 
ATOM   2934 C  CB  . LYS A 1 363 ? -75.176 16.487 6.690   1.00 21.59  ? 363 LYS A CB  1 
ATOM   2935 C  CG  . LYS A 1 363 ? -76.659 16.903 6.739   1.00 23.46  ? 363 LYS A CG  1 
ATOM   2936 C  CD  . LYS A 1 363 ? -77.075 17.829 7.875   1.00 29.92  ? 363 LYS A CD  1 
ATOM   2937 C  CE  . LYS A 1 363 ? -78.260 17.457 8.640   1.00 36.90  ? 363 LYS A CE  1 
ATOM   2938 N  NZ  . LYS A 1 363 ? -78.395 18.464 9.774   1.00 34.94  ? 363 LYS A NZ  1 
ATOM   2939 N  N   . ILE A 1 364 ? -74.656 16.463 3.553   1.00 17.68  ? 364 ILE A N   1 
ATOM   2940 C  CA  . ILE A 1 364 ? -74.989 16.823 2.167   1.00 18.93  ? 364 ILE A CA  1 
ATOM   2941 C  C   . ILE A 1 364 ? -75.009 15.591 1.261   1.00 19.01  ? 364 ILE A C   1 
ATOM   2942 O  O   . ILE A 1 364 ? -76.012 15.383 0.541   1.00 22.39  ? 364 ILE A O   1 
ATOM   2943 C  CB  . ILE A 1 364 ? -74.084 17.905 1.606   1.00 17.37  ? 364 ILE A CB  1 
ATOM   2944 C  CG1 . ILE A 1 364 ? -74.223 19.258 2.381   1.00 18.45  ? 364 ILE A CG1 1 
ATOM   2945 C  CG2 . ILE A 1 364 ? -74.397 18.138 0.081   1.00 17.02  ? 364 ILE A CG2 1 
ATOM   2946 C  CD1 . ILE A 1 364 ? -73.104 20.202 2.040   1.00 20.39  ? 364 ILE A CD1 1 
ATOM   2947 N  N   . LEU A 1 365 ? -73.926 14.834 1.203   1.00 18.16  ? 365 LEU A N   1 
ATOM   2948 C  CA  . LEU A 1 365 ? -73.834 13.651 0.393   1.00 22.45  ? 365 LEU A CA  1 
ATOM   2949 C  C   . LEU A 1 365 ? -74.818 12.589 0.806   1.00 25.07  ? 365 LEU A C   1 
ATOM   2950 O  O   . LEU A 1 365 ? -75.173 11.739 -0.041  1.00 27.10  ? 365 LEU A O   1 
ATOM   2951 C  CB  . LEU A 1 365 ? -72.394 13.160 0.308   1.00 20.81  ? 365 LEU A CB  1 
ATOM   2952 C  CG  . LEU A 1 365 ? -71.366 14.125 -0.411  1.00 20.63  ? 365 LEU A CG  1 
ATOM   2953 C  CD1 . LEU A 1 365 ? -69.958 13.580 -0.352  1.00 22.67  ? 365 LEU A CD1 1 
ATOM   2954 C  CD2 . LEU A 1 365 ? -71.800 14.481 -1.798  1.00 22.69  ? 365 LEU A CD2 1 
ATOM   2955 N  N   . ALA A 1 366 ? -75.345 12.616 2.037   1.00 24.23  ? 366 ALA A N   1 
ATOM   2956 C  CA  . ALA A 1 366 ? -76.375 11.670 2.369   1.00 27.58  ? 366 ALA A CA  1 
ATOM   2957 C  C   . ALA A 1 366 ? -77.713 12.045 1.824   1.00 28.83  ? 366 ALA A C   1 
ATOM   2958 O  O   . ALA A 1 366 ? -78.578 11.121 1.792   1.00 32.54  ? 366 ALA A O   1 
ATOM   2959 C  CB  . ALA A 1 366 ? -76.497 11.579 3.925   1.00 27.95  ? 366 ALA A CB  1 
ATOM   2960 N  N   . LYS A 1 367 ? -77.928 13.295 1.451   1.00 27.42  ? 367 LYS A N   1 
ATOM   2961 C  CA  . LYS A 1 367 ? -79.194 13.683 0.952   1.00 29.71  ? 367 LYS A CA  1 
ATOM   2962 C  C   . LYS A 1 367 ? -79.272 13.980 -0.541  1.00 29.87  ? 367 LYS A C   1 
ATOM   2963 O  O   . LYS A 1 367 ? -80.339 13.787 -1.142  1.00 33.93  ? 367 LYS A O   1 
ATOM   2964 C  CB  . LYS A 1 367 ? -79.821 14.830 1.762   1.00 34.22  ? 367 LYS A CB  1 
ATOM   2965 C  CG  . LYS A 1 367 ? -79.263 16.176 1.575   1.00 39.86  ? 367 LYS A CG  1 
ATOM   2966 C  CD  . LYS A 1 367 ? -79.968 17.387 2.333   1.00 48.49  ? 367 LYS A CD  1 
ATOM   2967 C  CE  . LYS A 1 367 ? -79.489 17.583 3.795   1.00 51.56  ? 367 LYS A CE  1 
ATOM   2968 N  NZ  . LYS A 1 367 ? -80.391 16.845 4.863   1.00 53.85  ? 367 LYS A NZ  1 
ATOM   2969 N  N   . VAL A 1 368 ? -78.226 14.465 -1.153  1.00 25.69  ? 368 VAL A N   1 
ATOM   2970 C  CA  . VAL A 1 368 ? -78.303 14.893 -2.520  1.00 26.03  ? 368 VAL A CA  1 
ATOM   2971 C  C   . VAL A 1 368 ? -78.004 13.700 -3.434  1.00 25.89  ? 368 VAL A C   1 
ATOM   2972 O  O   . VAL A 1 368 ? -77.007 13.012 -3.295  1.00 30.89  ? 368 VAL A O   1 
ATOM   2973 C  CB  . VAL A 1 368 ? -77.345 16.125 -2.812  1.00 22.11  ? 368 VAL A CB  1 
ATOM   2974 C  CG1 . VAL A 1 368 ? -77.606 16.627 -4.230  1.00 26.17  ? 368 VAL A CG1 1 
ATOM   2975 C  CG2 . VAL A 1 368 ? -77.698 17.339 -1.895  1.00 25.50  ? 368 VAL A CG2 1 
ATOM   2976 N  N   . LYS A 1 369 ? -78.950 13.491 -4.380  1.00 25.09  ? 369 LYS A N   1 
ATOM   2977 C  CA  . LYS A 1 369 ? -78.865 12.346 -5.245  1.00 25.36  ? 369 LYS A CA  1 
ATOM   2978 C  C   . LYS A 1 369 ? -77.757 12.500 -6.267  1.00 22.79  ? 369 LYS A C   1 
ATOM   2979 O  O   . LYS A 1 369 ? -77.728 13.538 -7.017  1.00 23.29  ? 369 LYS A O   1 
ATOM   2980 C  CB  . LYS A 1 369 ? -80.195 12.135 -5.929  1.00 26.03  ? 369 LYS A CB  1 
ATOM   2981 C  CG  . LYS A 1 369 ? -80.080 11.000 -7.036  1.00 32.54  ? 369 LYS A CG  1 
ATOM   2982 C  CD  . LYS A 1 369 ? -81.451 10.602 -7.535  1.00 39.47  ? 369 LYS A CD  1 
ATOM   2983 C  CE  . LYS A 1 369 ? -81.476 9.314  -8.495  1.00 46.00  ? 369 LYS A CE  1 
ATOM   2984 N  NZ  . LYS A 1 369 ? -80.613 8.139  -8.051  1.00 50.18  ? 369 LYS A NZ  1 
ATOM   2985 N  N   . PRO A 1 370 ? -76.831 11.535 -6.373  1.00 22.34  ? 370 PRO A N   1 
ATOM   2986 C  CA  . PRO A 1 370 ? -75.828 11.594 -7.438  1.00 22.49  ? 370 PRO A CA  1 
ATOM   2987 C  C   . PRO A 1 370 ? -76.284 10.890 -8.656  1.00 23.45  ? 370 PRO A C   1 
ATOM   2988 O  O   . PRO A 1 370 ? -77.117 9.892  -8.592  1.00 25.55  ? 370 PRO A O   1 
ATOM   2989 C  CB  . PRO A 1 370 ? -74.641 10.818 -6.825  1.00 26.04  ? 370 PRO A CB  1 
ATOM   2990 C  CG  . PRO A 1 370 ? -75.351 9.795  -5.909  1.00 26.66  ? 370 PRO A CG  1 
ATOM   2991 C  CD  . PRO A 1 370 ? -76.609 10.377 -5.463  1.00 23.93  ? 370 PRO A CD  1 
ATOM   2992 N  N   . TYR A 1 371 ? -75.762 11.299 -9.779  1.00 19.80  ? 371 TYR A N   1 
ATOM   2993 C  CA  . TYR A 1 371 ? -75.972 10.594 -11.019 1.00 20.72  ? 371 TYR A CA  1 
ATOM   2994 C  C   . TYR A 1 371 ? -74.612 10.309 -11.608 1.00 20.09  ? 371 TYR A C   1 
ATOM   2995 O  O   . TYR A 1 371 ? -73.780 11.187 -11.811 1.00 21.51  ? 371 TYR A O   1 
ATOM   2996 C  CB  . TYR A 1 371 ? -76.785 11.408 -12.017 1.00 20.95  ? 371 TYR A CB  1 
ATOM   2997 C  CG  . TYR A 1 371 ? -78.080 11.853 -11.493 1.00 20.25  ? 371 TYR A CG  1 
ATOM   2998 C  CD1 . TYR A 1 371 ? -79.177 11.030 -11.632 1.00 27.97  ? 371 TYR A CD1 1 
ATOM   2999 C  CD2 . TYR A 1 371 ? -78.286 13.091 -10.931 1.00 20.98  ? 371 TYR A CD2 1 
ATOM   3000 C  CE1 . TYR A 1 371 ? -80.426 11.438 -11.195 1.00 30.37  ? 371 TYR A CE1 1 
ATOM   3001 C  CE2 . TYR A 1 371 ? -79.519 13.538 -10.458 1.00 23.79  ? 371 TYR A CE2 1 
ATOM   3002 C  CZ  . TYR A 1 371 ? -80.624 12.704 -10.600 1.00 27.48  ? 371 TYR A CZ  1 
ATOM   3003 O  OH  . TYR A 1 371 ? -81.863 13.122 -10.175 1.00 33.44  ? 371 TYR A OH  1 
ATOM   3004 N  N   . PRO A 1 372 ? -74.290 9.024  -11.870 1.00 20.97  ? 372 PRO A N   1 
ATOM   3005 C  CA  . PRO A 1 372 ? -73.088 8.728  -12.666 1.00 20.75  ? 372 PRO A CA  1 
ATOM   3006 C  C   . PRO A 1 372 ? -73.066 9.580  -13.909 1.00 21.92  ? 372 PRO A C   1 
ATOM   3007 O  O   . PRO A 1 372 ? -74.114 9.669  -14.603 1.00 23.28  ? 372 PRO A O   1 
ATOM   3008 C  CB  . PRO A 1 372 ? -73.225 7.219  -12.981 1.00 23.31  ? 372 PRO A CB  1 
ATOM   3009 C  CG  . PRO A 1 372 ? -74.081 6.730  -11.891 1.00 25.80  ? 372 PRO A CG  1 
ATOM   3010 C  CD  . PRO A 1 372 ? -75.067 7.789  -11.507 1.00 24.61  ? 372 PRO A CD  1 
ATOM   3011 N  N   . ALA A 1 373 ? -71.944 10.224 -14.190 1.00 21.27  ? 373 ALA A N   1 
ATOM   3012 C  CA  . ALA A 1 373 ? -71.883 11.216 -15.251 1.00 22.05  ? 373 ALA A CA  1 
ATOM   3013 C  C   . ALA A 1 373 ? -72.191 10.742 -16.652 1.00 25.13  ? 373 ALA A C   1 
ATOM   3014 O  O   . ALA A 1 373 ? -72.825 11.420 -17.453 1.00 26.18  ? 373 ALA A O   1 
ATOM   3015 C  CB  . ALA A 1 373 ? -70.544 12.011 -15.201 1.00 24.70  ? 373 ALA A CB  1 
ATOM   3016 N  N   . ASP A 1 374 ? -71.807 9.528  -16.970 1.00 28.77  ? 374 ASP A N   1 
ATOM   3017 C  CA  . ASP A 1 374 ? -72.034 9.047  -18.343 1.00 31.76  ? 374 ASP A CA  1 
ATOM   3018 C  C   . ASP A 1 374 ? -73.531 8.761  -18.611 1.00 31.92  ? 374 ASP A C   1 
ATOM   3019 O  O   . ASP A 1 374 ? -74.150 9.222  -19.590 1.00 34.08  ? 374 ASP A O   1 
ATOM   3020 C  CB  . ASP A 1 374 ? -71.190 7.813  -18.530 1.00 34.09  ? 374 ASP A CB  1 
ATOM   3021 C  CG  . ASP A 1 374 ? -69.680 8.100  -18.631 1.00 40.25  ? 374 ASP A CG  1 
ATOM   3022 O  OD1 . ASP A 1 374 ? -69.217 9.214  -19.076 1.00 43.70  ? 374 ASP A OD1 1 
ATOM   3023 O  OD2 . ASP A 1 374 ? -68.947 7.146  -18.261 1.00 51.77  ? 374 ASP A OD2 1 
ATOM   3024 N  N   . GLN A 1 375 ? -74.186 8.211  -17.637 1.00 30.41  ? 375 GLN A N   1 
ATOM   3025 C  CA  . GLN A 1 375 ? -75.588 7.986  -17.779 1.00 31.98  ? 375 GLN A CA  1 
ATOM   3026 C  C   . GLN A 1 375 ? -76.394 9.235  -17.660 1.00 29.86  ? 375 GLN A C   1 
ATOM   3027 O  O   . GLN A 1 375 ? -77.410 9.423  -18.364 1.00 28.38  ? 375 GLN A O   1 
ATOM   3028 C  CB  . GLN A 1 375 ? -76.044 6.957  -16.767 1.00 35.58  ? 375 GLN A CB  1 
ATOM   3029 C  CG  . GLN A 1 375 ? -77.499 6.453  -16.980 1.00 39.57  ? 375 GLN A CG  1 
ATOM   3030 C  CD  . GLN A 1 375 ? -77.878 5.837  -18.414 1.00 46.85  ? 375 GLN A CD  1 
ATOM   3031 O  OE1 . GLN A 1 375 ? -79.024 6.045  -18.906 1.00 55.01  ? 375 GLN A OE1 1 
ATOM   3032 N  NE2 . GLN A 1 375 ? -76.922 5.108  -19.062 1.00 48.67  ? 375 GLN A NE2 1 
ATOM   3033 N  N   . TYR A 1 376 ? -75.930 10.170 -16.799 1.00 25.22  ? 376 TYR A N   1 
ATOM   3034 C  CA  . TYR A 1 376 ? -76.579 11.476 -16.735 1.00 24.85  ? 376 TYR A CA  1 
ATOM   3035 C  C   . TYR A 1 376 ? -76.665 12.165 -18.105 1.00 24.63  ? 376 TYR A C   1 
ATOM   3036 O  O   . TYR A 1 376 ? -77.714 12.726 -18.378 1.00 23.80  ? 376 TYR A O   1 
ATOM   3037 C  CB  . TYR A 1 376 ? -75.902 12.375 -15.722 1.00 22.91  ? 376 TYR A CB  1 
ATOM   3038 C  CG  . TYR A 1 376 ? -76.512 13.783 -15.645 1.00 18.91  ? 376 TYR A CG  1 
ATOM   3039 C  CD1 . TYR A 1 376 ? -76.035 14.824 -16.443 1.00 17.06  ? 376 TYR A CD1 1 
ATOM   3040 C  CD2 . TYR A 1 376 ? -77.551 14.035 -14.823 1.00 19.83  ? 376 TYR A CD2 1 
ATOM   3041 C  CE1 . TYR A 1 376 ? -76.625 16.049 -16.374 1.00 16.33  ? 376 TYR A CE1 1 
ATOM   3042 C  CE2 . TYR A 1 376 ? -78.171 15.284 -14.774 1.00 19.69  ? 376 TYR A CE2 1 
ATOM   3043 C  CZ  . TYR A 1 376 ? -77.665 16.306 -15.605 1.00 17.31  ? 376 TYR A CZ  1 
ATOM   3044 O  OH  . TYR A 1 376 ? -78.288 17.519 -15.495 1.00 18.21  ? 376 TYR A OH  1 
ATOM   3045 N  N   . GLU A 1 377 ? -75.627 12.155 -18.935 1.00 28.93  ? 377 GLU A N   1 
ATOM   3046 C  CA  . GLU A 1 377 ? -75.758 12.772 -20.239 1.00 34.78  ? 377 GLU A CA  1 
ATOM   3047 C  C   . GLU A 1 377 ? -76.972 12.327 -21.037 1.00 36.90  ? 377 GLU A C   1 
ATOM   3048 O  O   . GLU A 1 377 ? -77.648 13.137 -21.681 1.00 38.44  ? 377 GLU A O   1 
ATOM   3049 C  CB  . GLU A 1 377 ? -74.637 12.393 -21.165 1.00 36.69  ? 377 GLU A CB  1 
ATOM   3050 C  CG  . GLU A 1 377 ? -73.416 13.139 -20.946 1.00 38.24  ? 377 GLU A CG  1 
ATOM   3051 C  CD  . GLU A 1 377 ? -73.651 14.659 -20.973 1.00 38.66  ? 377 GLU A CD  1 
ATOM   3052 O  OE1 . GLU A 1 377 ? -74.204 15.259 -21.982 1.00 35.21  ? 377 GLU A OE1 1 
ATOM   3053 O  OE2 . GLU A 1 377 ? -73.297 15.253 -19.935 1.00 38.35  ? 377 GLU A OE2 1 
ATOM   3054 N  N   . LYS A 1 378 ? -77.268 11.025 -21.008 1.00 38.09  ? 378 LYS A N   1 
ATOM   3055 C  CA  . LYS A 1 378 ? -78.476 10.559 -21.746 1.00 36.44  ? 378 LYS A CA  1 
ATOM   3056 C  C   . LYS A 1 378 ? -79.793 11.014 -21.126 1.00 34.77  ? 378 LYS A C   1 
ATOM   3057 O  O   . LYS A 1 378 ? -80.798 11.206 -21.807 1.00 35.60  ? 378 LYS A O   1 
ATOM   3058 C  CB  . LYS A 1 378 ? -78.431 9.014  -21.793 1.00 38.39  ? 378 LYS A CB  1 
ATOM   3059 C  CG  . LYS A 1 378 ? -77.124 8.502  -22.377 1.00 44.51  ? 378 LYS A CG  1 
ATOM   3060 C  CD  . LYS A 1 378 ? -77.308 7.028  -22.918 1.00 49.22  ? 378 LYS A CD  1 
ATOM   3061 C  CE  . LYS A 1 378 ? -75.945 6.242  -23.110 1.00 53.53  ? 378 LYS A CE  1 
ATOM   3062 N  NZ  . LYS A 1 378 ? -75.432 5.641  -21.798 1.00 54.85  ? 378 LYS A NZ  1 
ATOM   3063 N  N   . ASP A 1 379 ? -79.826 11.185 -19.817 1.00 30.59  ? 379 ASP A N   1 
ATOM   3064 C  CA  . ASP A 1 379 ? -81.068 11.373 -19.084 1.00 29.94  ? 379 ASP A CA  1 
ATOM   3065 C  C   . ASP A 1 379 ? -81.317 12.852 -18.712 1.00 25.93  ? 379 ASP A C   1 
ATOM   3066 O  O   . ASP A 1 379 ? -82.277 13.139 -18.010 1.00 28.36  ? 379 ASP A O   1 
ATOM   3067 C  CB  . ASP A 1 379 ? -81.050 10.521 -17.782 1.00 32.94  ? 379 ASP A CB  1 
ATOM   3068 C  CG  . ASP A 1 379 ? -81.156 8.992  -18.078 1.00 36.98  ? 379 ASP A CG  1 
ATOM   3069 O  OD1 . ASP A 1 379 ? -81.784 8.589  -19.134 1.00 44.64  ? 379 ASP A OD1 1 
ATOM   3070 O  OD2 . ASP A 1 379 ? -80.528 8.263  -17.212 1.00 42.86  ? 379 ASP A OD2 1 
ATOM   3071 N  N   . ARG A 1 380 ? -80.357 13.742 -19.021 1.00 26.56  ? 380 ARG A N   1 
ATOM   3072 C  CA  . ARG A 1 380 ? -80.399 15.146 -18.522 1.00 24.90  ? 380 ARG A CA  1 
ATOM   3073 C  C   . ARG A 1 380 ? -81.696 15.848 -18.796 1.00 23.44  ? 380 ARG A C   1 
ATOM   3074 O  O   . ARG A 1 380 ? -82.377 16.348 -17.860 1.00 23.70  ? 380 ARG A O   1 
ATOM   3075 C  CB  . ARG A 1 380 ? -79.281 15.920 -19.245 1.00 24.68  ? 380 ARG A CB  1 
ATOM   3076 C  CG  . ARG A 1 380 ? -79.387 17.424 -18.937 1.00 22.67  ? 380 ARG A CG  1 
ATOM   3077 C  CD  . ARG A 1 380 ? -78.440 18.378 -19.647 1.00 21.11  ? 380 ARG A CD  1 
ATOM   3078 N  NE  . ARG A 1 380 ? -77.077 18.294 -19.162 1.00 19.94  ? 380 ARG A NE  1 
ATOM   3079 C  CZ  . ARG A 1 380 ? -76.117 17.660 -19.729 1.00 24.15  ? 380 ARG A CZ  1 
ATOM   3080 N  NH1 . ARG A 1 380 ? -76.423 16.872 -20.834 1.00 31.59  ? 380 ARG A NH1 1 
ATOM   3081 N  NH2 . ARG A 1 380 ? -74.886 17.645 -19.258 1.00 29.02  ? 380 ARG A NH2 1 
ATOM   3082 N  N   . LYS A 1 381 ? -82.171 15.764 -20.031 1.00 25.92  ? 381 LYS A N   1 
ATOM   3083 C  CA  . LYS A 1 381 ? -83.461 16.350 -20.318 1.00 28.07  ? 381 LYS A CA  1 
ATOM   3084 C  C   . LYS A 1 381 ? -84.580 15.785 -19.490 1.00 26.78  ? 381 LYS A C   1 
ATOM   3085 O  O   . LYS A 1 381 ? -85.380 16.517 -18.989 1.00 27.74  ? 381 LYS A O   1 
ATOM   3086 C  CB  . LYS A 1 381 ? -83.810 16.262 -21.795 1.00 20.00  ? 381 LYS A CB  1 
ATOM   3087 C  CG  . LYS A 1 381 ? -85.054 15.451 -22.027 1.00 20.00  ? 381 LYS A CG  1 
ATOM   3088 C  CD  . LYS A 1 381 ? -84.749 13.942 -21.888 1.00 20.00  ? 381 LYS A CD  1 
ATOM   3089 C  CE  . LYS A 1 381 ? -85.344 13.059 -23.066 1.00 20.00  ? 381 LYS A CE  1 
ATOM   3090 N  NZ  . LYS A 1 381 ? -84.528 12.948 -24.307 1.00 20.00  ? 381 LYS A NZ  1 
ATOM   3091 N  N   . LYS A 1 382 ? -84.620 14.475 -19.339 1.00 26.70  ? 382 LYS A N   1 
ATOM   3092 C  CA  . LYS A 1 382 ? -85.567 13.898 -18.427 1.00 29.53  ? 382 LYS A CA  1 
ATOM   3093 C  C   . LYS A 1 382 ? -85.468 14.343 -16.993 1.00 28.51  ? 382 LYS A C   1 
ATOM   3094 O  O   . LYS A 1 382 ? -86.484 14.713 -16.327 1.00 28.01  ? 382 LYS A O   1 
ATOM   3095 C  CB  . LYS A 1 382 ? -85.476 12.315 -18.554 1.00 31.81  ? 382 LYS A CB  1 
ATOM   3096 C  CG  . LYS A 1 382 ? -86.266 11.578 -17.480 1.00 39.29  ? 382 LYS A CG  1 
ATOM   3097 C  CD  . LYS A 1 382 ? -86.198 9.991  -17.600 1.00 45.98  ? 382 LYS A CD  1 
ATOM   3098 C  CE  . LYS A 1 382 ? -84.957 9.300  -16.961 1.00 48.51  ? 382 LYS A CE  1 
ATOM   3099 N  NZ  . LYS A 1 382 ? -84.890 7.777  -17.264 1.00 52.48  ? 382 LYS A NZ  1 
ATOM   3100 N  N   . TYR A 1 383 ? -84.226 14.438 -16.494 1.00 27.85  ? 383 TYR A N   1 
ATOM   3101 C  CA  . TYR A 1 383 ? -84.085 14.882 -15.137 1.00 29.93  ? 383 TYR A CA  1 
ATOM   3102 C  C   . TYR A 1 383 ? -84.447 16.330 -14.920 1.00 28.31  ? 383 TYR A C   1 
ATOM   3103 O  O   . TYR A 1 383 ? -85.132 16.701 -13.926 1.00 30.15  ? 383 TYR A O   1 
ATOM   3104 C  CB  . TYR A 1 383 ? -82.669 14.659 -14.752 1.00 30.54  ? 383 TYR A CB  1 
ATOM   3105 C  CG  . TYR A 1 383 ? -82.291 13.264 -14.555 1.00 31.19  ? 383 TYR A CG  1 
ATOM   3106 C  CD1 . TYR A 1 383 ? -83.229 12.308 -14.127 1.00 35.92  ? 383 TYR A CD1 1 
ATOM   3107 C  CD2 . TYR A 1 383 ? -81.060 12.844 -14.980 1.00 34.25  ? 383 TYR A CD2 1 
ATOM   3108 C  CE1 . TYR A 1 383 ? -82.835 11.030 -13.941 1.00 37.72  ? 383 TYR A CE1 1 
ATOM   3109 C  CE2 . TYR A 1 383 ? -80.644 11.614 -14.812 1.00 39.46  ? 383 TYR A CE2 1 
ATOM   3110 C  CZ  . TYR A 1 383 ? -81.540 10.655 -14.321 1.00 38.38  ? 383 TYR A CZ  1 
ATOM   3111 O  OH  . TYR A 1 383 ? -81.115 9.356  -14.192 1.00 42.54  ? 383 TYR A OH  1 
ATOM   3112 N  N   . ILE A 1 384 ? -84.066 17.189 -15.869 1.00 27.29  ? 384 ILE A N   1 
ATOM   3113 C  CA  . ILE A 1 384 ? -84.508 18.591 -15.788 1.00 26.20  ? 384 ILE A CA  1 
ATOM   3114 C  C   . ILE A 1 384 ? -86.002 18.751 -15.865 1.00 27.75  ? 384 ILE A C   1 
ATOM   3115 O  O   . ILE A 1 384 ? -86.585 19.491 -15.089 1.00 28.26  ? 384 ILE A O   1 
ATOM   3116 C  CB  . ILE A 1 384 ? -83.727 19.528 -16.865 1.00 25.33  ? 384 ILE A CB  1 
ATOM   3117 C  CG1 . ILE A 1 384 ? -82.205 19.470 -16.652 1.00 25.34  ? 384 ILE A CG1 1 
ATOM   3118 C  CG2 . ILE A 1 384 ? -84.312 20.936 -16.793 1.00 24.93  ? 384 ILE A CG2 1 
ATOM   3119 C  CD1 . ILE A 1 384 ? -81.638 19.909 -15.258 1.00 25.36  ? 384 ILE A CD1 1 
ATOM   3120 N  N   . GLU A 1 385 ? -86.691 18.020 -16.779 1.00 28.48  ? 385 GLU A N   1 
ATOM   3121 C  CA  . GLU A 1 385 ? -88.151 18.083 -16.800 1.00 32.54  ? 385 GLU A CA  1 
ATOM   3122 C  C   . GLU A 1 385 ? -88.735 17.621 -15.503 1.00 31.23  ? 385 GLU A C   1 
ATOM   3123 O  O   . GLU A 1 385 ? -89.694 18.241 -15.049 1.00 33.02  ? 385 GLU A O   1 
ATOM   3124 C  CB  . GLU A 1 385 ? -88.752 17.264 -17.940 1.00 33.34  ? 385 GLU A CB  1 
ATOM   3125 C  CG  . GLU A 1 385 ? -88.446 17.830 -19.273 1.00 41.04  ? 385 GLU A CG  1 
ATOM   3126 C  CD  . GLU A 1 385 ? -88.815 16.917 -20.483 1.00 50.51  ? 385 GLU A CD  1 
ATOM   3127 O  OE1 . GLU A 1 385 ? -89.437 15.793 -20.307 1.00 54.45  ? 385 GLU A OE1 1 
ATOM   3128 O  OE2 . GLU A 1 385 ? -88.460 17.361 -21.636 1.00 56.85  ? 385 GLU A OE2 1 
ATOM   3129 N  N   . ALA A 1 386 ? -88.123 16.610 -14.869 1.00 32.20  ? 386 ALA A N   1 
ATOM   3130 C  CA  . ALA A 1 386 ? -88.637 16.095 -13.587 1.00 33.70  ? 386 ALA A CA  1 
ATOM   3131 C  C   . ALA A 1 386 ? -88.463 17.129 -12.510 1.00 34.42  ? 386 ALA A C   1 
ATOM   3132 O  O   . ALA A 1 386 ? -89.388 17.380 -11.769 1.00 37.75  ? 386 ALA A O   1 
ATOM   3133 C  CB  . ALA A 1 386 ? -87.912 14.781 -13.219 1.00 34.56  ? 386 ALA A CB  1 
ATOM   3134 N  N   . VAL A 1 387 ? -87.331 17.884 -12.480 1.00 33.60  ? 387 VAL A N   1 
ATOM   3135 C  CA  . VAL A 1 387 ? -87.291 18.966 -11.490 1.00 33.15  ? 387 VAL A CA  1 
ATOM   3136 C  C   . VAL A 1 387 ? -88.312 20.063 -11.769 1.00 33.09  ? 387 VAL A C   1 
ATOM   3137 O  O   . VAL A 1 387 ? -88.927 20.684 -10.844 1.00 36.84  ? 387 VAL A O   1 
ATOM   3138 C  CB  . VAL A 1 387 ? -85.923 19.639 -11.483 1.00 31.94  ? 387 VAL A CB  1 
ATOM   3139 C  CG1 . VAL A 1 387 ? -85.912 20.924 -10.544 1.00 34.00  ? 387 VAL A CG1 1 
ATOM   3140 C  CG2 . VAL A 1 387 ? -84.859 18.641 -11.079 1.00 33.51  ? 387 VAL A CG2 1 
ATOM   3141 N  N   . VAL A 1 388 ? -88.420 20.439 -13.057 1.00 31.56  ? 388 VAL A N   1 
ATOM   3142 C  CA  . VAL A 1 388 ? -89.334 21.478 -13.462 1.00 32.43  ? 388 VAL A CA  1 
ATOM   3143 C  C   . VAL A 1 388 ? -90.794 21.197 -13.086 1.00 34.77  ? 388 VAL A C   1 
ATOM   3144 O  O   . VAL A 1 388 ? -91.491 22.054 -12.529 1.00 35.79  ? 388 VAL A O   1 
ATOM   3145 C  CB  . VAL A 1 388 ? -89.157 21.809 -14.979 1.00 30.57  ? 388 VAL A CB  1 
ATOM   3146 C  CG1 . VAL A 1 388 ? -90.228 22.740 -15.442 1.00 32.49  ? 388 VAL A CG1 1 
ATOM   3147 C  CG2 . VAL A 1 388 ? -87.752 22.384 -15.214 1.00 30.47  ? 388 VAL A CG2 1 
ATOM   3148 N  N   . LYS A 1 389 ? -91.264 20.022 -13.486 1.00 36.65  ? 389 LYS A N   1 
ATOM   3149 C  CA  . LYS A 1 389 ? -92.618 19.510 -13.133 1.00 39.82  ? 389 LYS A CA  1 
ATOM   3150 C  C   . LYS A 1 389 ? -92.717 19.283 -11.636 1.00 42.32  ? 389 LYS A C   1 
ATOM   3151 O  O   . LYS A 1 389 ? -93.631 19.815 -10.934 1.00 47.60  ? 389 LYS A O   1 
ATOM   3152 C  CB  . LYS A 1 389 ? -92.825 18.165 -13.839 1.00 39.51  ? 389 LYS A CB  1 
ATOM   3153 C  CG  . LYS A 1 389 ? -93.186 18.360 -15.347 1.00 44.92  ? 389 LYS A CG  1 
ATOM   3154 C  CD  . LYS A 1 389 ? -93.672 17.040 -16.061 1.00 48.11  ? 389 LYS A CD  1 
ATOM   3155 C  CE  . LYS A 1 389 ? -93.154 16.950 -17.568 1.00 49.15  ? 389 LYS A CE  1 
ATOM   3156 N  NZ  . LYS A 1 389 ? -92.500 15.595 -17.883 1.00 52.09  ? 389 LYS A NZ  1 
ATOM   3157 N  N   . GLY A 1 390 ? -91.803 18.456 -11.128 1.00 44.64  ? 390 GLY A N   1 
ATOM   3158 C  CA  . GLY A 1 390 ? -91.655 18.347 -9.687  1.00 45.06  ? 390 GLY A CA  1 
ATOM   3159 C  C   . GLY A 1 390 ? -92.060 19.717 -9.156  1.00 46.73  ? 390 GLY A C   1 
ATOM   3160 O  O   . GLY A 1 390 ? -92.417 19.868 -7.973  1.00 51.62  ? 390 GLY A O   1 
HETATM 3161 MG MG  . MG  B 2 .   ? -58.336 29.985 20.613  1.00 7.32   ? 408 MG  A MG  1 
HETATM 3162 MG MG  . MG  C 2 .   ? -62.314 28.594 22.417  1.00 8.70   ? 409 MG  A MG  1 
HETATM 3163 MG MG  . MG  D 2 .   ? -57.620 26.535 20.256  1.00 15.12  ? 410 MG  A MG  1 
HETATM 3164 MG MG  . MG  E 2 .   ? -59.559 26.518 17.257  1.00 12.36  ? 411 MG  A MG  1 
HETATM 3165 P  P1  . P6F F 3 .   ? -60.655 28.085 19.534  1.00 11.55  ? 412 P6F A P1  1 
HETATM 3166 O  O1P . P6F F 3 .   ? -59.744 26.921 19.165  1.00 15.04  ? 412 P6F A O1P 1 
HETATM 3167 O  O2P . P6F F 3 .   ? -61.490 27.855 20.744  1.00 9.35   ? 412 P6F A O2P 1 
HETATM 3168 O  O3P . P6F F 3 .   ? -59.935 29.436 19.434  1.00 8.84   ? 412 P6F A O3P 1 
HETATM 3169 O  O1  . P6F F 3 .   ? -61.582 27.851 18.162  1.00 15.57  ? 412 P6F A O1  1 
HETATM 3170 C  C1  . P6F F 3 .   ? -63.063 28.515 18.023  1.00 15.67  ? 412 P6F A C1  1 
HETATM 3171 C  C2  . P6F F 3 .   ? -63.408 28.917 16.652  1.00 11.95  ? 412 P6F A C2  1 
HETATM 3172 O  O2  . P6F F 3 .   ? -62.658 28.630 15.683  1.00 16.34  ? 412 P6F A O2  1 
HETATM 3173 C  C3  . P6F F 3 .   ? -64.727 29.585 16.501  1.00 8.89   ? 412 P6F A C3  1 
HETATM 3174 O  O3  . P6F F 3 .   ? -64.784 30.232 15.236  1.00 9.06   ? 412 P6F A O3  1 
HETATM 3175 C  C4  . P6F F 3 .   ? -65.896 28.568 16.631  1.00 9.53   ? 412 P6F A C4  1 
HETATM 3176 O  O4  . P6F F 3 .   ? -65.691 27.483 15.731  1.00 10.40  ? 412 P6F A O4  1 
HETATM 3177 C  C5  . P6F F 3 .   ? -67.245 29.207 16.384  1.00 8.56   ? 412 P6F A C5  1 
HETATM 3178 O  O5  . P6F F 3 .   ? -67.480 30.242 17.299  1.00 8.63   ? 412 P6F A O5  1 
HETATM 3179 C  C6  . P6F F 3 .   ? -68.390 28.203 16.454  1.00 9.31   ? 412 P6F A C6  1 
HETATM 3180 O  O6  . P6F F 3 .   ? -68.292 27.602 17.777  1.00 10.04  ? 412 P6F A O6  1 
HETATM 3181 P  P2  . P6F F 3 .   ? -69.474 26.619 18.266  1.00 11.51  ? 412 P6F A P2  1 
HETATM 3182 O  O4P . P6F F 3 .   ? -69.464 25.452 17.322  1.00 12.95  ? 412 P6F A O4P 1 
HETATM 3183 O  O5P . P6F F 3 .   ? -68.948 26.227 19.681  1.00 13.58  ? 412 P6F A O5P 1 
HETATM 3184 O  O6P . P6F F 3 .   ? -70.779 27.400 18.285  1.00 10.19  ? 412 P6F A O6P 1 
HETATM 3185 O  O   . HOH G 4 .   ? -47.323 32.576 24.407  1.00 9.69   ? 413 HOH A O   1 
HETATM 3186 O  O   . HOH G 4 .   ? -52.092 32.310 24.484  1.00 10.69  ? 414 HOH A O   1 
HETATM 3187 O  O   . HOH G 4 .   ? -52.172 31.013 21.866  1.00 10.18  ? 415 HOH A O   1 
HETATM 3188 O  O   . HOH G 4 .   ? -54.163 23.865 23.418  1.00 15.01  ? 416 HOH A O   1 
HETATM 3189 O  O   . HOH G 4 .   ? -58.758 20.599 22.268  1.00 15.80  ? 417 HOH A O   1 
HETATM 3190 O  O   . HOH G 4 .   ? -59.435 30.207 28.060  1.00 10.13  ? 418 HOH A O   1 
HETATM 3191 O  O   . HOH G 4 .   ? -63.780 39.994 27.656  1.00 14.90  ? 419 HOH A O   1 
HETATM 3192 O  O   . HOH G 4 .   ? -33.003 45.180 19.342  1.00 9.74   ? 420 HOH A O   1 
HETATM 3193 O  O   . HOH G 4 .   ? -50.781 33.300 45.442  1.00 25.60  ? 421 HOH A O   1 
HETATM 3194 O  O   . HOH G 4 .   ? -43.956 33.809 45.178  1.00 25.61  ? 422 HOH A O   1 
HETATM 3195 O  O   . HOH G 4 .   ? -38.744 30.034 43.195  1.00 18.78  ? 423 HOH A O   1 
HETATM 3196 O  O   . HOH G 4 .   ? -34.394 31.268 42.150  1.00 26.71  ? 424 HOH A O   1 
HETATM 3197 O  O   . HOH G 4 .   ? -31.956 19.850 32.666  1.00 21.95  ? 425 HOH A O   1 
HETATM 3198 O  O   . HOH G 4 .   ? -32.985 20.045 35.115  1.00 13.16  ? 426 HOH A O   1 
HETATM 3199 O  O   . HOH G 4 .   ? -48.897 37.407 40.452  1.00 19.44  ? 427 HOH A O   1 
HETATM 3200 O  O   . HOH G 4 .   ? -51.069 36.955 42.027  1.00 22.29  ? 428 HOH A O   1 
HETATM 3201 O  O   . HOH G 4 .   ? -37.173 25.133 38.886  1.00 14.38  ? 429 HOH A O   1 
HETATM 3202 O  O   . HOH G 4 .   ? -37.623 26.911 40.775  1.00 23.67  ? 430 HOH A O   1 
HETATM 3203 O  O   . HOH G 4 .   ? -38.294 32.623 42.571  1.00 18.96  ? 431 HOH A O   1 
HETATM 3204 O  O   . HOH G 4 .   ? -26.984 20.040 32.702  1.00 31.61  ? 432 HOH A O   1 
HETATM 3205 O  O   . HOH G 4 .   ? -40.697 21.129 31.191  1.00 12.65  ? 433 HOH A O   1 
HETATM 3206 O  O   . HOH G 4 .   ? -36.857 17.583 32.262  1.00 18.13  ? 434 HOH A O   1 
HETATM 3207 O  O   . HOH G 4 .   ? -41.610 15.825 41.842  1.00 17.59  ? 435 HOH A O   1 
HETATM 3208 O  O   . HOH G 4 .   ? -47.482 21.422 21.930  1.00 21.25  ? 436 HOH A O   1 
HETATM 3209 O  O   . HOH G 4 .   ? -40.892 22.942 22.623  1.00 19.12  ? 437 HOH A O   1 
HETATM 3210 O  O   . HOH G 4 .   ? -34.866 23.597 21.703  1.00 16.66  ? 438 HOH A O   1 
HETATM 3211 O  O   . HOH G 4 .   ? -34.633 25.310 19.557  1.00 11.79  ? 439 HOH A O   1 
HETATM 3212 O  O   . HOH G 4 .   ? -33.690 23.511 24.142  1.00 17.32  ? 440 HOH A O   1 
HETATM 3213 O  O   . HOH G 4 .   ? -27.152 26.547 25.747  1.00 20.22  ? 441 HOH A O   1 
HETATM 3214 O  O   . HOH G 4 .   ? -27.365 28.645 23.987  1.00 18.65  ? 442 HOH A O   1 
HETATM 3215 O  O   . HOH G 4 .   ? -28.850 24.430 25.059  1.00 22.86  ? 443 HOH A O   1 
HETATM 3216 O  O   . HOH G 4 .   ? -33.992 19.607 29.043  1.00 28.98  ? 444 HOH A O   1 
HETATM 3217 O  O   . HOH G 4 .   ? -25.888 34.921 21.499  1.00 19.27  ? 445 HOH A O   1 
HETATM 3218 O  O   . HOH G 4 .   ? -51.513 29.132 8.084   1.00 11.31  ? 446 HOH A O   1 
HETATM 3219 O  O   . HOH G 4 .   ? -49.920 30.776 6.010   1.00 9.11   ? 447 HOH A O   1 
HETATM 3220 O  O   . HOH G 4 .   ? -47.360 30.614 7.591   1.00 8.88   ? 448 HOH A O   1 
HETATM 3221 O  O   . HOH G 4 .   ? -51.645 22.628 4.449   1.00 15.53  ? 449 HOH A O   1 
HETATM 3222 O  O   . HOH G 4 .   ? -50.393 23.946 11.042  1.00 13.84  ? 450 HOH A O   1 
HETATM 3223 O  O   . HOH G 4 .   ? -44.665 38.874 7.729   1.00 9.04   ? 451 HOH A O   1 
HETATM 3224 O  O   . HOH G 4 .   ? -46.786 37.609 10.014  1.00 10.21  ? 452 HOH A O   1 
HETATM 3225 O  O   . HOH G 4 .   ? -48.351 39.403 11.576  1.00 9.02   ? 453 HOH A O   1 
HETATM 3226 O  O   . HOH G 4 .   ? -30.167 30.999 7.490   1.00 9.90   ? 454 HOH A O   1 
HETATM 3227 O  O   . HOH G 4 .   ? -33.015 42.929 5.196   1.00 12.33  ? 455 HOH A O   1 
HETATM 3228 O  O   . HOH G 4 .   ? -67.456 31.115 4.675   1.00 16.54  ? 456 HOH A O   1 
HETATM 3229 O  O   . HOH G 4 .   ? -44.035 22.195 -2.351  1.00 17.82  ? 457 HOH A O   1 
HETATM 3230 O  O   . HOH G 4 .   ? -46.174 20.417 -1.908  1.00 19.54  ? 458 HOH A O   1 
HETATM 3231 O  O   . HOH G 4 .   ? -48.735 15.721 -1.336  1.00 35.67  ? 459 HOH A O   1 
HETATM 3232 O  O   . HOH G 4 .   ? -43.086 13.490 4.661   1.00 16.17  ? 460 HOH A O   1 
HETATM 3233 O  O   . HOH G 4 .   ? -43.888 11.293 3.207   1.00 27.90  ? 461 HOH A O   1 
HETATM 3234 O  O   . HOH G 4 .   ? -69.181 38.840 3.256   1.00 14.39  ? 462 HOH A O   1 
HETATM 3235 O  O   . HOH G 4 .   ? -70.623 39.735 1.158   1.00 19.72  ? 463 HOH A O   1 
HETATM 3236 O  O   . HOH G 4 .   ? -69.962 38.979 -1.639  1.00 21.86  ? 464 HOH A O   1 
HETATM 3237 O  O   . HOH G 4 .   ? -27.596 39.632 16.069  1.00 12.30  ? 465 HOH A O   1 
HETATM 3238 O  O   . HOH G 4 .   ? -23.257 37.206 7.426   1.00 22.63  ? 466 HOH A O   1 
HETATM 3239 O  O   . HOH G 4 .   ? -23.040 31.876 11.752  1.00 18.50  ? 467 HOH A O   1 
HETATM 3240 O  O   . HOH G 4 .   ? -25.004 30.054 12.567  1.00 16.36  ? 468 HOH A O   1 
HETATM 3241 O  O   . HOH G 4 .   ? -25.780 32.789 13.916  1.00 22.94  ? 469 HOH A O   1 
HETATM 3242 O  O   . HOH G 4 .   ? -70.009 21.707 4.501   1.00 13.49  ? 470 HOH A O   1 
HETATM 3243 O  O   . HOH G 4 .   ? -23.534 31.671 3.979   1.00 22.04  ? 471 HOH A O   1 
HETATM 3244 O  O   . HOH G 4 .   ? -70.229 7.566  -15.277 1.00 35.95  ? 472 HOH A O   1 
HETATM 3245 O  O   . HOH G 4 .   ? -31.475 31.451 -3.521  1.00 22.67  ? 473 HOH A O   1 
HETATM 3246 O  O   . HOH G 4 .   ? -58.531 28.260 21.756  1.00 10.27  ? 474 HOH A O   1 
HETATM 3247 O  O   . HOH G 4 .   ? -55.034 23.522 20.752  1.00 17.17  ? 475 HOH A O   1 
HETATM 3248 O  O   . HOH G 4 .   ? -57.365 22.339 17.530  1.00 18.87  ? 476 HOH A O   1 
HETATM 3249 O  O   . HOH G 4 .   ? -56.137 21.257 22.307  1.00 20.11  ? 477 HOH A O   1 
HETATM 3250 O  O   . HOH G 4 .   ? -57.786 24.269 21.061  1.00 15.32  ? 478 HOH A O   1 
HETATM 3251 O  O   . HOH G 4 .   ? -59.333 23.093 19.312  1.00 16.93  ? 479 HOH A O   1 
HETATM 3252 O  O   . HOH G 4 .   ? -57.506 27.176 13.904  1.00 21.35  ? 480 HOH A O   1 
HETATM 3253 O  O   . HOH G 4 .   ? -59.482 29.081 14.037  1.00 11.17  ? 481 HOH A O   1 
HETATM 3254 O  O   . HOH G 4 .   ? -58.813 28.546 16.991  1.00 10.53  ? 482 HOH A O   1 
HETATM 3255 O  O   . HOH G 4 .   ? -60.516 24.739 17.603  1.00 15.59  ? 483 HOH A O   1 
HETATM 3256 O  O   . HOH G 4 .   ? -55.970 26.367 22.282  1.00 17.46  ? 484 HOH A O   1 
HETATM 3257 O  O   . HOH G 4 .   ? -51.089 25.242 17.722  1.00 23.03  ? 485 HOH A O   1 
HETATM 3258 O  O   . HOH G 4 .   ? -50.335 21.085 16.788  1.00 18.23  ? 486 HOH A O   1 
HETATM 3259 O  O   . HOH G 4 .   ? -71.801 24.276 16.671  1.00 18.80  ? 487 HOH A O   1 
HETATM 3260 O  O   . HOH G 4 .   ? -22.357 39.793 21.158  1.00 36.97  ? 488 HOH A O   1 
HETATM 3261 O  O   . HOH G 4 .   ? -70.977 20.511 22.451  1.00 30.00  ? 489 HOH A O   1 
HETATM 3262 O  O   . HOH G 4 .   ? -42.250 40.828 6.695   1.00 24.18  ? 490 HOH A O   1 
HETATM 3263 O  O   . HOH G 4 .   ? -44.553 50.105 8.903   1.00 8.50   ? 491 HOH A O   1 
HETATM 3264 O  O   . HOH G 4 .   ? -46.707 45.239 5.511   1.00 14.39  ? 492 HOH A O   1 
HETATM 3265 O  O   . HOH G 4 .   ? -48.863 45.753 3.942   1.00 22.29  ? 493 HOH A O   1 
HETATM 3266 O  O   . HOH G 4 .   ? -63.157 44.270 -1.580  1.00 15.30  ? 494 HOH A O   1 
HETATM 3267 O  O   . HOH G 4 .   ? -63.619 45.536 0.754   1.00 26.04  ? 495 HOH A O   1 
HETATM 3268 O  O   . HOH G 4 .   ? -60.796 46.182 1.573   1.00 23.10  ? 496 HOH A O   1 
HETATM 3269 O  O   . HOH G 4 .   ? -48.260 42.418 21.057  1.00 7.69   ? 497 HOH A O   1 
HETATM 3270 O  O   . HOH G 4 .   ? -54.176 48.745 18.255  1.00 24.63  ? 498 HOH A O   1 
HETATM 3271 O  O   . HOH G 4 .   ? -47.544 53.083 19.749  1.00 27.14  ? 499 HOH A O   1 
HETATM 3272 O  O   . HOH G 4 .   ? -45.578 47.168 26.998  1.00 15.34  ? 500 HOH A O   1 
HETATM 3273 O  O   . HOH G 4 .   ? -52.941 43.585 32.633  1.00 17.81  ? 501 HOH A O   1 
HETATM 3274 O  O   . HOH G 4 .   ? -54.749 43.411 34.861  1.00 39.74  ? 502 HOH A O   1 
HETATM 3275 O  O   . HOH G 4 .   ? -53.590 37.243 40.874  1.00 21.19  ? 503 HOH A O   1 
HETATM 3276 O  O   . HOH G 4 .   ? -57.396 26.874 -1.579  1.00 17.05  ? 504 HOH A O   1 
HETATM 3277 O  O   . HOH G 4 .   ? -57.468 27.996 1.279   1.00 18.08  ? 505 HOH A O   1 
HETATM 3278 O  O   . HOH G 4 .   ? -63.178 29.077 24.328  1.00 10.22  ? 506 HOH A O   1 
HETATM 3279 O  O   . HOH G 4 .   ? -57.039 22.428 14.677  1.00 27.05  ? 507 HOH A O   1 
HETATM 3280 O  O   . HOH G 4 .   ? -57.398 20.124 13.143  1.00 27.82  ? 508 HOH A O   1 
HETATM 3281 O  O   . HOH G 4 .   ? -58.655 24.266 13.543  1.00 28.85  ? 509 HOH A O   1 
HETATM 3282 O  O   . HOH G 4 .   ? -60.656 26.687 15.575  1.00 13.51  ? 510 HOH A O   1 
HETATM 3283 O  O   . HOH G 4 .   ? -58.692 23.588 10.536  1.00 26.96  ? 511 HOH A O   1 
HETATM 3284 O  O   . HOH G 4 .   ? -64.792 35.551 18.758  1.00 24.38  ? 512 HOH A O   1 
HETATM 3285 O  O   . HOH G 4 .   ? -59.850 39.370 30.126  1.00 25.47  ? 513 HOH A O   1 
HETATM 3286 O  O   . HOH G 4 .   ? -60.868 41.916 30.218  1.00 26.47  ? 514 HOH A O   1 
HETATM 3287 O  O   . HOH G 4 .   ? -42.125 47.747 32.027  1.00 34.52  ? 515 HOH A O   1 
HETATM 3288 O  O   . HOH G 4 .   ? -44.061 49.182 33.140  1.00 30.90  ? 516 HOH A O   1 
HETATM 3289 O  O   . HOH G 4 .   ? -46.241 47.893 31.162  1.00 32.77  ? 517 HOH A O   1 
HETATM 3290 O  O   . HOH G 4 .   ? -60.545 43.494 32.355  1.00 28.50  ? 518 HOH A O   1 
HETATM 3291 O  O   . HOH G 4 .   ? -59.156 43.259 34.502  1.00 31.56  ? 519 HOH A O   1 
HETATM 3292 O  O   . HOH G 4 .   ? -56.791 41.395 35.413  1.00 36.41  ? 520 HOH A O   1 
HETATM 3293 O  O   . HOH G 4 .   ? -59.660 34.968 40.273  1.00 30.18  ? 521 HOH A O   1 
HETATM 3294 O  O   . HOH G 4 .   ? -49.407 26.254 42.921  1.00 29.06  ? 522 HOH A O   1 
HETATM 3295 O  O   . HOH G 4 .   ? -48.546 32.850 47.152  1.00 34.05  ? 523 HOH A O   1 
HETATM 3296 O  O   . HOH G 4 .   ? -39.280 34.599 44.321  1.00 34.49  ? 524 HOH A O   1 
HETATM 3297 O  O   . HOH G 4 .   ? -42.188 37.174 40.189  1.00 18.70  ? 525 HOH A O   1 
HETATM 3298 O  O   . HOH G 4 .   ? -39.309 38.968 38.636  1.00 26.44  ? 526 HOH A O   1 
HETATM 3299 O  O   . HOH G 4 .   ? -43.803 41.155 40.606  1.00 36.59  ? 527 HOH A O   1 
HETATM 3300 O  O   . HOH G 4 .   ? -44.595 36.989 41.611  1.00 26.17  ? 528 HOH A O   1 
HETATM 3301 O  O   . HOH G 4 .   ? -47.666 39.474 41.936  1.00 36.41  ? 529 HOH A O   1 
HETATM 3302 O  O   . HOH G 4 .   ? -41.107 33.648 46.294  1.00 38.61  ? 530 HOH A O   1 
HETATM 3303 O  O   . HOH G 4 .   ? -32.515 31.461 40.183  1.00 23.92  ? 531 HOH A O   1 
HETATM 3304 O  O   . HOH G 4 .   ? -39.627 21.823 43.024  1.00 19.78  ? 532 HOH A O   1 
HETATM 3305 O  O   . HOH G 4 .   ? -39.293 23.054 45.348  1.00 33.96  ? 533 HOH A O   1 
HETATM 3306 O  O   . HOH G 4 .   ? -42.158 20.249 41.800  1.00 29.29  ? 534 HOH A O   1 
HETATM 3307 O  O   . HOH G 4 .   ? -40.338 18.408 41.893  1.00 26.05  ? 535 HOH A O   1 
HETATM 3308 O  O   . HOH G 4 .   ? -47.494 15.789 33.913  1.00 35.99  ? 536 HOH A O   1 
HETATM 3309 O  O   . HOH G 4 .   ? -49.847 20.496 30.604  1.00 31.48  ? 537 HOH A O   1 
HETATM 3310 O  O   . HOH G 4 .   ? -24.223 39.613 32.616  1.00 26.53  ? 538 HOH A O   1 
HETATM 3311 O  O   . HOH G 4 .   ? -67.998 23.016 29.291  1.00 29.41  ? 539 HOH A O   1 
HETATM 3312 O  O   . HOH G 4 .   ? -71.001 24.699 34.776  1.00 32.15  ? 540 HOH A O   1 
HETATM 3313 O  O   . HOH G 4 .   ? -65.177 15.989 21.825  1.00 31.85  ? 541 HOH A O   1 
HETATM 3314 O  O   . HOH G 4 .   ? -63.718 17.426 19.930  1.00 23.03  ? 542 HOH A O   1 
HETATM 3315 O  O   . HOH G 4 .   ? -65.853 18.173 18.338  1.00 26.94  ? 543 HOH A O   1 
HETATM 3316 O  O   . HOH G 4 .   ? -70.090 21.071 16.496  1.00 32.43  ? 544 HOH A O   1 
HETATM 3317 O  O   . HOH G 4 .   ? -20.697 40.803 14.348  1.00 30.56  ? 545 HOH A O   1 
HETATM 3318 O  O   . HOH G 4 .   ? -18.656 39.202 14.687  1.00 41.58  ? 546 HOH A O   1 
HETATM 3319 O  O   . HOH G 4 .   ? -22.493 37.854 17.559  1.00 39.28  ? 547 HOH A O   1 
HETATM 3320 O  O   . HOH G 4 .   ? -53.792 22.733 11.016  1.00 31.12  ? 548 HOH A O   1 
HETATM 3321 O  O   . HOH G 4 .   ? -54.330 22.993 13.969  1.00 31.33  ? 549 HOH A O   1 
HETATM 3322 O  O   . HOH G 4 .   ? -45.096 37.730 3.826   1.00 16.72  ? 550 HOH A O   1 
HETATM 3323 O  O   . HOH G 4 .   ? -69.779 16.498 9.638   1.00 28.81  ? 551 HOH A O   1 
HETATM 3324 O  O   . HOH G 4 .   ? -72.075 16.272 8.194   1.00 23.96  ? 552 HOH A O   1 
HETATM 3325 O  O   . HOH G 4 .   ? -67.453 14.974 9.473   1.00 32.74  ? 553 HOH A O   1 
HETATM 3326 O  O   . HOH G 4 .   ? -66.353 14.963 4.656   1.00 34.58  ? 554 HOH A O   1 
HETATM 3327 O  O   . HOH G 4 .   ? -65.159 18.995 4.095   1.00 20.83  ? 555 HOH A O   1 
HETATM 3328 O  O   . HOH G 4 .   ? -47.742 17.128 0.961   1.00 27.10  ? 556 HOH A O   1 
HETATM 3329 O  O   . HOH G 4 .   ? -46.281 14.944 1.851   1.00 28.00  ? 557 HOH A O   1 
HETATM 3330 O  O   . HOH G 4 .   ? -79.109 15.600 -7.491  1.00 22.64  ? 558 HOH A O   1 
HETATM 3331 O  O   . HOH G 4 .   ? -28.262 23.053 -1.980  1.00 35.42  ? 559 HOH A O   1 
HETATM 3332 O  O   . HOH G 4 .   ? -32.299 24.499 -1.586  1.00 16.15  ? 560 HOH A O   1 
HETATM 3333 O  O   . HOH G 4 .   ? -27.602 20.129 2.073   1.00 33.13  ? 561 HOH A O   1 
HETATM 3334 O  O   . HOH G 4 .   ? -44.215 17.754 18.891  1.00 20.17  ? 562 HOH A O   1 
HETATM 3335 O  O   . HOH G 4 .   ? -45.861 15.350 18.215  1.00 25.08  ? 563 HOH A O   1 
HETATM 3336 O  O   . HOH G 4 .   ? -51.765 18.432 17.114  1.00 27.63  ? 564 HOH A O   1 
HETATM 3337 O  O   . HOH G 4 .   ? -40.557 43.884 4.933   1.00 28.31  ? 565 HOH A O   1 
HETATM 3338 O  O   . HOH G 4 .   ? -66.381 42.130 4.184   1.00 18.02  ? 566 HOH A O   1 
HETATM 3339 O  O   . HOH G 4 .   ? -69.659 42.402 -4.890  1.00 31.76  ? 567 HOH A O   1 
HETATM 3340 O  O   . HOH G 4 .   ? -48.160 48.230 26.991  1.00 27.85  ? 568 HOH A O   1 
HETATM 3341 O  O   . HOH G 4 .   ? -53.732 48.741 23.731  1.00 24.97  ? 569 HOH A O   1 
HETATM 3342 O  O   . HOH G 4 .   ? -51.127 50.097 24.247  1.00 34.74  ? 570 HOH A O   1 
HETATM 3343 O  O   . HOH G 4 .   ? -50.107 52.301 22.970  1.00 29.60  ? 571 HOH A O   1 
HETATM 3344 O  O   . HOH G 4 .   ? -63.591 41.581 29.809  1.00 31.32  ? 572 HOH A O   1 
HETATM 3345 O  O   . HOH G 4 .   ? -38.881 45.568 38.023  1.00 36.61  ? 573 HOH A O   1 
HETATM 3346 O  O   . HOH G 4 .   ? -65.822 40.853 33.970  1.00 36.24  ? 574 HOH A O   1 
HETATM 3347 O  O   . HOH G 4 .   ? -40.595 43.755 34.827  1.00 23.12  ? 575 HOH A O   1 
HETATM 3348 O  O   . HOH G 4 .   ? -39.989 37.102 43.584  1.00 47.07  ? 576 HOH A O   1 
HETATM 3349 O  O   . HOH G 4 .   ? -51.371 36.069 44.664  1.00 31.96  ? 577 HOH A O   1 
HETATM 3350 O  O   . HOH G 4 .   ? -51.177 40.284 42.458  1.00 48.33  ? 578 HOH A O   1 
HETATM 3351 O  O   . HOH G 4 .   ? -33.283 20.127 26.558  1.00 31.32  ? 579 HOH A O   1 
HETATM 3352 O  O   . HOH G 4 .   ? -28.217 22.844 23.152  1.00 47.80  ? 580 HOH A O   1 
HETATM 3353 O  O   . HOH G 4 .   ? -31.170 22.535 24.127  1.00 41.28  ? 581 HOH A O   1 
HETATM 3354 O  O   . HOH G 4 .   ? -30.836 21.396 26.410  1.00 34.35  ? 582 HOH A O   1 
HETATM 3355 O  O   . HOH G 4 .   ? -49.721 16.652 33.034  1.00 40.46  ? 583 HOH A O   1 
HETATM 3356 O  O   . HOH G 4 .   ? -25.814 32.209 33.179  1.00 28.02  ? 584 HOH A O   1 
HETATM 3357 O  O   . HOH G 4 .   ? -27.368 33.320 34.821  1.00 26.70  ? 585 HOH A O   1 
HETATM 3358 O  O   . HOH G 4 .   ? -35.210 33.286 1.207   1.00 26.79  ? 586 HOH A O   1 
HETATM 3359 O  O   . HOH G 4 .   ? -32.674 32.993 1.191   1.00 31.69  ? 587 HOH A O   1 
HETATM 3360 O  O   . HOH G 4 .   ? -31.090 31.182 1.269   1.00 37.50  ? 588 HOH A O   1 
HETATM 3361 O  O   . HOH G 4 .   ? -39.318 38.773 1.733   1.00 23.15  ? 589 HOH A O   1 
HETATM 3362 O  O   . HOH G 4 .   ? -74.292 15.406 10.118  1.00 38.99  ? 590 HOH A O   1 
HETATM 3363 O  O   . HOH G 4 .   ? -23.042 27.540 6.450   1.00 31.39  ? 591 HOH A O   1 
HETATM 3364 O  O   . HOH G 4 .   ? -42.799 7.782  12.488  1.00 34.28  ? 592 HOH A O   1 
HETATM 3365 O  O   . HOH G 4 .   ? -73.390 7.779  -8.163  1.00 42.72  ? 593 HOH A O   1 
HETATM 3366 O  O   . HOH G 4 .   ? -40.049 8.440  4.981   1.00 31.34  ? 594 HOH A O   1 
HETATM 3367 O  O   . HOH G 4 .   ? -39.672 10.994 3.744   1.00 24.88  ? 595 HOH A O   1 
HETATM 3368 O  O   . HOH G 4 .   ? -75.014 11.569 -2.637  1.00 31.16  ? 596 HOH A O   1 
HETATM 3369 O  O   . HOH G 4 .   ? -41.728 10.028 2.101   1.00 33.68  ? 597 HOH A O   1 
HETATM 3370 O  O   . HOH G 4 .   ? -81.848 15.069 -8.531  1.00 37.17  ? 598 HOH A O   1 
HETATM 3371 O  O   . HOH G 4 .   ? -22.652 38.182 3.552   1.00 24.88  ? 599 HOH A O   1 
HETATM 3372 O  O   . HOH G 4 .   ? -53.824 15.097 22.269  1.00 31.18  ? 600 HOH A O   1 
HETATM 3373 O  O   . HOH G 4 .   ? -66.246 36.765 18.382  1.00 29.56  ? 601 HOH A O   1 
HETATM 3374 O  O   . HOH G 4 .   ? -50.505 55.626 13.598  1.00 24.82  ? 602 HOH A O   1 
HETATM 3375 O  O   . HOH G 4 .   ? -49.259 54.698 11.302  1.00 16.96  ? 603 HOH A O   1 
HETATM 3376 O  O   . HOH G 4 .   ? -50.719 53.924 9.313   1.00 31.67  ? 604 HOH A O   1 
HETATM 3377 O  O   . HOH G 4 .   ? -53.507 52.098 5.679   1.00 36.38  ? 605 HOH A O   1 
HETATM 3378 O  O   . HOH G 4 .   ? -53.114 49.670 4.326   1.00 33.23  ? 606 HOH A O   1 
HETATM 3379 O  O   . HOH G 4 .   ? -56.979 43.982 18.805  1.00 35.25  ? 607 HOH A O   1 
HETATM 3380 O  O   . HOH G 4 .   ? -55.800 49.385 25.800  1.00 31.07  ? 608 HOH A O   1 
HETATM 3381 O  O   . HOH G 4 .   ? -47.363 52.207 24.926  1.00 31.46  ? 609 HOH A O   1 
HETATM 3382 O  O   . HOH G 4 .   ? -44.397 46.754 29.584  1.00 27.36  ? 610 HOH A O   1 
HETATM 3383 O  O   . HOH G 4 .   ? -52.022 19.860 4.209   1.00 40.33  ? 611 HOH A O   1 
HETATM 3384 O  O   . HOH G 4 .   ? -64.250 16.441 3.773   1.00 33.27  ? 612 HOH A O   1 
HETATM 3385 O  O   . HOH G 4 .   ? -80.792 14.391 -22.328 1.00 38.92  ? 613 HOH A O   1 
HETATM 3386 O  O   . HOH G 4 .   ? -86.003 12.663 -11.544 1.00 43.23  ? 614 HOH A O   1 
HETATM 3387 O  O   . HOH G 4 .   ? -48.239 47.947 0.333   0.50 21.08  ? 615 HOH A O   1 
HETATM 3388 O  O   . HOH G 4 .   ? -29.293 26.129 36.605  1.00 19.73  ? 616 HOH A O   1 
HETATM 3389 O  O   . HOH G 4 .   ? -40.155 16.405 38.001  0.50 21.99  ? 617 HOH A O   1 
HETATM 3390 O  O   . HOH G 4 .   ? -34.253 40.898 33.752  1.00 30.22  ? 618 HOH A O   1 
HETATM 3391 O  O   . HOH G 4 .   ? -69.990 26.401 30.678  1.00 18.59  ? 619 HOH A O   1 
HETATM 3392 O  O   . HOH G 4 .   ? -43.996 25.357 -1.119  1.00 15.32  ? 620 HOH A O   1 
HETATM 3393 O  O   . HOH G 4 .   ? -45.794 19.770 0.579   1.00 23.97  ? 621 HOH A O   1 
HETATM 3394 O  O   . HOH G 4 .   ? -54.249 45.848 18.275  1.00 14.84  ? 622 HOH A O   1 
HETATM 3395 O  O   . HOH G 4 .   ? -72.981 31.301 30.194  1.00 10.68  ? 623 HOH A O   1 
HETATM 3396 O  O   . HOH G 4 .   ? -83.487 12.608 -21.313 1.00 40.90  ? 624 HOH A O   1 
HETATM 3397 O  O   . HOH G 4 .   ? -89.123 13.738 -16.691 1.00 39.33  ? 625 HOH A O   1 
HETATM 3398 O  O   . HOH G 4 .   ? -24.296 30.903 36.570  1.00 51.09  ? 626 HOH A O   1 
HETATM 3399 O  O   . HOH G 4 .   ? -28.302 32.225 39.574  1.00 57.70  ? 627 HOH A O   1 
HETATM 3400 O  O   . HOH G 4 .   ? -54.070 50.017 15.150  1.00 16.65  ? 628 HOH A O   1 
HETATM 3401 O  O   . HOH G 4 .   ? -49.827 47.558 24.993  1.00 22.65  ? 629 HOH A O   1 
HETATM 3402 O  O   . HOH G 4 .   ? -68.363 27.058 2.696   1.00 20.52  ? 630 HOH A O   1 
HETATM 3403 O  O   . HOH G 4 .   ? -35.750 35.750 -0.000  0.50 28.06  ? 631 HOH A O   1 
HETATM 3404 O  O   . HOH G 4 .   ? -59.502 43.178 19.212  1.00 21.81  ? 632 HOH A O   1 
HETATM 3405 O  O   . HOH G 4 .   ? -59.290 43.887 21.564  1.00 27.53  ? 633 HOH A O   1 
HETATM 3406 O  O   . HOH G 4 .   ? -33.458 26.613 40.442  1.00 23.91  ? 634 HOH A O   1 
HETATM 3407 O  O   . HOH G 4 .   ? -72.374 14.151 -17.683 1.00 27.44  ? 635 HOH A O   1 
HETATM 3408 O  O   . HOH G 4 .   ? -55.525 45.098 20.882  1.00 32.14  ? 636 HOH A O   1 
HETATM 3409 O  O   . HOH G 4 .   ? -72.418 10.883 3.555   1.00 34.77  ? 637 HOH A O   1 
HETATM 3410 O  O   . HOH G 4 .   ? -40.692 23.098 20.137  1.00 25.61  ? 638 HOH A O   1 
HETATM 3411 O  O   . HOH G 4 .   ? -51.407 21.409 11.637  1.00 29.88  ? 639 HOH A O   1 
HETATM 3412 O  O   . HOH G 4 .   ? -37.774 37.778 0.002   0.50 26.87  ? 640 HOH A O   1 
HETATM 3413 O  O   . HOH G 4 .   ? -54.454 23.849 7.453   1.00 27.54  ? 641 HOH A O   1 
HETATM 3414 O  O   . HOH G 4 .   ? -40.859 19.053 21.184  1.00 43.36  ? 642 HOH A O   1 
HETATM 3415 O  O   . HOH G 4 .   ? -27.347 24.739 35.567  1.00 33.75  ? 643 HOH A O   1 
HETATM 3416 O  O   . HOH G 4 .   ? -34.242 20.834 21.812  1.00 32.29  ? 644 HOH A O   1 
HETATM 3417 O  O   . HOH G 4 .   ? -51.048 48.478 30.293  1.00 28.46  ? 645 HOH A O   1 
HETATM 3418 O  O   . HOH G 4 .   ? -56.563 26.183 11.756  1.00 36.64  ? 646 HOH A O   1 
HETATM 3419 O  O   . HOH G 4 .   ? -57.003 45.910 31.421  1.00 35.72  ? 647 HOH A O   1 
HETATM 3420 O  O   . HOH G 4 .   ? -53.228 49.579 28.842  1.00 36.95  ? 648 HOH A O   1 
HETATM 3421 O  O   . HOH G 4 .   ? -35.525 27.108 41.790  1.00 36.53  ? 649 HOH A O   1 
HETATM 3422 O  O   . HOH G 4 .   ? -48.588 54.246 24.334  1.00 42.76  ? 650 HOH A O   1 
HETATM 3423 O  O   . HOH G 4 .   ? -24.268 25.352 30.557  1.00 40.62  ? 651 HOH A O   1 
HETATM 3424 O  O   . HOH G 4 .   ? -57.495 34.734 42.134  1.00 44.38  ? 652 HOH A O   1 
HETATM 3425 O  O   . HOH G 4 .   ? -40.712 23.994 48.915  1.00 45.44  ? 653 HOH A O   1 
HETATM 3426 O  O   . HOH G 4 .   ? -22.217 39.957 18.210  1.00 31.73  ? 654 HOH A O   1 
HETATM 3427 O  O   . HOH G 4 .   ? -52.939 20.645 10.188  1.00 36.30  ? 655 HOH A O   1 
HETATM 3428 O  O   . HOH G 4 .   ? -42.200 22.465 20.374  1.00 29.90  ? 656 HOH A O   1 
HETATM 3429 O  O   . HOH G 4 .   ? -43.593 21.326 19.737  1.00 24.95  ? 657 HOH A O   1 
HETATM 3430 O  O   . HOH G 4 .   ? -44.951 21.380 21.111  1.00 24.24  ? 658 HOH A O   1 
HETATM 3431 O  O   . HOH G 4 .   ? -30.194 30.522 35.324  1.00 37.03  ? 659 HOH A O   1 
HETATM 3432 O  O   . HOH G 4 .   ? -66.914 25.580 19.851  1.00 36.46  ? 660 HOH A O   1 
HETATM 3433 O  O   . HOH G 4 .   ? -60.400 41.636 36.918  1.00 68.10  ? 661 HOH A O   1 
HETATM 3434 O  O   . HOH G 4 .   ? -64.539 42.006 35.705  1.00 44.80  ? 662 HOH A O   1 
HETATM 3435 O  O   . HOH G 4 .   ? -41.940 45.365 32.660  1.00 47.30  ? 663 HOH A O   1 
HETATM 3436 O  O   . HOH G 4 .   ? -63.813 43.008 28.001  1.00 34.72  ? 664 HOH A O   1 
HETATM 3437 O  O   . HOH G 4 .   ? -60.739 43.573 28.282  1.00 39.00  ? 665 HOH A O   1 
HETATM 3438 O  O   . HOH G 4 .   ? -46.072 51.070 27.037  1.00 45.29  ? 666 HOH A O   1 
HETATM 3439 O  O   . HOH G 4 .   ? -59.344 45.337 30.581  1.00 39.00  ? 667 HOH A O   1 
HETATM 3440 O  O   . HOH G 4 .   ? -55.273 30.642 42.646  1.00 36.91  ? 668 HOH A O   1 
HETATM 3441 O  O   . HOH G 4 .   ? -54.792 29.054 43.702  1.00 64.59  ? 669 HOH A O   1 
HETATM 3442 O  O   . HOH G 4 .   ? -55.481 29.019 45.395  1.00 52.91  ? 670 HOH A O   1 
HETATM 3443 O  O   . HOH G 4 .   ? -54.683 26.058 44.185  1.00 39.88  ? 671 HOH A O   1 
HETATM 3444 O  O   . HOH G 4 .   ? -51.347 25.717 44.499  1.00 38.84  ? 672 HOH A O   1 
HETATM 3445 O  O   . HOH G 4 .   ? -47.422 21.901 41.670  1.00 52.97  ? 673 HOH A O   1 
HETATM 3446 O  O   . HOH G 4 .   ? -51.620 17.921 37.023  1.00 38.30  ? 674 HOH A O   1 
HETATM 3447 O  O   . HOH G 4 .   ? -52.851 32.108 46.625  1.00 42.19  ? 675 HOH A O   1 
HETATM 3448 O  O   . HOH G 4 .   ? -44.725 35.096 47.344  1.00 42.85  ? 676 HOH A O   1 
HETATM 3449 O  O   . HOH G 4 .   ? -47.022 34.638 48.059  1.00 46.82  ? 677 HOH A O   1 
HETATM 3450 O  O   . HOH G 4 .   ? -35.427 16.925 28.632  1.00 47.65  ? 678 HOH A O   1 
HETATM 3451 O  O   . HOH G 4 .   ? -39.384 20.888 23.904  1.00 33.48  ? 679 HOH A O   1 
HETATM 3452 O  O   . HOH G 4 .   ? -41.462 19.760 25.304  1.00 31.00  ? 680 HOH A O   1 
HETATM 3453 O  O   . HOH G 4 .   ? -42.645 20.561 23.064  1.00 46.49  ? 681 HOH A O   1 
HETATM 3454 O  O   . HOH G 4 .   ? -38.011 14.497 30.476  1.00 49.67  ? 682 HOH A O   1 
HETATM 3455 O  O   . HOH G 4 .   ? -49.039 20.076 40.090  1.00 92.28  ? 683 HOH A O   1 
HETATM 3456 O  O   . HOH G 4 .   ? -46.366 20.155 39.827  1.00 30.18  ? 684 HOH A O   1 
HETATM 3457 O  O   . HOH G 4 .   ? -59.977 21.709 40.059  1.00 38.33  ? 685 HOH A O   1 
HETATM 3458 O  O   . HOH G 4 .   ? -60.783 22.948 41.850  1.00 40.32  ? 686 HOH A O   1 
HETATM 3459 O  O   . HOH G 4 .   ? -69.406 24.675 32.623  1.00 44.36  ? 687 HOH A O   1 
HETATM 3460 O  O   . HOH G 4 .   ? -69.084 25.222 28.569  1.00 41.46  ? 688 HOH A O   1 
HETATM 3461 O  O   . HOH G 4 .   ? -59.493 14.541 26.760  1.00 48.32  ? 689 HOH A O   1 
HETATM 3462 O  O   . HOH G 4 .   ? -71.149 19.109 24.856  1.00 44.90  ? 690 HOH A O   1 
HETATM 3463 O  O   . HOH G 4 .   ? -33.064 23.977 33.116  1.00 27.73  ? 691 HOH A O   1 
HETATM 3464 O  O   . HOH G 4 .   ? -45.730 14.644 31.367  1.00 64.03  ? 692 HOH A O   1 
HETATM 3465 O  O   . HOH G 4 .   ? -43.775 15.508 30.611  1.00 53.87  ? 693 HOH A O   1 
HETATM 3466 O  O   . HOH G 4 .   ? -48.490 19.783 28.647  1.00 54.81  ? 694 HOH A O   1 
HETATM 3467 O  O   . HOH G 4 .   ? -55.597 20.918 41.724  1.00 46.73  ? 695 HOH A O   1 
HETATM 3468 O  O   . HOH G 4 .   ? -63.453 19.980 35.023  1.00 55.13  ? 696 HOH A O   1 
HETATM 3469 O  O   . HOH G 4 .   ? -33.551 41.505 41.105  1.00 54.68  ? 697 HOH A O   1 
HETATM 3470 O  O   . HOH G 4 .   ? -61.913 14.649 28.518  1.00 43.00  ? 698 HOH A O   1 
HETATM 3471 O  O   . HOH G 4 .   ? -24.087 36.120 23.613  1.00 37.68  ? 699 HOH A O   1 
HETATM 3472 O  O   . HOH G 4 .   ? -65.519 20.014 16.197  1.00 45.57  ? 700 HOH A O   1 
HETATM 3473 O  O   . HOH G 4 .   ? -66.365 20.092 14.156  1.00 44.71  ? 701 HOH A O   1 
HETATM 3474 O  O   . HOH G 4 .   ? -68.018 19.227 11.574  1.00 75.80  ? 702 HOH A O   1 
HETATM 3475 O  O   . HOH G 4 .   ? -65.833 17.343 11.060  1.00 51.43  ? 703 HOH A O   1 
HETATM 3476 O  O   . HOH G 4 .   ? -65.893 14.204 7.217   1.00 37.37  ? 704 HOH A O   1 
HETATM 3477 O  O   . HOH G 4 .   ? -51.683 17.045 25.544  1.00 39.18  ? 705 HOH A O   1 
HETATM 3478 O  O   . HOH G 4 .   ? -49.093 19.081 26.280  1.00 41.47  ? 706 HOH A O   1 
HETATM 3479 O  O   . HOH G 4 .   ? -50.741 14.618 19.240  1.00 39.02  ? 707 HOH A O   1 
HETATM 3480 O  O   . HOH G 4 .   ? -53.642 16.601 17.572  1.00 36.48  ? 708 HOH A O   1 
HETATM 3481 O  O   . HOH G 4 .   ? -50.477 20.107 14.079  1.00 37.14  ? 709 HOH A O   1 
HETATM 3482 O  O   . HOH G 4 .   ? -52.300 21.118 14.070  1.00 43.68  ? 710 HOH A O   1 
HETATM 3483 O  O   . HOH G 4 .   ? -24.486 26.106 25.685  1.00 39.57  ? 711 HOH A O   1 
HETATM 3484 O  O   . HOH G 4 .   ? -24.950 25.158 21.958  1.00 45.67  ? 712 HOH A O   1 
HETATM 3485 O  O   . HOH G 4 .   ? -28.559 22.103 20.767  1.00 40.43  ? 713 HOH A O   1 
HETATM 3486 O  O   . HOH G 4 .   ? -31.930 20.190 22.215  1.00 42.78  ? 714 HOH A O   1 
HETATM 3487 O  O   . HOH G 4 .   ? -23.223 34.108 24.871  1.00 32.01  ? 715 HOH A O   1 
HETATM 3488 O  O   . HOH G 4 .   ? -56.224 24.653 9.437   1.00 42.50  ? 716 HOH A O   1 
HETATM 3489 O  O   . HOH G 4 .   ? -29.951 40.441 4.749   1.00 22.61  ? 717 HOH A O   1 
HETATM 3490 O  O   . HOH G 4 .   ? -28.716 42.926 4.568   1.00 21.33  ? 718 HOH A O   1 
HETATM 3491 O  O   . HOH G 4 .   ? -39.483 41.710 5.487   1.00 34.64  ? 719 HOH A O   1 
HETATM 3492 O  O   . HOH G 4 .   ? -69.609 41.663 -2.049  1.00 20.31  ? 720 HOH A O   1 
HETATM 3493 O  O   . HOH G 4 .   ? -18.015 36.707 13.559  1.00 54.54  ? 721 HOH A O   1 
HETATM 3494 O  O   . HOH G 4 .   ? -22.299 34.879 18.363  1.00 43.21  ? 722 HOH A O   1 
HETATM 3495 O  O   . HOH G 4 .   ? -22.158 33.265 20.671  1.00 41.25  ? 723 HOH A O   1 
HETATM 3496 O  O   . HOH G 4 .   ? -20.552 28.430 11.321  1.00 58.53  ? 724 HOH A O   1 
HETATM 3497 O  O   . HOH G 4 .   ? -20.133 31.516 6.648   1.00 46.68  ? 725 HOH A O   1 
HETATM 3498 O  O   . HOH G 4 .   ? -45.444 7.232  9.378   1.00 40.75  ? 726 HOH A O   1 
HETATM 3499 O  O   . HOH G 4 .   ? -43.115 5.411  6.047   1.00 49.31  ? 727 HOH A O   1 
HETATM 3500 O  O   . HOH G 4 .   ? -29.202 19.104 4.635   1.00 74.96  ? 728 HOH A O   1 
HETATM 3501 O  O   . HOH G 4 .   ? -31.322 20.582 -0.172  1.00 37.27  ? 729 HOH A O   1 
HETATM 3502 O  O   . HOH G 4 .   ? -32.726 22.134 -1.284  1.00 39.91  ? 730 HOH A O   1 
HETATM 3503 O  O   . HOH G 4 .   ? -42.531 14.102 17.960  1.00 40.14  ? 731 HOH A O   1 
HETATM 3504 O  O   . HOH G 4 .   ? -90.634 24.501 -11.826 1.00 45.14  ? 732 HOH A O   1 
HETATM 3505 O  O   . HOH G 4 .   ? -21.371 25.894 8.000   1.00 45.07  ? 733 HOH A O   1 
HETATM 3506 O  O   . HOH G 4 .   ? -21.506 23.602 19.923  1.00 44.38  ? 734 HOH A O   1 
HETATM 3507 O  O   . HOH G 4 .   ? -62.244 7.491  15.312  1.00 59.48  ? 735 HOH A O   1 
HETATM 3508 O  O   . HOH G 4 .   ? -57.404 8.944  17.187  1.00 73.96  ? 736 HOH A O   1 
HETATM 3509 O  O   . HOH G 4 .   ? -59.431 15.500 7.632   1.00 47.92  ? 737 HOH A O   1 
HETATM 3510 O  O   . HOH G 4 .   ? -62.482 18.495 12.829  1.00 39.98  ? 738 HOH A O   1 
HETATM 3511 O  O   . HOH G 4 .   ? -62.907 16.912 14.698  1.00 65.59  ? 739 HOH A O   1 
HETATM 3512 O  O   . HOH G 4 .   ? -59.094 21.063 11.263  1.00 39.90  ? 740 HOH A O   1 
HETATM 3513 O  O   . HOH G 4 .   ? -61.438 15.367 4.974   1.00 65.90  ? 741 HOH A O   1 
HETATM 3514 O  O   . HOH G 4 .   ? -55.710 20.847 10.076  1.00 54.10  ? 742 HOH A O   1 
HETATM 3515 O  O   . HOH G 4 .   ? -55.717 47.715 22.310  1.00 37.04  ? 743 HOH A O   1 
HETATM 3516 O  O   . HOH G 4 .   ? -46.347 53.113 22.358  1.00 42.07  ? 744 HOH A O   1 
HETATM 3517 O  O   . HOH G 4 .   ? -51.997 51.335 26.917  1.00 49.92  ? 745 HOH A O   1 
HETATM 3518 O  O   . HOH G 4 .   ? -52.012 53.140 21.552  1.00 40.39  ? 746 HOH A O   1 
HETATM 3519 O  O   . HOH G 4 .   ? -46.170 47.121 37.044  1.00 45.27  ? 747 HOH A O   1 
HETATM 3520 O  O   . HOH G 4 .   ? -50.808 46.659 39.510  1.00 52.02  ? 748 HOH A O   1 
HETATM 3521 O  O   . HOH G 4 .   ? -30.543 38.007 39.001  1.00 72.54  ? 749 HOH A O   1 
HETATM 3522 O  O   . HOH G 4 .   ? -31.258 36.611 41.220  1.00 39.83  ? 750 HOH A O   1 
HETATM 3523 O  O   . HOH G 4 .   ? -22.449 24.939 33.801  1.00 75.57  ? 751 HOH A O   1 
HETATM 3524 O  O   . HOH G 4 .   ? -23.823 26.731 33.921  1.00 51.10  ? 752 HOH A O   1 
HETATM 3525 O  O   . HOH G 4 .   ? -50.444 54.572 17.391  1.00 36.66  ? 753 HOH A O   1 
HETATM 3526 O  O   . HOH G 4 .   ? -51.935 54.210 19.672  1.00 55.88  ? 754 HOH A O   1 
HETATM 3527 O  O   . HOH G 4 .   ? -48.699 55.444 19.726  1.00 54.47  ? 755 HOH A O   1 
HETATM 3528 O  O   . HOH G 4 .   ? -57.560 50.621 7.137   1.00 62.97  ? 756 HOH A O   1 
HETATM 3529 O  O   . HOH G 4 .   ? -58.052 45.920 0.569   1.00 39.23  ? 757 HOH A O   1 
HETATM 3530 O  O   . HOH G 4 .   ? -58.741 26.706 0.261   1.00 30.25  ? 758 HOH A O   1 
HETATM 3531 O  O   . HOH G 4 .   ? -50.228 17.042 2.362   1.00 43.22  ? 759 HOH A O   1 
HETATM 3532 O  O   . HOH G 4 .   ? -74.454 12.051 7.307   1.00 58.45  ? 760 HOH A O   1 
HETATM 3533 O  O   . HOH G 4 .   ? -69.429 11.264 3.230   1.00 42.10  ? 761 HOH A O   1 
HETATM 3534 O  O   . HOH G 4 .   ? -68.044 13.414 3.066   1.00 44.87  ? 762 HOH A O   1 
HETATM 3535 O  O   . HOH G 4 .   ? -45.965 13.078 -0.468  1.00 43.23  ? 763 HOH A O   1 
HETATM 3536 O  O   . HOH G 4 .   ? -70.167 9.792  0.663   1.00 52.79  ? 764 HOH A O   1 
HETATM 3537 O  O   . HOH G 4 .   ? -73.261 9.138  1.434   1.00 51.86  ? 765 HOH A O   1 
HETATM 3538 O  O   . HOH G 4 .   ? -78.453 14.123 5.357   1.00 35.72  ? 766 HOH A O   1 
HETATM 3539 O  O   . HOH G 4 .   ? -80.816 15.901 -5.063  1.00 48.34  ? 767 HOH A O   1 
HETATM 3540 O  O   . HOH G 4 .   ? -75.724 8.694  -2.289  1.00 44.37  ? 768 HOH A O   1 
HETATM 3541 O  O   . HOH G 4 .   ? -71.998 3.815  -12.742 1.00 56.68  ? 769 HOH A O   1 
HETATM 3542 O  O   . HOH G 4 .   ? -72.755 6.276  -16.391 1.00 45.78  ? 770 HOH A O   1 
HETATM 3543 O  O   . HOH G 4 .   ? -78.446 16.837 -22.935 1.00 50.00  ? 771 HOH A O   1 
HETATM 3544 O  O   . HOH G 4 .   ? -78.830 9.272  -15.274 1.00 46.04  ? 772 HOH A O   1 
HETATM 3545 O  O   . HOH G 4 .   ? -89.333 11.389 -14.563 1.00 100.12 ? 773 HOH A O   1 
HETATM 3546 O  O   . HOH G 4 .   ? -24.306 19.139 7.938   1.00 47.45  ? 774 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . MET A 1   ? 0.3065 0.4088 0.2652 -0.0438 -0.0636 0.0056  1   MET A N   
2    C  CA  . MET A 1   ? 0.2398 0.3459 0.2482 0.0019  -0.0783 0.0131  1   MET A CA  
3    C  C   . MET A 1   ? 0.1982 0.2702 0.1997 0.0056  -0.0766 0.0336  1   MET A C   
4    O  O   . MET A 1   ? 0.2100 0.2894 0.2093 -0.0072 -0.0160 0.0615  1   MET A O   
5    C  CB  . MET A 1   ? 0.2927 0.3267 0.2520 0.0166  -0.0631 0.0149  1   MET A CB  
6    C  CG  . MET A 1   ? 0.3112 0.3348 0.3032 0.0602  -0.0580 -0.0051 1   MET A CG  
7    S  SD  . MET A 1   ? 0.4703 0.4009 0.3174 0.1008  -0.0389 0.0394  1   MET A SD  
8    C  CE  . MET A 1   ? 0.2792 0.2331 0.2562 -0.0014 -0.0038 0.0532  1   MET A CE  
9    N  N   . ARG A 2   ? 0.1930 0.2322 0.2028 0.0173  -0.0775 0.0624  2   ARG A N   
10   C  CA  . ARG A 2   ? 0.1989 0.2186 0.1726 0.0148  -0.0524 0.0562  2   ARG A CA  
11   C  C   . ARG A 2   ? 0.1894 0.1984 0.1646 0.0184  -0.0334 0.0735  2   ARG A C   
12   O  O   . ARG A 2   ? 0.2288 0.2913 0.1612 0.0643  -0.0382 0.0847  2   ARG A O   
13   C  CB  . ARG A 2   ? 0.2035 0.2166 0.2216 0.0410  -0.0113 0.0942  2   ARG A CB  
14   C  CG  . ARG A 2   ? 0.2581 0.2777 0.2821 0.0425  -0.0242 0.0811  2   ARG A CG  
15   C  CD  . ARG A 2   ? 0.2962 0.3006 0.3726 0.0829  0.0056  0.0585  2   ARG A CD  
16   N  NE  . ARG A 2   ? 0.4140 0.3485 0.3095 0.1320  -0.0173 0.0476  2   ARG A NE  
17   C  CZ  . ARG A 2   ? 0.4044 0.3147 0.3757 0.1642  0.0012  -0.0251 2   ARG A CZ  
18   N  NH1 . ARG A 2   ? 0.5332 0.3398 0.4280 0.1159  0.0492  0.0910  2   ARG A NH1 
19   N  NH2 . ARG A 2   ? 0.4185 0.4418 0.2775 0.2403  -0.0360 0.0360  2   ARG A NH2 
20   N  N   . VAL A 3   ? 0.1611 0.2048 0.1233 0.0158  -0.0773 0.0509  3   VAL A N   
21   C  CA  A VAL A 3   ? 0.1517 0.1790 0.1215 0.0052  -0.0461 0.0250  3   VAL A CA  
22   C  CA  B VAL A 3   ? 0.1633 0.1856 0.1253 0.0057  -0.0513 0.0245  3   VAL A CA  
23   C  C   . VAL A 3   ? 0.1247 0.1354 0.0994 0.0005  -0.0419 0.0281  3   VAL A C   
24   O  O   . VAL A 3   ? 0.1360 0.1691 0.1239 0.0122  -0.0352 0.0268  3   VAL A O   
25   C  CB  A VAL A 3   ? 0.1499 0.1733 0.1399 -0.0085 -0.0573 -0.0036 3   VAL A CB  
26   C  CB  B VAL A 3   ? 0.1625 0.1808 0.1537 -0.0148 -0.0608 0.0010  3   VAL A CB  
27   C  CG1 A VAL A 3   ? 0.1994 0.2005 0.1711 0.0137  -0.0444 0.0351  3   VAL A CG1 
28   C  CG1 B VAL A 3   ? 0.2695 0.1939 0.2281 0.0191  -0.0529 -0.0507 3   VAL A CG1 
29   C  CG2 A VAL A 3   ? 0.1404 0.1484 0.2280 0.0030  0.0076  -0.0644 3   VAL A CG2 
30   C  CG2 B VAL A 3   ? 0.2125 0.1961 0.1842 0.0136  -0.0411 0.0259  3   VAL A CG2 
31   N  N   . THR A 4   ? 0.1354 0.1542 0.1021 0.0105  -0.0464 0.0462  4   THR A N   
32   C  CA  . THR A 4   ? 0.1349 0.1318 0.1378 0.0163  -0.0455 0.0315  4   THR A CA  
33   C  C   . THR A 4   ? 0.1322 0.1310 0.0953 0.0147  -0.0177 0.0173  4   THR A C   
34   O  O   . THR A 4   ? 0.1464 0.1366 0.1009 0.0362  -0.0487 0.0192  4   THR A O   
35   C  CB  . THR A 4   ? 0.1234 0.1355 0.1913 0.0287  -0.0362 0.0458  4   THR A CB  
36   O  OG1 . THR A 4   ? 0.1433 0.1315 0.2638 0.0353  -0.0280 0.0508  4   THR A OG1 
37   C  CG2 . THR A 4   ? 0.1502 0.1454 0.1925 -0.0017 -0.0647 0.0037  4   THR A CG2 
38   N  N   . VAL A 5   ? 0.1275 0.1445 0.0861 0.0173  -0.0400 0.0235  5   VAL A N   
39   C  CA  . VAL A 5   ? 0.1260 0.1145 0.1064 0.0013  -0.0256 0.0171  5   VAL A CA  
40   C  C   . VAL A 5   ? 0.1214 0.1098 0.0922 0.0311  -0.0428 0.0361  5   VAL A C   
41   O  O   . VAL A 5   ? 0.1295 0.1362 0.1021 0.0219  -0.0398 0.0305  5   VAL A O   
42   C  CB  . VAL A 5   ? 0.1503 0.1315 0.1115 -0.0048 -0.0336 0.0214  5   VAL A CB  
43   C  CG1 . VAL A 5   ? 0.1735 0.1273 0.1389 0.0630  -0.0330 0.0368  5   VAL A CG1 
44   C  CG2 . VAL A 5   ? 0.1759 0.1377 0.1511 -0.0370 -0.0554 0.0234  5   VAL A CG2 
45   N  N   . SER A 6   ? 0.1249 0.1158 0.0987 0.0292  -0.0340 0.0140  6   SER A N   
46   C  CA  . SER A 6   ? 0.1312 0.1199 0.1121 0.0303  -0.0338 0.0207  6   SER A CA  
47   C  C   . SER A 6   ? 0.1359 0.1219 0.1077 0.0237  -0.0363 0.0070  6   SER A C   
48   O  O   . SER A 6   ? 0.1387 0.1685 0.1280 0.0401  -0.0583 0.0004  6   SER A O   
49   C  CB  . SER A 6   ? 0.1339 0.1386 0.1190 0.0283  -0.0410 0.0307  6   SER A CB  
50   O  OG  . SER A 6   ? 0.1412 0.1466 0.1210 0.0287  -0.0626 0.0289  6   SER A OG  
51   N  N   . ILE A 7   ? 0.1157 0.1088 0.1063 0.0162  -0.0367 0.0150  7   ILE A N   
52   C  CA  . ILE A 7   ? 0.1147 0.1175 0.1012 0.0124  -0.0299 0.0240  7   ILE A CA  
53   C  C   . ILE A 7   ? 0.1146 0.1154 0.1137 0.0288  -0.0338 0.0283  7   ILE A C   
54   O  O   . ILE A 7   ? 0.1183 0.1270 0.1224 0.0194  -0.0277 0.0090  7   ILE A O   
55   C  CB  . ILE A 7   ? 0.1320 0.1062 0.0930 0.0161  -0.0060 0.0160  7   ILE A CB  
56   C  CG1 . ILE A 7   ? 0.1454 0.1160 0.1228 0.0249  -0.0270 0.0202  7   ILE A CG1 
57   C  CG2 . ILE A 7   ? 0.1205 0.1445 0.1319 0.0597  -0.0393 0.0258  7   ILE A CG2 
58   C  CD1 . ILE A 7   ? 0.2053 0.1145 0.1250 0.0215  -0.0104 0.0555  7   ILE A CD1 
59   N  N   . ILE A 8   ? 0.1325 0.1292 0.0922 0.0115  -0.0279 0.0103  8   ILE A N   
60   C  CA  . ILE A 8   ? 0.1414 0.1114 0.1011 0.0088  -0.0265 0.0168  8   ILE A CA  
61   C  C   . ILE A 8   ? 0.1294 0.1146 0.1084 0.0281  -0.0151 0.0146  8   ILE A C   
62   O  O   . ILE A 8   ? 0.1275 0.1111 0.1101 0.0254  -0.0292 0.0202  8   ILE A O   
63   C  CB  . ILE A 8   ? 0.1244 0.1515 0.1125 0.0062  -0.0310 0.0341  8   ILE A CB  
64   C  CG1 . ILE A 8   ? 0.1514 0.1845 0.1472 0.0210  -0.0518 0.0311  8   ILE A CG1 
65   C  CG2 . ILE A 8   ? 0.1572 0.1350 0.1681 0.0123  -0.0315 0.0489  8   ILE A CG2 
66   C  CD1 . ILE A 8   ? 0.2036 0.1830 0.1998 0.0657  -0.0391 0.0943  8   ILE A CD1 
67   N  N   . LYS A 9   ? 0.1221 0.1077 0.1160 0.0136  -0.0258 0.0156  9   LYS A N   
68   C  CA  A LYS A 9   ? 0.1262 0.1075 0.0977 0.0095  -0.0327 0.0353  9   LYS A CA  
69   C  CA  B LYS A 9   ? 0.1225 0.1051 0.0995 0.0077  -0.0355 0.0348  9   LYS A CA  
70   C  C   . LYS A 9   ? 0.1083 0.1049 0.0976 0.0211  -0.0381 0.0339  9   LYS A C   
71   O  O   . LYS A 9   ? 0.1365 0.1104 0.1247 0.0207  -0.0299 0.0297  9   LYS A O   
72   C  CB  A LYS A 9   ? 0.1371 0.0996 0.1058 0.0140  -0.0232 0.0239  9   LYS A CB  
73   C  CB  B LYS A 9   ? 0.1211 0.0970 0.1113 -0.0012 -0.0324 0.0210  9   LYS A CB  
74   C  CG  A LYS A 9   ? 0.1325 0.1502 0.1282 0.0172  -0.0436 0.0355  9   LYS A CG  
75   C  CG  B LYS A 9   ? 0.1149 0.1154 0.1098 0.0216  -0.0494 0.0382  9   LYS A CG  
76   C  CD  A LYS A 9   ? 0.1906 0.2470 0.1423 0.0072  0.0384  0.0016  9   LYS A CD  
77   C  CD  B LYS A 9   ? 0.1005 0.1238 0.1244 -0.0062 -0.0258 0.0359  9   LYS A CD  
78   C  CE  A LYS A 9   ? 0.2174 0.1522 0.2147 0.0128  0.0203  -0.0460 9   LYS A CE  
79   C  CE  B LYS A 9   ? 0.1390 0.1062 0.1103 -0.0102 -0.0583 0.0180  9   LYS A CE  
80   N  NZ  A LYS A 9   ? 0.1703 0.2023 0.0975 0.0116  -0.0268 0.0638  9   LYS A NZ  
81   N  NZ  B LYS A 9   ? 0.1479 0.1262 0.1072 -0.0221 -0.0292 0.0063  9   LYS A NZ  
82   N  N   . ALA A 10  ? 0.1115 0.0824 0.1049 0.0064  -0.0269 0.0301  10  ALA A N   
83   C  CA  . ALA A 10  ? 0.1199 0.0946 0.1161 0.0011  -0.0141 0.0268  10  ALA A CA  
84   C  C   . ALA A 10  ? 0.1134 0.0944 0.1023 0.0026  -0.0096 0.0200  10  ALA A C   
85   O  O   . ALA A 10  ? 0.1242 0.1105 0.1184 0.0049  -0.0182 0.0229  10  ALA A O   
86   C  CB  . ALA A 10  ? 0.1768 0.1119 0.1631 -0.0121 -0.0185 0.0707  10  ALA A CB  
87   N  N   . ASP A 11  ? 0.1206 0.0959 0.1129 0.0015  -0.0133 0.0221  11  ASP A N   
88   C  CA  . ASP A 11  ? 0.1192 0.1124 0.1093 0.0079  -0.0133 0.0345  11  ASP A CA  
89   C  C   . ASP A 11  ? 0.1176 0.0947 0.1050 0.0161  -0.0154 0.0168  11  ASP A C   
90   O  O   . ASP A 11  ? 0.1458 0.1254 0.1355 -0.0036 -0.0048 0.0260  11  ASP A O   
91   C  CB  . ASP A 11  ? 0.1115 0.1179 0.1180 0.0136  -0.0096 0.0276  11  ASP A CB  
92   C  CG  . ASP A 11  ? 0.1241 0.1285 0.1145 0.0044  -0.0058 0.0391  11  ASP A CG  
93   O  OD1 . ASP A 11  ? 0.1212 0.1436 0.1144 0.0101  -0.0140 0.0417  11  ASP A OD1 
94   O  OD2 . ASP A 11  ? 0.1244 0.1136 0.1179 0.0082  -0.0127 0.0390  11  ASP A OD2 
95   N  N   . VAL A 12  ? 0.1324 0.1126 0.1133 0.0071  0.0029  0.0247  12  VAL A N   
96   C  CA  . VAL A 12  ? 0.1269 0.1314 0.1055 0.0067  0.0089  0.0511  12  VAL A CA  
97   C  C   . VAL A 12  ? 0.1337 0.1406 0.1231 0.0115  0.0258  0.0535  12  VAL A C   
98   O  O   . VAL A 12  ? 0.1427 0.1593 0.1335 0.0272  0.0173  0.0731  12  VAL A O   
99   C  CB  . VAL A 12  ? 0.1663 0.1723 0.1043 0.0208  -0.0026 0.0552  12  VAL A CB  
100  C  CG1 . VAL A 12  ? 0.1691 0.1799 0.1586 0.0555  -0.0006 0.0715  12  VAL A CG1 
101  C  CG2 . VAL A 12  ? 0.2016 0.2360 0.1083 0.0249  -0.0373 0.0145  12  VAL A CG2 
102  N  N   . GLY A 13  ? 0.1322 0.1431 0.1066 0.0092  0.0107  0.0486  13  GLY A N   
103  C  CA  . GLY A 13  ? 0.1281 0.1235 0.1541 -0.0102 0.0011  0.0501  13  GLY A CA  
104  C  C   . GLY A 13  ? 0.1134 0.1105 0.1215 0.0020  -0.0013 0.0442  13  GLY A C   
105  O  O   . GLY A 13  ? 0.1226 0.1364 0.1320 0.0032  -0.0181 0.0455  13  GLY A O   
106  N  N   . GLY A 14  ? 0.1073 0.1215 0.1325 -0.0009 -0.0119 0.0504  14  GLY A N   
107  C  CA  . GLY A 14  ? 0.1306 0.1122 0.1168 -0.0061 -0.0166 0.0473  14  GLY A CA  
108  C  C   . GLY A 14  ? 0.1184 0.1194 0.1033 0.0097  -0.0036 0.0437  14  GLY A C   
109  O  O   . GLY A 14  ? 0.1292 0.1284 0.1324 0.0074  0.0008  0.0504  14  GLY A O   
110  N  N   . PHE A 15  ? 0.1502 0.1165 0.1063 0.0009  0.0136  0.0539  15  PHE A N   
111  C  CA  . PHE A 15  ? 0.1219 0.1217 0.1088 -0.0026 0.0179  0.0335  15  PHE A CA  
112  C  C   . PHE A 15  ? 0.0993 0.1130 0.1211 -0.0062 0.0058  0.0134  15  PHE A C   
113  O  O   . PHE A 15  ? 0.1415 0.1387 0.1230 -0.0125 0.0138  0.0322  15  PHE A O   
114  C  CB  . PHE A 15  ? 0.1448 0.1263 0.1159 0.0094  0.0070  0.0366  15  PHE A CB  
115  C  CG  . PHE A 15  ? 0.1357 0.1341 0.1034 0.0181  -0.0018 0.0324  15  PHE A CG  
116  C  CD1 . PHE A 15  ? 0.1552 0.1419 0.1141 0.0088  0.0042  0.0196  15  PHE A CD1 
117  C  CD2 . PHE A 15  ? 0.1530 0.1279 0.0967 0.0181  0.0004  0.0408  15  PHE A CD2 
118  C  CE1 . PHE A 15  ? 0.1341 0.1857 0.1189 0.0114  0.0025  0.0013  15  PHE A CE1 
119  C  CE2 . PHE A 15  ? 0.1599 0.1367 0.1160 0.0206  -0.0003 0.0176  15  PHE A CE2 
120  C  CZ  . PHE A 15  ? 0.1615 0.1498 0.1296 0.0392  0.0049  0.0255  15  PHE A CZ  
121  N  N   . PRO A 16  ? 0.1313 0.1061 0.0992 -0.0001 0.0076  0.0319  16  PRO A N   
122  C  CA  . PRO A 16  ? 0.1092 0.1080 0.0917 0.0047  0.0136  0.0213  16  PRO A CA  
123  C  C   . PRO A 16  ? 0.1184 0.1027 0.0898 0.0031  0.0021  0.0322  16  PRO A C   
124  O  O   . PRO A 16  ? 0.1288 0.1077 0.1063 -0.0039 0.0189  0.0374  16  PRO A O   
125  C  CB  . PRO A 16  ? 0.1222 0.1478 0.1204 0.0159  0.0074  0.0356  16  PRO A CB  
126  C  CG  . PRO A 16  ? 0.1488 0.1309 0.1214 0.0340  0.0168  0.0418  16  PRO A CG  
127  C  CD  . PRO A 16  ? 0.1805 0.0994 0.1047 0.0143  0.0003  0.0321  16  PRO A CD  
128  N  N   . GLY A 17  ? 0.1201 0.0965 0.1154 -0.0073 0.0179  0.0282  17  GLY A N   
129  C  CA  . GLY A 17  ? 0.1123 0.1018 0.0994 -0.0093 -0.0004 0.0304  17  GLY A CA  
130  C  C   . GLY A 17  ? 0.0888 0.1157 0.0972 -0.0004 -0.0158 0.0215  17  GLY A C   
131  O  O   . GLY A 17  ? 0.1185 0.1320 0.1182 -0.0126 -0.0028 0.0430  17  GLY A O   
132  N  N   . HIS A 18  ? 0.0968 0.1045 0.0823 0.0138  -0.0051 0.0252  18  HIS A N   
133  C  CA  . HIS A 18  ? 0.1051 0.1062 0.0930 0.0154  -0.0160 0.0188  18  HIS A CA  
134  C  C   . HIS A 18  ? 0.0935 0.1053 0.0874 0.0122  0.0000  0.0130  18  HIS A C   
135  O  O   . HIS A 18  ? 0.1008 0.1190 0.1075 0.0039  -0.0089 0.0275  18  HIS A O   
136  C  CB  . HIS A 18  ? 0.1025 0.1063 0.0876 0.0076  -0.0191 0.0126  18  HIS A CB  
137  C  CG  . HIS A 18  ? 0.0940 0.1013 0.1023 0.0075  -0.0248 0.0339  18  HIS A CG  
138  N  ND1 . HIS A 18  ? 0.1068 0.1130 0.1067 0.0009  -0.0150 0.0264  18  HIS A ND1 
139  C  CD2 . HIS A 18  ? 0.1074 0.1148 0.0981 0.0113  -0.0090 0.0437  18  HIS A CD2 
140  C  CE1 . HIS A 18  ? 0.1215 0.0996 0.1158 -0.0033 -0.0144 0.0375  18  HIS A CE1 
141  N  NE2 . HIS A 18  ? 0.1083 0.1323 0.1174 0.0087  0.0058  0.0494  18  HIS A NE2 
142  N  N   . ALA A 19  ? 0.1027 0.0955 0.0777 -0.0030 0.0018  0.0308  19  ALA A N   
143  C  CA  . ALA A 19  ? 0.1144 0.1009 0.0742 -0.0200 0.0051  0.0294  19  ALA A CA  
144  C  C   . ALA A 19  ? 0.0868 0.1144 0.0982 -0.0221 0.0037  0.0287  19  ALA A C   
145  O  O   . ALA A 19  ? 0.1121 0.1262 0.0867 -0.0306 -0.0033 0.0286  19  ALA A O   
146  C  CB  . ALA A 19  ? 0.1153 0.1027 0.1366 -0.0003 -0.0082 0.0239  19  ALA A CB  
147  N  N   . HIS A 20  ? 0.1167 0.1048 0.0936 -0.0068 0.0015  0.0405  20  HIS A N   
148  C  CA  . HIS A 20  ? 0.1000 0.1050 0.1060 -0.0093 -0.0022 0.0285  20  HIS A CA  
149  C  C   . HIS A 20  ? 0.1027 0.1086 0.0940 -0.0215 -0.0231 0.0222  20  HIS A C   
150  O  O   . HIS A 20  ? 0.1181 0.1195 0.0987 -0.0132 -0.0108 0.0410  20  HIS A O   
151  C  CB  . HIS A 20  ? 0.1151 0.1150 0.0888 -0.0063 -0.0060 0.0324  20  HIS A CB  
152  C  CG  . HIS A 20  ? 0.1279 0.1051 0.0821 -0.0147 -0.0140 0.0298  20  HIS A CG  
153  N  ND1 . HIS A 20  ? 0.1246 0.1357 0.1101 -0.0133 -0.0142 -0.0069 20  HIS A ND1 
154  C  CD2 . HIS A 20  ? 0.1158 0.1171 0.0690 -0.0040 -0.0091 0.0006  20  HIS A CD2 
155  C  CE1 . HIS A 20  ? 0.1389 0.1306 0.1248 -0.0127 -0.0051 -0.0227 20  HIS A CE1 
156  N  NE2 . HIS A 20  ? 0.1395 0.1189 0.0901 -0.0027 0.0125  -0.0071 20  HIS A NE2 
157  N  N   . VAL A 21  ? 0.1516 0.1270 0.0950 -0.0292 -0.0264 0.0406  21  VAL A N   
158  C  CA  . VAL A 21  ? 0.1656 0.1198 0.1151 -0.0110 -0.0166 0.0409  21  VAL A CA  
159  C  C   . VAL A 21  ? 0.1563 0.1419 0.1237 -0.0069 -0.0048 0.0361  21  VAL A C   
160  O  O   . VAL A 21  ? 0.2043 0.1505 0.1270 -0.0068 0.0160  0.0402  21  VAL A O   
161  C  CB  . VAL A 21  ? 0.1772 0.1580 0.1029 0.0277  -0.0248 0.0404  21  VAL A CB  
162  C  CG1 . VAL A 21  ? 0.2261 0.1891 0.0854 0.0335  0.0076  0.0370  21  VAL A CG1 
163  C  CG2 . VAL A 21  ? 0.1502 0.1954 0.1427 -0.0201 -0.0061 0.0106  21  VAL A CG2 
164  N  N   . HIS A 22  ? 0.1574 0.1383 0.1128 0.0049  0.0057  0.0426  22  HIS A N   
165  C  CA  . HIS A 22  ? 0.1524 0.1627 0.1277 0.0155  -0.0102 0.0367  22  HIS A CA  
166  C  C   . HIS A 22  ? 0.1588 0.1539 0.1137 0.0087  0.0020  0.0129  22  HIS A C   
167  O  O   . HIS A 22  ? 0.1814 0.1501 0.1167 0.0294  -0.0113 0.0425  22  HIS A O   
168  C  CB  . HIS A 22  ? 0.1490 0.1706 0.1497 0.0279  -0.0023 0.0535  22  HIS A CB  
169  C  CG  . HIS A 22  ? 0.1692 0.1995 0.1157 0.0274  -0.0054 0.0338  22  HIS A CG  
170  N  ND1 . HIS A 22  ? 0.1752 0.2232 0.1328 0.0474  0.0066  0.0336  22  HIS A ND1 
171  C  CD2 . HIS A 22  ? 0.1770 0.2075 0.1517 0.0397  -0.0168 0.0406  22  HIS A CD2 
172  C  CE1 . HIS A 22  ? 0.2009 0.2518 0.1417 0.0726  -0.0038 0.0211  22  HIS A CE1 
173  N  NE2 . HIS A 22  ? 0.2084 0.2296 0.1411 0.0424  -0.0197 0.0313  22  HIS A NE2 
174  N  N   . PRO A 23  ? 0.1736 0.1551 0.1356 0.0299  -0.0266 0.0285  23  PRO A N   
175  C  CA  . PRO A 23  ? 0.1909 0.1660 0.1632 0.0015  -0.0216 0.0370  23  PRO A CA  
176  C  C   . PRO A 23  ? 0.1686 0.1968 0.1256 0.0204  -0.0182 0.0188  23  PRO A C   
177  O  O   . PRO A 23  ? 0.1786 0.2018 0.1410 0.0263  -0.0180 0.0060  23  PRO A O   
178  C  CB  . PRO A 23  ? 0.2313 0.1886 0.2280 0.0375  -0.0491 0.0423  23  PRO A CB  
179  C  CG  . PRO A 23  ? 0.2404 0.1882 0.2667 0.0492  -0.0154 -0.0123 23  PRO A CG  
180  C  CD  . PRO A 23  ? 0.1901 0.1515 0.1649 0.0386  -0.0114 0.0182  23  PRO A CD  
181  N  N   . LYS A 24  ? 0.1804 0.1793 0.1288 0.0499  -0.0344 0.0160  24  LYS A N   
182  C  CA  . LYS A 24  ? 0.1861 0.1998 0.1054 0.0427  -0.0264 0.0255  24  LYS A CA  
183  C  C   . LYS A 24  ? 0.1655 0.1662 0.1451 0.0383  -0.0195 0.0278  24  LYS A C   
184  O  O   . LYS A 24  ? 0.1932 0.2108 0.1127 0.0573  -0.0125 0.0266  24  LYS A O   
185  C  CB  . LYS A 24  ? 0.2017 0.2396 0.1296 0.0555  -0.0231 0.0424  24  LYS A CB  
186  C  CG  . LYS A 24  ? 0.2488 0.2833 0.2335 0.0464  -0.0251 0.0285  24  LYS A CG  
187  C  CD  . LYS A 24  ? 0.3011 0.3867 0.3161 0.0417  0.0076  0.0012  24  LYS A CD  
188  C  CE  . LYS A 24  ? 0.3727 0.4991 0.3713 0.0282  0.0056  -0.0876 24  LYS A CE  
189  N  NZ  . LYS A 24  ? 0.5007 0.5991 0.4216 0.0137  -0.0105 -0.0994 24  LYS A NZ  
190  N  N   . MET A 25  ? 0.1633 0.1605 0.1067 0.0291  -0.0209 0.0131  25  MET A N   
191  C  CA  . MET A 25  ? 0.1704 0.1550 0.1052 0.0124  -0.0117 0.0317  25  MET A CA  
192  C  C   . MET A 25  ? 0.1695 0.1619 0.1070 0.0091  -0.0118 0.0247  25  MET A C   
193  O  O   . MET A 25  ? 0.1636 0.1647 0.1231 0.0194  -0.0186 0.0406  25  MET A O   
194  C  CB  . MET A 25  ? 0.1726 0.1582 0.0929 0.0114  -0.0104 0.0295  25  MET A CB  
195  C  CG  . MET A 25  ? 0.1979 0.1787 0.1111 0.0063  -0.0302 0.0356  25  MET A CG  
196  S  SD  . MET A 25  ? 0.2111 0.1812 0.1478 0.0038  -0.0378 0.0554  25  MET A SD  
197  C  CE  . MET A 25  ? 0.2054 0.1733 0.1481 0.0407  -0.0151 0.0652  25  MET A CE  
198  N  N   . LEU A 26  ? 0.1436 0.1492 0.1083 0.0113  -0.0139 0.0240  26  LEU A N   
199  C  CA  . LEU A 26  ? 0.1564 0.1535 0.1105 -0.0057 -0.0026 0.0192  26  LEU A CA  
200  C  C   . LEU A 26  ? 0.1482 0.1717 0.1123 0.0166  0.0083  0.0217  26  LEU A C   
201  O  O   . LEU A 26  ? 0.1674 0.1901 0.0885 0.0288  -0.0003 0.0253  26  LEU A O   
202  C  CB  . LEU A 26  ? 0.1884 0.1491 0.1106 0.0123  -0.0089 0.0122  26  LEU A CB  
203  C  CG  . LEU A 26  ? 0.2019 0.1810 0.0897 -0.0098 -0.0178 0.0195  26  LEU A CG  
204  C  CD1 . LEU A 26  ? 0.2728 0.1687 0.1476 -0.0301 -0.0386 0.0491  26  LEU A CD1 
205  C  CD2 . LEU A 26  ? 0.2159 0.2315 0.1064 0.0415  -0.0010 -0.0069 26  LEU A CD2 
206  N  N   . GLU A 27  ? 0.1617 0.1754 0.1004 0.0382  -0.0095 0.0208  27  GLU A N   
207  C  CA  . GLU A 27  ? 0.1817 0.1630 0.1076 0.0235  -0.0153 0.0199  27  GLU A CA  
208  C  C   . GLU A 27  ? 0.1715 0.1846 0.1140 0.0285  0.0088  0.0175  27  GLU A C   
209  O  O   . GLU A 27  ? 0.1837 0.2257 0.1231 0.0367  -0.0268 0.0250  27  GLU A O   
210  C  CB  . GLU A 27  ? 0.2290 0.2092 0.0907 0.0266  -0.0121 0.0257  27  GLU A CB  
211  C  CG  . GLU A 27  ? 0.2412 0.2023 0.1672 0.0375  -0.0322 0.0391  27  GLU A CG  
212  C  CD  . GLU A 27  ? 0.3260 0.3040 0.4020 0.0795  0.0029  0.0182  27  GLU A CD  
213  O  OE1 . GLU A 27  ? 0.4659 0.3852 0.4098 0.0719  0.0464  -0.0317 27  GLU A OE1 
214  O  OE2 . GLU A 27  ? 0.4556 0.3016 0.7005 0.0615  0.0658  -0.0286 27  GLU A OE2 
215  N  N   . TYR A 28  ? 0.1669 0.1840 0.1085 0.0197  -0.0166 0.0384  28  TYR A N   
216  C  CA  . TYR A 28  ? 0.1823 0.1859 0.0967 0.0150  -0.0081 0.0561  28  TYR A CA  
217  C  C   . TYR A 28  ? 0.1779 0.1830 0.1211 0.0291  -0.0144 0.0552  28  TYR A C   
218  O  O   . TYR A 28  ? 0.1910 0.2291 0.1289 0.0439  -0.0167 0.0621  28  TYR A O   
219  C  CB  . TYR A 28  ? 0.1798 0.2020 0.1256 0.0096  -0.0013 0.0586  28  TYR A CB  
220  C  CG  . TYR A 28  ? 0.2083 0.2413 0.1455 0.0216  -0.0095 0.0569  28  TYR A CG  
221  C  CD1 . TYR A 28  ? 0.2605 0.2424 0.1140 0.0528  -0.0126 0.0757  28  TYR A CD1 
222  C  CD2 . TYR A 28  ? 0.2802 0.3034 0.1697 0.0153  -0.0056 0.1087  28  TYR A CD2 
223  C  CE1 . TYR A 28  ? 0.3118 0.2894 0.2008 0.0338  -0.0398 0.1031  28  TYR A CE1 
224  C  CE2 . TYR A 28  ? 0.3339 0.2786 0.1205 0.0038  0.0221  0.0981  28  TYR A CE2 
225  C  CZ  . TYR A 28  ? 0.3565 0.2420 0.2129 0.0221  -0.0222 0.0731  28  TYR A CZ  
226  O  OH  . TYR A 28  ? 0.4784 0.3151 0.1960 -0.0245 -0.0441 0.1236  28  TYR A OH  
227  N  N   . ALA A 29  ? 0.1736 0.1907 0.1055 0.0344  -0.0091 0.0495  29  ALA A N   
228  C  CA  . ALA A 29  ? 0.1919 0.1678 0.1221 0.0324  -0.0061 0.0501  29  ALA A CA  
229  C  C   . ALA A 29  ? 0.1799 0.1730 0.1158 0.0286  -0.0034 0.0463  29  ALA A C   
230  O  O   . ALA A 29  ? 0.1855 0.2111 0.1252 0.0332  -0.0145 0.0613  29  ALA A O   
231  C  CB  . ALA A 29  ? 0.1857 0.2050 0.1032 0.0421  -0.0112 0.0449  29  ALA A CB  
232  N  N   . ALA A 30  ? 0.1609 0.1644 0.1115 0.0163  -0.0197 0.0377  30  ALA A N   
233  C  CA  . ALA A 30  ? 0.1847 0.1590 0.0967 0.0084  -0.0120 0.0255  30  ALA A CA  
234  C  C   . ALA A 30  ? 0.1760 0.2254 0.1058 0.0263  -0.0129 0.0325  30  ALA A C   
235  O  O   . ALA A 30  ? 0.1775 0.2293 0.1281 0.0323  -0.0221 0.0465  30  ALA A O   
236  C  CB  . ALA A 30  ? 0.2016 0.1767 0.1292 0.0284  -0.0089 0.0278  30  ALA A CB  
237  N  N   . ALA A 31  ? 0.1847 0.2159 0.0919 0.0226  -0.0265 0.0457  31  ALA A N   
238  C  CA  . ALA A 31  ? 0.1994 0.2431 0.0853 0.0405  -0.0107 0.0537  31  ALA A CA  
239  C  C   . ALA A 31  ? 0.1922 0.2168 0.1360 0.0403  -0.0220 0.0454  31  ALA A C   
240  O  O   . ALA A 31  ? 0.2068 0.2554 0.1338 0.0429  -0.0259 0.0632  31  ALA A O   
241  C  CB  . ALA A 31  ? 0.2107 0.2982 0.1121 0.0571  0.0095  0.0314  31  ALA A CB  
242  N  N   . LYS A 32  ? 0.1992 0.2009 0.1243 0.0212  -0.0091 0.0576  32  LYS A N   
243  C  CA  . LYS A 32  ? 0.2089 0.2087 0.1451 0.0117  0.0018  0.0563  32  LYS A CA  
244  C  C   . LYS A 32  ? 0.1808 0.2147 0.1347 0.0175  0.0027  0.0660  32  LYS A C   
245  O  O   . LYS A 32  ? 0.2023 0.2221 0.1538 0.0387  -0.0395 0.0711  32  LYS A O   
246  C  CB  . LYS A 32  ? 0.2183 0.2428 0.1981 0.0157  0.0084  0.0650  32  LYS A CB  
247  C  CG  . LYS A 32  ? 0.2413 0.2967 0.3744 0.0327  -0.0128 0.0262  32  LYS A CG  
248  C  CD  . LYS A 32  ? 0.3405 0.3585 0.4514 -0.0031 -0.0051 0.0549  32  LYS A CD  
249  C  CE  . LYS A 32  ? 0.3930 0.2783 0.3627 -0.0129 -0.0568 0.1161  32  LYS A CE  
250  N  NZ  . LYS A 32  ? 0.4780 0.3963 0.3379 -0.0291 -0.1250 0.1242  32  LYS A NZ  
251  N  N   . LEU A 33  ? 0.1635 0.1977 0.1179 0.0288  -0.0009 0.0587  33  LEU A N   
252  C  CA  . LEU A 33  ? 0.1624 0.1704 0.1141 0.0204  -0.0004 0.0223  33  LEU A CA  
253  C  C   . LEU A 33  ? 0.1803 0.2108 0.1220 0.0336  -0.0251 0.0192  33  LEU A C   
254  O  O   . LEU A 33  ? 0.1866 0.2431 0.1159 0.0429  -0.0348 0.0454  33  LEU A O   
255  C  CB  . LEU A 33  ? 0.1497 0.1876 0.1154 0.0505  -0.0126 0.0354  33  LEU A CB  
256  C  CG  . LEU A 33  ? 0.1530 0.1654 0.1267 0.0072  -0.0243 0.0009  33  LEU A CG  
257  C  CD1 . LEU A 33  ? 0.1996 0.1701 0.0954 0.0014  -0.0393 0.0404  33  LEU A CD1 
258  C  CD2 . LEU A 33  ? 0.2054 0.1515 0.1638 0.0238  -0.0328 0.0098  33  LEU A CD2 
259  N  N   . LYS A 34  ? 0.1938 0.1876 0.1231 0.0316  -0.0441 0.0329  34  LYS A N   
260  C  CA  . LYS A 34  ? 0.2152 0.2047 0.1396 0.0067  -0.0166 0.0359  34  LYS A CA  
261  C  C   . LYS A 34  ? 0.2160 0.2342 0.1282 0.0143  -0.0322 0.0351  34  LYS A C   
262  O  O   . LYS A 34  ? 0.2092 0.2700 0.1206 0.0211  -0.0367 0.0325  34  LYS A O   
263  C  CB  . LYS A 34  ? 0.2239 0.2187 0.1265 0.0175  -0.0318 0.0173  34  LYS A CB  
264  C  CG  . LYS A 34  ? 0.2833 0.2908 0.1715 0.0394  -0.0322 -0.0335 34  LYS A CG  
265  C  CD  . LYS A 34  ? 0.3414 0.3226 0.3033 0.0462  -0.0599 -0.1029 34  LYS A CD  
266  C  CE  . LYS A 34  ? 0.4611 0.3780 0.4116 0.0304  -0.0671 -0.0912 34  LYS A CE  
267  N  NZ  . LYS A 34  ? 0.5089 0.4614 0.5545 0.0379  -0.0409 -0.1624 34  LYS A NZ  
268  N  N   . GLU A 35  ? 0.1957 0.2354 0.1206 0.0295  -0.0436 0.0548  35  GLU A N   
269  C  CA  . GLU A 35  ? 0.2427 0.2390 0.1301 0.0256  -0.0277 0.0684  35  GLU A CA  
270  C  C   . GLU A 35  ? 0.2469 0.2442 0.1429 0.0499  -0.0327 0.0653  35  GLU A C   
271  O  O   . GLU A 35  ? 0.2669 0.2798 0.1336 0.0516  -0.0631 0.0570  35  GLU A O   
272  C  CB  . GLU A 35  ? 0.2965 0.2737 0.1370 0.0297  -0.0431 0.0931  35  GLU A CB  
273  C  CG  . GLU A 35  ? 0.3728 0.3579 0.2664 0.0679  -0.0091 0.1218  35  GLU A CG  
274  C  CD  . GLU A 35  ? 0.5215 0.4972 0.2805 0.0902  -0.0451 0.1031  35  GLU A CD  
275  O  OE1 . GLU A 35  ? 0.5527 0.6288 0.3480 0.1652  0.0177  0.1262  35  GLU A OE1 
276  O  OE2 . GLU A 35  ? 0.6661 0.7199 0.3403 0.2330  -0.1109 0.1473  35  GLU A OE2 
277  N  N   . ALA A 36  ? 0.2345 0.2466 0.1295 0.0636  -0.0324 0.0342  36  ALA A N   
278  C  CA  . ALA A 36  ? 0.2264 0.2187 0.1347 0.0339  -0.0357 0.0149  36  ALA A CA  
279  C  C   . ALA A 36  ? 0.2161 0.2166 0.1563 0.0462  -0.0317 0.0112  36  ALA A C   
280  O  O   . ALA A 36  ? 0.2124 0.2432 0.1729 0.0487  -0.0564 0.0436  36  ALA A O   
281  C  CB  . ALA A 36  ? 0.2374 0.2410 0.1398 0.0392  -0.0619 0.0133  36  ALA A CB  
282  N  N   . GLN A 37  ? 0.1867 0.2140 0.1268 0.0302  -0.0381 0.0350  37  GLN A N   
283  C  CA  . GLN A 37  ? 0.2198 0.1990 0.1027 0.0200  -0.0433 0.0360  37  GLN A CA  
284  C  C   . GLN A 37  ? 0.2069 0.2496 0.1433 0.0296  -0.0309 0.0281  37  GLN A C   
285  O  O   . GLN A 37  ? 0.2165 0.2809 0.1280 0.0543  -0.0394 0.0346  37  GLN A O   
286  C  CB  . GLN A 37  ? 0.2103 0.2032 0.1075 0.0201  -0.0455 0.0236  37  GLN A CB  
287  C  CG  . GLN A 37  ? 0.2079 0.2068 0.1070 0.0072  -0.0393 0.0269  37  GLN A CG  
288  C  CD  . GLN A 37  ? 0.2093 0.2216 0.1940 0.0338  -0.0418 0.0153  37  GLN A CD  
289  O  OE1 . GLN A 37  ? 0.2551 0.2333 0.1475 0.0537  -0.0236 0.0227  37  GLN A OE1 
290  N  NE2 . GLN A 37  ? 0.2222 0.2147 0.1455 0.0251  -0.0459 0.0184  37  GLN A NE2 
291  N  N   . LYS A 38  ? 0.2077 0.2565 0.1129 0.0458  -0.0583 0.0386  38  LYS A N   
292  C  CA  . LYS A 38  ? 0.2699 0.2950 0.1251 0.0319  -0.0572 0.0395  38  LYS A CA  
293  C  C   . LYS A 38  ? 0.2636 0.2896 0.1176 0.0183  -0.0391 0.0533  38  LYS A C   
294  O  O   . LYS A 38  ? 0.3036 0.3791 0.1465 0.0391  -0.0866 0.0702  38  LYS A O   
295  C  CB  . LYS A 38  ? 0.3063 0.3507 0.1074 0.0432  -0.0477 0.0451  38  LYS A CB  
296  C  CG  . LYS A 38  ? 0.4177 0.4812 0.1936 0.0801  -0.0498 0.0621  38  LYS A CG  
297  C  CD  . LYS A 38  ? 0.4978 0.5882 0.2721 0.0763  0.0090  0.0302  38  LYS A CD  
298  C  CE  . LYS A 38  ? 0.6478 0.6844 0.3345 0.0373  -0.0037 0.0558  38  LYS A CE  
299  N  NZ  . LYS A 38  ? 0.7586 0.7006 0.5291 -0.0400 0.0212  0.0569  38  LYS A NZ  
300  N  N   . ARG A 39  ? 0.2690 0.2912 0.1428 0.0362  -0.0410 0.0685  39  ARG A N   
301  C  CA  . ARG A 39  ? 0.3069 0.3012 0.1605 0.0561  -0.0428 0.0841  39  ARG A CA  
302  C  C   . ARG A 39  ? 0.2849 0.2785 0.1707 0.0712  -0.0250 0.0819  39  ARG A C   
303  O  O   . ARG A 39  ? 0.3298 0.3196 0.1704 0.0969  -0.0398 0.0996  39  ARG A O   
304  C  CB  . ARG A 39  ? 0.3349 0.2951 0.2220 0.0498  -0.0394 0.1061  39  ARG A CB  
305  C  CG  . ARG A 39  ? 0.4075 0.3967 0.3754 0.0501  0.0082  0.0624  39  ARG A CG  
306  C  CD  . ARG A 39  ? 0.5723 0.5629 0.5812 -0.0012 -0.0177 0.0173  39  ARG A CD  
307  N  NE  . ARG A 39  ? 0.6867 0.5971 0.6962 -0.0040 0.0053  -0.0107 39  ARG A NE  
308  C  CZ  . ARG A 39  ? 0.6869 0.6349 0.7167 -0.0138 -0.0135 0.0112  39  ARG A CZ  
309  N  NH1 . ARG A 39  ? 0.6318 0.5503 0.7839 -0.0328 -0.0068 0.0786  39  ARG A NH1 
310  N  NH2 . ARG A 39  ? 0.7242 0.6650 0.7399 -0.0326 0.0310  -0.0115 39  ARG A NH2 
311  N  N   . GLY A 40  ? 0.2692 0.2681 0.1383 0.0724  -0.0371 0.0785  40  GLY A N   
312  C  CA  . GLY A 40  ? 0.2358 0.2451 0.1497 0.0642  -0.0583 0.0668  40  GLY A CA  
313  C  C   . GLY A 40  ? 0.2305 0.2602 0.1199 0.0414  -0.0278 0.0651  40  GLY A C   
314  O  O   . GLY A 40  ? 0.2304 0.2995 0.1533 0.0645  -0.0360 0.0698  40  GLY A O   
315  N  N   . VAL A 41  ? 0.2002 0.2256 0.1552 0.0338  -0.0465 0.0753  41  VAL A N   
316  C  CA  . VAL A 41  ? 0.2020 0.1821 0.1549 0.0307  -0.0172 0.0699  41  VAL A CA  
317  C  C   . VAL A 41  ? 0.1776 0.1694 0.1482 0.0373  -0.0336 0.0535  41  VAL A C   
318  O  O   . VAL A 41  ? 0.1921 0.1801 0.1389 0.0599  -0.0325 0.0629  41  VAL A O   
319  C  CB  . VAL A 41  ? 0.2040 0.1798 0.1648 0.0302  -0.0116 0.0890  41  VAL A CB  
320  C  CG1 . VAL A 41  ? 0.2247 0.2044 0.1769 0.0446  -0.0441 0.0640  41  VAL A CG1 
321  C  CG2 . VAL A 41  ? 0.2537 0.2355 0.1974 0.0109  0.0057  0.0817  41  VAL A CG2 
322  N  N   . ILE A 42  ? 0.1736 0.1682 0.1353 0.0370  -0.0382 0.0574  42  ILE A N   
323  C  CA  . ILE A 42  ? 0.1834 0.1540 0.1019 0.0330  -0.0387 0.0543  42  ILE A CA  
324  C  C   . ILE A 42  ? 0.1380 0.1525 0.1231 0.0214  -0.0398 0.0314  42  ILE A C   
325  O  O   . ILE A 42  ? 0.1957 0.2044 0.1094 0.0313  -0.0311 0.0492  42  ILE A O   
326  C  CB  . ILE A 42  ? 0.1442 0.1396 0.1163 0.0218  -0.0500 0.0529  42  ILE A CB  
327  C  CG1 . ILE A 42  ? 0.1765 0.1591 0.1271 0.0329  -0.0477 0.0497  42  ILE A CG1 
328  C  CG2 . ILE A 42  ? 0.1896 0.1369 0.1711 0.0220  -0.0780 0.0390  42  ILE A CG2 
329  C  CD1 . ILE A 42  ? 0.1559 0.2044 0.1394 0.0488  -0.0579 0.0625  42  ILE A CD1 
330  N  N   . ILE A 43  ? 0.1664 0.1515 0.1019 0.0045  -0.0513 0.0325  43  ILE A N   
331  C  CA  . ILE A 43  ? 0.1635 0.1571 0.0856 0.0154  -0.0531 0.0255  43  ILE A CA  
332  C  C   . ILE A 43  ? 0.1714 0.1475 0.0926 0.0197  -0.0327 0.0262  43  ILE A C   
333  O  O   . ILE A 43  ? 0.1867 0.1758 0.1071 0.0325  -0.0526 0.0203  43  ILE A O   
334  C  CB  . ILE A 43  ? 0.1693 0.1670 0.0984 0.0272  -0.0582 0.0237  43  ILE A CB  
335  C  CG1 . ILE A 43  ? 0.1768 0.1895 0.1465 0.0280  -0.0666 0.0264  43  ILE A CG1 
336  C  CG2 . ILE A 43  ? 0.2020 0.1615 0.1452 0.0024  -0.0417 0.0181  43  ILE A CG2 
337  C  CD1 . ILE A 43  ? 0.1894 0.2070 0.2062 0.0065  -0.0485 0.0348  43  ILE A CD1 
338  N  N   . ASP A 44  ? 0.1658 0.1734 0.0874 0.0138  -0.0499 0.0268  44  ASP A N   
339  C  CA  . ASP A 44  ? 0.1586 0.1535 0.1035 0.0238  -0.0502 0.0046  44  ASP A CA  
340  C  C   . ASP A 44  ? 0.1550 0.1096 0.1113 0.0171  -0.0398 0.0138  44  ASP A C   
341  O  O   . ASP A 44  ? 0.1487 0.1538 0.0979 0.0266  -0.0489 0.0245  44  ASP A O   
342  C  CB  . ASP A 44  ? 0.1409 0.1626 0.1069 0.0165  -0.0580 0.0012  44  ASP A CB  
343  C  CG  . ASP A 44  ? 0.1541 0.1669 0.1074 -0.0067 -0.0360 0.0274  44  ASP A CG  
344  O  OD1 . ASP A 44  ? 0.1688 0.1799 0.1336 -0.0006 -0.0258 0.0220  44  ASP A OD1 
345  O  OD2 . ASP A 44  ? 0.1934 0.1615 0.1509 -0.0051 -0.0314 0.0105  44  ASP A OD2 
346  N  N   . TYR A 45  ? 0.1627 0.1302 0.1104 0.0180  -0.0406 0.0256  45  TYR A N   
347  C  CA  . TYR A 45  ? 0.1386 0.1290 0.1220 0.0141  -0.0376 0.0381  45  TYR A CA  
348  C  C   . TYR A 45  ? 0.1701 0.1081 0.1022 -0.0089 -0.0371 0.0212  45  TYR A C   
349  O  O   . TYR A 45  ? 0.1560 0.1321 0.1084 0.0167  -0.0543 0.0147  45  TYR A O   
350  C  CB  . TYR A 45  ? 0.1469 0.1179 0.1414 0.0303  -0.0582 0.0371  45  TYR A CB  
351  C  CG  . TYR A 45  ? 0.1442 0.1789 0.1121 0.0223  -0.0256 0.0379  45  TYR A CG  
352  C  CD1 . TYR A 45  ? 0.1823 0.1884 0.1370 0.0242  -0.0227 0.0413  45  TYR A CD1 
353  C  CD2 . TYR A 45  ? 0.1707 0.1581 0.1298 0.0431  -0.0183 0.0241  45  TYR A CD2 
354  C  CE1 . TYR A 45  ? 0.1713 0.2334 0.1119 0.0596  -0.0434 0.0462  45  TYR A CE1 
355  C  CE2 . TYR A 45  ? 0.1785 0.1979 0.1162 0.0362  -0.0317 0.0558  45  TYR A CE2 
356  C  CZ  . TYR A 45  ? 0.1953 0.2277 0.1267 0.0552  -0.0159 0.0496  45  TYR A CZ  
357  O  OH  . TYR A 45  ? 0.2302 0.2573 0.1249 0.0476  0.0000  0.0110  45  TYR A OH  
358  N  N   . PHE A 46  ? 0.1488 0.1172 0.0954 0.0176  -0.0438 0.0130  46  PHE A N   
359  C  CA  . PHE A 46  ? 0.1441 0.1021 0.1052 0.0297  -0.0423 0.0200  46  PHE A CA  
360  C  C   . PHE A 46  ? 0.1482 0.1188 0.0829 0.0298  -0.0284 0.0340  46  PHE A C   
361  O  O   . PHE A 46  ? 0.1511 0.1295 0.1322 0.0387  -0.0480 0.0059  46  PHE A O   
362  C  CB  . PHE A 46  ? 0.1726 0.1299 0.1051 0.0248  -0.0430 0.0183  46  PHE A CB  
363  C  CG  . PHE A 46  ? 0.1355 0.1164 0.1219 -0.0037 -0.0314 0.0184  46  PHE A CG  
364  C  CD1 . PHE A 46  ? 0.2038 0.1360 0.1072 0.0085  -0.0259 0.0126  46  PHE A CD1 
365  C  CD2 . PHE A 46  ? 0.1564 0.1478 0.2135 -0.0136 -0.0872 0.0369  46  PHE A CD2 
366  C  CE1 . PHE A 46  ? 0.2949 0.1534 0.1171 0.0092  0.0372  -0.0164 46  PHE A CE1 
367  C  CE2 . PHE A 46  ? 0.1454 0.1778 0.2668 0.0170  -0.0539 0.0799  46  PHE A CE2 
368  C  CZ  . PHE A 46  ? 0.1972 0.1624 0.2408 0.0464  0.0373  0.0385  46  PHE A CZ  
369  N  N   . VAL A 47  ? 0.1244 0.1130 0.0864 0.0197  -0.0292 0.0163  47  VAL A N   
370  C  CA  . VAL A 47  ? 0.1066 0.0972 0.0714 0.0320  -0.0223 0.0055  47  VAL A CA  
371  C  C   . VAL A 47  ? 0.1364 0.0930 0.0936 0.0285  -0.0470 -0.0099 47  VAL A C   
372  O  O   . VAL A 47  ? 0.1689 0.1253 0.0799 0.0309  -0.0467 0.0070  47  VAL A O   
373  C  CB  . VAL A 47  ? 0.0945 0.0723 0.0681 0.0378  -0.0034 -0.0067 47  VAL A CB  
374  C  CG1 . VAL A 47  ? 0.0399 0.1006 0.0417 0.0111  -0.0083 0.0216  47  VAL A CG1 
375  C  CG2 . VAL A 47  ? 0.1807 0.0804 0.0635 0.0341  -0.0126 -0.0109 47  VAL A CG2 
376  N  N   . TYR A 48  ? 0.1400 0.0893 0.0915 0.0152  -0.0358 -0.0029 48  TYR A N   
377  C  CA  . TYR A 48  ? 0.1386 0.0988 0.0800 0.0255  -0.0314 0.0117  48  TYR A CA  
378  C  C   . TYR A 48  ? 0.1372 0.0822 0.0718 0.0213  -0.0280 0.0133  48  TYR A C   
379  O  O   . TYR A 48  ? 0.1529 0.0978 0.1180 0.0101  -0.0472 0.0182  48  TYR A O   
380  C  CB  . TYR A 48  ? 0.1347 0.1031 0.0927 0.0080  -0.0284 0.0204  48  TYR A CB  
381  C  CG  . TYR A 48  ? 0.1221 0.1178 0.0763 0.0060  -0.0217 0.0161  48  TYR A CG  
382  C  CD1 . TYR A 48  ? 0.1156 0.1313 0.1076 0.0083  -0.0184 0.0164  48  TYR A CD1 
383  C  CD2 . TYR A 48  ? 0.1355 0.0999 0.1061 0.0026  -0.0155 0.0208  48  TYR A CD2 
384  C  CE1 . TYR A 48  ? 0.1108 0.1323 0.1043 0.0017  -0.0163 0.0172  48  TYR A CE1 
385  C  CE2 . TYR A 48  ? 0.1324 0.1081 0.1037 0.0037  -0.0200 0.0150  48  TYR A CE2 
386  C  CZ  . TYR A 48  ? 0.1436 0.1240 0.0904 0.0034  -0.0100 0.0169  48  TYR A CZ  
387  O  OH  . TYR A 48  ? 0.1259 0.1347 0.1207 0.0175  -0.0238 0.0215  48  TYR A OH  
388  N  N   . ASN A 49  ? 0.1298 0.0798 0.0940 0.0209  -0.0408 0.0238  49  ASN A N   
389  C  CA  . ASN A 49  ? 0.1179 0.1017 0.0832 0.0011  -0.0224 0.0187  49  ASN A CA  
390  C  C   . ASN A 49  ? 0.0999 0.0860 0.0819 0.0037  -0.0184 0.0168  49  ASN A C   
391  O  O   . ASN A 49  ? 0.1249 0.1079 0.0827 -0.0056 -0.0303 0.0223  49  ASN A O   
392  C  CB  . ASN A 49  ? 0.1486 0.1326 0.0647 0.0039  -0.0285 0.0162  49  ASN A CB  
393  C  CG  . ASN A 49  ? 0.1058 0.1185 0.0977 0.0038  -0.0225 0.0266  49  ASN A CG  
394  O  OD1 . ASN A 49  ? 0.1657 0.1765 0.1237 -0.0076 -0.0343 0.0345  49  ASN A OD1 
395  N  ND2 . ASN A 49  ? 0.1045 0.0816 0.0560 0.0021  -0.0259 0.0223  49  ASN A ND2 
396  N  N   . VAL A 50  ? 0.1174 0.0794 0.0875 0.0200  -0.0318 0.0156  50  VAL A N   
397  C  CA  . VAL A 50  ? 0.0966 0.0839 0.0890 0.0080  -0.0137 0.0215  50  VAL A CA  
398  C  C   . VAL A 50  ? 0.0982 0.0801 0.0451 0.0007  -0.0213 0.0180  50  VAL A C   
399  O  O   . VAL A 50  ? 0.1030 0.0913 0.0898 -0.0006 -0.0281 0.0167  50  VAL A O   
400  C  CB  . VAL A 50  ? 0.0989 0.0935 0.0868 -0.0023 -0.0174 0.0085  50  VAL A CB  
401  C  CG1 . VAL A 50  ? 0.1379 0.1213 0.0689 0.0173  -0.0151 0.0214  50  VAL A CG1 
402  C  CG2 . VAL A 50  ? 0.1135 0.1359 0.1104 -0.0182 -0.0173 0.0178  50  VAL A CG2 
403  N  N   . GLY A 51  ? 0.0984 0.1008 0.0822 0.0070  -0.0239 0.0317  51  GLY A N   
404  C  CA  . GLY A 51  ? 0.1060 0.0944 0.0936 0.0139  -0.0196 0.0314  51  GLY A CA  
405  C  C   . GLY A 51  ? 0.0778 0.0976 0.0867 0.0101  -0.0158 0.0103  51  GLY A C   
406  O  O   . GLY A 51  ? 0.1136 0.1163 0.0842 0.0065  -0.0167 0.0160  51  GLY A O   
407  N  N   . ASP A 52  ? 0.1025 0.0936 0.0752 -0.0103 -0.0158 0.0250  52  ASP A N   
408  C  CA  . ASP A 52  ? 0.0853 0.1048 0.1106 0.0059  -0.0043 0.0412  52  ASP A CA  
409  C  C   . ASP A 52  ? 0.1009 0.1006 0.0963 -0.0042 -0.0171 0.0412  52  ASP A C   
410  O  O   . ASP A 52  ? 0.1136 0.1199 0.1234 -0.0037 -0.0129 0.0512  52  ASP A O   
411  C  CB  . ASP A 52  ? 0.0964 0.1131 0.0903 0.0103  -0.0138 0.0520  52  ASP A CB  
412  C  CG  . ASP A 52  ? 0.1033 0.1153 0.0864 0.0072  -0.0279 0.0390  52  ASP A CG  
413  O  OD1 . ASP A 52  ? 0.1052 0.1117 0.1050 -0.0124 -0.0030 0.0255  52  ASP A OD1 
414  O  OD2 . ASP A 52  ? 0.1147 0.1319 0.1104 0.0010  -0.0301 0.0306  52  ASP A OD2 
415  N  N   . ASP A 53  ? 0.0898 0.0966 0.0963 0.0024  -0.0103 0.0324  53  ASP A N   
416  C  CA  . ASP A 53  ? 0.1085 0.0919 0.1128 0.0061  -0.0162 0.0307  53  ASP A CA  
417  C  C   . ASP A 53  ? 0.1077 0.0894 0.1001 0.0100  -0.0231 0.0259  53  ASP A C   
418  O  O   . ASP A 53  ? 0.1305 0.0949 0.1002 0.0094  -0.0287 0.0275  53  ASP A O   
419  C  CB  . ASP A 53  ? 0.1108 0.1187 0.1225 0.0291  -0.0338 0.0007  53  ASP A CB  
420  C  CG  . ASP A 53  ? 0.1621 0.1029 0.1308 -0.0058 -0.0218 0.0181  53  ASP A CG  
421  O  OD1 . ASP A 53  ? 0.1503 0.1301 0.1599 -0.0168 -0.0212 0.0277  53  ASP A OD1 
422  O  OD2 . ASP A 53  ? 0.1271 0.1422 0.1242 0.0093  -0.0133 0.0123  53  ASP A OD2 
423  N  N   . ILE A 54  ? 0.1026 0.1037 0.1013 0.0041  -0.0206 0.0373  54  ILE A N   
424  C  CA  . ILE A 54  ? 0.1074 0.1232 0.1232 -0.0002 -0.0204 0.0201  54  ILE A CA  
425  C  C   . ILE A 54  ? 0.1024 0.1089 0.0842 0.0088  -0.0182 0.0238  54  ILE A C   
426  O  O   . ILE A 54  ? 0.1163 0.1081 0.1289 0.0116  -0.0258 0.0254  54  ILE A O   
427  C  CB  . ILE A 54  ? 0.1049 0.1290 0.1277 -0.0025 0.0025  0.0139  54  ILE A CB  
428  C  CG1 . ILE A 54  ? 0.1543 0.1748 0.1244 0.0200  0.0008  0.0000  54  ILE A CG1 
429  C  CG2 . ILE A 54  ? 0.1500 0.1549 0.1171 0.0016  -0.0459 0.0132  54  ILE A CG2 
430  C  CD1 . ILE A 54  ? 0.1690 0.2893 0.1281 0.0251  0.0384  0.0341  54  ILE A CD1 
431  N  N   . SER A 55  ? 0.1070 0.0961 0.0769 0.0090  -0.0217 0.0378  55  SER A N   
432  C  CA  . SER A 55  ? 0.0943 0.0968 0.0993 0.0084  -0.0303 0.0157  55  SER A CA  
433  C  C   . SER A 55  ? 0.1218 0.0847 0.0978 0.0288  -0.0060 0.0209  55  SER A C   
434  O  O   . SER A 55  ? 0.1251 0.1158 0.0857 0.0200  -0.0214 0.0204  55  SER A O   
435  C  CB  . SER A 55  ? 0.0936 0.1209 0.0803 0.0069  -0.0311 0.0189  55  SER A CB  
436  O  OG  . SER A 55  ? 0.1310 0.1038 0.0823 0.0060  -0.0201 0.0210  55  SER A OG  
437  N  N   . LEU A 56  ? 0.1292 0.1076 0.0797 0.0196  -0.0338 0.0138  56  LEU A N   
438  C  CA  . LEU A 56  ? 0.1302 0.1249 0.0946 0.0206  -0.0348 0.0154  56  LEU A CA  
439  C  C   . LEU A 56  ? 0.1224 0.1067 0.0871 0.0220  -0.0347 0.0246  56  LEU A C   
440  O  O   . LEU A 56  ? 0.1329 0.1175 0.1099 0.0262  -0.0320 0.0167  56  LEU A O   
441  C  CB  . LEU A 56  ? 0.1364 0.1130 0.1068 0.0089  -0.0292 0.0227  56  LEU A CB  
442  C  CG  . LEU A 56  ? 0.1514 0.1302 0.0979 0.0144  -0.0356 0.0358  56  LEU A CG  
443  C  CD1 . LEU A 56  ? 0.1637 0.1552 0.1271 -0.0202 -0.0282 0.0589  56  LEU A CD1 
444  C  CD2 . LEU A 56  ? 0.1647 0.1547 0.1179 0.0190  -0.0318 0.0370  56  LEU A CD2 
445  N  N   . LEU A 57  ? 0.1179 0.1146 0.1060 0.0092  -0.0425 0.0318  57  LEU A N   
446  C  CA  . LEU A 57  ? 0.1250 0.1319 0.0915 0.0008  -0.0438 0.0200  57  LEU A CA  
447  C  C   . LEU A 57  ? 0.1324 0.1172 0.1049 0.0260  -0.0197 0.0135  57  LEU A C   
448  O  O   . LEU A 57  ? 0.1553 0.1385 0.1051 0.0363  -0.0582 0.0142  57  LEU A O   
449  C  CB  . LEU A 57  ? 0.1380 0.1337 0.1083 0.0094  -0.0431 0.0243  57  LEU A CB  
450  C  CG  . LEU A 57  ? 0.1790 0.1192 0.1250 0.0152  -0.0097 0.0375  57  LEU A CG  
451  C  CD1 . LEU A 57  ? 0.1755 0.1754 0.1689 0.0198  -0.0204 -0.0029 57  LEU A CD1 
452  C  CD2 . LEU A 57  ? 0.2170 0.1365 0.1802 0.0182  -0.0209 0.0319  57  LEU A CD2 
453  N  N   . MET A 58  ? 0.1295 0.1396 0.0846 0.0385  -0.0406 0.0120  58  MET A N   
454  C  CA  . MET A 58  ? 0.1343 0.1574 0.1033 0.0174  -0.0443 0.0246  58  MET A CA  
455  C  C   . MET A 58  ? 0.1356 0.1238 0.1203 0.0378  -0.0214 0.0225  58  MET A C   
456  O  O   . MET A 58  ? 0.1434 0.1568 0.1268 0.0355  -0.0499 0.0121  58  MET A O   
457  C  CB  . MET A 58  ? 0.1631 0.1741 0.1121 0.0161  -0.0540 0.0421  58  MET A CB  
458  C  CG  . MET A 58  ? 0.1765 0.1543 0.1260 0.0108  -0.0448 0.0241  58  MET A CG  
459  S  SD  . MET A 58  ? 0.1960 0.2023 0.1757 0.0071  -0.0319 0.0715  58  MET A SD  
460  C  CE  . MET A 58  ? 0.2067 0.1444 0.2321 0.0103  -0.0878 0.0028  58  MET A CE  
461  N  N   . THR A 59  ? 0.1281 0.1196 0.1063 0.0191  -0.0449 0.0182  59  THR A N   
462  C  CA  . THR A 59  ? 0.1374 0.1215 0.0948 0.0205  -0.0327 0.0239  59  THR A CA  
463  C  C   . THR A 59  ? 0.1172 0.1338 0.1096 0.0133  -0.0277 0.0214  59  THR A C   
464  O  O   . THR A 59  ? 0.1363 0.1537 0.1107 0.0324  -0.0348 0.0291  59  THR A O   
465  C  CB  . THR A 59  ? 0.1522 0.1275 0.0893 0.0185  -0.0352 0.0262  59  THR A CB  
466  O  OG1 . THR A 59  ? 0.1616 0.1572 0.1158 0.0107  -0.0401 0.0149  59  THR A OG1 
467  C  CG2 . THR A 59  ? 0.2046 0.1301 0.0978 0.0184  -0.0438 0.0357  59  THR A CG2 
468  N  N   . HIS A 60  ? 0.1289 0.1467 0.0914 0.0177  -0.0317 0.0166  60  HIS A N   
469  C  CA  . HIS A 60  ? 0.1417 0.1448 0.0781 0.0144  -0.0468 0.0397  60  HIS A CA  
470  C  C   . HIS A 60  ? 0.1467 0.1507 0.1093 0.0069  -0.0223 0.0356  60  HIS A C   
471  O  O   . HIS A 60  ? 0.1266 0.1471 0.1131 0.0310  -0.0370 0.0417  60  HIS A O   
472  C  CB  . HIS A 60  ? 0.1336 0.1201 0.0980 0.0121  -0.0505 0.0372  60  HIS A CB  
473  C  CG  . HIS A 60  ? 0.1236 0.1215 0.1193 0.0160  -0.0465 0.0118  60  HIS A CG  
474  N  ND1 . HIS A 60  ? 0.1508 0.1144 0.1170 0.0154  -0.0363 0.0102  60  HIS A ND1 
475  C  CD2 . HIS A 60  ? 0.1294 0.1331 0.1275 0.0273  -0.0650 0.0391  60  HIS A CD2 
476  C  CE1 . HIS A 60  ? 0.1330 0.1168 0.1447 0.0227  -0.0487 -0.0020 60  HIS A CE1 
477  N  NE2 . HIS A 60  ? 0.1435 0.1070 0.1444 0.0303  -0.0399 0.0335  60  HIS A NE2 
478  N  N   . THR A 61  ? 0.1341 0.1311 0.1181 0.0191  -0.0386 0.0470  61  THR A N   
479  C  CA  . THR A 61  ? 0.1402 0.1340 0.1123 0.0028  -0.0565 0.0396  61  THR A CA  
480  C  C   . THR A 61  ? 0.1509 0.1339 0.1309 0.0129  -0.0489 0.0543  61  THR A C   
481  O  O   . THR A 61  ? 0.1392 0.1394 0.1563 0.0281  -0.0673 0.0488  61  THR A O   
482  C  CB  . THR A 61  ? 0.1457 0.1318 0.1368 0.0205  -0.0584 0.0280  61  THR A CB  
483  O  OG1 . THR A 61  ? 0.1438 0.1687 0.1239 0.0237  -0.0602 0.0506  61  THR A OG1 
484  C  CG2 . THR A 61  ? 0.1957 0.1255 0.1582 -0.0002 -0.0959 0.0638  61  THR A CG2 
485  N  N   . LYS A 62  ? 0.1402 0.1189 0.1337 0.0059  -0.0603 0.0488  62  LYS A N   
486  C  CA  . LYS A 62  ? 0.1540 0.1340 0.1474 0.0204  -0.0562 0.0624  62  LYS A CA  
487  C  C   . LYS A 62  ? 0.1462 0.1483 0.1594 0.0291  -0.0559 0.0371  62  LYS A C   
488  O  O   . LYS A 62  ? 0.1702 0.1503 0.1731 0.0300  -0.0645 0.0506  62  LYS A O   
489  C  CB  . LYS A 62  ? 0.1537 0.1375 0.1478 0.0263  -0.0543 0.0580  62  LYS A CB  
490  C  CG  . LYS A 62  ? 0.1734 0.1403 0.1368 0.0316  -0.0392 0.0670  62  LYS A CG  
491  C  CD  . LYS A 62  ? 0.1883 0.1745 0.1625 0.0455  -0.0323 0.0500  62  LYS A CD  
492  C  CE  . LYS A 62  ? 0.1477 0.2235 0.2166 0.0212  -0.0243 0.0658  62  LYS A CE  
493  N  NZ  . LYS A 62  ? 0.1663 0.2160 0.1690 0.0147  -0.0312 0.0563  62  LYS A NZ  
494  N  N   . GLY A 63  ? 0.1562 0.1532 0.1534 0.0283  -0.0415 0.0398  63  GLY A N   
495  C  CA  . GLY A 63  ? 0.1730 0.1494 0.1530 0.0157  -0.0397 0.0358  63  GLY A CA  
496  C  C   . GLY A 63  ? 0.1490 0.1528 0.1516 0.0146  -0.0262 0.0418  63  GLY A C   
497  O  O   . GLY A 63  ? 0.1460 0.1440 0.1578 0.0152  -0.0542 0.0350  63  GLY A O   
498  N  N   . GLU A 64  ? 0.1574 0.1829 0.1666 0.0135  -0.0297 0.0248  64  GLU A N   
499  C  CA  . GLU A 64  ? 0.1771 0.1660 0.1824 -0.0007 -0.0439 0.0225  64  GLU A CA  
500  C  C   . GLU A 64  ? 0.1878 0.1743 0.1779 0.0069  -0.0377 0.0098  64  GLU A C   
501  O  O   . GLU A 64  ? 0.1961 0.1584 0.2008 0.0393  -0.0738 0.0200  64  GLU A O   
502  C  CB  . GLU A 64  ? 0.2198 0.1582 0.1842 0.0084  -0.0277 0.0147  64  GLU A CB  
503  C  CG  . GLU A 64  ? 0.2053 0.1969 0.2083 -0.0047 -0.0649 0.0338  64  GLU A CG  
504  C  CD  . GLU A 64  ? 0.3125 0.2620 0.2760 0.0417  0.0101  0.0611  64  GLU A CD  
505  O  OE1 . GLU A 64  ? 0.3783 0.2900 0.3021 -0.0038 -0.0056 0.0846  64  GLU A OE1 
506  O  OE2 . GLU A 64  ? 0.2704 0.5560 0.3100 0.0599  0.0610  0.0569  64  GLU A OE2 
507  N  N   . ASP A 65  ? 0.1772 0.1500 0.1683 0.0055  -0.0557 0.0310  65  ASP A N   
508  C  CA  . ASP A 65  ? 0.2001 0.1734 0.1951 0.0052  -0.0554 0.0304  65  ASP A CA  
509  C  C   . ASP A 65  ? 0.2067 0.1469 0.1714 0.0081  -0.0490 0.0463  65  ASP A C   
510  O  O   . ASP A 65  ? 0.2978 0.1422 0.2361 -0.0138 -0.0445 0.0560  65  ASP A O   
511  C  CB  . ASP A 65  ? 0.2301 0.2060 0.1885 -0.0059 -0.0435 0.0275  65  ASP A CB  
512  C  CG  . ASP A 65  ? 0.3422 0.2386 0.2858 0.0241  -0.0208 0.0235  65  ASP A CG  
513  O  OD1 . ASP A 65  ? 0.4454 0.3798 0.3296 0.0157  -0.1402 0.0531  65  ASP A OD1 
514  O  OD2 . ASP A 65  ? 0.4265 0.5048 0.3872 -0.0027 0.0493  0.0123  65  ASP A OD2 
515  N  N   . ASN A 66  ? 0.1896 0.1538 0.1553 0.0131  -0.0517 0.0484  66  ASN A N   
516  C  CA  . ASN A 66  ? 0.1470 0.1406 0.1570 0.0202  -0.0382 0.0463  66  ASN A CA  
517  C  C   . ASN A 66  ? 0.1495 0.1541 0.1810 0.0249  -0.0291 0.0619  66  ASN A C   
518  O  O   . ASN A 66  ? 0.1718 0.1527 0.1971 0.0306  -0.0494 0.0525  66  ASN A O   
519  C  CB  . ASN A 66  ? 0.1595 0.1563 0.1673 0.0201  -0.0366 0.0425  66  ASN A CB  
520  C  CG  . ASN A 66  ? 0.1617 0.1636 0.1641 0.0087  -0.0276 0.0318  66  ASN A CG  
521  O  OD1 . ASN A 66  ? 0.1740 0.1771 0.1606 0.0277  -0.0341 0.0610  66  ASN A OD1 
522  N  ND2 . ASN A 66  ? 0.1746 0.1546 0.2344 0.0151  -0.0911 0.0393  66  ASN A ND2 
523  N  N   . LYS A 67  ? 0.1582 0.1582 0.1960 0.0043  -0.0377 0.0730  67  LYS A N   
524  C  CA  . LYS A 67  ? 0.1865 0.1797 0.2380 0.0075  -0.0477 0.0805  67  LYS A CA  
525  C  C   . LYS A 67  ? 0.1917 0.1496 0.2134 0.0078  -0.0264 0.0793  67  LYS A C   
526  O  O   . LYS A 67  ? 0.1786 0.1815 0.2415 0.0032  -0.0265 0.0791  67  LYS A O   
527  C  CB  . LYS A 67  ? 0.2325 0.2092 0.3029 -0.0246 -0.0151 0.0635  67  LYS A CB  
528  C  CG  . LYS A 67  ? 0.3630 0.2881 0.4300 -0.0253 -0.0419 0.0592  67  LYS A CG  
529  C  CD  . LYS A 67  ? 0.5442 0.3718 0.6018 -0.0425 -0.0175 0.0945  67  LYS A CD  
530  C  CE  . LYS A 67  ? 0.6154 0.4704 0.6664 -0.0096 -0.0390 0.1061  67  LYS A CE  
531  N  NZ  . LYS A 67  ? 0.7738 0.3363 0.7445 -0.0534 -0.0795 0.0927  67  LYS A NZ  
532  N  N   A ASP A 68  ? 0.1757 0.1634 0.1913 0.0328  -0.0504 0.0774  68  ASP A N   
533  N  N   B ASP A 68  ? 0.1810 0.1626 0.1935 0.0299  -0.0508 0.0819  68  ASP A N   
534  C  CA  A ASP A 68  ? 0.1821 0.1812 0.1908 0.0269  -0.0428 0.0673  68  ASP A CA  
535  C  CA  B ASP A 68  ? 0.1964 0.1864 0.1979 0.0191  -0.0388 0.0764  68  ASP A CA  
536  C  C   A ASP A 68  ? 0.1711 0.1534 0.1631 0.0347  -0.0392 0.0523  68  ASP A C   
537  C  C   B ASP A 68  ? 0.1790 0.1574 0.1673 0.0345  -0.0368 0.0594  68  ASP A C   
538  O  O   A ASP A 68  ? 0.1940 0.1676 0.1644 0.0441  -0.0292 0.0667  68  ASP A O   
539  O  O   B ASP A 68  ? 0.2000 0.1753 0.1673 0.0448  -0.0165 0.0776  68  ASP A O   
540  C  CB  A ASP A 68  ? 0.1674 0.2081 0.1989 0.0481  -0.0301 0.0756  68  ASP A CB  
541  C  CB  B ASP A 68  ? 0.2050 0.2196 0.2206 0.0375  -0.0328 0.0900  68  ASP A CB  
542  C  CG  A ASP A 68  ? 0.2670 0.2610 0.2635 0.0375  -0.0539 0.0617  68  ASP A CG  
543  C  CG  B ASP A 68  ? 0.3110 0.2624 0.2795 0.0117  -0.0202 0.0910  68  ASP A CG  
544  O  OD1 A ASP A 68  ? 0.3442 0.2402 0.2629 0.0187  -0.0593 0.1153  68  ASP A OD1 
545  O  OD1 B ASP A 68  ? 0.3559 0.3189 0.3320 0.0855  -0.0230 0.2057  68  ASP A OD1 
546  O  OD2 A ASP A 68  ? 0.3276 0.3815 0.2504 0.1193  -0.0459 0.0340  68  ASP A OD2 
547  O  OD2 B ASP A 68  ? 0.3273 0.3562 0.3655 0.0789  -0.1038 0.0990  68  ASP A OD2 
548  N  N   . ILE A 69  ? 0.1673 0.1365 0.1614 0.0283  -0.0463 0.0581  69  ILE A N   
549  C  CA  . ILE A 69  ? 0.1533 0.1249 0.1617 0.0096  -0.0582 0.0599  69  ILE A CA  
550  C  C   . ILE A 69  ? 0.1454 0.1336 0.1418 0.0262  -0.0308 0.0358  69  ILE A C   
551  O  O   . ILE A 69  ? 0.1418 0.1539 0.1563 0.0160  -0.0384 0.0518  69  ILE A O   
552  C  CB  . ILE A 69  ? 0.1324 0.1605 0.1482 0.0143  -0.0687 0.0536  69  ILE A CB  
553  C  CG1 . ILE A 69  ? 0.1487 0.1350 0.1647 0.0043  -0.0584 0.0765  69  ILE A CG1 
554  C  CG2 . ILE A 69  ? 0.1530 0.1654 0.1580 0.0315  -0.0697 0.0759  69  ILE A CG2 
555  C  CD1 . ILE A 69  ? 0.1965 0.1566 0.1895 0.0171  -0.0641 0.0305  69  ILE A CD1 
556  N  N   . HIS A 70  ? 0.1457 0.1433 0.1698 0.0318  -0.0635 0.0374  70  HIS A N   
557  C  CA  . HIS A 70  ? 0.1534 0.1376 0.1664 0.0239  -0.0396 0.0432  70  HIS A CA  
558  C  C   . HIS A 70  ? 0.1560 0.1366 0.1755 0.0266  -0.0456 0.0422  70  HIS A C   
559  O  O   . HIS A 70  ? 0.1401 0.1846 0.2227 0.0243  -0.0493 0.0433  70  HIS A O   
560  C  CB  . HIS A 70  ? 0.1529 0.1574 0.1706 0.0321  -0.0645 0.0294  70  HIS A CB  
561  C  CG  . HIS A 70  ? 0.1777 0.1762 0.1590 0.0090  -0.0462 0.0500  70  HIS A CG  
562  N  ND1 . HIS A 70  ? 0.2182 0.2614 0.2064 0.0252  -0.0317 0.0704  70  HIS A ND1 
563  C  CD2 . HIS A 70  ? 0.2438 0.2327 0.1643 -0.0212 -0.0463 -0.0085 70  HIS A CD2 
564  C  CE1 . HIS A 70  ? 0.1657 0.1495 0.1605 -0.0014 -0.0434 0.0448  70  HIS A CE1 
565  N  NE2 . HIS A 70  ? 0.3025 0.3016 0.2629 0.0389  -0.0343 0.0472  70  HIS A NE2 
566  N  N   . GLY A 71  ? 0.1627 0.1663 0.1881 0.0202  -0.0383 0.0596  71  GLY A N   
567  C  CA  . GLY A 71  ? 0.1943 0.1599 0.1787 0.0356  -0.0444 0.0627  71  GLY A CA  
568  C  C   . GLY A 71  ? 0.1662 0.1513 0.1681 0.0281  -0.0336 0.0649  71  GLY A C   
569  O  O   . GLY A 71  ? 0.1759 0.1937 0.1910 0.0238  -0.0477 0.0702  71  GLY A O   
570  N  N   . LEU A 72  ? 0.1943 0.1531 0.1625 0.0099  -0.0498 0.0665  72  LEU A N   
571  C  CA  . LEU A 72  ? 0.1846 0.1672 0.1326 0.0147  -0.0525 0.0601  72  LEU A CA  
572  C  C   . LEU A 72  ? 0.1472 0.1652 0.1377 0.0199  -0.0226 0.0513  72  LEU A C   
573  O  O   . LEU A 72  ? 0.1484 0.1714 0.1401 0.0199  -0.0285 0.0621  72  LEU A O   
574  C  CB  . LEU A 72  ? 0.1749 0.1695 0.1344 -0.0015 -0.0637 0.0661  72  LEU A CB  
575  C  CG  . LEU A 72  ? 0.1720 0.1796 0.1475 0.0219  -0.0353 0.0544  72  LEU A CG  
576  C  CD1 . LEU A 72  ? 0.1506 0.2553 0.1774 0.0020  -0.0106 0.0620  72  LEU A CD1 
577  C  CD2 . LEU A 72  ? 0.1769 0.1857 0.1661 0.0041  -0.0600 0.0745  72  LEU A CD2 
578  N  N   . ALA A 73  ? 0.1458 0.1697 0.1431 0.0272  -0.0330 0.0579  73  ALA A N   
579  C  CA  . ALA A 73  ? 0.1259 0.1592 0.1431 0.0275  -0.0302 0.0580  73  ALA A CA  
580  C  C   . ALA A 73  ? 0.1405 0.1606 0.1298 0.0066  -0.0384 0.0515  73  ALA A C   
581  O  O   . ALA A 73  ? 0.1524 0.1852 0.1458 0.0138  -0.0373 0.0741  73  ALA A O   
582  C  CB  . ALA A 73  ? 0.1774 0.1889 0.1251 0.0253  -0.0182 0.0684  73  ALA A CB  
583  N  N   . TRP A 74  ? 0.1380 0.1546 0.1659 0.0194  -0.0577 0.0524  74  TRP A N   
584  C  CA  A TRP A 74  ? 0.1639 0.1695 0.1839 0.0172  -0.0423 0.0625  74  TRP A CA  
585  C  CA  B TRP A 74  ? 0.1657 0.1649 0.1817 0.0200  -0.0459 0.0601  74  TRP A CA  
586  C  C   . TRP A 74  ? 0.1663 0.1785 0.1919 0.0090  -0.0347 0.0703  74  TRP A C   
587  O  O   . TRP A 74  ? 0.1565 0.1818 0.2165 0.0136  -0.0378 0.0695  74  TRP A O   
588  C  CB  A TRP A 74  ? 0.1740 0.1858 0.2047 0.0051  -0.0321 0.0555  74  TRP A CB  
589  C  CB  B TRP A 74  ? 0.1768 0.1764 0.1982 0.0104  -0.0368 0.0612  74  TRP A CB  
590  C  CG  A TRP A 74  ? 0.2325 0.2109 0.2357 -0.0130 -0.0086 0.0572  74  TRP A CG  
591  C  CG  B TRP A 74  ? 0.2414 0.1752 0.2278 0.0191  -0.0405 0.0192  74  TRP A CG  
592  C  CD1 A TRP A 74  ? 0.2580 0.3107 0.2815 -0.0616 0.0211  -0.0068 74  TRP A CD1 
593  C  CD1 B TRP A 74  ? 0.2249 0.1572 0.2090 -0.0217 -0.0315 0.0434  74  TRP A CD1 
594  C  CD2 A TRP A 74  ? 0.2702 0.2423 0.2647 -0.0423 -0.0113 0.0317  74  TRP A CD2 
595  C  CD2 B TRP A 74  ? 0.2360 0.2222 0.2792 -0.0245 -0.0191 0.0313  74  TRP A CD2 
596  N  NE1 A TRP A 74  ? 0.3179 0.3421 0.2925 -0.1024 -0.0313 -0.0135 74  TRP A NE1 
597  N  NE1 B TRP A 74  ? 0.2167 0.1823 0.2803 -0.0011 -0.0399 0.0267  74  TRP A NE1 
598  C  CE2 A TRP A 74  ? 0.2650 0.2970 0.2725 -0.0518 0.0322  -0.0015 74  TRP A CE2 
599  C  CE2 B TRP A 74  ? 0.1939 0.1967 0.2615 0.0012  -0.0222 0.0616  74  TRP A CE2 
600  C  CE3 A TRP A 74  ? 0.3089 0.2565 0.2667 -0.0315 0.0403  0.0674  74  TRP A CE3 
601  C  CE3 B TRP A 74  ? 0.2716 0.2420 0.2802 -0.0803 0.0013  0.0228  74  TRP A CE3 
602  C  CZ2 A TRP A 74  ? 0.3189 0.2836 0.2864 -0.0423 0.0103  -0.0277 74  TRP A CZ2 
603  C  CZ2 B TRP A 74  ? 0.2096 0.1761 0.3418 -0.0006 0.0041  0.0699  74  TRP A CZ2 
604  C  CZ3 A TRP A 74  ? 0.3704 0.2868 0.3446 -0.0309 0.0330  0.0508  74  TRP A CZ3 
605  C  CZ3 B TRP A 74  ? 0.2594 0.2933 0.2904 -0.0294 0.0301  0.0299  74  TRP A CZ3 
606  C  CH2 A TRP A 74  ? 0.3563 0.2726 0.2519 -0.0304 0.0001  0.0205  74  TRP A CH2 
607  C  CH2 B TRP A 74  ? 0.2710 0.2627 0.3238 -0.0259 0.0314  0.0367  74  TRP A CH2 
608  N  N   . GLU A 75  ? 0.1716 0.1830 0.1767 0.0263  -0.0396 0.0716  75  GLU A N   
609  C  CA  . GLU A 75  ? 0.1882 0.2154 0.1564 0.0097  -0.0347 0.0526  75  GLU A CA  
610  C  C   . GLU A 75  ? 0.1743 0.1957 0.1417 0.0246  -0.0491 0.0644  75  GLU A C   
611  O  O   . GLU A 75  ? 0.1974 0.2178 0.1617 0.0286  -0.0201 0.0824  75  GLU A O   
612  C  CB  . GLU A 75  ? 0.2173 0.2305 0.1855 0.0249  -0.0046 0.0956  75  GLU A CB  
613  C  CG  . GLU A 75  ? 0.3366 0.3563 0.2847 0.0335  -0.0435 0.0776  75  GLU A CG  
614  C  CD  . GLU A 75  ? 0.5666 0.4107 0.3243 0.0323  -0.1193 0.1287  75  GLU A CD  
615  O  OE1 . GLU A 75  ? 0.6571 0.4360 0.4060 0.0657  -0.1983 0.0237  75  GLU A OE1 
616  O  OE2 . GLU A 75  ? 0.7502 0.4076 0.5048 0.1086  -0.1464 0.1341  75  GLU A OE2 
617  N  N   . THR A 76  ? 0.1680 0.1690 0.1411 0.0125  -0.0205 0.0619  76  THR A N   
618  C  CA  . THR A 76  ? 0.1677 0.1838 0.1347 0.0181  -0.0124 0.0470  76  THR A CA  
619  C  C   . THR A 76  ? 0.1653 0.1633 0.1576 0.0233  -0.0214 0.0492  76  THR A C   
620  O  O   . THR A 76  ? 0.1729 0.1826 0.1365 0.0359  -0.0137 0.0606  76  THR A O   
621  C  CB  . THR A 76  ? 0.1614 0.1797 0.1686 0.0111  -0.0456 0.0469  76  THR A CB  
622  O  OG1 . THR A 76  ? 0.1823 0.1987 0.1867 0.0097  -0.0413 0.0405  76  THR A OG1 
623  C  CG2 . THR A 76  ? 0.2079 0.1511 0.1959 0.0262  -0.0191 0.0372  76  THR A CG2 
624  N  N   . PHE A 77  ? 0.1403 0.1499 0.1615 0.0159  -0.0186 0.0452  77  PHE A N   
625  C  CA  . PHE A 77  ? 0.1393 0.1876 0.1426 0.0217  -0.0250 0.0694  77  PHE A CA  
626  C  C   . PHE A 77  ? 0.1366 0.1907 0.1544 0.0194  -0.0215 0.0700  77  PHE A C   
627  O  O   . PHE A 77  ? 0.1491 0.1975 0.1344 0.0227  -0.0190 0.0660  77  PHE A O   
628  C  CB  . PHE A 77  ? 0.1370 0.1919 0.1397 0.0347  -0.0276 0.0787  77  PHE A CB  
629  C  CG  . PHE A 77  ? 0.1378 0.1598 0.1298 0.0175  -0.0249 0.0484  77  PHE A CG  
630  C  CD1 . PHE A 77  ? 0.1771 0.1762 0.1591 0.0220  -0.0272 0.0535  77  PHE A CD1 
631  C  CD2 . PHE A 77  ? 0.1591 0.2012 0.1438 0.0313  -0.0365 0.0752  77  PHE A CD2 
632  C  CE1 . PHE A 77  ? 0.2318 0.1501 0.1372 -0.0173 -0.0078 0.0603  77  PHE A CE1 
633  C  CE2 . PHE A 77  ? 0.1372 0.2137 0.1325 -0.0042 -0.0426 0.0319  77  PHE A CE2 
634  C  CZ  . PHE A 77  ? 0.1934 0.1994 0.1435 -0.0458 -0.0142 0.0173  77  PHE A CZ  
635  N  N   . LYS A 78  ? 0.1447 0.1980 0.1515 0.0087  -0.0235 0.0809  78  LYS A N   
636  C  CA  . LYS A 78  ? 0.1549 0.2014 0.1683 0.0124  -0.0388 0.0885  78  LYS A CA  
637  C  C   . LYS A 78  ? 0.1732 0.1824 0.1596 -0.0060 -0.0175 0.0784  78  LYS A C   
638  O  O   . LYS A 78  ? 0.1793 0.2077 0.1450 0.0001  -0.0099 0.0858  78  LYS A O   
639  C  CB  . LYS A 78  ? 0.1851 0.1945 0.2005 0.0141  -0.0321 0.0965  78  LYS A CB  
640  C  CG  . LYS A 78  ? 0.2773 0.2492 0.2913 -0.0106 0.0064  0.1276  78  LYS A CG  
641  C  CD  . LYS A 78  ? 0.3690 0.3517 0.4091 -0.0539 -0.0008 0.1122  78  LYS A CD  
642  C  CE  . LYS A 78  ? 0.4345 0.3866 0.5100 -0.0578 0.0484  0.1010  78  LYS A CE  
643  N  NZ  . LYS A 78  ? 0.4776 0.4517 0.5227 -0.0248 0.0451  0.1329  78  LYS A NZ  
644  N  N   . GLU A 79  ? 0.1770 0.1925 0.1413 0.0103  -0.0154 0.0729  79  GLU A N   
645  C  CA  . GLU A 79  ? 0.1996 0.1922 0.1577 0.0195  -0.0042 0.0548  79  GLU A CA  
646  C  C   . GLU A 79  ? 0.1591 0.2088 0.1637 0.0415  0.0090  0.0642  79  GLU A C   
647  O  O   . GLU A 79  ? 0.1888 0.2312 0.1238 0.0409  0.0025  0.0688  79  GLU A O   
648  C  CB  . GLU A 79  ? 0.2446 0.2213 0.1647 0.0109  0.0049  0.0634  79  GLU A CB  
649  C  CG  . GLU A 79  ? 0.2385 0.2499 0.1952 0.0197  -0.0094 0.0909  79  GLU A CG  
650  C  CD  . GLU A 79  ? 0.3066 0.2942 0.2860 0.0468  -0.0833 0.0825  79  GLU A CD  
651  O  OE1 . GLU A 79  ? 0.3476 0.3330 0.2405 0.0100  -0.0553 0.1381  79  GLU A OE1 
652  O  OE2 . GLU A 79  ? 0.3923 0.3403 0.3336 0.1041  -0.1028 0.1242  79  GLU A OE2 
653  N  N   . VAL A 80  ? 0.1724 0.2129 0.1307 0.0337  -0.0123 0.0740  80  VAL A N   
654  C  CA  . VAL A 80  ? 0.1627 0.1700 0.1583 0.0314  -0.0038 0.0495  80  VAL A CA  
655  C  C   . VAL A 80  ? 0.1567 0.1818 0.1264 0.0292  0.0119  0.0575  80  VAL A C   
656  O  O   . VAL A 80  ? 0.1705 0.1812 0.1522 0.0280  0.0032  0.0746  80  VAL A O   
657  C  CB  . VAL A 80  ? 0.1763 0.1704 0.1572 0.0157  -0.0145 0.0504  80  VAL A CB  
658  C  CG1 . VAL A 80  ? 0.1781 0.1738 0.1566 0.0442  -0.0306 0.0744  80  VAL A CG1 
659  C  CG2 . VAL A 80  ? 0.1915 0.1903 0.1787 0.0061  -0.0377 0.0554  80  VAL A CG2 
660  N  N   . THR A 81  ? 0.1507 0.1685 0.1427 0.0266  -0.0109 0.0570  81  THR A N   
661  C  CA  . THR A 81  ? 0.1590 0.1786 0.1473 0.0066  -0.0134 0.0711  81  THR A CA  
662  C  C   . THR A 81  ? 0.1608 0.2049 0.1629 0.0235  -0.0142 0.0841  81  THR A C   
663  O  O   . THR A 81  ? 0.1761 0.2195 0.1842 0.0351  0.0034  0.0970  81  THR A O   
664  C  CB  . THR A 81  ? 0.1661 0.1806 0.1388 0.0091  -0.0062 0.0731  81  THR A CB  
665  O  OG1 . THR A 81  ? 0.1593 0.1909 0.1367 0.0088  -0.0030 0.0676  81  THR A OG1 
666  C  CG2 . THR A 81  ? 0.1558 0.2034 0.1662 -0.0218 -0.0082 0.0465  81  THR A CG2 
667  N  N   . ASP A 82  ? 0.1697 0.2298 0.1514 0.0250  -0.0072 0.0802  82  ASP A N   
668  C  CA  . ASP A 82  ? 0.1743 0.2585 0.1803 0.0310  0.0005  0.1033  82  ASP A CA  
669  C  C   . ASP A 82  ? 0.2061 0.2561 0.1815 0.0134  -0.0087 0.0871  82  ASP A C   
670  O  O   . ASP A 82  ? 0.2223 0.3695 0.2584 0.0076  0.0446  0.0703  82  ASP A O   
671  C  CB  . ASP A 82  ? 0.2202 0.2592 0.2248 0.0345  -0.0032 0.1057  82  ASP A CB  
672  C  CG  . ASP A 82  ? 0.2346 0.2606 0.2374 0.0008  0.0055  0.0846  82  ASP A CG  
673  O  OD1 . ASP A 82  ? 0.4048 0.2971 0.3261 -0.0221 -0.0812 0.0926  82  ASP A OD1 
674  O  OD2 . ASP A 82  ? 0.3344 0.3253 0.3686 0.0895  0.0158  0.1606  82  ASP A OD2 
675  N  N   . GLN A 83  ? 0.2185 0.2368 0.1483 0.0194  0.0053  0.0712  83  GLN A N   
676  C  CA  . GLN A 83  ? 0.2235 0.2696 0.1919 0.0361  0.0123  0.0478  83  GLN A CA  
677  C  C   . GLN A 83  ? 0.2431 0.2400 0.1663 0.0563  0.0182  0.0235  83  GLN A C   
678  O  O   . GLN A 83  ? 0.2816 0.2849 0.1553 0.0648  0.0132  0.0588  83  GLN A O   
679  C  CB  . GLN A 83  ? 0.2740 0.2993 0.1745 0.0664  -0.0175 0.0333  83  GLN A CB  
680  C  CG  . GLN A 83  ? 0.3608 0.3467 0.2019 0.0381  0.0070  0.0841  83  GLN A CG  
681  C  CD  . GLN A 83  ? 0.4663 0.4156 0.2795 0.0279  0.0224  0.1266  83  GLN A CD  
682  O  OE1 . GLN A 83  ? 0.5699 0.4677 0.4901 -0.0800 0.0668  0.1700  83  GLN A OE1 
683  N  NE2 . GLN A 83  ? 0.4545 0.5103 0.2119 0.0162  0.0518  0.1194  83  GLN A NE2 
684  N  N   . ILE A 84  ? 0.1896 0.2456 0.1464 0.0563  0.0188  0.0420  84  ILE A N   
685  C  CA  . ILE A 84  ? 0.2042 0.2243 0.1659 0.0451  -0.0068 0.0387  84  ILE A CA  
686  C  C   . ILE A 84  ? 0.2002 0.2207 0.1613 0.0227  0.0141  0.0471  84  ILE A C   
687  O  O   . ILE A 84  ? 0.2073 0.2485 0.1475 0.0585  0.0236  0.0619  84  ILE A O   
688  C  CB  . ILE A 84  ? 0.2025 0.2225 0.1562 0.0191  -0.0162 0.0227  84  ILE A CB  
689  C  CG1 . ILE A 84  ? 0.3120 0.2500 0.1756 0.0198  -0.0358 0.0349  84  ILE A CG1 
690  C  CG2 . ILE A 84  ? 0.2358 0.2302 0.1545 0.0450  0.0192  0.0676  84  ILE A CG2 
691  C  CD1 . ILE A 84  ? 0.3885 0.3280 0.1952 -0.0022 0.0286  0.0162  84  ILE A CD1 
692  N  N   . ALA A 85  ? 0.1769 0.1936 0.1383 0.0407  -0.0101 0.0659  85  ALA A N   
693  C  CA  . ALA A 85  ? 0.1668 0.1930 0.1368 0.0117  -0.0092 0.0615  85  ALA A CA  
694  C  C   . ALA A 85  ? 0.1491 0.2047 0.1891 0.0209  -0.0095 0.0916  85  ALA A C   
695  O  O   . ALA A 85  ? 0.1387 0.2470 0.2061 0.0343  0.0035  0.1071  85  ALA A O   
696  C  CB  . ALA A 85  ? 0.1851 0.2169 0.1391 0.0537  0.0126  0.0615  85  ALA A CB  
697  N  N   . LYS A 86  ? 0.1777 0.2248 0.1987 0.0039  -0.0244 0.1070  86  LYS A N   
698  C  CA  . LYS A 86  ? 0.1972 0.2682 0.2409 0.0091  -0.0317 0.1372  86  LYS A CA  
699  C  C   . LYS A 86  ? 0.2193 0.2629 0.2111 0.0017  -0.0062 0.1403  86  LYS A C   
700  O  O   . LYS A 86  ? 0.2111 0.3380 0.2822 0.0119  0.0091  0.1783  86  LYS A O   
701  C  CB  . LYS A 86  ? 0.2116 0.2429 0.2516 -0.0106 -0.0269 0.1443  86  LYS A CB  
702  C  CG  . LYS A 86  ? 0.2736 0.3141 0.4018 -0.0010 -0.0357 0.0648  86  LYS A CG  
703  C  CD  . LYS A 86  ? 0.3802 0.3423 0.5113 -0.0471 0.0205  0.0120  86  LYS A CD  
704  C  CE  . LYS A 86  ? 0.4335 0.4184 0.5887 -0.0367 0.0104  -0.0642 86  LYS A CE  
705  N  NZ  . LYS A 86  ? 0.6100 0.4412 0.6607 0.0174  0.0486  -0.0066 86  LYS A NZ  
706  N  N   . ARG A 87  ? 0.2258 0.3028 0.1691 0.0433  0.0123  0.1191  87  ARG A N   
707  C  CA  . ARG A 87  ? 0.2757 0.3433 0.2294 0.0595  0.0181  0.1068  87  ARG A CA  
708  C  C   . ARG A 87  ? 0.1939 0.3179 0.1980 0.0719  0.0295  0.1236  87  ARG A C   
709  O  O   . ARG A 87  ? 0.2091 0.3787 0.2469 0.0725  0.0584  0.1169  87  ARG A O   
710  C  CB  . ARG A 87  ? 0.2919 0.4063 0.2527 0.0534  0.0134  0.0685  87  ARG A CB  
711  C  CG  . ARG A 87  ? 0.4166 0.4798 0.3392 0.0722  0.0276  0.0299  87  ARG A CG  
712  C  CD  . ARG A 87  ? 0.5497 0.6341 0.5702 0.0347  -0.0119 0.0054  87  ARG A CD  
713  N  NE  . ARG A 87  ? 0.6016 0.7959 0.5971 0.0504  -0.0216 -0.0221 87  ARG A NE  
714  C  CZ  . ARG A 87  ? 0.7200 0.9086 0.7139 0.0374  -0.0124 0.0212  87  ARG A CZ  
715  N  NH1 . ARG A 87  ? 0.7044 0.9477 0.6938 0.0696  -0.0134 -0.0274 87  ARG A NH1 
716  N  NH2 . ARG A 87  ? 0.7392 0.9380 0.7677 0.0013  0.0129  0.0475  87  ARG A NH2 
717  N  N   . PHE A 88  ? 0.1822 0.3017 0.1384 0.0409  0.0163  0.0903  88  PHE A N   
718  C  CA  . PHE A 88  ? 0.1888 0.2390 0.1724 0.0168  0.0055  0.0455  88  PHE A CA  
719  C  C   . PHE A 88  ? 0.1504 0.1794 0.1293 0.0083  0.0147  0.0428  88  PHE A C   
720  O  O   . PHE A 88  ? 0.1593 0.2047 0.1586 0.0175  -0.0016 0.0668  88  PHE A O   
721  C  CB  . PHE A 88  ? 0.1660 0.2480 0.1737 0.0236  -0.0155 0.0288  88  PHE A CB  
722  C  CG  . PHE A 88  ? 0.1802 0.2730 0.1758 -0.0062 -0.0101 -0.0098 88  PHE A CG  
723  C  CD1 . PHE A 88  ? 0.2221 0.4870 0.2629 -0.0368 0.0006  -0.1039 88  PHE A CD1 
724  C  CD2 . PHE A 88  ? 0.1963 0.2105 0.2041 -0.0205 -0.0231 0.0086  88  PHE A CD2 
725  C  CE1 . PHE A 88  ? 0.2665 0.4641 0.2965 -0.0529 0.0346  -0.1135 88  PHE A CE1 
726  C  CE2 . PHE A 88  ? 0.2515 0.2693 0.2443 -0.0198 -0.0533 0.0026  88  PHE A CE2 
727  C  CZ  . PHE A 88  ? 0.2497 0.3776 0.2503 -0.0305 -0.0368 -0.0721 88  PHE A CZ  
728  N  N   . LYS A 89  ? 0.1657 0.1901 0.1524 -0.0031 0.0095  0.0698  89  LYS A N   
729  C  CA  . LYS A 89  ? 0.1665 0.1594 0.1768 0.0091  0.0225  0.0776  89  LYS A CA  
730  C  C   . LYS A 89  ? 0.1430 0.1827 0.1499 -0.0171 0.0071  0.0767  89  LYS A C   
731  O  O   . LYS A 89  ? 0.1476 0.1827 0.1331 0.0218  -0.0019 0.0664  89  LYS A O   
732  C  CB  . LYS A 89  ? 0.1693 0.1956 0.1603 0.0032  0.0140  0.0679  89  LYS A CB  
733  C  CG  . LYS A 89  ? 0.1989 0.1990 0.1880 0.0081  0.0292  0.1096  89  LYS A CG  
734  C  CD  . LYS A 89  ? 0.2041 0.2200 0.2202 -0.0312 0.0271  0.0918  89  LYS A CD  
735  C  CE  . LYS A 89  ? 0.2066 0.3127 0.2507 0.0062  0.0259  0.0572  89  LYS A CE  
736  N  NZ  . LYS A 89  ? 0.1659 0.2467 0.2560 -0.0142 0.0504  0.0262  89  LYS A NZ  
737  N  N   . LEU A 90  ? 0.1216 0.1692 0.1433 0.0018  -0.0144 0.0836  90  LEU A N   
738  C  CA  . LEU A 90  ? 0.1461 0.1419 0.1294 0.0031  0.0002  0.0829  90  LEU A CA  
739  C  C   . LEU A 90  ? 0.1290 0.1234 0.1313 0.0075  -0.0090 0.0460  90  LEU A C   
740  O  O   . LEU A 90  ? 0.1497 0.1320 0.1547 0.0079  -0.0080 0.0592  90  LEU A O   
741  C  CB  . LEU A 90  ? 0.1382 0.1613 0.1457 -0.0112 0.0003  0.0845  90  LEU A CB  
742  C  CG  . LEU A 90  ? 0.1562 0.1737 0.1326 -0.0040 -0.0045 0.0803  90  LEU A CG  
743  C  CD1 . LEU A 90  ? 0.1590 0.2236 0.1694 0.0012  0.0031  0.0745  90  LEU A CD1 
744  C  CD2 . LEU A 90  ? 0.2114 0.1473 0.1411 0.0132  -0.0031 0.0765  90  LEU A CD2 
745  N  N   . TYR A 91  ? 0.1415 0.1515 0.1259 -0.0098 0.0060  0.0529  91  TYR A N   
746  C  CA  . TYR A 91  ? 0.1260 0.1337 0.1469 -0.0116 0.0021  0.0632  91  TYR A CA  
747  C  C   . TYR A 91  ? 0.1324 0.1230 0.1414 -0.0049 -0.0087 0.0638  91  TYR A C   
748  O  O   . TYR A 91  ? 0.1290 0.1422 0.1839 0.0011  -0.0174 0.0491  91  TYR A O   
749  C  CB  . TYR A 91  ? 0.1198 0.1170 0.1475 -0.0016 0.0101  0.0617  91  TYR A CB  
750  C  CG  . TYR A 91  ? 0.1319 0.1168 0.1305 0.0139  -0.0126 0.0628  91  TYR A CG  
751  C  CD1 . TYR A 91  ? 0.1472 0.1207 0.1355 -0.0121 -0.0161 0.0567  91  TYR A CD1 
752  C  CD2 . TYR A 91  ? 0.1380 0.1244 0.1447 0.0019  0.0129  0.0391  91  TYR A CD2 
753  C  CE1 . TYR A 91  ? 0.1375 0.1495 0.1033 0.0105  0.0119  0.0532  91  TYR A CE1 
754  C  CE2 . TYR A 91  ? 0.1281 0.1359 0.1333 0.0201  0.0115  0.0382  91  TYR A CE2 
755  C  CZ  . TYR A 91  ? 0.1540 0.1264 0.1272 0.0050  -0.0005 0.0594  91  TYR A CZ  
756  O  OH  . TYR A 91  ? 0.1646 0.1276 0.1276 -0.0037 -0.0038 0.0593  91  TYR A OH  
757  N  N   . GLY A 92  ? 0.1498 0.1096 0.1775 0.0006  -0.0217 0.0425  92  GLY A N   
758  C  CA  . GLY A 92  ? 0.1688 0.1530 0.1532 0.0033  -0.0094 0.0474  92  GLY A CA  
759  C  C   . GLY A 92  ? 0.1699 0.1363 0.1374 0.0106  -0.0036 0.0620  92  GLY A C   
760  O  O   . GLY A 92  ? 0.1653 0.1647 0.1696 0.0153  -0.0129 0.0578  92  GLY A O   
761  N  N   . ALA A 93  ? 0.1554 0.1548 0.1621 -0.0042 0.0088  0.0587  93  ALA A N   
762  C  CA  . ALA A 93  ? 0.1806 0.1423 0.1625 0.0175  -0.0123 0.0409  93  ALA A CA  
763  C  C   . ALA A 93  ? 0.1496 0.1690 0.1418 0.0066  0.0149  0.0426  93  ALA A C   
764  O  O   . ALA A 93  ? 0.2189 0.1572 0.2045 -0.0167 -0.0342 0.0538  93  ALA A O   
765  C  CB  . ALA A 93  ? 0.1747 0.2252 0.1618 0.0043  0.0136  0.0624  93  ALA A CB  
766  N  N   . GLY A 94  ? 0.1531 0.1496 0.1707 0.0021  -0.0184 0.0681  94  GLY A N   
767  C  CA  . GLY A 94  ? 0.1680 0.1416 0.1747 0.0170  -0.0070 0.0648  94  GLY A CA  
768  C  C   . GLY A 94  ? 0.1628 0.1295 0.1582 0.0054  0.0069  0.0407  94  GLY A C   
769  O  O   . GLY A 94  ? 0.1868 0.1496 0.2029 0.0127  0.0118  0.0479  94  GLY A O   
770  N  N   . GLN A 95  ? 0.1752 0.1313 0.1622 0.0084  -0.0087 0.0487  95  GLN A N   
771  C  CA  . GLN A 95  ? 0.1524 0.1380 0.1720 0.0022  0.0036  0.0589  95  GLN A CA  
772  C  C   . GLN A 95  ? 0.1781 0.1266 0.1473 -0.0002 -0.0102 0.0493  95  GLN A C   
773  O  O   . GLN A 95  ? 0.1956 0.1303 0.1827 0.0107  -0.0217 0.0316  95  GLN A O   
774  C  CB  . GLN A 95  ? 0.1657 0.1428 0.1431 0.0004  -0.0065 0.0638  95  GLN A CB  
775  C  CG  . GLN A 95  ? 0.2036 0.1218 0.1641 -0.0107 -0.0221 0.0589  95  GLN A CG  
776  C  CD  . GLN A 95  ? 0.1838 0.1439 0.1577 0.0259  -0.0157 0.0353  95  GLN A CD  
777  O  OE1 . GLN A 95  ? 0.1406 0.1102 0.1247 -0.0032 -0.0033 0.0437  95  GLN A OE1 
778  N  NE2 . GLN A 95  ? 0.1630 0.1736 0.1522 0.0216  -0.0080 0.0396  95  GLN A NE2 
779  N  N   . ASP A 96  ? 0.1531 0.1283 0.1618 -0.0072 -0.0161 0.0324  96  ASP A N   
780  C  CA  . ASP A 96  ? 0.1616 0.1467 0.1691 0.0152  -0.0106 0.0244  96  ASP A CA  
781  C  C   . ASP A 96  ? 0.1762 0.1407 0.1616 0.0372  0.0022  0.0111  96  ASP A C   
782  O  O   . ASP A 96  ? 0.2194 0.1829 0.2134 0.0400  0.0189  0.0519  96  ASP A O   
783  C  CB  . ASP A 96  ? 0.1937 0.1461 0.1630 0.0179  -0.0232 0.0232  96  ASP A CB  
784  C  CG  . ASP A 96  ? 0.1767 0.1873 0.1693 -0.0158 -0.0449 0.0249  96  ASP A CG  
785  O  OD1 . ASP A 96  ? 0.1874 0.1424 0.1966 0.0042  -0.0239 0.0272  96  ASP A OD1 
786  O  OD2 . ASP A 96  ? 0.1528 0.1437 0.1866 -0.0045 -0.0082 0.0006  96  ASP A OD2 
787  N  N   . LEU A 97  ? 0.1771 0.1380 0.1960 0.0428  -0.0071 0.0505  97  LEU A N   
788  C  CA  . LEU A 97  ? 0.2095 0.1437 0.1954 0.0287  -0.0451 0.0799  97  LEU A CA  
789  C  C   . LEU A 97  ? 0.2431 0.1891 0.2419 0.0226  -0.0121 0.0926  97  LEU A C   
790  O  O   . LEU A 97  ? 0.3143 0.1786 0.2785 0.0112  0.0040  0.1062  97  LEU A O   
791  C  CB  . LEU A 97  ? 0.1971 0.1999 0.2150 0.0468  -0.0375 0.0911  97  LEU A CB  
792  C  CG  . LEU A 97  ? 0.3550 0.2905 0.2196 -0.0583 -0.0405 0.0618  97  LEU A CG  
793  C  CD1 . LEU A 97  ? 0.2157 0.3528 0.2725 -0.0281 0.0340  0.0474  97  LEU A CD1 
794  C  CD2 . LEU A 97  ? 0.4176 0.3062 0.1520 -0.1464 -0.0095 0.0138  97  LEU A CD2 
795  N  N   . LEU A 98  ? 0.2366 0.1802 0.2445 -0.0199 -0.0297 0.0898  98  LEU A N   
796  C  CA  . LEU A 98  ? 0.2355 0.1760 0.2467 -0.0219 -0.0017 0.0728  98  LEU A CA  
797  C  C   . LEU A 98  ? 0.2666 0.1865 0.2417 -0.0085 -0.0270 0.0817  98  LEU A C   
798  O  O   . LEU A 98  ? 0.2745 0.1919 0.2555 -0.0051 -0.0263 0.0944  98  LEU A O   
799  C  CB  . LEU A 98  ? 0.2571 0.2070 0.2566 -0.0113 -0.0044 0.0530  98  LEU A CB  
800  C  CG  . LEU A 98  ? 0.2815 0.2127 0.2848 -0.0219 0.0335  0.0461  98  LEU A CG  
801  C  CD1 . LEU A 98  ? 0.2839 0.2690 0.3400 -0.0153 0.0849  0.0615  98  LEU A CD1 
802  C  CD2 . LEU A 98  ? 0.3760 0.3203 0.2697 0.0329  0.0078  0.1600  98  LEU A CD2 
803  N  N   . LYS A 99  ? 0.3007 0.1973 0.2546 0.0068  -0.0174 0.0667  99  LYS A N   
804  C  CA  . LYS A 99  ? 0.3054 0.1952 0.3098 -0.0139 -0.0102 0.0637  99  LYS A CA  
805  C  C   . LYS A 99  ? 0.3043 0.1970 0.3155 -0.0174 -0.0037 0.0751  99  LYS A C   
806  O  O   . LYS A 99  ? 0.3274 0.2559 0.3271 -0.0503 -0.0259 0.0703  99  LYS A O   
807  C  CB  . LYS A 99  ? 0.3608 0.2394 0.3811 -0.0021 -0.0024 0.0313  99  LYS A CB  
808  C  CG  . LYS A 99  ? 0.4217 0.3445 0.5092 0.0023  0.0223  -0.0182 99  LYS A CG  
809  C  CD  . LYS A 99  ? 0.5838 0.5921 0.6106 0.0169  0.0624  -0.0670 99  LYS A CD  
810  C  CE  . LYS A 99  ? 0.6012 0.6593 0.6884 0.0178  0.0769  -0.0573 99  LYS A CE  
811  N  NZ  . LYS A 99  ? 0.7382 0.6978 0.6956 -0.0056 0.0659  -0.0654 99  LYS A NZ  
812  N  N   . ASP A 100 ? 0.2904 0.2337 0.3464 -0.0092 -0.0049 0.0833  100 ASP A N   
813  C  CA  . ASP A 100 ? 0.2955 0.2231 0.3694 -0.0121 0.0189  0.0865  100 ASP A CA  
814  C  C   . ASP A 100 ? 0.2860 0.2532 0.3391 -0.0022 0.0257  0.1006  100 ASP A C   
815  O  O   . ASP A 100 ? 0.2695 0.2407 0.3667 -0.0181 0.0470  0.1108  100 ASP A O   
816  C  CB  . ASP A 100 ? 0.3202 0.2544 0.4048 -0.0364 0.0751  0.1030  100 ASP A CB  
817  C  CG  . ASP A 100 ? 0.4357 0.3720 0.4143 0.0635  0.0087  0.1139  100 ASP A CG  
818  O  OD1 . ASP A 100 ? 0.6101 0.5957 0.5853 0.0562  0.0328  0.0038  100 ASP A OD1 
819  O  OD2 . ASP A 100 ? 0.5273 0.5004 0.5839 0.0754  0.0634  0.1421  100 ASP A OD2 
820  N  N   . ALA A 101 ? 0.2437 0.2063 0.2605 -0.0144 0.0153  0.0931  101 ALA A N   
821  C  CA  . ALA A 101 ? 0.2417 0.2111 0.2334 -0.0045 -0.0125 0.0672  101 ALA A CA  
822  C  C   . ALA A 101 ? 0.2272 0.1871 0.2252 -0.0125 0.0081  0.0414  101 ALA A C   
823  O  O   . ALA A 101 ? 0.2449 0.1960 0.2285 -0.0222 0.0251  0.0490  101 ALA A O   
824  C  CB  . ALA A 101 ? 0.2139 0.2337 0.2498 -0.0616 0.0035  0.0687  101 ALA A CB  
825  N  N   . PHE A 102 ? 0.2443 0.2029 0.2140 -0.0141 0.0052  0.0612  102 PHE A N   
826  C  CA  . PHE A 102 ? 0.2128 0.2005 0.2373 -0.0082 0.0096  0.0696  102 PHE A CA  
827  C  C   . PHE A 102 ? 0.2102 0.2053 0.2188 -0.0136 0.0084  0.0507  102 PHE A C   
828  O  O   . PHE A 102 ? 0.1833 0.1736 0.2510 -0.0192 -0.0065 0.0441  102 PHE A O   
829  C  CB  . PHE A 102 ? 0.2370 0.2226 0.2489 -0.0351 0.0378  0.0737  102 PHE A CB  
830  C  CG  . PHE A 102 ? 0.2066 0.2497 0.2899 -0.0284 0.0120  0.0334  102 PHE A CG  
831  C  CD1 . PHE A 102 ? 0.2464 0.2530 0.2863 -0.0823 0.0078  0.0096  102 PHE A CD1 
832  C  CD2 . PHE A 102 ? 0.2670 0.2241 0.2601 -0.0613 -0.0040 0.0745  102 PHE A CD2 
833  C  CE1 . PHE A 102 ? 0.2249 0.2724 0.3622 -0.0155 0.0092  0.0452  102 PHE A CE1 
834  C  CE2 . PHE A 102 ? 0.2582 0.2450 0.2239 -0.1021 -0.0230 0.0482  102 PHE A CE2 
835  C  CZ  . PHE A 102 ? 0.2344 0.2676 0.2604 0.0122  0.0053  0.0424  102 PHE A CZ  
836  N  N   . SER A 103 ? 0.2234 0.1663 0.2004 0.0255  0.0150  0.0575  103 SER A N   
837  C  CA  . SER A 103 ? 0.1928 0.1717 0.2040 -0.0135 0.0109  0.0613  103 SER A CA  
838  C  C   . SER A 103 ? 0.1910 0.1535 0.2027 0.0014  0.0104  0.0606  103 SER A C   
839  O  O   . SER A 103 ? 0.2168 0.1557 0.2592 -0.0054 -0.0310 0.0852  103 SER A O   
840  C  CB  . SER A 103 ? 0.1623 0.1680 0.2130 0.0058  -0.0095 0.0527  103 SER A CB  
841  O  OG  . SER A 103 ? 0.1900 0.1896 0.2190 -0.0006 -0.0054 0.0716  103 SER A OG  
842  N  N   . GLY A 104 ? 0.2130 0.1710 0.1919 -0.0056 -0.0084 0.0572  104 GLY A N   
843  C  CA  . GLY A 104 ? 0.1938 0.1630 0.2015 -0.0096 -0.0139 0.0278  104 GLY A CA  
844  C  C   . GLY A 104 ? 0.1981 0.1443 0.2164 -0.0063 -0.0095 0.0201  104 GLY A C   
845  O  O   . GLY A 104 ? 0.2212 0.1825 0.2148 -0.0263 -0.0251 0.0273  104 GLY A O   
846  N  N   . ASN A 105 ? 0.1915 0.1675 0.1800 -0.0074 -0.0197 0.0398  105 ASN A N   
847  C  CA  . ASN A 105 ? 0.1873 0.1576 0.2069 -0.0069 -0.0201 0.0407  105 ASN A CA  
848  C  C   . ASN A 105 ? 0.1801 0.1779 0.1754 -0.0183 -0.0158 0.0469  105 ASN A C   
849  O  O   . ASN A 105 ? 0.2155 0.1918 0.1890 -0.0198 -0.0090 0.0476  105 ASN A O   
850  C  CB  . ASN A 105 ? 0.2014 0.1493 0.1813 -0.0132 -0.0290 0.0296  105 ASN A CB  
851  C  CG  . ASN A 105 ? 0.1826 0.1429 0.1694 -0.0089 -0.0114 0.0563  105 ASN A CG  
852  O  OD1 . ASN A 105 ? 0.1937 0.1774 0.2423 -0.0671 -0.0247 0.0455  105 ASN A OD1 
853  N  ND2 . ASN A 105 ? 0.1789 0.1305 0.1668 -0.0283 -0.0184 0.0225  105 ASN A ND2 
854  N  N   . ILE A 106 ? 0.1703 0.1416 0.1885 -0.0112 -0.0110 0.0501  106 ILE A N   
855  C  CA  . ILE A 106 ? 0.2009 0.1686 0.2017 -0.0027 -0.0324 0.0456  106 ILE A CA  
856  C  C   . ILE A 106 ? 0.2266 0.1654 0.1959 -0.0034 -0.0219 0.0450  106 ILE A C   
857  O  O   . ILE A 106 ? 0.2456 0.1913 0.1851 -0.0397 -0.0408 0.0394  106 ILE A O   
858  C  CB  . ILE A 106 ? 0.2241 0.1686 0.2103 0.0187  -0.0064 0.0427  106 ILE A CB  
859  C  CG1 . ILE A 106 ? 0.2704 0.1826 0.1991 0.0079  -0.0055 0.0444  106 ILE A CG1 
860  C  CG2 . ILE A 106 ? 0.2278 0.2280 0.2455 0.0651  -0.0449 0.0807  106 ILE A CG2 
861  C  CD1 . ILE A 106 ? 0.2056 0.3315 0.2725 -0.0251 0.0231  0.0753  106 ILE A CD1 
862  N  N   . ARG A 107 ? 0.2290 0.1530 0.1945 -0.0080 -0.0108 0.0466  107 ARG A N   
863  C  CA  . ARG A 107 ? 0.1853 0.1733 0.1797 0.0019  -0.0131 0.0396  107 ARG A CA  
864  C  C   . ARG A 107 ? 0.1945 0.1789 0.1874 0.0047  -0.0292 0.0222  107 ARG A C   
865  O  O   . ARG A 107 ? 0.2273 0.1801 0.2067 0.0112  -0.0240 0.0304  107 ARG A O   
866  C  CB  . ARG A 107 ? 0.1984 0.1598 0.1792 -0.0024 -0.0246 0.0632  107 ARG A CB  
867  C  CG  . ARG A 107 ? 0.1932 0.1606 0.1859 0.0167  0.0037  0.0474  107 ARG A CG  
868  C  CD  . ARG A 107 ? 0.1913 0.2001 0.2103 0.0241  -0.0101 0.0662  107 ARG A CD  
869  N  NE  . ARG A 107 ? 0.2311 0.2071 0.2034 -0.0096 -0.0526 0.0512  107 ARG A NE  
870  C  CZ  . ARG A 107 ? 0.2442 0.2492 0.2809 -0.0018 -0.0033 0.0108  107 ARG A CZ  
871  N  NH1 . ARG A 107 ? 0.3006 0.2536 0.2586 -0.0417 -0.0234 0.0109  107 ARG A NH1 
872  N  NH2 . ARG A 107 ? 0.2299 0.1987 0.2932 -0.0202 -0.0217 0.0447  107 ARG A NH2 
873  N  N   . GLY A 108 ? 0.2015 0.1476 0.1886 -0.0096 -0.0388 0.0355  108 GLY A N   
874  C  CA  . GLY A 108 ? 0.1920 0.1653 0.2156 0.0032  -0.0247 0.0765  108 GLY A CA  
875  C  C   . GLY A 108 ? 0.1918 0.2113 0.2461 0.0184  -0.0344 0.0537  108 GLY A C   
876  O  O   . GLY A 108 ? 0.2570 0.1793 0.2706 0.0235  -0.0309 0.0654  108 GLY A O   
877  N  N   . MET A 109 ? 0.2119 0.1792 0.2254 0.0373  -0.0174 0.0398  109 MET A N   
878  C  CA  . MET A 109 ? 0.2099 0.1554 0.2289 0.0196  -0.0229 0.0387  109 MET A CA  
879  C  C   . MET A 109 ? 0.2077 0.1698 0.2324 0.0167  -0.0227 0.0486  109 MET A C   
880  O  O   . MET A 109 ? 0.1935 0.2371 0.2839 0.0608  0.0024  0.0419  109 MET A O   
881  C  CB  . MET A 109 ? 0.2305 0.2197 0.2286 0.0330  -0.0161 0.0327  109 MET A CB  
882  C  CG  . MET A 109 ? 0.2561 0.1834 0.2486 -0.0257 -0.0448 0.0364  109 MET A CG  
883  S  SD  . MET A 109 ? 0.4325 0.3039 0.3461 0.0013  -0.0851 -0.0065 109 MET A SD  
884  C  CE  . MET A 109 ? 0.4383 0.4240 0.4034 0.0503  0.0148  0.0205  109 MET A CE  
885  N  N   . GLY A 110 ? 0.2087 0.1637 0.2241 0.0387  -0.0372 0.0480  110 GLY A N   
886  C  CA  . GLY A 110 ? 0.2010 0.1519 0.2320 0.0271  -0.0308 0.0636  110 GLY A CA  
887  C  C   . GLY A 110 ? 0.2277 0.1269 0.2476 0.0265  -0.0255 0.0200  110 GLY A C   
888  O  O   . GLY A 110 ? 0.1856 0.1285 0.2359 -0.0035 -0.0307 0.0189  110 GLY A O   
889  N  N   . PRO A 111 ? 0.1981 0.1515 0.2321 0.0308  -0.0401 0.0573  111 PRO A N   
890  C  CA  . PRO A 111 ? 0.1849 0.1093 0.2454 -0.0020 -0.0178 0.0130  111 PRO A CA  
891  C  C   . PRO A 111 ? 0.1659 0.1524 0.2501 0.0304  -0.0362 -0.0084 111 PRO A C   
892  O  O   . PRO A 111 ? 0.1983 0.1774 0.2925 0.0478  -0.0565 -0.0126 111 PRO A O   
893  C  CB  . PRO A 111 ? 0.2135 0.1448 0.2495 0.0167  -0.0115 0.0530  111 PRO A CB  
894  C  CG  . PRO A 111 ? 0.3148 0.2321 0.2816 0.0080  -0.0100 0.0474  111 PRO A CG  
895  C  CD  . PRO A 111 ? 0.2223 0.1936 0.2360 -0.0016 -0.0252 0.0637  111 PRO A CD  
896  N  N   . GLN A 112 ? 0.1463 0.1980 0.2418 -0.0156 0.0235  -0.0440 112 GLN A N   
897  C  CA  . GLN A 112 ? 0.1893 0.2354 0.2402 -0.0254 0.0072  -0.0642 112 GLN A CA  
898  C  C   . GLN A 112 ? 0.1194 0.1590 0.2199 -0.0098 -0.0066 -0.0427 112 GLN A C   
899  O  O   . GLN A 112 ? 0.1373 0.1718 0.1843 0.0114  -0.0158 -0.0285 112 GLN A O   
900  C  CB  . GLN A 112 ? 0.1040 0.3333 0.2145 -0.0488 -0.0129 -0.0311 112 GLN A CB  
901  C  CG  . GLN A 112 ? 0.2186 0.3354 0.2732 -0.0591 0.0005  0.0196  112 GLN A CG  
902  C  CD  . GLN A 112 ? 0.2228 0.2690 0.1747 -0.0338 -0.0421 0.1046  112 GLN A CD  
903  O  OE1 . GLN A 112 ? 0.2819 0.3097 0.3738 -0.0814 0.1409  -0.0457 112 GLN A OE1 
904  N  NE2 . GLN A 112 ? 0.1833 0.2321 0.5348 -0.0642 -0.0622 0.1058  112 GLN A NE2 
905  N  N   . VAL A 113 ? 0.1449 0.1252 0.1685 0.0022  -0.0103 -0.0264 113 VAL A N   
906  C  CA  A VAL A 113 ? 0.1302 0.1185 0.1570 0.0303  -0.0205 0.0111  113 VAL A CA  
907  C  CA  B VAL A 113 ? 0.1460 0.1230 0.1654 0.0312  -0.0220 0.0120  113 VAL A CA  
908  C  C   . VAL A 113 ? 0.1350 0.1247 0.1333 0.0401  -0.0384 0.0247  113 VAL A C   
909  O  O   . VAL A 113 ? 0.1437 0.1269 0.1437 0.0166  -0.0291 0.0143  113 VAL A O   
910  C  CB  A VAL A 113 ? 0.1711 0.1222 0.1900 0.0443  0.0127  0.0295  113 VAL A CB  
911  C  CB  B VAL A 113 ? 0.1797 0.1516 0.1909 0.0552  -0.0065 0.0268  113 VAL A CB  
912  C  CG1 A VAL A 113 ? 0.1878 0.1874 0.2260 0.0792  -0.0444 0.0635  113 VAL A CG1 
913  C  CG1 B VAL A 113 ? 0.2950 0.1550 0.2619 0.0884  -0.0005 0.0386  113 VAL A CG1 
914  C  CG2 A VAL A 113 ? 0.1630 0.1744 0.2088 0.0424  0.0040  0.0791  113 VAL A CG2 
915  C  CG2 B VAL A 113 ? 0.2272 0.2217 0.1893 0.0608  -0.0264 0.0898  113 VAL A CG2 
916  N  N   . ALA A 114 ? 0.1423 0.1179 0.1094 0.0094  -0.0348 0.0239  114 ALA A N   
917  C  CA  . ALA A 114 ? 0.1071 0.1361 0.1205 0.0057  -0.0433 0.0101  114 ALA A CA  
918  C  C   . ALA A 114 ? 0.1221 0.1546 0.1164 0.0147  -0.0198 0.0092  114 ALA A C   
919  O  O   . ALA A 114 ? 0.1197 0.1752 0.1209 0.0331  -0.0297 -0.0116 114 ALA A O   
920  C  CB  . ALA A 114 ? 0.1463 0.1457 0.1341 0.0072  -0.0547 0.0600  114 ALA A CB  
921  N  N   . GLU A 115 ? 0.1266 0.1208 0.1028 0.0204  -0.0494 0.0078  115 GLU A N   
922  C  CA  . GLU A 115 ? 0.1528 0.1276 0.1018 0.0126  -0.0595 0.0190  115 GLU A CA  
923  C  C   . GLU A 115 ? 0.1454 0.1307 0.1178 0.0379  -0.0570 0.0227  115 GLU A C   
924  O  O   . GLU A 115 ? 0.1467 0.1545 0.1449 0.0377  -0.0543 -0.0101 115 GLU A O   
925  C  CB  . GLU A 115 ? 0.2166 0.1972 0.1312 -0.0047 -0.0819 0.0082  115 GLU A CB  
926  C  CG  . GLU A 115 ? 0.3186 0.2287 0.1753 -0.0099 -0.1281 0.0403  115 GLU A CG  
927  C  CD  . GLU A 115 ? 0.2455 0.1496 0.1504 0.0280  -0.0654 0.0836  115 GLU A CD  
928  O  OE1 . GLU A 115 ? 0.2674 0.1384 0.1700 0.0272  -0.0634 0.0551  115 GLU A OE1 
929  O  OE2 . GLU A 115 ? 0.2207 0.1583 0.1836 0.0219  -0.0806 0.0285  115 GLU A OE2 
930  N  N   A MET A 116 ? 0.1386 0.1533 0.1107 0.0295  -0.0576 0.0061  116 MET A N   
931  N  N   B MET A 116 ? 0.1414 0.1612 0.1190 0.0309  -0.0551 0.0020  116 MET A N   
932  C  CA  A MET A 116 ? 0.1438 0.1477 0.1194 0.0178  -0.0534 0.0065  116 MET A CA  
933  C  CA  B MET A 116 ? 0.1537 0.1799 0.1411 0.0304  -0.0482 -0.0075 116 MET A CA  
934  C  C   A MET A 116 ? 0.1452 0.1212 0.1069 0.0277  -0.0533 0.0031  116 MET A C   
935  C  C   B MET A 116 ? 0.1481 0.1329 0.1195 0.0275  -0.0513 -0.0028 116 MET A C   
936  O  O   A MET A 116 ? 0.1436 0.1678 0.1201 0.0374  -0.0661 -0.0061 116 MET A O   
937  O  O   B MET A 116 ? 0.1449 0.1715 0.1222 0.0440  -0.0660 0.0008  116 MET A O   
938  C  CB  A MET A 116 ? 0.1208 0.1537 0.1092 0.0266  -0.0587 0.0022  116 MET A CB  
939  C  CB  B MET A 116 ? 0.1387 0.2034 0.1628 0.0345  -0.0457 -0.0033 116 MET A CB  
940  C  CG  A MET A 116 ? 0.1429 0.1390 0.1021 -0.0237 -0.0941 0.0320  116 MET A CG  
941  C  CG  B MET A 116 ? 0.2200 0.2025 0.2029 0.0171  -0.0249 0.0063  116 MET A CG  
942  S  SD  A MET A 116 ? 0.1171 0.1872 0.0789 0.0366  -0.0390 0.0127  116 MET A SD  
943  S  SD  B MET A 116 ? 0.4286 0.3242 0.2980 -0.0586 -0.0505 0.0615  116 MET A SD  
944  C  CE  A MET A 116 ? 0.0967 0.1482 0.1134 0.0239  -0.0761 0.0026  116 MET A CE  
945  C  CE  B MET A 116 ? 0.0999 0.1592 0.1095 0.0122  -0.0572 0.0243  116 MET A CE  
946  N  N   A GLU A 117 ? 0.1491 0.1479 0.1381 0.0450  -0.0769 -0.0093 117 GLU A N   
947  N  N   B GLU A 117 ? 0.1556 0.1550 0.1394 0.0456  -0.0757 -0.0089 117 GLU A N   
948  C  CA  A GLU A 117 ? 0.1455 0.1314 0.1317 0.0257  -0.0653 0.0086  117 GLU A CA  
949  C  CA  B GLU A 117 ? 0.1509 0.1384 0.1341 0.0260  -0.0659 0.0097  117 GLU A CA  
950  C  C   A GLU A 117 ? 0.1374 0.1309 0.1257 0.0325  -0.0588 0.0269  117 GLU A C   
951  C  C   B GLU A 117 ? 0.1392 0.1330 0.1263 0.0322  -0.0591 0.0269  117 GLU A C   
952  O  O   A GLU A 117 ? 0.1681 0.1449 0.1374 0.0294  -0.0431 0.0239  117 GLU A O   
953  O  O   B GLU A 117 ? 0.1692 0.1487 0.1378 0.0297  -0.0453 0.0245  117 GLU A O   
954  C  CB  A GLU A 117 ? 0.1351 0.1388 0.1744 0.0164  -0.0446 0.0192  117 GLU A CB  
955  C  CB  B GLU A 117 ? 0.1452 0.1478 0.1762 0.0163  -0.0456 0.0207  117 GLU A CB  
956  C  CG  A GLU A 117 ? 0.1340 0.1270 0.1491 0.0397  -0.0442 0.0159  117 GLU A CG  
957  C  CG  B GLU A 117 ? 0.1799 0.1812 0.1572 0.0341  -0.0664 0.0300  117 GLU A CG  
958  C  CD  A GLU A 117 ? 0.1491 0.1714 0.2122 0.0892  -0.0221 0.0522  117 GLU A CD  
959  C  CD  B GLU A 117 ? 0.2331 0.3376 0.2204 0.0345  -0.0256 0.0615  117 GLU A CD  
960  O  OE1 A GLU A 117 ? 0.4447 0.2018 0.3447 0.1554  0.0833  0.0794  117 GLU A OE1 
961  O  OE1 B GLU A 117 ? 0.2351 0.3194 0.2630 0.0568  -0.0389 0.0944  117 GLU A OE1 
962  O  OE2 A GLU A 117 ? 0.1747 0.1753 0.1887 0.0806  -0.0341 0.0693  117 GLU A OE2 
963  O  OE2 B GLU A 117 ? 0.2027 0.5112 0.2525 0.0511  -0.0173 0.1238  117 GLU A OE2 
964  N  N   . PHE A 118 ? 0.1438 0.1257 0.1163 0.0183  -0.0309 0.0294  118 PHE A N   
965  C  CA  . PHE A 118 ? 0.1403 0.1352 0.1338 0.0271  -0.0236 0.0351  118 PHE A CA  
966  C  C   . PHE A 118 ? 0.1436 0.1367 0.1436 0.0267  -0.0296 0.0444  118 PHE A C   
967  O  O   . PHE A 118 ? 0.1325 0.1596 0.1468 0.0256  -0.0406 0.0441  118 PHE A O   
968  C  CB  . PHE A 118 ? 0.1517 0.1378 0.1272 0.0096  -0.0320 0.0357  118 PHE A CB  
969  C  CG  . PHE A 118 ? 0.1271 0.1196 0.1434 0.0093  -0.0308 0.0355  118 PHE A CG  
970  C  CD1 . PHE A 118 ? 0.1358 0.1425 0.1517 0.0128  -0.0520 0.0267  118 PHE A CD1 
971  C  CD2 . PHE A 118 ? 0.1459 0.1503 0.1511 0.0010  -0.0727 0.0243  118 PHE A CD2 
972  C  CE1 . PHE A 118 ? 0.1857 0.1157 0.1456 -0.0021 -0.0388 0.0271  118 PHE A CE1 
973  C  CE2 . PHE A 118 ? 0.1549 0.1417 0.1615 0.0175  -0.0612 0.0227  118 PHE A CE2 
974  C  CZ  . PHE A 118 ? 0.1661 0.1371 0.1690 0.0129  -0.0539 0.0225  118 PHE A CZ  
975  N  N   . GLU A 119 ? 0.1449 0.1563 0.1711 0.0124  -0.0373 0.0152  119 GLU A N   
976  C  CA  . GLU A 119 ? 0.1635 0.1521 0.1857 0.0126  -0.0355 0.0101  119 GLU A CA  
977  C  C   . GLU A 119 ? 0.1185 0.1534 0.1761 0.0021  -0.0354 0.0128  119 GLU A C   
978  O  O   . GLU A 119 ? 0.1857 0.1626 0.1559 0.0118  -0.0500 0.0181  119 GLU A O   
979  C  CB  . GLU A 119 ? 0.1648 0.1598 0.2575 0.0229  -0.0427 0.0415  119 GLU A CB  
980  C  CG  . GLU A 119 ? 0.2570 0.2648 0.3203 0.0438  -0.0411 0.0051  119 GLU A CG  
981  C  CD  . GLU A 119 ? 0.2128 0.3996 0.3531 0.0090  -0.1096 -0.0336 119 GLU A CD  
982  O  OE1 . GLU A 119 ? 0.2700 0.4586 0.4230 0.0185  -0.0642 0.0627  119 GLU A OE1 
983  O  OE2 . GLU A 119 ? 0.4110 0.6074 0.4675 -0.0920 -0.1486 -0.1009 119 GLU A OE2 
984  N  N   . GLU A 120 ? 0.1425 0.1570 0.1569 0.0414  -0.0513 0.0302  120 GLU A N   
985  C  CA  . GLU A 120 ? 0.1442 0.1413 0.1452 0.0208  -0.0564 0.0185  120 GLU A CA  
986  C  C   . GLU A 120 ? 0.1613 0.1388 0.1676 -0.0041 -0.0360 0.0298  120 GLU A C   
987  O  O   . GLU A 120 ? 0.1596 0.2004 0.2028 -0.0060 -0.0822 0.0480  120 GLU A O   
988  C  CB  . GLU A 120 ? 0.1742 0.1728 0.1463 0.0098  -0.0682 0.0147  120 GLU A CB  
989  C  CG  . GLU A 120 ? 0.1787 0.1647 0.1666 0.0327  -0.0646 0.0104  120 GLU A CG  
990  C  CD  . GLU A 120 ? 0.1675 0.1922 0.1717 0.0235  -0.0416 0.0045  120 GLU A CD  
991  O  OE1 . GLU A 120 ? 0.1827 0.1956 0.1745 -0.0004 -0.0627 0.0135  120 GLU A OE1 
992  O  OE2 . GLU A 120 ? 0.1591 0.2112 0.1444 0.0043  -0.0585 0.0104  120 GLU A OE2 
993  N  N   . ARG A 121 ? 0.1564 0.1494 0.1547 0.0069  -0.0581 0.0248  121 ARG A N   
994  C  CA  . ARG A 121 ? 0.1513 0.1494 0.1622 0.0318  -0.0547 0.0231  121 ARG A CA  
995  C  C   . ARG A 121 ? 0.1470 0.1549 0.1355 0.0056  -0.0410 0.0219  121 ARG A C   
996  O  O   . ARG A 121 ? 0.1426 0.1606 0.1556 -0.0005 -0.0639 0.0155  121 ARG A O   
997  C  CB  . ARG A 121 ? 0.1623 0.1505 0.1534 0.0240  -0.0561 0.0268  121 ARG A CB  
998  C  CG  . ARG A 121 ? 0.1525 0.1589 0.1514 0.0445  -0.0329 0.0345  121 ARG A CG  
999  C  CD  . ARG A 121 ? 0.1474 0.1647 0.1482 0.0336  -0.0529 0.0369  121 ARG A CD  
1000 N  NE  . ARG A 121 ? 0.1402 0.1254 0.1364 0.0107  -0.0378 0.0309  121 ARG A NE  
1001 C  CZ  . ARG A 121 ? 0.1568 0.1501 0.1424 0.0118  -0.0291 0.0176  121 ARG A CZ  
1002 N  NH1 . ARG A 121 ? 0.1092 0.2020 0.1569 0.0159  -0.0497 0.0352  121 ARG A NH1 
1003 N  NH2 . ARG A 121 ? 0.1337 0.1486 0.1223 0.0087  -0.0395 0.0181  121 ARG A NH2 
1004 N  N   . PRO A 122 ? 0.1521 0.1604 0.1646 0.0288  -0.0589 0.0358  122 PRO A N   
1005 C  CA  . PRO A 122 ? 0.1435 0.1667 0.1810 0.0071  -0.0655 0.0086  122 PRO A CA  
1006 C  C   . PRO A 122 ? 0.1562 0.1403 0.1641 0.0072  -0.0711 0.0007  122 PRO A C   
1007 O  O   . PRO A 122 ? 0.1751 0.1785 0.1603 0.0051  -0.0813 0.0026  122 PRO A O   
1008 C  CB  . PRO A 122 ? 0.1475 0.1906 0.2367 -0.0035 -0.0764 0.0215  122 PRO A CB  
1009 C  CG  . PRO A 122 ? 0.1415 0.2022 0.2775 -0.0053 -0.0579 0.0265  122 PRO A CG  
1010 C  CD  . PRO A 122 ? 0.1314 0.1850 0.2130 0.0183  -0.0541 0.0118  122 PRO A CD  
1011 N  N   . SER A 123 ? 0.1358 0.1558 0.1541 -0.0086 -0.0625 0.0225  123 SER A N   
1012 C  CA  . SER A 123 ? 0.1217 0.1304 0.1706 0.0109  -0.0534 0.0192  123 SER A CA  
1013 C  C   . SER A 123 ? 0.1361 0.1379 0.1306 0.0097  -0.0366 0.0206  123 SER A C   
1014 O  O   . SER A 123 ? 0.1061 0.1523 0.1494 0.0094  -0.0487 0.0186  123 SER A O   
1015 C  CB  . SER A 123 ? 0.1257 0.1603 0.1726 -0.0180 -0.0672 0.0081  123 SER A CB  
1016 O  OG  . SER A 123 ? 0.1237 0.1365 0.1559 -0.0015 -0.0697 0.0115  123 SER A OG  
1017 N  N   . GLU A 124 ? 0.1211 0.1287 0.1153 0.0124  -0.0414 -0.0056 124 GLU A N   
1018 C  CA  . GLU A 124 ? 0.1181 0.1214 0.1218 0.0050  -0.0503 0.0105  124 GLU A CA  
1019 C  C   . GLU A 124 ? 0.0980 0.1180 0.0886 -0.0079 -0.0408 0.0065  124 GLU A C   
1020 O  O   . GLU A 124 ? 0.1091 0.1315 0.1043 0.0019  -0.0428 0.0171  124 GLU A O   
1021 C  CB  . GLU A 124 ? 0.1323 0.1322 0.1299 -0.0005 -0.0460 0.0114  124 GLU A CB  
1022 C  CG  . GLU A 124 ? 0.1299 0.1386 0.1306 0.0186  -0.0615 0.0194  124 GLU A CG  
1023 C  CD  . GLU A 124 ? 0.1366 0.1269 0.1314 0.0348  -0.0297 0.0036  124 GLU A CD  
1024 O  OE1 . GLU A 124 ? 0.1323 0.1525 0.1417 0.0248  -0.0458 -0.0042 124 GLU A OE1 
1025 O  OE2 . GLU A 124 ? 0.1466 0.1249 0.1299 0.0172  -0.0455 0.0019  124 GLU A OE2 
1026 N  N   . PRO A 125 ? 0.1110 0.1117 0.1157 -0.0049 -0.0377 0.0057  125 PRO A N   
1027 C  CA  . PRO A 125 ? 0.0920 0.1127 0.1286 0.0046  -0.0431 0.0027  125 PRO A CA  
1028 C  C   . PRO A 125 ? 0.0956 0.1147 0.0879 0.0137  -0.0345 0.0106  125 PRO A C   
1029 O  O   . PRO A 125 ? 0.0999 0.1375 0.1105 0.0068  -0.0354 -0.0095 125 PRO A O   
1030 C  CB  . PRO A 125 ? 0.1139 0.1375 0.1113 -0.0047 -0.0414 -0.0027 125 PRO A CB  
1031 C  CG  . PRO A 125 ? 0.1091 0.1274 0.1012 -0.0163 -0.0416 0.0103  125 PRO A CG  
1032 C  CD  . PRO A 125 ? 0.1097 0.1264 0.1067 0.0225  -0.0444 0.0035  125 PRO A CD  
1033 N  N   . ILE A 126 ? 0.0960 0.1012 0.0927 0.0171  -0.0371 0.0143  126 ILE A N   
1034 C  CA  . ILE A 126 ? 0.0942 0.1156 0.1038 -0.0048 -0.0382 0.0008  126 ILE A CA  
1035 C  C   . ILE A 126 ? 0.1097 0.1250 0.1212 0.0140  -0.0289 -0.0347 126 ILE A C   
1036 O  O   . ILE A 126 ? 0.0972 0.1619 0.1485 0.0185  -0.0595 -0.0524 126 ILE A O   
1037 C  CB  . ILE A 126 ? 0.1424 0.1394 0.1070 -0.0140 -0.0337 0.0025  126 ILE A CB  
1038 C  CG1 . ILE A 126 ? 0.1974 0.1637 0.1464 -0.0030 -0.0170 0.0137  126 ILE A CG1 
1039 C  CG2 . ILE A 126 ? 0.1936 0.1910 0.1910 0.0236  -0.0861 -0.0102 126 ILE A CG2 
1040 C  CD1 . ILE A 126 ? 0.2800 0.2040 0.2089 -0.0252 0.0216  0.0707  126 ILE A CD1 
1041 N  N   . ILE A 127 ? 0.0927 0.0915 0.0989 0.0089  -0.0364 -0.0156 127 ILE A N   
1042 C  CA  . ILE A 127 ? 0.0932 0.0926 0.1037 0.0050  -0.0216 0.0032  127 ILE A CA  
1043 C  C   . ILE A 127 ? 0.0766 0.0936 0.0868 0.0064  -0.0314 -0.0077 127 ILE A C   
1044 O  O   . ILE A 127 ? 0.0987 0.1011 0.1091 0.0207  -0.0255 -0.0067 127 ILE A O   
1045 C  CB  . ILE A 127 ? 0.0928 0.0934 0.0918 -0.0052 -0.0248 -0.0073 127 ILE A CB  
1046 C  CG1 . ILE A 127 ? 0.1115 0.0976 0.1166 -0.0051 -0.0262 -0.0082 127 ILE A CG1 
1047 C  CG2 . ILE A 127 ? 0.0873 0.1184 0.1284 0.0285  -0.0441 0.0059  127 ILE A CG2 
1048 C  CD1 . ILE A 127 ? 0.1842 0.1434 0.0935 -0.0082 0.0002  0.0055  127 ILE A CD1 
1049 N  N   . ALA A 128 ? 0.0837 0.0807 0.0995 0.0088  -0.0322 0.0008  128 ALA A N   
1050 C  CA  . ALA A 128 ? 0.0858 0.0739 0.1111 0.0000  -0.0490 0.0051  128 ALA A CA  
1051 C  C   . ALA A 128 ? 0.0901 0.0832 0.1309 0.0233  -0.0350 -0.0015 128 ALA A C   
1052 O  O   . ALA A 128 ? 0.1118 0.0909 0.1337 0.0126  -0.0585 -0.0078 128 ALA A O   
1053 C  CB  . ALA A 128 ? 0.1165 0.1330 0.1061 -0.0019 -0.0245 0.0261  128 ALA A CB  
1054 N  N   . PHE A 129 ? 0.1048 0.0821 0.1256 0.0179  -0.0470 0.0000  129 PHE A N   
1055 C  CA  . PHE A 129 ? 0.0827 0.0825 0.1146 0.0227  -0.0393 0.0062  129 PHE A CA  
1056 C  C   . PHE A 129 ? 0.1001 0.0865 0.1133 0.0044  -0.0301 -0.0016 129 PHE A C   
1057 O  O   . PHE A 129 ? 0.0947 0.0914 0.1281 0.0089  -0.0361 0.0124  129 PHE A O   
1058 C  CB  . PHE A 129 ? 0.1033 0.0908 0.1115 0.0225  -0.0273 0.0103  129 PHE A CB  
1059 C  CG  . PHE A 129 ? 0.0940 0.1008 0.0941 0.0104  -0.0172 -0.0064 129 PHE A CG  
1060 C  CD1 . PHE A 129 ? 0.0836 0.1218 0.1093 0.0032  -0.0218 0.0152  129 PHE A CD1 
1061 C  CD2 . PHE A 129 ? 0.0885 0.1060 0.1403 0.0084  -0.0239 -0.0123 129 PHE A CD2 
1062 C  CE1 . PHE A 129 ? 0.0997 0.1049 0.1000 0.0186  -0.0171 -0.0053 129 PHE A CE1 
1063 C  CE2 . PHE A 129 ? 0.0773 0.1290 0.1442 0.0240  -0.0268 -0.0301 129 PHE A CE2 
1064 C  CZ  . PHE A 129 ? 0.1008 0.1428 0.1196 -0.0028 -0.0067 -0.0048 129 PHE A CZ  
1065 N  N   . ALA A 130 ? 0.0773 0.0815 0.1097 0.0091  -0.0438 0.0233  130 ALA A N   
1066 C  CA  . ALA A 130 ? 0.1021 0.0768 0.0905 0.0126  -0.0350 0.0176  130 ALA A CA  
1067 C  C   . ALA A 130 ? 0.0937 0.0895 0.0811 0.0132  -0.0240 0.0069  130 ALA A C   
1068 O  O   . ALA A 130 ? 0.1035 0.0833 0.0997 0.0005  -0.0398 0.0121  130 ALA A O   
1069 C  CB  . ALA A 130 ? 0.1458 0.1550 0.0822 0.0128  -0.0196 0.0269  130 ALA A CB  
1070 N  N   . ALA A 131 ? 0.1006 0.0758 0.1026 -0.0003 -0.0358 0.0148  131 ALA A N   
1071 C  CA  . ALA A 131 ? 0.0809 0.0739 0.1105 0.0073  -0.0408 0.0081  131 ALA A CA  
1072 C  C   . ALA A 131 ? 0.0917 0.0770 0.1124 0.0013  -0.0198 0.0309  131 ALA A C   
1073 O  O   . ALA A 131 ? 0.1145 0.1059 0.1617 -0.0087 -0.0453 0.0457  131 ALA A O   
1074 C  CB  . ALA A 131 ? 0.1142 0.1257 0.1020 0.0084  -0.0165 -0.0173 131 ALA A CB  
1075 N  N   . ASP A 132 ? 0.0805 0.0769 0.0906 0.0066  -0.0171 0.0186  132 ASP A N   
1076 C  CA  . ASP A 132 ? 0.0654 0.0861 0.0689 -0.0079 -0.0140 0.0190  132 ASP A CA  
1077 C  C   . ASP A 132 ? 0.0684 0.0755 0.0770 -0.0045 -0.0077 0.0078  132 ASP A C   
1078 O  O   . ASP A 132 ? 0.0841 0.0837 0.0867 -0.0031 -0.0156 0.0242  132 ASP A O   
1079 C  CB  . ASP A 132 ? 0.1048 0.1139 0.0786 -0.0062 -0.0240 0.0175  132 ASP A CB  
1080 C  CG  . ASP A 132 ? 0.1151 0.0777 0.0719 0.0045  -0.0087 0.0179  132 ASP A CG  
1081 O  OD1 . ASP A 132 ? 0.1183 0.0823 0.1247 0.0005  0.0132  0.0312  132 ASP A OD1 
1082 O  OD2 . ASP A 132 ? 0.1069 0.0997 0.0949 -0.0012 -0.0124 0.0143  132 ASP A OD2 
1083 N  N   . LYS A 133 ? 0.0840 0.0661 0.0796 -0.0067 -0.0244 0.0234  133 LYS A N   
1084 C  CA  . LYS A 133 ? 0.0756 0.0672 0.0796 0.0061  -0.0202 0.0194  133 LYS A CA  
1085 C  C   . LYS A 133 ? 0.0808 0.0663 0.0816 -0.0076 -0.0171 0.0143  133 LYS A C   
1086 O  O   . LYS A 133 ? 0.0917 0.1052 0.0847 -0.0004 -0.0168 0.0224  133 LYS A O   
1087 C  CB  . LYS A 133 ? 0.1050 0.0755 0.0985 0.0080  -0.0211 0.0173  133 LYS A CB  
1088 C  CG  . LYS A 133 ? 0.0980 0.0806 0.0928 0.0205  -0.0172 0.0309  133 LYS A CG  
1089 C  CD  . LYS A 133 ? 0.1071 0.0988 0.1002 0.0051  -0.0159 0.0163  133 LYS A CD  
1090 C  CE  . LYS A 133 ? 0.1098 0.1148 0.1029 0.0021  0.0007  0.0214  133 LYS A CE  
1091 N  NZ  . LYS A 133 ? 0.1054 0.1395 0.0790 -0.0121 -0.0193 0.0439  133 LYS A NZ  
1092 N  N   . THR A 134 ? 0.0781 0.0948 0.0859 0.0069  -0.0079 0.0231  134 THR A N   
1093 C  CA  A THR A 134 ? 0.0873 0.0711 0.0899 -0.0064 -0.0079 0.0175  134 THR A CA  
1094 C  CA  B THR A 134 ? 0.1091 0.1299 0.1124 0.0089  -0.0135 0.0156  134 THR A CA  
1095 C  C   . THR A 134 ? 0.1052 0.1105 0.1134 -0.0038 0.0106  0.0207  134 THR A C   
1096 O  O   . THR A 134 ? 0.1804 0.1374 0.1202 0.0464  -0.0120 0.0292  134 THR A O   
1097 C  CB  A THR A 134 ? 0.0780 0.0870 0.0699 -0.0386 -0.0252 0.0039  134 THR A CB  
1098 C  CB  B THR A 134 ? 0.1680 0.1789 0.1657 0.0108  0.0189  0.0177  134 THR A CB  
1099 O  OG1 A THR A 134 ? 0.0513 0.0370 0.0533 0.0005  -0.0058 0.0170  134 THR A OG1 
1100 O  OG1 B THR A 134 ? 0.1900 0.2987 0.2029 -0.0045 -0.0431 -0.0831 134 THR A OG1 
1101 C  CG2 A THR A 134 ? 0.1112 0.0335 0.1248 0.0265  -0.0924 -0.0285 134 THR A CG2 
1102 C  CG2 B THR A 134 ? 0.1856 0.1170 0.2149 0.0055  -0.0387 0.0405  134 THR A CG2 
1103 N  N   . GLU A 135 ? 0.1958 0.1304 0.1513 0.0455  0.0341  0.0607  135 GLU A N   
1104 C  CA  . GLU A 135 ? 0.2095 0.1272 0.1759 0.0360  0.0226  0.0615  135 GLU A CA  
1105 C  C   . GLU A 135 ? 0.1699 0.1508 0.1591 0.0302  0.0382  0.0189  135 GLU A C   
1106 O  O   . GLU A 135 ? 0.1801 0.1102 0.1483 0.0419  0.0063  0.0291  135 GLU A O   
1107 C  CB  . GLU A 135 ? 0.1806 0.1205 0.2384 -0.0261 0.0098  0.0379  135 GLU A CB  
1108 C  CG  . GLU A 135 ? 0.2125 0.1554 0.2429 0.0219  -0.0080 0.0188  135 GLU A CG  
1109 C  CD  . GLU A 135 ? 0.1828 0.1724 0.2266 0.0651  -0.0269 0.0114  135 GLU A CD  
1110 O  OE1 . GLU A 135 ? 0.2734 0.1943 0.4585 0.0185  -0.1037 -0.0724 135 GLU A OE1 
1111 O  OE2 . GLU A 135 ? 0.2005 0.1943 0.1915 0.0585  0.0117  0.0131  135 GLU A OE2 
1112 N  N   . PRO A 136 ? 0.1749 0.1187 0.1690 0.0131  0.0437  0.0511  136 PRO A N   
1113 C  CA  . PRO A 136 ? 0.1912 0.1115 0.1759 0.0388  0.0171  0.0293  136 PRO A CA  
1114 C  C   . PRO A 136 ? 0.1254 0.1096 0.1392 0.0119  0.0007  0.0127  136 PRO A C   
1115 O  O   . PRO A 136 ? 0.1805 0.1454 0.1092 0.0444  -0.0292 0.0186  136 PRO A O   
1116 C  CB  . PRO A 136 ? 0.1550 0.1505 0.1564 0.0183  -0.0354 0.0564  136 PRO A CB  
1117 C  CG  . PRO A 136 ? 0.2171 0.1520 0.3323 -0.0029 0.0000  0.1032  136 PRO A CG  
1118 C  CD  . PRO A 136 ? 0.2283 0.1624 0.2101 0.0082  0.0278  0.0525  136 PRO A CD  
1119 N  N   . GLY A 137 ? 0.1329 0.0937 0.1240 0.0301  -0.0213 0.0283  137 GLY A N   
1120 C  CA  . GLY A 137 ? 0.1063 0.1058 0.1093 0.0105  -0.0247 0.0163  137 GLY A CA  
1121 C  C   . GLY A 137 ? 0.0780 0.0950 0.0619 0.0069  -0.0253 0.0133  137 GLY A C   
1122 O  O   . GLY A 137 ? 0.0915 0.0992 0.0833 0.0045  -0.0166 0.0158  137 GLY A O   
1123 N  N   . ALA A 138 ? 0.0810 0.0783 0.0957 -0.0011 -0.0205 0.0141  138 ALA A N   
1124 C  CA  . ALA A 138 ? 0.0904 0.0685 0.0975 0.0041  -0.0223 0.0159  138 ALA A CA  
1125 C  C   . ALA A 138 ? 0.0822 0.0745 0.1043 -0.0066 -0.0168 0.0116  138 ALA A C   
1126 O  O   . ALA A 138 ? 0.1025 0.0720 0.1121 0.0021  -0.0171 0.0169  138 ALA A O   
1127 C  CB  . ALA A 138 ? 0.0931 0.1019 0.1392 0.0294  -0.0048 0.0234  138 ALA A CB  
1128 N  N   . PHE A 139 ? 0.0801 0.0624 0.0853 0.0084  -0.0198 0.0129  139 PHE A N   
1129 C  CA  . PHE A 139 ? 0.0791 0.0627 0.0788 0.0036  -0.0155 0.0091  139 PHE A CA  
1130 C  C   . PHE A 139 ? 0.0714 0.0676 0.0765 0.0057  -0.0172 0.0171  139 PHE A C   
1131 O  O   . PHE A 139 ? 0.0887 0.0706 0.0910 -0.0040 -0.0214 0.0053  139 PHE A O   
1132 C  CB  . PHE A 139 ? 0.0854 0.0770 0.0921 0.0059  -0.0243 0.0066  139 PHE A CB  
1133 C  CG  . PHE A 139 ? 0.1037 0.0836 0.0860 -0.0104 -0.0115 0.0149  139 PHE A CG  
1134 C  CD1 . PHE A 139 ? 0.3087 0.0877 0.1304 0.0159  0.0814  0.0415  139 PHE A CD1 
1135 C  CD2 . PHE A 139 ? 0.1183 0.0953 0.0965 0.0051  -0.0167 0.0203  139 PHE A CD2 
1136 C  CE1 . PHE A 139 ? 0.3111 0.1061 0.1707 0.0434  0.0979  0.0205  139 PHE A CE1 
1137 C  CE2 . PHE A 139 ? 0.0941 0.1240 0.1010 0.0081  -0.0252 0.0260  139 PHE A CE2 
1138 C  CZ  . PHE A 139 ? 0.1798 0.1222 0.1000 -0.0017 0.0192  0.0048  139 PHE A CZ  
1139 N  N   . ASN A 140 ? 0.0849 0.0675 0.0746 0.0035  -0.0170 -0.0088 140 ASN A N   
1140 C  CA  . ASN A 140 ? 0.0944 0.0608 0.0855 0.0120  -0.0215 0.0139  140 ASN A CA  
1141 C  C   . ASN A 140 ? 0.0636 0.0518 0.0915 0.0055  -0.0180 0.0021  140 ASN A C   
1142 O  O   . ASN A 140 ? 0.0750 0.0753 0.0883 0.0089  -0.0256 0.0041  140 ASN A O   
1143 C  CB  . ASN A 140 ? 0.0966 0.0537 0.0907 0.0186  -0.0269 0.0092  140 ASN A CB  
1144 C  CG  . ASN A 140 ? 0.0998 0.0819 0.0790 0.0280  -0.0249 0.0181  140 ASN A CG  
1145 O  OD1 . ASN A 140 ? 0.1216 0.0685 0.1010 0.0060  -0.0394 0.0107  140 ASN A OD1 
1146 N  ND2 . ASN A 140 ? 0.0965 0.0906 0.1037 0.0106  -0.0288 -0.0074 140 ASN A ND2 
1147 N  N   . LEU A 141 ? 0.0788 0.0673 0.0844 0.0093  -0.0143 0.0101  141 LEU A N   
1148 C  CA  A LEU A 141 ? 0.0650 0.0522 0.0803 0.0107  -0.0101 0.0022  141 LEU A CA  
1149 C  CA  B LEU A 141 ? 0.0695 0.0575 0.0867 0.0098  -0.0127 0.0024  141 LEU A CA  
1150 C  C   . LEU A 141 ? 0.0706 0.0598 0.0859 0.0138  -0.0116 -0.0071 141 LEU A C   
1151 O  O   . LEU A 141 ? 0.0716 0.0719 0.0816 0.0106  -0.0112 -0.0003 141 LEU A O   
1152 C  CB  A LEU A 141 ? 0.0733 0.0717 0.0883 0.0084  -0.0224 0.0141  141 LEU A CB  
1153 C  CB  B LEU A 141 ? 0.0740 0.0713 0.1113 0.0106  -0.0260 0.0062  141 LEU A CB  
1154 C  CG  A LEU A 141 ? 0.0778 0.0778 0.0805 0.0022  -0.0079 0.0111  141 LEU A CG  
1155 C  CG  B LEU A 141 ? 0.1064 0.1098 0.1241 0.0020  -0.0163 0.0059  141 LEU A CG  
1156 C  CD1 A LEU A 141 ? 0.0646 0.1222 0.0817 0.0307  -0.0223 0.0388  141 LEU A CD1 
1157 C  CD1 B LEU A 141 ? 0.1576 0.1653 0.2357 -0.0038 0.0121  0.0122  141 LEU A CD1 
1158 C  CD2 A LEU A 141 ? 0.0821 0.0302 0.0484 0.0157  -0.0354 -0.0105 141 LEU A CD2 
1159 C  CD2 B LEU A 141 ? 0.1011 0.1199 0.0543 0.0419  -0.0268 0.0163  141 LEU A CD2 
1160 N  N   . PRO A 142 ? 0.0568 0.0652 0.0693 0.0121  -0.0234 -0.0035 142 PRO A N   
1161 C  CA  . PRO A 142 ? 0.0712 0.0697 0.0801 0.0069  -0.0213 0.0018  142 PRO A CA  
1162 C  C   . PRO A 142 ? 0.0772 0.0722 0.0669 0.0009  -0.0127 -0.0101 142 PRO A C   
1163 O  O   . PRO A 142 ? 0.0770 0.0681 0.0855 0.0089  -0.0254 0.0001  142 PRO A O   
1164 C  CB  . PRO A 142 ? 0.0846 0.0769 0.1100 0.0205  -0.0421 -0.0084 142 PRO A CB  
1165 C  CG  . PRO A 142 ? 0.0901 0.1131 0.0993 0.0049  -0.0111 -0.0159 142 PRO A CG  
1166 C  CD  . PRO A 142 ? 0.0747 0.0632 0.0688 0.0177  -0.0202 -0.0019 142 PRO A CD  
1167 N  N   . LEU A 143 ? 0.0724 0.0585 0.0866 0.0026  -0.0235 0.0075  143 LEU A N   
1168 C  CA  . LEU A 143 ? 0.0776 0.0641 0.0876 0.0036  -0.0272 0.0041  143 LEU A CA  
1169 C  C   . LEU A 143 ? 0.0752 0.0723 0.0823 0.0143  -0.0205 0.0102  143 LEU A C   
1170 O  O   . LEU A 143 ? 0.0748 0.0833 0.1101 0.0159  -0.0258 -0.0018 143 LEU A O   
1171 C  CB  . LEU A 143 ? 0.0802 0.0782 0.1083 0.0141  -0.0316 0.0090  143 LEU A CB  
1172 C  CG  . LEU A 143 ? 0.1019 0.0715 0.0999 0.0103  -0.0135 0.0171  143 LEU A CG  
1173 C  CD1 . LEU A 143 ? 0.1302 0.0704 0.1160 -0.0059 -0.0280 0.0326  143 LEU A CD1 
1174 C  CD2 . LEU A 143 ? 0.1093 0.1407 0.1146 -0.0004 -0.0551 0.0157  143 LEU A CD2 
1175 N  N   . TYR A 144 ? 0.0755 0.0790 0.0729 0.0026  -0.0211 0.0023  144 TYR A N   
1176 C  CA  . TYR A 144 ? 0.0780 0.0710 0.0779 0.0225  -0.0283 -0.0072 144 TYR A CA  
1177 C  C   . TYR A 144 ? 0.0638 0.0844 0.0713 0.0110  -0.0078 -0.0067 144 TYR A C   
1178 O  O   . TYR A 144 ? 0.0802 0.0933 0.1065 0.0177  -0.0156 -0.0135 144 TYR A O   
1179 C  CB  . TYR A 144 ? 0.0982 0.0733 0.1002 0.0152  -0.0244 -0.0035 144 TYR A CB  
1180 C  CG  . TYR A 144 ? 0.0889 0.0893 0.0916 0.0178  -0.0327 -0.0159 144 TYR A CG  
1181 C  CD1 . TYR A 144 ? 0.0944 0.1130 0.1072 0.0092  -0.0128 -0.0118 144 TYR A CD1 
1182 C  CD2 . TYR A 144 ? 0.1349 0.1112 0.1136 0.0080  -0.0077 -0.0009 144 TYR A CD2 
1183 C  CE1 . TYR A 144 ? 0.1245 0.1304 0.1193 0.0228  -0.0133 -0.0006 144 TYR A CE1 
1184 C  CE2 . TYR A 144 ? 0.1502 0.1311 0.1034 -0.0140 -0.0291 -0.0017 144 TYR A CE2 
1185 C  CZ  . TYR A 144 ? 0.1134 0.1486 0.1213 -0.0214 0.0103  0.0093  144 TYR A CZ  
1186 O  OH  . TYR A 144 ? 0.1514 0.2077 0.1464 -0.0200 0.0071  -0.0415 144 TYR A OH  
1187 N  N   . LYS A 145 ? 0.0709 0.0647 0.0940 0.0184  -0.0107 -0.0062 145 LYS A N   
1188 C  CA  . LYS A 145 ? 0.0884 0.0810 0.0919 0.0075  -0.0205 0.0039  145 LYS A CA  
1189 C  C   . LYS A 145 ? 0.0817 0.0656 0.0850 0.0177  -0.0065 0.0049  145 LYS A C   
1190 O  O   . LYS A 145 ? 0.0745 0.0893 0.1060 0.0049  -0.0166 0.0044  145 LYS A O   
1191 C  CB  . LYS A 145 ? 0.0818 0.0608 0.1252 0.0059  -0.0179 -0.0015 145 LYS A CB  
1192 C  CG  . LYS A 145 ? 0.1002 0.1209 0.1174 -0.0158 -0.0352 0.0170  145 LYS A CG  
1193 C  CD  . LYS A 145 ? 0.1766 0.1708 0.2224 0.0491  -0.0936 0.0198  145 LYS A CD  
1194 C  CE  . LYS A 145 ? 0.3117 0.2114 0.3020 -0.0137 -0.0434 0.0397  145 LYS A CE  
1195 N  NZ  . LYS A 145 ? 0.2081 0.1663 0.2656 0.0717  0.0029  -0.0113 145 LYS A NZ  
1196 N  N   . MET A 146 ? 0.0649 0.0712 0.1023 0.0015  -0.0187 0.0003  146 MET A N   
1197 C  CA  . MET A 146 ? 0.0817 0.0693 0.0938 0.0037  -0.0162 -0.0058 146 MET A CA  
1198 C  C   . MET A 146 ? 0.0713 0.0805 0.1028 0.0114  -0.0305 -0.0039 146 MET A C   
1199 O  O   . MET A 146 ? 0.0753 0.0917 0.1275 0.0092  -0.0232 -0.0007 146 MET A O   
1200 C  CB  . MET A 146 ? 0.0740 0.0888 0.1035 0.0013  -0.0365 -0.0124 146 MET A CB  
1201 C  CG  . MET A 146 ? 0.0975 0.0824 0.1124 0.0022  -0.0500 -0.0135 146 MET A CG  
1202 S  SD  . MET A 146 ? 0.1052 0.1041 0.1001 0.0148  -0.0321 0.0051  146 MET A SD  
1203 C  CE  . MET A 146 ? 0.0855 0.1204 0.1322 0.0206  -0.0375 0.0128  146 MET A CE  
1204 N  N   . PHE A 147 ? 0.0815 0.0900 0.1134 0.0161  -0.0328 -0.0136 147 PHE A N   
1205 C  CA  . PHE A 147 ? 0.0780 0.0909 0.1015 0.0174  -0.0269 0.0175  147 PHE A CA  
1206 C  C   . PHE A 147 ? 0.0671 0.0890 0.1043 0.0115  -0.0150 -0.0011 147 PHE A C   
1207 O  O   . PHE A 147 ? 0.0828 0.1397 0.1195 0.0365  -0.0198 -0.0094 147 PHE A O   
1208 C  CB  . PHE A 147 ? 0.0785 0.0928 0.1255 0.0053  -0.0180 0.0077  147 PHE A CB  
1209 C  CG  . PHE A 147 ? 0.0798 0.0851 0.1031 0.0233  -0.0183 0.0198  147 PHE A CG  
1210 C  CD1 . PHE A 147 ? 0.0862 0.0863 0.1225 0.0120  -0.0204 0.0018  147 PHE A CD1 
1211 C  CD2 . PHE A 147 ? 0.0986 0.0915 0.1022 0.0263  -0.0323 0.0169  147 PHE A CD2 
1212 C  CE1 . PHE A 147 ? 0.0819 0.0965 0.1176 0.0055  -0.0277 0.0102  147 PHE A CE1 
1213 C  CE2 . PHE A 147 ? 0.0827 0.0949 0.1219 0.0160  -0.0167 0.0215  147 PHE A CE2 
1214 C  CZ  . PHE A 147 ? 0.1124 0.0979 0.1140 0.0263  -0.0187 0.0034  147 PHE A CZ  
1215 N  N   . ALA A 148 ? 0.0896 0.0997 0.0873 0.0250  -0.0268 -0.0101 148 ALA A N   
1216 C  CA  . ALA A 148 ? 0.0639 0.0940 0.1097 0.0101  -0.0138 -0.0078 148 ALA A CA  
1217 C  C   . ALA A 148 ? 0.1030 0.0924 0.1155 0.0225  0.0141  -0.0047 148 ALA A C   
1218 O  O   . ALA A 148 ? 0.2069 0.1243 0.1464 0.0589  0.0289  0.0098  148 ALA A O   
1219 C  CB  . ALA A 148 ? 0.1182 0.0756 0.1450 0.0031  -0.0233 -0.0094 148 ALA A CB  
1220 N  N   . ASP A 149 ? 0.0969 0.0927 0.0999 0.0136  0.0070  -0.0058 149 ASP A N   
1221 C  CA  . ASP A 149 ? 0.1196 0.0957 0.1153 -0.0192 -0.0033 0.0017  149 ASP A CA  
1222 C  C   . ASP A 149 ? 0.0986 0.0807 0.1058 0.0089  0.0022  0.0066  149 ASP A C   
1223 O  O   . ASP A 149 ? 0.0989 0.0790 0.1195 0.0118  -0.0091 -0.0168 149 ASP A O   
1224 C  CB  . ASP A 149 ? 0.1055 0.1176 0.1026 -0.0023 -0.0104 0.0161  149 ASP A CB  
1225 C  CG  . ASP A 149 ? 0.1454 0.1526 0.1728 0.0078  -0.0106 0.0120  149 ASP A CG  
1226 O  OD1 . ASP A 149 ? 0.1384 0.1197 0.1431 0.0148  -0.0020 0.0115  149 ASP A OD1 
1227 O  OD2 . ASP A 149 ? 0.1687 0.1538 0.1511 0.0082  -0.0121 -0.0031 149 ASP A OD2 
1228 N  N   . PRO A 150 ? 0.1084 0.0779 0.1316 0.0092  0.0245  -0.0212 150 PRO A N   
1229 C  CA  . PRO A 150 ? 0.0845 0.1089 0.1778 0.0129  0.0299  -0.0185 150 PRO A CA  
1230 C  C   . PRO A 150 ? 0.1092 0.0993 0.1299 -0.0062 0.0167  -0.0106 150 PRO A C   
1231 O  O   . PRO A 150 ? 0.1168 0.1026 0.1998 -0.0051 0.0116  -0.0135 150 PRO A O   
1232 C  CB  . PRO A 150 ? 0.1206 0.1340 0.1897 0.0083  0.0299  -0.0196 150 PRO A CB  
1233 C  CG  . PRO A 150 ? 0.2120 0.1945 0.1889 -0.0324 0.0603  -0.0573 150 PRO A CG  
1234 C  CD  . PRO A 150 ? 0.1236 0.0945 0.1819 0.0072  0.0476  -0.0316 150 PRO A CD  
1235 N  N   . PHE A 151 ? 0.1063 0.0827 0.1187 0.0132  0.0044  0.0035  151 PHE A N   
1236 C  CA  . PHE A 151 ? 0.1302 0.0796 0.1247 0.0190  0.0108  0.0071  151 PHE A CA  
1237 C  C   . PHE A 151 ? 0.0874 0.0715 0.1109 0.0123  0.0081  -0.0164 151 PHE A C   
1238 O  O   . PHE A 151 ? 0.1297 0.0752 0.1111 0.0180  -0.0082 -0.0175 151 PHE A O   
1239 C  CB  . PHE A 151 ? 0.1527 0.0824 0.1117 0.0371  -0.0028 -0.0052 151 PHE A CB  
1240 C  CG  . PHE A 151 ? 0.1512 0.0865 0.1072 0.0285  0.0210  -0.0081 151 PHE A CG  
1241 C  CD1 . PHE A 151 ? 0.3068 0.1430 0.1585 0.0892  0.0722  0.0114  151 PHE A CD1 
1242 C  CD2 . PHE A 151 ? 0.1524 0.0983 0.0910 -0.0037 -0.0136 -0.0183 151 PHE A CD2 
1243 C  CE1 . PHE A 151 ? 0.3536 0.2346 0.1501 0.1245  0.0806  -0.0368 151 PHE A CE1 
1244 C  CE2 . PHE A 151 ? 0.1910 0.1342 0.1216 -0.0117 -0.0116 -0.0098 151 PHE A CE2 
1245 C  CZ  . PHE A 151 ? 0.2210 0.1859 0.1544 0.0140  0.0644  0.0423  151 PHE A CZ  
1246 N  N   . THR A 152 ? 0.1005 0.0783 0.0936 0.0187  -0.0046 -0.0021 152 THR A N   
1247 C  CA  . THR A 152 ? 0.0769 0.0766 0.1000 0.0179  -0.0053 -0.0065 152 THR A CA  
1248 C  C   . THR A 152 ? 0.1008 0.0835 0.1128 0.0182  -0.0172 -0.0093 152 THR A C   
1249 O  O   . THR A 152 ? 0.1245 0.0909 0.1250 0.0201  -0.0235 -0.0126 152 THR A O   
1250 C  CB  . THR A 152 ? 0.0785 0.0710 0.1192 -0.0022 -0.0133 -0.0129 152 THR A CB  
1251 O  OG1 . THR A 152 ? 0.0962 0.1342 0.1190 -0.0248 -0.0276 0.0086  152 THR A OG1 
1252 C  CG2 . THR A 152 ? 0.1085 0.0904 0.0970 -0.0081 -0.0077 0.0151  152 THR A CG2 
1253 N  N   . THR A 153 ? 0.0800 0.0848 0.1130 0.0163  -0.0286 -0.0347 153 THR A N   
1254 C  CA  . THR A 153 ? 0.0910 0.0792 0.0991 -0.0014 -0.0163 -0.0133 153 THR A CA  
1255 C  C   . THR A 153 ? 0.0823 0.0987 0.1071 0.0022  -0.0120 -0.0090 153 THR A C   
1256 O  O   . THR A 153 ? 0.0908 0.1245 0.1319 0.0058  -0.0134 -0.0299 153 THR A O   
1257 C  CB  . THR A 153 ? 0.1038 0.0895 0.0982 -0.0036 -0.0055 -0.0143 153 THR A CB  
1258 O  OG1 . THR A 153 ? 0.0894 0.1006 0.1426 0.0006  0.0036  -0.0094 153 THR A OG1 
1259 C  CG2 . THR A 153 ? 0.0898 0.1328 0.1330 -0.0117 -0.0263 -0.0066 153 THR A CG2 
1260 N  N   . ALA A 154 ? 0.0818 0.0910 0.1084 0.0036  -0.0139 -0.0022 154 ALA A N   
1261 C  CA  . ALA A 154 ? 0.0840 0.1078 0.0964 -0.0034 -0.0108 0.0015  154 ALA A CA  
1262 C  C   . ALA A 154 ? 0.0790 0.0857 0.0984 0.0086  -0.0039 -0.0040 154 ALA A C   
1263 O  O   . ALA A 154 ? 0.0807 0.1124 0.1081 -0.0016 -0.0055 -0.0150 154 ALA A O   
1264 C  CB  . ALA A 154 ? 0.1178 0.1053 0.1737 0.0051  0.0129  -0.0115 154 ALA A CB  
1265 N  N   . GLY A 155 ? 0.0768 0.1006 0.0998 0.0081  -0.0069 -0.0106 155 GLY A N   
1266 C  CA  . GLY A 155 ? 0.0822 0.1225 0.1125 0.0057  -0.0174 -0.0211 155 GLY A CA  
1267 C  C   . GLY A 155 ? 0.0617 0.1083 0.0915 0.0119  -0.0134 -0.0169 155 GLY A C   
1268 O  O   . GLY A 155 ? 0.0746 0.1406 0.1263 0.0273  -0.0284 -0.0253 155 GLY A O   
1269 N  N   . LEU A 156 ? 0.0810 0.1006 0.1060 0.0130  -0.0168 -0.0194 156 LEU A N   
1270 C  CA  . LEU A 156 ? 0.1058 0.0939 0.1223 0.0056  -0.0248 -0.0096 156 LEU A CA  
1271 C  C   . LEU A 156 ? 0.0882 0.1313 0.1086 0.0197  -0.0366 -0.0124 156 LEU A C   
1272 O  O   . LEU A 156 ? 0.0951 0.1176 0.1430 0.0074  -0.0062 -0.0222 156 LEU A O   
1273 C  CB  . LEU A 156 ? 0.1226 0.0893 0.1219 0.0181  -0.0291 -0.0048 156 LEU A CB  
1274 C  CG  . LEU A 156 ? 0.1018 0.1244 0.1259 0.0078  -0.0203 -0.0234 156 LEU A CG  
1275 C  CD1 . LEU A 156 ? 0.1092 0.1297 0.1759 -0.0070 -0.0355 -0.0013 156 LEU A CD1 
1276 C  CD2 . LEU A 156 ? 0.1482 0.1206 0.1579 0.0292  -0.0369 0.0177  156 LEU A CD2 
1277 N  N   . VAL A 157 ? 0.0902 0.1094 0.1098 0.0216  -0.0055 -0.0105 157 VAL A N   
1278 C  CA  . VAL A 157 ? 0.0954 0.0990 0.1144 0.0095  -0.0043 -0.0178 157 VAL A CA  
1279 C  C   . VAL A 157 ? 0.0768 0.1485 0.1394 0.0071  -0.0005 -0.0197 157 VAL A C   
1280 O  O   . VAL A 157 ? 0.0985 0.1724 0.1557 -0.0164 0.0050  -0.0537 157 VAL A O   
1281 C  CB  . VAL A 157 ? 0.0924 0.1091 0.1148 0.0141  0.0090  -0.0105 157 VAL A CB  
1282 C  CG1 . VAL A 157 ? 0.1510 0.1216 0.1355 -0.0021 0.0028  0.0113  157 VAL A CG1 
1283 C  CG2 . VAL A 157 ? 0.1276 0.1553 0.1364 -0.0085 -0.0488 -0.0132 157 VAL A CG2 
1284 N  N   . ILE A 158 ? 0.0890 0.1407 0.1404 -0.0050 -0.0091 -0.0377 158 ILE A N   
1285 C  CA  . ILE A 158 ? 0.0860 0.1306 0.1378 0.0001  -0.0081 -0.0004 158 ILE A CA  
1286 C  C   . ILE A 158 ? 0.0744 0.1421 0.1585 0.0090  -0.0292 -0.0089 158 ILE A C   
1287 O  O   . ILE A 158 ? 0.1067 0.1365 0.1570 -0.0083 -0.0354 -0.0075 158 ILE A O   
1288 C  CB  . ILE A 158 ? 0.1021 0.1115 0.1403 0.0020  -0.0059 -0.0159 158 ILE A CB  
1289 C  CG1 . ILE A 158 ? 0.0957 0.1346 0.1576 -0.0008 -0.0311 -0.0171 158 ILE A CG1 
1290 C  CG2 . ILE A 158 ? 0.1495 0.1605 0.1152 0.0160  -0.0365 -0.0079 158 ILE A CG2 
1291 C  CD1 . ILE A 158 ? 0.1522 0.1049 0.1587 0.0207  -0.0122 -0.0013 158 ILE A CD1 
1292 N  N   . ASP A 159 ? 0.1143 0.1576 0.1325 -0.0104 -0.0204 -0.0128 159 ASP A N   
1293 C  CA  . ASP A 159 ? 0.1334 0.1542 0.1594 0.0020  -0.0261 0.0111  159 ASP A CA  
1294 C  C   . ASP A 159 ? 0.1243 0.1608 0.1731 0.0002  -0.0279 0.0021  159 ASP A C   
1295 O  O   . ASP A 159 ? 0.1142 0.1833 0.1784 0.0103  -0.0252 -0.0021 159 ASP A O   
1296 C  CB  . ASP A 159 ? 0.1148 0.1529 0.1439 0.0119  -0.0210 0.0075  159 ASP A CB  
1297 C  CG  . ASP A 159 ? 0.1427 0.1530 0.1605 0.0429  -0.0162 0.0151  159 ASP A CG  
1298 O  OD1 . ASP A 159 ? 0.1424 0.2039 0.1974 0.0620  -0.0508 -0.0290 159 ASP A OD1 
1299 O  OD2 . ASP A 159 ? 0.1375 0.2127 0.1630 0.0328  -0.0342 -0.0043 159 ASP A OD2 
1300 N  N   . PRO A 160 ? 0.1331 0.1580 0.2227 0.0094  -0.0376 -0.0080 160 PRO A N   
1301 C  CA  . PRO A 160 ? 0.1254 0.1977 0.2119 0.0050  -0.0389 -0.0095 160 PRO A CA  
1302 C  C   . PRO A 160 ? 0.1386 0.2178 0.1974 -0.0023 -0.0581 -0.0082 160 PRO A C   
1303 O  O   . PRO A 160 ? 0.1873 0.2088 0.2351 0.0527  -0.0581 -0.0135 160 PRO A O   
1304 C  CB  . PRO A 160 ? 0.1181 0.2508 0.2837 0.0120  -0.0206 -0.0107 160 PRO A CB  
1305 C  CG  . PRO A 160 ? 0.0991 0.2514 0.3233 -0.0029 -0.0590 -0.0166 160 PRO A CG  
1306 C  CD  . PRO A 160 ? 0.1033 0.1815 0.2135 0.0108  -0.0266 -0.0226 160 PRO A CD  
1307 N  N   . SER A 161 ? 0.1362 0.1759 0.2054 0.0236  -0.0559 -0.0062 161 SER A N   
1308 C  CA  . SER A 161 ? 0.1576 0.1968 0.2078 0.0352  -0.0601 0.0096  161 SER A CA  
1309 C  C   . SER A 161 ? 0.1910 0.1685 0.2059 0.0003  -0.0814 -0.0008 161 SER A C   
1310 O  O   . SER A 161 ? 0.1912 0.2033 0.2541 0.0099  -0.0878 0.0294  161 SER A O   
1311 C  CB  . SER A 161 ? 0.1956 0.1935 0.1997 0.0357  -0.0339 0.0230  161 SER A CB  
1312 O  OG  . SER A 161 ? 0.2138 0.2226 0.1926 0.0302  -0.0292 0.0011  161 SER A OG  
1313 N  N   . MET A 162 ? 0.1612 0.1630 0.1812 0.0156  -0.0553 0.0054  162 MET A N   
1314 C  CA  . MET A 162 ? 0.1403 0.1591 0.2082 0.0248  -0.0315 -0.0048 162 MET A CA  
1315 C  C   . MET A 162 ? 0.1677 0.1924 0.2089 0.0495  -0.0189 -0.0066 162 MET A C   
1316 O  O   . MET A 162 ? 0.1780 0.1885 0.1665 0.0466  -0.0144 0.0018  162 MET A O   
1317 C  CB  . MET A 162 ? 0.1513 0.1379 0.1670 0.0307  -0.0340 -0.0129 162 MET A CB  
1318 C  CG  . MET A 162 ? 0.1683 0.1888 0.2156 0.0657  -0.0330 -0.0083 162 MET A CG  
1319 S  SD  . MET A 162 ? 0.2298 0.1633 0.2189 0.0524  -0.0109 0.0021  162 MET A SD  
1320 C  CE  . MET A 162 ? 0.1241 0.2255 0.2287 0.0198  -0.0149 -0.0160 162 MET A CE  
1321 N  N   . HIS A 163 ? 0.1787 0.2101 0.1631 -0.0163 -0.0249 -0.0002 163 HIS A N   
1322 C  CA  . HIS A 163 ? 0.1956 0.2464 0.1686 -0.0080 0.0047  -0.0187 163 HIS A CA  
1323 C  C   . HIS A 163 ? 0.1517 0.2329 0.1770 -0.0026 0.0108  -0.0269 163 HIS A C   
1324 O  O   . HIS A 163 ? 0.1819 0.2537 0.1809 -0.0170 -0.0143 -0.0339 163 HIS A O   
1325 C  CB  . HIS A 163 ? 0.2289 0.2910 0.2194 -0.0323 0.0264  -0.0336 163 HIS A CB  
1326 C  CG  . HIS A 163 ? 0.3088 0.4457 0.3218 -0.0881 0.0007  -0.0044 163 HIS A CG  
1327 N  ND1 . HIS A 163 ? 0.3988 0.4931 0.3951 -0.1194 0.0108  -0.0141 163 HIS A ND1 
1328 C  CD2 . HIS A 163 ? 0.3065 0.4891 0.3329 -0.0599 0.0086  0.0022  163 HIS A CD2 
1329 C  CE1 . HIS A 163 ? 0.3462 0.5173 0.2745 -0.1105 0.0598  -0.0103 163 HIS A CE1 
1330 N  NE2 . HIS A 163 ? 0.3302 0.4563 0.3791 -0.1197 0.0142  -0.0350 163 HIS A NE2 
1331 N  N   . GLU A 164 ? 0.1239 0.1936 0.1973 -0.0092 -0.0281 -0.0271 164 GLU A N   
1332 C  CA  . GLU A 164 ? 0.1365 0.2046 0.2213 0.0222  -0.0175 -0.0364 164 GLU A CA  
1333 C  C   . GLU A 164 ? 0.1555 0.1439 0.1880 0.0116  -0.0207 -0.0361 164 GLU A C   
1334 O  O   . GLU A 164 ? 0.1862 0.1579 0.2518 0.0340  -0.0575 -0.0341 164 GLU A O   
1335 C  CB  . GLU A 164 ? 0.1494 0.2224 0.2603 0.0136  -0.0233 -0.0062 164 GLU A CB  
1336 C  CG  . GLU A 164 ? 0.1846 0.3413 0.4173 0.0289  -0.0397 0.0016  164 GLU A CG  
1337 C  CD  . GLU A 164 ? 0.2846 0.3791 0.5278 0.0580  -0.0313 0.0021  164 GLU A CD  
1338 O  OE1 . GLU A 164 ? 0.3750 0.5524 0.6018 0.0685  0.0442  0.0737  164 GLU A OE1 
1339 O  OE2 . GLU A 164 ? 0.3517 0.6262 0.5881 -0.0203 0.0452  -0.0317 164 GLU A OE2 
1340 N  N   . GLY A 165 ? 0.1134 0.1729 0.1699 0.0218  -0.0182 -0.0263 165 GLY A N   
1341 C  CA  . GLY A 165 ? 0.1161 0.1707 0.1550 0.0180  -0.0311 0.0095  165 GLY A CA  
1342 C  C   . GLY A 165 ? 0.1119 0.1649 0.1516 0.0202  -0.0179 -0.0049 165 GLY A C   
1343 O  O   . GLY A 165 ? 0.1083 0.1700 0.1607 0.0162  -0.0344 0.0065  165 GLY A O   
1344 N  N   . PHE A 166 ? 0.1093 0.1423 0.1415 0.0116  -0.0299 0.0063  166 PHE A N   
1345 C  CA  . PHE A 166 ? 0.1053 0.1352 0.1314 0.0238  -0.0576 0.0118  166 PHE A CA  
1346 C  C   . PHE A 166 ? 0.0927 0.1457 0.1275 0.0328  -0.0442 -0.0039 166 PHE A C   
1347 O  O   . PHE A 166 ? 0.1527 0.1574 0.1276 0.0244  -0.0287 -0.0101 166 PHE A O   
1348 C  CB  . PHE A 166 ? 0.0874 0.1413 0.1446 0.0331  -0.0357 0.0074  166 PHE A CB  
1349 C  CG  . PHE A 166 ? 0.1056 0.1129 0.1318 0.0370  -0.0284 0.0006  166 PHE A CG  
1350 C  CD1 . PHE A 166 ? 0.0979 0.1552 0.1542 0.0212  -0.0431 0.0013  166 PHE A CD1 
1351 C  CD2 . PHE A 166 ? 0.1018 0.1214 0.1482 0.0290  -0.0291 0.0001  166 PHE A CD2 
1352 C  CE1 . PHE A 166 ? 0.1159 0.1269 0.1456 0.0294  -0.0357 0.0319  166 PHE A CE1 
1353 C  CE2 . PHE A 166 ? 0.1166 0.1312 0.1329 0.0376  -0.0405 0.0121  166 PHE A CE2 
1354 C  CZ  . PHE A 166 ? 0.1173 0.1315 0.1585 0.0170  -0.0337 0.0094  166 PHE A CZ  
1355 N  N   . ILE A 167 ? 0.1093 0.1349 0.1364 0.0117  -0.0241 -0.0003 167 ILE A N   
1356 C  CA  . ILE A 167 ? 0.1279 0.1413 0.1165 0.0210  -0.0256 -0.0036 167 ILE A CA  
1357 C  C   . ILE A 167 ? 0.1346 0.1240 0.1301 0.0200  -0.0240 0.0048  167 ILE A C   
1358 O  O   . ILE A 167 ? 0.1088 0.1350 0.1397 0.0322  -0.0308 0.0040  167 ILE A O   
1359 C  CB  . ILE A 167 ? 0.1337 0.1644 0.1588 0.0236  -0.0313 0.0103  167 ILE A CB  
1360 C  CG1 . ILE A 167 ? 0.1456 0.1808 0.2360 0.0421  -0.0194 0.0221  167 ILE A CG1 
1361 C  CG2 . ILE A 167 ? 0.1841 0.1209 0.2368 0.0556  -0.0605 0.0085  167 ILE A CG2 
1362 C  CD1 . ILE A 167 ? 0.1852 0.2375 0.2554 0.0827  -0.0742 0.0614  167 ILE A CD1 
1363 N  N   . PHE A 168 ? 0.1229 0.1132 0.1296 0.0319  -0.0298 -0.0056 168 PHE A N   
1364 C  CA  . PHE A 168 ? 0.1121 0.1112 0.1080 0.0199  -0.0274 0.0084  168 PHE A CA  
1365 C  C   . PHE A 168 ? 0.0946 0.1111 0.1132 0.0306  -0.0400 0.0000  168 PHE A C   
1366 O  O   . PHE A 168 ? 0.1394 0.1117 0.1356 0.0341  -0.0193 -0.0013 168 PHE A O   
1367 C  CB  . PHE A 168 ? 0.1084 0.0910 0.1290 0.0016  -0.0460 -0.0068 168 PHE A CB  
1368 C  CG  . PHE A 168 ? 0.1150 0.0985 0.1047 0.0148  -0.0318 -0.0096 168 PHE A CG  
1369 C  CD1 . PHE A 168 ? 0.1126 0.1393 0.1261 0.0159  -0.0294 0.0033  168 PHE A CD1 
1370 C  CD2 . PHE A 168 ? 0.1010 0.1095 0.1189 0.0079  -0.0070 0.0196  168 PHE A CD2 
1371 C  CE1 . PHE A 168 ? 0.1056 0.1132 0.1251 -0.0211 -0.0105 0.0124  168 PHE A CE1 
1372 C  CE2 . PHE A 168 ? 0.1484 0.1001 0.1265 0.0167  -0.0141 0.0015  168 PHE A CE2 
1373 C  CZ  . PHE A 168 ? 0.1373 0.0947 0.1262 0.0038  -0.0108 0.0030  168 PHE A CZ  
1374 N  N   . GLU A 169 ? 0.1231 0.0921 0.1131 0.0259  -0.0259 0.0069  169 GLU A N   
1375 C  CA  . GLU A 169 ? 0.1280 0.0928 0.1335 0.0227  -0.0432 0.0171  169 GLU A CA  
1376 C  C   . GLU A 169 ? 0.1053 0.0987 0.1137 0.0245  -0.0318 0.0055  169 GLU A C   
1377 O  O   . GLU A 169 ? 0.1187 0.1022 0.1348 0.0372  -0.0261 -0.0038 169 GLU A O   
1378 C  CB  . GLU A 169 ? 0.1424 0.0926 0.1142 0.0448  -0.0333 0.0204  169 GLU A CB  
1379 C  CG  . GLU A 169 ? 0.1660 0.0974 0.1616 0.0279  -0.0306 0.0244  169 GLU A CG  
1380 C  CD  . GLU A 169 ? 0.1704 0.0998 0.1705 0.0113  -0.0170 0.0274  169 GLU A CD  
1381 O  OE1 . GLU A 169 ? 0.2007 0.1403 0.1704 0.0348  -0.0420 0.0334  169 GLU A OE1 
1382 O  OE2 . GLU A 169 ? 0.1996 0.1495 0.1911 0.0222  -0.0577 0.0377  169 GLU A OE2 
1383 N  N   . VAL A 170 ? 0.1331 0.0735 0.1327 0.0462  -0.0389 0.0058  170 VAL A N   
1384 C  CA  . VAL A 170 ? 0.1048 0.0786 0.1413 0.0293  -0.0313 0.0293  170 VAL A CA  
1385 C  C   . VAL A 170 ? 0.1290 0.1076 0.1369 0.0292  -0.0396 0.0173  170 VAL A C   
1386 O  O   . VAL A 170 ? 0.1445 0.0740 0.1820 0.0315  -0.0274 0.0078  170 VAL A O   
1387 C  CB  . VAL A 170 ? 0.1351 0.0894 0.1480 0.0322  -0.0297 -0.0013 170 VAL A CB  
1388 C  CG1 . VAL A 170 ? 0.1190 0.1274 0.1515 0.0000  -0.0470 0.0093  170 VAL A CG1 
1389 C  CG2 . VAL A 170 ? 0.1453 0.0896 0.1772 0.0005  -0.0407 0.0171  170 VAL A CG2 
1390 N  N   . LEU A 171 ? 0.1263 0.0786 0.1438 0.0054  -0.0188 0.0142  171 LEU A N   
1391 C  CA  . LEU A 171 ? 0.1235 0.0856 0.1582 0.0151  -0.0281 0.0300  171 LEU A CA  
1392 C  C   . LEU A 171 ? 0.1476 0.0885 0.1425 0.0179  -0.0338 0.0101  171 LEU A C   
1393 O  O   . LEU A 171 ? 0.1380 0.0813 0.1556 0.0174  -0.0432 0.0199  171 LEU A O   
1394 C  CB  . LEU A 171 ? 0.1435 0.1004 0.1541 0.0108  -0.0309 0.0220  171 LEU A CB  
1395 C  CG  . LEU A 171 ? 0.1545 0.1007 0.1669 0.0010  -0.0370 0.0235  171 LEU A CG  
1396 C  CD1 . LEU A 171 ? 0.2208 0.0834 0.2172 0.0391  -0.0139 0.0475  171 LEU A CD1 
1397 C  CD2 . LEU A 171 ? 0.1952 0.1449 0.1663 0.0204  -0.0083 0.0312  171 LEU A CD2 
1398 N  N   . ASP A 172 ? 0.1405 0.0758 0.1594 0.0121  -0.0224 -0.0010 172 ASP A N   
1399 C  CA  . ASP A 172 ? 0.1516 0.0876 0.1556 0.0314  -0.0187 0.0069  172 ASP A CA  
1400 C  C   . ASP A 172 ? 0.1684 0.0885 0.1442 0.0028  -0.0195 0.0014  172 ASP A C   
1401 O  O   . ASP A 172 ? 0.1878 0.0859 0.1806 0.0118  -0.0282 0.0385  172 ASP A O   
1402 C  CB  . ASP A 172 ? 0.1809 0.0926 0.1737 0.0201  -0.0187 0.0109  172 ASP A CB  
1403 C  CG  . ASP A 172 ? 0.1792 0.1080 0.1996 -0.0100 0.0059  -0.0037 172 ASP A CG  
1404 O  OD1 . ASP A 172 ? 0.1632 0.1104 0.1894 -0.0027 -0.0242 0.0005  172 ASP A OD1 
1405 O  OD2 . ASP A 172 ? 0.2354 0.1318 0.2186 0.0000  -0.0062 -0.0320 172 ASP A OD2 
1406 N  N   . VAL A 173 ? 0.1542 0.0957 0.1665 0.0256  -0.0030 0.0185  173 VAL A N   
1407 C  CA  . VAL A 173 ? 0.1593 0.0955 0.1608 0.0118  -0.0213 -0.0042 173 VAL A CA  
1408 C  C   . VAL A 173 ? 0.1581 0.1329 0.1803 0.0094  -0.0068 0.0167  173 VAL A C   
1409 O  O   . VAL A 173 ? 0.1985 0.0977 0.2230 -0.0110 -0.0059 0.0006  173 VAL A O   
1410 C  CB  . VAL A 173 ? 0.1472 0.1305 0.1609 0.0152  -0.0307 0.0131  173 VAL A CB  
1411 C  CG1 . VAL A 173 ? 0.1612 0.1224 0.1999 -0.0058 -0.0451 -0.0116 173 VAL A CG1 
1412 C  CG2 . VAL A 173 ? 0.1510 0.1361 0.2042 0.0096  -0.0491 0.0266  173 VAL A CG2 
1413 N  N   . VAL A 174 ? 0.1945 0.1181 0.1875 -0.0159 -0.0149 0.0083  174 VAL A N   
1414 C  CA  . VAL A 174 ? 0.1988 0.1602 0.2261 -0.0237 -0.0123 -0.0112 174 VAL A CA  
1415 C  C   . VAL A 174 ? 0.2165 0.1349 0.2439 -0.0234 -0.0037 0.0093  174 VAL A C   
1416 O  O   . VAL A 174 ? 0.2836 0.1452 0.3206 -0.0310 0.0230  0.0220  174 VAL A O   
1417 C  CB  . VAL A 174 ? 0.2016 0.1798 0.2344 -0.0518 -0.0380 -0.0121 174 VAL A CB  
1418 C  CG1 . VAL A 174 ? 0.2384 0.2188 0.2899 -0.0555 -0.0574 -0.0649 174 VAL A CG1 
1419 C  CG2 . VAL A 174 ? 0.2450 0.2095 0.2726 0.0167  -0.0261 0.0184  174 VAL A CG2 
1420 N  N   . GLU A 175 ? 0.2197 0.0928 0.2583 -0.0143 -0.0341 0.0000  175 GLU A N   
1421 C  CA  . GLU A 175 ? 0.2646 0.0994 0.3085 -0.0235 -0.0255 0.0185  175 GLU A CA  
1422 C  C   . GLU A 175 ? 0.2679 0.1525 0.3329 -0.0035 -0.0432 0.0284  175 GLU A C   
1423 O  O   . GLU A 175 ? 0.2909 0.1261 0.4072 0.0060  -0.0508 0.0383  175 GLU A O   
1424 C  CB  . GLU A 175 ? 0.3004 0.1130 0.3051 -0.0144 -0.0273 0.0237  175 GLU A CB  
1425 C  CG  . GLU A 175 ? 0.3132 0.1688 0.3187 -0.0272 -0.0321 -0.0081 175 GLU A CG  
1426 C  CD  . GLU A 175 ? 0.4310 0.1971 0.3775 0.0288  -0.0140 -0.0433 175 GLU A CD  
1427 O  OE1 . GLU A 175 ? 0.4798 0.2649 0.4393 0.0649  -0.0254 -0.0644 175 GLU A OE1 
1428 O  OE2 . GLU A 175 ? 0.4814 0.3831 0.4745 -0.0013 -0.0868 -0.0568 175 GLU A OE2 
1429 N  N   . HIS A 176 ? 0.2413 0.1270 0.3003 -0.0014 -0.0306 0.0414  176 HIS A N   
1430 C  CA  . HIS A 176 ? 0.2509 0.1352 0.2766 -0.0142 -0.0131 0.0679  176 HIS A CA  
1431 C  C   . HIS A 176 ? 0.2314 0.1403 0.2500 0.0219  -0.0184 0.0484  176 HIS A C   
1432 O  O   . HIS A 176 ? 0.2545 0.1321 0.3227 0.0292  -0.0396 0.0848  176 HIS A O   
1433 C  CB  . HIS A 176 ? 0.2631 0.2204 0.3033 0.0238  -0.0062 0.0863  176 HIS A CB  
1434 C  CG  . HIS A 176 ? 0.4318 0.3610 0.4146 0.0180  -0.0421 0.0655  176 HIS A CG  
1435 N  ND1 . HIS A 176 ? 0.5681 0.4817 0.4858 0.0661  -0.1034 0.0974  176 HIS A ND1 
1436 C  CD2 . HIS A 176 ? 0.4641 0.4689 0.4271 0.0716  -0.0785 0.0704  176 HIS A CD2 
1437 C  CE1 . HIS A 176 ? 0.5844 0.5314 0.4321 0.1278  -0.1286 0.0766  176 HIS A CE1 
1438 N  NE2 . HIS A 176 ? 0.6337 0.6117 0.3977 0.0479  -0.1025 0.0053  176 HIS A NE2 
1439 N  N   . LYS A 177 ? 0.2086 0.1149 0.2249 0.0040  -0.0171 0.0315  177 LYS A N   
1440 C  CA  . LYS A 177 ? 0.2197 0.1088 0.2116 0.0135  -0.0310 0.0413  177 LYS A CA  
1441 C  C   . LYS A 177 ? 0.1741 0.0837 0.2093 0.0236  -0.0309 0.0173  177 LYS A C   
1442 O  O   . LYS A 177 ? 0.1926 0.0922 0.2321 0.0413  -0.0465 0.0104  177 LYS A O   
1443 C  CB  . LYS A 177 ? 0.2385 0.1143 0.2375 0.0166  -0.0241 -0.0154 177 LYS A CB  
1444 C  CG  . LYS A 177 ? 0.2619 0.1405 0.3301 -0.0043 -0.0320 -0.0071 177 LYS A CG  
1445 C  CD  . LYS A 177 ? 0.2970 0.1565 0.3649 0.0292  -0.0237 -0.0593 177 LYS A CD  
1446 C  CE  . LYS A 177 ? 0.3206 0.1952 0.4156 -0.0033 -0.0277 -0.0792 177 LYS A CE  
1447 N  NZ  . LYS A 177 ? 0.4626 0.2349 0.4122 0.0174  -0.0639 -0.0553 177 LYS A NZ  
1448 N  N   . VAL A 178 ? 0.1871 0.0921 0.2211 0.0392  -0.0365 0.0122  178 VAL A N   
1449 C  CA  . VAL A 178 ? 0.1657 0.0922 0.1937 0.0495  -0.0575 0.0105  178 VAL A CA  
1450 C  C   . VAL A 178 ? 0.1672 0.1204 0.1971 0.0550  -0.0381 0.0057  178 VAL A C   
1451 O  O   . VAL A 178 ? 0.2108 0.1030 0.2390 0.0723  -0.0114 0.0032  178 VAL A O   
1452 C  CB  . VAL A 178 ? 0.1804 0.1014 0.2061 0.0706  -0.0566 0.0085  178 VAL A CB  
1453 C  CG1 . VAL A 178 ? 0.2292 0.1168 0.2399 0.0182  -0.0638 0.0208  178 VAL A CG1 
1454 C  CG2 . VAL A 178 ? 0.2143 0.1802 0.1963 0.0427  -0.0373 0.0083  178 VAL A CG2 
1455 N  N   . TYR A 179 ? 0.1637 0.0983 0.1843 0.0383  -0.0260 0.0124  179 TYR A N   
1456 C  CA  . TYR A 179 ? 0.1588 0.1204 0.1839 0.0374  -0.0256 0.0008  179 TYR A CA  
1457 C  C   . TYR A 179 ? 0.1587 0.1170 0.1969 0.0438  -0.0094 0.0132  179 TYR A C   
1458 O  O   . TYR A 179 ? 0.1670 0.1071 0.2430 0.0523  0.0004  -0.0096 179 TYR A O   
1459 C  CB  . TYR A 179 ? 0.1883 0.1642 0.2278 0.0352  0.0029  -0.0033 179 TYR A CB  
1460 C  CG  . TYR A 179 ? 0.1950 0.1727 0.1913 0.0519  -0.0201 -0.0245 179 TYR A CG  
1461 C  CD1 . TYR A 179 ? 0.2282 0.2270 0.2501 0.0107  0.0208  -0.0559 179 TYR A CD1 
1462 C  CD2 . TYR A 179 ? 0.2021 0.1340 0.2234 0.0356  -0.0233 -0.0104 179 TYR A CD2 
1463 C  CE1 . TYR A 179 ? 0.2405 0.1377 0.2910 0.0289  -0.0006 -0.0352 179 TYR A CE1 
1464 C  CE2 . TYR A 179 ? 0.2088 0.1816 0.2524 0.0594  -0.0316 -0.0380 179 TYR A CE2 
1465 C  CZ  . TYR A 179 ? 0.2410 0.1835 0.2225 0.0351  -0.0488 -0.0112 179 TYR A CZ  
1466 O  OH  . TYR A 179 ? 0.2546 0.1629 0.3151 0.0227  -0.0733 -0.0409 179 TYR A OH  
1467 N  N   . LEU A 180 ? 0.1481 0.0968 0.2122 0.0551  -0.0091 0.0063  180 LEU A N   
1468 C  CA  . LEU A 180 ? 0.1480 0.1386 0.2085 0.0677  -0.0149 -0.0053 180 LEU A CA  
1469 C  C   . LEU A 180 ? 0.1737 0.1340 0.2105 0.0207  -0.0085 -0.0183 180 LEU A C   
1470 O  O   . LEU A 180 ? 0.2577 0.1548 0.2725 0.0504  0.0500  -0.0048 180 LEU A O   
1471 C  CB  . LEU A 180 ? 0.1691 0.1687 0.2389 0.0636  -0.0374 0.0013  180 LEU A CB  
1472 C  CG  . LEU A 180 ? 0.2212 0.2179 0.2325 0.0798  -0.0618 0.0418  180 LEU A CG  
1473 C  CD1 . LEU A 180 ? 0.2388 0.2918 0.2762 0.1534  -0.0674 0.0768  180 LEU A CD1 
1474 C  CD2 . LEU A 180 ? 0.3130 0.3541 0.1763 0.1838  0.0038  0.0195  180 LEU A CD2 
1475 N  N   . LEU A 181 ? 0.1542 0.1094 0.1629 0.0310  -0.0182 -0.0182 181 LEU A N   
1476 C  CA  . LEU A 181 ? 0.1540 0.1619 0.1757 0.0030  -0.0202 -0.0300 181 LEU A CA  
1477 C  C   . LEU A 181 ? 0.1522 0.1260 0.1419 0.0128  -0.0244 -0.0090 181 LEU A C   
1478 O  O   . LEU A 181 ? 0.1666 0.1743 0.1770 0.0147  0.0111  -0.0435 181 LEU A O   
1479 C  CB  . LEU A 181 ? 0.2132 0.2022 0.1623 -0.0300 -0.0281 0.0216  181 LEU A CB  
1480 C  CG  . LEU A 181 ? 0.2736 0.3584 0.2582 -0.1219 -0.0709 -0.0311 181 LEU A CG  
1481 C  CD1 . LEU A 181 ? 0.2378 0.2550 0.3707 -0.0120 -0.0008 -0.0109 181 LEU A CD1 
1482 C  CD2 . LEU A 181 ? 0.3953 0.2251 0.2576 0.0417  -0.0974 -0.0064 181 LEU A CD2 
1483 N  N   . LYS A 182 ? 0.1370 0.1236 0.1324 0.0324  -0.0223 -0.0052 182 LYS A N   
1484 C  CA  . LYS A 182 ? 0.1222 0.1441 0.1750 0.0264  -0.0335 -0.0005 182 LYS A CA  
1485 C  C   . LYS A 182 ? 0.1678 0.1333 0.1331 0.0123  -0.0262 -0.0075 182 LYS A C   
1486 O  O   . LYS A 182 ? 0.2331 0.1326 0.1659 -0.0026 -0.0050 -0.0182 182 LYS A O   
1487 C  CB  . LYS A 182 ? 0.1645 0.2173 0.2581 -0.0060 -0.0455 0.0280  182 LYS A CB  
1488 C  CG  . LYS A 182 ? 0.2142 0.3190 0.3232 0.1002  -0.0578 0.0405  182 LYS A CG  
1489 C  CD  . LYS A 182 ? 0.4379 0.4485 0.4062 0.0732  0.0046  -0.0013 182 LYS A CD  
1490 C  CE  . LYS A 182 ? 0.2843 0.4439 0.5234 0.1991  0.0210  0.0042  182 LYS A CE  
1491 N  NZ  . LYS A 182 ? 0.5178 0.5133 0.5864 0.1591  0.0044  -0.0533 182 LYS A NZ  
1492 N  N   . THR A 183 ? 0.1455 0.1291 0.1214 0.0201  -0.0123 -0.0137 183 THR A N   
1493 C  CA  . THR A 183 ? 0.1304 0.1485 0.1299 0.0141  -0.0013 0.0004  183 THR A CA  
1494 C  C   . THR A 183 ? 0.1433 0.1737 0.1598 0.0305  -0.0098 -0.0081 183 THR A C   
1495 O  O   . THR A 183 ? 0.1568 0.2192 0.1644 -0.0038 -0.0247 -0.0238 183 THR A O   
1496 C  CB  . THR A 183 ? 0.1370 0.1189 0.1369 0.0191  -0.0146 -0.0044 183 THR A CB  
1497 O  OG1 . THR A 183 ? 0.1427 0.1416 0.1445 0.0178  -0.0158 -0.0120 183 THR A OG1 
1498 C  CG2 . THR A 183 ? 0.1117 0.1553 0.1694 0.0213  -0.0444 -0.0262 183 THR A CG2 
1499 N  N   . PRO A 184 ? 0.1423 0.1555 0.1741 -0.0144 -0.0026 -0.0165 184 PRO A N   
1500 C  CA  . PRO A 184 ? 0.1632 0.1588 0.1637 -0.0076 0.0115  -0.0139 184 PRO A CA  
1501 C  C   . PRO A 184 ? 0.1346 0.1280 0.1346 0.0019  0.0014  0.0074  184 PRO A C   
1502 O  O   . PRO A 184 ? 0.1319 0.1394 0.1541 0.0181  -0.0106 -0.0255 184 PRO A O   
1503 C  CB  . PRO A 184 ? 0.2073 0.1704 0.1593 -0.0179 0.0172  -0.0315 184 PRO A CB  
1504 C  CG  . PRO A 184 ? 0.2282 0.2320 0.2259 -0.0620 0.0272  -0.0335 184 PRO A CG  
1505 C  CD  . PRO A 184 ? 0.1795 0.1952 0.2070 -0.0567 -0.0135 -0.0308 184 PRO A CD  
1506 N  N   . GLU A 185 ? 0.1347 0.1511 0.1570 0.0245  -0.0278 -0.0167 185 GLU A N   
1507 C  CA  . GLU A 185 ? 0.1140 0.1498 0.1817 0.0318  0.0000  -0.0190 185 GLU A CA  
1508 C  C   . GLU A 185 ? 0.1367 0.1204 0.1581 0.0313  -0.0097 -0.0137 185 GLU A C   
1509 O  O   . GLU A 185 ? 0.1374 0.1715 0.1616 0.0329  -0.0087 -0.0072 185 GLU A O   
1510 C  CB  . GLU A 185 ? 0.1325 0.2002 0.2421 0.0164  -0.0093 -0.0312 185 GLU A CB  
1511 C  CG  . GLU A 185 ? 0.1700 0.2297 0.2741 0.0531  0.0033  0.0027  185 GLU A CG  
1512 C  CD  . GLU A 185 ? 0.2835 0.3311 0.2902 0.0943  -0.0606 0.0170  185 GLU A CD  
1513 O  OE1 . GLU A 185 ? 0.2004 0.2898 0.2891 0.0528  -0.0879 0.0255  185 GLU A OE1 
1514 O  OE2 . GLU A 185 ? 0.4046 0.3466 0.3590 0.1716  -0.0860 0.0233  185 GLU A OE2 
1515 N  N   . ASP A 186 ? 0.1258 0.1190 0.1423 0.0279  -0.0159 -0.0081 186 ASP A N   
1516 C  CA  . ASP A 186 ? 0.1175 0.1387 0.1453 0.0153  -0.0082 -0.0083 186 ASP A CA  
1517 C  C   . ASP A 186 ? 0.1358 0.1439 0.1310 0.0133  -0.0154 -0.0033 186 ASP A C   
1518 O  O   . ASP A 186 ? 0.1333 0.1346 0.1535 0.0135  -0.0213 0.0111  186 ASP A O   
1519 C  CB  . ASP A 186 ? 0.1215 0.1571 0.1505 0.0101  -0.0245 -0.0070 186 ASP A CB  
1520 C  CG  . ASP A 186 ? 0.1901 0.1610 0.1987 0.0264  -0.0087 0.0014  186 ASP A CG  
1521 O  OD1 . ASP A 186 ? 0.2565 0.1783 0.2019 0.0823  0.0152  0.0025  186 ASP A OD1 
1522 O  OD2 . ASP A 186 ? 0.1926 0.1559 0.1747 0.0561  -0.0153 -0.0285 186 ASP A OD2 
1523 N  N   . ALA A 187 ? 0.1088 0.1324 0.1377 0.0188  -0.0092 -0.0083 187 ALA A N   
1524 C  CA  . ALA A 187 ? 0.0920 0.1355 0.1330 0.0371  -0.0146 -0.0116 187 ALA A CA  
1525 C  C   . ALA A 187 ? 0.1062 0.1422 0.1157 0.0205  -0.0001 -0.0052 187 ALA A C   
1526 O  O   . ALA A 187 ? 0.1180 0.1335 0.1212 0.0248  -0.0223 0.0034  187 ALA A O   
1527 C  CB  . ALA A 187 ? 0.1357 0.1162 0.1898 0.0176  -0.0222 -0.0140 187 ALA A CB  
1528 N  N   . TYR A 188 ? 0.1013 0.1511 0.1133 0.0212  -0.0148 -0.0023 188 TYR A N   
1529 C  CA  . TYR A 188 ? 0.0980 0.1405 0.1284 0.0226  -0.0332 -0.0095 188 TYR A CA  
1530 C  C   . TYR A 188 ? 0.1090 0.1338 0.1374 0.0094  -0.0261 -0.0106 188 TYR A C   
1531 O  O   . TYR A 188 ? 0.1227 0.1427 0.1469 0.0034  -0.0302 0.0072  188 TYR A O   
1532 C  CB  . TYR A 188 ? 0.1140 0.1674 0.1293 0.0330  -0.0253 -0.0016 188 TYR A CB  
1533 C  CG  . TYR A 188 ? 0.1267 0.1787 0.1445 0.0233  -0.0300 0.0208  188 TYR A CG  
1534 C  CD1 . TYR A 188 ? 0.1483 0.1789 0.1342 -0.0408 -0.0400 0.0157  188 TYR A CD1 
1535 C  CD2 . TYR A 188 ? 0.1342 0.1686 0.1566 0.0375  -0.0047 0.0274  188 TYR A CD2 
1536 C  CE1 . TYR A 188 ? 0.1865 0.1822 0.1437 -0.0260 -0.0295 -0.0163 188 TYR A CE1 
1537 C  CE2 . TYR A 188 ? 0.1077 0.2574 0.1852 -0.0080 -0.0138 0.0477  188 TYR A CE2 
1538 C  CZ  . TYR A 188 ? 0.1625 0.2251 0.1543 -0.0698 -0.0632 0.0435  188 TYR A CZ  
1539 O  OH  . TYR A 188 ? 0.2077 0.3160 0.1727 -0.1041 -0.0419 0.0592  188 TYR A OH  
1540 N  N   . SER A 189 ? 0.1419 0.1262 0.1487 0.0349  -0.0187 -0.0025 189 SER A N   
1541 C  CA  . SER A 189 ? 0.1555 0.1203 0.1369 0.0330  -0.0113 -0.0068 189 SER A CA  
1542 C  C   . SER A 189 ? 0.1362 0.1246 0.1261 0.0275  -0.0163 0.0289  189 SER A C   
1543 O  O   . SER A 189 ? 0.1477 0.1006 0.1539 0.0107  -0.0199 -0.0101 189 SER A O   
1544 C  CB  . SER A 189 ? 0.2271 0.1443 0.1519 0.0594  0.0081  -0.0179 189 SER A CB  
1545 O  OG  . SER A 189 ? 0.2974 0.2327 0.2181 0.1123  0.0120  -0.0281 189 SER A OG  
1546 N  N   . LEU A 190 ? 0.1177 0.1128 0.1306 0.0206  -0.0406 -0.0207 190 LEU A N   
1547 C  CA  . LEU A 190 ? 0.1073 0.1067 0.1252 0.0229  -0.0324 0.0006  190 LEU A CA  
1548 C  C   . LEU A 190 ? 0.1070 0.1101 0.1217 0.0093  -0.0185 -0.0050 190 LEU A C   
1549 O  O   . LEU A 190 ? 0.0984 0.1130 0.1201 0.0171  -0.0208 0.0009  190 LEU A O   
1550 C  CB  . LEU A 190 ? 0.0888 0.1219 0.1160 0.0246  -0.0169 0.0134  190 LEU A CB  
1551 C  CG  . LEU A 190 ? 0.1032 0.1114 0.1280 0.0239  -0.0130 -0.0060 190 LEU A CG  
1552 C  CD1 . LEU A 190 ? 0.1373 0.1301 0.1196 0.0152  -0.0137 0.0095  190 LEU A CD1 
1553 C  CD2 . LEU A 190 ? 0.1271 0.0959 0.1382 -0.0132 -0.0419 -0.0020 190 LEU A CD2 
1554 N  N   . LEU A 191 ? 0.0992 0.1147 0.1116 0.0170  -0.0099 0.0110  191 LEU A N   
1555 C  CA  . LEU A 191 ? 0.0929 0.1153 0.1010 0.0201  -0.0087 -0.0108 191 LEU A CA  
1556 C  C   . LEU A 191 ? 0.1161 0.1026 0.1040 0.0102  0.0001  0.0114  191 LEU A C   
1557 O  O   . LEU A 191 ? 0.1002 0.1189 0.1253 0.0098  -0.0222 0.0073  191 LEU A O   
1558 C  CB  . LEU A 191 ? 0.0918 0.1090 0.1013 0.0043  -0.0224 -0.0077 191 LEU A CB  
1559 C  CG  . LEU A 191 ? 0.0977 0.1037 0.1142 0.0369  -0.0217 -0.0065 191 LEU A CG  
1560 C  CD1 . LEU A 191 ? 0.1455 0.1086 0.1239 -0.0017 0.0163  0.0246  191 LEU A CD1 
1561 C  CD2 . LEU A 191 ? 0.1233 0.1309 0.0988 0.0325  0.0022  -0.0251 191 LEU A CD2 
1562 N  N   . GLY A 192 ? 0.1025 0.1201 0.1222 0.0112  -0.0300 0.0071  192 GLY A N   
1563 C  CA  . GLY A 192 ? 0.1302 0.1270 0.1153 -0.0138 -0.0397 -0.0004 192 GLY A CA  
1564 C  C   . GLY A 192 ? 0.1327 0.1360 0.1271 0.0043  -0.0361 -0.0007 192 GLY A C   
1565 O  O   . GLY A 192 ? 0.1956 0.2257 0.1432 -0.0654 -0.0666 0.0176  192 GLY A O   
1566 N  N   . LEU A 193 ? 0.1246 0.1047 0.1203 0.0255  -0.0304 -0.0094 193 LEU A N   
1567 C  CA  . LEU A 193 ? 0.1247 0.0811 0.1368 0.0148  -0.0378 -0.0184 193 LEU A CA  
1568 C  C   . LEU A 193 ? 0.1088 0.0775 0.1331 0.0178  -0.0260 0.0073  193 LEU A C   
1569 O  O   . LEU A 193 ? 0.1227 0.0778 0.1326 0.0169  -0.0233 0.0085  193 LEU A O   
1570 C  CB  . LEU A 193 ? 0.1265 0.1003 0.1413 0.0291  -0.0283 -0.0108 193 LEU A CB  
1571 C  CG  . LEU A 193 ? 0.1739 0.1021 0.1660 0.0414  -0.0309 -0.0048 193 LEU A CG  
1572 C  CD1 . LEU A 193 ? 0.2097 0.1712 0.2186 0.1101  -0.0418 -0.0002 193 LEU A CD1 
1573 C  CD2 . LEU A 193 ? 0.2099 0.1022 0.2364 0.0491  -0.0483 -0.0409 193 LEU A CD2 
1574 N  N   . ILE A 194 ? 0.1004 0.0783 0.1226 0.0014  -0.0184 -0.0019 194 ILE A N   
1575 C  CA  . ILE A 194 ? 0.1238 0.0768 0.1138 0.0034  -0.0244 0.0012  194 ILE A CA  
1576 C  C   . ILE A 194 ? 0.1126 0.0773 0.0976 -0.0011 -0.0131 -0.0007 194 ILE A C   
1577 O  O   . ILE A 194 ? 0.1249 0.0791 0.0976 0.0141  -0.0284 -0.0030 194 ILE A O   
1578 C  CB  . ILE A 194 ? 0.1037 0.0875 0.1046 0.0124  -0.0131 -0.0073 194 ILE A CB  
1579 C  CG1 . ILE A 194 ? 0.1200 0.1025 0.1161 0.0059  -0.0302 -0.0060 194 ILE A CG1 
1580 C  CG2 . ILE A 194 ? 0.1167 0.1223 0.1166 0.0421  -0.0362 0.0126  194 ILE A CG2 
1581 C  CD1 . ILE A 194 ? 0.1237 0.0940 0.1077 -0.0093 -0.0364 -0.0223 194 ILE A CD1 
1582 N  N   . GLY A 195 ? 0.1035 0.0879 0.1021 0.0153  -0.0206 -0.0065 195 GLY A N   
1583 C  CA  . GLY A 195 ? 0.1191 0.0784 0.1015 0.0209  -0.0238 -0.0134 195 GLY A CA  
1584 C  C   . GLY A 195 ? 0.1043 0.0877 0.0936 0.0094  -0.0301 -0.0022 195 GLY A C   
1585 O  O   . GLY A 195 ? 0.1113 0.0879 0.1214 0.0101  -0.0214 0.0035  195 GLY A O   
1586 N  N   . THR A 196 ? 0.1141 0.0746 0.1086 0.0164  -0.0196 -0.0032 196 THR A N   
1587 C  CA  . THR A 196 ? 0.1141 0.0713 0.1041 0.0257  -0.0288 -0.0033 196 THR A CA  
1588 C  C   . THR A 196 ? 0.1186 0.0903 0.1022 0.0208  -0.0293 0.0036  196 THR A C   
1589 O  O   . THR A 196 ? 0.1324 0.0868 0.1189 0.0025  -0.0412 0.0163  196 THR A O   
1590 C  CB  . THR A 196 ? 0.1352 0.0751 0.1286 0.0285  -0.0244 -0.0035 196 THR A CB  
1591 O  OG1 . THR A 196 ? 0.1667 0.0810 0.1269 0.0023  -0.0297 -0.0101 196 THR A OG1 
1592 C  CG2 . THR A 196 ? 0.1628 0.0957 0.1494 -0.0262 -0.0479 0.0121  196 THR A CG2 
1593 N  N   . THR A 197 ? 0.1101 0.0808 0.1063 0.0193  -0.0243 -0.0082 197 THR A N   
1594 C  CA  . THR A 197 ? 0.1137 0.0925 0.1146 0.0120  -0.0147 0.0063  197 THR A CA  
1595 C  C   . THR A 197 ? 0.1174 0.0934 0.1131 0.0179  -0.0237 -0.0068 197 THR A C   
1596 O  O   . THR A 197 ? 0.1560 0.0823 0.1176 0.0055  -0.0153 0.0120  197 THR A O   
1597 C  CB  . THR A 197 ? 0.1419 0.0900 0.1200 0.0081  -0.0154 -0.0170 197 THR A CB  
1598 O  OG1 . THR A 197 ? 0.1598 0.0955 0.1744 0.0216  -0.0284 0.0104  197 THR A OG1 
1599 C  CG2 . THR A 197 ? 0.1495 0.0859 0.1389 0.0058  -0.0156 0.0197  197 THR A CG2 
1600 N  N   . GLY A 198 ? 0.1121 0.0971 0.1415 0.0026  -0.0355 0.0187  198 GLY A N   
1601 C  CA  . GLY A 198 ? 0.0854 0.1256 0.1714 0.0046  -0.0177 0.0174  198 GLY A CA  
1602 C  C   . GLY A 198 ? 0.1248 0.1198 0.1604 0.0047  -0.0229 0.0264  198 GLY A C   
1603 O  O   . GLY A 198 ? 0.1745 0.1520 0.2022 0.0115  0.0153  0.0493  198 GLY A O   
1604 N  N   . ARG A 199 ? 0.1271 0.1003 0.1464 -0.0014 -0.0334 0.0303  199 ARG A N   
1605 C  CA  . ARG A 199 ? 0.1428 0.0716 0.1565 0.0017  -0.0350 0.0170  199 ARG A CA  
1606 C  C   . ARG A 199 ? 0.1309 0.0985 0.1331 0.0077  -0.0419 0.0161  199 ARG A C   
1607 O  O   . ARG A 199 ? 0.1476 0.0948 0.1622 -0.0020 -0.0431 0.0357  199 ARG A O   
1608 C  CB  . ARG A 199 ? 0.1695 0.0987 0.1843 -0.0065 -0.0407 0.0086  199 ARG A CB  
1609 C  CG  . ARG A 199 ? 0.2238 0.1069 0.2491 0.0015  -0.0630 -0.0068 199 ARG A CG  
1610 C  CD  . ARG A 199 ? 0.2650 0.1384 0.2611 0.0477  -0.0873 0.0066  199 ARG A CD  
1611 N  NE  . ARG A 199 ? 0.2743 0.1417 0.3044 0.0105  -0.0840 -0.0474 199 ARG A NE  
1612 C  CZ  . ARG A 199 ? 0.3966 0.1652 0.2577 0.0494  -0.1115 -0.0251 199 ARG A CZ  
1613 N  NH1 . ARG A 199 ? 0.5157 0.2374 0.3205 0.0966  -0.1658 -0.0696 199 ARG A NH1 
1614 N  NH2 . ARG A 199 ? 0.3905 0.1427 0.2711 0.0308  -0.1188 -0.0636 199 ARG A NH2 
1615 N  N   . TYR A 200 ? 0.1204 0.0764 0.1475 0.0055  -0.0332 0.0079  200 TYR A N   
1616 C  CA  . TYR A 200 ? 0.1209 0.0637 0.1260 0.0073  -0.0431 -0.0051 200 TYR A CA  
1617 C  C   . TYR A 200 ? 0.1256 0.0720 0.1237 0.0076  -0.0305 -0.0027 200 TYR A C   
1618 O  O   . TYR A 200 ? 0.1665 0.0685 0.1283 0.0026  -0.0360 0.0118  200 TYR A O   
1619 C  CB  . TYR A 200 ? 0.1189 0.0650 0.1542 0.0124  -0.0313 0.0038  200 TYR A CB  
1620 C  CG  . TYR A 200 ? 0.1664 0.0823 0.1311 0.0315  -0.0444 0.0069  200 TYR A CG  
1621 C  CD1 . TYR A 200 ? 0.1805 0.1009 0.1453 0.0266  -0.0476 -0.0055 200 TYR A CD1 
1622 C  CD2 . TYR A 200 ? 0.1948 0.0777 0.1694 0.0064  -0.0543 0.0062  200 TYR A CD2 
1623 C  CE1 . TYR A 200 ? 0.2685 0.1095 0.1423 0.0423  -0.0417 0.0004  200 TYR A CE1 
1624 C  CE2 . TYR A 200 ? 0.2203 0.1270 0.1292 0.0215  -0.0712 -0.0231 200 TYR A CE2 
1625 C  CZ  . TYR A 200 ? 0.2125 0.1015 0.1707 -0.0032 -0.0373 -0.0202 200 TYR A CZ  
1626 O  OH  . TYR A 200 ? 0.2691 0.1101 0.2093 0.0224  -0.0279 -0.0431 200 TYR A OH  
1627 N  N   . ILE A 201 ? 0.1373 0.0686 0.1130 0.0224  -0.0377 0.0037  201 ILE A N   
1628 C  CA  . ILE A 201 ? 0.1355 0.0616 0.1182 0.0180  -0.0486 -0.0007 201 ILE A CA  
1629 C  C   . ILE A 201 ? 0.1165 0.0879 0.1152 0.0135  -0.0419 0.0086  201 ILE A C   
1630 O  O   . ILE A 201 ? 0.1254 0.0832 0.1348 0.0167  -0.0534 0.0095  201 ILE A O   
1631 C  CB  . ILE A 201 ? 0.1334 0.1001 0.1238 0.0082  -0.0383 0.0138  201 ILE A CB  
1632 C  CG1 . ILE A 201 ? 0.1674 0.1256 0.1961 -0.0003 -0.0472 0.0272  201 ILE A CG1 
1633 C  CG2 . ILE A 201 ? 0.1465 0.1143 0.1364 0.0268  -0.0180 -0.0285 201 ILE A CG2 
1634 C  CD1 . ILE A 201 ? 0.2045 0.1697 0.2289 -0.0479 -0.0477 0.0101  201 ILE A CD1 
1635 N  N   . ILE A 202 ? 0.1057 0.0709 0.1164 0.0025  -0.0347 0.0016  202 ILE A N   
1636 C  CA  . ILE A 202 ? 0.0945 0.0883 0.1067 0.0207  -0.0253 -0.0071 202 ILE A CA  
1637 C  C   . ILE A 202 ? 0.0860 0.0945 0.1056 0.0228  -0.0241 0.0036  202 ILE A C   
1638 O  O   . ILE A 202 ? 0.1321 0.1064 0.1022 0.0400  -0.0248 0.0060  202 ILE A O   
1639 C  CB  . ILE A 202 ? 0.1029 0.0792 0.1131 0.0066  -0.0253 0.0159  202 ILE A CB  
1640 C  CG1 . ILE A 202 ? 0.0975 0.0931 0.1130 0.0124  -0.0293 0.0032  202 ILE A CG1 
1641 C  CG2 . ILE A 202 ? 0.1078 0.1087 0.1460 -0.0022 -0.0521 0.0027  202 ILE A CG2 
1642 C  CD1 . ILE A 202 ? 0.1277 0.0761 0.1159 0.0062  -0.0294 0.0145  202 ILE A CD1 
1643 N  N   . ARG A 203 ? 0.1137 0.0890 0.1097 0.0102  -0.0250 0.0133  203 ARG A N   
1644 C  CA  . ARG A 203 ? 0.1170 0.0855 0.1166 0.0185  -0.0232 0.0097  203 ARG A CA  
1645 C  C   . ARG A 203 ? 0.1170 0.0731 0.1148 0.0273  -0.0147 0.0303  203 ARG A C   
1646 O  O   . ARG A 203 ? 0.1094 0.1008 0.1250 0.0300  -0.0216 0.0064  203 ARG A O   
1647 C  CB  . ARG A 203 ? 0.1351 0.0976 0.1387 0.0024  -0.0386 0.0106  203 ARG A CB  
1648 C  CG  . ARG A 203 ? 0.1549 0.0902 0.1535 0.0093  -0.0273 0.0270  203 ARG A CG  
1649 C  CD  . ARG A 203 ? 0.1571 0.1332 0.1798 0.0042  -0.0365 0.0251  203 ARG A CD  
1650 N  NE  . ARG A 203 ? 0.1809 0.1292 0.2106 0.0059  -0.0367 0.0454  203 ARG A NE  
1651 C  CZ  . ARG A 203 ? 0.1937 0.1632 0.1949 0.0046  -0.0429 0.0266  203 ARG A CZ  
1652 N  NH1 . ARG A 203 ? 0.2260 0.1315 0.2489 0.0273  -0.0554 0.0602  203 ARG A NH1 
1653 N  NH2 . ARG A 203 ? 0.2206 0.1610 0.2547 0.0195  -0.0161 0.0135  203 ARG A NH2 
1654 N  N   . LYS A 204 ? 0.0976 0.0840 0.1158 0.0133  -0.0248 -0.0018 204 LYS A N   
1655 C  CA  A LYS A 204 ? 0.1024 0.0845 0.1388 0.0286  -0.0309 -0.0038 204 LYS A CA  
1656 C  CA  B LYS A 204 ? 0.1043 0.0827 0.1260 0.0311  -0.0264 -0.0035 204 LYS A CA  
1657 C  C   . LYS A 204 ? 0.0969 0.1030 0.1166 0.0200  -0.0376 0.0074  204 LYS A C   
1658 O  O   . LYS A 204 ? 0.1245 0.1095 0.1145 0.0135  -0.0236 0.0045  204 LYS A O   
1659 C  CB  A LYS A 204 ? 0.1072 0.1008 0.1466 0.0149  -0.0319 0.0032  204 LYS A CB  
1660 C  CB  B LYS A 204 ? 0.1292 0.0906 0.1202 0.0273  -0.0255 0.0158  204 LYS A CB  
1661 C  CG  A LYS A 204 ? 0.0797 0.1157 0.2273 0.0346  -0.0635 0.0514  204 LYS A CG  
1662 C  CG  B LYS A 204 ? 0.1177 0.1196 0.0871 0.0269  -0.0180 0.0155  204 LYS A CG  
1663 C  CD  A LYS A 204 ? 0.1944 0.1538 0.1820 0.0087  -0.0255 0.0201  204 LYS A CD  
1664 C  CD  B LYS A 204 ? 0.1444 0.1647 0.1749 0.0095  -0.0441 -0.0051 204 LYS A CD  
1665 C  CE  A LYS A 204 ? 0.1238 0.1604 0.1310 0.0156  -0.0338 0.0912  204 LYS A CE  
1666 C  CE  B LYS A 204 ? 0.1725 0.1378 0.1709 0.0151  -0.0618 0.0628  204 LYS A CE  
1667 N  NZ  A LYS A 204 ? 0.2332 0.1009 0.1184 0.1024  0.0567  -0.0009 204 LYS A NZ  
1668 N  NZ  B LYS A 204 ? 0.2022 0.1404 0.2030 0.0144  -0.0633 0.0220  204 LYS A NZ  
1669 N  N   . VAL A 205 ? 0.1054 0.0952 0.1195 0.0242  -0.0536 -0.0029 205 VAL A N   
1670 C  CA  . VAL A 205 ? 0.0982 0.0771 0.1009 0.0248  -0.0476 0.0111  205 VAL A CA  
1671 C  C   . VAL A 205 ? 0.1139 0.0925 0.1140 0.0180  -0.0153 0.0121  205 VAL A C   
1672 O  O   . VAL A 205 ? 0.1050 0.1119 0.1129 0.0237  -0.0431 0.0021  205 VAL A O   
1673 C  CB  . VAL A 205 ? 0.0997 0.0861 0.1075 0.0145  -0.0327 -0.0021 205 VAL A CB  
1674 C  CG1 . VAL A 205 ? 0.1097 0.1030 0.1476 0.0145  -0.0134 0.0298  205 VAL A CG1 
1675 C  CG2 . VAL A 205 ? 0.0862 0.0989 0.1415 0.0243  -0.0526 0.0162  205 VAL A CG2 
1676 N  N   . PHE A 206 ? 0.1092 0.1129 0.1089 0.0306  -0.0336 0.0032  206 PHE A N   
1677 C  CA  . PHE A 206 ? 0.1109 0.1177 0.1358 0.0340  -0.0543 0.0008  206 PHE A CA  
1678 C  C   . PHE A 206 ? 0.1221 0.1249 0.1448 0.0336  -0.0387 0.0152  206 PHE A C   
1679 O  O   . PHE A 206 ? 0.1127 0.1455 0.1419 0.0314  -0.0453 -0.0006 206 PHE A O   
1680 C  CB  . PHE A 206 ? 0.1324 0.1398 0.1321 0.0345  -0.0438 -0.0021 206 PHE A CB  
1681 C  CG  . PHE A 206 ? 0.1379 0.1189 0.1578 0.0452  -0.0418 0.0006  206 PHE A CG  
1682 C  CD1 . PHE A 206 ? 0.1424 0.1239 0.1516 0.0366  -0.0270 0.0170  206 PHE A CD1 
1683 C  CD2 . PHE A 206 ? 0.1179 0.1382 0.1671 0.0461  -0.0330 0.0136  206 PHE A CD2 
1684 C  CE1 . PHE A 206 ? 0.1998 0.1471 0.1820 0.0799  -0.0317 0.0474  206 PHE A CE1 
1685 C  CE2 . PHE A 206 ? 0.1427 0.1448 0.2156 0.0433  -0.0132 0.0162  206 PHE A CE2 
1686 C  CZ  . PHE A 206 ? 0.1676 0.1339 0.2406 0.0433  -0.0093 0.0297  206 PHE A CZ  
1687 N  N   . ARG A 207 ? 0.1391 0.1450 0.1377 0.0197  -0.0330 0.0000  207 ARG A N   
1688 C  CA  . ARG A 207 ? 0.1336 0.1744 0.1592 0.0238  -0.0496 0.0197  207 ARG A CA  
1689 C  C   . ARG A 207 ? 0.1257 0.1674 0.1695 0.0088  -0.0358 0.0203  207 ARG A C   
1690 O  O   . ARG A 207 ? 0.1503 0.2156 0.2171 0.0493  -0.0355 0.0554  207 ARG A O   
1691 C  CB  . ARG A 207 ? 0.1338 0.2133 0.1946 -0.0387 -0.0572 0.0566  207 ARG A CB  
1692 C  CG  . ARG A 207 ? 0.2361 0.2749 0.2314 0.0158  -0.0683 0.0364  207 ARG A CG  
1693 C  CD  . ARG A 207 ? 0.2924 0.3551 0.3354 0.1062  -0.0168 0.0482  207 ARG A CD  
1694 N  NE  . ARG A 207 ? 0.3486 0.2742 0.4532 -0.0122 -0.0894 -0.1878 207 ARG A NE  
1695 C  CZ  . ARG A 207 ? 0.4739 0.3996 0.4846 -0.0418 -0.0771 0.0563  207 ARG A CZ  
1696 N  NH1 . ARG A 207 ? 0.3646 0.5226 0.4122 -0.0171 -0.0976 0.0572  207 ARG A NH1 
1697 N  NH2 . ARG A 207 ? 0.5684 0.5323 0.3639 0.1745  -0.0802 0.1019  207 ARG A NH2 
1698 N  N   . ARG A 208 ? 0.1172 0.1884 0.1842 0.0514  -0.0281 0.0179  208 ARG A N   
1699 C  CA  . ARG A 208 ? 0.1640 0.1993 0.2014 0.0326  -0.0220 -0.0015 208 ARG A CA  
1700 C  C   . ARG A 208 ? 0.1766 0.2378 0.2275 0.0569  -0.0120 -0.0002 208 ARG A C   
1701 O  O   . ARG A 208 ? 0.2033 0.2914 0.2990 0.1039  -0.0049 0.0207  208 ARG A O   
1702 C  CB  . ARG A 208 ? 0.2355 0.2203 0.2176 0.0645  0.0018  -0.0215 208 ARG A CB  
1703 C  CG  . ARG A 208 ? 0.2686 0.3751 0.3691 0.0807  -0.0415 -0.0262 208 ARG A CG  
1704 C  CD  . ARG A 208 ? 0.3005 0.4267 0.4146 0.0548  -0.1166 -0.0058 208 ARG A CD  
1705 N  NE  . ARG A 208 ? 0.2829 0.3905 0.2406 0.1066  -0.0842 0.0161  208 ARG A NE  
1706 C  CZ  . ARG A 208 ? 0.1701 0.3334 0.2710 0.0546  -0.0389 0.0058  208 ARG A CZ  
1707 N  NH1 . ARG A 208 ? 0.3379 0.2973 0.3268 0.1084  -0.0974 0.0012  208 ARG A NH1 
1708 N  NH2 . ARG A 208 ? 0.2225 0.2642 0.2613 0.0505  -0.0446 -0.0006 208 ARG A NH2 
1709 N  N   . ALA A 209 ? 0.1179 0.2559 0.2443 0.0440  -0.0300 0.0167  209 ALA A N   
1710 C  CA  . ALA A 209 ? 0.1463 0.3018 0.2750 0.0492  -0.0264 0.0354  209 ALA A CA  
1711 C  C   . ALA A 209 ? 0.1455 0.2998 0.2499 0.0658  -0.0271 0.0497  209 ALA A C   
1712 O  O   . ALA A 209 ? 0.1424 0.4210 0.3097 0.1096  -0.0223 0.0469  209 ALA A O   
1713 C  CB  . ALA A 209 ? 0.1699 0.3019 0.3164 0.0010  -0.0901 0.0592  209 ALA A CB  
1714 N  N   . ASP A 210 ? 0.1362 0.2681 0.2415 0.0562  -0.0450 0.0614  210 ASP A N   
1715 C  CA  . ASP A 210 ? 0.1484 0.2409 0.2219 0.0508  -0.0381 0.0366  210 ASP A CA  
1716 C  C   . ASP A 210 ? 0.1678 0.2379 0.2219 0.0611  -0.0336 0.0389  210 ASP A C   
1717 O  O   . ASP A 210 ? 0.1633 0.2851 0.2521 0.0701  -0.0531 0.0819  210 ASP A O   
1718 C  CB  . ASP A 210 ? 0.1630 0.2770 0.2399 0.0439  -0.0282 0.0354  210 ASP A CB  
1719 C  CG  . ASP A 210 ? 0.1673 0.2987 0.2817 0.0592  -0.0563 -0.0139 210 ASP A CG  
1720 O  OD1 . ASP A 210 ? 0.1407 0.2667 0.2536 0.0377  -0.0685 0.0102  210 ASP A OD1 
1721 O  OD2 . ASP A 210 ? 0.2211 0.3146 0.3455 0.0276  -0.0700 -0.0410 210 ASP A OD2 
1722 N  N   . GLY A 211 ? 0.1369 0.2353 0.2318 0.0724  -0.0480 0.0309  211 GLY A N   
1723 C  CA  . GLY A 211 ? 0.1885 0.1786 0.2085 0.0659  -0.0376 0.0407  211 GLY A CA  
1724 C  C   . GLY A 211 ? 0.1455 0.1931 0.1929 0.0372  -0.0566 0.0284  211 GLY A C   
1725 O  O   . GLY A 211 ? 0.1513 0.2216 0.2198 0.0546  -0.0495 0.0557  211 GLY A O   
1726 N  N   . ALA A 212 ? 0.1301 0.1948 0.1827 0.0278  -0.0535 0.0172  212 ALA A N   
1727 C  CA  . ALA A 212 ? 0.1218 0.2114 0.1629 0.0242  -0.0417 0.0202  212 ALA A CA  
1728 C  C   . ALA A 212 ? 0.1355 0.1641 0.1578 0.0260  -0.0435 0.0339  212 ALA A C   
1729 O  O   . ALA A 212 ? 0.1360 0.1828 0.1414 0.0278  -0.0393 0.0254  212 ALA A O   
1730 C  CB  . ALA A 212 ? 0.1642 0.2554 0.2008 -0.0283 -0.0515 -0.0455 212 ALA A CB  
1731 N  N   . PRO A 213 ? 0.1054 0.1602 0.1225 0.0212  -0.0527 0.0421  213 PRO A N   
1732 C  CA  . PRO A 213 ? 0.1267 0.1573 0.1382 0.0098  -0.0551 0.0103  213 PRO A CA  
1733 C  C   . PRO A 213 ? 0.1421 0.1236 0.1274 0.0293  -0.0464 -0.0107 213 PRO A C   
1734 O  O   . PRO A 213 ? 0.1478 0.1329 0.1394 0.0294  -0.0639 -0.0058 213 PRO A O   
1735 C  CB  . PRO A 213 ? 0.1521 0.1593 0.1831 0.0335  -0.0407 0.0462  213 PRO A CB  
1736 C  CG  . PRO A 213 ? 0.2069 0.3036 0.1636 -0.0052 -0.0448 0.0686  213 PRO A CG  
1737 C  CD  . PRO A 213 ? 0.1511 0.1537 0.1456 0.0259  -0.0566 0.0227  213 PRO A CD  
1738 N  N   . ALA A 214 ? 0.1296 0.1045 0.1177 0.0174  -0.0536 0.0005  214 ALA A N   
1739 C  CA  . ALA A 214 ? 0.1043 0.1051 0.1423 0.0187  -0.0441 0.0020  214 ALA A CA  
1740 C  C   . ALA A 214 ? 0.0973 0.0965 0.1155 0.0172  -0.0146 0.0105  214 ALA A C   
1741 O  O   . ALA A 214 ? 0.1126 0.1175 0.1395 0.0189  -0.0292 -0.0001 214 ALA A O   
1742 C  CB  . ALA A 214 ? 0.1153 0.1487 0.1267 0.0237  -0.0082 0.0268  214 ALA A CB  
1743 N  N   . ALA A 215 ? 0.0895 0.0883 0.1208 0.0073  -0.0213 0.0006  215 ALA A N   
1744 C  CA  . ALA A 215 ? 0.0901 0.1111 0.1082 0.0155  -0.0297 0.0166  215 ALA A CA  
1745 C  C   . ALA A 215 ? 0.0917 0.1012 0.0770 0.0133  -0.0323 0.0193  215 ALA A C   
1746 O  O   . ALA A 215 ? 0.0992 0.0965 0.1187 0.0172  -0.0397 0.0083  215 ALA A O   
1747 C  CB  . ALA A 215 ? 0.1414 0.1148 0.1034 0.0379  -0.0565 0.0271  215 ALA A CB  
1748 N  N   . ALA A 216 ? 0.1026 0.0787 0.0943 0.0097  -0.0067 0.0061  216 ALA A N   
1749 C  CA  . ALA A 216 ? 0.1077 0.0752 0.1017 -0.0002 -0.0199 0.0142  216 ALA A CA  
1750 C  C   . ALA A 216 ? 0.1038 0.1042 0.1002 0.0080  -0.0163 0.0002  216 ALA A C   
1751 O  O   . ALA A 216 ? 0.1129 0.0921 0.0996 0.0108  -0.0282 0.0057  216 ALA A O   
1752 C  CB  . ALA A 216 ? 0.1379 0.0936 0.1208 0.0218  -0.0308 0.0404  216 ALA A CB  
1753 N  N   . ASN A 217 ? 0.1140 0.0847 0.1170 0.0112  -0.0293 -0.0019 217 ASN A N   
1754 C  CA  . ASN A 217 ? 0.1030 0.1037 0.1188 0.0004  -0.0128 0.0025  217 ASN A CA  
1755 C  C   . ASN A 217 ? 0.1189 0.0963 0.1220 0.0204  -0.0148 0.0049  217 ASN A C   
1756 O  O   . ASN A 217 ? 0.1412 0.0962 0.2103 0.0099  0.0055  0.0033  217 ASN A O   
1757 C  CB  . ASN A 217 ? 0.1265 0.0917 0.1220 0.0099  -0.0202 0.0021  217 ASN A CB  
1758 C  CG  . ASN A 217 ? 0.1413 0.0949 0.1288 -0.0053 -0.0123 0.0040  217 ASN A CG  
1759 O  OD1 . ASN A 217 ? 0.1384 0.1484 0.1215 0.0285  -0.0286 0.0099  217 ASN A OD1 
1760 N  ND2 . ASN A 217 ? 0.1914 0.0986 0.1216 0.0143  -0.0326 0.0092  217 ASN A ND2 
1761 N  N   . SER A 218 ? 0.0971 0.0976 0.1216 0.0054  -0.0169 0.0216  218 SER A N   
1762 C  CA  . SER A 218 ? 0.1220 0.1044 0.1138 0.0124  -0.0319 0.0164  218 SER A CA  
1763 C  C   . SER A 218 ? 0.1727 0.1396 0.1625 0.0135  -0.0260 0.0140  218 SER A C   
1764 O  O   . SER A 218 ? 0.2400 0.1489 0.1903 0.0049  -0.0490 0.0124  218 SER A O   
1765 C  CB  . SER A 218 ? 0.1142 0.1020 0.1425 0.0178  -0.0224 0.0416  218 SER A CB  
1766 O  OG  . SER A 218 ? 0.1238 0.0817 0.1580 0.0086  -0.0354 0.0330  218 SER A OG  
1767 N  N   . VAL A 219 ? 0.1409 0.1383 0.2009 0.0289  -0.0654 -0.0133 219 VAL A N   
1768 C  CA  . VAL A 219 ? 0.1530 0.1280 0.1687 -0.0040 -0.0334 -0.0007 219 VAL A CA  
1769 C  C   . VAL A 219 ? 0.1815 0.1448 0.1960 0.0054  -0.0417 0.0013  219 VAL A C   
1770 O  O   . VAL A 219 ? 0.1884 0.1356 0.1846 0.0064  -0.0457 0.0143  219 VAL A O   
1771 C  CB  . VAL A 219 ? 0.1958 0.0927 0.1972 -0.0089 -0.0475 0.0007  219 VAL A CB  
1772 C  CG1 . VAL A 219 ? 0.1365 0.1657 0.1831 0.0405  -0.0230 0.0028  219 VAL A CG1 
1773 C  CG2 . VAL A 219 ? 0.2077 0.1310 0.1513 -0.0118 -0.0597 0.0056  219 VAL A CG2 
1774 N  N   . GLU A 220 ? 0.1935 0.1418 0.1941 0.0138  -0.0376 0.0183  220 GLU A N   
1775 C  CA  . GLU A 220 ? 0.2406 0.1428 0.1915 -0.0271 -0.0413 0.0245  220 GLU A CA  
1776 C  C   . GLU A 220 ? 0.1982 0.1368 0.1808 -0.0210 -0.0425 0.0149  220 GLU A C   
1777 O  O   . GLU A 220 ? 0.1905 0.1771 0.1832 0.0019  -0.0336 0.0087  220 GLU A O   
1778 C  CB  . GLU A 220 ? 0.3027 0.1816 0.1867 -0.0249 -0.0197 0.0238  220 GLU A CB  
1779 C  CG  . GLU A 220 ? 0.3029 0.2768 0.2614 -0.0820 -0.0141 0.0271  220 GLU A CG  
1780 C  CD  . GLU A 220 ? 0.3776 0.2993 0.3553 -0.0152 0.0459  0.0710  220 GLU A CD  
1781 O  OE1 . GLU A 220 ? 0.3288 0.4291 0.4060 -0.0335 0.0054  0.0920  220 GLU A OE1 
1782 O  OE2 . GLU A 220 ? 0.4262 0.4805 0.4627 -0.1084 0.0585  -0.1200 220 GLU A OE2 
1783 N  N   . ARG A 221 ? 0.2472 0.1565 0.1905 -0.0210 -0.0143 0.0260  221 ARG A N   
1784 C  CA  . ARG A 221 ? 0.2501 0.1631 0.2048 -0.0001 -0.0093 0.0043  221 ARG A CA  
1785 C  C   . ARG A 221 ? 0.2581 0.1693 0.2188 -0.0287 0.0094  0.0045  221 ARG A C   
1786 O  O   . ARG A 221 ? 0.2414 0.1974 0.2583 -0.0366 0.0043  -0.0300 221 ARG A O   
1787 C  CB  . ARG A 221 ? 0.2901 0.2017 0.2832 -0.0114 -0.0092 0.0063  221 ARG A CB  
1788 C  CG  . ARG A 221 ? 0.4037 0.2494 0.3546 0.0206  -0.0249 0.0450  221 ARG A CG  
1789 C  CD  . ARG A 221 ? 0.5571 0.3104 0.4998 0.0356  0.0092  0.0472  221 ARG A CD  
1790 N  NE  . ARG A 221 ? 0.6446 0.4219 0.5750 -0.0141 -0.0137 0.0195  221 ARG A NE  
1791 C  CZ  . ARG A 221 ? 0.7514 0.4138 0.6216 0.0114  -0.0171 0.0074  221 ARG A CZ  
1792 N  NH1 . ARG A 221 ? 0.7846 0.4536 0.7216 -0.0126 -0.0046 -0.0675 221 ARG A NH1 
1793 N  NH2 . ARG A 221 ? 0.8127 0.2507 0.5624 -0.0519 0.0364  0.0528  221 ARG A NH2 
1794 N  N   . LEU A 222 ? 0.2194 0.1690 0.2321 -0.0268 -0.0097 -0.0223 222 LEU A N   
1795 C  CA  . LEU A 222 ? 0.2255 0.1974 0.2678 -0.0247 0.0190  -0.0051 222 LEU A CA  
1796 C  C   . LEU A 222 ? 0.2828 0.1985 0.3455 -0.0264 0.0180  -0.0110 222 LEU A C   
1797 O  O   . LEU A 222 ? 0.2855 0.1809 0.3940 -0.0322 0.0326  -0.0317 222 LEU A O   
1798 C  CB  . LEU A 222 ? 0.2311 0.2314 0.2786 -0.0322 -0.0075 -0.0138 222 LEU A CB  
1799 C  CG  . LEU A 222 ? 0.2393 0.2575 0.2556 -0.0114 -0.0189 0.0268  222 LEU A CG  
1800 C  CD1 . LEU A 222 ? 0.2996 0.4164 0.2418 -0.0460 -0.0701 0.0575  222 LEU A CD1 
1801 C  CD2 . LEU A 222 ? 0.3575 0.2708 0.3559 0.0691  0.0625  0.0335  222 LEU A CD2 
1802 N  N   . SER A 223 ? 0.3156 0.2020 0.3964 -0.0668 0.0153  0.0038  223 SER A N   
1803 C  CA  . SER A 223 ? 0.3942 0.2544 0.4280 -0.0554 0.0105  0.0243  223 SER A CA  
1804 C  C   . SER A 223 ? 0.4081 0.2209 0.4554 -0.0520 -0.0212 0.0090  223 SER A C   
1805 O  O   . SER A 223 ? 0.4197 0.3055 0.5035 -0.0638 -0.0511 -0.0071 223 SER A O   
1806 C  CB  . SER A 223 ? 0.4263 0.3005 0.4297 -0.0565 0.0119  0.0190  223 SER A CB  
1807 O  OG  . SER A 223 ? 0.4595 0.3494 0.4667 -0.0644 0.0146  0.0954  223 SER A OG  
1808 N  N   . LEU A 224 ? 0.4817 0.3141 0.5121 -0.0478 -0.0397 -0.0121 224 LEU A N   
1809 C  CA  . LEU A 224 ? 0.5125 0.4118 0.5355 -0.0191 -0.0225 0.0001  224 LEU A CA  
1810 C  C   . LEU A 224 ? 0.5006 0.4442 0.5679 -0.0326 -0.0220 0.0218  224 LEU A C   
1811 O  O   . LEU A 224 ? 0.5554 0.4709 0.6100 -0.0574 -0.0240 0.0710  224 LEU A O   
1812 C  CB  . LEU A 224 ? 0.5438 0.4337 0.5550 -0.0148 -0.0141 -0.0156 224 LEU A CB  
1813 C  CG  . LEU A 224 ? 0.6071 0.4600 0.5673 0.0183  -0.0357 -0.0504 224 LEU A CG  
1814 C  CD1 . LEU A 224 ? 0.6423 0.4201 0.6159 0.0765  -0.0198 -0.0416 224 LEU A CD1 
1815 C  CD2 . LEU A 224 ? 0.6924 0.5352 0.6892 0.0727  -0.0223 -0.0756 224 LEU A CD2 
1816 N  N   . ILE A 225 ? 0.5038 0.4935 0.5845 -0.0337 -0.0110 0.0145  225 ILE A N   
1817 C  CA  . ILE A 225 ? 0.5325 0.5166 0.5699 -0.0363 -0.0025 0.0100  225 ILE A CA  
1818 C  C   . ILE A 225 ? 0.5284 0.5028 0.5896 -0.0450 -0.0200 0.0166  225 ILE A C   
1819 O  O   . ILE A 225 ? 0.5709 0.5282 0.6419 -0.0618 -0.0200 0.0385  225 ILE A O   
1820 C  CB  . ILE A 225 ? 0.5432 0.5204 0.5765 -0.0413 0.0014  -0.0063 225 ILE A CB  
1821 C  CG1 . ILE A 225 ? 0.5433 0.5058 0.5690 -0.0614 -0.0016 0.0130  225 ILE A CG1 
1822 C  CG2 . ILE A 225 ? 0.5157 0.5763 0.5890 -0.0420 0.0250  -0.0004 225 ILE A CG2 
1823 C  CD1 . ILE A 225 ? 0.5870 0.5497 0.5892 -0.0536 0.0321  -0.0451 225 ILE A CD1 
1824 N  N   . ALA A 226 ? 0.5416 0.5445 0.5969 -0.0399 -0.0246 0.0176  226 ALA A N   
1825 C  CA  . ALA A 226 ? 0.5441 0.5457 0.5808 -0.0263 -0.0247 0.0104  226 ALA A CA  
1826 C  C   . ALA A 226 ? 0.5596 0.5544 0.5599 -0.0167 -0.0308 -0.0007 226 ALA A C   
1827 O  O   . ALA A 226 ? 0.5992 0.6070 0.6012 -0.0143 -0.0538 0.0040  226 ALA A O   
1828 C  CB  . ALA A 226 ? 0.5625 0.5736 0.6032 -0.0196 -0.0098 0.0064  226 ALA A CB  
1829 N  N   . GLY A 227 ? 0.5625 0.5450 0.5318 -0.0313 -0.0206 -0.0056 227 GLY A N   
1830 C  CA  . GLY A 227 ? 0.5621 0.5020 0.5119 -0.0468 -0.0187 -0.0032 227 GLY A CA  
1831 C  C   . GLY A 227 ? 0.5694 0.5116 0.5005 -0.0568 -0.0262 -0.0013 227 GLY A C   
1832 O  O   . GLY A 227 ? 0.6144 0.5510 0.5157 -0.0906 -0.0241 -0.0240 227 GLY A O   
1833 N  N   . ARG A 228 ? 0.5557 0.4845 0.5013 -0.0522 -0.0357 -0.0016 228 ARG A N   
1834 C  CA  . ARG A 228 ? 0.4990 0.4736 0.5014 -0.0474 -0.0514 -0.0159 228 ARG A CA  
1835 C  C   . ARG A 228 ? 0.4717 0.4532 0.4681 -0.0750 -0.0498 -0.0260 228 ARG A C   
1836 O  O   . ARG A 228 ? 0.4687 0.3816 0.4554 -0.0950 -0.0679 -0.0538 228 ARG A O   
1837 C  CB  . ARG A 228 ? 0.4746 0.5113 0.5216 -0.0264 -0.0566 -0.0121 228 ARG A CB  
1838 C  CG  . ARG A 228 ? 0.5014 0.4977 0.5903 0.0133  -0.0500 0.0087  228 ARG A CG  
1839 C  CD  . ARG A 228 ? 0.4815 0.4555 0.5747 0.0263  -0.0158 0.0628  228 ARG A CD  
1840 N  NE  . ARG A 228 ? 0.4516 0.4827 0.4486 0.0469  -0.0096 0.1206  228 ARG A NE  
1841 C  CZ  . ARG A 228 ? 0.4195 0.3662 0.4144 0.0067  0.0208  0.0238  228 ARG A CZ  
1842 N  NH1 . ARG A 228 ? 0.4740 0.2767 0.5830 -0.0150 0.0019  -0.0160 228 ARG A NH1 
1843 N  NH2 . ARG A 228 ? 0.4905 0.1831 0.4581 -0.0266 0.0515  0.0617  228 ARG A NH2 
1844 N  N   . TYR A 229 ? 0.4372 0.4560 0.4180 -0.0719 -0.0508 -0.0241 229 TYR A N   
1845 C  CA  . TYR A 229 ? 0.4106 0.4215 0.4300 -0.0719 -0.0385 -0.0599 229 TYR A CA  
1846 C  C   . TYR A 229 ? 0.4207 0.4098 0.4076 -0.0295 -0.0417 -0.0442 229 TYR A C   
1847 O  O   . TYR A 229 ? 0.4803 0.4837 0.4259 -0.0002 -0.0745 -0.0580 229 TYR A O   
1848 C  CB  . TYR A 229 ? 0.3958 0.4555 0.4433 -0.0624 -0.0139 -0.0467 229 TYR A CB  
1849 C  CG  . TYR A 229 ? 0.4778 0.4518 0.5075 -0.1119 -0.0225 -0.0990 229 TYR A CG  
1850 C  CD1 . TYR A 229 ? 0.5117 0.4102 0.5603 -0.1451 -0.0219 -0.1254 229 TYR A CD1 
1851 C  CD2 . TYR A 229 ? 0.6181 0.5654 0.5631 -0.0744 -0.0103 -0.0981 229 TYR A CD2 
1852 C  CE1 . TYR A 229 ? 0.5944 0.5694 0.6336 -0.0763 0.0021  -0.1164 229 TYR A CE1 
1853 C  CE2 . TYR A 229 ? 0.6322 0.6238 0.6300 -0.0393 -0.0130 -0.1094 229 TYR A CE2 
1854 C  CZ  . TYR A 229 ? 0.6490 0.5914 0.6444 -0.0606 0.0140  -0.1093 229 TYR A CZ  
1855 O  OH  . TYR A 229 ? 0.6235 0.6076 0.7106 -0.0952 0.0290  -0.1801 229 TYR A OH  
1856 N  N   . VAL A 230 ? 0.3443 0.3694 0.3843 -0.0542 -0.0619 -0.0703 230 VAL A N   
1857 C  CA  . VAL A 230 ? 0.2978 0.3053 0.3760 -0.0280 -0.0336 -0.0459 230 VAL A CA  
1858 C  C   . VAL A 230 ? 0.3048 0.2532 0.3355 -0.0303 -0.0358 -0.0550 230 VAL A C   
1859 O  O   . VAL A 230 ? 0.3164 0.2092 0.3295 -0.0327 -0.0003 -0.0331 230 VAL A O   
1860 C  CB  . VAL A 230 ? 0.3156 0.3119 0.4038 -0.0479 -0.0195 -0.0610 230 VAL A CB  
1861 C  CG1 . VAL A 230 ? 0.3427 0.3117 0.3600 -0.0106 0.0006  -0.0400 230 VAL A CG1 
1862 C  CG2 . VAL A 230 ? 0.3227 0.3987 0.4662 -0.0645 -0.0189 -0.0517 230 VAL A CG2 
1863 N  N   . GLY A 231 ? 0.2839 0.2165 0.3228 -0.0176 -0.0232 -0.0292 231 GLY A N   
1864 C  CA  . GLY A 231 ? 0.2787 0.2143 0.2890 -0.0138 -0.0187 -0.0353 231 GLY A CA  
1865 C  C   . GLY A 231 ? 0.2271 0.2355 0.2518 -0.0018 0.0083  -0.0319 231 GLY A C   
1866 O  O   . GLY A 231 ? 0.2472 0.2318 0.3349 0.0273  0.0166  -0.0219 231 GLY A O   
1867 N  N   . LYS A 232 ? 0.2248 0.1926 0.2700 0.0126  -0.0031 -0.0356 232 LYS A N   
1868 C  CA  . LYS A 232 ? 0.2128 0.1464 0.2451 0.0191  0.0011  0.0009  232 LYS A CA  
1869 C  C   . LYS A 232 ? 0.1543 0.1579 0.1879 -0.0055 0.0079  0.0167  232 LYS A C   
1870 O  O   . LYS A 232 ? 0.2063 0.1859 0.2346 0.0286  0.0262  0.0563  232 LYS A O   
1871 C  CB  . LYS A 232 ? 0.2175 0.1545 0.2423 0.0235  -0.0019 0.0340  232 LYS A CB  
1872 C  CG  . LYS A 232 ? 0.2329 0.2288 0.2667 0.0324  -0.0074 0.0588  232 LYS A CG  
1873 C  CD  . LYS A 232 ? 0.2343 0.3010 0.2996 0.0453  -0.0222 0.0082  232 LYS A CD  
1874 C  CE  . LYS A 232 ? 0.3356 0.2522 0.2751 0.0462  -0.0496 -0.0293 232 LYS A CE  
1875 N  NZ  . LYS A 232 ? 0.2882 0.1345 0.2929 0.0246  -0.0032 0.0438  232 LYS A NZ  
1876 N  N   . ASP A 233 ? 0.1584 0.1590 0.1779 -0.0062 0.0109  0.0513  233 ASP A N   
1877 C  CA  . ASP A 233 ? 0.1479 0.1401 0.1762 -0.0379 -0.0410 0.0314  233 ASP A CA  
1878 C  C   . ASP A 233 ? 0.1582 0.1280 0.0978 -0.0449 -0.0648 0.0474  233 ASP A C   
1879 O  O   . ASP A 233 ? 0.2405 0.1368 0.1434 -0.0150 -0.0372 0.0295  233 ASP A O   
1880 C  CB  . ASP A 233 ? 0.1624 0.1338 0.1762 -0.0258 -0.0174 0.0115  233 ASP A CB  
1881 C  CG  . ASP A 233 ? 0.1746 0.1371 0.1654 -0.0225 -0.0216 0.0011  233 ASP A CG  
1882 O  OD1 . ASP A 233 ? 0.1881 0.1474 0.1825 -0.0239 0.0183  0.0195  233 ASP A OD1 
1883 O  OD2 . ASP A 233 ? 0.1657 0.1460 0.3152 0.0065  -0.0407 0.0043  233 ASP A OD2 
1884 N  N   . ASP A 234 ? 0.1370 0.1189 0.1364 0.0048  -0.0262 0.0199  234 ASP A N   
1885 C  CA  . ASP A 234 ? 0.1230 0.1010 0.1196 0.0120  -0.0130 0.0260  234 ASP A CA  
1886 C  C   . ASP A 234 ? 0.1185 0.1004 0.0982 0.0260  -0.0296 0.0167  234 ASP A C   
1887 O  O   . ASP A 234 ? 0.1382 0.1980 0.1048 0.0251  -0.0259 0.0238  234 ASP A O   
1888 C  CB  . ASP A 234 ? 0.1027 0.0894 0.1293 -0.0048 -0.0177 0.0218  234 ASP A CB  
1889 C  CG  . ASP A 234 ? 0.1184 0.0960 0.1054 -0.0155 -0.0025 0.0152  234 ASP A CG  
1890 O  OD1 . ASP A 234 ? 0.1170 0.1290 0.0953 0.0073  -0.0049 0.0251  234 ASP A OD1 
1891 O  OD2 . ASP A 234 ? 0.1024 0.1176 0.1295 -0.0067 -0.0093 0.0252  234 ASP A OD2 
1892 N  N   . PRO A 235 ? 0.1029 0.1029 0.0938 0.0164  -0.0287 0.0172  235 PRO A N   
1893 C  CA  . PRO A 235 ? 0.1047 0.0873 0.1071 0.0124  -0.0257 0.0216  235 PRO A CA  
1894 C  C   . PRO A 235 ? 0.1099 0.0792 0.1046 0.0103  -0.0300 0.0060  235 PRO A C   
1895 O  O   . PRO A 235 ? 0.1210 0.0917 0.1223 0.0224  -0.0529 0.0053  235 PRO A O   
1896 C  CB  . PRO A 235 ? 0.1169 0.0920 0.1063 0.0134  -0.0496 0.0123  235 PRO A CB  
1897 C  CG  . PRO A 235 ? 0.1179 0.1194 0.0999 -0.0004 -0.0129 0.0254  235 PRO A CG  
1898 C  CD  . PRO A 235 ? 0.1184 0.1146 0.1154 0.0122  -0.0221 0.0227  235 PRO A CD  
1899 N  N   . VAL A 236 ? 0.1111 0.0784 0.1152 0.0057  -0.0516 0.0219  236 VAL A N   
1900 C  CA  . VAL A 236 ? 0.1114 0.0758 0.1091 0.0114  -0.0233 0.0015  236 VAL A CA  
1901 C  C   . VAL A 236 ? 0.1103 0.0774 0.1001 0.0133  -0.0299 0.0052  236 VAL A C   
1902 O  O   . VAL A 236 ? 0.1002 0.1018 0.1190 0.0116  -0.0318 0.0009  236 VAL A O   
1903 C  CB  . VAL A 236 ? 0.1030 0.0950 0.0889 0.0146  -0.0235 0.0121  236 VAL A CB  
1904 C  CG1 . VAL A 236 ? 0.0976 0.1137 0.1100 0.0164  -0.0193 0.0093  236 VAL A CG1 
1905 C  CG2 . VAL A 236 ? 0.1335 0.0944 0.1098 0.0366  -0.0282 0.0170  236 VAL A CG2 
1906 N  N   . LEU A 237 ? 0.1024 0.0969 0.1211 0.0099  -0.0270 -0.0014 237 LEU A N   
1907 C  CA  . LEU A 237 ? 0.1033 0.0845 0.1137 -0.0012 -0.0209 0.0001  237 LEU A CA  
1908 C  C   . LEU A 237 ? 0.0786 0.0840 0.1037 0.0066  -0.0214 -0.0013 237 LEU A C   
1909 O  O   . LEU A 237 ? 0.0952 0.0849 0.1351 0.0178  -0.0382 0.0008  237 LEU A O   
1910 C  CB  . LEU A 237 ? 0.1063 0.1138 0.1185 0.0054  -0.0198 -0.0106 237 LEU A CB  
1911 C  CG  . LEU A 237 ? 0.1319 0.0859 0.0965 -0.0009 -0.0399 0.0065  237 LEU A CG  
1912 C  CD1 . LEU A 237 ? 0.1662 0.1131 0.1398 0.0545  -0.0182 0.0125  237 LEU A CD1 
1913 C  CD2 . LEU A 237 ? 0.1335 0.1132 0.1060 0.0116  -0.0427 0.0215  237 LEU A CD2 
1914 N  N   . LEU A 238 ? 0.0931 0.0786 0.1029 0.0205  -0.0264 0.0071  238 LEU A N   
1915 C  CA  A LEU A 238 ? 0.0914 0.0779 0.1005 0.0176  -0.0370 0.0165  238 LEU A CA  
1916 C  CA  B LEU A 238 ? 0.0958 0.0825 0.1001 0.0235  -0.0354 0.0186  238 LEU A CA  
1917 C  C   . LEU A 238 ? 0.0909 0.0996 0.0943 0.0242  -0.0357 0.0164  238 LEU A C   
1918 O  O   . LEU A 238 ? 0.1058 0.0929 0.1105 0.0139  -0.0217 0.0080  238 LEU A O   
1919 C  CB  A LEU A 238 ? 0.1239 0.0819 0.1024 -0.0013 -0.0261 0.0304  238 LEU A CB  
1920 C  CB  B LEU A 238 ? 0.1273 0.0953 0.0969 0.0280  -0.0275 0.0214  238 LEU A CB  
1921 C  CG  A LEU A 238 ? 0.0863 0.0769 0.1095 0.0263  -0.0201 0.0194  238 LEU A CG  
1922 C  CG  B LEU A 238 ? 0.1506 0.1306 0.1146 0.0391  -0.0631 0.0413  238 LEU A CG  
1923 C  CD1 A LEU A 238 ? 0.1435 0.1355 0.1061 0.0253  -0.0389 0.0721  238 LEU A CD1 
1924 C  CD1 B LEU A 238 ? 0.2082 0.1208 0.1442 0.0234  -0.0392 0.0111  238 LEU A CD1 
1925 C  CD2 A LEU A 238 ? 0.1212 0.1089 0.0935 0.0443  -0.0048 0.0238  238 LEU A CD2 
1926 C  CD2 B LEU A 238 ? 0.1648 0.1407 0.1169 0.0629  -0.0380 0.0337  238 LEU A CD2 
1927 N  N   . VAL A 239 ? 0.0886 0.0816 0.0883 0.0140  -0.0322 0.0162  239 VAL A N   
1928 C  CA  . VAL A 239 ? 0.0996 0.0785 0.0985 0.0115  -0.0244 0.0182  239 VAL A CA  
1929 C  C   . VAL A 239 ? 0.0986 0.0879 0.1088 0.0188  -0.0100 -0.0089 239 VAL A C   
1930 O  O   . VAL A 239 ? 0.0880 0.1214 0.1502 0.0091  -0.0279 -0.0247 239 VAL A O   
1931 C  CB  . VAL A 239 ? 0.0970 0.0847 0.1021 0.0188  -0.0217 0.0131  239 VAL A CB  
1932 C  CG1 . VAL A 239 ? 0.0976 0.1229 0.1240 0.0020  -0.0190 0.0292  239 VAL A CG1 
1933 C  CG2 . VAL A 239 ? 0.1058 0.1229 0.1211 -0.0140 -0.0574 0.0075  239 VAL A CG2 
1934 N  N   . ARG A 240 ? 0.1007 0.0930 0.1032 0.0155  -0.0274 0.0037  240 ARG A N   
1935 C  CA  . ARG A 240 ? 0.0897 0.0998 0.1119 0.0151  -0.0293 0.0071  240 ARG A CA  
1936 C  C   . ARG A 240 ? 0.0883 0.0976 0.0999 0.0078  -0.0223 0.0035  240 ARG A C   
1937 O  O   . ARG A 240 ? 0.1291 0.1084 0.1082 0.0056  -0.0158 0.0056  240 ARG A O   
1938 C  CB  . ARG A 240 ? 0.0954 0.1113 0.1254 0.0147  -0.0359 -0.0059 240 ARG A CB  
1939 C  CG  . ARG A 240 ? 0.1252 0.1117 0.1085 0.0180  -0.0394 0.0087  240 ARG A CG  
1940 C  CD  . ARG A 240 ? 0.1259 0.1185 0.1241 0.0071  -0.0637 0.0169  240 ARG A CD  
1941 N  NE  . ARG A 240 ? 0.1185 0.1014 0.1279 0.0148  -0.0426 0.0047  240 ARG A NE  
1942 C  CZ  . ARG A 240 ? 0.1263 0.1354 0.1265 0.0135  -0.0351 0.0079  240 ARG A CZ  
1943 N  NH1 . ARG A 240 ? 0.1278 0.1380 0.1381 0.0197  -0.0491 0.0069  240 ARG A NH1 
1944 N  NH2 . ARG A 240 ? 0.1280 0.1393 0.1355 0.0297  -0.0607 0.0000  240 ARG A NH2 
1945 N  N   . ALA A 241 ? 0.0984 0.0959 0.1079 0.0028  -0.0319 0.0037  241 ALA A N   
1946 C  CA  . ALA A 241 ? 0.0845 0.0943 0.0999 0.0008  -0.0121 0.0138  241 ALA A CA  
1947 C  C   . ALA A 241 ? 0.1019 0.0877 0.1196 0.0000  -0.0245 0.0027  241 ALA A C   
1948 O  O   . ALA A 241 ? 0.1151 0.1222 0.1224 0.0115  -0.0444 0.0164  241 ALA A O   
1949 C  CB  . ALA A 241 ? 0.1147 0.0911 0.1202 0.0306  -0.0341 0.0001  241 ALA A CB  
1950 N  N   . GLN A 242 ? 0.0970 0.1012 0.0982 -0.0013 -0.0380 0.0188  242 GLN A N   
1951 C  CA  . GLN A 242 ? 0.0932 0.1080 0.0962 -0.0041 -0.0309 0.0120  242 GLN A CA  
1952 C  C   . GLN A 242 ? 0.0970 0.1078 0.1285 -0.0006 -0.0357 0.0141  242 GLN A C   
1953 O  O   . GLN A 242 ? 0.1098 0.1268 0.1360 0.0128  -0.0428 0.0050  242 GLN A O   
1954 C  CB  . GLN A 242 ? 0.1025 0.1074 0.1049 0.0045  -0.0283 0.0056  242 GLN A CB  
1955 C  CG  . GLN A 242 ? 0.1183 0.1132 0.1030 0.0006  -0.0293 -0.0157 242 GLN A CG  
1956 C  CD  . GLN A 242 ? 0.0888 0.1030 0.1111 -0.0024 -0.0075 -0.0008 242 GLN A CD  
1957 O  OE1 . GLN A 242 ? 0.1004 0.1020 0.1095 -0.0001 -0.0413 -0.0007 242 GLN A OE1 
1958 N  NE2 . GLN A 242 ? 0.0813 0.1360 0.1020 -0.0126 -0.0387 0.0006  242 GLN A NE2 
1959 N  N   . SER A 243 ? 0.1056 0.1170 0.1361 0.0068  -0.0305 0.0265  243 SER A N   
1960 C  CA  A SER A 243 ? 0.0922 0.1600 0.1504 0.0242  -0.0228 0.0069  243 SER A CA  
1961 C  CA  B SER A 243 ? 0.0851 0.1457 0.1226 0.0189  -0.0277 0.0108  243 SER A CA  
1962 C  C   . SER A 243 ? 0.0963 0.1593 0.1461 0.0073  -0.0257 0.0080  243 SER A C   
1963 O  O   . SER A 243 ? 0.1382 0.1687 0.1574 0.0385  -0.0429 0.0121  243 SER A O   
1964 C  CB  A SER A 243 ? 0.1061 0.1921 0.1862 0.0148  -0.0248 0.0023  243 SER A CB  
1965 C  CB  B SER A 243 ? 0.1049 0.1606 0.1441 0.0097  -0.0336 0.0037  243 SER A CB  
1966 O  OG  A SER A 243 ? 0.1846 0.2830 0.2934 0.0474  -0.0306 -0.0144 243 SER A OG  
1967 O  OG  B SER A 243 ? 0.1033 0.1234 0.1206 -0.0028 -0.0857 -0.0027 243 SER A OG  
1968 N  N   . GLY A 244 ? 0.1280 0.1568 0.1287 0.0105  -0.0249 0.0245  244 GLY A N   
1969 C  CA  . GLY A 244 ? 0.1044 0.1713 0.1498 0.0097  -0.0307 0.0109  244 GLY A CA  
1970 C  C   . GLY A 244 ? 0.1219 0.1490 0.1241 0.0085  -0.0221 0.0019  244 GLY A C   
1971 O  O   . GLY A 244 ? 0.1348 0.1828 0.1915 -0.0083 0.0005  -0.0439 244 GLY A O   
1972 N  N   . LEU A 245 ? 0.1127 0.1252 0.1397 0.0041  -0.0332 -0.0141 245 LEU A N   
1973 C  CA  . LEU A 245 ? 0.1056 0.1158 0.1308 0.0003  -0.0336 -0.0149 245 LEU A CA  
1974 C  C   . LEU A 245 ? 0.1067 0.1123 0.1252 0.0040  -0.0408 0.0009  245 LEU A C   
1975 O  O   . LEU A 245 ? 0.1057 0.1098 0.1267 0.0078  -0.0408 -0.0018 245 LEU A O   
1976 C  CB  . LEU A 245 ? 0.0959 0.1196 0.1341 0.0270  -0.0502 0.0100  245 LEU A CB  
1977 C  CG  . LEU A 245 ? 0.1254 0.1093 0.1356 0.0176  -0.0530 0.0050  245 LEU A CG  
1978 C  CD1 . LEU A 245 ? 0.1708 0.1658 0.1325 0.0323  -0.0126 0.0454  245 LEU A CD1 
1979 C  CD2 . LEU A 245 ? 0.2398 0.1273 0.2145 0.0318  -0.0530 0.0051  245 LEU A CD2 
1980 N  N   . PRO A 246 ? 0.0936 0.0932 0.1241 0.0064  -0.0324 -0.0009 246 PRO A N   
1981 C  CA  . PRO A 246 ? 0.0968 0.0915 0.1014 0.0287  -0.0249 -0.0004 246 PRO A CA  
1982 C  C   . PRO A 246 ? 0.0763 0.1026 0.1040 0.0146  -0.0328 -0.0017 246 PRO A C   
1983 O  O   . PRO A 246 ? 0.0975 0.0930 0.1057 0.0005  -0.0176 0.0048  246 PRO A O   
1984 C  CB  . PRO A 246 ? 0.1075 0.0832 0.1177 0.0031  -0.0328 -0.0070 246 PRO A CB  
1985 C  CG  . PRO A 246 ? 0.1585 0.1100 0.2296 -0.0084 -0.0868 0.0174  246 PRO A CG  
1986 C  CD  . PRO A 246 ? 0.1018 0.0989 0.1443 0.0076  -0.0290 0.0104  246 PRO A CD  
1987 N  N   . ALA A 247 ? 0.0951 0.0946 0.0865 0.0084  -0.0301 0.0058  247 ALA A N   
1988 C  CA  . ALA A 247 ? 0.0803 0.0919 0.0890 0.0068  -0.0292 -0.0072 247 ALA A CA  
1989 C  C   . ALA A 247 ? 0.0929 0.0802 0.0925 0.0015  -0.0287 0.0091  247 ALA A C   
1990 O  O   . ALA A 247 ? 0.0871 0.0725 0.0910 0.0005  -0.0338 0.0020  247 ALA A O   
1991 C  CB  . ALA A 247 ? 0.0885 0.0963 0.1112 -0.0145 -0.0357 0.0137  247 ALA A CB  
1992 N  N   . VAL A 248 ? 0.0761 0.0959 0.0830 0.0028  -0.0287 -0.0083 248 VAL A N   
1993 C  CA  . VAL A 248 ? 0.0876 0.0852 0.0747 0.0016  -0.0199 0.0127  248 VAL A CA  
1994 C  C   . VAL A 248 ? 0.0754 0.0848 0.0851 -0.0076 -0.0096 -0.0033 248 VAL A C   
1995 O  O   . VAL A 248 ? 0.0797 0.0757 0.0849 -0.0048 -0.0259 -0.0045 248 VAL A O   
1996 C  CB  . VAL A 248 ? 0.0790 0.1067 0.0817 -0.0101 -0.0214 -0.0051 248 VAL A CB  
1997 C  CG1 . VAL A 248 ? 0.1073 0.1431 0.1007 0.0068  -0.0234 -0.0246 248 VAL A CG1 
1998 C  CG2 . VAL A 248 ? 0.1513 0.1315 0.0737 -0.0033 -0.0506 -0.0037 248 VAL A CG2 
1999 N  N   . GLY A 249 ? 0.0675 0.0812 0.0736 -0.0124 -0.0262 0.0044  249 GLY A N   
2000 C  CA  . GLY A 249 ? 0.0731 0.0755 0.0671 -0.0081 -0.0246 0.0013  249 GLY A CA  
2001 C  C   . GLY A 249 ? 0.0725 0.0732 0.0822 -0.0067 -0.0146 0.0136  249 GLY A C   
2002 O  O   . GLY A 249 ? 0.0757 0.0761 0.0848 -0.0006 -0.0308 0.0031  249 GLY A O   
2003 N  N   . GLU A 250 ? 0.0629 0.0830 0.0890 0.0006  -0.0300 -0.0104 250 GLU A N   
2004 C  CA  . GLU A 250 ? 0.0727 0.0690 0.0778 0.0112  -0.0136 0.0105  250 GLU A CA  
2005 C  C   . GLU A 250 ? 0.0757 0.0809 0.0714 0.0040  -0.0218 -0.0063 250 GLU A C   
2006 O  O   . GLU A 250 ? 0.0869 0.0876 0.0758 -0.0027 -0.0172 -0.0061 250 GLU A O   
2007 C  CB  . GLU A 250 ? 0.0794 0.0796 0.0884 0.0025  -0.0229 -0.0213 250 GLU A CB  
2008 C  CG  . GLU A 250 ? 0.0643 0.0899 0.0821 -0.0015 -0.0361 -0.0023 250 GLU A CG  
2009 C  CD  . GLU A 250 ? 0.0927 0.0828 0.0774 0.0011  -0.0252 0.0002  250 GLU A CD  
2010 O  OE1 . GLU A 250 ? 0.0823 0.1054 0.0970 0.0051  -0.0236 -0.0043 250 GLU A OE1 
2011 O  OE2 . GLU A 250 ? 0.0871 0.1040 0.0978 0.0101  -0.0180 -0.0066 250 GLU A OE2 
2012 N  N   . VAL A 251 ? 0.0769 0.0835 0.0769 -0.0064 -0.0205 0.0109  251 VAL A N   
2013 C  CA  . VAL A 251 ? 0.0831 0.0670 0.0627 0.0055  -0.0092 -0.0028 251 VAL A CA  
2014 C  C   . VAL A 251 ? 0.0775 0.0765 0.0758 -0.0015 -0.0215 -0.0115 251 VAL A C   
2015 O  O   . VAL A 251 ? 0.0813 0.0818 0.0910 -0.0048 -0.0238 -0.0100 251 VAL A O   
2016 C  CB  . VAL A 251 ? 0.0721 0.0711 0.0690 0.0048  -0.0092 -0.0004 251 VAL A CB  
2017 C  CG1 . VAL A 251 ? 0.0786 0.1227 0.0946 -0.0115 -0.0072 0.0068  251 VAL A CG1 
2018 C  CG2 . VAL A 251 ? 0.0927 0.0909 0.1269 0.0189  -0.0257 0.0247  251 VAL A CG2 
2019 N  N   . LEU A 252 ? 0.0701 0.0649 0.0813 0.0039  -0.0178 -0.0072 252 LEU A N   
2020 C  CA  . LEU A 252 ? 0.0714 0.0727 0.0754 0.0025  -0.0158 -0.0026 252 LEU A CA  
2021 C  C   . LEU A 252 ? 0.0778 0.0649 0.0733 0.0005  -0.0145 0.0052  252 LEU A C   
2022 O  O   . LEU A 252 ? 0.0711 0.0797 0.0756 0.0023  -0.0207 -0.0081 252 LEU A O   
2023 C  CB  . LEU A 252 ? 0.0837 0.0835 0.0823 0.0042  -0.0210 0.0033  252 LEU A CB  
2024 C  CG  . LEU A 252 ? 0.0796 0.0942 0.0761 0.0100  -0.0233 0.0087  252 LEU A CG  
2025 C  CD1 . LEU A 252 ? 0.1260 0.0899 0.1009 -0.0030 -0.0228 -0.0382 252 LEU A CD1 
2026 C  CD2 . LEU A 252 ? 0.1041 0.1004 0.0991 -0.0179 0.0089  -0.0007 252 LEU A CD2 
2027 N  N   . GLU A 253 ? 0.0743 0.0731 0.0604 -0.0045 -0.0108 -0.0042 253 GLU A N   
2028 C  CA  . GLU A 253 ? 0.0605 0.0763 0.0740 0.0087  -0.0157 -0.0066 253 GLU A CA  
2029 C  C   . GLU A 253 ? 0.0642 0.0697 0.0805 -0.0008 -0.0204 -0.0078 253 GLU A C   
2030 O  O   . GLU A 253 ? 0.0794 0.0704 0.0814 0.0076  -0.0249 0.0028  253 GLU A O   
2031 C  CB  . GLU A 253 ? 0.0684 0.0653 0.0649 -0.0020 -0.0084 -0.0159 253 GLU A CB  
2032 C  CG  . GLU A 253 ? 0.0731 0.0862 0.0737 0.0033  -0.0003 -0.0066 253 GLU A CG  
2033 C  CD  . GLU A 253 ? 0.0680 0.1061 0.0811 0.0000  -0.0059 -0.0021 253 GLU A CD  
2034 O  OE1 . GLU A 253 ? 0.1019 0.0834 0.1091 0.0063  -0.0297 -0.0009 253 GLU A OE1 
2035 O  OE2 . GLU A 253 ? 0.0947 0.1369 0.0885 0.0158  0.0035  0.0227  253 GLU A OE2 
2036 N  N   . ALA A 254 ? 0.0747 0.0597 0.0851 0.0037  -0.0279 -0.0048 254 ALA A N   
2037 C  CA  . ALA A 254 ? 0.0736 0.0764 0.0667 0.0060  -0.0225 -0.0099 254 ALA A CA  
2038 C  C   . ALA A 254 ? 0.0819 0.0849 0.0861 0.0053  -0.0265 -0.0071 254 ALA A C   
2039 O  O   . ALA A 254 ? 0.0793 0.0854 0.1005 0.0088  -0.0212 -0.0103 254 ALA A O   
2040 C  CB  . ALA A 254 ? 0.0989 0.0549 0.1074 0.0237  -0.0343 0.0216  254 ALA A CB  
2041 N  N   . PHE A 255 ? 0.0663 0.0705 0.0811 0.0031  -0.0080 -0.0069 255 PHE A N   
2042 C  CA  . PHE A 255 ? 0.0810 0.0647 0.0772 -0.0013 -0.0100 -0.0021 255 PHE A CA  
2043 C  C   . PHE A 255 ? 0.0626 0.0807 0.0903 0.0065  -0.0063 0.0061  255 PHE A C   
2044 O  O   . PHE A 255 ? 0.0758 0.0827 0.1123 -0.0043 -0.0074 0.0045  255 PHE A O   
2045 C  CB  . PHE A 255 ? 0.0783 0.0829 0.0727 -0.0164 -0.0016 -0.0034 255 PHE A CB  
2046 C  CG  . PHE A 255 ? 0.0839 0.0737 0.0600 0.0001  -0.0090 0.0026  255 PHE A CG  
2047 C  CD1 . PHE A 255 ? 0.0855 0.0913 0.0735 0.0004  -0.0085 0.0002  255 PHE A CD1 
2048 C  CD2 . PHE A 255 ? 0.1034 0.1133 0.0852 0.0001  -0.0212 -0.0009 255 PHE A CD2 
2049 C  CE1 . PHE A 255 ? 0.1079 0.0794 0.1052 -0.0082 -0.0010 0.0088  255 PHE A CE1 
2050 C  CE2 . PHE A 255 ? 0.1090 0.1173 0.0742 0.0244  -0.0239 0.0124  255 PHE A CE2 
2051 C  CZ  . PHE A 255 ? 0.1233 0.0799 0.0976 0.0193  -0.0019 0.0249  255 PHE A CZ  
2052 N  N   . ALA A 256 ? 0.0634 0.0663 0.0785 0.0014  -0.0113 -0.0018 256 ALA A N   
2053 C  CA  . ALA A 256 ? 0.0825 0.0600 0.0649 0.0014  -0.0120 -0.0027 256 ALA A CA  
2054 C  C   . ALA A 256 ? 0.0807 0.0753 0.0764 0.0125  -0.0021 -0.0047 256 ALA A C   
2055 O  O   . ALA A 256 ? 0.1426 0.0888 0.0918 0.0305  -0.0310 -0.0106 256 ALA A O   
2056 C  CB  . ALA A 256 ? 0.0936 0.0589 0.1522 -0.0196 -0.0184 0.0167  256 ALA A CB  
2057 N  N   . HIS A 257 ? 0.0772 0.0827 0.0946 0.0028  -0.0303 -0.0115 257 HIS A N   
2058 C  CA  . HIS A 257 ? 0.0752 0.0657 0.0954 0.0000  -0.0275 0.0090  257 HIS A CA  
2059 C  C   . HIS A 257 ? 0.0717 0.0599 0.0709 -0.0044 -0.0249 0.0070  257 HIS A C   
2060 O  O   . HIS A 257 ? 0.0914 0.0780 0.0915 0.0008  -0.0334 0.0069  257 HIS A O   
2061 C  CB  . HIS A 257 ? 0.1014 0.0984 0.1070 -0.0046 -0.0173 -0.0133 257 HIS A CB  
2062 C  CG  . HIS A 257 ? 0.1210 0.1311 0.0928 0.0004  0.0261  0.0055  257 HIS A CG  
2063 N  ND1 . HIS A 257 ? 0.1544 0.2045 0.0901 -0.0474 -0.0203 -0.0055 257 HIS A ND1 
2064 C  CD2 . HIS A 257 ? 0.1601 0.2169 0.1765 0.0151  0.0728  -0.0205 257 HIS A CD2 
2065 C  CE1 . HIS A 257 ? 0.1770 0.2871 0.0924 -0.0786 -0.0044 -0.0417 257 HIS A CE1 
2066 N  NE2 . HIS A 257 ? 0.0957 0.2826 0.1242 0.0055  -0.0099 -0.0130 257 HIS A NE2 
2067 N  N   . PRO A 258 ? 0.0697 0.0646 0.0630 -0.0017 -0.0126 0.0064  258 PRO A N   
2068 C  CA  . PRO A 258 ? 0.0756 0.0602 0.0645 0.0027  -0.0128 0.0065  258 PRO A CA  
2069 C  C   . PRO A 258 ? 0.0677 0.0676 0.0809 0.0012  -0.0148 0.0001  258 PRO A C   
2070 O  O   . PRO A 258 ? 0.0782 0.0685 0.0784 0.0005  -0.0115 -0.0008 258 PRO A O   
2071 C  CB  . PRO A 258 ? 0.0783 0.0912 0.0704 -0.0019 -0.0176 -0.0155 258 PRO A CB  
2072 C  CG  . PRO A 258 ? 0.0936 0.0784 0.0757 0.0115  -0.0101 -0.0029 258 PRO A CG  
2073 C  CD  . PRO A 258 ? 0.0891 0.0593 0.0629 0.0027  -0.0184 0.0074  258 PRO A CD  
2074 N  N   . HIS A 259 ? 0.0715 0.0694 0.0678 0.0133  -0.0213 0.0030  259 HIS A N   
2075 C  CA  . HIS A 259 ? 0.0779 0.0608 0.0723 0.0016  -0.0107 -0.0037 259 HIS A CA  
2076 C  C   . HIS A 259 ? 0.0780 0.0530 0.0716 0.0078  -0.0051 0.0094  259 HIS A C   
2077 O  O   . HIS A 259 ? 0.0725 0.0731 0.0721 0.0042  -0.0115 0.0073  259 HIS A O   
2078 C  CB  . HIS A 259 ? 0.0763 0.0634 0.0909 0.0004  -0.0130 0.0123  259 HIS A CB  
2079 C  CG  . HIS A 259 ? 0.0771 0.0795 0.0760 0.0028  -0.0120 -0.0057 259 HIS A CG  
2080 N  ND1 . HIS A 259 ? 0.0747 0.0972 0.0963 0.0229  -0.0167 0.0011  259 HIS A ND1 
2081 C  CD2 . HIS A 259 ? 0.0912 0.0616 0.1149 -0.0004 -0.0254 0.0047  259 HIS A CD2 
2082 C  CE1 . HIS A 259 ? 0.0773 0.1290 0.0729 0.0016  -0.0355 0.0178  259 HIS A CE1 
2083 N  NE2 . HIS A 259 ? 0.0874 0.1166 0.1070 -0.0064 -0.0311 0.0244  259 HIS A NE2 
2084 N  N   . LEU A 260 ? 0.0777 0.0580 0.0524 -0.0053 -0.0098 0.0021  260 LEU A N   
2085 C  CA  . LEU A 260 ? 0.0743 0.0552 0.0764 0.0092  -0.0124 0.0137  260 LEU A CA  
2086 C  C   . LEU A 260 ? 0.0714 0.0653 0.0714 -0.0006 -0.0154 -0.0008 260 LEU A C   
2087 O  O   . LEU A 260 ? 0.0852 0.0668 0.0752 0.0063  -0.0035 0.0013  260 LEU A O   
2088 C  CB  . LEU A 260 ? 0.0879 0.0546 0.0849 0.0000  -0.0317 0.0071  260 LEU A CB  
2089 C  CG  . LEU A 260 ? 0.0838 0.0471 0.0603 0.0022  -0.0211 0.0143  260 LEU A CG  
2090 C  CD1 . LEU A 260 ? 0.1295 0.1142 0.0492 0.0177  -0.0342 0.0026  260 LEU A CD1 
2091 C  CD2 . LEU A 260 ? 0.0909 0.0752 0.0925 0.0241  0.0026  0.0025  260 LEU A CD2 
2092 N  N   . VAL A 261 ? 0.0616 0.0588 0.0795 0.0084  -0.0055 0.0063  261 VAL A N   
2093 C  CA  . VAL A 261 ? 0.0605 0.0615 0.0648 0.0079  -0.0257 0.0203  261 VAL A CA  
2094 C  C   . VAL A 261 ? 0.0752 0.0614 0.0920 0.0038  -0.0205 0.0080  261 VAL A C   
2095 O  O   . VAL A 261 ? 0.0769 0.0675 0.1074 -0.0070 -0.0230 0.0117  261 VAL A O   
2096 C  CB  . VAL A 261 ? 0.0766 0.0553 0.0674 0.0084  -0.0194 0.0243  261 VAL A CB  
2097 C  CG1 . VAL A 261 ? 0.0717 0.0787 0.1089 -0.0274 -0.0240 0.0189  261 VAL A CG1 
2098 C  CG2 . VAL A 261 ? 0.0893 0.0776 0.0820 0.0111  -0.0118 0.0037  261 VAL A CG2 
2099 N  N   . HIS A 262 ? 0.0698 0.0700 0.1126 0.0056  -0.0215 0.0163  262 HIS A N   
2100 C  CA  . HIS A 262 ? 0.0690 0.0657 0.0943 0.0035  -0.0129 0.0082  262 HIS A CA  
2101 C  C   . HIS A 262 ? 0.0839 0.0799 0.0725 0.0038  -0.0226 0.0131  262 HIS A C   
2102 O  O   . HIS A 262 ? 0.1093 0.1583 0.0948 0.0250  -0.0261 0.0103  262 HIS A O   
2103 C  CB  . HIS A 262 ? 0.0918 0.0750 0.1199 0.0094  -0.0143 -0.0086 262 HIS A CB  
2104 C  CG  . HIS A 262 ? 0.1305 0.1020 0.1498 -0.0033 0.0004  -0.0080 262 HIS A CG  
2105 N  ND1 . HIS A 262 ? 0.1909 0.2114 0.1671 -0.0025 0.0199  -0.0319 262 HIS A ND1 
2106 C  CD2 . HIS A 262 ? 0.3073 0.1274 0.1650 0.0732  0.0669  -0.0182 262 HIS A CD2 
2107 C  CE1 . HIS A 262 ? 0.2327 0.1636 0.1010 0.0391  0.0042  0.0058  262 HIS A CE1 
2108 N  NE2 . HIS A 262 ? 0.3843 0.2700 0.2344 0.0192  0.0675  -0.0739 262 HIS A NE2 
2109 N  N   . GLY A 263 ? 0.0842 0.0862 0.0711 0.0005  -0.0069 0.0130  263 GLY A N   
2110 C  CA  . GLY A 263 ? 0.0990 0.0655 0.1003 0.0128  -0.0176 0.0248  263 GLY A CA  
2111 C  C   . GLY A 263 ? 0.0935 0.0742 0.0906 0.0027  -0.0074 0.0163  263 GLY A C   
2112 O  O   . GLY A 263 ? 0.1002 0.0839 0.1155 0.0128  -0.0221 -0.0041 263 GLY A O   
2113 N  N   . TRP A 264 ? 0.0832 0.0802 0.0789 -0.0037 -0.0172 0.0158  264 TRP A N   
2114 C  CA  . TRP A 264 ? 0.0820 0.0915 0.0778 0.0062  -0.0092 0.0068  264 TRP A CA  
2115 C  C   . TRP A 264 ? 0.0956 0.0897 0.0814 0.0132  0.0102  0.0144  264 TRP A C   
2116 O  O   . TRP A 264 ? 0.1004 0.0929 0.0966 0.0000  -0.0057 0.0321  264 TRP A O   
2117 C  CB  . TRP A 264 ? 0.0826 0.0809 0.0610 -0.0056 -0.0181 -0.0019 264 TRP A CB  
2118 C  CG  . TRP A 264 ? 0.0692 0.0672 0.0761 -0.0081 -0.0076 0.0034  264 TRP A CG  
2119 C  CD1 . TRP A 264 ? 0.0815 0.0757 0.0752 0.0086  -0.0063 0.0152  264 TRP A CD1 
2120 C  CD2 . TRP A 264 ? 0.0658 0.0701 0.0651 -0.0104 -0.0128 0.0073  264 TRP A CD2 
2121 N  NE1 . TRP A 264 ? 0.0773 0.0725 0.0612 0.0029  -0.0142 -0.0032 264 TRP A NE1 
2122 C  CE2 . TRP A 264 ? 0.0645 0.0728 0.0581 -0.0018 -0.0075 0.0014  264 TRP A CE2 
2123 C  CE3 . TRP A 264 ? 0.0615 0.0787 0.0751 -0.0077 -0.0034 -0.0007 264 TRP A CE3 
2124 C  CZ2 . TRP A 264 ? 0.0840 0.0678 0.0787 -0.0003 -0.0195 0.0041  264 TRP A CZ2 
2125 C  CZ3 . TRP A 264 ? 0.0730 0.0779 0.0629 0.0035  -0.0037 0.0033  264 TRP A CZ3 
2126 C  CH2 . TRP A 264 ? 0.0703 0.0767 0.0668 -0.0097 -0.0182 0.0046  264 TRP A CH2 
2127 N  N   . MET A 265 ? 0.0742 0.0907 0.0851 -0.0009 -0.0119 0.0220  265 MET A N   
2128 C  CA  . MET A 265 ? 0.0866 0.0762 0.0783 -0.0053 -0.0036 0.0094  265 MET A CA  
2129 C  C   . MET A 265 ? 0.0917 0.0971 0.0713 0.0015  -0.0135 0.0173  265 MET A C   
2130 O  O   . MET A 265 ? 0.0934 0.0848 0.0807 0.0045  -0.0013 0.0293  265 MET A O   
2131 C  CB  . MET A 265 ? 0.0835 0.0897 0.0822 0.0035  -0.0183 0.0259  265 MET A CB  
2132 C  CG  . MET A 265 ? 0.1004 0.0805 0.0971 0.0101  -0.0425 0.0169  265 MET A CG  
2133 S  SD  . MET A 265 ? 0.1018 0.0851 0.1086 0.0017  -0.0068 0.0271  265 MET A SD  
2134 C  CE  . MET A 265 ? 0.1356 0.0737 0.1198 0.0075  -0.0126 0.0262  265 MET A CE  
2135 N  N   . ARG A 266 ? 0.1012 0.0813 0.0788 0.0042  -0.0009 0.0245  266 ARG A N   
2136 C  CA  . ARG A 266 ? 0.1094 0.0835 0.0917 -0.0164 -0.0053 0.0336  266 ARG A CA  
2137 C  C   . ARG A 266 ? 0.1172 0.0924 0.0787 0.0009  -0.0058 0.0333  266 ARG A C   
2138 O  O   . ARG A 266 ? 0.1283 0.0890 0.1187 -0.0008 -0.0060 0.0147  266 ARG A O   
2139 C  CB  . ARG A 266 ? 0.1136 0.0727 0.1060 -0.0056 0.0031  0.0282  266 ARG A CB  
2140 C  CG  . ARG A 266 ? 0.0968 0.0848 0.1014 -0.0087 -0.0119 0.0306  266 ARG A CG  
2141 C  CD  . ARG A 266 ? 0.1105 0.0741 0.1220 -0.0103 0.0025  0.0343  266 ARG A CD  
2142 N  NE  . ARG A 266 ? 0.0952 0.1034 0.1112 0.0099  0.0021  0.0329  266 ARG A NE  
2143 C  CZ  . ARG A 266 ? 0.1031 0.0890 0.1300 0.0013  -0.0018 0.0233  266 ARG A CZ  
2144 N  NH1 . ARG A 266 ? 0.1161 0.0991 0.1373 -0.0004 -0.0001 0.0436  266 ARG A NH1 
2145 N  NH2 . ARG A 266 ? 0.1179 0.0839 0.1388 -0.0109 0.0151  0.0373  266 ARG A NH2 
2146 N  N   . GLY A 267 ? 0.1065 0.0797 0.0960 -0.0057 -0.0075 0.0252  267 GLY A N   
2147 C  CA  . GLY A 267 ? 0.1157 0.0945 0.0873 0.0088  -0.0097 0.0372  267 GLY A CA  
2148 C  C   . GLY A 267 ? 0.1204 0.0946 0.1040 0.0035  -0.0070 0.0284  267 GLY A C   
2149 O  O   . GLY A 267 ? 0.1684 0.1240 0.1165 0.0579  -0.0055 0.0312  267 GLY A O   
2150 N  N   . SER A 268 ? 0.1041 0.0766 0.0905 0.0159  -0.0189 0.0260  268 SER A N   
2151 C  CA  . SER A 268 ? 0.1060 0.0720 0.1033 0.0013  -0.0137 0.0222  268 SER A CA  
2152 C  C   . SER A 268 ? 0.0969 0.0704 0.0925 0.0115  -0.0207 0.0261  268 SER A C   
2153 O  O   . SER A 268 ? 0.1073 0.0867 0.0857 -0.0065 -0.0128 0.0122  268 SER A O   
2154 C  CB  . SER A 268 ? 0.1378 0.0932 0.0995 -0.0198 -0.0072 0.0147  268 SER A CB  
2155 O  OG  . SER A 268 ? 0.1617 0.0783 0.1245 -0.0282 0.0009  0.0156  268 SER A OG  
2156 N  N   . HIS A 269 ? 0.0934 0.0816 0.0766 0.0036  -0.0170 0.0156  269 HIS A N   
2157 C  CA  . HIS A 269 ? 0.0822 0.0714 0.0829 -0.0050 -0.0190 0.0251  269 HIS A CA  
2158 C  C   . HIS A 269 ? 0.0878 0.0943 0.0843 -0.0159 -0.0224 0.0183  269 HIS A C   
2159 O  O   . HIS A 269 ? 0.1096 0.1973 0.1447 -0.0365 -0.0323 0.0871  269 HIS A O   
2160 C  CB  . HIS A 269 ? 0.0894 0.0669 0.0915 -0.0109 -0.0214 0.0108  269 HIS A CB  
2161 C  CG  . HIS A 269 ? 0.0774 0.0852 0.1084 0.0155  -0.0125 0.0118  269 HIS A CG  
2162 N  ND1 . HIS A 269 ? 0.0889 0.0821 0.1146 -0.0010 0.0072  0.0262  269 HIS A ND1 
2163 C  CD2 . HIS A 269 ? 0.0955 0.0796 0.1042 -0.0071 -0.0161 0.0267  269 HIS A CD2 
2164 C  CE1 . HIS A 269 ? 0.1132 0.0887 0.1070 0.0031  0.0117  0.0374  269 HIS A CE1 
2165 N  NE2 . HIS A 269 ? 0.0944 0.1001 0.1176 -0.0025 -0.0076 0.0248  269 HIS A NE2 
2166 N  N   . ALA A 270 ? 0.0800 0.0752 0.0904 -0.0133 -0.0311 0.0283  270 ALA A N   
2167 C  CA  . ALA A 270 ? 0.0722 0.0700 0.1137 -0.0194 -0.0250 0.0219  270 ALA A CA  
2168 C  C   . ALA A 270 ? 0.0624 0.0684 0.0830 -0.0061 -0.0241 0.0124  270 ALA A C   
2169 O  O   . ALA A 270 ? 0.0724 0.0719 0.0882 0.0005  -0.0304 0.0080  270 ALA A O   
2170 C  CB  . ALA A 270 ? 0.0926 0.1072 0.1262 -0.0178 0.0137  -0.0181 270 ALA A CB  
2171 N  N   . GLY A 271 ? 0.0669 0.0621 0.0829 -0.0051 -0.0313 0.0095  271 GLY A N   
2172 C  CA  . GLY A 271 ? 0.0814 0.0591 0.0899 -0.0039 -0.0234 0.0071  271 GLY A CA  
2173 C  C   . GLY A 271 ? 0.0686 0.0469 0.0710 -0.0012 -0.0180 0.0053  271 GLY A C   
2174 O  O   . GLY A 271 ? 0.0666 0.0642 0.0854 0.0103  -0.0119 0.0083  271 GLY A O   
2175 N  N   . PRO A 272 ? 0.0588 0.0541 0.0789 -0.0040 -0.0219 0.0036  272 PRO A N   
2176 C  CA  . PRO A 272 ? 0.0557 0.0520 0.0644 -0.0070 -0.0064 0.0099  272 PRO A CA  
2177 C  C   . PRO A 272 ? 0.0732 0.0535 0.0606 0.0000  0.0005  -0.0009 272 PRO A C   
2178 O  O   . PRO A 272 ? 0.0767 0.0985 0.0656 0.0078  -0.0085 -0.0042 272 PRO A O   
2179 C  CB  . PRO A 272 ? 0.0795 0.0675 0.0686 0.0098  -0.0077 0.0062  272 PRO A CB  
2180 C  CG  . PRO A 272 ? 0.0783 0.0589 0.0828 0.0147  -0.0153 0.0018  272 PRO A CG  
2181 C  CD  . PRO A 272 ? 0.0767 0.0780 0.0719 -0.0010 -0.0145 0.0079  272 PRO A CD  
2182 N  N   . LEU A 273 ? 0.0665 0.0655 0.0628 0.0004  -0.0097 0.0096  273 LEU A N   
2183 C  CA  . LEU A 273 ? 0.0741 0.0689 0.0641 -0.0118 -0.0049 0.0012  273 LEU A CA  
2184 C  C   . LEU A 273 ? 0.0708 0.0700 0.0677 -0.0111 -0.0193 0.0062  273 LEU A C   
2185 O  O   . LEU A 273 ? 0.0793 0.0851 0.0901 -0.0060 -0.0013 -0.0019 273 LEU A O   
2186 C  CB  . LEU A 273 ? 0.0886 0.0695 0.0626 -0.0124 -0.0109 -0.0056 273 LEU A CB  
2187 C  CG  . LEU A 273 ? 0.0863 0.0761 0.0649 0.0004  -0.0305 -0.0048 273 LEU A CG  
2188 C  CD1 . LEU A 273 ? 0.1083 0.1199 0.0813 -0.0124 -0.0186 0.0260  273 LEU A CD1 
2189 C  CD2 . LEU A 273 ? 0.0734 0.1043 0.1060 0.0170  -0.0217 -0.0069 273 LEU A CD2 
2190 N  N   . MET A 274 ? 0.0692 0.0585 0.0701 -0.0058 -0.0132 0.0061  274 MET A N   
2191 C  CA  . MET A 274 ? 0.0724 0.0754 0.0563 -0.0065 -0.0071 0.0116  274 MET A CA  
2192 C  C   . MET A 274 ? 0.0676 0.0821 0.0612 0.0141  0.0011  0.0093  274 MET A C   
2193 O  O   . MET A 274 ? 0.0960 0.0962 0.0764 -0.0147 -0.0176 0.0175  274 MET A O   
2194 C  CB  . MET A 274 ? 0.1018 0.0629 0.0759 -0.0141 0.0043  0.0185  274 MET A CB  
2195 C  CG  . MET A 274 ? 0.1096 0.1063 0.1144 0.0184  -0.0143 0.0125  274 MET A CG  
2196 S  SD  . MET A 274 ? 0.1405 0.1270 0.1405 0.0225  0.0112  0.0120  274 MET A SD  
2197 C  CE  . MET A 274 ? 0.0982 0.1644 0.1495 0.0258  -0.0094 0.0049  274 MET A CE  
2198 N  N   . PRO A 275 ? 0.0593 0.0762 0.0576 -0.0141 -0.0151 0.0184  275 PRO A N   
2199 C  CA  . PRO A 275 ? 0.0845 0.0691 0.0530 0.0046  -0.0163 0.0132  275 PRO A CA  
2200 C  C   . PRO A 275 ? 0.1103 0.0634 0.0757 0.0011  -0.0156 0.0112  275 PRO A C   
2201 O  O   . PRO A 275 ? 0.1583 0.0811 0.0859 0.0162  0.0003  0.0181  275 PRO A O   
2202 C  CB  . PRO A 275 ? 0.0797 0.1089 0.0753 0.0023  -0.0304 0.0168  275 PRO A CB  
2203 C  CG  . PRO A 275 ? 0.0966 0.1509 0.0991 -0.0223 -0.0170 0.0034  275 PRO A CG  
2204 C  CD  . PRO A 275 ? 0.0654 0.0963 0.0727 -0.0062 -0.0133 0.0103  275 PRO A CD  
2205 N  N   . ALA A 276 ? 0.0874 0.0865 0.0691 0.0072  -0.0067 0.0164  276 ALA A N   
2206 C  CA  . ALA A 276 ? 0.0944 0.1012 0.0706 0.0005  -0.0076 -0.0002 276 ALA A CA  
2207 C  C   . ALA A 276 ? 0.1245 0.1155 0.0900 0.0078  -0.0066 0.0056  276 ALA A C   
2208 O  O   . ALA A 276 ? 0.1406 0.1120 0.1065 0.0250  -0.0401 -0.0028 276 ALA A O   
2209 C  CB  . ALA A 276 ? 0.1077 0.1321 0.1257 -0.0165 -0.0062 0.0177  276 ALA A CB  
2210 N  N   . ARG A 277 ? 0.1230 0.0961 0.0873 0.0256  -0.0240 0.0044  277 ARG A N   
2211 C  CA  . ARG A 277 ? 0.1353 0.0936 0.0804 0.0298  -0.0364 -0.0063 277 ARG A CA  
2212 C  C   . ARG A 277 ? 0.1262 0.1131 0.0980 0.0113  -0.0208 -0.0005 277 ARG A C   
2213 O  O   . ARG A 277 ? 0.1277 0.1251 0.1113 0.0110  -0.0231 0.0076  277 ARG A O   
2214 C  CB  . ARG A 277 ? 0.1703 0.1085 0.0858 0.0269  -0.0247 0.0002  277 ARG A CB  
2215 C  CG  . ARG A 277 ? 0.2370 0.1223 0.1205 0.0564  0.0226  -0.0151 277 ARG A CG  
2216 C  CD  . ARG A 277 ? 0.2601 0.1664 0.1676 0.0080  0.0031  -0.0188 277 ARG A CD  
2217 N  NE  . ARG A 277 ? 0.2823 0.1853 0.2094 0.0433  -0.0170 -0.0156 277 ARG A NE  
2218 C  CZ  . ARG A 277 ? 0.2096 0.1836 0.2149 0.0015  0.0018  -0.0682 277 ARG A CZ  
2219 N  NH1 . ARG A 277 ? 0.2383 0.1763 0.2381 0.0055  -0.0089 -0.0166 277 ARG A NH1 
2220 N  NH2 . ARG A 277 ? 0.2895 0.2296 0.1710 -0.0569 -0.0120 -0.0021 277 ARG A NH2 
2221 N  N   . PHE A 278 ? 0.0924 0.1132 0.0873 0.0156  -0.0203 0.0049  278 PHE A N   
2222 C  CA  . PHE A 278 ? 0.0981 0.1024 0.1029 0.0087  -0.0041 0.0106  278 PHE A CA  
2223 C  C   . PHE A 278 ? 0.1191 0.1192 0.1009 0.0054  -0.0111 0.0046  278 PHE A C   
2224 O  O   . PHE A 278 ? 0.1768 0.1218 0.1457 0.0109  0.0412  0.0006  278 PHE A O   
2225 C  CB  . PHE A 278 ? 0.1130 0.1157 0.0896 0.0182  -0.0184 0.0071  278 PHE A CB  
2226 C  CG  . PHE A 278 ? 0.0908 0.1058 0.0676 0.0166  -0.0335 0.0076  278 PHE A CG  
2227 C  CD1 . PHE A 278 ? 0.0992 0.1119 0.0992 0.0092  -0.0090 0.0245  278 PHE A CD1 
2228 C  CD2 . PHE A 278 ? 0.0869 0.1142 0.0872 0.0092  -0.0083 0.0198  278 PHE A CD2 
2229 C  CE1 . PHE A 278 ? 0.1100 0.1282 0.0951 0.0230  -0.0182 0.0226  278 PHE A CE1 
2230 C  CE2 . PHE A 278 ? 0.0964 0.1197 0.0848 0.0126  -0.0210 0.0295  278 PHE A CE2 
2231 C  CZ  . PHE A 278 ? 0.0970 0.1044 0.0901 0.0270  -0.0103 0.0068  278 PHE A CZ  
2232 N  N   . ILE A 279 ? 0.1135 0.1013 0.1030 -0.0024 0.0012  0.0058  279 ILE A N   
2233 C  CA  . ILE A 279 ? 0.1388 0.1048 0.1049 0.0244  -0.0096 0.0226  279 ILE A CA  
2234 C  C   . ILE A 279 ? 0.1278 0.1247 0.1246 0.0195  -0.0127 0.0080  279 ILE A C   
2235 O  O   . ILE A 279 ? 0.1754 0.1469 0.1356 0.0305  -0.0123 0.0009  279 ILE A O   
2236 C  CB  . ILE A 279 ? 0.1472 0.1198 0.1294 0.0272  -0.0031 0.0267  279 ILE A CB  
2237 C  CG1 . ILE A 279 ? 0.1274 0.1412 0.1381 0.0149  -0.0241 0.0114  279 ILE A CG1 
2238 C  CG2 . ILE A 279 ? 0.1675 0.1686 0.1877 0.0601  0.0128  -0.0296 279 ILE A CG2 
2239 C  CD1 . ILE A 279 ? 0.1590 0.1509 0.1982 0.0095  -0.0139 0.0032  279 ILE A CD1 
2240 N  N   . SER A 280 ? 0.1465 0.1209 0.1075 0.0283  -0.0224 0.0013  280 SER A N   
2241 C  CA  . SER A 280 ? 0.1664 0.1314 0.1274 0.0095  -0.0224 -0.0068 280 SER A CA  
2242 C  C   . SER A 280 ? 0.1774 0.1306 0.1203 0.0139  -0.0555 0.0174  280 SER A C   
2243 O  O   . SER A 280 ? 0.1792 0.1255 0.1278 0.0064  -0.0392 0.0174  280 SER A O   
2244 C  CB  . SER A 280 ? 0.2149 0.1771 0.1463 0.0467  -0.0326 -0.0256 280 SER A CB  
2245 O  OG  . SER A 280 ? 0.2315 0.2384 0.1515 0.0057  -0.0138 0.0027  280 SER A OG  
2246 N  N   . VAL A 281 ? 0.1932 0.1189 0.1580 0.0114  -0.0610 -0.0114 281 VAL A N   
2247 C  CA  . VAL A 281 ? 0.1998 0.1380 0.1475 0.0233  -0.0599 -0.0042 281 VAL A CA  
2248 C  C   . VAL A 281 ? 0.2584 0.1533 0.1643 0.0312  -0.0723 0.0102  281 VAL A C   
2249 O  O   . VAL A 281 ? 0.3082 0.1563 0.1788 0.0013  -0.0995 -0.0050 281 VAL A O   
2250 C  CB  . VAL A 281 ? 0.1919 0.1536 0.1900 0.0169  -0.0365 -0.0036 281 VAL A CB  
2251 C  CG1 . VAL A 281 ? 0.1829 0.1998 0.2784 0.0502  -0.0905 -0.0085 281 VAL A CG1 
2252 C  CG2 . VAL A 281 ? 0.1832 0.1952 0.1658 -0.0077 -0.0438 -0.0118 281 VAL A CG2 
2253 N  N   . ASP A 282 ? 0.2590 0.1354 0.1615 0.0083  -0.0864 -0.0103 282 ASP A N   
2254 C  CA  . ASP A 282 ? 0.2345 0.1943 0.1754 0.0166  -0.0782 -0.0409 282 ASP A CA  
2255 C  C   . ASP A 282 ? 0.2604 0.2007 0.1683 -0.0007 -0.0689 -0.0220 282 ASP A C   
2256 O  O   . ASP A 282 ? 0.2538 0.1950 0.1300 0.0005  -0.0680 0.0106  282 ASP A O   
2257 C  CB  . ASP A 282 ? 0.2542 0.2164 0.1852 0.0568  -0.0830 -0.0404 282 ASP A CB  
2258 C  CG  . ASP A 282 ? 0.2503 0.3111 0.2761 0.0787  -0.0517 -0.1047 282 ASP A CG  
2259 O  OD1 . ASP A 282 ? 0.2905 0.2799 0.2198 0.0806  -0.0699 -0.0636 282 ASP A OD1 
2260 O  OD2 . ASP A 282 ? 0.3155 0.4934 0.2543 0.1210  -0.0355 -0.1043 282 ASP A OD2 
2261 N  N   . PRO A 283 ? 0.2446 0.1710 0.2064 0.0025  -0.0642 -0.0065 283 PRO A N   
2262 C  CA  . PRO A 283 ? 0.2342 0.1702 0.2134 0.0060  -0.0701 -0.0212 283 PRO A CA  
2263 C  C   . PRO A 283 ? 0.2431 0.1974 0.2190 0.0223  -0.0658 -0.0043 283 PRO A C   
2264 O  O   . PRO A 283 ? 0.2715 0.2340 0.3056 0.0731  -0.0268 0.0727  283 PRO A O   
2265 C  CB  . PRO A 283 ? 0.2131 0.2226 0.2193 0.0141  -0.0827 0.0086  283 PRO A CB  
2266 C  CG  . PRO A 283 ? 0.3164 0.2610 0.2297 -0.0490 -0.0681 0.0132  283 PRO A CG  
2267 C  CD  . PRO A 283 ? 0.2677 0.2185 0.2655 -0.0184 -0.0777 0.0014  283 PRO A CD  
2268 N  N   . GLU A 284 ? 0.3140 0.2485 0.1649 0.0367  -0.1040 -0.0064 284 GLU A N   
2269 C  CA  . GLU A 284 ? 0.3586 0.2703 0.1884 0.0362  -0.0967 -0.0112 284 GLU A CA  
2270 C  C   . GLU A 284 ? 0.3267 0.2867 0.1683 0.0250  -0.0903 -0.0102 284 GLU A C   
2271 O  O   . GLU A 284 ? 0.3771 0.2785 0.1454 0.0329  -0.1120 -0.0165 284 GLU A O   
2272 C  CB  . GLU A 284 ? 0.4602 0.3552 0.1987 0.0385  -0.1046 -0.0335 284 GLU A CB  
2273 C  CG  . GLU A 284 ? 0.5606 0.4980 0.4093 0.0326  -0.0121 -0.0432 284 GLU A CG  
2274 C  CD  . GLU A 284 ? 0.6581 0.6927 0.5895 0.0581  -0.0510 -0.1376 284 GLU A CD  
2275 O  OE1 . GLU A 284 ? 0.7473 0.7562 0.8098 0.1181  -0.0119 -0.1591 284 GLU A OE1 
2276 O  OE2 . GLU A 284 ? 0.7959 0.7384 0.5995 0.0464  -0.0085 -0.2042 284 GLU A OE2 
2277 N  N   . ARG A 285 ? 0.2797 0.2439 0.1654 0.0416  -0.0773 -0.0409 285 ARG A N   
2278 C  CA  . ARG A 285 ? 0.2581 0.2656 0.1404 0.0376  -0.0458 -0.0342 285 ARG A CA  
2279 C  C   . ARG A 285 ? 0.2062 0.2019 0.1406 0.0206  -0.0328 -0.0222 285 ARG A C   
2280 O  O   . ARG A 285 ? 0.2320 0.2598 0.0999 0.0133  -0.0236 -0.0330 285 ARG A O   
2281 C  CB  . ARG A 285 ? 0.3178 0.3284 0.2032 0.0666  -0.0183 -0.0613 285 ARG A CB  
2282 C  CG  . ARG A 285 ? 0.4122 0.3912 0.3033 0.0851  -0.0463 -0.0668 285 ARG A CG  
2283 C  CD  . ARG A 285 ? 0.4664 0.5199 0.4593 0.0676  0.0109  -0.0584 285 ARG A CD  
2284 N  NE  . ARG A 285 ? 0.5824 0.5638 0.5621 0.0389  -0.0395 -0.0353 285 ARG A NE  
2285 C  CZ  . ARG A 285 ? 0.6232 0.6245 0.6630 0.0323  -0.0554 0.0194  285 ARG A CZ  
2286 N  NH1 . ARG A 285 ? 0.6483 0.6764 0.7178 0.0561  -0.0767 0.0255  285 ARG A NH1 
2287 N  NH2 . ARG A 285 ? 0.6915 0.6347 0.5828 0.0349  -0.0459 0.0619  285 ARG A NH2 
2288 N  N   . ARG A 286 ? 0.2026 0.1744 0.1278 -0.0002 -0.0418 0.0058  286 ARG A N   
2289 C  CA  . ARG A 286 ? 0.1800 0.1559 0.1139 0.0026  -0.0161 -0.0034 286 ARG A CA  
2290 C  C   . ARG A 286 ? 0.1724 0.1441 0.0856 0.0103  -0.0227 0.0011  286 ARG A C   
2291 O  O   . ARG A 286 ? 0.1848 0.1321 0.0883 0.0245  -0.0402 0.0100  286 ARG A O   
2292 C  CB  . ARG A 286 ? 0.1933 0.1908 0.1063 0.0095  -0.0405 0.0013  286 ARG A CB  
2293 C  CG  . ARG A 286 ? 0.2584 0.2763 0.0679 0.0716  -0.0524 -0.0350 286 ARG A CG  
2294 C  CD  . ARG A 286 ? 0.2252 0.3007 0.2582 -0.0537 -0.0934 0.0324  286 ARG A CD  
2295 N  NE  . ARG A 286 ? 0.2439 0.3831 0.2222 -0.0520 -0.1071 0.0218  286 ARG A NE  
2296 C  CZ  . ARG A 286 ? 0.2024 0.2735 0.2645 -0.0010 -0.0063 -0.0349 286 ARG A CZ  
2297 N  NH1 . ARG A 286 ? 0.2872 0.2412 0.2412 0.0080  -0.0829 0.0000  286 ARG A NH1 
2298 N  NH2 . ARG A 286 ? 0.2265 0.2059 0.4490 -0.0009 0.0847  0.0371  286 ARG A NH2 
2299 N  N   . ILE A 287 ? 0.1575 0.1310 0.1040 0.0195  -0.0212 -0.0052 287 ILE A N   
2300 C  CA  . ILE A 287 ? 0.1565 0.1155 0.1038 0.0046  -0.0279 0.0104  287 ILE A CA  
2301 C  C   . ILE A 287 ? 0.1657 0.1225 0.1030 0.0243  -0.0318 -0.0024 287 ILE A C   
2302 O  O   . ILE A 287 ? 0.2197 0.1406 0.0893 0.0063  -0.0390 0.0082  287 ILE A O   
2303 C  CB  . ILE A 287 ? 0.1622 0.1484 0.1220 0.0200  -0.0222 0.0174  287 ILE A CB  
2304 C  CG1 . ILE A 287 ? 0.1938 0.1714 0.1179 0.0371  -0.0286 0.0287  287 ILE A CG1 
2305 C  CG2 . ILE A 287 ? 0.1622 0.2197 0.1360 0.0307  -0.0467 0.0305  287 ILE A CG2 
2306 C  CD1 . ILE A 287 ? 0.1769 0.2663 0.1564 0.0246  0.0071  0.0355  287 ILE A CD1 
2307 N  N   . ALA A 288 ? 0.1567 0.1153 0.0844 0.0271  -0.0315 0.0040  288 ALA A N   
2308 C  CA  . ALA A 288 ? 0.1261 0.0993 0.1061 0.0238  -0.0278 0.0269  288 ALA A CA  
2309 C  C   . ALA A 288 ? 0.1356 0.1096 0.0817 0.0143  -0.0089 0.0083  288 ALA A C   
2310 O  O   . ALA A 288 ? 0.1486 0.1169 0.1432 0.0246  -0.0464 0.0111  288 ALA A O   
2311 C  CB  . ALA A 288 ? 0.1177 0.1333 0.0943 0.0120  -0.0156 0.0066  288 ALA A CB  
2312 N  N   . ILE A 289 ? 0.1369 0.1252 0.1017 0.0158  -0.0305 0.0028  289 ILE A N   
2313 C  CA  . ILE A 289 ? 0.1250 0.1408 0.0984 0.0299  -0.0251 0.0133  289 ILE A CA  
2314 C  C   . ILE A 289 ? 0.1106 0.0985 0.0945 0.0072  -0.0163 0.0145  289 ILE A C   
2315 O  O   . ILE A 289 ? 0.1248 0.1024 0.1051 0.0089  -0.0160 0.0153  289 ILE A O   
2316 C  CB  . ILE A 289 ? 0.1361 0.1406 0.0766 0.0237  -0.0199 0.0190  289 ILE A CB  
2317 C  CG1 . ILE A 289 ? 0.1900 0.1832 0.1103 0.0295  -0.0005 0.0288  289 ILE A CG1 
2318 C  CG2 . ILE A 289 ? 0.1202 0.1847 0.1142 0.0233  -0.0067 0.0286  289 ILE A CG2 
2319 C  CD1 . ILE A 289 ? 0.2196 0.2750 0.1541 0.0428  0.0335  0.0127  289 ILE A CD1 
2320 N  N   . GLY A 290 ? 0.1206 0.0966 0.0790 0.0030  -0.0154 0.0211  290 GLY A N   
2321 C  CA  . GLY A 290 ? 0.1125 0.0939 0.0871 0.0120  -0.0070 0.0068  290 GLY A CA  
2322 C  C   . GLY A 290 ? 0.0988 0.0983 0.0906 -0.0032 -0.0112 0.0020  290 GLY A C   
2323 O  O   . GLY A 290 ? 0.1016 0.1114 0.0897 -0.0063 -0.0058 0.0176  290 GLY A O   
2324 N  N   . PRO A 291 ? 0.0928 0.1099 0.0853 0.0049  -0.0060 0.0080  291 PRO A N   
2325 C  CA  . PRO A 291 ? 0.0999 0.1073 0.0801 -0.0102 -0.0163 0.0210  291 PRO A CA  
2326 C  C   . PRO A 291 ? 0.0850 0.0811 0.0852 0.0015  -0.0077 0.0099  291 PRO A C   
2327 O  O   . PRO A 291 ? 0.1004 0.0939 0.0969 0.0116  -0.0074 0.0120  291 PRO A O   
2328 C  CB  . PRO A 291 ? 0.1236 0.1236 0.0755 -0.0286 -0.0183 0.0165  291 PRO A CB  
2329 C  CG  . PRO A 291 ? 0.1420 0.1398 0.0884 -0.0135 -0.0101 0.0157  291 PRO A CG  
2330 C  CD  . PRO A 291 ? 0.0983 0.1110 0.1168 0.0105  -0.0140 -0.0006 291 PRO A CD  
2331 N  N   . LYS A 292 ? 0.0787 0.0921 0.1028 0.0116  -0.0149 0.0035  292 LYS A N   
2332 C  CA  . LYS A 292 ? 0.0833 0.1001 0.0899 0.0047  -0.0093 0.0113  292 LYS A CA  
2333 C  C   . LYS A 292 ? 0.0760 0.0965 0.0804 0.0142  -0.0093 0.0226  292 LYS A C   
2334 O  O   . LYS A 292 ? 0.1217 0.1247 0.1106 -0.0129 -0.0090 0.0373  292 LYS A O   
2335 C  CB  . LYS A 292 ? 0.1231 0.1236 0.1227 0.0000  -0.0054 -0.0009 292 LYS A CB  
2336 C  CG  . LYS A 292 ? 0.1054 0.1367 0.1319 0.0153  -0.0177 -0.0037 292 LYS A CG  
2337 C  CD  . LYS A 292 ? 0.1421 0.2310 0.1334 0.0549  -0.0233 -0.0364 292 LYS A CD  
2338 C  CE  . LYS A 292 ? 0.1788 0.2128 0.1903 0.0304  -0.0454 -0.0510 292 LYS A CE  
2339 N  NZ  . LYS A 292 ? 0.1525 0.1948 0.2079 0.0616  -0.0384 -0.0285 292 LYS A NZ  
2340 N  N   . MET A 293 ? 0.1011 0.0818 0.0853 -0.0002 0.0009  0.0124  293 MET A N   
2341 C  CA  A MET A 293 ? 0.0838 0.0948 0.0883 0.0113  -0.0052 0.0150  293 MET A CA  
2342 C  CA  B MET A 293 ? 0.0858 0.0984 0.0867 0.0134  -0.0058 0.0154  293 MET A CA  
2343 C  C   . MET A 293 ? 0.1040 0.1442 0.0773 0.0066  0.0142  0.0268  293 MET A C   
2344 O  O   . MET A 293 ? 0.1057 0.2151 0.1341 0.0182  0.0093  0.0651  293 MET A O   
2345 C  CB  A MET A 293 ? 0.0945 0.1122 0.0832 -0.0053 0.0068  0.0138  293 MET A CB  
2346 C  CB  B MET A 293 ? 0.0878 0.1137 0.0834 -0.0207 0.0065  0.0195  293 MET A CB  
2347 C  CG  A MET A 293 ? 0.1417 0.0724 0.1023 0.0041  -0.0013 0.0051  293 MET A CG  
2348 C  CG  B MET A 293 ? 0.1118 0.0677 0.0464 0.0048  0.0059  0.0060  293 MET A CG  
2349 S  SD  A MET A 293 ? 0.1279 0.1277 0.1148 0.0124  0.0061  0.0203  293 MET A SD  
2350 S  SD  B MET A 293 ? 0.0898 0.0909 0.1030 0.0016  -0.0124 -0.0073 293 MET A SD  
2351 C  CE  A MET A 293 ? 0.1807 0.1459 0.1127 0.0056  -0.0453 0.0437  293 MET A CE  
2352 C  CE  B MET A 293 ? 0.1174 0.0690 0.0613 -0.0059 0.0232  -0.0024 293 MET A CE  
2353 N  N   . THR A 294 ? 0.0776 0.1100 0.0863 0.0212  0.0052  0.0274  294 THR A N   
2354 C  CA  . THR A 294 ? 0.0957 0.1062 0.1210 0.0186  0.0011  -0.0155 294 THR A CA  
2355 C  C   . THR A 294 ? 0.0833 0.0967 0.1072 0.0015  -0.0047 0.0180  294 THR A C   
2356 O  O   . THR A 294 ? 0.1093 0.0966 0.0889 0.0042  -0.0126 0.0157  294 THR A O   
2357 C  CB  . THR A 294 ? 0.0993 0.1307 0.1530 0.0234  -0.0068 -0.0006 294 THR A CB  
2358 O  OG1 . THR A 294 ? 0.1317 0.0874 0.1736 0.0003  -0.0216 0.0049  294 THR A OG1 
2359 C  CG2 . THR A 294 ? 0.1656 0.1663 0.1585 0.0249  -0.0360 -0.0308 294 THR A CG2 
2360 N  N   . ARG A 295 ? 0.1071 0.0640 0.1159 -0.0082 0.0152  0.0117  295 ARG A N   
2361 C  CA  . ARG A 295 ? 0.1319 0.0575 0.1108 0.0077  0.0181  0.0219  295 ARG A CA  
2362 C  C   . ARG A 295 ? 0.0956 0.0762 0.0722 0.0227  -0.0005 0.0247  295 ARG A C   
2363 O  O   . ARG A 295 ? 0.0755 0.0878 0.0818 0.0078  -0.0050 0.0227  295 ARG A O   
2364 C  CB  . ARG A 295 ? 0.2356 0.0765 0.2281 0.0294  0.0556  0.0224  295 ARG A CB  
2365 C  CG  . ARG A 295 ? 0.2443 0.1033 0.2764 0.0241  0.0600  0.0218  295 ARG A CG  
2366 C  CD  . ARG A 295 ? 0.1362 0.0828 0.1372 -0.0022 0.0336  0.0460  295 ARG A CD  
2367 N  NE  . ARG A 295 ? 0.1128 0.0667 0.1219 -0.0046 0.0109  0.0168  295 ARG A NE  
2368 C  CZ  . ARG A 295 ? 0.0892 0.0943 0.1056 0.0028  0.0075  0.0183  295 ARG A CZ  
2369 N  NH1 . ARG A 295 ? 0.1084 0.0907 0.1196 -0.0219 0.0184  0.0203  295 ARG A NH1 
2370 N  NH2 . ARG A 295 ? 0.1113 0.0977 0.0805 0.0069  0.0195  0.0150  295 ARG A NH2 
2371 N  N   . PHE A 296 ? 0.0811 0.0870 0.0711 0.0059  -0.0021 0.0337  296 PHE A N   
2372 C  CA  . PHE A 296 ? 0.0777 0.0822 0.0710 0.0051  -0.0079 0.0212  296 PHE A CA  
2373 C  C   . PHE A 296 ? 0.0733 0.0657 0.0874 0.0105  0.0058  0.0084  296 PHE A C   
2374 O  O   . PHE A 296 ? 0.0736 0.0713 0.0774 0.0024  0.0010  0.0161  296 PHE A O   
2375 C  CB  . PHE A 296 ? 0.0726 0.0963 0.0763 0.0219  -0.0227 0.0101  296 PHE A CB  
2376 C  CG  . PHE A 296 ? 0.0768 0.0835 0.0623 0.0028  -0.0138 0.0254  296 PHE A CG  
2377 C  CD1 . PHE A 296 ? 0.1039 0.0836 0.0915 0.0005  -0.0019 0.0232  296 PHE A CD1 
2378 C  CD2 . PHE A 296 ? 0.0837 0.0710 0.0873 0.0072  -0.0075 0.0076  296 PHE A CD2 
2379 C  CE1 . PHE A 296 ? 0.0916 0.0886 0.1095 -0.0127 -0.0268 0.0315  296 PHE A CE1 
2380 C  CE2 . PHE A 296 ? 0.1212 0.0743 0.0812 0.0028  0.0068  0.0161  296 PHE A CE2 
2381 C  CZ  . PHE A 296 ? 0.1301 0.0813 0.1013 -0.0164 -0.0225 0.0272  296 PHE A CZ  
2382 N  N   . ASP A 297 ? 0.0729 0.0824 0.0696 0.0020  -0.0063 0.0189  297 ASP A N   
2383 C  CA  . ASP A 297 ? 0.0920 0.0864 0.0723 0.0123  -0.0124 0.0199  297 ASP A CA  
2384 C  C   . ASP A 297 ? 0.0945 0.0787 0.0797 0.0106  -0.0071 0.0229  297 ASP A C   
2385 O  O   . ASP A 297 ? 0.0941 0.1038 0.1088 0.0027  -0.0105 0.0442  297 ASP A O   
2386 C  CB  . ASP A 297 ? 0.0924 0.0739 0.0809 0.0185  -0.0014 0.0304  297 ASP A CB  
2387 C  CG  . ASP A 297 ? 0.1128 0.0851 0.0815 -0.0025 0.0102  0.0225  297 ASP A CG  
2388 O  OD1 . ASP A 297 ? 0.0879 0.1000 0.0913 0.0076  0.0094  0.0367  297 ASP A OD1 
2389 O  OD2 . ASP A 297 ? 0.1400 0.0961 0.1068 -0.0030 0.0156  0.0177  297 ASP A OD2 
2390 N  N   . GLY A 298 ? 0.0747 0.0605 0.0922 0.0045  -0.0044 0.0111  298 GLY A N   
2391 C  CA  . GLY A 298 ? 0.0765 0.0723 0.0710 0.0016  -0.0138 0.0093  298 GLY A CA  
2392 C  C   . GLY A 298 ? 0.0719 0.0763 0.0909 0.0031  -0.0083 0.0032  298 GLY A C   
2393 O  O   . GLY A 298 ? 0.0973 0.0931 0.0893 0.0053  0.0045  0.0128  298 GLY A O   
2394 N  N   . PRO A 299 ? 0.0713 0.0752 0.0828 -0.0023 -0.0101 0.0135  299 PRO A N   
2395 C  CA  . PRO A 299 ? 0.0785 0.0811 0.0764 -0.0062 -0.0077 0.0236  299 PRO A CA  
2396 C  C   . PRO A 299 ? 0.0758 0.0676 0.0745 -0.0184 -0.0059 0.0096  299 PRO A C   
2397 O  O   . PRO A 299 ? 0.0717 0.0943 0.0807 -0.0040 -0.0103 0.0118  299 PRO A O   
2398 C  CB  . PRO A 299 ? 0.0782 0.1080 0.0988 0.0255  -0.0118 0.0453  299 PRO A CB  
2399 C  CG  . PRO A 299 ? 0.2401 0.1165 0.1674 -0.0124 0.0505  0.0451  299 PRO A CG  
2400 C  CD  . PRO A 299 ? 0.1370 0.0705 0.0872 -0.0030 -0.0106 0.0029  299 PRO A CD  
2401 N  N   . PRO A 300 ? 0.0831 0.0521 0.0751 -0.0051 -0.0236 0.0078  300 PRO A N   
2402 C  CA  . PRO A 300 ? 0.0829 0.0700 0.0871 -0.0050 -0.0175 0.0200  300 PRO A CA  
2403 C  C   . PRO A 300 ? 0.0645 0.0770 0.0740 -0.0067 -0.0111 0.0180  300 PRO A C   
2404 O  O   . PRO A 300 ? 0.0751 0.0691 0.0755 -0.0084 -0.0266 0.0207  300 PRO A O   
2405 C  CB  . PRO A 300 ? 0.0805 0.0838 0.1113 -0.0107 -0.0304 0.0137  300 PRO A CB  
2406 C  CG  . PRO A 300 ? 0.0915 0.0880 0.1096 -0.0024 -0.0256 -0.0020 300 PRO A CG  
2407 C  CD  . PRO A 300 ? 0.0796 0.0710 0.0766 -0.0075 -0.0167 0.0078  300 PRO A CD  
2408 N  N   . LYS A 301 ? 0.0840 0.0647 0.0627 -0.0137 -0.0149 0.0251  301 LYS A N   
2409 C  CA  A LYS A 301 ? 0.0642 0.0647 0.0804 -0.0056 -0.0176 0.0191  301 LYS A CA  
2410 C  CA  B LYS A 301 ? 0.0569 0.0686 0.0836 -0.0063 -0.0172 0.0226  301 LYS A CA  
2411 C  C   . LYS A 301 ? 0.0728 0.0668 0.0612 -0.0118 -0.0200 0.0230  301 LYS A C   
2412 O  O   . LYS A 301 ? 0.0898 0.0765 0.0968 -0.0067 -0.0196 0.0333  301 LYS A O   
2413 C  CB  A LYS A 301 ? 0.0503 0.0756 0.1004 -0.0131 -0.0037 0.0125  301 LYS A CB  
2414 C  CB  B LYS A 301 ? 0.0602 0.0893 0.0785 0.0054  -0.0134 0.0083  301 LYS A CB  
2415 C  CG  A LYS A 301 ? 0.0626 0.0518 0.0561 -0.0058 -0.0107 0.0239  301 LYS A CG  
2416 C  CG  B LYS A 301 ? 0.0682 0.0792 0.0878 -0.0104 0.0045  0.0292  301 LYS A CG  
2417 C  CD  A LYS A 301 ? 0.0585 0.0941 0.0890 -0.0013 0.0044  0.0046  301 LYS A CD  
2418 C  CD  B LYS A 301 ? 0.0761 0.0891 0.0650 0.0019  0.0079  0.0433  301 LYS A CD  
2419 C  CE  A LYS A 301 ? 0.0686 0.0877 0.0341 0.0222  0.0092  0.0033  301 LYS A CE  
2420 C  CE  B LYS A 301 ? 0.1290 0.1826 0.1296 0.0370  0.0210  0.0324  301 LYS A CE  
2421 N  NZ  A LYS A 301 ? 0.0402 0.0541 0.0484 -0.0199 -0.0173 0.0208  301 LYS A NZ  
2422 N  NZ  B LYS A 301 ? 0.2274 0.2304 0.1546 0.0524  0.0194  0.0138  301 LYS A NZ  
2423 N  N   . VAL A 302 ? 0.0643 0.0706 0.0783 -0.0103 -0.0233 0.0113  302 VAL A N   
2424 C  CA  . VAL A 302 ? 0.0768 0.0610 0.0727 0.0142  -0.0286 0.0032  302 VAL A CA  
2425 C  C   . VAL A 302 ? 0.0797 0.0704 0.0684 0.0053  -0.0181 0.0106  302 VAL A C   
2426 O  O   . VAL A 302 ? 0.0903 0.0683 0.0716 -0.0034 -0.0248 0.0147  302 VAL A O   
2427 C  CB  . VAL A 302 ? 0.0809 0.0753 0.0741 -0.0060 -0.0103 -0.0130 302 VAL A CB  
2428 C  CG1 . VAL A 302 ? 0.0935 0.0862 0.0849 -0.0124 -0.0170 0.0107  302 VAL A CG1 
2429 C  CG2 . VAL A 302 ? 0.0713 0.1129 0.1042 0.0314  -0.0510 -0.0122 302 VAL A CG2 
2430 N  N   . GLY A 303 ? 0.0839 0.0719 0.0567 0.0084  -0.0245 0.0172  303 GLY A N   
2431 C  CA  . GLY A 303 ? 0.0649 0.0773 0.0842 0.0079  -0.0110 0.0071  303 GLY A CA  
2432 C  C   . GLY A 303 ? 0.0896 0.0813 0.0534 0.0045  -0.0201 0.0086  303 GLY A C   
2433 O  O   . GLY A 303 ? 0.1060 0.0750 0.0966 0.0051  -0.0347 -0.0012 303 GLY A O   
2434 N  N   . ALA A 304 ? 0.0714 0.0713 0.0909 0.0068  -0.0257 -0.0032 304 ALA A N   
2435 C  CA  . ALA A 304 ? 0.0781 0.0761 0.0818 0.0200  -0.0287 0.0012  304 ALA A CA  
2436 C  C   . ALA A 304 ? 0.0974 0.0780 0.0852 0.0001  -0.0307 0.0026  304 ALA A C   
2437 O  O   . ALA A 304 ? 0.0945 0.0833 0.0915 0.0089  -0.0330 0.0066  304 ALA A O   
2438 C  CB  . ALA A 304 ? 0.0923 0.1363 0.0840 0.0044  0.0016  0.0084  304 ALA A CB  
2439 N  N   . LEU A 305 ? 0.0873 0.0848 0.0815 0.0107  -0.0332 0.0067  305 LEU A N   
2440 C  CA  . LEU A 305 ? 0.0974 0.0940 0.0726 0.0024  -0.0214 -0.0048 305 LEU A CA  
2441 C  C   . LEU A 305 ? 0.0945 0.0945 0.0711 0.0061  -0.0323 0.0030  305 LEU A C   
2442 O  O   . LEU A 305 ? 0.0983 0.0986 0.0996 0.0061  -0.0389 0.0024  305 LEU A O   
2443 C  CB  . LEU A 305 ? 0.0901 0.0942 0.1050 0.0022  -0.0271 0.0028  305 LEU A CB  
2444 C  CG  . LEU A 305 ? 0.0993 0.1107 0.0842 -0.0008 -0.0269 0.0153  305 LEU A CG  
2445 C  CD1 . LEU A 305 ? 0.1210 0.1303 0.1286 -0.0045 0.0071  0.0469  305 LEU A CD1 
2446 C  CD2 . LEU A 305 ? 0.1372 0.0956 0.1454 0.0131  -0.0194 0.0117  305 LEU A CD2 
2447 N  N   . GLY A 306 ? 0.0957 0.0864 0.0890 0.0119  -0.0384 0.0105  306 GLY A N   
2448 C  CA  . GLY A 306 ? 0.0988 0.1109 0.0816 0.0040  -0.0135 0.0061  306 GLY A CA  
2449 C  C   . GLY A 306 ? 0.0959 0.0989 0.0922 0.0028  -0.0142 -0.0120 306 GLY A C   
2450 O  O   . GLY A 306 ? 0.1100 0.1164 0.0877 0.0176  -0.0408 -0.0052 306 GLY A O   
2451 N  N   . PHE A 307 ? 0.1180 0.0944 0.0808 0.0115  -0.0267 -0.0074 307 PHE A N   
2452 C  CA  . PHE A 307 ? 0.1095 0.1107 0.0790 0.0006  -0.0229 0.0087  307 PHE A CA  
2453 C  C   . PHE A 307 ? 0.1205 0.0998 0.0975 -0.0007 -0.0384 -0.0046 307 PHE A C   
2454 O  O   . PHE A 307 ? 0.1097 0.1283 0.0965 0.0066  -0.0374 0.0005  307 PHE A O   
2455 C  CB  . PHE A 307 ? 0.1235 0.1290 0.0739 0.0037  -0.0433 0.0009  307 PHE A CB  
2456 C  CG  . PHE A 307 ? 0.1177 0.1105 0.0937 -0.0024 -0.0247 0.0189  307 PHE A CG  
2457 C  CD1 . PHE A 307 ? 0.1245 0.1018 0.1133 0.0164  -0.0183 0.0321  307 PHE A CD1 
2458 C  CD2 . PHE A 307 ? 0.1201 0.1311 0.1096 0.0085  -0.0224 0.0317  307 PHE A CD2 
2459 C  CE1 . PHE A 307 ? 0.1353 0.1413 0.1339 0.0061  -0.0322 0.0292  307 PHE A CE1 
2460 C  CE2 . PHE A 307 ? 0.1527 0.1261 0.1138 0.0200  -0.0029 0.0156  307 PHE A CE2 
2461 C  CZ  . PHE A 307 ? 0.1155 0.1314 0.1486 -0.0080 -0.0243 0.0560  307 PHE A CZ  
2462 N  N   . GLN A 308 ? 0.1192 0.1332 0.0883 0.0111  -0.0366 0.0074  308 GLN A N   
2463 C  CA  . GLN A 308 ? 0.1206 0.1205 0.1099 0.0064  -0.0397 0.0196  308 GLN A CA  
2464 C  C   . GLN A 308 ? 0.1038 0.1183 0.1127 -0.0116 -0.0299 -0.0027 308 GLN A C   
2465 O  O   . GLN A 308 ? 0.1587 0.1506 0.1083 0.0161  -0.0433 0.0124  308 GLN A O   
2466 C  CB  . GLN A 308 ? 0.1087 0.1314 0.1131 0.0019  -0.0434 0.0221  308 GLN A CB  
2467 C  CG  . GLN A 308 ? 0.1280 0.1377 0.0978 -0.0148 -0.0552 0.0116  308 GLN A CG  
2468 C  CD  . GLN A 308 ? 0.1231 0.1333 0.1090 -0.0102 -0.0511 -0.0053 308 GLN A CD  
2469 O  OE1 . GLN A 308 ? 0.1489 0.1447 0.1095 -0.0086 -0.0516 0.0174  308 GLN A OE1 
2470 N  NE2 . GLN A 308 ? 0.1295 0.1179 0.1136 0.0131  -0.0526 -0.0028 308 GLN A NE2 
2471 N  N   . LEU A 309 ? 0.1452 0.1286 0.1072 0.0151  -0.0337 0.0113  309 LEU A N   
2472 C  CA  A LEU A 309 ? 0.1561 0.1467 0.1395 -0.0071 -0.0410 0.0123  309 LEU A CA  
2473 C  CA  B LEU A 309 ? 0.1550 0.1449 0.1307 -0.0083 -0.0379 0.0142  309 LEU A CA  
2474 C  C   . LEU A 309 ? 0.1506 0.1567 0.1564 0.0065  -0.0282 0.0220  309 LEU A C   
2475 O  O   . LEU A 309 ? 0.1577 0.1728 0.1552 0.0073  -0.0535 0.0567  309 LEU A O   
2476 C  CB  A LEU A 309 ? 0.1643 0.1320 0.1897 -0.0055 -0.0301 0.0130  309 LEU A CB  
2477 C  CB  B LEU A 309 ? 0.1572 0.1277 0.1693 0.0003  -0.0308 0.0180  309 LEU A CB  
2478 C  CG  A LEU A 309 ? 0.1574 0.2016 0.2423 0.0042  -0.0333 -0.0234 309 LEU A CG  
2479 C  CG  B LEU A 309 ? 0.1709 0.1779 0.1685 -0.0271 0.0000  -0.0166 309 LEU A CG  
2480 C  CD1 A LEU A 309 ? 0.1801 0.1651 0.2105 -0.0415 0.0014  -0.0395 309 LEU A CD1 
2481 C  CD1 B LEU A 309 ? 0.1283 0.1867 0.2308 -0.0068 -0.1150 0.0214  309 LEU A CD1 
2482 C  CD2 A LEU A 309 ? 0.1820 0.3148 0.2981 -0.0353 0.0213  -0.0761 309 LEU A CD2 
2483 C  CD2 B LEU A 309 ? 0.2317 0.0909 0.1698 -0.0059 0.0054  0.0340  309 LEU A CD2 
2484 N  N   . HIS A 310 ? 0.1374 0.1784 0.1365 -0.0168 -0.0284 0.0102  310 HIS A N   
2485 C  CA  . HIS A 310 ? 0.1580 0.1607 0.1548 -0.0290 -0.0550 0.0089  310 HIS A CA  
2486 C  C   . HIS A 310 ? 0.1565 0.1736 0.1102 0.0042  -0.0463 -0.0085 310 HIS A C   
2487 O  O   . HIS A 310 ? 0.1681 0.1736 0.1385 -0.0068 -0.0503 -0.0002 310 HIS A O   
2488 C  CB  . HIS A 310 ? 0.1899 0.1744 0.1670 -0.0401 -0.0495 0.0124  310 HIS A CB  
2489 C  CG  . HIS A 310 ? 0.2579 0.1730 0.2448 -0.0266 -0.0373 0.0080  310 HIS A CG  
2490 N  ND1 . HIS A 310 ? 0.3370 0.1923 0.3498 -0.1217 0.0298  -0.0626 310 HIS A ND1 
2491 C  CD2 . HIS A 310 ? 0.3065 0.3024 0.2647 0.0341  -0.0096 -0.0058 310 HIS A CD2 
2492 C  CE1 . HIS A 310 ? 0.3041 0.2503 0.2721 -0.0319 0.0095  -0.0247 310 HIS A CE1 
2493 N  NE2 . HIS A 310 ? 0.3805 0.3043 0.3525 -0.0197 0.0374  -0.0451 310 HIS A NE2 
2494 N  N   . GLU A 311 ? 0.1562 0.1817 0.1549 -0.0038 -0.0511 0.0107  311 GLU A N   
2495 C  CA  . GLU A 311 ? 0.1954 0.2056 0.1435 -0.0049 -0.0494 0.0143  311 GLU A CA  
2496 C  C   . GLU A 311 ? 0.1718 0.2075 0.1527 -0.0088 -0.0492 0.0268  311 GLU A C   
2497 O  O   . GLU A 311 ? 0.2142 0.2117 0.1561 0.0025  -0.0466 0.0430  311 GLU A O   
2498 C  CB  . GLU A 311 ? 0.2035 0.2684 0.1699 -0.0203 -0.0834 0.0317  311 GLU A CB  
2499 C  CG  . GLU A 311 ? 0.2833 0.4140 0.1895 -0.0401 -0.1165 -0.0214 311 GLU A CG  
2500 C  CD  . GLU A 311 ? 0.5040 0.5393 0.3706 -0.0516 -0.1059 0.0086  311 GLU A CD  
2501 O  OE1 . GLU A 311 ? 0.5978 0.5229 0.5584 -0.1415 -0.1577 -0.0353 311 GLU A OE1 
2502 O  OE2 . GLU A 311 ? 0.7395 0.6275 0.3774 -0.2221 -0.2077 0.0786  311 GLU A OE2 
2503 N  N   . GLY A 312 ? 0.1562 0.1772 0.1386 0.0138  -0.0615 0.0194  312 GLY A N   
2504 C  CA  . GLY A 312 ? 0.1891 0.1971 0.1529 -0.0030 -0.0530 0.0048  312 GLY A CA  
2505 C  C   . GLY A 312 ? 0.1756 0.1779 0.1359 0.0019  -0.0343 0.0056  312 GLY A C   
2506 O  O   . GLY A 312 ? 0.1738 0.2369 0.1839 -0.0353 -0.0460 0.0088  312 GLY A O   
2507 N  N   . TYR A 313 ? 0.1603 0.1639 0.1247 -0.0060 -0.0519 0.0083  313 TYR A N   
2508 C  CA  . TYR A 313 ? 0.1883 0.1708 0.1391 0.0104  -0.0323 0.0161  313 TYR A CA  
2509 C  C   . TYR A 313 ? 0.1621 0.1763 0.1598 0.0079  -0.0102 0.0388  313 TYR A C   
2510 O  O   . TYR A 313 ? 0.1688 0.1908 0.1461 -0.0030 -0.0352 0.0335  313 TYR A O   
2511 C  CB  . TYR A 313 ? 0.2174 0.1942 0.1750 0.0131  -0.0299 0.0087  313 TYR A CB  
2512 C  CG  . TYR A 313 ? 0.2049 0.2486 0.1371 -0.0228 -0.0183 0.0050  313 TYR A CG  
2513 C  CD1 . TYR A 313 ? 0.2159 0.2705 0.1265 -0.0157 -0.0402 0.0328  313 TYR A CD1 
2514 C  CD2 . TYR A 313 ? 0.2143 0.2905 0.1245 -0.0291 -0.0368 0.0294  313 TYR A CD2 
2515 C  CE1 . TYR A 313 ? 0.2187 0.3085 0.1241 -0.0191 -0.0196 0.0413  313 TYR A CE1 
2516 C  CE2 . TYR A 313 ? 0.1970 0.3040 0.1383 -0.0042 -0.0642 0.0254  313 TYR A CE2 
2517 C  CZ  . TYR A 313 ? 0.2328 0.2672 0.1542 -0.0231 -0.0420 0.0265  313 TYR A CZ  
2518 O  OH  . TYR A 313 ? 0.2835 0.3446 0.1471 -0.0151 -0.0615 0.0607  313 TYR A OH  
2519 N  N   . LEU A 314 ? 0.1536 0.1901 0.1385 0.0185  -0.0068 0.0575  314 LEU A N   
2520 C  CA  . LEU A 314 ? 0.1861 0.1648 0.1458 0.0144  -0.0125 0.0530  314 LEU A CA  
2521 C  C   . LEU A 314 ? 0.1846 0.2080 0.1660 0.0359  0.0061  0.0355  314 LEU A C   
2522 O  O   . LEU A 314 ? 0.2278 0.2010 0.3119 0.0211  0.0667  0.0569  314 LEU A O   
2523 C  CB  . LEU A 314 ? 0.1995 0.2125 0.1229 0.0276  -0.0163 0.0435  314 LEU A CB  
2524 C  CG  . LEU A 314 ? 0.1904 0.1930 0.1507 0.0285  -0.0377 0.0512  314 LEU A CG  
2525 C  CD1 . LEU A 314 ? 0.1894 0.2504 0.1751 0.0214  -0.0502 0.0465  314 LEU A CD1 
2526 C  CD2 . LEU A 314 ? 0.2631 0.2353 0.1438 0.0531  0.0044  0.0689  314 LEU A CD2 
2527 N  N   . GLU A 315 ? 0.1494 0.1936 0.1208 0.0072  -0.0411 0.0228  315 GLU A N   
2528 C  CA  . GLU A 315 ? 0.1617 0.2022 0.1109 -0.0236 -0.0431 0.0002  315 GLU A CA  
2529 C  C   . GLU A 315 ? 0.1304 0.1220 0.1190 -0.0044 -0.0159 0.0087  315 GLU A C   
2530 O  O   . GLU A 315 ? 0.1605 0.1592 0.1223 0.0281  -0.0269 0.0186  315 GLU A O   
2531 C  CB  . GLU A 315 ? 0.2512 0.2879 0.1462 -0.0571 -0.0674 0.0143  315 GLU A CB  
2532 C  CG  . GLU A 315 ? 0.3504 0.3222 0.2951 -0.0887 0.0183  -0.0381 315 GLU A CG  
2533 C  CD  . GLU A 315 ? 0.3968 0.2503 0.1315 -0.1466 -0.0607 0.0195  315 GLU A CD  
2534 O  OE1 . GLU A 315 ? 0.6568 0.2389 0.4477 -0.1553 -0.1241 0.0627  315 GLU A OE1 
2535 O  OE2 . GLU A 315 ? 0.3764 0.3034 0.2017 -0.1010 0.0069  0.0063  315 GLU A OE2 
2536 N  N   . GLY A 316 ? 0.1485 0.1728 0.1003 -0.0021 -0.0261 -0.0128 316 GLY A N   
2537 C  CA  . GLY A 316 ? 0.1913 0.1592 0.1249 0.0042  -0.0352 0.0055  316 GLY A CA  
2538 C  C   . GLY A 316 ? 0.1777 0.1981 0.1501 0.0036  -0.0156 -0.0136 316 GLY A C   
2539 O  O   . GLY A 316 ? 0.1930 0.2033 0.1542 0.0034  -0.0266 0.0120  316 GLY A O   
2540 N  N   . GLY A 317 ? 0.1799 0.1808 0.1525 -0.0210 -0.0196 0.0129  317 GLY A N   
2541 C  CA  . GLY A 317 ? 0.2077 0.1458 0.0919 -0.0113 0.0088  0.0113  317 GLY A CA  
2542 C  C   . GLY A 317 ? 0.1551 0.1475 0.1387 0.0241  -0.0156 -0.0080 317 GLY A C   
2543 O  O   . GLY A 317 ? 0.2444 0.1804 0.1578 0.0628  0.0227  0.0265  317 GLY A O   
2544 N  N   . VAL A 318 ? 0.1306 0.1206 0.0898 0.0170  -0.0228 0.0010  318 VAL A N   
2545 C  CA  . VAL A 318 ? 0.1252 0.1091 0.0942 -0.0193 -0.0307 0.0052  318 VAL A CA  
2546 C  C   . VAL A 318 ? 0.1139 0.0901 0.0831 0.0101  -0.0153 -0.0113 318 VAL A C   
2547 O  O   . VAL A 318 ? 0.1174 0.0819 0.0919 0.0098  -0.0342 -0.0019 318 VAL A O   
2548 C  CB  . VAL A 318 ? 0.1250 0.1167 0.1038 -0.0071 -0.0295 -0.0026 318 VAL A CB  
2549 C  CG1 . VAL A 318 ? 0.1772 0.1006 0.1273 -0.0183 -0.0322 0.0130  318 VAL A CG1 
2550 C  CG2 . VAL A 318 ? 0.1560 0.1655 0.0912 -0.0095 -0.0624 -0.0286 318 VAL A CG2 
2551 N  N   . ASP A 319 ? 0.1050 0.0953 0.0727 0.0183  -0.0237 -0.0143 319 ASP A N   
2552 C  CA  . ASP A 319 ? 0.1091 0.0804 0.0631 -0.0006 -0.0249 -0.0083 319 ASP A CA  
2553 C  C   . ASP A 319 ? 0.1055 0.0920 0.0927 -0.0069 -0.0216 0.0140  319 ASP A C   
2554 O  O   . ASP A 319 ? 0.1517 0.0974 0.1298 -0.0111 0.0151  -0.0025 319 ASP A O   
2555 C  CB  . ASP A 319 ? 0.1003 0.1228 0.0911 -0.0010 -0.0137 -0.0019 319 ASP A CB  
2556 C  CG  . ASP A 319 ? 0.0991 0.1022 0.1092 -0.0018 -0.0161 -0.0011 319 ASP A CG  
2557 O  OD1 . ASP A 319 ? 0.1117 0.0984 0.1126 -0.0007 -0.0319 -0.0034 319 ASP A OD1 
2558 O  OD2 . ASP A 319 ? 0.1143 0.1223 0.1284 0.0158  -0.0303 -0.0091 319 ASP A OD2 
2559 N  N   . LEU A 320 ? 0.1013 0.0836 0.0764 -0.0028 -0.0265 0.0037  320 LEU A N   
2560 C  CA  . LEU A 320 ? 0.0919 0.1021 0.0705 -0.0015 -0.0267 -0.0084 320 LEU A CA  
2561 C  C   . LEU A 320 ? 0.1022 0.0968 0.0859 -0.0076 -0.0133 0.0010  320 LEU A C   
2562 O  O   . LEU A 320 ? 0.1005 0.1351 0.0900 -0.0133 -0.0148 0.0150  320 LEU A O   
2563 C  CB  . LEU A 320 ? 0.1050 0.1159 0.0798 -0.0030 -0.0186 -0.0059 320 LEU A CB  
2564 C  CG  . LEU A 320 ? 0.1195 0.1324 0.0717 0.0064  -0.0340 0.0131  320 LEU A CG  
2565 C  CD1 . LEU A 320 ? 0.1371 0.1283 0.1140 0.0443  -0.0064 0.0032  320 LEU A CD1 
2566 C  CD2 . LEU A 320 ? 0.1464 0.1732 0.1428 -0.0027 -0.0500 -0.0389 320 LEU A CD2 
2567 N  N   . PHE A 321 ? 0.0882 0.1107 0.0690 -0.0060 -0.0204 0.0119  321 PHE A N   
2568 C  CA  . PHE A 321 ? 0.1074 0.0888 0.0708 -0.0004 -0.0290 0.0102  321 PHE A CA  
2569 C  C   . PHE A 321 ? 0.1252 0.1049 0.0925 0.0043  -0.0232 -0.0065 321 PHE A C   
2570 O  O   . PHE A 321 ? 0.1344 0.0987 0.0944 0.0200  -0.0312 -0.0075 321 PHE A O   
2571 C  CB  . PHE A 321 ? 0.1000 0.0913 0.0757 -0.0026 -0.0434 0.0192  321 PHE A CB  
2572 C  CG  . PHE A 321 ? 0.0812 0.0785 0.0702 0.0086  -0.0192 0.0229  321 PHE A CG  
2573 C  CD1 . PHE A 321 ? 0.0892 0.0887 0.0756 -0.0109 -0.0219 -0.0023 321 PHE A CD1 
2574 C  CD2 . PHE A 321 ? 0.0826 0.0970 0.0631 -0.0033 -0.0144 0.0147  321 PHE A CD2 
2575 C  CE1 . PHE A 321 ? 0.0822 0.1006 0.0732 -0.0130 -0.0157 0.0010  321 PHE A CE1 
2576 C  CE2 . PHE A 321 ? 0.0910 0.0913 0.0669 -0.0187 -0.0228 0.0130  321 PHE A CE2 
2577 C  CZ  . PHE A 321 ? 0.0963 0.0744 0.0690 -0.0080 -0.0312 -0.0068 321 PHE A CZ  
2578 N  N   . ASP A 322 ? 0.1602 0.1192 0.1100 0.0128  -0.0459 -0.0204 322 ASP A N   
2579 C  CA  . ASP A 322 ? 0.2251 0.1435 0.0921 0.0198  -0.0334 -0.0208 322 ASP A CA  
2580 C  C   . ASP A 322 ? 0.2093 0.1124 0.1816 0.0186  -0.0360 -0.0384 322 ASP A C   
2581 O  O   . ASP A 322 ? 0.2627 0.1588 0.2693 0.0038  -0.1097 -0.0283 322 ASP A O   
2582 C  CB  . ASP A 322 ? 0.2837 0.1719 0.1395 0.0398  -0.0279 -0.0263 322 ASP A CB  
2583 C  CG  . ASP A 322 ? 0.3206 0.2255 0.2289 0.0379  -0.0816 -0.0720 322 ASP A CG  
2584 O  OD1 . ASP A 322 ? 0.3578 0.2465 0.2341 0.1355  -0.0948 -0.1054 322 ASP A OD1 
2585 O  OD2 . ASP A 322 ? 0.3776 0.2603 0.1830 0.0737  -0.0503 -0.0670 322 ASP A OD2 
2586 N  N   . ASP A 323 ? 0.1876 0.1468 0.1307 -0.0085 -0.0111 -0.0474 323 ASP A N   
2587 C  CA  . ASP A 323 ? 0.1971 0.1036 0.1673 0.0054  -0.0071 -0.0295 323 ASP A CA  
2588 C  C   . ASP A 323 ? 0.1781 0.1355 0.1582 -0.0042 -0.0053 -0.0105 323 ASP A C   
2589 O  O   . ASP A 323 ? 0.1748 0.1219 0.1594 -0.0354 -0.0147 -0.0415 323 ASP A O   
2590 C  CB  . ASP A 323 ? 0.1425 0.1220 0.2847 -0.0019 0.0435  -0.0342 323 ASP A CB  
2591 C  CG  . ASP A 323 ? 0.1619 0.1043 0.2068 -0.0114 -0.0112 -0.0397 323 ASP A CG  
2592 O  OD1 . ASP A 323 ? 0.1428 0.1384 0.2208 -0.0077 0.0137  -0.0352 323 ASP A OD1 
2593 O  OD2 . ASP A 323 ? 0.1313 0.1666 0.2280 -0.0290 -0.0235 -0.0313 323 ASP A OD2 
2594 N  N   . PRO A 324 ? 0.1499 0.1099 0.1710 -0.0065 -0.0134 -0.0378 324 PRO A N   
2595 C  CA  . PRO A 324 ? 0.1211 0.0896 0.1830 -0.0064 -0.0152 -0.0137 324 PRO A CA  
2596 C  C   . PRO A 324 ? 0.1169 0.0839 0.1462 -0.0224 -0.0089 -0.0016 324 PRO A C   
2597 O  O   . PRO A 324 ? 0.1032 0.0922 0.1826 -0.0005 -0.0185 0.0277  324 PRO A O   
2598 C  CB  . PRO A 324 ? 0.1444 0.1091 0.2711 0.0129  -0.0203 -0.0186 324 PRO A CB  
2599 C  CG  . PRO A 324 ? 0.2093 0.1316 0.2556 -0.0138 -0.0067 -0.0361 324 PRO A CG  
2600 C  CD  . PRO A 324 ? 0.1689 0.1397 0.2415 0.0045  -0.0401 -0.0800 324 PRO A CD  
2601 N  N   . ALA A 325 ? 0.0985 0.0886 0.1698 0.0057  -0.0085 0.0053  325 ALA A N   
2602 C  CA  . ALA A 325 ? 0.0979 0.1194 0.1245 0.0016  -0.0146 0.0135  325 ALA A CA  
2603 C  C   . ALA A 325 ? 0.0819 0.1029 0.1024 0.0127  -0.0147 -0.0212 325 ALA A C   
2604 O  O   . ALA A 325 ? 0.1263 0.1447 0.0873 0.0203  -0.0081 0.0001  325 ALA A O   
2605 C  CB  . ALA A 325 ? 0.0738 0.1986 0.1480 0.0208  -0.0002 -0.0039 325 ALA A CB  
2606 N  N   . PHE A 326 ? 0.0818 0.0979 0.0900 -0.0061 -0.0163 0.0175  326 PHE A N   
2607 C  CA  . PHE A 326 ? 0.0833 0.0759 0.0865 0.0104  -0.0199 -0.0097 326 PHE A CA  
2608 C  C   . PHE A 326 ? 0.0887 0.0750 0.0929 0.0096  -0.0185 -0.0155 326 PHE A C   
2609 O  O   . PHE A 326 ? 0.0942 0.0705 0.1036 0.0039  -0.0389 -0.0043 326 PHE A O   
2610 C  CB  . PHE A 326 ? 0.0854 0.0879 0.0855 -0.0036 -0.0176 -0.0141 326 PHE A CB  
2611 C  CG  . PHE A 326 ? 0.0791 0.0693 0.0727 0.0028  -0.0177 -0.0132 326 PHE A CG  
2612 C  CD1 . PHE A 326 ? 0.0931 0.0938 0.0822 0.0128  -0.0494 -0.0047 326 PHE A CD1 
2613 C  CD2 . PHE A 326 ? 0.0932 0.0625 0.1019 -0.0056 -0.0217 -0.0052 326 PHE A CD2 
2614 C  CE1 . PHE A 326 ? 0.1088 0.0709 0.0852 0.0187  -0.0178 -0.0067 326 PHE A CE1 
2615 C  CE2 . PHE A 326 ? 0.0675 0.1019 0.0927 -0.0010 -0.0246 0.0192  326 PHE A CE2 
2616 C  CZ  . PHE A 326 ? 0.1134 0.0908 0.0943 0.0270  0.0055  -0.0052 326 PHE A CZ  
2617 N  N   . ASP A 327 ? 0.0808 0.0725 0.1390 0.0096  -0.0253 -0.0144 327 ASP A N   
2618 C  CA  . ASP A 327 ? 0.0867 0.0785 0.1323 0.0058  -0.0117 0.0007  327 ASP A CA  
2619 C  C   . ASP A 327 ? 0.0990 0.0724 0.1353 0.0111  -0.0265 0.0144  327 ASP A C   
2620 O  O   . ASP A 327 ? 0.0840 0.0893 0.1586 -0.0090 -0.0441 0.0043  327 ASP A O   
2621 C  CB  . ASP A 327 ? 0.0866 0.0706 0.1793 0.0146  -0.0071 -0.0085 327 ASP A CB  
2622 C  CG  . ASP A 327 ? 0.1352 0.1302 0.2060 0.0201  0.0109  -0.0116 327 ASP A CG  
2623 O  OD1 . ASP A 327 ? 0.2807 0.1708 0.1931 0.0861  -0.0060 -0.0174 327 ASP A OD1 
2624 O  OD2 . ASP A 327 ? 0.2857 0.1350 0.2830 0.0119  0.0636  -0.0626 327 ASP A OD2 
2625 N  N   . TYR A 328 ? 0.0964 0.0915 0.1334 -0.0224 -0.0228 0.0238  328 TYR A N   
2626 C  CA  A TYR A 328 ? 0.0870 0.0804 0.1448 -0.0105 -0.0094 0.0356  328 TYR A CA  
2627 C  CA  B TYR A 328 ? 0.0838 0.0733 0.1423 -0.0114 -0.0089 0.0334  328 TYR A CA  
2628 C  C   . TYR A 328 ? 0.1037 0.0771 0.1102 -0.0221 -0.0175 0.0164  328 TYR A C   
2629 O  O   . TYR A 328 ? 0.0978 0.1002 0.1227 -0.0219 -0.0408 0.0308  328 TYR A O   
2630 C  CB  A TYR A 328 ? 0.1055 0.1220 0.1742 -0.0119 -0.0100 0.0295  328 TYR A CB  
2631 C  CB  B TYR A 328 ? 0.1063 0.1095 0.1759 -0.0175 -0.0099 0.0253  328 TYR A CB  
2632 C  CG  A TYR A 328 ? 0.1289 0.1459 0.1573 -0.0185 0.0161  0.0498  328 TYR A CG  
2633 C  CG  B TYR A 328 ? 0.1001 0.1045 0.1546 -0.0194 0.0059  0.0221  328 TYR A CG  
2634 C  CD1 A TYR A 328 ? 0.2021 0.2033 0.1576 0.0637  0.0449  0.0465  328 TYR A CD1 
2635 C  CD1 B TYR A 328 ? 0.1413 0.2283 0.1809 -0.0126 0.0042  0.0592  328 TYR A CD1 
2636 C  CD2 A TYR A 328 ? 0.0539 0.1975 0.1700 -0.0240 0.0066  0.0318  328 TYR A CD2 
2637 C  CD2 B TYR A 328 ? 0.1192 0.1058 0.2062 -0.0609 0.0192  0.0724  328 TYR A CD2 
2638 C  CE1 A TYR A 328 ? 0.2552 0.2117 0.1754 0.0673  -0.0085 0.0684  328 TYR A CE1 
2639 C  CE1 B TYR A 328 ? 0.1251 0.2902 0.2210 0.0135  -0.0193 0.0016  328 TYR A CE1 
2640 C  CE2 A TYR A 328 ? 0.1607 0.2617 0.1870 0.0567  -0.0280 0.0370  328 TYR A CE2 
2641 C  CE2 B TYR A 328 ? 0.1263 0.1426 0.2447 -0.0510 0.0238  -0.0139 328 TYR A CE2 
2642 C  CZ  A TYR A 328 ? 0.2064 0.2782 0.1373 0.0716  -0.0446 0.0285  328 TYR A CZ  
2643 C  CZ  B TYR A 328 ? 0.1867 0.2388 0.2160 -0.0092 -0.0190 -0.0303 328 TYR A CZ  
2644 O  OH  A TYR A 328 ? 0.2648 0.3337 0.1248 0.0741  -0.0515 0.0127  328 TYR A OH  
2645 O  OH  B TYR A 328 ? 0.2519 0.4460 0.2425 0.0736  -0.0055 -0.0264 328 TYR A OH  
2646 N  N   . VAL A 329 ? 0.0740 0.0700 0.0989 -0.0096 -0.0281 0.0114  329 VAL A N   
2647 C  CA  . VAL A 329 ? 0.0927 0.0892 0.0614 0.0034  -0.0194 0.0024  329 VAL A CA  
2648 C  C   . VAL A 329 ? 0.0768 0.0649 0.0906 0.0003  -0.0234 0.0083  329 VAL A C   
2649 O  O   . VAL A 329 ? 0.0747 0.0881 0.0868 0.0094  -0.0248 -0.0075 329 VAL A O   
2650 C  CB  . VAL A 329 ? 0.0839 0.0861 0.0585 0.0035  -0.0175 -0.0028 329 VAL A CB  
2651 C  CG1 . VAL A 329 ? 0.1234 0.0703 0.0977 -0.0069 -0.0233 0.0017  329 VAL A CG1 
2652 C  CG2 . VAL A 329 ? 0.0866 0.1084 0.1194 -0.0143 -0.0081 -0.0177 329 VAL A CG2 
2653 N  N   . ARG A 330 ? 0.0753 0.0834 0.0768 -0.0110 -0.0157 -0.0099 330 ARG A N   
2654 C  CA  . ARG A 330 ? 0.0684 0.0730 0.0739 0.0014  -0.0103 0.0099  330 ARG A CA  
2655 C  C   . ARG A 330 ? 0.0775 0.0628 0.0870 -0.0170 -0.0014 -0.0030 330 ARG A C   
2656 O  O   . ARG A 330 ? 0.0732 0.0839 0.0907 -0.0136 -0.0186 -0.0035 330 ARG A O   
2657 C  CB  . ARG A 330 ? 0.0788 0.0664 0.1027 0.0027  -0.0073 0.0025  330 ARG A CB  
2658 C  CG  . ARG A 330 ? 0.0929 0.0896 0.0789 -0.0162 -0.0222 -0.0008 330 ARG A CG  
2659 C  CD  . ARG A 330 ? 0.0847 0.1142 0.1121 0.0027  -0.0129 0.0114  330 ARG A CD  
2660 N  NE  . ARG A 330 ? 0.1336 0.0885 0.0965 0.0192  -0.0248 -0.0148 330 ARG A NE  
2661 C  CZ  . ARG A 330 ? 0.1299 0.0979 0.0952 0.0011  -0.0431 -0.0136 330 ARG A CZ  
2662 N  NH1 . ARG A 330 ? 0.1397 0.1102 0.0794 0.0246  -0.0270 -0.0016 330 ARG A NH1 
2663 N  NH2 . ARG A 330 ? 0.1412 0.1028 0.1422 0.0211  -0.0669 -0.0274 330 ARG A NH2 
2664 N  N   . GLN A 331 ? 0.0766 0.0748 0.0990 -0.0192 -0.0342 0.0100  331 GLN A N   
2665 C  CA  . GLN A 331 ? 0.0763 0.0853 0.1050 -0.0001 -0.0214 0.0085  331 GLN A CA  
2666 C  C   . GLN A 331 ? 0.0944 0.0900 0.0819 0.0029  -0.0140 0.0106  331 GLN A C   
2667 O  O   . GLN A 331 ? 0.0867 0.0951 0.1139 -0.0038 -0.0295 0.0172  331 GLN A O   
2668 C  CB  . GLN A 331 ? 0.1233 0.1161 0.1488 0.0115  -0.0711 0.0341  331 GLN A CB  
2669 C  CG  . GLN A 331 ? 0.1779 0.1301 0.2428 -0.0108 -0.0780 0.0216  331 GLN A CG  
2670 C  CD  . GLN A 331 ? 0.2986 0.1709 0.3339 0.0392  -0.0140 0.0353  331 GLN A CD  
2671 O  OE1 . GLN A 331 ? 0.3024 0.2049 0.4545 -0.0380 -0.0224 0.0352  331 GLN A OE1 
2672 N  NE2 . GLN A 331 ? 0.4023 0.2596 0.4394 0.1044  -0.0817 -0.0703 331 GLN A NE2 
2673 N  N   . THR A 332 ? 0.0744 0.0964 0.0993 -0.0091 -0.0163 0.0000  332 THR A N   
2674 C  CA  . THR A 332 ? 0.1044 0.1187 0.0681 0.0018  0.0035  0.0217  332 THR A CA  
2675 C  C   . THR A 332 ? 0.0627 0.0885 0.0829 -0.0061 -0.0030 0.0001  332 THR A C   
2676 O  O   . THR A 332 ? 0.0685 0.1172 0.0815 -0.0064 -0.0080 0.0078  332 THR A O   
2677 C  CB  . THR A 332 ? 0.0877 0.1409 0.1200 -0.0379 0.0241  -0.0062 332 THR A CB  
2678 O  OG1 . THR A 332 ? 0.1375 0.1803 0.1334 -0.0607 -0.0031 0.0180  332 THR A OG1 
2679 C  CG2 . THR A 332 ? 0.1031 0.1788 0.1205 -0.0214 0.0261  -0.0250 332 THR A CG2 
2680 N  N   . ALA A 333 ? 0.0661 0.0801 0.0712 -0.0024 -0.0168 0.0048  333 ALA A N   
2681 C  CA  . ALA A 333 ? 0.0612 0.0627 0.0885 0.0070  -0.0005 -0.0108 333 ALA A CA  
2682 C  C   . ALA A 333 ? 0.0563 0.0731 0.0744 -0.0042 -0.0210 -0.0059 333 ALA A C   
2683 O  O   . ALA A 333 ? 0.0658 0.0658 0.0808 0.0056  -0.0186 -0.0007 333 ALA A O   
2684 C  CB  . ALA A 333 ? 0.0899 0.0932 0.0806 0.0179  -0.0269 0.0169  333 ALA A CB  
2685 N  N   . ALA A 334 ? 0.0541 0.0549 0.0753 0.0000  -0.0140 -0.0051 334 ALA A N   
2686 C  CA  . ALA A 334 ? 0.0529 0.0672 0.0665 0.0029  -0.0088 0.0015  334 ALA A CA  
2687 C  C   . ALA A 334 ? 0.0563 0.0654 0.0720 0.0009  -0.0065 -0.0008 334 ALA A C   
2688 O  O   . ALA A 334 ? 0.0618 0.0727 0.0806 -0.0041 -0.0125 0.0021  334 ALA A O   
2689 C  CB  . ALA A 334 ? 0.0891 0.0702 0.0920 0.0133  0.0017  -0.0230 334 ALA A CB  
2690 N  N   . GLN A 335 ? 0.0670 0.0702 0.0617 -0.0021 -0.0075 0.0087  335 GLN A N   
2691 C  CA  . GLN A 335 ? 0.0651 0.0550 0.0695 0.0024  -0.0079 0.0080  335 GLN A CA  
2692 C  C   . GLN A 335 ? 0.0680 0.0688 0.0545 0.0033  -0.0116 0.0025  335 GLN A C   
2693 O  O   . GLN A 335 ? 0.0776 0.0714 0.0768 -0.0061 -0.0199 0.0074  335 GLN A O   
2694 C  CB  . GLN A 335 ? 0.1138 0.0914 0.0874 0.0032  -0.0414 0.0259  335 GLN A CB  
2695 C  CG  . GLN A 335 ? 0.2210 0.1738 0.1465 -0.0020 -0.0175 0.0307  335 GLN A CG  
2696 C  CD  . GLN A 335 ? 0.4072 0.2800 0.4420 -0.0624 0.1304  0.0665  335 GLN A CD  
2697 O  OE1 . GLN A 335 ? 0.4071 0.3310 0.5097 -0.1230 0.1262  0.0625  335 GLN A OE1 
2698 N  NE2 . GLN A 335 ? 0.4444 0.2266 0.5500 -0.0829 0.0863  -0.0195 335 GLN A NE2 
2699 N  N   . ILE A 336 ? 0.0522 0.0603 0.0718 0.0055  -0.0041 0.0078  336 ILE A N   
2700 C  CA  . ILE A 336 ? 0.0612 0.0648 0.0584 0.0105  -0.0120 0.0103  336 ILE A CA  
2701 C  C   . ILE A 336 ? 0.0545 0.0597 0.0602 0.0040  -0.0211 -0.0026 336 ILE A C   
2702 O  O   . ILE A 336 ? 0.0719 0.0670 0.0692 0.0019  -0.0151 -0.0058 336 ILE A O   
2703 C  CB  . ILE A 336 ? 0.0729 0.0827 0.0759 -0.0023 -0.0148 0.0047  336 ILE A CB  
2704 C  CG1 . ILE A 336 ? 0.0632 0.0862 0.1112 0.0106  -0.0069 0.0088  336 ILE A CG1 
2705 C  CG2 . ILE A 336 ? 0.0822 0.0676 0.1058 0.0272  -0.0062 -0.0145 336 ILE A CG2 
2706 C  CD1 . ILE A 336 ? 0.1187 0.1333 0.0919 0.0141  0.0016  0.0265  336 ILE A CD1 
2707 N  N   . ALA A 337 ? 0.0617 0.0686 0.0544 -0.0040 -0.0109 0.0106  337 ALA A N   
2708 C  CA  . ALA A 337 ? 0.0600 0.0538 0.0709 0.0023  -0.0075 0.0124  337 ALA A CA  
2709 C  C   . ALA A 337 ? 0.0730 0.0671 0.0597 -0.0056 0.0025  -0.0004 337 ALA A C   
2710 O  O   . ALA A 337 ? 0.0792 0.0747 0.0706 -0.0050 -0.0043 0.0004  337 ALA A O   
2711 C  CB  . ALA A 337 ? 0.0849 0.0956 0.0477 -0.0185 -0.0048 0.0070  337 ALA A CB  
2712 N  N   . ASP A 338 ? 0.0610 0.0547 0.0705 -0.0021 -0.0212 0.0086  338 ASP A N   
2713 C  CA  . ASP A 338 ? 0.0644 0.0646 0.0613 0.0123  -0.0014 -0.0057 338 ASP A CA  
2714 C  C   . ASP A 338 ? 0.0682 0.0702 0.0637 0.0035  -0.0089 0.0021  338 ASP A C   
2715 O  O   . ASP A 338 ? 0.0631 0.1099 0.0714 -0.0152 -0.0117 0.0043  338 ASP A O   
2716 C  CB  . ASP A 338 ? 0.0719 0.0781 0.0725 0.0139  -0.0022 -0.0020 338 ASP A CB  
2717 C  CG  . ASP A 338 ? 0.1104 0.1163 0.0953 0.0075  0.0092  0.0141  338 ASP A CG  
2718 O  OD1 . ASP A 338 ? 0.1183 0.1428 0.1468 0.0432  0.0196  0.0467  338 ASP A OD1 
2719 O  OD2 . ASP A 338 ? 0.0958 0.1432 0.1151 0.0151  -0.0230 0.0116  338 ASP A OD2 
2720 N  N   . TYR A 339 ? 0.0562 0.0729 0.0571 -0.0029 0.0020  0.0011  339 TYR A N   
2721 C  CA  . TYR A 339 ? 0.0597 0.0486 0.0493 0.0076  -0.0139 0.0007  339 TYR A CA  
2722 C  C   . TYR A 339 ? 0.0552 0.0666 0.0684 -0.0024 -0.0079 -0.0045 339 TYR A C   
2723 O  O   . TYR A 339 ? 0.0705 0.0634 0.0679 -0.0079 -0.0190 0.0060  339 TYR A O   
2724 C  CB  . TYR A 339 ? 0.0739 0.0711 0.0534 -0.0070 -0.0067 0.0095  339 TYR A CB  
2725 C  CG  . TYR A 339 ? 0.0622 0.0726 0.0484 -0.0059 0.0025  0.0033  339 TYR A CG  
2726 C  CD1 . TYR A 339 ? 0.0718 0.0545 0.0776 0.0037  -0.0021 0.0018  339 TYR A CD1 
2727 C  CD2 . TYR A 339 ? 0.0747 0.0807 0.0586 -0.0045 -0.0093 -0.0097 339 TYR A CD2 
2728 C  CE1 . TYR A 339 ? 0.0729 0.0776 0.0589 -0.0076 -0.0181 0.0059  339 TYR A CE1 
2729 C  CE2 . TYR A 339 ? 0.0624 0.0712 0.0751 -0.0030 -0.0154 0.0137  339 TYR A CE2 
2730 C  CZ  . TYR A 339 ? 0.0744 0.0614 0.0640 0.0006  -0.0202 -0.0041 339 TYR A CZ  
2731 O  OH  . TYR A 339 ? 0.0810 0.0774 0.0817 0.0051  -0.0081 -0.0108 339 TYR A OH  
2732 N  N   . ILE A 340 ? 0.0615 0.0626 0.0577 0.0040  -0.0103 0.0019  340 ILE A N   
2733 C  CA  . ILE A 340 ? 0.0541 0.0626 0.0572 -0.0017 -0.0140 0.0054  340 ILE A CA  
2734 C  C   . ILE A 340 ? 0.0664 0.0554 0.0572 -0.0101 -0.0147 0.0025  340 ILE A C   
2735 O  O   . ILE A 340 ? 0.0719 0.0606 0.0716 -0.0118 -0.0115 0.0048  340 ILE A O   
2736 C  CB  . ILE A 340 ? 0.0547 0.0604 0.0762 -0.0138 -0.0151 0.0071  340 ILE A CB  
2737 C  CG1 . ILE A 340 ? 0.0804 0.0710 0.0855 -0.0242 -0.0017 -0.0034 340 ILE A CG1 
2738 C  CG2 . ILE A 340 ? 0.0840 0.0903 0.0461 -0.0077 -0.0125 0.0121  340 ILE A CG2 
2739 C  CD1 . ILE A 340 ? 0.0868 0.0906 0.0949 0.0223  -0.0209 0.0091  340 ILE A CD1 
2740 N  N   . ARG A 341 ? 0.0614 0.0594 0.0551 -0.0080 0.0026  -0.0058 341 ARG A N   
2741 C  CA  . ARG A 341 ? 0.0629 0.0526 0.0691 -0.0145 -0.0060 0.0091  341 ARG A CA  
2742 C  C   . ARG A 341 ? 0.0496 0.0751 0.0550 -0.0141 -0.0030 0.0027  341 ARG A C   
2743 O  O   . ARG A 341 ? 0.0701 0.0798 0.0660 -0.0216 -0.0039 0.0093  341 ARG A O   
2744 C  CB  . ARG A 341 ? 0.0466 0.0605 0.0810 0.0061  0.0020  0.0086  341 ARG A CB  
2745 C  CG  . ARG A 341 ? 0.0720 0.0845 0.0605 -0.0043 -0.0123 0.0268  341 ARG A CG  
2746 C  CD  . ARG A 341 ? 0.0906 0.0807 0.0694 -0.0011 -0.0061 0.0117  341 ARG A CD  
2747 N  NE  . ARG A 341 ? 0.0870 0.0652 0.0795 -0.0060 -0.0103 0.0318  341 ARG A NE  
2748 C  CZ  . ARG A 341 ? 0.0850 0.0796 0.0600 -0.0072 -0.0090 0.0222  341 ARG A CZ  
2749 N  NH1 . ARG A 341 ? 0.0701 0.0708 0.0861 -0.0124 -0.0112 0.0103  341 ARG A NH1 
2750 N  NH2 . ARG A 341 ? 0.0878 0.0954 0.0839 -0.0036 -0.0113 -0.0082 341 ARG A NH2 
2751 N  N   . ARG A 342 ? 0.0670 0.0638 0.0681 -0.0214 -0.0186 0.0138  342 ARG A N   
2752 C  CA  . ARG A 342 ? 0.0635 0.0635 0.0748 -0.0028 -0.0212 0.0061  342 ARG A CA  
2753 C  C   . ARG A 342 ? 0.0749 0.0763 0.0778 -0.0088 -0.0178 0.0142  342 ARG A C   
2754 O  O   . ARG A 342 ? 0.0928 0.0941 0.0963 -0.0106 -0.0273 -0.0043 342 ARG A O   
2755 C  CB  . ARG A 342 ? 0.0829 0.0930 0.0777 0.0030  -0.0250 0.0196  342 ARG A CB  
2756 C  CG  . ARG A 342 ? 0.1031 0.0722 0.1152 -0.0053 -0.0125 0.0239  342 ARG A CG  
2757 C  CD  . ARG A 342 ? 0.1167 0.1171 0.1323 0.0108  -0.0324 0.0208  342 ARG A CD  
2758 N  NE  . ARG A 342 ? 0.1115 0.1201 0.1685 -0.0040 -0.0438 0.0399  342 ARG A NE  
2759 C  CZ  . ARG A 342 ? 0.1488 0.1328 0.1338 0.0100  -0.0269 0.0210  342 ARG A CZ  
2760 N  NH1 . ARG A 342 ? 0.1487 0.1098 0.1628 0.0190  -0.0100 0.0459  342 ARG A NH1 
2761 N  NH2 . ARG A 342 ? 0.1717 0.1789 0.1861 -0.0054 -0.0422 0.0378  342 ARG A NH2 
2762 N  N   . MET A 343 ? 0.0720 0.0667 0.0790 -0.0001 -0.0202 -0.0092 343 MET A N   
2763 C  CA  . MET A 343 ? 0.0889 0.0751 0.0775 0.0047  -0.0158 -0.0112 343 MET A CA  
2764 C  C   . MET A 343 ? 0.0829 0.0734 0.0778 -0.0055 -0.0041 -0.0023 343 MET A C   
2765 O  O   . MET A 343 ? 0.1033 0.0911 0.1076 -0.0248 0.0008  -0.0203 343 MET A O   
2766 C  CB  . MET A 343 ? 0.1044 0.0850 0.0878 -0.0140 -0.0187 -0.0171 343 MET A CB  
2767 C  CG  . MET A 343 ? 0.0780 0.1188 0.1086 -0.0148 -0.0097 -0.0085 343 MET A CG  
2768 S  SD  . MET A 343 ? 0.0889 0.1051 0.0949 0.0039  -0.0074 0.0051  343 MET A SD  
2769 C  CE  . MET A 343 ? 0.1211 0.0952 0.1334 -0.0122 -0.0024 -0.0033 343 MET A CE  
2770 N  N   . GLY A 344 ? 0.0795 0.0755 0.0679 -0.0107 -0.0113 0.0001  344 GLY A N   
2771 C  CA  . GLY A 344 ? 0.0914 0.1265 0.0800 -0.0100 -0.0151 0.0216  344 GLY A CA  
2772 C  C   . GLY A 344 ? 0.0932 0.1198 0.1231 -0.0299 -0.0374 0.0069  344 GLY A C   
2773 O  O   . GLY A 344 ? 0.1543 0.0818 0.2756 -0.0138 -0.1192 -0.0101 344 GLY A O   
2774 N  N   . PRO A 345 ? 0.1419 0.1146 0.1001 -0.0131 -0.0091 -0.0122 345 PRO A N   
2775 C  CA  . PRO A 345 ? 0.1978 0.1274 0.1339 -0.0398 0.0516  -0.0314 345 PRO A CA  
2776 C  C   . PRO A 345 ? 0.1133 0.0792 0.0942 -0.0314 0.0119  -0.0176 345 PRO A C   
2777 O  O   . PRO A 345 ? 0.1210 0.1079 0.1053 -0.0059 -0.0037 0.0116  345 PRO A O   
2778 C  CB  . PRO A 345 ? 0.1875 0.1017 0.2067 -0.0689 0.0755  -0.0226 345 PRO A CB  
2779 C  CG  . PRO A 345 ? 0.1756 0.2661 0.2926 -0.0571 0.0089  -0.0976 345 PRO A CG  
2780 C  CD  . PRO A 345 ? 0.1301 0.1709 0.2328 -0.0282 0.0334  -0.0902 345 PRO A CD  
2781 N  N   . PHE A 346 ? 0.1363 0.1269 0.1191 -0.0644 0.0311  -0.0078 346 PHE A N   
2782 C  CA  . PHE A 346 ? 0.1143 0.0885 0.1044 -0.0389 -0.0157 0.0111  346 PHE A CA  
2783 C  C   . PHE A 346 ? 0.0929 0.1004 0.0795 -0.0226 -0.0251 0.0172  346 PHE A C   
2784 O  O   . PHE A 346 ? 0.1200 0.0818 0.0905 -0.0431 -0.0249 0.0079  346 PHE A O   
2785 C  CB  . PHE A 346 ? 0.0907 0.0965 0.0956 -0.0356 -0.0081 0.0014  346 PHE A CB  
2786 C  CG  . PHE A 346 ? 0.0844 0.1002 0.0834 -0.0270 -0.0089 0.0045  346 PHE A CG  
2787 C  CD1 . PHE A 346 ? 0.1071 0.0785 0.0753 -0.0040 -0.0199 -0.0002 346 PHE A CD1 
2788 C  CD2 . PHE A 346 ? 0.1004 0.1220 0.1405 -0.0340 -0.0091 -0.0492 346 PHE A CD2 
2789 C  CE1 . PHE A 346 ? 0.1071 0.0769 0.0948 -0.0150 -0.0252 -0.0082 346 PHE A CE1 
2790 C  CE2 . PHE A 346 ? 0.0864 0.1241 0.1592 -0.0084 -0.0015 -0.0118 346 PHE A CE2 
2791 C  CZ  . PHE A 346 ? 0.0948 0.1047 0.0886 -0.0294 -0.0275 -0.0027 346 PHE A CZ  
2792 N  N   . GLN A 347 ? 0.1168 0.0752 0.0987 -0.0213 -0.0190 0.0056  347 GLN A N   
2793 C  CA  . GLN A 347 ? 0.1185 0.0743 0.1028 -0.0223 -0.0123 0.0029  347 GLN A CA  
2794 C  C   . GLN A 347 ? 0.1087 0.0959 0.0926 -0.0065 -0.0064 -0.0013 347 GLN A C   
2795 O  O   . GLN A 347 ? 0.1281 0.1019 0.0957 -0.0252 -0.0267 0.0061  347 GLN A O   
2796 C  CB  . GLN A 347 ? 0.1525 0.0986 0.1054 -0.0200 -0.0257 -0.0012 347 GLN A CB  
2797 C  CG  . GLN A 347 ? 0.1903 0.1322 0.1050 -0.0408 -0.0127 0.0001  347 GLN A CG  
2798 C  CD  . GLN A 347 ? 0.1683 0.0998 0.1310 0.0081  -0.0377 -0.0403 347 GLN A CD  
2799 O  OE1 . GLN A 347 ? 0.1655 0.1708 0.2481 0.0126  -0.0304 -0.0810 347 GLN A OE1 
2800 N  NE2 . GLN A 347 ? 0.1782 0.1172 0.1649 -0.0131 -0.0682 0.0044  347 GLN A NE2 
2801 N  N   . PRO A 348 ? 0.0913 0.0742 0.0947 -0.0159 -0.0143 0.0090  348 PRO A N   
2802 C  CA  . PRO A 348 ? 0.1046 0.0647 0.1056 -0.0001 -0.0139 0.0127  348 PRO A CA  
2803 C  C   . PRO A 348 ? 0.1028 0.0653 0.0984 -0.0068 -0.0066 0.0015  348 PRO A C   
2804 O  O   . PRO A 348 ? 0.1059 0.1011 0.1204 0.0042  -0.0230 -0.0144 348 PRO A O   
2805 C  CB  . PRO A 348 ? 0.1106 0.0719 0.1302 0.0100  -0.0017 0.0158  348 PRO A CB  
2806 C  CG  . PRO A 348 ? 0.1109 0.1041 0.1545 0.0034  0.0128  0.0237  348 PRO A CG  
2807 C  CD  . PRO A 348 ? 0.1102 0.0800 0.1204 -0.0092 -0.0114 0.0132  348 PRO A CD  
2808 N  N   . HIS A 349 ? 0.0854 0.0708 0.0797 0.0025  -0.0148 0.0022  349 HIS A N   
2809 C  CA  . HIS A 349 ? 0.0669 0.0658 0.0815 -0.0122 -0.0145 -0.0031 349 HIS A CA  
2810 C  C   . HIS A 349 ? 0.0832 0.0710 0.0731 -0.0104 -0.0266 0.0191  349 HIS A C   
2811 O  O   . HIS A 349 ? 0.1157 0.0767 0.0852 -0.0174 -0.0340 0.0115  349 HIS A O   
2812 C  CB  . HIS A 349 ? 0.0769 0.0681 0.0870 -0.0062 -0.0144 0.0057  349 HIS A CB  
2813 C  CG  . HIS A 349 ? 0.0880 0.0558 0.0755 -0.0032 -0.0240 0.0050  349 HIS A CG  
2814 N  ND1 . HIS A 349 ? 0.0834 0.0572 0.0732 -0.0123 -0.0216 0.0054  349 HIS A ND1 
2815 C  CD2 . HIS A 349 ? 0.0707 0.0856 0.0779 0.0016  -0.0248 0.0060  349 HIS A CD2 
2816 C  CE1 . HIS A 349 ? 0.0905 0.0680 0.0646 -0.0148 -0.0197 0.0079  349 HIS A CE1 
2817 N  NE2 . HIS A 349 ? 0.0944 0.0669 0.0826 0.0000  -0.0202 0.0089  349 HIS A NE2 
2818 N  N   . ARG A 350 ? 0.0906 0.0728 0.0919 -0.0158 -0.0273 0.0067  350 ARG A N   
2819 C  CA  . ARG A 350 ? 0.0855 0.0788 0.0683 -0.0087 -0.0205 0.0105  350 ARG A CA  
2820 C  C   . ARG A 350 ? 0.0995 0.0816 0.0925 -0.0193 -0.0107 -0.0046 350 ARG A C   
2821 O  O   . ARG A 350 ? 0.1289 0.0894 0.0969 -0.0041 -0.0012 -0.0048 350 ARG A O   
2822 C  CB  . ARG A 350 ? 0.1033 0.0788 0.0965 -0.0054 -0.0260 0.0170  350 ARG A CB  
2823 C  CG  . ARG A 350 ? 0.0912 0.0930 0.0786 -0.0273 -0.0324 0.0054  350 ARG A CG  
2824 C  CD  . ARG A 350 ? 0.1001 0.0884 0.1014 -0.0092 -0.0197 0.0143  350 ARG A CD  
2825 N  NE  . ARG A 350 ? 0.1082 0.0754 0.1209 -0.0155 -0.0278 -0.0035 350 ARG A NE  
2826 C  CZ  . ARG A 350 ? 0.1064 0.0853 0.1024 -0.0050 -0.0228 -0.0060 350 ARG A CZ  
2827 N  NH1 . ARG A 350 ? 0.1396 0.0847 0.1194 0.0018  -0.0253 -0.0130 350 ARG A NH1 
2828 N  NH2 . ARG A 350 ? 0.1140 0.0852 0.1275 -0.0058 -0.0355 -0.0126 350 ARG A NH2 
2829 N  N   . LEU A 351 ? 0.1001 0.0720 0.0927 -0.0097 -0.0165 0.0030  351 LEU A N   
2830 C  CA  . LEU A 351 ? 0.1106 0.0971 0.1007 -0.0053 -0.0124 -0.0115 351 LEU A CA  
2831 C  C   . LEU A 351 ? 0.1109 0.0971 0.1109 -0.0024 -0.0133 0.0025  351 LEU A C   
2832 O  O   . LEU A 351 ? 0.1078 0.0737 0.1201 0.0059  -0.0245 0.0030  351 LEU A O   
2833 C  CB  . LEU A 351 ? 0.1076 0.1147 0.1274 0.0074  -0.0245 -0.0057 351 LEU A CB  
2834 C  CG  . LEU A 351 ? 0.1086 0.1371 0.1655 0.0186  -0.0451 -0.0224 351 LEU A CG  
2835 C  CD1 . LEU A 351 ? 0.1485 0.2159 0.1355 0.0283  -0.0524 -0.0168 351 LEU A CD1 
2836 C  CD2 . LEU A 351 ? 0.1486 0.1711 0.1993 -0.0363 -0.0415 -0.0260 351 LEU A CD2 
2837 N  N   . PRO A 352 ? 0.1267 0.1169 0.1411 0.0031  -0.0119 -0.0134 352 PRO A N   
2838 C  CA  . PRO A 352 ? 0.1596 0.1364 0.1402 0.0258  -0.0240 -0.0134 352 PRO A CA  
2839 C  C   . PRO A 352 ? 0.1519 0.1212 0.1397 0.0370  -0.0347 -0.0103 352 PRO A C   
2840 O  O   . PRO A 352 ? 0.1732 0.1103 0.1480 0.0365  -0.0211 0.0079  352 PRO A O   
2841 C  CB  . PRO A 352 ? 0.1728 0.1431 0.1951 0.0557  -0.0036 -0.0188 352 PRO A CB  
2842 C  CG  . PRO A 352 ? 0.1544 0.2103 0.1517 0.0272  -0.0253 -0.0211 352 PRO A CG  
2843 C  CD  . PRO A 352 ? 0.1381 0.1337 0.1622 0.0160  -0.0029 -0.0051 352 PRO A CD  
2844 N  N   . PRO A 353 ? 0.2106 0.1151 0.1656 0.0245  -0.0380 0.0067  353 PRO A N   
2845 C  CA  . PRO A 353 ? 0.2424 0.1443 0.2117 -0.0105 -0.0298 -0.0315 353 PRO A CA  
2846 C  C   . PRO A 353 ? 0.2909 0.1926 0.2019 -0.0025 0.0104  -0.0071 353 PRO A C   
2847 O  O   . PRO A 353 ? 0.3920 0.1498 0.2646 -0.0041 0.0431  0.0178  353 PRO A O   
2848 C  CB  . PRO A 353 ? 0.2930 0.1919 0.2587 -0.0231 -0.0106 -0.0663 353 PRO A CB  
2849 C  CG  . PRO A 353 ? 0.3274 0.1847 0.2163 -0.0112 -0.0737 0.0350  353 PRO A CG  
2850 C  CD  . PRO A 353 ? 0.2326 0.0987 0.1677 0.0179  -0.0440 -0.0438 353 PRO A CD  
2851 N  N   . GLU A 354 ? 0.3287 0.1563 0.2039 0.0606  -0.0468 0.0051  354 GLU A N   
2852 C  CA  . GLU A 354 ? 0.3748 0.2257 0.2697 0.0968  -0.0512 0.0207  354 GLU A CA  
2853 C  C   . GLU A 354 ? 0.3221 0.2126 0.2112 0.1123  -0.0812 0.0327  354 GLU A C   
2854 O  O   . GLU A 354 ? 0.4255 0.2467 0.2665 0.1165  -0.0601 0.0782  354 GLU A O   
2855 C  CB  . GLU A 354 ? 0.4407 0.3155 0.3067 0.1170  -0.0426 0.0143  354 GLU A CB  
2856 C  CG  . GLU A 354 ? 0.4400 0.3761 0.3758 0.1130  -0.0669 0.0285  354 GLU A CG  
2857 C  CD  . GLU A 354 ? 0.4866 0.3797 0.4803 0.0105  0.0048  0.1096  354 GLU A CD  
2858 O  OE1 . GLU A 354 ? 0.3386 0.2396 0.3285 0.1084  -0.0629 -0.0013 354 GLU A OE1 
2859 O  OE2 . GLU A 354 ? 0.5917 0.2456 0.4262 0.0644  0.1348  0.0586  354 GLU A OE2 
2860 N  N   . GLU A 355 ? 0.2582 0.1594 0.1922 0.0877  -0.0390 0.0130  355 GLU A N   
2861 C  CA  . GLU A 355 ? 0.2177 0.2214 0.1979 0.0710  -0.0713 0.0285  355 GLU A CA  
2862 C  C   . GLU A 355 ? 0.2183 0.1967 0.2020 0.0433  -0.0515 -0.0074 355 GLU A C   
2863 O  O   . GLU A 355 ? 0.2678 0.3254 0.2326 -0.0275 -0.0462 -0.0386 355 GLU A O   
2864 C  CB  . GLU A 355 ? 0.2352 0.2496 0.2383 0.0557  -0.0440 0.0498  355 GLU A CB  
2865 C  CG  . GLU A 355 ? 0.2588 0.2772 0.3270 0.0414  -0.0016 0.0274  355 GLU A CG  
2866 C  CD  . GLU A 355 ? 0.3470 0.3679 0.3984 -0.0068 -0.0337 0.0109  355 GLU A CD  
2867 O  OE1 . GLU A 355 ? 0.3169 0.4236 0.3872 -0.0374 -0.0472 -0.0319 355 GLU A OE1 
2868 O  OE2 . GLU A 355 ? 0.2565 0.2342 0.3459 -0.0274 -0.0994 0.0746  355 GLU A OE2 
2869 N  N   . MET A 356 ? 0.2104 0.1932 0.1614 0.0213  -0.0325 -0.0069 356 MET A N   
2870 C  CA  A MET A 356 ? 0.2293 0.1629 0.1674 0.0394  -0.0226 0.0118  356 MET A CA  
2871 C  CA  B MET A 356 ? 0.1965 0.1566 0.1500 0.0499  -0.0256 0.0087  356 MET A CA  
2872 C  C   . MET A 356 ? 0.2155 0.1442 0.1602 0.0373  -0.0249 0.0050  356 MET A C   
2873 O  O   . MET A 356 ? 0.3080 0.1296 0.1980 0.0170  -0.0346 -0.0131 356 MET A O   
2874 C  CB  A MET A 356 ? 0.2497 0.1812 0.1862 0.0438  -0.0182 0.0153  356 MET A CB  
2875 C  CB  B MET A 356 ? 0.1967 0.1578 0.1580 0.0682  -0.0216 0.0085  356 MET A CB  
2876 C  CG  A MET A 356 ? 0.3421 0.1647 0.1949 -0.0281 -0.0055 0.0413  356 MET A CG  
2877 C  CG  B MET A 356 ? 0.0824 0.2026 0.0563 0.0163  -0.0080 0.0164  356 MET A CG  
2878 S  SD  A MET A 356 ? 0.5125 0.3468 0.3258 -0.0487 -0.0645 0.0438  356 MET A SD  
2879 S  SD  B MET A 356 ? 0.1208 0.0876 0.1030 0.0096  -0.0272 0.0126  356 MET A SD  
2880 C  CE  A MET A 356 ? 0.5423 0.2214 0.2317 -0.0728 -0.0816 0.0248  356 MET A CE  
2881 C  CE  B MET A 356 ? 0.0807 0.1831 0.1726 0.0100  -0.0045 0.0665  356 MET A CE  
2882 N  N   . GLU A 357 ? 0.2020 0.1070 0.1494 0.0175  -0.0090 0.0251  357 GLU A N   
2883 C  CA  . GLU A 357 ? 0.1748 0.1257 0.1602 0.0236  -0.0154 0.0314  357 GLU A CA  
2884 C  C   . GLU A 357 ? 0.1661 0.1250 0.1730 0.0043  -0.0133 0.0313  357 GLU A C   
2885 O  O   . GLU A 357 ? 0.2147 0.1593 0.2031 -0.0409 -0.0427 0.0585  357 GLU A O   
2886 C  CB  . GLU A 357 ? 0.1872 0.1338 0.1370 0.0174  -0.0131 0.0224  357 GLU A CB  
2887 C  CG  . GLU A 357 ? 0.1896 0.1212 0.1653 -0.0138 -0.0398 0.0219  357 GLU A CG  
2888 C  CD  . GLU A 357 ? 0.1834 0.1536 0.1405 -0.0319 0.0023  0.0030  357 GLU A CD  
2889 O  OE1 . GLU A 357 ? 0.2726 0.1793 0.1950 -0.0237 -0.0446 0.0349  357 GLU A OE1 
2890 O  OE2 . GLU A 357 ? 0.2154 0.1610 0.1764 -0.0117 0.0035  0.0329  357 GLU A OE2 
2891 N  N   . TYR A 358 ? 0.1593 0.1042 0.1820 0.0010  -0.0175 0.0332  358 TYR A N   
2892 C  CA  . TYR A 358 ? 0.1855 0.1111 0.1710 -0.0087 -0.0103 0.0241  358 TYR A CA  
2893 C  C   . TYR A 358 ? 0.1757 0.1294 0.1666 -0.0087 -0.0135 0.0199  358 TYR A C   
2894 O  O   . TYR A 358 ? 0.1926 0.1444 0.1688 -0.0119 -0.0095 0.0357  358 TYR A O   
2895 C  CB  . TYR A 358 ? 0.1868 0.1219 0.1755 -0.0090 -0.0278 0.0246  358 TYR A CB  
2896 C  CG  . TYR A 358 ? 0.1598 0.1051 0.1723 0.0240  -0.0253 0.0196  358 TYR A CG  
2897 C  CD1 . TYR A 358 ? 0.1813 0.0953 0.1554 -0.0030 -0.0011 0.0378  358 TYR A CD1 
2898 C  CD2 . TYR A 358 ? 0.1277 0.1842 0.1689 0.0175  0.0003  0.0064  358 TYR A CD2 
2899 C  CE1 . TYR A 358 ? 0.1960 0.1532 0.1337 -0.0113 -0.0146 0.0232  358 TYR A CE1 
2900 C  CE2 . TYR A 358 ? 0.1502 0.1248 0.1892 0.0155  0.0124  0.0360  358 TYR A CE2 
2901 C  CZ  . TYR A 358 ? 0.1833 0.1235 0.1435 0.0101  -0.0070 0.0298  358 TYR A CZ  
2902 O  OH  . TYR A 358 ? 0.1687 0.1404 0.1665 0.0053  -0.0171 0.0333  358 TYR A OH  
2903 N  N   . THR A 359 ? 0.2002 0.1057 0.1780 0.0030  -0.0461 0.0302  359 THR A N   
2904 C  CA  . THR A 359 ? 0.1754 0.1189 0.1667 0.0034  -0.0396 0.0034  359 THR A CA  
2905 C  C   . THR A 359 ? 0.1639 0.1408 0.1727 -0.0268 -0.0216 0.0245  359 THR A C   
2906 O  O   . THR A 359 ? 0.1941 0.1444 0.1840 -0.0193 -0.0212 0.0326  359 THR A O   
2907 C  CB  . THR A 359 ? 0.1930 0.1327 0.1674 0.0130  -0.0395 -0.0194 359 THR A CB  
2908 O  OG1 . THR A 359 ? 0.2223 0.1677 0.1761 -0.0066 -0.0408 -0.0093 359 THR A OG1 
2909 C  CG2 . THR A 359 ? 0.2961 0.1394 0.2501 0.0605  -0.0237 0.0155  359 THR A CG2 
2910 N  N   . ALA A 360 ? 0.1788 0.1276 0.1750 -0.0351 -0.0422 0.0353  360 ALA A N   
2911 C  CA  . ALA A 360 ? 0.2013 0.1301 0.1731 -0.0468 -0.0106 0.0349  360 ALA A CA  
2912 C  C   . ALA A 360 ? 0.1994 0.1324 0.1963 -0.0431 -0.0116 0.0209  360 ALA A C   
2913 O  O   . ALA A 360 ? 0.2318 0.1466 0.2460 -0.0652 -0.0383 0.0263  360 ALA A O   
2914 C  CB  . ALA A 360 ? 0.1862 0.1567 0.2411 -0.0228 -0.0430 0.0505  360 ALA A CB  
2915 N  N   . LEU A 361 ? 0.2113 0.1300 0.1665 -0.0066 -0.0259 0.0023  361 LEU A N   
2916 C  CA  . LEU A 361 ? 0.2680 0.1298 0.2332 -0.0140 -0.0287 0.0010  361 LEU A CA  
2917 C  C   . LEU A 361 ? 0.2990 0.1536 0.2421 -0.0309 -0.0457 0.0241  361 LEU A C   
2918 O  O   . LEU A 361 ? 0.2918 0.1418 0.2792 -0.0485 -0.0572 -0.0084 361 LEU A O   
2919 C  CB  . LEU A 361 ? 0.2854 0.1367 0.2393 0.0126  -0.0283 0.0191  361 LEU A CB  
2920 C  CG  . LEU A 361 ? 0.2711 0.1700 0.2434 -0.0236 0.0067  -0.0029 361 LEU A CG  
2921 C  CD1 . LEU A 361 ? 0.2884 0.1968 0.2182 0.0022  -0.0276 0.0474  361 LEU A CD1 
2922 C  CD2 . LEU A 361 ? 0.2612 0.2882 0.2441 0.0201  0.0027  -0.0146 361 LEU A CD2 
2923 N  N   . PRO A 362 ? 0.3199 0.1345 0.2350 -0.0358 -0.0579 0.0063  362 PRO A N   
2924 C  CA  . PRO A 362 ? 0.3364 0.1462 0.2629 -0.0161 -0.0434 0.0283  362 PRO A CA  
2925 C  C   . PRO A 362 ? 0.3345 0.2000 0.2542 -0.0552 -0.0269 0.0446  362 PRO A C   
2926 O  O   . PRO A 362 ? 0.3577 0.1644 0.3084 -0.0731 -0.0636 0.0261  362 PRO A O   
2927 C  CB  . PRO A 362 ? 0.3563 0.1813 0.2974 0.0048  -0.0444 0.0436  362 PRO A CB  
2928 C  CG  . PRO A 362 ? 0.3627 0.1715 0.2617 -0.0127 -0.0701 0.0536  362 PRO A CG  
2929 C  CD  . PRO A 362 ? 0.2888 0.1119 0.2679 -0.0015 -0.0841 0.0152  362 PRO A CD  
2930 N  N   . LYS A 363 ? 0.2989 0.2079 0.2600 -0.0512 -0.0188 0.0464  363 LYS A N   
2931 C  CA  . LYS A 363 ? 0.2945 0.2026 0.2688 -0.1010 -0.0158 0.0638  363 LYS A CA  
2932 C  C   . LYS A 363 ? 0.2826 0.2495 0.2447 -0.1106 -0.0255 0.0225  363 LYS A C   
2933 O  O   . LYS A 363 ? 0.2962 0.2541 0.2806 -0.1339 -0.0519 0.0457  363 LYS A O   
2934 C  CB  . LYS A 363 ? 0.2934 0.2515 0.2752 -0.0733 -0.0332 0.0420  363 LYS A CB  
2935 C  CG  . LYS A 363 ? 0.3080 0.2405 0.3428 -0.0856 -0.0324 0.0021  363 LYS A CG  
2936 C  CD  . LYS A 363 ? 0.4361 0.2635 0.4370 -0.1050 0.0045  -0.0692 363 LYS A CD  
2937 C  CE  . LYS A 363 ? 0.4930 0.4582 0.4508 -0.0222 0.0268  -0.0836 363 LYS A CE  
2938 N  NZ  . LYS A 363 ? 0.4593 0.4153 0.4527 -0.0560 0.0347  -0.0645 363 LYS A NZ  
2939 N  N   . ILE A 364 ? 0.2662 0.1725 0.2332 -0.0679 -0.0266 0.0370  364 ILE A N   
2940 C  CA  . ILE A 364 ? 0.2423 0.2234 0.2534 -0.0639 -0.0347 0.0448  364 ILE A CA  
2941 C  C   . ILE A 364 ? 0.2390 0.2476 0.2354 -0.0809 -0.0496 0.0106  364 ILE A C   
2942 O  O   . ILE A 364 ? 0.2905 0.2954 0.2648 -0.1198 -0.0790 0.0183  364 ILE A O   
2943 C  CB  . ILE A 364 ? 0.2225 0.2188 0.2186 -0.0709 -0.0191 0.0561  364 ILE A CB  
2944 C  CG1 . ILE A 364 ? 0.2488 0.2133 0.2389 -0.0525 -0.0591 0.0552  364 ILE A CG1 
2945 C  CG2 . ILE A 364 ? 0.2212 0.2350 0.1904 -0.0551 -0.0436 0.0469  364 ILE A CG2 
2946 C  CD1 . ILE A 364 ? 0.2096 0.2335 0.3313 -0.0963 -0.0581 0.1302  364 ILE A CD1 
2947 N  N   . LEU A 365 ? 0.2853 0.1609 0.2436 -0.0647 -0.0636 0.0132  365 LEU A N   
2948 C  CA  . LEU A 365 ? 0.3462 0.2294 0.2772 -0.0899 -0.0230 -0.0039 365 LEU A CA  
2949 C  C   . LEU A 365 ? 0.3874 0.2511 0.3140 -0.1101 -0.0134 0.0019  365 LEU A C   
2950 O  O   . LEU A 365 ? 0.4172 0.2682 0.3441 -0.1500 -0.0265 -0.0374 365 LEU A O   
2951 C  CB  . LEU A 365 ? 0.3431 0.1733 0.2742 -0.0740 -0.0310 -0.0124 365 LEU A CB  
2952 C  CG  . LEU A 365 ? 0.3255 0.1621 0.2961 -0.0858 -0.0317 -0.0192 365 LEU A CG  
2953 C  CD1 . LEU A 365 ? 0.2856 0.2370 0.3387 -0.0310 -0.0294 -0.0252 365 LEU A CD1 
2954 C  CD2 . LEU A 365 ? 0.3970 0.2503 0.2147 -0.0692 -0.0183 -0.0015 365 LEU A CD2 
2955 N  N   . ALA A 366 ? 0.4074 0.2020 0.3112 -0.1338 -0.0214 0.0112  366 ALA A N   
2956 C  CA  . ALA A 366 ? 0.4044 0.2751 0.3683 -0.1578 -0.0301 0.0123  366 ALA A CA  
2957 C  C   . ALA A 366 ? 0.4095 0.2934 0.3924 -0.1667 -0.0205 0.0223  366 ALA A C   
2958 O  O   . ALA A 366 ? 0.4164 0.3643 0.4553 -0.2326 -0.0080 0.0184  366 ALA A O   
2959 C  CB  . ALA A 366 ? 0.4363 0.2638 0.3616 -0.1659 -0.0040 0.0635  366 ALA A CB  
2960 N  N   . LYS A 367 ? 0.3782 0.3179 0.3457 -0.1475 -0.0025 0.0456  367 LYS A N   
2961 C  CA  . LYS A 367 ? 0.3716 0.3760 0.3812 -0.1281 -0.0028 0.0437  367 LYS A CA  
2962 C  C   . LYS A 367 ? 0.3567 0.4192 0.3587 -0.1249 -0.0290 0.0305  367 LYS A C   
2963 O  O   . LYS A 367 ? 0.3534 0.5198 0.4157 -0.1222 -0.0562 0.0438  367 LYS A O   
2964 C  CB  . LYS A 367 ? 0.4246 0.4472 0.4281 -0.0965 0.0067  0.0285  367 LYS A CB  
2965 C  CG  . LYS A 367 ? 0.4921 0.4925 0.5299 -0.0916 0.0277  0.0216  367 LYS A CG  
2966 C  CD  . LYS A 367 ? 0.6068 0.6280 0.6073 -0.0308 0.0673  -0.0087 367 LYS A CD  
2967 C  CE  . LYS A 367 ? 0.6625 0.6666 0.6298 -0.0492 0.0517  -0.0124 367 LYS A CE  
2968 N  NZ  . LYS A 367 ? 0.6755 0.6650 0.7055 -0.0673 0.0716  0.0128  367 LYS A NZ  
2969 N  N   . VAL A 368 ? 0.3426 0.3370 0.2963 -0.1171 -0.0226 0.0336  368 VAL A N   
2970 C  CA  . VAL A 368 ? 0.3415 0.3325 0.3149 -0.0988 -0.0324 0.0194  368 VAL A CA  
2971 C  C   . VAL A 368 ? 0.3263 0.3331 0.3240 -0.0657 -0.0333 0.0215  368 VAL A C   
2972 O  O   . VAL A 368 ? 0.3732 0.3927 0.4077 -0.0081 -0.0425 0.0147  368 VAL A O   
2973 C  CB  . VAL A 368 ? 0.3077 0.3020 0.2302 -0.1035 -0.0232 0.0387  368 VAL A CB  
2974 C  CG1 . VAL A 368 ? 0.3915 0.3807 0.2220 -0.1187 -0.0101 0.0322  368 VAL A CG1 
2975 C  CG2 . VAL A 368 ? 0.3930 0.3482 0.2276 -0.1034 -0.0448 0.0251  368 VAL A CG2 
2976 N  N   . LYS A 369 ? 0.3279 0.2955 0.3299 -0.0917 -0.0207 0.0218  369 LYS A N   
2977 C  CA  . LYS A 369 ? 0.3391 0.2983 0.3258 -0.0830 -0.0182 0.0130  369 LYS A CA  
2978 C  C   . LYS A 369 ? 0.3046 0.2558 0.3052 -0.0882 -0.0321 0.0189  369 LYS A C   
2979 O  O   . LYS A 369 ? 0.3059 0.2746 0.3044 -0.0990 -0.0733 0.0367  369 LYS A O   
2980 C  CB  . LYS A 369 ? 0.3160 0.3248 0.3482 -0.0888 -0.0065 0.0161  369 LYS A CB  
2981 C  CG  . LYS A 369 ? 0.4037 0.4106 0.4219 -0.0871 -0.0048 -0.0189 369 LYS A CG  
2982 C  CD  . LYS A 369 ? 0.4399 0.5131 0.5467 -0.0490 -0.0294 -0.0479 369 LYS A CD  
2983 C  CE  . LYS A 369 ? 0.5877 0.5220 0.6378 0.0000  -0.0212 -0.0489 369 LYS A CE  
2984 N  NZ  . LYS A 369 ? 0.6503 0.5540 0.7021 0.0392  -0.0218 -0.0094 369 LYS A NZ  
2985 N  N   . PRO A 370 ? 0.3388 0.1965 0.3134 -0.0957 -0.0476 0.0436  370 PRO A N   
2986 C  CA  . PRO A 370 ? 0.3281 0.2030 0.3233 -0.0655 -0.0541 0.0119  370 PRO A CA  
2987 C  C   . PRO A 370 ? 0.3337 0.2288 0.3284 -0.0921 -0.0401 0.0057  370 PRO A C   
2988 O  O   . PRO A 370 ? 0.3792 0.2262 0.3653 -0.1301 -0.0337 0.0223  370 PRO A O   
2989 C  CB  . PRO A 370 ? 0.3728 0.2307 0.3858 -0.0818 -0.0772 0.0079  370 PRO A CB  
2990 C  CG  . PRO A 370 ? 0.3612 0.2757 0.3761 -0.0701 -0.0540 0.0335  370 PRO A CG  
2991 C  CD  . PRO A 370 ? 0.3800 0.2155 0.3137 -0.0662 -0.0512 0.0147  370 PRO A CD  
2992 N  N   . TYR A 371 ? 0.2849 0.1741 0.2932 -0.0985 -0.0567 0.0139  371 TYR A N   
2993 C  CA  . TYR A 371 ? 0.3041 0.1647 0.3185 -0.1095 -0.0455 0.0046  371 TYR A CA  
2994 C  C   . TYR A 371 ? 0.2983 0.1719 0.2928 -0.0552 -0.0433 -0.0287 371 TYR A C   
2995 O  O   . TYR A 371 ? 0.3207 0.1374 0.3593 -0.0806 -0.0440 -0.0425 371 TYR A O   
2996 C  CB  . TYR A 371 ? 0.2769 0.1838 0.3350 -0.1144 -0.0473 -0.0097 371 TYR A CB  
2997 C  CG  . TYR A 371 ? 0.2731 0.2141 0.2821 -0.0985 -0.0160 -0.0173 371 TYR A CG  
2998 C  CD1 . TYR A 371 ? 0.2856 0.3682 0.4089 -0.1203 -0.0435 -0.0897 371 TYR A CD1 
2999 C  CD2 . TYR A 371 ? 0.2711 0.1675 0.3583 -0.0415 -0.0249 0.0231  371 TYR A CD2 
3000 C  CE1 . TYR A 371 ? 0.2998 0.3886 0.4652 -0.1067 -0.0098 -0.1134 371 TYR A CE1 
3001 C  CE2 . TYR A 371 ? 0.2573 0.2314 0.4148 -0.0768 -0.0474 -0.0193 371 TYR A CE2 
3002 C  CZ  . TYR A 371 ? 0.2878 0.3045 0.4515 -0.0994 0.0305  -0.0879 371 TYR A CZ  
3003 O  OH  . TYR A 371 ? 0.2914 0.4684 0.5107 -0.0876 -0.0308 -0.0579 371 TYR A OH  
3004 N  N   . PRO A 372 ? 0.3137 0.1329 0.3499 -0.0719 -0.0454 -0.0352 372 PRO A N   
3005 C  CA  . PRO A 372 ? 0.3343 0.1461 0.3079 -0.0486 -0.0564 -0.0446 372 PRO A CA  
3006 C  C   . PRO A 372 ? 0.3309 0.1646 0.3374 -0.0253 -0.0695 -0.0382 372 PRO A C   
3007 O  O   . PRO A 372 ? 0.3427 0.1715 0.3701 -0.0367 -0.0963 -0.0549 372 PRO A O   
3008 C  CB  . PRO A 372 ? 0.3865 0.1491 0.3500 -0.0412 -0.0408 -0.0292 372 PRO A CB  
3009 C  CG  . PRO A 372 ? 0.3897 0.1880 0.4025 -0.0442 -0.0221 -0.0562 372 PRO A CG  
3010 C  CD  . PRO A 372 ? 0.3640 0.1814 0.3896 -0.0507 0.0015  -0.0268 372 PRO A CD  
3011 N  N   . ALA A 373 ? 0.3172 0.1835 0.3074 -0.0290 -0.0713 -0.0423 373 ALA A N   
3012 C  CA  . ALA A 373 ? 0.3482 0.1824 0.3072 -0.0364 -0.0773 -0.0258 373 ALA A CA  
3013 C  C   . ALA A 373 ? 0.4121 0.1933 0.3493 0.0014  -0.0778 -0.0505 373 ALA A C   
3014 O  O   . ALA A 373 ? 0.4373 0.1934 0.3638 -0.0273 -0.0983 -0.0690 373 ALA A O   
3015 C  CB  . ALA A 373 ? 0.3437 0.2180 0.3768 -0.0329 -0.0771 -0.0250 373 ALA A CB  
3016 N  N   . ASP A 374 ? 0.4582 0.2486 0.3863 -0.0046 -0.0482 -0.0781 374 ASP A N   
3017 C  CA  . ASP A 374 ? 0.4734 0.3199 0.4132 -0.0015 -0.0448 -0.0881 374 ASP A CA  
3018 C  C   . ASP A 374 ? 0.4965 0.2922 0.4238 -0.0135 -0.0474 -0.1128 374 ASP A C   
3019 O  O   . ASP A 374 ? 0.5669 0.2905 0.4374 -0.0161 -0.0649 -0.1449 374 ASP A O   
3020 C  CB  . ASP A 374 ? 0.4995 0.3480 0.4475 0.0124  -0.0375 -0.0784 374 ASP A CB  
3021 C  CG  . ASP A 374 ? 0.5393 0.4453 0.5447 0.0251  -0.0064 -0.0378 374 ASP A CG  
3022 O  OD1 . ASP A 374 ? 0.6226 0.4828 0.5549 -0.0137 0.0334  -0.0479 374 ASP A OD1 
3023 O  OD2 . ASP A 374 ? 0.6636 0.5530 0.7503 0.1091  -0.0115 0.0043  374 ASP A OD2 
3024 N  N   . GLN A 375 ? 0.4856 0.2226 0.4473 -0.0294 -0.0735 -0.1122 375 GLN A N   
3025 C  CA  . GLN A 375 ? 0.4526 0.2889 0.4734 -0.0321 -0.0908 -0.0884 375 GLN A CA  
3026 C  C   . GLN A 375 ? 0.4223 0.2595 0.4527 -0.0426 -0.1163 -0.0770 375 GLN A C   
3027 O  O   . GLN A 375 ? 0.4325 0.1707 0.4748 -0.0595 -0.1469 -0.0644 375 GLN A O   
3028 C  CB  . GLN A 375 ? 0.4768 0.3599 0.5151 -0.0348 -0.0834 -0.0585 375 GLN A CB  
3029 C  CG  . GLN A 375 ? 0.4903 0.4175 0.5954 -0.0456 -0.1072 -0.0983 375 GLN A CG  
3030 C  CD  . GLN A 375 ? 0.5599 0.5305 0.6896 -0.0459 -0.1049 -0.1700 375 GLN A CD  
3031 O  OE1 . GLN A 375 ? 0.6081 0.6889 0.7930 -0.0355 -0.1704 -0.1278 375 GLN A OE1 
3032 N  NE2 . GLN A 375 ? 0.6189 0.4075 0.8228 -0.0679 -0.1127 -0.2508 375 GLN A NE2 
3033 N  N   . TYR A 376 ? 0.3509 0.1966 0.4108 -0.0250 -0.1357 -0.0854 376 TYR A N   
3034 C  CA  . TYR A 376 ? 0.3497 0.2183 0.3761 -0.0472 -0.1106 -0.0714 376 TYR A CA  
3035 C  C   . TYR A 376 ? 0.3786 0.1731 0.3840 -0.0658 -0.1016 -0.0774 376 TYR A C   
3036 O  O   . TYR A 376 ? 0.3410 0.1918 0.3714 -0.0608 -0.1328 -0.0761 376 TYR A O   
3037 C  CB  . TYR A 376 ? 0.3319 0.1925 0.3458 -0.0519 -0.1280 -0.0744 376 TYR A CB  
3038 C  CG  . TYR A 376 ? 0.2328 0.2023 0.2833 -0.0751 -0.0860 -0.0574 376 TYR A CG  
3039 C  CD1 . TYR A 376 ? 0.2195 0.1987 0.2298 -0.0802 -0.0670 -0.0390 376 TYR A CD1 
3040 C  CD2 . TYR A 376 ? 0.2507 0.2280 0.2745 -0.0639 -0.0593 -0.0271 376 TYR A CD2 
3041 C  CE1 . TYR A 376 ? 0.2630 0.1599 0.1972 -0.0539 -0.0736 -0.0506 376 TYR A CE1 
3042 C  CE2 . TYR A 376 ? 0.2581 0.2356 0.2543 -0.0432 -0.0185 -0.0556 376 TYR A CE2 
3043 C  CZ  . TYR A 376 ? 0.1884 0.1889 0.2801 -0.0973 -0.0312 -0.0179 376 TYR A CZ  
3044 O  OH  . TYR A 376 ? 0.2149 0.2260 0.2509 -0.0381 -0.0545 -0.0687 376 TYR A OH  
3045 N  N   . GLU A 377 ? 0.4413 0.2510 0.4066 -0.0310 -0.0738 -0.0989 377 GLU A N   
3046 C  CA  . GLU A 377 ? 0.5278 0.3264 0.4672 -0.0223 -0.0551 -0.0604 377 GLU A CA  
3047 C  C   . GLU A 377 ? 0.5591 0.3651 0.4779 -0.0319 -0.0687 -0.0585 377 GLU A C   
3048 O  O   . GLU A 377 ? 0.6094 0.3979 0.4530 -0.0160 -0.1173 -0.0723 377 GLU A O   
3049 C  CB  . GLU A 377 ? 0.5400 0.3541 0.4999 -0.0098 -0.0299 -0.0484 377 GLU A CB  
3050 C  CG  . GLU A 377 ? 0.5900 0.3805 0.4823 -0.0194 -0.0725 -0.0972 377 GLU A CG  
3051 C  CD  . GLU A 377 ? 0.6652 0.3760 0.4274 0.0108  -0.0986 -0.0275 377 GLU A CD  
3052 O  OE1 . GLU A 377 ? 0.6330 0.3597 0.3449 0.0117  -0.0632 -0.0409 377 GLU A OE1 
3053 O  OE2 . GLU A 377 ? 0.7044 0.3759 0.3767 -0.0257 -0.0871 -0.0713 377 GLU A OE2 
3054 N  N   . LYS A 378 ? 0.5740 0.3748 0.4983 -0.0260 -0.0621 -0.0650 378 LYS A N   
3055 C  CA  . LYS A 378 ? 0.5220 0.3803 0.4822 -0.0357 -0.0683 -0.0670 378 LYS A CA  
3056 C  C   . LYS A 378 ? 0.5031 0.3690 0.4490 -0.0351 -0.1001 -0.0757 378 LYS A C   
3057 O  O   . LYS A 378 ? 0.4966 0.4076 0.4481 -0.0459 -0.1520 -0.1136 378 LYS A O   
3058 C  CB  . LYS A 378 ? 0.5535 0.3940 0.5111 -0.0226 -0.0611 -0.0736 378 LYS A CB  
3059 C  CG  . LYS A 378 ? 0.5825 0.4955 0.6132 0.0226  -0.0322 -0.0304 378 LYS A CG  
3060 C  CD  . LYS A 378 ? 0.6379 0.5359 0.6961 0.0410  -0.0462 -0.0402 378 LYS A CD  
3061 C  CE  . LYS A 378 ? 0.6495 0.6427 0.7415 0.0567  -0.0565 -0.0108 378 LYS A CE  
3062 N  NZ  . LYS A 378 ? 0.6461 0.6709 0.7667 0.0658  -0.0903 0.0102  378 LYS A NZ  
3063 N  N   . ASP A 379 ? 0.4368 0.3104 0.4148 -0.0758 -0.1229 -0.1065 379 ASP A N   
3064 C  CA  . ASP A 379 ? 0.4367 0.2969 0.4040 -0.0423 -0.1201 -0.0716 379 ASP A CA  
3065 C  C   . ASP A 379 ? 0.3527 0.2605 0.3718 -0.0424 -0.1155 -0.0752 379 ASP A C   
3066 O  O   . ASP A 379 ? 0.3713 0.2973 0.4089 -0.0838 -0.1423 -0.0605 379 ASP A O   
3067 C  CB  . ASP A 379 ? 0.4826 0.2982 0.4707 -0.0574 -0.0990 -0.0688 379 ASP A CB  
3068 C  CG  . ASP A 379 ? 0.5765 0.2888 0.5395 -0.0618 -0.1299 -0.0513 379 ASP A CG  
3069 O  OD1 . ASP A 379 ? 0.6591 0.3791 0.6577 -0.1046 -0.2003 -0.0997 379 ASP A OD1 
3070 O  OD2 . ASP A 379 ? 0.6825 0.3128 0.6331 -0.0768 -0.1725 0.0104  379 ASP A OD2 
3071 N  N   . ARG A 380 ? 0.3673 0.2866 0.3549 -0.0084 -0.1013 -0.0492 380 ARG A N   
3072 C  CA  . ARG A 380 ? 0.3535 0.2782 0.3142 -0.0182 -0.0997 -0.0718 380 ARG A CA  
3073 C  C   . ARG A 380 ? 0.3288 0.2691 0.2924 -0.0349 -0.0975 -0.0730 380 ARG A C   
3074 O  O   . ARG A 380 ? 0.3341 0.2285 0.3379 -0.0579 -0.1195 -0.0595 380 ARG A O   
3075 C  CB  . ARG A 380 ? 0.3547 0.2776 0.3054 -0.0198 -0.1086 -0.0878 380 ARG A CB  
3076 C  CG  . ARG A 380 ? 0.3285 0.2374 0.2953 -0.0174 -0.1388 -0.0558 380 ARG A CG  
3077 C  CD  . ARG A 380 ? 0.3688 0.2246 0.2085 0.0137  -0.1273 -0.0494 380 ARG A CD  
3078 N  NE  . ARG A 380 ? 0.3393 0.2048 0.2132 0.0176  -0.1112 -0.0716 380 ARG A NE  
3079 C  CZ  . ARG A 380 ? 0.4208 0.3231 0.1734 0.0488  -0.0921 -0.1076 380 ARG A CZ  
3080 N  NH1 . ARG A 380 ? 0.5699 0.4076 0.2228 0.0705  -0.1096 -0.1319 380 ARG A NH1 
3081 N  NH2 . ARG A 380 ? 0.4570 0.4103 0.2350 0.0922  -0.1027 -0.1661 380 ARG A NH2 
3082 N  N   . LYS A 381 ? 0.3870 0.2951 0.3027 -0.0259 -0.1011 -0.0692 381 LYS A N   
3083 C  CA  . LYS A 381 ? 0.3936 0.3388 0.3339 -0.0375 -0.0964 -0.0852 381 LYS A CA  
3084 C  C   . LYS A 381 ? 0.3692 0.3193 0.3286 -0.0502 -0.1056 -0.0648 381 LYS A C   
3085 O  O   . LYS A 381 ? 0.3341 0.3397 0.3799 -0.0703 -0.1217 -0.0698 381 LYS A O   
3091 N  N   . LYS A 382 ? 0.3410 0.3084 0.3648 -0.0863 -0.1267 -0.0631 382 LYS A N   
3092 C  CA  . LYS A 382 ? 0.4025 0.3286 0.3906 -0.0866 -0.0863 -0.0259 382 LYS A CA  
3093 C  C   . LYS A 382 ? 0.3663 0.2989 0.4180 -0.1205 -0.0779 -0.0260 382 LYS A C   
3094 O  O   . LYS A 382 ? 0.3579 0.2880 0.4183 -0.1706 -0.1207 -0.0244 382 LYS A O   
3095 C  CB  . LYS A 382 ? 0.4278 0.3349 0.4459 -0.0932 -0.0822 -0.0311 382 LYS A CB  
3096 C  CG  . LYS A 382 ? 0.5314 0.4458 0.5152 -0.0716 -0.0261 -0.0207 382 LYS A CG  
3097 C  CD  . LYS A 382 ? 0.6152 0.4771 0.6546 -0.0559 -0.0413 -0.0210 382 LYS A CD  
3098 C  CE  . LYS A 382 ? 0.6467 0.5023 0.6940 -0.0290 -0.0497 -0.0003 382 LYS A CE  
3099 N  NZ  . LYS A 382 ? 0.7120 0.5026 0.7791 -0.0656 -0.0207 -0.0120 382 LYS A NZ  
3100 N  N   . TYR A 383 ? 0.3853 0.2783 0.3944 -0.1388 -0.0921 -0.0123 383 TYR A N   
3101 C  CA  . TYR A 383 ? 0.4143 0.3210 0.4018 -0.1172 -0.0631 0.0164  383 TYR A CA  
3102 C  C   . TYR A 383 ? 0.4017 0.3002 0.3738 -0.1584 -0.0621 -0.0251 383 TYR A C   
3103 O  O   . TYR A 383 ? 0.4741 0.2904 0.3810 -0.1947 -0.0709 0.0076  383 TYR A O   
3104 C  CB  . TYR A 383 ? 0.4024 0.3226 0.4352 -0.1302 -0.0771 0.0155  383 TYR A CB  
3105 C  CG  . TYR A 383 ? 0.3924 0.3126 0.4798 -0.1157 -0.0749 0.0732  383 TYR A CG  
3106 C  CD1 . TYR A 383 ? 0.3907 0.3490 0.6251 -0.1455 -0.0619 0.0517  383 TYR A CD1 
3107 C  CD2 . TYR A 383 ? 0.3505 0.3802 0.5704 -0.1654 -0.0937 0.0744  383 TYR A CD2 
3108 C  CE1 . TYR A 383 ? 0.4653 0.3071 0.6607 -0.1262 -0.0751 0.0279  383 TYR A CE1 
3109 C  CE2 . TYR A 383 ? 0.4814 0.3767 0.6409 -0.1252 -0.0816 0.0649  383 TYR A CE2 
3110 C  CZ  . TYR A 383 ? 0.4110 0.3675 0.6794 -0.1336 -0.0809 0.0911  383 TYR A CZ  
3111 O  OH  . TYR A 383 ? 0.5206 0.4114 0.6841 -0.0599 -0.0931 0.1405  383 TYR A OH  
3112 N  N   . ILE A 384 ? 0.4137 0.2988 0.3243 -0.1422 -0.0766 -0.0232 384 ILE A N   
3113 C  CA  . ILE A 384 ? 0.4074 0.2768 0.3112 -0.1173 -0.0460 -0.0356 384 ILE A CA  
3114 C  C   . ILE A 384 ? 0.4282 0.2702 0.3557 -0.1240 -0.0260 -0.0337 384 ILE A C   
3115 O  O   . ILE A 384 ? 0.4030 0.2747 0.3958 -0.1637 0.0120  -0.0369 384 ILE A O   
3116 C  CB  . ILE A 384 ? 0.4024 0.2781 0.2818 -0.1066 -0.0435 -0.0251 384 ILE A CB  
3117 C  CG1 . ILE A 384 ? 0.4280 0.2475 0.2871 -0.0984 -0.0528 -0.0522 384 ILE A CG1 
3118 C  CG2 . ILE A 384 ? 0.3990 0.2651 0.2831 -0.1011 -0.0189 -0.0274 384 ILE A CG2 
3119 C  CD1 . ILE A 384 ? 0.4423 0.2767 0.2444 -0.1275 -0.0681 0.0157  384 ILE A CD1 
3120 N  N   . GLU A 385 ? 0.4145 0.2752 0.3921 -0.1333 -0.0572 -0.0477 385 GLU A N   
3121 C  CA  . GLU A 385 ? 0.4427 0.3626 0.4310 -0.1053 -0.0395 -0.0288 385 GLU A CA  
3122 C  C   . GLU A 385 ? 0.3982 0.3447 0.4435 -0.1525 -0.0311 -0.0376 385 GLU A C   
3123 O  O   . GLU A 385 ? 0.4112 0.3343 0.5089 -0.1995 -0.0249 -0.0148 385 GLU A O   
3124 C  CB  . GLU A 385 ? 0.4600 0.3545 0.4521 -0.0932 -0.0556 -0.0418 385 GLU A CB  
3125 C  CG  . GLU A 385 ? 0.5546 0.4992 0.5053 -0.0946 -0.0426 -0.0216 385 GLU A CG  
3126 C  CD  . GLU A 385 ? 0.7079 0.6653 0.5459 -0.1053 -0.0459 -0.0463 385 GLU A CD  
3127 O  OE1 . GLU A 385 ? 0.7509 0.7198 0.5980 -0.1915 -0.0857 -0.0977 385 GLU A OE1 
3128 O  OE2 . GLU A 385 ? 0.8167 0.8105 0.5325 -0.0815 -0.0516 -0.0030 385 GLU A OE2 
3129 N  N   . ALA A 386 ? 0.4067 0.3603 0.4564 -0.1775 -0.0257 -0.0327 386 ALA A N   
3130 C  CA  . ALA A 386 ? 0.3994 0.4110 0.4698 -0.1730 -0.0042 -0.0129 386 ALA A CA  
3131 C  C   . ALA A 386 ? 0.4003 0.4437 0.4635 -0.1785 0.0220  -0.0015 386 ALA A C   
3132 O  O   . ALA A 386 ? 0.4064 0.5006 0.5270 -0.2065 0.0358  0.0207  386 ALA A O   
3133 C  CB  . ALA A 386 ? 0.4109 0.4221 0.4800 -0.1667 -0.0006 -0.0008 386 ALA A CB  
3134 N  N   . VAL A 387 ? 0.3934 0.4328 0.4503 -0.2046 0.0239  0.0028  387 VAL A N   
3135 C  CA  . VAL A 387 ? 0.3933 0.4459 0.4202 -0.1799 0.0388  -0.0045 387 VAL A CA  
3136 C  C   . VAL A 387 ? 0.3658 0.4566 0.4345 -0.1749 0.0417  -0.0118 387 VAL A C   
3137 O  O   . VAL A 387 ? 0.4396 0.5217 0.4384 -0.1892 0.0406  -0.0166 387 VAL A O   
3138 C  CB  . VAL A 387 ? 0.3683 0.4422 0.4031 -0.1816 0.0598  -0.0107 387 VAL A CB  
3139 C  CG1 . VAL A 387 ? 0.3886 0.4622 0.4411 -0.1920 0.0259  -0.0598 387 VAL A CG1 
3140 C  CG2 . VAL A 387 ? 0.3762 0.4947 0.4023 -0.1938 0.0116  -0.0016 387 VAL A CG2 
3141 N  N   . VAL A 388 ? 0.3624 0.4024 0.4341 -0.1870 0.0210  -0.0289 388 VAL A N   
3142 C  CA  . VAL A 388 ? 0.3662 0.4021 0.4636 -0.1670 0.0348  -0.0212 388 VAL A CA  
3143 C  C   . VAL A 388 ? 0.3998 0.4311 0.4901 -0.1374 0.0567  -0.0222 388 VAL A C   
3144 O  O   . VAL A 388 ? 0.3952 0.4300 0.5345 -0.1721 0.0834  -0.0203 388 VAL A O   
3145 C  CB  . VAL A 388 ? 0.3439 0.3783 0.4394 -0.1771 0.0121  -0.0379 388 VAL A CB  
3146 C  CG1 . VAL A 388 ? 0.3505 0.3720 0.5118 -0.1663 -0.0063 -0.0371 388 VAL A CG1 
3147 C  CG2 . VAL A 388 ? 0.3731 0.3628 0.4216 -0.1944 0.0406  0.0112  388 VAL A CG2 
3148 N  N   . LYS A 389 ? 0.4372 0.4588 0.4965 -0.1112 0.0561  -0.0079 389 LYS A N   
3149 C  CA  . LYS A 389 ? 0.4679 0.5281 0.5167 -0.0588 0.0422  -0.0088 389 LYS A CA  
3150 C  C   . LYS A 389 ? 0.4999 0.5754 0.5324 -0.0217 0.0378  0.0032  389 LYS A C   
3151 O  O   . LYS A 389 ? 0.5670 0.6592 0.5823 -0.0100 0.0461  0.0084  389 LYS A O   
3152 C  CB  . LYS A 389 ? 0.4811 0.5185 0.5016 -0.0658 0.0351  -0.0197 389 LYS A CB  
3153 C  CG  . LYS A 389 ? 0.5832 0.5752 0.5480 -0.0267 0.0151  -0.0215 389 LYS A CG  
3154 C  CD  . LYS A 389 ? 0.6396 0.5940 0.5941 -0.0156 0.0163  -0.0539 389 LYS A CD  
3155 C  CE  . LYS A 389 ? 0.6419 0.6097 0.6158 0.0090  0.0598  -0.0736 389 LYS A CE  
3156 N  NZ  . LYS A 389 ? 0.6891 0.6000 0.6897 0.0386  0.0697  -0.0810 389 LYS A NZ  
3157 N  N   . GLY A 390 ? 0.5436 0.6045 0.5478 -0.0096 0.0296  0.0115  390 GLY A N   
3158 C  CA  . GLY A 390 ? 0.5574 0.6169 0.5374 -0.0031 0.0206  -0.0156 390 GLY A CA  
3159 C  C   . GLY A 390 ? 0.5881 0.6377 0.5495 0.0091  0.0250  -0.0210 390 GLY A C   
3160 O  O   . GLY A 390 ? 0.6442 0.7252 0.5919 0.0161  0.0341  -0.0440 390 GLY A O   
3161 MG MG  . MG  B .   ? 0.0990 0.0923 0.0865 -0.0029 -0.0184 0.0268  408 MG  A MG  
3162 MG MG  . MG  C .   ? 0.1091 0.1155 0.1060 0.0019  -0.0182 0.0292  409 MG  A MG  
3163 MG MG  . MG  D .   ? 0.2305 0.1617 0.1822 -0.0276 0.0064  0.0344  410 MG  A MG  
3164 MG MG  . MG  E .   ? 0.1766 0.1389 0.1539 -0.0049 -0.0268 0.0343  411 MG  A MG  
3165 P  P1  . P6F F .   ? 0.1396 0.1532 0.1458 -0.0171 -0.0050 0.0195  412 P6F A P1  
3166 O  O1P . P6F F .   ? 0.2148 0.1690 0.1874 -0.0035 0.0644  -0.0023 412 P6F A O1P 
3167 O  O2P . P6F F .   ? 0.1083 0.1205 0.1264 -0.0197 0.0030  0.0387  412 P6F A O2P 
3168 O  O3P . P6F F .   ? 0.1214 0.0970 0.1174 -0.0192 -0.0144 0.0388  412 P6F A O3P 
3169 O  O1  . P6F F .   ? 0.2253 0.2210 0.1453 -0.0397 -0.0122 0.0147  412 P6F A O1  
3170 C  C1  . P6F F .   ? 0.2491 0.1952 0.1509 0.0825  0.0458  0.0585  412 P6F A C1  
3171 C  C2  . P6F F .   ? 0.1362 0.1534 0.1643 0.0119  -0.0142 0.0122  412 P6F A C2  
3172 O  O2  . P6F F .   ? 0.1758 0.2794 0.1654 0.0726  -0.0084 0.0311  412 P6F A O2  
3173 C  C3  . P6F F .   ? 0.1119 0.1307 0.0952 -0.0051 0.0022  0.0347  412 P6F A C3  
3174 O  O3  . P6F F .   ? 0.1410 0.1111 0.0920 -0.0117 -0.0006 0.0292  412 P6F A O3  
3175 C  C4  . P6F F .   ? 0.1316 0.1125 0.1180 -0.0029 -0.0063 0.0312  412 P6F A C4  
3176 O  O4  . P6F F .   ? 0.1471 0.1185 0.1292 -0.0045 0.0097  0.0212  412 P6F A O4  
3177 C  C5  . P6F F .   ? 0.1180 0.1113 0.0959 -0.0180 -0.0192 0.0185  412 P6F A C5  
3178 O  O5  . P6F F .   ? 0.1165 0.1128 0.0985 -0.0019 -0.0117 0.0224  412 P6F A O5  
3179 C  C6  . P6F F .   ? 0.1279 0.1326 0.0930 0.0074  -0.0263 0.0400  412 P6F A C6  
3180 O  O6  . P6F F .   ? 0.1313 0.1107 0.1392 0.0018  0.0035  0.0459  412 P6F A O6  
3181 P  P2  . P6F F .   ? 0.1575 0.1209 0.1587 0.0081  0.0184  0.0396  412 P6F A P2  
3182 O  O4P . P6F F .   ? 0.1804 0.1381 0.1733 -0.0220 0.0403  0.0292  412 P6F A O4P 
3183 O  O5P . P6F F .   ? 0.1986 0.1461 0.1710 0.0173  0.0233  0.0651  412 P6F A O5P 
3184 O  O6P . P6F F .   ? 0.1293 0.1191 0.1384 0.0043  0.0060  0.0501  412 P6F A O6P 
3185 O  O   . HOH G .   ? 0.1481 0.1094 0.1105 0.0206  -0.0359 0.0226  413 HOH A O   
3186 O  O   . HOH G .   ? 0.1254 0.1754 0.1053 -0.0086 -0.0293 0.0341  414 HOH A O   
3187 O  O   . HOH G .   ? 0.1354 0.1318 0.1195 0.0205  -0.0213 0.0195  415 HOH A O   
3188 O  O   . HOH G .   ? 0.2030 0.1884 0.1788 -0.0160 -0.0126 0.0418  416 HOH A O   
3189 O  O   . HOH G .   ? 0.2220 0.1805 0.1978 0.0172  -0.0048 0.0563  417 HOH A O   
3190 O  O   . HOH G .   ? 0.1427 0.1184 0.1236 -0.0063 -0.0190 0.0358  418 HOH A O   
3191 O  O   . HOH G .   ? 0.1639 0.2083 0.1939 0.0238  0.0345  0.0259  419 HOH A O   
3192 O  O   . HOH G .   ? 0.1407 0.1254 0.1038 -0.0200 -0.0476 -0.0038 420 HOH A O   
3193 O  O   . HOH G .   ? 0.3715 0.4270 0.1742 0.0539  -0.0435 0.0181  421 HOH A O   
3194 O  O   . HOH G .   ? 0.3583 0.4062 0.2083 0.0487  0.0134  0.0263  422 HOH A O   
3195 O  O   . HOH G .   ? 0.2750 0.2644 0.1740 -0.0080 -0.0669 0.0336  423 HOH A O   
3196 O  O   . HOH G .   ? 0.3785 0.3595 0.2767 0.0000  -0.1125 0.0973  424 HOH A O   
3197 O  O   . HOH G .   ? 0.3984 0.2348 0.2008 0.0686  -0.0010 0.0566  425 HOH A O   
3198 O  O   . HOH G .   ? 0.1642 0.1734 0.1622 0.0258  -0.0622 0.0515  426 HOH A O   
3199 O  O   . HOH G .   ? 0.2780 0.2714 0.1892 0.0538  -0.0370 0.0074  427 HOH A O   
3200 O  O   . HOH G .   ? 0.2836 0.3264 0.2367 0.0282  -0.0459 0.0141  428 HOH A O   
3201 O  O   . HOH G .   ? 0.1697 0.2389 0.1374 0.0227  -0.0636 0.0847  429 HOH A O   
3202 O  O   . HOH G .   ? 0.3313 0.2936 0.2743 0.1170  0.0112  0.1129  430 HOH A O   
3203 O  O   . HOH G .   ? 0.2700 0.2603 0.1901 0.0007  -0.0691 0.0362  431 HOH A O   
3204 O  O   . HOH G .   ? 0.3643 0.4093 0.4273 0.0150  -0.0871 0.0173  432 HOH A O   
3205 O  O   . HOH G .   ? 0.1690 0.1337 0.1780 0.0224  -0.0594 0.0503  433 HOH A O   
3206 O  O   . HOH G .   ? 0.2387 0.1903 0.2599 0.0493  -0.1322 0.0186  434 HOH A O   
3207 O  O   . HOH G .   ? 0.1752 0.2387 0.2544 0.0467  -0.0481 0.0906  435 HOH A O   
3208 O  O   . HOH G .   ? 0.2897 0.2032 0.3142 -0.0205 0.0341  -0.0649 436 HOH A O   
3209 O  O   . HOH G .   ? 0.3363 0.1480 0.2420 0.0464  -0.1089 -0.0411 437 HOH A O   
3210 O  O   . HOH G .   ? 0.2503 0.2200 0.1624 -0.0266 -0.0637 0.0289  438 HOH A O   
3211 O  O   . HOH G .   ? 0.1449 0.1407 0.1623 0.0193  -0.0548 0.0190  439 HOH A O   
3212 O  O   . HOH G .   ? 0.2424 0.2352 0.1802 0.0257  -0.0745 -0.0094 440 HOH A O   
3213 O  O   . HOH G .   ? 0.2006 0.3063 0.2612 0.0507  -0.0146 0.0104  441 HOH A O   
3214 O  O   . HOH G .   ? 0.1766 0.3112 0.2207 0.0664  -0.0701 0.0333  442 HOH A O   
3215 O  O   . HOH G .   ? 0.3158 0.3397 0.2130 0.0747  -0.0772 0.0299  443 HOH A O   
3216 O  O   . HOH G .   ? 0.2452 0.3142 0.5418 0.0316  0.0592  -0.0763 444 HOH A O   
3217 O  O   . HOH G .   ? 0.2267 0.2920 0.2134 0.0384  0.0142  0.0730  445 HOH A O   
3218 O  O   . HOH G .   ? 0.1153 0.1071 0.2071 0.0237  -0.0248 0.0111  446 HOH A O   
3219 O  O   . HOH G .   ? 0.1461 0.0967 0.1030 0.0360  -0.0419 -0.0046 447 HOH A O   
3220 O  O   . HOH G .   ? 0.1352 0.0944 0.1078 -0.0092 -0.0227 0.0081  448 HOH A O   
3221 O  O   . HOH G .   ? 0.1719 0.2369 0.1810 -0.0503 -0.0864 0.0477  449 HOH A O   
3222 O  O   . HOH G .   ? 0.1851 0.1508 0.1899 -0.0091 0.0082  -0.0035 450 HOH A O   
3223 O  O   . HOH G .   ? 0.1230 0.0962 0.1241 0.0043  -0.0326 0.0037  451 HOH A O   
3224 O  O   . HOH G .   ? 0.1406 0.1111 0.1361 -0.0156 -0.0335 0.0133  452 HOH A O   
3225 O  O   . HOH G .   ? 0.1064 0.1140 0.1220 -0.0044 -0.0198 0.0194  453 HOH A O   
3226 O  O   . HOH G .   ? 0.0843 0.1193 0.1723 0.0116  -0.0104 -0.0228 454 HOH A O   
3227 O  O   . HOH G .   ? 0.1154 0.1401 0.2127 0.0218  -0.0262 -0.0470 455 HOH A O   
3228 O  O   . HOH G .   ? 0.1571 0.3427 0.1284 0.0881  -0.0429 -0.0588 456 HOH A O   
3229 O  O   . HOH G .   ? 0.1945 0.2714 0.2109 -0.0023 -0.0446 0.0012  457 HOH A O   
3230 O  O   . HOH G .   ? 0.2340 0.2236 0.2847 -0.0073 -0.0308 0.0191  458 HOH A O   
3231 O  O   . HOH G .   ? 0.5659 0.3003 0.4890 -0.0270 -0.0278 -0.0277 459 HOH A O   
3232 O  O   . HOH G .   ? 0.2643 0.1007 0.2493 0.0125  -0.0177 -0.0357 460 HOH A O   
3233 O  O   . HOH G .   ? 0.4606 0.1908 0.4086 -0.0369 -0.0378 -0.1148 461 HOH A O   
3234 O  O   . HOH G .   ? 0.1838 0.2191 0.1438 0.0461  -0.0055 0.0548  462 HOH A O   
3235 O  O   . HOH G .   ? 0.2744 0.2762 0.1985 0.1071  -0.0703 0.0149  463 HOH A O   
3236 O  O   . HOH G .   ? 0.1696 0.1508 0.5098 0.0148  -0.0818 0.0091  464 HOH A O   
3237 O  O   . HOH G .   ? 0.1567 0.1643 0.1461 -0.0049 -0.0398 0.0135  465 HOH A O   
3238 O  O   . HOH G .   ? 0.2040 0.3514 0.3043 0.0508  -0.0643 -0.0449 466 HOH A O   
3239 O  O   . HOH G .   ? 0.2574 0.2155 0.2297 0.0070  -0.0630 -0.0036 467 HOH A O   
3240 O  O   . HOH G .   ? 0.1587 0.2552 0.2075 -0.0252 -0.0619 0.0343  468 HOH A O   
3241 O  O   . HOH G .   ? 0.2905 0.2740 0.3071 0.0747  -0.0175 0.0097  469 HOH A O   
3242 O  O   . HOH G .   ? 0.2121 0.1248 0.1757 -0.0018 -0.0199 0.0251  470 HOH A O   
3243 O  O   . HOH G .   ? 0.2520 0.3802 0.2049 0.1301  -0.0357 -0.0479 471 HOH A O   
3244 O  O   . HOH G .   ? 0.6224 0.3039 0.4395 0.1401  -0.0495 -0.0672 472 HOH A O   
3245 O  O   . HOH G .   ? 0.2676 0.2430 0.3507 0.0274  0.0158  0.0142  473 HOH A O   
3246 O  O   . HOH G .   ? 0.1394 0.1145 0.1362 0.0160  -0.0101 0.0414  474 HOH A O   
3247 O  O   . HOH G .   ? 0.2752 0.1706 0.2064 0.0183  -0.0171 0.0417  475 HOH A O   
3248 O  O   . HOH G .   ? 0.2227 0.1852 0.3090 0.0045  -0.0161 0.0150  476 HOH A O   
3249 O  O   . HOH G .   ? 0.2611 0.2146 0.2883 -0.0031 -0.0436 0.0678  477 HOH A O   
3250 O  O   . HOH G .   ? 0.2447 0.1521 0.1850 0.0036  -0.0090 0.0399  478 HOH A O   
3251 O  O   . HOH G .   ? 0.2516 0.1679 0.2236 -0.0010 -0.0254 0.0505  479 HOH A O   
3252 O  O   . HOH G .   ? 0.2404 0.3306 0.2402 0.0952  -0.0087 0.0745  480 HOH A O   
3253 O  O   . HOH G .   ? 0.1408 0.1287 0.1546 0.0040  -0.0262 0.0254  481 HOH A O   
3254 O  O   . HOH G .   ? 0.1395 0.1156 0.1450 -0.0126 -0.0280 0.0387  482 HOH A O   
3255 O  O   . HOH G .   ? 0.2328 0.1561 0.2031 -0.0157 -0.0267 0.0333  483 HOH A O   
3256 O  O   . HOH G .   ? 0.2726 0.1810 0.2097 0.0024  0.0318  0.0465  484 HOH A O   
3257 O  O   . HOH G .   ? 0.3283 0.2582 0.2884 0.0509  -0.0320 0.0207  485 HOH A O   
3258 O  O   . HOH G .   ? 0.1995 0.1945 0.2985 0.0456  -0.0125 0.0515  486 HOH A O   
3259 O  O   . HOH G .   ? 0.2909 0.2216 0.2019 -0.0961 0.0138  0.0387  487 HOH A O   
3260 O  O   . HOH G .   ? 0.2673 0.4282 0.7091 -0.0349 -0.0131 -0.1467 488 HOH A O   
3261 O  O   . HOH G .   ? 0.3351 0.2504 0.5544 -0.0461 -0.0147 0.0831  489 HOH A O   
3262 O  O   . HOH G .   ? 0.3123 0.3783 0.2282 0.1418  -0.1351 -0.1168 490 HOH A O   
3263 O  O   . HOH G .   ? 0.1079 0.1153 0.0994 0.0223  -0.0061 0.0083  491 HOH A O   
3264 O  O   . HOH G .   ? 0.2222 0.1675 0.1567 -0.0714 -0.0500 0.0320  492 HOH A O   
3265 O  O   . HOH G .   ? 0.2240 0.3642 0.2587 -0.0420 -0.0642 -0.0481 493 HOH A O   
3266 O  O   . HOH G .   ? 0.2047 0.1985 0.1779 0.0464  -0.0306 0.0106  494 HOH A O   
3267 O  O   . HOH G .   ? 0.5458 0.2123 0.2310 0.0331  0.1646  0.0387  495 HOH A O   
3268 O  O   . HOH G .   ? 0.2926 0.2996 0.2854 0.0048  -0.0883 0.0929  496 HOH A O   
3269 O  O   . HOH G .   ? 0.1109 0.0963 0.0846 0.0097  -0.0170 0.0054  497 HOH A O   
3270 O  O   . HOH G .   ? 0.3628 0.2003 0.3726 0.0765  0.0645  -0.0259 498 HOH A O   
3271 O  O   . HOH G .   ? 0.2531 0.3420 0.4358 0.0323  -0.0465 -0.0942 499 HOH A O   
3272 O  O   . HOH G .   ? 0.2422 0.1782 0.1621 0.0556  -0.0526 -0.0588 500 HOH A O   
3273 O  O   . HOH G .   ? 0.2624 0.2347 0.1793 0.0254  -0.0531 0.0020  501 HOH A O   
3274 O  O   . HOH G .   ? 0.6288 0.5028 0.3780 0.1678  0.0290  -0.0076 502 HOH A O   
3275 O  O   . HOH G .   ? 0.3299 0.2779 0.1973 0.0310  -0.0673 -0.0328 503 HOH A O   
3276 O  O   . HOH G .   ? 0.2342 0.1323 0.2812 -0.0018 -0.0813 0.0010  504 HOH A O   
3277 O  O   . HOH G .   ? 0.2229 0.1851 0.2788 0.0678  -0.0221 0.0357  505 HOH A O   
3278 O  O   . HOH G .   ? 0.1369 0.1311 0.1201 0.0057  -0.0156 0.0356  506 HOH A O   
3279 O  O   . HOH G .   ? 0.3541 0.2671 0.4066 0.0107  -0.0865 -0.0031 507 HOH A O   
3280 O  O   . HOH G .   ? 0.3642 0.2707 0.4218 0.0472  -0.0634 -0.0475 508 HOH A O   
3281 O  O   . HOH G .   ? 0.2712 0.3043 0.5206 0.0075  -0.0175 0.0691  509 HOH A O   
3282 O  O   . HOH G .   ? 0.1654 0.1821 0.1657 0.0067  -0.0133 0.0123  510 HOH A O   
3283 O  O   . HOH G .   ? 0.2508 0.3496 0.4240 0.1119  -0.0333 -0.1395 511 HOH A O   
3284 O  O   . HOH G .   ? 0.3357 0.3474 0.2430 -0.0462 -0.0500 0.0418  512 HOH A O   
3285 O  O   . HOH G .   ? 0.3309 0.3394 0.2972 -0.0210 0.0380  0.0406  513 HOH A O   
3286 O  O   . HOH G .   ? 0.3257 0.3072 0.3728 -0.0017 -0.0513 0.0019  514 HOH A O   
3287 O  O   . HOH G .   ? 0.5641 0.3081 0.4391 0.0901  0.1757  0.0680  515 HOH A O   
3288 O  O   . HOH G .   ? 0.4976 0.3360 0.3403 0.0470  0.0578  0.0617  516 HOH A O   
3289 O  O   . HOH G .   ? 0.5986 0.3404 0.3060 -0.0401 0.0667  -0.0750 517 HOH A O   
3290 O  O   . HOH G .   ? 0.2867 0.3859 0.4101 -0.0240 0.0083  -0.0103 518 HOH A O   
3291 O  O   . HOH G .   ? 0.4686 0.3516 0.3787 -0.0651 0.0519  -0.0472 519 HOH A O   
3292 O  O   . HOH G .   ? 0.5344 0.5291 0.3197 -0.0228 -0.0375 0.1048  520 HOH A O   
3293 O  O   . HOH G .   ? 0.4247 0.4344 0.2874 0.0548  0.0538  0.0127  521 HOH A O   
3294 O  O   . HOH G .   ? 0.4525 0.3239 0.3277 -0.0062 -0.0216 0.1605  522 HOH A O   
3295 O  O   . HOH G .   ? 0.4733 0.5828 0.2377 0.0960  -0.1301 0.0161  523 HOH A O   
3296 O  O   . HOH G .   ? 0.5235 0.4774 0.3094 0.0191  -0.0593 -0.0547 524 HOH A O   
3297 O  O   . HOH G .   ? 0.3118 0.2295 0.1693 0.0359  -0.0201 0.0002  525 HOH A O   
3298 O  O   . HOH G .   ? 0.4553 0.2187 0.3303 -0.0576 -0.0009 -0.0071 526 HOH A O   
3299 O  O   . HOH G .   ? 0.5567 0.3822 0.4511 0.1110  -0.1417 0.0064  527 HOH A O   
3300 O  O   . HOH G .   ? 0.3209 0.4566 0.2167 0.0214  -0.0290 -0.0897 528 HOH A O   
3301 O  O   . HOH G .   ? 0.5084 0.4200 0.4548 -0.0189 -0.1923 -0.0438 529 HOH A O   
3302 O  O   . HOH G .   ? 0.5948 0.4783 0.3936 0.0477  -0.0997 -0.0054 530 HOH A O   
3303 O  O   . HOH G .   ? 0.3669 0.3052 0.2367 -0.0354 -0.0941 0.0528  531 HOH A O   
3304 O  O   . HOH G .   ? 0.2906 0.2616 0.1991 0.0947  0.0095  0.1098  532 HOH A O   
3305 O  O   . HOH G .   ? 0.6316 0.4372 0.2213 0.1080  -0.0748 0.0817  533 HOH A O   
3306 O  O   . HOH G .   ? 0.3173 0.3457 0.4497 0.0031  -0.0255 0.1334  534 HOH A O   
3307 O  O   . HOH G .   ? 0.3081 0.2815 0.3999 0.0432  -0.0538 0.0329  535 HOH A O   
3308 O  O   . HOH G .   ? 0.3815 0.2967 0.6891 -0.0294 -0.0499 -0.0227 536 HOH A O   
3309 O  O   . HOH G .   ? 0.4027 0.3641 0.4290 0.0557  -0.0668 0.0498  537 HOH A O   
3310 O  O   . HOH G .   ? 0.3047 0.3829 0.3203 0.0369  -0.1735 -0.0278 538 HOH A O   
3311 O  O   . HOH G .   ? 0.3759 0.4461 0.2953 -0.1124 0.0255  0.0022  539 HOH A O   
3312 O  O   . HOH G .   ? 0.4123 0.3960 0.4133 -0.0172 -0.0956 0.1347  540 HOH A O   
3313 O  O   . HOH G .   ? 0.5493 0.2769 0.3837 -0.0753 0.0275  0.0678  541 HOH A O   
3314 O  O   . HOH G .   ? 0.3738 0.2006 0.3007 -0.0597 -0.0541 0.0143  542 HOH A O   
3315 O  O   . HOH G .   ? 0.3509 0.3446 0.3279 -0.0886 -0.0372 -0.0139 543 HOH A O   
3316 O  O   . HOH G .   ? 0.3742 0.4952 0.3625 -0.1849 -0.1189 0.0343  544 HOH A O   
3317 O  O   . HOH G .   ? 0.2512 0.4947 0.4150 -0.0567 -0.0800 -0.1694 545 HOH A O   
3318 O  O   . HOH G .   ? 0.3040 0.8064 0.4693 0.1047  -0.1164 -0.1552 546 HOH A O   
3319 O  O   . HOH G .   ? 0.3780 0.7119 0.4025 -0.1781 -0.0193 -0.0664 547 HOH A O   
3320 O  O   . HOH G .   ? 0.4204 0.3287 0.4331 -0.0639 -0.0761 -0.0135 548 HOH A O   
3321 O  O   . HOH G .   ? 0.4661 0.3939 0.3302 0.0478  0.0243  -0.0711 549 HOH A O   
3322 O  O   . HOH G .   ? 0.3325 0.1361 0.1667 -0.0172 0.0155  -0.0078 550 HOH A O   
3323 O  O   . HOH G .   ? 0.5080 0.2091 0.3775 -0.0201 -0.0445 0.1001  551 HOH A O   
3324 O  O   . HOH G .   ? 0.4019 0.2053 0.3030 -0.0222 -0.0324 -0.0029 552 HOH A O   
3325 O  O   . HOH G .   ? 0.5147 0.3003 0.4286 0.0244  -0.0446 0.0471  553 HOH A O   
3326 O  O   . HOH G .   ? 0.3557 0.4130 0.5452 0.0011  -0.0136 0.0540  554 HOH A O   
3327 O  O   . HOH G .   ? 0.2966 0.2717 0.2230 0.0183  -0.0265 -0.0114 555 HOH A O   
3328 O  O   . HOH G .   ? 0.4617 0.2269 0.3410 0.0975  -0.0939 0.0231  556 HOH A O   
3329 O  O   . HOH G .   ? 0.4516 0.2125 0.3997 0.0255  -0.1474 0.0156  557 HOH A O   
3330 O  O   . HOH G .   ? 0.3597 0.1894 0.3112 -0.1114 0.0052  0.0441  558 HOH A O   
3331 O  O   . HOH G .   ? 0.5247 0.4085 0.4125 0.1674  0.1127  -0.1321 559 HOH A O   
3332 O  O   . HOH G .   ? 0.1758 0.2459 0.1919 0.0717  -0.0316 -0.0325 560 HOH A O   
3333 O  O   . HOH G .   ? 0.3437 0.4123 0.5025 0.1570  -0.0243 -0.1005 561 HOH A O   
3334 O  O   . HOH G .   ? 0.2195 0.2050 0.3417 0.0282  0.0053  0.0887  562 HOH A O   
3335 O  O   . HOH G .   ? 0.3377 0.2540 0.3611 0.0535  -0.0766 0.0458  563 HOH A O   
3336 O  O   . HOH G .   ? 0.2558 0.3372 0.4565 0.0327  0.0048  -0.0611 564 HOH A O   
3337 O  O   . HOH G .   ? 0.3836 0.4007 0.2914 -0.0757 0.0059  -0.0927 565 HOH A O   
3338 O  O   . HOH G .   ? 0.2196 0.2836 0.1813 0.0836  0.0346  0.0649  566 HOH A O   
3339 O  O   . HOH G .   ? 0.2762 0.5048 0.4257 0.0749  -0.1230 -0.0996 567 HOH A O   
3340 O  O   . HOH G .   ? 0.3436 0.3057 0.4087 0.0910  -0.0564 -0.1132 568 HOH A O   
3341 O  O   . HOH G .   ? 0.4034 0.2693 0.2760 0.0591  0.0167  0.0344  569 HOH A O   
3342 O  O   . HOH G .   ? 0.4867 0.3685 0.4646 -0.0278 -0.0437 -0.0156 570 HOH A O   
3343 O  O   . HOH G .   ? 0.3475 0.3798 0.3972 0.0621  0.0421  -0.1263 571 HOH A O   
3344 O  O   . HOH G .   ? 0.3572 0.4312 0.4017 -0.1508 0.0517  -0.0964 572 HOH A O   
3345 O  O   . HOH G .   ? 0.4910 0.5469 0.3528 -0.1528 0.1002  -0.1300 573 HOH A O   
3346 O  O   . HOH G .   ? 0.5518 0.4443 0.3806 0.1109  0.0870  -0.0118 574 HOH A O   
3347 O  O   . HOH G .   ? 0.3324 0.3383 0.2075 -0.0131 -0.0250 -0.0626 575 HOH A O   
3348 O  O   . HOH G .   ? 0.8163 0.5944 0.3777 -0.0897 -0.0783 -0.0441 576 HOH A O   
3349 O  O   . HOH G .   ? 0.4060 0.5533 0.2549 0.0925  -0.0646 -0.0529 577 HOH A O   
3350 O  O   . HOH G .   ? 0.8546 0.5127 0.4690 0.0461  0.0629  -0.0766 578 HOH A O   
3351 O  O   . HOH G .   ? 0.3449 0.3836 0.4613 0.0810  -0.0139 -0.0260 579 HOH A O   
3352 O  O   . HOH G .   ? 0.8473 0.3946 0.5739 0.2604  -0.1987 0.0000  580 HOH A O   
3353 O  O   . HOH G .   ? 0.3287 0.3855 0.8539 0.1124  -0.0430 0.0312  581 HOH A O   
3354 O  O   . HOH G .   ? 0.4683 0.3637 0.4728 -0.0246 0.0065  -0.0582 582 HOH A O   
3355 O  O   . HOH G .   ? 0.5807 0.4372 0.5194 -0.0334 -0.0601 0.0398  583 HOH A O   
3356 O  O   . HOH G .   ? 0.3344 0.4130 0.3172 -0.0611 -0.1361 0.1226  584 HOH A O   
3357 O  O   . HOH G .   ? 0.2892 0.3707 0.3543 0.0114  -0.0878 0.1000  585 HOH A O   
3358 O  O   . HOH G .   ? 0.4178 0.3354 0.2647 -0.1785 0.0386  -0.0027 586 HOH A O   
3359 O  O   . HOH G .   ? 0.3761 0.4538 0.3739 -0.0788 -0.1573 0.1578  587 HOH A O   
3360 O  O   . HOH G .   ? 0.3392 0.7399 0.3453 -0.0861 -0.0677 0.0515  588 HOH A O   
3361 O  O   . HOH G .   ? 0.3120 0.2144 0.3532 0.0189  -0.1330 0.0353  589 HOH A O   
3362 O  O   . HOH G .   ? 0.7108 0.3010 0.4694 -0.0834 -0.0317 0.0732  590 HOH A O   
3363 O  O   . HOH G .   ? 0.3135 0.3762 0.5027 -0.0139 -0.0364 -0.1178 591 HOH A O   
3364 O  O   . HOH G .   ? 0.4613 0.1656 0.6755 -0.0164 -0.0074 0.0527  592 HOH A O   
3365 O  O   . HOH G .   ? 0.6139 0.2984 0.7108 -0.0623 -0.0501 0.0233  593 HOH A O   
3366 O  O   . HOH G .   ? 0.4510 0.2629 0.4766 0.1126  -0.0031 -0.0319 594 HOH A O   
3367 O  O   . HOH G .   ? 0.3404 0.2316 0.3732 0.0671  -0.0422 -0.0068 595 HOH A O   
3368 O  O   . HOH G .   ? 0.4092 0.3731 0.4016 -0.0889 -0.0933 -0.0361 596 HOH A O   
3369 O  O   . HOH G .   ? 0.5221 0.2917 0.4658 0.0028  -0.0011 -0.0264 597 HOH A O   
3370 O  O   . HOH G .   ? 0.3349 0.4503 0.6270 -0.1393 -0.0385 0.0177  598 HOH A O   
3371 O  O   . HOH G .   ? 0.1938 0.3645 0.3870 0.1101  -0.0722 -0.1814 599 HOH A O   
3372 O  O   . HOH G .   ? 0.4502 0.2795 0.4550 0.0312  -0.0164 -0.0528 600 HOH A O   
3373 O  O   . HOH G .   ? 0.3274 0.4360 0.3595 0.0531  -0.0673 -0.0765 601 HOH A O   
3374 O  O   . HOH G .   ? 0.2788 0.2882 0.3758 0.0719  0.0761  0.0362  602 HOH A O   
3375 O  O   . HOH G .   ? 0.2157 0.2080 0.2204 0.0292  0.0265  0.0695  603 HOH A O   
3376 O  O   . HOH G .   ? 0.4333 0.2526 0.5174 0.0768  0.0727  -0.0394 604 HOH A O   
3377 O  O   . HOH G .   ? 0.4831 0.3349 0.5641 0.0634  0.0021  0.1214  605 HOH A O   
3378 O  O   . HOH G .   ? 0.3969 0.3868 0.4788 -0.0022 -0.0859 0.2018  606 HOH A O   
3379 O  O   . HOH G .   ? 0.4839 0.5193 0.3361 0.1282  0.0006  0.2392  607 HOH A O   
3380 O  O   . HOH G .   ? 0.4641 0.2302 0.4860 0.0392  -0.1348 0.0620  608 HOH A O   
3381 O  O   . HOH G .   ? 0.4331 0.3633 0.3988 0.0160  -0.0379 -0.1301 609 HOH A O   
3382 O  O   . HOH G .   ? 0.4578 0.2928 0.2889 0.0412  -0.0221 -0.0407 610 HOH A O   
3383 O  O   . HOH G .   ? 0.3346 0.2757 0.9219 -0.1071 -0.1022 0.1185  611 HOH A O   
3384 O  O   . HOH G .   ? 0.4932 0.2700 0.5007 0.0597  -0.0149 -0.0003 612 HOH A O   
3385 O  O   . HOH G .   ? 0.5892 0.4538 0.4356 0.0193  -0.0900 -0.1581 613 HOH A O   
3386 O  O   . HOH G .   ? 0.4726 0.6038 0.5659 -0.2441 -0.1376 0.1425  614 HOH A O   
3387 O  O   . HOH G .   ? 0.1573 0.2845 0.3589 -0.0033 -0.0082 -0.0434 615 HOH A O   
3388 O  O   . HOH G .   ? 0.2315 0.2594 0.2586 -0.0208 -0.1113 0.1082  616 HOH A O   
3389 O  O   . HOH G .   ? 0.3114 0.3040 0.2202 0.1187  -0.0342 0.1162  617 HOH A O   
3390 O  O   . HOH G .   ? 0.4390 0.3680 0.3410 -0.0067 -0.1092 -0.0053 618 HOH A O   
3391 O  O   . HOH G .   ? 0.1959 0.2346 0.2756 0.0054  0.0055  0.1382  619 HOH A O   
3392 O  O   . HOH G .   ? 0.1077 0.3166 0.1577 0.0073  -0.0387 0.0777  620 HOH A O   
3393 O  O   . HOH G .   ? 0.4512 0.2545 0.2049 0.2407  -0.0246 -0.0138 621 HOH A O   
3394 O  O   . HOH G .   ? 0.2452 0.2252 0.0933 0.1313  -0.0512 0.0084  622 HOH A O   
3395 O  O   . HOH G .   ? 0.1328 0.1517 0.1211 -0.0085 0.0236  0.0574  623 HOH A O   
3396 O  O   . HOH G .   ? 0.6595 0.4594 0.4351 -0.0081 -0.2971 -0.1231 624 HOH A O   
3397 O  O   . HOH G .   ? 0.4769 0.3682 0.6491 -0.1955 -0.2329 -0.0157 625 HOH A O   
3398 O  O   . HOH G .   ? 0.5482 0.9559 0.4369 -0.4237 -0.2247 0.0794  626 HOH A O   
3399 O  O   . HOH G .   ? 0.9486 0.6282 0.6154 0.1789  0.0564  0.2082  627 HOH A O   
3400 O  O   . HOH G .   ? 0.2384 0.1320 0.2622 0.0260  -0.0651 -0.0083 628 HOH A O   
3401 O  O   . HOH G .   ? 0.3174 0.2963 0.2467 0.1340  -0.0080 -0.1108 629 HOH A O   
3402 O  O   . HOH G .   ? 0.2652 0.2470 0.2675 -0.0405 -0.0157 0.0362  630 HOH A O   
3403 O  O   . HOH G .   ? 0.3249 0.3249 0.4161 -0.0154 -0.1268 -0.1268 631 HOH A O   
3404 O  O   . HOH G .   ? 0.3440 0.1923 0.2922 -0.0220 -0.0793 0.0647  632 HOH A O   
3405 O  O   . HOH G .   ? 0.4256 0.1514 0.4691 0.0423  0.0133  0.0877  633 HOH A O   
3406 O  O   . HOH G .   ? 0.4938 0.2296 0.1851 -0.0225 -0.0588 0.0381  634 HOH A O   
3407 O  O   . HOH G .   ? 0.4930 0.1721 0.3772 -0.0017 -0.0638 -0.0361 635 HOH A O   
3408 O  O   . HOH G .   ? 0.2616 0.2399 0.7193 0.0732  -0.2614 -0.0586 636 HOH A O   
3409 O  O   . HOH G .   ? 0.5913 0.2095 0.5202 -0.0525 -0.1263 0.0358  637 HOH A O   
3410 O  O   . HOH G .   ? 0.3612 0.2561 0.3556 0.0497  -0.0235 0.0512  638 HOH A O   
3411 O  O   . HOH G .   ? 0.3709 0.2404 0.5236 -0.1108 -0.0350 0.0770  639 HOH A O   
3412 O  O   . HOH G .   ? 0.3204 0.3183 0.3822 0.0193  -0.0909 -0.0936 640 HOH A O   
3413 O  O   . HOH G .   ? 0.4517 0.1944 0.4003 0.0168  -0.1196 0.0025  641 HOH A O   
3414 O  O   . HOH G .   ? 0.6571 0.5287 0.4616 -0.0926 0.0811  -0.0676 642 HOH A O   
3415 O  O   . HOH G .   ? 0.3830 0.6919 0.2074 0.1577  -0.1003 0.0939  643 HOH A O   
3416 O  O   . HOH G .   ? 0.6305 0.1999 0.3965 0.0196  -0.2436 0.0298  644 HOH A O   
3417 O  O   . HOH G .   ? 0.4451 0.1834 0.4529 0.0243  -0.1763 -0.0049 645 HOH A O   
3418 O  O   . HOH G .   ? 0.5863 0.3750 0.4307 0.2239  -0.1544 -0.0789 646 HOH A O   
3419 O  O   . HOH G .   ? 0.3911 0.4143 0.5515 0.0851  0.1846  0.1032  647 HOH A O   
3420 O  O   . HOH G .   ? 0.6459 0.2848 0.4730 0.0016  -0.2707 0.0106  648 HOH A O   
3421 O  O   . HOH G .   ? 0.5373 0.3997 0.4508 0.0500  0.0105  0.1272  649 HOH A O   
3422 O  O   . HOH G .   ? 0.4564 0.4149 0.7534 0.0105  -0.2966 -0.1708 650 HOH A O   
3423 O  O   . HOH G .   ? 0.3759 0.3610 0.8063 0.0349  -0.0527 0.1280  651 HOH A O   
3424 O  O   . HOH G .   ? 0.7234 0.5806 0.3821 0.0959  0.1453  0.0389  652 HOH A O   
3425 O  O   . HOH G .   ? 0.8483 0.5434 0.3345 0.3353  -0.0009 0.1376  653 HOH A O   
3426 O  O   . HOH G .   ? 0.3156 0.3980 0.4917 0.1261  -0.1836 -0.0634 654 HOH A O   
3427 O  O   . HOH G .   ? 0.4778 0.3429 0.5582 -0.1251 0.0850  -0.0298 655 HOH A O   
3428 O  O   . HOH G .   ? 0.4710 0.2738 0.3911 0.0491  -0.2092 0.0024  656 HOH A O   
3429 O  O   . HOH G .   ? 0.2897 0.3011 0.3569 0.0378  -0.0527 0.0246  657 HOH A O   
3430 O  O   . HOH G .   ? 0.3243 0.2463 0.3501 0.0286  -0.0317 -0.0403 658 HOH A O   
3431 O  O   . HOH G .   ? 0.3971 0.4322 0.5776 0.0268  -0.1794 0.1460  659 HOH A O   
3432 O  O   . HOH G .   ? 0.4918 0.4144 0.4791 -0.0407 -0.1140 0.1048  660 HOH A O   
3433 O  O   . HOH G .   ? 0.5808 1.4908 0.5156 -0.0772 0.0207  -0.4451 661 HOH A O   
3434 O  O   . HOH G .   ? 0.3952 0.7407 0.5662 0.0064  -0.0106 -0.1997 662 HOH A O   
3435 O  O   . HOH G .   ? 0.3890 0.5437 0.8644 0.0131  0.2329  -0.0365 663 HOH A O   
3436 O  O   . HOH G .   ? 0.3619 0.4453 0.5120 0.0003  -0.0579 0.0712  664 HOH A O   
3437 O  O   . HOH G .   ? 0.7345 0.3642 0.3828 0.1098  0.2635  -0.0175 665 HOH A O   
3438 O  O   . HOH G .   ? 0.8771 0.4459 0.3976 -0.2296 -0.0526 0.0397  666 HOH A O   
3439 O  O   . HOH G .   ? 0.4192 0.5705 0.4921 0.1824  0.0414  0.1413  667 HOH A O   
3440 O  O   . HOH G .   ? 0.4338 0.5739 0.3945 -0.0665 -0.0170 -0.0464 668 HOH A O   
3441 O  O   . HOH G .   ? 0.8366 1.0937 0.5234 -0.0405 -0.0909 0.4006  669 HOH A O   
3442 O  O   . HOH G .   ? 0.7518 0.6269 0.6314 -0.1350 0.0882  -0.0861 670 HOH A O   
3443 O  O   . HOH G .   ? 0.5333 0.6092 0.3726 -0.0107 -0.1005 0.1040  671 HOH A O   
3444 O  O   . HOH G .   ? 0.5855 0.4957 0.3944 0.0775  0.0102  0.1665  672 HOH A O   
3445 O  O   . HOH G .   ? 0.7246 0.7137 0.5743 0.2477  0.1977  0.3211  673 HOH A O   
3446 O  O   . HOH G .   ? 0.4850 0.5205 0.4495 -0.0837 0.0240  0.1531  674 HOH A O   
3447 O  O   . HOH G .   ? 0.4530 0.7081 0.4417 -0.0221 0.1329  0.0557  675 HOH A O   
3448 O  O   . HOH G .   ? 0.6298 0.6553 0.3428 0.1733  0.0465  -0.0748 676 HOH A O   
3449 O  O   . HOH G .   ? 0.7161 0.6347 0.4281 -0.0942 -0.0852 0.1039  677 HOH A O   
3450 O  O   . HOH G .   ? 0.5867 0.6496 0.5740 0.2558  -0.2175 -0.0255 678 HOH A O   
3451 O  O   . HOH G .   ? 0.6721 0.2655 0.3343 -0.0234 -0.1445 0.0597  679 HOH A O   
3452 O  O   . HOH G .   ? 0.5258 0.3762 0.2756 0.0477  -0.0856 -0.0830 680 HOH A O   
3453 O  O   . HOH G .   ? 0.9642 0.4269 0.3750 -0.0613 0.0139  -0.0468 681 HOH A O   
3454 O  O   . HOH G .   ? 0.6655 0.5005 0.7210 0.2473  -0.2163 0.0334  682 HOH A O   
3455 O  O   . HOH G .   ? 1.4155 1.7565 0.3339 -0.2873 -0.4429 0.5868  683 HOH A O   
3456 O  O   . HOH G .   ? 0.3918 0.4475 0.3071 0.0659  0.0254  0.1852  684 HOH A O   
3457 O  O   . HOH G .   ? 0.4223 0.5177 0.5164 -0.0774 -0.0811 0.2622  685 HOH A O   
3458 O  O   . HOH G .   ? 0.6145 0.4477 0.4696 0.1064  -0.1161 0.1290  686 HOH A O   
3459 O  O   . HOH G .   ? 0.3991 0.4667 0.8197 -0.0436 -0.1222 0.4376  687 HOH A O   
3460 O  O   . HOH G .   ? 0.3661 0.5298 0.6790 -0.0794 -0.0711 0.2067  688 HOH A O   
3461 O  O   . HOH G .   ? 0.6890 0.4902 0.6567 0.0070  0.0945  0.2455  689 HOH A O   
3462 O  O   . HOH G .   ? 0.5447 0.4765 0.6846 -0.1479 0.2355  0.0193  690 HOH A O   
3463 O  O   . HOH G .   ? 0.3094 0.5850 0.1592 0.2288  -0.0350 0.1464  691 HOH A O   
3464 O  O   . HOH G .   ? 1.1130 0.6198 0.6997 -0.2552 0.2383  0.0198  692 HOH A O   
3465 O  O   . HOH G .   ? 0.6272 0.9270 0.4923 -0.2002 0.0419  -0.2208 693 HOH A O   
3466 O  O   . HOH G .   ? 0.4714 1.0554 0.5554 0.2737  -0.1988 -0.1094 694 HOH A O   
3467 O  O   . HOH G .   ? 0.8405 0.4540 0.4808 0.1847  -0.0785 0.1293  695 HOH A O   
3468 O  O   . HOH G .   ? 1.1785 0.5437 0.3723 0.1250  -0.1216 0.1664  696 HOH A O   
3469 O  O   . HOH G .   ? 0.9542 0.6424 0.4811 -0.0578 0.0460  0.1132  697 HOH A O   
3470 O  O   . HOH G .   ? 0.8493 0.3144 0.4700 0.2132  -0.2679 -0.0206 698 HOH A O   
3471 O  O   . HOH G .   ? 0.5054 0.5525 0.3735 -0.0025 -0.0862 0.1189  699 HOH A O   
3472 O  O   . HOH G .   ? 0.5488 0.4514 0.7309 0.1247  -0.2980 -0.2251 700 HOH A O   
3473 O  O   . HOH G .   ? 0.4940 0.7679 0.4366 -0.1111 0.0153  0.3128  701 HOH A O   
3474 O  O   . HOH G .   ? 1.1780 0.7521 0.9499 -0.8681 -0.8675 0.5987  702 HOH A O   
3475 O  O   . HOH G .   ? 0.5507 0.8347 0.5684 0.1059  -0.1753 0.0960  703 HOH A O   
3476 O  O   . HOH G .   ? 0.5027 0.3896 0.5275 -0.0159 -0.0450 0.1770  704 HOH A O   
3477 O  O   . HOH G .   ? 0.3913 0.5307 0.5664 0.1283  0.0540  0.3309  705 HOH A O   
3478 O  O   . HOH G .   ? 0.5236 0.5004 0.5514 0.0795  -0.1228 0.0804  706 HOH A O   
3479 O  O   . HOH G .   ? 0.4534 0.5647 0.4644 0.0158  0.0013  0.0637  707 HOH A O   
3480 O  O   . HOH G .   ? 0.4854 0.5452 0.3555 0.0018  -0.0757 -0.0872 708 HOH A O   
3481 O  O   . HOH G .   ? 0.4827 0.3985 0.5299 0.2234  -0.0609 0.0195  709 HOH A O   
3482 O  O   . HOH G .   ? 0.5425 0.4099 0.7071 -0.0464 0.0807  0.2548  710 HOH A O   
3483 O  O   . HOH G .   ? 0.2518 0.6028 0.6487 0.1178  -0.0397 -0.0876 711 HOH A O   
3484 O  O   . HOH G .   ? 0.5451 0.7251 0.4648 0.2791  0.0551  0.1651  712 HOH A O   
3485 O  O   . HOH G .   ? 0.6024 0.5186 0.4150 -0.1073 -0.1383 0.2542  713 HOH A O   
3486 O  O   . HOH G .   ? 0.5296 0.7418 0.3540 0.2135  -0.1055 -0.0436 714 HOH A O   
3487 O  O   . HOH G .   ? 0.3582 0.3359 0.5220 0.0237  0.0406  -0.0134 715 HOH A O   
3488 O  O   . HOH G .   ? 0.6479 0.2820 0.6847 -0.0059 -0.0670 0.1662  716 HOH A O   
3489 O  O   . HOH G .   ? 0.2223 0.3184 0.3183 0.0345  -0.0676 -0.0659 717 HOH A O   
3490 O  O   . HOH G .   ? 0.2290 0.3031 0.2782 0.0222  -0.0191 -0.0214 718 HOH A O   
3491 O  O   . HOH G .   ? 0.2751 0.7178 0.3233 0.0358  0.0212  0.2352  719 HOH A O   
3492 O  O   . HOH G .   ? 0.2064 0.2207 0.3444 -0.0528 -0.0984 0.0837  720 HOH A O   
3493 O  O   . HOH G .   ? 0.2321 0.8330 1.0069 0.2169  -0.3014 -0.1740 721 HOH A O   
3494 O  O   . HOH G .   ? 0.5016 0.5231 0.6168 0.0861  -0.0998 0.0936  722 HOH A O   
3495 O  O   . HOH G .   ? 0.3742 0.4770 0.7158 0.0825  -0.0080 -0.0148 723 HOH A O   
3496 O  O   . HOH G .   ? 0.4287 1.2095 0.5855 0.1094  -0.0026 0.4555  724 HOH A O   
3497 O  O   . HOH G .   ? 0.4781 0.6440 0.6514 -0.1053 0.0717  -0.0740 725 HOH A O   
3498 O  O   . HOH G .   ? 0.6848 0.1662 0.6971 -0.0024 -0.1041 -0.0014 726 HOH A O   
3499 O  O   . HOH G .   ? 1.0015 0.3366 0.5353 -0.1793 0.0035  -0.0548 727 HOH A O   
3500 O  O   . HOH G .   ? 1.2051 0.3615 1.2814 0.5531  0.0872  0.1259  728 HOH A O   
3501 O  O   . HOH G .   ? 0.6643 0.4037 0.3480 0.1940  -0.1497 -0.1474 729 HOH A O   
3502 O  O   . HOH G .   ? 0.4431 0.6372 0.4360 -0.2311 -0.0464 -0.0855 730 HOH A O   
3503 O  O   . HOH G .   ? 0.7779 0.2081 0.5389 -0.0276 0.0806  -0.0210 731 HOH A O   
3504 O  O   . HOH G .   ? 0.4834 0.5913 0.6401 -0.3131 0.1377  -0.1301 732 HOH A O   
3505 O  O   . HOH G .   ? 0.4169 0.4986 0.7968 0.0759  -0.0084 -0.0109 733 HOH A O   
3506 O  O   . HOH G .   ? 0.4756 0.5129 0.6975 0.1835  -0.2349 0.0787  734 HOH A O   
3507 O  O   . HOH G .   ? 0.8135 0.6672 0.7793 -0.4419 0.0344  0.1065  735 HOH A O   
3508 O  O   . HOH G .   ? 0.8344 1.2202 0.7554 0.1162  -0.1936 0.4903  736 HOH A O   
3509 O  O   . HOH G .   ? 0.8323 0.5751 0.4133 -0.1113 -0.1458 -0.0120 737 HOH A O   
3510 O  O   . HOH G .   ? 0.4254 0.3054 0.7879 0.0254  -0.1222 0.1275  738 HOH A O   
3511 O  O   . HOH G .   ? 1.0506 0.6173 0.8242 0.1620  0.0439  0.3677  739 HOH A O   
3512 O  O   . HOH G .   ? 0.3378 0.5843 0.5938 0.2156  -0.1296 -0.0692 740 HOH A O   
3513 O  O   . HOH G .   ? 0.7322 0.5204 1.2511 -0.2705 -0.2583 -0.0473 741 HOH A O   
3514 O  O   . HOH G .   ? 0.4561 0.6003 0.9988 -0.0682 -0.2635 0.3298  742 HOH A O   
3515 O  O   . HOH G .   ? 0.5225 0.3012 0.5834 0.1447  0.0009  -0.0708 743 HOH A O   
3516 O  O   . HOH G .   ? 0.3743 0.7778 0.4461 -0.1208 0.0239  -0.1669 744 HOH A O   
3517 O  O   . HOH G .   ? 0.7150 0.5488 0.6326 0.0534  -0.1978 0.1057  745 HOH A O   
3518 O  O   . HOH G .   ? 0.5369 0.5172 0.4806 0.1407  0.0997  0.0761  746 HOH A O   
3519 O  O   . HOH G .   ? 0.9750 0.3511 0.3937 0.1168  -0.0249 -0.0048 747 HOH A O   
3520 O  O   . HOH G .   ? 0.9548 0.6588 0.3627 0.2086  -0.1572 -0.2420 748 HOH A O   
3521 O  O   . HOH G .   ? 0.8399 1.3011 0.6151 -0.6620 -0.2908 0.0967  749 HOH A O   
3522 O  O   . HOH G .   ? 0.5860 0.6578 0.2695 -0.1178 -0.1019 0.0049  750 HOH A O   
3523 O  O   . HOH G .   ? 1.6571 0.8149 0.3993 -0.3930 0.0120  -0.0062 751 HOH A O   
3524 O  O   . HOH G .   ? 0.5477 0.6357 0.7578 0.2111  -0.2053 -0.2530 752 HOH A O   
3525 O  O   . HOH G .   ? 0.7910 0.2879 0.3137 0.0096  0.0028  0.0233  753 HOH A O   
3526 O  O   . HOH G .   ? 1.1378 0.5730 0.4123 0.3284  0.1829  -0.0102 754 HOH A O   
3527 O  O   . HOH G .   ? 0.8520 0.5795 0.6378 0.0999  0.1777  0.0054  755 HOH A O   
3528 O  O   . HOH G .   ? 0.2979 1.6141 0.4804 0.2093  -0.3407 -0.0574 756 HOH A O   
3529 O  O   . HOH G .   ? 0.4802 0.3182 0.6919 0.0405  0.2722  0.0703  757 HOH A O   
3530 O  O   . HOH G .   ? 0.4001 0.2981 0.4512 -0.0229 -0.0562 0.0307  758 HOH A O   
3531 O  O   . HOH G .   ? 0.5190 0.7670 0.3561 -0.2599 -0.2349 0.2999  759 HOH A O   
3532 O  O   . HOH G .   ? 0.8970 0.7877 0.5361 -0.3047 -0.2425 0.4318  760 HOH A O   
3533 O  O   . HOH G .   ? 0.6246 0.3159 0.6589 0.0753  -0.0526 0.0346  761 HOH A O   
3534 O  O   . HOH G .   ? 0.7826 0.3259 0.5962 -0.0917 0.0027  0.0138  762 HOH A O   
3535 O  O   . HOH G .   ? 0.5628 0.3837 0.6959 -0.0422 -0.0347 -0.1262 763 HOH A O   
3536 O  O   . HOH G .   ? 0.9954 0.4894 0.5210 0.0422  0.2269  0.0729  764 HOH A O   
3537 O  O   . HOH G .   ? 0.6915 0.4169 0.8620 0.0428  -0.0930 -0.0136 765 HOH A O   
3538 O  O   . HOH G .   ? 0.5454 0.3700 0.4416 -0.2300 0.0932  -0.0144 766 HOH A O   
3539 O  O   . HOH G .   ? 0.5435 0.8815 0.4116 0.0569  -0.0604 -0.0092 767 HOH A O   
3540 O  O   . HOH G .   ? 0.7408 0.3443 0.6005 -0.0620 -0.0289 -0.0060 768 HOH A O   
3541 O  O   . HOH G .   ? 0.9051 0.3952 0.8530 0.0867  0.1554  0.1559  769 HOH A O   
3542 O  O   . HOH G .   ? 0.7420 0.3092 0.6880 0.1053  -0.1030 -0.1218 770 HOH A O   
3543 O  O   . HOH G .   ? 1.0844 0.3678 0.4475 0.0804  -0.4792 -0.1825 771 HOH A O   
3544 O  O   . HOH G .   ? 0.6569 0.3559 0.7363 0.0012  -0.3077 -0.0305 772 HOH A O   
3545 O  O   . HOH G .   ? 0.8638 0.6685 2.2718 -0.1241 -0.5248 0.3804  773 HOH A O   
3546 O  O   . HOH G .   ? 0.6030 0.5442 0.6557 0.2481  0.0990  0.1159  774 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ARG 2   2   2   ARG ARG A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  HIS 18  18  18  HIS HIS A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  HIS 22  22  22  HIS HIS A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  MET 25  25  25  MET MET A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  MET 58  58  58  MET MET A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  HIS 60  60  60  HIS HIS A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  TRP 74  74  74  TRP TRP A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 MET 116 116 116 MET MET A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 MET 146 146 146 MET MET A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 PHE 151 151 151 PHE PHE A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 MET 162 162 162 MET MET A . n 
A 1 163 HIS 163 163 163 HIS HIS A . n 
A 1 164 GLU 164 164 164 GLU GLU A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 HIS 176 176 176 HIS HIS A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 LYS 182 182 182 LYS LYS A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 THR 197 197 197 THR THR A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 ARG 203 203 203 ARG ARG A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 PHE 206 206 206 PHE PHE A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 TYR 229 229 229 TYR TYR A . n 
A 1 230 VAL 230 230 230 VAL VAL A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 LEU 245 245 245 LEU LEU A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 HIS 257 257 257 HIS HIS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 HIS 259 259 259 HIS HIS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 HIS 262 262 262 HIS HIS A . n 
A 1 263 GLY 263 263 263 GLY GLY A . n 
A 1 264 TRP 264 264 264 TRP TRP A . n 
A 1 265 MET 265 265 265 MET MET A . n 
A 1 266 ARG 266 266 266 ARG ARG A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 HIS 269 269 269 HIS HIS A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 PRO 275 275 275 PRO PRO A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 ASP 282 282 282 ASP ASP A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 PRO 291 291 291 PRO PRO A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 MET 293 293 293 MET MET A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 ARG 295 295 295 ARG ARG A . n 
A 1 296 PHE 296 296 296 PHE PHE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 PRO 299 299 299 PRO PRO A . n 
A 1 300 PRO 300 300 300 PRO PRO A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLY 306 306 306 GLY GLY A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 HIS 310 310 310 HIS HIS A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 TYR 313 313 313 TYR TYR A . n 
A 1 314 LEU 314 314 314 LEU LEU A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 ASP 319 319 319 ASP ASP A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 ASP 322 322 322 ASP ASP A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 PRO 324 324 324 PRO PRO A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 PHE 326 326 326 PHE PHE A . n 
A 1 327 ASP 327 327 327 ASP ASP A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 VAL 329 329 329 VAL VAL A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 GLN 331 331 331 GLN GLN A . n 
A 1 332 THR 332 332 332 THR THR A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 GLN 335 335 335 GLN GLN A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 ASP 338 338 338 ASP ASP A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 ILE 340 340 340 ILE ILE A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 ARG 342 342 342 ARG ARG A . n 
A 1 343 MET 343 343 343 MET MET A . n 
A 1 344 GLY 344 344 344 GLY GLY A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 GLN 347 347 347 GLN GLN A . n 
A 1 348 PRO 348 348 348 PRO PRO A . n 
A 1 349 HIS 349 349 349 HIS HIS A . n 
A 1 350 ARG 350 350 350 ARG ARG A . n 
A 1 351 LEU 351 351 351 LEU LEU A . n 
A 1 352 PRO 352 352 352 PRO PRO A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 GLU 355 355 355 GLU GLU A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 TYR 358 358 358 TYR TYR A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 LEU 361 361 361 LEU LEU A . n 
A 1 362 PRO 362 362 362 PRO PRO A . n 
A 1 363 LYS 363 363 363 LYS LYS A . n 
A 1 364 ILE 364 364 364 ILE ILE A . n 
A 1 365 LEU 365 365 365 LEU LEU A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 LYS 367 367 367 LYS LYS A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 LYS 369 369 369 LYS LYS A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 TYR 371 371 371 TYR TYR A . n 
A 1 372 PRO 372 372 372 PRO PRO A . n 
A 1 373 ALA 373 373 373 ALA ALA A . n 
A 1 374 ASP 374 374 374 ASP ASP A . n 
A 1 375 GLN 375 375 375 GLN GLN A . n 
A 1 376 TYR 376 376 376 TYR TYR A . n 
A 1 377 GLU 377 377 377 GLU GLU A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 ARG 380 380 380 ARG ARG A . n 
A 1 381 LYS 381 381 381 LYS LYS A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 TYR 383 383 383 TYR TYR A . n 
A 1 384 ILE 384 384 384 ILE ILE A . n 
A 1 385 GLU 385 385 385 GLU GLU A . n 
A 1 386 ALA 386 386 386 ALA ALA A . n 
A 1 387 VAL 387 387 387 VAL VAL A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 LYS 389 389 389 LYS LYS A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 ALA 391 391 ?   ?   ?   A . n 
A 1 392 LYS 392 392 ?   ?   ?   A . n 
A 1 393 VAL 393 393 ?   ?   ?   A . n 
A 1 394 GLU 394 394 ?   ?   ?   A . n 
A 1 395 GLU 395 395 ?   ?   ?   A . n 
A 1 396 SER 396 396 ?   ?   ?   A . n 
A 1 397 GLN 397 397 ?   ?   ?   A . n 
A 1 398 HIS 398 398 ?   ?   ?   A . n 
A 1 399 ASP 399 399 ?   ?   ?   A . n 
A 1 400 LEU 400 400 ?   ?   ?   A . n 
A 1 401 GLU 401 401 ?   ?   ?   A . n 
A 1 402 HIS 402 402 ?   ?   ?   A . n 
A 1 403 HIS 403 403 ?   ?   ?   A . n 
A 1 404 HIS 404 404 ?   ?   ?   A . n 
A 1 405 HIS 405 405 ?   ?   ?   A . n 
A 1 406 HIS 406 406 ?   ?   ?   A . n 
A 1 407 HIS 407 407 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6,7,8 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 62400 ? 
1 MORE         -659  ? 
1 'SSA (A^2)'  82200 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000    0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_465 -x-1,-y+1,z -1.0000000000 0.0000000000  0.0000000000 -112.2910000000 0.0000000000  
-1.0000000000 0.0000000000 112.2910000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_565 -y,x+1,z    0.0000000000  -1.0000000000 0.0000000000 0.0000000000    1.0000000000  
0.0000000000  0.0000000000 112.2910000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
4 'crystal symmetry operation' 4_455 y-1,-x,z    0.0000000000  1.0000000000  0.0000000000 -112.2910000000 -1.0000000000 
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
5 'crystal symmetry operation' 5_455 -x-1,y,-z   -1.0000000000 0.0000000000  0.0000000000 -112.2910000000 0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
6 'crystal symmetry operation' 6_565 x,-y+1,-z   1.0000000000  0.0000000000  0.0000000000 0.0000000000    0.0000000000  
-1.0000000000 0.0000000000 112.2910000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
7 'crystal symmetry operation' 7_465 y-1,x+1,-z  0.0000000000  1.0000000000  0.0000000000 -112.2910000000 1.0000000000  
0.0000000000  0.0000000000 112.2910000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
8 'crystal symmetry operation' 8_555 -y,-x,-z    0.0000000000  -1.0000000000 0.0000000000 0.0000000000    -1.0000000000 
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 631 ? G HOH . 
2 1 A HOH 640 ? G HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O1P ? F P6F .   ? A P6F 412 ? 1_555 125.7 ? 
2  OD2 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 510 ? 1_555 96.0  ? 
3  O1P ? F P6F .   ? A P6F 412 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 510 ? 1_555 138.1 ? 
4  OD2 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 483 ? 1_555 100.8 ? 
5  O1P ? F P6F .   ? A P6F 412 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 483 ? 1_555 88.3  ? 
6  O   ? G HOH .   ? A HOH 510 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 483 ? 1_555 87.7  ? 
7  OD2 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 482 ? 1_555 87.6  ? 
8  O1P ? F P6F .   ? A P6F 412 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 482 ? 1_555 87.7  ? 
9  O   ? G HOH .   ? A HOH 510 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 482 ? 1_555 90.4  ? 
10 O   ? G HOH .   ? A HOH 483 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O   ? G HOH .   ? A HOH 482 ? 1_555 171.6 ? 
11 OD2 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O1  ? F P6F .   ? A P6F 412 ? 1_555 167.0 ? 
12 O1P ? F P6F .   ? A P6F 412 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O1  ? F P6F .   ? A P6F 412 ? 1_555 58.6  ? 
13 O   ? G HOH .   ? A HOH 510 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O1  ? F P6F .   ? A P6F 412 ? 1_555 79.8  ? 
14 O   ? G HOH .   ? A HOH 483 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O1  ? F P6F .   ? A P6F 412 ? 1_555 91.3  ? 
15 O   ? G HOH .   ? A HOH 482 ? 1_555 MG ? E MG . ? A MG 411 ? 1_555 O1  ? F P6F .   ? A P6F 412 ? 1_555 80.3  ? 
16 O2P ? F P6F .   ? A P6F 412 ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OD2 ? A ASP 52  ? A ASP 52  ? 1_555 94.2  ? 
17 O2P ? F P6F .   ? A P6F 412 ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OD2 ? A ASP 11  ? A ASP 11  ? 1_555 92.8  ? 
18 OD2 ? A ASP 52  ? A ASP 52  ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OD2 ? A ASP 11  ? A ASP 11  ? 1_555 86.4  ? 
19 O2P ? F P6F .   ? A P6F 412 ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 O   ? G HOH .   ? A HOH 506 ? 1_555 171.2 ? 
20 OD2 ? A ASP 52  ? A ASP 52  ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 O   ? G HOH .   ? A HOH 506 ? 1_555 93.7  ? 
21 OD2 ? A ASP 11  ? A ASP 11  ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 O   ? G HOH .   ? A HOH 506 ? 1_555 84.0  ? 
22 O2P ? F P6F .   ? A P6F 412 ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OE1 ? A GLN 95  ? A GLN 95  ? 1_555 86.3  ? 
23 OD2 ? A ASP 52  ? A ASP 52  ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OE1 ? A GLN 95  ? A GLN 95  ? 1_555 171.6 ? 
24 OD2 ? A ASP 11  ? A ASP 11  ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OE1 ? A GLN 95  ? A GLN 95  ? 1_555 85.2  ? 
25 O   ? G HOH .   ? A HOH 506 ? 1_555 MG ? C MG . ? A MG 409 ? 1_555 OE1 ? A GLN 95  ? A GLN 95  ? 1_555 85.3  ? 
26 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 O3P ? F P6F .   ? A P6F 412 ? 1_555 96.7  ? 
27 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 O   ? G HOH .   ? A HOH 474 ? 1_555 168.0 ? 
28 O3P ? F P6F .   ? A P6F 412 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 O   ? G HOH .   ? A HOH 474 ? 1_555 91.2  ? 
29 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD1 ? A ASP 52  ? A ASP 52  ? 1_555 94.9  ? 
30 O3P ? F P6F .   ? A P6F 412 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD1 ? A ASP 52  ? A ASP 52  ? 1_555 94.5  ? 
31 O   ? G HOH .   ? A HOH 474 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD1 ? A ASP 52  ? A ASP 52  ? 1_555 93.5  ? 
32 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 53  ? A ASP 53  ? 1_555 82.1  ? 
33 O3P ? F P6F .   ? A P6F 412 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 53  ? A ASP 53  ? 1_555 178.7 ? 
34 O   ? G HOH .   ? A HOH 474 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 53  ? A ASP 53  ? 1_555 89.9  ? 
35 OD1 ? A ASP 52  ? A ASP 52  ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 53  ? A ASP 53  ? 1_555 86.2  ? 
36 OD1 ? A ASP 132 ? A ASP 132 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 90.6  ? 
37 O3P ? F P6F .   ? A P6F 412 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 90.5  ? 
38 O   ? G HOH .   ? A HOH 474 ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 80.3  ? 
39 OD1 ? A ASP 52  ? A ASP 52  ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 172.1 ? 
40 OD2 ? A ASP 53  ? A ASP 53  ? 1_555 MG ? B MG . ? A MG 408 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 89.0  ? 
41 OD1 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 90.2  ? 
42 OD1 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 478 ? 1_555 87.4  ? 
43 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 478 ? 1_555 170.3 ? 
44 OD1 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O1P ? F P6F .   ? A P6F 412 ? 1_555 87.9  ? 
45 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O1P ? F P6F .   ? A P6F 412 ? 1_555 85.4  ? 
46 O   ? G HOH .   ? A HOH 478 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O1P ? F P6F .   ? A P6F 412 ? 1_555 103.9 ? 
47 OD1 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 474 ? 1_555 156.3 ? 
48 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 474 ? 1_555 68.4  ? 
49 O   ? G HOH .   ? A HOH 478 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 474 ? 1_555 115.5 ? 
50 O1P ? F P6F .   ? A P6F 412 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 474 ? 1_555 80.7  ? 
51 OD1 ? A ASP 233 ? A ASP 233 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 484 ? 1_555 115.7 ? 
52 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 484 ? 1_555 98.7  ? 
53 O   ? G HOH .   ? A HOH 478 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 484 ? 1_555 74.0  ? 
54 O1P ? F P6F .   ? A P6F 412 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 484 ? 1_555 155.9 ? 
55 O   ? G HOH .   ? A HOH 474 ? 1_555 MG ? D MG . ? A MG 410 ? 1_555 O   ? G HOH .   ? A HOH 484 ? 1_555 78.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-26 
2 'Structure model' 1 1 2011-11-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
MOLREP    phasing           .        ? 2 
REFMAC    refinement        5.5.0109 ? 3 
XDS       'data reduction'  .        ? 4 
SCALA     'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A HOH 638 ? ? O A HOH 656 ? ? 1.65 
2  1 O   A HOH 669 ? ? O A HOH 670 ? ? 1.83 
3  1 CG  A MET 1   ? ? O A HOH 659 ? ? 1.90 
4  1 O   A HOH 656 ? ? O A HOH 657 ? ? 1.91 
5  1 CD  A LYS 381 ? ? O A HOH 624 ? ? 1.92 
6  1 O   A HOH 512 ? ? O A HOH 601 ? ? 1.93 
7  1 O   A HOH 657 ? ? O A HOH 658 ? ? 1.93 
8  1 CE  A MET 1   ? ? O A HOH 659 ? ? 1.97 
9  1 O   A HOH 668 ? ? O A HOH 669 ? ? 1.97 
10 1 SD  A MET 1   ? ? O A HOH 659 ? ? 2.03 
11 1 OD2 A ASP 68  ? A O A HOH 535 ? ? 2.05 
12 1 NZ  A LYS 9   ? A O A HOH 484 ? ? 2.07 
13 1 O   A HOH 505 ? ? O A HOH 758 ? ? 2.08 
14 1 O   A HOH 709 ? ? O A HOH 710 ? ? 2.08 
15 1 O5P A P6F 412 ? ? O A HOH 660 ? ? 2.14 
16 1 O   A HOH 746 ? ? O A HOH 754 ? ? 2.16 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CZ A PHE 102 ? ? 1_555 O A HOH 699 ? ? 4_455 1.95 
2 1 O  A HOH 574 ? ? 1_555 O A HOH 663 ? ? 4_455 2.03 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CG A GLU 35  ? ? CD  A GLU 35  ? ? 1.624 1.515 0.109  0.015 N 
2  1 CB A ASP 100 ? ? CG  A ASP 100 ? ? 1.709 1.513 0.196  0.021 N 
3  1 CA A GLN 112 ? ? CB  A GLN 112 ? ? 1.355 1.535 -0.180 0.022 N 
4  1 CB A GLU 115 ? ? CG  A GLU 115 ? ? 1.325 1.517 -0.192 0.019 N 
5  1 CD A GLU 117 ? A OE2 A GLU 117 ? A 1.141 1.252 -0.111 0.011 N 
6  1 CD A GLU 135 ? ? OE2 A GLU 135 ? ? 1.175 1.252 -0.077 0.011 N 
7  1 CD A GLU 164 ? ? OE1 A GLU 164 ? ? 1.341 1.252 0.089  0.011 N 
8  1 CG A ARG 207 ? ? CD  A ARG 207 ? ? 1.245 1.515 -0.270 0.025 N 
9  1 CD A ARG 207 ? ? NE  A ARG 207 ? ? 1.292 1.460 -0.168 0.017 N 
10 1 CG A ARG 208 ? ? CD  A ARG 208 ? ? 1.365 1.515 -0.150 0.025 N 
11 1 CD A ARG 286 ? ? NE  A ARG 286 ? ? 1.342 1.460 -0.118 0.017 N 
12 1 CG A GLU 311 ? ? CD  A GLU 311 ? ? 1.409 1.515 -0.106 0.015 N 
13 1 CD A GLU 311 ? ? OE2 A GLU 311 ? ? 1.348 1.252 0.096  0.011 N 
14 1 CB A GLU 315 ? ? CG  A GLU 315 ? ? 1.296 1.517 -0.221 0.019 N 
15 1 CA A PRO 345 ? ? CB  A PRO 345 ? ? 1.707 1.531 0.176  0.020 N 
16 1 CB A GLU 354 ? ? CG  A GLU 354 ? ? 1.770 1.517 0.253  0.019 N 
17 1 CG A GLU 354 ? ? CD  A GLU 354 ? ? 1.655 1.515 0.140  0.015 N 
18 1 CD A GLU 354 ? ? OE1 A GLU 354 ? ? 1.389 1.252 0.137  0.011 N 
19 1 CD A GLU 354 ? ? OE2 A GLU 354 ? ? 1.476 1.252 0.224  0.011 N 
20 1 CB A GLU 355 ? ? CG  A GLU 355 ? ? 1.633 1.517 0.116  0.019 N 
21 1 CG A GLU 355 ? ? CD  A GLU 355 ? ? 1.659 1.515 0.144  0.015 N 
22 1 CD A GLU 355 ? ? OE2 A GLU 355 ? ? 1.429 1.252 0.177  0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A ASP 11  ? ? CG A ASP 11  ? ? OD1 A ASP 11  ? ? 124.48 118.30 6.18   0.90 N 
2  1 NE  A ARG 39  ? ? CZ A ARG 39  ? ? NH1 A ARG 39  ? ? 125.08 120.30 4.78   0.50 N 
3  1 NE  A ARG 39  ? ? CZ A ARG 39  ? ? NH2 A ARG 39  ? ? 116.74 120.30 -3.56  0.50 N 
4  1 CB  A LEU 97  ? ? CG A LEU 97  ? ? CD1 A LEU 97  ? ? 124.99 111.00 13.99  1.70 N 
5  1 CB  A ASP 100 ? ? CG A ASP 100 ? ? OD2 A ASP 100 ? ? 123.98 118.30 5.68   0.90 N 
6  1 CD  A LYS 204 ? A CE A LYS 204 ? A NZ  A LYS 204 ? A 126.81 111.70 15.11  2.30 N 
7  1 NH1 A ARG 207 ? ? CZ A ARG 207 ? ? NH2 A ARG 207 ? ? 112.20 119.40 -7.20  1.10 N 
8  1 NE  A ARG 207 ? ? CZ A ARG 207 ? ? NH2 A ARG 207 ? ? 125.08 120.30 4.78   0.50 N 
9  1 CD  A ARG 208 ? ? NE A ARG 208 ? ? CZ  A ARG 208 ? ? 134.97 123.60 11.37  1.40 N 
10 1 NE  A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 124.24 120.30 3.94   0.50 N 
11 1 NE  A ARG 208 ? ? CZ A ARG 208 ? ? NH2 A ARG 208 ? ? 117.30 120.30 -3.00  0.50 N 
12 1 CG  A ARG 221 ? ? CD A ARG 221 ? ? NE  A ARG 221 ? ? 124.53 111.80 12.73  2.10 N 
13 1 CD  A ARG 221 ? ? NE A ARG 221 ? ? CZ  A ARG 221 ? ? 138.94 123.60 15.34  1.40 N 
14 1 NE  A ARG 221 ? ? CZ A ARG 221 ? ? NH1 A ARG 221 ? ? 112.67 120.30 -7.63  0.50 N 
15 1 NE  A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 131.64 120.30 11.34  0.50 N 
16 1 NE  A ARG 240 ? ? CZ A ARG 240 ? ? NH2 A ARG 240 ? ? 117.00 120.30 -3.30  0.50 N 
17 1 OE1 A GLU 311 ? ? CD A GLU 311 ? ? OE2 A GLU 311 ? ? 132.14 123.30 8.84   1.20 N 
18 1 CB  A ASP 323 ? ? CG A ASP 323 ? ? OD2 A ASP 323 ? ? 125.06 118.30 6.76   0.90 N 
19 1 NE  A ARG 341 ? ? CZ A ARG 341 ? ? NH2 A ARG 341 ? ? 117.17 120.30 -3.13  0.50 N 
20 1 N   A PRO 345 ? ? CA A PRO 345 ? ? CB  A PRO 345 ? ? 94.09  103.30 -9.21  1.20 N 
21 1 OE1 A GLU 354 ? ? CD A GLU 354 ? ? OE2 A GLU 354 ? ? 131.25 123.30 7.95   1.20 N 
22 1 CG  A MET 356 ? B SD A MET 356 ? B CE  A MET 356 ? B 88.88  100.20 -11.32 1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 15  ? ? -153.14 89.80   
2 1 ASP A 234 ? ? 69.96   72.79   
3 1 GLN A 242 ? ? 75.29   166.01  
4 1 TRP A 264 ? ? 51.26   -148.26 
5 1 ARG A 286 ? ? 70.05   34.27   
6 1 THR A 294 ? ? -123.36 -97.77  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 391 ? A ALA 391 
2  1 Y 1 A LYS 392 ? A LYS 392 
3  1 Y 1 A VAL 393 ? A VAL 393 
4  1 Y 1 A GLU 394 ? A GLU 394 
5  1 Y 1 A GLU 395 ? A GLU 395 
6  1 Y 1 A SER 396 ? A SER 396 
7  1 Y 1 A GLN 397 ? A GLN 397 
8  1 Y 1 A HIS 398 ? A HIS 398 
9  1 Y 1 A ASP 399 ? A ASP 399 
10 1 Y 1 A LEU 400 ? A LEU 400 
11 1 Y 1 A GLU 401 ? A GLU 401 
12 1 Y 1 A HIS 402 ? A HIS 402 
13 1 Y 1 A HIS 403 ? A HIS 403 
14 1 Y 1 A HIS 404 ? A HIS 404 
15 1 Y 1 A HIS 405 ? A HIS 405 
16 1 Y 1 A HIS 406 ? A HIS 406 
17 1 Y 1 A HIS 407 ? A HIS 407 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'               MG  
3 1,6-di-O-phosphono-D-fructose P6F 
4 water                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   408 400 MG  MG  A . 
C 2 MG  1   409 401 MG  MG  A . 
D 2 MG  1   410 402 MG  MG  A . 
E 2 MG  1   411 403 MG  MG  A . 
F 3 P6F 1   412 1   P6F 2FP A . 
G 4 HOH 1   413 1   HOH HOH A . 
G 4 HOH 2   414 2   HOH HOH A . 
G 4 HOH 3   415 3   HOH HOH A . 
G 4 HOH 4   416 4   HOH HOH A . 
G 4 HOH 5   417 5   HOH HOH A . 
G 4 HOH 6   418 6   HOH HOH A . 
G 4 HOH 7   419 7   HOH HOH A . 
G 4 HOH 8   420 8   HOH HOH A . 
G 4 HOH 9   421 9   HOH HOH A . 
G 4 HOH 10  422 10  HOH HOH A . 
G 4 HOH 11  423 11  HOH HOH A . 
G 4 HOH 12  424 12  HOH HOH A . 
G 4 HOH 13  425 13  HOH HOH A . 
G 4 HOH 14  426 14  HOH HOH A . 
G 4 HOH 15  427 15  HOH HOH A . 
G 4 HOH 16  428 16  HOH HOH A . 
G 4 HOH 17  429 17  HOH HOH A . 
G 4 HOH 18  430 18  HOH HOH A . 
G 4 HOH 19  431 19  HOH HOH A . 
G 4 HOH 20  432 20  HOH HOH A . 
G 4 HOH 21  433 21  HOH HOH A . 
G 4 HOH 22  434 22  HOH HOH A . 
G 4 HOH 23  435 23  HOH HOH A . 
G 4 HOH 24  436 24  HOH HOH A . 
G 4 HOH 25  437 25  HOH HOH A . 
G 4 HOH 26  438 26  HOH HOH A . 
G 4 HOH 27  439 27  HOH HOH A . 
G 4 HOH 28  440 28  HOH HOH A . 
G 4 HOH 29  441 29  HOH HOH A . 
G 4 HOH 30  442 30  HOH HOH A . 
G 4 HOH 31  443 31  HOH HOH A . 
G 4 HOH 32  444 32  HOH HOH A . 
G 4 HOH 33  445 33  HOH HOH A . 
G 4 HOH 34  446 34  HOH HOH A . 
G 4 HOH 35  447 35  HOH HOH A . 
G 4 HOH 36  448 36  HOH HOH A . 
G 4 HOH 37  449 37  HOH HOH A . 
G 4 HOH 38  450 38  HOH HOH A . 
G 4 HOH 39  451 39  HOH HOH A . 
G 4 HOH 40  452 40  HOH HOH A . 
G 4 HOH 41  453 41  HOH HOH A . 
G 4 HOH 42  454 42  HOH HOH A . 
G 4 HOH 43  455 43  HOH HOH A . 
G 4 HOH 44  456 44  HOH HOH A . 
G 4 HOH 45  457 45  HOH HOH A . 
G 4 HOH 46  458 46  HOH HOH A . 
G 4 HOH 47  459 47  HOH HOH A . 
G 4 HOH 48  460 48  HOH HOH A . 
G 4 HOH 49  461 49  HOH HOH A . 
G 4 HOH 50  462 50  HOH HOH A . 
G 4 HOH 51  463 51  HOH HOH A . 
G 4 HOH 52  464 52  HOH HOH A . 
G 4 HOH 53  465 53  HOH HOH A . 
G 4 HOH 54  466 54  HOH HOH A . 
G 4 HOH 55  467 55  HOH HOH A . 
G 4 HOH 56  468 56  HOH HOH A . 
G 4 HOH 57  469 57  HOH HOH A . 
G 4 HOH 58  470 58  HOH HOH A . 
G 4 HOH 59  471 59  HOH HOH A . 
G 4 HOH 60  472 60  HOH HOH A . 
G 4 HOH 61  473 61  HOH HOH A . 
G 4 HOH 62  474 62  HOH HOH A . 
G 4 HOH 63  475 63  HOH HOH A . 
G 4 HOH 64  476 64  HOH HOH A . 
G 4 HOH 65  477 65  HOH HOH A . 
G 4 HOH 66  478 66  HOH HOH A . 
G 4 HOH 67  479 67  HOH HOH A . 
G 4 HOH 68  480 68  HOH HOH A . 
G 4 HOH 69  481 69  HOH HOH A . 
G 4 HOH 70  482 70  HOH HOH A . 
G 4 HOH 71  483 71  HOH HOH A . 
G 4 HOH 72  484 72  HOH HOH A . 
G 4 HOH 73  485 73  HOH HOH A . 
G 4 HOH 74  486 74  HOH HOH A . 
G 4 HOH 75  487 75  HOH HOH A . 
G 4 HOH 76  488 76  HOH HOH A . 
G 4 HOH 77  489 77  HOH HOH A . 
G 4 HOH 78  490 78  HOH HOH A . 
G 4 HOH 79  491 79  HOH HOH A . 
G 4 HOH 80  492 80  HOH HOH A . 
G 4 HOH 81  493 81  HOH HOH A . 
G 4 HOH 82  494 82  HOH HOH A . 
G 4 HOH 83  495 83  HOH HOH A . 
G 4 HOH 84  496 84  HOH HOH A . 
G 4 HOH 85  497 85  HOH HOH A . 
G 4 HOH 86  498 86  HOH HOH A . 
G 4 HOH 87  499 87  HOH HOH A . 
G 4 HOH 88  500 88  HOH HOH A . 
G 4 HOH 89  501 89  HOH HOH A . 
G 4 HOH 90  502 90  HOH HOH A . 
G 4 HOH 91  503 91  HOH HOH A . 
G 4 HOH 92  504 92  HOH HOH A . 
G 4 HOH 93  505 93  HOH HOH A . 
G 4 HOH 94  506 94  HOH HOH A . 
G 4 HOH 95  507 95  HOH HOH A . 
G 4 HOH 96  508 96  HOH HOH A . 
G 4 HOH 97  509 97  HOH HOH A . 
G 4 HOH 98  510 98  HOH HOH A . 
G 4 HOH 99  511 99  HOH HOH A . 
G 4 HOH 100 512 100 HOH HOH A . 
G 4 HOH 101 513 101 HOH HOH A . 
G 4 HOH 102 514 102 HOH HOH A . 
G 4 HOH 103 515 103 HOH HOH A . 
G 4 HOH 104 516 104 HOH HOH A . 
G 4 HOH 105 517 105 HOH HOH A . 
G 4 HOH 106 518 106 HOH HOH A . 
G 4 HOH 107 519 107 HOH HOH A . 
G 4 HOH 108 520 108 HOH HOH A . 
G 4 HOH 109 521 109 HOH HOH A . 
G 4 HOH 110 522 110 HOH HOH A . 
G 4 HOH 111 523 111 HOH HOH A . 
G 4 HOH 112 524 112 HOH HOH A . 
G 4 HOH 113 525 113 HOH HOH A . 
G 4 HOH 114 526 114 HOH HOH A . 
G 4 HOH 115 527 115 HOH HOH A . 
G 4 HOH 116 528 116 HOH HOH A . 
G 4 HOH 117 529 117 HOH HOH A . 
G 4 HOH 118 530 118 HOH HOH A . 
G 4 HOH 119 531 119 HOH HOH A . 
G 4 HOH 120 532 120 HOH HOH A . 
G 4 HOH 121 533 121 HOH HOH A . 
G 4 HOH 122 534 122 HOH HOH A . 
G 4 HOH 123 535 123 HOH HOH A . 
G 4 HOH 124 536 124 HOH HOH A . 
G 4 HOH 125 537 125 HOH HOH A . 
G 4 HOH 126 538 126 HOH HOH A . 
G 4 HOH 127 539 127 HOH HOH A . 
G 4 HOH 128 540 128 HOH HOH A . 
G 4 HOH 129 541 129 HOH HOH A . 
G 4 HOH 130 542 130 HOH HOH A . 
G 4 HOH 131 543 131 HOH HOH A . 
G 4 HOH 132 544 132 HOH HOH A . 
G 4 HOH 133 545 133 HOH HOH A . 
G 4 HOH 134 546 134 HOH HOH A . 
G 4 HOH 135 547 135 HOH HOH A . 
G 4 HOH 136 548 136 HOH HOH A . 
G 4 HOH 137 549 137 HOH HOH A . 
G 4 HOH 138 550 138 HOH HOH A . 
G 4 HOH 139 551 139 HOH HOH A . 
G 4 HOH 140 552 140 HOH HOH A . 
G 4 HOH 141 553 141 HOH HOH A . 
G 4 HOH 142 554 142 HOH HOH A . 
G 4 HOH 143 555 143 HOH HOH A . 
G 4 HOH 144 556 144 HOH HOH A . 
G 4 HOH 145 557 145 HOH HOH A . 
G 4 HOH 146 558 146 HOH HOH A . 
G 4 HOH 147 559 147 HOH HOH A . 
G 4 HOH 148 560 148 HOH HOH A . 
G 4 HOH 149 561 149 HOH HOH A . 
G 4 HOH 150 562 150 HOH HOH A . 
G 4 HOH 151 563 151 HOH HOH A . 
G 4 HOH 152 564 152 HOH HOH A . 
G 4 HOH 153 565 153 HOH HOH A . 
G 4 HOH 154 566 154 HOH HOH A . 
G 4 HOH 155 567 155 HOH HOH A . 
G 4 HOH 156 568 156 HOH HOH A . 
G 4 HOH 157 569 157 HOH HOH A . 
G 4 HOH 158 570 158 HOH HOH A . 
G 4 HOH 159 571 159 HOH HOH A . 
G 4 HOH 160 572 160 HOH HOH A . 
G 4 HOH 161 573 161 HOH HOH A . 
G 4 HOH 162 574 162 HOH HOH A . 
G 4 HOH 163 575 163 HOH HOH A . 
G 4 HOH 164 576 164 HOH HOH A . 
G 4 HOH 165 577 165 HOH HOH A . 
G 4 HOH 166 578 166 HOH HOH A . 
G 4 HOH 167 579 167 HOH HOH A . 
G 4 HOH 168 580 168 HOH HOH A . 
G 4 HOH 169 581 169 HOH HOH A . 
G 4 HOH 170 582 170 HOH HOH A . 
G 4 HOH 171 583 171 HOH HOH A . 
G 4 HOH 172 584 172 HOH HOH A . 
G 4 HOH 173 585 173 HOH HOH A . 
G 4 HOH 174 586 174 HOH HOH A . 
G 4 HOH 175 587 175 HOH HOH A . 
G 4 HOH 176 588 176 HOH HOH A . 
G 4 HOH 177 589 177 HOH HOH A . 
G 4 HOH 178 590 178 HOH HOH A . 
G 4 HOH 179 591 179 HOH HOH A . 
G 4 HOH 180 592 180 HOH HOH A . 
G 4 HOH 181 593 181 HOH HOH A . 
G 4 HOH 182 594 182 HOH HOH A . 
G 4 HOH 183 595 183 HOH HOH A . 
G 4 HOH 184 596 184 HOH HOH A . 
G 4 HOH 185 597 185 HOH HOH A . 
G 4 HOH 186 598 186 HOH HOH A . 
G 4 HOH 187 599 187 HOH HOH A . 
G 4 HOH 188 600 188 HOH HOH A . 
G 4 HOH 189 601 189 HOH HOH A . 
G 4 HOH 190 602 190 HOH HOH A . 
G 4 HOH 191 603 191 HOH HOH A . 
G 4 HOH 192 604 192 HOH HOH A . 
G 4 HOH 193 605 193 HOH HOH A . 
G 4 HOH 194 606 194 HOH HOH A . 
G 4 HOH 195 607 195 HOH HOH A . 
G 4 HOH 196 608 196 HOH HOH A . 
G 4 HOH 197 609 197 HOH HOH A . 
G 4 HOH 198 610 198 HOH HOH A . 
G 4 HOH 199 611 199 HOH HOH A . 
G 4 HOH 200 612 200 HOH HOH A . 
G 4 HOH 201 613 201 HOH HOH A . 
G 4 HOH 202 614 202 HOH HOH A . 
G 4 HOH 203 615 203 HOH HOH A . 
G 4 HOH 204 616 204 HOH HOH A . 
G 4 HOH 205 617 205 HOH HOH A . 
G 4 HOH 206 618 206 HOH HOH A . 
G 4 HOH 207 619 207 HOH HOH A . 
G 4 HOH 208 620 208 HOH HOH A . 
G 4 HOH 209 621 209 HOH HOH A . 
G 4 HOH 210 622 210 HOH HOH A . 
G 4 HOH 211 623 211 HOH HOH A . 
G 4 HOH 212 624 212 HOH HOH A . 
G 4 HOH 213 625 213 HOH HOH A . 
G 4 HOH 214 626 214 HOH HOH A . 
G 4 HOH 215 627 215 HOH HOH A . 
G 4 HOH 216 628 216 HOH HOH A . 
G 4 HOH 217 629 217 HOH HOH A . 
G 4 HOH 218 630 218 HOH HOH A . 
G 4 HOH 219 631 219 HOH HOH A . 
G 4 HOH 220 632 220 HOH HOH A . 
G 4 HOH 221 633 221 HOH HOH A . 
G 4 HOH 222 634 222 HOH HOH A . 
G 4 HOH 223 635 223 HOH HOH A . 
G 4 HOH 224 636 224 HOH HOH A . 
G 4 HOH 225 637 225 HOH HOH A . 
G 4 HOH 226 638 226 HOH HOH A . 
G 4 HOH 227 639 227 HOH HOH A . 
G 4 HOH 228 640 228 HOH HOH A . 
G 4 HOH 229 641 229 HOH HOH A . 
G 4 HOH 230 642 230 HOH HOH A . 
G 4 HOH 231 643 231 HOH HOH A . 
G 4 HOH 232 644 232 HOH HOH A . 
G 4 HOH 233 645 233 HOH HOH A . 
G 4 HOH 234 646 234 HOH HOH A . 
G 4 HOH 235 647 235 HOH HOH A . 
G 4 HOH 236 648 236 HOH HOH A . 
G 4 HOH 237 649 237 HOH HOH A . 
G 4 HOH 238 650 238 HOH HOH A . 
G 4 HOH 239 651 239 HOH HOH A . 
G 4 HOH 240 652 240 HOH HOH A . 
G 4 HOH 241 653 241 HOH HOH A . 
G 4 HOH 242 654 242 HOH HOH A . 
G 4 HOH 243 655 243 HOH HOH A . 
G 4 HOH 244 656 244 HOH HOH A . 
G 4 HOH 245 657 245 HOH HOH A . 
G 4 HOH 246 658 246 HOH HOH A . 
G 4 HOH 247 659 247 HOH HOH A . 
G 4 HOH 248 660 248 HOH HOH A . 
G 4 HOH 249 661 249 HOH HOH A . 
G 4 HOH 250 662 250 HOH HOH A . 
G 4 HOH 251 663 251 HOH HOH A . 
G 4 HOH 252 664 252 HOH HOH A . 
G 4 HOH 253 665 253 HOH HOH A . 
G 4 HOH 254 666 254 HOH HOH A . 
G 4 HOH 255 667 255 HOH HOH A . 
G 4 HOH 256 668 256 HOH HOH A . 
G 4 HOH 257 669 257 HOH HOH A . 
G 4 HOH 258 670 258 HOH HOH A . 
G 4 HOH 259 671 259 HOH HOH A . 
G 4 HOH 260 672 260 HOH HOH A . 
G 4 HOH 261 673 261 HOH HOH A . 
G 4 HOH 262 674 262 HOH HOH A . 
G 4 HOH 263 675 263 HOH HOH A . 
G 4 HOH 264 676 264 HOH HOH A . 
G 4 HOH 265 677 265 HOH HOH A . 
G 4 HOH 266 678 266 HOH HOH A . 
G 4 HOH 267 679 267 HOH HOH A . 
G 4 HOH 268 680 268 HOH HOH A . 
G 4 HOH 269 681 269 HOH HOH A . 
G 4 HOH 270 682 270 HOH HOH A . 
G 4 HOH 271 683 271 HOH HOH A . 
G 4 HOH 272 684 272 HOH HOH A . 
G 4 HOH 273 685 273 HOH HOH A . 
G 4 HOH 274 686 274 HOH HOH A . 
G 4 HOH 275 687 275 HOH HOH A . 
G 4 HOH 276 688 276 HOH HOH A . 
G 4 HOH 277 689 277 HOH HOH A . 
G 4 HOH 278 690 278 HOH HOH A . 
G 4 HOH 279 691 279 HOH HOH A . 
G 4 HOH 280 692 280 HOH HOH A . 
G 4 HOH 281 693 281 HOH HOH A . 
G 4 HOH 282 694 282 HOH HOH A . 
G 4 HOH 283 695 283 HOH HOH A . 
G 4 HOH 284 696 284 HOH HOH A . 
G 4 HOH 285 697 285 HOH HOH A . 
G 4 HOH 286 698 286 HOH HOH A . 
G 4 HOH 287 699 287 HOH HOH A . 
G 4 HOH 288 700 288 HOH HOH A . 
G 4 HOH 289 701 289 HOH HOH A . 
G 4 HOH 290 702 290 HOH HOH A . 
G 4 HOH 291 703 291 HOH HOH A . 
G 4 HOH 292 704 292 HOH HOH A . 
G 4 HOH 293 705 293 HOH HOH A . 
G 4 HOH 294 706 294 HOH HOH A . 
G 4 HOH 295 707 295 HOH HOH A . 
G 4 HOH 296 708 296 HOH HOH A . 
G 4 HOH 297 709 297 HOH HOH A . 
G 4 HOH 298 710 298 HOH HOH A . 
G 4 HOH 299 711 299 HOH HOH A . 
G 4 HOH 300 712 300 HOH HOH A . 
G 4 HOH 301 713 301 HOH HOH A . 
G 4 HOH 302 714 302 HOH HOH A . 
G 4 HOH 303 715 303 HOH HOH A . 
G 4 HOH 304 716 304 HOH HOH A . 
G 4 HOH 305 717 305 HOH HOH A . 
G 4 HOH 306 718 306 HOH HOH A . 
G 4 HOH 307 719 307 HOH HOH A . 
G 4 HOH 308 720 308 HOH HOH A . 
G 4 HOH 309 721 309 HOH HOH A . 
G 4 HOH 310 722 310 HOH HOH A . 
G 4 HOH 311 723 311 HOH HOH A . 
G 4 HOH 312 724 312 HOH HOH A . 
G 4 HOH 313 725 313 HOH HOH A . 
G 4 HOH 314 726 314 HOH HOH A . 
G 4 HOH 315 727 315 HOH HOH A . 
G 4 HOH 316 728 316 HOH HOH A . 
G 4 HOH 317 729 317 HOH HOH A . 
G 4 HOH 318 730 318 HOH HOH A . 
G 4 HOH 319 731 319 HOH HOH A . 
G 4 HOH 320 732 320 HOH HOH A . 
G 4 HOH 321 733 321 HOH HOH A . 
G 4 HOH 322 734 322 HOH HOH A . 
G 4 HOH 323 735 323 HOH HOH A . 
G 4 HOH 324 736 324 HOH HOH A . 
G 4 HOH 325 737 325 HOH HOH A . 
G 4 HOH 326 738 326 HOH HOH A . 
G 4 HOH 327 739 327 HOH HOH A . 
G 4 HOH 328 740 328 HOH HOH A . 
G 4 HOH 329 741 329 HOH HOH A . 
G 4 HOH 330 742 330 HOH HOH A . 
G 4 HOH 331 743 331 HOH HOH A . 
G 4 HOH 332 744 332 HOH HOH A . 
G 4 HOH 333 745 333 HOH HOH A . 
G 4 HOH 334 746 334 HOH HOH A . 
G 4 HOH 335 747 335 HOH HOH A . 
G 4 HOH 336 748 336 HOH HOH A . 
G 4 HOH 337 749 337 HOH HOH A . 
G 4 HOH 338 750 338 HOH HOH A . 
G 4 HOH 339 751 339 HOH HOH A . 
G 4 HOH 340 752 340 HOH HOH A . 
G 4 HOH 341 753 341 HOH HOH A . 
G 4 HOH 342 754 342 HOH HOH A . 
G 4 HOH 343 755 343 HOH HOH A . 
G 4 HOH 344 756 344 HOH HOH A . 
G 4 HOH 345 757 345 HOH HOH A . 
G 4 HOH 346 758 346 HOH HOH A . 
G 4 HOH 347 759 347 HOH HOH A . 
G 4 HOH 348 760 348 HOH HOH A . 
G 4 HOH 349 761 349 HOH HOH A . 
G 4 HOH 350 762 350 HOH HOH A . 
G 4 HOH 351 763 351 HOH HOH A . 
G 4 HOH 352 764 352 HOH HOH A . 
G 4 HOH 353 765 353 HOH HOH A . 
G 4 HOH 354 766 354 HOH HOH A . 
G 4 HOH 355 767 355 HOH HOH A . 
G 4 HOH 356 768 356 HOH HOH A . 
G 4 HOH 357 769 357 HOH HOH A . 
G 4 HOH 358 770 358 HOH HOH A . 
G 4 HOH 359 771 359 HOH HOH A . 
G 4 HOH 360 772 360 HOH HOH A . 
G 4 HOH 361 773 361 HOH HOH A . 
G 4 HOH 362 774 362 HOH HOH A . 
#