data_3T6A
# 
_entry.id   3T6A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3T6A         
RCSB  RCSB067090   
WWPDB D_1000067090 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3T6G 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3T6A 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mace, P.D.'   1 
'Robinson, H.' 2 
'Riedl, S.J.'  3 
# 
_citation.id                        primary 
_citation.title                     'NSP-Cas protein structures reveal a promiscuous interaction module in cell signaling.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            18 
_citation.page_first                1381 
_citation.page_last                 1387 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22081014 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2152 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mace, P.D.'        1 
primary 'Wallez, Y.'        2 
primary 'Dobaczewska, M.K.' 3 
primary 'Lee, J.J.'         4 
primary 'Robinson, H.'      5 
primary 'Pasquale, E.B.'    6 
primary 'Riedl, S.J.'       7 
# 
_cell.entry_id           3T6A 
_cell.length_a           50.233 
_cell.length_b           151.889 
_cell.length_c           196.503 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3T6A 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Breast cancer anti-estrogen resistance protein 3'                           38009.824 4   ? M536L 
'C-terminal domain (UNP residues 502-825)' ? 
2 non-polymer syn '(20S)-2,5,8,11,14,17-HEXAMETHYL-3,6,9,12,15,18-HEXAOXAHENICOSANE-1,20-DIOL' 424.569   2   ? ?     ? ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'                                                        ?         8   ? ?     ? ? 
4 water       nat water                                                                        18.015    373 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Novel SH2-containing protein 2, SH2 domain-containing protein 3B' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVS
SGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQIT
RLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIM
LNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPV
KQAELLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVS
SGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQIT
RLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIM
LNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPV
KQAELLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   GLU n 
1 4   PHE n 
1 5   VAL n 
1 6   THR n 
1 7   PRO n 
1 8   LEU n 
1 9   LEU n 
1 10  GLU n 
1 11  THR n 
1 12  VAL n 
1 13  SER n 
1 14  SER n 
1 15  PHE n 
1 16  ARG n 
1 17  PRO n 
1 18  ASN n 
1 19  GLU n 
1 20  PHE n 
1 21  GLU n 
1 22  SER n 
1 23  LYS n 
1 24  PHE n 
1 25  LEU n 
1 26  PRO n 
1 27  PRO n 
1 28  GLU n 
1 29  ASN n 
1 30  LYS n 
1 31  PRO n 
1 32  LEU n 
1 33  GLU n 
1 34  THR n 
1 35  ALA n 
1 36  LEU n 
1 37  LEU n 
1 38  LYS n 
1 39  ARG n 
1 40  ALA n 
1 41  LYS n 
1 42  GLU n 
1 43  LEU n 
1 44  PHE n 
1 45  THR n 
1 46  ASN n 
1 47  ASN n 
1 48  ASP n 
1 49  PRO n 
1 50  LYS n 
1 51  VAL n 
1 52  ILE n 
1 53  ALA n 
1 54  GLN n 
1 55  HIS n 
1 56  VAL n 
1 57  LEU n 
1 58  SER n 
1 59  MET n 
1 60  ASP n 
1 61  CYS n 
1 62  ARG n 
1 63  VAL n 
1 64  ALA n 
1 65  ARG n 
1 66  ILE n 
1 67  LEU n 
1 68  GLY n 
1 69  VAL n 
1 70  SER n 
1 71  GLU n 
1 72  GLU n 
1 73  MET n 
1 74  ARG n 
1 75  ARG n 
1 76  ASN n 
1 77  MET n 
1 78  GLY n 
1 79  VAL n 
1 80  SER n 
1 81  SER n 
1 82  GLY n 
1 83  LEU n 
1 84  GLU n 
1 85  LEU n 
1 86  ILE n 
1 87  THR n 
1 88  LEU n 
1 89  PRO n 
1 90  HIS n 
1 91  GLY n 
1 92  HIS n 
1 93  GLN n 
1 94  LEU n 
1 95  ARG n 
1 96  LEU n 
1 97  ASP n 
1 98  ILE n 
1 99  ILE n 
1 100 GLU n 
1 101 ARG n 
1 102 HIS n 
1 103 ASN n 
1 104 THR n 
1 105 MET n 
1 106 ALA n 
1 107 ILE n 
1 108 GLY n 
1 109 ILE n 
1 110 ALA n 
1 111 VAL n 
1 112 ASP n 
1 113 ILE n 
1 114 LEU n 
1 115 GLY n 
1 116 CYS n 
1 117 THR n 
1 118 GLY n 
1 119 THR n 
1 120 LEU n 
1 121 GLU n 
1 122 ASP n 
1 123 ARG n 
1 124 ALA n 
1 125 ALA n 
1 126 THR n 
1 127 LEU n 
1 128 SER n 
1 129 LYS n 
1 130 ILE n 
1 131 ILE n 
1 132 GLN n 
1 133 VAL n 
1 134 ALA n 
1 135 VAL n 
1 136 GLU n 
1 137 LEU n 
1 138 LYS n 
1 139 ASP n 
1 140 SER n 
1 141 MET n 
1 142 GLY n 
1 143 ASP n 
1 144 LEU n 
1 145 TYR n 
1 146 SER n 
1 147 PHE n 
1 148 SER n 
1 149 ALA n 
1 150 LEU n 
1 151 MET n 
1 152 LYS n 
1 153 ALA n 
1 154 LEU n 
1 155 GLU n 
1 156 MET n 
1 157 PRO n 
1 158 GLN n 
1 159 ILE n 
1 160 THR n 
1 161 ARG n 
1 162 LEU n 
1 163 GLU n 
1 164 LYS n 
1 165 THR n 
1 166 TRP n 
1 167 THR n 
1 168 ALA n 
1 169 LEU n 
1 170 ARG n 
1 171 HIS n 
1 172 GLN n 
1 173 TYR n 
1 174 THR n 
1 175 GLN n 
1 176 THR n 
1 177 ALA n 
1 178 ILE n 
1 179 LEU n 
1 180 TYR n 
1 181 GLU n 
1 182 LYS n 
1 183 GLN n 
1 184 LEU n 
1 185 LYS n 
1 186 PRO n 
1 187 PHE n 
1 188 SER n 
1 189 LYS n 
1 190 LEU n 
1 191 LEU n 
1 192 HIS n 
1 193 GLU n 
1 194 GLY n 
1 195 ARG n 
1 196 GLU n 
1 197 SER n 
1 198 THR n 
1 199 CYS n 
1 200 VAL n 
1 201 PRO n 
1 202 PRO n 
1 203 ASN n 
1 204 ASN n 
1 205 VAL n 
1 206 SER n 
1 207 VAL n 
1 208 PRO n 
1 209 LEU n 
1 210 LEU n 
1 211 MET n 
1 212 PRO n 
1 213 LEU n 
1 214 VAL n 
1 215 THR n 
1 216 LEU n 
1 217 MET n 
1 218 GLU n 
1 219 ARG n 
1 220 GLN n 
1 221 ALA n 
1 222 VAL n 
1 223 THR n 
1 224 PHE n 
1 225 GLU n 
1 226 GLY n 
1 227 THR n 
1 228 ASP n 
1 229 MET n 
1 230 TRP n 
1 231 GLU n 
1 232 LYS n 
1 233 ASN n 
1 234 ASP n 
1 235 GLN n 
1 236 SER n 
1 237 CYS n 
1 238 GLU n 
1 239 ILE n 
1 240 MET n 
1 241 LEU n 
1 242 ASN n 
1 243 HIS n 
1 244 LEU n 
1 245 ALA n 
1 246 THR n 
1 247 ALA n 
1 248 ARG n 
1 249 PHE n 
1 250 MET n 
1 251 ALA n 
1 252 GLU n 
1 253 ALA n 
1 254 ALA n 
1 255 ASP n 
1 256 SER n 
1 257 TYR n 
1 258 ARG n 
1 259 MET n 
1 260 ASN n 
1 261 ALA n 
1 262 GLU n 
1 263 ARG n 
1 264 ILE n 
1 265 LEU n 
1 266 ALA n 
1 267 GLY n 
1 268 PHE n 
1 269 GLN n 
1 270 PRO n 
1 271 ASP n 
1 272 GLU n 
1 273 GLU n 
1 274 MET n 
1 275 ASN n 
1 276 GLU n 
1 277 ILE n 
1 278 CYS n 
1 279 LYS n 
1 280 THR n 
1 281 GLU n 
1 282 PHE n 
1 283 GLN n 
1 284 MET n 
1 285 ARG n 
1 286 LEU n 
1 287 LEU n 
1 288 TRP n 
1 289 GLY n 
1 290 SER n 
1 291 LYS n 
1 292 GLY n 
1 293 ALA n 
1 294 GLN n 
1 295 VAL n 
1 296 ASN n 
1 297 GLN n 
1 298 THR n 
1 299 GLU n 
1 300 ARG n 
1 301 TYR n 
1 302 GLU n 
1 303 LYS n 
1 304 PHE n 
1 305 ASN n 
1 306 GLN n 
1 307 ILE n 
1 308 LEU n 
1 309 THR n 
1 310 ALA n 
1 311 LEU n 
1 312 SER n 
1 313 ARG n 
1 314 LYS n 
1 315 LEU n 
1 316 GLU n 
1 317 PRO n 
1 318 PRO n 
1 319 PRO n 
1 320 VAL n 
1 321 LYS n 
1 322 GLN n 
1 323 ALA n 
1 324 GLU n 
1 325 LEU n 
1 326 LEU n 
1 327 GLU n 
1 328 HIS n 
1 329 HIS n 
1 330 HIS n 
1 331 HIS n 
1 332 HIS n 
1 333 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BCAR3, NSP2, SH2D3B, UNQ271/PRO308' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BCAR3_HUMAN 
_struct_ref.pdbx_db_accession          O75815 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GEFVTPLLETVSSFRPNEFESKFLPPENKPLETAMLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSS
GLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITR
LEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIML
NHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVK
QAEL
;
_struct_ref.pdbx_align_begin           502 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3T6A A 2 ? 325 ? O75815 502 ? 825 ? 502 825 
2 1 3T6A B 2 ? 325 ? O75815 502 ? 825 ? 502 825 
3 1 3T6A C 2 ? 325 ? O75815 502 ? 825 ? 502 825 
4 1 3T6A D 2 ? 325 ? O75815 502 ? 825 ? 502 825 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3T6A MET A 1   ? UNP O75815 ?   ?   'INITIATING METHIONINE' 501 1  
1 3T6A LEU A 36  ? UNP O75815 MET 536 'ENGINEERED MUTATION'   536 2  
1 3T6A LEU A 326 ? UNP O75815 ?   ?   'EXPRESSION TAG'        826 3  
1 3T6A GLU A 327 ? UNP O75815 ?   ?   'EXPRESSION TAG'        827 4  
1 3T6A HIS A 328 ? UNP O75815 ?   ?   'EXPRESSION TAG'        828 5  
1 3T6A HIS A 329 ? UNP O75815 ?   ?   'EXPRESSION TAG'        829 6  
1 3T6A HIS A 330 ? UNP O75815 ?   ?   'EXPRESSION TAG'        830 7  
1 3T6A HIS A 331 ? UNP O75815 ?   ?   'EXPRESSION TAG'        831 8  
1 3T6A HIS A 332 ? UNP O75815 ?   ?   'EXPRESSION TAG'        832 9  
1 3T6A HIS A 333 ? UNP O75815 ?   ?   'EXPRESSION TAG'        833 10 
2 3T6A MET B 1   ? UNP O75815 ?   ?   'INITIATING METHIONINE' 501 11 
2 3T6A LEU B 36  ? UNP O75815 MET 536 'ENGINEERED MUTATION'   536 12 
2 3T6A LEU B 326 ? UNP O75815 ?   ?   'EXPRESSION TAG'        826 13 
2 3T6A GLU B 327 ? UNP O75815 ?   ?   'EXPRESSION TAG'        827 14 
2 3T6A HIS B 328 ? UNP O75815 ?   ?   'EXPRESSION TAG'        828 15 
2 3T6A HIS B 329 ? UNP O75815 ?   ?   'EXPRESSION TAG'        829 16 
2 3T6A HIS B 330 ? UNP O75815 ?   ?   'EXPRESSION TAG'        830 17 
2 3T6A HIS B 331 ? UNP O75815 ?   ?   'EXPRESSION TAG'        831 18 
2 3T6A HIS B 332 ? UNP O75815 ?   ?   'EXPRESSION TAG'        832 19 
2 3T6A HIS B 333 ? UNP O75815 ?   ?   'EXPRESSION TAG'        833 20 
3 3T6A MET C 1   ? UNP O75815 ?   ?   'INITIATING METHIONINE' 501 21 
3 3T6A LEU C 36  ? UNP O75815 MET 536 'ENGINEERED MUTATION'   536 22 
3 3T6A LEU C 326 ? UNP O75815 ?   ?   'EXPRESSION TAG'        826 23 
3 3T6A GLU C 327 ? UNP O75815 ?   ?   'EXPRESSION TAG'        827 24 
3 3T6A HIS C 328 ? UNP O75815 ?   ?   'EXPRESSION TAG'        828 25 
3 3T6A HIS C 329 ? UNP O75815 ?   ?   'EXPRESSION TAG'        829 26 
3 3T6A HIS C 330 ? UNP O75815 ?   ?   'EXPRESSION TAG'        830 27 
3 3T6A HIS C 331 ? UNP O75815 ?   ?   'EXPRESSION TAG'        831 28 
3 3T6A HIS C 332 ? UNP O75815 ?   ?   'EXPRESSION TAG'        832 29 
3 3T6A HIS C 333 ? UNP O75815 ?   ?   'EXPRESSION TAG'        833 30 
4 3T6A MET D 1   ? UNP O75815 ?   ?   'INITIATING METHIONINE' 501 31 
4 3T6A LEU D 36  ? UNP O75815 MET 536 'ENGINEERED MUTATION'   536 32 
4 3T6A LEU D 326 ? UNP O75815 ?   ?   'EXPRESSION TAG'        826 33 
4 3T6A GLU D 327 ? UNP O75815 ?   ?   'EXPRESSION TAG'        827 34 
4 3T6A HIS D 328 ? UNP O75815 ?   ?   'EXPRESSION TAG'        828 35 
4 3T6A HIS D 329 ? UNP O75815 ?   ?   'EXPRESSION TAG'        829 36 
4 3T6A HIS D 330 ? UNP O75815 ?   ?   'EXPRESSION TAG'        830 37 
4 3T6A HIS D 331 ? UNP O75815 ?   ?   'EXPRESSION TAG'        831 38 
4 3T6A HIS D 332 ? UNP O75815 ?   ?   'EXPRESSION TAG'        832 39 
4 3T6A HIS D 333 ? UNP O75815 ?   ?   'EXPRESSION TAG'        833 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                     ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                   ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                              ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                     ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                    ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                        ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                       ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                   ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                ? 'C9 H11 N O2'    165.189 
POG non-polymer         . '(20S)-2,5,8,11,14,17-HEXAMETHYL-3,6,9,12,15,18-HEXAOXAHENICOSANE-1,20-DIOL' 
'POLYPROPYLENE GLYCOL, HEPTAPROPYLENE GLYCOL' 'C21 H44 O8'     424.569 
PRO 'L-peptide linking' y PROLINE                                                                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                    ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                   ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                     ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                                                        ? ?                ?       
VAL 'L-peptide linking' y VALINE                                                                       ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3T6A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.47 
_exptl_crystal.density_percent_sol   50.11 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_details    
'15-20 % PEG3350, 0.04 M citric acid and 0.06 M Bis-Tris propane (pH 6.4), VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS HTC' 
_diffrn_detector.pdbx_collection_date   2011-01-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3T6A 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.75 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   59059 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.096 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3T6A 
_refine.ls_number_reflns_obs                     56380 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.761 
_refine.ls_d_res_high                            2.400 
_refine.ls_percent_reflns_obs                    94.27 
_refine.ls_R_factor_obs                          0.1772 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1736 
_refine.ls_R_factor_R_free                       0.2442 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_number_reflns_R_free                  2805 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.6322 
_refine.aniso_B[2][2]                            -7.2727 
_refine.aniso_B[3][3]                            7.9049 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.356 
_refine.solvent_model_param_bsol                 45.279 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.77 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.35 
_refine.pdbx_overall_phase_error                 24.59 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9792 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             373 
_refine_hist.number_atoms_total               10206 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        19.761 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 10046 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.053  ? ? 13572 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 16.531 ? ? 3910  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.069  ? ? 1550  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 1754  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.4000 2.4856  4741 0.2317 85.00 0.3051 . . 260 . . . . 'X-RAY DIFFRACTION' 
. 2.4856 2.5850  4913 0.2157 88.00 0.3350 . . 237 . . . . 'X-RAY DIFFRACTION' 
. 2.5850 2.7023  5061 0.2191 90.00 0.3199 . . 277 . . . . 'X-RAY DIFFRACTION' 
. 2.7023 2.8444  5173 0.2151 92.00 0.3015 . . 278 . . . . 'X-RAY DIFFRACTION' 
. 2.8444 3.0220  5353 0.2042 95.00 0.3009 . . 276 . . . . 'X-RAY DIFFRACTION' 
. 3.0220 3.2544  5467 0.1904 96.00 0.2534 . . 265 . . . . 'X-RAY DIFFRACTION' 
. 3.2544 3.5802  5581 0.1797 98.00 0.2680 . . 308 . . . . 'X-RAY DIFFRACTION' 
. 3.5802 4.0942  5635 0.1556 99.00 0.2320 . . 294 . . . . 'X-RAY DIFFRACTION' 
. 4.0942 5.1432  5693 0.1246 99.00 0.1771 . . 323 . . . . 'X-RAY DIFFRACTION' 
. 5.1432 19.7616 5958 0.1581 99.00 0.2005 . . 287 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3T6A 
_struct.title                     'Structure of the C-terminal domain of BCAR3' 
_struct.pdbx_descriptor           'Breast cancer anti-estrogen resistance protein 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3T6A 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Cdc25-homology domain, GTPase exchange factor, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 16  ? PHE A 20  ? ARG A 516 PHE A 520 5 ? 5  
HELX_P HELX_P2  2  GLU A 33  ? ASN A 47  ? GLU A 533 ASN A 547 1 ? 15 
HELX_P HELX_P3  3  ASP A 48  ? ALA A 64  ? ASP A 548 ALA A 564 1 ? 17 
HELX_P HELX_P4  4  SER A 70  ? GLY A 78  ? SER A 570 GLY A 578 1 ? 9  
HELX_P HELX_P5  5  SER A 81  ? ILE A 86  ? SER A 581 ILE A 586 1 ? 6  
HELX_P HELX_P6  6  THR A 87  ? HIS A 90  ? THR A 587 HIS A 590 5 ? 4  
HELX_P HELX_P7  7  GLY A 91  ? GLY A 115 ? GLY A 591 GLY A 615 1 ? 25 
HELX_P HELX_P8  8  THR A 119 ? SER A 140 ? THR A 619 SER A 640 1 ? 22 
HELX_P HELX_P9  9  ASP A 143 ? MET A 156 ? ASP A 643 MET A 656 1 ? 14 
HELX_P HELX_P10 10 MET A 156 ? ARG A 161 ? MET A 656 ARG A 661 1 ? 6  
HELX_P HELX_P11 11 LEU A 162 ? TYR A 173 ? LEU A 662 TYR A 673 1 ? 12 
HELX_P HELX_P12 12 TYR A 173 ? GLN A 183 ? TYR A 673 GLN A 683 1 ? 11 
HELX_P HELX_P13 13 GLN A 183 ? GLU A 193 ? GLN A 683 GLU A 693 1 ? 11 
HELX_P HELX_P14 14 ARG A 195 ? CYS A 199 ? ARG A 695 CYS A 699 5 ? 5  
HELX_P HELX_P15 15 LEU A 210 ? GLU A 218 ? LEU A 710 GLU A 718 1 ? 9  
HELX_P HELX_P16 16 THR A 223 ? THR A 227 ? THR A 723 THR A 727 5 ? 5  
HELX_P HELX_P17 17 GLU A 231 ? GLN A 235 ? GLU A 731 GLN A 735 5 ? 5  
HELX_P HELX_P18 18 SER A 236 ? ALA A 253 ? SER A 736 ALA A 753 1 ? 18 
HELX_P HELX_P19 19 ALA A 253 ? LEU A 265 ? ALA A 753 LEU A 765 1 ? 13 
HELX_P HELX_P20 20 ASP A 271 ? CYS A 278 ? ASP A 771 CYS A 778 1 ? 8  
HELX_P HELX_P21 21 LYS A 279 ? ALA A 293 ? LYS A 779 ALA A 793 1 ? 15 
HELX_P HELX_P22 22 ASN A 296 ? GLU A 316 ? ASN A 796 GLU A 816 1 ? 21 
HELX_P HELX_P23 23 GLU B 33  ? ASN B 47  ? GLU B 533 ASN B 547 1 ? 15 
HELX_P HELX_P24 24 ASP B 48  ? ALA B 64  ? ASP B 548 ALA B 564 1 ? 17 
HELX_P HELX_P25 25 SER B 70  ? GLY B 78  ? SER B 570 GLY B 578 1 ? 9  
HELX_P HELX_P26 26 SER B 81  ? ILE B 86  ? SER B 581 ILE B 586 1 ? 6  
HELX_P HELX_P27 27 THR B 87  ? HIS B 90  ? THR B 587 HIS B 590 5 ? 4  
HELX_P HELX_P28 28 GLY B 91  ? GLY B 115 ? GLY B 591 GLY B 615 1 ? 25 
HELX_P HELX_P29 29 THR B 119 ? SER B 140 ? THR B 619 SER B 640 1 ? 22 
HELX_P HELX_P30 30 ASP B 143 ? MET B 156 ? ASP B 643 MET B 656 1 ? 14 
HELX_P HELX_P31 31 MET B 156 ? ARG B 161 ? MET B 656 ARG B 661 1 ? 6  
HELX_P HELX_P32 32 LEU B 162 ? TYR B 173 ? LEU B 662 TYR B 673 1 ? 12 
HELX_P HELX_P33 33 TYR B 173 ? GLN B 183 ? TYR B 673 GLN B 683 1 ? 11 
HELX_P HELX_P34 34 GLN B 183 ? GLU B 193 ? GLN B 683 GLU B 693 1 ? 11 
HELX_P HELX_P35 35 LEU B 210 ? GLU B 218 ? LEU B 710 GLU B 718 1 ? 9  
HELX_P HELX_P36 36 THR B 223 ? THR B 227 ? THR B 723 THR B 727 5 ? 5  
HELX_P HELX_P37 37 GLU B 231 ? GLN B 235 ? GLU B 731 GLN B 735 5 ? 5  
HELX_P HELX_P38 38 SER B 236 ? ALA B 253 ? SER B 736 ALA B 753 1 ? 18 
HELX_P HELX_P39 39 ALA B 253 ? LEU B 265 ? ALA B 753 LEU B 765 1 ? 13 
HELX_P HELX_P40 40 ASP B 271 ? CYS B 278 ? ASP B 771 CYS B 778 1 ? 8  
HELX_P HELX_P41 41 LYS B 279 ? GLY B 289 ? LYS B 779 GLY B 789 1 ? 11 
HELX_P HELX_P42 42 ASN B 296 ? GLU B 316 ? ASN B 796 GLU B 816 1 ? 21 
HELX_P HELX_P43 43 GLU C 33  ? ASN C 46  ? GLU C 533 ASN C 546 1 ? 14 
HELX_P HELX_P44 44 ASP C 48  ? ALA C 64  ? ASP C 548 ALA C 564 1 ? 17 
HELX_P HELX_P45 45 SER C 70  ? GLY C 78  ? SER C 570 GLY C 578 1 ? 9  
HELX_P HELX_P46 46 SER C 81  ? ILE C 86  ? SER C 581 ILE C 586 1 ? 6  
HELX_P HELX_P47 47 THR C 87  ? HIS C 90  ? THR C 587 HIS C 590 5 ? 4  
HELX_P HELX_P48 48 GLY C 91  ? GLY C 115 ? GLY C 591 GLY C 615 1 ? 25 
HELX_P HELX_P49 49 THR C 119 ? SER C 140 ? THR C 619 SER C 640 1 ? 22 
HELX_P HELX_P50 50 ASP C 143 ? GLU C 155 ? ASP C 643 GLU C 655 1 ? 13 
HELX_P HELX_P51 51 MET C 156 ? ARG C 161 ? MET C 656 ARG C 661 1 ? 6  
HELX_P HELX_P52 52 LEU C 162 ? TYR C 173 ? LEU C 662 TYR C 673 1 ? 12 
HELX_P HELX_P53 53 TYR C 173 ? GLN C 183 ? TYR C 673 GLN C 683 1 ? 11 
HELX_P HELX_P54 54 GLN C 183 ? GLU C 193 ? GLN C 683 GLU C 693 1 ? 11 
HELX_P HELX_P55 55 ARG C 195 ? CYS C 199 ? ARG C 695 CYS C 699 5 ? 5  
HELX_P HELX_P56 56 LEU C 210 ? GLU C 218 ? LEU C 710 GLU C 718 1 ? 9  
HELX_P HELX_P57 57 THR C 223 ? THR C 227 ? THR C 723 THR C 727 5 ? 5  
HELX_P HELX_P58 58 GLU C 231 ? GLN C 235 ? GLU C 731 GLN C 735 5 ? 5  
HELX_P HELX_P59 59 SER C 236 ? ALA C 253 ? SER C 736 ALA C 753 1 ? 18 
HELX_P HELX_P60 60 ALA C 253 ? ALA C 266 ? ALA C 753 ALA C 766 1 ? 14 
HELX_P HELX_P61 61 ASP C 271 ? CYS C 278 ? ASP C 771 CYS C 778 1 ? 8  
HELX_P HELX_P62 62 LYS C 279 ? ALA C 293 ? LYS C 779 ALA C 793 1 ? 15 
HELX_P HELX_P63 63 ASN C 296 ? GLU C 316 ? ASN C 796 GLU C 816 1 ? 21 
HELX_P HELX_P64 64 ARG D 16  ? PHE D 20  ? ARG D 516 PHE D 520 5 ? 5  
HELX_P HELX_P65 65 GLU D 33  ? ASN D 46  ? GLU D 533 ASN D 546 1 ? 14 
HELX_P HELX_P66 66 ASP D 48  ? ALA D 64  ? ASP D 548 ALA D 564 1 ? 17 
HELX_P HELX_P67 67 SER D 70  ? GLY D 78  ? SER D 570 GLY D 578 1 ? 9  
HELX_P HELX_P68 68 SER D 81  ? ILE D 86  ? SER D 581 ILE D 586 1 ? 6  
HELX_P HELX_P69 69 THR D 87  ? HIS D 90  ? THR D 587 HIS D 590 5 ? 4  
HELX_P HELX_P70 70 GLY D 91  ? GLY D 115 ? GLY D 591 GLY D 615 1 ? 25 
HELX_P HELX_P71 71 THR D 119 ? SER D 140 ? THR D 619 SER D 640 1 ? 22 
HELX_P HELX_P72 72 ASP D 143 ? MET D 156 ? ASP D 643 MET D 656 1 ? 14 
HELX_P HELX_P73 73 MET D 156 ? ARG D 161 ? MET D 656 ARG D 661 1 ? 6  
HELX_P HELX_P74 74 LEU D 162 ? TYR D 173 ? LEU D 662 TYR D 673 1 ? 12 
HELX_P HELX_P75 75 TYR D 173 ? GLN D 183 ? TYR D 673 GLN D 683 1 ? 11 
HELX_P HELX_P76 76 GLN D 183 ? GLU D 193 ? GLN D 683 GLU D 693 1 ? 11 
HELX_P HELX_P77 77 ARG D 195 ? CYS D 199 ? ARG D 695 CYS D 699 5 ? 5  
HELX_P HELX_P78 78 LEU D 210 ? GLU D 218 ? LEU D 710 GLU D 718 1 ? 9  
HELX_P HELX_P79 79 THR D 223 ? THR D 227 ? THR D 723 THR D 727 5 ? 5  
HELX_P HELX_P80 80 GLU D 231 ? GLN D 235 ? GLU D 731 GLN D 735 5 ? 5  
HELX_P HELX_P81 81 SER D 236 ? ALA D 253 ? SER D 736 ALA D 753 1 ? 18 
HELX_P HELX_P82 82 ALA D 253 ? LEU D 265 ? ALA D 753 LEU D 765 1 ? 13 
HELX_P HELX_P83 83 ASP D 271 ? CYS D 278 ? ASP D 771 CYS D 778 1 ? 8  
HELX_P HELX_P84 84 LYS D 279 ? ALA D 293 ? LYS D 779 ALA D 793 1 ? 15 
HELX_P HELX_P85 85 ASN D 296 ? GLU D 316 ? ASN D 796 GLU D 816 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE POG A 834' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE POG B 834' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 SER A 197 ? SER A 697 . ? 1_555 ? 
2 AC1 3 ARG C 248 ? ARG C 748 . ? 1_555 ? 
3 AC1 3 GLU C 252 ? GLU C 752 . ? 1_555 ? 
4 AC2 5 ALA B 245 ? ALA B 745 . ? 1_555 ? 
5 AC2 5 THR B 246 ? THR B 746 . ? 1_555 ? 
6 AC2 5 HOH P .   ? HOH B 835 . ? 1_555 ? 
7 AC2 5 SER D 197 ? SER D 697 . ? 1_555 ? 
8 AC2 5 ASN D 242 ? ASN D 742 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3T6A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3T6A 
_atom_sites.fract_transf_matrix[1][1]   0.019907 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006584 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005089 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . THR A 1 11  ? 5.085   74.843  112.715 1.00 75.55  ? 511 THR A N   1 
ATOM   2     C CA  . THR A 1 11  ? 4.212   74.039  113.565 1.00 88.98  ? 511 THR A CA  1 
ATOM   3     C C   . THR A 1 11  ? 4.912   72.726  113.951 1.00 94.95  ? 511 THR A C   1 
ATOM   4     O O   . THR A 1 11  ? 6.134   72.704  114.112 1.00 94.72  ? 511 THR A O   1 
ATOM   5     C CB  . THR A 1 11  ? 2.844   73.775  112.880 1.00 99.99  ? 511 THR A CB  1 
ATOM   6     O OG1 . THR A 1 11  ? 2.380   74.977  112.248 1.00 95.87  ? 511 THR A OG1 1 
ATOM   7     C CG2 . THR A 1 11  ? 1.802   73.310  113.897 1.00 100.26 ? 511 THR A CG2 1 
ATOM   8     N N   . VAL A 1 12  ? 4.146   71.646  114.105 1.00 97.38  ? 512 VAL A N   1 
ATOM   9     C CA  . VAL A 1 12  ? 4.702   70.333  114.452 1.00 95.76  ? 512 VAL A CA  1 
ATOM   10    C C   . VAL A 1 12  ? 4.399   69.333  113.329 1.00 91.14  ? 512 VAL A C   1 
ATOM   11    O O   . VAL A 1 12  ? 3.982   69.737  112.247 1.00 89.98  ? 512 VAL A O   1 
ATOM   12    C CB  . VAL A 1 12  ? 4.132   69.816  115.805 1.00 83.72  ? 512 VAL A CB  1 
ATOM   13    C CG1 . VAL A 1 12  ? 2.662   69.430  115.663 1.00 82.93  ? 512 VAL A CG1 1 
ATOM   14    C CG2 . VAL A 1 12  ? 4.948   68.639  116.328 1.00 81.69  ? 512 VAL A CG2 1 
ATOM   15    N N   . SER A 1 13  ? 4.614   68.039  113.572 1.00 86.98  ? 513 SER A N   1 
ATOM   16    C CA  . SER A 1 13  ? 4.180   67.010  112.621 1.00 81.36  ? 513 SER A CA  1 
ATOM   17    C C   . SER A 1 13  ? 2.657   66.877  112.661 1.00 79.34  ? 513 SER A C   1 
ATOM   18    O O   . SER A 1 13  ? 2.024   67.225  113.660 1.00 84.33  ? 513 SER A O   1 
ATOM   19    C CB  . SER A 1 13  ? 4.798   65.646  112.950 1.00 75.80  ? 513 SER A CB  1 
ATOM   20    O OG  . SER A 1 13  ? 6.198   65.721  113.123 1.00 71.72  ? 513 SER A OG  1 
ATOM   21    N N   . SER A 1 14  ? 2.071   66.371  111.580 1.00 71.00  ? 514 SER A N   1 
ATOM   22    C CA  . SER A 1 14  ? 0.651   66.043  111.581 1.00 64.49  ? 514 SER A CA  1 
ATOM   23    C C   . SER A 1 14  ? 0.450   64.744  112.352 1.00 67.33  ? 514 SER A C   1 
ATOM   24    O O   . SER A 1 14  ? -0.605  64.516  112.938 1.00 73.35  ? 514 SER A O   1 
ATOM   25    C CB  . SER A 1 14  ? 0.101   65.919  110.156 1.00 55.22  ? 514 SER A CB  1 
ATOM   26    O OG  . SER A 1 14  ? 0.495   64.703  109.542 1.00 55.74  ? 514 SER A OG  1 
ATOM   27    N N   . PHE A 1 15  ? 1.482   63.902  112.359 1.00 67.32  ? 515 PHE A N   1 
ATOM   28    C CA  . PHE A 1 15  ? 1.446   62.630  113.077 1.00 67.05  ? 515 PHE A CA  1 
ATOM   29    C C   . PHE A 1 15  ? 1.092   62.828  114.540 1.00 73.02  ? 515 PHE A C   1 
ATOM   30    O O   . PHE A 1 15  ? 1.871   63.396  115.298 1.00 79.08  ? 515 PHE A O   1 
ATOM   31    C CB  . PHE A 1 15  ? 2.810   61.946  113.006 1.00 56.41  ? 515 PHE A CB  1 
ATOM   32    C CG  . PHE A 1 15  ? 3.232   61.581  111.623 1.00 48.74  ? 515 PHE A CG  1 
ATOM   33    C CD1 . PHE A 1 15  ? 4.471   61.975  111.141 1.00 45.57  ? 515 PHE A CD1 1 
ATOM   34    C CD2 . PHE A 1 15  ? 2.402   60.829  110.809 1.00 49.12  ? 515 PHE A CD2 1 
ATOM   35    C CE1 . PHE A 1 15  ? 4.872   61.645  109.864 1.00 45.74  ? 515 PHE A CE1 1 
ATOM   36    C CE2 . PHE A 1 15  ? 2.794   60.485  109.533 1.00 50.17  ? 515 PHE A CE2 1 
ATOM   37    C CZ  . PHE A 1 15  ? 4.034   60.895  109.056 1.00 50.88  ? 515 PHE A CZ  1 
ATOM   38    N N   . ARG A 1 16  ? -0.077  62.352  114.943 1.00 75.16  ? 516 ARG A N   1 
ATOM   39    C CA  . ARG A 1 16  ? -0.437  62.373  116.355 1.00 78.30  ? 516 ARG A CA  1 
ATOM   40    C C   . ARG A 1 16  ? -0.630  60.944  116.862 1.00 75.50  ? 516 ARG A C   1 
ATOM   41    O O   . ARG A 1 16  ? -1.721  60.378  116.778 1.00 74.69  ? 516 ARG A O   1 
ATOM   42    C CB  . ARG A 1 16  ? -1.668  63.253  116.595 1.00 80.97  ? 516 ARG A CB  1 
ATOM   43    C CG  . ARG A 1 16  ? -1.418  64.728  116.285 1.00 88.49  ? 516 ARG A CG  1 
ATOM   44    C CD  . ARG A 1 16  ? -2.703  65.538  116.243 1.00 100.85 ? 516 ARG A CD  1 
ATOM   45    N NE  . ARG A 1 16  ? -3.260  65.770  117.573 1.00 115.71 ? 516 ARG A NE  1 
ATOM   46    C CZ  . ARG A 1 16  ? -4.483  66.243  117.804 1.00 123.60 ? 516 ARG A CZ  1 
ATOM   47    N NH1 . ARG A 1 16  ? -5.292  66.530  116.792 1.00 125.20 ? 516 ARG A NH1 1 
ATOM   48    N NH2 . ARG A 1 16  ? -4.902  66.424  119.050 1.00 125.32 ? 516 ARG A NH2 1 
ATOM   49    N N   . PRO A 1 17  ? 0.462   60.349  117.359 1.00 70.09  ? 517 PRO A N   1 
ATOM   50    C CA  . PRO A 1 17  ? 0.550   58.980  117.879 1.00 74.46  ? 517 PRO A CA  1 
ATOM   51    C C   . PRO A 1 17  ? -0.327  58.693  119.103 1.00 81.68  ? 517 PRO A C   1 
ATOM   52    O O   . PRO A 1 17  ? -0.932  57.622  119.171 1.00 83.51  ? 517 PRO A O   1 
ATOM   53    C CB  . PRO A 1 17  ? 2.038   58.830  118.234 1.00 71.10  ? 517 PRO A CB  1 
ATOM   54    C CG  . PRO A 1 17  ? 2.589   60.216  118.249 1.00 67.04  ? 517 PRO A CG  1 
ATOM   55    C CD  . PRO A 1 17  ? 1.786   60.980  117.257 1.00 67.81  ? 517 PRO A CD  1 
ATOM   56    N N   . ASN A 1 18  ? -0.393  59.619  120.053 1.00 84.52  ? 518 ASN A N   1 
ATOM   57    C CA  . ASN A 1 18  ? -1.164  59.391  121.271 1.00 84.57  ? 518 ASN A CA  1 
ATOM   58    C C   . ASN A 1 18  ? -2.640  59.136  120.986 1.00 77.14  ? 518 ASN A C   1 
ATOM   59    O O   . ASN A 1 18  ? -3.380  58.694  121.862 1.00 79.82  ? 518 ASN A O   1 
ATOM   60    C CB  . ASN A 1 18  ? -1.017  60.565  122.249 1.00 97.36  ? 518 ASN A CB  1 
ATOM   61    C CG  . ASN A 1 18  ? 0.397   60.707  122.797 1.00 101.07 ? 518 ASN A CG  1 
ATOM   62    O OD1 . ASN A 1 18  ? 1.207   59.782  122.713 1.00 100.24 ? 518 ASN A OD1 1 
ATOM   63    N ND2 . ASN A 1 18  ? 0.695   61.871  123.372 1.00 100.26 ? 518 ASN A ND2 1 
ATOM   64    N N   . GLU A 1 19  ? -3.062  59.412  119.758 1.00 74.75  ? 519 GLU A N   1 
ATOM   65    C CA  . GLU A 1 19  ? -4.474  59.322  119.397 1.00 79.09  ? 519 GLU A CA  1 
ATOM   66    C C   . GLU A 1 19  ? -4.706  58.341  118.255 1.00 79.92  ? 519 GLU A C   1 
ATOM   67    O O   . GLU A 1 19  ? -5.836  58.153  117.806 1.00 81.30  ? 519 GLU A O   1 
ATOM   68    C CB  . GLU A 1 19  ? -5.003  60.704  119.017 1.00 84.87  ? 519 GLU A CB  1 
ATOM   69    C CG  . GLU A 1 19  ? -4.711  61.763  120.063 1.00 90.52  ? 519 GLU A CG  1 
ATOM   70    C CD  . GLU A 1 19  ? -4.496  63.128  119.455 1.00 97.10  ? 519 GLU A CD  1 
ATOM   71    O OE1 . GLU A 1 19  ? -5.103  63.407  118.398 1.00 96.52  ? 519 GLU A OE1 1 
ATOM   72    O OE2 . GLU A 1 19  ? -3.712  63.918  120.027 1.00 100.31 ? 519 GLU A OE2 1 
ATOM   73    N N   . PHE A 1 20  ? -3.626  57.725  117.785 1.00 79.39  ? 520 PHE A N   1 
ATOM   74    C CA  . PHE A 1 20  ? -3.695  56.704  116.746 1.00 71.65  ? 520 PHE A CA  1 
ATOM   75    C C   . PHE A 1 20  ? -4.257  55.403  117.314 1.00 71.66  ? 520 PHE A C   1 
ATOM   76    O O   . PHE A 1 20  ? -3.813  54.941  118.364 1.00 68.22  ? 520 PHE A O   1 
ATOM   77    C CB  . PHE A 1 20  ? -2.299  56.465  116.170 1.00 59.19  ? 520 PHE A CB  1 
ATOM   78    C CG  . PHE A 1 20  ? -2.191  55.246  115.294 1.00 55.44  ? 520 PHE A CG  1 
ATOM   79    C CD1 . PHE A 1 20  ? -2.612  55.283  113.971 1.00 59.50  ? 520 PHE A CD1 1 
ATOM   80    C CD2 . PHE A 1 20  ? -1.632  54.070  115.786 1.00 48.68  ? 520 PHE A CD2 1 
ATOM   81    C CE1 . PHE A 1 20  ? -2.497  54.164  113.159 1.00 63.69  ? 520 PHE A CE1 1 
ATOM   82    C CE2 . PHE A 1 20  ? -1.512  52.945  114.980 1.00 53.97  ? 520 PHE A CE2 1 
ATOM   83    C CZ  . PHE A 1 20  ? -1.945  52.989  113.668 1.00 61.21  ? 520 PHE A CZ  1 
ATOM   84    N N   . GLU A 1 21  ? -5.239  54.824  116.627 1.00 70.80  ? 521 GLU A N   1 
ATOM   85    C CA  . GLU A 1 21  ? -5.791  53.533  117.029 1.00 73.54  ? 521 GLU A CA  1 
ATOM   86    C C   . GLU A 1 21  ? -5.404  52.463  116.022 1.00 74.56  ? 521 GLU A C   1 
ATOM   87    O O   . GLU A 1 21  ? -5.106  52.765  114.865 1.00 79.32  ? 521 GLU A O   1 
ATOM   88    C CB  . GLU A 1 21  ? -7.315  53.596  117.158 1.00 75.22  ? 521 GLU A CB  1 
ATOM   89    C CG  . GLU A 1 21  ? -7.809  54.476  118.289 1.00 83.49  ? 521 GLU A CG  1 
ATOM   90    C CD  . GLU A 1 21  ? -8.823  53.774  119.169 1.00 96.46  ? 521 GLU A CD  1 
ATOM   91    O OE1 . GLU A 1 21  ? -9.661  53.016  118.632 1.00 99.70  ? 521 GLU A OE1 1 
ATOM   92    O OE2 . GLU A 1 21  ? -8.774  53.967  120.402 1.00 100.04 ? 521 GLU A OE2 1 
ATOM   93    N N   . SER A 1 22  ? -5.401  51.211  116.463 1.00 64.63  ? 522 SER A N   1 
ATOM   94    C CA  . SER A 1 22  ? -5.115  50.103  115.567 1.00 61.55  ? 522 SER A CA  1 
ATOM   95    C C   . SER A 1 22  ? -5.533  48.764  116.152 1.00 68.38  ? 522 SER A C   1 
ATOM   96    O O   . SER A 1 22  ? -5.352  48.497  117.340 1.00 63.92  ? 522 SER A O   1 
ATOM   97    C CB  . SER A 1 22  ? -3.632  50.071  115.197 1.00 57.67  ? 522 SER A CB  1 
ATOM   98    O OG  . SER A 1 22  ? -3.343  48.947  114.394 1.00 55.85  ? 522 SER A OG  1 
ATOM   99    N N   . LYS A 1 23  ? -6.103  47.931  115.292 1.00 73.59  ? 523 LYS A N   1 
ATOM   100   C CA  . LYS A 1 23  ? -6.472  46.571  115.640 1.00 76.62  ? 523 LYS A CA  1 
ATOM   101   C C   . LYS A 1 23  ? -5.254  45.762  116.096 1.00 75.11  ? 523 LYS A C   1 
ATOM   102   O O   . LYS A 1 23  ? -5.393  44.672  116.648 1.00 79.83  ? 523 LYS A O   1 
ATOM   103   C CB  . LYS A 1 23  ? -7.153  45.915  114.432 1.00 85.52  ? 523 LYS A CB  1 
ATOM   104   C CG  . LYS A 1 23  ? -7.322  44.409  114.510 1.00 95.09  ? 523 LYS A CG  1 
ATOM   105   C CD  . LYS A 1 23  ? -8.427  43.929  113.570 1.00 99.85  ? 523 LYS A CD  1 
ATOM   106   C CE  . LYS A 1 23  ? -8.255  44.483  112.162 1.00 98.02  ? 523 LYS A CE  1 
ATOM   107   N NZ  . LYS A 1 23  ? -9.322  44.000  111.235 1.00 97.43  ? 523 LYS A NZ  1 
ATOM   108   N N   . PHE A 1 24  ? -4.059  46.309  115.889 1.00 72.26  ? 524 PHE A N   1 
ATOM   109   C CA  . PHE A 1 24  ? -2.829  45.572  116.182 1.00 71.21  ? 524 PHE A CA  1 
ATOM   110   C C   . PHE A 1 24  ? -1.985  46.192  117.294 1.00 71.02  ? 524 PHE A C   1 
ATOM   111   O O   . PHE A 1 24  ? -0.808  45.862  117.452 1.00 67.64  ? 524 PHE A O   1 
ATOM   112   C CB  . PHE A 1 24  ? -1.995  45.410  114.907 1.00 65.48  ? 524 PHE A CB  1 
ATOM   113   C CG  . PHE A 1 24  ? -2.674  44.587  113.845 1.00 63.05  ? 524 PHE A CG  1 
ATOM   114   C CD1 . PHE A 1 24  ? -2.792  43.212  113.987 1.00 64.88  ? 524 PHE A CD1 1 
ATOM   115   C CD2 . PHE A 1 24  ? -3.200  45.184  112.711 1.00 54.22  ? 524 PHE A CD2 1 
ATOM   116   C CE1 . PHE A 1 24  ? -3.420  42.451  113.019 1.00 61.71  ? 524 PHE A CE1 1 
ATOM   117   C CE2 . PHE A 1 24  ? -3.827  44.426  111.737 1.00 51.49  ? 524 PHE A CE2 1 
ATOM   118   C CZ  . PHE A 1 24  ? -3.936  43.059  111.893 1.00 58.76  ? 524 PHE A CZ  1 
ATOM   119   N N   . LEU A 1 25  ? -2.596  47.078  118.072 1.00 71.06  ? 525 LEU A N   1 
ATOM   120   C CA  . LEU A 1 25  ? -1.873  47.819  119.096 1.00 70.68  ? 525 LEU A CA  1 
ATOM   121   C C   . LEU A 1 25  ? -2.730  47.989  120.342 1.00 76.68  ? 525 LEU A C   1 
ATOM   122   O O   . LEU A 1 25  ? -3.874  48.439  120.255 1.00 81.22  ? 525 LEU A O   1 
ATOM   123   C CB  . LEU A 1 25  ? -1.490  49.194  118.560 1.00 70.68  ? 525 LEU A CB  1 
ATOM   124   C CG  . LEU A 1 25  ? -0.135  49.724  119.007 1.00 67.56  ? 525 LEU A CG  1 
ATOM   125   C CD1 . LEU A 1 25  ? 0.954   48.828  118.456 1.00 60.47  ? 525 LEU A CD1 1 
ATOM   126   C CD2 . LEU A 1 25  ? 0.051   51.160  118.550 1.00 63.53  ? 525 LEU A CD2 1 
ATOM   127   N N   . PRO A 1 26  ? -2.181  47.632  121.512 1.00 72.69  ? 526 PRO A N   1 
ATOM   128   C CA  . PRO A 1 26  ? -2.926  47.821  122.761 1.00 74.94  ? 526 PRO A CA  1 
ATOM   129   C C   . PRO A 1 26  ? -3.195  49.302  122.995 1.00 79.60  ? 526 PRO A C   1 
ATOM   130   O O   . PRO A 1 26  ? -2.351  50.131  122.663 1.00 89.76  ? 526 PRO A O   1 
ATOM   131   C CB  . PRO A 1 26  ? -1.968  47.277  123.829 1.00 73.93  ? 526 PRO A CB  1 
ATOM   132   C CG  . PRO A 1 26  ? -1.027  46.382  123.087 1.00 70.90  ? 526 PRO A CG  1 
ATOM   133   C CD  . PRO A 1 26  ? -0.861  47.027  121.742 1.00 68.00  ? 526 PRO A CD  1 
ATOM   134   N N   . PRO A 1 27  ? -4.368  49.634  123.552 1.00 78.89  ? 527 PRO A N   1 
ATOM   135   C CA  . PRO A 1 27  ? -4.768  51.023  123.800 1.00 74.56  ? 527 PRO A CA  1 
ATOM   136   C C   . PRO A 1 27  ? -3.720  51.778  124.607 1.00 72.07  ? 527 PRO A C   1 
ATOM   137   O O   . PRO A 1 27  ? -3.454  52.950  124.351 1.00 54.83  ? 527 PRO A O   1 
ATOM   138   C CB  . PRO A 1 27  ? -6.048  50.867  124.626 1.00 78.56  ? 527 PRO A CB  1 
ATOM   139   C CG  . PRO A 1 27  ? -6.589  49.539  124.238 1.00 77.82  ? 527 PRO A CG  1 
ATOM   140   C CD  . PRO A 1 27  ? -5.392  48.676  124.003 1.00 82.63  ? 527 PRO A CD  1 
ATOM   141   N N   . GLU A 1 28  ? -3.136  51.092  125.581 1.00 91.26  ? 528 GLU A N   1 
ATOM   142   C CA  . GLU A 1 28  ? -2.133  51.677  126.461 1.00 106.65 ? 528 GLU A CA  1 
ATOM   143   C C   . GLU A 1 28  ? -0.873  50.821  126.442 1.00 102.00 ? 528 GLU A C   1 
ATOM   144   O O   . GLU A 1 28  ? -0.731  49.880  127.224 1.00 106.52 ? 528 GLU A O   1 
ATOM   145   C CB  . GLU A 1 28  ? -2.674  51.776  127.888 1.00 126.01 ? 528 GLU A CB  1 
ATOM   146   C CG  . GLU A 1 28  ? -1.639  52.128  128.945 1.00 138.86 ? 528 GLU A CG  1 
ATOM   147   C CD  . GLU A 1 28  ? -2.181  51.984  130.367 1.00 148.58 ? 528 GLU A CD  1 
ATOM   148   O OE1 . GLU A 1 28  ? -2.235  50.838  130.876 1.00 151.74 ? 528 GLU A OE1 1 
ATOM   149   O OE2 . GLU A 1 28  ? -2.566  53.019  130.961 1.00 149.58 ? 528 GLU A OE2 1 
ATOM   150   N N   . ASN A 1 29  ? 0.036   51.143  125.534 1.00 91.87  ? 529 ASN A N   1 
ATOM   151   C CA  . ASN A 1 29  ? 1.281   50.400  125.433 1.00 84.71  ? 529 ASN A CA  1 
ATOM   152   C C   . ASN A 1 29  ? 2.461   51.191  125.984 1.00 78.92  ? 529 ASN A C   1 
ATOM   153   O O   . ASN A 1 29  ? 2.512   52.417  125.872 1.00 72.96  ? 529 ASN A O   1 
ATOM   154   C CB  . ASN A 1 29  ? 1.540   49.959  123.984 1.00 82.25  ? 529 ASN A CB  1 
ATOM   155   C CG  . ASN A 1 29  ? 2.144   51.059  123.127 1.00 74.55  ? 529 ASN A CG  1 
ATOM   156   O OD1 . ASN A 1 29  ? 3.365   51.193  123.048 1.00 73.03  ? 529 ASN A OD1 1 
ATOM   157   N ND2 . ASN A 1 29  ? 1.291   51.837  122.465 1.00 69.53  ? 529 ASN A ND2 1 
ATOM   158   N N   . LYS A 1 30  ? 3.399   50.478  126.597 1.00 77.37  ? 530 LYS A N   1 
ATOM   159   C CA  . LYS A 1 30  ? 4.604   51.094  127.128 1.00 79.79  ? 530 LYS A CA  1 
ATOM   160   C C   . LYS A 1 30  ? 5.692   51.123  126.055 1.00 73.61  ? 530 LYS A C   1 
ATOM   161   O O   . LYS A 1 30  ? 5.575   50.458  125.023 1.00 64.71  ? 530 LYS A O   1 
ATOM   162   C CB  . LYS A 1 30  ? 5.075   50.332  128.368 1.00 85.66  ? 530 LYS A CB  1 
ATOM   163   C CG  . LYS A 1 30  ? 5.082   48.818  128.191 1.00 92.37  ? 530 LYS A CG  1 
ATOM   164   C CD  . LYS A 1 30  ? 4.859   48.105  129.517 1.00 97.31  ? 530 LYS A CD  1 
ATOM   165   C CE  . LYS A 1 30  ? 3.558   48.562  130.164 1.00 99.27  ? 530 LYS A CE  1 
ATOM   166   N NZ  . LYS A 1 30  ? 3.424   48.077  131.564 1.00 97.22  ? 530 LYS A NZ  1 
ATOM   167   N N   . PRO A 1 31  ? 6.743   51.923  126.274 1.00 74.18  ? 531 PRO A N   1 
ATOM   168   C CA  . PRO A 1 31  ? 7.823   51.914  125.285 1.00 72.07  ? 531 PRO A CA  1 
ATOM   169   C C   . PRO A 1 31  ? 8.504   50.553  125.107 1.00 67.60  ? 531 PRO A C   1 
ATOM   170   O O   . PRO A 1 31  ? 8.692   49.781  126.051 1.00 64.23  ? 531 PRO A O   1 
ATOM   171   C CB  . PRO A 1 31  ? 8.808   52.979  125.808 1.00 70.17  ? 531 PRO A CB  1 
ATOM   172   C CG  . PRO A 1 31  ? 8.286   53.417  127.139 1.00 68.35  ? 531 PRO A CG  1 
ATOM   173   C CD  . PRO A 1 31  ? 6.832   53.081  127.175 1.00 71.79  ? 531 PRO A CD  1 
ATOM   174   N N   . LEU A 1 32  ? 8.862   50.274  123.861 1.00 61.00  ? 532 LEU A N   1 
ATOM   175   C CA  . LEU A 1 32  ? 9.600   49.074  123.513 1.00 59.31  ? 532 LEU A CA  1 
ATOM   176   C C   . LEU A 1 32  ? 9.040   47.831  124.199 1.00 59.33  ? 532 LEU A C   1 
ATOM   177   O O   . LEU A 1 32  ? 9.788   46.928  124.581 1.00 59.94  ? 532 LEU A O   1 
ATOM   178   C CB  . LEU A 1 32  ? 11.091  49.254  123.817 1.00 57.53  ? 532 LEU A CB  1 
ATOM   179   C CG  . LEU A 1 32  ? 11.793  50.416  123.097 1.00 54.86  ? 532 LEU A CG  1 
ATOM   180   C CD1 . LEU A 1 32  ? 13.289  50.415  123.367 1.00 43.56  ? 532 LEU A CD1 1 
ATOM   181   C CD2 . LEU A 1 32  ? 11.539  50.383  121.592 1.00 58.77  ? 532 LEU A CD2 1 
ATOM   182   N N   . GLU A 1 33  ? 7.720   47.784  124.341 1.00 56.52  ? 533 GLU A N   1 
ATOM   183   C CA  . GLU A 1 33  ? 7.069   46.582  124.846 1.00 59.22  ? 533 GLU A CA  1 
ATOM   184   C C   . GLU A 1 33  ? 7.657   45.358  124.164 1.00 60.26  ? 533 GLU A C   1 
ATOM   185   O O   . GLU A 1 33  ? 7.724   45.271  122.936 1.00 53.42  ? 533 GLU A O   1 
ATOM   186   C CB  . GLU A 1 33  ? 5.559   46.635  124.640 1.00 62.55  ? 533 GLU A CB  1 
ATOM   187   C CG  . GLU A 1 33  ? 4.790   47.002  125.888 1.00 72.26  ? 533 GLU A CG  1 
ATOM   188   C CD  . GLU A 1 33  ? 3.297   46.846  125.706 1.00 86.47  ? 533 GLU A CD  1 
ATOM   189   O OE1 . GLU A 1 33  ? 2.884   45.989  124.897 1.00 92.35  ? 533 GLU A OE1 1 
ATOM   190   O OE2 . GLU A 1 33  ? 2.536   47.587  126.362 1.00 93.19  ? 533 GLU A OE2 1 
ATOM   191   N N   . THR A 1 34  ? 8.091   44.413  124.981 1.00 65.00  ? 534 THR A N   1 
ATOM   192   C CA  . THR A 1 34  ? 8.832   43.267  124.493 1.00 64.86  ? 534 THR A CA  1 
ATOM   193   C C   . THR A 1 34  ? 7.993   42.339  123.588 1.00 68.57  ? 534 THR A C   1 
ATOM   194   O O   . THR A 1 34  ? 8.486   41.841  122.569 1.00 60.21  ? 534 THR A O   1 
ATOM   195   C CB  . THR A 1 34  ? 9.466   42.516  125.677 1.00 62.53  ? 534 THR A CB  1 
ATOM   196   O OG1 . THR A 1 34  ? 9.560   41.119  125.373 1.00 62.31  ? 534 THR A OG1 1 
ATOM   197   C CG2 . THR A 1 34  ? 8.630   42.722  126.939 1.00 66.51  ? 534 THR A CG2 1 
ATOM   198   N N   . ALA A 1 35  ? 6.729   42.126  123.947 1.00 67.54  ? 535 ALA A N   1 
ATOM   199   C CA  . ALA A 1 35  ? 5.832   41.303  123.138 1.00 59.03  ? 535 ALA A CA  1 
ATOM   200   C C   . ALA A 1 35  ? 5.571   41.946  121.785 1.00 58.34  ? 535 ALA A C   1 
ATOM   201   O O   . ALA A 1 35  ? 5.477   41.259  120.774 1.00 57.81  ? 535 ALA A O   1 
ATOM   202   C CB  . ALA A 1 35  ? 4.520   41.084  123.860 1.00 58.05  ? 535 ALA A CB  1 
ATOM   203   N N   . LEU A 1 36  ? 5.434   43.270  121.777 1.00 61.47  ? 536 LEU A N   1 
ATOM   204   C CA  . LEU A 1 36  ? 5.177   44.006  120.541 1.00 63.50  ? 536 LEU A CA  1 
ATOM   205   C C   . LEU A 1 36  ? 6.389   44.097  119.617 1.00 58.19  ? 536 LEU A C   1 
ATOM   206   O O   . LEU A 1 36  ? 6.234   44.042  118.402 1.00 56.18  ? 536 LEU A O   1 
ATOM   207   C CB  . LEU A 1 36  ? 4.616   45.395  120.836 1.00 70.95  ? 536 LEU A CB  1 
ATOM   208   C CG  . LEU A 1 36  ? 3.142   45.363  121.247 1.00 81.02  ? 536 LEU A CG  1 
ATOM   209   C CD1 . LEU A 1 36  ? 2.651   46.737  121.666 1.00 74.80  ? 536 LEU A CD1 1 
ATOM   210   C CD2 . LEU A 1 36  ? 2.297   44.807  120.107 1.00 89.36  ? 536 LEU A CD2 1 
ATOM   211   N N   . LEU A 1 37  ? 7.587   44.242  120.181 1.00 61.60  ? 537 LEU A N   1 
ATOM   212   C CA  . LEU A 1 37  ? 8.806   44.169  119.371 1.00 58.94  ? 537 LEU A CA  1 
ATOM   213   C C   . LEU A 1 37  ? 8.956   42.758  118.823 1.00 54.38  ? 537 LEU A C   1 
ATOM   214   O O   . LEU A 1 37  ? 9.477   42.555  117.729 1.00 46.59  ? 537 LEU A O   1 
ATOM   215   C CB  . LEU A 1 37  ? 10.044  44.524  120.188 1.00 49.68  ? 537 LEU A CB  1 
ATOM   216   C CG  . LEU A 1 37  ? 10.002  45.877  120.880 1.00 54.00  ? 537 LEU A CG  1 
ATOM   217   C CD1 . LEU A 1 37  ? 11.240  46.061  121.739 1.00 53.78  ? 537 LEU A CD1 1 
ATOM   218   C CD2 . LEU A 1 37  ? 9.880   46.983  119.853 1.00 51.92  ? 537 LEU A CD2 1 
ATOM   219   N N   . LYS A 1 38  ? 8.504   41.785  119.606 1.00 57.09  ? 538 LYS A N   1 
ATOM   220   C CA  . LYS A 1 38  ? 8.518   40.396  119.178 1.00 60.43  ? 538 LYS A CA  1 
ATOM   221   C C   . LYS A 1 38  ? 7.669   40.255  117.915 1.00 56.84  ? 538 LYS A C   1 
ATOM   222   O O   . LYS A 1 38  ? 8.154   39.795  116.883 1.00 52.00  ? 538 LYS A O   1 
ATOM   223   C CB  . LYS A 1 38  ? 7.998   39.479  120.292 1.00 62.26  ? 538 LYS A CB  1 
ATOM   224   C CG  . LYS A 1 38  ? 8.178   37.996  120.017 1.00 73.13  ? 538 LYS A CG  1 
ATOM   225   C CD  . LYS A 1 38  ? 7.760   37.153  121.221 1.00 78.90  ? 538 LYS A CD  1 
ATOM   226   C CE  . LYS A 1 38  ? 8.050   35.665  121.008 1.00 78.37  ? 538 LYS A CE  1 
ATOM   227   N NZ  . LYS A 1 38  ? 7.927   34.860  122.278 1.00 79.09  ? 538 LYS A NZ  1 
ATOM   228   N N   . ARG A 1 39  ? 6.408   40.673  117.995 1.00 50.83  ? 539 ARG A N   1 
ATOM   229   C CA  . ARG A 1 39  ? 5.485   40.547  116.870 1.00 52.35  ? 539 ARG A CA  1 
ATOM   230   C C   . ARG A 1 39  ? 6.008   41.271  115.624 1.00 56.12  ? 539 ARG A C   1 
ATOM   231   O O   . ARG A 1 39  ? 5.928   40.739  114.515 1.00 62.27  ? 539 ARG A O   1 
ATOM   232   C CB  . ARG A 1 39  ? 4.074   41.029  117.262 1.00 56.58  ? 539 ARG A CB  1 
ATOM   233   C CG  . ARG A 1 39  ? 2.988   40.787  116.210 1.00 60.89  ? 539 ARG A CG  1 
ATOM   234   C CD  . ARG A 1 39  ? 3.217   39.470  115.478 1.00 68.65  ? 539 ARG A CD  1 
ATOM   235   N NE  . ARG A 1 39  ? 2.270   39.254  114.386 1.00 78.59  ? 539 ARG A NE  1 
ATOM   236   C CZ  . ARG A 1 39  ? 2.469   38.400  113.384 1.00 86.44  ? 539 ARG A CZ  1 
ATOM   237   N NH1 . ARG A 1 39  ? 3.586   37.688  113.329 1.00 86.94  ? 539 ARG A NH1 1 
ATOM   238   N NH2 . ARG A 1 39  ? 1.556   38.261  112.430 1.00 90.69  ? 539 ARG A NH2 1 
ATOM   239   N N   . ALA A 1 40  ? 6.549   42.474  115.801 1.00 48.70  ? 540 ALA A N   1 
ATOM   240   C CA  . ALA A 1 40  ? 7.122   43.211  114.676 1.00 52.78  ? 540 ALA A CA  1 
ATOM   241   C C   . ALA A 1 40  ? 8.220   42.408  113.983 1.00 55.62  ? 540 ALA A C   1 
ATOM   242   O O   . ALA A 1 40  ? 8.120   42.113  112.793 1.00 58.75  ? 540 ALA A O   1 
ATOM   243   C CB  . ALA A 1 40  ? 7.662   44.563  115.129 1.00 47.63  ? 540 ALA A CB  1 
ATOM   244   N N   . LYS A 1 41  ? 9.269   42.065  114.726 1.00 51.39  ? 541 LYS A N   1 
ATOM   245   C CA  . LYS A 1 41  ? 10.369  41.279  114.178 1.00 55.68  ? 541 LYS A CA  1 
ATOM   246   C C   . LYS A 1 41  ? 9.834   40.114  113.350 1.00 58.15  ? 541 LYS A C   1 
ATOM   247   O O   . LYS A 1 41  ? 10.204  39.956  112.185 1.00 59.15  ? 541 LYS A O   1 
ATOM   248   C CB  . LYS A 1 41  ? 11.260  40.751  115.300 1.00 62.94  ? 541 LYS A CB  1 
ATOM   249   C CG  . LYS A 1 41  ? 12.524  40.048  114.827 1.00 64.07  ? 541 LYS A CG  1 
ATOM   250   C CD  . LYS A 1 41  ? 13.639  41.039  114.572 1.00 65.85  ? 541 LYS A CD  1 
ATOM   251   C CE  . LYS A 1 41  ? 14.892  40.353  114.059 1.00 67.12  ? 541 LYS A CE  1 
ATOM   252   N NZ  . LYS A 1 41  ? 14.776  40.012  112.613 1.00 73.81  ? 541 LYS A NZ  1 
ATOM   253   N N   . GLU A 1 42  ? 8.958   39.312  113.960 1.00 58.87  ? 542 GLU A N   1 
ATOM   254   C CA  . GLU A 1 42  ? 8.342   38.156  113.303 1.00 62.28  ? 542 GLU A CA  1 
ATOM   255   C C   . GLU A 1 42  ? 7.774   38.484  111.924 1.00 63.00  ? 542 GLU A C   1 
ATOM   256   O O   . GLU A 1 42  ? 7.934   37.708  110.981 1.00 58.74  ? 542 GLU A O   1 
ATOM   257   C CB  . GLU A 1 42  ? 7.231   37.557  114.172 1.00 70.69  ? 542 GLU A CB  1 
ATOM   258   C CG  . GLU A 1 42  ? 7.702   36.687  115.322 1.00 79.68  ? 542 GLU A CG  1 
ATOM   259   C CD  . GLU A 1 42  ? 6.547   35.999  116.026 1.00 89.18  ? 542 GLU A CD  1 
ATOM   260   O OE1 . GLU A 1 42  ? 5.710   35.390  115.325 1.00 86.67  ? 542 GLU A OE1 1 
ATOM   261   O OE2 . GLU A 1 42  ? 6.469   36.075  117.274 1.00 94.48  ? 542 GLU A OE2 1 
ATOM   262   N N   . LEU A 1 43  ? 7.092   39.622  111.818 1.00 62.79  ? 543 LEU A N   1 
ATOM   263   C CA  . LEU A 1 43  ? 6.534   40.068  110.546 1.00 59.56  ? 543 LEU A CA  1 
ATOM   264   C C   . LEU A 1 43  ? 7.611   40.256  109.478 1.00 52.77  ? 543 LEU A C   1 
ATOM   265   O O   . LEU A 1 43  ? 7.537   39.666  108.397 1.00 51.51  ? 543 LEU A O   1 
ATOM   266   C CB  . LEU A 1 43  ? 5.760   41.371  110.728 1.00 60.72  ? 543 LEU A CB  1 
ATOM   267   C CG  . LEU A 1 43  ? 4.254   41.252  110.900 1.00 63.12  ? 543 LEU A CG  1 
ATOM   268   C CD1 . LEU A 1 43  ? 3.663   42.650  110.978 1.00 70.12  ? 543 LEU A CD1 1 
ATOM   269   C CD2 . LEU A 1 43  ? 3.645   40.459  109.747 1.00 60.90  ? 543 LEU A CD2 1 
ATOM   270   N N   . PHE A 1 44  ? 8.599   41.090  109.779 1.00 40.59  ? 544 PHE A N   1 
ATOM   271   C CA  . PHE A 1 44  ? 9.695   41.352  108.852 1.00 52.12  ? 544 PHE A CA  1 
ATOM   272   C C   . PHE A 1 44  ? 10.543  40.081  108.598 1.00 51.75  ? 544 PHE A C   1 
ATOM   273   O O   . PHE A 1 44  ? 11.006  39.812  107.480 1.00 48.01  ? 544 PHE A O   1 
ATOM   274   C CB  . PHE A 1 44  ? 10.512  42.528  109.391 1.00 60.30  ? 544 PHE A CB  1 
ATOM   275   C CG  . PHE A 1 44  ? 11.951  42.521  108.985 1.00 72.50  ? 544 PHE A CG  1 
ATOM   276   C CD1 . PHE A 1 44  ? 12.396  43.336  107.956 1.00 76.63  ? 544 PHE A CD1 1 
ATOM   277   C CD2 . PHE A 1 44  ? 12.869  41.729  109.657 1.00 75.51  ? 544 PHE A CD2 1 
ATOM   278   C CE1 . PHE A 1 44  ? 13.723  43.352  107.592 1.00 77.36  ? 544 PHE A CE1 1 
ATOM   279   C CE2 . PHE A 1 44  ? 14.199  41.735  109.299 1.00 76.36  ? 544 PHE A CE2 1 
ATOM   280   C CZ  . PHE A 1 44  ? 14.629  42.547  108.263 1.00 79.06  ? 544 PHE A CZ  1 
ATOM   281   N N   . THR A 1 45  ? 10.703  39.277  109.638 1.00 46.15  ? 545 THR A N   1 
ATOM   282   C CA  . THR A 1 45  ? 11.400  38.004  109.529 1.00 46.31  ? 545 THR A CA  1 
ATOM   283   C C   . THR A 1 45  ? 10.710  37.024  108.571 1.00 48.88  ? 545 THR A C   1 
ATOM   284   O O   . THR A 1 45  ? 11.358  36.430  107.713 1.00 50.09  ? 545 THR A O   1 
ATOM   285   C CB  . THR A 1 45  ? 11.535  37.359  110.909 1.00 49.02  ? 545 THR A CB  1 
ATOM   286   O OG1 . THR A 1 45  ? 12.559  38.041  111.648 1.00 50.23  ? 545 THR A OG1 1 
ATOM   287   C CG2 . THR A 1 45  ? 11.877  35.878  110.786 1.00 44.42  ? 545 THR A CG2 1 
ATOM   288   N N   . ASN A 1 46  ? 9.395   36.873  108.707 1.00 42.90  ? 546 ASN A N   1 
ATOM   289   C CA  . ASN A 1 46  ? 8.647   35.913  107.899 1.00 47.69  ? 546 ASN A CA  1 
ATOM   290   C C   . ASN A 1 46  ? 8.170   36.419  106.550 1.00 50.21  ? 546 ASN A C   1 
ATOM   291   O O   . ASN A 1 46  ? 7.476   35.696  105.836 1.00 59.01  ? 546 ASN A O   1 
ATOM   292   C CB  . ASN A 1 46  ? 7.426   35.389  108.660 1.00 58.30  ? 546 ASN A CB  1 
ATOM   293   C CG  . ASN A 1 46  ? 7.784   34.770  109.990 1.00 60.45  ? 546 ASN A CG  1 
ATOM   294   O OD1 . ASN A 1 46  ? 8.963   34.550  110.291 1.00 60.83  ? 546 ASN A OD1 1 
ATOM   295   N ND2 . ASN A 1 46  ? 6.765   34.482  110.799 1.00 60.98  ? 546 ASN A ND2 1 
ATOM   296   N N   . ASN A 1 47  ? 8.499   37.655  106.198 1.00 38.18  ? 547 ASN A N   1 
ATOM   297   C CA  . ASN A 1 47  ? 8.077   38.157  104.902 1.00 31.39  ? 547 ASN A CA  1 
ATOM   298   C C   . ASN A 1 47  ? 9.235   38.338  103.931 1.00 29.64  ? 547 ASN A C   1 
ATOM   299   O O   . ASN A 1 47  ? 10.357  38.661  104.331 1.00 32.08  ? 547 ASN A O   1 
ATOM   300   C CB  . ASN A 1 47  ? 7.252   39.443  105.029 1.00 40.11  ? 547 ASN A CB  1 
ATOM   301   C CG  . ASN A 1 47  ? 5.791   39.173  105.364 1.00 42.06  ? 547 ASN A CG  1 
ATOM   302   O OD1 . ASN A 1 47  ? 4.969   38.921  104.478 1.00 47.38  ? 547 ASN A OD1 1 
ATOM   303   N ND2 . ASN A 1 47  ? 5.461   39.238  106.644 1.00 35.33  ? 547 ASN A ND2 1 
ATOM   304   N N   . ASP A 1 48  ? 8.945   38.084  102.658 1.00 22.06  ? 548 ASP A N   1 
ATOM   305   C CA  . ASP A 1 48  ? 9.882   38.294  101.560 1.00 21.21  ? 548 ASP A CA  1 
ATOM   306   C C   . ASP A 1 48  ? 10.255  39.790  101.433 1.00 34.55  ? 548 ASP A C   1 
ATOM   307   O O   . ASP A 1 48  ? 9.379   40.667  101.555 1.00 24.30  ? 548 ASP A O   1 
ATOM   308   C CB  . ASP A 1 48  ? 9.233   37.811  100.262 1.00 19.94  ? 548 ASP A CB  1 
ATOM   309   C CG  . ASP A 1 48  ? 10.147  37.944  99.070  1.00 42.70  ? 548 ASP A CG  1 
ATOM   310   O OD1 . ASP A 1 48  ? 10.246  39.070  98.528  1.00 42.90  ? 548 ASP A OD1 1 
ATOM   311   O OD2 . ASP A 1 48  ? 10.762  36.925  98.676  1.00 42.46  ? 548 ASP A OD2 1 
ATOM   312   N N   . PRO A 1 49  ? 11.549  40.083  101.178 1.00 27.80  ? 549 PRO A N   1 
ATOM   313   C CA  . PRO A 1 49  ? 12.041  41.467  101.058 1.00 29.16  ? 549 PRO A CA  1 
ATOM   314   C C   . PRO A 1 49  ? 11.312  42.291  99.992  1.00 24.20  ? 549 PRO A C   1 
ATOM   315   O O   . PRO A 1 49  ? 11.169  43.487  100.189 1.00 23.10  ? 549 PRO A O   1 
ATOM   316   C CB  . PRO A 1 49  ? 13.516  41.301  100.677 1.00 28.66  ? 549 PRO A CB  1 
ATOM   317   C CG  . PRO A 1 49  ? 13.881  39.906  101.119 1.00 27.21  ? 549 PRO A CG  1 
ATOM   318   C CD  . PRO A 1 49  ? 12.627  39.087  101.033 1.00 24.58  ? 549 PRO A CD  1 
ATOM   319   N N   . LYS A 1 50  ? 10.855  41.683  98.899  1.00 17.52  ? 550 LYS A N   1 
ATOM   320   C CA  . LYS A 1 50  ? 10.114  42.444  97.907  1.00 13.86  ? 550 LYS A CA  1 
ATOM   321   C C   . LYS A 1 50  ? 8.763   42.857  98.473  1.00 22.96  ? 550 LYS A C   1 
ATOM   322   O O   . LYS A 1 50  ? 8.325   43.992  98.263  1.00 26.03  ? 550 LYS A O   1 
ATOM   323   C CB  . LYS A 1 50  ? 9.938   41.688  96.593  1.00 13.39  ? 550 LYS A CB  1 
ATOM   324   C CG  . LYS A 1 50  ? 9.086   42.447  95.565  1.00 24.65  ? 550 LYS A CG  1 
ATOM   325   C CD  . LYS A 1 50  ? 8.963   41.704  94.231  1.00 27.62  ? 550 LYS A CD  1 
ATOM   326   C CE  . LYS A 1 50  ? 10.278  41.659  93.447  1.00 25.11  ? 550 LYS A CE  1 
ATOM   327   N NZ  . LYS A 1 50  ? 10.794  43.007  93.080  1.00 31.47  ? 550 LYS A NZ  1 
ATOM   328   N N   . VAL A 1 51  ? 8.123   41.943  99.206  1.00 20.84  ? 551 VAL A N   1 
ATOM   329   C CA  . VAL A 1 51  ? 6.817   42.216  99.815  1.00 32.27  ? 551 VAL A CA  1 
ATOM   330   C C   . VAL A 1 51  ? 6.918   43.334  100.851 1.00 30.35  ? 551 VAL A C   1 
ATOM   331   O O   . VAL A 1 51  ? 6.066   44.219  100.926 1.00 35.76  ? 551 VAL A O   1 
ATOM   332   C CB  . VAL A 1 51  ? 6.197   40.952  100.464 1.00 22.42  ? 551 VAL A CB  1 
ATOM   333   C CG1 . VAL A 1 51  ? 4.940   41.305  101.226 1.00 13.44  ? 551 VAL A CG1 1 
ATOM   334   C CG2 . VAL A 1 51  ? 5.904   39.922  99.402  1.00 14.15  ? 551 VAL A CG2 1 
ATOM   335   N N   . ILE A 1 52  ? 7.968   43.275  101.654 1.00 26.51  ? 552 ILE A N   1 
ATOM   336   C CA  . ILE A 1 52  ? 8.271   44.344  102.590 1.00 32.51  ? 552 ILE A CA  1 
ATOM   337   C C   . ILE A 1 52  ? 8.444   45.682  101.846 1.00 27.79  ? 552 ILE A C   1 
ATOM   338   O O   . ILE A 1 52  ? 7.850   46.686  102.224 1.00 27.85  ? 552 ILE A O   1 
ATOM   339   C CB  . ILE A 1 52  ? 9.533   44.009  103.424 1.00 28.61  ? 552 ILE A CB  1 
ATOM   340   C CG1 . ILE A 1 52  ? 9.291   42.744  104.264 1.00 24.61  ? 552 ILE A CG1 1 
ATOM   341   C CG2 . ILE A 1 52  ? 9.928   45.204  104.299 1.00 22.48  ? 552 ILE A CG2 1 
ATOM   342   C CD1 . ILE A 1 52  ? 10.527  42.188  104.971 1.00 24.93  ? 552 ILE A CD1 1 
ATOM   343   N N   . ALA A 1 53  ? 9.223   45.674  100.766 1.00 23.00  ? 553 ALA A N   1 
ATOM   344   C CA  . ALA A 1 53  ? 9.530   46.890  100.020 1.00 14.29  ? 553 ALA A CA  1 
ATOM   345   C C   . ALA A 1 53  ? 8.304   47.479  99.320  1.00 21.32  ? 553 ALA A C   1 
ATOM   346   O O   . ALA A 1 53  ? 8.211   48.688  99.165  1.00 24.37  ? 553 ALA A O   1 
ATOM   347   C CB  . ALA A 1 53  ? 10.648  46.639  99.014  1.00 10.46  ? 553 ALA A CB  1 
ATOM   348   N N   . GLN A 1 54  ? 7.379   46.625  98.891  1.00 29.08  ? 554 GLN A N   1 
ATOM   349   C CA  . GLN A 1 54  ? 6.119   47.083  98.301  1.00 22.12  ? 554 GLN A CA  1 
ATOM   350   C C   . GLN A 1 54  ? 5.250   47.819  99.322  1.00 25.32  ? 554 GLN A C   1 
ATOM   351   O O   . GLN A 1 54  ? 4.600   48.812  98.984  1.00 27.92  ? 554 GLN A O   1 
ATOM   352   C CB  . GLN A 1 54  ? 5.328   45.918  97.685  1.00 23.12  ? 554 GLN A CB  1 
ATOM   353   C CG  . GLN A 1 54  ? 6.004   45.268  96.476  1.00 23.44  ? 554 GLN A CG  1 
ATOM   354   C CD  . GLN A 1 54  ? 5.383   43.923  96.099  1.00 26.96  ? 554 GLN A CD  1 
ATOM   355   O OE1 . GLN A 1 54  ? 4.827   43.201  96.945  1.00 14.74  ? 554 GLN A OE1 1 
ATOM   356   N NE2 . GLN A 1 54  ? 5.483   43.579  94.818  1.00 17.81  ? 554 GLN A NE2 1 
ATOM   357   N N   . HIS A 1 55  ? 5.231   47.334  100.564 1.00 18.30  ? 555 HIS A N   1 
ATOM   358   C CA  . HIS A 1 55  ? 4.491   48.023  101.626 1.00 19.59  ? 555 HIS A CA  1 
ATOM   359   C C   . HIS A 1 55  ? 5.142   49.382  101.972 1.00 25.97  ? 555 HIS A C   1 
ATOM   360   O O   . HIS A 1 55  ? 4.460   50.378  102.162 1.00 27.79  ? 555 HIS A O   1 
ATOM   361   C CB  . HIS A 1 55  ? 4.334   47.131  102.868 1.00 14.25  ? 555 HIS A CB  1 
ATOM   362   C CG  . HIS A 1 55  ? 3.287   46.071  102.721 1.00 30.97  ? 555 HIS A CG  1 
ATOM   363   N ND1 . HIS A 1 55  ? 3.492   44.913  102.000 1.00 28.02  ? 555 HIS A ND1 1 
ATOM   364   C CD2 . HIS A 1 55  ? 2.019   45.996  103.195 1.00 34.48  ? 555 HIS A CD2 1 
ATOM   365   C CE1 . HIS A 1 55  ? 2.400   44.169  102.044 1.00 30.86  ? 555 HIS A CE1 1 
ATOM   366   N NE2 . HIS A 1 55  ? 1.490   44.803  102.763 1.00 35.77  ? 555 HIS A NE2 1 
ATOM   367   N N   . VAL A 1 56  ? 6.465   49.420  102.031 1.00 29.49  ? 556 VAL A N   1 
ATOM   368   C CA  . VAL A 1 56  ? 7.153   50.661  102.349 1.00 32.29  ? 556 VAL A CA  1 
ATOM   369   C C   . VAL A 1 56  ? 6.903   51.702  101.255 1.00 30.20  ? 556 VAL A C   1 
ATOM   370   O O   . VAL A 1 56  ? 6.454   52.819  101.526 1.00 31.30  ? 556 VAL A O   1 
ATOM   371   C CB  . VAL A 1 56  ? 8.658   50.415  102.577 1.00 25.57  ? 556 VAL A CB  1 
ATOM   372   C CG1 . VAL A 1 56  ? 9.412   51.744  102.718 1.00 12.64  ? 556 VAL A CG1 1 
ATOM   373   C CG2 . VAL A 1 56  ? 8.841   49.553  103.817 1.00 20.11  ? 556 VAL A CG2 1 
ATOM   374   N N   . LEU A 1 57  ? 7.165   51.321  100.013 1.00 27.44  ? 557 LEU A N   1 
ATOM   375   C CA  . LEU A 1 57  ? 6.898   52.202  98.878  1.00 22.11  ? 557 LEU A CA  1 
ATOM   376   C C   . LEU A 1 57  ? 5.445   52.712  98.848  1.00 20.92  ? 557 LEU A C   1 
ATOM   377   O O   . LEU A 1 57  ? 5.189   53.896  98.640  1.00 27.17  ? 557 LEU A O   1 
ATOM   378   C CB  . LEU A 1 57  ? 7.227   51.485  97.568  1.00 13.32  ? 557 LEU A CB  1 
ATOM   379   C CG  . LEU A 1 57  ? 6.650   52.132  96.309  1.00 22.25  ? 557 LEU A CG  1 
ATOM   380   C CD1 . LEU A 1 57  ? 7.155   53.544  96.165  1.00 16.59  ? 557 LEU A CD1 1 
ATOM   381   C CD2 . LEU A 1 57  ? 7.015   51.309  95.096  1.00 27.28  ? 557 LEU A CD2 1 
ATOM   382   N N   . SER A 1 58  ? 4.501   51.800  99.032  1.00 16.52  ? 558 SER A N   1 
ATOM   383   C CA  . SER A 1 58  ? 3.077   52.133  99.016  1.00 20.53  ? 558 SER A CA  1 
ATOM   384   C C   . SER A 1 58  ? 2.743   53.152  100.111 1.00 21.88  ? 558 SER A C   1 
ATOM   385   O O   . SER A 1 58  ? 1.956   54.065  99.901  1.00 25.71  ? 558 SER A O   1 
ATOM   386   C CB  . SER A 1 58  ? 2.242   50.850  99.189  1.00 15.71  ? 558 SER A CB  1 
ATOM   387   O OG  . SER A 1 58  ? 0.951   51.117  99.694  1.00 27.80  ? 558 SER A OG  1 
ATOM   388   N N   . MET A 1 59  ? 3.360   52.984  101.274 1.00 26.06  ? 559 MET A N   1 
ATOM   389   C CA  . MET A 1 59  ? 3.137   53.878  102.400 1.00 31.39  ? 559 MET A CA  1 
ATOM   390   C C   . MET A 1 59  ? 3.842   55.222  102.181 1.00 33.73  ? 559 MET A C   1 
ATOM   391   O O   . MET A 1 59  ? 3.283   56.281  102.453 1.00 32.82  ? 559 MET A O   1 
ATOM   392   C CB  . MET A 1 59  ? 3.596   53.217  103.705 1.00 23.00  ? 559 MET A CB  1 
ATOM   393   C CG  . MET A 1 59  ? 3.395   54.075  104.949 1.00 25.95  ? 559 MET A CG  1 
ATOM   394   S SD  . MET A 1 59  ? 1.664   54.386  105.361 1.00 41.10  ? 559 MET A SD  1 
ATOM   395   C CE  . MET A 1 59  ? 1.884   55.466  106.776 1.00 113.18 ? 559 MET A CE  1 
ATOM   396   N N   . ASP A 1 60  ? 5.071   55.170  101.681 1.00 28.23  ? 560 ASP A N   1 
ATOM   397   C CA  . ASP A 1 60  ? 5.789   56.387  101.350 1.00 24.96  ? 560 ASP A CA  1 
ATOM   398   C C   . ASP A 1 60  ? 5.000   57.203  100.327 1.00 28.68  ? 560 ASP A C   1 
ATOM   399   O O   . ASP A 1 60  ? 4.991   58.435  100.383 1.00 22.70  ? 560 ASP A O   1 
ATOM   400   C CB  . ASP A 1 60  ? 7.201   56.081  100.820 1.00 23.29  ? 560 ASP A CB  1 
ATOM   401   C CG  . ASP A 1 60  ? 8.151   55.609  101.905 1.00 24.84  ? 560 ASP A CG  1 
ATOM   402   O OD1 . ASP A 1 60  ? 7.838   55.784  103.099 1.00 31.41  ? 560 ASP A OD1 1 
ATOM   403   O OD2 . ASP A 1 60  ? 9.221   55.057  101.562 1.00 30.72  ? 560 ASP A OD2 1 
ATOM   404   N N   . CYS A 1 61  ? 4.333   56.531  99.392  1.00 24.64  ? 561 CYS A N   1 
ATOM   405   C CA  . CYS A 1 61  ? 3.580   57.273  98.388  1.00 25.23  ? 561 CYS A CA  1 
ATOM   406   C C   . CYS A 1 61  ? 2.361   57.969  98.977  1.00 36.67  ? 561 CYS A C   1 
ATOM   407   O O   . CYS A 1 61  ? 1.938   59.029  98.498  1.00 33.94  ? 561 CYS A O   1 
ATOM   408   C CB  . CYS A 1 61  ? 3.195   56.400  97.200  1.00 21.73  ? 561 CYS A CB  1 
ATOM   409   S SG  . CYS A 1 61  ? 4.596   56.001  96.171  1.00 28.46  ? 561 CYS A SG  1 
ATOM   410   N N   . ARG A 1 62  ? 1.794   57.383  100.021 1.00 33.44  ? 562 ARG A N   1 
ATOM   411   C CA  . ARG A 1 62  ? 0.695   58.053  100.686 1.00 39.93  ? 562 ARG A CA  1 
ATOM   412   C C   . ARG A 1 62  ? 1.216   59.263  101.460 1.00 35.01  ? 562 ARG A C   1 
ATOM   413   O O   . ARG A 1 62  ? 0.650   60.359  101.354 1.00 31.96  ? 562 ARG A O   1 
ATOM   414   C CB  . ARG A 1 62  ? -0.116  57.090  101.573 1.00 44.02  ? 562 ARG A CB  1 
ATOM   415   C CG  . ARG A 1 62  ? -0.961  56.099  100.765 1.00 54.75  ? 562 ARG A CG  1 
ATOM   416   C CD  . ARG A 1 62  ? -2.097  55.490  101.578 1.00 70.57  ? 562 ARG A CD  1 
ATOM   417   N NE  . ARG A 1 62  ? -1.608  54.703  102.706 1.00 83.63  ? 562 ARG A NE  1 
ATOM   418   C CZ  . ARG A 1 62  ? -1.294  53.411  102.640 1.00 90.27  ? 562 ARG A CZ  1 
ATOM   419   N NH1 . ARG A 1 62  ? -1.419  52.750  101.495 1.00 91.75  ? 562 ARG A NH1 1 
ATOM   420   N NH2 . ARG A 1 62  ? -0.852  52.777  103.719 1.00 88.66  ? 562 ARG A NH2 1 
ATOM   421   N N   . VAL A 1 63  ? 2.306   59.078  102.207 1.00 32.60  ? 563 VAL A N   1 
ATOM   422   C CA  . VAL A 1 63  ? 2.787   60.131  103.106 1.00 31.17  ? 563 VAL A CA  1 
ATOM   423   C C   . VAL A 1 63  ? 3.300   61.338  102.324 1.00 34.52  ? 563 VAL A C   1 
ATOM   424   O O   . VAL A 1 63  ? 3.050   62.475  102.700 1.00 41.11  ? 563 VAL A O   1 
ATOM   425   C CB  . VAL A 1 63  ? 3.876   59.646  104.092 1.00 25.44  ? 563 VAL A CB  1 
ATOM   426   C CG1 . VAL A 1 63  ? 4.520   60.834  104.740 1.00 32.80  ? 563 VAL A CG1 1 
ATOM   427   C CG2 . VAL A 1 63  ? 3.281   58.757  105.169 1.00 22.69  ? 563 VAL A CG2 1 
ATOM   428   N N   . ALA A 1 64  ? 3.998   61.079  101.224 1.00 26.80  ? 564 ALA A N   1 
ATOM   429   C CA  . ALA A 1 64  ? 4.520   62.142  100.377 1.00 29.86  ? 564 ALA A CA  1 
ATOM   430   C C   . ALA A 1 64  ? 3.463   62.653  99.398  1.00 28.54  ? 564 ALA A C   1 
ATOM   431   O O   . ALA A 1 64  ? 3.724   63.572  98.631  1.00 30.61  ? 564 ALA A O   1 
ATOM   432   C CB  . ALA A 1 64  ? 5.796   61.678  99.624  1.00 17.20  ? 564 ALA A CB  1 
ATOM   433   N N   . ARG A 1 65  ? 2.268   62.065  99.449  1.00 26.02  ? 565 ARG A N   1 
ATOM   434   C CA  . ARG A 1 65  ? 1.151   62.444  98.585  1.00 27.36  ? 565 ARG A CA  1 
ATOM   435   C C   . ARG A 1 65  ? 1.456   62.327  97.094  1.00 31.59  ? 565 ARG A C   1 
ATOM   436   O O   . ARG A 1 65  ? 1.140   63.227  96.310  1.00 32.90  ? 565 ARG A O   1 
ATOM   437   C CB  . ARG A 1 65  ? 0.639   63.843  98.933  1.00 33.80  ? 565 ARG A CB  1 
ATOM   438   C CG  . ARG A 1 65  ? 0.107   63.922  100.346 1.00 38.71  ? 565 ARG A CG  1 
ATOM   439   C CD  . ARG A 1 65  ? -0.309  65.314  100.704 1.00 43.45  ? 565 ARG A CD  1 
ATOM   440   N NE  . ARG A 1 65  ? -0.054  65.598  102.113 1.00 51.89  ? 565 ARG A NE  1 
ATOM   441   C CZ  . ARG A 1 65  ? -0.349  66.751  102.706 1.00 51.23  ? 565 ARG A CZ  1 
ATOM   442   N NH1 . ARG A 1 65  ? -0.916  67.726  102.012 1.00 56.84  ? 565 ARG A NH1 1 
ATOM   443   N NH2 . ARG A 1 65  ? -0.079  66.930  103.991 1.00 46.75  ? 565 ARG A NH2 1 
ATOM   444   N N   . ILE A 1 66  ? 2.063   61.205  96.713  1.00 34.02  ? 566 ILE A N   1 
ATOM   445   C CA  . ILE A 1 66  ? 2.251   60.860  95.313  1.00 28.58  ? 566 ILE A CA  1 
ATOM   446   C C   . ILE A 1 66  ? 1.064   60.029  94.840  1.00 30.28  ? 566 ILE A C   1 
ATOM   447   O O   . ILE A 1 66  ? 0.610   60.169  93.713  1.00 30.53  ? 566 ILE A O   1 
ATOM   448   C CB  . ILE A 1 66  ? 3.562   60.084  95.105  1.00 33.22  ? 566 ILE A CB  1 
ATOM   449   C CG1 . ILE A 1 66  ? 4.748   60.979  95.452  1.00 30.82  ? 566 ILE A CG1 1 
ATOM   450   C CG2 . ILE A 1 66  ? 3.678   59.577  93.664  1.00 32.74  ? 566 ILE A CG2 1 
ATOM   451   C CD1 . ILE A 1 66  ? 6.075   60.269  95.464  1.00 32.35  ? 566 ILE A CD1 1 
ATOM   452   N N   . LEU A 1 67  ? 0.555   59.170  95.716  1.00 36.34  ? 567 LEU A N   1 
ATOM   453   C CA  . LEU A 1 67  ? -0.635  58.367  95.419  1.00 30.33  ? 567 LEU A CA  1 
ATOM   454   C C   . LEU A 1 67  ? -1.745  58.616  96.438  1.00 35.09  ? 567 LEU A C   1 
ATOM   455   O O   . LEU A 1 67  ? -1.477  59.024  97.568  1.00 36.92  ? 567 LEU A O   1 
ATOM   456   C CB  . LEU A 1 67  ? -0.278  56.885  95.407  1.00 18.70  ? 567 LEU A CB  1 
ATOM   457   C CG  . LEU A 1 67  ? 0.591   56.424  94.235  1.00 26.05  ? 567 LEU A CG  1 
ATOM   458   C CD1 . LEU A 1 67  ? 1.072   54.978  94.382  1.00 21.35  ? 567 LEU A CD1 1 
ATOM   459   C CD2 . LEU A 1 67  ? -0.184  56.615  92.951  1.00 27.81  ? 567 LEU A CD2 1 
ATOM   460   N N   . GLY A 1 68  ? -2.991  58.381  96.032  1.00 43.55  ? 568 GLY A N   1 
ATOM   461   C CA  . GLY A 1 68  ? -4.118  58.369  96.961  1.00 45.88  ? 568 GLY A CA  1 
ATOM   462   C C   . GLY A 1 68  ? -4.643  59.730  97.374  1.00 58.13  ? 568 GLY A C   1 
ATOM   463   O O   . GLY A 1 68  ? -5.357  59.859  98.371  1.00 62.37  ? 568 GLY A O   1 
ATOM   464   N N   . VAL A 1 69  ? -4.289  60.750  96.599  1.00 59.07  ? 569 VAL A N   1 
ATOM   465   C CA  . VAL A 1 69  ? -4.675  62.113  96.912  1.00 55.92  ? 569 VAL A CA  1 
ATOM   466   C C   . VAL A 1 69  ? -6.143  62.328  96.558  1.00 56.30  ? 569 VAL A C   1 
ATOM   467   O O   . VAL A 1 69  ? -6.506  62.359  95.386  1.00 56.89  ? 569 VAL A O   1 
ATOM   468   C CB  . VAL A 1 69  ? -3.781  63.117  96.154  1.00 49.69  ? 569 VAL A CB  1 
ATOM   469   C CG1 . VAL A 1 69  ? -3.995  64.531  96.670  1.00 42.75  ? 569 VAL A CG1 1 
ATOM   470   C CG2 . VAL A 1 69  ? -2.323  62.718  96.298  1.00 48.55  ? 569 VAL A CG2 1 
ATOM   471   N N   . SER A 1 70  ? -6.988  62.447  97.578  1.00 59.32  ? 570 SER A N   1 
ATOM   472   C CA  . SER A 1 70  ? -8.404  62.745  97.366  1.00 62.06  ? 570 SER A CA  1 
ATOM   473   C C   . SER A 1 70  ? -8.537  64.103  96.702  1.00 61.56  ? 570 SER A C   1 
ATOM   474   O O   . SER A 1 70  ? -7.582  64.876  96.667  1.00 58.20  ? 570 SER A O   1 
ATOM   475   C CB  . SER A 1 70  ? -9.157  62.763  98.698  1.00 61.07  ? 570 SER A CB  1 
ATOM   476   O OG  . SER A 1 70  ? -8.756  63.865  99.497  1.00 51.30  ? 570 SER A OG  1 
ATOM   477   N N   . GLU A 1 71  ? -9.720  64.406  96.180  1.00 69.19  ? 571 GLU A N   1 
ATOM   478   C CA  . GLU A 1 71  ? -9.936  65.717  95.566  1.00 74.82  ? 571 GLU A CA  1 
ATOM   479   C C   . GLU A 1 71  ? -9.929  66.846  96.611  1.00 64.34  ? 571 GLU A C   1 
ATOM   480   O O   . GLU A 1 71  ? -9.491  67.959  96.335  1.00 44.96  ? 571 GLU A O   1 
ATOM   481   C CB  . GLU A 1 71  ? -11.230 65.741  94.746  1.00 82.30  ? 571 GLU A CB  1 
ATOM   482   C CG  . GLU A 1 71  ? -11.334 66.948  93.815  1.00 87.99  ? 571 GLU A CG  1 
ATOM   483   C CD  . GLU A 1 71  ? -10.200 67.000  92.798  1.00 91.02  ? 571 GLU A CD  1 
ATOM   484   O OE1 . GLU A 1 71  ? -9.713  65.918  92.397  1.00 94.37  ? 571 GLU A OE1 1 
ATOM   485   O OE2 . GLU A 1 71  ? -9.792  68.119  92.408  1.00 85.03  ? 571 GLU A OE2 1 
ATOM   486   N N   . GLU A 1 72  ? -10.420 66.541  97.809  1.00 70.49  ? 572 GLU A N   1 
ATOM   487   C CA  . GLU A 1 72  ? -10.356 67.453  98.947  1.00 63.20  ? 572 GLU A CA  1 
ATOM   488   C C   . GLU A 1 72  ? -8.896  67.797  99.250  1.00 58.47  ? 572 GLU A C   1 
ATOM   489   O O   . GLU A 1 72  ? -8.545  68.958  99.417  1.00 47.83  ? 572 GLU A O   1 
ATOM   490   C CB  . GLU A 1 72  ? -11.029 66.790  100.152 1.00 72.48  ? 572 GLU A CB  1 
ATOM   491   C CG  . GLU A 1 72  ? -11.021 67.571  101.453 1.00 87.95  ? 572 GLU A CG  1 
ATOM   492   C CD  . GLU A 1 72  ? -11.754 66.823  102.570 1.00 104.36 ? 572 GLU A CD  1 
ATOM   493   O OE1 . GLU A 1 72  ? -12.658 66.015  102.260 1.00 106.45 ? 572 GLU A OE1 1 
ATOM   494   O OE2 . GLU A 1 72  ? -11.422 67.033  103.758 1.00 111.70 ? 572 GLU A OE2 1 
ATOM   495   N N   . MET A 1 73  ? -8.039  66.780  99.292  1.00 66.48  ? 573 MET A N   1 
ATOM   496   C CA  . MET A 1 73  ? -6.612  66.989  99.544  1.00 65.82  ? 573 MET A CA  1 
ATOM   497   C C   . MET A 1 73  ? -5.933  67.865  98.480  1.00 52.66  ? 573 MET A C   1 
ATOM   498   O O   . MET A 1 73  ? -5.108  68.709  98.811  1.00 44.29  ? 573 MET A O   1 
ATOM   499   C CB  . MET A 1 73  ? -5.876  65.649  99.682  1.00 70.45  ? 573 MET A CB  1 
ATOM   500   C CG  . MET A 1 73  ? -4.387  65.803  99.971  1.00 71.96  ? 573 MET A CG  1 
ATOM   501   S SD  . MET A 1 73  ? -4.019  66.591  101.559 1.00 79.83  ? 573 MET A SD  1 
ATOM   502   C CE  . MET A 1 73  ? -4.155  65.185  102.666 1.00 70.69  ? 573 MET A CE  1 
ATOM   503   N N   . ARG A 1 74  ? -6.285  67.660  97.213  1.00 50.62  ? 574 ARG A N   1 
ATOM   504   C CA  . ARG A 1 74  ? -5.715  68.428  96.102  1.00 45.78  ? 574 ARG A CA  1 
ATOM   505   C C   . ARG A 1 74  ? -6.148  69.891  96.084  1.00 44.10  ? 574 ARG A C   1 
ATOM   506   O O   . ARG A 1 74  ? -5.327  70.786  95.875  1.00 43.35  ? 574 ARG A O   1 
ATOM   507   C CB  . ARG A 1 74  ? -6.082  67.766  94.776  1.00 54.39  ? 574 ARG A CB  1 
ATOM   508   C CG  . ARG A 1 74  ? -5.569  68.457  93.524  1.00 60.73  ? 574 ARG A CG  1 
ATOM   509   C CD  . ARG A 1 74  ? -5.540  67.459  92.378  1.00 69.73  ? 574 ARG A CD  1 
ATOM   510   N NE  . ARG A 1 74  ? -6.611  66.464  92.508  1.00 84.16  ? 574 ARG A NE  1 
ATOM   511   C CZ  . ARG A 1 74  ? -6.492  65.291  93.139  1.00 86.51  ? 574 ARG A CZ  1 
ATOM   512   N NH1 . ARG A 1 74  ? -5.342  64.945  93.706  1.00 87.66  ? 574 ARG A NH1 1 
ATOM   513   N NH2 . ARG A 1 74  ? -7.526  64.458  93.206  1.00 80.45  ? 574 ARG A NH2 1 
ATOM   514   N N   . ARG A 1 75  ? -7.440  70.136  96.273  1.00 52.72  ? 575 ARG A N   1 
ATOM   515   C CA  . ARG A 1 75  ? -7.928  71.509  96.360  1.00 66.78  ? 575 ARG A CA  1 
ATOM   516   C C   . ARG A 1 75  ? -7.278  72.169  97.565  1.00 65.92  ? 575 ARG A C   1 
ATOM   517   O O   . ARG A 1 75  ? -7.112  73.391  97.621  1.00 65.04  ? 575 ARG A O   1 
ATOM   518   C CB  . ARG A 1 75  ? -9.452  71.542  96.503  1.00 74.65  ? 575 ARG A CB  1 
ATOM   519   C CG  . ARG A 1 75  ? -10.208 71.286  95.211  1.00 87.68  ? 575 ARG A CG  1 
ATOM   520   C CD  . ARG A 1 75  ? -11.704 71.513  95.384  1.00 100.63 ? 575 ARG A CD  1 
ATOM   521   N NE  . ARG A 1 75  ? -12.300 70.592  96.352  1.00 110.36 ? 575 ARG A NE  1 
ATOM   522   C CZ  . ARG A 1 75  ? -12.671 70.930  97.585  1.00 113.80 ? 575 ARG A CZ  1 
ATOM   523   N NH1 . ARG A 1 75  ? -12.512 72.179  98.009  1.00 112.73 ? 575 ARG A NH1 1 
ATOM   524   N NH2 . ARG A 1 75  ? -13.206 70.020  98.393  1.00 112.14 ? 575 ARG A NH2 1 
ATOM   525   N N   . ASN A 1 76  ? -6.903  71.321  98.516  1.00 64.71  ? 576 ASN A N   1 
ATOM   526   C CA  . ASN A 1 76  ? -6.327  71.724  99.788  1.00 59.32  ? 576 ASN A CA  1 
ATOM   527   C C   . ASN A 1 76  ? -4.852  72.068  99.635  1.00 51.58  ? 576 ASN A C   1 
ATOM   528   O O   . ASN A 1 76  ? -4.336  72.931  100.341 1.00 46.74  ? 576 ASN A O   1 
ATOM   529   C CB  . ASN A 1 76  ? -6.506  70.580  100.799 1.00 63.72  ? 576 ASN A CB  1 
ATOM   530   C CG  . ASN A 1 76  ? -6.201  70.990  102.235 1.00 64.61  ? 576 ASN A CG  1 
ATOM   531   O OD1 . ASN A 1 76  ? -5.121  71.508  102.540 1.00 62.08  ? 576 ASN A OD1 1 
ATOM   532   N ND2 . ASN A 1 76  ? -7.155  70.740  103.130 1.00 59.06  ? 576 ASN A ND2 1 
ATOM   533   N N   . MET A 1 77  ? -4.172  71.387  98.714  1.00 46.84  ? 577 MET A N   1 
ATOM   534   C CA  . MET A 1 77  ? -2.751  71.625  98.494  1.00 39.59  ? 577 MET A CA  1 
ATOM   535   C C   . MET A 1 77  ? -2.532  72.774  97.508  1.00 47.63  ? 577 MET A C   1 
ATOM   536   O O   . MET A 1 77  ? -1.608  73.569  97.673  1.00 46.07  ? 577 MET A O   1 
ATOM   537   C CB  . MET A 1 77  ? -2.045  70.361  97.984  1.00 38.21  ? 577 MET A CB  1 
ATOM   538   C CG  . MET A 1 77  ? -2.028  69.153  98.936  1.00 30.85  ? 577 MET A CG  1 
ATOM   539   S SD  . MET A 1 77  ? -0.898  67.850  98.354  1.00 49.23  ? 577 MET A SD  1 
ATOM   540   C CE  . MET A 1 77  ? -1.619  67.448  96.762  1.00 50.88  ? 577 MET A CE  1 
ATOM   541   N N   . GLY A 1 78  ? -3.381  72.855  96.485  1.00 50.32  ? 578 GLY A N   1 
ATOM   542   C CA  . GLY A 1 78  ? -3.222  73.841  95.424  1.00 46.44  ? 578 GLY A CA  1 
ATOM   543   C C   . GLY A 1 78  ? -2.464  73.240  94.249  1.00 49.89  ? 578 GLY A C   1 
ATOM   544   O O   . GLY A 1 78  ? -2.296  73.869  93.194  1.00 46.39  ? 578 GLY A O   1 
ATOM   545   N N   . VAL A 1 79  ? -2.011  72.002  94.445  1.00 41.65  ? 579 VAL A N   1 
ATOM   546   C CA  . VAL A 1 79  ? -1.209  71.292  93.464  1.00 38.40  ? 579 VAL A CA  1 
ATOM   547   C C   . VAL A 1 79  ? -1.612  69.836  93.481  1.00 44.69  ? 579 VAL A C   1 
ATOM   548   O O   . VAL A 1 79  ? -2.308  69.388  94.388  1.00 55.60  ? 579 VAL A O   1 
ATOM   549   C CB  . VAL A 1 79  ? 0.289   71.391  93.789  1.00 39.17  ? 579 VAL A CB  1 
ATOM   550   C CG1 . VAL A 1 79  ? 0.818   72.771  93.437  1.00 37.20  ? 579 VAL A CG1 1 
ATOM   551   C CG2 . VAL A 1 79  ? 0.540   71.073  95.261  1.00 40.48  ? 579 VAL A CG2 1 
ATOM   552   N N   . SER A 1 80  ? -1.168  69.081  92.492  1.00 36.34  ? 580 SER A N   1 
ATOM   553   C CA  . SER A 1 80  ? -1.594  67.696  92.412  1.00 41.66  ? 580 SER A CA  1 
ATOM   554   C C   . SER A 1 80  ? -0.778  66.751  93.298  1.00 44.03  ? 580 SER A C   1 
ATOM   555   O O   . SER A 1 80  ? -1.304  65.770  93.810  1.00 44.46  ? 580 SER A O   1 
ATOM   556   C CB  . SER A 1 80  ? -1.584  67.228  90.960  1.00 53.21  ? 580 SER A CB  1 
ATOM   557   O OG  . SER A 1 80  ? -2.702  67.757  90.266  1.00 66.67  ? 580 SER A OG  1 
ATOM   558   N N   . SER A 1 81  ? 0.497   67.062  93.495  1.00 41.75  ? 581 SER A N   1 
ATOM   559   C CA  . SER A 1 81  ? 1.399   66.160  94.194  1.00 34.44  ? 581 SER A CA  1 
ATOM   560   C C   . SER A 1 81  ? 2.157   66.812  95.337  1.00 30.66  ? 581 SER A C   1 
ATOM   561   O O   . SER A 1 81  ? 2.612   67.956  95.231  1.00 21.67  ? 581 SER A O   1 
ATOM   562   C CB  . SER A 1 81  ? 2.413   65.590  93.213  1.00 38.00  ? 581 SER A CB  1 
ATOM   563   O OG  . SER A 1 81  ? 3.627   65.270  93.869  1.00 41.35  ? 581 SER A OG  1 
ATOM   564   N N   . GLY A 1 82  ? 2.324   66.062  96.418  1.00 20.19  ? 582 GLY A N   1 
ATOM   565   C CA  . GLY A 1 82  ? 3.135   66.512  97.528  1.00 21.02  ? 582 GLY A CA  1 
ATOM   566   C C   . GLY A 1 82  ? 4.565   66.877  97.149  1.00 26.51  ? 582 GLY A C   1 
ATOM   567   O O   . GLY A 1 82  ? 5.197   67.668  97.845  1.00 31.78  ? 582 GLY A O   1 
ATOM   568   N N   . LEU A 1 83  ? 5.072   66.302  96.057  1.00 20.11  ? 583 LEU A N   1 
ATOM   569   C CA  . LEU A 1 83  ? 6.439   66.557  95.591  1.00 30.34  ? 583 LEU A CA  1 
ATOM   570   C C   . LEU A 1 83  ? 6.578   67.980  95.034  1.00 39.95  ? 583 LEU A C   1 
ATOM   571   O O   . LEU A 1 83  ? 7.672   68.545  94.989  1.00 36.72  ? 583 LEU A O   1 
ATOM   572   C CB  . LEU A 1 83  ? 6.851   65.543  94.517  1.00 21.84  ? 583 LEU A CB  1 
ATOM   573   C CG  . LEU A 1 83  ? 6.954   64.083  94.925  1.00 20.17  ? 583 LEU A CG  1 
ATOM   574   C CD1 . LEU A 1 83  ? 7.504   63.222  93.774  1.00 26.17  ? 583 LEU A CD1 1 
ATOM   575   C CD2 . LEU A 1 83  ? 7.832   63.978  96.135  1.00 24.93  ? 583 LEU A CD2 1 
ATOM   576   N N   . GLU A 1 84  ? 5.459   68.539  94.590  1.00 44.69  ? 584 GLU A N   1 
ATOM   577   C CA  . GLU A 1 84  ? 5.411   69.937  94.202  1.00 43.17  ? 584 GLU A CA  1 
ATOM   578   C C   . GLU A 1 84  ? 5.290   70.774  95.467  1.00 35.23  ? 584 GLU A C   1 
ATOM   579   O O   . GLU A 1 84  ? 5.996   71.772  95.643  1.00 32.15  ? 584 GLU A O   1 
ATOM   580   C CB  . GLU A 1 84  ? 4.224   70.184  93.269  1.00 49.57  ? 584 GLU A CB  1 
ATOM   581   C CG  . GLU A 1 84  ? 4.079   71.618  92.815  1.00 62.85  ? 584 GLU A CG  1 
ATOM   582   C CD  . GLU A 1 84  ? 3.547   71.721  91.399  1.00 73.20  ? 584 GLU A CD  1 
ATOM   583   O OE1 . GLU A 1 84  ? 3.290   70.661  90.790  1.00 72.90  ? 584 GLU A OE1 1 
ATOM   584   O OE2 . GLU A 1 84  ? 3.403   72.858  90.892  1.00 73.39  ? 584 GLU A OE2 1 
ATOM   585   N N   . LEU A 1 85  ? 4.432   70.319  96.374  1.00 36.27  ? 585 LEU A N   1 
ATOM   586   C CA  . LEU A 1 85  ? 4.098   71.084  97.568  1.00 38.27  ? 585 LEU A CA  1 
ATOM   587   C C   . LEU A 1 85  ? 5.292   71.336  98.465  1.00 35.96  ? 585 LEU A C   1 
ATOM   588   O O   . LEU A 1 85  ? 5.342   72.371  99.133  1.00 28.60  ? 585 LEU A O   1 
ATOM   589   C CB  . LEU A 1 85  ? 2.993   70.403  98.387  1.00 30.74  ? 585 LEU A CB  1 
ATOM   590   C CG  . LEU A 1 85  ? 2.591   71.184  99.641  1.00 24.03  ? 585 LEU A CG  1 
ATOM   591   C CD1 . LEU A 1 85  ? 1.890   72.508  99.257  1.00 22.51  ? 585 LEU A CD1 1 
ATOM   592   C CD2 . LEU A 1 85  ? 1.694   70.360  100.529 1.00 17.69  ? 585 LEU A CD2 1 
ATOM   593   N N   . ILE A 1 86  ? 6.244   70.401  98.498  1.00 27.28  ? 586 ILE A N   1 
ATOM   594   C CA  . ILE A 1 86  ? 7.376   70.553  99.421  1.00 32.65  ? 586 ILE A CA  1 
ATOM   595   C C   . ILE A 1 86  ? 8.414   71.598  98.986  1.00 37.55  ? 586 ILE A C   1 
ATOM   596   O O   . ILE A 1 86  ? 9.290   71.971  99.771  1.00 37.72  ? 586 ILE A O   1 
ATOM   597   C CB  . ILE A 1 86  ? 8.087   69.235  99.736  1.00 33.78  ? 586 ILE A CB  1 
ATOM   598   C CG1 . ILE A 1 86  ? 8.474   68.520  98.455  1.00 34.47  ? 586 ILE A CG1 1 
ATOM   599   C CG2 . ILE A 1 86  ? 7.219   68.355  100.591 1.00 43.23  ? 586 ILE A CG2 1 
ATOM   600   C CD1 . ILE A 1 86  ? 9.544   67.542  98.682  1.00 45.47  ? 586 ILE A CD1 1 
ATOM   601   N N   . THR A 1 87  ? 8.308   72.077  97.752  1.00 30.50  ? 587 THR A N   1 
ATOM   602   C CA  . THR A 1 87  ? 9.208   73.114  97.281  1.00 27.55  ? 587 THR A CA  1 
ATOM   603   C C   . THR A 1 87  ? 8.601   74.482  97.542  1.00 31.57  ? 587 THR A C   1 
ATOM   604   O O   . THR A 1 87  ? 9.227   75.516  97.265  1.00 30.62  ? 587 THR A O   1 
ATOM   605   C CB  . THR A 1 87  ? 9.463   72.987  95.782  1.00 29.33  ? 587 THR A CB  1 
ATOM   606   O OG1 . THR A 1 87  ? 8.245   73.265  95.064  1.00 26.86  ? 587 THR A OG1 1 
ATOM   607   C CG2 . THR A 1 87  ? 9.961   71.592  95.448  1.00 17.56  ? 587 THR A CG2 1 
ATOM   608   N N   . LEU A 1 88  ? 7.377   74.475  98.069  1.00 27.12  ? 588 LEU A N   1 
ATOM   609   C CA  . LEU A 1 88  ? 6.625   75.699  98.333  1.00 26.18  ? 588 LEU A CA  1 
ATOM   610   C C   . LEU A 1 88  ? 6.502   76.005  99.832  1.00 33.18  ? 588 LEU A C   1 
ATOM   611   O O   . LEU A 1 88  ? 6.538   75.111  100.664 1.00 27.83  ? 588 LEU A O   1 
ATOM   612   C CB  . LEU A 1 88  ? 5.225   75.604  97.721  1.00 23.60  ? 588 LEU A CB  1 
ATOM   613   C CG  . LEU A 1 88  ? 5.178   75.207  96.247  1.00 31.71  ? 588 LEU A CG  1 
ATOM   614   C CD1 . LEU A 1 88  ? 3.741   75.149  95.770  1.00 23.82  ? 588 LEU A CD1 1 
ATOM   615   C CD2 . LEU A 1 88  ? 6.005   76.165  95.387  1.00 28.58  ? 588 LEU A CD2 1 
ATOM   616   N N   . PRO A 1 89  ? 6.351   77.289  100.176 1.00 51.34  ? 589 PRO A N   1 
ATOM   617   C CA  . PRO A 1 89  ? 6.186   77.692  101.578 1.00 47.78  ? 589 PRO A CA  1 
ATOM   618   C C   . PRO A 1 89  ? 5.160   76.851  102.348 1.00 36.87  ? 589 PRO A C   1 
ATOM   619   O O   . PRO A 1 89  ? 5.490   76.347  103.418 1.00 35.96  ? 589 PRO A O   1 
ATOM   620   C CB  . PRO A 1 89  ? 5.735   79.151  101.461 1.00 42.68  ? 589 PRO A CB  1 
ATOM   621   C CG  . PRO A 1 89  ? 6.446   79.630  100.244 1.00 42.40  ? 589 PRO A CG  1 
ATOM   622   C CD  . PRO A 1 89  ? 6.447   78.456  99.279  1.00 42.35  ? 589 PRO A CD  1 
ATOM   623   N N   . HIS A 1 90  ? 3.948   76.692  101.825 1.00 28.87  ? 590 HIS A N   1 
ATOM   624   C CA  . HIS A 1 90  ? 2.931   75.951  102.569 1.00 34.84  ? 590 HIS A CA  1 
ATOM   625   C C   . HIS A 1 90  ? 3.123   74.430  102.595 1.00 40.97  ? 590 HIS A C   1 
ATOM   626   O O   . HIS A 1 90  ? 2.198   73.690  102.954 1.00 37.77  ? 590 HIS A O   1 
ATOM   627   C CB  . HIS A 1 90  ? 1.524   76.281  102.082 1.00 43.68  ? 590 HIS A CB  1 
ATOM   628   C CG  . HIS A 1 90  ? 1.383   76.296  100.596 1.00 56.05  ? 590 HIS A CG  1 
ATOM   629   N ND1 . HIS A 1 90  ? 0.379   75.616  99.940  1.00 63.28  ? 590 HIS A ND1 1 
ATOM   630   C CD2 . HIS A 1 90  ? 2.101   76.930  99.637  1.00 62.08  ? 590 HIS A CD2 1 
ATOM   631   C CE1 . HIS A 1 90  ? 0.491   75.821  98.638  1.00 67.34  ? 590 HIS A CE1 1 
ATOM   632   N NE2 . HIS A 1 90  ? 1.525   76.618  98.428  1.00 69.02  ? 590 HIS A NE2 1 
ATOM   633   N N   . GLY A 1 91  ? 4.312   73.967  102.219 1.00 36.65  ? 591 GLY A N   1 
ATOM   634   C CA  . GLY A 1 91  ? 4.631   72.559  102.334 1.00 39.44  ? 591 GLY A CA  1 
ATOM   635   C C   . GLY A 1 91  ? 5.392   72.301  103.620 1.00 38.19  ? 591 GLY A C   1 
ATOM   636   O O   . GLY A 1 91  ? 5.958   71.227  103.811 1.00 37.04  ? 591 GLY A O   1 
ATOM   637   N N   . HIS A 1 92  ? 5.408   73.300  104.497 1.00 30.91  ? 592 HIS A N   1 
ATOM   638   C CA  . HIS A 1 92  ? 6.165   73.231  105.744 1.00 31.92  ? 592 HIS A CA  1 
ATOM   639   C C   . HIS A 1 92  ? 5.768   72.016  106.578 1.00 37.21  ? 592 HIS A C   1 
ATOM   640   O O   . HIS A 1 92  ? 6.623   71.283  107.053 1.00 37.70  ? 592 HIS A O   1 
ATOM   641   C CB  . HIS A 1 92  ? 5.961   74.521  106.551 1.00 33.23  ? 592 HIS A CB  1 
ATOM   642   C CG  . HIS A 1 92  ? 6.671   74.541  107.870 1.00 34.09  ? 592 HIS A CG  1 
ATOM   643   N ND1 . HIS A 1 92  ? 8.025   74.303  107.992 1.00 41.83  ? 592 HIS A ND1 1 
ATOM   644   C CD2 . HIS A 1 92  ? 6.216   74.776  109.124 1.00 30.12  ? 592 HIS A CD2 1 
ATOM   645   C CE1 . HIS A 1 92  ? 8.370   74.385  109.266 1.00 44.54  ? 592 HIS A CE1 1 
ATOM   646   N NE2 . HIS A 1 92  ? 7.291   74.672  109.974 1.00 37.43  ? 592 HIS A NE2 1 
ATOM   647   N N   . GLN A 1 93  ? 4.468   71.809  106.759 1.00 38.77  ? 593 GLN A N   1 
ATOM   648   C CA  . GLN A 1 93  ? 3.977   70.668  107.521 1.00 38.46  ? 593 GLN A CA  1 
ATOM   649   C C   . GLN A 1 93  ? 4.459   69.350  106.915 1.00 39.03  ? 593 GLN A C   1 
ATOM   650   O O   . GLN A 1 93  ? 4.980   68.482  107.614 1.00 34.33  ? 593 GLN A O   1 
ATOM   651   C CB  . GLN A 1 93  ? 2.458   70.678  107.537 1.00 42.26  ? 593 GLN A CB  1 
ATOM   652   C CG  . GLN A 1 93  ? 1.853   69.518  108.295 1.00 51.96  ? 593 GLN A CG  1 
ATOM   653   C CD  . GLN A 1 93  ? 1.815   69.766  109.781 1.00 60.45  ? 593 GLN A CD  1 
ATOM   654   O OE1 . GLN A 1 93  ? 0.911   69.300  110.470 1.00 69.91  ? 593 GLN A OE1 1 
ATOM   655   N NE2 . GLN A 1 93  ? 2.791   70.511  110.286 1.00 57.78  ? 593 GLN A NE2 1 
ATOM   656   N N   . LEU A 1 94  ? 4.270   69.215  105.605 1.00 38.30  ? 594 LEU A N   1 
ATOM   657   C CA  . LEU A 1 94  ? 4.678   68.028  104.866 1.00 29.27  ? 594 LEU A CA  1 
ATOM   658   C C   . LEU A 1 94  ? 6.155   67.757  105.101 1.00 30.09  ? 594 LEU A C   1 
ATOM   659   O O   . LEU A 1 94  ? 6.540   66.658  105.502 1.00 25.83  ? 594 LEU A O   1 
ATOM   660   C CB  . LEU A 1 94  ? 4.416   68.223  103.377 1.00 23.68  ? 594 LEU A CB  1 
ATOM   661   C CG  . LEU A 1 94  ? 3.737   67.059  102.661 1.00 40.57  ? 594 LEU A CG  1 
ATOM   662   C CD1 . LEU A 1 94  ? 3.903   67.205  101.157 1.00 40.88  ? 594 LEU A CD1 1 
ATOM   663   C CD2 . LEU A 1 94  ? 4.272   65.702  103.152 1.00 30.62  ? 594 LEU A CD2 1 
ATOM   664   N N   . ARG A 1 95  ? 6.975   68.776  104.860 1.00 28.69  ? 595 ARG A N   1 
ATOM   665   C CA  . ARG A 1 95  ? 8.402   68.689  105.135 1.00 25.26  ? 595 ARG A CA  1 
ATOM   666   C C   . ARG A 1 95  ? 8.691   68.148  106.544 1.00 32.46  ? 595 ARG A C   1 
ATOM   667   O O   . ARG A 1 95  ? 9.556   67.286  106.705 1.00 27.27  ? 595 ARG A O   1 
ATOM   668   C CB  . ARG A 1 95  ? 9.113   70.036  104.886 1.00 17.73  ? 595 ARG A CB  1 
ATOM   669   C CG  . ARG A 1 95  ? 9.313   70.381  103.389 1.00 20.12  ? 595 ARG A CG  1 
ATOM   670   C CD  . ARG A 1 95  ? 10.208  71.628  103.152 1.00 27.13  ? 595 ARG A CD  1 
ATOM   671   N NE  . ARG A 1 95  ? 9.624   72.842  103.710 1.00 25.53  ? 595 ARG A NE  1 
ATOM   672   C CZ  . ARG A 1 95  ? 8.756   73.619  103.066 1.00 30.46  ? 595 ARG A CZ  1 
ATOM   673   N NH1 . ARG A 1 95  ? 8.379   73.325  101.831 1.00 29.21  ? 595 ARG A NH1 1 
ATOM   674   N NH2 . ARG A 1 95  ? 8.255   74.693  103.662 1.00 37.46  ? 595 ARG A NH2 1 
ATOM   675   N N   . LEU A 1 96  ? 7.978   68.644  107.556 1.00 26.07  ? 596 LEU A N   1 
ATOM   676   C CA  . LEU A 1 96  ? 8.193   68.166  108.918 1.00 28.99  ? 596 LEU A CA  1 
ATOM   677   C C   . LEU A 1 96  ? 7.777   66.717  109.048 1.00 35.79  ? 596 LEU A C   1 
ATOM   678   O O   . LEU A 1 96  ? 8.442   65.950  109.736 1.00 41.53  ? 596 LEU A O   1 
ATOM   679   C CB  . LEU A 1 96  ? 7.431   69.010  109.939 1.00 35.14  ? 596 LEU A CB  1 
ATOM   680   C CG  . LEU A 1 96  ? 7.801   70.500  109.991 1.00 43.74  ? 596 LEU A CG  1 
ATOM   681   C CD1 . LEU A 1 96  ? 6.825   71.289  110.875 1.00 47.33  ? 596 LEU A CD1 1 
ATOM   682   C CD2 . LEU A 1 96  ? 9.245   70.710  110.440 1.00 27.24  ? 596 LEU A CD2 1 
ATOM   683   N N   . ASP A 1 97  ? 6.667   66.348  108.407 1.00 35.05  ? 597 ASP A N   1 
ATOM   684   C CA  . ASP A 1 97  ? 6.206   64.959  108.420 1.00 27.03  ? 597 ASP A CA  1 
ATOM   685   C C   . ASP A 1 97  ? 7.270   64.072  107.765 1.00 31.05  ? 597 ASP A C   1 
ATOM   686   O O   . ASP A 1 97  ? 7.649   63.033  108.303 1.00 31.12  ? 597 ASP A O   1 
ATOM   687   C CB  . ASP A 1 97  ? 4.868   64.800  107.684 1.00 25.65  ? 597 ASP A CB  1 
ATOM   688   C CG  . ASP A 1 97  ? 3.697   65.444  108.421 1.00 36.65  ? 597 ASP A CG  1 
ATOM   689   O OD1 . ASP A 1 97  ? 3.777   65.631  109.655 1.00 32.57  ? 597 ASP A OD1 1 
ATOM   690   O OD2 . ASP A 1 97  ? 2.681   65.758  107.757 1.00 47.27  ? 597 ASP A OD2 1 
ATOM   691   N N   . ILE A 1 98  ? 7.760   64.505  106.608 1.00 26.71  ? 598 ILE A N   1 
ATOM   692   C CA  . ILE A 1 98  ? 8.789   63.768  105.885 1.00 21.05  ? 598 ILE A CA  1 
ATOM   693   C C   . ILE A 1 98  ? 10.013  63.507  106.752 1.00 23.00  ? 598 ILE A C   1 
ATOM   694   O O   . ILE A 1 98  ? 10.546  62.395  106.761 1.00 22.21  ? 598 ILE A O   1 
ATOM   695   C CB  . ILE A 1 98  ? 9.160   64.455  104.556 1.00 20.94  ? 598 ILE A CB  1 
ATOM   696   C CG1 . ILE A 1 98  ? 8.075   64.171  103.528 1.00 25.87  ? 598 ILE A CG1 1 
ATOM   697   C CG2 . ILE A 1 98  ? 10.502  63.953  104.027 1.00 16.59  ? 598 ILE A CG2 1 
ATOM   698   C CD1 . ILE A 1 98  ? 8.072   65.149  102.393 1.00 43.05  ? 598 ILE A CD1 1 
ATOM   699   N N   . ILE A 1 99  ? 10.420  64.518  107.513 1.00 29.61  ? 599 ILE A N   1 
ATOM   700   C CA  . ILE A 1 99  ? 11.545  64.397  108.431 1.00 34.53  ? 599 ILE A CA  1 
ATOM   701   C C   . ILE A 1 99  ? 11.277  63.404  109.573 1.00 31.49  ? 599 ILE A C   1 
ATOM   702   O O   . ILE A 1 99  ? 12.134  62.582  109.884 1.00 28.67  ? 599 ILE A O   1 
ATOM   703   C CB  . ILE A 1 99  ? 11.969  65.775  108.988 1.00 30.24  ? 599 ILE A CB  1 
ATOM   704   C CG1 . ILE A 1 99  ? 12.627  66.597  107.874 1.00 31.33  ? 599 ILE A CG1 1 
ATOM   705   C CG2 . ILE A 1 99  ? 12.926  65.613  110.171 1.00 23.82  ? 599 ILE A CG2 1 
ATOM   706   C CD1 . ILE A 1 99  ? 12.655  68.081  108.152 1.00 34.83  ? 599 ILE A CD1 1 
ATOM   707   N N   . GLU A 1 100 ? 10.092  63.470  110.178 1.00 20.58  ? 600 GLU A N   1 
ATOM   708   C CA  . GLU A 1 100 ? 9.756   62.574  111.295 1.00 32.08  ? 600 GLU A CA  1 
ATOM   709   C C   . GLU A 1 100 ? 9.715   61.081  110.898 1.00 32.30  ? 600 GLU A C   1 
ATOM   710   O O   . GLU A 1 100 ? 10.223  60.221  111.612 1.00 31.83  ? 600 GLU A O   1 
ATOM   711   C CB  . GLU A 1 100 ? 8.424   62.988  111.939 1.00 30.80  ? 600 GLU A CB  1 
ATOM   712   C CG  . GLU A 1 100 ? 7.999   62.152  113.150 1.00 39.88  ? 600 GLU A CG  1 
ATOM   713   C CD  . GLU A 1 100 ? 8.883   62.372  114.380 1.00 47.61  ? 600 GLU A CD  1 
ATOM   714   O OE1 . GLU A 1 100 ? 8.769   63.446  115.017 1.00 48.01  ? 600 GLU A OE1 1 
ATOM   715   O OE2 . GLU A 1 100 ? 9.685   61.467  114.715 1.00 46.77  ? 600 GLU A OE2 1 
ATOM   716   N N   . ARG A 1 101 ? 9.117   60.784  109.754 1.00 29.98  ? 601 ARG A N   1 
ATOM   717   C CA  . ARG A 1 101 ? 8.966   59.411  109.321 1.00 30.07  ? 601 ARG A CA  1 
ATOM   718   C C   . ARG A 1 101 ? 10.331  58.783  109.042 1.00 31.42  ? 601 ARG A C   1 
ATOM   719   O O   . ARG A 1 101 ? 10.569  57.620  109.366 1.00 25.37  ? 601 ARG A O   1 
ATOM   720   C CB  . ARG A 1 101 ? 8.071   59.354  108.083 1.00 27.97  ? 601 ARG A CB  1 
ATOM   721   C CG  . ARG A 1 101 ? 8.152   58.056  107.325 1.00 28.10  ? 601 ARG A CG  1 
ATOM   722   C CD  . ARG A 1 101 ? 6.998   57.905  106.361 1.00 31.06  ? 601 ARG A CD  1 
ATOM   723   N NE  . ARG A 1 101 ? 7.092   56.644  105.630 1.00 30.93  ? 601 ARG A NE  1 
ATOM   724   C CZ  . ARG A 1 101 ? 6.475   55.523  105.987 1.00 33.85  ? 601 ARG A CZ  1 
ATOM   725   N NH1 . ARG A 1 101 ? 5.702   55.498  107.068 1.00 27.47  ? 601 ARG A NH1 1 
ATOM   726   N NH2 . ARG A 1 101 ? 6.623   54.428  105.253 1.00 37.54  ? 601 ARG A NH2 1 
ATOM   727   N N   . HIS A 1 102 ? 11.226  59.577  108.465 1.00 24.57  ? 602 HIS A N   1 
ATOM   728   C CA  . HIS A 1 102 ? 12.551  59.116  108.104 1.00 22.09  ? 602 HIS A CA  1 
ATOM   729   C C   . HIS A 1 102 ? 13.354  58.765  109.363 1.00 28.02  ? 602 HIS A C   1 
ATOM   730   O O   . HIS A 1 102 ? 13.886  57.656  109.481 1.00 35.00  ? 602 HIS A O   1 
ATOM   731   C CB  . HIS A 1 102 ? 13.258  60.189  107.250 1.00 21.58  ? 602 HIS A CB  1 
ATOM   732   C CG  . HIS A 1 102 ? 14.522  59.721  106.593 1.00 27.07  ? 602 HIS A CG  1 
ATOM   733   N ND1 . HIS A 1 102 ? 15.726  59.644  107.261 1.00 17.53  ? 602 HIS A ND1 1 
ATOM   734   C CD2 . HIS A 1 102 ? 14.765  59.305  105.324 1.00 28.55  ? 602 HIS A CD2 1 
ATOM   735   C CE1 . HIS A 1 102 ? 16.657  59.206  106.428 1.00 25.71  ? 602 HIS A CE1 1 
ATOM   736   N NE2 . HIS A 1 102 ? 16.101  58.992  105.248 1.00 19.59  ? 602 HIS A NE2 1 
ATOM   737   N N   . ASN A 1 103 ? 13.427  59.702  110.304 1.00 25.32  ? 603 ASN A N   1 
ATOM   738   C CA  . ASN A 1 103 ? 14.110  59.482  111.579 1.00 28.07  ? 603 ASN A CA  1 
ATOM   739   C C   . ASN A 1 103 ? 13.555  58.294  112.337 1.00 27.64  ? 603 ASN A C   1 
ATOM   740   O O   . ASN A 1 103 ? 14.304  57.484  112.877 1.00 24.14  ? 603 ASN A O   1 
ATOM   741   C CB  . ASN A 1 103 ? 13.953  60.696  112.494 1.00 32.74  ? 603 ASN A CB  1 
ATOM   742   C CG  . ASN A 1 103 ? 14.785  61.862  112.061 1.00 38.00  ? 603 ASN A CG  1 
ATOM   743   O OD1 . ASN A 1 103 ? 15.909  61.696  111.586 1.00 45.40  ? 603 ASN A OD1 1 
ATOM   744   N ND2 . ASN A 1 103 ? 14.245  63.064  112.232 1.00 28.55  ? 603 ASN A ND2 1 
ATOM   745   N N   . THR A 1 104 ? 12.230  58.225  112.415 1.00 23.71  ? 604 THR A N   1 
ATOM   746   C CA  . THR A 1 104 ? 11.578  57.156  113.155 1.00 28.96  ? 604 THR A CA  1 
ATOM   747   C C   . THR A 1 104 ? 11.870  55.792  112.502 1.00 33.96  ? 604 THR A C   1 
ATOM   748   O O   . THR A 1 104 ? 12.131  54.799  113.188 1.00 23.95  ? 604 THR A O   1 
ATOM   749   C CB  . THR A 1 104 ? 10.070  57.427  113.272 1.00 28.29  ? 604 THR A CB  1 
ATOM   750   O OG1 . THR A 1 104 ? 9.868   58.526  114.165 1.00 33.79  ? 604 THR A OG1 1 
ATOM   751   C CG2 . THR A 1 104 ? 9.319   56.218  113.813 1.00 21.95  ? 604 THR A CG2 1 
ATOM   752   N N   . MET A 1 105 ? 11.847  55.767  111.172 1.00 30.50  ? 605 MET A N   1 
ATOM   753   C CA  . MET A 1 105 ? 12.135  54.561  110.422 1.00 25.24  ? 605 MET A CA  1 
ATOM   754   C C   . MET A 1 105 ? 13.594  54.122  110.616 1.00 33.10  ? 605 MET A C   1 
ATOM   755   O O   . MET A 1 105 ? 13.862  52.955  110.911 1.00 31.20  ? 605 MET A O   1 
ATOM   756   C CB  . MET A 1 105 ? 11.797  54.751  108.937 1.00 22.32  ? 605 MET A CB  1 
ATOM   757   C CG  . MET A 1 105 ? 12.055  53.523  108.084 1.00 26.25  ? 605 MET A CG  1 
ATOM   758   S SD  . MET A 1 105 ? 11.482  53.713  106.390 1.00 43.26  ? 605 MET A SD  1 
ATOM   759   C CE  . MET A 1 105 ? 9.932   54.570  106.677 1.00 67.69  ? 605 MET A CE  1 
ATOM   760   N N   . ALA A 1 106 ? 14.537  55.048  110.479 1.00 28.07  ? 606 ALA A N   1 
ATOM   761   C CA  . ALA A 1 106 ? 15.930  54.685  110.705 1.00 15.75  ? 606 ALA A CA  1 
ATOM   762   C C   . ALA A 1 106 ? 16.128  54.151  112.120 1.00 31.56  ? 606 ALA A C   1 
ATOM   763   O O   . ALA A 1 106 ? 16.819  53.146  112.331 1.00 32.56  ? 606 ALA A O   1 
ATOM   764   C CB  . ALA A 1 106 ? 16.827  55.843  110.462 1.00 18.32  ? 606 ALA A CB  1 
ATOM   765   N N   . ILE A 1 107 ? 15.521  54.816  113.097 1.00 30.07  ? 607 ILE A N   1 
ATOM   766   C CA  . ILE A 1 107 ? 15.627  54.340  114.466 1.00 29.23  ? 607 ILE A CA  1 
ATOM   767   C C   . ILE A 1 107 ? 15.080  52.907  114.619 1.00 35.00  ? 607 ILE A C   1 
ATOM   768   O O   . ILE A 1 107 ? 15.705  52.078  115.272 1.00 34.75  ? 607 ILE A O   1 
ATOM   769   C CB  . ILE A 1 107 ? 14.942  55.279  115.459 1.00 27.43  ? 607 ILE A CB  1 
ATOM   770   C CG1 . ILE A 1 107 ? 15.566  56.676  115.389 1.00 26.44  ? 607 ILE A CG1 1 
ATOM   771   C CG2 . ILE A 1 107 ? 15.078  54.742  116.853 1.00 27.40  ? 607 ILE A CG2 1 
ATOM   772   C CD1 . ILE A 1 107 ? 14.795  57.719  116.205 1.00 25.40  ? 607 ILE A CD1 1 
ATOM   773   N N   . GLY A 1 108 ? 13.937  52.613  114.002 1.00 26.15  ? 608 GLY A N   1 
ATOM   774   C CA  . GLY A 1 108 ? 13.338  51.292  114.109 1.00 24.06  ? 608 GLY A CA  1 
ATOM   775   C C   . GLY A 1 108 ? 14.202  50.177  113.530 1.00 27.72  ? 608 GLY A C   1 
ATOM   776   O O   . GLY A 1 108 ? 14.317  49.095  114.107 1.00 26.94  ? 608 GLY A O   1 
ATOM   777   N N   . ILE A 1 109 ? 14.815  50.447  112.385 1.00 27.05  ? 609 ILE A N   1 
ATOM   778   C CA  . ILE A 1 109 ? 15.743  49.508  111.783 1.00 28.70  ? 609 ILE A CA  1 
ATOM   779   C C   . ILE A 1 109 ? 16.845  49.147  112.779 1.00 25.89  ? 609 ILE A C   1 
ATOM   780   O O   . ILE A 1 109 ? 17.042  47.984  113.089 1.00 34.29  ? 609 ILE A O   1 
ATOM   781   C CB  . ILE A 1 109 ? 16.363  50.065  110.478 1.00 29.66  ? 609 ILE A CB  1 
ATOM   782   C CG1 . ILE A 1 109 ? 15.274  50.436  109.462 1.00 31.15  ? 609 ILE A CG1 1 
ATOM   783   C CG2 . ILE A 1 109 ? 17.299  49.043  109.864 1.00 22.73  ? 609 ILE A CG2 1 
ATOM   784   C CD1 . ILE A 1 109 ? 14.372  49.257  109.075 1.00 30.67  ? 609 ILE A CD1 1 
ATOM   785   N N   . ALA A 1 110 ? 17.554  50.153  113.274 1.00 25.18  ? 610 ALA A N   1 
ATOM   786   C CA  . ALA A 1 110 ? 18.566  49.958  114.304 1.00 32.38  ? 610 ALA A CA  1 
ATOM   787   C C   . ALA A 1 110 ? 18.051  49.129  115.489 1.00 40.49  ? 610 ALA A C   1 
ATOM   788   O O   . ALA A 1 110 ? 18.751  48.256  116.006 1.00 44.10  ? 610 ALA A O   1 
ATOM   789   C CB  . ALA A 1 110 ? 19.077  51.304  114.796 1.00 27.73  ? 610 ALA A CB  1 
ATOM   790   N N   . VAL A 1 111 ? 16.834  49.409  115.933 1.00 31.48  ? 611 VAL A N   1 
ATOM   791   C CA  . VAL A 1 111 ? 16.313  48.727  117.097 1.00 38.14  ? 611 VAL A CA  1 
ATOM   792   C C   . VAL A 1 111 ? 16.027  47.285  116.717 1.00 44.74  ? 611 VAL A C   1 
ATOM   793   O O   . VAL A 1 111 ? 15.960  46.395  117.563 1.00 33.65  ? 611 VAL A O   1 
ATOM   794   C CB  . VAL A 1 111 ? 15.049  49.414  117.616 1.00 35.34  ? 611 VAL A CB  1 
ATOM   795   C CG1 . VAL A 1 111 ? 14.178  48.436  118.399 1.00 25.81  ? 611 VAL A CG1 1 
ATOM   796   C CG2 . VAL A 1 111 ? 15.435  50.614  118.462 1.00 37.11  ? 611 VAL A CG2 1 
ATOM   797   N N   . ASP A 1 112 ? 15.872  47.063  115.421 1.00 46.80  ? 612 ASP A N   1 
ATOM   798   C CA  . ASP A 1 112 ? 15.542  45.747  114.930 1.00 37.44  ? 612 ASP A CA  1 
ATOM   799   C C   . ASP A 1 112 ? 16.778  44.853  114.927 1.00 39.82  ? 612 ASP A C   1 
ATOM   800   O O   . ASP A 1 112 ? 16.691  43.640  115.136 1.00 40.43  ? 612 ASP A O   1 
ATOM   801   C CB  . ASP A 1 112 ? 14.929  45.836  113.540 1.00 44.00  ? 612 ASP A CB  1 
ATOM   802   C CG  . ASP A 1 112 ? 14.577  44.480  112.989 1.00 59.19  ? 612 ASP A CG  1 
ATOM   803   O OD1 . ASP A 1 112 ? 14.225  43.591  113.795 1.00 69.50  ? 612 ASP A OD1 1 
ATOM   804   O OD2 . ASP A 1 112 ? 14.665  44.292  111.761 1.00 64.26  ? 612 ASP A OD2 1 
ATOM   805   N N   . ILE A 1 113 ? 17.932  45.455  114.690 1.00 34.52  ? 613 ILE A N   1 
ATOM   806   C CA  . ILE A 1 113 ? 19.180  44.719  114.777 1.00 32.44  ? 613 ILE A CA  1 
ATOM   807   C C   . ILE A 1 113 ? 19.617  44.563  116.217 1.00 33.79  ? 613 ILE A C   1 
ATOM   808   O O   . ILE A 1 113 ? 20.033  43.501  116.615 1.00 37.20  ? 613 ILE A O   1 
ATOM   809   C CB  . ILE A 1 113 ? 20.302  45.426  114.024 1.00 27.48  ? 613 ILE A CB  1 
ATOM   810   C CG1 . ILE A 1 113 ? 19.926  45.564  112.545 1.00 32.22  ? 613 ILE A CG1 1 
ATOM   811   C CG2 . ILE A 1 113 ? 21.606  44.653  114.196 1.00 24.95  ? 613 ILE A CG2 1 
ATOM   812   C CD1 . ILE A 1 113 ? 20.766  46.570  111.780 1.00 32.83  ? 613 ILE A CD1 1 
ATOM   813   N N   . LEU A 1 114 ? 19.518  45.634  116.996 1.00 40.84  ? 614 LEU A N   1 
ATOM   814   C CA  . LEU A 1 114 ? 20.124  45.685  118.324 1.00 33.85  ? 614 LEU A CA  1 
ATOM   815   C C   . LEU A 1 114 ? 19.223  45.189  119.451 1.00 39.42  ? 614 LEU A C   1 
ATOM   816   O O   . LEU A 1 114 ? 19.686  44.966  120.562 1.00 45.44  ? 614 LEU A O   1 
ATOM   817   C CB  . LEU A 1 114 ? 20.573  47.117  118.636 1.00 30.82  ? 614 LEU A CB  1 
ATOM   818   C CG  . LEU A 1 114 ? 21.936  47.609  118.137 1.00 31.93  ? 614 LEU A CG  1 
ATOM   819   C CD1 . LEU A 1 114 ? 22.003  49.130  118.156 1.00 31.31  ? 614 LEU A CD1 1 
ATOM   820   C CD2 . LEU A 1 114 ? 23.039  47.039  118.984 1.00 32.59  ? 614 LEU A CD2 1 
ATOM   821   N N   . GLY A 1 115 ? 17.936  45.033  119.182 1.00 46.38  ? 615 GLY A N   1 
ATOM   822   C CA  . GLY A 1 115 ? 17.008  44.687  120.241 1.00 54.63  ? 615 GLY A CA  1 
ATOM   823   C C   . GLY A 1 115 ? 16.191  43.443  119.958 1.00 68.78  ? 615 GLY A C   1 
ATOM   824   O O   . GLY A 1 115 ? 15.923  42.639  120.853 1.00 67.94  ? 615 GLY A O   1 
ATOM   825   N N   . CYS A 1 116 ? 15.796  43.286  118.701 1.00 81.30  ? 616 CYS A N   1 
ATOM   826   C CA  . CYS A 1 116 ? 14.895  42.211  118.308 1.00 91.30  ? 616 CYS A CA  1 
ATOM   827   C C   . CYS A 1 116 ? 15.657  40.939  117.949 1.00 92.39  ? 616 CYS A C   1 
ATOM   828   O O   . CYS A 1 116 ? 15.129  40.056  117.266 1.00 91.68  ? 616 CYS A O   1 
ATOM   829   C CB  . CYS A 1 116 ? 14.020  42.657  117.131 1.00 96.18  ? 616 CYS A CB  1 
ATOM   830   S SG  . CYS A 1 116 ? 13.026  44.145  117.444 1.00 118.51 ? 616 CYS A SG  1 
ATOM   831   N N   . THR A 1 117 ? 16.897  40.848  118.415 1.00 91.30  ? 617 THR A N   1 
ATOM   832   C CA  . THR A 1 117 ? 17.708  39.672  118.142 1.00 88.52  ? 617 THR A CA  1 
ATOM   833   C C   . THR A 1 117 ? 18.320  39.040  119.396 1.00 94.15  ? 617 THR A C   1 
ATOM   834   O O   . THR A 1 117 ? 18.544  39.710  120.413 1.00 87.08  ? 617 THR A O   1 
ATOM   835   C CB  . THR A 1 117 ? 18.811  39.986  117.135 1.00 75.61  ? 617 THR A CB  1 
ATOM   836   O OG1 . THR A 1 117 ? 19.471  41.188  117.538 1.00 80.22  ? 617 THR A OG1 1 
ATOM   837   C CG2 . THR A 1 117 ? 18.216  40.179  115.757 1.00 63.74  ? 617 THR A CG2 1 
ATOM   838   N N   . GLY A 1 118 ? 18.574  37.736  119.296 1.00 96.19  ? 618 GLY A N   1 
ATOM   839   C CA  . GLY A 1 118 ? 19.198  36.966  120.353 1.00 91.71  ? 618 GLY A CA  1 
ATOM   840   C C   . GLY A 1 118 ? 20.661  36.696  120.058 1.00 84.96  ? 618 GLY A C   1 
ATOM   841   O O   . GLY A 1 118 ? 21.537  37.369  120.602 1.00 97.45  ? 618 GLY A O   1 
ATOM   842   N N   . THR A 1 119 ? 20.933  35.727  119.187 1.00 63.58  ? 619 THR A N   1 
ATOM   843   C CA  . THR A 1 119 ? 22.314  35.324  118.908 1.00 57.43  ? 619 THR A CA  1 
ATOM   844   C C   . THR A 1 119 ? 23.030  36.186  117.856 1.00 59.56  ? 619 THR A C   1 
ATOM   845   O O   . THR A 1 119 ? 22.408  36.994  117.164 1.00 63.98  ? 619 THR A O   1 
ATOM   846   C CB  . THR A 1 119 ? 22.398  33.855  118.467 1.00 51.33  ? 619 THR A CB  1 
ATOM   847   O OG1 . THR A 1 119 ? 21.809  33.709  117.173 1.00 53.10  ? 619 THR A OG1 1 
ATOM   848   C CG2 . THR A 1 119 ? 21.669  32.962  119.446 1.00 50.16  ? 619 THR A CG2 1 
ATOM   849   N N   . LEU A 1 120 ? 24.345  36.003  117.759 1.00 48.46  ? 620 LEU A N   1 
ATOM   850   C CA  . LEU A 1 120 ? 25.161  36.648  116.743 1.00 43.10  ? 620 LEU A CA  1 
ATOM   851   C C   . LEU A 1 120 ? 24.666  36.289  115.344 1.00 43.38  ? 620 LEU A C   1 
ATOM   852   O O   . LEU A 1 120 ? 24.528  37.162  114.475 1.00 38.20  ? 620 LEU A O   1 
ATOM   853   C CB  . LEU A 1 120 ? 26.618  36.206  116.876 1.00 37.35  ? 620 LEU A CB  1 
ATOM   854   C CG  . LEU A 1 120 ? 27.557  36.787  115.814 1.00 43.42  ? 620 LEU A CG  1 
ATOM   855   C CD1 . LEU A 1 120 ? 27.751  38.283  116.018 1.00 38.10  ? 620 LEU A CD1 1 
ATOM   856   C CD2 . LEU A 1 120 ? 28.901  36.085  115.809 1.00 47.56  ? 620 LEU A CD2 1 
ATOM   857   N N   . GLU A 1 121 ? 24.415  35.000  115.125 1.00 33.35  ? 621 GLU A N   1 
ATOM   858   C CA  . GLU A 1 121 ? 23.921  34.523  113.835 1.00 37.82  ? 621 GLU A CA  1 
ATOM   859   C C   . GLU A 1 121 ? 22.561  35.140  113.473 1.00 43.44  ? 621 GLU A C   1 
ATOM   860   O O   . GLU A 1 121 ? 22.305  35.467  112.312 1.00 45.08  ? 621 GLU A O   1 
ATOM   861   C CB  . GLU A 1 121 ? 23.851  32.993  113.810 1.00 51.07  ? 621 GLU A CB  1 
ATOM   862   C CG  . GLU A 1 121 ? 25.220  32.290  113.897 1.00 66.30  ? 621 GLU A CG  1 
ATOM   863   C CD  . GLU A 1 121 ? 25.896  32.413  115.272 1.00 76.39  ? 621 GLU A CD  1 
ATOM   864   O OE1 . GLU A 1 121 ? 25.188  32.595  116.291 1.00 82.73  ? 621 GLU A OE1 1 
ATOM   865   O OE2 . GLU A 1 121 ? 27.144  32.326  115.331 1.00 71.32  ? 621 GLU A OE2 1 
ATOM   866   N N   . ASP A 1 122 ? 21.700  35.308  114.474 1.00 38.58  ? 622 ASP A N   1 
ATOM   867   C CA  . ASP A 1 122 ? 20.408  35.953  114.285 1.00 46.21  ? 622 ASP A CA  1 
ATOM   868   C C   . ASP A 1 122 ? 20.604  37.436  113.906 1.00 41.99  ? 622 ASP A C   1 
ATOM   869   O O   . ASP A 1 122 ? 19.898  37.986  113.065 1.00 36.33  ? 622 ASP A O   1 
ATOM   870   C CB  . ASP A 1 122 ? 19.573  35.820  115.568 1.00 65.76  ? 622 ASP A CB  1 
ATOM   871   C CG  . ASP A 1 122 ? 18.082  36.034  115.331 1.00 85.52  ? 622 ASP A CG  1 
ATOM   872   O OD1 . ASP A 1 122 ? 17.555  35.483  114.340 1.00 93.96  ? 622 ASP A OD1 1 
ATOM   873   O OD2 . ASP A 1 122 ? 17.435  36.748  116.134 1.00 90.15  ? 622 ASP A OD2 1 
ATOM   874   N N   . ARG A 1 123 ? 21.576  38.082  114.530 1.00 38.62  ? 623 ARG A N   1 
ATOM   875   C CA  . ARG A 1 123 ? 21.843  39.474  114.241 1.00 34.73  ? 623 ARG A CA  1 
ATOM   876   C C   . ARG A 1 123 ? 22.321  39.626  112.794 1.00 39.67  ? 623 ARG A C   1 
ATOM   877   O O   . ARG A 1 123 ? 21.796  40.445  112.025 1.00 38.06  ? 623 ARG A O   1 
ATOM   878   C CB  . ARG A 1 123 ? 22.869  40.009  115.234 1.00 26.69  ? 623 ARG A CB  1 
ATOM   879   C CG  . ARG A 1 123 ? 22.499  41.336  115.819 1.00 37.58  ? 623 ARG A CG  1 
ATOM   880   C CD  . ARG A 1 123 ? 23.106  41.550  117.196 1.00 38.95  ? 623 ARG A CD  1 
ATOM   881   N NE  . ARG A 1 123 ? 24.534  41.269  117.237 1.00 39.88  ? 623 ARG A NE  1 
ATOM   882   C CZ  . ARG A 1 123 ? 25.093  40.438  118.110 1.00 44.85  ? 623 ARG A CZ  1 
ATOM   883   N NH1 . ARG A 1 123 ? 24.338  39.816  119.009 1.00 45.82  ? 623 ARG A NH1 1 
ATOM   884   N NH2 . ARG A 1 123 ? 26.401  40.230  118.085 1.00 42.39  ? 623 ARG A NH2 1 
ATOM   885   N N   . ALA A 1 124 ? 23.305  38.815  112.425 1.00 35.76  ? 624 ALA A N   1 
ATOM   886   C CA  . ALA A 1 124 ? 23.849  38.829  111.072 1.00 32.80  ? 624 ALA A CA  1 
ATOM   887   C C   . ALA A 1 124 ? 22.797  38.523  109.989 1.00 35.76  ? 624 ALA A C   1 
ATOM   888   O O   . ALA A 1 124 ? 22.776  39.178  108.941 1.00 36.48  ? 624 ALA A O   1 
ATOM   889   C CB  . ALA A 1 124 ? 25.022  37.858  110.970 1.00 25.09  ? 624 ALA A CB  1 
ATOM   890   N N   . ALA A 1 125 ? 21.945  37.523  110.233 1.00 19.86  ? 625 ALA A N   1 
ATOM   891   C CA  . ALA A 1 125 ? 20.840  37.212  109.318 1.00 24.89  ? 625 ALA A CA  1 
ATOM   892   C C   . ALA A 1 125 ? 19.909  38.409  109.137 1.00 32.80  ? 625 ALA A C   1 
ATOM   893   O O   . ALA A 1 125 ? 19.376  38.648  108.047 1.00 35.22  ? 625 ALA A O   1 
ATOM   894   C CB  . ALA A 1 125 ? 20.031  36.012  109.824 1.00 10.52  ? 625 ALA A CB  1 
ATOM   895   N N   . THR A 1 126 ? 19.697  39.129  110.232 1.00 26.29  ? 626 THR A N   1 
ATOM   896   C CA  . THR A 1 126 ? 18.839  40.299  110.246 1.00 34.21  ? 626 THR A CA  1 
ATOM   897   C C   . THR A 1 126 ? 19.462  41.381  109.385 1.00 33.69  ? 626 THR A C   1 
ATOM   898   O O   . THR A 1 126 ? 18.783  42.055  108.615 1.00 31.80  ? 626 THR A O   1 
ATOM   899   C CB  . THR A 1 126 ? 18.676  40.834  111.683 1.00 30.15  ? 626 THR A CB  1 
ATOM   900   O OG1 . THR A 1 126 ? 17.935  39.884  112.456 1.00 29.51  ? 626 THR A OG1 1 
ATOM   901   C CG2 . THR A 1 126 ? 17.951  42.178  111.690 1.00 20.87  ? 626 THR A CG2 1 
ATOM   902   N N   . LEU A 1 127 ? 20.771  41.520  109.525 1.00 26.81  ? 627 LEU A N   1 
ATOM   903   C CA  . LEU A 1 127 ? 21.533  42.525  108.811 1.00 28.04  ? 627 LEU A CA  1 
ATOM   904   C C   . LEU A 1 127 ? 21.463  42.251  107.309 1.00 33.71  ? 627 LEU A C   1 
ATOM   905   O O   . LEU A 1 127 ? 21.320  43.168  106.501 1.00 38.92  ? 627 LEU A O   1 
ATOM   906   C CB  . LEU A 1 127 ? 22.973  42.478  109.303 1.00 26.93  ? 627 LEU A CB  1 
ATOM   907   C CG  . LEU A 1 127 ? 23.844  43.705  109.172 1.00 31.25  ? 627 LEU A CG  1 
ATOM   908   C CD1 . LEU A 1 127 ? 23.226  44.845  109.945 1.00 32.41  ? 627 LEU A CD1 1 
ATOM   909   C CD2 . LEU A 1 127 ? 25.222  43.376  109.712 1.00 29.77  ? 627 LEU A CD2 1 
ATOM   910   N N   . SER A 1 128 ? 21.547  40.981  106.938 1.00 29.12  ? 628 SER A N   1 
ATOM   911   C CA  . SER A 1 128 ? 21.453  40.604  105.538 1.00 24.65  ? 628 SER A CA  1 
ATOM   912   C C   . SER A 1 128 ? 20.054  40.905  105.004 1.00 28.57  ? 628 SER A C   1 
ATOM   913   O O   . SER A 1 128 ? 19.902  41.459  103.920 1.00 26.82  ? 628 SER A O   1 
ATOM   914   C CB  . SER A 1 128 ? 21.782  39.120  105.362 1.00 25.12  ? 628 SER A CB  1 
ATOM   915   O OG  . SER A 1 128 ? 21.733  38.743  103.997 1.00 33.58  ? 628 SER A OG  1 
ATOM   916   N N   . LYS A 1 129 ? 19.031  40.524  105.761 1.00 29.22  ? 629 LYS A N   1 
ATOM   917   C CA  . LYS A 1 129 ? 17.652  40.768  105.358 1.00 23.51  ? 629 LYS A CA  1 
ATOM   918   C C   . LYS A 1 129 ? 17.420  42.274  105.120 1.00 29.01  ? 629 LYS A C   1 
ATOM   919   O O   . LYS A 1 129 ? 16.749  42.678  104.156 1.00 21.50  ? 629 LYS A O   1 
ATOM   920   C CB  . LYS A 1 129 ? 16.705  40.243  106.431 1.00 18.52  ? 629 LYS A CB  1 
ATOM   921   C CG  . LYS A 1 129 ? 15.228  40.383  106.108 1.00 25.83  ? 629 LYS A CG  1 
ATOM   922   C CD  . LYS A 1 129 ? 14.888  39.748  104.777 1.00 37.23  ? 629 LYS A CD  1 
ATOM   923   C CE  . LYS A 1 129 ? 13.526  39.083  104.812 1.00 45.10  ? 629 LYS A CE  1 
ATOM   924   N NZ  . LYS A 1 129 ? 13.496  37.898  105.707 1.00 44.52  ? 629 LYS A NZ  1 
ATOM   925   N N   . ILE A 1 130 ? 17.988  43.097  106.000 1.00 19.63  ? 630 ILE A N   1 
ATOM   926   C CA  . ILE A 1 130 ? 17.909  44.555  105.872 1.00 17.39  ? 630 ILE A CA  1 
ATOM   927   C C   . ILE A 1 130 ? 18.560  45.042  104.567 1.00 17.90  ? 630 ILE A C   1 
ATOM   928   O O   . ILE A 1 130 ? 17.965  45.815  103.837 1.00 22.44  ? 630 ILE A O   1 
ATOM   929   C CB  . ILE A 1 130 ? 18.498  45.261  107.105 1.00 17.97  ? 630 ILE A CB  1 
ATOM   930   C CG1 . ILE A 1 130 ? 17.602  44.997  108.323 1.00 21.61  ? 630 ILE A CG1 1 
ATOM   931   C CG2 . ILE A 1 130 ? 18.708  46.785  106.841 1.00 20.49  ? 630 ILE A CG2 1 
ATOM   932   C CD1 . ILE A 1 130 ? 18.248  45.351  109.659 1.00 21.05  ? 630 ILE A CD1 1 
ATOM   933   N N   . ILE A 1 131 ? 19.756  44.557  104.254 1.00 21.18  ? 631 ILE A N   1 
ATOM   934   C CA  . ILE A 1 131 ? 20.378  44.891  102.974 1.00 23.67  ? 631 ILE A CA  1 
ATOM   935   C C   . ILE A 1 131 ? 19.579  44.416  101.746 1.00 21.15  ? 631 ILE A C   1 
ATOM   936   O O   . ILE A 1 131 ? 19.561  45.068  100.704 1.00 28.21  ? 631 ILE A O   1 
ATOM   937   C CB  . ILE A 1 131 ? 21.812  44.357  102.890 1.00 25.45  ? 631 ILE A CB  1 
ATOM   938   C CG1 . ILE A 1 131 ? 22.642  44.882  104.073 1.00 22.63  ? 631 ILE A CG1 1 
ATOM   939   C CG2 . ILE A 1 131 ? 22.432  44.719  101.527 1.00 19.32  ? 631 ILE A CG2 1 
ATOM   940   C CD1 . ILE A 1 131 ? 24.083  44.405  104.087 1.00 16.71  ? 631 ILE A CD1 1 
ATOM   941   N N   . GLN A 1 132 ? 18.918  43.276  101.862 1.00 22.50  ? 632 GLN A N   1 
ATOM   942   C CA  . GLN A 1 132 ? 18.125  42.782  100.751 1.00 24.43  ? 632 GLN A CA  1 
ATOM   943   C C   . GLN A 1 132 ? 16.924  43.686  100.557 1.00 22.32  ? 632 GLN A C   1 
ATOM   944   O O   . GLN A 1 132 ? 16.545  44.002  99.428  1.00 26.55  ? 632 GLN A O   1 
ATOM   945   C CB  . GLN A 1 132 ? 17.685  41.338  100.986 1.00 22.42  ? 632 GLN A CB  1 
ATOM   946   C CG  . GLN A 1 132 ? 18.845  40.380  101.096 1.00 28.06  ? 632 GLN A CG  1 
ATOM   947   C CD  . GLN A 1 132 ? 18.383  38.957  101.213 1.00 26.62  ? 632 GLN A CD  1 
ATOM   948   O OE1 . GLN A 1 132 ? 17.676  38.595  102.147 1.00 28.29  ? 632 GLN A OE1 1 
ATOM   949   N NE2 . GLN A 1 132 ? 18.760  38.142  100.249 1.00 36.81  ? 632 GLN A NE2 1 
ATOM   950   N N   . VAL A 1 133 ? 16.328  44.106  101.668 1.00 16.01  ? 633 VAL A N   1 
ATOM   951   C CA  . VAL A 1 133 ? 15.230  45.042  101.599 1.00 14.07  ? 633 VAL A CA  1 
ATOM   952   C C   . VAL A 1 133 ? 15.688  46.358  100.952 1.00 23.04  ? 633 VAL A C   1 
ATOM   953   O O   . VAL A 1 133 ? 14.973  46.941  100.144 1.00 21.81  ? 633 VAL A O   1 
ATOM   954   C CB  . VAL A 1 133 ? 14.576  45.270  102.983 1.00 16.59  ? 633 VAL A CB  1 
ATOM   955   C CG1 . VAL A 1 133 ? 13.509  46.346  102.878 1.00 8.37   ? 633 VAL A CG1 1 
ATOM   956   C CG2 . VAL A 1 133 ? 13.926  43.981  103.465 1.00 20.17  ? 633 VAL A CG2 1 
ATOM   957   N N   . ALA A 1 134 ? 16.902  46.796  101.276 1.00 20.03  ? 634 ALA A N   1 
ATOM   958   C CA  . ALA A 1 134 ? 17.410  48.053  100.747 1.00 16.71  ? 634 ALA A CA  1 
ATOM   959   C C   . ALA A 1 134 ? 17.621  47.928  99.253  1.00 19.93  ? 634 ALA A C   1 
ATOM   960   O O   . ALA A 1 134 ? 17.333  48.854  98.504  1.00 20.22  ? 634 ALA A O   1 
ATOM   961   C CB  . ALA A 1 134 ? 18.698  48.442  101.435 1.00 13.45  ? 634 ALA A CB  1 
ATOM   962   N N   . VAL A 1 135 ? 18.138  46.777  98.831  1.00 22.88  ? 635 VAL A N   1 
ATOM   963   C CA  . VAL A 1 135 ? 18.310  46.484  97.416  1.00 6.15   ? 635 VAL A CA  1 
ATOM   964   C C   . VAL A 1 135 ? 16.951  46.526  96.690  1.00 25.45  ? 635 VAL A C   1 
ATOM   965   O O   . VAL A 1 135 ? 16.858  47.057  95.577  1.00 23.47  ? 635 VAL A O   1 
ATOM   966   C CB  . VAL A 1 135 ? 18.984  45.112  97.210  1.00 14.23  ? 635 VAL A CB  1 
ATOM   967   C CG1 . VAL A 1 135 ? 18.791  44.611  95.757  1.00 11.23  ? 635 VAL A CG1 1 
ATOM   968   C CG2 . VAL A 1 135 ? 20.477  45.168  97.595  1.00 13.24  ? 635 VAL A CG2 1 
ATOM   969   N N   . GLU A 1 136 ? 15.900  45.982  97.317  1.00 25.43  ? 636 GLU A N   1 
ATOM   970   C CA  . GLU A 1 136 ? 14.572  45.991  96.696  1.00 25.22  ? 636 GLU A CA  1 
ATOM   971   C C   . GLU A 1 136 ? 14.037  47.427  96.571  1.00 22.23  ? 636 GLU A C   1 
ATOM   972   O O   . GLU A 1 136 ? 13.521  47.830  95.518  1.00 20.40  ? 636 GLU A O   1 
ATOM   973   C CB  . GLU A 1 136 ? 13.577  45.083  97.442  1.00 21.17  ? 636 GLU A CB  1 
ATOM   974   C CG  . GLU A 1 136 ? 13.701  43.573  97.136  1.00 21.47  ? 636 GLU A CG  1 
ATOM   975   C CD  . GLU A 1 136 ? 13.101  43.167  95.795  1.00 29.89  ? 636 GLU A CD  1 
ATOM   976   O OE1 . GLU A 1 136 ? 12.221  43.899  95.301  1.00 28.27  ? 636 GLU A OE1 1 
ATOM   977   O OE2 . GLU A 1 136 ? 13.500  42.110  95.236  1.00 30.83  ? 636 GLU A OE2 1 
ATOM   978   N N   . LEU A 1 137 ? 14.187  48.200  97.637  1.00 17.36  ? 637 LEU A N   1 
ATOM   979   C CA  . LEU A 1 137 ? 13.798  49.605  97.617  1.00 19.65  ? 637 LEU A CA  1 
ATOM   980   C C   . LEU A 1 137 ? 14.484  50.364  96.477  1.00 20.17  ? 637 LEU A C   1 
ATOM   981   O O   . LEU A 1 137 ? 13.834  51.122  95.740  1.00 18.74  ? 637 LEU A O   1 
ATOM   982   C CB  . LEU A 1 137 ? 14.095  50.256  98.969  1.00 14.40  ? 637 LEU A CB  1 
ATOM   983   C CG  . LEU A 1 137 ? 13.187  49.729  100.081 1.00 18.64  ? 637 LEU A CG  1 
ATOM   984   C CD1 . LEU A 1 137 ? 13.659  50.200  101.464 1.00 9.38   ? 637 LEU A CD1 1 
ATOM   985   C CD2 . LEU A 1 137 ? 11.708  50.080  99.827  1.00 6.36   ? 637 LEU A CD2 1 
ATOM   986   N N   . LYS A 1 138 ? 15.788  50.154  96.320  1.00 21.45  ? 638 LYS A N   1 
ATOM   987   C CA  . LYS A 1 138 ? 16.555  50.843  95.278  1.00 18.16  ? 638 LYS A CA  1 
ATOM   988   C C   . LYS A 1 138 ? 16.187  50.360  93.859  1.00 25.52  ? 638 LYS A C   1 
ATOM   989   O O   . LYS A 1 138 ? 15.622  51.118  93.059  1.00 17.73  ? 638 LYS A O   1 
ATOM   990   C CB  . LYS A 1 138 ? 18.069  50.723  95.547  1.00 16.08  ? 638 LYS A CB  1 
ATOM   991   C CG  . LYS A 1 138 ? 18.973  51.359  94.492  1.00 14.70  ? 638 LYS A CG  1 
ATOM   992   C CD  . LYS A 1 138 ? 20.431  50.968  94.741  1.00 13.42  ? 638 LYS A CD  1 
ATOM   993   C CE  . LYS A 1 138 ? 21.360  51.420  93.612  1.00 16.35  ? 638 LYS A CE  1 
ATOM   994   N NZ  . LYS A 1 138 ? 21.709  50.337  92.646  1.00 24.74  ? 638 LYS A NZ  1 
ATOM   995   N N   . ASP A 1 139 ? 16.464  49.090  93.565  1.00 25.57  ? 639 ASP A N   1 
ATOM   996   C CA  . ASP A 1 139 ? 16.337  48.562  92.199  1.00 16.72  ? 639 ASP A CA  1 
ATOM   997   C C   . ASP A 1 139 ? 14.930  48.128  91.754  1.00 22.24  ? 639 ASP A C   1 
ATOM   998   O O   . ASP A 1 139 ? 14.681  47.950  90.554  1.00 23.53  ? 639 ASP A O   1 
ATOM   999   C CB  . ASP A 1 139 ? 17.336  47.419  91.982  1.00 16.72  ? 639 ASP A CB  1 
ATOM   1000  C CG  . ASP A 1 139 ? 18.770  47.883  92.118  1.00 30.71  ? 639 ASP A CG  1 
ATOM   1001  O OD1 . ASP A 1 139 ? 19.002  49.113  92.025  1.00 36.34  ? 639 ASP A OD1 1 
ATOM   1002  O OD2 . ASP A 1 139 ? 19.664  47.033  92.322  1.00 33.73  ? 639 ASP A OD2 1 
ATOM   1003  N N   . SER A 1 140 ? 13.999  47.961  92.690  1.00 15.67  ? 640 SER A N   1 
ATOM   1004  C CA  . SER A 1 140 ? 12.677  47.493  92.273  1.00 24.25  ? 640 SER A CA  1 
ATOM   1005  C C   . SER A 1 140 ? 11.559  48.498  92.493  1.00 15.99  ? 640 SER A C   1 
ATOM   1006  O O   . SER A 1 140 ? 10.698  48.673  91.632  1.00 16.07  ? 640 SER A O   1 
ATOM   1007  C CB  . SER A 1 140 ? 12.329  46.155  92.937  1.00 21.86  ? 640 SER A CB  1 
ATOM   1008  O OG  . SER A 1 140 ? 13.120  45.132  92.379  1.00 23.04  ? 640 SER A OG  1 
ATOM   1009  N N   . MET A 1 141 ? 11.567  49.118  93.668  1.00 13.86  ? 641 MET A N   1 
ATOM   1010  C CA  . MET A 1 141 ? 10.597  50.141  94.042  1.00 22.03  ? 641 MET A CA  1 
ATOM   1011  C C   . MET A 1 141 ? 11.028  51.540  93.581  1.00 20.83  ? 641 MET A C   1 
ATOM   1012  O O   . MET A 1 141 ? 10.185  52.410  93.389  1.00 19.29  ? 641 MET A O   1 
ATOM   1013  C CB  . MET A 1 141 ? 10.405  50.146  95.568  1.00 28.94  ? 641 MET A CB  1 
ATOM   1014  C CG  . MET A 1 141 ? 10.028  48.791  96.161  1.00 36.57  ? 641 MET A CG  1 
ATOM   1015  S SD  . MET A 1 141 ? 8.483   48.124  95.495  1.00 26.47  ? 641 MET A SD  1 
ATOM   1016  C CE  . MET A 1 141 ? 9.054   46.694  94.592  1.00 30.87  ? 641 MET A CE  1 
ATOM   1017  N N   . GLY A 1 142 ? 12.336  51.754  93.412  1.00 19.48  ? 642 GLY A N   1 
ATOM   1018  C CA  . GLY A 1 142 ? 12.853  53.089  93.172  1.00 19.21  ? 642 GLY A CA  1 
ATOM   1019  C C   . GLY A 1 142 ? 12.394  54.044  94.261  1.00 20.50  ? 642 GLY A C   1 
ATOM   1020  O O   . GLY A 1 142 ? 12.025  55.173  93.976  1.00 29.49  ? 642 GLY A O   1 
ATOM   1021  N N   . ASP A 1 143 ? 12.383  53.568  95.504  1.00 20.22  ? 643 ASP A N   1 
ATOM   1022  C CA  . ASP A 1 143 ? 12.098  54.410  96.668  1.00 21.77  ? 643 ASP A CA  1 
ATOM   1023  C C   . ASP A 1 143 ? 13.424  54.850  97.259  1.00 20.32  ? 643 ASP A C   1 
ATOM   1024  O O   . ASP A 1 143 ? 13.962  54.182  98.151  1.00 28.42  ? 643 ASP A O   1 
ATOM   1025  C CB  . ASP A 1 143 ? 11.296  53.632  97.732  1.00 18.70  ? 643 ASP A CB  1 
ATOM   1026  C CG  . ASP A 1 143 ? 10.731  54.540  98.833  1.00 26.30  ? 643 ASP A CG  1 
ATOM   1027  O OD1 . ASP A 1 143 ? 11.353  55.577  99.164  1.00 21.12  ? 643 ASP A OD1 1 
ATOM   1028  O OD2 . ASP A 1 143 ? 9.655   54.212  99.374  1.00 20.49  ? 643 ASP A OD2 1 
ATOM   1029  N N   . LEU A 1 144 ? 13.973  55.950  96.752  1.00 20.62  ? 644 LEU A N   1 
ATOM   1030  C CA  . LEU A 1 144 ? 15.257  56.447  97.264  1.00 22.72  ? 644 LEU A CA  1 
ATOM   1031  C C   . LEU A 1 144 ? 15.120  56.937  98.719  1.00 25.44  ? 644 LEU A C   1 
ATOM   1032  O O   . LEU A 1 144 ? 16.049  56.816  99.520  1.00 24.76  ? 644 LEU A O   1 
ATOM   1033  C CB  . LEU A 1 144 ? 15.860  57.527  96.350  1.00 15.09  ? 644 LEU A CB  1 
ATOM   1034  C CG  . LEU A 1 144 ? 15.976  57.255  94.833  1.00 16.24  ? 644 LEU A CG  1 
ATOM   1035  C CD1 . LEU A 1 144 ? 16.614  58.431  94.133  1.00 7.86   ? 644 LEU A CD1 1 
ATOM   1036  C CD2 . LEU A 1 144 ? 16.744  55.981  94.496  1.00 12.16  ? 644 LEU A CD2 1 
ATOM   1037  N N   . TYR A 1 145 ? 13.943  57.445  99.072  1.00 21.53  ? 645 TYR A N   1 
ATOM   1038  C CA  . TYR A 1 145 ? 13.701  57.941  100.430 1.00 21.42  ? 645 TYR A CA  1 
ATOM   1039  C C   . TYR A 1 145 ? 13.889  56.876  101.537 1.00 24.34  ? 645 TYR A C   1 
ATOM   1040  O O   . TYR A 1 145 ? 14.753  57.031  102.410 1.00 24.10  ? 645 TYR A O   1 
ATOM   1041  C CB  . TYR A 1 145 ? 12.322  58.605  100.472 1.00 21.46  ? 645 TYR A CB  1 
ATOM   1042  C CG  . TYR A 1 145 ? 11.756  58.994  101.824 1.00 21.36  ? 645 TYR A CG  1 
ATOM   1043  C CD1 . TYR A 1 145 ? 12.326  60.013  102.586 1.00 25.85  ? 645 TYR A CD1 1 
ATOM   1044  C CD2 . TYR A 1 145 ? 10.601  58.389  102.302 1.00 13.77  ? 645 TYR A CD2 1 
ATOM   1045  C CE1 . TYR A 1 145 ? 11.776  60.391  103.814 1.00 30.66  ? 645 TYR A CE1 1 
ATOM   1046  C CE2 . TYR A 1 145 ? 10.038  58.769  103.523 1.00 28.34  ? 645 TYR A CE2 1 
ATOM   1047  C CZ  . TYR A 1 145 ? 10.628  59.768  104.269 1.00 32.05  ? 645 TYR A CZ  1 
ATOM   1048  O OH  . TYR A 1 145 ? 10.075  60.129  105.474 1.00 27.71  ? 645 TYR A OH  1 
ATOM   1049  N N   . SER A 1 146 ? 13.113  55.792  101.501 1.00 19.42  ? 646 SER A N   1 
ATOM   1050  C CA  . SER A 1 146 ? 13.278  54.755  102.525 1.00 24.49  ? 646 SER A CA  1 
ATOM   1051  C C   . SER A 1 146 ? 14.551  53.918  102.328 1.00 23.57  ? 646 SER A C   1 
ATOM   1052  O O   . SER A 1 146 ? 15.150  53.455  103.302 1.00 18.60  ? 646 SER A O   1 
ATOM   1053  C CB  . SER A 1 146 ? 12.043  53.864  102.638 1.00 23.18  ? 646 SER A CB  1 
ATOM   1054  O OG  . SER A 1 146 ? 10.977  54.593  103.201 1.00 25.27  ? 646 SER A OG  1 
ATOM   1055  N N   . PHE A 1 147 ? 14.972  53.736  101.083 1.00 17.22  ? 647 PHE A N   1 
ATOM   1056  C CA  . PHE A 1 147 ? 16.316  53.219  100.850 1.00 25.91  ? 647 PHE A CA  1 
ATOM   1057  C C   . PHE A 1 147 ? 17.343  53.957  101.719 1.00 26.27  ? 647 PHE A C   1 
ATOM   1058  O O   . PHE A 1 147 ? 18.165  53.329  102.379 1.00 25.99  ? 647 PHE A O   1 
ATOM   1059  C CB  . PHE A 1 147 ? 16.719  53.334  99.384  1.00 25.43  ? 647 PHE A CB  1 
ATOM   1060  C CG  . PHE A 1 147 ? 18.188  53.108  99.153  1.00 24.28  ? 647 PHE A CG  1 
ATOM   1061  C CD1 . PHE A 1 147 ? 18.715  51.814  99.147  1.00 21.65  ? 647 PHE A CD1 1 
ATOM   1062  C CD2 . PHE A 1 147 ? 19.052  54.188  98.961  1.00 12.54  ? 647 PHE A CD2 1 
ATOM   1063  C CE1 . PHE A 1 147 ? 20.087  51.595  98.949  1.00 15.38  ? 647 PHE A CE1 1 
ATOM   1064  C CE2 . PHE A 1 147 ? 20.436  53.979  98.762  1.00 6.59   ? 647 PHE A CE2 1 
ATOM   1065  C CZ  . PHE A 1 147 ? 20.945  52.677  98.756  1.00 19.02  ? 647 PHE A CZ  1 
ATOM   1066  N N   . SER A 1 148 ? 17.287  55.287  101.731 1.00 21.05  ? 648 SER A N   1 
ATOM   1067  C CA  . SER A 1 148 ? 18.241  56.067  102.522 1.00 27.22  ? 648 SER A CA  1 
ATOM   1068  C C   . SER A 1 148 ? 18.077  55.884  104.050 1.00 29.05  ? 648 SER A C   1 
ATOM   1069  O O   . SER A 1 148 ? 19.064  55.907  104.789 1.00 25.49  ? 648 SER A O   1 
ATOM   1070  C CB  . SER A 1 148 ? 18.192  57.554  102.142 1.00 19.91  ? 648 SER A CB  1 
ATOM   1071  O OG  . SER A 1 148 ? 16.989  58.159  102.598 1.00 25.77  ? 648 SER A OG  1 
ATOM   1072  N N   . ALA A 1 149 ? 16.847  55.712  104.524 1.00 26.18  ? 649 ALA A N   1 
ATOM   1073  C CA  . ALA A 1 149 ? 16.630  55.502  105.957 1.00 30.49  ? 649 ALA A CA  1 
ATOM   1074  C C   . ALA A 1 149 ? 17.287  54.203  106.437 1.00 34.50  ? 649 ALA A C   1 
ATOM   1075  O O   . ALA A 1 149 ? 17.896  54.174  107.516 1.00 32.12  ? 649 ALA A O   1 
ATOM   1076  C CB  . ALA A 1 149 ? 15.154  55.513  106.298 1.00 30.69  ? 649 ALA A CB  1 
ATOM   1077  N N   . LEU A 1 150 ? 17.171  53.137  105.639 1.00 19.67  ? 650 LEU A N   1 
ATOM   1078  C CA  . LEU A 1 150 ? 17.884  51.883  105.942 1.00 22.77  ? 650 LEU A CA  1 
ATOM   1079  C C   . LEU A 1 150 ? 19.397  52.064  105.901 1.00 26.85  ? 650 LEU A C   1 
ATOM   1080  O O   . LEU A 1 150 ? 20.093  51.582  106.778 1.00 24.22  ? 650 LEU A O   1 
ATOM   1081  C CB  . LEU A 1 150 ? 17.494  50.746  104.990 1.00 18.91  ? 650 LEU A CB  1 
ATOM   1082  C CG  . LEU A 1 150 ? 16.194  50.007  105.288 1.00 22.98  ? 650 LEU A CG  1 
ATOM   1083  C CD1 . LEU A 1 150 ? 14.994  50.975  105.271 1.00 26.18  ? 650 LEU A CD1 1 
ATOM   1084  C CD2 . LEU A 1 150 ? 16.010  48.843  104.306 1.00 19.35  ? 650 LEU A CD2 1 
ATOM   1085  N N   . MET A 1 151 ? 19.904  52.751  104.879 1.00 25.35  ? 651 MET A N   1 
ATOM   1086  C CA  . MET A 1 151 ? 21.340  52.999  104.791 1.00 27.64  ? 651 MET A CA  1 
ATOM   1087  C C   . MET A 1 151 ? 21.839  53.805  105.988 1.00 29.66  ? 651 MET A C   1 
ATOM   1088  O O   . MET A 1 151 ? 22.920  53.552  106.496 1.00 34.44  ? 651 MET A O   1 
ATOM   1089  C CB  . MET A 1 151 ? 21.706  53.696  103.481 1.00 24.36  ? 651 MET A CB  1 
ATOM   1090  C CG  . MET A 1 151 ? 21.427  52.849  102.230 1.00 28.54  ? 651 MET A CG  1 
ATOM   1091  S SD  . MET A 1 151 ? 22.432  51.340  102.104 1.00 27.62  ? 651 MET A SD  1 
ATOM   1092  C CE  . MET A 1 151 ? 24.050  52.037  101.734 1.00 12.21  ? 651 MET A CE  1 
ATOM   1093  N N   . LYS A 1 152 ? 21.049  54.765  106.450 1.00 31.24  ? 652 LYS A N   1 
ATOM   1094  C CA  . LYS A 1 152 ? 21.429  55.532  107.633 1.00 21.52  ? 652 LYS A CA  1 
ATOM   1095  C C   . LYS A 1 152 ? 21.522  54.658  108.895 1.00 27.02  ? 652 LYS A C   1 
ATOM   1096  O O   . LYS A 1 152 ? 22.441  54.816  109.700 1.00 19.50  ? 652 LYS A O   1 
ATOM   1097  C CB  . LYS A 1 152 ? 20.452  56.673  107.887 1.00 16.65  ? 652 LYS A CB  1 
ATOM   1098  C CG  . LYS A 1 152 ? 20.514  57.151  109.334 1.00 29.00  ? 652 LYS A CG  1 
ATOM   1099  C CD  . LYS A 1 152 ? 19.756  58.441  109.580 1.00 31.71  ? 652 LYS A CD  1 
ATOM   1100  C CE  . LYS A 1 152 ? 20.065  58.947  110.978 1.00 43.60  ? 652 LYS A CE  1 
ATOM   1101  N NZ  . LYS A 1 152 ? 19.164  60.062  111.359 1.00 51.42  ? 652 LYS A NZ  1 
ATOM   1102  N N   . ALA A 1 153 ? 20.564  53.750  109.075 1.00 23.13  ? 653 ALA A N   1 
ATOM   1103  C CA  . ALA A 1 153 ? 20.646  52.790  110.173 1.00 29.20  ? 653 ALA A CA  1 
ATOM   1104  C C   . ALA A 1 153 ? 21.967  51.991  110.121 1.00 31.85  ? 653 ALA A C   1 
ATOM   1105  O O   . ALA A 1 153 ? 22.669  51.840  111.132 1.00 30.25  ? 653 ALA A O   1 
ATOM   1106  C CB  . ALA A 1 153 ? 19.426  51.846  110.163 1.00 22.29  ? 653 ALA A CB  1 
ATOM   1107  N N   . LEU A 1 154 ? 22.309  51.499  108.935 1.00 22.15  ? 654 LEU A N   1 
ATOM   1108  C CA  . LEU A 1 154 ? 23.467  50.629  108.781 1.00 31.68  ? 654 LEU A CA  1 
ATOM   1109  C C   . LEU A 1 154 ? 24.788  51.369  109.063 1.00 32.58  ? 654 LEU A C   1 
ATOM   1110  O O   . LEU A 1 154 ? 25.785  50.747  109.432 1.00 39.84  ? 654 LEU A O   1 
ATOM   1111  C CB  . LEU A 1 154 ? 23.456  49.943  107.396 1.00 28.45  ? 654 LEU A CB  1 
ATOM   1112  C CG  . LEU A 1 154 ? 22.236  49.040  107.121 1.00 30.66  ? 654 LEU A CG  1 
ATOM   1113  C CD1 . LEU A 1 154 ? 22.215  48.422  105.711 1.00 19.22  ? 654 LEU A CD1 1 
ATOM   1114  C CD2 . LEU A 1 154 ? 22.126  47.941  108.163 1.00 30.87  ? 654 LEU A CD2 1 
ATOM   1115  N N   . GLU A 1 155 ? 24.780  52.692  108.914 1.00 28.53  ? 655 GLU A N   1 
ATOM   1116  C CA  . GLU A 1 155 ? 25.961  53.518  109.165 1.00 31.22  ? 655 GLU A CA  1 
ATOM   1117  C C   . GLU A 1 155 ? 26.004  54.120  110.574 1.00 31.91  ? 655 GLU A C   1 
ATOM   1118  O O   . GLU A 1 155 ? 26.976  54.782  110.929 1.00 36.07  ? 655 GLU A O   1 
ATOM   1119  C CB  . GLU A 1 155 ? 26.043  54.675  108.169 1.00 31.77  ? 655 GLU A CB  1 
ATOM   1120  C CG  . GLU A 1 155 ? 26.291  54.297  106.735 1.00 48.01  ? 655 GLU A CG  1 
ATOM   1121  C CD  . GLU A 1 155 ? 25.872  55.408  105.778 1.00 65.16  ? 655 GLU A CD  1 
ATOM   1122  O OE1 . GLU A 1 155 ? 25.790  55.157  104.552 1.00 69.08  ? 655 GLU A OE1 1 
ATOM   1123  O OE2 . GLU A 1 155 ? 25.611  56.536  106.256 1.00 70.01  ? 655 GLU A OE2 1 
ATOM   1124  N N   . MET A 1 156 ? 24.954  53.933  111.367 1.00 28.19  ? 656 MET A N   1 
ATOM   1125  C CA  . MET A 1 156 ? 24.989  54.425  112.739 1.00 27.99  ? 656 MET A CA  1 
ATOM   1126  C C   . MET A 1 156 ? 26.200  53.850  113.475 1.00 29.10  ? 656 MET A C   1 
ATOM   1127  O O   . MET A 1 156 ? 26.494  52.660  113.369 1.00 24.66  ? 656 MET A O   1 
ATOM   1128  C CB  . MET A 1 156 ? 23.710  54.065  113.494 1.00 27.59  ? 656 MET A CB  1 
ATOM   1129  C CG  . MET A 1 156 ? 22.471  54.844  113.073 1.00 26.29  ? 656 MET A CG  1 
ATOM   1130  S SD  . MET A 1 156 ? 21.025  54.294  114.007 1.00 41.41  ? 656 MET A SD  1 
ATOM   1131  C CE  . MET A 1 156 ? 19.694  55.048  113.059 1.00 37.09  ? 656 MET A CE  1 
ATOM   1132  N N   . PRO A 1 157 ? 26.901  54.700  114.233 1.00 33.30  ? 657 PRO A N   1 
ATOM   1133  C CA  . PRO A 1 157 ? 28.059  54.280  115.028 1.00 40.89  ? 657 PRO A CA  1 
ATOM   1134  C C   . PRO A 1 157 ? 27.778  53.072  115.923 1.00 34.74  ? 657 PRO A C   1 
ATOM   1135  O O   . PRO A 1 157 ? 28.702  52.296  116.170 1.00 33.14  ? 657 PRO A O   1 
ATOM   1136  C CB  . PRO A 1 157 ? 28.375  55.520  115.877 1.00 40.55  ? 657 PRO A CB  1 
ATOM   1137  C CG  . PRO A 1 157 ? 27.176  56.416  115.740 1.00 37.30  ? 657 PRO A CG  1 
ATOM   1138  C CD  . PRO A 1 157 ? 26.634  56.137  114.380 1.00 28.69  ? 657 PRO A CD  1 
ATOM   1139  N N   . GLN A 1 158 ? 26.538  52.915  116.386 1.00 26.60  ? 658 GLN A N   1 
ATOM   1140  C CA  . GLN A 1 158 ? 26.169  51.779  117.237 1.00 30.94  ? 658 GLN A CA  1 
ATOM   1141  C C   . GLN A 1 158 ? 25.983  50.455  116.473 1.00 42.43  ? 658 GLN A C   1 
ATOM   1142  O O   . GLN A 1 158 ? 25.879  49.394  117.091 1.00 35.69  ? 658 GLN A O   1 
ATOM   1143  C CB  . GLN A 1 158 ? 24.883  52.064  118.014 1.00 25.26  ? 658 GLN A CB  1 
ATOM   1144  C CG  . GLN A 1 158 ? 24.938  53.236  118.968 1.00 31.92  ? 658 GLN A CG  1 
ATOM   1145  C CD  . GLN A 1 158 ? 24.344  54.501  118.362 1.00 40.11  ? 658 GLN A CD  1 
ATOM   1146  O OE1 . GLN A 1 158 ? 23.843  55.365  119.078 1.00 48.60  ? 658 GLN A OE1 1 
ATOM   1147  N NE2 . GLN A 1 158 ? 24.402  54.615  117.038 1.00 34.01  ? 658 GLN A NE2 1 
ATOM   1148  N N   . ILE A 1 159 ? 25.894  50.527  115.145 1.00 42.80  ? 659 ILE A N   1 
ATOM   1149  C CA  . ILE A 1 159 ? 25.729  49.338  114.310 1.00 40.19  ? 659 ILE A CA  1 
ATOM   1150  C C   . ILE A 1 159 ? 27.076  49.043  113.678 1.00 36.50  ? 659 ILE A C   1 
ATOM   1151  O O   . ILE A 1 159 ? 27.534  47.896  113.630 1.00 36.48  ? 659 ILE A O   1 
ATOM   1152  C CB  . ILE A 1 159 ? 24.671  49.566  113.199 1.00 38.94  ? 659 ILE A CB  1 
ATOM   1153  C CG1 . ILE A 1 159 ? 23.274  49.713  113.806 1.00 31.52  ? 659 ILE A CG1 1 
ATOM   1154  C CG2 . ILE A 1 159 ? 24.681  48.431  112.182 1.00 36.55  ? 659 ILE A CG2 1 
ATOM   1155  C CD1 . ILE A 1 159 ? 22.847  48.536  114.629 1.00 35.71  ? 659 ILE A CD1 1 
ATOM   1156  N N   . THR A 1 160 ? 27.714  50.114  113.226 1.00 31.43  ? 660 THR A N   1 
ATOM   1157  C CA  . THR A 1 160 ? 29.021  50.059  112.598 1.00 35.87  ? 660 THR A CA  1 
ATOM   1158  C C   . THR A 1 160 ? 30.095  49.343  113.440 1.00 41.17  ? 660 THR A C   1 
ATOM   1159  O O   . THR A 1 160 ? 30.975  48.657  112.901 1.00 33.06  ? 660 THR A O   1 
ATOM   1160  C CB  . THR A 1 160 ? 29.476  51.486  112.248 1.00 36.53  ? 660 THR A CB  1 
ATOM   1161  O OG1 . THR A 1 160 ? 29.360  51.682  110.832 1.00 42.58  ? 660 THR A OG1 1 
ATOM   1162  C CG2 . THR A 1 160 ? 30.902  51.727  112.683 1.00 35.69  ? 660 THR A CG2 1 
ATOM   1163  N N   . ARG A 1 161 ? 30.022  49.495  114.760 1.00 38.04  ? 661 ARG A N   1 
ATOM   1164  C CA  . ARG A 1 161 ? 31.039  48.921  115.627 1.00 40.90  ? 661 ARG A CA  1 
ATOM   1165  C C   . ARG A 1 161 ? 30.711  47.505  116.082 1.00 43.62  ? 661 ARG A C   1 
ATOM   1166  O O   . ARG A 1 161 ? 31.370  46.979  116.973 1.00 46.70  ? 661 ARG A O   1 
ATOM   1167  C CB  . ARG A 1 161 ? 31.239  49.787  116.866 1.00 44.39  ? 661 ARG A CB  1 
ATOM   1168  C CG  . ARG A 1 161 ? 30.152  49.586  117.902 1.00 41.40  ? 661 ARG A CG  1 
ATOM   1169  C CD  . ARG A 1 161 ? 30.526  50.206  119.230 1.00 40.10  ? 661 ARG A CD  1 
ATOM   1170  N NE  . ARG A 1 161 ? 29.912  49.447  120.308 1.00 51.18  ? 661 ARG A NE  1 
ATOM   1171  C CZ  . ARG A 1 161 ? 30.529  48.499  121.005 1.00 49.11  ? 661 ARG A CZ  1 
ATOM   1172  N NH1 . ARG A 1 161 ? 31.799  48.204  120.764 1.00 43.74  ? 661 ARG A NH1 1 
ATOM   1173  N NH2 . ARG A 1 161 ? 29.875  47.862  121.962 1.00 56.45  ? 661 ARG A NH2 1 
ATOM   1174  N N   . LEU A 1 162 ? 29.685  46.890  115.507 1.00 45.08  ? 662 LEU A N   1 
ATOM   1175  C CA  . LEU A 1 162 ? 29.392  45.500  115.836 1.00 36.39  ? 662 LEU A CA  1 
ATOM   1176  C C   . LEU A 1 162 ? 30.297  44.597  115.005 1.00 42.45  ? 662 LEU A C   1 
ATOM   1177  O O   . LEU A 1 162 ? 29.852  43.959  114.041 1.00 45.10  ? 662 LEU A O   1 
ATOM   1178  C CB  . LEU A 1 162 ? 27.928  45.168  115.576 1.00 32.38  ? 662 LEU A CB  1 
ATOM   1179  C CG  . LEU A 1 162 ? 26.903  45.990  116.333 1.00 29.95  ? 662 LEU A CG  1 
ATOM   1180  C CD1 . LEU A 1 162 ? 25.534  45.637  115.823 1.00 25.57  ? 662 LEU A CD1 1 
ATOM   1181  C CD2 . LEU A 1 162 ? 27.025  45.703  117.801 1.00 27.90  ? 662 LEU A CD2 1 
ATOM   1182  N N   . GLU A 1 163 ? 31.568  44.539  115.394 1.00 39.68  ? 663 GLU A N   1 
ATOM   1183  C CA  . GLU A 1 163 ? 32.589  43.899  114.579 1.00 42.40  ? 663 GLU A CA  1 
ATOM   1184  C C   . GLU A 1 163 ? 32.311  42.421  114.333 1.00 33.92  ? 663 GLU A C   1 
ATOM   1185  O O   . GLU A 1 163 ? 32.484  41.934  113.219 1.00 41.05  ? 663 GLU A O   1 
ATOM   1186  C CB  . GLU A 1 163 ? 33.979  44.091  115.189 1.00 55.65  ? 663 GLU A CB  1 
ATOM   1187  C CG  . GLU A 1 163 ? 35.098  43.898  114.187 1.00 68.10  ? 663 GLU A CG  1 
ATOM   1188  C CD  . GLU A 1 163 ? 34.784  44.558  112.853 1.00 84.56  ? 663 GLU A CD  1 
ATOM   1189  O OE1 . GLU A 1 163 ? 34.342  45.731  112.846 1.00 92.49  ? 663 GLU A OE1 1 
ATOM   1190  O OE2 . GLU A 1 163 ? 34.962  43.897  111.808 1.00 89.08  ? 663 GLU A OE2 1 
ATOM   1191  N N   . LYS A 1 164 ? 31.870  41.712  115.363 1.00 32.32  ? 664 LYS A N   1 
ATOM   1192  C CA  . LYS A 1 164 ? 31.650  40.278  115.226 1.00 43.06  ? 664 LYS A CA  1 
ATOM   1193  C C   . LYS A 1 164 ? 30.516  40.012  114.250 1.00 38.85  ? 664 LYS A C   1 
ATOM   1194  O O   . LYS A 1 164 ? 30.511  39.005  113.531 1.00 42.29  ? 664 LYS A O   1 
ATOM   1195  C CB  . LYS A 1 164 ? 31.369  39.639  116.589 1.00 41.88  ? 664 LYS A CB  1 
ATOM   1196  C CG  . LYS A 1 164 ? 32.504  39.829  117.597 1.00 47.18  ? 664 LYS A CG  1 
ATOM   1197  C CD  . LYS A 1 164 ? 32.215  39.088  118.896 1.00 56.36  ? 664 LYS A CD  1 
ATOM   1198  C CE  . LYS A 1 164 ? 33.355  39.226  119.893 1.00 62.95  ? 664 LYS A CE  1 
ATOM   1199  N NZ  . LYS A 1 164 ? 33.642  40.652  120.237 1.00 70.21  ? 664 LYS A NZ  1 
ATOM   1200  N N   . THR A 1 165 ? 29.569  40.941  114.212 1.00 34.86  ? 665 THR A N   1 
ATOM   1201  C CA  . THR A 1 165 ? 28.367  40.774  113.403 1.00 34.15  ? 665 THR A CA  1 
ATOM   1202  C C   . THR A 1 165 ? 28.648  41.044  111.927 1.00 28.15  ? 665 THR A C   1 
ATOM   1203  O O   . THR A 1 165 ? 28.071  40.416  111.056 1.00 32.67  ? 665 THR A O   1 
ATOM   1204  C CB  . THR A 1 165 ? 27.229  41.694  113.903 1.00 34.37  ? 665 THR A CB  1 
ATOM   1205  O OG1 . THR A 1 165 ? 26.898  41.360  115.263 1.00 24.95  ? 665 THR A OG1 1 
ATOM   1206  C CG2 . THR A 1 165 ? 25.986  41.581  113.009 1.00 26.10  ? 665 THR A CG2 1 
ATOM   1207  N N   . TRP A 1 166 ? 29.534  41.987  111.645 1.00 23.16  ? 666 TRP A N   1 
ATOM   1208  C CA  . TRP A 1 166 ? 29.817  42.323  110.263 1.00 28.14  ? 666 TRP A CA  1 
ATOM   1209  C C   . TRP A 1 166 ? 30.706  41.234  109.712 1.00 35.31  ? 666 TRP A C   1 
ATOM   1210  O O   . TRP A 1 166 ? 30.624  40.866  108.534 1.00 33.95  ? 666 TRP A O   1 
ATOM   1211  C CB  . TRP A 1 166 ? 30.470  43.713  110.138 1.00 27.10  ? 666 TRP A CB  1 
ATOM   1212  C CG  . TRP A 1 166 ? 29.472  44.804  110.231 1.00 25.05  ? 666 TRP A CG  1 
ATOM   1213  C CD1 . TRP A 1 166 ? 29.134  45.517  111.350 1.00 27.11  ? 666 TRP A CD1 1 
ATOM   1214  C CD2 . TRP A 1 166 ? 28.631  45.288  109.176 1.00 26.74  ? 666 TRP A CD2 1 
ATOM   1215  N NE1 . TRP A 1 166 ? 28.149  46.421  111.052 1.00 25.96  ? 666 TRP A NE1 1 
ATOM   1216  C CE2 . TRP A 1 166 ? 27.822  46.303  109.722 1.00 24.17  ? 666 TRP A CE2 1 
ATOM   1217  C CE3 . TRP A 1 166 ? 28.499  44.977  107.817 1.00 26.75  ? 666 TRP A CE3 1 
ATOM   1218  C CZ2 . TRP A 1 166 ? 26.887  47.008  108.957 1.00 26.22  ? 666 TRP A CZ2 1 
ATOM   1219  C CZ3 . TRP A 1 166 ? 27.572  45.683  107.057 1.00 23.55  ? 666 TRP A CZ3 1 
ATOM   1220  C CH2 . TRP A 1 166 ? 26.775  46.683  107.633 1.00 24.68  ? 666 TRP A CH2 1 
ATOM   1221  N N   . THR A 1 167 ? 31.546  40.699  110.587 1.00 33.06  ? 667 THR A N   1 
ATOM   1222  C CA  . THR A 1 167 ? 32.393  39.583  110.226 1.00 29.48  ? 667 THR A CA  1 
ATOM   1223  C C   . THR A 1 167 ? 31.549  38.345  109.849 1.00 23.24  ? 667 THR A C   1 
ATOM   1224  O O   . THR A 1 167 ? 31.803  37.711  108.835 1.00 19.65  ? 667 THR A O   1 
ATOM   1225  C CB  . THR A 1 167 ? 33.346  39.284  111.355 1.00 33.02  ? 667 THR A CB  1 
ATOM   1226  O OG1 . THR A 1 167 ? 34.164  40.442  111.551 1.00 27.01  ? 667 THR A OG1 1 
ATOM   1227  C CG2 . THR A 1 167 ? 34.220  38.040  111.034 1.00 22.03  ? 667 THR A CG2 1 
ATOM   1228  N N   . ALA A 1 168 ? 30.527  38.034  110.638 1.00 19.73  ? 668 ALA A N   1 
ATOM   1229  C CA  . ALA A 1 168 ? 29.612  36.948  110.276 1.00 28.29  ? 668 ALA A CA  1 
ATOM   1230  C C   . ALA A 1 168 ? 28.898  37.242  108.944 1.00 34.55  ? 668 ALA A C   1 
ATOM   1231  O O   . ALA A 1 168 ? 28.719  36.351  108.105 1.00 22.06  ? 668 ALA A O   1 
ATOM   1232  C CB  . ALA A 1 168 ? 28.604  36.678  111.397 1.00 14.22  ? 668 ALA A CB  1 
ATOM   1233  N N   . LEU A 1 169 ? 28.499  38.492  108.734 1.00 32.16  ? 669 LEU A N   1 
ATOM   1234  C CA  . LEU A 1 169 ? 27.938  38.840  107.433 1.00 33.78  ? 669 LEU A CA  1 
ATOM   1235  C C   . LEU A 1 169 ? 28.943  38.588  106.293 1.00 32.50  ? 669 LEU A C   1 
ATOM   1236  O O   . LEU A 1 169 ? 28.573  38.021  105.270 1.00 29.63  ? 669 LEU A O   1 
ATOM   1237  C CB  . LEU A 1 169 ? 27.437  40.282  107.397 1.00 30.15  ? 669 LEU A CB  1 
ATOM   1238  C CG  . LEU A 1 169 ? 26.619  40.644  106.156 1.00 26.54  ? 669 LEU A CG  1 
ATOM   1239  C CD1 . LEU A 1 169 ? 25.160  40.267  106.350 1.00 21.55  ? 669 LEU A CD1 1 
ATOM   1240  C CD2 . LEU A 1 169 ? 26.759  42.129  105.832 1.00 20.71  ? 669 LEU A CD2 1 
ATOM   1241  N N   . ARG A 1 170 ? 30.201  39.006  106.465 1.00 28.57  ? 670 ARG A N   1 
ATOM   1242  C CA  . ARG A 1 170 ? 31.230  38.773  105.440 1.00 27.92  ? 670 ARG A CA  1 
ATOM   1243  C C   . ARG A 1 170 ? 31.450  37.292  105.135 1.00 34.16  ? 670 ARG A C   1 
ATOM   1244  O O   . ARG A 1 170 ? 31.718  36.917  103.989 1.00 28.99  ? 670 ARG A O   1 
ATOM   1245  C CB  . ARG A 1 170 ? 32.569  39.401  105.836 1.00 29.03  ? 670 ARG A CB  1 
ATOM   1246  C CG  . ARG A 1 170 ? 32.551  40.921  105.871 1.00 43.91  ? 670 ARG A CG  1 
ATOM   1247  C CD  . ARG A 1 170 ? 33.872  41.534  106.348 1.00 45.22  ? 670 ARG A CD  1 
ATOM   1248  N NE  . ARG A 1 170 ? 33.597  42.844  106.922 1.00 58.07  ? 670 ARG A NE  1 
ATOM   1249  C CZ  . ARG A 1 170 ? 33.676  43.132  108.216 1.00 66.28  ? 670 ARG A CZ  1 
ATOM   1250  N NH1 . ARG A 1 170 ? 34.068  42.206  109.086 1.00 69.09  ? 670 ARG A NH1 1 
ATOM   1251  N NH2 . ARG A 1 170 ? 33.380  44.357  108.634 1.00 70.77  ? 670 ARG A NH2 1 
ATOM   1252  N N   . HIS A 1 171 ? 31.340  36.455  106.165 1.00 32.36  ? 671 HIS A N   1 
ATOM   1253  C CA  . HIS A 1 171 ? 31.628  35.027  106.020 1.00 34.25  ? 671 HIS A CA  1 
ATOM   1254  C C   . HIS A 1 171 ? 30.458  34.166  105.538 1.00 26.27  ? 671 HIS A C   1 
ATOM   1255  O O   . HIS A 1 171 ? 30.663  33.214  104.788 1.00 25.07  ? 671 HIS A O   1 
ATOM   1256  C CB  . HIS A 1 171 ? 32.240  34.464  107.312 1.00 34.85  ? 671 HIS A CB  1 
ATOM   1257  C CG  . HIS A 1 171 ? 33.631  34.954  107.568 1.00 42.23  ? 671 HIS A CG  1 
ATOM   1258  N ND1 . HIS A 1 171 ? 34.735  34.410  106.949 1.00 49.07  ? 671 HIS A ND1 1 
ATOM   1259  C CD2 . HIS A 1 171 ? 34.093  35.960  108.345 1.00 43.26  ? 671 HIS A CD2 1 
ATOM   1260  C CE1 . HIS A 1 171 ? 35.819  35.052  107.344 1.00 52.31  ? 671 HIS A CE1 1 
ATOM   1261  N NE2 . HIS A 1 171 ? 35.457  35.998  108.190 1.00 48.06  ? 671 HIS A NE2 1 
ATOM   1262  N N   . GLN A 1 172 ? 29.243  34.496  105.966 1.00 16.54  ? 672 GLN A N   1 
ATOM   1263  C CA  . GLN A 1 172 ? 28.060  33.710  105.587 1.00 28.31  ? 672 GLN A CA  1 
ATOM   1264  C C   . GLN A 1 172 ? 27.251  34.341  104.441 1.00 29.02  ? 672 GLN A C   1 
ATOM   1265  O O   . GLN A 1 172 ? 26.817  33.656  103.519 1.00 33.66  ? 672 GLN A O   1 
ATOM   1266  C CB  . GLN A 1 172 ? 27.164  33.481  106.811 1.00 28.47  ? 672 GLN A CB  1 
ATOM   1267  C CG  . GLN A 1 172 ? 27.928  32.989  108.036 1.00 31.35  ? 672 GLN A CG  1 
ATOM   1268  C CD  . GLN A 1 172 ? 28.757  31.747  107.755 1.00 37.40  ? 672 GLN A CD  1 
ATOM   1269  O OE1 . GLN A 1 172 ? 28.310  30.817  107.075 1.00 36.64  ? 672 GLN A OE1 1 
ATOM   1270  N NE2 . GLN A 1 172 ? 29.973  31.727  108.277 1.00 48.18  ? 672 GLN A NE2 1 
ATOM   1271  N N   . TYR A 1 173 ? 27.056  35.651  104.501 1.00 21.08  ? 673 TYR A N   1 
ATOM   1272  C CA  . TYR A 1 173 ? 26.304  36.348  103.467 1.00 24.85  ? 673 TYR A CA  1 
ATOM   1273  C C   . TYR A 1 173 ? 27.191  37.212  102.578 1.00 24.32  ? 673 TYR A C   1 
ATOM   1274  O O   . TYR A 1 173 ? 26.856  38.354  102.263 1.00 20.74  ? 673 TYR A O   1 
ATOM   1275  C CB  . TYR A 1 173 ? 25.227  37.195  104.116 1.00 24.83  ? 673 TYR A CB  1 
ATOM   1276  C CG  . TYR A 1 173 ? 24.414  36.408  105.097 1.00 28.11  ? 673 TYR A CG  1 
ATOM   1277  C CD1 . TYR A 1 173 ? 24.776  36.345  106.440 1.00 29.04  ? 673 TYR A CD1 1 
ATOM   1278  C CD2 . TYR A 1 173 ? 23.297  35.700  104.680 1.00 24.41  ? 673 TYR A CD2 1 
ATOM   1279  C CE1 . TYR A 1 173 ? 24.024  35.622  107.345 1.00 22.99  ? 673 TYR A CE1 1 
ATOM   1280  C CE2 . TYR A 1 173 ? 22.541  34.985  105.569 1.00 23.23  ? 673 TYR A CE2 1 
ATOM   1281  C CZ  . TYR A 1 173 ? 22.906  34.942  106.897 1.00 28.12  ? 673 TYR A CZ  1 
ATOM   1282  O OH  . TYR A 1 173 ? 22.140  34.206  107.770 1.00 32.88  ? 673 TYR A OH  1 
ATOM   1283  N N   . THR A 1 174 ? 28.304  36.628  102.154 1.00 22.86  ? 674 THR A N   1 
ATOM   1284  C CA  . THR A 1 174 ? 29.341  37.310  101.387 1.00 24.02  ? 674 THR A CA  1 
ATOM   1285  C C   . THR A 1 174 ? 28.890  38.182  100.203 1.00 26.02  ? 674 THR A C   1 
ATOM   1286  O O   . THR A 1 174 ? 29.360  39.303  100.040 1.00 30.61  ? 674 THR A O   1 
ATOM   1287  C CB  . THR A 1 174 ? 30.367  36.285  100.889 1.00 19.99  ? 674 THR A CB  1 
ATOM   1288  O OG1 . THR A 1 174 ? 30.674  35.391  101.964 1.00 18.61  ? 674 THR A OG1 1 
ATOM   1289  C CG2 . THR A 1 174 ? 31.636  36.986  100.430 1.00 19.47  ? 674 THR A CG2 1 
ATOM   1290  N N   . GLN A 1 175 ? 28.007  37.659  99.365  1.00 18.88  ? 675 GLN A N   1 
ATOM   1291  C CA  . GLN A 1 175 ? 27.596  38.383  98.181  1.00 22.80  ? 675 GLN A CA  1 
ATOM   1292  C C   . GLN A 1 175 ? 26.803  39.639  98.562  1.00 26.32  ? 675 GLN A C   1 
ATOM   1293  O O   . GLN A 1 175 ? 27.061  40.737  98.058  1.00 21.14  ? 675 GLN A O   1 
ATOM   1294  C CB  . GLN A 1 175 ? 26.778  37.487  97.259  1.00 23.53  ? 675 GLN A CB  1 
ATOM   1295  C CG  . GLN A 1 175 ? 26.902  37.896  95.803  1.00 35.66  ? 675 GLN A CG  1 
ATOM   1296  C CD  . GLN A 1 175 ? 26.317  36.875  94.851  1.00 46.78  ? 675 GLN A CD  1 
ATOM   1297  O OE1 . GLN A 1 175 ? 25.811  37.229  93.787  1.00 48.80  ? 675 GLN A OE1 1 
ATOM   1298  N NE2 . GLN A 1 175 ? 26.386  35.604  95.224  1.00 46.03  ? 675 GLN A NE2 1 
ATOM   1299  N N   . THR A 1 176 ? 25.840  39.461  99.455  1.00 13.12  ? 676 THR A N   1 
ATOM   1300  C CA  . THR A 1 176 ? 25.135  40.566  100.041 1.00 17.78  ? 676 THR A CA  1 
ATOM   1301  C C   . THR A 1 176 ? 26.096  41.586  100.696 1.00 27.50  ? 676 THR A C   1 
ATOM   1302  O O   . THR A 1 176 ? 25.940  42.797  100.519 1.00 28.64  ? 676 THR A O   1 
ATOM   1303  C CB  . THR A 1 176 ? 24.055  40.047  101.004 1.00 26.24  ? 676 THR A CB  1 
ATOM   1304  O OG1 . THR A 1 176 ? 23.038  39.399  100.231 1.00 25.03  ? 676 THR A OG1 1 
ATOM   1305  C CG2 . THR A 1 176 ? 23.430  41.178  101.803 1.00 25.58  ? 676 THR A CG2 1 
ATOM   1306  N N   . ALA A 1 177 ? 27.104  41.104  101.418 1.00 22.74  ? 677 ALA A N   1 
ATOM   1307  C CA  . ALA A 1 177 ? 28.028  42.007  102.116 1.00 25.18  ? 677 ALA A CA  1 
ATOM   1308  C C   . ALA A 1 177 ? 28.855  42.848  101.139 1.00 28.18  ? 677 ALA A C   1 
ATOM   1309  O O   . ALA A 1 177 ? 29.091  44.036  101.365 1.00 22.58  ? 677 ALA A O   1 
ATOM   1310  C CB  . ALA A 1 177 ? 28.938  41.235  103.060 1.00 17.89  ? 677 ALA A CB  1 
ATOM   1311  N N   . ILE A 1 178 ? 29.272  42.231  100.040 1.00 27.56  ? 678 ILE A N   1 
ATOM   1312  C CA  . ILE A 1 178 ? 30.020  42.946  99.016  1.00 25.98  ? 678 ILE A CA  1 
ATOM   1313  C C   . ILE A 1 178 ? 29.138  43.907  98.208  1.00 17.74  ? 678 ILE A C   1 
ATOM   1314  O O   . ILE A 1 178 ? 29.553  45.023  97.874  1.00 20.76  ? 678 ILE A O   1 
ATOM   1315  C CB  . ILE A 1 178 ? 30.743  41.976  98.089  1.00 25.10  ? 678 ILE A CB  1 
ATOM   1316  C CG1 . ILE A 1 178 ? 31.709  41.102  98.914  1.00 26.93  ? 678 ILE A CG1 1 
ATOM   1317  C CG2 . ILE A 1 178 ? 31.460  42.756  96.987  1.00 16.39  ? 678 ILE A CG2 1 
ATOM   1318  C CD1 . ILE A 1 178 ? 32.295  39.901  98.151  1.00 23.82  ? 678 ILE A CD1 1 
ATOM   1319  N N   . LEU A 1 179 ? 27.921  43.473  97.908  1.00 23.10  ? 679 LEU A N   1 
ATOM   1320  C CA  . LEU A 1 179 ? 26.925  44.338  97.281  1.00 27.57  ? 679 LEU A CA  1 
ATOM   1321  C C   . LEU A 1 179 ? 26.719  45.631  98.100  1.00 26.26  ? 679 LEU A C   1 
ATOM   1322  O O   . LEU A 1 179 ? 26.677  46.725  97.539  1.00 29.71  ? 679 LEU A O   1 
ATOM   1323  C CB  . LEU A 1 179 ? 25.609  43.578  97.093  1.00 25.79  ? 679 LEU A CB  1 
ATOM   1324  C CG  . LEU A 1 179 ? 24.405  44.329  96.528  1.00 36.16  ? 679 LEU A CG  1 
ATOM   1325  C CD1 . LEU A 1 179 ? 24.745  44.901  95.170  1.00 47.22  ? 679 LEU A CD1 1 
ATOM   1326  C CD2 . LEU A 1 179 ? 23.230  43.383  96.419  1.00 43.05  ? 679 LEU A CD2 1 
ATOM   1327  N N   . TYR A 1 180 ? 26.624  45.503  99.423  1.00 24.59  ? 680 TYR A N   1 
ATOM   1328  C CA  . TYR A 1 180 ? 26.462  46.663  100.303 1.00 19.53  ? 680 TYR A CA  1 
ATOM   1329  C C   . TYR A 1 180 ? 27.651  47.617  100.269 1.00 29.68  ? 680 TYR A C   1 
ATOM   1330  O O   . TYR A 1 180 ? 27.473  48.816  100.105 1.00 28.61  ? 680 TYR A O   1 
ATOM   1331  C CB  . TYR A 1 180 ? 26.231  46.218  101.743 1.00 21.39  ? 680 TYR A CB  1 
ATOM   1332  C CG  . TYR A 1 180 ? 26.269  47.337  102.767 1.00 23.70  ? 680 TYR A CG  1 
ATOM   1333  C CD1 . TYR A 1 180 ? 25.241  48.289  102.843 1.00 23.55  ? 680 TYR A CD1 1 
ATOM   1334  C CD2 . TYR A 1 180 ? 27.323  47.440  103.667 1.00 23.03  ? 680 TYR A CD2 1 
ATOM   1335  C CE1 . TYR A 1 180 ? 25.265  49.310  103.794 1.00 19.57  ? 680 TYR A CE1 1 
ATOM   1336  C CE2 . TYR A 1 180 ? 27.357  48.451  104.616 1.00 22.72  ? 680 TYR A CE2 1 
ATOM   1337  C CZ  . TYR A 1 180 ? 26.330  49.380  104.673 1.00 26.43  ? 680 TYR A CZ  1 
ATOM   1338  O OH  . TYR A 1 180 ? 26.383  50.373  105.613 1.00 25.92  ? 680 TYR A OH  1 
ATOM   1339  N N   . GLU A 1 181 ? 28.857  47.081  100.439 1.00 35.63  ? 681 GLU A N   1 
ATOM   1340  C CA  . GLU A 1 181 ? 30.058  47.906  100.481 1.00 39.17  ? 681 GLU A CA  1 
ATOM   1341  C C   . GLU A 1 181 ? 30.413  48.510  99.122  1.00 40.75  ? 681 GLU A C   1 
ATOM   1342  O O   . GLU A 1 181 ? 30.804  49.678  99.034  1.00 40.41  ? 681 GLU A O   1 
ATOM   1343  C CB  . GLU A 1 181 ? 31.251  47.107  101.020 1.00 40.11  ? 681 GLU A CB  1 
ATOM   1344  C CG  . GLU A 1 181 ? 31.316  47.033  102.539 1.00 51.72  ? 681 GLU A CG  1 
ATOM   1345  C CD  . GLU A 1 181 ? 31.728  48.359  103.187 1.00 57.14  ? 681 GLU A CD  1 
ATOM   1346  O OE1 . GLU A 1 181 ? 32.529  49.111  102.575 1.00 36.42  ? 681 GLU A OE1 1 
ATOM   1347  O OE2 . GLU A 1 181 ? 31.252  48.637  104.314 1.00 69.17  ? 681 GLU A OE2 1 
ATOM   1348  N N   . LYS A 1 182 ? 30.263  47.719  98.066  1.00 29.33  ? 682 LYS A N   1 
ATOM   1349  C CA  . LYS A 1 182 ? 30.813  48.090  96.774  1.00 24.27  ? 682 LYS A CA  1 
ATOM   1350  C C   . LYS A 1 182 ? 29.828  48.792  95.868  1.00 30.85  ? 682 LYS A C   1 
ATOM   1351  O O   . LYS A 1 182 ? 30.234  49.486  94.949  1.00 33.37  ? 682 LYS A O   1 
ATOM   1352  C CB  . LYS A 1 182 ? 31.366  46.859  96.056  1.00 21.72  ? 682 LYS A CB  1 
ATOM   1353  C CG  . LYS A 1 182 ? 32.542  46.225  96.776  1.00 33.97  ? 682 LYS A CG  1 
ATOM   1354  C CD  . LYS A 1 182 ? 33.647  47.242  97.015  1.00 48.02  ? 682 LYS A CD  1 
ATOM   1355  C CE  . LYS A 1 182 ? 34.848  46.605  97.710  1.00 61.96  ? 682 LYS A CE  1 
ATOM   1356  N NZ  . LYS A 1 182 ? 35.810  47.605  98.267  1.00 65.14  ? 682 LYS A NZ  1 
ATOM   1357  N N   . GLN A 1 183 ? 28.536  48.613  96.116  1.00 29.82  ? 683 GLN A N   1 
ATOM   1358  C CA  . GLN A 1 183 ? 27.527  49.172  95.230  1.00 30.56  ? 683 GLN A CA  1 
ATOM   1359  C C   . GLN A 1 183 ? 26.625  50.170  95.944  1.00 31.08  ? 683 GLN A C   1 
ATOM   1360  O O   . GLN A 1 183 ? 26.475  51.313  95.514  1.00 35.15  ? 683 GLN A O   1 
ATOM   1361  C CB  . GLN A 1 183 ? 26.699  48.046  94.621  1.00 37.93  ? 683 GLN A CB  1 
ATOM   1362  C CG  . GLN A 1 183 ? 27.545  46.954  93.977  1.00 50.60  ? 683 GLN A CG  1 
ATOM   1363  C CD  . GLN A 1 183 ? 27.142  46.672  92.542  1.00 62.69  ? 683 GLN A CD  1 
ATOM   1364  O OE1 . GLN A 1 183 ? 26.483  45.669  92.252  1.00 65.52  ? 683 GLN A OE1 1 
ATOM   1365  N NE2 . GLN A 1 183 ? 27.528  47.565  91.634  1.00 65.67  ? 683 GLN A NE2 1 
ATOM   1366  N N   . LEU A 1 184 ? 26.044  49.728  97.050  1.00 25.17  ? 684 LEU A N   1 
ATOM   1367  C CA  . LEU A 1 184 ? 25.110  50.532  97.826  1.00 23.11  ? 684 LEU A CA  1 
ATOM   1368  C C   . LEU A 1 184 ? 25.759  51.745  98.484  1.00 26.18  ? 684 LEU A C   1 
ATOM   1369  O O   . LEU A 1 184 ? 25.210  52.838  98.437  1.00 23.71  ? 684 LEU A O   1 
ATOM   1370  C CB  . LEU A 1 184 ? 24.448  49.668  98.897  1.00 18.85  ? 684 LEU A CB  1 
ATOM   1371  C CG  . LEU A 1 184 ? 23.118  49.010  98.493  1.00 24.88  ? 684 LEU A CG  1 
ATOM   1372  C CD1 . LEU A 1 184 ? 23.043  48.685  97.017  1.00 14.48  ? 684 LEU A CD1 1 
ATOM   1373  C CD2 . LEU A 1 184 ? 22.786  47.793  99.360  1.00 9.17   ? 684 LEU A CD2 1 
ATOM   1374  N N   . LYS A 1 185 ? 26.910  51.562  99.121  1.00 19.06  ? 685 LYS A N   1 
ATOM   1375  C CA  . LYS A 1 185 ? 27.551  52.694  99.773  1.00 29.69  ? 685 LYS A CA  1 
ATOM   1376  C C   . LYS A 1 185 ? 27.904  53.804  98.773  1.00 26.09  ? 685 LYS A C   1 
ATOM   1377  O O   . LYS A 1 185 ? 27.542  54.951  98.976  1.00 21.59  ? 685 LYS A O   1 
ATOM   1378  C CB  . LYS A 1 185 ? 28.764  52.250  100.573 1.00 30.62  ? 685 LYS A CB  1 
ATOM   1379  C CG  . LYS A 1 185 ? 28.444  51.991  102.027 1.00 37.10  ? 685 LYS A CG  1 
ATOM   1380  C CD  . LYS A 1 185 ? 29.665  51.484  102.771 1.00 42.32  ? 685 LYS A CD  1 
ATOM   1381  C CE  . LYS A 1 185 ? 29.703  52.017  104.189 1.00 52.81  ? 685 LYS A CE  1 
ATOM   1382  N NZ  . LYS A 1 185 ? 30.457  51.103  105.091 1.00 59.13  ? 685 LYS A NZ  1 
ATOM   1383  N N   . PRO A 1 186 ? 28.571  53.447  97.671  1.00 22.74  ? 686 PRO A N   1 
ATOM   1384  C CA  . PRO A 1 186 ? 28.929  54.443  96.654  1.00 28.35  ? 686 PRO A CA  1 
ATOM   1385  C C   . PRO A 1 186 ? 27.702  55.140  96.051  1.00 25.39  ? 686 PRO A C   1 
ATOM   1386  O O   . PRO A 1 186 ? 27.712  56.360  95.862  1.00 31.51  ? 686 PRO A O   1 
ATOM   1387  C CB  . PRO A 1 186 ? 29.676  53.614  95.592  1.00 26.19  ? 686 PRO A CB  1 
ATOM   1388  C CG  . PRO A 1 186 ? 30.175  52.390  96.351  1.00 23.60  ? 686 PRO A CG  1 
ATOM   1389  C CD  . PRO A 1 186 ? 29.077  52.101  97.342  1.00 23.57  ? 686 PRO A CD  1 
ATOM   1390  N N   . PHE A 1 187 ? 26.657  54.379  95.755  1.00 21.78  ? 687 PHE A N   1 
ATOM   1391  C CA  . PHE A 1 187 ? 25.406  54.960  95.258  1.00 31.98  ? 687 PHE A CA  1 
ATOM   1392  C C   . PHE A 1 187 ? 24.779  55.936  96.272  1.00 30.23  ? 687 PHE A C   1 
ATOM   1393  O O   . PHE A 1 187 ? 24.335  57.039  95.924  1.00 34.12  ? 687 PHE A O   1 
ATOM   1394  C CB  . PHE A 1 187 ? 24.420  53.847  94.896  1.00 22.74  ? 687 PHE A CB  1 
ATOM   1395  C CG  . PHE A 1 187 ? 23.072  54.339  94.463  1.00 17.22  ? 687 PHE A CG  1 
ATOM   1396  C CD1 . PHE A 1 187 ? 22.867  54.785  93.173  1.00 22.91  ? 687 PHE A CD1 1 
ATOM   1397  C CD2 . PHE A 1 187 ? 22.002  54.336  95.344  1.00 5.70   ? 687 PHE A CD2 1 
ATOM   1398  C CE1 . PHE A 1 187 ? 21.606  55.225  92.763  1.00 26.06  ? 687 PHE A CE1 1 
ATOM   1399  C CE2 . PHE A 1 187 ? 20.754  54.763  94.946  1.00 19.45  ? 687 PHE A CE2 1 
ATOM   1400  C CZ  . PHE A 1 187 ? 20.556  55.208  93.643  1.00 18.39  ? 687 PHE A CZ  1 
ATOM   1401  N N   . SER A 1 188 ? 24.761  55.511  97.527  1.00 18.67  ? 688 SER A N   1 
ATOM   1402  C CA  . SER A 1 188 ? 24.290  56.319  98.639  1.00 13.35  ? 688 SER A CA  1 
ATOM   1403  C C   . SER A 1 188 ? 25.009  57.684  98.656  1.00 31.13  ? 688 SER A C   1 
ATOM   1404  O O   . SER A 1 188 ? 24.409  58.727  98.932  1.00 28.67  ? 688 SER A O   1 
ATOM   1405  C CB  . SER A 1 188 ? 24.547  55.553  99.932  1.00 16.42  ? 688 SER A CB  1 
ATOM   1406  O OG  . SER A 1 188 ? 23.972  56.185  101.051 1.00 24.90  ? 688 SER A OG  1 
ATOM   1407  N N   . LYS A 1 189 ? 26.295  57.660  98.330  1.00 24.82  ? 689 LYS A N   1 
ATOM   1408  C CA  . LYS A 1 189 ? 27.143  58.831  98.390  1.00 27.02  ? 689 LYS A CA  1 
ATOM   1409  C C   . LYS A 1 189 ? 26.770  59.775  97.255  1.00 33.72  ? 689 LYS A C   1 
ATOM   1410  O O   . LYS A 1 189 ? 26.610  60.997  97.450  1.00 27.99  ? 689 LYS A O   1 
ATOM   1411  C CB  . LYS A 1 189 ? 28.606  58.396  98.291  1.00 26.76  ? 689 LYS A CB  1 
ATOM   1412  C CG  . LYS A 1 189 ? 29.621  59.502  98.347  1.00 38.32  ? 689 LYS A CG  1 
ATOM   1413  C CD  . LYS A 1 189 ? 30.991  58.933  98.018  1.00 53.56  ? 689 LYS A CD  1 
ATOM   1414  C CE  . LYS A 1 189 ? 31.863  59.956  97.324  1.00 58.09  ? 689 LYS A CE  1 
ATOM   1415  N NZ  . LYS A 1 189 ? 32.132  61.078  98.253  1.00 68.39  ? 689 LYS A NZ  1 
ATOM   1416  N N   . LEU A 1 190 ? 26.623  59.201  96.068  1.00 24.03  ? 690 LEU A N   1 
ATOM   1417  C CA  . LEU A 1 190 ? 26.113  59.956  94.947  1.00 14.50  ? 690 LEU A CA  1 
ATOM   1418  C C   . LEU A 1 190 ? 24.818  60.678  95.318  1.00 21.96  ? 690 LEU A C   1 
ATOM   1419  O O   . LEU A 1 190 ? 24.678  61.871  95.058  1.00 27.85  ? 690 LEU A O   1 
ATOM   1420  C CB  . LEU A 1 190 ? 25.857  59.037  93.772  1.00 19.12  ? 690 LEU A CB  1 
ATOM   1421  C CG  . LEU A 1 190 ? 27.120  58.753  93.002  1.00 29.79  ? 690 LEU A CG  1 
ATOM   1422  C CD1 . LEU A 1 190 ? 26.745  58.227  91.632  1.00 34.41  ? 690 LEU A CD1 1 
ATOM   1423  C CD2 . LEU A 1 190 ? 27.879  60.043  92.884  1.00 32.99  ? 690 LEU A CD2 1 
ATOM   1424  N N   . LEU A 1 191 ? 23.863  59.961  95.911  1.00 25.24  ? 691 LEU A N   1 
ATOM   1425  C CA  . LEU A 1 191 ? 22.588  60.588  96.255  1.00 19.40  ? 691 LEU A CA  1 
ATOM   1426  C C   . LEU A 1 191 ? 22.826  61.803  97.140  1.00 26.93  ? 691 LEU A C   1 
ATOM   1427  O O   . LEU A 1 191 ? 22.216  62.862  96.942  1.00 24.63  ? 691 LEU A O   1 
ATOM   1428  C CB  . LEU A 1 191 ? 21.644  59.615  96.961  1.00 20.32  ? 691 LEU A CB  1 
ATOM   1429  C CG  . LEU A 1 191 ? 21.250  58.327  96.233  1.00 19.28  ? 691 LEU A CG  1 
ATOM   1430  C CD1 . LEU A 1 191 ? 20.197  57.577  97.022  1.00 17.58  ? 691 LEU A CD1 1 
ATOM   1431  C CD2 . LEU A 1 191 ? 20.741  58.609  94.843  1.00 13.05  ? 691 LEU A CD2 1 
ATOM   1432  N N   . HIS A 1 192 ? 23.729  61.641  98.103  1.00 23.72  ? 692 HIS A N   1 
ATOM   1433  C CA  . HIS A 1 192 ? 23.999  62.674  99.088  1.00 25.60  ? 692 HIS A CA  1 
ATOM   1434  C C   . HIS A 1 192 ? 24.657  63.909  98.456  1.00 29.17  ? 692 HIS A C   1 
ATOM   1435  O O   . HIS A 1 192 ? 24.458  65.024  98.919  1.00 19.09  ? 692 HIS A O   1 
ATOM   1436  C CB  . HIS A 1 192 ? 24.852  62.131  100.237 1.00 28.17  ? 692 HIS A CB  1 
ATOM   1437  C CG  . HIS A 1 192 ? 24.965  63.071  101.397 1.00 56.28  ? 692 HIS A CG  1 
ATOM   1438  N ND1 . HIS A 1 192 ? 23.950  63.247  102.317 1.00 74.17  ? 692 HIS A ND1 1 
ATOM   1439  C CD2 . HIS A 1 192 ? 25.968  63.897  101.785 1.00 57.98  ? 692 HIS A CD2 1 
ATOM   1440  C CE1 . HIS A 1 192 ? 24.324  64.137  103.219 1.00 74.08  ? 692 HIS A CE1 1 
ATOM   1441  N NE2 . HIS A 1 192 ? 25.545  64.546  102.919 1.00 64.40  ? 692 HIS A NE2 1 
ATOM   1442  N N   . GLU A 1 193 ? 25.425  63.710  97.393  1.00 27.78  ? 693 GLU A N   1 
ATOM   1443  C CA  . GLU A 1 193 ? 26.024  64.840  96.702  1.00 29.68  ? 693 GLU A CA  1 
ATOM   1444  C C   . GLU A 1 193 ? 25.028  65.463  95.731  1.00 27.32  ? 693 GLU A C   1 
ATOM   1445  O O   . GLU A 1 193 ? 25.374  66.374  94.981  1.00 20.20  ? 693 GLU A O   1 
ATOM   1446  C CB  . GLU A 1 193 ? 27.292  64.420  95.968  1.00 21.17  ? 693 GLU A CB  1 
ATOM   1447  C CG  . GLU A 1 193 ? 28.355  63.916  96.900  1.00 33.03  ? 693 GLU A CG  1 
ATOM   1448  C CD  . GLU A 1 193 ? 29.313  62.944  96.231  1.00 45.29  ? 693 GLU A CD  1 
ATOM   1449  O OE1 . GLU A 1 193 ? 29.144  62.639  95.023  1.00 39.52  ? 693 GLU A OE1 1 
ATOM   1450  O OE2 . GLU A 1 193 ? 30.238  62.480  96.927  1.00 54.35  ? 693 GLU A OE2 1 
ATOM   1451  N N   . GLY A 1 194 ? 23.797  64.956  95.741  1.00 26.17  ? 694 GLY A N   1 
ATOM   1452  C CA  . GLY A 1 194 ? 22.727  65.536  94.945  1.00 26.24  ? 694 GLY A CA  1 
ATOM   1453  C C   . GLY A 1 194 ? 22.720  65.160  93.469  1.00 34.05  ? 694 GLY A C   1 
ATOM   1454  O O   . GLY A 1 194 ? 22.243  65.946  92.623  1.00 20.60  ? 694 GLY A O   1 
ATOM   1455  N N   . ARG A 1 195 ? 23.206  63.953  93.162  1.00 27.52  ? 695 ARG A N   1 
ATOM   1456  C CA  . ARG A 1 195 ? 23.290  63.479  91.779  1.00 26.19  ? 695 ARG A CA  1 
ATOM   1457  C C   . ARG A 1 195 ? 22.214  62.449  91.418  1.00 26.83  ? 695 ARG A C   1 
ATOM   1458  O O   . ARG A 1 195 ? 22.390  61.680  90.472  1.00 22.03  ? 695 ARG A O   1 
ATOM   1459  C CB  . ARG A 1 195 ? 24.659  62.833  91.497  1.00 27.49  ? 695 ARG A CB  1 
ATOM   1460  C CG  . ARG A 1 195 ? 25.876  63.572  92.024  1.00 29.34  ? 695 ARG A CG  1 
ATOM   1461  C CD  . ARG A 1 195 ? 26.016  64.919  91.385  1.00 51.05  ? 695 ARG A CD  1 
ATOM   1462  N NE  . ARG A 1 195 ? 26.005  64.826  89.932  1.00 68.67  ? 695 ARG A NE  1 
ATOM   1463  C CZ  . ARG A 1 195 ? 27.014  64.353  89.212  1.00 77.23  ? 695 ARG A CZ  1 
ATOM   1464  N NH1 . ARG A 1 195 ? 28.112  63.919  89.821  1.00 80.49  ? 695 ARG A NH1 1 
ATOM   1465  N NH2 . ARG A 1 195 ? 26.919  64.307  87.887  1.00 77.89  ? 695 ARG A NH2 1 
ATOM   1466  N N   . GLU A 1 196 ? 21.105  62.415  92.145  1.00 22.83  ? 696 GLU A N   1 
ATOM   1467  C CA  . GLU A 1 196 ? 20.136  61.339  91.915  1.00 30.65  ? 696 GLU A CA  1 
ATOM   1468  C C   . GLU A 1 196 ? 19.506  61.344  90.512  1.00 33.20  ? 696 GLU A C   1 
ATOM   1469  O O   . GLU A 1 196 ? 19.073  60.299  90.016  1.00 38.51  ? 696 GLU A O   1 
ATOM   1470  C CB  . GLU A 1 196 ? 19.044  61.329  92.992  1.00 32.87  ? 696 GLU A CB  1 
ATOM   1471  C CG  . GLU A 1 196 ? 17.998  62.435  92.843  1.00 40.37  ? 696 GLU A CG  1 
ATOM   1472  C CD  . GLU A 1 196 ? 17.165  62.612  94.107  1.00 45.42  ? 696 GLU A CD  1 
ATOM   1473  O OE1 . GLU A 1 196 ? 16.138  61.899  94.261  1.00 44.69  ? 696 GLU A OE1 1 
ATOM   1474  O OE2 . GLU A 1 196 ? 17.547  63.461  94.949  1.00 34.46  ? 696 GLU A OE2 1 
ATOM   1475  N N   . SER A 1 197 ? 19.448  62.508  89.874  1.00 30.40  ? 697 SER A N   1 
ATOM   1476  C CA  . SER A 1 197 ? 18.689  62.638  88.632  1.00 26.50  ? 697 SER A CA  1 
ATOM   1477  C C   . SER A 1 197 ? 19.433  62.003  87.468  1.00 30.04  ? 697 SER A C   1 
ATOM   1478  O O   . SER A 1 197 ? 18.827  61.646  86.454  1.00 26.70  ? 697 SER A O   1 
ATOM   1479  C CB  . SER A 1 197 ? 18.396  64.102  88.329  1.00 27.60  ? 697 SER A CB  1 
ATOM   1480  O OG  . SER A 1 197 ? 19.609  64.829  88.292  1.00 39.91  ? 697 SER A OG  1 
ATOM   1481  N N   . THR A 1 198 ? 20.745  61.848  87.622  1.00 20.79  ? 698 THR A N   1 
ATOM   1482  C CA  . THR A 1 198 ? 21.557  61.264  86.564  1.00 33.28  ? 698 THR A CA  1 
ATOM   1483  C C   . THR A 1 198 ? 22.095  59.861  86.863  1.00 33.85  ? 698 THR A C   1 
ATOM   1484  O O   . THR A 1 198 ? 22.844  59.298  86.066  1.00 33.86  ? 698 THR A O   1 
ATOM   1485  C CB  . THR A 1 198 ? 22.759  62.159  86.209  1.00 36.31  ? 698 THR A CB  1 
ATOM   1486  O OG1 . THR A 1 198 ? 23.591  62.316  87.364  1.00 34.83  ? 698 THR A OG1 1 
ATOM   1487  C CG2 . THR A 1 198 ? 22.293  63.520  85.691  1.00 36.79  ? 698 THR A CG2 1 
ATOM   1488  N N   . CYS A 1 199 ? 21.742  59.292  88.003  1.00 32.15  ? 699 CYS A N   1 
ATOM   1489  C CA  . CYS A 1 199 ? 22.156  57.915  88.252  1.00 39.54  ? 699 CYS A CA  1 
ATOM   1490  C C   . CYS A 1 199 ? 20.986  57.048  88.714  1.00 29.39  ? 699 CYS A C   1 
ATOM   1491  O O   . CYS A 1 199 ? 20.989  56.542  89.832  1.00 41.95  ? 699 CYS A O   1 
ATOM   1492  C CB  . CYS A 1 199 ? 23.309  57.879  89.261  1.00 46.82  ? 699 CYS A CB  1 
ATOM   1493  S SG  . CYS A 1 199 ? 22.886  58.476  90.896  1.00 51.99  ? 699 CYS A SG  1 
ATOM   1494  N N   . VAL A 1 200 ? 19.981  56.884  87.857  1.00 21.33  ? 700 VAL A N   1 
ATOM   1495  C CA  . VAL A 1 200 ? 18.753  56.209  88.287  1.00 27.40  ? 700 VAL A CA  1 
ATOM   1496  C C   . VAL A 1 200 ? 18.942  54.704  88.258  1.00 27.86  ? 700 VAL A C   1 
ATOM   1497  O O   . VAL A 1 200 ? 19.662  54.182  87.405  1.00 22.06  ? 700 VAL A O   1 
ATOM   1498  C CB  . VAL A 1 200 ? 17.503  56.605  87.457  1.00 48.41  ? 700 VAL A CB  1 
ATOM   1499  C CG1 . VAL A 1 200 ? 17.320  58.116  87.458  1.00 50.46  ? 700 VAL A CG1 1 
ATOM   1500  C CG2 . VAL A 1 200 ? 17.597  56.062  86.039  1.00 47.71  ? 700 VAL A CG2 1 
ATOM   1501  N N   . PRO A 1 201 ? 18.307  54.011  89.212  1.00 25.04  ? 701 PRO A N   1 
ATOM   1502  C CA  . PRO A 1 201 ? 18.390  52.552  89.332  1.00 28.72  ? 701 PRO A CA  1 
ATOM   1503  C C   . PRO A 1 201 ? 17.590  51.928  88.199  1.00 26.54  ? 701 PRO A C   1 
ATOM   1504  O O   . PRO A 1 201 ? 16.866  52.650  87.514  1.00 19.88  ? 701 PRO A O   1 
ATOM   1505  C CB  . PRO A 1 201 ? 17.734  52.270  90.689  1.00 27.96  ? 701 PRO A CB  1 
ATOM   1506  C CG  . PRO A 1 201 ? 17.608  53.638  91.363  1.00 27.57  ? 701 PRO A CG  1 
ATOM   1507  C CD  . PRO A 1 201 ? 17.455  54.604  90.253  1.00 16.39  ? 701 PRO A CD  1 
ATOM   1508  N N   . PRO A 1 202 ? 17.704  50.607  88.009  1.00 25.02  ? 702 PRO A N   1 
ATOM   1509  C CA  . PRO A 1 202 ? 17.116  49.951  86.827  1.00 25.97  ? 702 PRO A CA  1 
ATOM   1510  C C   . PRO A 1 202 ? 15.592  50.070  86.699  1.00 26.72  ? 702 PRO A C   1 
ATOM   1511  O O   . PRO A 1 202 ? 15.071  49.863  85.600  1.00 30.86  ? 702 PRO A O   1 
ATOM   1512  C CB  . PRO A 1 202 ? 17.561  48.482  86.960  1.00 17.03  ? 702 PRO A CB  1 
ATOM   1513  C CG  . PRO A 1 202 ? 17.992  48.324  88.375  1.00 22.59  ? 702 PRO A CG  1 
ATOM   1514  C CD  . PRO A 1 202 ? 18.451  49.674  88.862  1.00 24.27  ? 702 PRO A CD  1 
ATOM   1515  N N   . ASN A 1 203 ? 14.889  50.403  87.780  1.00 18.49  ? 703 ASN A N   1 
ATOM   1516  C CA  . ASN A 1 203 ? 13.438  50.559  87.685  1.00 19.97  ? 703 ASN A CA  1 
ATOM   1517  C C   . ASN A 1 203 ? 12.944  52.009  87.813  1.00 21.60  ? 703 ASN A C   1 
ATOM   1518  O O   . ASN A 1 203 ? 11.768  52.253  88.096  1.00 21.34  ? 703 ASN A O   1 
ATOM   1519  C CB  . ASN A 1 203 ? 12.722  49.638  88.679  1.00 28.46  ? 703 ASN A CB  1 
ATOM   1520  C CG  . ASN A 1 203 ? 11.480  49.008  88.088  1.00 30.88  ? 703 ASN A CG  1 
ATOM   1521  O OD1 . ASN A 1 203 ? 11.197  49.165  86.901  1.00 28.30  ? 703 ASN A OD1 1 
ATOM   1522  N ND2 . ASN A 1 203 ? 10.729  48.298  88.910  1.00 32.01  ? 703 ASN A ND2 1 
ATOM   1523  N N   . ASN A 1 204 ? 13.854  52.954  87.581  1.00 25.83  ? 704 ASN A N   1 
ATOM   1524  C CA  . ASN A 1 204 ? 13.589  54.385  87.743  1.00 26.46  ? 704 ASN A CA  1 
ATOM   1525  C C   . ASN A 1 204 ? 13.295  54.782  89.192  1.00 31.45  ? 704 ASN A C   1 
ATOM   1526  O O   . ASN A 1 204 ? 13.474  53.983  90.117  1.00 24.17  ? 704 ASN A O   1 
ATOM   1527  C CB  . ASN A 1 204 ? 12.465  54.853  86.813  1.00 35.34  ? 704 ASN A CB  1 
ATOM   1528  C CG  . ASN A 1 204 ? 12.958  55.159  85.406  1.00 53.79  ? 704 ASN A CG  1 
ATOM   1529  O OD1 . ASN A 1 204 ? 13.381  56.293  85.113  1.00 56.80  ? 704 ASN A OD1 1 
ATOM   1530  N ND2 . ASN A 1 204 ? 12.902  54.152  84.520  1.00 45.39  ? 704 ASN A ND2 1 
ATOM   1531  N N   . VAL A 1 205 ? 12.844  56.020  89.375  1.00 28.05  ? 705 VAL A N   1 
ATOM   1532  C CA  . VAL A 1 205 ? 12.591  56.570  90.703  1.00 23.14  ? 705 VAL A CA  1 
ATOM   1533  C C   . VAL A 1 205 ? 11.100  56.754  90.948  1.00 23.48  ? 705 VAL A C   1 
ATOM   1534  O O   . VAL A 1 205 ? 10.390  57.280  90.090  1.00 27.24  ? 705 VAL A O   1 
ATOM   1535  C CB  . VAL A 1 205 ? 13.315  57.925  90.873  1.00 19.39  ? 705 VAL A CB  1 
ATOM   1536  C CG1 . VAL A 1 205 ? 12.935  58.580  92.191  1.00 23.99  ? 705 VAL A CG1 1 
ATOM   1537  C CG2 . VAL A 1 205 ? 14.821  57.722  90.767  1.00 12.83  ? 705 VAL A CG2 1 
ATOM   1538  N N   . SER A 1 206 ? 10.627  56.315  92.113  1.00 16.34  ? 706 SER A N   1 
ATOM   1539  C CA  . SER A 1 206 ? 9.218   56.477  92.490  1.00 19.95  ? 706 SER A CA  1 
ATOM   1540  C C   . SER A 1 206 ? 9.091   57.488  93.614  1.00 27.50  ? 706 SER A C   1 
ATOM   1541  O O   . SER A 1 206 ? 8.150   58.268  93.651  1.00 26.63  ? 706 SER A O   1 
ATOM   1542  C CB  . SER A 1 206 ? 8.584   55.148  92.936  1.00 15.53  ? 706 SER A CB  1 
ATOM   1543  O OG  . SER A 1 206 ? 8.674   54.172  91.912  1.00 18.69  ? 706 SER A OG  1 
ATOM   1544  N N   . VAL A 1 207 ? 10.029  57.444  94.550  1.00 22.33  ? 707 VAL A N   1 
ATOM   1545  C CA  . VAL A 1 207 ? 10.099  58.452  95.580  1.00 20.29  ? 707 VAL A CA  1 
ATOM   1546  C C   . VAL A 1 207 ? 11.524  58.950  95.638  1.00 23.87  ? 707 VAL A C   1 
ATOM   1547  O O   . VAL A 1 207 ? 12.424  58.165  95.857  1.00 22.68  ? 707 VAL A O   1 
ATOM   1548  C CB  . VAL A 1 207 ? 9.741   57.893  96.952  1.00 21.39  ? 707 VAL A CB  1 
ATOM   1549  C CG1 . VAL A 1 207 ? 9.651   59.033  97.966  1.00 15.55  ? 707 VAL A CG1 1 
ATOM   1550  C CG2 . VAL A 1 207 ? 8.438   57.128  96.876  1.00 21.16  ? 707 VAL A CG2 1 
ATOM   1551  N N   . PRO A 1 208 ? 11.728  60.263  95.443  1.00 25.47  ? 708 PRO A N   1 
ATOM   1552  C CA  . PRO A 1 208 ? 13.086  60.812  95.510  1.00 19.79  ? 708 PRO A CA  1 
ATOM   1553  C C   . PRO A 1 208 ? 13.678  60.718  96.909  1.00 24.67  ? 708 PRO A C   1 
ATOM   1554  O O   . PRO A 1 208 ? 12.963  60.378  97.847  1.00 22.63  ? 708 PRO A O   1 
ATOM   1555  C CB  . PRO A 1 208 ? 12.913  62.290  95.095  1.00 19.92  ? 708 PRO A CB  1 
ATOM   1556  C CG  . PRO A 1 208 ? 11.473  62.547  95.038  1.00 23.03  ? 708 PRO A CG  1 
ATOM   1557  C CD  . PRO A 1 208 ? 10.732  61.246  94.976  1.00 21.79  ? 708 PRO A CD  1 
ATOM   1558  N N   . LEU A 1 209 ? 14.969  61.026  97.030  1.00 22.37  ? 709 LEU A N   1 
ATOM   1559  C CA  . LEU A 1 209 ? 15.687  61.000  98.297  1.00 23.56  ? 709 LEU A CA  1 
ATOM   1560  C C   . LEU A 1 209 ? 15.050  61.937  99.336  1.00 26.20  ? 709 LEU A C   1 
ATOM   1561  O O   . LEU A 1 209 ? 14.894  61.576  100.497 1.00 22.53  ? 709 LEU A O   1 
ATOM   1562  C CB  . LEU A 1 209 ? 17.140  61.422  98.055  1.00 23.59  ? 709 LEU A CB  1 
ATOM   1563  C CG  . LEU A 1 209 ? 18.090  61.484  99.249  1.00 22.97  ? 709 LEU A CG  1 
ATOM   1564  C CD1 . LEU A 1 209 ? 18.354  60.081  99.799  1.00 24.11  ? 709 LEU A CD1 1 
ATOM   1565  C CD2 . LEU A 1 209 ? 19.381  62.116  98.806  1.00 23.60  ? 709 LEU A CD2 1 
ATOM   1566  N N   . LEU A 1 210 ? 14.726  63.153  98.901  1.00 21.25  ? 710 LEU A N   1 
ATOM   1567  C CA  . LEU A 1 210 ? 13.981  64.141  99.694  1.00 22.64  ? 710 LEU A CA  1 
ATOM   1568  C C   . LEU A 1 210 ? 14.725  64.736  100.876 1.00 21.82  ? 710 LEU A C   1 
ATOM   1569  O O   . LEU A 1 210 ? 14.716  65.948  101.081 1.00 28.86  ? 710 LEU A O   1 
ATOM   1570  C CB  . LEU A 1 210 ? 12.638  63.586  100.178 1.00 16.11  ? 710 LEU A CB  1 
ATOM   1571  C CG  . LEU A 1 210 ? 11.615  63.272  99.095  1.00 29.73  ? 710 LEU A CG  1 
ATOM   1572  C CD1 . LEU A 1 210 ? 10.343  62.663  99.696  1.00 36.17  ? 710 LEU A CD1 1 
ATOM   1573  C CD2 . LEU A 1 210 ? 11.298  64.521  98.301  1.00 32.78  ? 710 LEU A CD2 1 
ATOM   1574  N N   . MET A 1 211 ? 15.369  63.881  101.648 1.00 19.42  ? 711 MET A N   1 
ATOM   1575  C CA  . MET A 1 211 ? 15.822  64.251  102.982 1.00 21.31  ? 711 MET A CA  1 
ATOM   1576  C C   . MET A 1 211 ? 16.791  65.459  103.049 1.00 36.46  ? 711 MET A C   1 
ATOM   1577  O O   . MET A 1 211 ? 16.574  66.392  103.827 1.00 41.61  ? 711 MET A O   1 
ATOM   1578  C CB  . MET A 1 211 ? 16.383  63.014  103.680 1.00 18.07  ? 711 MET A CB  1 
ATOM   1579  C CG  . MET A 1 211 ? 16.115  62.951  105.144 1.00 26.11  ? 711 MET A CG  1 
ATOM   1580  S SD  . MET A 1 211 ? 14.468  63.448  105.699 1.00 28.39  ? 711 MET A SD  1 
ATOM   1581  C CE  . MET A 1 211 ? 14.891  63.565  107.432 1.00 15.11  ? 711 MET A CE  1 
ATOM   1582  N N   . PRO A 1 212 ? 17.855  65.457  102.234 1.00 27.52  ? 712 PRO A N   1 
ATOM   1583  C CA  . PRO A 1 212 ? 18.786  66.597  102.285 1.00 26.08  ? 712 PRO A CA  1 
ATOM   1584  C C   . PRO A 1 212 ? 18.194  67.925  101.767 1.00 31.09  ? 712 PRO A C   1 
ATOM   1585  O O   . PRO A 1 212 ? 18.629  68.980  102.224 1.00 26.95  ? 712 PRO A O   1 
ATOM   1586  C CB  . PRO A 1 212 ? 19.960  66.146  101.402 1.00 17.28  ? 712 PRO A CB  1 
ATOM   1587  C CG  . PRO A 1 212 ? 19.855  64.644  101.381 1.00 24.36  ? 712 PRO A CG  1 
ATOM   1588  C CD  . PRO A 1 212 ? 18.374  64.349  101.421 1.00 18.09  ? 712 PRO A CD  1 
ATOM   1589  N N   . LEU A 1 213 ? 17.238  67.867  100.839 1.00 23.02  ? 713 LEU A N   1 
ATOM   1590  C CA  . LEU A 1 213 ? 16.533  69.052  100.370 1.00 19.08  ? 713 LEU A CA  1 
ATOM   1591  C C   . LEU A 1 213 ? 15.567  69.597  101.436 1.00 30.61  ? 713 LEU A C   1 
ATOM   1592  O O   . LEU A 1 213 ? 15.538  70.781  101.724 1.00 33.03  ? 713 LEU A O   1 
ATOM   1593  C CB  . LEU A 1 213 ? 15.749  68.746  99.090  1.00 10.00  ? 713 LEU A CB  1 
ATOM   1594  C CG  . LEU A 1 213 ? 14.692  69.815  98.768  1.00 27.45  ? 713 LEU A CG  1 
ATOM   1595  C CD1 . LEU A 1 213 ? 15.289  70.951  97.949  1.00 27.21  ? 713 LEU A CD1 1 
ATOM   1596  C CD2 . LEU A 1 213 ? 13.483  69.230  98.053  1.00 26.72  ? 713 LEU A CD2 1 
ATOM   1597  N N   . VAL A 1 214 ? 14.758  68.710  101.996 1.00 34.78  ? 714 VAL A N   1 
ATOM   1598  C CA  . VAL A 1 214 ? 13.788  69.064  103.018 1.00 24.50  ? 714 VAL A CA  1 
ATOM   1599  C C   . VAL A 1 214 ? 14.464  69.660  104.264 1.00 28.16  ? 714 VAL A C   1 
ATOM   1600  O O   . VAL A 1 214 ? 13.872  70.474  104.985 1.00 30.11  ? 714 VAL A O   1 
ATOM   1601  C CB  . VAL A 1 214 ? 12.957  67.815  103.384 1.00 31.53  ? 714 VAL A CB  1 
ATOM   1602  C CG1 . VAL A 1 214 ? 12.453  67.872  104.822 1.00 42.54  ? 714 VAL A CG1 1 
ATOM   1603  C CG2 . VAL A 1 214 ? 11.819  67.629  102.382 1.00 28.08  ? 714 VAL A CG2 1 
ATOM   1604  N N   . THR A 1 215 ? 15.716  69.266  104.485 1.00 30.93  ? 715 THR A N   1 
ATOM   1605  C CA  . THR A 1 215 ? 16.481  69.638  105.670 1.00 30.11  ? 715 THR A CA  1 
ATOM   1606  C C   . THR A 1 215 ? 17.159  70.992  105.493 1.00 32.14  ? 715 THR A C   1 
ATOM   1607  O O   . THR A 1 215 ? 17.223  71.804  106.419 1.00 38.04  ? 715 THR A O   1 
ATOM   1608  C CB  . THR A 1 215 ? 17.545  68.573  105.971 1.00 35.96  ? 715 THR A CB  1 
ATOM   1609  O OG1 . THR A 1 215 ? 17.262  67.973  107.231 1.00 41.69  ? 715 THR A OG1 1 
ATOM   1610  C CG2 . THR A 1 215 ? 18.916  69.186  106.028 1.00 33.48  ? 715 THR A CG2 1 
ATOM   1611  N N   . LEU A 1 216 ? 17.661  71.223  104.287 1.00 33.05  ? 716 LEU A N   1 
ATOM   1612  C CA  . LEU A 1 216 ? 18.212  72.512  103.889 1.00 27.98  ? 716 LEU A CA  1 
ATOM   1613  C C   . LEU A 1 216 ? 17.160  73.620  104.018 1.00 28.69  ? 716 LEU A C   1 
ATOM   1614  O O   . LEU A 1 216 ? 17.459  74.735  104.456 1.00 34.38  ? 716 LEU A O   1 
ATOM   1615  C CB  . LEU A 1 216 ? 18.680  72.429  102.442 1.00 34.38  ? 716 LEU A CB  1 
ATOM   1616  C CG  . LEU A 1 216 ? 19.523  73.615  102.011 1.00 40.67  ? 716 LEU A CG  1 
ATOM   1617  C CD1 . LEU A 1 216 ? 20.753  73.656  102.901 1.00 38.72  ? 716 LEU A CD1 1 
ATOM   1618  C CD2 . LEU A 1 216 ? 19.891  73.491  100.538 1.00 35.59  ? 716 LEU A CD2 1 
ATOM   1619  N N   . MET A 1 217 ? 15.932  73.296  103.621 1.00 20.82  ? 717 MET A N   1 
ATOM   1620  C CA  . MET A 1 217 ? 14.782  74.186  103.744 1.00 26.35  ? 717 MET A CA  1 
ATOM   1621  C C   . MET A 1 217 ? 14.322  74.411  105.194 1.00 30.09  ? 717 MET A C   1 
ATOM   1622  O O   . MET A 1 217 ? 13.807  75.482  105.548 1.00 31.52  ? 717 MET A O   1 
ATOM   1623  C CB  . MET A 1 217 ? 13.624  73.619  102.927 1.00 27.31  ? 717 MET A CB  1 
ATOM   1624  C CG  . MET A 1 217 ? 13.976  73.392  101.461 1.00 21.13  ? 717 MET A CG  1 
ATOM   1625  S SD  . MET A 1 217 ? 12.509  73.035  100.489 1.00 36.11  ? 717 MET A SD  1 
ATOM   1626  C CE  . MET A 1 217 ? 11.573  74.573  100.658 1.00 34.43  ? 717 MET A CE  1 
ATOM   1627  N N   . GLU A 1 218 ? 14.505  73.402  106.033 1.00 27.88  ? 718 GLU A N   1 
ATOM   1628  C CA  . GLU A 1 218 ? 14.032  73.480  107.407 1.00 31.01  ? 718 GLU A CA  1 
ATOM   1629  C C   . GLU A 1 218 ? 15.205  73.650  108.369 1.00 34.14  ? 718 GLU A C   1 
ATOM   1630  O O   . GLU A 1 218 ? 15.717  72.676  108.923 1.00 36.89  ? 718 GLU A O   1 
ATOM   1631  C CB  . GLU A 1 218 ? 13.219  72.231  107.760 1.00 24.80  ? 718 GLU A CB  1 
ATOM   1632  C CG  . GLU A 1 218 ? 12.007  72.037  106.876 1.00 34.09  ? 718 GLU A CG  1 
ATOM   1633  C CD  . GLU A 1 218 ? 10.910  73.076  107.121 1.00 43.11  ? 718 GLU A CD  1 
ATOM   1634  O OE1 . GLU A 1 218 ? 10.975  73.812  108.133 1.00 48.15  ? 718 GLU A OE1 1 
ATOM   1635  O OE2 . GLU A 1 218 ? 9.979   73.154  106.293 1.00 39.18  ? 718 GLU A OE2 1 
ATOM   1636  N N   . ARG A 1 219 ? 15.618  74.897  108.565 1.00 31.41  ? 719 ARG A N   1 
ATOM   1637  C CA  . ARG A 1 219 ? 16.804  75.206  109.358 1.00 45.36  ? 719 ARG A CA  1 
ATOM   1638  C C   . ARG A 1 219 ? 16.634  74.793  110.826 1.00 46.37  ? 719 ARG A C   1 
ATOM   1639  O O   . ARG A 1 219 ? 17.616  74.654  111.557 1.00 40.83  ? 719 ARG A O   1 
ATOM   1640  C CB  . ARG A 1 219 ? 17.167  76.697  109.207 1.00 46.91  ? 719 ARG A CB  1 
ATOM   1641  C CG  . ARG A 1 219 ? 17.509  77.067  107.758 1.00 47.83  ? 719 ARG A CG  1 
ATOM   1642  C CD  . ARG A 1 219 ? 17.679  78.561  107.526 1.00 49.54  ? 719 ARG A CD  1 
ATOM   1643  N NE  . ARG A 1 219 ? 18.983  79.089  107.932 1.00 46.16  ? 719 ARG A NE  1 
ATOM   1644  C CZ  . ARG A 1 219 ? 19.214  79.683  109.102 1.00 48.22  ? 719 ARG A CZ  1 
ATOM   1645  N NH1 . ARG A 1 219 ? 18.236  79.817  109.987 1.00 49.17  ? 719 ARG A NH1 1 
ATOM   1646  N NH2 . ARG A 1 219 ? 20.420  80.141  109.396 1.00 47.24  ? 719 ARG A NH2 1 
ATOM   1647  N N   . GLN A 1 220 ? 15.386  74.570  111.233 1.00 45.67  ? 720 GLN A N   1 
ATOM   1648  C CA  . GLN A 1 220 ? 15.067  74.164  112.603 1.00 49.54  ? 720 GLN A CA  1 
ATOM   1649  C C   . GLN A 1 220 ? 14.765  72.672  112.711 1.00 46.52  ? 720 GLN A C   1 
ATOM   1650  O O   . GLN A 1 220 ? 14.229  72.214  113.720 1.00 48.50  ? 720 GLN A O   1 
ATOM   1651  C CB  . GLN A 1 220 ? 13.866  74.957  113.124 1.00 60.28  ? 720 GLN A CB  1 
ATOM   1652  C CG  . GLN A 1 220 ? 14.102  75.670  114.444 1.00 73.06  ? 720 GLN A CG  1 
ATOM   1653  C CD  . GLN A 1 220 ? 15.146  76.766  114.338 1.00 85.77  ? 720 GLN A CD  1 
ATOM   1654  O OE1 . GLN A 1 220 ? 16.021  76.726  113.473 1.00 90.09  ? 720 GLN A OE1 1 
ATOM   1655  N NE2 . GLN A 1 220 ? 15.055  77.758  115.219 1.00 92.78  ? 720 GLN A NE2 1 
ATOM   1656  N N   . ALA A 1 221 ? 15.092  71.920  111.664 1.00 44.36  ? 721 ALA A N   1 
ATOM   1657  C CA  . ALA A 1 221 ? 14.846  70.475  111.646 1.00 38.18  ? 721 ALA A CA  1 
ATOM   1658  C C   . ALA A 1 221 ? 15.759  69.730  112.601 1.00 38.68  ? 721 ALA A C   1 
ATOM   1659  O O   . ALA A 1 221 ? 16.967  69.979  112.651 1.00 37.57  ? 721 ALA A O   1 
ATOM   1660  C CB  . ALA A 1 221 ? 15.013  69.914  110.247 1.00 28.07  ? 721 ALA A CB  1 
ATOM   1661  N N   . VAL A 1 222 ? 15.173  68.806  113.353 1.00 36.81  ? 722 VAL A N   1 
ATOM   1662  C CA  . VAL A 1 222 ? 15.949  67.883  114.164 1.00 46.98  ? 722 VAL A CA  1 
ATOM   1663  C C   . VAL A 1 222 ? 16.043  66.563  113.408 1.00 51.17  ? 722 VAL A C   1 
ATOM   1664  O O   . VAL A 1 222 ? 15.055  66.115  112.819 1.00 57.48  ? 722 VAL A O   1 
ATOM   1665  C CB  . VAL A 1 222 ? 15.286  67.638  115.530 1.00 47.47  ? 722 VAL A CB  1 
ATOM   1666  C CG1 . VAL A 1 222 ? 16.246  66.911  116.457 1.00 43.91  ? 722 VAL A CG1 1 
ATOM   1667  C CG2 . VAL A 1 222 ? 14.821  68.965  116.146 1.00 47.53  ? 722 VAL A CG2 1 
ATOM   1668  N N   . THR A 1 223 ? 17.229  65.957  113.397 1.00 45.12  ? 723 THR A N   1 
ATOM   1669  C CA  . THR A 1 223 ? 17.384  64.595  112.876 1.00 47.95  ? 723 THR A CA  1 
ATOM   1670  C C   . THR A 1 223 ? 18.027  63.696  113.927 1.00 43.51  ? 723 THR A C   1 
ATOM   1671  O O   . THR A 1 223 ? 18.721  64.181  114.824 1.00 33.79  ? 723 THR A O   1 
ATOM   1672  C CB  . THR A 1 223 ? 18.247  64.550  111.603 1.00 45.15  ? 723 THR A CB  1 
ATOM   1673  O OG1 . THR A 1 223 ? 19.587  64.935  111.923 1.00 43.24  ? 723 THR A OG1 1 
ATOM   1674  C CG2 . THR A 1 223 ? 17.688  65.485  110.539 1.00 47.23  ? 723 THR A CG2 1 
ATOM   1675  N N   . PHE A 1 224 ? 17.803  62.389  113.821 1.00 45.28  ? 724 PHE A N   1 
ATOM   1676  C CA  . PHE A 1 224 ? 18.406  61.466  114.776 1.00 45.00  ? 724 PHE A CA  1 
ATOM   1677  C C   . PHE A 1 224 ? 19.925  61.380  114.594 1.00 43.99  ? 724 PHE A C   1 
ATOM   1678  O O   . PHE A 1 224 ? 20.412  61.150  113.489 1.00 44.77  ? 724 PHE A O   1 
ATOM   1679  C CB  . PHE A 1 224 ? 17.783  60.073  114.686 1.00 48.39  ? 724 PHE A CB  1 
ATOM   1680  C CG  . PHE A 1 224 ? 18.492  59.058  115.534 1.00 45.27  ? 724 PHE A CG  1 
ATOM   1681  C CD1 . PHE A 1 224 ? 19.527  58.301  115.008 1.00 38.49  ? 724 PHE A CD1 1 
ATOM   1682  C CD2 . PHE A 1 224 ? 18.163  58.905  116.870 1.00 44.97  ? 724 PHE A CD2 1 
ATOM   1683  C CE1 . PHE A 1 224 ? 20.201  57.390  115.791 1.00 44.01  ? 724 PHE A CE1 1 
ATOM   1684  C CE2 . PHE A 1 224 ? 18.836  57.996  117.663 1.00 46.33  ? 724 PHE A CE2 1 
ATOM   1685  C CZ  . PHE A 1 224 ? 19.857  57.237  117.124 1.00 46.08  ? 724 PHE A CZ  1 
ATOM   1686  N N   . GLU A 1 225 ? 20.666  61.559  115.684 1.00 47.35  ? 725 GLU A N   1 
ATOM   1687  C CA  . GLU A 1 225 ? 22.128  61.626  115.627 1.00 55.49  ? 725 GLU A CA  1 
ATOM   1688  C C   . GLU A 1 225 ? 22.645  62.743  114.707 1.00 54.65  ? 725 GLU A C   1 
ATOM   1689  O O   . GLU A 1 225 ? 23.800  62.728  114.273 1.00 53.14  ? 725 GLU A O   1 
ATOM   1690  C CB  . GLU A 1 225 ? 22.719  60.276  115.220 1.00 61.00  ? 725 GLU A CB  1 
ATOM   1691  C CG  . GLU A 1 225 ? 22.851  59.287  116.367 1.00 70.47  ? 725 GLU A CG  1 
ATOM   1692  C CD  . GLU A 1 225 ? 23.260  57.895  115.901 1.00 72.72  ? 725 GLU A CD  1 
ATOM   1693  O OE1 . GLU A 1 225 ? 23.697  57.754  114.735 1.00 72.57  ? 725 GLU A OE1 1 
ATOM   1694  O OE2 . GLU A 1 225 ? 23.133  56.943  116.700 1.00 68.89  ? 725 GLU A OE2 1 
ATOM   1695  N N   . GLY A 1 226 ? 21.777  63.704  114.405 1.00 55.04  ? 726 GLY A N   1 
ATOM   1696  C CA  . GLY A 1 226 ? 22.164  64.885  113.652 1.00 56.74  ? 726 GLY A CA  1 
ATOM   1697  C C   . GLY A 1 226 ? 22.823  64.665  112.301 1.00 53.98  ? 726 GLY A C   1 
ATOM   1698  O O   . GLY A 1 226 ? 23.823  65.310  111.998 1.00 58.67  ? 726 GLY A O   1 
ATOM   1699  N N   . THR A 1 227 ? 22.266  63.772  111.485 1.00 44.35  ? 727 THR A N   1 
ATOM   1700  C CA  . THR A 1 227 ? 22.715  63.610  110.102 1.00 41.21  ? 727 THR A CA  1 
ATOM   1701  C C   . THR A 1 227 ? 22.055  64.660  109.206 1.00 49.59  ? 727 THR A C   1 
ATOM   1702  O O   . THR A 1 227 ? 21.084  65.301  109.608 1.00 54.26  ? 727 THR A O   1 
ATOM   1703  C CB  . THR A 1 227 ? 22.377  62.213  109.561 1.00 39.01  ? 727 THR A CB  1 
ATOM   1704  O OG1 . THR A 1 227 ? 20.961  61.988  109.662 1.00 43.17  ? 727 THR A OG1 1 
ATOM   1705  C CG2 . THR A 1 227 ? 23.120  61.149  110.361 1.00 35.74  ? 727 THR A CG2 1 
ATOM   1706  N N   . ASP A 1 228 ? 22.576  64.833  107.993 1.00 54.65  ? 728 ASP A N   1 
ATOM   1707  C CA  . ASP A 1 228 ? 22.063  65.846  107.066 1.00 59.27  ? 728 ASP A CA  1 
ATOM   1708  C C   . ASP A 1 228 ? 21.898  67.209  107.752 1.00 59.01  ? 728 ASP A C   1 
ATOM   1709  O O   . ASP A 1 228 ? 20.923  67.930  107.519 1.00 49.21  ? 728 ASP A O   1 
ATOM   1710  C CB  . ASP A 1 228 ? 20.740  65.390  106.429 1.00 66.18  ? 728 ASP A CB  1 
ATOM   1711  C CG  . ASP A 1 228 ? 20.908  64.166  105.535 1.00 77.67  ? 728 ASP A CG  1 
ATOM   1712  O OD1 . ASP A 1 228 ? 21.372  64.325  104.385 1.00 84.93  ? 728 ASP A OD1 1 
ATOM   1713  O OD2 . ASP A 1 228 ? 20.573  63.045  105.979 1.00 77.16  ? 728 ASP A OD2 1 
ATOM   1714  N N   . MET A 1 229 ? 22.859  67.551  108.605 1.00 58.95  ? 729 MET A N   1 
ATOM   1715  C CA  . MET A 1 229 ? 22.835  68.827  109.311 1.00 56.89  ? 729 MET A CA  1 
ATOM   1716  C C   . MET A 1 229 ? 23.713  69.867  108.598 1.00 55.06  ? 729 MET A C   1 
ATOM   1717  O O   . MET A 1 229 ? 23.951  70.970  109.112 1.00 41.32  ? 729 MET A O   1 
ATOM   1718  C CB  . MET A 1 229 ? 23.263  68.654  110.775 1.00 51.65  ? 729 MET A CB  1 
ATOM   1719  C CG  . MET A 1 229 ? 22.189  68.081  111.693 1.00 53.59  ? 729 MET A CG  1 
ATOM   1720  S SD  . MET A 1 229 ? 20.700  69.100  111.839 1.00 58.07  ? 729 MET A SD  1 
ATOM   1721  C CE  . MET A 1 229 ? 19.816  68.655  110.346 1.00 51.67  ? 729 MET A CE  1 
ATOM   1722  N N   . TRP A 1 230 ? 24.199  69.503  107.414 1.00 52.98  ? 730 TRP A N   1 
ATOM   1723  C CA  . TRP A 1 230 ? 24.906  70.444  106.552 1.00 48.86  ? 730 TRP A CA  1 
ATOM   1724  C C   . TRP A 1 230 ? 26.035  71.203  107.273 1.00 55.95  ? 730 TRP A C   1 
ATOM   1725  O O   . TRP A 1 230 ? 26.084  72.434  107.255 1.00 61.06  ? 730 TRP A O   1 
ATOM   1726  C CB  . TRP A 1 230 ? 23.900  71.422  105.937 1.00 43.70  ? 730 TRP A CB  1 
ATOM   1727  C CG  . TRP A 1 230 ? 22.897  70.784  104.987 1.00 38.25  ? 730 TRP A CG  1 
ATOM   1728  C CD1 . TRP A 1 230 ? 21.620  70.368  105.279 1.00 29.92  ? 730 TRP A CD1 1 
ATOM   1729  C CD2 . TRP A 1 230 ? 23.094  70.518  103.592 1.00 30.24  ? 730 TRP A CD2 1 
ATOM   1730  N NE1 . TRP A 1 230 ? 21.021  69.845  104.148 1.00 36.31  ? 730 TRP A NE1 1 
ATOM   1731  C CE2 . TRP A 1 230 ? 21.903  69.929  103.103 1.00 32.02  ? 730 TRP A CE2 1 
ATOM   1732  C CE3 . TRP A 1 230 ? 24.162  70.716  102.712 1.00 24.05  ? 730 TRP A CE3 1 
ATOM   1733  C CZ2 . TRP A 1 230 ? 21.756  69.541  101.777 1.00 35.40  ? 730 TRP A CZ2 1 
ATOM   1734  C CZ3 . TRP A 1 230 ? 24.012  70.336  101.391 1.00 33.49  ? 730 TRP A CZ3 1 
ATOM   1735  C CH2 . TRP A 1 230 ? 22.818  69.754  100.936 1.00 36.95  ? 730 TRP A CH2 1 
ATOM   1736  N N   . GLU A 1 231 ? 26.938  70.464  107.908 1.00 61.09  ? 731 GLU A N   1 
ATOM   1737  C CA  . GLU A 1 231 ? 28.080  71.067  108.584 1.00 69.28  ? 731 GLU A CA  1 
ATOM   1738  C C   . GLU A 1 231 ? 29.349  70.731  107.827 1.00 74.13  ? 731 GLU A C   1 
ATOM   1739  O O   . GLU A 1 231 ? 29.299  70.150  106.746 1.00 74.24  ? 731 GLU A O   1 
ATOM   1740  C CB  . GLU A 1 231 ? 28.210  70.526  110.005 1.00 70.94  ? 731 GLU A CB  1 
ATOM   1741  C CG  . GLU A 1 231 ? 26.932  70.541  110.808 1.00 80.88  ? 731 GLU A CG  1 
ATOM   1742  C CD  . GLU A 1 231 ? 26.860  69.384  111.792 1.00 91.84  ? 731 GLU A CD  1 
ATOM   1743  O OE1 . GLU A 1 231 ? 26.228  69.551  112.857 1.00 98.01  ? 731 GLU A OE1 1 
ATOM   1744  O OE2 . GLU A 1 231 ? 27.432  68.308  111.498 1.00 91.41  ? 731 GLU A OE2 1 
ATOM   1745  N N   . LYS A 1 232 ? 30.487  71.073  108.420 1.00 77.06  ? 732 LYS A N   1 
ATOM   1746  C CA  . LYS A 1 232 ? 31.792  70.759  107.844 1.00 74.52  ? 732 LYS A CA  1 
ATOM   1747  C C   . LYS A 1 232 ? 31.766  70.708  106.315 1.00 67.24  ? 732 LYS A C   1 
ATOM   1748  O O   . LYS A 1 232 ? 31.361  71.673  105.662 1.00 66.67  ? 732 LYS A O   1 
ATOM   1749  C CB  . LYS A 1 232 ? 32.342  69.447  108.419 1.00 76.54  ? 732 LYS A CB  1 
ATOM   1750  C CG  . LYS A 1 232 ? 32.492  69.430  109.937 1.00 80.59  ? 732 LYS A CG  1 
ATOM   1751  C CD  . LYS A 1 232 ? 33.273  68.198  110.390 1.00 88.27  ? 732 LYS A CD  1 
ATOM   1752  C CE  . LYS A 1 232 ? 32.429  67.250  111.237 1.00 93.02  ? 732 LYS A CE  1 
ATOM   1753  N NZ  . LYS A 1 232 ? 32.048  67.852  112.549 1.00 96.71  ? 732 LYS A NZ  1 
ATOM   1754  N N   . ASN A 1 233 ? 32.190  69.578  105.752 1.00 57.75  ? 733 ASN A N   1 
ATOM   1755  C CA  . ASN A 1 233 ? 32.395  69.471  104.311 1.00 59.02  ? 733 ASN A CA  1 
ATOM   1756  C C   . ASN A 1 233 ? 31.124  69.487  103.475 1.00 59.59  ? 733 ASN A C   1 
ATOM   1757  O O   . ASN A 1 233 ? 31.178  69.452  102.246 1.00 60.71  ? 733 ASN A O   1 
ATOM   1758  C CB  . ASN A 1 233 ? 33.229  68.235  103.976 1.00 67.59  ? 733 ASN A CB  1 
ATOM   1759  C CG  . ASN A 1 233 ? 34.675  68.576  103.690 1.00 76.95  ? 733 ASN A CG  1 
ATOM   1760  O OD1 . ASN A 1 233 ? 35.073  68.727  102.533 1.00 77.85  ? 733 ASN A OD1 1 
ATOM   1761  N ND2 . ASN A 1 233 ? 35.470  68.714  104.746 1.00 82.20  ? 733 ASN A ND2 1 
ATOM   1762  N N   . ASP A 1 234 ? 29.979  69.542  104.140 1.00 59.09  ? 734 ASP A N   1 
ATOM   1763  C CA  . ASP A 1 234 ? 28.707  69.593  103.438 1.00 56.09  ? 734 ASP A CA  1 
ATOM   1764  C C   . ASP A 1 234 ? 28.346  71.027  103.026 1.00 50.23  ? 734 ASP A C   1 
ATOM   1765  O O   . ASP A 1 234 ? 27.647  71.227  102.040 1.00 51.28  ? 734 ASP A O   1 
ATOM   1766  C CB  . ASP A 1 234 ? 27.602  68.966  104.294 1.00 65.70  ? 734 ASP A CB  1 
ATOM   1767  C CG  . ASP A 1 234 ? 27.863  67.497  104.606 1.00 74.93  ? 734 ASP A CG  1 
ATOM   1768  O OD1 . ASP A 1 234 ? 28.165  66.732  103.661 1.00 70.74  ? 734 ASP A OD1 1 
ATOM   1769  O OD2 . ASP A 1 234 ? 27.769  67.111  105.798 1.00 81.85  ? 734 ASP A OD2 1 
ATOM   1770  N N   . GLN A 1 235 ? 28.832  72.015  103.779 1.00 50.87  ? 735 GLN A N   1 
ATOM   1771  C CA  . GLN A 1 235 ? 28.584  73.434  103.476 1.00 42.38  ? 735 GLN A CA  1 
ATOM   1772  C C   . GLN A 1 235 ? 29.277  73.833  102.175 1.00 32.04  ? 735 GLN A C   1 
ATOM   1773  O O   . GLN A 1 235 ? 30.279  74.556  102.188 1.00 31.16  ? 735 GLN A O   1 
ATOM   1774  C CB  . GLN A 1 235 ? 29.060  74.335  104.624 1.00 40.53  ? 735 GLN A CB  1 
ATOM   1775  C CG  . GLN A 1 235 ? 28.390  74.053  105.970 1.00 44.23  ? 735 GLN A CG  1 
ATOM   1776  C CD  . GLN A 1 235 ? 28.800  75.041  107.068 1.00 47.15  ? 735 GLN A CD  1 
ATOM   1777  O OE1 . GLN A 1 235 ? 29.822  75.722  106.968 1.00 50.37  ? 735 GLN A OE1 1 
ATOM   1778  N NE2 . GLN A 1 235 ? 27.991  75.120  108.119 1.00 44.17  ? 735 GLN A NE2 1 
ATOM   1779  N N   . SER A 1 236 ? 28.742  73.324  101.068 1.00 29.53  ? 736 SER A N   1 
ATOM   1780  C CA  . SER A 1 236 ? 29.273  73.539  99.732  1.00 37.77  ? 736 SER A CA  1 
ATOM   1781  C C   . SER A 1 236 ? 28.155  74.052  98.842  1.00 42.80  ? 736 SER A C   1 
ATOM   1782  O O   . SER A 1 236 ? 27.136  73.370  98.671  1.00 39.19  ? 736 SER A O   1 
ATOM   1783  C CB  . SER A 1 236 ? 29.779  72.214  99.153  1.00 41.09  ? 736 SER A CB  1 
ATOM   1784  O OG  . SER A 1 236 ? 29.734  72.213  97.730  1.00 42.12  ? 736 SER A OG  1 
ATOM   1785  N N   . CYS A 1 237 ? 28.333  75.244  98.272  1.00 37.30  ? 737 CYS A N   1 
ATOM   1786  C CA  . CYS A 1 237 ? 27.334  75.762  97.347  1.00 33.21  ? 737 CYS A CA  1 
ATOM   1787  C C   . CYS A 1 237 ? 27.070  74.786  96.232  1.00 28.44  ? 737 CYS A C   1 
ATOM   1788  O O   . CYS A 1 237 ? 25.931  74.639  95.793  1.00 29.97  ? 737 CYS A O   1 
ATOM   1789  C CB  . CYS A 1 237 ? 27.734  77.114  96.779  1.00 32.84  ? 737 CYS A CB  1 
ATOM   1790  S SG  . CYS A 1 237 ? 27.428  78.405  97.978  1.00 49.98  ? 737 CYS A SG  1 
ATOM   1791  N N   . GLU A 1 238 ? 28.117  74.111  95.771  1.00 24.66  ? 738 GLU A N   1 
ATOM   1792  C CA  . GLU A 1 238 ? 27.936  73.155  94.693  1.00 23.01  ? 738 GLU A CA  1 
ATOM   1793  C C   . GLU A 1 238 ? 26.907  72.082  95.063  1.00 26.55  ? 738 GLU A C   1 
ATOM   1794  O O   . GLU A 1 238 ? 25.921  71.885  94.342  1.00 28.38  ? 738 GLU A O   1 
ATOM   1795  C CB  . GLU A 1 238 ? 29.254  72.516  94.295  1.00 27.83  ? 738 GLU A CB  1 
ATOM   1796  C CG  . GLU A 1 238 ? 29.148  71.755  92.997  1.00 49.33  ? 738 GLU A CG  1 
ATOM   1797  C CD  . GLU A 1 238 ? 30.358  70.890  92.725  1.00 66.58  ? 738 GLU A CD  1 
ATOM   1798  O OE1 . GLU A 1 238 ? 31.209  70.747  93.626  1.00 67.28  ? 738 GLU A OE1 1 
ATOM   1799  O OE2 . GLU A 1 238 ? 30.454  70.350  91.606  1.00 77.42  ? 738 GLU A OE2 1 
ATOM   1800  N N   . ILE A 1 239 ? 27.114  71.405  96.194  1.00 28.13  ? 739 ILE A N   1 
ATOM   1801  C CA  . ILE A 1 239 ? 26.185  70.349  96.575  1.00 27.60  ? 739 ILE A CA  1 
ATOM   1802  C C   . ILE A 1 239 ? 24.782  70.912  96.809  1.00 28.98  ? 739 ILE A C   1 
ATOM   1803  O O   . ILE A 1 239 ? 23.796  70.289  96.394  1.00 30.06  ? 739 ILE A O   1 
ATOM   1804  C CB  . ILE A 1 239 ? 26.661  69.483  97.769  1.00 29.91  ? 739 ILE A CB  1 
ATOM   1805  C CG1 . ILE A 1 239 ? 27.961  68.764  97.423  1.00 38.54  ? 739 ILE A CG1 1 
ATOM   1806  C CG2 . ILE A 1 239 ? 25.633  68.425  98.094  1.00 22.69  ? 739 ILE A CG2 1 
ATOM   1807  C CD1 . ILE A 1 239 ? 29.175  69.661  97.495  1.00 55.19  ? 739 ILE A CD1 1 
ATOM   1808  N N   . MET A 1 240 ? 24.684  72.088  97.433  1.00 23.14  ? 740 MET A N   1 
ATOM   1809  C CA  . MET A 1 240 ? 23.365  72.640  97.731  1.00 27.25  ? 740 MET A CA  1 
ATOM   1810  C C   . MET A 1 240 ? 22.656  72.994  96.428  1.00 27.75  ? 740 MET A C   1 
ATOM   1811  O O   . MET A 1 240 ? 21.444  72.814  96.301  1.00 31.54  ? 740 MET A O   1 
ATOM   1812  C CB  . MET A 1 240 ? 23.449  73.849  98.664  1.00 33.24  ? 740 MET A CB  1 
ATOM   1813  C CG  . MET A 1 240 ? 23.934  73.530  100.068 1.00 32.05  ? 740 MET A CG  1 
ATOM   1814  S SD  . MET A 1 240 ? 24.390  75.024  100.997 1.00 30.34  ? 740 MET A SD  1 
ATOM   1815  C CE  . MET A 1 240 ? 25.391  75.867  99.777  1.00 58.14  ? 740 MET A CE  1 
ATOM   1816  N N   . LEU A 1 241 ? 23.422  73.453  95.447  1.00 13.13  ? 741 LEU A N   1 
ATOM   1817  C CA  . LEU A 1 241 ? 22.870  73.738  94.137  1.00 14.06  ? 741 LEU A CA  1 
ATOM   1818  C C   . LEU A 1 241 ? 22.310  72.464  93.489  1.00 20.22  ? 741 LEU A C   1 
ATOM   1819  O O   . LEU A 1 241 ? 21.213  72.478  92.919  1.00 27.78  ? 741 LEU A O   1 
ATOM   1820  C CB  . LEU A 1 241 ? 23.931  74.374  93.224  1.00 21.25  ? 741 LEU A CB  1 
ATOM   1821  C CG  . LEU A 1 241 ? 23.528  75.507  92.262  1.00 28.45  ? 741 LEU A CG  1 
ATOM   1822  C CD1 . LEU A 1 241 ? 24.452  75.530  91.073  1.00 24.66  ? 741 LEU A CD1 1 
ATOM   1823  C CD2 . LEU A 1 241 ? 22.081  75.431  91.778  1.00 15.14  ? 741 LEU A CD2 1 
ATOM   1824  N N   . ASN A 1 242 ? 23.054  71.365  93.557  1.00 20.03  ? 742 ASN A N   1 
ATOM   1825  C CA  . ASN A 1 242 ? 22.567  70.121  92.951  1.00 16.73  ? 742 ASN A CA  1 
ATOM   1826  C C   . ASN A 1 242 ? 21.178  69.728  93.474  1.00 14.93  ? 742 ASN A C   1 
ATOM   1827  O O   . ASN A 1 242 ? 20.278  69.464  92.693  1.00 15.56  ? 742 ASN A O   1 
ATOM   1828  C CB  . ASN A 1 242 ? 23.571  68.966  93.105  1.00 14.78  ? 742 ASN A CB  1 
ATOM   1829  C CG  . ASN A 1 242 ? 24.870  69.201  92.324  1.00 20.94  ? 742 ASN A CG  1 
ATOM   1830  O OD1 . ASN A 1 242 ? 24.863  69.745  91.223  1.00 25.52  ? 742 ASN A OD1 1 
ATOM   1831  N ND2 . ASN A 1 242 ? 25.981  68.787  92.897  1.00 22.96  ? 742 ASN A ND2 1 
ATOM   1832  N N   . HIS A 1 243 ? 21.001  69.701  94.792  1.00 13.34  ? 743 HIS A N   1 
ATOM   1833  C CA  . HIS A 1 243 ? 19.705  69.357  95.347  1.00 18.03  ? 743 HIS A CA  1 
ATOM   1834  C C   . HIS A 1 243 ? 18.632  70.377  94.926  1.00 26.48  ? 743 HIS A C   1 
ATOM   1835  O O   . HIS A 1 243 ? 17.521  69.990  94.562  1.00 23.83  ? 743 HIS A O   1 
ATOM   1836  C CB  . HIS A 1 243 ? 19.749  69.216  96.887  1.00 21.60  ? 743 HIS A CB  1 
ATOM   1837  C CG  . HIS A 1 243 ? 20.641  68.118  97.381  1.00 32.13  ? 743 HIS A CG  1 
ATOM   1838  N ND1 . HIS A 1 243 ? 20.236  66.799  97.449  1.00 32.94  ? 743 HIS A ND1 1 
ATOM   1839  C CD2 . HIS A 1 243 ? 21.912  68.144  97.848  1.00 32.35  ? 743 HIS A CD2 1 
ATOM   1840  C CE1 . HIS A 1 243 ? 21.221  66.060  97.926  1.00 18.98  ? 743 HIS A CE1 1 
ATOM   1841  N NE2 . HIS A 1 243 ? 22.248  66.851  98.179  1.00 32.30  ? 743 HIS A NE2 1 
ATOM   1842  N N   . LEU A 1 244 ? 18.942  71.674  94.977  1.00 25.23  ? 744 LEU A N   1 
ATOM   1843  C CA  . LEU A 1 244 ? 17.909  72.668  94.673  1.00 22.37  ? 744 LEU A CA  1 
ATOM   1844  C C   . LEU A 1 244 ? 17.557  72.699  93.187  1.00 27.55  ? 744 LEU A C   1 
ATOM   1845  O O   . LEU A 1 244 ? 16.402  72.901  92.826  1.00 33.74  ? 744 LEU A O   1 
ATOM   1846  C CB  . LEU A 1 244 ? 18.282  74.063  95.172  1.00 20.51  ? 744 LEU A CB  1 
ATOM   1847  C CG  . LEU A 1 244 ? 18.039  74.287  96.668  1.00 27.27  ? 744 LEU A CG  1 
ATOM   1848  C CD1 . LEU A 1 244 ? 18.440  75.690  97.036  1.00 38.08  ? 744 LEU A CD1 1 
ATOM   1849  C CD2 . LEU A 1 244 ? 16.594  74.051  97.010  1.00 26.65  ? 744 LEU A CD2 1 
ATOM   1850  N N   . ALA A 1 245 ? 18.547  72.509  92.323  1.00 19.00  ? 745 ALA A N   1 
ATOM   1851  C CA  . ALA A 1 245 ? 18.252  72.367  90.904  1.00 35.14  ? 745 ALA A CA  1 
ATOM   1852  C C   . ALA A 1 245 ? 17.376  71.125  90.702  1.00 29.25  ? 745 ALA A C   1 
ATOM   1853  O O   . ALA A 1 245 ? 16.471  71.096  89.860  1.00 27.96  ? 745 ALA A O   1 
ATOM   1854  C CB  . ALA A 1 245 ? 19.535  72.253  90.099  1.00 29.87  ? 745 ALA A CB  1 
ATOM   1855  N N   . THR A 1 246 ? 17.642  70.109  91.508  1.00 16.53  ? 746 THR A N   1 
ATOM   1856  C CA  . THR A 1 246 ? 16.939  68.845  91.378  1.00 23.92  ? 746 THR A CA  1 
ATOM   1857  C C   . THR A 1 246 ? 15.523  68.965  91.901  1.00 25.38  ? 746 THR A C   1 
ATOM   1858  O O   . THR A 1 246 ? 14.598  68.438  91.299  1.00 25.27  ? 746 THR A O   1 
ATOM   1859  C CB  . THR A 1 246 ? 17.691  67.723  92.096  1.00 20.74  ? 746 THR A CB  1 
ATOM   1860  O OG1 . THR A 1 246 ? 18.902  67.464  91.378  1.00 21.64  ? 746 THR A OG1 1 
ATOM   1861  C CG2 . THR A 1 246 ? 16.854  66.452  92.145  1.00 16.76  ? 746 THR A CG2 1 
ATOM   1862  N N   . ALA A 1 247 ? 15.367  69.671  93.017  1.00 25.11  ? 747 ALA A N   1 
ATOM   1863  C CA  . ALA A 1 247 ? 14.059  69.970  93.588  1.00 23.87  ? 747 ALA A CA  1 
ATOM   1864  C C   . ALA A 1 247 ? 13.139  70.611  92.550  1.00 28.38  ? 747 ALA A C   1 
ATOM   1865  O O   . ALA A 1 247 ? 11.985  70.214  92.402  1.00 37.87  ? 747 ALA A O   1 
ATOM   1866  C CB  . ALA A 1 247 ? 14.214  70.881  94.807  1.00 22.98  ? 747 ALA A CB  1 
ATOM   1867  N N   . ARG A 1 248 ? 13.657  71.590  91.816  1.00 24.09  ? 748 ARG A N   1 
ATOM   1868  C CA  . ARG A 1 248 ? 12.847  72.306  90.840  1.00 33.79  ? 748 ARG A CA  1 
ATOM   1869  C C   . ARG A 1 248 ? 12.404  71.396  89.698  1.00 36.46  ? 748 ARG A C   1 
ATOM   1870  O O   . ARG A 1 248 ? 11.263  71.465  89.226  1.00 38.62  ? 748 ARG A O   1 
ATOM   1871  C CB  . ARG A 1 248 ? 13.602  73.510  90.285  1.00 38.53  ? 748 ARG A CB  1 
ATOM   1872  C CG  . ARG A 1 248 ? 13.389  73.707  88.796  1.00 56.57  ? 748 ARG A CG  1 
ATOM   1873  C CD  . ARG A 1 248 ? 13.423  75.174  88.425  1.00 74.59  ? 748 ARG A CD  1 
ATOM   1874  N NE  . ARG A 1 248 ? 13.450  75.370  86.980  1.00 86.90  ? 748 ARG A NE  1 
ATOM   1875  C CZ  . ARG A 1 248 ? 14.566  75.491  86.269  1.00 96.70  ? 748 ARG A CZ  1 
ATOM   1876  N NH1 . ARG A 1 248 ? 15.744  75.433  86.878  1.00 92.82  ? 748 ARG A NH1 1 
ATOM   1877  N NH2 . ARG A 1 248 ? 14.506  75.670  84.953  1.00 103.46 ? 748 ARG A NH2 1 
ATOM   1878  N N   . PHE A 1 249 ? 13.325  70.561  89.240  1.00 28.15  ? 749 PHE A N   1 
ATOM   1879  C CA  . PHE A 1 249 ? 12.997  69.513  88.288  1.00 25.26  ? 749 PHE A CA  1 
ATOM   1880  C C   . PHE A 1 249 ? 11.927  68.539  88.857  1.00 25.53  ? 749 PHE A C   1 
ATOM   1881  O O   . PHE A 1 249 ? 10.969  68.179  88.183  1.00 23.49  ? 749 PHE A O   1 
ATOM   1882  C CB  . PHE A 1 249 ? 14.282  68.798  87.880  1.00 29.48  ? 749 PHE A CB  1 
ATOM   1883  C CG  . PHE A 1 249 ? 14.061  67.632  87.010  1.00 38.83  ? 749 PHE A CG  1 
ATOM   1884  C CD1 . PHE A 1 249 ? 13.444  67.783  85.785  1.00 40.90  ? 749 PHE A CD1 1 
ATOM   1885  C CD2 . PHE A 1 249 ? 14.459  66.376  87.415  1.00 51.71  ? 749 PHE A CD2 1 
ATOM   1886  C CE1 . PHE A 1 249 ? 13.225  66.700  84.975  1.00 50.32  ? 749 PHE A CE1 1 
ATOM   1887  C CE2 . PHE A 1 249 ? 14.249  65.281  86.610  1.00 63.71  ? 749 PHE A CE2 1 
ATOM   1888  C CZ  . PHE A 1 249 ? 13.629  65.442  85.385  1.00 62.59  ? 749 PHE A CZ  1 
ATOM   1889  N N   . MET A 1 250 ? 12.075  68.155  90.115  1.00 25.85  ? 750 MET A N   1 
ATOM   1890  C CA  . MET A 1 250 ? 11.119  67.272  90.768  1.00 26.35  ? 750 MET A CA  1 
ATOM   1891  C C   . MET A 1 250 ? 9.706   67.831  90.654  1.00 36.67  ? 750 MET A C   1 
ATOM   1892  O O   . MET A 1 250 ? 8.760   67.109  90.314  1.00 32.23  ? 750 MET A O   1 
ATOM   1893  C CB  . MET A 1 250 ? 11.498  67.105  92.247  1.00 22.21  ? 750 MET A CB  1 
ATOM   1894  C CG  . MET A 1 250 ? 10.631  66.151  93.022  1.00 22.72  ? 750 MET A CG  1 
ATOM   1895  S SD  . MET A 1 250 ? 11.090  66.142  94.763  1.00 30.06  ? 750 MET A SD  1 
ATOM   1896  C CE  . MET A 1 250 ? 10.903  67.877  95.147  1.00 42.76  ? 750 MET A CE  1 
ATOM   1897  N N   . ALA A 1 251 ? 9.566   69.123  90.934  1.00 31.14  ? 751 ALA A N   1 
ATOM   1898  C CA  . ALA A 1 251 ? 8.242   69.723  91.032  1.00 31.13  ? 751 ALA A CA  1 
ATOM   1899  C C   . ALA A 1 251 ? 7.596   69.799  89.664  1.00 29.15  ? 751 ALA A C   1 
ATOM   1900  O O   . ALA A 1 251 ? 6.417   69.480  89.497  1.00 36.33  ? 751 ALA A O   1 
ATOM   1901  C CB  . ALA A 1 251 ? 8.321   71.096  91.675  1.00 29.01  ? 751 ALA A CB  1 
ATOM   1902  N N   . GLU A 1 252 ? 8.368   70.214  88.674  1.00 24.57  ? 752 GLU A N   1 
ATOM   1903  C CA  . GLU A 1 252 ? 7.841   70.251  87.321  1.00 37.43  ? 752 GLU A CA  1 
ATOM   1904  C C   . GLU A 1 252 ? 7.499   68.860  86.795  1.00 48.95  ? 752 GLU A C   1 
ATOM   1905  O O   . GLU A 1 252 ? 6.555   68.699  86.019  1.00 50.66  ? 752 GLU A O   1 
ATOM   1906  C CB  . GLU A 1 252 ? 8.818   70.934  86.382  1.00 42.25  ? 752 GLU A CB  1 
ATOM   1907  C CG  . GLU A 1 252 ? 8.345   72.303  85.941  1.00 62.06  ? 752 GLU A CG  1 
ATOM   1908  C CD  . GLU A 1 252 ? 9.315   72.957  84.986  1.00 76.86  ? 752 GLU A CD  1 
ATOM   1909  O OE1 . GLU A 1 252 ? 10.362  73.457  85.456  1.00 71.51  ? 752 GLU A OE1 1 
ATOM   1910  O OE2 . GLU A 1 252 ? 9.033   72.956  83.765  1.00 87.54  ? 752 GLU A OE2 1 
ATOM   1911  N N   . ALA A 1 253 ? 8.264   67.855  87.217  1.00 44.63  ? 753 ALA A N   1 
ATOM   1912  C CA  . ALA A 1 253 ? 8.051   66.495  86.738  1.00 34.24  ? 753 ALA A CA  1 
ATOM   1913  C C   . ALA A 1 253 ? 7.349   65.598  87.750  1.00 33.16  ? 753 ALA A C   1 
ATOM   1914  O O   . ALA A 1 253 ? 7.353   64.384  87.591  1.00 35.57  ? 753 ALA A O   1 
ATOM   1915  C CB  . ALA A 1 253 ? 9.367   65.870  86.315  1.00 26.77  ? 753 ALA A CB  1 
ATOM   1916  N N   . ALA A 1 254 ? 6.744   66.192  88.777  1.00 34.61  ? 754 ALA A N   1 
ATOM   1917  C CA  . ALA A 1 254 ? 6.073   65.432  89.845  1.00 30.97  ? 754 ALA A CA  1 
ATOM   1918  C C   . ALA A 1 254 ? 5.247   64.239  89.332  1.00 34.64  ? 754 ALA A C   1 
ATOM   1919  O O   . ALA A 1 254 ? 5.193   63.176  89.958  1.00 29.57  ? 754 ALA A O   1 
ATOM   1920  C CB  . ALA A 1 254 ? 5.195   66.363  90.690  1.00 27.00  ? 754 ALA A CB  1 
ATOM   1921  N N   . ASP A 1 255 ? 4.604   64.415  88.186  1.00 35.02  ? 755 ASP A N   1 
ATOM   1922  C CA  . ASP A 1 255 ? 3.724   63.385  87.682  1.00 31.07  ? 755 ASP A CA  1 
ATOM   1923  C C   . ASP A 1 255 ? 4.454   62.092  87.319  1.00 35.25  ? 755 ASP A C   1 
ATOM   1924  O O   . ASP A 1 255 ? 3.942   61.000  87.557  1.00 30.49  ? 755 ASP A O   1 
ATOM   1925  C CB  . ASP A 1 255 ? 2.929   63.904  86.498  1.00 43.30  ? 755 ASP A CB  1 
ATOM   1926  C CG  . ASP A 1 255 ? 1.559   63.297  86.431  1.00 59.43  ? 755 ASP A CG  1 
ATOM   1927  O OD1 . ASP A 1 255 ? 0.688   63.730  87.220  1.00 66.07  ? 755 ASP A OD1 1 
ATOM   1928  O OD2 . ASP A 1 255 ? 1.361   62.382  85.603  1.00 63.27  ? 755 ASP A OD2 1 
ATOM   1929  N N   . SER A 1 256 ? 5.650   62.219  86.751  1.00 33.14  ? 756 SER A N   1 
ATOM   1930  C CA  . SER A 1 256 ? 6.424   61.054  86.335  1.00 30.75  ? 756 SER A CA  1 
ATOM   1931  C C   . SER A 1 256 ? 6.658   60.073  87.497  1.00 27.95  ? 756 SER A C   1 
ATOM   1932  O O   . SER A 1 256 ? 6.680   58.854  87.293  1.00 29.37  ? 756 SER A O   1 
ATOM   1933  C CB  . SER A 1 256 ? 7.755   61.484  85.692  1.00 30.16  ? 756 SER A CB  1 
ATOM   1934  O OG  . SER A 1 256 ? 8.686   61.901  86.672  1.00 29.43  ? 756 SER A OG  1 
ATOM   1935  N N   . TYR A 1 257 ? 6.825   60.607  88.706  1.00 19.21  ? 757 TYR A N   1 
ATOM   1936  C CA  . TYR A 1 257 ? 6.958   59.776  89.898  1.00 18.96  ? 757 TYR A CA  1 
ATOM   1937  C C   . TYR A 1 257 ? 5.704   58.926  90.158  1.00 25.91  ? 757 TYR A C   1 
ATOM   1938  O O   . TYR A 1 257 ? 5.796   57.717  90.403  1.00 19.27  ? 757 TYR A O   1 
ATOM   1939  C CB  . TYR A 1 257 ? 7.268   60.630  91.125  1.00 12.16  ? 757 TYR A CB  1 
ATOM   1940  C CG  . TYR A 1 257 ? 8.582   61.354  91.026  1.00 27.31  ? 757 TYR A CG  1 
ATOM   1941  C CD1 . TYR A 1 257 ? 9.769   60.720  91.332  1.00 26.44  ? 757 TYR A CD1 1 
ATOM   1942  C CD2 . TYR A 1 257 ? 8.630   62.689  90.643  1.00 28.83  ? 757 TYR A CD2 1 
ATOM   1943  C CE1 . TYR A 1 257 ? 10.968  61.394  91.248  1.00 36.46  ? 757 TYR A CE1 1 
ATOM   1944  C CE2 . TYR A 1 257 ? 9.813   63.359  90.551  1.00 16.09  ? 757 TYR A CE2 1 
ATOM   1945  C CZ  . TYR A 1 257 ? 10.982  62.713  90.847  1.00 28.91  ? 757 TYR A CZ  1 
ATOM   1946  O OH  . TYR A 1 257 ? 12.167  63.402  90.743  1.00 29.36  ? 757 TYR A OH  1 
ATOM   1947  N N   . ARG A 1 258 ? 4.542   59.577  90.118  1.00 22.12  ? 758 ARG A N   1 
ATOM   1948  C CA  . ARG A 1 258 ? 3.258   58.910  90.293  1.00 25.90  ? 758 ARG A CA  1 
ATOM   1949  C C   . ARG A 1 258 ? 3.175   57.777  89.293  1.00 25.71  ? 758 ARG A C   1 
ATOM   1950  O O   . ARG A 1 258 ? 2.711   56.683  89.603  1.00 35.31  ? 758 ARG A O   1 
ATOM   1951  C CB  . ARG A 1 258 ? 2.118   59.898  90.001  1.00 24.31  ? 758 ARG A CB  1 
ATOM   1952  C CG  . ARG A 1 258 ? 0.827   59.605  90.742  1.00 36.29  ? 758 ARG A CG  1 
ATOM   1953  C CD  . ARG A 1 258 ? -0.337  59.362  89.803  1.00 42.01  ? 758 ARG A CD  1 
ATOM   1954  N NE  . ARG A 1 258 ? -0.462  60.421  88.816  1.00 52.22  ? 758 ARG A NE  1 
ATOM   1955  C CZ  . ARG A 1 258 ? -0.553  60.212  87.506  1.00 58.86  ? 758 ARG A CZ  1 
ATOM   1956  N NH1 . ARG A 1 258 ? -0.552  58.979  87.018  1.00 53.31  ? 758 ARG A NH1 1 
ATOM   1957  N NH2 . ARG A 1 258 ? -0.658  61.240  86.681  1.00 63.80  ? 758 ARG A NH2 1 
ATOM   1958  N N   . MET A 1 259 ? 3.617   58.091  88.080  1.00 25.50  ? 759 MET A N   1 
ATOM   1959  C CA  . MET A 1 259 ? 3.594   57.215  86.929  1.00 33.69  ? 759 MET A CA  1 
ATOM   1960  C C   . MET A 1 259 ? 4.357   55.936  87.258  1.00 35.83  ? 759 MET A C   1 
ATOM   1961  O O   . MET A 1 259 ? 3.878   54.828  87.022  1.00 32.96  ? 759 MET A O   1 
ATOM   1962  C CB  . MET A 1 259 ? 4.289   57.939  85.775  1.00 41.87  ? 759 MET A CB  1 
ATOM   1963  C CG  . MET A 1 259 ? 3.653   57.747  84.428  1.00 46.86  ? 759 MET A CG  1 
ATOM   1964  S SD  . MET A 1 259 ? 2.035   58.504  84.357  1.00 46.73  ? 759 MET A SD  1 
ATOM   1965  C CE  . MET A 1 259 ? 2.253   59.555  82.928  1.00 29.66  ? 759 MET A CE  1 
ATOM   1966  N N   . ASN A 1 260 ? 5.547   56.116  87.821  1.00 24.20  ? 760 ASN A N   1 
ATOM   1967  C CA  . ASN A 1 260 ? 6.435   55.023  88.156  1.00 27.34  ? 760 ASN A CA  1 
ATOM   1968  C C   . ASN A 1 260 ? 5.838   54.183  89.277  1.00 31.03  ? 760 ASN A C   1 
ATOM   1969  O O   . ASN A 1 260 ? 5.822   52.943  89.201  1.00 27.98  ? 760 ASN A O   1 
ATOM   1970  C CB  . ASN A 1 260 ? 7.814   55.568  88.561  1.00 19.49  ? 760 ASN A CB  1 
ATOM   1971  C CG  . ASN A 1 260 ? 8.945   54.656  88.136  1.00 22.55  ? 760 ASN A CG  1 
ATOM   1972  O OD1 . ASN A 1 260 ? 9.215   54.493  86.940  1.00 21.32  ? 760 ASN A OD1 1 
ATOM   1973  N ND2 . ASN A 1 260 ? 9.627   54.066  89.114  1.00 15.76  ? 760 ASN A ND2 1 
ATOM   1974  N N   . ALA A 1 261 ? 5.323   54.864  90.299  1.00 13.26  ? 761 ALA A N   1 
ATOM   1975  C CA  . ALA A 1 261 ? 4.805   54.179  91.466  1.00 21.29  ? 761 ALA A CA  1 
ATOM   1976  C C   . ALA A 1 261 ? 3.572   53.352  91.098  1.00 31.04  ? 761 ALA A C   1 
ATOM   1977  O O   . ALA A 1 261 ? 3.402   52.232  91.587  1.00 27.08  ? 761 ALA A O   1 
ATOM   1978  C CB  . ALA A 1 261 ? 4.500   55.160  92.580  1.00 11.53  ? 761 ALA A CB  1 
ATOM   1979  N N   . GLU A 1 262 ? 2.735   53.896  90.216  1.00 28.25  ? 762 GLU A N   1 
ATOM   1980  C CA  . GLU A 1 262 ? 1.554   53.181  89.733  1.00 23.40  ? 762 GLU A CA  1 
ATOM   1981  C C   . GLU A 1 262 ? 1.905   51.932  88.912  1.00 27.33  ? 762 GLU A C   1 
ATOM   1982  O O   . GLU A 1 262 ? 1.241   50.908  89.023  1.00 30.91  ? 762 GLU A O   1 
ATOM   1983  C CB  . GLU A 1 262 ? 0.630   54.116  88.945  1.00 19.65  ? 762 GLU A CB  1 
ATOM   1984  C CG  . GLU A 1 262 ? -0.752  54.269  89.585  1.00 39.13  ? 762 GLU A CG  1 
ATOM   1985  C CD  . GLU A 1 262 ? -1.466  55.566  89.224  1.00 52.15  ? 762 GLU A CD  1 
ATOM   1986  O OE1 . GLU A 1 262 ? -0.852  56.433  88.577  1.00 42.23  ? 762 GLU A OE1 1 
ATOM   1987  O OE2 . GLU A 1 262 ? -2.651  55.720  89.599  1.00 66.74  ? 762 GLU A OE2 1 
ATOM   1988  N N   . ARG A 1 263 ? 2.955   52.030  88.100  1.00 28.94  ? 763 ARG A N   1 
ATOM   1989  C CA  . ARG A 1 263 ? 3.415   50.920  87.275  1.00 28.86  ? 763 ARG A CA  1 
ATOM   1990  C C   . ARG A 1 263 ? 3.943   49.790  88.148  1.00 26.10  ? 763 ARG A C   1 
ATOM   1991  O O   . ARG A 1 263 ? 3.567   48.622  87.976  1.00 26.73  ? 763 ARG A O   1 
ATOM   1992  C CB  . ARG A 1 263 ? 4.517   51.395  86.325  1.00 29.29  ? 763 ARG A CB  1 
ATOM   1993  C CG  . ARG A 1 263 ? 5.233   50.292  85.572  1.00 22.25  ? 763 ARG A CG  1 
ATOM   1994  C CD  . ARG A 1 263 ? 6.328   50.843  84.645  1.00 21.22  ? 763 ARG A CD  1 
ATOM   1995  N NE  . ARG A 1 263 ? 7.378   51.551  85.386  1.00 22.36  ? 763 ARG A NE  1 
ATOM   1996  C CZ  . ARG A 1 263 ? 8.487   50.972  85.847  1.00 25.00  ? 763 ARG A CZ  1 
ATOM   1997  N NH1 . ARG A 1 263 ? 8.688   49.682  85.639  1.00 18.84  ? 763 ARG A NH1 1 
ATOM   1998  N NH2 . ARG A 1 263 ? 9.400   51.673  86.509  1.00 22.55  ? 763 ARG A NH2 1 
ATOM   1999  N N   . ILE A 1 264 ? 4.805   50.157  89.090  1.00 19.06  ? 764 ILE A N   1 
ATOM   2000  C CA  . ILE A 1 264 ? 5.434   49.206  90.000  1.00 27.91  ? 764 ILE A CA  1 
ATOM   2001  C C   . ILE A 1 264 ? 4.413   48.500  90.888  1.00 29.38  ? 764 ILE A C   1 
ATOM   2002  O O   . ILE A 1 264 ? 4.517   47.293  91.144  1.00 26.96  ? 764 ILE A O   1 
ATOM   2003  C CB  . ILE A 1 264 ? 6.528   49.891  90.854  1.00 24.66  ? 764 ILE A CB  1 
ATOM   2004  C CG1 . ILE A 1 264 ? 7.723   50.255  89.966  1.00 26.74  ? 764 ILE A CG1 1 
ATOM   2005  C CG2 . ILE A 1 264 ? 6.987   48.992  92.000  1.00 18.57  ? 764 ILE A CG2 1 
ATOM   2006  C CD1 . ILE A 1 264 ? 8.762   51.094  90.662  1.00 19.79  ? 764 ILE A CD1 1 
ATOM   2007  N N   . LEU A 1 265 ? 3.402   49.242  91.312  1.00 28.71  ? 765 LEU A N   1 
ATOM   2008  C CA  . LEU A 1 265 ? 2.429   48.730  92.268  1.00 21.84  ? 765 LEU A CA  1 
ATOM   2009  C C   . LEU A 1 265 ? 1.130   48.237  91.640  1.00 19.14  ? 765 LEU A C   1 
ATOM   2010  O O   . LEU A 1 265 ? 0.172   47.920  92.355  1.00 17.39  ? 765 LEU A O   1 
ATOM   2011  C CB  . LEU A 1 265 ? 2.095   49.816  93.279  1.00 19.96  ? 765 LEU A CB  1 
ATOM   2012  C CG  . LEU A 1 265 ? 3.226   50.178  94.210  1.00 22.37  ? 765 LEU A CG  1 
ATOM   2013  C CD1 . LEU A 1 265 ? 2.718   51.208  95.223  1.00 20.29  ? 765 LEU A CD1 1 
ATOM   2014  C CD2 . LEU A 1 265 ? 3.723   48.909  94.874  1.00 17.24  ? 765 LEU A CD2 1 
ATOM   2015  N N   . ALA A 1 266 ? 1.069   48.196  90.316  1.00 17.36  ? 766 ALA A N   1 
ATOM   2016  C CA  . ALA A 1 266 ? -0.142  47.696  89.669  1.00 15.29  ? 766 ALA A CA  1 
ATOM   2017  C C   . ALA A 1 266 ? -0.449  46.307  90.214  1.00 27.96  ? 766 ALA A C   1 
ATOM   2018  O O   . ALA A 1 266 ? 0.428   45.433  90.245  1.00 25.00  ? 766 ALA A O   1 
ATOM   2019  C CB  . ALA A 1 266 ? 0.036   47.653  88.153  1.00 16.00  ? 766 ALA A CB  1 
ATOM   2020  N N   . GLY A 1 267 ? -1.686  46.105  90.657  1.00 35.07  ? 767 GLY A N   1 
ATOM   2021  C CA  . GLY A 1 267 ? -2.112  44.814  91.170  1.00 30.52  ? 767 GLY A CA  1 
ATOM   2022  C C   . GLY A 1 267 ? -1.696  44.532  92.604  1.00 34.88  ? 767 GLY A C   1 
ATOM   2023  O O   . GLY A 1 267 ? -2.023  43.476  93.133  1.00 37.74  ? 767 GLY A O   1 
ATOM   2024  N N   . PHE A 1 268 ? -0.968  45.455  93.235  1.00 30.16  ? 768 PHE A N   1 
ATOM   2025  C CA  . PHE A 1 268 ? -0.493  45.231  94.598  1.00 25.85  ? 768 PHE A CA  1 
ATOM   2026  C C   . PHE A 1 268 ? -1.661  45.124  95.549  1.00 30.05  ? 768 PHE A C   1 
ATOM   2027  O O   . PHE A 1 268 ? -2.584  45.932  95.500  1.00 44.61  ? 768 PHE A O   1 
ATOM   2028  C CB  . PHE A 1 268 ? 0.450   46.345  95.064  1.00 26.99  ? 768 PHE A CB  1 
ATOM   2029  C CG  . PHE A 1 268 ? 0.869   46.231  96.512  1.00 28.23  ? 768 PHE A CG  1 
ATOM   2030  C CD1 . PHE A 1 268 ? 1.630   45.152  96.956  1.00 22.18  ? 768 PHE A CD1 1 
ATOM   2031  C CD2 . PHE A 1 268 ? 0.512   47.213  97.432  1.00 28.89  ? 768 PHE A CD2 1 
ATOM   2032  C CE1 . PHE A 1 268 ? 2.019   45.054  98.294  1.00 18.37  ? 768 PHE A CE1 1 
ATOM   2033  C CE2 . PHE A 1 268 ? 0.903   47.129  98.777  1.00 21.57  ? 768 PHE A CE2 1 
ATOM   2034  C CZ  . PHE A 1 268 ? 1.654   46.056  99.209  1.00 16.01  ? 768 PHE A CZ  1 
ATOM   2035  N N   . GLN A 1 269 ? -1.627  44.119  96.411  1.00 35.05  ? 769 GLN A N   1 
ATOM   2036  C CA  . GLN A 1 269 ? -2.646  43.968  97.442  1.00 47.23  ? 769 GLN A CA  1 
ATOM   2037  C C   . GLN A 1 269 ? -2.000  43.881  98.825  1.00 41.86  ? 769 GLN A C   1 
ATOM   2038  O O   . GLN A 1 269 ? -1.390  42.865  99.181  1.00 38.29  ? 769 GLN A O   1 
ATOM   2039  C CB  . GLN A 1 269 ? -3.512  42.742  97.153  1.00 60.04  ? 769 GLN A CB  1 
ATOM   2040  C CG  . GLN A 1 269 ? -3.007  41.912  95.989  1.00 65.85  ? 769 GLN A CG  1 
ATOM   2041  C CD  . GLN A 1 269 ? -4.046  40.932  95.485  1.00 73.93  ? 769 GLN A CD  1 
ATOM   2042  O OE1 . GLN A 1 269 ? -4.569  41.075  94.378  1.00 71.93  ? 769 GLN A OE1 1 
ATOM   2043  N NE2 . GLN A 1 269 ? -4.349  39.927  96.296  1.00 78.73  ? 769 GLN A NE2 1 
ATOM   2044  N N   . PRO A 1 270 ? -2.130  44.959  99.606  1.00 39.64  ? 770 PRO A N   1 
ATOM   2045  C CA  . PRO A 1 270 ? -1.512  45.117  100.929 1.00 37.42  ? 770 PRO A CA  1 
ATOM   2046  C C   . PRO A 1 270 ? -2.005  44.100  101.949 1.00 39.50  ? 770 PRO A C   1 
ATOM   2047  O O   . PRO A 1 270 ? -3.171  43.694  101.935 1.00 37.07  ? 770 PRO A O   1 
ATOM   2048  C CB  . PRO A 1 270 ? -1.951  46.523  101.361 1.00 28.68  ? 770 PRO A CB  1 
ATOM   2049  C CG  . PRO A 1 270 ? -3.175  46.795  100.580 1.00 36.83  ? 770 PRO A CG  1 
ATOM   2050  C CD  . PRO A 1 270 ? -2.964  46.115  99.249  1.00 41.19  ? 770 PRO A CD  1 
ATOM   2051  N N   . ASP A 1 271 ? -1.098  43.706  102.831 1.00 35.22  ? 771 ASP A N   1 
ATOM   2052  C CA  . ASP A 1 271 ? -1.425  42.865  103.969 1.00 36.82  ? 771 ASP A CA  1 
ATOM   2053  C C   . ASP A 1 271 ? -1.687  43.799  105.133 1.00 39.75  ? 771 ASP A C   1 
ATOM   2054  O O   . ASP A 1 271 ? -0.855  44.659  105.446 1.00 31.62  ? 771 ASP A O   1 
ATOM   2055  C CB  . ASP A 1 271 ? -0.248  41.938  104.286 1.00 38.43  ? 771 ASP A CB  1 
ATOM   2056  C CG  . ASP A 1 271 ? -0.442  41.177  105.567 1.00 49.22  ? 771 ASP A CG  1 
ATOM   2057  O OD1 . ASP A 1 271 ? -1.002  40.059  105.512 1.00 57.98  ? 771 ASP A OD1 1 
ATOM   2058  O OD2 . ASP A 1 271 ? -0.037  41.693  106.630 1.00 49.49  ? 771 ASP A OD2 1 
ATOM   2059  N N   . GLU A 1 272 ? -2.842  43.638  105.766 1.00 46.13  ? 772 GLU A N   1 
ATOM   2060  C CA  . GLU A 1 272 ? -3.305  44.588  106.778 1.00 47.36  ? 772 GLU A CA  1 
ATOM   2061  C C   . GLU A 1 272 ? -2.283  44.922  107.859 1.00 45.37  ? 772 GLU A C   1 
ATOM   2062  O O   . GLU A 1 272 ? -1.923  46.079  108.062 1.00 45.73  ? 772 GLU A O   1 
ATOM   2063  C CB  . GLU A 1 272 ? -4.570  44.067  107.440 1.00 50.48  ? 772 GLU A CB  1 
ATOM   2064  C CG  . GLU A 1 272 ? -5.062  44.961  108.553 1.00 69.12  ? 772 GLU A CG  1 
ATOM   2065  C CD  . GLU A 1 272 ? -6.563  44.883  108.742 1.00 82.52  ? 772 GLU A CD  1 
ATOM   2066  O OE1 . GLU A 1 272 ? -7.159  43.840  108.395 1.00 86.43  ? 772 GLU A OE1 1 
ATOM   2067  O OE2 . GLU A 1 272 ? -7.148  45.873  109.232 1.00 88.72  ? 772 GLU A OE2 1 
ATOM   2068  N N   . GLU A 1 273 ? -1.835  43.901  108.568 1.00 46.30  ? 773 GLU A N   1 
ATOM   2069  C CA  . GLU A 1 273 ? -0.886  44.096  109.649 1.00 49.64  ? 773 GLU A CA  1 
ATOM   2070  C C   . GLU A 1 273 ? 0.402   44.738  109.141 1.00 37.73  ? 773 GLU A C   1 
ATOM   2071  O O   . GLU A 1 273 ? 0.935   45.658  109.753 1.00 45.71  ? 773 GLU A O   1 
ATOM   2072  C CB  . GLU A 1 273 ? -0.576  42.758  110.326 1.00 45.56  ? 773 GLU A CB  1 
ATOM   2073  C CG  . GLU A 1 273 ? 0.381   42.875  111.491 1.00 48.44  ? 773 GLU A CG  1 
ATOM   2074  C CD  . GLU A 1 273 ? 0.268   41.714  112.450 1.00 65.75  ? 773 GLU A CD  1 
ATOM   2075  O OE1 . GLU A 1 273 ? -0.455  40.741  112.131 1.00 71.45  ? 773 GLU A OE1 1 
ATOM   2076  O OE2 . GLU A 1 273 ? 0.896   41.777  113.529 1.00 69.87  ? 773 GLU A OE2 1 
ATOM   2077  N N   . MET A 1 274 ? 0.904   44.227  108.027 1.00 22.70  ? 774 MET A N   1 
ATOM   2078  C CA  . MET A 1 274 ? 2.122   44.735  107.416 1.00 31.80  ? 774 MET A CA  1 
ATOM   2079  C C   . MET A 1 274 ? 1.965   46.216  107.129 1.00 36.86  ? 774 MET A C   1 
ATOM   2080  O O   . MET A 1 274 ? 2.872   47.014  107.367 1.00 33.67  ? 774 MET A O   1 
ATOM   2081  C CB  . MET A 1 274 ? 2.387   44.021  106.097 1.00 27.84  ? 774 MET A CB  1 
ATOM   2082  C CG  . MET A 1 274 ? 3.577   44.588  105.344 1.00 34.25  ? 774 MET A CG  1 
ATOM   2083  S SD  . MET A 1 274 ? 5.118   43.963  106.039 1.00 59.51  ? 774 MET A SD  1 
ATOM   2084  C CE  . MET A 1 274 ? 4.753   42.203  105.958 1.00 28.34  ? 774 MET A CE  1 
ATOM   2085  N N   . ASN A 1 275 ? 0.804   46.562  106.588 1.00 36.55  ? 775 ASN A N   1 
ATOM   2086  C CA  . ASN A 1 275 ? 0.480   47.937  106.290 1.00 37.04  ? 775 ASN A CA  1 
ATOM   2087  C C   . ASN A 1 275 ? 0.515   48.777  107.555 1.00 44.07  ? 775 ASN A C   1 
ATOM   2088  O O   . ASN A 1 275 ? 1.076   49.872  107.557 1.00 45.95  ? 775 ASN A O   1 
ATOM   2089  C CB  . ASN A 1 275 ? -0.884  48.036  105.611 1.00 34.92  ? 775 ASN A CB  1 
ATOM   2090  C CG  . ASN A 1 275 ? -1.121  49.399  104.985 1.00 47.44  ? 775 ASN A CG  1 
ATOM   2091  O OD1 . ASN A 1 275 ? -1.724  50.285  105.596 1.00 51.50  ? 775 ASN A OD1 1 
ATOM   2092  N ND2 . ASN A 1 275 ? -0.637  49.579  103.761 1.00 51.36  ? 775 ASN A ND2 1 
ATOM   2093  N N   . GLU A 1 276 ? -0.071  48.262  108.633 1.00 41.98  ? 776 GLU A N   1 
ATOM   2094  C CA  . GLU A 1 276 ? -0.125  49.014  109.887 1.00 46.03  ? 776 GLU A CA  1 
ATOM   2095  C C   . GLU A 1 276 ? 1.273   49.312  110.409 1.00 45.55  ? 776 GLU A C   1 
ATOM   2096  O O   . GLU A 1 276 ? 1.555   50.437  110.828 1.00 44.77  ? 776 GLU A O   1 
ATOM   2097  C CB  . GLU A 1 276 ? -0.925  48.268  110.963 1.00 56.67  ? 776 GLU A CB  1 
ATOM   2098  C CG  . GLU A 1 276 ? -2.422  48.184  110.702 1.00 61.11  ? 776 GLU A CG  1 
ATOM   2099  C CD  . GLU A 1 276 ? -3.107  49.536  110.740 1.00 55.98  ? 776 GLU A CD  1 
ATOM   2100  O OE1 . GLU A 1 276 ? -3.305  50.081  111.850 1.00 52.79  ? 776 GLU A OE1 1 
ATOM   2101  O OE2 . GLU A 1 276 ? -3.452  50.051  109.656 1.00 56.82  ? 776 GLU A OE2 1 
ATOM   2102  N N   . ILE A 1 277 ? 2.158   48.316  110.380 1.00 32.51  ? 777 ILE A N   1 
ATOM   2103  C CA  . ILE A 1 277 ? 3.470   48.518  110.982 1.00 39.53  ? 777 ILE A CA  1 
ATOM   2104  C C   . ILE A 1 277 ? 4.342   49.466  110.166 1.00 40.82  ? 777 ILE A C   1 
ATOM   2105  O O   . ILE A 1 277 ? 5.358   49.943  110.659 1.00 43.90  ? 777 ILE A O   1 
ATOM   2106  C CB  . ILE A 1 277 ? 4.226   47.204  111.280 1.00 34.22  ? 777 ILE A CB  1 
ATOM   2107  C CG1 . ILE A 1 277 ? 5.347   47.491  112.269 1.00 41.35  ? 777 ILE A CG1 1 
ATOM   2108  C CG2 . ILE A 1 277 ? 4.806   46.597  110.016 1.00 25.74  ? 777 ILE A CG2 1 
ATOM   2109  C CD1 . ILE A 1 277 ? 6.036   46.260  112.763 1.00 49.80  ? 777 ILE A CD1 1 
ATOM   2110  N N   . CYS A 1 278 ? 3.934   49.740  108.929 1.00 39.79  ? 778 CYS A N   1 
ATOM   2111  C CA  . CYS A 1 278 ? 4.627   50.711  108.081 1.00 35.93  ? 778 CYS A CA  1 
ATOM   2112  C C   . CYS A 1 278 ? 4.224   52.142  108.409 1.00 37.12  ? 778 CYS A C   1 
ATOM   2113  O O   . CYS A 1 278 ? 4.858   53.089  107.949 1.00 37.94  ? 778 CYS A O   1 
ATOM   2114  C CB  . CYS A 1 278 ? 4.332   50.440  106.608 1.00 33.50  ? 778 CYS A CB  1 
ATOM   2115  S SG  . CYS A 1 278 ? 5.172   49.006  105.955 1.00 39.23  ? 778 CYS A SG  1 
ATOM   2116  N N   . LYS A 1 279 ? 3.156   52.292  109.189 1.00 33.83  ? 779 LYS A N   1 
ATOM   2117  C CA  . LYS A 1 279 ? 2.684   53.612  109.583 1.00 36.33  ? 779 LYS A CA  1 
ATOM   2118  C C   . LYS A 1 279 ? 3.635   54.226  110.600 1.00 41.28  ? 779 LYS A C   1 
ATOM   2119  O O   . LYS A 1 279 ? 4.013   53.570  111.574 1.00 36.21  ? 779 LYS A O   1 
ATOM   2120  C CB  . LYS A 1 279 ? 1.256   53.548  110.147 1.00 40.54  ? 779 LYS A CB  1 
ATOM   2121  C CG  . LYS A 1 279 ? 0.179   53.419  109.069 1.00 46.18  ? 779 LYS A CG  1 
ATOM   2122  C CD  . LYS A 1 279 ? -1.215  53.154  109.642 1.00 53.99  ? 779 LYS A CD  1 
ATOM   2123  C CE  . LYS A 1 279 ? -2.272  53.113  108.530 1.00 59.71  ? 779 LYS A CE  1 
ATOM   2124  N NZ  . LYS A 1 279 ? -3.659  52.834  109.015 1.00 61.33  ? 779 LYS A NZ  1 
ATOM   2125  N N   . THR A 1 280 ? 4.027   55.479  110.361 1.00 39.23  ? 780 THR A N   1 
ATOM   2126  C CA  . THR A 1 280 ? 4.936   56.173  111.263 1.00 36.98  ? 780 THR A CA  1 
ATOM   2127  C C   . THR A 1 280 ? 4.308   56.278  112.662 1.00 37.85  ? 780 THR A C   1 
ATOM   2128  O O   . THR A 1 280 ? 4.960   56.031  113.680 1.00 35.51  ? 780 THR A O   1 
ATOM   2129  C CB  . THR A 1 280 ? 5.326   57.567  110.706 1.00 51.29  ? 780 THR A CB  1 
ATOM   2130  O OG1 . THR A 1 280 ? 5.991   57.410  109.448 1.00 37.41  ? 780 THR A OG1 1 
ATOM   2131  C CG2 . THR A 1 280 ? 6.265   58.295  111.660 1.00 57.03  ? 780 THR A CG2 1 
ATOM   2132  N N   . GLU A 1 281 ? 3.029   56.624  112.700 1.00 34.73  ? 781 GLU A N   1 
ATOM   2133  C CA  A GLU A 1 281 ? 2.324   56.740  113.969 0.47 40.49  ? 781 GLU A CA  1 
ATOM   2134  C CA  B GLU A 1 281 ? 2.279   56.719  113.945 0.53 40.53  ? 781 GLU A CA  1 
ATOM   2135  C C   . GLU A 1 281 ? 2.493   55.454  114.784 1.00 47.35  ? 781 GLU A C   1 
ATOM   2136  O O   . GLU A 1 281 ? 2.908   55.501  115.948 1.00 45.37  ? 781 GLU A O   1 
ATOM   2137  C CB  A GLU A 1 281 ? 0.845   57.063  113.738 0.47 42.81  ? 781 GLU A CB  1 
ATOM   2138  C CB  B GLU A 1 281 ? 0.784   56.909  113.638 0.53 41.96  ? 781 GLU A CB  1 
ATOM   2139  C CG  A GLU A 1 281 ? 0.625   58.138  112.680 0.47 46.60  ? 781 GLU A CG  1 
ATOM   2140  C CG  B GLU A 1 281 ? 0.470   58.006  112.603 0.53 44.90  ? 781 GLU A CG  1 
ATOM   2141  C CD  A GLU A 1 281 ? -0.544  59.046  112.992 0.47 47.41  ? 781 GLU A CD  1 
ATOM   2142  C CD  B GLU A 1 281 ? 0.213   57.464  111.191 0.53 38.42  ? 781 GLU A CD  1 
ATOM   2143  O OE1 A GLU A 1 281 ? -1.466  59.137  112.152 0.47 47.94  ? 781 GLU A OE1 1 
ATOM   2144  O OE1 B GLU A 1 281 ? 1.152   56.940  110.557 0.53 19.93  ? 781 GLU A OE1 1 
ATOM   2145  O OE2 A GLU A 1 281 ? -0.530  59.682  114.066 0.47 46.83  ? 781 GLU A OE2 1 
ATOM   2146  O OE2 B GLU A 1 281 ? -0.937  57.571  110.710 0.53 46.61  ? 781 GLU A OE2 1 
ATOM   2147  H H   A GLU A 1 281 ? 2.547   56.797  112.009 0.47 41.56  ? 781 GLU A H   1 
ATOM   2148  H H   B GLU A 1 281 ? 2.562   56.813  112.002 0.53 41.56  ? 781 GLU A H   1 
ATOM   2149  H HA  A GLU A 1 281 ? 2.716   57.476  114.483 0.47 48.48  ? 781 GLU A HA  1 
ATOM   2150  H HA  B GLU A 1 281 ? 2.593   57.492  114.460 0.53 48.53  ? 781 GLU A HA  1 
ATOM   2151  H HB2 A GLU A 1 281 ? 0.389   56.258  113.445 0.47 51.27  ? 781 GLU A HB2 1 
ATOM   2152  H HB2 B GLU A 1 281 ? 0.431   56.073  113.296 0.53 50.25  ? 781 GLU A HB2 1 
ATOM   2153  H HB3 A GLU A 1 281 ? 0.458   57.378  114.569 0.47 51.27  ? 781 GLU A HB3 1 
ATOM   2154  H HB3 B GLU A 1 281 ? 0.327   57.143  114.461 0.53 50.25  ? 781 GLU A HB3 1 
ATOM   2155  H HG2 A GLU A 1 281 ? 1.422   58.687  112.619 0.47 55.81  ? 781 GLU A HG2 1 
ATOM   2156  H HG2 B GLU A 1 281 ? -0.324  58.485  112.886 0.53 53.77  ? 781 GLU A HG2 1 
ATOM   2157  H HG3 A GLU A 1 281 ? 0.452   57.709  111.827 0.47 55.81  ? 781 GLU A HG3 1 
ATOM   2158  H HG3 B GLU A 1 281 ? 1.223   58.616  112.555 0.53 53.77  ? 781 GLU A HG3 1 
ATOM   2159  N N   . PHE A 1 282 ? 2.202   54.313  114.170 1.00 47.20  ? 782 PHE A N   1 
ATOM   2160  C CA  . PHE A 1 282 ? 2.341   53.021  114.818 1.00 31.85  ? 782 PHE A CA  1 
ATOM   2161  C C   . PHE A 1 282 ? 3.764   52.818  115.320 1.00 36.58  ? 782 PHE A C   1 
ATOM   2162  O O   . PHE A 1 282 ? 3.976   52.478  116.481 1.00 35.47  ? 782 PHE A O   1 
ATOM   2163  C CB  . PHE A 1 282 ? 1.980   51.927  113.826 1.00 33.00  ? 782 PHE A CB  1 
ATOM   2164  C CG  . PHE A 1 282 ? 2.007   50.552  114.402 1.00 40.82  ? 782 PHE A CG  1 
ATOM   2165  C CD1 . PHE A 1 282 ? 0.824   49.859  114.627 1.00 42.45  ? 782 PHE A CD1 1 
ATOM   2166  C CD2 . PHE A 1 282 ? 3.211   49.943  114.707 1.00 45.97  ? 782 PHE A CD2 1 
ATOM   2167  C CE1 . PHE A 1 282 ? 0.839   48.584  115.151 1.00 43.44  ? 782 PHE A CE1 1 
ATOM   2168  C CE2 . PHE A 1 282 ? 3.235   48.670  115.234 1.00 43.12  ? 782 PHE A CE2 1 
ATOM   2169  C CZ  . PHE A 1 282 ? 2.047   47.991  115.457 1.00 42.39  ? 782 PHE A CZ  1 
ATOM   2170  N N   . GLN A 1 283 ? 4.738   53.021  114.436 1.00 41.20  ? 783 GLN A N   1 
ATOM   2171  C CA  . GLN A 1 283 ? 6.146   52.935  114.803 1.00 29.25  ? 783 GLN A CA  1 
ATOM   2172  C C   . GLN A 1 283 ? 6.494   53.839  115.998 1.00 36.85  ? 783 GLN A C   1 
ATOM   2173  O O   . GLN A 1 283 ? 7.233   53.431  116.900 1.00 38.74  ? 783 GLN A O   1 
ATOM   2174  C CB  . GLN A 1 283 ? 7.029   53.271  113.602 1.00 28.44  ? 783 GLN A CB  1 
ATOM   2175  C CG  . GLN A 1 283 ? 6.961   52.260  112.476 1.00 40.77  ? 783 GLN A CG  1 
ATOM   2176  C CD  . GLN A 1 283 ? 7.607   52.768  111.200 1.00 55.08  ? 783 GLN A CD  1 
ATOM   2177  O OE1 . GLN A 1 283 ? 8.503   53.607  111.241 1.00 60.80  ? 783 GLN A OE1 1 
ATOM   2178  N NE2 . GLN A 1 283 ? 7.145   52.270  110.056 1.00 59.25  ? 783 GLN A NE2 1 
ATOM   2179  N N   . MET A 1 284 ? 5.969   55.063  116.008 1.00 41.54  ? 784 MET A N   1 
ATOM   2180  C CA  . MET A 1 284 ? 6.238   55.984  117.112 1.00 40.93  ? 784 MET A CA  1 
ATOM   2181  C C   . MET A 1 284 ? 5.727   55.420  118.441 1.00 47.71  ? 784 MET A C   1 
ATOM   2182  O O   . MET A 1 284 ? 6.385   55.539  119.471 1.00 47.38  ? 784 MET A O   1 
ATOM   2183  C CB  . MET A 1 284 ? 5.621   57.359  116.845 1.00 36.70  ? 784 MET A CB  1 
ATOM   2184  C CG  . MET A 1 284 ? 6.229   58.107  115.660 1.00 47.10  ? 784 MET A CG  1 
ATOM   2185  S SD  . MET A 1 284 ? 5.532   59.763  115.396 1.00 49.39  ? 784 MET A SD  1 
ATOM   2186  C CE  . MET A 1 284 ? 6.467   60.728  116.580 1.00 60.08  ? 784 MET A CE  1 
ATOM   2187  N N   . ARG A 1 285 ? 4.547   54.810  118.410 1.00 48.01  ? 785 ARG A N   1 
ATOM   2188  C CA  . ARG A 1 285 ? 3.969   54.192  119.598 1.00 51.30  ? 785 ARG A CA  1 
ATOM   2189  C C   . ARG A 1 285 ? 4.840   53.050  120.109 1.00 52.43  ? 785 ARG A C   1 
ATOM   2190  O O   . ARG A 1 285 ? 5.069   52.918  121.314 1.00 51.38  ? 785 ARG A O   1 
ATOM   2191  C CB  . ARG A 1 285 ? 2.560   53.686  119.294 1.00 49.06  ? 785 ARG A CB  1 
ATOM   2192  C CG  . ARG A 1 285 ? 1.518   54.791  119.207 1.00 54.82  ? 785 ARG A CG  1 
ATOM   2193  C CD  . ARG A 1 285 ? 0.955   55.122  120.579 1.00 64.14  ? 785 ARG A CD  1 
ATOM   2194  N NE  . ARG A 1 285 ? 0.324   53.954  121.190 1.00 75.02  ? 785 ARG A NE  1 
ATOM   2195  C CZ  . ARG A 1 285 ? -0.938  53.592  120.982 1.00 78.38  ? 785 ARG A CZ  1 
ATOM   2196  N NH1 . ARG A 1 285 ? -1.706  54.317  120.183 1.00 84.16  ? 785 ARG A NH1 1 
ATOM   2197  N NH2 . ARG A 1 285 ? -1.433  52.511  121.575 1.00 73.36  ? 785 ARG A NH2 1 
ATOM   2198  N N   . LEU A 1 286 ? 5.322   52.228  119.181 1.00 51.08  ? 786 LEU A N   1 
ATOM   2199  C CA  . LEU A 1 286 ? 6.211   51.118  119.505 1.00 43.14  ? 786 LEU A CA  1 
ATOM   2200  C C   . LEU A 1 286 ? 7.429   51.624  120.240 1.00 43.84  ? 786 LEU A C   1 
ATOM   2201  O O   . LEU A 1 286 ? 7.781   51.107  121.294 1.00 45.18  ? 786 LEU A O   1 
ATOM   2202  C CB  . LEU A 1 286 ? 6.664   50.404  118.231 1.00 42.96  ? 786 LEU A CB  1 
ATOM   2203  C CG  . LEU A 1 286 ? 5.971   49.091  117.880 1.00 49.40  ? 786 LEU A CG  1 
ATOM   2204  C CD1 . LEU A 1 286 ? 6.359   48.612  116.483 1.00 44.75  ? 786 LEU A CD1 1 
ATOM   2205  C CD2 . LEU A 1 286 ? 6.320   48.047  118.916 1.00 52.84  ? 786 LEU A CD2 1 
ATOM   2206  N N   . LEU A 1 287 ? 8.066   52.647  119.678 1.00 42.46  ? 787 LEU A N   1 
ATOM   2207  C CA  . LEU A 1 287 ? 9.343   53.131  120.192 1.00 49.01  ? 787 LEU A CA  1 
ATOM   2208  C C   . LEU A 1 287 ? 9.265   53.896  121.527 1.00 50.43  ? 787 LEU A C   1 
ATOM   2209  O O   . LEU A 1 287 ? 10.022  53.597  122.449 1.00 47.59  ? 787 LEU A O   1 
ATOM   2210  C CB  . LEU A 1 287 ? 10.072  53.963  119.124 1.00 51.43  ? 787 LEU A CB  1 
ATOM   2211  C CG  . LEU A 1 287 ? 10.643  53.194  117.925 1.00 47.52  ? 787 LEU A CG  1 
ATOM   2212  C CD1 . LEU A 1 287 ? 11.245  54.149  116.913 1.00 44.50  ? 787 LEU A CD1 1 
ATOM   2213  C CD2 . LEU A 1 287 ? 11.674  52.165  118.374 1.00 40.12  ? 787 LEU A CD2 1 
ATOM   2214  N N   . TRP A 1 288 ? 8.361   54.873  121.630 1.00 49.50  ? 788 TRP A N   1 
ATOM   2215  C CA  . TRP A 1 288 ? 8.312   55.762  122.797 1.00 52.51  ? 788 TRP A CA  1 
ATOM   2216  C C   . TRP A 1 288 ? 7.089   55.548  123.696 1.00 60.11  ? 788 TRP A C   1 
ATOM   2217  O O   . TRP A 1 288 ? 6.956   56.194  124.737 1.00 61.94  ? 788 TRP A O   1 
ATOM   2218  C CB  . TRP A 1 288 ? 8.388   57.235  122.370 1.00 46.23  ? 788 TRP A CB  1 
ATOM   2219  C CG  . TRP A 1 288 ? 9.687   57.623  121.745 1.00 39.28  ? 788 TRP A CG  1 
ATOM   2220  C CD1 . TRP A 1 288 ? 10.836  57.967  122.393 1.00 40.55  ? 788 TRP A CD1 1 
ATOM   2221  C CD2 . TRP A 1 288 ? 9.976   57.712  120.338 1.00 41.14  ? 788 TRP A CD2 1 
ATOM   2222  N NE1 . TRP A 1 288 ? 11.824  58.267  121.478 1.00 45.55  ? 788 TRP A NE1 1 
ATOM   2223  C CE2 . TRP A 1 288 ? 11.322  58.116  120.212 1.00 41.15  ? 788 TRP A CE2 1 
ATOM   2224  C CE3 . TRP A 1 288 ? 9.228   57.485  119.175 1.00 36.76  ? 788 TRP A CE3 1 
ATOM   2225  C CZ2 . TRP A 1 288 ? 11.934  58.298  118.969 1.00 39.93  ? 788 TRP A CZ2 1 
ATOM   2226  C CZ3 . TRP A 1 288 ? 9.838   57.675  117.942 1.00 35.81  ? 788 TRP A CZ3 1 
ATOM   2227  C CH2 . TRP A 1 288 ? 11.179  58.073  117.850 1.00 34.35  ? 788 TRP A CH2 1 
ATOM   2228  N N   . GLY A 1 289 ? 6.201   54.648  123.288 1.00 61.74  ? 789 GLY A N   1 
ATOM   2229  C CA  . GLY A 1 289 ? 5.015   54.345  124.064 1.00 60.66  ? 789 GLY A CA  1 
ATOM   2230  C C   . GLY A 1 289 ? 3.859   55.291  123.799 1.00 62.78  ? 789 GLY A C   1 
ATOM   2231  O O   . GLY A 1 289 ? 3.961   56.215  122.994 1.00 53.11  ? 789 GLY A O   1 
ATOM   2232  N N   . SER A 1 290 ? 2.755   55.058  124.497 1.00 70.02  ? 790 SER A N   1 
ATOM   2233  C CA  . SER A 1 290 ? 1.542   55.837  124.302 1.00 76.61  ? 790 SER A CA  1 
ATOM   2234  C C   . SER A 1 290 ? 1.591   57.197  124.995 1.00 82.18  ? 790 SER A C   1 
ATOM   2235  O O   . SER A 1 290 ? 0.738   58.048  124.760 1.00 88.90  ? 790 SER A O   1 
ATOM   2236  C CB  . SER A 1 290 ? 0.329   55.038  124.781 1.00 86.42  ? 790 SER A CB  1 
ATOM   2237  O OG  . SER A 1 290 ? 0.578   54.444  126.045 1.00 91.03  ? 790 SER A OG  1 
ATOM   2238  N N   . LYS A 1 291 ? 2.584   57.406  125.852 1.00 80.46  ? 791 LYS A N   1 
ATOM   2239  C CA  . LYS A 1 291 ? 2.731   58.698  126.518 1.00 77.44  ? 791 LYS A CA  1 
ATOM   2240  C C   . LYS A 1 291 ? 3.923   59.481  125.981 1.00 71.63  ? 791 LYS A C   1 
ATOM   2241  O O   . LYS A 1 291 ? 3.807   60.663  125.659 1.00 78.81  ? 791 LYS A O   1 
ATOM   2242  C CB  . LYS A 1 291 ? 2.871   58.526  128.033 1.00 81.02  ? 791 LYS A CB  1 
ATOM   2243  C CG  . LYS A 1 291 ? 1.577   58.677  128.809 1.00 81.94  ? 791 LYS A CG  1 
ATOM   2244  C CD  . LYS A 1 291 ? 1.037   57.335  129.244 1.00 84.63  ? 791 LYS A CD  1 
ATOM   2245  C CE  . LYS A 1 291 ? 0.161   57.478  130.482 1.00 87.49  ? 791 LYS A CE  1 
ATOM   2246  N NZ  . LYS A 1 291 ? -0.081  56.166  131.148 1.00 85.12  ? 791 LYS A NZ  1 
ATOM   2247  N N   . GLY A 1 292 ? 5.066   58.809  125.885 1.00 63.01  ? 792 GLY A N   1 
ATOM   2248  C CA  . GLY A 1 292 ? 6.303   59.442  125.473 1.00 63.60  ? 792 GLY A CA  1 
ATOM   2249  C C   . GLY A 1 292 ? 6.364   59.756  123.991 1.00 60.96  ? 792 GLY A C   1 
ATOM   2250  O O   . GLY A 1 292 ? 7.194   60.548  123.561 1.00 62.86  ? 792 GLY A O   1 
ATOM   2251  N N   . ALA A 1 293 ? 5.477   59.142  123.214 1.00 59.08  ? 793 ALA A N   1 
ATOM   2252  C CA  . ALA A 1 293 ? 5.475   59.307  121.764 1.00 54.74  ? 793 ALA A CA  1 
ATOM   2253  C C   . ALA A 1 293 ? 5.260   60.755  121.350 1.00 58.45  ? 793 ALA A C   1 
ATOM   2254  O O   . ALA A 1 293 ? 5.507   61.120  120.199 1.00 51.49  ? 793 ALA A O   1 
ATOM   2255  C CB  . ALA A 1 293 ? 4.422   58.413  121.118 1.00 47.74  ? 793 ALA A CB  1 
ATOM   2256  N N   . GLN A 1 294 ? 4.793   61.581  122.282 1.00 73.06  ? 794 GLN A N   1 
ATOM   2257  C CA  . GLN A 1 294 ? 4.553   62.986  121.962 1.00 79.57  ? 794 GLN A CA  1 
ATOM   2258  C C   . GLN A 1 294 ? 5.458   63.976  122.706 1.00 73.25  ? 794 GLN A C   1 
ATOM   2259  O O   . GLN A 1 294 ? 5.174   65.166  122.749 1.00 77.09  ? 794 GLN A O   1 
ATOM   2260  C CB  . GLN A 1 294 ? 3.059   63.341  122.056 1.00 86.89  ? 794 GLN A CB  1 
ATOM   2261  C CG  . GLN A 1 294 ? 2.374   63.302  120.679 1.00 92.34  ? 794 GLN A CG  1 
ATOM   2262  C CD  . GLN A 1 294 ? 0.854   63.333  120.733 1.00 98.30  ? 794 GLN A CD  1 
ATOM   2263  O OE1 . GLN A 1 294 ? 0.184   62.745  119.877 1.00 91.73  ? 794 GLN A OE1 1 
ATOM   2264  N NE2 . GLN A 1 294 ? 0.302   64.029  121.725 1.00 104.70 ? 794 GLN A NE2 1 
ATOM   2265  N N   . VAL A 1 295 ? 6.559   63.474  123.262 1.00 68.22  ? 795 VAL A N   1 
ATOM   2266  C CA  . VAL A 1 295 ? 7.639   64.318  123.777 1.00 63.58  ? 795 VAL A CA  1 
ATOM   2267  C C   . VAL A 1 295 ? 8.368   64.986  122.611 1.00 66.51  ? 795 VAL A C   1 
ATOM   2268  O O   . VAL A 1 295 ? 8.245   64.540  121.468 1.00 71.11  ? 795 VAL A O   1 
ATOM   2269  C CB  . VAL A 1 295 ? 8.660   63.480  124.579 1.00 60.49  ? 795 VAL A CB  1 
ATOM   2270  C CG1 . VAL A 1 295 ? 9.949   64.255  124.787 1.00 57.92  ? 795 VAL A CG1 1 
ATOM   2271  C CG2 . VAL A 1 295 ? 8.066   63.031  125.911 1.00 63.02  ? 795 VAL A CG2 1 
ATOM   2272  N N   . ASN A 1 296 ? 9.136   66.041  122.882 1.00 62.03  ? 796 ASN A N   1 
ATOM   2273  C CA  . ASN A 1 296 ? 9.829   66.741  121.796 1.00 61.88  ? 796 ASN A CA  1 
ATOM   2274  C C   . ASN A 1 296 ? 10.859  65.879  121.055 1.00 56.98  ? 796 ASN A C   1 
ATOM   2275  O O   . ASN A 1 296 ? 11.495  64.994  121.636 1.00 50.21  ? 796 ASN A O   1 
ATOM   2276  C CB  . ASN A 1 296 ? 10.462  68.055  122.271 1.00 68.17  ? 796 ASN A CB  1 
ATOM   2277  C CG  . ASN A 1 296 ? 11.719  67.843  123.088 1.00 74.37  ? 796 ASN A CG  1 
ATOM   2278  O OD1 . ASN A 1 296 ? 12.797  67.606  122.539 1.00 69.29  ? 796 ASN A OD1 1 
ATOM   2279  N ND2 . ASN A 1 296 ? 11.592  67.944  124.407 1.00 82.01  ? 796 ASN A ND2 1 
ATOM   2280  N N   . GLN A 1 297 ? 11.008  66.151  119.762 1.00 48.55  ? 797 GLN A N   1 
ATOM   2281  C CA  . GLN A 1 297 ? 11.935  65.415  118.918 1.00 44.87  ? 797 GLN A CA  1 
ATOM   2282  C C   . GLN A 1 297 ? 13.305  65.236  119.549 1.00 49.33  ? 797 GLN A C   1 
ATOM   2283  O O   . GLN A 1 297 ? 13.808  64.115  119.647 1.00 53.87  ? 797 GLN A O   1 
ATOM   2284  C CB  . GLN A 1 297 ? 12.094  66.117  117.570 1.00 48.22  ? 797 GLN A CB  1 
ATOM   2285  C CG  . GLN A 1 297 ? 10.977  65.833  116.586 1.00 45.67  ? 797 GLN A CG  1 
ATOM   2286  C CD  . GLN A 1 297 ? 11.245  66.442  115.228 1.00 48.91  ? 797 GLN A CD  1 
ATOM   2287  O OE1 . GLN A 1 297 ? 11.659  67.598  115.128 1.00 54.33  ? 797 GLN A OE1 1 
ATOM   2288  N NE2 . GLN A 1 297 ? 11.032  65.659  114.171 1.00 37.78  ? 797 GLN A NE2 1 
ATOM   2289  N N   . THR A 1 298 ? 13.917  66.347  119.946 1.00 50.68  ? 798 THR A N   1 
ATOM   2290  C CA  . THR A 1 298 ? 15.270  66.325  120.487 1.00 52.28  ? 798 THR A CA  1 
ATOM   2291  C C   . THR A 1 298 ? 15.396  65.345  121.645 1.00 61.09  ? 798 THR A C   1 
ATOM   2292  O O   . THR A 1 298 ? 16.348  64.557  121.717 1.00 62.87  ? 798 THR A O   1 
ATOM   2293  C CB  . THR A 1 298 ? 15.709  67.719  120.939 1.00 49.81  ? 798 THR A CB  1 
ATOM   2294  O OG1 . THR A 1 298 ? 15.994  68.512  119.786 1.00 55.34  ? 798 THR A OG1 1 
ATOM   2295  C CG2 . THR A 1 298 ? 16.956  67.636  121.781 1.00 44.85  ? 798 THR A CG2 1 
ATOM   2296  N N   . GLU A 1 299 ? 14.421  65.386  122.540 1.00 59.67  ? 799 GLU A N   1 
ATOM   2297  C CA  . GLU A 1 299 ? 14.439  64.540  123.718 1.00 60.63  ? 799 GLU A CA  1 
ATOM   2298  C C   . GLU A 1 299 ? 14.196  63.080  123.324 1.00 61.42  ? 799 GLU A C   1 
ATOM   2299  O O   . GLU A 1 299 ? 14.833  62.165  123.842 1.00 54.22  ? 799 GLU A O   1 
ATOM   2300  C CB  . GLU A 1 299 ? 13.387  65.028  124.712 1.00 61.64  ? 799 GLU A CB  1 
ATOM   2301  C CG  . GLU A 1 299 ? 13.517  64.466  126.116 1.00 75.80  ? 799 GLU A CG  1 
ATOM   2302  C CD  . GLU A 1 299 ? 12.856  65.363  127.159 1.00 89.82  ? 799 GLU A CD  1 
ATOM   2303  O OE1 . GLU A 1 299 ? 12.264  64.819  128.118 1.00 91.87  ? 799 GLU A OE1 1 
ATOM   2304  O OE2 . GLU A 1 299 ? 12.932  66.611  127.018 1.00 89.72  ? 799 GLU A OE2 1 
ATOM   2305  N N   . ARG A 1 300 ? 13.273  62.865  122.396 1.00 60.83  ? 800 ARG A N   1 
ATOM   2306  C CA  . ARG A 1 300 ? 12.974  61.515  121.950 1.00 52.10  ? 800 ARG A CA  1 
ATOM   2307  C C   . ARG A 1 300 ? 14.170  60.899  121.232 1.00 53.20  ? 800 ARG A C   1 
ATOM   2308  O O   . ARG A 1 300 ? 14.462  59.710  121.408 1.00 55.24  ? 800 ARG A O   1 
ATOM   2309  C CB  . ARG A 1 300 ? 11.734  61.499  121.049 1.00 47.02  ? 800 ARG A CB  1 
ATOM   2310  C CG  . ARG A 1 300 ? 10.428  61.445  121.820 1.00 46.91  ? 800 ARG A CG  1 
ATOM   2311  C CD  . ARG A 1 300 ? 9.258   61.124  120.919 1.00 39.42  ? 800 ARG A CD  1 
ATOM   2312  N NE  . ARG A 1 300 ? 8.983   62.197  119.967 1.00 45.05  ? 800 ARG A NE  1 
ATOM   2313  C CZ  . ARG A 1 300 ? 9.255   62.142  118.665 1.00 47.57  ? 800 ARG A CZ  1 
ATOM   2314  N NH1 . ARG A 1 300 ? 9.822   61.052  118.136 1.00 40.72  ? 800 ARG A NH1 1 
ATOM   2315  N NH2 . ARG A 1 300 ? 8.950   63.180  117.888 1.00 43.61  ? 800 ARG A NH2 1 
ATOM   2316  N N   . TYR A 1 301 ? 14.864  61.702  120.427 1.00 48.11  ? 801 TYR A N   1 
ATOM   2317  C CA  . TYR A 1 301 ? 16.002  61.183  119.677 1.00 52.07  ? 801 TYR A CA  1 
ATOM   2318  C C   . TYR A 1 301 ? 17.196  60.942  120.592 1.00 55.44  ? 801 TYR A C   1 
ATOM   2319  O O   . TYR A 1 301 ? 17.833  59.891  120.514 1.00 58.22  ? 801 TYR A O   1 
ATOM   2320  C CB  . TYR A 1 301 ? 16.365  62.074  118.483 1.00 42.97  ? 801 TYR A CB  1 
ATOM   2321  C CG  . TYR A 1 301 ? 15.251  62.190  117.462 1.00 34.49  ? 801 TYR A CG  1 
ATOM   2322  C CD1 . TYR A 1 301 ? 14.176  61.310  117.478 1.00 34.86  ? 801 TYR A CD1 1 
ATOM   2323  C CD2 . TYR A 1 301 ? 15.267  63.180  116.493 1.00 32.28  ? 801 TYR A CD2 1 
ATOM   2324  C CE1 . TYR A 1 301 ? 13.151  61.408  116.557 1.00 35.26  ? 801 TYR A CE1 1 
ATOM   2325  C CE2 . TYR A 1 301 ? 14.244  63.290  115.566 1.00 39.83  ? 801 TYR A CE2 1 
ATOM   2326  C CZ  . TYR A 1 301 ? 13.187  62.401  115.604 1.00 43.63  ? 801 TYR A CZ  1 
ATOM   2327  O OH  . TYR A 1 301 ? 12.168  62.500  114.686 1.00 43.81  ? 801 TYR A OH  1 
ATOM   2328  N N   . GLU A 1 302 ? 17.476  61.893  121.478 1.00 53.35  ? 802 GLU A N   1 
ATOM   2329  C CA  . GLU A 1 302 ? 18.546  61.716  122.452 1.00 55.44  ? 802 GLU A CA  1 
ATOM   2330  C C   . GLU A 1 302 ? 18.327  60.464  123.292 1.00 56.54  ? 802 GLU A C   1 
ATOM   2331  O O   . GLU A 1 302 ? 19.277  59.768  123.653 1.00 55.34  ? 802 GLU A O   1 
ATOM   2332  C CB  . GLU A 1 302 ? 18.671  62.929  123.369 1.00 54.78  ? 802 GLU A CB  1 
ATOM   2333  C CG  . GLU A 1 302 ? 19.710  62.746  124.466 1.00 61.98  ? 802 GLU A CG  1 
ATOM   2334  C CD  . GLU A 1 302 ? 21.065  62.279  123.937 1.00 76.09  ? 802 GLU A CD  1 
ATOM   2335  O OE1 . GLU A 1 302 ? 21.259  62.267  122.696 1.00 75.52  ? 802 GLU A OE1 1 
ATOM   2336  O OE2 . GLU A 1 302 ? 21.936  61.923  124.767 1.00 81.58  ? 802 GLU A OE2 1 
ATOM   2337  N N   . LYS A 1 303 ? 17.070  60.171  123.596 1.00 55.15  ? 803 LYS A N   1 
ATOM   2338  C CA  . LYS A 1 303 ? 16.762  58.981  124.370 1.00 52.92  ? 803 LYS A CA  1 
ATOM   2339  C C   . LYS A 1 303 ? 17.288  57.728  123.674 1.00 58.48  ? 803 LYS A C   1 
ATOM   2340  O O   . LYS A 1 303 ? 17.973  56.916  124.299 1.00 64.21  ? 803 LYS A O   1 
ATOM   2341  C CB  . LYS A 1 303 ? 15.259  58.851  124.621 1.00 50.50  ? 803 LYS A CB  1 
ATOM   2342  C CG  . LYS A 1 303 ? 14.896  57.692  125.541 1.00 62.59  ? 803 LYS A CG  1 
ATOM   2343  C CD  . LYS A 1 303 ? 13.396  57.441  125.555 1.00 74.37  ? 803 LYS A CD  1 
ATOM   2344  C CE  . LYS A 1 303 ? 13.007  56.396  126.590 1.00 79.60  ? 803 LYS A CE  1 
ATOM   2345  N NZ  . LYS A 1 303 ? 11.561  56.508  126.937 1.00 83.09  ? 803 LYS A NZ  1 
ATOM   2346  N N   . PHE A 1 304 ? 16.973  57.563  122.389 1.00 45.96  ? 804 PHE A N   1 
ATOM   2347  C CA  . PHE A 1 304 ? 17.396  56.352  121.691 1.00 39.26  ? 804 PHE A CA  1 
ATOM   2348  C C   . PHE A 1 304 ? 18.878  56.319  121.395 1.00 32.39  ? 804 PHE A C   1 
ATOM   2349  O O   . PHE A 1 304 ? 19.467  55.250  121.341 1.00 37.91  ? 804 PHE A O   1 
ATOM   2350  C CB  . PHE A 1 304 ? 16.564  56.056  120.441 1.00 35.51  ? 804 PHE A CB  1 
ATOM   2351  C CG  . PHE A 1 304 ? 15.397  55.165  120.715 1.00 41.01  ? 804 PHE A CG  1 
ATOM   2352  C CD1 . PHE A 1 304 ? 15.562  53.792  120.766 1.00 44.57  ? 804 PHE A CD1 1 
ATOM   2353  C CD2 . PHE A 1 304 ? 14.147  55.697  120.972 1.00 43.00  ? 804 PHE A CD2 1 
ATOM   2354  C CE1 . PHE A 1 304 ? 14.495  52.954  121.044 1.00 46.18  ? 804 PHE A CE1 1 
ATOM   2355  C CE2 . PHE A 1 304 ? 13.075  54.868  121.250 1.00 53.64  ? 804 PHE A CE2 1 
ATOM   2356  C CZ  . PHE A 1 304 ? 13.252  53.484  121.288 1.00 51.28  ? 804 PHE A CZ  1 
ATOM   2357  N N   . ASN A 1 305 ? 19.491  57.482  121.226 1.00 31.29  ? 805 ASN A N   1 
ATOM   2358  C CA  . ASN A 1 305 ? 20.939  57.504  121.119 1.00 35.11  ? 805 ASN A CA  1 
ATOM   2359  C C   . ASN A 1 305 ? 21.562  56.819  122.343 1.00 48.74  ? 805 ASN A C   1 
ATOM   2360  O O   . ASN A 1 305 ? 22.483  56.011  122.208 1.00 55.25  ? 805 ASN A O   1 
ATOM   2361  C CB  . ASN A 1 305 ? 21.461  58.929  120.939 1.00 39.16  ? 805 ASN A CB  1 
ATOM   2362  C CG  . ASN A 1 305 ? 22.944  58.967  120.665 1.00 47.24  ? 805 ASN A CG  1 
ATOM   2363  O OD1 . ASN A 1 305 ? 23.394  58.581  119.586 1.00 53.07  ? 805 ASN A OD1 1 
ATOM   2364  N ND2 . ASN A 1 305 ? 23.719  59.425  121.644 1.00 51.50  ? 805 ASN A ND2 1 
ATOM   2365  N N   . GLN A 1 306 ? 21.035  57.114  123.531 1.00 53.87  ? 806 GLN A N   1 
ATOM   2366  C CA  . GLN A 1 306 ? 21.489  56.452  124.759 1.00 59.03  ? 806 GLN A CA  1 
ATOM   2367  C C   . GLN A 1 306 ? 21.139  54.951  124.805 1.00 55.13  ? 806 GLN A C   1 
ATOM   2368  O O   . GLN A 1 306 ? 21.993  54.114  125.133 1.00 51.57  ? 806 GLN A O   1 
ATOM   2369  C CB  . GLN A 1 306 ? 20.943  57.173  125.996 1.00 61.23  ? 806 GLN A CB  1 
ATOM   2370  C CG  . GLN A 1 306 ? 21.541  58.550  126.212 1.00 74.48  ? 806 GLN A CG  1 
ATOM   2371  C CD  . GLN A 1 306 ? 20.778  59.364  127.244 1.00 90.04  ? 806 GLN A CD  1 
ATOM   2372  O OE1 . GLN A 1 306 ? 19.896  58.845  127.933 1.00 95.44  ? 806 GLN A OE1 1 
ATOM   2373  N NE2 . GLN A 1 306 ? 21.112  60.650  127.351 1.00 89.76  ? 806 GLN A NE2 1 
ATOM   2374  N N   . ILE A 1 307 ? 19.889  54.623  124.472 1.00 46.04  ? 807 ILE A N   1 
ATOM   2375  C CA  . ILE A 1 307 ? 19.425  53.233  124.459 1.00 45.02  ? 807 ILE A CA  1 
ATOM   2376  C C   . ILE A 1 307 ? 20.194  52.362  123.470 1.00 47.28  ? 807 ILE A C   1 
ATOM   2377  O O   . ILE A 1 307 ? 20.535  51.220  123.779 1.00 50.98  ? 807 ILE A O   1 
ATOM   2378  C CB  . ILE A 1 307 ? 17.924  53.121  124.109 1.00 42.76  ? 807 ILE A CB  1 
ATOM   2379  C CG1 . ILE A 1 307 ? 17.051  53.558  125.284 1.00 41.54  ? 807 ILE A CG1 1 
ATOM   2380  C CG2 . ILE A 1 307 ? 17.576  51.687  123.727 1.00 39.92  ? 807 ILE A CG2 1 
ATOM   2381  C CD1 . ILE A 1 307 ? 15.567  53.571  124.962 1.00 39.78  ? 807 ILE A CD1 1 
ATOM   2382  N N   . LEU A 1 308 ? 20.451  52.891  122.276 1.00 47.21  ? 808 LEU A N   1 
ATOM   2383  C CA  . LEU A 1 308 ? 21.161  52.127  121.251 1.00 46.06  ? 808 LEU A CA  1 
ATOM   2384  C C   . LEU A 1 308 ? 22.636  51.941  121.603 1.00 48.69  ? 808 LEU A C   1 
ATOM   2385  O O   . LEU A 1 308 ? 23.219  50.909  121.299 1.00 42.70  ? 808 LEU A O   1 
ATOM   2386  C CB  . LEU A 1 308 ? 21.024  52.778  119.874 1.00 33.06  ? 808 LEU A CB  1 
ATOM   2387  C CG  . LEU A 1 308 ? 19.617  52.784  119.278 1.00 41.13  ? 808 LEU A CG  1 
ATOM   2388  C CD1 . LEU A 1 308 ? 19.580  53.618  117.995 1.00 37.77  ? 808 LEU A CD1 1 
ATOM   2389  C CD2 . LEU A 1 308 ? 19.132  51.368  119.017 1.00 44.73  ? 808 LEU A CD2 1 
ATOM   2390  N N   . THR A 1 309 ? 23.241  52.943  122.234 1.00 50.24  ? 809 THR A N   1 
ATOM   2391  C CA  . THR A 1 309 ? 24.637  52.830  122.633 1.00 46.81  ? 809 THR A CA  1 
ATOM   2392  C C   . THR A 1 309 ? 24.781  51.775  123.723 1.00 50.77  ? 809 THR A C   1 
ATOM   2393  O O   . THR A 1 309 ? 25.816  51.117  123.835 1.00 48.67  ? 809 THR A O   1 
ATOM   2394  C CB  . THR A 1 309 ? 25.194  54.162  123.152 1.00 42.99  ? 809 THR A CB  1 
ATOM   2395  O OG1 . THR A 1 309 ? 25.093  55.153  122.124 1.00 48.66  ? 809 THR A OG1 1 
ATOM   2396  C CG2 . THR A 1 309 ? 26.656  54.007  123.546 1.00 30.37  ? 809 THR A CG2 1 
ATOM   2397  N N   . ALA A 1 310 ? 23.730  51.614  124.519 1.00 50.04  ? 810 ALA A N   1 
ATOM   2398  C CA  . ALA A 1 310 ? 23.753  50.683  125.634 1.00 44.59  ? 810 ALA A CA  1 
ATOM   2399  C C   . ALA A 1 310 ? 23.505  49.244  125.167 1.00 51.46  ? 810 ALA A C   1 
ATOM   2400  O O   . ALA A 1 310 ? 24.145  48.300  125.644 1.00 48.37  ? 810 ALA A O   1 
ATOM   2401  C CB  . ALA A 1 310 ? 22.738  51.100  126.692 1.00 36.88  ? 810 ALA A CB  1 
ATOM   2402  N N   . LEU A 1 311 ? 22.575  49.079  124.233 1.00 45.79  ? 811 LEU A N   1 
ATOM   2403  C CA  . LEU A 1 311 ? 22.311  47.764  123.677 1.00 39.19  ? 811 LEU A CA  1 
ATOM   2404  C C   . LEU A 1 311 ? 23.500  47.299  122.861 1.00 44.43  ? 811 LEU A C   1 
ATOM   2405  O O   . LEU A 1 311 ? 23.828  46.113  122.847 1.00 47.48  ? 811 LEU A O   1 
ATOM   2406  C CB  . LEU A 1 311 ? 21.064  47.773  122.795 1.00 41.81  ? 811 LEU A CB  1 
ATOM   2407  C CG  . LEU A 1 311 ? 19.705  47.810  123.486 1.00 40.39  ? 811 LEU A CG  1 
ATOM   2408  C CD1 . LEU A 1 311 ? 18.611  47.744  122.450 1.00 40.28  ? 811 LEU A CD1 1 
ATOM   2409  C CD2 . LEU A 1 311 ? 19.575  46.661  124.465 1.00 39.46  ? 811 LEU A CD2 1 
ATOM   2410  N N   . SER A 1 312 ? 24.143  48.233  122.168 1.00 44.45  ? 812 SER A N   1 
ATOM   2411  C CA  . SER A 1 312 ? 25.314  47.888  121.368 1.00 43.45  ? 812 SER A CA  1 
ATOM   2412  C C   . SER A 1 312 ? 26.463  47.422  122.272 1.00 46.24  ? 812 SER A C   1 
ATOM   2413  O O   . SER A 1 312 ? 27.211  46.501  121.916 1.00 41.54  ? 812 SER A O   1 
ATOM   2414  C CB  . SER A 1 312 ? 25.749  49.067  120.495 1.00 33.82  ? 812 SER A CB  1 
ATOM   2415  O OG  . SER A 1 312 ? 26.869  48.724  119.692 1.00 40.50  ? 812 SER A OG  1 
ATOM   2416  N N   . ARG A 1 313 ? 26.580  48.063  123.438 1.00 46.45  ? 813 ARG A N   1 
ATOM   2417  C CA  . ARG A 1 313 ? 27.618  47.755  124.419 1.00 47.47  ? 813 ARG A CA  1 
ATOM   2418  C C   . ARG A 1 313 ? 27.336  46.429  125.112 1.00 45.97  ? 813 ARG A C   1 
ATOM   2419  O O   . ARG A 1 313 ? 28.226  45.602  125.274 1.00 42.92  ? 813 ARG A O   1 
ATOM   2420  C CB  . ARG A 1 313 ? 27.737  48.883  125.450 1.00 53.79  ? 813 ARG A CB  1 
ATOM   2421  C CG  . ARG A 1 313 ? 28.147  50.218  124.844 1.00 60.40  ? 813 ARG A CG  1 
ATOM   2422  C CD  . ARG A 1 313 ? 28.360  51.300  125.896 1.00 69.34  ? 813 ARG A CD  1 
ATOM   2423  N NE  . ARG A 1 313 ? 29.779  51.554  126.137 1.00 78.10  ? 813 ARG A NE  1 
ATOM   2424  C CZ  . ARG A 1 313 ? 30.434  51.193  127.239 1.00 84.43  ? 813 ARG A CZ  1 
ATOM   2425  N NH1 . ARG A 1 313 ? 29.802  50.564  128.226 1.00 83.65  ? 813 ARG A NH1 1 
ATOM   2426  N NH2 . ARG A 1 313 ? 31.727  51.469  127.355 1.00 84.24  ? 813 ARG A NH2 1 
ATOM   2427  N N   . LYS A 1 314 ? 26.087  46.232  125.514 1.00 49.86  ? 814 LYS A N   1 
ATOM   2428  C CA  . LYS A 1 314 ? 25.654  44.960  126.067 1.00 48.16  ? 814 LYS A CA  1 
ATOM   2429  C C   . LYS A 1 314 ? 25.928  43.815  125.086 1.00 50.02  ? 814 LYS A C   1 
ATOM   2430  O O   . LYS A 1 314 ? 26.431  42.770  125.480 1.00 54.68  ? 814 LYS A O   1 
ATOM   2431  C CB  . LYS A 1 314 ? 24.170  45.027  126.444 1.00 53.42  ? 814 LYS A CB  1 
ATOM   2432  C CG  . LYS A 1 314 ? 23.634  43.788  127.145 1.00 63.83  ? 814 LYS A CG  1 
ATOM   2433  C CD  . LYS A 1 314 ? 22.242  44.023  127.739 1.00 74.71  ? 814 LYS A CD  1 
ATOM   2434  C CE  . LYS A 1 314 ? 21.216  44.426  126.677 1.00 82.02  ? 814 LYS A CE  1 
ATOM   2435  N NZ  . LYS A 1 314 ? 21.019  43.405  125.601 1.00 82.60  ? 814 LYS A NZ  1 
ATOM   2436  N N   . LEU A 1 315 ? 25.621  44.022  123.807 1.00 54.56  ? 815 LEU A N   1 
ATOM   2437  C CA  . LEU A 1 315 ? 25.799  42.980  122.781 1.00 53.03  ? 815 LEU A CA  1 
ATOM   2438  C C   . LEU A 1 315 ? 27.251  42.690  122.387 1.00 43.11  ? 815 LEU A C   1 
ATOM   2439  O O   . LEU A 1 315 ? 27.636  41.537  122.269 1.00 39.80  ? 815 LEU A O   1 
ATOM   2440  C CB  . LEU A 1 315 ? 24.982  43.297  121.520 1.00 57.30  ? 815 LEU A CB  1 
ATOM   2441  C CG  . LEU A 1 315 ? 23.454  43.200  121.615 1.00 60.79  ? 815 LEU A CG  1 
ATOM   2442  C CD1 . LEU A 1 315 ? 22.813  43.653  120.318 1.00 61.38  ? 815 LEU A CD1 1 
ATOM   2443  C CD2 . LEU A 1 315 ? 23.007  41.788  121.965 1.00 57.07  ? 815 LEU A CD2 1 
ATOM   2444  N N   . GLU A 1 316 ? 28.051  43.727  122.161 1.00 49.63  ? 816 GLU A N   1 
ATOM   2445  C CA  . GLU A 1 316 ? 29.466  43.523  121.844 1.00 47.38  ? 816 GLU A CA  1 
ATOM   2446  C C   . GLU A 1 316 ? 30.361  44.511  122.583 1.00 57.96  ? 816 GLU A C   1 
ATOM   2447  O O   . GLU A 1 316 ? 30.734  45.536  122.026 1.00 66.36  ? 816 GLU A O   1 
ATOM   2448  C CB  . GLU A 1 316 ? 29.705  43.605  120.328 1.00 43.69  ? 816 GLU A CB  1 
ATOM   2449  C CG  . GLU A 1 316 ? 29.061  42.448  119.540 1.00 48.03  ? 816 GLU A CG  1 
ATOM   2450  C CD  . GLU A 1 316 ? 29.485  42.387  118.072 1.00 53.94  ? 816 GLU A CD  1 
ATOM   2451  O OE1 . GLU A 1 316 ? 30.631  42.778  117.748 1.00 58.40  ? 816 GLU A OE1 1 
ATOM   2452  O OE2 . GLU A 1 316 ? 28.668  41.935  117.238 1.00 49.93  ? 816 GLU A OE2 1 
ATOM   2453  N N   . PRO A 1 317 ? 30.708  44.203  123.846 1.00 56.93  ? 817 PRO A N   1 
ATOM   2454  C CA  . PRO A 1 317 ? 31.548  45.087  124.665 1.00 53.85  ? 817 PRO A CA  1 
ATOM   2455  C C   . PRO A 1 317 ? 32.955  45.194  124.091 1.00 55.47  ? 817 PRO A C   1 
ATOM   2456  O O   . PRO A 1 317 ? 33.363  44.336  123.321 1.00 46.35  ? 817 PRO A O   1 
ATOM   2457  C CB  . PRO A 1 317 ? 31.607  44.372  126.017 1.00 49.83  ? 817 PRO A CB  1 
ATOM   2458  C CG  . PRO A 1 317 ? 30.501  43.369  125.995 1.00 46.27  ? 817 PRO A CG  1 
ATOM   2459  C CD  . PRO A 1 317 ? 30.327  42.978  124.569 1.00 51.76  ? 817 PRO A CD  1 
ATOM   2460  N N   . PRO A 1 318 ? 33.685  46.256  124.441 1.00 62.97  ? 818 PRO A N   1 
ATOM   2461  C CA  . PRO A 1 318 ? 35.078  46.386  123.991 1.00 65.09  ? 818 PRO A CA  1 
ATOM   2462  C C   . PRO A 1 318 ? 36.064  45.738  124.957 1.00 62.51  ? 818 PRO A C   1 
ATOM   2463  O O   . PRO A 1 318 ? 37.271  45.905  124.779 1.00 65.46  ? 818 PRO A O   1 
ATOM   2464  C CB  . PRO A 1 318 ? 35.297  47.902  123.965 1.00 68.03  ? 818 PRO A CB  1 
ATOM   2465  C CG  . PRO A 1 318 ? 33.913  48.512  124.109 1.00 67.72  ? 818 PRO A CG  1 
ATOM   2466  C CD  . PRO A 1 318 ? 33.133  47.533  124.909 1.00 58.75  ? 818 PRO A CD  1 
ATOM   2467  N N   . THR B 1 11  ? 32.839  77.255  114.819 1.00 77.16  ? 511 THR B N   1 
ATOM   2468  C CA  . THR B 1 11  ? 33.651  78.159  115.634 1.00 82.68  ? 511 THR B CA  1 
ATOM   2469  C C   . THR B 1 11  ? 32.868  79.451  115.950 1.00 83.62  ? 511 THR B C   1 
ATOM   2470  O O   . THR B 1 11  ? 31.641  79.413  116.038 1.00 82.34  ? 511 THR B O   1 
ATOM   2471  C CB  . THR B 1 11  ? 35.013  78.430  114.955 1.00 73.76  ? 511 THR B CB  1 
ATOM   2472  O OG1 . THR B 1 11  ? 34.819  79.229  113.785 1.00 76.23  ? 511 THR B OG1 1 
ATOM   2473  C CG2 . THR B 1 11  ? 35.663  77.104  114.548 1.00 53.90  ? 511 THR B CG2 1 
ATOM   2474  N N   . VAL B 1 12  ? 33.549  80.579  116.142 1.00 87.80  ? 512 VAL B N   1 
ATOM   2475  C CA  . VAL B 1 12  ? 32.848  81.863  116.326 1.00 91.23  ? 512 VAL B CA  1 
ATOM   2476  C C   . VAL B 1 12  ? 33.330  82.877  115.292 1.00 83.02  ? 512 VAL B C   1 
ATOM   2477  O O   . VAL B 1 12  ? 34.103  82.525  114.411 1.00 82.05  ? 512 VAL B O   1 
ATOM   2478  C CB  . VAL B 1 12  ? 33.051  82.447  117.749 1.00 99.28  ? 512 VAL B CB  1 
ATOM   2479  C CG1 . VAL B 1 12  ? 34.492  82.885  117.944 1.00 101.14 ? 512 VAL B CG1 1 
ATOM   2480  C CG2 . VAL B 1 12  ? 32.100  83.619  117.994 1.00 94.35  ? 512 VAL B CG2 1 
ATOM   2481  N N   . SER B 1 13  ? 32.883  84.127  115.391 1.00 75.52  ? 513 SER B N   1 
ATOM   2482  C CA  . SER B 1 13  ? 33.447  85.185  114.554 1.00 73.94  ? 513 SER B CA  1 
ATOM   2483  C C   . SER B 1 13  ? 34.944  85.276  114.846 1.00 68.74  ? 513 SER B C   1 
ATOM   2484  O O   . SER B 1 13  ? 35.413  84.784  115.873 1.00 64.96  ? 513 SER B O   1 
ATOM   2485  C CB  . SER B 1 13  ? 32.798  86.545  114.845 1.00 77.78  ? 513 SER B CB  1 
ATOM   2486  O OG  . SER B 1 13  ? 31.454  86.418  115.276 1.00 83.19  ? 513 SER B OG  1 
ATOM   2487  N N   . SER B 1 14  ? 35.691  85.916  113.954 1.00 64.67  ? 514 SER B N   1 
ATOM   2488  C CA  . SER B 1 14  ? 37.111  86.138  114.191 1.00 60.32  ? 514 SER B CA  1 
ATOM   2489  C C   . SER B 1 14  ? 37.349  87.487  114.868 1.00 59.32  ? 514 SER B C   1 
ATOM   2490  O O   . SER B 1 14  ? 38.480  87.826  115.207 1.00 64.49  ? 514 SER B O   1 
ATOM   2491  C CB  . SER B 1 14  ? 37.895  86.057  112.880 1.00 54.48  ? 514 SER B CB  1 
ATOM   2492  O OG  . SER B 1 14  ? 37.902  87.299  112.206 1.00 50.19  ? 514 SER B OG  1 
ATOM   2493  N N   . PHE B 1 15  ? 36.279  88.254  115.063 1.00 55.62  ? 515 PHE B N   1 
ATOM   2494  C CA  . PHE B 1 15  ? 36.384  89.573  115.679 1.00 49.51  ? 515 PHE B CA  1 
ATOM   2495  C C   . PHE B 1 15  ? 36.735  89.459  117.149 1.00 60.15  ? 515 PHE B C   1 
ATOM   2496  O O   . PHE B 1 15  ? 36.224  88.584  117.848 1.00 62.03  ? 515 PHE B O   1 
ATOM   2497  C CB  . PHE B 1 15  ? 35.074  90.336  115.539 1.00 38.81  ? 515 PHE B CB  1 
ATOM   2498  C CG  . PHE B 1 15  ? 34.661  90.574  114.118 1.00 33.45  ? 515 PHE B CG  1 
ATOM   2499  C CD1 . PHE B 1 15  ? 33.598  89.890  113.569 1.00 31.49  ? 515 PHE B CD1 1 
ATOM   2500  C CD2 . PHE B 1 15  ? 35.331  91.490  113.335 1.00 36.79  ? 515 PHE B CD2 1 
ATOM   2501  C CE1 . PHE B 1 15  ? 33.203  90.115  112.255 1.00 33.35  ? 515 PHE B CE1 1 
ATOM   2502  C CE2 . PHE B 1 15  ? 34.953  91.716  112.023 1.00 36.17  ? 515 PHE B CE2 1 
ATOM   2503  C CZ  . PHE B 1 15  ? 33.885  91.025  111.483 1.00 35.18  ? 515 PHE B CZ  1 
ATOM   2504  N N   . ARG B 1 16  ? 37.599  90.354  117.620 1.00 57.23  ? 516 ARG B N   1 
ATOM   2505  C CA  . ARG B 1 16  ? 38.025  90.332  119.015 1.00 53.77  ? 516 ARG B CA  1 
ATOM   2506  C C   . ARG B 1 16  ? 37.867  91.714  119.635 1.00 59.64  ? 516 ARG B C   1 
ATOM   2507  O O   . ARG B 1 16  ? 38.851  92.400  119.917 1.00 67.48  ? 516 ARG B O   1 
ATOM   2508  C CB  . ARG B 1 16  ? 39.472  89.841  119.137 1.00 52.19  ? 516 ARG B CB  1 
ATOM   2509  C CG  . ARG B 1 16  ? 39.670  88.381  118.741 1.00 58.19  ? 516 ARG B CG  1 
ATOM   2510  C CD  . ARG B 1 16  ? 38.863  87.441  119.629 1.00 71.47  ? 516 ARG B CD  1 
ATOM   2511  N NE  . ARG B 1 16  ? 38.244  86.362  118.861 1.00 88.48  ? 516 ARG B NE  1 
ATOM   2512  C CZ  . ARG B 1 16  ? 38.768  85.149  118.709 1.00 104.69 ? 516 ARG B CZ  1 
ATOM   2513  N NH1 . ARG B 1 16  ? 39.929  84.849  119.283 1.00 108.83 ? 516 ARG B NH1 1 
ATOM   2514  N NH2 . ARG B 1 16  ? 38.131  84.233  117.985 1.00 108.60 ? 516 ARG B NH2 1 
ATOM   2515  N N   . PRO B 1 17  ? 36.613  92.124  119.850 1.00 52.84  ? 517 PRO B N   1 
ATOM   2516  C CA  . PRO B 1 17  ? 36.267  93.474  120.309 1.00 51.62  ? 517 PRO B CA  1 
ATOM   2517  C C   . PRO B 1 17  ? 36.825  93.797  121.694 1.00 69.47  ? 517 PRO B C   1 
ATOM   2518  O O   . PRO B 1 17  ? 37.028  94.973  122.012 1.00 73.79  ? 517 PRO B O   1 
ATOM   2519  C CB  . PRO B 1 17  ? 34.733  93.452  120.339 1.00 42.92  ? 517 PRO B CB  1 
ATOM   2520  C CG  . PRO B 1 17  ? 34.368  92.014  120.443 1.00 45.52  ? 517 PRO B CG  1 
ATOM   2521  C CD  . PRO B 1 17  ? 35.427  91.266  119.685 1.00 46.59  ? 517 PRO B CD  1 
ATOM   2522  N N   . ASN B 1 18  ? 37.068  92.771  122.506 1.00 76.02  ? 518 ASN B N   1 
ATOM   2523  C CA  . ASN B 1 18  ? 37.630  92.968  123.840 1.00 80.21  ? 518 ASN B CA  1 
ATOM   2524  C C   . ASN B 1 18  ? 39.120  93.281  123.798 1.00 85.72  ? 518 ASN B C   1 
ATOM   2525  O O   . ASN B 1 18  ? 39.631  94.027  124.638 1.00 86.89  ? 518 ASN B O   1 
ATOM   2526  C CB  . ASN B 1 18  ? 37.376  91.744  124.721 1.00 87.46  ? 518 ASN B CB  1 
ATOM   2527  C CG  . ASN B 1 18  ? 36.124  91.879  125.565 1.00 90.22  ? 518 ASN B CG  1 
ATOM   2528  O OD1 . ASN B 1 18  ? 35.002  91.828  125.052 1.00 86.01  ? 518 ASN B OD1 1 
ATOM   2529  N ND2 . ASN B 1 18  ? 36.310  92.039  126.875 1.00 94.75  ? 518 ASN B ND2 1 
ATOM   2530  N N   . GLU B 1 19  ? 39.806  92.706  122.813 1.00 88.66  ? 519 GLU B N   1 
ATOM   2531  C CA  . GLU B 1 19  ? 41.242  92.908  122.637 1.00 86.76  ? 519 GLU B CA  1 
ATOM   2532  C C   . GLU B 1 19  ? 41.506  94.073  121.690 1.00 74.53  ? 519 GLU B C   1 
ATOM   2533  O O   . GLU B 1 19  ? 42.653  94.465  121.491 1.00 72.09  ? 519 GLU B O   1 
ATOM   2534  C CB  . GLU B 1 19  ? 41.898  91.644  122.071 1.00 91.83  ? 519 GLU B CB  1 
ATOM   2535  C CG  . GLU B 1 19  ? 41.349  90.333  122.615 1.00 94.75  ? 519 GLU B CG  1 
ATOM   2536  C CD  . GLU B 1 19  ? 41.634  89.157  121.690 1.00 95.54  ? 519 GLU B CD  1 
ATOM   2537  O OE1 . GLU B 1 19  ? 42.162  89.384  120.578 1.00 95.59  ? 519 GLU B OE1 1 
ATOM   2538  O OE2 . GLU B 1 19  ? 41.328  88.006  122.072 1.00 92.15  ? 519 GLU B OE2 1 
ATOM   2539  N N   . PHE B 1 20  ? 40.436  94.610  121.107 1.00 68.69  ? 520 PHE B N   1 
ATOM   2540  C CA  . PHE B 1 20  ? 40.527  95.700  120.130 1.00 62.61  ? 520 PHE B CA  1 
ATOM   2541  C C   . PHE B 1 20  ? 40.908  97.027  120.776 1.00 62.15  ? 520 PHE B C   1 
ATOM   2542  O O   . PHE B 1 20  ? 40.302  97.456  121.757 1.00 60.04  ? 520 PHE B O   1 
ATOM   2543  C CB  . PHE B 1 20  ? 39.206  95.844  119.357 1.00 52.23  ? 520 PHE B CB  1 
ATOM   2544  C CG  . PHE B 1 20  ? 39.199  96.965  118.343 1.00 48.76  ? 520 PHE B CG  1 
ATOM   2545  C CD1 . PHE B 1 20  ? 39.881  96.840  117.143 1.00 45.02  ? 520 PHE B CD1 1 
ATOM   2546  C CD2 . PHE B 1 20  ? 38.485  98.135  118.580 1.00 52.05  ? 520 PHE B CD2 1 
ATOM   2547  C CE1 . PHE B 1 20  ? 39.867  97.867  116.202 1.00 39.10  ? 520 PHE B CE1 1 
ATOM   2548  C CE2 . PHE B 1 20  ? 38.469  99.168  117.647 1.00 49.23  ? 520 PHE B CE2 1 
ATOM   2549  C CZ  . PHE B 1 20  ? 39.163  99.029  116.456 1.00 45.07  ? 520 PHE B CZ  1 
ATOM   2550  N N   . GLU B 1 21  ? 41.922  97.674  120.221 1.00 69.02  ? 521 GLU B N   1 
ATOM   2551  C CA  . GLU B 1 21  ? 42.306  99.001  120.674 1.00 78.57  ? 521 GLU B CA  1 
ATOM   2552  C C   . GLU B 1 21  ? 42.221  99.965  119.502 1.00 73.39  ? 521 GLU B C   1 
ATOM   2553  O O   . GLU B 1 21  ? 42.350  99.562  118.348 1.00 73.39  ? 521 GLU B O   1 
ATOM   2554  C CB  . GLU B 1 21  ? 43.713  98.988  121.276 1.00 90.59  ? 521 GLU B CB  1 
ATOM   2555  C CG  . GLU B 1 21  ? 43.819  98.197  122.573 1.00 100.71 ? 521 GLU B CG  1 
ATOM   2556  C CD  . GLU B 1 21  ? 45.254  98.002  123.025 1.00 106.63 ? 521 GLU B CD  1 
ATOM   2557  O OE1 . GLU B 1 21  ? 46.154  97.994  122.156 1.00 106.25 ? 521 GLU B OE1 1 
ATOM   2558  O OE2 . GLU B 1 21  ? 45.481  97.863  124.248 1.00 108.23 ? 521 GLU B OE2 1 
ATOM   2559  N N   . SER B 1 22  ? 41.981  101.235 119.804 1.00 65.76  ? 522 SER B N   1 
ATOM   2560  C CA  . SER B 1 22  ? 41.867  102.258 118.782 1.00 59.43  ? 522 SER B CA  1 
ATOM   2561  C C   . SER B 1 22  ? 42.240  103.605 119.361 1.00 56.89  ? 522 SER B C   1 
ATOM   2562  O O   . SER B 1 22  ? 41.904  103.911 120.503 1.00 49.92  ? 522 SER B O   1 
ATOM   2563  C CB  . SER B 1 22  ? 40.443  102.320 118.239 1.00 57.16  ? 522 SER B CB  1 
ATOM   2564  O OG  . SER B 1 22  ? 40.274  103.462 117.419 1.00 52.78  ? 522 SER B OG  1 
ATOM   2565  N N   . LYS B 1 23  ? 42.930  104.414 118.567 1.00 63.82  ? 523 LYS B N   1 
ATOM   2566  C CA  . LYS B 1 23  ? 43.349  105.730 119.029 1.00 72.48  ? 523 LYS B CA  1 
ATOM   2567  C C   . LYS B 1 23  ? 42.141  106.611 119.366 1.00 74.38  ? 523 LYS B C   1 
ATOM   2568  O O   . LYS B 1 23  ? 42.258  107.583 120.117 1.00 81.04  ? 523 LYS B O   1 
ATOM   2569  C CB  . LYS B 1 23  ? 44.276  106.405 118.006 1.00 77.05  ? 523 LYS B CB  1 
ATOM   2570  C CG  . LYS B 1 23  ? 43.682  107.615 117.299 1.00 81.21  ? 523 LYS B CG  1 
ATOM   2571  C CD  . LYS B 1 23  ? 44.769  108.497 116.681 1.00 81.58  ? 523 LYS B CD  1 
ATOM   2572  C CE  . LYS B 1 23  ? 45.598  107.740 115.658 1.00 78.67  ? 523 LYS B CE  1 
ATOM   2573  N NZ  . LYS B 1 23  ? 46.591  108.622 114.986 1.00 77.91  ? 523 LYS B NZ  1 
ATOM   2574  N N   . PHE B 1 24  ? 40.977  106.257 118.826 1.00 67.43  ? 524 PHE B N   1 
ATOM   2575  C CA  . PHE B 1 24  ? 39.746  106.980 119.131 1.00 58.70  ? 524 PHE B CA  1 
ATOM   2576  C C   . PHE B 1 24  ? 38.856  106.209 120.100 1.00 60.65  ? 524 PHE B C   1 
ATOM   2577  O O   . PHE B 1 24  ? 37.634  106.302 120.027 1.00 61.91  ? 524 PHE B O   1 
ATOM   2578  C CB  . PHE B 1 24  ? 38.954  107.253 117.862 1.00 49.20  ? 524 PHE B CB  1 
ATOM   2579  C CG  . PHE B 1 24  ? 39.764  107.834 116.754 1.00 51.20  ? 524 PHE B CG  1 
ATOM   2580  C CD1 . PHE B 1 24  ? 39.805  109.201 116.557 1.00 54.31  ? 524 PHE B CD1 1 
ATOM   2581  C CD2 . PHE B 1 24  ? 40.466  107.010 115.892 1.00 55.69  ? 524 PHE B CD2 1 
ATOM   2582  C CE1 . PHE B 1 24  ? 40.544  109.744 115.525 1.00 60.72  ? 524 PHE B CE1 1 
ATOM   2583  C CE2 . PHE B 1 24  ? 41.207  107.542 114.856 1.00 62.96  ? 524 PHE B CE2 1 
ATOM   2584  C CZ  . PHE B 1 24  ? 41.245  108.914 114.671 1.00 65.97  ? 524 PHE B CZ  1 
ATOM   2585  N N   . LEU B 1 25  ? 39.469  105.458 121.008 1.00 65.22  ? 525 LEU B N   1 
ATOM   2586  C CA  . LEU B 1 25  ? 38.722  104.615 121.938 1.00 70.74  ? 525 LEU B CA  1 
ATOM   2587  C C   . LEU B 1 25  ? 39.435  104.502 123.291 1.00 77.22  ? 525 LEU B C   1 
ATOM   2588  O O   . LEU B 1 25  ? 40.636  104.226 123.347 1.00 84.39  ? 525 LEU B O   1 
ATOM   2589  C CB  . LEU B 1 25  ? 38.520  103.225 121.324 1.00 71.67  ? 525 LEU B CB  1 
ATOM   2590  C CG  . LEU B 1 25  ? 37.195  102.506 121.593 1.00 67.83  ? 525 LEU B CG  1 
ATOM   2591  C CD1 . LEU B 1 25  ? 36.038  103.476 121.451 1.00 68.20  ? 525 LEU B CD1 1 
ATOM   2592  C CD2 . LEU B 1 25  ? 37.020  101.318 120.660 1.00 56.53  ? 525 LEU B CD2 1 
ATOM   2593  N N   . PRO B 1 26  ? 38.696  104.717 124.390 1.00 72.44  ? 526 PRO B N   1 
ATOM   2594  C CA  . PRO B 1 26  ? 39.301  104.619 125.724 1.00 74.22  ? 526 PRO B CA  1 
ATOM   2595  C C   . PRO B 1 26  ? 39.613  103.171 126.093 1.00 79.34  ? 526 PRO B C   1 
ATOM   2596  O O   . PRO B 1 26  ? 38.857  102.274 125.719 1.00 76.96  ? 526 PRO B O   1 
ATOM   2597  C CB  . PRO B 1 26  ? 38.211  105.172 126.645 1.00 72.21  ? 526 PRO B CB  1 
ATOM   2598  C CG  . PRO B 1 26  ? 36.932  104.913 125.911 1.00 74.40  ? 526 PRO B CG  1 
ATOM   2599  C CD  . PRO B 1 26  ? 37.260  105.046 124.448 1.00 70.41  ? 526 PRO B CD  1 
ATOM   2600  N N   . PRO B 1 27  ? 40.719  102.951 126.821 1.00 81.85  ? 527 PRO B N   1 
ATOM   2601  C CA  . PRO B 1 27  ? 41.127  101.629 127.295 1.00 82.25  ? 527 PRO B CA  1 
ATOM   2602  C C   . PRO B 1 27  ? 39.941  100.694 127.535 1.00 86.89  ? 527 PRO B C   1 
ATOM   2603  O O   . PRO B 1 27  ? 39.985  99.548  127.080 1.00 87.29  ? 527 PRO B O   1 
ATOM   2604  C CB  . PRO B 1 27  ? 41.829  101.957 128.612 1.00 79.76  ? 527 PRO B CB  1 
ATOM   2605  C CG  . PRO B 1 27  ? 42.526  103.265 128.315 1.00 77.25  ? 527 PRO B CG  1 
ATOM   2606  C CD  . PRO B 1 27  ? 41.616  104.007 127.331 1.00 81.94  ? 527 PRO B CD  1 
ATOM   2607  N N   . GLU B 1 28  ? 38.909  101.172 128.231 1.00 86.80  ? 528 GLU B N   1 
ATOM   2608  C CA  . GLU B 1 28  ? 37.726  100.357 128.512 1.00 89.48  ? 528 GLU B CA  1 
ATOM   2609  C C   . GLU B 1 28  ? 36.490  101.224 128.685 1.00 86.78  ? 528 GLU B C   1 
ATOM   2610  O O   . GLU B 1 28  ? 36.494  102.170 129.471 1.00 97.71  ? 528 GLU B O   1 
ATOM   2611  C CB  . GLU B 1 28  ? 37.943  99.507  129.764 1.00 97.72  ? 528 GLU B CB  1 
ATOM   2612  C CG  . GLU B 1 28  ? 37.360  98.110  129.664 1.00 100.37 ? 528 GLU B CG  1 
ATOM   2613  C CD  . GLU B 1 28  ? 38.188  97.094  130.420 1.00 100.67 ? 528 GLU B CD  1 
ATOM   2614  O OE1 . GLU B 1 28  ? 38.434  97.320  131.626 1.00 103.50 ? 528 GLU B OE1 1 
ATOM   2615  O OE2 . GLU B 1 28  ? 38.606  96.087  129.800 1.00 97.69  ? 528 GLU B OE2 1 
ATOM   2616  N N   . ASN B 1 29  ? 35.433  100.897 127.951 1.00 74.59  ? 529 ASN B N   1 
ATOM   2617  C CA  . ASN B 1 29  ? 34.223  101.703 127.970 1.00 63.35  ? 529 ASN B CA  1 
ATOM   2618  C C   . ASN B 1 29  ? 32.998  100.875 128.325 1.00 52.28  ? 529 ASN B C   1 
ATOM   2619  O O   . ASN B 1 29  ? 33.006  99.650  128.202 1.00 50.11  ? 529 ASN B O   1 
ATOM   2620  C CB  . ASN B 1 29  ? 34.015  102.378 126.615 1.00 68.42  ? 529 ASN B CB  1 
ATOM   2621  C CG  . ASN B 1 29  ? 33.885  101.373 125.465 1.00 64.45  ? 529 ASN B CG  1 
ATOM   2622  O OD1 . ASN B 1 29  ? 32.799  100.860 125.196 1.00 53.84  ? 529 ASN B OD1 1 
ATOM   2623  N ND2 . ASN B 1 29  ? 34.993  101.104 124.779 1.00 65.36  ? 529 ASN B ND2 1 
ATOM   2624  N N   . LYS B 1 30  ? 31.950  101.547 128.782 1.00 52.80  ? 530 LYS B N   1 
ATOM   2625  C CA  . LYS B 1 30  ? 30.688  100.888 129.080 1.00 53.65  ? 530 LYS B CA  1 
ATOM   2626  C C   . LYS B 1 30  ? 29.872  100.808 127.799 1.00 47.12  ? 530 LYS B C   1 
ATOM   2627  O O   . LYS B 1 30  ? 30.232  101.418 126.795 1.00 46.08  ? 530 LYS B O   1 
ATOM   2628  C CB  . LYS B 1 30  ? 29.918  101.676 130.147 1.00 62.36  ? 530 LYS B CB  1 
ATOM   2629  C CG  . LYS B 1 30  ? 30.443  101.519 131.577 1.00 74.72  ? 530 LYS B CG  1 
ATOM   2630  C CD  . LYS B 1 30  ? 29.897  100.243 132.234 1.00 86.96  ? 530 LYS B CD  1 
ATOM   2631  C CE  . LYS B 1 30  ? 28.373  100.289 132.361 1.00 89.25  ? 530 LYS B CE  1 
ATOM   2632  N NZ  . LYS B 1 30  ? 27.785  98.933  132.543 1.00 89.72  ? 530 LYS B NZ  1 
ATOM   2633  N N   . PRO B 1 31  ? 28.759  100.065 127.828 1.00 45.82  ? 531 PRO B N   1 
ATOM   2634  C CA  . PRO B 1 31  ? 27.932  100.008 126.623 1.00 43.54  ? 531 PRO B CA  1 
ATOM   2635  C C   . PRO B 1 31  ? 27.256  101.350 126.389 1.00 48.13  ? 531 PRO B C   1 
ATOM   2636  O O   . PRO B 1 31  ? 26.781  101.974 127.334 1.00 47.54  ? 531 PRO B O   1 
ATOM   2637  C CB  . PRO B 1 31  ? 26.870  98.945  126.962 1.00 38.55  ? 531 PRO B CB  1 
ATOM   2638  C CG  . PRO B 1 31  ? 27.339  98.277  128.217 1.00 45.05  ? 531 PRO B CG  1 
ATOM   2639  C CD  . PRO B 1 31  ? 28.179  99.291  128.937 1.00 47.26  ? 531 PRO B CD  1 
ATOM   2640  N N   . LEU B 1 32  ? 27.219  101.790 125.138 1.00 55.63  ? 532 LEU B N   1 
ATOM   2641  C CA  . LEU B 1 32  ? 26.448  102.969 124.769 1.00 51.71  ? 532 LEU B CA  1 
ATOM   2642  C C   . LEU B 1 32  ? 26.861  104.220 125.535 1.00 51.33  ? 532 LEU B C   1 
ATOM   2643  O O   . LEU B 1 32  ? 26.008  105.045 125.868 1.00 46.06  ? 532 LEU B O   1 
ATOM   2644  C CB  . LEU B 1 32  ? 24.955  102.710 124.997 1.00 46.56  ? 532 LEU B CB  1 
ATOM   2645  C CG  . LEU B 1 32  ? 24.250  101.660 124.134 1.00 40.77  ? 532 LEU B CG  1 
ATOM   2646  C CD1 . LEU B 1 32  ? 22.765  101.604 124.473 1.00 29.82  ? 532 LEU B CD1 1 
ATOM   2647  C CD2 . LEU B 1 32  ? 24.454  101.924 122.638 1.00 32.20  ? 532 LEU B CD2 1 
ATOM   2648  N N   . GLU B 1 33  ? 28.154  104.362 125.824 1.00 54.01  ? 533 GLU B N   1 
ATOM   2649  C CA  . GLU B 1 33  ? 28.630  105.553 126.525 1.00 55.41  ? 533 GLU B CA  1 
ATOM   2650  C C   . GLU B 1 33  ? 28.191  106.802 125.770 1.00 57.86  ? 533 GLU B C   1 
ATOM   2651  O O   . GLU B 1 33  ? 28.438  106.944 124.572 1.00 54.79  ? 533 GLU B O   1 
ATOM   2652  C CB  . GLU B 1 33  ? 30.148  105.530 126.710 1.00 57.50  ? 533 GLU B CB  1 
ATOM   2653  C CG  . GLU B 1 33  ? 30.627  104.549 127.766 1.00 66.86  ? 533 GLU B CG  1 
ATOM   2654  C CD  . GLU B 1 33  ? 31.942  104.969 128.406 1.00 75.61  ? 533 GLU B CD  1 
ATOM   2655  O OE1 . GLU B 1 33  ? 32.709  105.722 127.769 1.00 76.29  ? 533 GLU B OE1 1 
ATOM   2656  O OE2 . GLU B 1 33  ? 32.204  104.556 129.556 1.00 80.10  ? 533 GLU B OE2 1 
ATOM   2657  N N   . THR B 1 34  ? 27.529  107.705 126.477 1.00 61.14  ? 534 THR B N   1 
ATOM   2658  C CA  . THR B 1 34  ? 26.830  108.806 125.821 1.00 60.18  ? 534 THR B CA  1 
ATOM   2659  C C   . THR B 1 34  ? 27.735  109.715 124.986 1.00 51.24  ? 534 THR B C   1 
ATOM   2660  O O   . THR B 1 34  ? 27.335  110.192 123.918 1.00 47.11  ? 534 THR B O   1 
ATOM   2661  C CB  . THR B 1 34  ? 26.051  109.625 126.838 1.00 61.74  ? 534 THR B CB  1 
ATOM   2662  O OG1 . THR B 1 34  ? 26.060  111.002 126.448 1.00 65.46  ? 534 THR B OG1 1 
ATOM   2663  C CG2 . THR B 1 34  ? 26.691  109.477 128.208 1.00 66.97  ? 534 THR B CG2 1 
ATOM   2664  N N   . ALA B 1 35  ? 28.953  109.946 125.460 1.00 47.81  ? 535 ALA B N   1 
ATOM   2665  C CA  . ALA B 1 35  ? 29.884  110.814 124.741 1.00 46.03  ? 535 ALA B CA  1 
ATOM   2666  C C   . ALA B 1 35  ? 30.466  110.107 123.517 1.00 53.91  ? 535 ALA B C   1 
ATOM   2667  O O   . ALA B 1 35  ? 30.732  110.735 122.490 1.00 51.98  ? 535 ALA B O   1 
ATOM   2668  C CB  . ALA B 1 35  ? 30.989  111.300 125.667 1.00 33.98  ? 535 ALA B CB  1 
ATOM   2669  N N   . LEU B 1 36  ? 30.666  108.796 123.633 1.00 58.10  ? 536 LEU B N   1 
ATOM   2670  C CA  . LEU B 1 36  ? 31.109  107.993 122.501 1.00 51.52  ? 536 LEU B CA  1 
ATOM   2671  C C   . LEU B 1 36  ? 30.072  108.008 121.386 1.00 51.99  ? 536 LEU B C   1 
ATOM   2672  O O   . LEU B 1 36  ? 30.379  108.343 120.239 1.00 48.73  ? 536 LEU B O   1 
ATOM   2673  C CB  . LEU B 1 36  ? 31.358  106.561 122.944 1.00 53.95  ? 536 LEU B CB  1 
ATOM   2674  C CG  . LEU B 1 36  ? 32.655  106.384 123.711 1.00 58.52  ? 536 LEU B CG  1 
ATOM   2675  C CD1 . LEU B 1 36  ? 32.897  104.910 124.004 1.00 57.31  ? 536 LEU B CD1 1 
ATOM   2676  C CD2 . LEU B 1 36  ? 33.775  106.970 122.885 1.00 58.98  ? 536 LEU B CD2 1 
ATOM   2677  N N   . LEU B 1 37  ? 28.842  107.634 121.729 1.00 50.26  ? 537 LEU B N   1 
ATOM   2678  C CA  . LEU B 1 37  ? 27.752  107.663 120.768 1.00 46.72  ? 537 LEU B CA  1 
ATOM   2679  C C   . LEU B 1 37  ? 27.630  109.049 120.163 1.00 49.26  ? 537 LEU B C   1 
ATOM   2680  O O   . LEU B 1 37  ? 27.405  109.184 118.965 1.00 43.43  ? 537 LEU B O   1 
ATOM   2681  C CB  . LEU B 1 37  ? 26.431  107.254 121.417 1.00 44.72  ? 537 LEU B CB  1 
ATOM   2682  C CG  . LEU B 1 37  ? 26.328  105.800 121.882 1.00 54.82  ? 537 LEU B CG  1 
ATOM   2683  C CD1 . LEU B 1 37  ? 25.001  105.553 122.579 1.00 56.67  ? 537 LEU B CD1 1 
ATOM   2684  C CD2 . LEU B 1 37  ? 26.504  104.845 120.715 1.00 51.05  ? 537 LEU B CD2 1 
ATOM   2685  N N   . LYS B 1 38  ? 27.786  110.078 120.991 1.00 53.65  ? 538 LYS B N   1 
ATOM   2686  C CA  . LYS B 1 38  ? 27.660  111.446 120.511 1.00 52.11  ? 538 LYS B CA  1 
ATOM   2687  C C   . LYS B 1 38  ? 28.731  111.748 119.479 1.00 45.36  ? 538 LYS B C   1 
ATOM   2688  O O   . LYS B 1 38  ? 28.445  112.281 118.404 1.00 37.54  ? 538 LYS B O   1 
ATOM   2689  C CB  . LYS B 1 38  ? 27.769  112.449 121.658 1.00 60.00  ? 538 LYS B CB  1 
ATOM   2690  C CG  . LYS B 1 38  ? 27.561  113.877 121.197 1.00 67.43  ? 538 LYS B CG  1 
ATOM   2691  C CD  . LYS B 1 38  ? 27.718  114.875 122.323 1.00 75.50  ? 538 LYS B CD  1 
ATOM   2692  C CE  . LYS B 1 38  ? 27.486  116.286 121.813 1.00 78.78  ? 538 LYS B CE  1 
ATOM   2693  N NZ  . LYS B 1 38  ? 27.814  117.312 122.837 1.00 83.21  ? 538 LYS B NZ  1 
ATOM   2694  N N   . ARG B 1 39  ? 29.968  111.405 119.814 1.00 39.83  ? 539 ARG B N   1 
ATOM   2695  C CA  . ARG B 1 39  ? 31.091  111.638 118.921 1.00 44.66  ? 539 ARG B CA  1 
ATOM   2696  C C   . ARG B 1 39  ? 30.923  110.962 117.543 1.00 46.18  ? 539 ARG B C   1 
ATOM   2697  O O   . ARG B 1 39  ? 31.159  111.576 116.492 1.00 42.93  ? 539 ARG B O   1 
ATOM   2698  C CB  . ARG B 1 39  ? 32.382  111.178 119.594 1.00 48.92  ? 539 ARG B CB  1 
ATOM   2699  C CG  . ARG B 1 39  ? 33.579  111.239 118.677 1.00 55.09  ? 539 ARG B CG  1 
ATOM   2700  C CD  . ARG B 1 39  ? 33.534  112.495 117.823 1.00 51.14  ? 539 ARG B CD  1 
ATOM   2701  N NE  . ARG B 1 39  ? 34.629  112.530 116.860 1.00 61.76  ? 539 ARG B NE  1 
ATOM   2702  C CZ  . ARG B 1 39  ? 34.716  113.404 115.862 1.00 80.06  ? 539 ARG B CZ  1 
ATOM   2703  N NH1 . ARG B 1 39  ? 33.767  114.317 115.693 1.00 87.03  ? 539 ARG B NH1 1 
ATOM   2704  N NH2 . ARG B 1 39  ? 35.748  113.363 115.028 1.00 84.29  ? 539 ARG B NH2 1 
ATOM   2705  N N   . ALA B 1 40  ? 30.518  109.696 117.549 1.00 41.56  ? 540 ALA B N   1 
ATOM   2706  C CA  . ALA B 1 40  ? 30.292  108.969 116.302 1.00 43.66  ? 540 ALA B CA  1 
ATOM   2707  C C   . ALA B 1 40  ? 29.189  109.617 115.457 1.00 48.61  ? 540 ALA B C   1 
ATOM   2708  O O   . ALA B 1 40  ? 29.327  109.772 114.233 1.00 46.61  ? 540 ALA B O   1 
ATOM   2709  C CB  . ALA B 1 40  ? 29.955  107.515 116.598 1.00 40.69  ? 540 ALA B CB  1 
ATOM   2710  N N   . LYS B 1 41  ? 28.097  109.981 116.125 1.00 47.63  ? 541 LYS B N   1 
ATOM   2711  C CA  . LYS B 1 41  ? 26.980  110.687 115.503 1.00 51.00  ? 541 LYS B CA  1 
ATOM   2712  C C   . LYS B 1 41  ? 27.467  111.939 114.779 1.00 45.94  ? 541 LYS B C   1 
ATOM   2713  O O   . LYS B 1 41  ? 27.069  112.205 113.642 1.00 46.28  ? 541 LYS B O   1 
ATOM   2714  C CB  . LYS B 1 41  ? 25.943  111.057 116.570 1.00 57.58  ? 541 LYS B CB  1 
ATOM   2715  C CG  . LYS B 1 41  ? 24.782  111.919 116.089 1.00 63.36  ? 541 LYS B CG  1 
ATOM   2716  C CD  . LYS B 1 41  ? 23.874  111.172 115.125 1.00 66.95  ? 541 LYS B CD  1 
ATOM   2717  C CE  . LYS B 1 41  ? 22.657  112.009 114.753 1.00 62.20  ? 541 LYS B CE  1 
ATOM   2718  N NZ  . LYS B 1 41  ? 22.021  111.472 113.524 1.00 60.81  ? 541 LYS B NZ  1 
ATOM   2719  N N   . GLU B 1 42  ? 28.336  112.699 115.443 1.00 46.27  ? 542 GLU B N   1 
ATOM   2720  C CA  . GLU B 1 42  ? 28.921  113.896 114.850 1.00 48.39  ? 542 GLU B CA  1 
ATOM   2721  C C   . GLU B 1 42  ? 29.631  113.559 113.537 1.00 49.06  ? 542 GLU B C   1 
ATOM   2722  O O   . GLU B 1 42  ? 29.552  114.334 112.579 1.00 43.70  ? 542 GLU B O   1 
ATOM   2723  C CB  . GLU B 1 42  ? 29.906  114.564 115.817 1.00 53.20  ? 542 GLU B CB  1 
ATOM   2724  C CG  . GLU B 1 42  ? 29.293  115.125 117.091 1.00 66.52  ? 542 GLU B CG  1 
ATOM   2725  C CD  . GLU B 1 42  ? 30.320  115.838 117.972 1.00 79.47  ? 542 GLU B CD  1 
ATOM   2726  O OE1 . GLU B 1 42  ? 31.542  115.674 117.735 1.00 76.73  ? 542 GLU B OE1 1 
ATOM   2727  O OE2 . GLU B 1 42  ? 29.905  116.571 118.897 1.00 84.34  ? 542 GLU B OE2 1 
ATOM   2728  N N   . LEU B 1 43  ? 30.326  112.414 113.501 1.00 44.71  ? 543 LEU B N   1 
ATOM   2729  C CA  . LEU B 1 43  ? 31.050  111.989 112.301 1.00 47.11  ? 543 LEU B CA  1 
ATOM   2730  C C   . LEU B 1 43  ? 30.102  111.767 111.129 1.00 48.12  ? 543 LEU B C   1 
ATOM   2731  O O   . LEU B 1 43  ? 30.335  112.247 110.017 1.00 48.66  ? 543 LEU B O   1 
ATOM   2732  C CB  . LEU B 1 43  ? 31.869  110.716 112.555 1.00 54.59  ? 543 LEU B CB  1 
ATOM   2733  C CG  . LEU B 1 43  ? 33.344  110.825 112.956 1.00 58.04  ? 543 LEU B CG  1 
ATOM   2734  C CD1 . LEU B 1 43  ? 33.977  109.452 112.930 1.00 61.62  ? 543 LEU B CD1 1 
ATOM   2735  C CD2 . LEU B 1 43  ? 34.128  111.779 112.059 1.00 58.64  ? 543 LEU B CD2 1 
ATOM   2736  N N   . PHE B 1 44  ? 29.039  111.021 111.389 1.00 50.15  ? 544 PHE B N   1 
ATOM   2737  C CA  A PHE B 1 44  ? 28.066  110.760 110.343 0.52 48.79  ? 544 PHE B CA  1 
ATOM   2738  C CA  B PHE B 1 44  ? 27.969  110.740 110.432 0.48 48.00  ? 544 PHE B CA  1 
ATOM   2739  C C   . PHE B 1 44  ? 27.346  112.051 109.951 1.00 54.14  ? 544 PHE B C   1 
ATOM   2740  O O   . PHE B 1 44  ? 27.001  112.234 108.781 1.00 55.67  ? 544 PHE B O   1 
ATOM   2741  C CB  A PHE B 1 44  ? 27.102  109.640 110.747 0.52 44.04  ? 544 PHE B CB  1 
ATOM   2742  C CB  B PHE B 1 44  ? 26.926  109.883 111.160 0.48 44.27  ? 544 PHE B CB  1 
ATOM   2743  C CG  A PHE B 1 44  ? 27.776  108.302 110.923 0.52 40.72  ? 544 PHE B CG  1 
ATOM   2744  C CG  B PHE B 1 44  ? 25.742  109.485 110.330 0.48 41.53  ? 544 PHE B CG  1 
ATOM   2745  C CD1 A PHE B 1 44  ? 28.849  107.944 110.121 0.52 36.60  ? 544 PHE B CD1 1 
ATOM   2746  C CD1 B PHE B 1 44  ? 24.464  109.853 110.717 0.48 37.04  ? 544 PHE B CD1 1 
ATOM   2747  C CD2 A PHE B 1 44  ? 27.353  107.416 111.902 0.52 36.09  ? 544 PHE B CD2 1 
ATOM   2748  C CD2 B PHE B 1 44  ? 25.894  108.708 109.197 0.48 43.35  ? 544 PHE B CD2 1 
ATOM   2749  C CE1 A PHE B 1 44  ? 29.475  106.721 110.283 0.52 32.98  ? 544 PHE B CE1 1 
ATOM   2750  C CE1 B PHE B 1 44  ? 23.366  109.476 109.978 0.48 36.74  ? 544 PHE B CE1 1 
ATOM   2751  C CE2 A PHE B 1 44  ? 27.973  106.203 112.068 0.52 31.88  ? 544 PHE B CE2 1 
ATOM   2752  C CE2 B PHE B 1 44  ? 24.794  108.328 108.452 0.48 41.60  ? 544 PHE B CE2 1 
ATOM   2753  C CZ  A PHE B 1 44  ? 29.036  105.854 111.255 0.52 32.96  ? 544 PHE B CZ  1 
ATOM   2754  C CZ  B PHE B 1 44  ? 23.531  108.711 108.846 0.48 38.82  ? 544 PHE B CZ  1 
ATOM   2755  N N   . THR B 1 45  ? 27.184  112.965 110.895 1.00 54.84  ? 545 THR B N   1 
ATOM   2756  C CA  . THR B 1 45  ? 26.560  114.245 110.615 1.00 53.90  ? 545 THR B CA  1 
ATOM   2757  C C   . THR B 1 45  ? 27.456  115.155 109.761 1.00 49.14  ? 545 THR B C   1 
ATOM   2758  O O   . THR B 1 45  ? 26.986  115.792 108.820 1.00 47.63  ? 545 THR B O   1 
ATOM   2759  C CB  . THR B 1 45  ? 26.177  114.957 111.932 1.00 62.35  ? 545 THR B CB  1 
ATOM   2760  O OG1 . THR B 1 45  ? 25.137  114.218 112.593 1.00 60.19  ? 545 THR B OG1 1 
ATOM   2761  C CG2 . THR B 1 45  ? 25.711  116.384 111.661 1.00 61.68  ? 545 THR B CG2 1 
ATOM   2762  N N   . ASN B 1 46  ? 28.746  115.201 110.082 1.00 46.86  ? 546 ASN B N   1 
ATOM   2763  C CA  . ASN B 1 46  ? 29.657  116.151 109.445 1.00 48.09  ? 546 ASN B CA  1 
ATOM   2764  C C   . ASN B 1 46  ? 30.174  115.753 108.071 1.00 45.49  ? 546 ASN B C   1 
ATOM   2765  O O   . ASN B 1 46  ? 30.927  116.510 107.456 1.00 52.30  ? 546 ASN B O   1 
ATOM   2766  C CB  . ASN B 1 46  ? 30.863  116.433 110.344 1.00 57.50  ? 546 ASN B CB  1 
ATOM   2767  C CG  . ASN B 1 46  ? 30.497  117.201 111.601 1.00 65.83  ? 546 ASN B CG  1 
ATOM   2768  O OD1 . ASN B 1 46  ? 29.420  117.805 111.694 1.00 63.51  ? 546 ASN B OD1 1 
ATOM   2769  N ND2 . ASN B 1 46  ? 31.405  117.190 112.577 1.00 64.27  ? 546 ASN B ND2 1 
ATOM   2770  N N   . ASN B 1 47  ? 29.799  114.569 107.598 1.00 32.43  ? 547 ASN B N   1 
ATOM   2771  C CA  . ASN B 1 47  ? 30.350  114.064 106.349 1.00 29.60  ? 547 ASN B CA  1 
ATOM   2772  C C   . ASN B 1 47  ? 29.301  113.821 105.286 1.00 26.08  ? 547 ASN B C   1 
ATOM   2773  O O   . ASN B 1 47  ? 28.165  113.479 105.598 1.00 33.23  ? 547 ASN B O   1 
ATOM   2774  C CB  . ASN B 1 47  ? 31.130  112.772 106.590 1.00 34.88  ? 547 ASN B CB  1 
ATOM   2775  C CG  . ASN B 1 47  ? 32.501  113.019 107.162 1.00 38.09  ? 547 ASN B CG  1 
ATOM   2776  O OD1 . ASN B 1 47  ? 33.452  113.276 106.427 1.00 39.64  ? 547 ASN B OD1 1 
ATOM   2777  N ND2 . ASN B 1 47  ? 32.617  112.933 108.484 1.00 45.25  ? 547 ASN B ND2 1 
ATOM   2778  N N   . ASP B 1 48  ? 29.705  113.995 104.031 1.00 22.59  ? 548 ASP B N   1 
ATOM   2779  C CA  . ASP B 1 48  ? 28.860  113.750 102.857 1.00 27.12  ? 548 ASP B CA  1 
ATOM   2780  C C   . ASP B 1 48  ? 28.458  112.265 102.690 1.00 30.82  ? 548 ASP B C   1 
ATOM   2781  O O   . ASP B 1 48  ? 29.275  111.365 102.918 1.00 29.81  ? 548 ASP B O   1 
ATOM   2782  C CB  . ASP B 1 48  ? 29.600  114.250 101.613 1.00 30.46  ? 548 ASP B CB  1 
ATOM   2783  C CG  . ASP B 1 48  ? 28.811  114.058 100.354 1.00 41.07  ? 548 ASP B CG  1 
ATOM   2784  O OD1 . ASP B 1 48  ? 28.922  112.970 99.762  1.00 51.32  ? 548 ASP B OD1 1 
ATOM   2785  O OD2 . ASP B 1 48  ? 28.079  114.991 99.953  1.00 48.08  ? 548 ASP B OD2 1 
ATOM   2786  N N   . PRO B 1 49  ? 27.195  112.003 102.296 1.00 26.93  ? 549 PRO B N   1 
ATOM   2787  C CA  . PRO B 1 49  ? 26.748  110.610 102.191 1.00 25.35  ? 549 PRO B CA  1 
ATOM   2788  C C   . PRO B 1 49  ? 27.653  109.771 101.292 1.00 28.46  ? 549 PRO B C   1 
ATOM   2789  O O   . PRO B 1 49  ? 27.940  108.620 101.623 1.00 29.19  ? 549 PRO B O   1 
ATOM   2790  C CB  . PRO B 1 49  ? 25.334  110.735 101.605 1.00 33.44  ? 549 PRO B CB  1 
ATOM   2791  C CG  . PRO B 1 49  ? 24.868  112.104 102.041 1.00 26.40  ? 549 PRO B CG  1 
ATOM   2792  C CD  . PRO B 1 49  ? 26.100  112.961 102.045 1.00 19.41  ? 549 PRO B CD  1 
ATOM   2793  N N   . LYS B 1 50  ? 28.111  110.348 100.185 1.00 22.45  ? 550 LYS B N   1 
ATOM   2794  C CA  . LYS B 1 50  ? 29.044  109.668 99.280  1.00 19.93  ? 550 LYS B CA  1 
ATOM   2795  C C   . LYS B 1 50  ? 30.412  109.340 99.935  1.00 32.74  ? 550 LYS B C   1 
ATOM   2796  O O   . LYS B 1 50  ? 30.995  108.282 99.675  1.00 21.37  ? 550 LYS B O   1 
ATOM   2797  C CB  . LYS B 1 50  ? 29.231  110.513 98.022  1.00 20.92  ? 550 LYS B CB  1 
ATOM   2798  C CG  . LYS B 1 50  ? 30.053  109.896 96.933  1.00 24.49  ? 550 LYS B CG  1 
ATOM   2799  C CD  . LYS B 1 50  ? 30.088  110.861 95.755  1.00 29.12  ? 550 LYS B CD  1 
ATOM   2800  C CE  . LYS B 1 50  ? 28.980  110.587 94.780  1.00 21.34  ? 550 LYS B CE  1 
ATOM   2801  N NZ  . LYS B 1 50  ? 29.161  109.219 94.211  1.00 28.23  ? 550 LYS B NZ  1 
ATOM   2802  N N   . VAL B 1 51  ? 30.921  110.232 100.783 1.00 20.64  ? 551 VAL B N   1 
ATOM   2803  C CA  . VAL B 1 51  ? 32.179  109.966 101.475 1.00 19.54  ? 551 VAL B CA  1 
ATOM   2804  C C   . VAL B 1 51  ? 31.981  108.864 102.531 1.00 26.46  ? 551 VAL B C   1 
ATOM   2805  O O   . VAL B 1 51  ? 32.828  107.977 102.677 1.00 28.89  ? 551 VAL B O   1 
ATOM   2806  C CB  . VAL B 1 51  ? 32.790  111.258 102.113 1.00 23.97  ? 551 VAL B CB  1 
ATOM   2807  C CG1 . VAL B 1 51  ? 34.050  110.934 102.918 1.00 20.33  ? 551 VAL B CG1 1 
ATOM   2808  C CG2 . VAL B 1 51  ? 33.136  112.264 101.042 1.00 29.40  ? 551 VAL B CG2 1 
ATOM   2809  N N   . ILE B 1 52  ? 30.869  108.924 103.266 1.00 23.85  ? 552 ILE B N   1 
ATOM   2810  C CA  . ILE B 1 52  ? 30.513  107.866 104.214 1.00 25.95  ? 552 ILE B CA  1 
ATOM   2811  C C   . ILE B 1 52  ? 30.455  106.500 103.501 1.00 27.99  ? 552 ILE B C   1 
ATOM   2812  O O   . ILE B 1 52  ? 30.960  105.502 104.005 1.00 25.10  ? 552 ILE B O   1 
ATOM   2813  C CB  . ILE B 1 52  ? 29.139  108.138 104.889 1.00 24.36  ? 552 ILE B CB  1 
ATOM   2814  C CG1 . ILE B 1 52  ? 29.250  109.230 105.950 1.00 21.78  ? 552 ILE B CG1 1 
ATOM   2815  C CG2 . ILE B 1 52  ? 28.579  106.861 105.541 1.00 24.12  ? 552 ILE B CG2 1 
ATOM   2816  C CD1 . ILE B 1 52  ? 27.873  109.853 106.349 1.00 19.87  ? 552 ILE B CD1 1 
ATOM   2817  N N   . ALA B 1 53  ? 29.849  106.467 102.317 1.00 22.63  ? 553 ALA B N   1 
ATOM   2818  C CA  . ALA B 1 53  ? 29.623  105.210 101.614 1.00 24.25  ? 553 ALA B CA  1 
ATOM   2819  C C   . ALA B 1 53  ? 30.921  104.615 101.042 1.00 23.26  ? 553 ALA B C   1 
ATOM   2820  O O   . ALA B 1 53  ? 31.097  103.402 101.025 1.00 18.12  ? 553 ALA B O   1 
ATOM   2821  C CB  . ALA B 1 53  ? 28.560  105.379 100.525 1.00 12.16  ? 553 ALA B CB  1 
ATOM   2822  N N   . GLN B 1 54  ? 31.832  105.467 100.590 1.00 19.50  ? 554 GLN B N   1 
ATOM   2823  C CA  . GLN B 1 54  ? 33.119  104.980 100.107 1.00 23.73  ? 554 GLN B CA  1 
ATOM   2824  C C   . GLN B 1 54  ? 33.896  104.297 101.247 1.00 27.94  ? 554 GLN B C   1 
ATOM   2825  O O   . GLN B 1 54  ? 34.534  103.258 101.042 1.00 29.33  ? 554 GLN B O   1 
ATOM   2826  C CB  . GLN B 1 54  ? 33.933  106.106 99.474  1.00 16.95  ? 554 GLN B CB  1 
ATOM   2827  C CG  . GLN B 1 54  ? 33.210  106.823 98.332  1.00 28.69  ? 554 GLN B CG  1 
ATOM   2828  C CD  . GLN B 1 54  ? 33.905  108.125 97.929  1.00 38.94  ? 554 GLN B CD  1 
ATOM   2829  O OE1 . GLN B 1 54  ? 34.598  108.750 98.740  1.00 36.03  ? 554 GLN B OE1 1 
ATOM   2830  N NE2 . GLN B 1 54  ? 33.726  108.532 96.672  1.00 30.87  ? 554 GLN B NE2 1 
ATOM   2831  N N   . HIS B 1 55  ? 33.808  104.858 102.449 1.00 22.23  ? 555 HIS B N   1 
ATOM   2832  C CA  . HIS B 1 55  ? 34.431  104.234 103.609 1.00 25.37  ? 555 HIS B CA  1 
ATOM   2833  C C   . HIS B 1 55  ? 33.787  102.882 103.893 1.00 30.23  ? 555 HIS B C   1 
ATOM   2834  O O   . HIS B 1 55  ? 34.484  101.907 104.149 1.00 34.22  ? 555 HIS B O   1 
ATOM   2835  C CB  . HIS B 1 55  ? 34.338  105.123 104.849 1.00 24.99  ? 555 HIS B CB  1 
ATOM   2836  C CG  . HIS B 1 55  ? 35.290  106.280 104.844 1.00 34.00  ? 555 HIS B CG  1 
ATOM   2837  N ND1 . HIS B 1 55  ? 35.042  107.448 104.152 1.00 36.22  ? 555 HIS B ND1 1 
ATOM   2838  C CD2 . HIS B 1 55  ? 36.488  106.451 105.453 1.00 32.15  ? 555 HIS B CD2 1 
ATOM   2839  C CE1 . HIS B 1 55  ? 36.048  108.286 104.333 1.00 36.40  ? 555 HIS B CE1 1 
ATOM   2840  N NE2 . HIS B 1 55  ? 36.940  107.705 105.116 1.00 36.40  ? 555 HIS B NE2 1 
ATOM   2841  N N   . VAL B 1 56  ? 32.459  102.823 103.848 1.00 24.12  ? 556 VAL B N   1 
ATOM   2842  C CA  . VAL B 1 56  ? 31.779  101.559 104.054 1.00 23.62  ? 556 VAL B CA  1 
ATOM   2843  C C   . VAL B 1 56  ? 32.218  100.549 102.987 1.00 23.98  ? 556 VAL B C   1 
ATOM   2844  O O   . VAL B 1 56  ? 32.469  99.385  103.311 1.00 28.38  ? 556 VAL B O   1 
ATOM   2845  C CB  . VAL B 1 56  ? 30.232  101.705 104.086 1.00 28.58  ? 556 VAL B CB  1 
ATOM   2846  C CG1 . VAL B 1 56  ? 29.561  100.326 104.266 1.00 19.47  ? 556 VAL B CG1 1 
ATOM   2847  C CG2 . VAL B 1 56  ? 29.826  102.633 105.198 1.00 14.01  ? 556 VAL B CG2 1 
ATOM   2848  N N   . LEU B 1 57  ? 32.333  101.001 101.735 1.00 14.50  ? 557 LEU B N   1 
ATOM   2849  C CA  . LEU B 1 57  ? 32.707  100.120 100.626 1.00 20.14  ? 557 LEU B CA  1 
ATOM   2850  C C   . LEU B 1 57  ? 34.121  99.584  100.834 1.00 28.10  ? 557 LEU B C   1 
ATOM   2851  O O   . LEU B 1 57  ? 34.401  98.394  100.661 1.00 26.13  ? 557 LEU B O   1 
ATOM   2852  C CB  . LEU B 1 57  ? 32.631  100.867 99.288  1.00 13.38  ? 557 LEU B CB  1 
ATOM   2853  C CG  . LEU B 1 57  ? 33.176  100.086 98.078  1.00 21.36  ? 557 LEU B CG  1 
ATOM   2854  C CD1 . LEU B 1 57  ? 32.380  98.805  97.879  1.00 25.06  ? 557 LEU B CD1 1 
ATOM   2855  C CD2 . LEU B 1 57  ? 33.203  100.891 96.777  1.00 17.07  ? 557 LEU B CD2 1 
ATOM   2856  N N   . SER B 1 58  ? 35.004  100.494 101.225 1.00 23.66  ? 558 SER B N   1 
ATOM   2857  C CA  . SER B 1 58  ? 36.399  100.180 101.454 1.00 21.82  ? 558 SER B CA  1 
ATOM   2858  C C   . SER B 1 58  ? 36.545  99.116  102.542 1.00 21.52  ? 558 SER B C   1 
ATOM   2859  O O   . SER B 1 58  ? 37.279  98.157  102.377 1.00 22.75  ? 558 SER B O   1 
ATOM   2860  C CB  . SER B 1 58  ? 37.134  101.466 101.840 1.00 24.22  ? 558 SER B CB  1 
ATOM   2861  O OG  . SER B 1 58  ? 38.407  101.190 102.379 1.00 35.21  ? 558 SER B OG  1 
ATOM   2862  N N   . MET B 1 59  ? 35.834  99.301  103.650 1.00 26.55  ? 559 MET B N   1 
ATOM   2863  C CA  . MET B 1 59  ? 35.866  98.366  104.765 1.00 24.16  ? 559 MET B CA  1 
ATOM   2864  C C   . MET B 1 59  ? 35.238  97.030  104.380 1.00 23.39  ? 559 MET B C   1 
ATOM   2865  O O   . MET B 1 59  ? 35.739  95.955  104.751 1.00 22.73  ? 559 MET B O   1 
ATOM   2866  C CB  . MET B 1 59  ? 35.133  98.936  105.984 1.00 20.47  ? 559 MET B CB  1 
ATOM   2867  C CG  . MET B 1 59  ? 35.325  98.086  107.252 1.00 27.21  ? 559 MET B CG  1 
ATOM   2868  S SD  . MET B 1 59  ? 37.030  98.168  107.817 1.00 42.99  ? 559 MET B SD  1 
ATOM   2869  C CE  . MET B 1 59  ? 37.210  96.561  108.582 1.00 134.23 ? 559 MET B CE  1 
ATOM   2870  N N   . ASP B 1 60  ? 34.140  97.101  103.638 1.00 16.70  ? 560 ASP B N   1 
ATOM   2871  C CA  . ASP B 1 60  ? 33.433  95.893  103.234 1.00 19.87  ? 560 ASP B CA  1 
ATOM   2872  C C   . ASP B 1 60  ? 34.301  95.037  102.336 1.00 29.49  ? 560 ASP B C   1 
ATOM   2873  O O   . ASP B 1 60  ? 34.241  93.807  102.391 1.00 26.82  ? 560 ASP B O   1 
ATOM   2874  C CB  . ASP B 1 60  ? 32.124  96.239  102.536 1.00 12.70  ? 560 ASP B CB  1 
ATOM   2875  C CG  . ASP B 1 60  ? 31.024  96.529  103.519 1.00 22.95  ? 560 ASP B CG  1 
ATOM   2876  O OD1 . ASP B 1 60  ? 31.277  96.308  104.727 1.00 25.93  ? 560 ASP B OD1 1 
ATOM   2877  O OD2 . ASP B 1 60  ? 29.921  96.952  103.100 1.00 25.90  ? 560 ASP B OD2 1 
ATOM   2878  N N   . CYS B 1 61  ? 35.111  95.696  101.512 1.00 24.42  ? 561 CYS B N   1 
ATOM   2879  C CA  . CYS B 1 61  ? 35.975  94.986  100.585 1.00 28.99  ? 561 CYS B CA  1 
ATOM   2880  C C   . CYS B 1 61  ? 37.142  94.307  101.285 1.00 31.73  ? 561 CYS B C   1 
ATOM   2881  O O   . CYS B 1 61  ? 37.620  93.278  100.843 1.00 34.32  ? 561 CYS B O   1 
ATOM   2882  C CB  . CYS B 1 61  ? 36.499  95.932  99.520  1.00 30.28  ? 561 CYS B CB  1 
ATOM   2883  S SG  . CYS B 1 61  ? 35.316  96.294  98.243  1.00 26.74  ? 561 CYS B SG  1 
ATOM   2884  N N   . ARG B 1 62  ? 37.606  94.894  102.373 1.00 36.87  ? 562 ARG B N   1 
ATOM   2885  C CA  . ARG B 1 62  ? 38.670  94.272  103.137 1.00 37.22  ? 562 ARG B CA  1 
ATOM   2886  C C   . ARG B 1 62  ? 38.145  93.066  103.915 1.00 33.68  ? 562 ARG B C   1 
ATOM   2887  O O   . ARG B 1 62  ? 38.715  91.977  103.835 1.00 33.67  ? 562 ARG B O   1 
ATOM   2888  C CB  . ARG B 1 62  ? 39.349  95.296  104.046 1.00 38.79  ? 562 ARG B CB  1 
ATOM   2889  C CG  . ARG B 1 62  ? 40.252  96.248  103.261 1.00 57.15  ? 562 ARG B CG  1 
ATOM   2890  C CD  . ARG B 1 62  ? 39.981  97.705  103.593 1.00 67.30  ? 562 ARG B CD  1 
ATOM   2891  N NE  . ARG B 1 62  ? 40.628  98.120  104.835 1.00 75.21  ? 562 ARG B NE  1 
ATOM   2892  C CZ  . ARG B 1 62  ? 40.336  99.240  105.492 1.00 77.71  ? 562 ARG B CZ  1 
ATOM   2893  N NH1 . ARG B 1 62  ? 39.395  100.056 105.031 1.00 72.64  ? 562 ARG B NH1 1 
ATOM   2894  N NH2 . ARG B 1 62  ? 40.979  99.541  106.616 1.00 79.95  ? 562 ARG B NH2 1 
ATOM   2895  N N   . VAL B 1 63  ? 37.048  93.259  104.639 1.00 26.31  ? 563 VAL B N   1 
ATOM   2896  C CA  . VAL B 1 63  ? 36.426  92.183  105.419 1.00 29.19  ? 563 VAL B CA  1 
ATOM   2897  C C   . VAL B 1 63  ? 35.987  90.973  104.577 1.00 28.79  ? 563 VAL B C   1 
ATOM   2898  O O   . VAL B 1 63  ? 36.214  89.827  104.968 1.00 29.91  ? 563 VAL B O   1 
ATOM   2899  C CB  . VAL B 1 63  ? 35.208  92.694  106.227 1.00 26.22  ? 563 VAL B CB  1 
ATOM   2900  C CG1 . VAL B 1 63  ? 34.534  91.547  106.932 1.00 17.47  ? 563 VAL B CG1 1 
ATOM   2901  C CG2 . VAL B 1 63  ? 35.634  93.777  107.229 1.00 19.23  ? 563 VAL B CG2 1 
ATOM   2902  N N   . ALA B 1 64  ? 35.357  91.223  103.431 1.00 24.31  ? 564 ALA B N   1 
ATOM   2903  C CA  . ALA B 1 64  ? 34.948  90.136  102.545 1.00 24.12  ? 564 ALA B CA  1 
ATOM   2904  C C   . ALA B 1 64  ? 36.126  89.582  101.746 1.00 27.94  ? 564 ALA B C   1 
ATOM   2905  O O   . ALA B 1 64  ? 35.969  88.648  100.967 1.00 23.93  ? 564 ALA B O   1 
ATOM   2906  C CB  . ALA B 1 64  ? 33.838  90.592  101.605 1.00 17.42  ? 564 ALA B CB  1 
ATOM   2907  N N   . ARG B 1 65  ? 37.296  90.180  101.935 1.00 25.94  ? 565 ARG B N   1 
ATOM   2908  C CA  . ARG B 1 65  ? 38.516  89.730  101.287 1.00 29.34  ? 565 ARG B CA  1 
ATOM   2909  C C   . ARG B 1 65  ? 38.471  89.850  99.756  1.00 32.28  ? 565 ARG B C   1 
ATOM   2910  O O   . ARG B 1 65  ? 38.951  88.971  99.029  1.00 27.37  ? 565 ARG B O   1 
ATOM   2911  C CB  . ARG B 1 65  ? 38.859  88.315  101.756 1.00 27.80  ? 565 ARG B CB  1 
ATOM   2912  C CG  . ARG B 1 65  ? 38.881  88.220  103.281 1.00 37.86  ? 565 ARG B CG  1 
ATOM   2913  C CD  . ARG B 1 65  ? 39.390  86.875  103.788 1.00 48.34  ? 565 ARG B CD  1 
ATOM   2914  N NE  . ARG B 1 65  ? 39.163  86.725  105.226 1.00 61.56  ? 565 ARG B NE  1 
ATOM   2915  C CZ  . ARG B 1 65  ? 39.376  85.600  105.909 1.00 55.10  ? 565 ARG B CZ  1 
ATOM   2916  N NH1 . ARG B 1 65  ? 39.831  84.516  105.290 1.00 34.68  ? 565 ARG B NH1 1 
ATOM   2917  N NH2 . ARG B 1 65  ? 39.129  85.558  107.214 1.00 56.65  ? 565 ARG B NH2 1 
ATOM   2918  N N   . ILE B 1 66  ? 37.902  90.965  99.296  1.00 35.46  ? 566 ILE B N   1 
ATOM   2919  C CA  . ILE B 1 66  ? 37.837  91.335  97.888  1.00 27.42  ? 566 ILE B CA  1 
ATOM   2920  C C   . ILE B 1 66  ? 39.060  92.175  97.525  1.00 32.36  ? 566 ILE B C   1 
ATOM   2921  O O   . ILE B 1 66  ? 39.587  92.071  96.418  1.00 36.59  ? 566 ILE B O   1 
ATOM   2922  C CB  . ILE B 1 66  ? 36.559  92.155  97.595  1.00 19.90  ? 566 ILE B CB  1 
ATOM   2923  C CG1 . ILE B 1 66  ? 35.314  91.288  97.771  1.00 29.89  ? 566 ILE B CG1 1 
ATOM   2924  C CG2 . ILE B 1 66  ? 36.579  92.738  96.179  1.00 14.81  ? 566 ILE B CG2 1 
ATOM   2925  C CD1 . ILE B 1 66  ? 34.001  92.048  97.557  1.00 27.84  ? 566 ILE B CD1 1 
ATOM   2926  N N   . LEU B 1 67  ? 39.493  93.019  98.460  1.00 30.21  ? 567 LEU B N   1 
ATOM   2927  C CA  . LEU B 1 67  ? 40.671  93.867  98.270  1.00 33.22  ? 567 LEU B CA  1 
ATOM   2928  C C   . LEU B 1 67  ? 41.614  93.758  99.462  1.00 43.15  ? 567 LEU B C   1 
ATOM   2929  O O   . LEU B 1 67  ? 41.185  93.461  100.581 1.00 37.84  ? 567 LEU B O   1 
ATOM   2930  C CB  . LEU B 1 67  ? 40.273  95.332  98.100  1.00 33.07  ? 567 LEU B CB  1 
ATOM   2931  C CG  . LEU B 1 67  ? 39.361  95.765  96.957  1.00 34.36  ? 567 LEU B CG  1 
ATOM   2932  C CD1 . LEU B 1 67  ? 39.064  97.245  97.102  1.00 27.55  ? 567 LEU B CD1 1 
ATOM   2933  C CD2 . LEU B 1 67  ? 40.008  95.470  95.606  1.00 38.66  ? 567 LEU B CD2 1 
ATOM   2934  N N   . GLY B 1 68  ? 42.900  94.005  99.225  1.00 43.51  ? 568 GLY B N   1 
ATOM   2935  C CA  . GLY B 1 68  ? 43.873  93.987  100.303 1.00 40.62  ? 568 GLY B CA  1 
ATOM   2936  C C   . GLY B 1 68  ? 44.310  92.596  100.725 1.00 52.21  ? 568 GLY B C   1 
ATOM   2937  O O   . GLY B 1 68  ? 44.778  92.398  101.845 1.00 56.58  ? 568 GLY B O   1 
ATOM   2938  N N   . VAL B 1 69  ? 44.166  91.623  99.832  1.00 53.29  ? 569 VAL B N   1 
ATOM   2939  C CA  . VAL B 1 69  ? 44.553  90.258  100.157 1.00 53.87  ? 569 VAL B CA  1 
ATOM   2940  C C   . VAL B 1 69  ? 46.063  90.064  100.064 1.00 46.86  ? 569 VAL B C   1 
ATOM   2941  O O   . VAL B 1 69  ? 46.658  90.185  98.987  1.00 37.61  ? 569 VAL B O   1 
ATOM   2942  C CB  . VAL B 1 69  ? 43.860  89.245  99.243  1.00 61.04  ? 569 VAL B CB  1 
ATOM   2943  C CG1 . VAL B 1 69  ? 44.258  87.830  99.632  1.00 64.88  ? 569 VAL B CG1 1 
ATOM   2944  C CG2 . VAL B 1 69  ? 42.359  89.420  99.323  1.00 60.18  ? 569 VAL B CG2 1 
ATOM   2945  N N   . SER B 1 70  ? 46.680  89.763  101.202 1.00 50.29  ? 570 SER B N   1 
ATOM   2946  C CA  . SER B 1 70  ? 48.114  89.478  101.235 1.00 55.47  ? 570 SER B CA  1 
ATOM   2947  C C   . SER B 1 70  ? 48.434  88.198  100.463 1.00 53.83  ? 570 SER B C   1 
ATOM   2948  O O   . SER B 1 70  ? 47.542  87.396  100.167 1.00 40.24  ? 570 SER B O   1 
ATOM   2949  C CB  . SER B 1 70  ? 48.618  89.361  102.680 1.00 55.57  ? 570 SER B CB  1 
ATOM   2950  O OG  . SER B 1 70  ? 47.985  88.291  103.367 1.00 57.13  ? 570 SER B OG  1 
ATOM   2951  N N   . GLU B 1 71  ? 49.707  87.998  100.136 1.00 62.31  ? 571 GLU B N   1 
ATOM   2952  C CA  . GLU B 1 71  ? 50.089  86.770  99.460  1.00 66.51  ? 571 GLU B CA  1 
ATOM   2953  C C   . GLU B 1 71  ? 49.915  85.579  100.406 1.00 55.88  ? 571 GLU B C   1 
ATOM   2954  O O   . GLU B 1 71  ? 49.507  84.488  99.983  1.00 52.48  ? 571 GLU B O   1 
ATOM   2955  C CB  . GLU B 1 71  ? 51.508  86.851  98.900  1.00 81.54  ? 571 GLU B CB  1 
ATOM   2956  C CG  . GLU B 1 71  ? 51.791  85.807  97.823  1.00 94.84  ? 571 GLU B CG  1 
ATOM   2957  C CD  . GLU B 1 71  ? 50.714  85.768  96.741  1.00 100.33 ? 571 GLU B CD  1 
ATOM   2958  O OE1 . GLU B 1 71  ? 50.030  86.796  96.532  1.00 98.57  ? 571 GLU B OE1 1 
ATOM   2959  O OE2 . GLU B 1 71  ? 50.546  84.703  96.107  1.00 100.25 ? 571 GLU B OE2 1 
ATOM   2960  N N   . GLU B 1 72  ? 50.189  85.795  101.691 1.00 50.40  ? 572 GLU B N   1 
ATOM   2961  C CA  . GLU B 1 72  ? 49.970  84.744  102.680 1.00 61.54  ? 572 GLU B CA  1 
ATOM   2962  C C   . GLU B 1 72  ? 48.485  84.418  102.785 1.00 67.72  ? 572 GLU B C   1 
ATOM   2963  O O   . GLU B 1 72  ? 48.093  83.256  102.704 1.00 68.24  ? 572 GLU B O   1 
ATOM   2964  C CB  . GLU B 1 72  ? 50.556  85.112  104.045 1.00 67.01  ? 572 GLU B CB  1 
ATOM   2965  C CG  . GLU B 1 72  ? 50.054  86.417  104.608 1.00 83.10  ? 572 GLU B CG  1 
ATOM   2966  C CD  . GLU B 1 72  ? 50.641  86.727  105.973 1.00 89.91  ? 572 GLU B CD  1 
ATOM   2967  O OE1 . GLU B 1 72  ? 51.284  85.824  106.568 1.00 90.64  ? 572 GLU B OE1 1 
ATOM   2968  O OE2 . GLU B 1 72  ? 50.455  87.877  106.442 1.00 84.16  ? 572 GLU B OE2 1 
ATOM   2969  N N   . MET B 1 73  ? 47.658  85.448  102.939 1.00 66.99  ? 573 MET B N   1 
ATOM   2970  C CA  . MET B 1 73  ? 46.212  85.261  102.981 1.00 59.14  ? 573 MET B CA  1 
ATOM   2971  C C   . MET B 1 73  ? 45.685  84.466  101.782 1.00 45.66  ? 573 MET B C   1 
ATOM   2972  O O   . MET B 1 73  ? 44.834  83.600  101.940 1.00 37.68  ? 573 MET B O   1 
ATOM   2973  C CB  . MET B 1 73  ? 45.492  86.606  103.068 1.00 69.49  ? 573 MET B CB  1 
ATOM   2974  C CG  . MET B 1 73  ? 43.974  86.472  103.120 1.00 79.50  ? 573 MET B CG  1 
ATOM   2975  S SD  . MET B 1 73  ? 43.345  85.922  104.723 1.00 83.73  ? 573 MET B SD  1 
ATOM   2976  C CE  . MET B 1 73  ? 43.151  87.506  105.546 1.00 76.94  ? 573 MET B CE  1 
ATOM   2977  N N   . ARG B 1 74  ? 46.177  84.769  100.585 1.00 45.54  ? 574 ARG B N   1 
ATOM   2978  C CA  . ARG B 1 74  ? 45.754  84.044  99.388  1.00 49.32  ? 574 ARG B CA  1 
ATOM   2979  C C   . ARG B 1 74  ? 46.191  82.574  99.480  1.00 54.85  ? 574 ARG B C   1 
ATOM   2980  O O   . ARG B 1 74  ? 45.522  81.671  98.963  1.00 45.07  ? 574 ARG B O   1 
ATOM   2981  C CB  . ARG B 1 74  ? 46.306  84.730  98.134  1.00 52.71  ? 574 ARG B CB  1 
ATOM   2982  C CG  . ARG B 1 74  ? 46.491  83.838  96.920  1.00 70.32  ? 574 ARG B CG  1 
ATOM   2983  C CD  . ARG B 1 74  ? 45.164  83.499  96.274  1.00 86.83  ? 574 ARG B CD  1 
ATOM   2984  N NE  . ARG B 1 74  ? 45.297  83.127  94.863  1.00 96.34  ? 574 ARG B NE  1 
ATOM   2985  C CZ  . ARG B 1 74  ? 45.283  81.876  94.405  1.00 101.11 ? 574 ARG B CZ  1 
ATOM   2986  N NH1 . ARG B 1 74  ? 45.150  80.855  95.247  1.00 104.11 ? 574 ARG B NH1 1 
ATOM   2987  N NH2 . ARG B 1 74  ? 45.401  81.647  93.101  1.00 98.68  ? 574 ARG B NH2 1 
ATOM   2988  N N   . ARG B 1 75  ? 47.308  82.341  100.164 1.00 62.91  ? 575 ARG B N   1 
ATOM   2989  C CA  . ARG B 1 75  ? 47.781  80.983  100.413 1.00 58.55  ? 575 ARG B CA  1 
ATOM   2990  C C   . ARG B 1 75  ? 46.894  80.278  101.439 1.00 63.63  ? 575 ARG B C   1 
ATOM   2991  O O   . ARG B 1 75  ? 46.451  79.154  101.224 1.00 66.56  ? 575 ARG B O   1 
ATOM   2992  C CB  . ARG B 1 75  ? 49.230  80.999  100.891 1.00 54.99  ? 575 ARG B CB  1 
ATOM   2993  C CG  . ARG B 1 75  ? 49.988  79.723  100.583 1.00 60.59  ? 575 ARG B CG  1 
ATOM   2994  C CD  . ARG B 1 75  ? 51.465  79.837  100.947 1.00 66.25  ? 575 ARG B CD  1 
ATOM   2995  N NE  . ARG B 1 75  ? 51.724  79.508  102.345 1.00 70.45  ? 575 ARG B NE  1 
ATOM   2996  C CZ  . ARG B 1 75  ? 52.114  80.388  103.258 1.00 79.87  ? 575 ARG B CZ  1 
ATOM   2997  N NH1 . ARG B 1 75  ? 52.294  81.656  102.916 1.00 80.52  ? 575 ARG B NH1 1 
ATOM   2998  N NH2 . ARG B 1 75  ? 52.332  79.998  104.509 1.00 84.24  ? 575 ARG B NH2 1 
ATOM   2999  N N   . ASN B 1 76  ? 46.635  80.939  102.557 1.00 65.95  ? 576 ASN B N   1 
ATOM   3000  C CA  . ASN B 1 76  ? 45.761  80.372  103.572 1.00 70.84  ? 576 ASN B CA  1 
ATOM   3001  C C   . ASN B 1 76  ? 44.385  79.992  103.014 1.00 62.82  ? 576 ASN B C   1 
ATOM   3002  O O   . ASN B 1 76  ? 43.840  78.951  103.369 1.00 56.95  ? 576 ASN B O   1 
ATOM   3003  C CB  . ASN B 1 76  ? 45.602  81.336  104.757 1.00 81.74  ? 576 ASN B CB  1 
ATOM   3004  C CG  . ASN B 1 76  ? 46.911  81.583  105.500 1.00 89.69  ? 576 ASN B CG  1 
ATOM   3005  O OD1 . ASN B 1 76  ? 47.753  80.687  105.622 1.00 89.74  ? 576 ASN B OD1 1 
ATOM   3006  N ND2 . ASN B 1 76  ? 47.085  82.805  106.003 1.00 89.79  ? 576 ASN B ND2 1 
ATOM   3007  N N   . MET B 1 77  ? 43.833  80.836  102.143 1.00 57.50  ? 577 MET B N   1 
ATOM   3008  C CA  . MET B 1 77  ? 42.476  80.650  101.618 1.00 49.21  ? 577 MET B CA  1 
ATOM   3009  C C   . MET B 1 77  ? 42.368  79.527  100.594 1.00 44.46  ? 577 MET B C   1 
ATOM   3010  O O   . MET B 1 77  ? 41.362  78.822  100.536 1.00 48.02  ? 577 MET B O   1 
ATOM   3011  C CB  . MET B 1 77  ? 41.945  81.946  100.980 1.00 40.04  ? 577 MET B CB  1 
ATOM   3012  C CG  . MET B 1 77  ? 41.682  83.081  101.957 1.00 37.99  ? 577 MET B CG  1 
ATOM   3013  S SD  . MET B 1 77  ? 40.647  84.363  101.240 1.00 47.77  ? 577 MET B SD  1 
ATOM   3014  C CE  . MET B 1 77  ? 41.666  84.962  99.884  1.00 34.88  ? 577 MET B CE  1 
ATOM   3015  N N   . GLY B 1 78  ? 43.391  79.383  99.764  1.00 39.71  ? 578 GLY B N   1 
ATOM   3016  C CA  . GLY B 1 78  ? 43.343  78.416  98.689  1.00 36.10  ? 578 GLY B CA  1 
ATOM   3017  C C   . GLY B 1 78  ? 42.654  78.986  97.472  1.00 36.82  ? 578 GLY B C   1 
ATOM   3018  O O   . GLY B 1 78  ? 42.536  78.314  96.452  1.00 36.74  ? 578 GLY B O   1 
ATOM   3019  N N   . VAL B 1 79  ? 42.199  80.232  97.584  1.00 35.97  ? 579 VAL B N   1 
ATOM   3020  C CA  . VAL B 1 79  ? 41.586  80.955  96.464  1.00 30.73  ? 579 VAL B CA  1 
ATOM   3021  C C   . VAL B 1 79  ? 41.943  82.439  96.553  1.00 38.77  ? 579 VAL B C   1 
ATOM   3022  O O   . VAL B 1 79  ? 42.346  82.924  97.618  1.00 38.18  ? 579 VAL B O   1 
ATOM   3023  C CB  . VAL B 1 79  ? 40.054  80.826  96.472  1.00 37.28  ? 579 VAL B CB  1 
ATOM   3024  C CG1 . VAL B 1 79  ? 39.623  79.465  95.927  1.00 30.95  ? 579 VAL B CG1 1 
ATOM   3025  C CG2 . VAL B 1 79  ? 39.491  81.087  97.894  1.00 19.12  ? 579 VAL B CG2 1 
ATOM   3026  N N   . SER B 1 80  ? 41.791  83.162  95.445  1.00 40.74  ? 580 SER B N   1 
ATOM   3027  C CA  . SER B 1 80  ? 42.157  84.575  95.411  1.00 45.11  ? 580 SER B CA  1 
ATOM   3028  C C   . SER B 1 80  ? 41.145  85.465  96.125  1.00 41.79  ? 580 SER B C   1 
ATOM   3029  O O   . SER B 1 80  ? 41.496  86.471  96.730  1.00 42.46  ? 580 SER B O   1 
ATOM   3030  C CB  . SER B 1 80  ? 42.308  85.050  93.969  1.00 56.38  ? 580 SER B CB  1 
ATOM   3031  O OG  . SER B 1 80  ? 43.487  84.533  93.388  1.00 64.58  ? 580 SER B OG  1 
ATOM   3032  N N   . SER B 1 81  ? 39.880  85.092  96.051  1.00 37.63  ? 581 SER B N   1 
ATOM   3033  C CA  . SER B 1 81  ? 38.846  85.976  96.531  1.00 25.99  ? 581 SER B CA  1 
ATOM   3034  C C   . SER B 1 81  ? 38.063  85.426  97.715  1.00 32.83  ? 581 SER B C   1 
ATOM   3035  O O   . SER B 1 81  ? 37.742  84.244  97.761  1.00 40.69  ? 581 SER B O   1 
ATOM   3036  C CB  . SER B 1 81  ? 37.890  86.305  95.399  1.00 21.92  ? 581 SER B CB  1 
ATOM   3037  O OG  . SER B 1 81  ? 36.891  87.204  95.849  1.00 32.52  ? 581 SER B OG  1 
ATOM   3038  N N   . GLY B 1 82  ? 37.753  86.298  98.669  1.00 28.28  ? 582 GLY B N   1 
ATOM   3039  C CA  . GLY B 1 82  ? 36.839  85.956  99.737  1.00 20.84  ? 582 GLY B CA  1 
ATOM   3040  C C   . GLY B 1 82  ? 35.487  85.534  99.162  1.00 30.99  ? 582 GLY B C   1 
ATOM   3041  O O   . GLY B 1 82  ? 34.775  84.723  99.761  1.00 30.61  ? 582 GLY B O   1 
ATOM   3042  N N   . LEU B 1 83  ? 35.135  86.071  97.994  1.00 28.15  ? 583 LEU B N   1 
ATOM   3043  C CA  . LEU B 1 83  ? 33.831  85.796  97.403  1.00 29.78  ? 583 LEU B CA  1 
ATOM   3044  C C   . LEU B 1 83  ? 33.759  84.370  96.896  1.00 37.07  ? 583 LEU B C   1 
ATOM   3045  O O   . LEU B 1 83  ? 32.677  83.774  96.846  1.00 47.80  ? 583 LEU B O   1 
ATOM   3046  C CB  . LEU B 1 83  ? 33.505  86.775  96.274  1.00 29.40  ? 583 LEU B CB  1 
ATOM   3047  C CG  . LEU B 1 83  ? 33.243  88.223  96.672  1.00 28.72  ? 583 LEU B CG  1 
ATOM   3048  C CD1 . LEU B 1 83  ? 32.787  89.019  95.455  1.00 27.06  ? 583 LEU B CD1 1 
ATOM   3049  C CD2 . LEU B 1 83  ? 32.205  88.289  97.765  1.00 23.50  ? 583 LEU B CD2 1 
ATOM   3050  N N   . GLU B 1 84  ? 34.909  83.823  96.516  1.00 32.63  ? 584 GLU B N   1 
ATOM   3051  C CA  . GLU B 1 84  ? 34.981  82.406  96.178  1.00 36.01  ? 584 GLU B CA  1 
ATOM   3052  C C   . GLU B 1 84  ? 35.032  81.540  97.445  1.00 32.75  ? 584 GLU B C   1 
ATOM   3053  O O   . GLU B 1 84  ? 34.383  80.491  97.532  1.00 38.13  ? 584 GLU B O   1 
ATOM   3054  C CB  . GLU B 1 84  ? 36.182  82.123  95.280  1.00 42.36  ? 584 GLU B CB  1 
ATOM   3055  C CG  . GLU B 1 84  ? 36.330  80.651  94.919  1.00 61.26  ? 584 GLU B CG  1 
ATOM   3056  C CD  . GLU B 1 84  ? 37.102  80.438  93.630  1.00 69.07  ? 584 GLU B CD  1 
ATOM   3057  O OE1 . GLU B 1 84  ? 37.632  81.440  93.090  1.00 69.95  ? 584 GLU B OE1 1 
ATOM   3058  O OE2 . GLU B 1 84  ? 37.169  79.274  93.159  1.00 61.86  ? 584 GLU B OE2 1 
ATOM   3059  N N   . LEU B 1 85  ? 35.788  82.003  98.433  1.00 29.73  ? 585 LEU B N   1 
ATOM   3060  C CA  . LEU B 1 85  ? 35.961  81.269  99.679  1.00 27.96  ? 585 LEU B CA  1 
ATOM   3061  C C   . LEU B 1 85  ? 34.650  80.936  100.383 1.00 30.34  ? 585 LEU B C   1 
ATOM   3062  O O   . LEU B 1 85  ? 34.468  79.817  100.858 1.00 30.26  ? 585 LEU B O   1 
ATOM   3063  C CB  . LEU B 1 85  ? 36.867  82.028  100.642 1.00 18.29  ? 585 LEU B CB  1 
ATOM   3064  C CG  . LEU B 1 85  ? 37.115  81.225  101.925 1.00 26.27  ? 585 LEU B CG  1 
ATOM   3065  C CD1 . LEU B 1 85  ? 37.769  79.900  101.587 1.00 29.19  ? 585 LEU B CD1 1 
ATOM   3066  C CD2 . LEU B 1 85  ? 37.958  81.996  102.936 1.00 19.48  ? 585 LEU B CD2 1 
ATOM   3067  N N   . ILE B 1 86  ? 33.736  81.897  100.462 1.00 27.22  ? 586 ILE B N   1 
ATOM   3068  C CA  . ILE B 1 86  ? 32.496  81.667  101.207 1.00 33.23  ? 586 ILE B CA  1 
ATOM   3069  C C   . ILE B 1 86  ? 31.534  80.653  100.588 1.00 30.34  ? 586 ILE B C   1 
ATOM   3070  O O   . ILE B 1 86  ? 30.588  80.228  101.245 1.00 35.02  ? 586 ILE B O   1 
ATOM   3071  C CB  . ILE B 1 86  ? 31.723  82.954  101.455 1.00 31.81  ? 586 ILE B CB  1 
ATOM   3072  C CG1 . ILE B 1 86  ? 31.417  83.635  100.130 1.00 27.49  ? 586 ILE B CG1 1 
ATOM   3073  C CG2 . ILE B 1 86  ? 32.501  83.851  102.370 1.00 30.61  ? 586 ILE B CG2 1 
ATOM   3074  C CD1 . ILE B 1 86  ? 30.482  84.795  100.292 1.00 42.69  ? 586 ILE B CD1 1 
ATOM   3075  N N   . THR B 1 87  ? 31.757  80.270  99.336  1.00 28.08  ? 587 THR B N   1 
ATOM   3076  C CA  . THR B 1 87  ? 30.953  79.204  98.737  1.00 32.48  ? 587 THR B CA  1 
ATOM   3077  C C   . THR B 1 87  ? 31.542  77.826  99.082  1.00 37.32  ? 587 THR B C   1 
ATOM   3078  O O   . THR B 1 87  ? 30.949  76.785  98.798  1.00 31.67  ? 587 THR B O   1 
ATOM   3079  C CB  . THR B 1 87  ? 30.874  79.365  97.224  1.00 30.80  ? 587 THR B CB  1 
ATOM   3080  O OG1 . THR B 1 87  ? 32.156  79.081  96.644  1.00 31.35  ? 587 THR B OG1 1 
ATOM   3081  C CG2 . THR B 1 87  ? 30.472  80.787  96.896  1.00 25.70  ? 587 THR B CG2 1 
ATOM   3082  N N   . LEU B 1 88  ? 32.713  77.840  99.711  1.00 37.45  ? 588 LEU B N   1 
ATOM   3083  C CA  . LEU B 1 88  ? 33.408  76.613  100.053 1.00 41.13  ? 588 LEU B CA  1 
ATOM   3084  C C   . LEU B 1 88  ? 33.232  76.270  101.525 1.00 39.30  ? 588 LEU B C   1 
ATOM   3085  O O   . LEU B 1 88  ? 32.940  77.135  102.345 1.00 38.35  ? 588 LEU B O   1 
ATOM   3086  C CB  . LEU B 1 88  ? 34.900  76.727  99.711  1.00 32.29  ? 588 LEU B CB  1 
ATOM   3087  C CG  . LEU B 1 88  ? 35.200  77.128  98.268  1.00 32.47  ? 588 LEU B CG  1 
ATOM   3088  C CD1 . LEU B 1 88  ? 36.696  77.209  98.034  1.00 37.00  ? 588 LEU B CD1 1 
ATOM   3089  C CD2 . LEU B 1 88  ? 34.565  76.141  97.299  1.00 24.44  ? 588 LEU B CD2 1 
ATOM   3090  N N   . PRO B 1 89  ? 33.406  74.991  101.860 1.00 38.52  ? 589 PRO B N   1 
ATOM   3091  C CA  . PRO B 1 89  ? 33.310  74.552  103.253 1.00 35.13  ? 589 PRO B CA  1 
ATOM   3092  C C   . PRO B 1 89  ? 34.207  75.332  104.208 1.00 33.64  ? 589 PRO B C   1 
ATOM   3093  O O   . PRO B 1 89  ? 33.752  75.673  105.295 1.00 34.37  ? 589 PRO B O   1 
ATOM   3094  C CB  . PRO B 1 89  ? 33.743  73.092  103.175 1.00 30.99  ? 589 PRO B CB  1 
ATOM   3095  C CG  . PRO B 1 89  ? 33.242  72.667  101.794 1.00 33.43  ? 589 PRO B CG  1 
ATOM   3096  C CD  . PRO B 1 89  ? 33.506  73.857  100.919 1.00 26.58  ? 589 PRO B CD  1 
ATOM   3097  N N   . HIS B 1 90  ? 35.454  75.599  103.838 1.00 31.40  ? 590 HIS B N   1 
ATOM   3098  C CA  . HIS B 1 90  ? 36.337  76.344  104.744 1.00 32.24  ? 590 HIS B CA  1 
ATOM   3099  C C   . HIS B 1 90  ? 36.122  77.870  104.779 1.00 28.22  ? 590 HIS B C   1 
ATOM   3100  O O   . HIS B 1 90  ? 36.864  78.589  105.465 1.00 24.20  ? 590 HIS B O   1 
ATOM   3101  C CB  . HIS B 1 90  ? 37.812  76.007  104.503 1.00 44.79  ? 590 HIS B CB  1 
ATOM   3102  C CG  . HIS B 1 90  ? 38.178  75.922  103.061 1.00 61.98  ? 590 HIS B CG  1 
ATOM   3103  N ND1 . HIS B 1 90  ? 39.188  76.679  102.506 1.00 67.06  ? 590 HIS B ND1 1 
ATOM   3104  C CD2 . HIS B 1 90  ? 37.675  75.166  102.057 1.00 65.48  ? 590 HIS B CD2 1 
ATOM   3105  C CE1 . HIS B 1 90  ? 39.289  76.395  101.220 1.00 68.51  ? 590 HIS B CE1 1 
ATOM   3106  N NE2 . HIS B 1 90  ? 38.382  75.480  100.922 1.00 70.07  ? 590 HIS B NE2 1 
ATOM   3107  N N   . GLY B 1 91  ? 35.113  78.353  104.054 1.00 19.77  ? 591 GLY B N   1 
ATOM   3108  C CA  . GLY B 1 91  ? 34.663  79.725  104.193 1.00 30.22  ? 591 GLY B CA  1 
ATOM   3109  C C   . GLY B 1 91  ? 33.770  79.916  105.417 1.00 34.56  ? 591 GLY B C   1 
ATOM   3110  O O   . GLY B 1 91  ? 33.191  80.987  105.628 1.00 35.13  ? 591 GLY B O   1 
ATOM   3111  N N   . HIS B 1 92  ? 33.673  78.874  106.237 1.00 25.38  ? 592 HIS B N   1 
ATOM   3112  C CA  . HIS B 1 92  ? 32.783  78.871  107.397 1.00 26.59  ? 592 HIS B CA  1 
ATOM   3113  C C   . HIS B 1 92  ? 32.995  80.100  108.305 1.00 35.58  ? 592 HIS B C   1 
ATOM   3114  O O   . HIS B 1 92  ? 32.044  80.803  108.651 1.00 47.31  ? 592 HIS B O   1 
ATOM   3115  C CB  . HIS B 1 92  ? 32.942  77.554  108.167 1.00 16.94  ? 592 HIS B CB  1 
ATOM   3116  C CG  . HIS B 1 92  ? 32.245  77.527  109.488 1.00 24.30  ? 592 HIS B CG  1 
ATOM   3117  N ND1 . HIS B 1 92  ? 30.877  77.628  109.611 1.00 30.28  ? 592 HIS B ND1 1 
ATOM   3118  C CD2 . HIS B 1 92  ? 32.729  77.412  110.750 1.00 26.64  ? 592 HIS B CD2 1 
ATOM   3119  C CE1 . HIS B 1 92  ? 30.546  77.567  110.889 1.00 30.51  ? 592 HIS B CE1 1 
ATOM   3120  N NE2 . HIS B 1 92  ? 31.652  77.442  111.602 1.00 26.54  ? 592 HIS B NE2 1 
ATOM   3121  N N   . GLN B 1 93  ? 34.247  80.360  108.662 1.00 32.53  ? 593 GLN B N   1 
ATOM   3122  C CA  . GLN B 1 93  ? 34.616  81.486  109.521 1.00 33.88  ? 593 GLN B CA  1 
ATOM   3123  C C   . GLN B 1 93  ? 34.290  82.852  108.879 1.00 27.74  ? 593 GLN B C   1 
ATOM   3124  O O   . GLN B 1 93  ? 33.738  83.731  109.536 1.00 18.12  ? 593 GLN B O   1 
ATOM   3125  C CB  . GLN B 1 93  ? 36.111  81.403  109.863 1.00 39.36  ? 593 GLN B CB  1 
ATOM   3126  C CG  . GLN B 1 93  ? 36.665  82.565  110.682 1.00 55.66  ? 593 GLN B CG  1 
ATOM   3127  C CD  . GLN B 1 93  ? 36.515  82.332  112.163 1.00 73.30  ? 593 GLN B CD  1 
ATOM   3128  O OE1 . GLN B 1 93  ? 37.457  82.515  112.940 1.00 78.82  ? 593 GLN B OE1 1 
ATOM   3129  N NE2 . GLN B 1 93  ? 35.326  81.904  112.566 1.00 78.69  ? 593 GLN B NE2 1 
ATOM   3130  N N   . LEU B 1 94  ? 34.640  83.020  107.604 1.00 24.57  ? 594 LEU B N   1 
ATOM   3131  C CA  . LEU B 1 94  ? 34.333  84.240  106.869 1.00 28.01  ? 594 LEU B CA  1 
ATOM   3132  C C   . LEU B 1 94  ? 32.820  84.466  106.858 1.00 33.01  ? 594 LEU B C   1 
ATOM   3133  O O   . LEU B 1 94  ? 32.358  85.575  107.097 1.00 32.49  ? 594 LEU B O   1 
ATOM   3134  C CB  . LEU B 1 94  ? 34.863  84.141  105.443 1.00 25.63  ? 594 LEU B CB  1 
ATOM   3135  C CG  . LEU B 1 94  ? 35.433  85.400  104.791 1.00 30.44  ? 594 LEU B CG  1 
ATOM   3136  C CD1 . LEU B 1 94  ? 34.986  85.487  103.348 1.00 27.81  ? 594 LEU B CD1 1 
ATOM   3137  C CD2 . LEU B 1 94  ? 35.073  86.661  105.540 1.00 24.91  ? 594 LEU B CD2 1 
ATOM   3138  N N   . ARG B 1 95  ? 32.050  83.408  106.597 1.00 31.07  ? 595 ARG B N   1 
ATOM   3139  C CA  . ARG B 1 95  ? 30.591  83.502  106.645 1.00 23.25  ? 595 ARG B CA  1 
ATOM   3140  C C   . ARG B 1 95  ? 30.086  84.066  107.978 1.00 29.63  ? 595 ARG B C   1 
ATOM   3141  O O   . ARG B 1 95  ? 29.250  84.974  108.004 1.00 29.26  ? 595 ARG B O   1 
ATOM   3142  C CB  . ARG B 1 95  ? 29.939  82.151  106.345 1.00 19.96  ? 595 ARG B CB  1 
ATOM   3143  C CG  . ARG B 1 95  ? 29.906  81.824  104.861 1.00 18.13  ? 595 ARG B CG  1 
ATOM   3144  C CD  . ARG B 1 95  ? 29.154  80.527  104.553 1.00 23.63  ? 595 ARG B CD  1 
ATOM   3145  N NE  . ARG B 1 95  ? 29.714  79.370  105.232 1.00 30.61  ? 595 ARG B NE  1 
ATOM   3146  C CZ  . ARG B 1 95  ? 30.626  78.569  104.696 1.00 35.57  ? 595 ARG B CZ  1 
ATOM   3147  N NH1 . ARG B 1 95  ? 31.070  78.818  103.471 1.00 25.61  ? 595 ARG B NH1 1 
ATOM   3148  N NH2 . ARG B 1 95  ? 31.088  77.525  105.383 1.00 30.27  ? 595 ARG B NH2 1 
ATOM   3149  N N   . LEU B 1 96  ? 30.595  83.536  109.085 1.00 26.84  ? 596 LEU B N   1 
ATOM   3150  C CA  . LEU B 1 96  ? 30.193  84.039  110.393 1.00 23.82  ? 596 LEU B CA  1 
ATOM   3151  C C   . LEU B 1 96  ? 30.554  85.513  110.544 1.00 33.88  ? 596 LEU B C   1 
ATOM   3152  O O   . LEU B 1 96  ? 29.769  86.292  111.079 1.00 43.56  ? 596 LEU B O   1 
ATOM   3153  C CB  . LEU B 1 96  ? 30.826  83.212  111.518 1.00 21.93  ? 596 LEU B CB  1 
ATOM   3154  C CG  . LEU B 1 96  ? 30.528  81.710  111.454 1.00 29.93  ? 596 LEU B CG  1 
ATOM   3155  C CD1 . LEU B 1 96  ? 31.114  80.981  112.648 1.00 29.58  ? 596 LEU B CD1 1 
ATOM   3156  C CD2 . LEU B 1 96  ? 29.033  81.455  111.360 1.00 28.72  ? 596 LEU B CD2 1 
ATOM   3157  N N   . ASP B 1 97  ? 31.740  85.897  110.066 1.00 32.41  ? 597 ASP B N   1 
ATOM   3158  C CA  . ASP B 1 97  ? 32.198  87.273  110.201 1.00 30.75  ? 597 ASP B CA  1 
ATOM   3159  C C   . ASP B 1 97  ? 31.239  88.154  109.449 1.00 31.75  ? 597 ASP B C   1 
ATOM   3160  O O   . ASP B 1 97  ? 30.762  89.151  109.971 1.00 32.78  ? 597 ASP B O   1 
ATOM   3161  C CB  . ASP B 1 97  ? 33.621  87.456  109.672 1.00 38.73  ? 597 ASP B CB  1 
ATOM   3162  C CG  . ASP B 1 97  ? 34.662  86.696  110.499 1.00 47.15  ? 597 ASP B CG  1 
ATOM   3163  O OD1 . ASP B 1 97  ? 34.349  86.288  111.636 1.00 50.62  ? 597 ASP B OD1 1 
ATOM   3164  O OD2 . ASP B 1 97  ? 35.797  86.512  110.011 1.00 50.22  ? 597 ASP B OD2 1 
ATOM   3165  N N   . ILE B 1 98  ? 30.928  87.750  108.226 1.00 29.03  ? 598 ILE B N   1 
ATOM   3166  C CA  . ILE B 1 98  ? 29.987  88.485  107.405 1.00 25.68  ? 598 ILE B CA  1 
ATOM   3167  C C   . ILE B 1 98  ? 28.622  88.624  108.075 1.00 20.05  ? 598 ILE B C   1 
ATOM   3168  O O   . ILE B 1 98  ? 27.956  89.638  107.934 1.00 28.21  ? 598 ILE B O   1 
ATOM   3169  C CB  . ILE B 1 98  ? 29.852  87.851  106.011 1.00 24.30  ? 598 ILE B CB  1 
ATOM   3170  C CG1 . ILE B 1 98  ? 31.080  88.208  105.170 1.00 24.77  ? 598 ILE B CG1 1 
ATOM   3171  C CG2 . ILE B 1 98  ? 28.568  88.322  105.322 1.00 12.02  ? 598 ILE B CG2 1 
ATOM   3172  C CD1 . ILE B 1 98  ? 31.114  87.522  103.852 1.00 27.02  ? 598 ILE B CD1 1 
ATOM   3173  N N   . ILE B 1 99  ? 28.210  87.619  108.825 1.00 24.64  ? 599 ILE B N   1 
ATOM   3174  C CA  . ILE B 1 99  ? 26.910  87.679  109.469 1.00 30.23  ? 599 ILE B CA  1 
ATOM   3175  C C   . ILE B 1 99  ? 26.950  88.644  110.656 1.00 25.12  ? 599 ILE B C   1 
ATOM   3176  O O   . ILE B 1 99  ? 26.058  89.475  110.836 1.00 21.51  ? 599 ILE B O   1 
ATOM   3177  C CB  . ILE B 1 99  ? 26.445  86.272  109.895 1.00 31.41  ? 599 ILE B CB  1 
ATOM   3178  C CG1 . ILE B 1 99  ? 26.151  85.432  108.650 1.00 32.40  ? 599 ILE B CG1 1 
ATOM   3179  C CG2 . ILE B 1 99  ? 25.237  86.342  110.821 1.00 22.21  ? 599 ILE B CG2 1 
ATOM   3180  C CD1 . ILE B 1 99  ? 25.933  83.922  108.934 1.00 38.15  ? 599 ILE B CD1 1 
ATOM   3181  N N   . GLU B 1 100 ? 27.999  88.540  111.460 1.00 25.92  ? 600 GLU B N   1 
ATOM   3182  C CA  . GLU B 1 100 ? 28.125  89.399  112.625 1.00 24.83  ? 600 GLU B CA  1 
ATOM   3183  C C   . GLU B 1 100 ? 28.081  90.869  112.202 1.00 23.17  ? 600 GLU B C   1 
ATOM   3184  O O   . GLU B 1 100 ? 27.349  91.675  112.788 1.00 21.44  ? 600 GLU B O   1 
ATOM   3185  C CB  . GLU B 1 100 ? 29.417  89.082  113.388 1.00 25.37  ? 600 GLU B CB  1 
ATOM   3186  C CG  . GLU B 1 100 ? 29.659  89.944  114.622 1.00 31.92  ? 600 GLU B CG  1 
ATOM   3187  C CD  . GLU B 1 100 ? 28.605  89.743  115.697 1.00 43.50  ? 600 GLU B CD  1 
ATOM   3188  O OE1 . GLU B 1 100 ? 28.558  88.628  116.272 1.00 43.03  ? 600 GLU B OE1 1 
ATOM   3189  O OE2 . GLU B 1 100 ? 27.826  90.696  115.965 1.00 40.27  ? 600 GLU B OE2 1 
ATOM   3190  N N   . ARG B 1 101 ? 28.852  91.190  111.165 1.00 19.83  ? 601 ARG B N   1 
ATOM   3191  C CA  . ARG B 1 101 ? 29.052  92.561  110.712 1.00 27.34  ? 601 ARG B CA  1 
ATOM   3192  C C   . ARG B 1 101 ? 27.762  93.165  110.181 1.00 28.20  ? 601 ARG B C   1 
ATOM   3193  O O   . ARG B 1 101 ? 27.449  94.325  110.447 1.00 30.06  ? 601 ARG B O   1 
ATOM   3194  C CB  . ARG B 1 101 ? 30.135  92.622  109.636 1.00 24.77  ? 601 ARG B CB  1 
ATOM   3195  C CG  . ARG B 1 101 ? 30.269  93.990  109.013 1.00 29.54  ? 601 ARG B CG  1 
ATOM   3196  C CD  . ARG B 1 101 ? 31.421  94.058  108.025 1.00 34.00  ? 601 ARG B CD  1 
ATOM   3197  N NE  . ARG B 1 101 ? 31.397  95.326  107.302 1.00 33.83  ? 601 ARG B NE  1 
ATOM   3198  C CZ  . ARG B 1 101 ? 31.871  96.471  107.786 1.00 35.56  ? 601 ARG B CZ  1 
ATOM   3199  N NH1 . ARG B 1 101 ? 32.411  96.523  109.002 1.00 31.00  ? 601 ARG B NH1 1 
ATOM   3200  N NH2 . ARG B 1 101 ? 31.794  97.574  107.057 1.00 29.63  ? 601 ARG B NH2 1 
ATOM   3201  N N   . HIS B 1 102 ? 27.012  92.368  109.436 1.00 19.70  ? 602 HIS B N   1 
ATOM   3202  C CA  . HIS B 1 102 ? 25.711  92.799  108.944 1.00 26.55  ? 602 HIS B CA  1 
ATOM   3203  C C   . HIS B 1 102 ? 24.759  93.076  110.115 1.00 28.25  ? 602 HIS B C   1 
ATOM   3204  O O   . HIS B 1 102 ? 24.140  94.142  110.176 1.00 25.70  ? 602 HIS B O   1 
ATOM   3205  C CB  . HIS B 1 102 ? 25.131  91.739  108.008 1.00 21.35  ? 602 HIS B CB  1 
ATOM   3206  C CG  . HIS B 1 102 ? 24.000  92.221  107.149 1.00 25.12  ? 602 HIS B CG  1 
ATOM   3207  N ND1 . HIS B 1 102 ? 22.677  92.123  107.532 1.00 21.54  ? 602 HIS B ND1 1 
ATOM   3208  C CD2 . HIS B 1 102 ? 23.992  92.761  105.907 1.00 22.33  ? 602 HIS B CD2 1 
ATOM   3209  C CE1 . HIS B 1 102 ? 21.906  92.595  106.567 1.00 22.50  ? 602 HIS B CE1 1 
ATOM   3210  N NE2 . HIS B 1 102 ? 22.679  92.991  105.571 1.00 27.90  ? 602 HIS B NE2 1 
ATOM   3211  N N   . ASN B 1 103 ? 24.651  92.120  111.040 1.00 20.44  ? 603 ASN B N   1 
ATOM   3212  C CA  . ASN B 1 103 ? 23.823  92.302  112.232 1.00 25.21  ? 603 ASN B CA  1 
ATOM   3213  C C   . ASN B 1 103 ? 24.197  93.586  112.960 1.00 24.19  ? 603 ASN B C   1 
ATOM   3214  O O   . ASN B 1 103 ? 23.355  94.440  113.194 1.00 34.64  ? 603 ASN B O   1 
ATOM   3215  C CB  . ASN B 1 103 ? 23.969  91.132  113.227 1.00 19.51  ? 603 ASN B CB  1 
ATOM   3216  C CG  . ASN B 1 103 ? 23.341  89.841  112.742 1.00 28.49  ? 603 ASN B CG  1 
ATOM   3217  O OD1 . ASN B 1 103 ? 22.372  89.837  111.976 1.00 27.37  ? 603 ASN B OD1 1 
ATOM   3218  N ND2 . ASN B 1 103 ? 23.890  88.720  113.210 1.00 33.82  ? 603 ASN B ND2 1 
ATOM   3219  N N   . THR B 1 104 ? 25.468  93.694  113.332 1.00 29.54  ? 604 THR B N   1 
ATOM   3220  C CA  . THR B 1 104 ? 25.972  94.811  114.133 1.00 27.40  ? 604 THR B CA  1 
ATOM   3221  C C   . THR B 1 104 ? 25.743  96.148  113.445 1.00 26.31  ? 604 THR B C   1 
ATOM   3222  O O   . THR B 1 104 ? 25.330  97.106  114.073 1.00 24.49  ? 604 THR B O   1 
ATOM   3223  C CB  . THR B 1 104 ? 27.465  94.648  114.441 1.00 24.47  ? 604 THR B CB  1 
ATOM   3224  O OG1 . THR B 1 104 ? 27.640  93.557  115.349 1.00 33.35  ? 604 THR B OG1 1 
ATOM   3225  C CG2 . THR B 1 104 ? 28.008  95.897  115.081 1.00 28.22  ? 604 THR B CG2 1 
ATOM   3226  N N   . MET B 1 105 ? 25.985  96.195  112.144 1.00 31.14  ? 605 MET B N   1 
ATOM   3227  C CA  . MET B 1 105 ? 25.691  97.388  111.368 1.00 25.35  ? 605 MET B CA  1 
ATOM   3228  C C   . MET B 1 105 ? 24.204  97.784  111.429 1.00 29.66  ? 605 MET B C   1 
ATOM   3229  O O   . MET B 1 105 ? 23.876  98.938  111.725 1.00 26.00  ? 605 MET B O   1 
ATOM   3230  C CB  . MET B 1 105 ? 26.144  97.214  109.916 1.00 26.29  ? 605 MET B CB  1 
ATOM   3231  C CG  . MET B 1 105 ? 26.322  98.539  109.189 1.00 39.21  ? 605 MET B CG  1 
ATOM   3232  S SD  . MET B 1 105 ? 26.802  98.361  107.470 1.00 42.32  ? 605 MET B SD  1 
ATOM   3233  C CE  . MET B 1 105 ? 27.947  96.979  107.580 1.00 41.92  ? 605 MET B CE  1 
ATOM   3234  N N   . ALA B 1 106 ? 23.305  96.841  111.151 1.00 24.15  ? 606 ALA B N   1 
ATOM   3235  C CA  . ALA B 1 106 ? 21.877  97.165  111.147 1.00 25.87  ? 606 ALA B CA  1 
ATOM   3236  C C   . ALA B 1 106 ? 21.400  97.628  112.525 1.00 29.01  ? 606 ALA B C   1 
ATOM   3237  O O   . ALA B 1 106 ? 20.588  98.555  112.632 1.00 34.39  ? 606 ALA B O   1 
ATOM   3238  C CB  . ALA B 1 106 ? 21.050  96.001  110.657 1.00 19.43  ? 606 ALA B CB  1 
ATOM   3239  N N   . ILE B 1 107 ? 21.914  96.994  113.576 1.00 18.36  ? 607 ILE B N   1 
ATOM   3240  C CA  . ILE B 1 107 ? 21.623  97.432  114.942 1.00 23.13  ? 607 ILE B CA  1 
ATOM   3241  C C   . ILE B 1 107 ? 22.101  98.886  115.180 1.00 35.25  ? 607 ILE B C   1 
ATOM   3242  O O   . ILE B 1 107 ? 21.374  99.708  115.750 1.00 31.82  ? 607 ILE B O   1 
ATOM   3243  C CB  . ILE B 1 107 ? 22.224  96.453  115.987 1.00 19.64  ? 607 ILE B CB  1 
ATOM   3244  C CG1 . ILE B 1 107 ? 21.375  95.173  116.083 1.00 26.57  ? 607 ILE B CG1 1 
ATOM   3245  C CG2 . ILE B 1 107 ? 22.338  97.101  117.338 1.00 17.62  ? 607 ILE B CG2 1 
ATOM   3246  C CD1 . ILE B 1 107 ? 22.081  94.007  116.794 1.00 21.98  ? 607 ILE B CD1 1 
ATOM   3247  N N   . GLY B 1 108 ? 23.313  99.201  114.722 1.00 33.29  ? 608 GLY B N   1 
ATOM   3248  C CA  . GLY B 1 108 ? 23.889  100.520 114.918 1.00 24.56  ? 608 GLY B CA  1 
ATOM   3249  C C   . GLY B 1 108 ? 23.096  101.612 114.214 1.00 32.23  ? 608 GLY B C   1 
ATOM   3250  O O   . GLY B 1 108 ? 22.830  102.669 114.804 1.00 23.89  ? 608 GLY B O   1 
ATOM   3251  N N   . ILE B 1 109 ? 22.727  101.359 112.954 1.00 25.40  ? 609 ILE B N   1 
ATOM   3252  C CA  . ILE B 1 109 ? 21.818  102.237 112.244 1.00 25.13  ? 609 ILE B CA  1 
ATOM   3253  C C   . ILE B 1 109 ? 20.540  102.436 113.083 1.00 33.98  ? 609 ILE B C   1 
ATOM   3254  O O   . ILE B 1 109 ? 20.125  103.562 113.328 1.00 37.51  ? 609 ILE B O   1 
ATOM   3255  C CB  . ILE B 1 109 ? 21.437  101.694 110.843 1.00 26.65  ? 609 ILE B CB  1 
ATOM   3256  C CG1 . ILE B 1 109 ? 22.673  101.433 109.986 1.00 30.20  ? 609 ILE B CG1 1 
ATOM   3257  C CG2 . ILE B 1 109 ? 20.519  102.663 110.129 1.00 21.76  ? 609 ILE B CG2 1 
ATOM   3258  C CD1 . ILE B 1 109 ? 23.425  102.664 109.613 1.00 31.27  ? 609 ILE B CD1 1 
ATOM   3259  N N   . ALA B 1 110 ? 19.919  101.351 113.535 1.00 38.46  ? 610 ALA B N   1 
ATOM   3260  C CA  . ALA B 1 110 ? 18.706  101.479 114.354 1.00 37.26  ? 610 ALA B CA  1 
ATOM   3261  C C   . ALA B 1 110 ? 18.920  102.376 115.582 1.00 39.44  ? 610 ALA B C   1 
ATOM   3262  O O   . ALA B 1 110 ? 18.092  103.237 115.896 1.00 38.67  ? 610 ALA B O   1 
ATOM   3263  C CB  . ALA B 1 110 ? 18.195  100.106 114.774 1.00 32.60  ? 610 ALA B CB  1 
ATOM   3264  N N   . VAL B 1 111 ? 20.037  102.164 116.273 1.00 40.01  ? 611 VAL B N   1 
ATOM   3265  C CA  . VAL B 1 111 ? 20.372  102.933 117.461 1.00 40.45  ? 611 VAL B CA  1 
ATOM   3266  C C   . VAL B 1 111 ? 20.608  104.397 117.121 1.00 46.67  ? 611 VAL B C   1 
ATOM   3267  O O   . VAL B 1 111 ? 20.340  105.291 117.929 1.00 47.52  ? 611 VAL B O   1 
ATOM   3268  C CB  . VAL B 1 111 ? 21.631  102.377 118.150 1.00 33.96  ? 611 VAL B CB  1 
ATOM   3269  C CG1 . VAL B 1 111 ? 22.264  103.433 119.014 1.00 30.79  ? 611 VAL B CG1 1 
ATOM   3270  C CG2 . VAL B 1 111 ? 21.283  101.155 118.976 1.00 37.92  ? 611 VAL B CG2 1 
ATOM   3271  N N   . ASP B 1 112 ? 21.122  104.639 115.923 1.00 49.02  ? 612 ASP B N   1 
ATOM   3272  C CA  . ASP B 1 112 ? 21.423  105.999 115.501 1.00 49.34  ? 612 ASP B CA  1 
ATOM   3273  C C   . ASP B 1 112 ? 20.130  106.808 115.419 1.00 46.30  ? 612 ASP B C   1 
ATOM   3274  O O   . ASP B 1 112 ? 20.129  108.020 115.605 1.00 47.89  ? 612 ASP B O   1 
ATOM   3275  C CB  . ASP B 1 112 ? 22.174  106.002 114.164 1.00 47.41  ? 612 ASP B CB  1 
ATOM   3276  C CG  . ASP B 1 112 ? 22.542  107.398 113.706 1.00 70.27  ? 612 ASP B CG  1 
ATOM   3277  O OD1 . ASP B 1 112 ? 22.421  108.343 114.514 1.00 76.32  ? 612 ASP B OD1 1 
ATOM   3278  O OD2 . ASP B 1 112 ? 22.962  107.555 112.539 1.00 84.27  ? 612 ASP B OD2 1 
ATOM   3279  N N   . ILE B 1 113 ? 19.026  106.113 115.175 1.00 38.47  ? 613 ILE B N   1 
ATOM   3280  C CA  . ILE B 1 113 ? 17.741  106.758 114.978 1.00 37.34  ? 613 ILE B CA  1 
ATOM   3281  C C   . ILE B 1 113 ? 16.911  106.913 116.252 1.00 41.56  ? 613 ILE B C   1 
ATOM   3282  O O   . ILE B 1 113 ? 16.316  107.961 116.485 1.00 36.42  ? 613 ILE B O   1 
ATOM   3283  C CB  . ILE B 1 113 ? 16.910  106.000 113.943 1.00 40.95  ? 613 ILE B CB  1 
ATOM   3284  C CG1 . ILE B 1 113 ? 17.547  106.127 112.559 1.00 44.94  ? 613 ILE B CG1 1 
ATOM   3285  C CG2 . ILE B 1 113 ? 15.466  106.503 113.936 1.00 34.55  ? 613 ILE B CG2 1 
ATOM   3286  C CD1 . ILE B 1 113 ? 16.716  105.509 111.467 1.00 46.38  ? 613 ILE B CD1 1 
ATOM   3287  N N   . LEU B 1 114 ? 16.851  105.861 117.062 1.00 48.69  ? 614 LEU B N   1 
ATOM   3288  C CA  . LEU B 1 114 ? 16.021  105.865 118.263 1.00 39.97  ? 614 LEU B CA  1 
ATOM   3289  C C   . LEU B 1 114 ? 16.799  106.298 119.501 1.00 48.96  ? 614 LEU B C   1 
ATOM   3290  O O   . LEU B 1 114 ? 16.213  106.612 120.531 1.00 56.51  ? 614 LEU B O   1 
ATOM   3291  C CB  . LEU B 1 114 ? 15.421  104.477 118.495 1.00 35.42  ? 614 LEU B CB  1 
ATOM   3292  C CG  . LEU B 1 114 ? 14.456  103.985 117.415 1.00 42.19  ? 614 LEU B CG  1 
ATOM   3293  C CD1 . LEU B 1 114 ? 14.523  102.464 117.280 1.00 32.90  ? 614 LEU B CD1 1 
ATOM   3294  C CD2 . LEU B 1 114 ? 13.020  104.477 117.684 1.00 45.23  ? 614 LEU B CD2 1 
ATOM   3295  N N   . GLY B 1 115 ? 18.122  106.299 119.408 1.00 54.76  ? 615 GLY B N   1 
ATOM   3296  C CA  . GLY B 1 115 ? 18.945  106.651 120.545 1.00 68.40  ? 615 GLY B CA  1 
ATOM   3297  C C   . GLY B 1 115 ? 19.508  108.053 120.445 1.00 89.48  ? 615 GLY B C   1 
ATOM   3298  O O   . GLY B 1 115 ? 19.097  108.949 121.182 1.00 92.76  ? 615 GLY B O   1 
ATOM   3299  N N   . CYS B 1 116 ? 20.440  108.241 119.513 1.00 101.53 ? 616 CYS B N   1 
ATOM   3300  C CA  . CYS B 1 116 ? 21.206  109.479 119.415 1.00 108.22 ? 616 CYS B CA  1 
ATOM   3301  C C   . CYS B 1 116 ? 20.491  110.605 118.645 1.00 111.34 ? 616 CYS B C   1 
ATOM   3302  O O   . CYS B 1 116 ? 21.085  111.250 117.780 1.00 116.58 ? 616 CYS B O   1 
ATOM   3303  C CB  . CYS B 1 116 ? 22.580  109.190 118.800 1.00 106.32 ? 616 CYS B CB  1 
ATOM   3304  S SG  . CYS B 1 116 ? 23.891  110.304 119.348 1.00 165.64 ? 616 CYS B SG  1 
ATOM   3305  N N   . THR B 1 117 ? 19.220  110.836 118.964 1.00 104.96 ? 617 THR B N   1 
ATOM   3306  C CA  . THR B 1 117 ? 18.484  111.970 118.408 1.00 93.64  ? 617 THR B CA  1 
ATOM   3307  C C   . THR B 1 117 ? 17.975  112.877 119.530 1.00 83.87  ? 617 THR B C   1 
ATOM   3308  O O   . THR B 1 117 ? 18.101  112.554 120.716 1.00 79.08  ? 617 THR B O   1 
ATOM   3309  C CB  . THR B 1 117 ? 17.288  111.529 117.516 1.00 52.70  ? 617 THR B CB  1 
ATOM   3310  O OG1 . THR B 1 117 ? 16.587  110.450 118.150 1.00 57.03  ? 617 THR B OG1 1 
ATOM   3311  C CG2 . THR B 1 117 ? 17.755  111.095 116.117 1.00 37.11  ? 617 THR B CG2 1 
ATOM   3312  N N   . GLY B 1 118 ? 17.410  114.016 119.142 1.00 76.68  ? 618 GLY B N   1 
ATOM   3313  C CA  . GLY B 1 118 ? 16.828  114.950 120.084 1.00 63.86  ? 618 GLY B CA  1 
ATOM   3314  C C   . GLY B 1 118 ? 15.343  115.160 119.848 1.00 67.15  ? 618 GLY B C   1 
ATOM   3315  O O   . GLY B 1 118 ? 14.522  114.732 120.655 1.00 78.45  ? 618 GLY B O   1 
ATOM   3316  N N   . THR B 1 119 ? 15.000  115.818 118.740 1.00 61.43  ? 619 THR B N   1 
ATOM   3317  C CA  . THR B 1 119 ? 13.608  116.142 118.407 1.00 53.97  ? 619 THR B CA  1 
ATOM   3318  C C   . THR B 1 119 ? 13.067  115.282 117.261 1.00 50.78  ? 619 THR B C   1 
ATOM   3319  O O   . THR B 1 119 ? 13.820  114.551 116.619 1.00 58.55  ? 619 THR B O   1 
ATOM   3320  C CB  . THR B 1 119 ? 13.462  117.638 118.020 1.00 67.29  ? 619 THR B CB  1 
ATOM   3321  O OG1 . THR B 1 119 ? 12.108  117.923 117.632 1.00 64.11  ? 619 THR B OG1 1 
ATOM   3322  C CG2 . THR B 1 119 ? 14.400  117.991 116.871 1.00 66.35  ? 619 THR B CG2 1 
ATOM   3323  N N   . LEU B 1 120 ? 11.761  115.365 117.017 1.00 42.07  ? 620 LEU B N   1 
ATOM   3324  C CA  . LEU B 1 120 ? 11.151  114.723 115.856 1.00 40.65  ? 620 LEU B CA  1 
ATOM   3325  C C   . LEU B 1 120 ? 11.870  115.169 114.598 1.00 46.58  ? 620 LEU B C   1 
ATOM   3326  O O   . LEU B 1 120 ? 12.031  114.401 113.650 1.00 51.63  ? 620 LEU B O   1 
ATOM   3327  C CB  . LEU B 1 120 ? 9.669   115.085 115.737 1.00 28.95  ? 620 LEU B CB  1 
ATOM   3328  C CG  . LEU B 1 120 ? 8.971   114.677 114.435 1.00 30.56  ? 620 LEU B CG  1 
ATOM   3329  C CD1 . LEU B 1 120 ? 9.150   113.165 114.122 1.00 20.73  ? 620 LEU B CD1 1 
ATOM   3330  C CD2 . LEU B 1 120 ? 7.488   115.060 114.466 1.00 27.54  ? 620 LEU B CD2 1 
ATOM   3331  N N   . GLU B 1 121 ? 12.311  116.419 114.608 1.00 48.69  ? 621 GLU B N   1 
ATOM   3332  C CA  . GLU B 1 121 ? 12.906  117.037 113.438 1.00 46.69  ? 621 GLU B CA  1 
ATOM   3333  C C   . GLU B 1 121 ? 14.307  116.494 113.150 1.00 43.23  ? 621 GLU B C   1 
ATOM   3334  O O   . GLU B 1 121 ? 14.702  116.409 111.988 1.00 39.00  ? 621 GLU B O   1 
ATOM   3335  C CB  . GLU B 1 121 ? 12.930  118.556 113.612 1.00 54.03  ? 621 GLU B CB  1 
ATOM   3336  C CG  . GLU B 1 121 ? 13.128  119.330 112.331 1.00 66.93  ? 621 GLU B CG  1 
ATOM   3337  C CD  . GLU B 1 121 ? 13.290  120.814 112.579 1.00 84.38  ? 621 GLU B CD  1 
ATOM   3338  O OE1 . GLU B 1 121 ? 13.075  121.250 113.733 1.00 90.63  ? 621 GLU B OE1 1 
ATOM   3339  O OE2 . GLU B 1 121 ? 13.636  121.542 111.624 1.00 89.30  ? 621 GLU B OE2 1 
ATOM   3340  N N   . ASP B 1 122 ? 15.050  116.131 114.198 1.00 48.61  ? 622 ASP B N   1 
ATOM   3341  C CA  . ASP B 1 122 ? 16.388  115.535 114.050 1.00 51.36  ? 622 ASP B CA  1 
ATOM   3342  C C   . ASP B 1 122 ? 16.288  114.074 113.630 1.00 44.59  ? 622 ASP B C   1 
ATOM   3343  O O   . ASP B 1 122 ? 17.144  113.539 112.921 1.00 42.29  ? 622 ASP B O   1 
ATOM   3344  C CB  . ASP B 1 122 ? 17.164  115.591 115.369 1.00 64.81  ? 622 ASP B CB  1 
ATOM   3345  C CG  . ASP B 1 122 ? 17.139  116.963 116.009 1.00 84.61  ? 622 ASP B CG  1 
ATOM   3346  O OD1 . ASP B 1 122 ? 17.215  117.972 115.273 1.00 89.55  ? 622 ASP B OD1 1 
ATOM   3347  O OD2 . ASP B 1 122 ? 17.041  117.031 117.255 1.00 90.67  ? 622 ASP B OD2 1 
ATOM   3348  N N   . ARG B 1 123 ? 15.250  113.419 114.116 1.00 39.92  ? 623 ARG B N   1 
ATOM   3349  C CA  . ARG B 1 123 ? 15.041  112.018 113.825 1.00 39.34  ? 623 ARG B CA  1 
ATOM   3350  C C   . ARG B 1 123 ? 14.798  111.898 112.323 1.00 34.50  ? 623 ARG B C   1 
ATOM   3351  O O   . ARG B 1 123 ? 15.360  111.019 111.657 1.00 21.87  ? 623 ARG B O   1 
ATOM   3352  C CB  . ARG B 1 123 ? 13.842  111.506 114.621 1.00 36.52  ? 623 ARG B CB  1 
ATOM   3353  C CG  . ARG B 1 123 ? 14.030  110.145 115.204 1.00 36.63  ? 623 ARG B CG  1 
ATOM   3354  C CD  . ARG B 1 123 ? 13.268  109.991 116.509 1.00 30.71  ? 623 ARG B CD  1 
ATOM   3355  N NE  . ARG B 1 123 ? 11.816  110.054 116.351 1.00 35.22  ? 623 ARG B NE  1 
ATOM   3356  C CZ  . ARG B 1 123 ? 11.029  110.852 117.081 1.00 49.84  ? 623 ARG B CZ  1 
ATOM   3357  N NH1 . ARG B 1 123 ? 11.562  111.656 117.997 1.00 49.80  ? 623 ARG B NH1 1 
ATOM   3358  N NH2 . ARG B 1 123 ? 9.712   110.856 116.902 1.00 43.89  ? 623 ARG B NH2 1 
ATOM   3359  N N   . ALA B 1 124 ? 13.979  112.811 111.798 1.00 30.09  ? 624 ALA B N   1 
ATOM   3360  C CA  . ALA B 1 124 ? 13.659  112.842 110.380 1.00 32.01  ? 624 ALA B CA  1 
ATOM   3361  C C   . ALA B 1 124 ? 14.907  113.145 109.572 1.00 34.92  ? 624 ALA B C   1 
ATOM   3362  O O   . ALA B 1 124 ? 15.155  112.508 108.549 1.00 36.29  ? 624 ALA B O   1 
ATOM   3363  C CB  . ALA B 1 124 ? 12.570  113.868 110.089 1.00 25.16  ? 624 ALA B CB  1 
ATOM   3364  N N   . ALA B 1 125 ? 15.703  114.105 110.043 1.00 28.50  ? 625 ALA B N   1 
ATOM   3365  C CA  . ALA B 1 125 ? 16.940  114.480 109.354 1.00 28.18  ? 625 ALA B CA  1 
ATOM   3366  C C   . ALA B 1 125 ? 17.944  113.321 109.284 1.00 25.59  ? 625 ALA B C   1 
ATOM   3367  O O   . ALA B 1 125 ? 18.611  113.123 108.265 1.00 28.97  ? 625 ALA B O   1 
ATOM   3368  C CB  . ALA B 1 125 ? 17.568  115.710 110.004 1.00 22.12  ? 625 ALA B CB  1 
ATOM   3369  N N   . THR B 1 126 ? 18.032  112.565 110.373 1.00 32.22  ? 626 THR B N   1 
ATOM   3370  C CA  . THR B 1 126 ? 18.843  111.348 110.444 1.00 30.99  ? 626 THR B CA  1 
ATOM   3371  C C   . THR B 1 126 ? 18.337  110.300 109.475 1.00 27.68  ? 626 THR B C   1 
ATOM   3372  O O   . THR B 1 126 ? 19.091  109.774 108.670 1.00 29.83  ? 626 THR B O   1 
ATOM   3373  C CB  . THR B 1 126 ? 18.793  110.751 111.850 1.00 34.04  ? 626 THR B CB  1 
ATOM   3374  O OG1 . THR B 1 126 ? 19.405  111.661 112.773 1.00 37.66  ? 626 THR B OG1 1 
ATOM   3375  C CG2 . THR B 1 126 ? 19.501  109.410 111.893 1.00 27.39  ? 626 THR B CG2 1 
ATOM   3376  N N   . LEU B 1 127 ? 17.045  110.005 109.561 1.00 28.65  ? 627 LEU B N   1 
ATOM   3377  C CA  . LEU B 1 127 ? 16.400  109.086 108.635 1.00 23.24  ? 627 LEU B CA  1 
ATOM   3378  C C   . LEU B 1 127 ? 16.690  109.457 107.174 1.00 20.80  ? 627 LEU B C   1 
ATOM   3379  O O   . LEU B 1 127 ? 16.955  108.588 106.337 1.00 18.26  ? 627 LEU B O   1 
ATOM   3380  C CB  . LEU B 1 127 ? 14.896  109.072 108.885 1.00 27.24  ? 627 LEU B CB  1 
ATOM   3381  C CG  . LEU B 1 127 ? 14.112  107.970 108.176 1.00 34.64  ? 627 LEU B CG  1 
ATOM   3382  C CD1 . LEU B 1 127 ? 14.700  106.613 108.510 1.00 41.32  ? 627 LEU B CD1 1 
ATOM   3383  C CD2 . LEU B 1 127 ? 12.648  108.027 108.559 1.00 32.79  ? 627 LEU B CD2 1 
ATOM   3384  N N   . SER B 1 128 ? 16.641  110.748 106.870 1.00 22.11  ? 628 SER B N   1 
ATOM   3385  C CA  . SER B 1 128 ? 16.936  111.219 105.525 1.00 23.39  ? 628 SER B CA  1 
ATOM   3386  C C   . SER B 1 128 ? 18.387  110.937 105.160 1.00 28.09  ? 628 SER B C   1 
ATOM   3387  O O   . SER B 1 128 ? 18.667  110.519 104.038 1.00 20.55  ? 628 SER B O   1 
ATOM   3388  C CB  . SER B 1 128 ? 16.646  112.716 105.384 1.00 27.78  ? 628 SER B CB  1 
ATOM   3389  O OG  . SER B 1 128 ? 17.147  113.239 104.163 1.00 17.85  ? 628 SER B OG  1 
ATOM   3390  N N   . LYS B 1 129 ? 19.315  111.168 106.088 1.00 26.56  ? 629 LYS B N   1 
ATOM   3391  C CA  . LYS B 1 129 ? 20.719  110.945 105.759 1.00 26.92  ? 629 LYS B CA  1 
ATOM   3392  C C   . LYS B 1 129 ? 21.002  109.460 105.546 1.00 27.00  ? 629 LYS B C   1 
ATOM   3393  O O   . LYS B 1 129 ? 21.737  109.076 104.634 1.00 24.75  ? 629 LYS B O   1 
ATOM   3394  C CB  . LYS B 1 129 ? 21.660  111.521 106.805 1.00 17.77  ? 629 LYS B CB  1 
ATOM   3395  C CG  . LYS B 1 129 ? 22.790  112.304 106.166 1.00 28.95  ? 629 LYS B CG  1 
ATOM   3396  C CD  . LYS B 1 129 ? 24.144  111.857 106.680 1.00 43.11  ? 629 LYS B CD  1 
ATOM   3397  C CE  . LYS B 1 129 ? 25.036  113.040 107.077 1.00 47.26  ? 629 LYS B CE  1 
ATOM   3398  N NZ  . LYS B 1 129 ? 25.279  113.976 105.959 1.00 49.37  ? 629 LYS B NZ  1 
ATOM   3399  N N   . ILE B 1 130 ? 20.413  108.629 106.394 1.00 26.10  ? 630 ILE B N   1 
ATOM   3400  C CA  . ILE B 1 130 ? 20.505  107.186 106.227 1.00 22.50  ? 630 ILE B CA  1 
ATOM   3401  C C   . ILE B 1 130 ? 20.078  106.773 104.805 1.00 22.49  ? 630 ILE B C   1 
ATOM   3402  O O   . ILE B 1 130 ? 20.808  106.068 104.121 1.00 27.47  ? 630 ILE B O   1 
ATOM   3403  C CB  . ILE B 1 130 ? 19.684  106.450 107.322 1.00 27.53  ? 630 ILE B CB  1 
ATOM   3404  C CG1 . ILE B 1 130 ? 20.262  106.775 108.705 1.00 19.45  ? 630 ILE B CG1 1 
ATOM   3405  C CG2 . ILE B 1 130 ? 19.634  104.932 107.065 1.00 22.89  ? 630 ILE B CG2 1 
ATOM   3406  C CD1 . ILE B 1 130 ? 19.387  106.342 109.872 1.00 20.61  ? 630 ILE B CD1 1 
ATOM   3407  N N   . ILE B 1 131 ? 18.915  107.230 104.349 1.00 27.76  ? 631 ILE B N   1 
ATOM   3408  C CA  . ILE B 1 131 ? 18.430  106.886 103.007 1.00 22.98  ? 631 ILE B CA  1 
ATOM   3409  C C   . ILE B 1 131 ? 19.407  107.353 101.908 1.00 22.95  ? 631 ILE B C   1 
ATOM   3410  O O   . ILE B 1 131 ? 19.661  106.634 100.932 1.00 20.68  ? 631 ILE B O   1 
ATOM   3411  C CB  . ILE B 1 131 ? 16.985  107.432 102.766 1.00 23.05  ? 631 ILE B CB  1 
ATOM   3412  C CG1 . ILE B 1 131 ? 15.978  106.718 103.684 1.00 21.69  ? 631 ILE B CG1 1 
ATOM   3413  C CG2 . ILE B 1 131 ? 16.570  107.285 101.305 1.00 14.62  ? 631 ILE B CG2 1 
ATOM   3414  C CD1 . ILE B 1 131 ? 14.632  107.422 103.803 1.00 22.57  ? 631 ILE B CD1 1 
ATOM   3415  N N   . GLN B 1 132 ? 19.984  108.540 102.084 1.00 23.15  ? 632 GLN B N   1 
ATOM   3416  C CA  . GLN B 1 132 ? 20.916  109.083 101.090 1.00 25.35  ? 632 GLN B CA  1 
ATOM   3417  C C   . GLN B 1 132 ? 22.155  108.212 100.985 1.00 23.27  ? 632 GLN B C   1 
ATOM   3418  O O   . GLN B 1 132 ? 22.662  107.975 99.887  1.00 18.83  ? 632 GLN B O   1 
ATOM   3419  C CB  . GLN B 1 132 ? 21.315  110.530 101.396 1.00 26.10  ? 632 GLN B CB  1 
ATOM   3420  C CG  . GLN B 1 132 ? 20.183  111.522 101.248 1.00 30.41  ? 632 GLN B CG  1 
ATOM   3421  C CD  . GLN B 1 132 ? 20.590  112.943 101.612 1.00 36.49  ? 632 GLN B CD  1 
ATOM   3422  O OE1 . GLN B 1 132 ? 21.105  113.205 102.698 1.00 41.22  ? 632 GLN B OE1 1 
ATOM   3423  N NE2 . GLN B 1 132 ? 20.365  113.864 100.693 1.00 32.49  ? 632 GLN B NE2 1 
ATOM   3424  N N   . VAL B 1 133 ? 22.630  107.729 102.125 1.00 7.46   ? 633 VAL B N   1 
ATOM   3425  C CA  . VAL B 1 133 ? 23.782  106.833 102.135 1.00 24.23  ? 633 VAL B CA  1 
ATOM   3426  C C   . VAL B 1 133 ? 23.450  105.511 101.427 1.00 26.45  ? 633 VAL B C   1 
ATOM   3427  O O   . VAL B 1 133 ? 24.202  105.035 100.581 1.00 24.31  ? 633 VAL B O   1 
ATOM   3428  C CB  . VAL B 1 133 ? 24.299  106.593 103.565 1.00 19.98  ? 633 VAL B CB  1 
ATOM   3429  C CG1 . VAL B 1 133 ? 25.336  105.475 103.576 1.00 12.27  ? 633 VAL B CG1 1 
ATOM   3430  C CG2 . VAL B 1 133 ? 24.898  107.871 104.099 1.00 21.74  ? 633 VAL B CG2 1 
ATOM   3431  N N   . ALA B 1 134 ? 22.295  104.944 101.745 1.00 22.84  ? 634 ALA B N   1 
ATOM   3432  C CA  . ALA B 1 134 ? 21.837  103.760 101.053 1.00 18.24  ? 634 ALA B CA  1 
ATOM   3433  C C   . ALA B 1 134 ? 21.820  103.973 99.522  1.00 21.01  ? 634 ALA B C   1 
ATOM   3434  O O   . ALA B 1 134 ? 22.318  103.140 98.760  1.00 17.99  ? 634 ALA B O   1 
ATOM   3435  C CB  . ALA B 1 134 ? 20.462  103.369 101.571 1.00 18.55  ? 634 ALA B CB  1 
ATOM   3436  N N   . VAL B 1 135 ? 21.231  105.078 99.075  1.00 22.95  ? 635 VAL B N   1 
ATOM   3437  C CA  . VAL B 1 135 ? 21.254  105.415 97.654  1.00 20.67  ? 635 VAL B CA  1 
ATOM   3438  C C   . VAL B 1 135 ? 22.688  105.423 97.113  1.00 22.82  ? 635 VAL B C   1 
ATOM   3439  O O   . VAL B 1 135 ? 22.945  104.963 96.005  1.00 23.10  ? 635 VAL B O   1 
ATOM   3440  C CB  . VAL B 1 135 ? 20.593  106.780 97.390  1.00 24.33  ? 635 VAL B CB  1 
ATOM   3441  C CG1 . VAL B 1 135 ? 20.897  107.273 95.958  1.00 21.00  ? 635 VAL B CG1 1 
ATOM   3442  C CG2 . VAL B 1 135 ? 19.092  106.678 97.643  1.00 20.29  ? 635 VAL B CG2 1 
ATOM   3443  N N   . GLU B 1 136 ? 23.624  105.928 97.905  1.00 16.84  ? 636 GLU B N   1 
ATOM   3444  C CA  . GLU B 1 136 ? 25.008  106.000 97.470  1.00 20.42  ? 636 GLU B CA  1 
ATOM   3445  C C   . GLU B 1 136 ? 25.631  104.598 97.442  1.00 22.03  ? 636 GLU B C   1 
ATOM   3446  O O   . GLU B 1 136 ? 26.389  104.261 96.525  1.00 18.74  ? 636 GLU B O   1 
ATOM   3447  C CB  . GLU B 1 136 ? 25.820  106.930 98.379  1.00 14.12  ? 636 GLU B CB  1 
ATOM   3448  C CG  . GLU B 1 136 ? 25.522  108.411 98.197  1.00 29.28  ? 636 GLU B CG  1 
ATOM   3449  C CD  . GLU B 1 136 ? 25.996  108.958 96.867  1.00 43.73  ? 636 GLU B CD  1 
ATOM   3450  O OE1 . GLU B 1 136 ? 27.098  108.573 96.421  1.00 44.74  ? 636 GLU B OE1 1 
ATOM   3451  O OE2 . GLU B 1 136 ? 25.261  109.774 96.267  1.00 54.90  ? 636 GLU B OE2 1 
ATOM   3452  N N   . LEU B 1 137 ? 25.308  103.794 98.453  1.00 18.11  ? 637 LEU B N   1 
ATOM   3453  C CA  . LEU B 1 137 ? 25.790  102.416 98.530  1.00 17.39  ? 637 LEU B CA  1 
ATOM   3454  C C   . LEU B 1 137 ? 25.315  101.633 97.330  1.00 15.37  ? 637 LEU B C   1 
ATOM   3455  O O   . LEU B 1 137 ? 26.074  100.862 96.751  1.00 20.19  ? 637 LEU B O   1 
ATOM   3456  C CB  . LEU B 1 137 ? 25.334  101.736 99.818  1.00 12.19  ? 637 LEU B CB  1 
ATOM   3457  C CG  . LEU B 1 137 ? 26.098  102.243 101.031 1.00 18.11  ? 637 LEU B CG  1 
ATOM   3458  C CD1 . LEU B 1 137 ? 25.378  101.795 102.311 1.00 11.01  ? 637 LEU B CD1 1 
ATOM   3459  C CD2 . LEU B 1 137 ? 27.579  101.778 100.952 1.00 8.87   ? 637 LEU B CD2 1 
ATOM   3460  N N   . LYS B 1 138 ? 24.063  101.849 96.947  1.00 20.32  ? 638 LYS B N   1 
ATOM   3461  C CA  . LYS B 1 138 ? 23.493  101.154 95.795  1.00 23.36  ? 638 LYS B CA  1 
ATOM   3462  C C   . LYS B 1 138 ? 24.063  101.672 94.476  1.00 19.21  ? 638 LYS B C   1 
ATOM   3463  O O   . LYS B 1 138 ? 24.733  100.946 93.745  1.00 17.29  ? 638 LYS B O   1 
ATOM   3464  C CB  . LYS B 1 138 ? 21.966  101.292 95.802  1.00 20.67  ? 638 LYS B CB  1 
ATOM   3465  C CG  . LYS B 1 138 ? 21.248  100.755 94.564  1.00 14.82  ? 638 LYS B CG  1 
ATOM   3466  C CD  . LYS B 1 138 ? 19.725  100.998 94.718  1.00 21.18  ? 638 LYS B CD  1 
ATOM   3467  C CE  . LYS B 1 138 ? 18.930  100.633 93.456  1.00 25.86  ? 638 LYS B CE  1 
ATOM   3468  N NZ  . LYS B 1 138 ? 19.136  101.560 92.281  1.00 23.88  ? 638 LYS B NZ  1 
ATOM   3469  N N   . ASP B 1 139 ? 23.821  102.947 94.194  1.00 14.35  ? 639 ASP B N   1 
ATOM   3470  C CA  . ASP B 1 139 ? 24.047  103.478 92.858  1.00 15.86  ? 639 ASP B CA  1 
ATOM   3471  C C   . ASP B 1 139 ? 25.478  103.894 92.569  1.00 16.72  ? 639 ASP B C   1 
ATOM   3472  O O   . ASP B 1 139 ? 25.851  104.025 91.405  1.00 16.65  ? 639 ASP B O   1 
ATOM   3473  C CB  . ASP B 1 139 ? 23.081  104.638 92.559  1.00 18.07  ? 639 ASP B CB  1 
ATOM   3474  C CG  . ASP B 1 139 ? 21.639  104.162 92.440  1.00 33.61  ? 639 ASP B CG  1 
ATOM   3475  O OD1 . ASP B 1 139 ? 21.450  102.929 92.315  1.00 34.93  ? 639 ASP B OD1 1 
ATOM   3476  O OD2 . ASP B 1 139 ? 20.705  104.996 92.479  1.00 41.62  ? 639 ASP B OD2 1 
ATOM   3477  N N   . SER B 1 140 ? 26.285  104.100 93.603  1.00 12.11  ? 640 SER B N   1 
ATOM   3478  C CA  . SER B 1 140 ? 27.640  104.616 93.355  1.00 25.21  ? 640 SER B CA  1 
ATOM   3479  C C   . SER B 1 140 ? 28.732  103.631 93.744  1.00 23.02  ? 640 SER B C   1 
ATOM   3480  O O   . SER B 1 140 ? 29.721  103.480 93.038  1.00 26.14  ? 640 SER B O   1 
ATOM   3481  C CB  . SER B 1 140 ? 27.867  105.972 94.053  1.00 17.06  ? 640 SER B CB  1 
ATOM   3482  O OG  . SER B 1 140 ? 27.039  106.973 93.480  1.00 27.37  ? 640 SER B OG  1 
ATOM   3483  N N   . MET B 1 141 ? 28.548  102.986 94.886  1.00 13.85  ? 641 MET B N   1 
ATOM   3484  C CA  . MET B 1 141 ? 29.497  102.015 95.379  1.00 19.36  ? 641 MET B CA  1 
ATOM   3485  C C   . MET B 1 141 ? 29.207  100.610 94.828  1.00 19.92  ? 641 MET B C   1 
ATOM   3486  O O   . MET B 1 141 ? 30.117  99.799  94.676  1.00 21.74  ? 641 MET B O   1 
ATOM   3487  C CB  . MET B 1 141 ? 29.452  101.997 96.902  1.00 19.69  ? 641 MET B CB  1 
ATOM   3488  C CG  . MET B 1 141 ? 29.689  103.334 97.536  1.00 21.03  ? 641 MET B CG  1 
ATOM   3489  S SD  . MET B 1 141 ? 31.249  104.053 96.997  1.00 25.94  ? 641 MET B SD  1 
ATOM   3490  C CE  . MET B 1 141 ? 30.675  105.348 95.923  1.00 29.92  ? 641 MET B CE  1 
ATOM   3491  N N   . GLY B 1 142 ? 27.944  100.332 94.513  1.00 19.47  ? 642 GLY B N   1 
ATOM   3492  C CA  . GLY B 1 142 ? 27.539  98.976  94.169  1.00 24.27  ? 642 GLY B CA  1 
ATOM   3493  C C   . GLY B 1 142 ? 27.886  98.013  95.296  1.00 26.25  ? 642 GLY B C   1 
ATOM   3494  O O   . GLY B 1 142 ? 28.423  96.937  95.057  1.00 28.88  ? 642 GLY B O   1 
ATOM   3495  N N   . ASP B 1 143 ? 27.610  98.436  96.530  1.00 24.22  ? 643 ASP B N   1 
ATOM   3496  C CA  . ASP B 1 143 ? 27.809  97.627  97.736  1.00 18.42  ? 643 ASP B CA  1 
ATOM   3497  C C   . ASP B 1 143 ? 26.451  97.107  98.211  1.00 24.33  ? 643 ASP B C   1 
ATOM   3498  O O   . ASP B 1 143 ? 25.775  97.757  99.021  1.00 26.58  ? 643 ASP B O   1 
ATOM   3499  C CB  . ASP B 1 143 ? 28.442  98.489  98.840  1.00 9.99   ? 643 ASP B CB  1 
ATOM   3500  C CG  . ASP B 1 143 ? 28.874  97.667  100.057 1.00 21.56  ? 643 ASP B CG  1 
ATOM   3501  O OD1 . ASP B 1 143 ? 28.361  96.552  100.251 1.00 19.21  ? 643 ASP B OD1 1 
ATOM   3502  O OD2 . ASP B 1 143 ? 29.731  98.142  100.824 1.00 30.04  ? 643 ASP B OD2 1 
ATOM   3503  N N   . LEU B 1 144 ? 26.020  95.962  97.688  1.00 21.03  ? 644 LEU B N   1 
ATOM   3504  C CA  . LEU B 1 144 ? 24.667  95.495  97.984  1.00 15.63  ? 644 LEU B CA  1 
ATOM   3505  C C   . LEU B 1 144 ? 24.619  95.000  99.425  1.00 12.90  ? 644 LEU B C   1 
ATOM   3506  O O   . LEU B 1 144 ? 23.609  95.131  100.122 1.00 15.00  ? 644 LEU B O   1 
ATOM   3507  C CB  . LEU B 1 144 ? 24.228  94.409  97.013  1.00 17.87  ? 644 LEU B CB  1 
ATOM   3508  C CG  . LEU B 1 144 ? 24.349  94.721  95.517  1.00 22.36  ? 644 LEU B CG  1 
ATOM   3509  C CD1 . LEU B 1 144 ? 23.884  93.539  94.711  1.00 23.45  ? 644 LEU B CD1 1 
ATOM   3510  C CD2 . LEU B 1 144 ? 23.570  95.959  95.123  1.00 17.76  ? 644 LEU B CD2 1 
ATOM   3511  N N   . TYR B 1 145 ? 25.741  94.477  99.887  1.00 17.80  ? 645 TYR B N   1 
ATOM   3512  C CA  . TYR B 1 145 ? 25.864  94.038  101.278 1.00 21.86  ? 645 TYR B CA  1 
ATOM   3513  C C   . TYR B 1 145 ? 25.462  95.130  102.290 1.00 23.36  ? 645 TYR B C   1 
ATOM   3514  O O   . TYR B 1 145 ? 24.453  94.981  102.985 1.00 24.96  ? 645 TYR B O   1 
ATOM   3515  C CB  . TYR B 1 145 ? 27.271  93.453  101.525 1.00 12.10  ? 645 TYR B CB  1 
ATOM   3516  C CG  . TYR B 1 145 ? 27.567  93.011  102.933 1.00 17.14  ? 645 TYR B CG  1 
ATOM   3517  C CD1 . TYR B 1 145 ? 26.918  91.924  103.510 1.00 23.05  ? 645 TYR B CD1 1 
ATOM   3518  C CD2 . TYR B 1 145 ? 28.539  93.652  103.671 1.00 17.71  ? 645 TYR B CD2 1 
ATOM   3519  C CE1 . TYR B 1 145 ? 27.228  91.520  104.812 1.00 24.95  ? 645 TYR B CE1 1 
ATOM   3520  C CE2 . TYR B 1 145 ? 28.850  93.257  104.946 1.00 18.78  ? 645 TYR B CE2 1 
ATOM   3521  C CZ  . TYR B 1 145 ? 28.201  92.202  105.513 1.00 21.78  ? 645 TYR B CZ  1 
ATOM   3522  O OH  . TYR B 1 145 ? 28.557  91.858  106.790 1.00 27.40  ? 645 TYR B OH  1 
ATOM   3523  N N   . SER B 1 146 ? 26.202  96.238  102.362 1.00 25.43  ? 646 SER B N   1 
ATOM   3524  C CA  . SER B 1 146 ? 25.837  97.269  103.339 1.00 21.93  ? 646 SER B CA  1 
ATOM   3525  C C   . SER B 1 146 ? 24.556  98.022  102.992 1.00 17.13  ? 646 SER B C   1 
ATOM   3526  O O   . SER B 1 146 ? 23.873  98.535  103.858 1.00 23.49  ? 646 SER B O   1 
ATOM   3527  C CB  . SER B 1 146 ? 26.987  98.211  103.621 1.00 20.31  ? 646 SER B CB  1 
ATOM   3528  O OG  . SER B 1 146 ? 27.923  97.553  104.452 1.00 26.35  ? 646 SER B OG  1 
ATOM   3529  N N   . PHE B 1 147 ? 24.200  98.054  101.726 1.00 10.00  ? 647 PHE B N   1 
ATOM   3530  C CA  . PHE B 1 147 ? 22.935  98.656  101.365 1.00 9.81   ? 647 PHE B CA  1 
ATOM   3531  C C   . PHE B 1 147 ? 21.810  97.885  102.033 1.00 20.42  ? 647 PHE B C   1 
ATOM   3532  O O   . PHE B 1 147 ? 20.875  98.472  102.566 1.00 29.68  ? 647 PHE B O   1 
ATOM   3533  C CB  . PHE B 1 147 ? 22.766  98.655  99.848  1.00 16.32  ? 647 PHE B CB  1 
ATOM   3534  C CG  . PHE B 1 147 ? 21.354  98.871  99.399  1.00 23.75  ? 647 PHE B CG  1 
ATOM   3535  C CD1 . PHE B 1 147 ? 20.849  100.155 99.250  1.00 20.87  ? 647 PHE B CD1 1 
ATOM   3536  C CD2 . PHE B 1 147 ? 20.523  97.784  99.134  1.00 15.62  ? 647 PHE B CD2 1 
ATOM   3537  C CE1 . PHE B 1 147 ? 19.540  100.353 98.846  1.00 19.48  ? 647 PHE B CE1 1 
ATOM   3538  C CE2 . PHE B 1 147 ? 19.222  97.976  98.726  1.00 17.88  ? 647 PHE B CE2 1 
ATOM   3539  C CZ  . PHE B 1 147 ? 18.727  99.273  98.582  1.00 17.80  ? 647 PHE B CZ  1 
ATOM   3540  N N   . SER B 1 148 ? 21.900  96.562  102.025 1.00 18.59  ? 648 SER B N   1 
ATOM   3541  C CA  . SER B 1 148 ? 20.862  95.756  102.659 1.00 13.96  ? 648 SER B CA  1 
ATOM   3542  C C   . SER B 1 148 ? 20.856  95.923  104.197 1.00 15.58  ? 648 SER B C   1 
ATOM   3543  O O   . SER B 1 148 ? 19.807  95.824  104.821 1.00 25.65  ? 648 SER B O   1 
ATOM   3544  C CB  . SER B 1 148 ? 20.978  94.279  102.245 1.00 18.11  ? 648 SER B CB  1 
ATOM   3545  O OG  . SER B 1 148 ? 21.990  93.594  102.968 1.00 23.75  ? 648 SER B OG  1 
ATOM   3546  N N   . ALA B 1 149 ? 22.012  96.185  104.807 1.00 17.29  ? 649 ALA B N   1 
ATOM   3547  C CA  . ALA B 1 149 ? 22.055  96.361  106.259 1.00 23.50  ? 649 ALA B CA  1 
ATOM   3548  C C   . ALA B 1 149 ? 21.251  97.598  106.661 1.00 29.33  ? 649 ALA B C   1 
ATOM   3549  O O   . ALA B 1 149 ? 20.429  97.537  107.568 1.00 26.15  ? 649 ALA B O   1 
ATOM   3550  C CB  . ALA B 1 149 ? 23.495  96.451  106.777 1.00 12.91  ? 649 ALA B CB  1 
ATOM   3551  N N   . LEU B 1 150 ? 21.483  98.716  105.978 1.00 23.67  ? 650 LEU B N   1 
ATOM   3552  C CA  . LEU B 1 150 ? 20.702  99.930  106.230 1.00 19.38  ? 650 LEU B CA  1 
ATOM   3553  C C   . LEU B 1 150 ? 19.213  99.714  105.997 1.00 24.46  ? 650 LEU B C   1 
ATOM   3554  O O   . LEU B 1 150 ? 18.404  100.099 106.828 1.00 30.84  ? 650 LEU B O   1 
ATOM   3555  C CB  . LEU B 1 150 ? 21.190  101.092 105.370 1.00 12.67  ? 650 LEU B CB  1 
ATOM   3556  C CG  . LEU B 1 150 ? 22.403  101.845 105.901 1.00 20.95  ? 650 LEU B CG  1 
ATOM   3557  C CD1 . LEU B 1 150 ? 23.536  100.873 106.252 1.00 20.09  ? 650 LEU B CD1 1 
ATOM   3558  C CD2 . LEU B 1 150 ? 22.859  102.895 104.883 1.00 15.18  ? 650 LEU B CD2 1 
ATOM   3559  N N   . MET B 1 151 ? 18.853  99.110  104.864 1.00 23.57  ? 651 MET B N   1 
ATOM   3560  C CA  . MET B 1 151 ? 17.454  98.784  104.575 1.00 27.90  ? 651 MET B CA  1 
ATOM   3561  C C   . MET B 1 151 ? 16.802  97.944  105.685 1.00 31.29  ? 651 MET B C   1 
ATOM   3562  O O   . MET B 1 151 ? 15.640  98.171  106.053 1.00 35.36  ? 651 MET B O   1 
ATOM   3563  C CB  . MET B 1 151 ? 17.324  98.068  103.218 1.00 25.88  ? 651 MET B CB  1 
ATOM   3564  C CG  . MET B 1 151 ? 17.759  98.923  102.019 1.00 19.92  ? 651 MET B CG  1 
ATOM   3565  S SD  . MET B 1 151 ? 16.715  100.388 101.808 1.00 25.59  ? 651 MET B SD  1 
ATOM   3566  C CE  . MET B 1 151 ? 15.185  99.587  101.293 1.00 35.14  ? 651 MET B CE  1 
ATOM   3567  N N   . LYS B 1 152 ? 17.548  96.984  106.223 1.00 21.94  ? 652 LYS B N   1 
ATOM   3568  C CA  . LYS B 1 152 ? 17.034  96.141  107.298 1.00 28.09  ? 652 LYS B CA  1 
ATOM   3569  C C   . LYS B 1 152 ? 16.588  96.975  108.508 1.00 30.93  ? 652 LYS B C   1 
ATOM   3570  O O   . LYS B 1 152 ? 15.439  96.896  108.952 1.00 32.01  ? 652 LYS B O   1 
ATOM   3571  C CB  . LYS B 1 152 ? 18.077  95.110  107.725 1.00 35.12  ? 652 LYS B CB  1 
ATOM   3572  C CG  . LYS B 1 152 ? 17.498  94.026  108.609 1.00 46.22  ? 652 LYS B CG  1 
ATOM   3573  C CD  . LYS B 1 152 ? 18.565  93.308  109.426 1.00 58.73  ? 652 LYS B CD  1 
ATOM   3574  C CE  . LYS B 1 152 ? 17.913  92.480  110.529 1.00 65.25  ? 652 LYS B CE  1 
ATOM   3575  N NZ  . LYS B 1 152 ? 18.889  91.793  111.413 1.00 68.03  ? 652 LYS B NZ  1 
ATOM   3576  N N   . ALA B 1 153 ? 17.517  97.755  109.044 1.00 29.21  ? 653 ALA B N   1 
ATOM   3577  C CA  . ALA B 1 153 ? 17.214  98.753  110.063 1.00 33.46  ? 653 ALA B CA  1 
ATOM   3578  C C   . ALA B 1 153 ? 15.912  99.542  109.794 1.00 35.96  ? 653 ALA B C   1 
ATOM   3579  O O   . ALA B 1 153 ? 15.035  99.607  110.652 1.00 35.49  ? 653 ALA B O   1 
ATOM   3580  C CB  . ALA B 1 153 ? 18.398  99.707  110.217 1.00 19.30  ? 653 ALA B CB  1 
ATOM   3581  N N   . LEU B 1 154 ? 15.783  100.129 108.605 1.00 31.20  ? 654 LEU B N   1 
ATOM   3582  C CA  . LEU B 1 154 ? 14.605  100.936 108.270 1.00 31.43  ? 654 LEU B CA  1 
ATOM   3583  C C   . LEU B 1 154 ? 13.283  100.141 108.216 1.00 34.03  ? 654 LEU B C   1 
ATOM   3584  O O   . LEU B 1 154 ? 12.191  100.740 108.220 1.00 28.13  ? 654 LEU B O   1 
ATOM   3585  C CB  . LEU B 1 154 ? 14.821  101.692 106.951 1.00 33.18  ? 654 LEU B CB  1 
ATOM   3586  C CG  . LEU B 1 154 ? 15.969  102.706 106.891 1.00 38.32  ? 654 LEU B CG  1 
ATOM   3587  C CD1 . LEU B 1 154 ? 15.906  103.480 105.593 1.00 33.99  ? 654 LEU B CD1 1 
ATOM   3588  C CD2 . LEU B 1 154 ? 15.906  103.667 108.082 1.00 32.66  ? 654 LEU B CD2 1 
ATOM   3589  N N   . GLU B 1 155 ? 13.386  98.809  108.163 1.00 21.23  ? 655 GLU B N   1 
ATOM   3590  C CA  . GLU B 1 155 ? 12.212  97.927  108.110 1.00 30.35  ? 655 GLU B CA  1 
ATOM   3591  C C   . GLU B 1 155 ? 11.943  97.260  109.457 1.00 32.68  ? 655 GLU B C   1 
ATOM   3592  O O   . GLU B 1 155 ? 10.945  96.558  109.621 1.00 32.01  ? 655 GLU B O   1 
ATOM   3593  C CB  . GLU B 1 155 ? 12.368  96.844  107.027 1.00 47.15  ? 655 GLU B CB  1 
ATOM   3594  C CG  . GLU B 1 155 ? 12.294  97.355  105.587 1.00 61.64  ? 655 GLU B CG  1 
ATOM   3595  C CD  . GLU B 1 155 ? 12.408  96.242  104.550 1.00 75.29  ? 655 GLU B CD  1 
ATOM   3596  O OE1 . GLU B 1 155 ? 12.787  96.532  103.385 1.00 74.55  ? 655 GLU B OE1 1 
ATOM   3597  O OE2 . GLU B 1 155 ? 12.114  95.078  104.903 1.00 81.25  ? 655 GLU B OE2 1 
ATOM   3598  N N   . MET B 1 156 ? 12.845  97.456  110.415 1.00 34.19  ? 656 MET B N   1 
ATOM   3599  C CA  . MET B 1 156 ? 12.606  97.000  111.780 1.00 35.08  ? 656 MET B CA  1 
ATOM   3600  C C   . MET B 1 156 ? 11.329  97.637  112.300 1.00 38.13  ? 656 MET B C   1 
ATOM   3601  O O   . MET B 1 156 ? 11.162  98.862  112.218 1.00 36.44  ? 656 MET B O   1 
ATOM   3602  C CB  . MET B 1 156 ? 13.739  97.420  112.716 1.00 32.66  ? 656 MET B CB  1 
ATOM   3603  C CG  . MET B 1 156 ? 14.960  96.540  112.711 1.00 30.24  ? 656 MET B CG  1 
ATOM   3604  S SD  . MET B 1 156 ? 16.216  97.266  113.780 1.00 58.61  ? 656 MET B SD  1 
ATOM   3605  C CE  . MET B 1 156 ? 17.709  96.717  112.947 1.00 67.43  ? 656 MET B CE  1 
ATOM   3606  N N   . PRO B 1 157 ? 10.438  96.810  112.861 1.00 34.73  ? 657 PRO B N   1 
ATOM   3607  C CA  . PRO B 1 157 ? 9.181   97.240  113.488 1.00 37.56  ? 657 PRO B CA  1 
ATOM   3608  C C   . PRO B 1 157 ? 9.338   98.440  114.451 1.00 42.69  ? 657 PRO B C   1 
ATOM   3609  O O   . PRO B 1 157 ? 8.433   99.273  114.515 1.00 38.05  ? 657 PRO B O   1 
ATOM   3610  C CB  . PRO B 1 157 ? 8.718   95.982  114.241 1.00 34.13  ? 657 PRO B CB  1 
ATOM   3611  C CG  . PRO B 1 157 ? 9.890   95.053  114.232 1.00 31.90  ? 657 PRO B CG  1 
ATOM   3612  C CD  . PRO B 1 157 ? 10.647  95.362  112.995 1.00 26.50  ? 657 PRO B CD  1 
ATOM   3613  N N   . GLN B 1 158 ? 10.457  98.524  115.175 1.00 40.16  ? 658 GLN B N   1 
ATOM   3614  C CA  . GLN B 1 158 ? 10.717  99.651  116.070 1.00 39.02  ? 658 GLN B CA  1 
ATOM   3615  C C   . GLN B 1 158 ? 10.871  100.963 115.301 1.00 38.07  ? 658 GLN B C   1 
ATOM   3616  O O   . GLN B 1 158 ? 10.678  102.045 115.853 1.00 32.31  ? 658 GLN B O   1 
ATOM   3617  C CB  . GLN B 1 158 ? 11.980  99.424  116.914 1.00 37.65  ? 658 GLN B CB  1 
ATOM   3618  C CG  . GLN B 1 158 ? 11.896  98.294  117.905 1.00 41.71  ? 658 GLN B CG  1 
ATOM   3619  C CD  . GLN B 1 158 ? 12.262  96.955  117.291 1.00 45.01  ? 658 GLN B CD  1 
ATOM   3620  O OE1 . GLN B 1 158 ? 12.412  95.967  117.997 1.00 38.10  ? 658 GLN B OE1 1 
ATOM   3621  N NE2 . GLN B 1 158 ? 12.418  96.923  115.969 1.00 45.16  ? 658 GLN B NE2 1 
ATOM   3622  N N   . ILE B 1 159 ? 11.242  100.858 114.033 1.00 36.96  ? 659 ILE B N   1 
ATOM   3623  C CA  . ILE B 1 159 ? 11.461  102.035 113.215 1.00 43.03  ? 659 ILE B CA  1 
ATOM   3624  C C   . ILE B 1 159 ? 10.214  102.300 112.378 1.00 39.61  ? 659 ILE B C   1 
ATOM   3625  O O   . ILE B 1 159 ? 9.766   103.437 112.240 1.00 35.88  ? 659 ILE B O   1 
ATOM   3626  C CB  . ILE B 1 159 ? 12.708  101.863 112.306 1.00 32.57  ? 659 ILE B CB  1 
ATOM   3627  C CG1 . ILE B 1 159 ? 13.970  101.689 113.156 1.00 28.59  ? 659 ILE B CG1 1 
ATOM   3628  C CG2 . ILE B 1 159 ? 12.877  103.056 111.388 1.00 28.63  ? 659 ILE B CG2 1 
ATOM   3629  C CD1 . ILE B 1 159 ? 14.182  102.810 114.137 1.00 26.63  ? 659 ILE B CD1 1 
ATOM   3630  N N   . THR B 1 160 ? 9.645   101.229 111.846 1.00 35.85  ? 660 THR B N   1 
ATOM   3631  C CA  . THR B 1 160 ? 8.544   101.336 110.910 1.00 41.63  ? 660 THR B CA  1 
ATOM   3632  C C   . THR B 1 160 ? 7.304   101.959 111.566 1.00 50.98  ? 660 THR B C   1 
ATOM   3633  O O   . THR B 1 160 ? 6.531   102.679 110.920 1.00 50.17  ? 660 THR B O   1 
ATOM   3634  C CB  . THR B 1 160 ? 8.213   99.952  110.301 1.00 45.53  ? 660 THR B CB  1 
ATOM   3635  O OG1 . THR B 1 160 ? 7.425   100.115 109.119 1.00 51.90  ? 660 THR B OG1 1 
ATOM   3636  C CG2 . THR B 1 160 ? 7.469   99.082  111.301 1.00 42.60  ? 660 THR B CG2 1 
ATOM   3637  N N   . ARG B 1 161 ? 7.129   101.708 112.859 1.00 46.61  ? 661 ARG B N   1 
ATOM   3638  C CA  . ARG B 1 161 ? 5.949   102.212 113.542 1.00 43.03  ? 661 ARG B CA  1 
ATOM   3639  C C   . ARG B 1 161 ? 6.070   103.670 113.976 1.00 40.28  ? 661 ARG B C   1 
ATOM   3640  O O   . ARG B 1 161 ? 5.089   104.252 114.428 1.00 50.58  ? 661 ARG B O   1 
ATOM   3641  C CB  . ARG B 1 161 ? 5.598   101.338 114.741 1.00 37.15  ? 661 ARG B CB  1 
ATOM   3642  C CG  . ARG B 1 161 ? 6.580   101.450 115.867 1.00 35.03  ? 661 ARG B CG  1 
ATOM   3643  C CD  . ARG B 1 161 ? 6.025   100.851 117.154 1.00 39.45  ? 661 ARG B CD  1 
ATOM   3644  N NE  . ARG B 1 161 ? 6.455   101.673 118.271 1.00 52.24  ? 661 ARG B NE  1 
ATOM   3645  C CZ  . ARG B 1 161 ? 5.647   102.436 118.993 1.00 55.49  ? 661 ARG B CZ  1 
ATOM   3646  N NH1 . ARG B 1 161 ? 4.342   102.452 118.753 1.00 55.31  ? 661 ARG B NH1 1 
ATOM   3647  N NH2 . ARG B 1 161 ? 6.149   103.162 119.975 1.00 57.13  ? 661 ARG B NH2 1 
ATOM   3648  N N   . LEU B 1 162 ? 7.260   104.253 113.848 1.00 31.20  ? 662 LEU B N   1 
ATOM   3649  C CA  . LEU B 1 162 ? 7.470   105.658 114.196 1.00 34.22  ? 662 LEU B CA  1 
ATOM   3650  C C   . LEU B 1 162 ? 6.742   106.550 113.197 1.00 41.61  ? 662 LEU B C   1 
ATOM   3651  O O   . LEU B 1 162 ? 7.368   107.268 112.418 1.00 45.45  ? 662 LEU B O   1 
ATOM   3652  C CB  . LEU B 1 162 ? 8.961   106.006 114.203 1.00 32.84  ? 662 LEU B CB  1 
ATOM   3653  C CG  . LEU B 1 162 ? 9.850   105.366 115.272 1.00 35.45  ? 662 LEU B CG  1 
ATOM   3654  C CD1 . LEU B 1 162 ? 11.300  105.741 115.039 1.00 31.79  ? 662 LEU B CD1 1 
ATOM   3655  C CD2 . LEU B 1 162 ? 9.399   105.778 116.662 1.00 33.05  ? 662 LEU B CD2 1 
ATOM   3656  N N   . GLU B 1 163 ? 5.415   106.524 113.233 1.00 46.92  ? 663 GLU B N   1 
ATOM   3657  C CA  . GLU B 1 163 ? 4.639   107.078 112.129 1.00 57.18  ? 663 GLU B CA  1 
ATOM   3658  C C   . GLU B 1 163 ? 4.737   108.596 111.957 1.00 46.28  ? 663 GLU B C   1 
ATOM   3659  O O   . GLU B 1 163 ? 4.499   109.094 110.861 1.00 46.27  ? 663 GLU B O   1 
ATOM   3660  C CB  . GLU B 1 163 ? 3.179   106.617 112.185 1.00 69.63  ? 663 GLU B CB  1 
ATOM   3661  C CG  . GLU B 1 163 ? 2.282   107.471 113.045 1.00 91.09  ? 663 GLU B CG  1 
ATOM   3662  C CD  . GLU B 1 163 ? 0.814   107.185 112.797 1.00 105.17 ? 663 GLU B CD  1 
ATOM   3663  O OE1 . GLU B 1 163 ? 0.511   106.461 111.823 1.00 111.96 ? 663 GLU B OE1 1 
ATOM   3664  O OE2 . GLU B 1 163 ? -0.034  107.682 113.572 1.00 105.37 ? 663 GLU B OE2 1 
ATOM   3665  N N   . LYS B 1 164 ? 5.084   109.321 113.023 1.00 40.56  ? 664 LYS B N   1 
ATOM   3666  C CA  . LYS B 1 164 ? 5.303   110.771 112.927 1.00 43.87  ? 664 LYS B CA  1 
ATOM   3667  C C   . LYS B 1 164 ? 6.621   111.050 112.235 1.00 44.26  ? 664 LYS B C   1 
ATOM   3668  O O   . LYS B 1 164 ? 6.719   111.962 111.407 1.00 44.25  ? 664 LYS B O   1 
ATOM   3669  C CB  . LYS B 1 164 ? 5.326   111.447 114.309 1.00 44.65  ? 664 LYS B CB  1 
ATOM   3670  C CG  . LYS B 1 164 ? 3.973   111.644 114.984 1.00 45.53  ? 664 LYS B CG  1 
ATOM   3671  C CD  . LYS B 1 164 ? 4.161   112.153 116.408 1.00 50.17  ? 664 LYS B CD  1 
ATOM   3672  C CE  . LYS B 1 164 ? 3.057   111.656 117.348 1.00 55.40  ? 664 LYS B CE  1 
ATOM   3673  N NZ  . LYS B 1 164 ? 3.497   111.689 118.782 1.00 56.36  ? 664 LYS B NZ  1 
ATOM   3674  N N   . THR B 1 165 ? 7.638   110.266 112.588 1.00 38.18  ? 665 THR B N   1 
ATOM   3675  C CA  . THR B 1 165 ? 8.963   110.438 112.007 1.00 39.05  ? 665 THR B CA  1 
ATOM   3676  C C   . THR B 1 165 ? 8.925   110.188 110.495 1.00 33.59  ? 665 THR B C   1 
ATOM   3677  O O   . THR B 1 165 ? 9.578   110.882 109.720 1.00 36.12  ? 665 THR B O   1 
ATOM   3678  C CB  . THR B 1 165 ? 10.014  109.535 112.700 1.00 38.73  ? 665 THR B CB  1 
ATOM   3679  O OG1 . THR B 1 165 ? 10.117  109.893 114.085 1.00 37.38  ? 665 THR B OG1 1 
ATOM   3680  C CG2 . THR B 1 165 ? 11.379  109.691 112.042 1.00 30.19  ? 665 THR B CG2 1 
ATOM   3681  N N   . TRP B 1 166 ? 8.144   109.199 110.077 1.00 31.28  ? 666 TRP B N   1 
ATOM   3682  C CA  . TRP B 1 166 ? 7.970   108.942 108.657 1.00 32.99  ? 666 TRP B CA  1 
ATOM   3683  C C   . TRP B 1 166 ? 7.165   110.047 107.954 1.00 37.53  ? 666 TRP B C   1 
ATOM   3684  O O   . TRP B 1 166 ? 7.380   110.318 106.774 1.00 38.68  ? 666 TRP B O   1 
ATOM   3685  C CB  . TRP B 1 166 ? 7.335   107.568 108.434 1.00 27.41  ? 666 TRP B CB  1 
ATOM   3686  C CG  . TRP B 1 166 ? 8.312   106.472 108.646 1.00 37.11  ? 666 TRP B CG  1 
ATOM   3687  C CD1 . TRP B 1 166 ? 8.431   105.681 109.750 1.00 37.19  ? 666 TRP B CD1 1 
ATOM   3688  C CD2 . TRP B 1 166 ? 9.339   106.056 107.742 1.00 35.02  ? 666 TRP B CD2 1 
ATOM   3689  N NE1 . TRP B 1 166 ? 9.456   104.792 109.583 1.00 37.69  ? 666 TRP B NE1 1 
ATOM   3690  C CE2 . TRP B 1 166 ? 10.033  105.001 108.358 1.00 36.35  ? 666 TRP B CE2 1 
ATOM   3691  C CE3 . TRP B 1 166 ? 9.738   106.473 106.468 1.00 32.06  ? 666 TRP B CE3 1 
ATOM   3692  C CZ2 . TRP B 1 166 ? 11.099  104.351 107.746 1.00 33.00  ? 666 TRP B CZ2 1 
ATOM   3693  C CZ3 . TRP B 1 166 ? 10.789  105.830 105.858 1.00 29.23  ? 666 TRP B CZ3 1 
ATOM   3694  C CH2 . TRP B 1 166 ? 11.461  104.776 106.498 1.00 31.88  ? 666 TRP B CH2 1 
ATOM   3695  N N   . THR B 1 167 ? 6.237   110.673 108.675 1.00 31.84  ? 667 THR B N   1 
ATOM   3696  C CA  . THR B 1 167 ? 5.418   111.732 108.096 1.00 32.86  ? 667 THR B CA  1 
ATOM   3697  C C   . THR B 1 167 ? 6.251   112.982 107.968 1.00 30.72  ? 667 THR B C   1 
ATOM   3698  O O   . THR B 1 167 ? 6.226   113.647 106.935 1.00 29.36  ? 667 THR B O   1 
ATOM   3699  C CB  . THR B 1 167 ? 4.183   112.056 108.951 1.00 41.76  ? 667 THR B CB  1 
ATOM   3700  O OG1 . THR B 1 167 ? 3.252   110.971 108.867 1.00 35.82  ? 667 THR B OG1 1 
ATOM   3701  C CG2 . THR B 1 167 ? 3.507   113.375 108.466 1.00 16.52  ? 667 THR B CG2 1 
ATOM   3702  N N   . ALA B 1 168 ? 6.989   113.296 109.027 1.00 24.24  ? 668 ALA B N   1 
ATOM   3703  C CA  . ALA B 1 168 ? 7.934   114.391 108.978 1.00 21.66  ? 668 ALA B CA  1 
ATOM   3704  C C   . ALA B 1 168 ? 8.914   114.196 107.815 1.00 31.37  ? 668 ALA B C   1 
ATOM   3705  O O   . ALA B 1 168 ? 9.275   115.164 107.152 1.00 36.12  ? 668 ALA B O   1 
ATOM   3706  C CB  . ALA B 1 168 ? 8.672   114.520 110.295 1.00 17.96  ? 668 ALA B CB  1 
ATOM   3707  N N   . LEU B 1 169 ? 9.332   112.955 107.552 1.00 32.59  ? 669 LEU B N   1 
ATOM   3708  C CA  . LEU B 1 169 ? 10.266  112.700 106.448 1.00 26.05  ? 669 LEU B CA  1 
ATOM   3709  C C   . LEU B 1 169 ? 9.633   113.058 105.110 1.00 24.57  ? 669 LEU B C   1 
ATOM   3710  O O   . LEU B 1 169 ? 10.239  113.760 104.305 1.00 23.34  ? 669 LEU B O   1 
ATOM   3711  C CB  . LEU B 1 169 ? 10.752  111.251 106.419 1.00 24.54  ? 669 LEU B CB  1 
ATOM   3712  C CG  . LEU B 1 169 ? 11.646  110.926 105.215 1.00 24.56  ? 669 LEU B CG  1 
ATOM   3713  C CD1 . LEU B 1 169 ? 13.102  111.384 105.444 1.00 18.35  ? 669 LEU B CD1 1 
ATOM   3714  C CD2 . LEU B 1 169 ? 11.593  109.445 104.891 1.00 18.65  ? 669 LEU B CD2 1 
ATOM   3715  N N   . ARG B 1 170 ? 8.407   112.588 104.893 1.00 23.44  ? 670 ARG B N   1 
ATOM   3716  C CA  . ARG B 1 170 ? 7.611   112.964 103.721 1.00 36.34  ? 670 ARG B CA  1 
ATOM   3717  C C   . ARG B 1 170 ? 7.484   114.482 103.564 1.00 35.79  ? 670 ARG B C   1 
ATOM   3718  O O   . ARG B 1 170 ? 7.549   115.020 102.451 1.00 38.13  ? 670 ARG B O   1 
ATOM   3719  C CB  . ARG B 1 170 ? 6.203   112.363 103.822 1.00 47.46  ? 670 ARG B CB  1 
ATOM   3720  C CG  . ARG B 1 170 ? 5.808   111.467 102.661 1.00 56.22  ? 670 ARG B CG  1 
ATOM   3721  C CD  . ARG B 1 170 ? 5.759   112.236 101.350 1.00 66.76  ? 670 ARG B CD  1 
ATOM   3722  N NE  . ARG B 1 170 ? 5.958   111.364 100.193 1.00 71.91  ? 670 ARG B NE  1 
ATOM   3723  C CZ  . ARG B 1 170 ? 4.976   110.770 99.526  1.00 70.90  ? 670 ARG B CZ  1 
ATOM   3724  N NH1 . ARG B 1 170 ? 3.717   110.950 99.894  1.00 63.80  ? 670 ARG B NH1 1 
ATOM   3725  N NH2 . ARG B 1 170 ? 5.256   109.998 98.488  1.00 77.75  ? 670 ARG B NH2 1 
ATOM   3726  N N   . HIS B 1 171 ? 7.290   115.165 104.687 1.00 25.48  ? 671 HIS B N   1 
ATOM   3727  C CA  . HIS B 1 171 ? 7.056   116.593 104.674 1.00 31.71  ? 671 HIS B CA  1 
ATOM   3728  C C   . HIS B 1 171 ? 8.308   117.414 104.368 1.00 35.19  ? 671 HIS B C   1 
ATOM   3729  O O   . HIS B 1 171 ? 8.232   118.399 103.640 1.00 31.86  ? 671 HIS B O   1 
ATOM   3730  C CB  . HIS B 1 171 ? 6.419   117.042 105.994 1.00 41.73  ? 671 HIS B CB  1 
ATOM   3731  C CG  . HIS B 1 171 ? 4.959   116.734 106.087 1.00 55.09  ? 671 HIS B CG  1 
ATOM   3732  N ND1 . HIS B 1 171 ? 4.166   116.566 104.974 1.00 64.37  ? 671 HIS B ND1 1 
ATOM   3733  C CD2 . HIS B 1 171 ? 4.151   116.554 107.159 1.00 62.32  ? 671 HIS B CD2 1 
ATOM   3734  C CE1 . HIS B 1 171 ? 2.927   116.300 105.354 1.00 66.39  ? 671 HIS B CE1 1 
ATOM   3735  N NE2 . HIS B 1 171 ? 2.893   116.284 106.673 1.00 65.73  ? 671 HIS B NE2 1 
ATOM   3736  N N   . GLN B 1 172 ? 9.453   116.999 104.908 1.00 31.46  ? 672 GLN B N   1 
ATOM   3737  C CA  . GLN B 1 172 ? 10.661  117.814 104.850 1.00 32.17  ? 672 GLN B CA  1 
ATOM   3738  C C   . GLN B 1 172 ? 11.694  117.272 103.852 1.00 40.77  ? 672 GLN B C   1 
ATOM   3739  O O   . GLN B 1 172 ? 12.504  118.023 103.303 1.00 35.39  ? 672 GLN B O   1 
ATOM   3740  C CB  . GLN B 1 172 ? 11.263  117.937 106.252 1.00 34.53  ? 672 GLN B CB  1 
ATOM   3741  C CG  . GLN B 1 172 ? 12.351  118.996 106.389 1.00 55.25  ? 672 GLN B CG  1 
ATOM   3742  C CD  . GLN B 1 172 ? 11.853  120.425 106.154 1.00 66.06  ? 672 GLN B CD  1 
ATOM   3743  O OE1 . GLN B 1 172 ? 12.552  121.242 105.549 1.00 67.19  ? 672 GLN B OE1 1 
ATOM   3744  N NE2 . GLN B 1 172 ? 10.654  120.731 106.642 1.00 66.86  ? 672 GLN B NE2 1 
ATOM   3745  N N   . TYR B 1 173 ? 11.658  115.966 103.610 1.00 33.06  ? 673 TYR B N   1 
ATOM   3746  C CA  . TYR B 1 173 ? 12.588  115.362 102.668 1.00 25.37  ? 673 TYR B CA  1 
ATOM   3747  C C   . TYR B 1 173 ? 11.830  114.536 101.627 1.00 29.47  ? 673 TYR B C   1 
ATOM   3748  O O   . TYR B 1 173 ? 12.083  113.338 101.427 1.00 30.77  ? 673 TYR B O   1 
ATOM   3749  C CB  . TYR B 1 173 ? 13.618  114.524 103.412 1.00 21.92  ? 673 TYR B CB  1 
ATOM   3750  C CG  . TYR B 1 173 ? 14.320  115.291 104.484 1.00 27.20  ? 673 TYR B CG  1 
ATOM   3751  C CD1 . TYR B 1 173 ? 13.881  115.240 105.796 1.00 30.71  ? 673 TYR B CD1 1 
ATOM   3752  C CD2 . TYR B 1 173 ? 15.423  116.083 104.187 1.00 28.08  ? 673 TYR B CD2 1 
ATOM   3753  C CE1 . TYR B 1 173 ? 14.526  115.950 106.786 1.00 29.43  ? 673 TYR B CE1 1 
ATOM   3754  C CE2 . TYR B 1 173 ? 16.075  116.795 105.169 1.00 17.20  ? 673 TYR B CE2 1 
ATOM   3755  C CZ  . TYR B 1 173 ? 15.622  116.724 106.464 1.00 28.39  ? 673 TYR B CZ  1 
ATOM   3756  O OH  . TYR B 1 173 ? 16.265  117.436 107.447 1.00 40.70  ? 673 TYR B OH  1 
ATOM   3757  N N   . THR B 1 174 ? 10.908  115.211 100.952 1.00 23.65  ? 674 THR B N   1 
ATOM   3758  C CA  . THR B 1 174 ? 9.933   114.560 100.095 1.00 25.18  ? 674 THR B CA  1 
ATOM   3759  C C   . THR B 1 174 ? 10.545  113.701 98.982  1.00 24.74  ? 674 THR B C   1 
ATOM   3760  O O   . THR B 1 174 ? 10.133  112.569 98.757  1.00 27.73  ? 674 THR B O   1 
ATOM   3761  C CB  . THR B 1 174 ? 8.985   115.606 99.514  1.00 25.39  ? 674 THR B CB  1 
ATOM   3762  O OG1 . THR B 1 174 ? 8.587   116.505 100.564 1.00 28.67  ? 674 THR B OG1 1 
ATOM   3763  C CG2 . THR B 1 174 ? 7.768   114.932 98.921  1.00 19.52  ? 674 THR B CG2 1 
ATOM   3764  N N   . GLN B 1 175 ? 11.534  114.252 98.299  1.00 26.92  ? 675 GLN B N   1 
ATOM   3765  C CA  A GLN B 1 175 ? 12.152  113.548 97.187  0.54 30.63  ? 675 GLN B CA  1 
ATOM   3766  C CA  B GLN B 1 175 ? 12.226  113.589 97.201  0.46 29.96  ? 675 GLN B CA  1 
ATOM   3767  C C   . GLN B 1 175 ? 12.808  112.265 97.696  1.00 30.51  ? 675 GLN B C   1 
ATOM   3768  O O   . GLN B 1 175 ? 12.703  111.214 97.053  1.00 21.65  ? 675 GLN B O   1 
ATOM   3769  C CB  A GLN B 1 175 ? 13.146  114.470 96.475  0.54 27.79  ? 675 GLN B CB  1 
ATOM   3770  C CB  B GLN B 1 175 ? 13.367  114.488 96.692  0.46 25.48  ? 675 GLN B CB  1 
ATOM   3771  C CG  A GLN B 1 175 ? 12.796  115.935 96.702  0.54 29.89  ? 675 GLN B CG  1 
ATOM   3772  C CG  B GLN B 1 175 ? 12.964  115.930 96.325  0.46 28.18  ? 675 GLN B CG  1 
ATOM   3773  C CD  A GLN B 1 175 ? 13.392  116.883 95.691  0.54 23.48  ? 675 GLN B CD  1 
ATOM   3774  C CD  B GLN B 1 175 ? 12.487  116.766 97.519  0.46 28.86  ? 675 GLN B CD  1 
ATOM   3775  O OE1 A GLN B 1 175 ? 14.212  117.732 96.043  0.54 22.91  ? 675 GLN B OE1 1 
ATOM   3776  O OE1 B GLN B 1 175 ? 13.260  117.101 98.420  0.46 11.07  ? 675 GLN B OE1 1 
ATOM   3777  N NE2 A GLN B 1 175 ? 12.961  116.773 94.438  0.54 11.75  ? 675 GLN B NE2 1 
ATOM   3778  N NE2 B GLN B 1 175 ? 11.206  117.111 97.517  0.46 32.77  ? 675 GLN B NE2 1 
ATOM   3779  N N   . THR B 1 176 ? 13.436  112.342 98.863  1.00 32.85  ? 676 THR B N   1 
ATOM   3780  C CA  . THR B 1 176 ? 14.104  111.209 99.475  1.00 30.87  ? 676 THR B CA  1 
ATOM   3781  C C   . THR B 1 176 ? 13.123  110.179 100.046 1.00 35.53  ? 676 THR B C   1 
ATOM   3782  O O   . THR B 1 176 ? 13.344  108.979 99.904  1.00 32.36  ? 676 THR B O   1 
ATOM   3783  C CB  . THR B 1 176 ? 15.080  111.684 100.554 1.00 26.27  ? 676 THR B CB  1 
ATOM   3784  O OG1 . THR B 1 176 ? 16.150  112.387 99.918  1.00 23.24  ? 676 THR B OG1 1 
ATOM   3785  C CG2 . THR B 1 176 ? 15.637  110.508 101.339 1.00 25.08  ? 676 THR B CG2 1 
ATOM   3786  N N   . ALA B 1 177 ? 12.043  110.637 100.679 1.00 28.03  ? 677 ALA B N   1 
ATOM   3787  C CA  . ALA B 1 177 ? 11.035  109.710 101.173 1.00 26.61  ? 677 ALA B CA  1 
ATOM   3788  C C   . ALA B 1 177 ? 10.403  108.907 100.019 1.00 26.40  ? 677 ALA B C   1 
ATOM   3789  O O   . ALA B 1 177 ? 10.153  107.709 100.150 1.00 24.97  ? 677 ALA B O   1 
ATOM   3790  C CB  . ALA B 1 177 ? 9.966   110.450 101.972 1.00 24.04  ? 677 ALA B CB  1 
ATOM   3791  N N   . ILE B 1 178 ? 10.155  109.568 98.893  1.00 24.13  ? 678 ILE B N   1 
ATOM   3792  C CA  . ILE B 1 178 ? 9.514   108.917 97.750  1.00 24.82  ? 678 ILE B CA  1 
ATOM   3793  C C   . ILE B 1 178 ? 10.455  107.917 97.080  1.00 28.42  ? 678 ILE B C   1 
ATOM   3794  O O   . ILE B 1 178 ? 10.070  106.792 96.762  1.00 34.15  ? 678 ILE B O   1 
ATOM   3795  C CB  . ILE B 1 178 ? 9.017   109.953 96.722  1.00 22.82  ? 678 ILE B CB  1 
ATOM   3796  C CG1 . ILE B 1 178 ? 7.773   110.675 97.256  1.00 28.65  ? 678 ILE B CG1 1 
ATOM   3797  C CG2 . ILE B 1 178 ? 8.684   109.285 95.400  1.00 23.01  ? 678 ILE B CG2 1 
ATOM   3798  C CD1 . ILE B 1 178 ? 7.554   112.070 96.657  1.00 22.49  ? 678 ILE B CD1 1 
ATOM   3799  N N   . LEU B 1 179 ? 11.689  108.344 96.868  1.00 23.63  ? 679 LEU B N   1 
ATOM   3800  C CA  . LEU B 1 179 ? 12.725  107.485 96.337  1.00 25.80  ? 679 LEU B CA  1 
ATOM   3801  C C   . LEU B 1 179 ? 12.858  106.215 97.189  1.00 29.31  ? 679 LEU B C   1 
ATOM   3802  O O   . LEU B 1 179 ? 13.022  105.116 96.674  1.00 32.73  ? 679 LEU B O   1 
ATOM   3803  C CB  . LEU B 1 179 ? 14.024  108.277 96.305  1.00 31.70  ? 679 LEU B CB  1 
ATOM   3804  C CG  . LEU B 1 179 ? 15.383  107.617 96.270  1.00 47.55  ? 679 LEU B CG  1 
ATOM   3805  C CD1 . LEU B 1 179 ? 15.609  106.936 94.942  1.00 53.12  ? 679 LEU B CD1 1 
ATOM   3806  C CD2 . LEU B 1 179 ? 16.383  108.724 96.463  1.00 59.54  ? 679 LEU B CD2 1 
ATOM   3807  N N   . TYR B 1 180 ? 12.763  106.362 98.500  1.00 32.31  ? 680 TYR B N   1 
ATOM   3808  C CA  . TYR B 1 180 ? 12.856  105.208 99.381  1.00 27.58  ? 680 TYR B CA  1 
ATOM   3809  C C   . TYR B 1 180 ? 11.688  104.234 99.174  1.00 31.74  ? 680 TYR B C   1 
ATOM   3810  O O   . TYR B 1 180 ? 11.879  103.007 99.126  1.00 30.57  ? 680 TYR B O   1 
ATOM   3811  C CB  . TYR B 1 180 ? 12.927  105.643 100.846 1.00 18.60  ? 680 TYR B CB  1 
ATOM   3812  C CG  . TYR B 1 180 ? 12.754  104.495 101.801 1.00 18.58  ? 680 TYR B CG  1 
ATOM   3813  C CD1 . TYR B 1 180 ? 13.793  103.588 102.034 1.00 20.25  ? 680 TYR B CD1 1 
ATOM   3814  C CD2 . TYR B 1 180 ? 11.553  104.289 102.447 1.00 21.76  ? 680 TYR B CD2 1 
ATOM   3815  C CE1 . TYR B 1 180 ? 13.630  102.522 102.898 1.00 16.77  ? 680 TYR B CE1 1 
ATOM   3816  C CE2 . TYR B 1 180 ? 11.378  103.233 103.319 1.00 21.17  ? 680 TYR B CE2 1 
ATOM   3817  C CZ  . TYR B 1 180 ? 12.412  102.347 103.544 1.00 25.04  ? 680 TYR B CZ  1 
ATOM   3818  O OH  . TYR B 1 180 ? 12.216  101.294 104.420 1.00 24.70  ? 680 TYR B OH  1 
ATOM   3819  N N   . GLU B 1 181 ? 10.481  104.782 99.055  1.00 31.42  ? 681 GLU B N   1 
ATOM   3820  C CA  . GLU B 1 181 ? 9.279   103.972 98.914  1.00 33.50  ? 681 GLU B CA  1 
ATOM   3821  C C   . GLU B 1 181 ? 9.102   103.395 97.502  1.00 33.99  ? 681 GLU B C   1 
ATOM   3822  O O   . GLU B 1 181 ? 8.667   102.243 97.336  1.00 27.13  ? 681 GLU B O   1 
ATOM   3823  C CB  . GLU B 1 181 ? 8.036   104.770 99.342  1.00 40.54  ? 681 GLU B CB  1 
ATOM   3824  C CG  . GLU B 1 181 ? 7.561   104.483 100.775 1.00 47.04  ? 681 GLU B CG  1 
ATOM   3825  C CD  . GLU B 1 181 ? 6.792   103.158 100.911 1.00 61.76  ? 681 GLU B CD  1 
ATOM   3826  O OE1 . GLU B 1 181 ? 5.846   102.917 100.123 1.00 64.02  ? 681 GLU B OE1 1 
ATOM   3827  O OE2 . GLU B 1 181 ? 7.128   102.355 101.813 1.00 67.66  ? 681 GLU B OE2 1 
ATOM   3828  N N   . LYS B 1 182 ? 9.444   104.188 96.491  1.00 29.19  ? 682 LYS B N   1 
ATOM   3829  C CA  . LYS B 1 182 ? 9.188   103.790 95.109  1.00 33.82  ? 682 LYS B CA  1 
ATOM   3830  C C   . LYS B 1 182 ? 10.334  103.050 94.434  1.00 30.44  ? 682 LYS B C   1 
ATOM   3831  O O   . LYS B 1 182 ? 10.094  102.288 93.515  1.00 27.66  ? 682 LYS B O   1 
ATOM   3832  C CB  . LYS B 1 182 ? 8.776   104.995 94.252  1.00 41.84  ? 682 LYS B CB  1 
ATOM   3833  C CG  . LYS B 1 182 ? 7.440   105.605 94.636  1.00 45.35  ? 682 LYS B CG  1 
ATOM   3834  C CD  . LYS B 1 182 ? 6.321   104.574 94.590  1.00 44.09  ? 682 LYS B CD  1 
ATOM   3835  C CE  . LYS B 1 182 ? 4.975   105.216 94.915  1.00 51.70  ? 682 LYS B CE  1 
ATOM   3836  N NZ  . LYS B 1 182 ? 3.899   104.194 95.134  1.00 59.53  ? 682 LYS B NZ  1 
ATOM   3837  N N   . GLN B 1 183 ? 11.571  103.273 94.877  1.00 29.14  ? 683 GLN B N   1 
ATOM   3838  C CA  . GLN B 1 183 ? 12.722  102.642 94.224  1.00 40.08  ? 683 GLN B CA  1 
ATOM   3839  C C   . GLN B 1 183 ? 13.439  101.615 95.119  1.00 37.77  ? 683 GLN B C   1 
ATOM   3840  O O   . GLN B 1 183 ? 13.686  100.482 94.705  1.00 36.66  ? 683 GLN B O   1 
ATOM   3841  C CB  . GLN B 1 183 ? 13.738  103.687 93.731  1.00 49.21  ? 683 GLN B CB  1 
ATOM   3842  C CG  . GLN B 1 183 ? 13.169  105.072 93.442  1.00 66.98  ? 683 GLN B CG  1 
ATOM   3843  C CD  . GLN B 1 183 ? 12.757  105.260 91.996  1.00 74.68  ? 683 GLN B CD  1 
ATOM   3844  O OE1 . GLN B 1 183 ? 12.136  106.264 91.643  1.00 74.76  ? 683 GLN B OE1 1 
ATOM   3845  N NE2 . GLN B 1 183 ? 13.106  104.298 91.150  1.00 77.80  ? 683 GLN B NE2 1 
ATOM   3846  N N   . LEU B 1 184 ? 13.769  102.029 96.337  1.00 27.71  ? 684 LEU B N   1 
ATOM   3847  C CA  . LEU B 1 184 ? 14.588  101.234 97.237  1.00 19.05  ? 684 LEU B CA  1 
ATOM   3848  C C   . LEU B 1 184 ? 13.863  100.009 97.794  1.00 27.60  ? 684 LEU B C   1 
ATOM   3849  O O   . LEU B 1 184 ? 14.394  98.897  97.754  1.00 24.69  ? 684 LEU B O   1 
ATOM   3850  C CB  . LEU B 1 184 ? 15.105  102.103 98.375  1.00 17.89  ? 684 LEU B CB  1 
ATOM   3851  C CG  . LEU B 1 184 ? 16.480  102.729 98.129  1.00 27.94  ? 684 LEU B CG  1 
ATOM   3852  C CD1 . LEU B 1 184 ? 16.771  102.944 96.646  1.00 21.70  ? 684 LEU B CD1 1 
ATOM   3853  C CD2 . LEU B 1 184 ? 16.602  104.026 98.896  1.00 21.91  ? 684 LEU B CD2 1 
ATOM   3854  N N   . LYS B 1 185 ? 12.660  100.204 98.317  1.00 27.63  ? 685 LYS B N   1 
ATOM   3855  C CA  . LYS B 1 185 ? 11.928  99.072  98.849  1.00 24.63  ? 685 LYS B CA  1 
ATOM   3856  C C   . LYS B 1 185 ? 11.719  97.997  97.779  1.00 28.35  ? 685 LYS B C   1 
ATOM   3857  O O   . LYS B 1 185 ? 12.050  96.840  98.019  1.00 18.72  ? 685 LYS B O   1 
ATOM   3858  C CB  . LYS B 1 185 ? 10.629  99.494  99.538  1.00 22.05  ? 685 LYS B CB  1 
ATOM   3859  C CG  . LYS B 1 185 ? 10.886  100.113 100.912 1.00 33.30  ? 685 LYS B CG  1 
ATOM   3860  C CD  . LYS B 1 185 ? 9.616   100.597 101.583 1.00 40.48  ? 685 LYS B CD  1 
ATOM   3861  C CE  . LYS B 1 185 ? 8.879   99.485  102.279 1.00 51.81  ? 685 LYS B CE  1 
ATOM   3862  N NZ  . LYS B 1 185 ? 7.642   100.029 102.895 1.00 56.99  ? 685 LYS B NZ  1 
ATOM   3863  N N   . PRO B 1 186 ? 11.218  98.382  96.582  1.00 28.25  ? 686 PRO B N   1 
ATOM   3864  C CA  . PRO B 1 186 ? 11.000  97.358  95.541  1.00 24.10  ? 686 PRO B CA  1 
ATOM   3865  C C   . PRO B 1 186 ? 12.304  96.679  95.110  1.00 31.73  ? 686 PRO B C   1 
ATOM   3866  O O   . PRO B 1 186 ? 12.329  95.475  94.880  1.00 28.99  ? 686 PRO B O   1 
ATOM   3867  C CB  . PRO B 1 186 ? 10.400  98.151  94.370  1.00 14.09  ? 686 PRO B CB  1 
ATOM   3868  C CG  . PRO B 1 186 ? 9.814   99.405  95.008  1.00 18.26  ? 686 PRO B CG  1 
ATOM   3869  C CD  . PRO B 1 186 ? 10.773  99.723  96.148  1.00 18.24  ? 686 PRO B CD  1 
ATOM   3870  N N   . PHE B 1 187 ? 13.376  97.453  95.001  1.00 28.53  ? 687 PHE B N   1 
ATOM   3871  C CA  . PHE B 1 187 ? 14.674  96.902  94.654  1.00 21.28  ? 687 PHE B CA  1 
ATOM   3872  C C   . PHE B 1 187 ? 15.146  95.963  95.768  1.00 29.26  ? 687 PHE B C   1 
ATOM   3873  O O   . PHE B 1 187 ? 15.731  94.910  95.514  1.00 26.02  ? 687 PHE B O   1 
ATOM   3874  C CB  . PHE B 1 187 ? 15.679  98.032  94.446  1.00 9.39   ? 687 PHE B CB  1 
ATOM   3875  C CG  . PHE B 1 187 ? 17.108  97.568  94.279  1.00 16.17  ? 687 PHE B CG  1 
ATOM   3876  C CD1 . PHE B 1 187 ? 17.554  97.079  93.058  1.00 21.77  ? 687 PHE B CD1 1 
ATOM   3877  C CD2 . PHE B 1 187 ? 17.999  97.640  95.331  1.00 14.16  ? 687 PHE B CD2 1 
ATOM   3878  C CE1 . PHE B 1 187 ? 18.847  96.674  92.888  1.00 15.71  ? 687 PHE B CE1 1 
ATOM   3879  C CE2 . PHE B 1 187 ? 19.304  97.234  95.173  1.00 19.11  ? 687 PHE B CE2 1 
ATOM   3880  C CZ  . PHE B 1 187 ? 19.731  96.747  93.943  1.00 23.04  ? 687 PHE B CZ  1 
ATOM   3881  N N   . SER B 1 188 ? 14.870  96.346  97.005  1.00 27.16  ? 688 SER B N   1 
ATOM   3882  C CA  . SER B 1 188 ? 15.276  95.546  98.140  1.00 23.59  ? 688 SER B CA  1 
ATOM   3883  C C   . SER B 1 188 ? 14.624  94.160  98.080  1.00 29.51  ? 688 SER B C   1 
ATOM   3884  O O   . SER B 1 188 ? 15.253  93.146  98.395  1.00 29.08  ? 688 SER B O   1 
ATOM   3885  C CB  . SER B 1 188 ? 14.916  96.265  99.435  1.00 18.56  ? 688 SER B CB  1 
ATOM   3886  O OG  . SER B 1 188 ? 15.630  95.720  100.519 1.00 24.29  ? 688 SER B OG  1 
ATOM   3887  N N   . LYS B 1 189 ? 13.362  94.142  97.665  1.00 25.52  ? 689 LYS B N   1 
ATOM   3888  C CA  . LYS B 1 189 ? 12.585  92.928  97.499  1.00 27.87  ? 689 LYS B CA  1 
ATOM   3889  C C   . LYS B 1 189 ? 13.159  92.039  96.399  1.00 30.33  ? 689 LYS B C   1 
ATOM   3890  O O   . LYS B 1 189 ? 13.253  90.825  96.562  1.00 33.87  ? 689 LYS B O   1 
ATOM   3891  C CB  . LYS B 1 189 ? 11.143  93.306  97.175  1.00 32.79  ? 689 LYS B CB  1 
ATOM   3892  C CG  . LYS B 1 189 ? 10.155  92.160  97.093  1.00 29.03  ? 689 LYS B CG  1 
ATOM   3893  C CD  . LYS B 1 189 ? 8.718   92.708  97.152  1.00 35.33  ? 689 LYS B CD  1 
ATOM   3894  C CE  . LYS B 1 189 ? 7.792   92.056  96.119  1.00 48.85  ? 689 LYS B CE  1 
ATOM   3895  N NZ  . LYS B 1 189 ? 7.616   90.582  96.316  1.00 49.79  ? 689 LYS B NZ  1 
ATOM   3896  N N   . LEU B 1 190 ? 13.534  92.636  95.274  1.00 18.38  ? 690 LEU B N   1 
ATOM   3897  C CA  . LEU B 1 190 ? 14.207  91.872  94.238  1.00 25.11  ? 690 LEU B CA  1 
ATOM   3898  C C   . LEU B 1 190 ? 15.489  91.219  94.759  1.00 23.11  ? 690 LEU B C   1 
ATOM   3899  O O   . LEU B 1 190 ? 15.781  90.068  94.438  1.00 22.27  ? 690 LEU B O   1 
ATOM   3900  C CB  . LEU B 1 190 ? 14.526  92.754  93.043  1.00 24.24  ? 690 LEU B CB  1 
ATOM   3901  C CG  . LEU B 1 190 ? 13.292  93.237  92.300  1.00 33.98  ? 690 LEU B CG  1 
ATOM   3902  C CD1 . LEU B 1 190 ? 13.713  93.961  91.034  1.00 35.76  ? 690 LEU B CD1 1 
ATOM   3903  C CD2 . LEU B 1 190 ? 12.405  92.070  91.966  1.00 36.66  ? 690 LEU B CD2 1 
ATOM   3904  N N   . LEU B 1 191 ? 16.265  91.955  95.547  1.00 17.60  ? 691 LEU B N   1 
ATOM   3905  C CA  . LEU B 1 191 ? 17.503  91.412  96.086  1.00 15.62  ? 691 LEU B CA  1 
ATOM   3906  C C   . LEU B 1 191 ? 17.209  90.175  96.916  1.00 22.72  ? 691 LEU B C   1 
ATOM   3907  O O   . LEU B 1 191 ? 17.891  89.157  96.807  1.00 28.14  ? 691 LEU B O   1 
ATOM   3908  C CB  . LEU B 1 191 ? 18.225  92.444  96.943  1.00 28.07  ? 691 LEU B CB  1 
ATOM   3909  C CG  . LEU B 1 191 ? 18.923  93.601  96.228  1.00 30.89  ? 691 LEU B CG  1 
ATOM   3910  C CD1 . LEU B 1 191 ? 19.899  94.230  97.176  1.00 22.07  ? 691 LEU B CD1 1 
ATOM   3911  C CD2 . LEU B 1 191 ? 19.649  93.089  95.017  1.00 34.84  ? 691 LEU B CD2 1 
ATOM   3912  N N   . HIS B 1 192 ? 16.172  90.273  97.738  1.00 18.60  ? 692 HIS B N   1 
ATOM   3913  C CA  . HIS B 1 192 ? 15.838  89.230  98.692  1.00 19.25  ? 692 HIS B CA  1 
ATOM   3914  C C   . HIS B 1 192 ? 15.365  87.950  97.976  1.00 20.99  ? 692 HIS B C   1 
ATOM   3915  O O   . HIS B 1 192 ? 15.658  86.845  98.420  1.00 18.03  ? 692 HIS B O   1 
ATOM   3916  C CB  . HIS B 1 192 ? 14.790  89.754  99.686  1.00 26.69  ? 692 HIS B CB  1 
ATOM   3917  C CG  . HIS B 1 192 ? 14.352  88.745  100.693 1.00 49.59  ? 692 HIS B CG  1 
ATOM   3918  N ND1 . HIS B 1 192 ? 15.175  88.302  101.706 1.00 63.35  ? 692 HIS B ND1 1 
ATOM   3919  C CD2 . HIS B 1 192 ? 13.181  88.079  100.836 1.00 53.93  ? 692 HIS B CD2 1 
ATOM   3920  C CE1 . HIS B 1 192 ? 14.527  87.410  102.435 1.00 65.65  ? 692 HIS B CE1 1 
ATOM   3921  N NE2 . HIS B 1 192 ? 13.314  87.259  101.930 1.00 59.19  ? 692 HIS B NE2 1 
ATOM   3922  N N   . GLU B 1 193 ? 14.657  88.122  96.864  1.00 16.74  ? 693 GLU B N   1 
ATOM   3923  C CA  . GLU B 1 193 ? 14.231  87.027  96.007  1.00 20.28  ? 693 GLU B CA  1 
ATOM   3924  C C   . GLU B 1 193 ? 15.381  86.447  95.181  1.00 26.95  ? 693 GLU B C   1 
ATOM   3925  O O   . GLU B 1 193 ? 15.174  85.571  94.330  1.00 24.06  ? 693 GLU B O   1 
ATOM   3926  C CB  . GLU B 1 193 ? 13.119  87.505  95.078  1.00 23.14  ? 693 GLU B CB  1 
ATOM   3927  C CG  . GLU B 1 193 ? 11.783  87.655  95.795  1.00 36.64  ? 693 GLU B CG  1 
ATOM   3928  C CD  . GLU B 1 193 ? 10.868  88.690  95.150  1.00 47.65  ? 693 GLU B CD  1 
ATOM   3929  O OE1 . GLU B 1 193 ? 11.078  89.044  93.968  1.00 53.69  ? 693 GLU B OE1 1 
ATOM   3930  O OE2 . GLU B 1 193 ? 9.931   89.153  95.831  1.00 47.91  ? 693 GLU B OE2 1 
ATOM   3931  N N   . GLY B 1 194 ? 16.589  86.946  95.423  1.00 21.43  ? 694 GLY B N   1 
ATOM   3932  C CA  . GLY B 1 194 ? 17.775  86.437  94.755  1.00 19.58  ? 694 GLY B CA  1 
ATOM   3933  C C   . GLY B 1 194 ? 17.899  86.803  93.284  1.00 25.30  ? 694 GLY B C   1 
ATOM   3934  O O   . GLY B 1 194 ? 18.413  86.009  92.485  1.00 23.10  ? 694 GLY B O   1 
ATOM   3935  N N   . ARG B 1 195 ? 17.470  88.015  92.928  1.00 23.73  ? 695 ARG B N   1 
ATOM   3936  C CA  . ARG B 1 195 ? 17.536  88.488  91.541  1.00 18.28  ? 695 ARG B CA  1 
ATOM   3937  C C   . ARG B 1 195 ? 18.590  89.575  91.327  1.00 30.53  ? 695 ARG B C   1 
ATOM   3938  O O   . ARG B 1 195 ? 18.500  90.331  90.352  1.00 33.08  ? 695 ARG B O   1 
ATOM   3939  C CB  . ARG B 1 195 ? 16.199  89.071  91.079  1.00 13.96  ? 695 ARG B CB  1 
ATOM   3940  C CG  . ARG B 1 195 ? 14.938  88.551  91.757  1.00 36.58  ? 695 ARG B CG  1 
ATOM   3941  C CD  . ARG B 1 195 ? 14.469  87.221  91.211  1.00 51.57  ? 695 ARG B CD  1 
ATOM   3942  N NE  . ARG B 1 195 ? 14.567  87.137  89.756  1.00 70.29  ? 695 ARG B NE  1 
ATOM   3943  C CZ  . ARG B 1 195 ? 13.531  87.172  88.923  1.00 75.12  ? 695 ARG B CZ  1 
ATOM   3944  N NH1 . ARG B 1 195 ? 12.297  87.301  89.394  1.00 80.40  ? 695 ARG B NH1 1 
ATOM   3945  N NH2 . ARG B 1 195 ? 13.736  87.075  87.615  1.00 69.79  ? 695 ARG B NH2 1 
ATOM   3946  N N   . GLU B 1 196 ? 19.573  89.664  92.225  1.00 27.64  ? 696 GLU B N   1 
ATOM   3947  C CA  . GLU B 1 196 ? 20.574  90.738  92.168  1.00 26.51  ? 696 GLU B CA  1 
ATOM   3948  C C   . GLU B 1 196 ? 21.412  90.717  90.890  1.00 30.19  ? 696 GLU B C   1 
ATOM   3949  O O   . GLU B 1 196 ? 22.094  91.685  90.573  1.00 34.98  ? 696 GLU B O   1 
ATOM   3950  C CB  . GLU B 1 196 ? 21.509  90.692  93.388  1.00 25.08  ? 696 GLU B CB  1 
ATOM   3951  C CG  . GLU B 1 196 ? 22.645  89.664  93.299  1.00 29.45  ? 696 GLU B CG  1 
ATOM   3952  C CD  . GLU B 1 196 ? 23.373  89.434  94.640  1.00 35.11  ? 696 GLU B CD  1 
ATOM   3953  O OE1 . GLU B 1 196 ? 24.428  90.080  94.882  1.00 25.29  ? 696 GLU B OE1 1 
ATOM   3954  O OE2 . GLU B 1 196 ? 22.887  88.599  95.441  1.00 35.33  ? 696 GLU B OE2 1 
ATOM   3955  N N   . SER B 1 197 ? 21.373  89.610  90.161  1.00 24.37  ? 697 SER B N   1 
ATOM   3956  C CA  . SER B 1 197 ? 22.232  89.463  88.997  1.00 19.35  ? 697 SER B CA  1 
ATOM   3957  C C   . SER B 1 197 ? 21.579  90.113  87.794  1.00 25.93  ? 697 SER B C   1 
ATOM   3958  O O   . SER B 1 197 ? 22.257  90.388  86.802  1.00 31.39  ? 697 SER B O   1 
ATOM   3959  C CB  . SER B 1 197 ? 22.548  87.979  88.717  1.00 32.46  ? 697 SER B CB  1 
ATOM   3960  O OG  . SER B 1 197 ? 21.379  87.257  88.342  1.00 31.33  ? 697 SER B OG  1 
ATOM   3961  N N   . THR B 1 198 ? 20.270  90.368  87.889  1.00 21.90  ? 698 THR B N   1 
ATOM   3962  C CA  . THR B 1 198 ? 19.518  90.910  86.757  1.00 21.33  ? 698 THR B CA  1 
ATOM   3963  C C   . THR B 1 198 ? 18.934  92.297  86.991  1.00 32.37  ? 698 THR B C   1 
ATOM   3964  O O   . THR B 1 198 ? 18.083  92.756  86.223  1.00 39.68  ? 698 THR B O   1 
ATOM   3965  C CB  . THR B 1 198 ? 18.359  89.972  86.313  1.00 35.57  ? 698 THR B CB  1 
ATOM   3966  O OG1 . THR B 1 198 ? 17.337  89.947  87.316  1.00 32.85  ? 698 THR B OG1 1 
ATOM   3967  C CG2 . THR B 1 198 ? 18.863  88.554  86.053  1.00 31.88  ? 698 THR B CG2 1 
ATOM   3968  N N   . CYS B 1 199 ? 19.382  92.972  88.042  1.00 33.60  ? 699 CYS B N   1 
ATOM   3969  C CA  . CYS B 1 199 ? 18.983  94.363  88.237  1.00 34.88  ? 699 CYS B CA  1 
ATOM   3970  C C   . CYS B 1 199 ? 20.149  95.177  88.791  1.00 34.04  ? 699 CYS B C   1 
ATOM   3971  O O   . CYS B 1 199 ? 20.040  95.792  89.854  1.00 44.89  ? 699 CYS B O   1 
ATOM   3972  C CB  . CYS B 1 199 ? 17.761  94.451  89.158  1.00 39.70  ? 699 CYS B CB  1 
ATOM   3973  S SG  . CYS B 1 199 ? 17.959  93.595  90.743  1.00 41.86  ? 699 CYS B SG  1 
ATOM   3974  N N   . VAL B 1 200 ? 21.270  95.185  88.077  1.00 14.51  ? 700 VAL B N   1 
ATOM   3975  C CA  . VAL B 1 200 ? 22.443  95.841  88.624  1.00 28.03  ? 700 VAL B CA  1 
ATOM   3976  C C   . VAL B 1 200 ? 22.346  97.366  88.515  1.00 24.12  ? 700 VAL B C   1 
ATOM   3977  O O   . VAL B 1 200 ? 21.801  97.898  87.560  1.00 21.05  ? 700 VAL B O   1 
ATOM   3978  C CB  . VAL B 1 200 ? 23.772  95.306  88.021  1.00 30.77  ? 700 VAL B CB  1 
ATOM   3979  C CG1 . VAL B 1 200 ? 23.663  93.796  87.702  1.00 17.55  ? 700 VAL B CG1 1 
ATOM   3980  C CG2 . VAL B 1 200 ? 24.155  96.100  86.812  1.00 22.63  ? 700 VAL B CG2 1 
ATOM   3981  N N   . PRO B 1 201 ? 22.852  98.065  89.530  1.00 17.04  ? 701 PRO B N   1 
ATOM   3982  C CA  . PRO B 1 201 ? 22.827  99.528  89.600  1.00 26.34  ? 701 PRO B CA  1 
ATOM   3983  C C   . PRO B 1 201 ? 23.747  100.159 88.565  1.00 25.07  ? 701 PRO B C   1 
ATOM   3984  O O   . PRO B 1 201 ? 24.638  99.490  88.056  1.00 17.76  ? 701 PRO B O   1 
ATOM   3985  C CB  . PRO B 1 201 ? 23.340  99.815  91.012  1.00 32.27  ? 701 PRO B CB  1 
ATOM   3986  C CG  . PRO B 1 201 ? 23.080  98.544  91.771  1.00 28.62  ? 701 PRO B CG  1 
ATOM   3987  C CD  . PRO B 1 201 ? 23.320  97.457  90.782  1.00 16.73  ? 701 PRO B CD  1 
ATOM   3988  N N   . PRO B 1 202 ? 23.525  101.443 88.259  1.00 24.71  ? 702 PRO B N   1 
ATOM   3989  C CA  . PRO B 1 202 ? 24.263  102.194 87.233  1.00 28.17  ? 702 PRO B CA  1 
ATOM   3990  C C   . PRO B 1 202 ? 25.783  102.137 87.364  1.00 25.16  ? 702 PRO B C   1 
ATOM   3991  O O   . PRO B 1 202 ? 26.460  102.373 86.365  1.00 31.02  ? 702 PRO B O   1 
ATOM   3992  C CB  . PRO B 1 202 ? 23.753  103.643 87.387  1.00 20.43  ? 702 PRO B CB  1 
ATOM   3993  C CG  . PRO B 1 202 ? 22.883  103.638 88.604  1.00 22.06  ? 702 PRO B CG  1 
ATOM   3994  C CD  . PRO B 1 202 ? 22.438  102.232 88.851  1.00 20.08  ? 702 PRO B CD  1 
ATOM   3995  N N   . ASN B 1 203 ? 26.317  101.827 88.539  1.00 14.17  ? 703 ASN B N   1 
ATOM   3996  C CA  . ASN B 1 203 ? 27.772  101.695 88.652  1.00 21.24  ? 703 ASN B CA  1 
ATOM   3997  C C   . ASN B 1 203 ? 28.278  100.252 88.788  1.00 26.74  ? 703 ASN B C   1 
ATOM   3998  O O   . ASN B 1 203 ? 29.427  100.022 89.194  1.00 17.58  ? 703 ASN B O   1 
ATOM   3999  C CB  . ASN B 1 203 ? 28.340  102.574 89.772  1.00 20.20  ? 703 ASN B CB  1 
ATOM   4000  C CG  . ASN B 1 203 ? 29.616  103.283 89.348  1.00 27.93  ? 703 ASN B CG  1 
ATOM   4001  O OD1 . ASN B 1 203 ? 29.894  103.385 88.161  1.00 31.69  ? 703 ASN B OD1 1 
ATOM   4002  N ND2 . ASN B 1 203 ? 30.408  103.752 90.315  1.00 19.71  ? 703 ASN B ND2 1 
ATOM   4003  N N   . ASN B 1 204 ? 27.429  99.293  88.414  1.00 19.74  ? 704 ASN B N   1 
ATOM   4004  C CA  . ASN B 1 204 ? 27.714  97.868  88.623  1.00 18.66  ? 704 ASN B CA  1 
ATOM   4005  C C   . ASN B 1 204 ? 27.836  97.499  90.110  1.00 22.87  ? 704 ASN B C   1 
ATOM   4006  O O   . ASN B 1 204 ? 27.689  98.349  91.002  1.00 16.28  ? 704 ASN B O   1 
ATOM   4007  C CB  . ASN B 1 204 ? 28.975  97.406  87.865  1.00 19.95  ? 704 ASN B CB  1 
ATOM   4008  C CG  . ASN B 1 204 ? 28.877  97.597  86.342  1.00 29.53  ? 704 ASN B CG  1 
ATOM   4009  O OD1 . ASN B 1 204 ? 27.818  97.916  85.790  1.00 31.25  ? 704 ASN B OD1 1 
ATOM   4010  N ND2 . ASN B 1 204 ? 29.996  97.382  85.659  1.00 27.73  ? 704 ASN B ND2 1 
ATOM   4011  N N   . VAL B 1 205 ? 28.129  96.224  90.355  1.00 16.56  ? 705 VAL B N   1 
ATOM   4012  C CA  . VAL B 1 205 ? 28.198  95.660  91.696  1.00 22.08  ? 705 VAL B CA  1 
ATOM   4013  C C   . VAL B 1 205 ? 29.632  95.454  92.159  1.00 25.41  ? 705 VAL B C   1 
ATOM   4014  O O   . VAL B 1 205 ? 30.412  94.788  91.481  1.00 28.18  ? 705 VAL B O   1 
ATOM   4015  C CB  . VAL B 1 205 ? 27.506  94.289  91.736  1.00 20.19  ? 705 VAL B CB  1 
ATOM   4016  C CG1 . VAL B 1 205 ? 27.515  93.729  93.136  1.00 16.69  ? 705 VAL B CG1 1 
ATOM   4017  C CG2 . VAL B 1 205 ? 26.098  94.413  91.213  1.00 12.34  ? 705 VAL B CG2 1 
ATOM   4018  N N   . SER B 1 206 ? 29.965  95.993  93.329  1.00 24.55  ? 706 SER B N   1 
ATOM   4019  C CA  . SER B 1 206 ? 31.301  95.819  93.908  1.00 27.42  ? 706 SER B CA  1 
ATOM   4020  C C   . SER B 1 206 ? 31.315  94.762  95.019  1.00 22.91  ? 706 SER B C   1 
ATOM   4021  O O   . SER B 1 206 ? 32.334  94.134  95.279  1.00 21.44  ? 706 SER B O   1 
ATOM   4022  C CB  . SER B 1 206 ? 31.835  97.151  94.461  1.00 23.64  ? 706 SER B CB  1 
ATOM   4023  O OG  . SER B 1 206 ? 31.962  98.131  93.443  1.00 19.38  ? 706 SER B OG  1 
ATOM   4024  N N   . VAL B 1 207 ? 30.184  94.595  95.688  1.00 15.62  ? 707 VAL B N   1 
ATOM   4025  C CA  . VAL B 1 207 ? 30.055  93.641  96.781  1.00 17.76  ? 707 VAL B CA  1 
ATOM   4026  C C   . VAL B 1 207 ? 28.634  93.099  96.696  1.00 21.71  ? 707 VAL B C   1 
ATOM   4027  O O   . VAL B 1 207 ? 27.684  93.848  96.850  1.00 19.04  ? 707 VAL B O   1 
ATOM   4028  C CB  . VAL B 1 207 ? 30.265  94.304  98.163  1.00 13.02  ? 707 VAL B CB  1 
ATOM   4029  C CG1 . VAL B 1 207 ? 30.209  93.271  99.259  1.00 17.10  ? 707 VAL B CG1 1 
ATOM   4030  C CG2 . VAL B 1 207 ? 31.589  95.045  98.225  1.00 12.47  ? 707 VAL B CG2 1 
ATOM   4031  N N   . PRO B 1 208 ? 28.484  91.799  96.421  1.00 22.60  ? 708 PRO B N   1 
ATOM   4032  C CA  . PRO B 1 208 ? 27.122  91.278  96.295  1.00 19.25  ? 708 PRO B CA  1 
ATOM   4033  C C   . PRO B 1 208 ? 26.366  91.344  97.612  1.00 19.82  ? 708 PRO B C   1 
ATOM   4034  O O   . PRO B 1 208 ? 26.917  91.734  98.642  1.00 24.48  ? 708 PRO B O   1 
ATOM   4035  C CB  . PRO B 1 208 ? 27.330  89.807  95.880  1.00 22.98  ? 708 PRO B CB  1 
ATOM   4036  C CG  . PRO B 1 208 ? 28.746  89.492  96.214  1.00 23.44  ? 708 PRO B CG  1 
ATOM   4037  C CD  . PRO B 1 208 ? 29.514  90.780  96.150  1.00 19.19  ? 708 PRO B CD  1 
ATOM   4038  N N   . LEU B 1 209 ? 25.103  90.943  97.565  1.00 21.24  ? 709 LEU B N   1 
ATOM   4039  C CA  . LEU B 1 209 ? 24.238  90.920  98.739  1.00 22.48  ? 709 LEU B CA  1 
ATOM   4040  C C   . LEU B 1 209 ? 24.794  90.074  99.913  1.00 23.69  ? 709 LEU B C   1 
ATOM   4041  O O   . LEU B 1 209 ? 24.776  90.534  101.060 1.00 19.09  ? 709 LEU B O   1 
ATOM   4042  C CB  . LEU B 1 209 ? 22.846  90.436  98.322  1.00 17.71  ? 709 LEU B CB  1 
ATOM   4043  C CG  . LEU B 1 209 ? 21.770  90.430  99.394  1.00 20.18  ? 709 LEU B CG  1 
ATOM   4044  C CD1 . LEU B 1 209 ? 21.523  91.849  99.899  1.00 25.39  ? 709 LEU B CD1 1 
ATOM   4045  C CD2 . LEU B 1 209 ? 20.497  89.816  98.841  1.00 22.46  ? 709 LEU B CD2 1 
ATOM   4046  N N   . LEU B 1 210 ? 25.257  88.851  99.609  1.00 21.01  ? 710 LEU B N   1 
ATOM   4047  C CA  . LEU B 1 210 ? 25.893  87.912  100.561 1.00 25.48  ? 710 LEU B CA  1 
ATOM   4048  C C   . LEU B 1 210 ? 25.009  87.338  101.672 1.00 35.04  ? 710 LEU B C   1 
ATOM   4049  O O   . LEU B 1 210 ? 25.177  86.196  102.074 1.00 46.54  ? 710 LEU B O   1 
ATOM   4050  C CB  . LEU B 1 210 ? 27.157  88.503  101.204 1.00 15.99  ? 710 LEU B CB  1 
ATOM   4051  C CG  . LEU B 1 210 ? 28.180  89.064  100.225 1.00 26.08  ? 710 LEU B CG  1 
ATOM   4052  C CD1 . LEU B 1 210 ? 29.262  89.846  100.953 1.00 27.01  ? 710 LEU B CD1 1 
ATOM   4053  C CD2 . LEU B 1 210 ? 28.768  87.938  99.417  1.00 28.64  ? 710 LEU B CD2 1 
ATOM   4054  N N   . MET B 1 211 ? 24.080  88.121  102.183 1.00 28.13  ? 711 MET B N   1 
ATOM   4055  C CA  . MET B 1 211 ? 23.458  87.762  103.441 1.00 23.95  ? 711 MET B CA  1 
ATOM   4056  C C   . MET B 1 211 ? 22.526  86.534  103.363 1.00 24.71  ? 711 MET B C   1 
ATOM   4057  O O   . MET B 1 211 ? 22.643  85.600  104.154 1.00 28.61  ? 711 MET B O   1 
ATOM   4058  C CB  . MET B 1 211 ? 22.741  88.982  104.013 1.00 22.00  ? 711 MET B CB  1 
ATOM   4059  C CG  . MET B 1 211 ? 22.583  88.961  105.493 1.00 30.96  ? 711 MET B CG  1 
ATOM   4060  S SD  . MET B 1 211 ? 24.082  88.625  106.456 1.00 30.45  ? 711 MET B SD  1 
ATOM   4061  C CE  . MET B 1 211 ? 23.218  88.386  108.005 1.00 16.40  ? 711 MET B CE  1 
ATOM   4062  N N   . PRO B 1 212 ? 21.580  86.542  102.423 1.00 24.10  ? 712 PRO B N   1 
ATOM   4063  C CA  . PRO B 1 212 ? 20.649  85.408  102.329 1.00 26.74  ? 712 PRO B CA  1 
ATOM   4064  C C   . PRO B 1 212 ? 21.356  84.099  101.980 1.00 29.29  ? 712 PRO B C   1 
ATOM   4065  O O   . PRO B 1 212 ? 20.977  83.030  102.478 1.00 25.49  ? 712 PRO B O   1 
ATOM   4066  C CB  . PRO B 1 212 ? 19.710  85.825  101.200 1.00 25.24  ? 712 PRO B CB  1 
ATOM   4067  C CG  . PRO B 1 212 ? 19.755  87.341  101.234 1.00 20.94  ? 712 PRO B CG  1 
ATOM   4068  C CD  . PRO B 1 212 ? 21.178  87.667  101.568 1.00 16.90  ? 712 PRO B CD  1 
ATOM   4069  N N   . LEU B 1 213 ? 22.371  84.196  101.128 1.00 28.90  ? 713 LEU B N   1 
ATOM   4070  C CA  . LEU B 1 213 ? 23.211  83.059  100.767 1.00 30.68  ? 713 LEU B CA  1 
ATOM   4071  C C   . LEU B 1 213 ? 23.978  82.516  101.966 1.00 30.30  ? 713 LEU B C   1 
ATOM   4072  O O   . LEU B 1 213 ? 23.945  81.322  102.251 1.00 28.24  ? 713 LEU B O   1 
ATOM   4073  C CB  . LEU B 1 213 ? 24.202  83.457  99.670  1.00 20.18  ? 713 LEU B CB  1 
ATOM   4074  C CG  . LEU B 1 213 ? 25.319  82.443  99.458  1.00 23.28  ? 713 LEU B CG  1 
ATOM   4075  C CD1 . LEU B 1 213 ? 24.774  81.182  98.818  1.00 16.58  ? 713 LEU B CD1 1 
ATOM   4076  C CD2 . LEU B 1 213 ? 26.411  83.038  98.609  1.00 26.28  ? 713 LEU B CD2 1 
ATOM   4077  N N   . VAL B 1 214 ? 24.685  83.406  102.651 1.00 27.82  ? 714 VAL B N   1 
ATOM   4078  C CA  . VAL B 1 214 ? 25.526  83.044  103.793 1.00 22.80  ? 714 VAL B CA  1 
ATOM   4079  C C   . VAL B 1 214 ? 24.688  82.478  104.940 1.00 30.09  ? 714 VAL B C   1 
ATOM   4080  O O   . VAL B 1 214 ? 25.140  81.646  105.719 1.00 31.36  ? 714 VAL B O   1 
ATOM   4081  C CB  . VAL B 1 214 ? 26.295  84.270  104.282 1.00 27.05  ? 714 VAL B CB  1 
ATOM   4082  C CG1 . VAL B 1 214 ? 26.560  84.167  105.758 1.00 32.11  ? 714 VAL B CG1 1 
ATOM   4083  C CG2 . VAL B 1 214 ? 27.585  84.448  103.462 1.00 24.66  ? 714 VAL B CG2 1 
ATOM   4084  N N   . THR B 1 215 ? 23.443  82.916  105.013 1.00 28.90  ? 715 THR B N   1 
ATOM   4085  C CA  . THR B 1 215 ? 22.553  82.496  106.070 1.00 36.65  ? 715 THR B CA  1 
ATOM   4086  C C   . THR B 1 215 ? 21.932  81.135  105.716 1.00 41.87  ? 715 THR B C   1 
ATOM   4087  O O   . THR B 1 215 ? 21.672  80.302  106.594 1.00 41.17  ? 715 THR B O   1 
ATOM   4088  C CB  . THR B 1 215 ? 21.463  83.562  106.289 1.00 40.46  ? 715 THR B CB  1 
ATOM   4089  O OG1 . THR B 1 215 ? 20.887  83.401  107.582 1.00 37.58  ? 715 THR B OG1 1 
ATOM   4090  C CG2 . THR B 1 215 ? 20.373  83.459  105.223 1.00 42.43  ? 715 THR B CG2 1 
ATOM   4091  N N   . LEU B 1 216 ? 21.721  80.911  104.420 1.00 39.05  ? 716 LEU B N   1 
ATOM   4092  C CA  . LEU B 1 216 ? 21.190  79.644  103.914 1.00 35.27  ? 716 LEU B CA  1 
ATOM   4093  C C   . LEU B 1 216 ? 22.162  78.495  104.189 1.00 32.48  ? 716 LEU B C   1 
ATOM   4094  O O   . LEU B 1 216 ? 21.742  77.405  104.580 1.00 33.37  ? 716 LEU B O   1 
ATOM   4095  C CB  . LEU B 1 216 ? 20.926  79.749  102.412 1.00 40.51  ? 716 LEU B CB  1 
ATOM   4096  C CG  . LEU B 1 216 ? 20.141  78.614  101.768 1.00 46.20  ? 716 LEU B CG  1 
ATOM   4097  C CD1 . LEU B 1 216 ? 18.777  78.495  102.429 1.00 52.15  ? 716 LEU B CD1 1 
ATOM   4098  C CD2 . LEU B 1 216 ? 20.005  78.850  100.268 1.00 40.64  ? 716 LEU B CD2 1 
ATOM   4099  N N   . MET B 1 217 ? 23.454  78.763  103.985 1.00 27.79  ? 717 MET B N   1 
ATOM   4100  C CA  . MET B 1 217 ? 24.526  77.802  104.208 1.00 24.45  ? 717 MET B CA  1 
ATOM   4101  C C   . MET B 1 217 ? 24.832  77.599  105.682 1.00 33.60  ? 717 MET B C   1 
ATOM   4102  O O   . MET B 1 217 ? 25.355  76.558  106.064 1.00 36.66  ? 717 MET B O   1 
ATOM   4103  C CB  . MET B 1 217 ? 25.815  78.260  103.531 1.00 23.72  ? 717 MET B CB  1 
ATOM   4104  C CG  . MET B 1 217 ? 25.732  78.427  102.039 1.00 23.58  ? 717 MET B CG  1 
ATOM   4105  S SD  . MET B 1 217 ? 27.323  78.994  101.401 1.00 33.56  ? 717 MET B SD  1 
ATOM   4106  C CE  . MET B 1 217 ? 28.349  77.572  101.695 1.00 20.44  ? 717 MET B CE  1 
ATOM   4107  N N   . GLU B 1 218 ? 24.541  78.596  106.509 1.00 29.39  ? 718 GLU B N   1 
ATOM   4108  C CA  . GLU B 1 218 ? 24.806  78.470  107.945 1.00 30.27  ? 718 GLU B CA  1 
ATOM   4109  C C   . GLU B 1 218 ? 23.513  78.238  108.719 1.00 40.71  ? 718 GLU B C   1 
ATOM   4110  O O   . GLU B 1 218 ? 22.843  79.196  109.123 1.00 35.40  ? 718 GLU B O   1 
ATOM   4111  C CB  . GLU B 1 218 ? 25.499  79.723  108.482 1.00 25.64  ? 718 GLU B CB  1 
ATOM   4112  C CG  . GLU B 1 218 ? 26.904  79.959  107.930 1.00 38.94  ? 718 GLU B CG  1 
ATOM   4113  C CD  . GLU B 1 218 ? 27.896  78.867  108.320 1.00 39.58  ? 718 GLU B CD  1 
ATOM   4114  O OE1 . GLU B 1 218 ? 27.629  78.113  109.285 1.00 40.42  ? 718 GLU B OE1 1 
ATOM   4115  O OE2 . GLU B 1 218 ? 28.946  78.773  107.656 1.00 34.64  ? 718 GLU B OE2 1 
ATOM   4116  N N   . ARG B 1 219 ? 23.159  76.972  108.924 1.00 40.32  ? 719 ARG B N   1 
ATOM   4117  C CA  . ARG B 1 219 ? 21.894  76.640  109.563 1.00 42.05  ? 719 ARG B CA  1 
ATOM   4118  C C   . ARG B 1 219 ? 21.918  76.994  111.049 1.00 44.52  ? 719 ARG B C   1 
ATOM   4119  O O   . ARG B 1 219 ? 20.880  77.002  111.710 1.00 42.32  ? 719 ARG B O   1 
ATOM   4120  C CB  . ARG B 1 219 ? 21.521  75.171  109.321 1.00 45.99  ? 719 ARG B CB  1 
ATOM   4121  C CG  . ARG B 1 219 ? 21.157  74.893  107.855 1.00 53.12  ? 719 ARG B CG  1 
ATOM   4122  C CD  . ARG B 1 219 ? 20.905  73.410  107.541 1.00 48.65  ? 719 ARG B CD  1 
ATOM   4123  N NE  . ARG B 1 219 ? 19.649  72.890  108.088 1.00 43.37  ? 719 ARG B NE  1 
ATOM   4124  C CZ  . ARG B 1 219 ? 19.541  72.351  109.300 1.00 52.49  ? 719 ARG B CZ  1 
ATOM   4125  N NH1 . ARG B 1 219 ? 20.606  72.276  110.086 1.00 51.46  ? 719 ARG B NH1 1 
ATOM   4126  N NH2 . ARG B 1 219 ? 18.373  71.894  109.736 1.00 54.50  ? 719 ARG B NH2 1 
ATOM   4127  N N   . GLN B 1 220 ? 23.102  77.321  111.558 1.00 40.87  ? 720 GLN B N   1 
ATOM   4128  C CA  . GLN B 1 220 ? 23.256  77.682  112.964 1.00 53.52  ? 720 GLN B CA  1 
ATOM   4129  C C   . GLN B 1 220 ? 23.327  79.205  113.163 1.00 55.96  ? 720 GLN B C   1 
ATOM   4130  O O   . GLN B 1 220 ? 23.414  79.699  114.295 1.00 50.45  ? 720 GLN B O   1 
ATOM   4131  C CB  . GLN B 1 220 ? 24.505  77.012  113.540 1.00 65.38  ? 720 GLN B CB  1 
ATOM   4132  C CG  . GLN B 1 220 ? 24.238  76.071  114.703 1.00 81.35  ? 720 GLN B CG  1 
ATOM   4133  C CD  . GLN B 1 220 ? 23.351  74.895  114.333 1.00 91.34  ? 720 GLN B CD  1 
ATOM   4134  O OE1 . GLN B 1 220 ? 23.116  74.624  113.154 1.00 97.59  ? 720 GLN B OE1 1 
ATOM   4135  N NE2 . GLN B 1 220 ? 22.855  74.187  115.345 1.00 92.70  ? 720 GLN B NE2 1 
ATOM   4136  N N   . ALA B 1 221 ? 23.286  79.941  112.056 1.00 49.70  ? 721 ALA B N   1 
ATOM   4137  C CA  . ALA B 1 221 ? 23.378  81.401  112.083 1.00 42.83  ? 721 ALA B CA  1 
ATOM   4138  C C   . ALA B 1 221 ? 22.398  82.059  113.049 1.00 43.34  ? 721 ALA B C   1 
ATOM   4139  O O   . ALA B 1 221 ? 21.216  81.714  113.080 1.00 47.88  ? 721 ALA B O   1 
ATOM   4140  C CB  . ALA B 1 221 ? 23.177  81.972  110.687 1.00 35.02  ? 721 ALA B CB  1 
ATOM   4141  N N   . VAL B 1 222 ? 22.903  83.017  113.824 1.00 41.95  ? 722 VAL B N   1 
ATOM   4142  C CA  . VAL B 1 222 ? 22.065  83.897  114.634 1.00 44.32  ? 722 VAL B CA  1 
ATOM   4143  C C   . VAL B 1 222 ? 21.990  85.280  113.980 1.00 41.54  ? 722 VAL B C   1 
ATOM   4144  O O   . VAL B 1 222 ? 23.021  85.906  113.742 1.00 44.67  ? 722 VAL B O   1 
ATOM   4145  C CB  . VAL B 1 222 ? 22.621  84.050  116.067 1.00 42.15  ? 722 VAL B CB  1 
ATOM   4146  C CG1 . VAL B 1 222 ? 21.769  85.037  116.875 1.00 39.09  ? 722 VAL B CG1 1 
ATOM   4147  C CG2 . VAL B 1 222 ? 22.712  82.681  116.771 1.00 33.57  ? 722 VAL B CG2 1 
ATOM   4148  N N   . THR B 1 223 ? 20.781  85.743  113.669 1.00 41.64  ? 723 THR B N   1 
ATOM   4149  C CA  . THR B 1 223 ? 20.589  87.089  113.109 1.00 44.64  ? 723 THR B CA  1 
ATOM   4150  C C   . THR B 1 223 ? 19.742  87.921  114.048 1.00 41.77  ? 723 THR B C   1 
ATOM   4151  O O   . THR B 1 223 ? 18.919  87.388  114.787 1.00 45.01  ? 723 THR B O   1 
ATOM   4152  C CB  . THR B 1 223 ? 19.854  87.077  111.751 1.00 45.93  ? 723 THR B CB  1 
ATOM   4153  O OG1 . THR B 1 223 ? 18.708  86.230  111.851 1.00 58.46  ? 723 THR B OG1 1 
ATOM   4154  C CG2 . THR B 1 223 ? 20.745  86.568  110.633 1.00 36.59  ? 723 THR B CG2 1 
ATOM   4155  N N   . PHE B 1 224 ? 19.928  89.233  114.006 1.00 52.98  ? 724 PHE B N   1 
ATOM   4156  C CA  . PHE B 1 224 ? 19.175  90.129  114.877 1.00 55.78  ? 724 PHE B CA  1 
ATOM   4157  C C   . PHE B 1 224 ? 17.696  90.219  114.479 1.00 70.65  ? 724 PHE B C   1 
ATOM   4158  O O   . PHE B 1 224 ? 17.363  90.523  113.327 1.00 70.02  ? 724 PHE B O   1 
ATOM   4159  C CB  . PHE B 1 224 ? 19.821  91.508  114.901 1.00 40.93  ? 724 PHE B CB  1 
ATOM   4160  C CG  . PHE B 1 224 ? 19.030  92.527  115.656 1.00 46.09  ? 724 PHE B CG  1 
ATOM   4161  C CD1 . PHE B 1 224 ? 18.194  93.411  114.987 1.00 47.78  ? 724 PHE B CD1 1 
ATOM   4162  C CD2 . PHE B 1 224 ? 19.109  92.600  117.040 1.00 44.75  ? 724 PHE B CD2 1 
ATOM   4163  C CE1 . PHE B 1 224 ? 17.456  94.360  115.687 1.00 51.87  ? 724 PHE B CE1 1 
ATOM   4164  C CE2 . PHE B 1 224 ? 18.373  93.547  117.744 1.00 43.84  ? 724 PHE B CE2 1 
ATOM   4165  C CZ  . PHE B 1 224 ? 17.546  94.425  117.069 1.00 46.37  ? 724 PHE B CZ  1 
ATOM   4166  N N   . GLU B 1 225 ? 16.818  89.945  115.444 1.00 77.23  ? 725 GLU B N   1 
ATOM   4167  C CA  . GLU B 1 225 ? 15.375  89.929  115.215 1.00 83.69  ? 725 GLU B CA  1 
ATOM   4168  C C   . GLU B 1 225 ? 14.954  88.911  114.164 1.00 90.66  ? 725 GLU B C   1 
ATOM   4169  O O   . GLU B 1 225 ? 14.053  89.171  113.368 1.00 92.82  ? 725 GLU B O   1 
ATOM   4170  C CB  . GLU B 1 225 ? 14.871  91.314  114.824 1.00 87.11  ? 725 GLU B CB  1 
ATOM   4171  C CG  . GLU B 1 225 ? 14.544  92.195  116.005 1.00 96.67  ? 725 GLU B CG  1 
ATOM   4172  C CD  . GLU B 1 225 ? 14.339  93.639  115.603 1.00 104.14 ? 725 GLU B CD  1 
ATOM   4173  O OE1 . GLU B 1 225 ? 14.358  93.935  114.387 1.00 103.51 ? 725 GLU B OE1 1 
ATOM   4174  O OE2 . GLU B 1 225 ? 14.167  94.481  116.507 1.00 108.90 ? 725 GLU B OE2 1 
ATOM   4175  N N   . GLY B 1 226 ? 15.615  87.758  114.163 1.00 93.97  ? 726 GLY B N   1 
ATOM   4176  C CA  . GLY B 1 226 ? 15.249  86.655  113.292 1.00 95.03  ? 726 GLY B CA  1 
ATOM   4177  C C   . GLY B 1 226 ? 14.977  86.989  111.832 1.00 91.49  ? 726 GLY B C   1 
ATOM   4178  O O   . GLY B 1 226 ? 14.055  86.425  111.234 1.00 94.38  ? 726 GLY B O   1 
ATOM   4179  N N   . THR B 1 227 ? 15.769  87.894  111.255 1.00 79.69  ? 727 THR B N   1 
ATOM   4180  C CA  . THR B 1 227 ? 15.707  88.166  109.816 1.00 70.87  ? 727 THR B CA  1 
ATOM   4181  C C   . THR B 1 227 ? 16.563  87.170  109.004 1.00 76.03  ? 727 THR B C   1 
ATOM   4182  O O   . THR B 1 227 ? 17.491  86.558  109.538 1.00 76.68  ? 727 THR B O   1 
ATOM   4183  C CB  . THR B 1 227 ? 16.131  89.621  109.489 1.00 62.93  ? 727 THR B CB  1 
ATOM   4184  O OG1 . THR B 1 227 ? 17.399  89.910  110.100 1.00 61.86  ? 727 THR B OG1 1 
ATOM   4185  C CG2 . THR B 1 227 ? 15.076  90.613  109.985 1.00 52.21  ? 727 THR B CG2 1 
ATOM   4186  N N   . ASP B 1 228 ? 16.250  87.010  107.717 1.00 77.96  ? 728 ASP B N   1 
ATOM   4187  C CA  . ASP B 1 228 ? 16.974  86.072  106.847 1.00 75.80  ? 728 ASP B CA  1 
ATOM   4188  C C   . ASP B 1 228 ? 16.988  84.650  107.432 1.00 71.51  ? 728 ASP B C   1 
ATOM   4189  O O   . ASP B 1 228 ? 17.976  83.927  107.294 1.00 61.00  ? 728 ASP B O   1 
ATOM   4190  C CB  . ASP B 1 228 ? 18.419  86.551  106.570 1.00 80.86  ? 728 ASP B CB  1 
ATOM   4191  C CG  . ASP B 1 228 ? 18.497  87.677  105.521 1.00 82.57  ? 728 ASP B CG  1 
ATOM   4192  O OD1 . ASP B 1 228 ? 18.301  87.392  104.318 1.00 85.81  ? 728 ASP B OD1 1 
ATOM   4193  O OD2 . ASP B 1 228 ? 18.782  88.840  105.897 1.00 72.72  ? 728 ASP B OD2 1 
ATOM   4194  N N   . MET B 1 229 ? 15.888  84.256  108.078 1.00 71.88  ? 729 MET B N   1 
ATOM   4195  C CA  . MET B 1 229 ? 15.806  82.962  108.768 1.00 73.63  ? 729 MET B CA  1 
ATOM   4196  C C   . MET B 1 229 ? 15.024  81.886  107.994 1.00 72.28  ? 729 MET B C   1 
ATOM   4197  O O   . MET B 1 229 ? 14.699  80.832  108.543 1.00 71.90  ? 729 MET B O   1 
ATOM   4198  C CB  . MET B 1 229 ? 15.211  83.125  110.181 1.00 70.91  ? 729 MET B CB  1 
ATOM   4199  C CG  . MET B 1 229 ? 16.103  83.849  111.196 1.00 67.48  ? 729 MET B CG  1 
ATOM   4200  S SD  . MET B 1 229 ? 17.446  82.876  111.926 1.00 85.25  ? 729 MET B SD  1 
ATOM   4201  C CE  . MET B 1 229 ? 18.745  83.054  110.715 1.00 23.84  ? 729 MET B CE  1 
ATOM   4202  N N   . TRP B 1 230 ? 14.716  82.159  106.730 1.00 71.00  ? 730 TRP B N   1 
ATOM   4203  C CA  . TRP B 1 230 ? 14.097  81.164  105.853 1.00 73.79  ? 730 TRP B CA  1 
ATOM   4204  C C   . TRP B 1 230 ? 12.934  80.403  106.502 1.00 79.00  ? 730 TRP B C   1 
ATOM   4205  O O   . TRP B 1 230 ? 12.962  79.177  106.623 1.00 85.04  ? 730 TRP B O   1 
ATOM   4206  C CB  . TRP B 1 230 ? 15.163  80.193  105.324 1.00 68.44  ? 730 TRP B CB  1 
ATOM   4207  C CG  . TRP B 1 230 ? 16.290  80.910  104.637 1.00 58.85  ? 730 TRP B CG  1 
ATOM   4208  C CD1 . TRP B 1 230 ? 17.475  81.330  105.197 1.00 45.85  ? 730 TRP B CD1 1 
ATOM   4209  C CD2 . TRP B 1 230 ? 16.325  81.323  103.265 1.00 50.77  ? 730 TRP B CD2 1 
ATOM   4210  N NE1 . TRP B 1 230 ? 18.241  81.973  104.248 1.00 48.18  ? 730 TRP B NE1 1 
ATOM   4211  C CE2 . TRP B 1 230 ? 17.558  81.984  103.058 1.00 51.77  ? 730 TRP B CE2 1 
ATOM   4212  C CE3 . TRP B 1 230 ? 15.435  81.199  102.194 1.00 42.12  ? 730 TRP B CE3 1 
ATOM   4213  C CZ2 . TRP B 1 230 ? 17.919  82.514  101.818 1.00 48.58  ? 730 TRP B CZ2 1 
ATOM   4214  C CZ3 . TRP B 1 230 ? 15.797  81.721  100.965 1.00 44.95  ? 730 TRP B CZ3 1 
ATOM   4215  C CH2 . TRP B 1 230 ? 17.028  82.376  100.787 1.00 43.76  ? 730 TRP B CH2 1 
ATOM   4216  N N   . GLU B 1 231 ? 11.908  81.142  106.905 1.00 73.17  ? 731 GLU B N   1 
ATOM   4217  C CA  . GLU B 1 231 ? 10.725  80.554  107.507 1.00 77.10  ? 731 GLU B CA  1 
ATOM   4218  C C   . GLU B 1 231 ? 9.526   80.920  106.652 1.00 86.97  ? 731 GLU B C   1 
ATOM   4219  O O   . GLU B 1 231 ? 9.647   81.720  105.730 1.00 80.93  ? 731 GLU B O   1 
ATOM   4220  C CB  . GLU B 1 231 ? 10.554  81.103  108.918 1.00 79.12  ? 731 GLU B CB  1 
ATOM   4221  C CG  . GLU B 1 231 ? 10.922  82.579  109.026 1.00 88.50  ? 731 GLU B CG  1 
ATOM   4222  C CD  . GLU B 1 231 ? 10.750  83.130  110.428 1.00 97.01  ? 731 GLU B CD  1 
ATOM   4223  O OE1 . GLU B 1 231 ? 10.161  82.426  111.271 1.00 99.35  ? 731 GLU B OE1 1 
ATOM   4224  O OE2 . GLU B 1 231 ? 11.203  84.266  110.687 1.00 98.64  ? 731 GLU B OE2 1 
ATOM   4225  N N   . LYS B 1 232 ? 8.373   80.328  106.944 1.00 105.20 ? 732 LYS B N   1 
ATOM   4226  C CA  . LYS B 1 232 ? 7.115   80.736  106.309 1.00 122.24 ? 732 LYS B CA  1 
ATOM   4227  C C   . LYS B 1 232 ? 7.202   80.916  104.783 1.00 127.47 ? 732 LYS B C   1 
ATOM   4228  O O   . LYS B 1 232 ? 7.274   79.934  104.037 1.00 130.25 ? 732 LYS B O   1 
ATOM   4229  C CB  . LYS B 1 232 ? 6.576   82.019  106.967 1.00 125.54 ? 732 LYS B CB  1 
ATOM   4230  C CG  . LYS B 1 232 ? 5.219   82.485  106.443 1.00 128.36 ? 732 LYS B CG  1 
ATOM   4231  C CD  . LYS B 1 232 ? 4.814   83.832  107.039 1.00 128.98 ? 732 LYS B CD  1 
ATOM   4232  C CE  . LYS B 1 232 ? 4.101   83.681  108.378 1.00 127.73 ? 732 LYS B CE  1 
ATOM   4233  N NZ  . LYS B 1 232 ? 2.661   83.326  108.218 1.00 125.41 ? 732 LYS B NZ  1 
ATOM   4234  N N   . ASN B 1 233 ? 7.193   82.173  104.335 1.00 123.56 ? 733 ASN B N   1 
ATOM   4235  C CA  . ASN B 1 233 ? 7.078   82.507  102.910 1.00 116.96 ? 733 ASN B CA  1 
ATOM   4236  C C   . ASN B 1 233 ? 8.383   82.533  102.114 1.00 107.14 ? 733 ASN B C   1 
ATOM   4237  O O   . ASN B 1 233 ? 8.365   82.752  100.901 1.00 109.71 ? 733 ASN B O   1 
ATOM   4238  C CB  . ASN B 1 233 ? 6.363   83.852  102.727 1.00 121.32 ? 733 ASN B CB  1 
ATOM   4239  C CG  . ASN B 1 233 ? 4.868   83.756  102.944 1.00 128.09 ? 733 ASN B CG  1 
ATOM   4240  O OD1 . ASN B 1 233 ? 4.130   83.318  102.060 1.00 132.93 ? 733 ASN B OD1 1 
ATOM   4241  N ND2 . ASN B 1 233 ? 4.409   84.179  104.120 1.00 127.33 ? 733 ASN B ND2 1 
ATOM   4242  N N   . ASP B 1 234 ? 9.510   82.329  102.789 1.00 94.39  ? 734 ASP B N   1 
ATOM   4243  C CA  . ASP B 1 234 ? 10.802  82.321  102.109 1.00 80.24  ? 734 ASP B CA  1 
ATOM   4244  C C   . ASP B 1 234 ? 11.291  80.906  101.876 1.00 73.38  ? 734 ASP B C   1 
ATOM   4245  O O   . ASP B 1 234 ? 12.308  80.695  101.217 1.00 74.58  ? 734 ASP B O   1 
ATOM   4246  C CB  . ASP B 1 234 ? 11.842  83.112  102.898 1.00 76.49  ? 734 ASP B CB  1 
ATOM   4247  C CG  . ASP B 1 234 ? 11.641  84.605  102.783 1.00 70.55  ? 734 ASP B CG  1 
ATOM   4248  O OD1 . ASP B 1 234 ? 11.332  85.078  101.665 1.00 66.58  ? 734 ASP B OD1 1 
ATOM   4249  O OD2 . ASP B 1 234 ? 11.786  85.296  103.814 1.00 64.31  ? 734 ASP B OD2 1 
ATOM   4250  N N   . GLN B 1 235 ? 10.573  79.938  102.439 1.00 70.58  ? 735 GLN B N   1 
ATOM   4251  C CA  . GLN B 1 235 ? 10.836  78.532  102.155 1.00 57.18  ? 735 GLN B CA  1 
ATOM   4252  C C   . GLN B 1 235 ? 10.269  78.204  100.777 1.00 47.76  ? 735 GLN B C   1 
ATOM   4253  O O   . GLN B 1 235 ? 9.280   77.465  100.667 1.00 41.08  ? 735 GLN B O   1 
ATOM   4254  C CB  . GLN B 1 235 ? 10.223  77.622  103.228 1.00 55.06  ? 735 GLN B CB  1 
ATOM   4255  C CG  . GLN B 1 235 ? 10.866  77.750  104.608 1.00 60.66  ? 735 GLN B CG  1 
ATOM   4256  C CD  . GLN B 1 235 ? 10.138  76.955  105.681 1.00 68.20  ? 735 GLN B CD  1 
ATOM   4257  O OE1 . GLN B 1 235 ? 8.926   76.757  105.609 1.00 69.07  ? 735 GLN B OE1 1 
ATOM   4258  N NE2 . GLN B 1 235 ? 10.878  76.494  106.682 1.00 71.87  ? 735 GLN B NE2 1 
ATOM   4259  N N   . SER B 1 236 ? 10.870  78.809  99.744  1.00 36.64  ? 736 SER B N   1 
ATOM   4260  C CA  . SER B 1 236 ? 10.671  78.397  98.354  1.00 39.58  ? 736 SER B CA  1 
ATOM   4261  C C   . SER B 1 236 ? 12.024  77.980  97.757  1.00 36.66  ? 736 SER B C   1 
ATOM   4262  O O   . SER B 1 236 ? 13.027  78.697  97.895  1.00 32.36  ? 736 SER B O   1 
ATOM   4263  C CB  . SER B 1 236 ? 9.990   79.504  97.519  1.00 46.41  ? 736 SER B CB  1 
ATOM   4264  O OG  . SER B 1 236 ? 10.847  80.061  96.525  1.00 49.35  ? 736 SER B OG  1 
ATOM   4265  N N   . CYS B 1 237 ? 12.051  76.804  97.130  1.00 33.34  ? 737 CYS B N   1 
ATOM   4266  C CA  . CYS B 1 237 ? 13.245  76.316  96.432  1.00 28.95  ? 737 CYS B CA  1 
ATOM   4267  C C   . CYS B 1 237 ? 13.621  77.262  95.315  1.00 25.00  ? 737 CYS B C   1 
ATOM   4268  O O   . CYS B 1 237 ? 14.793  77.388  94.953  1.00 26.18  ? 737 CYS B O   1 
ATOM   4269  C CB  . CYS B 1 237 ? 12.996  74.926  95.829  1.00 27.85  ? 737 CYS B CB  1 
ATOM   4270  S SG  . CYS B 1 237 ? 12.719  73.660  97.052  1.00 48.82  ? 737 CYS B SG  1 
ATOM   4271  N N   . GLU B 1 238 ? 12.612  77.903  94.742  1.00 25.20  ? 738 GLU B N   1 
ATOM   4272  C CA  . GLU B 1 238 ? 12.844  78.879  93.694  1.00 31.52  ? 738 GLU B CA  1 
ATOM   4273  C C   . GLU B 1 238 ? 13.805  79.965  94.181  1.00 31.75  ? 738 GLU B C   1 
ATOM   4274  O O   . GLU B 1 238 ? 14.821  80.234  93.545  1.00 32.81  ? 738 GLU B O   1 
ATOM   4275  C CB  . GLU B 1 238 ? 11.529  79.499  93.236  1.00 38.02  ? 738 GLU B CB  1 
ATOM   4276  C CG  . GLU B 1 238 ? 11.631  80.160  91.874  1.00 50.95  ? 738 GLU B CG  1 
ATOM   4277  C CD  . GLU B 1 238 ? 10.473  81.091  91.580  1.00 61.45  ? 738 GLU B CD  1 
ATOM   4278  O OE1 . GLU B 1 238 ? 9.306   80.671  91.759  1.00 61.59  ? 738 GLU B OE1 1 
ATOM   4279  O OE2 . GLU B 1 238 ? 10.739  82.245  91.173  1.00 68.16  ? 738 GLU B OE2 1 
ATOM   4280  N N   . ILE B 1 239 ? 13.492  80.580  95.318  1.00 28.49  ? 739 ILE B N   1 
ATOM   4281  C CA  . ILE B 1 239 ? 14.328  81.663  95.825  1.00 24.40  ? 739 ILE B CA  1 
ATOM   4282  C C   . ILE B 1 239 ? 15.677  81.090  96.247  1.00 23.54  ? 739 ILE B C   1 
ATOM   4283  O O   . ILE B 1 239 ? 16.737  81.633  95.915  1.00 26.10  ? 739 ILE B O   1 
ATOM   4284  C CB  . ILE B 1 239 ? 13.621  82.431  96.975  1.00 30.90  ? 739 ILE B CB  1 
ATOM   4285  C CG1 . ILE B 1 239 ? 12.375  83.130  96.426  1.00 33.09  ? 739 ILE B CG1 1 
ATOM   4286  C CG2 . ILE B 1 239 ? 14.558  83.459  97.650  1.00 11.79  ? 739 ILE B CG2 1 
ATOM   4287  C CD1 . ILE B 1 239 ? 11.550  83.816  97.487  1.00 38.12  ? 739 ILE B CD1 1 
ATOM   4288  N N   . MET B 1 240 ? 15.630  79.969  96.951  1.00 31.18  ? 740 MET B N   1 
ATOM   4289  C CA  . MET B 1 240 ? 16.847  79.274  97.357  1.00 30.64  ? 740 MET B CA  1 
ATOM   4290  C C   . MET B 1 240 ? 17.755  79.002  96.166  1.00 27.58  ? 740 MET B C   1 
ATOM   4291  O O   . MET B 1 240 ? 18.957  79.285  96.238  1.00 23.18  ? 740 MET B O   1 
ATOM   4292  C CB  . MET B 1 240 ? 16.529  77.986  98.115  1.00 24.45  ? 740 MET B CB  1 
ATOM   4293  C CG  . MET B 1 240 ? 16.368  78.190  99.617  1.00 37.51  ? 740 MET B CG  1 
ATOM   4294  S SD  . MET B 1 240 ? 15.633  76.782  100.499 1.00 37.26  ? 740 MET B SD  1 
ATOM   4295  C CE  . MET B 1 240 ? 14.039  76.689  99.694  1.00 106.29 ? 740 MET B CE  1 
ATOM   4296  N N   . LEU B 1 241 ? 17.179  78.478  95.078  1.00 20.32  ? 741 LEU B N   1 
ATOM   4297  C CA  . LEU B 1 241 ? 17.914  78.247  93.820  1.00 20.29  ? 741 LEU B CA  1 
ATOM   4298  C C   . LEU B 1 241 ? 18.528  79.539  93.236  1.00 27.28  ? 741 LEU B C   1 
ATOM   4299  O O   . LEU B 1 241 ? 19.709  79.563  92.879  1.00 26.62  ? 741 LEU B O   1 
ATOM   4300  C CB  . LEU B 1 241 ? 16.998  77.605  92.771  1.00 18.48  ? 741 LEU B CB  1 
ATOM   4301  C CG  . LEU B 1 241 ? 17.521  76.492  91.850  1.00 30.68  ? 741 LEU B CG  1 
ATOM   4302  C CD1 . LEU B 1 241 ? 16.818  76.598  90.515  1.00 31.47  ? 741 LEU B CD1 1 
ATOM   4303  C CD2 . LEU B 1 241 ? 19.044  76.458  91.649  1.00 19.12  ? 741 LEU B CD2 1 
ATOM   4304  N N   . ASN B 1 242 ? 17.723  80.597  93.123  1.00 11.10  ? 742 ASN B N   1 
ATOM   4305  C CA  . ASN B 1 242 ? 18.235  81.912  92.699  1.00 25.17  ? 742 ASN B CA  1 
ATOM   4306  C C   . ASN B 1 242 ? 19.536  82.321  93.392  1.00 19.03  ? 742 ASN B C   1 
ATOM   4307  O O   . ASN B 1 242 ? 20.473  82.765  92.748  1.00 25.47  ? 742 ASN B O   1 
ATOM   4308  C CB  . ASN B 1 242 ? 17.183  83.011  92.898  1.00 9.46   ? 742 ASN B CB  1 
ATOM   4309  C CG  . ASN B 1 242 ? 16.045  82.901  91.914  1.00 28.80  ? 742 ASN B CG  1 
ATOM   4310  O OD1 . ASN B 1 242 ? 16.232  82.422  90.800  1.00 35.41  ? 742 ASN B OD1 1 
ATOM   4311  N ND2 . ASN B 1 242 ? 14.860  83.355  92.310  1.00 24.22  ? 742 ASN B ND2 1 
ATOM   4312  N N   . HIS B 1 243 ? 19.590  82.157  94.709  1.00 22.33  ? 743 HIS B N   1 
ATOM   4313  C CA  . HIS B 1 243 ? 20.764  82.542  95.476  1.00 20.38  ? 743 HIS B CA  1 
ATOM   4314  C C   . HIS B 1 243 ? 21.946  81.606  95.215  1.00 29.23  ? 743 HIS B C   1 
ATOM   4315  O O   . HIS B 1 243 ? 23.077  82.053  94.989  1.00 21.53  ? 743 HIS B O   1 
ATOM   4316  C CB  . HIS B 1 243 ? 20.436  82.586  96.967  1.00 17.74  ? 743 HIS B CB  1 
ATOM   4317  C CG  . HIS B 1 243 ? 19.557  83.729  97.350  1.00 24.58  ? 743 HIS B CG  1 
ATOM   4318  N ND1 . HIS B 1 243 ? 19.994  85.036  97.342  1.00 33.11  ? 743 HIS B ND1 1 
ATOM   4319  C CD2 . HIS B 1 243 ? 18.261  83.766  97.741  1.00 24.86  ? 743 HIS B CD2 1 
ATOM   4320  C CE1 . HIS B 1 243 ? 19.006  85.830  97.711  1.00 31.85  ? 743 HIS B CE1 1 
ATOM   4321  N NE2 . HIS B 1 243 ? 17.945  85.085  97.965  1.00 28.70  ? 743 HIS B NE2 1 
ATOM   4322  N N   . LEU B 1 244 ? 21.680  80.305  95.229  1.00 28.74  ? 744 LEU B N   1 
ATOM   4323  C CA  . LEU B 1 244 ? 22.743  79.338  95.012  1.00 24.04  ? 744 LEU B CA  1 
ATOM   4324  C C   . LEU B 1 244 ? 23.286  79.427  93.593  1.00 27.11  ? 744 LEU B C   1 
ATOM   4325  O O   . LEU B 1 244 ? 24.496  79.359  93.400  1.00 28.79  ? 744 LEU B O   1 
ATOM   4326  C CB  . LEU B 1 244 ? 22.272  77.930  95.353  1.00 25.46  ? 744 LEU B CB  1 
ATOM   4327  C CG  . LEU B 1 244 ? 22.040  77.761  96.855  1.00 36.26  ? 744 LEU B CG  1 
ATOM   4328  C CD1 . LEU B 1 244 ? 21.392  76.417  97.153  1.00 40.71  ? 744 LEU B CD1 1 
ATOM   4329  C CD2 . LEU B 1 244 ? 23.348  77.920  97.602  1.00 32.70  ? 744 LEU B CD2 1 
ATOM   4330  N N   . ALA B 1 245 ? 22.410  79.588  92.601  1.00 24.73  ? 745 ALA B N   1 
ATOM   4331  C CA  . ALA B 1 245 ? 22.877  79.783  91.222  1.00 27.75  ? 745 ALA B CA  1 
ATOM   4332  C C   . ALA B 1 245 ? 23.733  81.054  91.111  1.00 28.54  ? 745 ALA B C   1 
ATOM   4333  O O   . ALA B 1 245 ? 24.737  81.083  90.406  1.00 20.59  ? 745 ALA B O   1 
ATOM   4334  C CB  . ALA B 1 245 ? 21.720  79.842  90.248  1.00 19.53  ? 745 ALA B CB  1 
ATOM   4335  N N   . THR B 1 246 ? 23.336  82.100  91.825  1.00 18.36  ? 746 THR B N   1 
ATOM   4336  C CA  . THR B 1 246 ? 24.079  83.338  91.793  1.00 28.45  ? 746 THR B CA  1 
ATOM   4337  C C   . THR B 1 246 ? 25.444  83.167  92.453  1.00 32.40  ? 746 THR B C   1 
ATOM   4338  O O   . THR B 1 246 ? 26.426  83.783  92.031  1.00 26.65  ? 746 THR B O   1 
ATOM   4339  C CB  . THR B 1 246 ? 23.292  84.461  92.475  1.00 29.68  ? 746 THR B CB  1 
ATOM   4340  O OG1 . THR B 1 246 ? 22.160  84.787  91.663  1.00 32.18  ? 746 THR B OG1 1 
ATOM   4341  C CG2 . THR B 1 246 ? 24.151  85.684  92.644  1.00 26.89  ? 746 THR B CG2 1 
ATOM   4342  N N   . ALA B 1 247 ? 25.501  82.330  93.485  1.00 24.24  ? 747 ALA B N   1 
ATOM   4343  C CA  . ALA B 1 247 ? 26.751  82.096  94.194  1.00 29.63  ? 747 ALA B CA  1 
ATOM   4344  C C   . ALA B 1 247 ? 27.757  81.383  93.294  1.00 30.82  ? 747 ALA B C   1 
ATOM   4345  O O   . ALA B 1 247 ? 28.955  81.671  93.322  1.00 34.88  ? 747 ALA B O   1 
ATOM   4346  C CB  . ALA B 1 247 ? 26.508  81.299  95.473  1.00 25.61  ? 747 ALA B CB  1 
ATOM   4347  N N   . ARG B 1 248 ? 27.282  80.456  92.479  1.00 30.98  ? 748 ARG B N   1 
ATOM   4348  C CA  . ARG B 1 248 ? 28.203  79.766  91.578  1.00 33.23  ? 748 ARG B CA  1 
ATOM   4349  C C   . ARG B 1 248 ? 28.758  80.760  90.547  1.00 33.77  ? 748 ARG B C   1 
ATOM   4350  O O   . ARG B 1 248 ? 29.955  80.762  90.247  1.00 37.20  ? 748 ARG B O   1 
ATOM   4351  C CB  . ARG B 1 248 ? 27.537  78.564  90.908  1.00 33.24  ? 748 ARG B CB  1 
ATOM   4352  C CG  . ARG B 1 248 ? 28.372  77.922  89.804  1.00 49.77  ? 748 ARG B CG  1 
ATOM   4353  C CD  . ARG B 1 248 ? 28.092  76.422  89.686  1.00 68.26  ? 748 ARG B CD  1 
ATOM   4354  N NE  . ARG B 1 248 ? 27.416  76.023  88.448  1.00 73.54  ? 748 ARG B NE  1 
ATOM   4355  C CZ  . ARG B 1 248 ? 26.710  76.829  87.657  1.00 80.06  ? 748 ARG B CZ  1 
ATOM   4356  N NH1 . ARG B 1 248 ? 26.557  78.117  87.951  1.00 84.20  ? 748 ARG B NH1 1 
ATOM   4357  N NH2 . ARG B 1 248 ? 26.145  76.339  86.563  1.00 81.12  ? 748 ARG B NH2 1 
ATOM   4358  N N   . PHE B 1 249 ? 27.885  81.619  90.032  1.00 33.91  ? 749 PHE B N   1 
ATOM   4359  C CA  . PHE B 1 249 ? 28.301  82.703  89.149  1.00 36.89  ? 749 PHE B CA  1 
ATOM   4360  C C   . PHE B 1 249 ? 29.277  83.643  89.854  1.00 33.46  ? 749 PHE B C   1 
ATOM   4361  O O   . PHE B 1 249 ? 30.349  83.961  89.326  1.00 32.43  ? 749 PHE B O   1 
ATOM   4362  C CB  . PHE B 1 249 ? 27.084  83.493  88.679  1.00 44.92  ? 749 PHE B CB  1 
ATOM   4363  C CG  . PHE B 1 249 ? 27.420  84.602  87.732  1.00 52.27  ? 749 PHE B CG  1 
ATOM   4364  C CD1 . PHE B 1 249 ? 27.730  84.331  86.415  1.00 47.89  ? 749 PHE B CD1 1 
ATOM   4365  C CD2 . PHE B 1 249 ? 27.430  85.919  88.161  1.00 61.26  ? 749 PHE B CD2 1 
ATOM   4366  C CE1 . PHE B 1 249 ? 28.037  85.348  85.547  1.00 56.16  ? 749 PHE B CE1 1 
ATOM   4367  C CE2 . PHE B 1 249 ? 27.737  86.943  87.290  1.00 60.88  ? 749 PHE B CE2 1 
ATOM   4368  C CZ  . PHE B 1 249 ? 28.041  86.656  85.983  1.00 59.07  ? 749 PHE B CZ  1 
ATOM   4369  N N   . MET B 1 250 ? 28.895  84.073  91.054  1.00 25.00  ? 750 MET B N   1 
ATOM   4370  C CA  . MET B 1 250 ? 29.732  84.928  91.890  1.00 19.23  ? 750 MET B CA  1 
ATOM   4371  C C   . MET B 1 250 ? 31.145  84.380  92.054  1.00 27.02  ? 750 MET B C   1 
ATOM   4372  O O   . MET B 1 250 ? 32.110  85.131  91.984  1.00 33.56  ? 750 MET B O   1 
ATOM   4373  C CB  . MET B 1 250 ? 29.091  85.131  93.274  1.00 18.62  ? 750 MET B CB  1 
ATOM   4374  C CG  . MET B 1 250 ? 30.012  85.785  94.294  1.00 18.51  ? 750 MET B CG  1 
ATOM   4375  S SD  . MET B 1 250 ? 29.310  86.043  95.926  1.00 31.84  ? 750 MET B SD  1 
ATOM   4376  C CE  . MET B 1 250 ? 29.418  84.383  96.584  1.00 21.36  ? 750 MET B CE  1 
ATOM   4377  N N   . ALA B 1 251 ? 31.268  83.075  92.275  1.00 29.66  ? 751 ALA B N   1 
ATOM   4378  C CA  . ALA B 1 251 ? 32.576  82.479  92.543  1.00 39.60  ? 751 ALA B CA  1 
ATOM   4379  C C   . ALA B 1 251 ? 33.458  82.420  91.293  1.00 44.24  ? 751 ALA B C   1 
ATOM   4380  O O   . ALA B 1 251 ? 34.668  82.627  91.368  1.00 49.10  ? 751 ALA B O   1 
ATOM   4381  C CB  . ALA B 1 251 ? 32.431  81.076  93.193  1.00 23.42  ? 751 ALA B CB  1 
ATOM   4382  N N   . GLU B 1 252 ? 32.860  82.140  90.141  1.00 45.66  ? 752 GLU B N   1 
ATOM   4383  C CA  . GLU B 1 252 ? 33.631  82.128  88.899  1.00 47.53  ? 752 GLU B CA  1 
ATOM   4384  C C   . GLU B 1 252 ? 34.053  83.534  88.477  1.00 44.57  ? 752 GLU B C   1 
ATOM   4385  O O   . GLU B 1 252 ? 35.150  83.737  87.967  1.00 46.46  ? 752 GLU B O   1 
ATOM   4386  C CB  . GLU B 1 252 ? 32.850  81.464  87.768  1.00 48.25  ? 752 GLU B CB  1 
ATOM   4387  C CG  . GLU B 1 252 ? 32.638  79.981  87.950  1.00 59.51  ? 752 GLU B CG  1 
ATOM   4388  C CD  . GLU B 1 252 ? 31.887  79.367  86.786  1.00 67.72  ? 752 GLU B CD  1 
ATOM   4389  O OE1 . GLU B 1 252 ? 31.073  78.446  87.019  1.00 67.52  ? 752 GLU B OE1 1 
ATOM   4390  O OE2 . GLU B 1 252 ? 32.114  79.808  85.639  1.00 69.50  ? 752 GLU B OE2 1 
ATOM   4391  N N   . ALA B 1 253 ? 33.179  84.508  88.697  1.00 42.50  ? 753 ALA B N   1 
ATOM   4392  C CA  . ALA B 1 253 ? 33.471  85.875  88.286  1.00 41.16  ? 753 ALA B CA  1 
ATOM   4393  C C   . ALA B 1 253 ? 33.908  86.764  89.454  1.00 33.20  ? 753 ALA B C   1 
ATOM   4394  O O   . ALA B 1 253 ? 33.584  87.939  89.492  1.00 33.29  ? 753 ALA B O   1 
ATOM   4395  C CB  . ALA B 1 253 ? 32.260  86.476  87.579  1.00 30.83  ? 753 ALA B CB  1 
ATOM   4396  N N   . ALA B 1 254 ? 34.646  86.206  90.400  1.00 32.05  ? 754 ALA B N   1 
ATOM   4397  C CA  . ALA B 1 254 ? 35.030  86.957  91.586  1.00 34.74  ? 754 ALA B CA  1 
ATOM   4398  C C   . ALA B 1 254 ? 35.857  88.208  91.250  1.00 40.44  ? 754 ALA B C   1 
ATOM   4399  O O   . ALA B 1 254 ? 35.778  89.229  91.939  1.00 40.09  ? 754 ALA B O   1 
ATOM   4400  C CB  . ALA B 1 254 ? 35.800  86.054  92.556  1.00 30.74  ? 754 ALA B CB  1 
ATOM   4401  N N   . ASP B 1 255 ? 36.654  88.129  90.193  1.00 32.84  ? 755 ASP B N   1 
ATOM   4402  C CA  . ASP B 1 255 ? 37.572  89.210  89.881  1.00 31.38  ? 755 ASP B CA  1 
ATOM   4403  C C   . ASP B 1 255 ? 36.859  90.454  89.339  1.00 29.62  ? 755 ASP B C   1 
ATOM   4404  O O   . ASP B 1 255 ? 37.347  91.579  89.487  1.00 31.85  ? 755 ASP B O   1 
ATOM   4405  C CB  . ASP B 1 255 ? 38.650  88.737  88.899  1.00 30.49  ? 755 ASP B CB  1 
ATOM   4406  C CG  . ASP B 1 255 ? 39.911  89.576  88.975  1.00 45.47  ? 755 ASP B CG  1 
ATOM   4407  O OD1 . ASP B 1 255 ? 40.350  90.061  87.906  1.00 59.69  ? 755 ASP B OD1 1 
ATOM   4408  O OD2 . ASP B 1 255 ? 40.461  89.754  90.095  1.00 42.47  ? 755 ASP B OD2 1 
ATOM   4409  N N   . SER B 1 256 ? 35.714  90.258  88.700  1.00 23.68  ? 756 SER B N   1 
ATOM   4410  C CA  . SER B 1 256 ? 34.978  91.391  88.163  1.00 32.79  ? 756 SER B CA  1 
ATOM   4411  C C   . SER B 1 256 ? 34.541  92.304  89.299  1.00 26.90  ? 756 SER B C   1 
ATOM   4412  O O   . SER B 1 256 ? 34.588  93.527  89.150  1.00 19.95  ? 756 SER B O   1 
ATOM   4413  C CB  . SER B 1 256 ? 33.770  90.940  87.355  1.00 37.06  ? 756 SER B CB  1 
ATOM   4414  O OG  . SER B 1 256 ? 32.801  90.389  88.219  1.00 43.46  ? 756 SER B OG  1 
ATOM   4415  N N   . TYR B 1 257 ? 34.145  91.718  90.435  1.00 20.02  ? 757 TYR B N   1 
ATOM   4416  C CA  . TYR B 1 257 ? 33.804  92.528  91.612  1.00 21.58  ? 757 TYR B CA  1 
ATOM   4417  C C   . TYR B 1 257 ? 35.008  93.322  92.090  1.00 24.68  ? 757 TYR B C   1 
ATOM   4418  O O   . TYR B 1 257 ? 34.891  94.490  92.437  1.00 28.94  ? 757 TYR B O   1 
ATOM   4419  C CB  . TYR B 1 257 ? 33.278  91.663  92.760  1.00 16.49  ? 757 TYR B CB  1 
ATOM   4420  C CG  . TYR B 1 257 ? 32.038  90.862  92.406  1.00 31.31  ? 757 TYR B CG  1 
ATOM   4421  C CD1 . TYR B 1 257 ? 30.774  91.447  92.429  1.00 28.42  ? 757 TYR B CD1 1 
ATOM   4422  C CD2 . TYR B 1 257 ? 32.134  89.528  92.040  1.00 28.99  ? 757 TYR B CD2 1 
ATOM   4423  C CE1 . TYR B 1 257 ? 29.651  90.725  92.103  1.00 27.86  ? 757 TYR B CE1 1 
ATOM   4424  C CE2 . TYR B 1 257 ? 31.015  88.796  91.719  1.00 33.10  ? 757 TYR B CE2 1 
ATOM   4425  C CZ  . TYR B 1 257 ? 29.772  89.396  91.753  1.00 37.70  ? 757 TYR B CZ  1 
ATOM   4426  O OH  . TYR B 1 257 ? 28.653  88.654  91.432  1.00 35.35  ? 757 TYR B OH  1 
ATOM   4427  N N   . ARG B 1 258 ? 36.162  92.663  92.116  1.00 27.86  ? 758 ARG B N   1 
ATOM   4428  C CA  . ARG B 1 258 ? 37.412  93.263  92.571  1.00 30.97  ? 758 ARG B CA  1 
ATOM   4429  C C   . ARG B 1 258 ? 37.770  94.487  91.732  1.00 29.18  ? 758 ARG B C   1 
ATOM   4430  O O   . ARG B 1 258 ? 38.025  95.550  92.278  1.00 30.87  ? 758 ARG B O   1 
ATOM   4431  C CB  . ARG B 1 258 ? 38.543  92.230  92.498  1.00 27.59  ? 758 ARG B CB  1 
ATOM   4432  C CG  . ARG B 1 258 ? 39.776  92.527  93.338  1.00 29.64  ? 758 ARG B CG  1 
ATOM   4433  C CD  . ARG B 1 258 ? 40.934  93.077  92.513  1.00 33.39  ? 758 ARG B CD  1 
ATOM   4434  N NE  . ARG B 1 258 ? 41.132  92.392  91.238  1.00 39.63  ? 758 ARG B NE  1 
ATOM   4435  C CZ  . ARG B 1 258 ? 41.887  92.874  90.253  1.00 43.75  ? 758 ARG B CZ  1 
ATOM   4436  N NH1 . ARG B 1 258 ? 42.521  94.024  90.413  1.00 50.80  ? 758 ARG B NH1 1 
ATOM   4437  N NH2 . ARG B 1 258 ? 42.016  92.217  89.110  1.00 38.82  ? 758 ARG B NH2 1 
ATOM   4438  N N   . MET B 1 259 ? 37.796  94.322  90.408  1.00 16.98  ? 759 MET B N   1 
ATOM   4439  C CA  . MET B 1 259 ? 38.096  95.411  89.486  1.00 23.43  ? 759 MET B CA  1 
ATOM   4440  C C   . MET B 1 259 ? 37.103  96.570  89.623  1.00 32.58  ? 759 MET B C   1 
ATOM   4441  O O   . MET B 1 259 ? 37.490  97.742  89.571  1.00 27.11  ? 759 MET B O   1 
ATOM   4442  C CB  . MET B 1 259 ? 38.088  94.909  88.041  1.00 23.46  ? 759 MET B CB  1 
ATOM   4443  C CG  . MET B 1 259 ? 39.202  93.921  87.738  1.00 36.02  ? 759 MET B CG  1 
ATOM   4444  S SD  . MET B 1 259 ? 39.246  93.426  86.001  1.00 50.41  ? 759 MET B SD  1 
ATOM   4445  C CE  . MET B 1 259 ? 37.533  92.957  85.737  1.00 86.59  ? 759 MET B CE  1 
ATOM   4446  N N   . ASN B 1 260 ? 35.826  96.231  89.778  1.00 23.64  ? 760 ASN B N   1 
ATOM   4447  C CA  . ASN B 1 260 ? 34.793  97.235  89.923  1.00 22.81  ? 760 ASN B CA  1 
ATOM   4448  C C   . ASN B 1 260 ? 35.037  98.095  91.155  1.00 25.80  ? 760 ASN B C   1 
ATOM   4449  O O   . ASN B 1 260 ? 34.922  99.320  91.094  1.00 30.05  ? 760 ASN B O   1 
ATOM   4450  C CB  . ASN B 1 260 ? 33.406  96.593  89.975  1.00 18.30  ? 760 ASN B CB  1 
ATOM   4451  C CG  . ASN B 1 260 ? 32.289  97.594  89.735  1.00 26.67  ? 760 ASN B CG  1 
ATOM   4452  O OD1 . ASN B 1 260 ? 32.042  97.986  88.601  1.00 32.19  ? 760 ASN B OD1 1 
ATOM   4453  N ND2 . ASN B 1 260 ? 31.602  98.007  90.807  1.00 21.38  ? 760 ASN B ND2 1 
ATOM   4454  N N   . ALA B 1 261 ? 35.395  97.461  92.266  1.00 23.80  ? 761 ALA B N   1 
ATOM   4455  C CA  . ALA B 1 261 ? 35.670  98.201  93.498  1.00 23.76  ? 761 ALA B CA  1 
ATOM   4456  C C   . ALA B 1 261 ? 36.943  99.056  93.382  1.00 33.67  ? 761 ALA B C   1 
ATOM   4457  O O   . ALA B 1 261 ? 37.007  100.167 93.931  1.00 28.82  ? 761 ALA B O   1 
ATOM   4458  C CB  . ALA B 1 261 ? 35.766  97.254  94.698  1.00 9.98   ? 761 ALA B CB  1 
ATOM   4459  N N   . GLU B 1 262 ? 37.951  98.535  92.679  1.00 23.79  ? 762 GLU B N   1 
ATOM   4460  C CA  . GLU B 1 262 ? 39.197  99.262  92.497  1.00 24.96  ? 762 GLU B CA  1 
ATOM   4461  C C   . GLU B 1 262 ? 38.981  100.520 91.689  1.00 33.69  ? 762 GLU B C   1 
ATOM   4462  O O   . GLU B 1 262 ? 39.563  101.556 91.980  1.00 40.32  ? 762 GLU B O   1 
ATOM   4463  C CB  . GLU B 1 262 ? 40.223  98.411  91.788  1.00 17.33  ? 762 GLU B CB  1 
ATOM   4464  C CG  . GLU B 1 262 ? 40.974  97.501  92.705  1.00 35.49  ? 762 GLU B CG  1 
ATOM   4465  C CD  . GLU B 1 262 ? 41.996  96.674  91.950  1.00 61.31  ? 762 GLU B CD  1 
ATOM   4466  O OE1 . GLU B 1 262 ? 42.046  96.792  90.699  1.00 64.91  ? 762 GLU B OE1 1 
ATOM   4467  O OE2 . GLU B 1 262 ? 42.749  95.916  92.604  1.00 70.01  ? 762 GLU B OE2 1 
ATOM   4468  N N   . ARG B 1 263 ? 38.153  100.412 90.660  1.00 28.75  ? 763 ARG B N   1 
ATOM   4469  C CA  . ARG B 1 263 ? 37.853  101.536 89.795  1.00 24.19  ? 763 ARG B CA  1 
ATOM   4470  C C   . ARG B 1 263 ? 37.133  102.640 90.567  1.00 27.41  ? 763 ARG B C   1 
ATOM   4471  O O   . ARG B 1 263 ? 37.450  103.808 90.444  1.00 29.91  ? 763 ARG B O   1 
ATOM   4472  C CB  . ARG B 1 263 ? 36.980  101.068 88.634  1.00 18.83  ? 763 ARG B CB  1 
ATOM   4473  C CG  . ARG B 1 263 ? 36.496  102.208 87.764  1.00 27.36  ? 763 ARG B CG  1 
ATOM   4474  C CD  . ARG B 1 263 ? 35.611  101.719 86.640  1.00 34.20  ? 763 ARG B CD  1 
ATOM   4475  N NE  . ARG B 1 263 ? 34.418  101.014 87.113  1.00 43.33  ? 763 ARG B NE  1 
ATOM   4476  C CZ  . ARG B 1 263 ? 33.302  101.612 87.525  1.00 39.23  ? 763 ARG B CZ  1 
ATOM   4477  N NH1 . ARG B 1 263 ? 33.222  102.935 87.550  1.00 40.59  ? 763 ARG B NH1 1 
ATOM   4478  N NH2 . ARG B 1 263 ? 32.273  100.884 87.930  1.00 29.87  ? 763 ARG B NH2 1 
ATOM   4479  N N   . ILE B 1 264 ? 36.154  102.245 91.366  1.00 29.01  ? 764 ILE B N   1 
ATOM   4480  C CA  . ILE B 1 264 ? 35.341  103.180 92.124  1.00 25.70  ? 764 ILE B CA  1 
ATOM   4481  C C   . ILE B 1 264 ? 36.153  103.874 93.216  1.00 26.84  ? 764 ILE B C   1 
ATOM   4482  O O   . ILE B 1 264 ? 35.865  105.015 93.580  1.00 26.82  ? 764 ILE B O   1 
ATOM   4483  C CB  . ILE B 1 264 ? 34.095  102.458 92.720  1.00 23.43  ? 764 ILE B CB  1 
ATOM   4484  C CG1 . ILE B 1 264 ? 33.073  102.151 91.619  1.00 19.85  ? 764 ILE B CG1 1 
ATOM   4485  C CG2 . ILE B 1 264 ? 33.455  103.256 93.832  1.00 18.39  ? 764 ILE B CG2 1 
ATOM   4486  C CD1 . ILE B 1 264 ? 32.010  101.219 92.042  1.00 22.70  ? 764 ILE B CD1 1 
ATOM   4487  N N   . LEU B 1 265 ? 37.182  103.201 93.720  1.00 20.30  ? 765 LEU B N   1 
ATOM   4488  C CA  . LEU B 1 265 ? 37.916  103.706 94.878  1.00 26.04  ? 765 LEU B CA  1 
ATOM   4489  C C   . LEU B 1 265 ? 39.261  104.323 94.536  1.00 30.75  ? 765 LEU B C   1 
ATOM   4490  O O   . LEU B 1 265 ? 40.012  104.667 95.444  1.00 25.04  ? 765 LEU B O   1 
ATOM   4491  C CB  . LEU B 1 265 ? 38.138  102.604 95.913  1.00 26.60  ? 765 LEU B CB  1 
ATOM   4492  C CG  . LEU B 1 265 ? 36.905  102.181 96.712  1.00 25.66  ? 765 LEU B CG  1 
ATOM   4493  C CD1 . LEU B 1 265 ? 37.268  101.027 97.599  1.00 19.33  ? 765 LEU B CD1 1 
ATOM   4494  C CD2 . LEU B 1 265 ? 36.357  103.334 97.529  1.00 21.90  ? 765 LEU B CD2 1 
ATOM   4495  N N   . ALA B 1 266 ? 39.555  104.474 93.244  1.00 28.88  ? 766 ALA B N   1 
ATOM   4496  C CA  . ALA B 1 266 ? 40.898  104.860 92.806  1.00 38.56  ? 766 ALA B CA  1 
ATOM   4497  C C   . ALA B 1 266 ? 41.404  106.195 93.386  1.00 42.55  ? 766 ALA B C   1 
ATOM   4498  O O   . ALA B 1 266 ? 42.531  106.285 93.872  1.00 43.12  ? 766 ALA B O   1 
ATOM   4499  C CB  . ALA B 1 266 ? 40.996  104.841 91.280  1.00 34.14  ? 766 ALA B CB  1 
ATOM   4500  N N   . GLY B 1 267 ? 40.582  107.229 93.366  1.00 31.18  ? 767 GLY B N   1 
ATOM   4501  C CA  . GLY B 1 267 ? 41.032  108.474 93.955  1.00 38.64  ? 767 GLY B CA  1 
ATOM   4502  C C   . GLY B 1 267 ? 40.598  108.648 95.399  1.00 43.06  ? 767 GLY B C   1 
ATOM   4503  O O   . GLY B 1 267 ? 40.412  109.774 95.862  1.00 48.87  ? 767 GLY B O   1 
ATOM   4504  N N   . PHE B 1 268 ? 40.420  107.543 96.115  1.00 33.20  ? 768 PHE B N   1 
ATOM   4505  C CA  . PHE B 1 268 ? 39.891  107.612 97.477  1.00 21.84  ? 768 PHE B CA  1 
ATOM   4506  C C   . PHE B 1 268 ? 40.945  107.376 98.541  1.00 29.01  ? 768 PHE B C   1 
ATOM   4507  O O   . PHE B 1 268 ? 41.736  106.438 98.450  1.00 30.79  ? 768 PHE B O   1 
ATOM   4508  C CB  . PHE B 1 268 ? 38.758  106.616 97.658  1.00 19.64  ? 768 PHE B CB  1 
ATOM   4509  C CG  . PHE B 1 268 ? 38.320  106.426 99.092  1.00 32.47  ? 768 PHE B CG  1 
ATOM   4510  C CD1 . PHE B 1 268 ? 37.469  107.336 99.709  1.00 36.39  ? 768 PHE B CD1 1 
ATOM   4511  C CD2 . PHE B 1 268 ? 38.724  105.309 99.813  1.00 35.17  ? 768 PHE B CD2 1 
ATOM   4512  C CE1 . PHE B 1 268 ? 37.049  107.139 101.024 1.00 36.61  ? 768 PHE B CE1 1 
ATOM   4513  C CE2 . PHE B 1 268 ? 38.306  105.112 101.128 1.00 25.25  ? 768 PHE B CE2 1 
ATOM   4514  C CZ  . PHE B 1 268 ? 37.472  106.022 101.732 1.00 27.40  ? 768 PHE B CZ  1 
ATOM   4515  N N   . GLN B 1 269 ? 40.946  108.240 99.551  1.00 37.76  ? 769 GLN B N   1 
ATOM   4516  C CA  . GLN B 1 269 ? 41.831  108.082 100.694 1.00 44.85  ? 769 GLN B CA  1 
ATOM   4517  C C   . GLN B 1 269 ? 41.009  108.122 101.971 1.00 40.00  ? 769 GLN B C   1 
ATOM   4518  O O   . GLN B 1 269 ? 40.366  109.119 102.281 1.00 43.25  ? 769 GLN B O   1 
ATOM   4519  C CB  . GLN B 1 269 ? 42.893  109.180 100.718 1.00 61.84  ? 769 GLN B CB  1 
ATOM   4520  C CG  . GLN B 1 269 ? 44.027  108.921 101.702 1.00 78.36  ? 769 GLN B CG  1 
ATOM   4521  C CD  . GLN B 1 269 ? 45.051  107.927 101.169 1.00 90.21  ? 769 GLN B CD  1 
ATOM   4522  O OE1 . GLN B 1 269 ? 45.295  106.876 101.771 1.00 91.58  ? 769 GLN B OE1 1 
ATOM   4523  N NE2 . GLN B 1 269 ? 45.661  108.261 100.035 1.00 91.32  ? 769 GLN B NE2 1 
ATOM   4524  N N   . PRO B 1 270 ? 41.028  107.032 102.730 1.00 35.06  ? 770 PRO B N   1 
ATOM   4525  C CA  . PRO B 1 270 ? 40.183  106.973 103.921 1.00 39.40  ? 770 PRO B CA  1 
ATOM   4526  C C   . PRO B 1 270 ? 40.609  108.002 104.953 1.00 52.05  ? 770 PRO B C   1 
ATOM   4527  O O   . PRO B 1 270 ? 41.808  108.260 105.115 1.00 62.16  ? 770 PRO B O   1 
ATOM   4528  C CB  . PRO B 1 270 ? 40.465  105.578 104.461 1.00 36.15  ? 770 PRO B CB  1 
ATOM   4529  C CG  . PRO B 1 270 ? 41.842  105.293 104.008 1.00 37.83  ? 770 PRO B CG  1 
ATOM   4530  C CD  . PRO B 1 270 ? 41.935  105.882 102.640 1.00 32.76  ? 770 PRO B CD  1 
ATOM   4531  N N   . ASP B 1 271 ? 39.640  108.591 105.640 1.00 45.66  ? 771 ASP B N   1 
ATOM   4532  C CA  . ASP B 1 271 ? 39.959  109.423 106.782 1.00 47.44  ? 771 ASP B CA  1 
ATOM   4533  C C   . ASP B 1 271 ? 40.081  108.490 107.962 1.00 43.02  ? 771 ASP B C   1 
ATOM   4534  O O   . ASP B 1 271 ? 39.279  107.569 108.113 1.00 36.28  ? 771 ASP B O   1 
ATOM   4535  C CB  . ASP B 1 271 ? 38.868  110.442 107.060 1.00 47.96  ? 771 ASP B CB  1 
ATOM   4536  C CG  . ASP B 1 271 ? 38.866  110.879 108.502 1.00 49.48  ? 771 ASP B CG  1 
ATOM   4537  O OD1 . ASP B 1 271 ? 39.872  111.473 108.940 1.00 60.93  ? 771 ASP B OD1 1 
ATOM   4538  O OD2 . ASP B 1 271 ? 37.875  110.614 109.203 1.00 46.48  ? 771 ASP B OD2 1 
ATOM   4539  N N   . GLU B 1 272 ? 41.071  108.725 108.806 1.00 43.58  ? 772 GLU B N   1 
ATOM   4540  C CA  . GLU B 1 272 ? 41.431  107.722 109.799 1.00 48.27  ? 772 GLU B CA  1 
ATOM   4541  C C   . GLU B 1 272 ? 40.300  107.394 110.782 1.00 46.26  ? 772 GLU B C   1 
ATOM   4542  O O   . GLU B 1 272 ? 39.994  106.229 111.022 1.00 42.92  ? 772 GLU B O   1 
ATOM   4543  C CB  . GLU B 1 272 ? 42.706  108.120 110.544 1.00 49.50  ? 772 GLU B CB  1 
ATOM   4544  C CG  . GLU B 1 272 ? 43.440  106.925 111.132 1.00 64.08  ? 772 GLU B CG  1 
ATOM   4545  C CD  . GLU B 1 272 ? 44.424  107.301 112.233 1.00 74.86  ? 772 GLU B CD  1 
ATOM   4546  O OE1 . GLU B 1 272 ? 44.829  108.485 112.321 1.00 75.88  ? 772 GLU B OE1 1 
ATOM   4547  O OE2 . GLU B 1 272 ? 44.784  106.398 113.018 1.00 74.17  ? 772 GLU B OE2 1 
ATOM   4548  N N   . GLU B 1 273 ? 39.670  108.416 111.345 1.00 46.70  ? 773 GLU B N   1 
ATOM   4549  C CA  . GLU B 1 273 ? 38.676  108.181 112.379 1.00 44.61  ? 773 GLU B CA  1 
ATOM   4550  C C   . GLU B 1 273 ? 37.405  107.538 111.813 1.00 41.02  ? 773 GLU B C   1 
ATOM   4551  O O   . GLU B 1 273 ? 36.797  106.670 112.448 1.00 33.58  ? 773 GLU B O   1 
ATOM   4552  C CB  . GLU B 1 273 ? 38.343  109.485 113.082 1.00 40.99  ? 773 GLU B CB  1 
ATOM   4553  C CG  . GLU B 1 273 ? 37.536  109.316 114.338 1.00 44.79  ? 773 GLU B CG  1 
ATOM   4554  C CD  . GLU B 1 273 ? 37.145  110.648 114.939 1.00 50.98  ? 773 GLU B CD  1 
ATOM   4555  O OE1 . GLU B 1 273 ? 37.578  111.697 114.409 1.00 44.05  ? 773 GLU B OE1 1 
ATOM   4556  O OE2 . GLU B 1 273 ? 36.408  110.645 115.943 1.00 57.33  ? 773 GLU B OE2 1 
ATOM   4557  N N   . MET B 1 274 ? 37.014  107.969 110.619 1.00 30.04  ? 774 MET B N   1 
ATOM   4558  C CA  . MET B 1 274 ? 35.818  107.462 109.978 1.00 26.15  ? 774 MET B CA  1 
ATOM   4559  C C   . MET B 1 274 ? 36.031  105.996 109.618 1.00 42.94  ? 774 MET B C   1 
ATOM   4560  O O   . MET B 1 274 ? 35.133  105.157 109.745 1.00 41.25  ? 774 MET B O   1 
ATOM   4561  C CB  . MET B 1 274 ? 35.516  108.268 108.724 1.00 30.87  ? 774 MET B CB  1 
ATOM   4562  C CG  . MET B 1 274 ? 34.318  107.749 107.951 1.00 45.51  ? 774 MET B CG  1 
ATOM   4563  S SD  . MET B 1 274 ? 32.731  108.203 108.691 1.00 65.99  ? 774 MET B SD  1 
ATOM   4564  C CE  . MET B 1 274 ? 32.598  109.910 108.150 1.00 34.33  ? 774 MET B CE  1 
ATOM   4565  N N   . ASN B 1 275 ? 37.235  105.683 109.165 1.00 42.70  ? 775 ASN B N   1 
ATOM   4566  C CA  . ASN B 1 275 ? 37.572  104.303 108.888 1.00 30.09  ? 775 ASN B CA  1 
ATOM   4567  C C   . ASN B 1 275 ? 37.484  103.487 110.167 1.00 32.65  ? 775 ASN B C   1 
ATOM   4568  O O   . ASN B 1 275 ? 37.081  102.334 110.138 1.00 35.27  ? 775 ASN B O   1 
ATOM   4569  C CB  . ASN B 1 275 ? 38.974  104.204 108.294 1.00 29.20  ? 775 ASN B CB  1 
ATOM   4570  C CG  . ASN B 1 275 ? 39.279  102.829 107.759 1.00 34.92  ? 775 ASN B CG  1 
ATOM   4571  O OD1 . ASN B 1 275 ? 40.031  102.065 108.368 1.00 36.99  ? 775 ASN B OD1 1 
ATOM   4572  N ND2 . ASN B 1 275 ? 38.701  102.502 106.607 1.00 39.94  ? 775 ASN B ND2 1 
ATOM   4573  N N   . GLU B 1 276 ? 37.859  104.084 111.294 1.00 32.87  ? 776 GLU B N   1 
ATOM   4574  C CA  . GLU B 1 276 ? 37.842  103.362 112.561 1.00 37.95  ? 776 GLU B CA  1 
ATOM   4575  C C   . GLU B 1 276 ? 36.431  102.934 112.945 1.00 39.29  ? 776 GLU B C   1 
ATOM   4576  O O   . GLU B 1 276 ? 36.200  101.781 113.332 1.00 44.11  ? 776 GLU B O   1 
ATOM   4577  C CB  . GLU B 1 276 ? 38.491  104.180 113.682 1.00 39.25  ? 776 GLU B CB  1 
ATOM   4578  C CG  . GLU B 1 276 ? 40.025  104.173 113.659 1.00 48.41  ? 776 GLU B CG  1 
ATOM   4579  C CD  . GLU B 1 276 ? 40.625  102.767 113.693 1.00 53.44  ? 776 GLU B CD  1 
ATOM   4580  O OE1 . GLU B 1 276 ? 40.665  102.148 114.783 1.00 54.97  ? 776 GLU B OE1 1 
ATOM   4581  O OE2 . GLU B 1 276 ? 41.072  102.286 112.628 1.00 48.37  ? 776 GLU B OE2 1 
ATOM   4582  N N   . ILE B 1 277 ? 35.491  103.860 112.804 1.00 33.23  ? 777 ILE B N   1 
ATOM   4583  C CA  . ILE B 1 277 ? 34.113  103.631 113.209 1.00 39.78  ? 777 ILE B CA  1 
ATOM   4584  C C   . ILE B 1 277 ? 33.415  102.665 112.250 1.00 41.05  ? 777 ILE B C   1 
ATOM   4585  O O   . ILE B 1 277 ? 32.385  102.081 112.582 1.00 45.22  ? 777 ILE B O   1 
ATOM   4586  C CB  . ILE B 1 277 ? 33.333  104.961 113.275 1.00 39.46  ? 777 ILE B CB  1 
ATOM   4587  C CG1 . ILE B 1 277 ? 32.291  104.917 114.378 1.00 40.78  ? 777 ILE B CG1 1 
ATOM   4588  C CG2 . ILE B 1 277 ? 32.650  105.263 111.952 1.00 44.34  ? 777 ILE B CG2 1 
ATOM   4589  C CD1 . ILE B 1 277 ? 31.296  106.052 114.279 1.00 44.77  ? 777 ILE B CD1 1 
ATOM   4590  N N   . CYS B 1 278 ? 33.976  102.507 111.056 1.00 34.39  ? 778 CYS B N   1 
ATOM   4591  C CA  . CYS B 1 278 ? 33.472  101.517 110.111 1.00 35.12  ? 778 CYS B CA  1 
ATOM   4592  C C   . CYS B 1 278 ? 33.911  100.080 110.450 1.00 33.32  ? 778 CYS B C   1 
ATOM   4593  O O   . CYS B 1 278 ? 33.431  99.135  109.834 1.00 29.56  ? 778 CYS B O   1 
ATOM   4594  C CB  . CYS B 1 278 ? 33.876  101.871 108.677 1.00 35.35  ? 778 CYS B CB  1 
ATOM   4595  S SG  . CYS B 1 278 ? 32.926  103.232 107.925 1.00 40.40  ? 778 CYS B SG  1 
ATOM   4596  N N   . LYS B 1 279 ? 34.814  99.917  111.421 1.00 26.19  ? 779 LYS B N   1 
ATOM   4597  C CA  . LYS B 1 279 ? 35.252  98.581  111.824 1.00 28.87  ? 779 LYS B CA  1 
ATOM   4598  C C   . LYS B 1 279 ? 34.211  97.904  112.709 1.00 32.86  ? 779 LYS B C   1 
ATOM   4599  O O   . LYS B 1 279 ? 33.689  98.513  113.645 1.00 34.80  ? 779 LYS B O   1 
ATOM   4600  C CB  . LYS B 1 279 ? 36.593  98.620  112.552 1.00 31.78  ? 779 LYS B CB  1 
ATOM   4601  C CG  . LYS B 1 279 ? 37.781  98.891  111.658 1.00 40.21  ? 779 LYS B CG  1 
ATOM   4602  C CD  . LYS B 1 279 ? 39.059  99.032  112.476 1.00 39.79  ? 779 LYS B CD  1 
ATOM   4603  C CE  . LYS B 1 279 ? 40.210  99.548  111.629 1.00 40.75  ? 779 LYS B CE  1 
ATOM   4604  N NZ  . LYS B 1 279 ? 41.500  99.583  112.379 1.00 44.75  ? 779 LYS B NZ  1 
ATOM   4605  N N   . THR B 1 280 ? 33.917  96.640  112.412 1.00 28.36  ? 780 THR B N   1 
ATOM   4606  C CA  . THR B 1 280 ? 32.901  95.901  113.153 1.00 28.04  ? 780 THR B CA  1 
ATOM   4607  C C   . THR B 1 280 ? 33.232  95.797  114.648 1.00 32.48  ? 780 THR B C   1 
ATOM   4608  O O   . THR B 1 280 ? 32.339  95.827  115.494 1.00 27.59  ? 780 THR B O   1 
ATOM   4609  C CB  . THR B 1 280 ? 32.662  94.505  112.532 1.00 30.16  ? 780 THR B CB  1 
ATOM   4610  O OG1 . THR B 1 280 ? 31.984  94.663  111.276 1.00 26.03  ? 780 THR B OG1 1 
ATOM   4611  C CG2 . THR B 1 280 ? 31.817  93.619  113.473 1.00 28.13  ? 780 THR B CG2 1 
ATOM   4612  N N   . GLU B 1 281 ? 34.525  95.711  114.952 1.00 35.66  ? 781 GLU B N   1 
ATOM   4613  C CA  A GLU B 1 281 ? 34.980  95.629  116.337 0.41 39.09  ? 781 GLU B CA  1 
ATOM   4614  C CA  B GLU B 1 281 ? 35.025  95.652  116.326 0.59 39.18  ? 781 GLU B CA  1 
ATOM   4615  C C   . GLU B 1 281 ? 34.659  96.927  117.089 1.00 41.00  ? 781 GLU B C   1 
ATOM   4616  O O   . GLU B 1 281 ? 34.205  96.898  118.238 1.00 37.42  ? 781 GLU B O   1 
ATOM   4617  C CB  A GLU B 1 281 ? 36.480  95.323  116.378 0.41 43.47  ? 781 GLU B CB  1 
ATOM   4618  C CB  B GLU B 1 281 ? 36.550  95.486  116.316 0.59 41.63  ? 781 GLU B CB  1 
ATOM   4619  C CG  A GLU B 1 281 ? 36.940  94.491  115.183 0.41 49.82  ? 781 GLU B CG  1 
ATOM   4620  C CG  B GLU B 1 281 ? 37.065  94.313  115.465 0.59 49.03  ? 781 GLU B CG  1 
ATOM   4621  C CD  A GLU B 1 281 ? 38.156  93.630  115.464 0.41 53.47  ? 781 GLU B CD  1 
ATOM   4622  C CD  B GLU B 1 281 ? 37.516  94.725  114.060 0.59 46.30  ? 781 GLU B CD  1 
ATOM   4623  O OE1 A GLU B 1 281 ? 39.007  93.508  114.557 0.41 57.27  ? 781 GLU B OE1 1 
ATOM   4624  O OE1 B GLU B 1 281 ? 36.697  95.282  113.296 0.59 32.31  ? 781 GLU B OE1 1 
ATOM   4625  O OE2 A GLU B 1 281 ? 38.253  93.059  116.571 0.41 53.66  ? 781 GLU B OE2 1 
ATOM   4626  O OE2 B GLU B 1 281 ? 38.695  94.483  113.715 0.59 51.77  ? 781 GLU B OE2 1 
ATOM   4627  H H   A GLU B 1 281 ? 35.160  95.698  114.373 0.41 42.69  ? 781 GLU B H   1 
ATOM   4628  H H   B GLU B 1 281 ? 35.150  95.684  114.363 0.59 42.69  ? 781 GLU B H   1 
ATOM   4629  H HA  A GLU B 1 281 ? 34.509  94.896  116.785 0.41 46.80  ? 781 GLU B HA  1 
ATOM   4630  H HA  B GLU B 1 281 ? 34.628  94.884  116.788 0.59 46.91  ? 781 GLU B HA  1 
ATOM   4631  H HB2 A GLU B 1 281 ? 36.974  96.158  116.372 0.41 52.06  ? 781 GLU B HB2 1 
ATOM   4632  H HB2 B GLU B 1 281 ? 36.947  96.299  115.966 0.59 49.85  ? 781 GLU B HB2 1 
ATOM   4633  H HB3 A GLU B 1 281 ? 36.679  94.825  117.186 0.41 52.06  ? 781 GLU B HB3 1 
ATOM   4634  H HB3 B GLU B 1 281 ? 36.851  95.342  117.227 0.59 49.85  ? 781 GLU B HB3 1 
ATOM   4635  H HG2 A GLU B 1 281 ? 36.217  93.903  114.915 0.41 59.68  ? 781 GLU B HG2 1 
ATOM   4636  H HG2 B GLU B 1 281 ? 37.824  93.910  115.915 0.59 58.73  ? 781 GLU B HG2 1 
ATOM   4637  H HG3 A GLU B 1 281 ? 37.164  95.090  114.453 0.41 59.68  ? 781 GLU B HG3 1 
ATOM   4638  H HG3 B GLU B 1 281 ? 36.354  93.660  115.369 0.59 58.73  ? 781 GLU B HG3 1 
ATOM   4639  N N   . PHE B 1 282 ? 34.870  98.060  116.437 1.00 37.96  ? 782 PHE B N   1 
ATOM   4640  C CA  . PHE B 1 282 ? 34.542  99.353  117.011 1.00 39.53  ? 782 PHE B CA  1 
ATOM   4641  C C   . PHE B 1 282 ? 33.043  99.409  117.371 1.00 36.05  ? 782 PHE B C   1 
ATOM   4642  O O   . PHE B 1 282 ? 32.680  99.706  118.510 1.00 42.27  ? 782 PHE B O   1 
ATOM   4643  C CB  . PHE B 1 282 ? 34.906  100.442 116.000 1.00 41.29  ? 782 PHE B CB  1 
ATOM   4644  C CG  . PHE B 1 282 ? 35.282  101.742 116.619 1.00 47.56  ? 782 PHE B CG  1 
ATOM   4645  C CD1 . PHE B 1 282 ? 36.616  102.063 116.818 1.00 60.45  ? 782 PHE B CD1 1 
ATOM   4646  C CD2 . PHE B 1 282 ? 34.309  102.651 116.995 1.00 47.78  ? 782 PHE B CD2 1 
ATOM   4647  C CE1 . PHE B 1 282 ? 36.977  103.262 117.393 1.00 62.18  ? 782 PHE B CE1 1 
ATOM   4648  C CE2 . PHE B 1 282 ? 34.657  103.851 117.568 1.00 55.02  ? 782 PHE B CE2 1 
ATOM   4649  C CZ  . PHE B 1 282 ? 35.997  104.160 117.771 1.00 61.26  ? 782 PHE B CZ  1 
ATOM   4650  N N   . GLN B 1 283 ? 32.183  99.100  116.403 1.00 27.62  ? 783 GLN B N   1 
ATOM   4651  C CA  . GLN B 1 283 ? 30.732  99.079  116.621 1.00 32.02  ? 783 GLN B CA  1 
ATOM   4652  C C   . GLN B 1 283 ? 30.261  98.122  117.723 1.00 40.56  ? 783 GLN B C   1 
ATOM   4653  O O   . GLN B 1 283 ? 29.289  98.424  118.428 1.00 41.31  ? 783 GLN B O   1 
ATOM   4654  C CB  . GLN B 1 283 ? 29.990  98.753  115.322 1.00 25.62  ? 783 GLN B CB  1 
ATOM   4655  C CG  . GLN B 1 283 ? 30.477  99.527  114.125 1.00 26.76  ? 783 GLN B CG  1 
ATOM   4656  C CD  . GLN B 1 283 ? 29.826  99.085  112.843 1.00 34.17  ? 783 GLN B CD  1 
ATOM   4657  O OE1 . GLN B 1 283 ? 28.915  98.249  112.834 1.00 33.46  ? 783 GLN B OE1 1 
ATOM   4658  N NE2 . GLN B 1 283 ? 30.295  99.642  111.740 1.00 37.75  ? 783 GLN B NE2 1 
ATOM   4659  N N   . MET B 1 284 ? 30.916  96.966  117.855 1.00 34.43  ? 784 MET B N   1 
ATOM   4660  C CA  . MET B 1 284 ? 30.571  96.023  118.923 1.00 34.93  ? 784 MET B CA  1 
ATOM   4661  C C   . MET B 1 284 ? 30.918  96.615  120.282 1.00 47.34  ? 784 MET B C   1 
ATOM   4662  O O   . MET B 1 284 ? 30.213  96.388  121.256 1.00 56.04  ? 784 MET B O   1 
ATOM   4663  C CB  . MET B 1 284 ? 31.272  94.660  118.748 1.00 31.98  ? 784 MET B CB  1 
ATOM   4664  C CG  . MET B 1 284 ? 30.971  93.948  117.427 1.00 30.09  ? 784 MET B CG  1 
ATOM   4665  S SD  . MET B 1 284 ? 31.826  92.376  117.194 1.00 39.36  ? 784 MET B SD  1 
ATOM   4666  C CE  . MET B 1 284 ? 31.045  91.400  118.469 1.00 32.21  ? 784 MET B CE  1 
ATOM   4667  N N   . ARG B 1 285 ? 32.003  97.377  120.355 1.00 53.75  ? 785 ARG B N   1 
ATOM   4668  C CA  . ARG B 1 285 ? 32.400  97.955  121.635 1.00 57.34  ? 785 ARG B CA  1 
ATOM   4669  C C   . ARG B 1 285 ? 31.461  99.077  122.027 1.00 54.41  ? 785 ARG B C   1 
ATOM   4670  O O   . ARG B 1 285 ? 31.082  99.215  123.187 1.00 60.03  ? 785 ARG B O   1 
ATOM   4671  C CB  . ARG B 1 285 ? 33.853  98.433  121.600 1.00 57.22  ? 785 ARG B CB  1 
ATOM   4672  C CG  . ARG B 1 285 ? 34.843  97.323  121.920 1.00 62.22  ? 785 ARG B CG  1 
ATOM   4673  C CD  . ARG B 1 285 ? 36.249  97.854  122.057 1.00 67.50  ? 785 ARG B CD  1 
ATOM   4674  N NE  . ARG B 1 285 ? 36.311  99.006  122.947 1.00 71.54  ? 785 ARG B NE  1 
ATOM   4675  C CZ  . ARG B 1 285 ? 37.439  99.511  123.437 1.00 72.40  ? 785 ARG B CZ  1 
ATOM   4676  N NH1 . ARG B 1 285 ? 38.605  98.955  123.136 1.00 66.71  ? 785 ARG B NH1 1 
ATOM   4677  N NH2 . ARG B 1 285 ? 37.401  100.568 124.236 1.00 74.47  ? 785 ARG B NH2 1 
ATOM   4678  N N   . LEU B 1 286 ? 31.074  99.860  121.031 1.00 51.64  ? 786 LEU B N   1 
ATOM   4679  C CA  . LEU B 1 286 ? 30.164  100.981 121.206 1.00 43.76  ? 786 LEU B CA  1 
ATOM   4680  C C   . LEU B 1 286 ? 28.807  100.508 121.707 1.00 44.35  ? 786 LEU B C   1 
ATOM   4681  O O   . LEU B 1 286 ? 28.197  101.128 122.573 1.00 49.56  ? 786 LEU B O   1 
ATOM   4682  C CB  . LEU B 1 286 ? 29.988  101.673 119.860 1.00 34.83  ? 786 LEU B CB  1 
ATOM   4683  C CG  . LEU B 1 286 ? 30.049  103.189 119.792 1.00 41.28  ? 786 LEU B CG  1 
ATOM   4684  C CD1 . LEU B 1 286 ? 31.088  103.752 120.750 1.00 47.39  ? 786 LEU B CD1 1 
ATOM   4685  C CD2 . LEU B 1 286 ? 30.355  103.591 118.365 1.00 41.42  ? 786 LEU B CD2 1 
ATOM   4686  N N   . LEU B 1 287 ? 28.343  99.396  121.155 1.00 35.18  ? 787 LEU B N   1 
ATOM   4687  C CA  . LEU B 1 287 ? 27.002  98.912  121.429 1.00 40.65  ? 787 LEU B CA  1 
ATOM   4688  C C   . LEU B 1 287 ? 26.909  98.119  122.735 1.00 49.01  ? 787 LEU B C   1 
ATOM   4689  O O   . LEU B 1 287 ? 26.035  98.379  123.566 1.00 46.83  ? 787 LEU B O   1 
ATOM   4690  C CB  . LEU B 1 287 ? 26.502  98.064  120.252 1.00 39.48  ? 787 LEU B CB  1 
ATOM   4691  C CG  . LEU B 1 287 ? 26.117  98.832  118.982 1.00 40.55  ? 787 LEU B CG  1 
ATOM   4692  C CD1 . LEU B 1 287 ? 25.802  97.879  117.832 1.00 38.89  ? 787 LEU B CD1 1 
ATOM   4693  C CD2 . LEU B 1 287 ? 24.936  99.758  119.255 1.00 37.44  ? 787 LEU B CD2 1 
ATOM   4694  N N   . TRP B 1 288 ? 27.815  97.159  122.907 1.00 47.67  ? 788 TRP B N   1 
ATOM   4695  C CA  . TRP B 1 288 ? 27.730  96.195  124.002 1.00 50.19  ? 788 TRP B CA  1 
ATOM   4696  C C   . TRP B 1 288 ? 28.745  96.423  125.131 1.00 57.40  ? 788 TRP B C   1 
ATOM   4697  O O   . TRP B 1 288 ? 28.672  95.764  126.178 1.00 47.95  ? 788 TRP B O   1 
ATOM   4698  C CB  . TRP B 1 288 ? 27.838  94.762  123.453 1.00 48.66  ? 788 TRP B CB  1 
ATOM   4699  C CG  . TRP B 1 288 ? 26.617  94.336  122.666 1.00 43.86  ? 788 TRP B CG  1 
ATOM   4700  C CD1 . TRP B 1 288 ? 25.418  93.932  123.180 1.00 39.58  ? 788 TRP B CD1 1 
ATOM   4701  C CD2 . TRP B 1 288 ? 26.479  94.284  121.231 1.00 40.64  ? 788 TRP B CD2 1 
ATOM   4702  N NE1 . TRP B 1 288 ? 24.542  93.626  122.160 1.00 46.98  ? 788 TRP B NE1 1 
ATOM   4703  C CE2 . TRP B 1 288 ? 25.163  93.835  120.958 1.00 42.12  ? 788 TRP B CE2 1 
ATOM   4704  C CE3 . TRP B 1 288 ? 27.335  94.566  120.159 1.00 36.65  ? 788 TRP B CE3 1 
ATOM   4705  C CZ2 . TRP B 1 288 ? 24.682  93.668  119.650 1.00 32.75  ? 788 TRP B CZ2 1 
ATOM   4706  C CZ3 . TRP B 1 288 ? 26.853  94.399  118.853 1.00 38.16  ? 788 TRP B CZ3 1 
ATOM   4707  C CH2 . TRP B 1 288 ? 25.538  93.953  118.615 1.00 34.67  ? 788 TRP B CH2 1 
ATOM   4708  N N   . GLY B 1 289 ? 29.671  97.361  124.922 1.00 63.72  ? 789 GLY B N   1 
ATOM   4709  C CA  . GLY B 1 289 ? 30.710  97.650  125.899 1.00 70.10  ? 789 GLY B CA  1 
ATOM   4710  C C   . GLY B 1 289 ? 31.940  96.781  125.693 1.00 77.41  ? 789 GLY B C   1 
ATOM   4711  O O   . GLY B 1 289 ? 31.862  95.743  125.039 1.00 77.00  ? 789 GLY B O   1 
ATOM   4712  N N   . SER B 1 290 ? 33.075  97.191  126.253 1.00 81.55  ? 790 SER B N   1 
ATOM   4713  C CA  . SER B 1 290 ? 34.328  96.472  126.020 1.00 81.93  ? 790 SER B CA  1 
ATOM   4714  C C   . SER B 1 290 ? 34.460  95.192  126.840 1.00 82.27  ? 790 SER B C   1 
ATOM   4715  O O   . SER B 1 290 ? 35.516  94.568  126.838 1.00 83.34  ? 790 SER B O   1 
ATOM   4716  C CB  . SER B 1 290 ? 35.546  97.376  126.246 1.00 80.56  ? 790 SER B CB  1 
ATOM   4717  O OG  . SER B 1 290 ? 35.593  97.869  127.573 1.00 79.36  ? 790 SER B OG  1 
ATOM   4718  N N   . LYS B 1 291 ? 33.397  94.807  127.540 1.00 83.72  ? 791 LYS B N   1 
ATOM   4719  C CA  . LYS B 1 291 ? 33.381  93.533  128.260 1.00 89.56  ? 791 LYS B CA  1 
ATOM   4720  C C   . LYS B 1 291 ? 32.162  92.702  127.871 1.00 84.60  ? 791 LYS B C   1 
ATOM   4721  O O   . LYS B 1 291 ? 32.140  91.487  128.056 1.00 85.62  ? 791 LYS B O   1 
ATOM   4722  C CB  . LYS B 1 291 ? 33.402  93.753  129.778 1.00 95.54  ? 791 LYS B CB  1 
ATOM   4723  C CG  . LYS B 1 291 ? 34.646  94.466  130.296 1.00 98.56  ? 791 LYS B CG  1 
ATOM   4724  C CD  . LYS B 1 291 ? 35.910  93.620  130.141 1.00 96.87  ? 791 LYS B CD  1 
ATOM   4725  C CE  . LYS B 1 291 ? 36.041  92.586  131.248 1.00 93.84  ? 791 LYS B CE  1 
ATOM   4726  N NZ  . LYS B 1 291 ? 37.372  91.924  131.218 1.00 91.72  ? 791 LYS B NZ  1 
ATOM   4727  N N   . GLY B 1 292 ? 31.146  93.366  127.333 1.00 77.27  ? 792 GLY B N   1 
ATOM   4728  C CA  . GLY B 1 292 ? 29.917  92.692  126.967 1.00 70.09  ? 792 GLY B CA  1 
ATOM   4729  C C   . GLY B 1 292 ? 29.823  92.395  125.485 1.00 61.34  ? 792 GLY B C   1 
ATOM   4730  O O   . GLY B 1 292 ? 28.831  91.833  125.026 1.00 54.21  ? 792 GLY B O   1 
ATOM   4731  N N   . ALA B 1 293 ? 30.853  92.781  124.738 1.00 59.88  ? 793 ALA B N   1 
ATOM   4732  C CA  . ALA B 1 293 ? 30.874  92.556  123.298 1.00 62.24  ? 793 ALA B CA  1 
ATOM   4733  C C   . ALA B 1 293 ? 31.284  91.119  123.007 1.00 71.38  ? 793 ALA B C   1 
ATOM   4734  O O   . ALA B 1 293 ? 31.220  90.656  121.867 1.00 74.51  ? 793 ALA B O   1 
ATOM   4735  C CB  . ALA B 1 293 ? 31.820  93.533  122.616 1.00 50.67  ? 793 ALA B CB  1 
ATOM   4736  N N   . GLN B 1 294 ? 31.698  90.415  124.053 1.00 72.66  ? 794 GLN B N   1 
ATOM   4737  C CA  . GLN B 1 294 ? 32.161  89.040  123.922 1.00 74.28  ? 794 GLN B CA  1 
ATOM   4738  C C   . GLN B 1 294 ? 31.066  88.023  124.275 1.00 63.23  ? 794 GLN B C   1 
ATOM   4739  O O   . GLN B 1 294 ? 31.237  86.823  124.067 1.00 54.09  ? 794 GLN B O   1 
ATOM   4740  C CB  . GLN B 1 294 ? 33.398  88.835  124.794 1.00 84.10  ? 794 GLN B CB  1 
ATOM   4741  C CG  . GLN B 1 294 ? 33.251  89.410  126.202 1.00 91.96  ? 794 GLN B CG  1 
ATOM   4742  C CD  . GLN B 1 294 ? 34.554  89.395  126.983 1.00 102.66 ? 794 GLN B CD  1 
ATOM   4743  O OE1 . GLN B 1 294 ? 35.630  89.236  126.406 1.00 106.83 ? 794 GLN B OE1 1 
ATOM   4744  N NE2 . GLN B 1 294 ? 34.462  89.557  128.305 1.00 104.91 ? 794 GLN B NE2 1 
ATOM   4745  N N   . VAL B 1 295 ? 29.946  88.512  124.806 1.00 59.43  ? 795 VAL B N   1 
ATOM   4746  C CA  . VAL B 1 295 ? 28.799  87.668  125.130 1.00 53.02  ? 795 VAL B CA  1 
ATOM   4747  C C   . VAL B 1 295 ? 28.228  87.006  123.878 1.00 56.12  ? 795 VAL B C   1 
ATOM   4748  O O   . VAL B 1 295 ? 28.425  87.498  122.762 1.00 55.37  ? 795 VAL B O   1 
ATOM   4749  C CB  . VAL B 1 295 ? 27.685  88.483  125.812 1.00 52.93  ? 795 VAL B CB  1 
ATOM   4750  C CG1 . VAL B 1 295 ? 26.405  87.679  125.869 1.00 58.82  ? 795 VAL B CG1 1 
ATOM   4751  C CG2 . VAL B 1 295 ? 28.110  88.896  127.204 1.00 49.58  ? 795 VAL B CG2 1 
ATOM   4752  N N   . ASN B 1 296 ? 27.515  85.896  124.059 1.00 52.49  ? 796 ASN B N   1 
ATOM   4753  C CA  . ASN B 1 296 ? 26.963  85.167  122.916 1.00 50.58  ? 796 ASN B CA  1 
ATOM   4754  C C   . ASN B 1 296 ? 25.965  85.996  122.094 1.00 48.22  ? 796 ASN B C   1 
ATOM   4755  O O   . ASN B 1 296 ? 25.192  86.787  122.634 1.00 53.36  ? 796 ASN B O   1 
ATOM   4756  C CB  . ASN B 1 296 ? 26.350  83.823  123.346 1.00 49.36  ? 796 ASN B CB  1 
ATOM   4757  C CG  . ASN B 1 296 ? 25.185  83.990  124.312 1.00 59.23  ? 796 ASN B CG  1 
ATOM   4758  O OD1 . ASN B 1 296 ? 24.020  83.934  123.907 1.00 63.66  ? 796 ASN B OD1 1 
ATOM   4759  N ND2 . ASN B 1 296 ? 25.494  84.197  125.598 1.00 53.27  ? 796 ASN B ND2 1 
ATOM   4760  N N   . GLN B 1 297 ? 25.997  85.804  120.782 1.00 45.07  ? 797 GLN B N   1 
ATOM   4761  C CA  . GLN B 1 297 ? 25.131  86.525  119.863 1.00 43.85  ? 797 GLN B CA  1 
ATOM   4762  C C   . GLN B 1 297 ? 23.686  86.631  120.315 1.00 48.56  ? 797 GLN B C   1 
ATOM   4763  O O   . GLN B 1 297 ? 23.128  87.725  120.393 1.00 52.16  ? 797 GLN B O   1 
ATOM   4764  C CB  . GLN B 1 297 ? 25.150  85.853  118.496 1.00 39.77  ? 797 GLN B CB  1 
ATOM   4765  C CG  . GLN B 1 297 ? 26.209  86.365  117.557 1.00 36.29  ? 797 GLN B CG  1 
ATOM   4766  C CD  . GLN B 1 297 ? 26.165  85.646  116.227 1.00 42.30  ? 797 GLN B CD  1 
ATOM   4767  O OE1 . GLN B 1 297 ? 26.253  86.272  115.168 1.00 42.94  ? 797 GLN B OE1 1 
ATOM   4768  N NE2 . GLN B 1 297 ? 26.029  84.316  116.271 1.00 42.27  ? 797 GLN B NE2 1 
ATOM   4769  N N   . THR B 1 298 ? 23.071  85.484  120.573 1.00 49.06  ? 798 THR B N   1 
ATOM   4770  C CA  . THR B 1 298 ? 21.649  85.444  120.873 1.00 49.18  ? 798 THR B CA  1 
ATOM   4771  C C   . THR B 1 298 ? 21.272  86.381  122.009 1.00 55.33  ? 798 THR B C   1 
ATOM   4772  O O   . THR B 1 298 ? 20.264  87.087  121.950 1.00 49.73  ? 798 THR B O   1 
ATOM   4773  C CB  . THR B 1 298 ? 21.209  84.038  121.243 1.00 43.60  ? 798 THR B CB  1 
ATOM   4774  O OG1 . THR B 1 298 ? 20.803  83.353  120.052 1.00 45.72  ? 798 THR B OG1 1 
ATOM   4775  C CG2 . THR B 1 298 ? 20.047  84.108  122.216 1.00 36.33  ? 798 THR B CG2 1 
ATOM   4776  N N   . GLU B 1 299 ? 22.092  86.375  123.048 1.00 56.68  ? 799 GLU B N   1 
ATOM   4777  C CA  . GLU B 1 299 ? 21.868  87.241  124.180 1.00 59.06  ? 799 GLU B CA  1 
ATOM   4778  C C   . GLU B 1 299 ? 22.109  88.722  123.810 1.00 56.38  ? 799 GLU B C   1 
ATOM   4779  O O   . GLU B 1 299 ? 21.337  89.608  124.199 1.00 50.58  ? 799 GLU B O   1 
ATOM   4780  C CB  . GLU B 1 299 ? 22.750  86.793  125.343 1.00 64.49  ? 799 GLU B CB  1 
ATOM   4781  C CG  . GLU B 1 299 ? 22.401  87.431  126.670 1.00 77.33  ? 799 GLU B CG  1 
ATOM   4782  C CD  . GLU B 1 299 ? 23.241  86.886  127.807 1.00 93.44  ? 799 GLU B CD  1 
ATOM   4783  O OE1 . GLU B 1 299 ? 23.635  85.696  127.738 1.00 96.32  ? 799 GLU B OE1 1 
ATOM   4784  O OE2 . GLU B 1 299 ? 23.512  87.652  128.762 1.00 98.32  ? 799 GLU B OE2 1 
ATOM   4785  N N   . ARG B 1 300 ? 23.169  88.991  123.057 1.00 46.79  ? 800 ARG B N   1 
ATOM   4786  C CA  . ARG B 1 300 ? 23.456  90.359  122.662 1.00 41.27  ? 800 ARG B CA  1 
ATOM   4787  C C   . ARG B 1 300 ? 22.318  90.920  121.828 1.00 51.45  ? 800 ARG B C   1 
ATOM   4788  O O   . ARG B 1 300 ? 21.883  92.063  122.028 1.00 55.80  ? 800 ARG B O   1 
ATOM   4789  C CB  . ARG B 1 300 ? 24.778  90.461  121.903 1.00 30.36  ? 800 ARG B CB  1 
ATOM   4790  C CG  . ARG B 1 300 ? 25.977  90.489  122.825 1.00 38.98  ? 800 ARG B CG  1 
ATOM   4791  C CD  . ARG B 1 300 ? 27.275  90.782  122.093 1.00 40.67  ? 800 ARG B CD  1 
ATOM   4792  N NE  . ARG B 1 300 ? 27.678  89.694  121.203 1.00 37.08  ? 800 ARG B NE  1 
ATOM   4793  C CZ  . ARG B 1 300 ? 27.681  89.792  119.878 1.00 36.11  ? 800 ARG B CZ  1 
ATOM   4794  N NH1 . ARG B 1 300 ? 27.307  90.924  119.304 1.00 37.62  ? 800 ARG B NH1 1 
ATOM   4795  N NH2 . ARG B 1 300 ? 28.065  88.772  119.125 1.00 42.84  ? 800 ARG B NH2 1 
ATOM   4796  N N   . TYR B 1 301 ? 21.819  90.115  120.901 1.00 46.83  ? 801 TYR B N   1 
ATOM   4797  C CA  . TYR B 1 301 ? 20.765  90.599  120.027 1.00 43.86  ? 801 TYR B CA  1 
ATOM   4798  C C   . TYR B 1 301 ? 19.444  90.781  120.791 1.00 46.56  ? 801 TYR B C   1 
ATOM   4799  O O   . TYR B 1 301 ? 18.696  91.722  120.538 1.00 43.55  ? 801 TYR B O   1 
ATOM   4800  C CB  . TYR B 1 301 ? 20.620  89.710  118.787 1.00 30.45  ? 801 TYR B CB  1 
ATOM   4801  C CG  . TYR B 1 301 ? 21.889  89.625  117.956 1.00 26.67  ? 801 TYR B CG  1 
ATOM   4802  C CD1 . TYR B 1 301 ? 22.933  90.519  118.159 1.00 31.06  ? 801 TYR B CD1 1 
ATOM   4803  C CD2 . TYR B 1 301 ? 22.053  88.640  116.981 1.00 33.72  ? 801 TYR B CD2 1 
ATOM   4804  C CE1 . TYR B 1 301 ? 24.100  90.457  117.403 1.00 32.03  ? 801 TYR B CE1 1 
ATOM   4805  C CE2 . TYR B 1 301 ? 23.223  88.561  116.221 1.00 37.49  ? 801 TYR B CE2 1 
ATOM   4806  C CZ  . TYR B 1 301 ? 24.241  89.473  116.441 1.00 42.40  ? 801 TYR B CZ  1 
ATOM   4807  O OH  . TYR B 1 301 ? 25.401  89.411  115.703 1.00 42.61  ? 801 TYR B OH  1 
ATOM   4808  N N   . GLU B 1 302 ? 19.171  89.913  121.755 1.00 46.74  ? 802 GLU B N   1 
ATOM   4809  C CA  . GLU B 1 302 ? 17.941  90.054  122.520 1.00 53.61  ? 802 GLU B CA  1 
ATOM   4810  C C   . GLU B 1 302 ? 17.976  91.330  123.352 1.00 54.17  ? 802 GLU B C   1 
ATOM   4811  O O   . GLU B 1 302 ? 16.961  92.005  123.530 1.00 55.25  ? 802 GLU B O   1 
ATOM   4812  C CB  . GLU B 1 302 ? 17.701  88.840  123.417 1.00 64.49  ? 802 GLU B CB  1 
ATOM   4813  C CG  . GLU B 1 302 ? 16.363  88.889  124.135 1.00 78.73  ? 802 GLU B CG  1 
ATOM   4814  C CD  . GLU B 1 302 ? 15.182  88.929  123.173 1.00 88.12  ? 802 GLU B CD  1 
ATOM   4815  O OE1 . GLU B 1 302 ? 15.207  88.181  122.168 1.00 91.68  ? 802 GLU B OE1 1 
ATOM   4816  O OE2 . GLU B 1 302 ? 14.232  89.708  123.421 1.00 86.72  ? 802 GLU B OE2 1 
ATOM   4817  N N   . LYS B 1 303 ? 19.159  91.656  123.853 1.00 52.88  ? 803 LYS B N   1 
ATOM   4818  C CA  . LYS B 1 303 ? 19.355  92.852  124.654 1.00 54.54  ? 803 LYS B CA  1 
ATOM   4819  C C   . LYS B 1 303 ? 18.912  94.108  123.889 1.00 56.90  ? 803 LYS B C   1 
ATOM   4820  O O   . LYS B 1 303 ? 18.214  94.968  124.436 1.00 61.97  ? 803 LYS B O   1 
ATOM   4821  C CB  . LYS B 1 303 ? 20.826  92.944  125.067 1.00 56.68  ? 803 LYS B CB  1 
ATOM   4822  C CG  . LYS B 1 303 ? 21.196  94.113  125.958 1.00 59.26  ? 803 LYS B CG  1 
ATOM   4823  C CD  . LYS B 1 303 ? 22.683  94.049  126.285 1.00 63.70  ? 803 LYS B CD  1 
ATOM   4824  C CE  . LYS B 1 303 ? 23.170  95.313  126.952 1.00 72.23  ? 803 LYS B CE  1 
ATOM   4825  N NZ  . LYS B 1 303 ? 22.356  95.642  128.155 1.00 80.28  ? 803 LYS B NZ  1 
ATOM   4826  N N   . PHE B 1 304 ? 19.304  94.215  122.625 1.00 45.93  ? 804 PHE B N   1 
ATOM   4827  C CA  . PHE B 1 304 ? 18.895  95.371  121.830 1.00 47.42  ? 804 PHE B CA  1 
ATOM   4828  C C   . PHE B 1 304 ? 17.463  95.305  121.321 1.00 52.17  ? 804 PHE B C   1 
ATOM   4829  O O   . PHE B 1 304 ? 16.840  96.337  121.092 1.00 60.30  ? 804 PHE B O   1 
ATOM   4830  C CB  . PHE B 1 304 ? 19.865  95.643  120.684 1.00 43.66  ? 804 PHE B CB  1 
ATOM   4831  C CG  . PHE B 1 304 ? 20.997  96.506  121.081 1.00 45.43  ? 804 PHE B CG  1 
ATOM   4832  C CD1 . PHE B 1 304 ? 20.868  97.887  121.049 1.00 43.88  ? 804 PHE B CD1 1 
ATOM   4833  C CD2 . PHE B 1 304 ? 22.178  95.949  121.544 1.00 41.61  ? 804 PHE B CD2 1 
ATOM   4834  C CE1 . PHE B 1 304 ? 21.905  98.700  121.448 1.00 39.54  ? 804 PHE B CE1 1 
ATOM   4835  C CE2 . PHE B 1 304 ? 23.226  96.761  121.939 1.00 41.96  ? 804 PHE B CE2 1 
ATOM   4836  C CZ  . PHE B 1 304 ? 23.084  98.143  121.892 1.00 38.81  ? 804 PHE B CZ  1 
ATOM   4837  N N   . ASN B 1 305 ? 16.940  94.101  121.134 1.00 48.88  ? 805 ASN B N   1 
ATOM   4838  C CA  . ASN B 1 305 ? 15.526  93.977  120.848 1.00 49.29  ? 805 ASN B CA  1 
ATOM   4839  C C   . ASN B 1 305 ? 14.769  94.781  121.902 1.00 48.62  ? 805 ASN B C   1 
ATOM   4840  O O   . ASN B 1 305 ? 14.049  95.734  121.576 1.00 39.35  ? 805 ASN B O   1 
ATOM   4841  C CB  . ASN B 1 305 ? 15.093  92.518  120.886 1.00 54.00  ? 805 ASN B CB  1 
ATOM   4842  C CG  . ASN B 1 305 ? 13.726  92.301  120.265 1.00 63.67  ? 805 ASN B CG  1 
ATOM   4843  O OD1 . ASN B 1 305 ? 13.249  93.126  119.479 1.00 58.43  ? 805 ASN B OD1 1 
ATOM   4844  N ND2 . ASN B 1 305 ? 13.091  91.178  120.606 1.00 68.81  ? 805 ASN B ND2 1 
ATOM   4845  N N   . GLN B 1 306 ? 14.969  94.410  123.166 1.00 47.47  ? 806 GLN B N   1 
ATOM   4846  C CA  . GLN B 1 306 ? 14.327  95.090  124.289 1.00 50.47  ? 806 GLN B CA  1 
ATOM   4847  C C   . GLN B 1 306 ? 14.645  96.587  124.321 1.00 44.02  ? 806 GLN B C   1 
ATOM   4848  O O   . GLN B 1 306 ? 13.745  97.408  124.458 1.00 42.17  ? 806 GLN B O   1 
ATOM   4849  C CB  . GLN B 1 306 ? 14.708  94.428  125.617 1.00 56.86  ? 806 GLN B CB  1 
ATOM   4850  C CG  . GLN B 1 306 ? 14.265  92.972  125.724 1.00 63.97  ? 806 GLN B CG  1 
ATOM   4851  C CD  . GLN B 1 306 ? 14.977  92.218  126.840 1.00 66.25  ? 806 GLN B CD  1 
ATOM   4852  O OE1 . GLN B 1 306 ? 15.385  92.809  127.845 1.00 68.88  ? 806 GLN B OE1 1 
ATOM   4853  N NE2 . GLN B 1 306 ? 15.139  90.906  126.660 1.00 58.27  ? 806 GLN B NE2 1 
ATOM   4854  N N   . ILE B 1 307 ? 15.921  96.934  124.189 1.00 41.06  ? 807 ILE B N   1 
ATOM   4855  C CA  . ILE B 1 307 ? 16.335  98.330  124.202 1.00 39.10  ? 807 ILE B CA  1 
ATOM   4856  C C   . ILE B 1 307 ? 15.608  99.140  123.138 1.00 46.43  ? 807 ILE B C   1 
ATOM   4857  O O   . ILE B 1 307 ? 14.846  100.054 123.462 1.00 49.03  ? 807 ILE B O   1 
ATOM   4858  C CB  . ILE B 1 307 ? 17.841  98.478  123.983 1.00 37.98  ? 807 ILE B CB  1 
ATOM   4859  C CG1 . ILE B 1 307 ? 18.602  98.075  125.245 1.00 39.49  ? 807 ILE B CG1 1 
ATOM   4860  C CG2 . ILE B 1 307 ? 18.173  99.900  123.625 1.00 31.77  ? 807 ILE B CG2 1 
ATOM   4861  C CD1 . ILE B 1 307 ? 20.107  98.204  125.105 1.00 37.45  ? 807 ILE B CD1 1 
ATOM   4862  N N   . LEU B 1 308 ? 15.850  98.799  121.873 1.00 43.94  ? 808 LEU B N   1 
ATOM   4863  C CA  . LEU B 1 308 ? 15.220  99.487  120.741 1.00 42.47  ? 808 LEU B CA  1 
ATOM   4864  C C   . LEU B 1 308 ? 13.701  99.600  120.880 1.00 45.32  ? 808 LEU B C   1 
ATOM   4865  O O   . LEU B 1 308 ? 13.106  100.616 120.503 1.00 44.70  ? 808 LEU B O   1 
ATOM   4866  C CB  . LEU B 1 308 ? 15.563  98.810  119.407 1.00 27.73  ? 808 LEU B CB  1 
ATOM   4867  C CG  . LEU B 1 308 ? 17.027  98.827  118.970 1.00 30.69  ? 808 LEU B CG  1 
ATOM   4868  C CD1 . LEU B 1 308 ? 17.164  98.092  117.662 1.00 29.78  ? 808 LEU B CD1 1 
ATOM   4869  C CD2 . LEU B 1 308 ? 17.542  100.251 118.823 1.00 31.76  ? 808 LEU B CD2 1 
ATOM   4870  N N   . THR B 1 309 ? 13.075  98.558  121.415 1.00 41.88  ? 809 THR B N   1 
ATOM   4871  C CA  . THR B 1 309 ? 11.629  98.578  121.595 1.00 47.87  ? 809 THR B CA  1 
ATOM   4872  C C   . THR B 1 309 ? 11.235  99.594  122.661 1.00 47.38  ? 809 THR B C   1 
ATOM   4873  O O   . THR B 1 309 ? 10.243  100.313 122.509 1.00 43.95  ? 809 THR B O   1 
ATOM   4874  C CB  . THR B 1 309 ? 11.064  97.182  121.923 1.00 48.04  ? 809 THR B CB  1 
ATOM   4875  O OG1 . THR B 1 309 ? 10.786  96.493  120.697 1.00 38.93  ? 809 THR B OG1 1 
ATOM   4876  C CG2 . THR B 1 309 ? 9.780   97.293  122.724 1.00 44.84  ? 809 THR B CG2 1 
ATOM   4877  N N   . ALA B 1 310 ? 12.036  99.676  123.718 1.00 45.28  ? 810 ALA B N   1 
ATOM   4878  C CA  . ALA B 1 310 ? 11.791  100.643 124.781 1.00 46.32  ? 810 ALA B CA  1 
ATOM   4879  C C   . ALA B 1 310 ? 11.977  102.064 124.270 1.00 43.72  ? 810 ALA B C   1 
ATOM   4880  O O   . ALA B 1 310 ? 11.287  102.989 124.704 1.00 48.53  ? 810 ALA B O   1 
ATOM   4881  C CB  . ALA B 1 310 ? 12.706  100.378 125.976 1.00 45.94  ? 810 ALA B CB  1 
ATOM   4882  N N   . LEU B 1 311 ? 12.914  102.247 123.350 1.00 39.06  ? 811 LEU B N   1 
ATOM   4883  C CA  . LEU B 1 311 ? 13.137  103.583 122.823 1.00 40.71  ? 811 LEU B CA  1 
ATOM   4884  C C   . LEU B 1 311 ? 11.953  103.993 121.948 1.00 44.57  ? 811 LEU B C   1 
ATOM   4885  O O   . LEU B 1 311 ? 11.356  105.046 122.151 1.00 42.65  ? 811 LEU B O   1 
ATOM   4886  C CB  . LEU B 1 311 ? 14.473  103.677 122.082 1.00 36.76  ? 811 LEU B CB  1 
ATOM   4887  C CG  . LEU B 1 311 ? 15.696  103.491 122.992 1.00 39.06  ? 811 LEU B CG  1 
ATOM   4888  C CD1 . LEU B 1 311 ? 16.994  103.431 122.201 1.00 29.73  ? 811 LEU B CD1 1 
ATOM   4889  C CD2 . LEU B 1 311 ? 15.771  104.585 124.057 1.00 35.92  ? 811 LEU B CD2 1 
ATOM   4890  N N   . SER B 1 312 ? 11.587  103.138 121.001 1.00 47.44  ? 812 SER B N   1 
ATOM   4891  C CA  . SER B 1 312 ? 10.519  103.470 120.071 1.00 39.57  ? 812 SER B CA  1 
ATOM   4892  C C   . SER B 1 312 ? 9.205   103.807 120.773 1.00 44.92  ? 812 SER B C   1 
ATOM   4893  O O   . SER B 1 312 ? 8.398   104.583 120.252 1.00 40.71  ? 812 SER B O   1 
ATOM   4894  C CB  . SER B 1 312 ? 10.304  102.347 119.071 1.00 28.22  ? 812 SER B CB  1 
ATOM   4895  O OG  . SER B 1 312 ? 9.285   102.692 118.155 1.00 39.25  ? 812 SER B OG  1 
ATOM   4896  N N   . ARG B 1 313 ? 8.989   103.231 121.953 1.00 48.34  ? 813 ARG B N   1 
ATOM   4897  C CA  . ARG B 1 313 ? 7.734   103.457 122.671 1.00 51.55  ? 813 ARG B CA  1 
ATOM   4898  C C   . ARG B 1 313 ? 7.767   104.738 123.501 1.00 52.70  ? 813 ARG B C   1 
ATOM   4899  O O   . ARG B 1 313 ? 6.756   105.442 123.615 1.00 50.45  ? 813 ARG B O   1 
ATOM   4900  C CB  . ARG B 1 313 ? 7.332   102.231 123.500 1.00 54.10  ? 813 ARG B CB  1 
ATOM   4901  C CG  . ARG B 1 313 ? 6.611   101.166 122.673 1.00 63.54  ? 813 ARG B CG  1 
ATOM   4902  C CD  . ARG B 1 313 ? 6.427   99.860  123.429 1.00 77.57  ? 813 ARG B CD  1 
ATOM   4903  N NE  . ARG B 1 313 ? 5.016   99.545  123.647 1.00 89.88  ? 813 ARG B NE  1 
ATOM   4904  C CZ  . ARG B 1 313 ? 4.377   99.723  124.801 1.00 97.68  ? 813 ARG B CZ  1 
ATOM   4905  N NH1 . ARG B 1 313 ? 5.023   100.210 125.853 1.00 96.74  ? 813 ARG B NH1 1 
ATOM   4906  N NH2 . ARG B 1 313 ? 3.091   99.409  124.907 1.00 102.26 ? 813 ARG B NH2 1 
ATOM   4907  N N   . LYS B 1 314 ? 8.937   105.038 124.060 1.00 53.92  ? 814 LYS B N   1 
ATOM   4908  C CA  . LYS B 1 314 ? 9.178   106.329 124.692 1.00 51.24  ? 814 LYS B CA  1 
ATOM   4909  C C   . LYS B 1 314 ? 8.915   107.415 123.668 1.00 53.82  ? 814 LYS B C   1 
ATOM   4910  O O   . LYS B 1 314 ? 8.094   108.310 123.880 1.00 58.41  ? 814 LYS B O   1 
ATOM   4911  C CB  . LYS B 1 314 ? 10.633  106.439 125.151 1.00 47.55  ? 814 LYS B CB  1 
ATOM   4912  C CG  . LYS B 1 314 ? 10.793  106.999 126.537 1.00 47.10  ? 814 LYS B CG  1 
ATOM   4913  C CD  . LYS B 1 314 ? 10.029  106.116 127.514 1.00 60.99  ? 814 LYS B CD  1 
ATOM   4914  C CE  . LYS B 1 314 ? 10.094  106.645 128.939 1.00 72.05  ? 814 LYS B CE  1 
ATOM   4915  N NZ  . LYS B 1 314 ? 9.309   107.903 129.095 1.00 77.98  ? 814 LYS B NZ  1 
ATOM   4916  N N   . LEU B 1 315 ? 9.620   107.313 122.545 1.00 50.66  ? 815 LEU B N   1 
ATOM   4917  C CA  . LEU B 1 315 ? 9.640   108.358 121.530 1.00 49.56  ? 815 LEU B CA  1 
ATOM   4918  C C   . LEU B 1 315 ? 8.276   108.646 120.926 1.00 45.43  ? 815 LEU B C   1 
ATOM   4919  O O   . LEU B 1 315 ? 7.902   109.804 120.755 1.00 54.09  ? 815 LEU B O   1 
ATOM   4920  C CB  . LEU B 1 315 ? 10.616  107.991 120.419 1.00 51.24  ? 815 LEU B CB  1 
ATOM   4921  C CG  . LEU B 1 315 ? 12.085  108.157 120.785 1.00 49.96  ? 815 LEU B CG  1 
ATOM   4922  C CD1 . LEU B 1 315 ? 12.961  107.828 119.580 1.00 44.35  ? 815 LEU B CD1 1 
ATOM   4923  C CD2 . LEU B 1 315 ? 12.333  109.578 121.280 1.00 42.22  ? 815 LEU B CD2 1 
ATOM   4924  N N   . GLU B 1 316 ? 7.552   107.586 120.588 1.00 31.83  ? 816 GLU B N   1 
ATOM   4925  C CA  . GLU B 1 316 ? 6.229   107.704 119.996 1.00 35.46  ? 816 GLU B CA  1 
ATOM   4926  C C   . GLU B 1 316 ? 5.325   106.608 120.555 1.00 45.14  ? 816 GLU B C   1 
ATOM   4927  O O   . GLU B 1 316 ? 5.320   105.490 120.045 1.00 52.56  ? 816 GLU B O   1 
ATOM   4928  C CB  . GLU B 1 316 ? 6.316   107.621 118.456 1.00 37.33  ? 816 GLU B CB  1 
ATOM   4929  C CG  . GLU B 1 316 ? 7.033   108.815 117.784 1.00 39.67  ? 816 GLU B CG  1 
ATOM   4930  C CD  . GLU B 1 316 ? 7.055   108.748 116.242 1.00 45.30  ? 816 GLU B CD  1 
ATOM   4931  O OE1 . GLU B 1 316 ? 6.214   108.039 115.639 1.00 46.65  ? 816 GLU B OE1 1 
ATOM   4932  O OE2 . GLU B 1 316 ? 7.920   109.418 115.630 1.00 40.15  ? 816 GLU B OE2 1 
ATOM   4933  N N   . PRO B 1 317 ? 4.564   106.920 121.620 1.00 51.80  ? 817 PRO B N   1 
ATOM   4934  C CA  . PRO B 1 317 ? 3.722   105.931 122.309 1.00 51.83  ? 817 PRO B CA  1 
ATOM   4935  C C   . PRO B 1 317 ? 2.516   105.500 121.484 1.00 48.68  ? 817 PRO B C   1 
ATOM   4936  O O   . PRO B 1 317 ? 2.093   106.215 120.580 1.00 51.83  ? 817 PRO B O   1 
ATOM   4937  C CB  . PRO B 1 317 ? 3.242   106.684 123.556 1.00 52.30  ? 817 PRO B CB  1 
ATOM   4938  C CG  . PRO B 1 317 ? 4.171   107.852 123.694 1.00 49.82  ? 817 PRO B CG  1 
ATOM   4939  C CD  . PRO B 1 317 ? 4.540   108.223 122.303 1.00 50.29  ? 817 PRO B CD  1 
ATOM   4940  N N   . PRO B 1 318 ? 1.964   104.324 121.793 1.00 51.34  ? 818 PRO B N   1 
ATOM   4941  C CA  . PRO B 1 318 ? 0.748   103.820 121.138 1.00 61.86  ? 818 PRO B CA  1 
ATOM   4942  C C   . PRO B 1 318 ? -0.492  104.664 121.481 1.00 70.60  ? 818 PRO B C   1 
ATOM   4943  O O   . PRO B 1 318 ? -1.454  104.734 120.709 1.00 69.33  ? 818 PRO B O   1 
ATOM   4944  C CB  . PRO B 1 318 ? 0.602   102.404 121.717 1.00 54.31  ? 818 PRO B CB  1 
ATOM   4945  C CG  . PRO B 1 318 ? 1.952   102.065 122.294 1.00 46.37  ? 818 PRO B CG  1 
ATOM   4946  C CD  . PRO B 1 318 ? 2.531   103.360 122.751 1.00 47.01  ? 818 PRO B CD  1 
ATOM   4947  N N   . THR C 1 11  ? 27.918  65.416  55.633  1.00 109.77 ? 511 THR C N   1 
ATOM   4948  C CA  . THR C 1 11  ? 28.029  64.345  54.643  1.00 115.63 ? 511 THR C CA  1 
ATOM   4949  C C   . THR C 1 11  ? 26.647  63.837  54.200  1.00 115.18 ? 511 THR C C   1 
ATOM   4950  O O   . THR C 1 11  ? 25.704  64.621  54.052  1.00 119.25 ? 511 THR C O   1 
ATOM   4951  C CB  . THR C 1 11  ? 28.891  63.170  55.180  1.00 147.99 ? 511 THR C CB  1 
ATOM   4952  O OG1 . THR C 1 11  ? 29.037  62.164  54.167  1.00 149.53 ? 511 THR C OG1 1 
ATOM   4953  C CG2 . THR C 1 11  ? 28.259  62.556  56.421  1.00 145.36 ? 511 THR C CG2 1 
ATOM   4954  N N   . VAL C 1 12  ? 26.538  62.531  53.967  1.00 103.92 ? 512 VAL C N   1 
ATOM   4955  C CA  . VAL C 1 12  ? 25.244  61.900  53.722  1.00 85.25  ? 512 VAL C CA  1 
ATOM   4956  C C   . VAL C 1 12  ? 25.074  60.793  54.767  1.00 71.61  ? 512 VAL C C   1 
ATOM   4957  O O   . VAL C 1 12  ? 25.856  60.711  55.713  1.00 64.96  ? 512 VAL C O   1 
ATOM   4958  C CB  . VAL C 1 12  ? 25.120  61.373  52.266  1.00 61.28  ? 512 VAL C CB  1 
ATOM   4959  C CG1 . VAL C 1 12  ? 25.972  60.119  52.049  1.00 59.94  ? 512 VAL C CG1 1 
ATOM   4960  C CG2 . VAL C 1 12  ? 23.656  61.134  51.900  1.00 62.28  ? 512 VAL C CG2 1 
ATOM   4961  N N   . SER C 1 13  ? 24.054  59.955  54.620  1.00 75.50  ? 513 SER C N   1 
ATOM   4962  C CA  . SER C 1 13  ? 23.822  58.878  55.587  1.00 73.19  ? 513 SER C CA  1 
ATOM   4963  C C   . SER C 1 13  ? 24.950  57.849  55.564  1.00 57.59  ? 513 SER C C   1 
ATOM   4964  O O   . SER C 1 13  ? 25.841  57.904  54.717  1.00 48.58  ? 513 SER C O   1 
ATOM   4965  C CB  . SER C 1 13  ? 22.489  58.166  55.315  1.00 80.36  ? 513 SER C CB  1 
ATOM   4966  O OG  . SER C 1 13  ? 21.401  59.070  55.308  1.00 85.95  ? 513 SER C OG  1 
ATOM   4967  N N   . SER C 1 14  ? 24.903  56.923  56.514  1.00 50.49  ? 514 SER C N   1 
ATOM   4968  C CA  . SER C 1 14  ? 25.759  55.752  56.491  1.00 47.87  ? 514 SER C CA  1 
ATOM   4969  C C   . SER C 1 14  ? 24.931  54.577  55.952  1.00 53.58  ? 514 SER C C   1 
ATOM   4970  O O   . SER C 1 14  ? 25.433  53.465  55.777  1.00 56.79  ? 514 SER C O   1 
ATOM   4971  C CB  . SER C 1 14  ? 26.311  55.460  57.890  1.00 41.35  ? 514 SER C CB  1 
ATOM   4972  O OG  . SER C 1 14  ? 25.321  54.896  58.733  1.00 47.07  ? 514 SER C OG  1 
ATOM   4973  N N   . PHE C 1 15  ? 23.653  54.838  55.685  1.00 52.77  ? 515 PHE C N   1 
ATOM   4974  C CA  . PHE C 1 15  ? 22.789  53.845  55.058  1.00 45.85  ? 515 PHE C CA  1 
ATOM   4975  C C   . PHE C 1 15  ? 23.254  53.635  53.626  1.00 49.78  ? 515 PHE C C   1 
ATOM   4976  O O   . PHE C 1 15  ? 23.717  54.573  52.970  1.00 48.55  ? 515 PHE C O   1 
ATOM   4977  C CB  . PHE C 1 15  ? 21.323  54.282  55.079  1.00 35.85  ? 515 PHE C CB  1 
ATOM   4978  C CG  . PHE C 1 15  ? 20.767  54.474  56.460  1.00 34.16  ? 515 PHE C CG  1 
ATOM   4979  C CD1 . PHE C 1 15  ? 20.226  55.694  56.840  1.00 33.00  ? 515 PHE C CD1 1 
ATOM   4980  C CD2 . PHE C 1 15  ? 20.798  53.439  57.385  1.00 33.04  ? 515 PHE C CD2 1 
ATOM   4981  C CE1 . PHE C 1 15  ? 19.709  55.879  58.113  1.00 31.68  ? 515 PHE C CE1 1 
ATOM   4982  C CE2 . PHE C 1 15  ? 20.289  53.613  58.659  1.00 34.81  ? 515 PHE C CE2 1 
ATOM   4983  C CZ  . PHE C 1 15  ? 19.740  54.841  59.026  1.00 35.55  ? 515 PHE C CZ  1 
ATOM   4984  N N   . ARG C 1 16  ? 23.138  52.400  53.149  1.00 44.92  ? 516 ARG C N   1 
ATOM   4985  C CA  . ARG C 1 16  ? 23.644  52.046  51.833  1.00 45.68  ? 516 ARG C CA  1 
ATOM   4986  C C   . ARG C 1 16  ? 22.597  51.263  51.063  1.00 32.28  ? 516 ARG C C   1 
ATOM   4987  O O   . ARG C 1 16  ? 22.834  50.128  50.689  1.00 28.74  ? 516 ARG C O   1 
ATOM   4988  C CB  . ARG C 1 16  ? 24.924  51.215  51.966  1.00 57.25  ? 516 ARG C CB  1 
ATOM   4989  C CG  . ARG C 1 16  ? 26.103  51.942  52.628  1.00 70.81  ? 516 ARG C CG  1 
ATOM   4990  C CD  . ARG C 1 16  ? 26.923  52.763  51.622  1.00 79.06  ? 516 ARG C CD  1 
ATOM   4991  N NE  . ARG C 1 16  ? 26.724  54.206  51.765  1.00 81.43  ? 516 ARG C NE  1 
ATOM   4992  C CZ  . ARG C 1 16  ? 27.504  55.006  52.489  1.00 80.97  ? 516 ARG C CZ  1 
ATOM   4993  N NH1 . ARG C 1 16  ? 28.549  54.514  53.145  1.00 82.01  ? 516 ARG C NH1 1 
ATOM   4994  N NH2 . ARG C 1 16  ? 27.241  56.305  52.556  1.00 77.56  ? 516 ARG C NH2 1 
ATOM   4995  N N   . PRO C 1 17  ? 21.438  51.885  50.811  1.00 35.99  ? 517 PRO C N   1 
ATOM   4996  C CA  . PRO C 1 17  ? 20.244  51.255  50.233  1.00 35.02  ? 517 PRO C CA  1 
ATOM   4997  C C   . PRO C 1 17  ? 20.442  50.572  48.878  1.00 45.14  ? 517 PRO C C   1 
ATOM   4998  O O   . PRO C 1 17  ? 19.736  49.605  48.588  1.00 46.17  ? 517 PRO C O   1 
ATOM   4999  C CB  . PRO C 1 17  ? 19.254  52.422  50.109  1.00 39.19  ? 517 PRO C CB  1 
ATOM   5000  C CG  . PRO C 1 17  ? 20.097  53.659  50.182  1.00 35.00  ? 517 PRO C CG  1 
ATOM   5001  C CD  . PRO C 1 17  ? 21.215  53.309  51.104  1.00 30.96  ? 517 PRO C CD  1 
ATOM   5002  N N   . ASN C 1 18  ? 21.369  51.052  48.056  1.00 56.53  ? 518 ASN C N   1 
ATOM   5003  C CA  . ASN C 1 18  ? 21.654  50.370  46.797  1.00 60.01  ? 518 ASN C CA  1 
ATOM   5004  C C   . ASN C 1 18  ? 22.370  49.035  47.040  1.00 61.58  ? 518 ASN C C   1 
ATOM   5005  O O   . ASN C 1 18  ? 22.080  48.040  46.369  1.00 55.75  ? 518 ASN C O   1 
ATOM   5006  C CB  . ASN C 1 18  ? 22.458  51.267  45.844  1.00 68.96  ? 518 ASN C CB  1 
ATOM   5007  C CG  . ASN C 1 18  ? 21.609  52.382  45.206  1.00 73.36  ? 518 ASN C CG  1 
ATOM   5008  O OD1 . ASN C 1 18  ? 20.425  52.560  45.534  1.00 56.22  ? 518 ASN C OD1 1 
ATOM   5009  N ND2 . ASN C 1 18  ? 22.221  53.139  44.288  1.00 80.49  ? 518 ASN C ND2 1 
ATOM   5010  N N   . GLU C 1 19  ? 23.284  49.021  48.014  1.00 62.21  ? 519 GLU C N   1 
ATOM   5011  C CA  . GLU C 1 19  ? 24.060  47.822  48.369  1.00 55.09  ? 519 GLU C CA  1 
ATOM   5012  C C   . GLU C 1 19  ? 23.286  46.868  49.271  1.00 54.85  ? 519 GLU C C   1 
ATOM   5013  O O   . GLU C 1 19  ? 23.628  45.692  49.393  1.00 57.98  ? 519 GLU C O   1 
ATOM   5014  C CB  . GLU C 1 19  ? 25.352  48.206  49.086  1.00 46.30  ? 519 GLU C CB  1 
ATOM   5015  C CG  . GLU C 1 19  ? 26.216  49.179  48.326  1.00 64.07  ? 519 GLU C CG  1 
ATOM   5016  C CD  . GLU C 1 19  ? 27.306  49.760  49.199  1.00 84.19  ? 519 GLU C CD  1 
ATOM   5017  O OE1 . GLU C 1 19  ? 27.747  49.058  50.137  1.00 88.45  ? 519 GLU C OE1 1 
ATOM   5018  O OE2 . GLU C 1 19  ? 27.711  50.921  48.963  1.00 91.80  ? 519 GLU C OE2 1 
ATOM   5019  N N   . PHE C 1 20  ? 22.248  47.383  49.915  1.00 49.07  ? 520 PHE C N   1 
ATOM   5020  C CA  . PHE C 1 20  ? 21.457  46.588  50.836  1.00 45.32  ? 520 PHE C CA  1 
ATOM   5021  C C   . PHE C 1 20  ? 20.803  45.369  50.170  1.00 50.44  ? 520 PHE C C   1 
ATOM   5022  O O   . PHE C 1 20  ? 20.164  45.476  49.114  1.00 45.32  ? 520 PHE C O   1 
ATOM   5023  C CB  . PHE C 1 20  ? 20.395  47.466  51.484  1.00 44.45  ? 520 PHE C CB  1 
ATOM   5024  C CG  . PHE C 1 20  ? 19.496  46.728  52.421  1.00 47.43  ? 520 PHE C CG  1 
ATOM   5025  C CD1 . PHE C 1 20  ? 19.958  46.311  53.652  1.00 45.45  ? 520 PHE C CD1 1 
ATOM   5026  C CD2 . PHE C 1 20  ? 18.189  46.453  52.071  1.00 42.57  ? 520 PHE C CD2 1 
ATOM   5027  C CE1 . PHE C 1 20  ? 19.133  45.630  54.516  1.00 47.62  ? 520 PHE C CE1 1 
ATOM   5028  C CE2 . PHE C 1 20  ? 17.354  45.779  52.935  1.00 42.52  ? 520 PHE C CE2 1 
ATOM   5029  C CZ  . PHE C 1 20  ? 17.828  45.362  54.161  1.00 46.39  ? 520 PHE C CZ  1 
ATOM   5030  N N   . GLU C 1 21  ? 20.966  44.208  50.798  1.00 49.59  ? 521 GLU C N   1 
ATOM   5031  C CA  . GLU C 1 21  ? 20.323  42.985  50.323  1.00 51.23  ? 521 GLU C CA  1 
ATOM   5032  C C   . GLU C 1 21  ? 19.427  42.408  51.412  1.00 45.67  ? 521 GLU C C   1 
ATOM   5033  O O   . GLU C 1 21  ? 19.616  42.684  52.599  1.00 43.35  ? 521 GLU C O   1 
ATOM   5034  C CB  . GLU C 1 21  ? 21.374  41.958  49.893  1.00 58.44  ? 521 GLU C CB  1 
ATOM   5035  C CG  . GLU C 1 21  ? 22.217  42.383  48.693  1.00 65.03  ? 521 GLU C CG  1 
ATOM   5036  C CD  . GLU C 1 21  ? 23.399  41.457  48.460  1.00 79.94  ? 521 GLU C CD  1 
ATOM   5037  O OE1 . GLU C 1 21  ? 23.978  40.973  49.455  1.00 85.01  ? 521 GLU C OE1 1 
ATOM   5038  O OE2 . GLU C 1 21  ? 23.748  41.205  47.286  1.00 86.98  ? 521 GLU C OE2 1 
ATOM   5039  N N   . SER C 1 22  ? 18.441  41.616  51.013  1.00 44.55  ? 522 SER C N   1 
ATOM   5040  C CA  . SER C 1 22  ? 17.527  41.016  51.980  1.00 46.78  ? 522 SER C CA  1 
ATOM   5041  C C   . SER C 1 22  ? 16.666  39.944  51.336  1.00 45.89  ? 522 SER C C   1 
ATOM   5042  O O   . SER C 1 22  ? 16.203  40.093  50.201  1.00 39.79  ? 522 SER C O   1 
ATOM   5043  C CB  . SER C 1 22  ? 16.635  42.080  52.651  1.00 47.37  ? 522 SER C CB  1 
ATOM   5044  O OG  . SER C 1 22  ? 15.746  41.510  53.611  1.00 40.59  ? 522 SER C OG  1 
ATOM   5045  N N   . LYS C 1 23  ? 16.461  38.871  52.096  1.00 49.88  ? 523 LYS C N   1 
ATOM   5046  C CA  . LYS C 1 23  ? 15.642  37.723  51.722  1.00 41.09  ? 523 LYS C CA  1 
ATOM   5047  C C   . LYS C 1 23  ? 14.240  38.138  51.262  1.00 43.51  ? 523 LYS C C   1 
ATOM   5048  O O   . LYS C 1 23  ? 13.613  37.452  50.450  1.00 45.21  ? 523 LYS C O   1 
ATOM   5049  C CB  . LYS C 1 23  ? 15.534  36.827  52.946  1.00 40.24  ? 523 LYS C CB  1 
ATOM   5050  C CG  . LYS C 1 23  ? 15.179  35.408  52.681  1.00 58.14  ? 523 LYS C CG  1 
ATOM   5051  C CD  . LYS C 1 23  ? 15.754  34.536  53.787  1.00 71.20  ? 523 LYS C CD  1 
ATOM   5052  C CE  . LYS C 1 23  ? 15.634  35.210  55.147  1.00 71.85  ? 523 LYS C CE  1 
ATOM   5053  N NZ  . LYS C 1 23  ? 16.492  34.541  56.172  1.00 72.29  ? 523 LYS C NZ  1 
ATOM   5054  N N   . PHE C 1 24  ? 13.766  39.276  51.773  1.00 36.30  ? 524 PHE C N   1 
ATOM   5055  C CA  . PHE C 1 24  ? 12.410  39.758  51.505  1.00 45.56  ? 524 PHE C CA  1 
ATOM   5056  C C   . PHE C 1 24  ? 12.349  40.931  50.518  1.00 44.94  ? 524 PHE C C   1 
ATOM   5057  O O   . PHE C 1 24  ? 11.291  41.518  50.322  1.00 40.52  ? 524 PHE C O   1 
ATOM   5058  C CB  . PHE C 1 24  ? 11.730  40.166  52.822  1.00 44.08  ? 524 PHE C CB  1 
ATOM   5059  C CG  . PHE C 1 24  ? 11.673  39.059  53.842  1.00 46.30  ? 524 PHE C CG  1 
ATOM   5060  C CD1 . PHE C 1 24  ? 10.701  38.064  53.758  1.00 48.38  ? 524 PHE C CD1 1 
ATOM   5061  C CD2 . PHE C 1 24  ? 12.592  39.005  54.877  1.00 40.40  ? 524 PHE C CD2 1 
ATOM   5062  C CE1 . PHE C 1 24  ? 10.639  37.040  54.692  1.00 41.43  ? 524 PHE C CE1 1 
ATOM   5063  C CE2 . PHE C 1 24  ? 12.540  37.980  55.814  1.00 46.32  ? 524 PHE C CE2 1 
ATOM   5064  C CZ  . PHE C 1 24  ? 11.559  36.994  55.721  1.00 44.05  ? 524 PHE C CZ  1 
ATOM   5065  N N   . LEU C 1 25  ? 13.475  41.266  49.897  1.00 45.24  ? 525 LEU C N   1 
ATOM   5066  C CA  . LEU C 1 25  ? 13.529  42.404  48.977  1.00 45.69  ? 525 LEU C CA  1 
ATOM   5067  C C   . LEU C 1 25  ? 14.179  42.062  47.631  1.00 46.30  ? 525 LEU C C   1 
ATOM   5068  O O   . LEU C 1 25  ? 15.389  41.826  47.561  1.00 45.45  ? 525 LEU C O   1 
ATOM   5069  C CB  . LEU C 1 25  ? 14.289  43.565  49.620  1.00 33.01  ? 525 LEU C CB  1 
ATOM   5070  C CG  . LEU C 1 25  ? 14.364  44.830  48.768  1.00 41.22  ? 525 LEU C CG  1 
ATOM   5071  C CD1 . LEU C 1 25  ? 13.001  45.510  48.737  1.00 32.22  ? 525 LEU C CD1 1 
ATOM   5072  C CD2 . LEU C 1 25  ? 15.439  45.785  49.301  1.00 46.07  ? 525 LEU C CD2 1 
ATOM   5073  N N   . PRO C 1 26  ? 13.383  42.058  46.554  1.00 45.84  ? 526 PRO C N   1 
ATOM   5074  C CA  . PRO C 1 26  ? 13.923  41.759  45.221  1.00 48.53  ? 526 PRO C CA  1 
ATOM   5075  C C   . PRO C 1 26  ? 15.068  42.711  44.873  1.00 49.53  ? 526 PRO C C   1 
ATOM   5076  O O   . PRO C 1 26  ? 14.864  43.925  44.866  1.00 55.96  ? 526 PRO C O   1 
ATOM   5077  C CB  . PRO C 1 26  ? 12.729  42.011  44.290  1.00 50.28  ? 526 PRO C CB  1 
ATOM   5078  C CG  . PRO C 1 26  ? 11.520  41.972  45.167  1.00 46.20  ? 526 PRO C CG  1 
ATOM   5079  C CD  . PRO C 1 26  ? 11.968  42.462  46.508  1.00 46.20  ? 526 PRO C CD  1 
ATOM   5080  N N   . PRO C 1 27  ? 16.264  42.170  44.605  1.00 49.81  ? 527 PRO C N   1 
ATOM   5081  C CA  . PRO C 1 27  ? 17.452  42.973  44.288  1.00 54.30  ? 527 PRO C CA  1 
ATOM   5082  C C   . PRO C 1 27  ? 17.248  43.990  43.157  1.00 57.25  ? 527 PRO C C   1 
ATOM   5083  O O   . PRO C 1 27  ? 17.837  45.064  43.209  1.00 49.80  ? 527 PRO C O   1 
ATOM   5084  C CB  . PRO C 1 27  ? 18.478  41.914  43.879  1.00 50.32  ? 527 PRO C CB  1 
ATOM   5085  C CG  . PRO C 1 27  ? 18.097  40.730  44.681  1.00 50.03  ? 527 PRO C CG  1 
ATOM   5086  C CD  . PRO C 1 27  ? 16.586  40.739  44.707  1.00 44.54  ? 527 PRO C CD  1 
ATOM   5087  N N   . GLU C 1 28  ? 16.442  43.670  42.150  1.00 64.93  ? 528 GLU C N   1 
ATOM   5088  C CA  . GLU C 1 28  ? 16.264  44.600  41.040  1.00 75.59  ? 528 GLU C CA  1 
ATOM   5089  C C   . GLU C 1 28  ? 15.061  45.504  41.216  1.00 72.26  ? 528 GLU C C   1 
ATOM   5090  O O   . GLU C 1 28  ? 14.663  46.191  40.280  1.00 74.67  ? 528 GLU C O   1 
ATOM   5091  C CB  . GLU C 1 28  ? 16.130  43.843  39.727  1.00 90.13  ? 528 GLU C CB  1 
ATOM   5092  C CG  . GLU C 1 28  ? 17.407  43.194  39.259  1.00 106.88 ? 528 GLU C CG  1 
ATOM   5093  C CD  . GLU C 1 28  ? 17.184  42.310  38.044  1.00 118.94 ? 528 GLU C CD  1 
ATOM   5094  O OE1 . GLU C 1 28  ? 16.003  42.098  37.685  1.00 120.91 ? 528 GLU C OE1 1 
ATOM   5095  O OE2 . GLU C 1 28  ? 18.184  41.836  37.454  1.00 122.54 ? 528 GLU C OE2 1 
ATOM   5096  N N   . ASN C 1 29  ? 14.485  45.493  42.413  1.00 63.82  ? 529 ASN C N   1 
ATOM   5097  C CA  . ASN C 1 29  ? 13.252  46.225  42.680  1.00 54.62  ? 529 ASN C CA  1 
ATOM   5098  C C   . ASN C 1 29  ? 13.312  47.668  42.200  1.00 53.68  ? 529 ASN C C   1 
ATOM   5099  O O   . ASN C 1 29  ? 14.364  48.316  42.254  1.00 52.42  ? 529 ASN C O   1 
ATOM   5100  C CB  . ASN C 1 29  ? 12.915  46.197  44.173  1.00 48.37  ? 529 ASN C CB  1 
ATOM   5101  C CG  . ASN C 1 29  ? 13.517  47.371  44.933  1.00 40.58  ? 529 ASN C CG  1 
ATOM   5102  O OD1 . ASN C 1 29  ? 14.727  47.441  45.135  1.00 43.71  ? 529 ASN C OD1 1 
ATOM   5103  N ND2 . ASN C 1 29  ? 12.672  48.291  45.358  1.00 36.60  ? 529 ASN C ND2 1 
ATOM   5104  N N   . LYS C 1 30  ? 12.182  48.169  41.720  1.00 57.15  ? 530 LYS C N   1 
ATOM   5105  C CA  . LYS C 1 30  ? 12.099  49.569  41.346  1.00 69.29  ? 530 LYS C CA  1 
ATOM   5106  C C   . LYS C 1 30  ? 11.168  50.307  42.298  1.00 61.85  ? 530 LYS C C   1 
ATOM   5107  O O   . LYS C 1 30  ? 10.606  49.708  43.213  1.00 68.46  ? 530 LYS C O   1 
ATOM   5108  C CB  . LYS C 1 30  ? 11.693  49.742  39.874  1.00 81.99  ? 530 LYS C CB  1 
ATOM   5109  C CG  . LYS C 1 30  ? 10.502  48.925  39.418  1.00 91.35  ? 530 LYS C CG  1 
ATOM   5110  C CD  . LYS C 1 30  ? 9.446   49.833  38.804  1.00 104.00 ? 530 LYS C CD  1 
ATOM   5111  C CE  . LYS C 1 30  ? 10.081  50.920  37.938  1.00 107.87 ? 530 LYS C CE  1 
ATOM   5112  N NZ  . LYS C 1 30  ? 9.154   52.065  37.677  1.00 103.08 ? 530 LYS C NZ  1 
ATOM   5113  N N   . PRO C 1 31  ? 11.013  51.616  42.096  1.00 48.04  ? 531 PRO C N   1 
ATOM   5114  C CA  . PRO C 1 31  ? 10.268  52.406  43.083  1.00 48.00  ? 531 PRO C CA  1 
ATOM   5115  C C   . PRO C 1 31  ? 8.802   51.995  43.240  1.00 47.28  ? 531 PRO C C   1 
ATOM   5116  O O   . PRO C 1 31  ? 8.095   51.785  42.255  1.00 53.57  ? 531 PRO C O   1 
ATOM   5117  C CB  . PRO C 1 31  ? 10.394  53.850  42.563  1.00 40.20  ? 531 PRO C CB  1 
ATOM   5118  C CG  . PRO C 1 31  ? 10.878  53.728  41.143  1.00 41.29  ? 531 PRO C CG  1 
ATOM   5119  C CD  . PRO C 1 31  ? 11.606  52.437  41.025  1.00 38.83  ? 531 PRO C CD  1 
ATOM   5120  N N   . LEU C 1 32  ? 8.364   51.878  44.490  1.00 45.23  ? 532 LEU C N   1 
ATOM   5121  C CA  . LEU C 1 32  ? 6.956   51.653  44.817  1.00 44.24  ? 532 LEU C CA  1 
ATOM   5122  C C   . LEU C 1 32  ? 6.347   50.442  44.114  1.00 52.20  ? 532 LEU C C   1 
ATOM   5123  O O   . LEU C 1 32  ? 5.179   50.482  43.725  1.00 53.73  ? 532 LEU C O   1 
ATOM   5124  C CB  . LEU C 1 32  ? 6.128   52.899  44.495  1.00 38.51  ? 532 LEU C CB  1 
ATOM   5125  C CG  . LEU C 1 32  ? 6.588   54.207  45.150  1.00 43.95  ? 532 LEU C CG  1 
ATOM   5126  C CD1 . LEU C 1 32  ? 5.981   55.414  44.443  1.00 45.12  ? 532 LEU C CD1 1 
ATOM   5127  C CD2 . LEU C 1 32  ? 6.273   54.226  46.649  1.00 34.77  ? 532 LEU C CD2 1 
ATOM   5128  N N   . GLU C 1 33  ? 7.129   49.373  43.955  1.00 51.38  ? 533 GLU C N   1 
ATOM   5129  C CA  . GLU C 1 33  ? 6.614   48.145  43.350  1.00 56.18  ? 533 GLU C CA  1 
ATOM   5130  C C   . GLU C 1 33  ? 5.333   47.693  44.036  1.00 55.57  ? 533 GLU C C   1 
ATOM   5131  O O   . GLU C 1 33  ? 5.311   47.412  45.230  1.00 51.31  ? 533 GLU C O   1 
ATOM   5132  C CB  . GLU C 1 33  ? 7.658   47.027  43.351  1.00 63.39  ? 533 GLU C CB  1 
ATOM   5133  C CG  . GLU C 1 33  ? 8.625   47.089  42.172  1.00 69.24  ? 533 GLU C CG  1 
ATOM   5134  C CD  . GLU C 1 33  ? 9.502   45.852  42.063  1.00 75.50  ? 533 GLU C CD  1 
ATOM   5135  O OE1 . GLU C 1 33  ? 9.054   44.761  42.473  1.00 82.25  ? 533 GLU C OE1 1 
ATOM   5136  O OE2 . GLU C 1 33  ? 10.641  45.968  41.569  1.00 72.63  ? 533 GLU C OE2 1 
ATOM   5137  N N   . THR C 1 34  ? 4.266   47.629  43.255  1.00 62.18  ? 534 THR C N   1 
ATOM   5138  C CA  . THR C 1 34  ? 2.927   47.369  43.770  1.00 61.83  ? 534 THR C CA  1 
ATOM   5139  C C   . THR C 1 34  ? 2.807   46.148  44.700  1.00 59.70  ? 534 THR C C   1 
ATOM   5140  O O   . THR C 1 34  ? 2.174   46.228  45.752  1.00 52.50  ? 534 THR C O   1 
ATOM   5141  C CB  . THR C 1 34  ? 1.937   47.247  42.607  1.00 64.09  ? 534 THR C CB  1 
ATOM   5142  O OG1 . THR C 1 34  ? 0.778   46.534  43.045  1.00 62.16  ? 534 THR C OG1 1 
ATOM   5143  C CG2 . THR C 1 34  ? 2.584   46.498  41.439  1.00 70.78  ? 534 THR C CG2 1 
ATOM   5144  N N   . ALA C 1 35  ? 3.411   45.026  44.314  1.00 63.50  ? 535 ALA C N   1 
ATOM   5145  C CA  . ALA C 1 35  ? 3.355   43.802  45.118  1.00 57.98  ? 535 ALA C CA  1 
ATOM   5146  C C   . ALA C 1 35  ? 4.106   43.963  46.436  1.00 51.15  ? 535 ALA C C   1 
ATOM   5147  O O   . ALA C 1 35  ? 3.654   43.490  47.482  1.00 44.54  ? 535 ALA C O   1 
ATOM   5148  C CB  . ALA C 1 35  ? 3.914   42.627  44.333  1.00 58.87  ? 535 ALA C CB  1 
ATOM   5149  N N   . LEU C 1 36  ? 5.256   44.629  46.374  1.00 48.31  ? 536 LEU C N   1 
ATOM   5150  C CA  . LEU C 1 36  ? 6.030   44.956  47.569  1.00 50.61  ? 536 LEU C CA  1 
ATOM   5151  C C   . LEU C 1 36  ? 5.251   45.811  48.560  1.00 47.15  ? 536 LEU C C   1 
ATOM   5152  O O   . LEU C 1 36  ? 5.342   45.613  49.767  1.00 48.09  ? 536 LEU C O   1 
ATOM   5153  C CB  . LEU C 1 36  ? 7.311   45.666  47.183  1.00 53.27  ? 536 LEU C CB  1 
ATOM   5154  C CG  . LEU C 1 36  ? 8.329   44.685  46.632  1.00 64.65  ? 536 LEU C CG  1 
ATOM   5155  C CD1 . LEU C 1 36  ? 9.403   45.417  45.850  1.00 69.07  ? 536 LEU C CD1 1 
ATOM   5156  C CD2 . LEU C 1 36  ? 8.915   43.911  47.793  1.00 65.54  ? 536 LEU C CD2 1 
ATOM   5157  N N   . LEU C 1 37  ? 4.483   46.766  48.058  1.00 42.09  ? 537 LEU C N   1 
ATOM   5158  C CA  . LEU C 1 37  ? 3.661   47.564  48.948  1.00 46.61  ? 537 LEU C CA  1 
ATOM   5159  C C   . LEU C 1 37  ? 2.507   46.727  49.493  1.00 54.48  ? 537 LEU C C   1 
ATOM   5160  O O   . LEU C 1 37  ? 2.188   46.791  50.677  1.00 61.01  ? 537 LEU C O   1 
ATOM   5161  C CB  . LEU C 1 37  ? 3.143   48.807  48.239  1.00 45.46  ? 537 LEU C CB  1 
ATOM   5162  C CG  . LEU C 1 37  ? 4.196   49.833  47.832  1.00 45.19  ? 537 LEU C CG  1 
ATOM   5163  C CD1 . LEU C 1 37  ? 3.617   50.794  46.810  1.00 53.40  ? 537 LEU C CD1 1 
ATOM   5164  C CD2 . LEU C 1 37  ? 4.674   50.583  49.044  1.00 37.83  ? 537 LEU C CD2 1 
ATOM   5165  N N   . LYS C 1 38  ? 1.887   45.935  48.628  1.00 52.65  ? 538 LYS C N   1 
ATOM   5166  C CA  . LYS C 1 38  ? 0.802   45.064  49.060  1.00 62.97  ? 538 LYS C CA  1 
ATOM   5167  C C   . LYS C 1 38  ? 1.248   44.208  50.240  1.00 61.10  ? 538 LYS C C   1 
ATOM   5168  O O   . LYS C 1 38  ? 0.539   44.105  51.243  1.00 59.17  ? 538 LYS C O   1 
ATOM   5169  C CB  . LYS C 1 38  ? 0.328   44.171  47.908  1.00 69.75  ? 538 LYS C CB  1 
ATOM   5170  C CG  . LYS C 1 38  ? -0.923  43.363  48.221  1.00 76.90  ? 538 LYS C CG  1 
ATOM   5171  C CD  . LYS C 1 38  ? -1.335  42.502  47.034  1.00 85.54  ? 538 LYS C CD  1 
ATOM   5172  C CE  . LYS C 1 38  ? -2.496  41.577  47.379  1.00 87.53  ? 538 LYS C CE  1 
ATOM   5173  N NZ  . LYS C 1 38  ? -2.146  40.597  48.446  1.00 86.62  ? 538 LYS C NZ  1 
ATOM   5174  N N   . ARG C 1 39  ? 2.426   43.601  50.117  1.00 54.89  ? 539 ARG C N   1 
ATOM   5175  C CA  . ARG C 1 39  ? 2.964   42.763  51.179  1.00 51.76  ? 539 ARG C CA  1 
ATOM   5176  C C   . ARG C 1 39  ? 3.196   43.547  52.462  1.00 57.62  ? 539 ARG C C   1 
ATOM   5177  O O   . ARG C 1 39  ? 2.790   43.120  53.542  1.00 65.75  ? 539 ARG C O   1 
ATOM   5178  C CB  . ARG C 1 39  ? 4.281   42.119  50.753  1.00 56.23  ? 539 ARG C CB  1 
ATOM   5179  C CG  . ARG C 1 39  ? 4.818   41.133  51.786  1.00 65.81  ? 539 ARG C CG  1 
ATOM   5180  C CD  . ARG C 1 39  ? 3.759   40.078  52.108  1.00 74.53  ? 539 ARG C CD  1 
ATOM   5181  N NE  . ARG C 1 39  ? 4.242   38.988  52.956  1.00 76.67  ? 539 ARG C NE  1 
ATOM   5182  C CZ  . ARG C 1 39  ? 3.886   38.811  54.225  1.00 74.33  ? 539 ARG C CZ  1 
ATOM   5183  N NH1 . ARG C 1 39  ? 3.048   39.656  54.807  1.00 75.07  ? 539 ARG C NH1 1 
ATOM   5184  N NH2 . ARG C 1 39  ? 4.367   37.786  54.915  1.00 70.40  ? 539 ARG C NH2 1 
ATOM   5185  N N   . ALA C 1 40  ? 3.865   44.688  52.345  1.00 48.77  ? 540 ALA C N   1 
ATOM   5186  C CA  . ALA C 1 40  ? 4.175   45.505  53.508  1.00 46.28  ? 540 ALA C CA  1 
ATOM   5187  C C   . ALA C 1 40  ? 2.915   45.824  54.310  1.00 58.76  ? 540 ALA C C   1 
ATOM   5188  O O   . ALA C 1 40  ? 2.888   45.661  55.531  1.00 66.04  ? 540 ALA C O   1 
ATOM   5189  C CB  . ALA C 1 40  ? 4.875   46.777  53.081  1.00 38.05  ? 540 ALA C CB  1 
ATOM   5190  N N   . LYS C 1 41  ? 1.873   46.273  53.616  1.00 59.02  ? 541 LYS C N   1 
ATOM   5191  C CA  . LYS C 1 41  ? 0.590   46.553  54.246  1.00 56.71  ? 541 LYS C CA  1 
ATOM   5192  C C   . LYS C 1 41  ? 0.013   45.286  54.884  1.00 51.11  ? 541 LYS C C   1 
ATOM   5193  O O   . LYS C 1 41  ? -0.410  45.314  56.033  1.00 54.75  ? 541 LYS C O   1 
ATOM   5194  C CB  . LYS C 1 41  ? -0.388  47.163  53.233  1.00 61.93  ? 541 LYS C CB  1 
ATOM   5195  C CG  . LYS C 1 41  ? -1.773  47.504  53.782  1.00 65.23  ? 541 LYS C CG  1 
ATOM   5196  C CD  . LYS C 1 41  ? -1.771  48.778  54.618  1.00 67.80  ? 541 LYS C CD  1 
ATOM   5197  C CE  . LYS C 1 41  ? -3.170  49.119  55.163  1.00 69.18  ? 541 LYS C CE  1 
ATOM   5198  N NZ  . LYS C 1 41  ? -3.983  49.948  54.225  1.00 64.79  ? 541 LYS C NZ  1 
ATOM   5199  N N   . GLU C 1 42  ? 0.002   44.177  54.150  1.00 52.91  ? 542 GLU C N   1 
ATOM   5200  C CA  . GLU C 1 42  ? -0.349  42.873  54.735  1.00 64.07  ? 542 GLU C CA  1 
ATOM   5201  C C   . GLU C 1 42  ? 0.252   42.651  56.136  1.00 61.34  ? 542 GLU C C   1 
ATOM   5202  O O   . GLU C 1 42  ? -0.420  42.136  57.034  1.00 51.47  ? 542 GLU C O   1 
ATOM   5203  C CB  . GLU C 1 42  ? 0.085   41.720  53.819  1.00 72.00  ? 542 GLU C CB  1 
ATOM   5204  C CG  . GLU C 1 42  ? -0.744  41.544  52.559  1.00 81.81  ? 542 GLU C CG  1 
ATOM   5205  C CD  . GLU C 1 42  ? -0.220  40.423  51.671  1.00 91.76  ? 542 GLU C CD  1 
ATOM   5206  O OE1 . GLU C 1 42  ? 0.359   39.450  52.207  1.00 95.35  ? 542 GLU C OE1 1 
ATOM   5207  O OE2 . GLU C 1 42  ? -0.378  40.520  50.435  1.00 92.96  ? 542 GLU C OE2 1 
ATOM   5208  N N   . LEU C 1 43  ? 1.518   43.028  56.312  1.00 64.39  ? 543 LEU C N   1 
ATOM   5209  C CA  . LEU C 1 43  ? 2.196   42.896  57.604  1.00 63.54  ? 543 LEU C CA  1 
ATOM   5210  C C   . LEU C 1 43  ? 1.615   43.821  58.666  1.00 57.69  ? 543 LEU C C   1 
ATOM   5211  O O   . LEU C 1 43  ? 1.367   43.413  59.798  1.00 56.29  ? 543 LEU C O   1 
ATOM   5212  C CB  . LEU C 1 43  ? 3.689   43.174  57.456  1.00 59.55  ? 543 LEU C CB  1 
ATOM   5213  C CG  . LEU C 1 43  ? 4.474   42.018  56.862  1.00 53.62  ? 543 LEU C CG  1 
ATOM   5214  C CD1 . LEU C 1 43  ? 5.952   42.347  56.891  1.00 58.89  ? 543 LEU C CD1 1 
ATOM   5215  C CD2 . LEU C 1 43  ? 4.173   40.764  57.656  1.00 43.53  ? 543 LEU C CD2 1 
ATOM   5216  N N   . PHE C 1 44  ? 1.405   45.074  58.296  1.00 55.86  ? 544 PHE C N   1 
ATOM   5217  C CA  . PHE C 1 44  ? 0.851   46.036  59.230  1.00 61.90  ? 544 PHE C CA  1 
ATOM   5218  C C   . PHE C 1 44  ? -0.606  45.692  59.540  1.00 60.49  ? 544 PHE C C   1 
ATOM   5219  O O   . PHE C 1 44  ? -1.095  45.911  60.647  1.00 58.07  ? 544 PHE C O   1 
ATOM   5220  C CB  . PHE C 1 44  ? 1.040   47.456  58.687  1.00 71.30  ? 544 PHE C CB  1 
ATOM   5221  C CG  . PHE C 1 44  ? 2.497   47.876  58.598  1.00 85.85  ? 544 PHE C CG  1 
ATOM   5222  C CD1 . PHE C 1 44  ? 3.438   47.355  59.480  1.00 86.66  ? 544 PHE C CD1 1 
ATOM   5223  C CD2 . PHE C 1 44  ? 2.928   48.776  57.632  1.00 90.55  ? 544 PHE C CD2 1 
ATOM   5224  C CE1 . PHE C 1 44  ? 4.771   47.729  59.409  1.00 85.19  ? 544 PHE C CE1 1 
ATOM   5225  C CE2 . PHE C 1 44  ? 4.268   49.156  57.555  1.00 87.90  ? 544 PHE C CE2 1 
ATOM   5226  C CZ  . PHE C 1 44  ? 5.186   48.632  58.446  1.00 87.35  ? 544 PHE C CZ  1 
ATOM   5227  N N   . THR C 1 45  ? -1.283  45.105  58.563  1.00 61.04  ? 545 THR C N   1 
ATOM   5228  C CA  . THR C 1 45  ? -2.663  44.673  58.729  1.00 48.44  ? 545 THR C CA  1 
ATOM   5229  C C   . THR C 1 45  ? -2.769  43.486  59.680  1.00 47.76  ? 545 THR C C   1 
ATOM   5230  O O   . THR C 1 45  ? -3.641  43.452  60.542  1.00 46.89  ? 545 THR C O   1 
ATOM   5231  C CB  . THR C 1 45  ? -3.272  44.259  57.381  1.00 46.06  ? 545 THR C CB  1 
ATOM   5232  O OG1 . THR C 1 45  ? -3.423  45.415  56.550  1.00 56.31  ? 545 THR C OG1 1 
ATOM   5233  C CG2 . THR C 1 45  ? -4.623  43.618  57.591  1.00 39.05  ? 545 THR C CG2 1 
ATOM   5234  N N   . ASN C 1 46  ? -1.874  42.516  59.513  1.00 47.45  ? 546 ASN C N   1 
ATOM   5235  C CA  . ASN C 1 46  ? -1.943  41.254  60.249  1.00 53.61  ? 546 ASN C CA  1 
ATOM   5236  C C   . ASN C 1 46  ? -1.340  41.262  61.641  1.00 52.34  ? 546 ASN C C   1 
ATOM   5237  O O   . ASN C 1 46  ? -1.273  40.221  62.286  1.00 51.48  ? 546 ASN C O   1 
ATOM   5238  C CB  . ASN C 1 46  ? -1.280  40.136  59.449  1.00 65.24  ? 546 ASN C CB  1 
ATOM   5239  C CG  . ASN C 1 46  ? -2.103  39.710  58.262  1.00 72.21  ? 546 ASN C CG  1 
ATOM   5240  O OD1 . ASN C 1 46  ? -3.337  39.728  58.306  1.00 64.99  ? 546 ASN C OD1 1 
ATOM   5241  N ND2 . ASN C 1 46  ? -1.426  39.329  57.184  1.00 75.96  ? 546 ASN C ND2 1 
ATOM   5242  N N   . ASN C 1 47  ? -0.879  42.420  62.095  1.00 50.64  ? 547 ASN C N   1 
ATOM   5243  C CA  . ASN C 1 47  ? -0.294  42.516  63.426  1.00 43.58  ? 547 ASN C CA  1 
ATOM   5244  C C   . ASN C 1 47  ? -0.971  43.589  64.260  1.00 43.67  ? 547 ASN C C   1 
ATOM   5245  O O   . ASN C 1 47  ? -1.512  44.558  63.727  1.00 51.63  ? 547 ASN C O   1 
ATOM   5246  C CB  . ASN C 1 47  ? 1.215   42.741  63.347  1.00 36.46  ? 547 ASN C CB  1 
ATOM   5247  C CG  . ASN C 1 47  ? 1.958   41.529  62.794  1.00 44.45  ? 547 ASN C CG  1 
ATOM   5248  O OD1 . ASN C 1 47  ? 2.300   40.600  63.533  1.00 42.19  ? 547 ASN C OD1 1 
ATOM   5249  N ND2 . ASN C 1 47  ? 2.204   41.530  61.487  1.00 46.67  ? 547 ASN C ND2 1 
ATOM   5250  N N   . ASP C 1 48  ? -0.973  43.393  65.571  1.00 38.38  ? 548 ASP C N   1 
ATOM   5251  C CA  . ASP C 1 48  ? -1.609  44.343  66.461  1.00 38.62  ? 548 ASP C CA  1 
ATOM   5252  C C   . ASP C 1 48  ? -0.658  45.533  66.718  1.00 36.56  ? 548 ASP C C   1 
ATOM   5253  O O   . ASP C 1 48  ? 0.553   45.411  66.539  1.00 37.59  ? 548 ASP C O   1 
ATOM   5254  C CB  . ASP C 1 48  ? -2.069  43.635  67.743  1.00 46.51  ? 548 ASP C CB  1 
ATOM   5255  C CG  . ASP C 1 48  ? -1.178  43.920  68.936  1.00 59.29  ? 548 ASP C CG  1 
ATOM   5256  O OD1 . ASP C 1 48  ? 0.039   44.100  68.737  1.00 68.79  ? 548 ASP C OD1 1 
ATOM   5257  O OD2 . ASP C 1 48  ? -1.698  43.962  70.080  1.00 59.09  ? 548 ASP C OD2 1 
ATOM   5258  N N   . PRO C 1 49  ? -1.208  46.691  67.107  1.00 28.27  ? 549 PRO C N   1 
ATOM   5259  C CA  . PRO C 1 49  ? -0.406  47.916  67.312  1.00 28.73  ? 549 PRO C CA  1 
ATOM   5260  C C   . PRO C 1 49  ? 0.816   47.761  68.228  1.00 37.15  ? 549 PRO C C   1 
ATOM   5261  O O   . PRO C 1 49  ? 1.856   48.352  67.936  1.00 39.64  ? 549 PRO C O   1 
ATOM   5262  C CB  . PRO C 1 49  ? -1.414  48.900  67.925  1.00 25.04  ? 549 PRO C CB  1 
ATOM   5263  C CG  . PRO C 1 49  ? -2.760  48.440  67.362  1.00 31.79  ? 549 PRO C CG  1 
ATOM   5264  C CD  . PRO C 1 49  ? -2.651  46.922  67.306  1.00 17.14  ? 549 PRO C CD  1 
ATOM   5265  N N   . LYS C 1 50  ? 0.708   46.991  69.308  1.00 36.86  ? 550 LYS C N   1 
ATOM   5266  C CA  . LYS C 1 50  ? 1.843   46.844  70.210  1.00 33.61  ? 550 LYS C CA  1 
ATOM   5267  C C   . LYS C 1 50  ? 2.999   46.019  69.613  1.00 30.29  ? 550 LYS C C   1 
ATOM   5268  O O   . LYS C 1 50  ? 4.164   46.329  69.869  1.00 30.10  ? 550 LYS C O   1 
ATOM   5269  C CB  . LYS C 1 50  ? 1.425   46.278  71.569  1.00 37.42  ? 550 LYS C CB  1 
ATOM   5270  C CG  . LYS C 1 50  ? 2.565   46.276  72.588  1.00 47.30  ? 550 LYS C CG  1 
ATOM   5271  C CD  . LYS C 1 50  ? 2.208   45.509  73.844  1.00 53.98  ? 550 LYS C CD  1 
ATOM   5272  C CE  . LYS C 1 50  ? 0.939   46.051  74.476  1.00 62.53  ? 550 LYS C CE  1 
ATOM   5273  N NZ  . LYS C 1 50  ? 1.236   46.971  75.603  1.00 66.03  ? 550 LYS C NZ  1 
ATOM   5274  N N   . VAL C 1 51  ? 2.691   44.985  68.823  1.00 17.98  ? 551 VAL C N   1 
ATOM   5275  C CA  . VAL C 1 51  ? 3.761   44.165  68.220  1.00 24.20  ? 551 VAL C CA  1 
ATOM   5276  C C   . VAL C 1 51  ? 4.519   44.993  67.204  1.00 28.94  ? 551 VAL C C   1 
ATOM   5277  O O   . VAL C 1 51  ? 5.728   44.842  67.039  1.00 31.68  ? 551 VAL C O   1 
ATOM   5278  C CB  . VAL C 1 51  ? 3.253   42.873  67.507  1.00 31.62  ? 551 VAL C CB  1 
ATOM   5279  C CG1 . VAL C 1 51  ? 4.431   42.078  66.915  1.00 23.75  ? 551 VAL C CG1 1 
ATOM   5280  C CG2 . VAL C 1 51  ? 2.445   41.999  68.454  1.00 19.21  ? 551 VAL C CG2 1 
ATOM   5281  N N   . ILE C 1 52  ? 3.788   45.857  66.507  1.00 30.54  ? 552 ILE C N   1 
ATOM   5282  C CA  . ILE C 1 52  ? 4.396   46.766  65.553  1.00 28.36  ? 552 ILE C CA  1 
ATOM   5283  C C   . ILE C 1 52  ? 5.322   47.735  66.292  1.00 31.75  ? 552 ILE C C   1 
ATOM   5284  O O   . ILE C 1 52  ? 6.507   47.864  65.963  1.00 30.37  ? 552 ILE C O   1 
ATOM   5285  C CB  . ILE C 1 52  ? 3.320   47.550  64.801  1.00 29.80  ? 552 ILE C CB  1 
ATOM   5286  C CG1 . ILE C 1 52  ? 2.483   46.607  63.941  1.00 25.79  ? 552 ILE C CG1 1 
ATOM   5287  C CG2 . ILE C 1 52  ? 3.947   48.609  63.918  1.00 30.22  ? 552 ILE C CG2 1 
ATOM   5288  C CD1 . ILE C 1 52  ? 1.150   47.222  63.474  1.00 32.84  ? 552 ILE C CD1 1 
ATOM   5289  N N   . ALA C 1 53  ? 4.774   48.392  67.307  1.00 30.07  ? 553 ALA C N   1 
ATOM   5290  C CA  . ALA C 1 53  ? 5.521   49.362  68.095  1.00 30.41  ? 553 ALA C CA  1 
ATOM   5291  C C   . ALA C 1 53  ? 6.807   48.763  68.686  1.00 24.98  ? 553 ALA C C   1 
ATOM   5292  O O   . ALA C 1 53  ? 7.855   49.425  68.729  1.00 19.57  ? 553 ALA C O   1 
ATOM   5293  C CB  . ALA C 1 53  ? 4.623   49.953  69.200  1.00 30.53  ? 553 ALA C CB  1 
ATOM   5294  N N   . GLN C 1 54  ? 6.724   47.512  69.129  1.00 24.04  ? 554 GLN C N   1 
ATOM   5295  C CA  . GLN C 1 54  ? 7.881   46.820  69.685  1.00 22.40  ? 554 GLN C CA  1 
ATOM   5296  C C   . GLN C 1 54  ? 8.996   46.682  68.659  1.00 28.24  ? 554 GLN C C   1 
ATOM   5297  O O   . GLN C 1 54  ? 10.170  46.883  68.994  1.00 17.52  ? 554 GLN C O   1 
ATOM   5298  C CB  . GLN C 1 54  ? 7.504   45.436  70.169  1.00 19.66  ? 554 GLN C CB  1 
ATOM   5299  C CG  . GLN C 1 54  ? 7.058   45.341  71.610  1.00 21.62  ? 554 GLN C CG  1 
ATOM   5300  C CD  . GLN C 1 54  ? 6.512   43.927  71.927  1.00 43.08  ? 554 GLN C CD  1 
ATOM   5301  O OE1 . GLN C 1 54  ? 5.914   43.265  71.068  1.00 39.76  ? 554 GLN C OE1 1 
ATOM   5302  N NE2 . GLN C 1 54  ? 6.747   43.459  73.149  1.00 41.43  ? 554 GLN C NE2 1 
ATOM   5303  N N   . HIS C 1 55  ? 8.642   46.342  67.416  1.00 24.02  ? 555 HIS C N   1 
ATOM   5304  C CA  . HIS C 1 55  ? 9.673   46.204  66.387  1.00 29.51  ? 555 HIS C CA  1 
ATOM   5305  C C   . HIS C 1 55  ? 10.284  47.565  66.082  1.00 28.29  ? 555 HIS C C   1 
ATOM   5306  O O   . HIS C 1 55  ? 11.487  47.691  65.882  1.00 28.63  ? 555 HIS C O   1 
ATOM   5307  C CB  . HIS C 1 55  ? 9.131   45.577  65.108  1.00 21.84  ? 555 HIS C CB  1 
ATOM   5308  C CG  . HIS C 1 55  ? 8.841   44.118  65.225  1.00 22.60  ? 555 HIS C CG  1 
ATOM   5309  N ND1 . HIS C 1 55  ? 7.676   43.632  65.785  1.00 21.91  ? 555 HIS C ND1 1 
ATOM   5310  C CD2 . HIS C 1 55  ? 9.557   43.035  64.838  1.00 24.93  ? 555 HIS C CD2 1 
ATOM   5311  C CE1 . HIS C 1 55  ? 7.695   42.310  65.741  1.00 34.21  ? 555 HIS C CE1 1 
ATOM   5312  N NE2 . HIS C 1 55  ? 8.824   41.923  65.171  1.00 21.33  ? 555 HIS C NE2 1 
ATOM   5313  N N   . VAL C 1 56  ? 9.448   48.590  66.062  1.00 28.10  ? 556 VAL C N   1 
ATOM   5314  C CA  . VAL C 1 56  ? 9.945   49.932  65.850  1.00 25.34  ? 556 VAL C CA  1 
ATOM   5315  C C   . VAL C 1 56  ? 10.875  50.378  66.978  1.00 27.13  ? 556 VAL C C   1 
ATOM   5316  O O   . VAL C 1 56  ? 11.965  50.887  66.727  1.00 28.11  ? 556 VAL C O   1 
ATOM   5317  C CB  . VAL C 1 56  ? 8.804   50.900  65.682  1.00 24.76  ? 556 VAL C CB  1 
ATOM   5318  C CG1 . VAL C 1 56  ? 9.337   52.332  65.590  1.00 19.22  ? 556 VAL C CG1 1 
ATOM   5319  C CG2 . VAL C 1 56  ? 7.992   50.484  64.445  1.00 15.08  ? 556 VAL C CG2 1 
ATOM   5320  N N   . LEU C 1 57  ? 10.455  50.162  68.216  1.00 26.42  ? 557 LEU C N   1 
ATOM   5321  C CA  . LEU C 1 57  ? 11.303  50.470  69.357  1.00 24.52  ? 557 LEU C CA  1 
ATOM   5322  C C   . LEU C 1 57  ? 12.633  49.723  69.259  1.00 27.47  ? 557 LEU C C   1 
ATOM   5323  O O   . LEU C 1 57  ? 13.714  50.302  69.414  1.00 23.85  ? 557 LEU C O   1 
ATOM   5324  C CB  . LEU C 1 57  ? 10.596  50.110  70.664  1.00 16.54  ? 557 LEU C CB  1 
ATOM   5325  C CG  . LEU C 1 57  ? 11.514  50.148  71.878  1.00 12.47  ? 557 LEU C CG  1 
ATOM   5326  C CD1 . LEU C 1 57  ? 12.112  51.541  72.029  1.00 12.65  ? 557 LEU C CD1 1 
ATOM   5327  C CD2 . LEU C 1 57  ? 10.781  49.714  73.130  1.00 16.21  ? 557 LEU C CD2 1 
ATOM   5328  N N   . SER C 1 58  ? 12.551  48.430  68.988  1.00 28.55  ? 558 SER C N   1 
ATOM   5329  C CA  . SER C 1 58  ? 13.756  47.619  68.877  1.00 30.60  ? 558 SER C CA  1 
ATOM   5330  C C   . SER C 1 58  ? 14.726  48.152  67.820  1.00 29.41  ? 558 SER C C   1 
ATOM   5331  O O   . SER C 1 58  ? 15.934  48.222  68.058  1.00 31.74  ? 558 SER C O   1 
ATOM   5332  C CB  . SER C 1 58  ? 13.408  46.171  68.565  1.00 18.28  ? 558 SER C CB  1 
ATOM   5333  O OG  . SER C 1 58  ? 14.606  45.441  68.440  1.00 30.76  ? 558 SER C OG  1 
ATOM   5334  N N   . MET C 1 59  ? 14.198  48.509  66.652  1.00 18.19  ? 559 MET C N   1 
ATOM   5335  C CA  . MET C 1 59  ? 15.023  49.051  65.575  1.00 21.80  ? 559 MET C CA  1 
ATOM   5336  C C   . MET C 1 59  ? 15.606  50.412  65.946  1.00 24.80  ? 559 MET C C   1 
ATOM   5337  O O   . MET C 1 59  ? 16.807  50.646  65.791  1.00 27.60  ? 559 MET C O   1 
ATOM   5338  C CB  . MET C 1 59  ? 14.237  49.149  64.270  1.00 22.28  ? 559 MET C CB  1 
ATOM   5339  C CG  . MET C 1 59  ? 15.067  49.536  63.052  1.00 16.35  ? 559 MET C CG  1 
ATOM   5340  S SD  . MET C 1 59  ? 16.448  48.416  62.792  1.00 36.15  ? 559 MET C SD  1 
ATOM   5341  C CE  . MET C 1 59  ? 16.804  48.683  61.065  1.00 197.72 ? 559 MET C CE  1 
ATOM   5342  N N   . ASP C 1 60  ? 14.763  51.302  66.456  1.00 19.38  ? 560 ASP C N   1 
ATOM   5343  C CA  . ASP C 1 60  ? 15.243  52.606  66.875  1.00 19.67  ? 560 ASP C CA  1 
ATOM   5344  C C   . ASP C 1 60  ? 16.375  52.482  67.906  1.00 27.64  ? 560 ASP C C   1 
ATOM   5345  O O   . ASP C 1 60  ? 17.340  53.249  67.880  1.00 29.24  ? 560 ASP C O   1 
ATOM   5346  C CB  . ASP C 1 60  ? 14.090  53.449  67.418  1.00 14.85  ? 560 ASP C CB  1 
ATOM   5347  C CG  . ASP C 1 60  ? 13.198  53.961  66.318  1.00 25.51  ? 560 ASP C CG  1 
ATOM   5348  O OD1 . ASP C 1 60  ? 13.683  54.029  65.165  1.00 25.69  ? 560 ASP C OD1 1 
ATOM   5349  O OD2 . ASP C 1 60  ? 12.025  54.294  66.600  1.00 20.03  ? 560 ASP C OD2 1 
ATOM   5350  N N   . CYS C 1 61  ? 16.271  51.515  68.809  1.00 16.30  ? 561 CYS C N   1 
ATOM   5351  C CA  . CYS C 1 61  ? 17.317  51.348  69.805  1.00 24.11  ? 561 CYS C CA  1 
ATOM   5352  C C   . CYS C 1 61  ? 18.644  50.923  69.172  1.00 29.35  ? 561 CYS C C   1 
ATOM   5353  O O   . CYS C 1 61  ? 19.710  51.283  69.664  1.00 27.85  ? 561 CYS C O   1 
ATOM   5354  C CB  . CYS C 1 61  ? 16.885  50.387  70.912  1.00 21.34  ? 561 CYS C CB  1 
ATOM   5355  S SG  . CYS C 1 61  ? 15.749  51.137  72.083  1.00 26.71  ? 561 CYS C SG  1 
ATOM   5356  N N   . ARG C 1 62  ? 18.574  50.182  68.071  1.00 26.58  ? 562 ARG C N   1 
ATOM   5357  C CA  . ARG C 1 62  ? 19.787  49.739  67.397  1.00 26.64  ? 562 ARG C CA  1 
ATOM   5358  C C   . ARG C 1 62  ? 20.392  50.870  66.578  1.00 23.40  ? 562 ARG C C   1 
ATOM   5359  O O   . ARG C 1 62  ? 21.601  51.096  66.629  1.00 21.21  ? 562 ARG C O   1 
ATOM   5360  C CB  . ARG C 1 62  ? 19.559  48.481  66.545  1.00 24.82  ? 562 ARG C CB  1 
ATOM   5361  C CG  . ARG C 1 62  ? 19.211  47.238  67.378  1.00 51.74  ? 562 ARG C CG  1 
ATOM   5362  C CD  . ARG C 1 62  ? 19.611  45.919  66.705  1.00 68.80  ? 562 ARG C CD  1 
ATOM   5363  N NE  . ARG C 1 62  ? 18.861  45.659  65.481  1.00 82.02  ? 562 ARG C NE  1 
ATOM   5364  C CZ  . ARG C 1 62  ? 17.610  45.214  65.455  1.00 94.14  ? 562 ARG C CZ  1 
ATOM   5365  N NH1 . ARG C 1 62  ? 16.964  44.984  66.590  1.00 96.86  ? 562 ARG C NH1 1 
ATOM   5366  N NH2 . ARG C 1 62  ? 17.001  45.011  64.294  1.00 100.08 ? 562 ARG C NH2 1 
ATOM   5367  N N   . VAL C 1 63  ? 19.563  51.599  65.844  1.00 18.98  ? 563 VAL C N   1 
ATOM   5368  C CA  . VAL C 1 63  ? 20.079  52.747  65.092  1.00 29.39  ? 563 VAL C CA  1 
ATOM   5369  C C   . VAL C 1 63  ? 20.695  53.823  66.005  1.00 28.99  ? 563 VAL C C   1 
ATOM   5370  O O   . VAL C 1 63  ? 21.768  54.338  65.719  1.00 26.20  ? 563 VAL C O   1 
ATOM   5371  C CB  . VAL C 1 63  ? 19.026  53.366  64.153  1.00 25.66  ? 563 VAL C CB  1 
ATOM   5372  C CG1 . VAL C 1 63  ? 19.579  54.650  63.481  1.00 15.49  ? 563 VAL C CG1 1 
ATOM   5373  C CG2 . VAL C 1 63  ? 18.625  52.343  63.094  1.00 23.17  ? 563 VAL C CG2 1 
ATOM   5374  N N   . ALA C 1 64  ? 20.019  54.130  67.108  1.00 22.04  ? 564 ALA C N   1 
ATOM   5375  C CA  . ALA C 1 64  ? 20.501  55.112  68.073  1.00 18.27  ? 564 ALA C CA  1 
ATOM   5376  C C   . ALA C 1 64  ? 21.651  54.611  68.946  1.00 21.46  ? 564 ALA C C   1 
ATOM   5377  O O   . ALA C 1 64  ? 22.165  55.356  69.765  1.00 22.10  ? 564 ALA C O   1 
ATOM   5378  C CB  . ALA C 1 64  ? 19.339  55.597  68.967  1.00 17.45  ? 564 ALA C CB  1 
ATOM   5379  N N   . ARG C 1 65  ? 22.037  53.350  68.791  1.00 27.25  ? 565 ARG C N   1 
ATOM   5380  C CA  . ARG C 1 65  ? 23.038  52.756  69.672  1.00 27.19  ? 565 ARG C CA  1 
ATOM   5381  C C   . ARG C 1 65  ? 22.682  52.916  71.152  1.00 26.10  ? 565 ARG C C   1 
ATOM   5382  O O   . ARG C 1 65  ? 23.492  53.374  71.965  1.00 22.12  ? 565 ARG C O   1 
ATOM   5383  C CB  . ARG C 1 65  ? 24.422  53.317  69.377  1.00 16.66  ? 565 ARG C CB  1 
ATOM   5384  C CG  . ARG C 1 65  ? 24.791  53.179  67.917  1.00 20.79  ? 565 ARG C CG  1 
ATOM   5385  C CD  . ARG C 1 65  ? 26.179  53.732  67.662  1.00 26.14  ? 565 ARG C CD  1 
ATOM   5386  N NE  . ARG C 1 65  ? 26.430  53.895  66.232  1.00 41.92  ? 565 ARG C NE  1 
ATOM   5387  C CZ  . ARG C 1 65  ? 27.548  54.407  65.721  1.00 51.75  ? 565 ARG C CZ  1 
ATOM   5388  N NH1 . ARG C 1 65  ? 28.525  54.813  66.525  1.00 44.42  ? 565 ARG C NH1 1 
ATOM   5389  N NH2 . ARG C 1 65  ? 27.690  54.520  64.404  1.00 56.18  ? 565 ARG C NH2 1 
ATOM   5390  N N   . ILE C 1 66  ? 21.461  52.519  71.481  1.00 17.29  ? 566 ILE C N   1 
ATOM   5391  C CA  . ILE C 1 66  ? 21.011  52.425  72.859  1.00 21.43  ? 566 ILE C CA  1 
ATOM   5392  C C   . ILE C 1 66  ? 21.100  50.973  73.335  1.00 25.01  ? 566 ILE C C   1 
ATOM   5393  O O   . ILE C 1 66  ? 21.561  50.693  74.442  1.00 31.46  ? 566 ILE C O   1 
ATOM   5394  C CB  . ILE C 1 66  ? 19.570  52.951  72.983  1.00 18.92  ? 566 ILE C CB  1 
ATOM   5395  C CG1 . ILE C 1 66  ? 19.578  54.477  72.812  1.00 23.82  ? 566 ILE C CG1 1 
ATOM   5396  C CG2 . ILE C 1 66  ? 18.966  52.559  74.319  1.00 15.48  ? 566 ILE C CG2 1 
ATOM   5397  C CD1 . ILE C 1 66  ? 18.225  55.097  72.458  1.00 18.44  ? 566 ILE C CD1 1 
ATOM   5398  N N   . LEU C 1 67  ? 20.656  50.057  72.481  1.00 31.74  ? 567 LEU C N   1 
ATOM   5399  C CA  . LEU C 1 67  ? 20.729  48.625  72.740  1.00 31.38  ? 567 LEU C CA  1 
ATOM   5400  C C   . LEU C 1 67  ? 21.519  47.931  71.631  1.00 27.85  ? 567 LEU C C   1 
ATOM   5401  O O   . LEU C 1 67  ? 21.571  48.408  70.499  1.00 34.85  ? 567 LEU C O   1 
ATOM   5402  C CB  . LEU C 1 67  ? 19.319  48.033  72.775  1.00 34.76  ? 567 LEU C CB  1 
ATOM   5403  C CG  . LEU C 1 67  ? 18.423  48.247  73.992  1.00 31.25  ? 567 LEU C CG  1 
ATOM   5404  C CD1 . LEU C 1 67  ? 17.057  47.614  73.754  1.00 29.66  ? 567 LEU C CD1 1 
ATOM   5405  C CD2 . LEU C 1 67  ? 19.068  47.652  75.202  1.00 26.32  ? 567 LEU C CD2 1 
ATOM   5406  N N   . GLY C 1 68  ? 22.116  46.789  71.943  1.00 32.78  ? 568 GLY C N   1 
ATOM   5407  C CA  . GLY C 1 68  ? 22.772  45.982  70.923  1.00 28.60  ? 568 GLY C CA  1 
ATOM   5408  C C   . GLY C 1 68  ? 24.081  46.556  70.415  1.00 33.99  ? 568 GLY C C   1 
ATOM   5409  O O   . GLY C 1 68  ? 24.465  46.360  69.264  1.00 39.97  ? 568 GLY C O   1 
ATOM   5410  N N   . VAL C 1 69  ? 24.777  47.278  71.278  1.00 32.00  ? 569 VAL C N   1 
ATOM   5411  C CA  . VAL C 1 69  ? 26.063  47.828  70.905  1.00 36.60  ? 569 VAL C CA  1 
ATOM   5412  C C   . VAL C 1 69  ? 27.138  46.772  71.133  1.00 38.47  ? 569 VAL C C   1 
ATOM   5413  O O   . VAL C 1 69  ? 27.341  46.315  72.264  1.00 34.99  ? 569 VAL C O   1 
ATOM   5414  C CB  . VAL C 1 69  ? 26.374  49.078  71.727  1.00 38.19  ? 569 VAL C CB  1 
ATOM   5415  C CG1 . VAL C 1 69  ? 27.804  49.555  71.466  1.00 46.70  ? 569 VAL C CG1 1 
ATOM   5416  C CG2 . VAL C 1 69  ? 25.373  50.154  71.413  1.00 29.61  ? 569 VAL C CG2 1 
ATOM   5417  N N   . SER C 1 70  ? 27.821  46.370  70.065  1.00 42.09  ? 570 SER C N   1 
ATOM   5418  C CA  . SER C 1 70  ? 28.893  45.386  70.208  1.00 47.39  ? 570 SER C CA  1 
ATOM   5419  C C   . SER C 1 70  ? 30.048  45.965  71.033  1.00 48.62  ? 570 SER C C   1 
ATOM   5420  O O   . SER C 1 70  ? 30.140  47.186  71.230  1.00 41.63  ? 570 SER C O   1 
ATOM   5421  C CB  . SER C 1 70  ? 29.378  44.878  68.848  1.00 46.45  ? 570 SER C CB  1 
ATOM   5422  O OG  . SER C 1 70  ? 30.284  45.781  68.250  1.00 52.50  ? 570 SER C OG  1 
ATOM   5423  N N   . GLU C 1 71  ? 30.909  45.086  71.537  1.00 54.53  ? 571 GLU C N   1 
ATOM   5424  C CA  . GLU C 1 71  ? 32.036  45.518  72.351  1.00 64.92  ? 571 GLU C CA  1 
ATOM   5425  C C   . GLU C 1 71  ? 32.988  46.369  71.515  1.00 59.79  ? 571 GLU C C   1 
ATOM   5426  O O   . GLU C 1 71  ? 33.532  47.373  71.984  1.00 49.17  ? 571 GLU C O   1 
ATOM   5427  C CB  . GLU C 1 71  ? 32.771  44.319  72.951  1.00 80.43  ? 571 GLU C CB  1 
ATOM   5428  C CG  . GLU C 1 71  ? 33.976  44.705  73.800  1.00 94.60  ? 571 GLU C CG  1 
ATOM   5429  C CD  . GLU C 1 71  ? 33.656  45.800  74.810  1.00 104.45 ? 571 GLU C CD  1 
ATOM   5430  O OE1 . GLU C 1 71  ? 32.637  45.676  75.525  1.00 103.36 ? 571 GLU C OE1 1 
ATOM   5431  O OE2 . GLU C 1 71  ? 34.420  46.790  74.882  1.00 110.13 ? 571 GLU C OE2 1 
ATOM   5432  N N   . GLU C 1 72  ? 33.180  45.960  70.268  1.00 58.09  ? 572 GLU C N   1 
ATOM   5433  C CA  . GLU C 1 72  ? 33.998  46.718  69.350  1.00 50.75  ? 572 GLU C CA  1 
ATOM   5434  C C   . GLU C 1 72  ? 33.416  48.120  69.269  1.00 48.19  ? 572 GLU C C   1 
ATOM   5435  O O   . GLU C 1 72  ? 34.134  49.116  69.381  1.00 51.34  ? 572 GLU C O   1 
ATOM   5436  C CB  . GLU C 1 72  ? 33.990  46.057  67.974  1.00 54.49  ? 572 GLU C CB  1 
ATOM   5437  C CG  . GLU C 1 72  ? 35.148  46.473  67.082  1.00 68.69  ? 572 GLU C CG  1 
ATOM   5438  C CD  . GLU C 1 72  ? 34.960  46.038  65.642  1.00 74.47  ? 572 GLU C CD  1 
ATOM   5439  O OE1 . GLU C 1 72  ? 33.835  45.614  65.293  1.00 73.56  ? 572 GLU C OE1 1 
ATOM   5440  O OE2 . GLU C 1 72  ? 35.937  46.121  64.863  1.00 79.94  ? 572 GLU C OE2 1 
ATOM   5441  N N   . MET C 1 73  ? 32.101  48.191  69.091  1.00 48.48  ? 573 MET C N   1 
ATOM   5442  C CA  . MET C 1 73  ? 31.409  49.470  68.959  1.00 42.09  ? 573 MET C CA  1 
ATOM   5443  C C   . MET C 1 73  ? 31.585  50.398  70.185  1.00 37.75  ? 573 MET C C   1 
ATOM   5444  O O   . MET C 1 73  ? 31.764  51.603  70.010  1.00 43.82  ? 573 MET C O   1 
ATOM   5445  C CB  . MET C 1 73  ? 29.933  49.250  68.586  1.00 47.22  ? 573 MET C CB  1 
ATOM   5446  C CG  . MET C 1 73  ? 29.114  50.525  68.360  1.00 56.54  ? 573 MET C CG  1 
ATOM   5447  S SD  . MET C 1 73  ? 29.351  51.374  66.773  1.00 89.60  ? 573 MET C SD  1 
ATOM   5448  C CE  . MET C 1 73  ? 28.107  50.570  65.766  1.00 73.54  ? 573 MET C CE  1 
ATOM   5449  N N   . ARG C 1 74  ? 31.571  49.864  71.410  1.00 35.49  ? 574 ARG C N   1 
ATOM   5450  C CA  . ARG C 1 74  ? 31.804  50.717  72.599  1.00 42.75  ? 574 ARG C CA  1 
ATOM   5451  C C   . ARG C 1 74  ? 33.237  51.221  72.718  1.00 43.56  ? 574 ARG C C   1 
ATOM   5452  O O   . ARG C 1 74  ? 33.458  52.362  73.118  1.00 44.79  ? 574 ARG C O   1 
ATOM   5453  C CB  . ARG C 1 74  ? 31.406  50.025  73.907  1.00 51.66  ? 574 ARG C CB  1 
ATOM   5454  C CG  . ARG C 1 74  ? 29.984  50.326  74.354  1.00 72.65  ? 574 ARG C CG  1 
ATOM   5455  C CD  . ARG C 1 74  ? 29.629  49.595  75.643  1.00 83.99  ? 574 ARG C CD  1 
ATOM   5456  N NE  . ARG C 1 74  ? 30.028  48.189  75.599  1.00 91.10  ? 574 ARG C NE  1 
ATOM   5457  C CZ  . ARG C 1 74  ? 29.287  47.204  75.095  1.00 83.50  ? 574 ARG C CZ  1 
ATOM   5458  N NH1 . ARG C 1 74  ? 28.090  47.457  74.587  1.00 80.65  ? 574 ARG C NH1 1 
ATOM   5459  N NH2 . ARG C 1 74  ? 29.748  45.961  75.102  1.00 75.84  ? 574 ARG C NH2 1 
ATOM   5460  N N   . ARG C 1 75  ? 34.200  50.356  72.396  1.00 47.24  ? 575 ARG C N   1 
ATOM   5461  C CA  . ARG C 1 75  ? 35.616  50.728  72.368  1.00 48.37  ? 575 ARG C CA  1 
ATOM   5462  C C   . ARG C 1 75  ? 35.850  51.767  71.285  1.00 40.98  ? 575 ARG C C   1 
ATOM   5463  O O   . ARG C 1 75  ? 36.580  52.736  71.478  1.00 30.05  ? 575 ARG C O   1 
ATOM   5464  C CB  . ARG C 1 75  ? 36.508  49.514  72.085  1.00 46.32  ? 575 ARG C CB  1 
ATOM   5465  C CG  . ARG C 1 75  ? 36.697  48.560  73.257  1.00 62.91  ? 575 ARG C CG  1 
ATOM   5466  C CD  . ARG C 1 75  ? 37.815  47.532  72.979  1.00 76.01  ? 575 ARG C CD  1 
ATOM   5467  N NE  . ARG C 1 75  ? 37.442  46.495  72.007  1.00 83.05  ? 575 ARG C NE  1 
ATOM   5468  C CZ  . ARG C 1 75  ? 37.664  46.562  70.693  1.00 79.68  ? 575 ARG C CZ  1 
ATOM   5469  N NH1 . ARG C 1 75  ? 38.260  47.625  70.165  1.00 79.59  ? 575 ARG C NH1 1 
ATOM   5470  N NH2 . ARG C 1 75  ? 37.283  45.562  69.904  1.00 72.26  ? 575 ARG C NH2 1 
ATOM   5471  N N   . ASN C 1 76  ? 35.227  51.547  70.136  1.00 35.73  ? 576 ASN C N   1 
ATOM   5472  C CA  . ASN C 1 76  ? 35.408  52.441  69.012  1.00 38.86  ? 576 ASN C CA  1 
ATOM   5473  C C   . ASN C 1 76  ? 34.757  53.790  69.268  1.00 37.51  ? 576 ASN C C   1 
ATOM   5474  O O   . ASN C 1 76  ? 35.282  54.825  68.868  1.00 40.63  ? 576 ASN C O   1 
ATOM   5475  C CB  . ASN C 1 76  ? 34.839  51.804  67.755  1.00 46.60  ? 576 ASN C CB  1 
ATOM   5476  C CG  . ASN C 1 76  ? 35.862  50.981  67.019  1.00 58.34  ? 576 ASN C CG  1 
ATOM   5477  O OD1 . ASN C 1 76  ? 36.287  51.359  65.937  1.00 76.39  ? 576 ASN C OD1 1 
ATOM   5478  N ND2 . ASN C 1 76  ? 36.284  49.860  67.607  1.00 48.11  ? 576 ASN C ND2 1 
ATOM   5479  N N   . MET C 1 77  ? 33.615  53.768  69.948  1.00 34.17  ? 577 MET C N   1 
ATOM   5480  C CA  . MET C 1 77  ? 32.871  54.986  70.252  1.00 36.93  ? 577 MET C CA  1 
ATOM   5481  C C   . MET C 1 77  ? 33.495  55.726  71.430  1.00 32.10  ? 577 MET C C   1 
ATOM   5482  O O   . MET C 1 77  ? 33.511  56.945  71.460  1.00 30.03  ? 577 MET C O   1 
ATOM   5483  C CB  . MET C 1 77  ? 31.398  54.672  70.571  1.00 32.36  ? 577 MET C CB  1 
ATOM   5484  C CG  . MET C 1 77  ? 30.429  54.746  69.396  1.00 25.01  ? 577 MET C CG  1 
ATOM   5485  S SD  . MET C 1 77  ? 28.688  54.793  69.942  1.00 41.19  ? 577 MET C SD  1 
ATOM   5486  C CE  . MET C 1 77  ? 28.618  53.379  71.033  1.00 43.48  ? 577 MET C CE  1 
ATOM   5487  N N   . GLY C 1 78  ? 33.995  54.983  72.408  1.00 38.41  ? 578 GLY C N   1 
ATOM   5488  C CA  . GLY C 1 78  ? 34.568  55.605  73.585  1.00 38.69  ? 578 GLY C CA  1 
ATOM   5489  C C   . GLY C 1 78  ? 33.507  56.054  74.569  1.00 38.00  ? 578 GLY C C   1 
ATOM   5490  O O   . GLY C 1 78  ? 33.809  56.437  75.687  1.00 44.08  ? 578 GLY C O   1 
ATOM   5491  N N   . VAL C 1 79  ? 32.252  56.019  74.157  1.00 37.73  ? 579 VAL C N   1 
ATOM   5492  C CA  . VAL C 1 79  ? 31.167  56.190  75.112  1.00 34.46  ? 579 VAL C CA  1 
ATOM   5493  C C   . VAL C 1 79  ? 30.244  54.994  74.987  1.00 38.62  ? 579 VAL C C   1 
ATOM   5494  O O   . VAL C 1 79  ? 30.341  54.244  74.018  1.00 40.51  ? 579 VAL C O   1 
ATOM   5495  C CB  . VAL C 1 79  ? 30.414  57.523  74.912  1.00 28.16  ? 579 VAL C CB  1 
ATOM   5496  C CG1 . VAL C 1 79  ? 31.350  58.694  75.211  1.00 18.53  ? 579 VAL C CG1 1 
ATOM   5497  C CG2 . VAL C 1 79  ? 29.850  57.625  73.506  1.00 19.33  ? 579 VAL C CG2 1 
ATOM   5498  N N   . SER C 1 80  ? 29.360  54.805  75.961  1.00 44.71  ? 580 SER C N   1 
ATOM   5499  C CA  . SER C 1 80  ? 28.532  53.597  75.995  1.00 40.73  ? 580 SER C CA  1 
ATOM   5500  C C   . SER C 1 80  ? 27.228  53.689  75.210  1.00 42.81  ? 580 SER C C   1 
ATOM   5501  O O   . SER C 1 80  ? 26.549  52.675  75.001  1.00 47.83  ? 580 SER C O   1 
ATOM   5502  C CB  . SER C 1 80  ? 28.245  53.178  77.434  1.00 38.45  ? 580 SER C CB  1 
ATOM   5503  O OG  . SER C 1 80  ? 29.210  52.234  77.872  1.00 53.29  ? 580 SER C OG  1 
ATOM   5504  N N   . SER C 1 81  ? 26.880  54.895  74.770  1.00 37.31  ? 581 SER C N   1 
ATOM   5505  C CA  . SER C 1 81  ? 25.594  55.101  74.118  1.00 29.79  ? 581 SER C CA  1 
ATOM   5506  C C   . SER C 1 81  ? 25.639  56.142  73.005  1.00 30.02  ? 581 SER C C   1 
ATOM   5507  O O   . SER C 1 81  ? 26.246  57.199  73.150  1.00 32.84  ? 581 SER C O   1 
ATOM   5508  C CB  . SER C 1 81  ? 24.539  55.490  75.161  1.00 27.05  ? 581 SER C CB  1 
ATOM   5509  O OG  . SER C 1 81  ? 23.404  56.070  74.544  1.00 32.52  ? 581 SER C OG  1 
ATOM   5510  N N   . GLY C 1 82  ? 24.988  55.837  71.892  1.00 17.83  ? 582 GLY C N   1 
ATOM   5511  C CA  . GLY C 1 82  ? 24.779  56.825  70.859  1.00 16.56  ? 582 GLY C CA  1 
ATOM   5512  C C   . GLY C 1 82  ? 24.185  58.132  71.391  1.00 26.39  ? 582 GLY C C   1 
ATOM   5513  O O   . GLY C 1 82  ? 24.392  59.192  70.805  1.00 21.31  ? 582 GLY C O   1 
ATOM   5514  N N   . LEU C 1 83  ? 23.446  58.074  72.496  1.00 28.78  ? 583 LEU C N   1 
ATOM   5515  C CA  . LEU C 1 83  ? 22.804  59.283  73.001  1.00 21.25  ? 583 LEU C CA  1 
ATOM   5516  C C   . LEU C 1 83  ? 23.863  60.221  73.574  1.00 23.96  ? 583 LEU C C   1 
ATOM   5517  O O   . LEU C 1 83  ? 23.695  61.435  73.578  1.00 31.03  ? 583 LEU C O   1 
ATOM   5518  C CB  . LEU C 1 83  ? 21.726  58.964  74.049  1.00 16.89  ? 583 LEU C CB  1 
ATOM   5519  C CG  . LEU C 1 83  ? 20.560  58.036  73.694  1.00 17.29  ? 583 LEU C CG  1 
ATOM   5520  C CD1 . LEU C 1 83  ? 19.577  58.024  74.835  1.00 15.04  ? 583 LEU C CD1 1 
ATOM   5521  C CD2 . LEU C 1 83  ? 19.835  58.467  72.415  1.00 15.81  ? 583 LEU C CD2 1 
ATOM   5522  N N   . GLU C 1 84  ? 24.963  59.667  74.060  1.00 28.18  ? 584 GLU C N   1 
ATOM   5523  C CA  . GLU C 1 84  ? 26.045  60.543  74.478  1.00 34.45  ? 584 GLU C CA  1 
ATOM   5524  C C   . GLU C 1 84  ? 26.809  61.002  73.236  1.00 32.46  ? 584 GLU C C   1 
ATOM   5525  O O   . GLU C 1 84  ? 27.164  62.172  73.116  1.00 41.64  ? 584 GLU C O   1 
ATOM   5526  C CB  . GLU C 1 84  ? 26.950  59.896  75.528  1.00 31.23  ? 584 GLU C CB  1 
ATOM   5527  C CG  . GLU C 1 84  ? 28.035  60.831  76.057  1.00 53.42  ? 584 GLU C CG  1 
ATOM   5528  C CD  . GLU C 1 84  ? 28.600  60.404  77.415  1.00 68.91  ? 584 GLU C CD  1 
ATOM   5529  O OE1 . GLU C 1 84  ? 28.098  59.412  78.000  1.00 77.06  ? 584 GLU C OE1 1 
ATOM   5530  O OE2 . GLU C 1 84  ? 29.548  61.068  77.898  1.00 59.27  ? 584 GLU C OE2 1 
ATOM   5531  N N   . LEU C 1 85  ? 27.001  60.097  72.283  1.00 25.96  ? 585 LEU C N   1 
ATOM   5532  C CA  . LEU C 1 85  ? 27.676  60.440  71.029  1.00 26.16  ? 585 LEU C CA  1 
ATOM   5533  C C   . LEU C 1 85  ? 27.041  61.606  70.245  1.00 28.27  ? 585 LEU C C   1 
ATOM   5534  O O   . LEU C 1 85  ? 27.763  62.429  69.673  1.00 19.94  ? 585 LEU C O   1 
ATOM   5535  C CB  . LEU C 1 85  ? 27.794  59.220  70.117  1.00 22.00  ? 585 LEU C CB  1 
ATOM   5536  C CG  . LEU C 1 85  ? 28.713  59.426  68.917  1.00 24.53  ? 585 LEU C CG  1 
ATOM   5537  C CD1 . LEU C 1 85  ? 30.123  59.699  69.389  1.00 25.70  ? 585 LEU C CD1 1 
ATOM   5538  C CD2 . LEU C 1 85  ? 28.691  58.205  68.020  1.00 21.39  ? 585 LEU C CD2 1 
ATOM   5539  N N   . ILE C 1 86  ? 25.709  61.683  70.188  1.00 25.68  ? 586 ILE C N   1 
ATOM   5540  C CA  . ILE C 1 86  ? 25.097  62.722  69.357  1.00 22.58  ? 586 ILE C CA  1 
ATOM   5541  C C   . ILE C 1 86  ? 25.280  64.155  69.886  1.00 21.21  ? 586 ILE C C   1 
ATOM   5542  O O   . ILE C 1 86  ? 25.173  65.112  69.119  1.00 17.57  ? 586 ILE C O   1 
ATOM   5543  C CB  . ILE C 1 86  ? 23.634  62.432  68.999  1.00 22.78  ? 586 ILE C CB  1 
ATOM   5544  C CG1 . ILE C 1 86  ? 22.771  62.339  70.244  1.00 30.00  ? 586 ILE C CG1 1 
ATOM   5545  C CG2 . ILE C 1 86  ? 23.539  61.155  68.211  1.00 22.54  ? 586 ILE C CG2 1 
ATOM   5546  C CD1 . ILE C 1 86  ? 21.382  61.853  69.933  1.00 39.49  ? 586 ILE C CD1 1 
ATOM   5547  N N   . THR C 1 87  ? 25.595  64.285  71.177  1.00 19.63  ? 587 THR C N   1 
ATOM   5548  C CA  . THR C 1 87  ? 25.877  65.585  71.803  1.00 19.76  ? 587 THR C CA  1 
ATOM   5549  C C   . THR C 1 87  ? 27.293  66.125  71.524  1.00 25.34  ? 587 THR C C   1 
ATOM   5550  O O   . THR C 1 87  ? 27.605  67.260  71.870  1.00 23.00  ? 587 THR C O   1 
ATOM   5551  C CB  . THR C 1 87  ? 25.668  65.535  73.332  1.00 22.97  ? 587 THR C CB  1 
ATOM   5552  O OG1 . THR C 1 87  ? 26.693  64.743  73.937  1.00 24.10  ? 587 THR C OG1 1 
ATOM   5553  C CG2 . THR C 1 87  ? 24.308  64.928  73.669  1.00 31.01  ? 587 THR C CG2 1 
ATOM   5554  N N   . LEU C 1 88  ? 28.137  65.310  70.897  1.00 23.21  ? 588 LEU C N   1 
ATOM   5555  C CA  . LEU C 1 88  ? 29.508  65.699  70.568  1.00 30.08  ? 588 LEU C CA  1 
ATOM   5556  C C   . LEU C 1 88  ? 29.682  65.953  69.065  1.00 23.59  ? 588 LEU C C   1 
ATOM   5557  O O   . LEU C 1 88  ? 28.896  65.470  68.258  1.00 28.19  ? 588 LEU C O   1 
ATOM   5558  C CB  . LEU C 1 88  ? 30.481  64.599  71.004  1.00 27.74  ? 588 LEU C CB  1 
ATOM   5559  C CG  . LEU C 1 88  ? 30.212  64.004  72.387  1.00 30.46  ? 588 LEU C CG  1 
ATOM   5560  C CD1 . LEU C 1 88  ? 30.986  62.699  72.580  1.00 26.93  ? 588 LEU C CD1 1 
ATOM   5561  C CD2 . LEU C 1 88  ? 30.512  65.009  73.499  1.00 16.60  ? 588 LEU C CD2 1 
ATOM   5562  N N   . PRO C 1 89  ? 30.707  66.728  68.689  1.00 20.14  ? 589 PRO C N   1 
ATOM   5563  C CA  . PRO C 1 89  ? 30.992  66.964  67.264  1.00 24.15  ? 589 PRO C CA  1 
ATOM   5564  C C   . PRO C 1 89  ? 31.071  65.659  66.475  1.00 29.10  ? 589 PRO C C   1 
ATOM   5565  O O   . PRO C 1 89  ? 30.488  65.547  65.389  1.00 29.91  ? 589 PRO C O   1 
ATOM   5566  C CB  . PRO C 1 89  ? 32.376  67.621  67.295  1.00 20.49  ? 589 PRO C CB  1 
ATOM   5567  C CG  . PRO C 1 89  ? 32.376  68.379  68.611  1.00 22.11  ? 589 PRO C CG  1 
ATOM   5568  C CD  . PRO C 1 89  ? 31.639  67.458  69.572  1.00 21.06  ? 589 PRO C CD  1 
ATOM   5569  N N   . HIS C 1 90  ? 31.787  64.677  67.018  1.00 22.35  ? 590 HIS C N   1 
ATOM   5570  C CA  . HIS C 1 90  ? 31.971  63.413  66.316  1.00 28.42  ? 590 HIS C CA  1 
ATOM   5571  C C   . HIS C 1 90  ? 30.690  62.593  66.102  1.00 26.71  ? 590 HIS C C   1 
ATOM   5572  O O   . HIS C 1 90  ? 30.732  61.571  65.442  1.00 27.42  ? 590 HIS C O   1 
ATOM   5573  C CB  . HIS C 1 90  ? 33.056  62.584  66.998  1.00 45.77  ? 590 HIS C CB  1 
ATOM   5574  C CG  . HIS C 1 90  ? 34.387  63.261  67.008  1.00 59.59  ? 590 HIS C CG  1 
ATOM   5575  N ND1 . HIS C 1 90  ? 34.897  63.886  68.128  1.00 66.11  ? 590 HIS C ND1 1 
ATOM   5576  C CD2 . HIS C 1 90  ? 35.294  63.459  66.022  1.00 55.07  ? 590 HIS C CD2 1 
ATOM   5577  C CE1 . HIS C 1 90  ? 36.072  64.408  67.838  1.00 66.11  ? 590 HIS C CE1 1 
ATOM   5578  N NE2 . HIS C 1 90  ? 36.337  64.164  66.564  1.00 63.26  ? 590 HIS C NE2 1 
ATOM   5579  N N   . GLY C 1 91  ? 29.558  63.056  66.632  1.00 16.86  ? 591 GLY C N   1 
ATOM   5580  C CA  . GLY C 1 91  ? 28.293  62.389  66.422  1.00 18.06  ? 591 GLY C CA  1 
ATOM   5581  C C   . GLY C 1 91  ? 27.609  62.866  65.161  1.00 23.01  ? 591 GLY C C   1 
ATOM   5582  O O   . GLY C 1 91  ? 26.422  62.613  64.944  1.00 25.95  ? 591 GLY C O   1 
ATOM   5583  N N   . HIS C 1 92  ? 28.363  63.575  64.333  1.00 27.69  ? 592 HIS C N   1 
ATOM   5584  C CA  . HIS C 1 92  ? 27.840  64.138  63.090  1.00 26.73  ? 592 HIS C CA  1 
ATOM   5585  C C   . HIS C 1 92  ? 27.147  63.066  62.215  1.00 28.59  ? 592 HIS C C   1 
ATOM   5586  O O   . HIS C 1 92  ? 25.987  63.227  61.802  1.00 26.53  ? 592 HIS C O   1 
ATOM   5587  C CB  . HIS C 1 92  ? 28.986  64.843  62.348  1.00 25.00  ? 592 HIS C CB  1 
ATOM   5588  C CG  . HIS C 1 92  ? 28.602  65.425  61.022  1.00 28.94  ? 592 HIS C CG  1 
ATOM   5589  N ND1 . HIS C 1 92  ? 27.458  66.169  60.833  1.00 28.74  ? 592 HIS C ND1 1 
ATOM   5590  C CD2 . HIS C 1 92  ? 29.228  65.388  59.821  1.00 36.78  ? 592 HIS C CD2 1 
ATOM   5591  C CE1 . HIS C 1 92  ? 27.386  66.553  59.571  1.00 34.83  ? 592 HIS C CE1 1 
ATOM   5592  N NE2 . HIS C 1 92  ? 28.455  66.103  58.938  1.00 44.26  ? 592 HIS C NE2 1 
ATOM   5593  N N   . GLN C 1 93  ? 27.858  61.968  61.963  1.00 18.97  ? 593 GLN C N   1 
ATOM   5594  C CA  . GLN C 1 93  ? 27.357  60.888  61.121  1.00 30.48  ? 593 GLN C CA  1 
ATOM   5595  C C   . GLN C 1 93  ? 26.025  60.342  61.674  1.00 25.92  ? 593 GLN C C   1 
ATOM   5596  O O   . GLN C 1 93  ? 25.013  60.291  60.966  1.00 18.97  ? 593 GLN C O   1 
ATOM   5597  C CB  . GLN C 1 93  ? 28.427  59.783  61.008  1.00 28.10  ? 593 GLN C CB  1 
ATOM   5598  C CG  . GLN C 1 93  ? 28.107  58.674  60.023  1.00 36.95  ? 593 GLN C CG  1 
ATOM   5599  C CD  . GLN C 1 93  ? 27.597  59.213  58.711  1.00 54.88  ? 593 GLN C CD  1 
ATOM   5600  O OE1 . GLN C 1 93  ? 26.593  58.738  58.187  1.00 70.27  ? 593 GLN C OE1 1 
ATOM   5601  N NE2 . GLN C 1 93  ? 28.280  60.216  58.173  1.00 52.84  ? 593 GLN C NE2 1 
ATOM   5602  N N   . LEU C 1 94  ? 26.047  59.952  62.948  1.00 18.01  ? 594 LEU C N   1 
ATOM   5603  C CA  . LEU C 1 94  ? 24.872  59.461  63.652  1.00 20.40  ? 594 LEU C CA  1 
ATOM   5604  C C   . LEU C 1 94  ? 23.685  60.441  63.559  1.00 20.20  ? 594 LEU C C   1 
ATOM   5605  O O   . LEU C 1 94  ? 22.580  60.017  63.246  1.00 31.30  ? 594 LEU C O   1 
ATOM   5606  C CB  . LEU C 1 94  ? 25.207  59.177  65.114  1.00 20.38  ? 594 LEU C CB  1 
ATOM   5607  C CG  . LEU C 1 94  ? 24.652  57.896  65.733  1.00 25.70  ? 594 LEU C CG  1 
ATOM   5608  C CD1 . LEU C 1 94  ? 24.500  58.070  67.227  1.00 15.63  ? 594 LEU C CD1 1 
ATOM   5609  C CD2 . LEU C 1 94  ? 23.332  57.470  65.104  1.00 18.92  ? 594 LEU C CD2 1 
ATOM   5610  N N   . ARG C 1 95  ? 23.909  61.732  63.820  1.00 18.30  ? 595 ARG C N   1 
ATOM   5611  C CA  . ARG C 1 95  ? 22.848  62.744  63.657  1.00 18.25  ? 595 ARG C CA  1 
ATOM   5612  C C   . ARG C 1 95  ? 22.231  62.718  62.238  1.00 27.14  ? 595 ARG C C   1 
ATOM   5613  O O   . ARG C 1 95  ? 21.003  62.748  62.084  1.00 20.52  ? 595 ARG C O   1 
ATOM   5614  C CB  . ARG C 1 95  ? 23.343  64.167  64.018  1.00 19.12  ? 595 ARG C CB  1 
ATOM   5615  C CG  . ARG C 1 95  ? 23.626  64.394  65.521  1.00 13.83  ? 595 ARG C CG  1 
ATOM   5616  C CD  . ARG C 1 95  ? 23.964  65.851  65.850  1.00 17.97  ? 595 ARG C CD  1 
ATOM   5617  N NE  . ARG C 1 95  ? 25.229  66.284  65.256  1.00 16.00  ? 595 ARG C NE  1 
ATOM   5618  C CZ  . ARG C 1 95  ? 26.406  66.193  65.863  1.00 21.01  ? 595 ARG C CZ  1 
ATOM   5619  N NH1 . ARG C 1 95  ? 26.480  65.705  67.092  1.00 18.25  ? 595 ARG C NH1 1 
ATOM   5620  N NH2 . ARG C 1 95  ? 27.508  66.594  65.248  1.00 23.41  ? 595 ARG C NH2 1 
ATOM   5621  N N   . LEU C 1 96  ? 23.070  62.656  61.203  1.00 21.06  ? 596 LEU C N   1 
ATOM   5622  C CA  . LEU C 1 96  ? 22.532  62.568  59.850  1.00 24.50  ? 596 LEU C CA  1 
ATOM   5623  C C   . LEU C 1 96  ? 21.745  61.269  59.636  1.00 28.88  ? 596 LEU C C   1 
ATOM   5624  O O   . LEU C 1 96  ? 20.761  61.277  58.914  1.00 30.24  ? 596 LEU C O   1 
ATOM   5625  C CB  . LEU C 1 96  ? 23.618  62.738  58.778  1.00 17.16  ? 596 LEU C CB  1 
ATOM   5626  C CG  . LEU C 1 96  ? 24.476  63.998  58.904  1.00 25.87  ? 596 LEU C CG  1 
ATOM   5627  C CD1 . LEU C 1 96  ? 25.590  64.011  57.872  1.00 30.15  ? 596 LEU C CD1 1 
ATOM   5628  C CD2 . LEU C 1 96  ? 23.627  65.228  58.760  1.00 29.60  ? 596 LEU C CD2 1 
ATOM   5629  N N   . ASP C 1 97  ? 22.161  60.163  60.260  1.00 27.68  ? 597 ASP C N   1 
ATOM   5630  C CA  . ASP C 1 97  ? 21.431  58.887  60.117  1.00 23.50  ? 597 ASP C CA  1 
ATOM   5631  C C   . ASP C 1 97  ? 20.055  58.984  60.754  1.00 30.21  ? 597 ASP C C   1 
ATOM   5632  O O   . ASP C 1 97  ? 19.044  58.529  60.193  1.00 27.49  ? 597 ASP C O   1 
ATOM   5633  C CB  . ASP C 1 97  ? 22.197  57.708  60.745  1.00 28.39  ? 597 ASP C CB  1 
ATOM   5634  C CG  . ASP C 1 97  ? 23.497  57.395  60.023  1.00 39.00  ? 597 ASP C CG  1 
ATOM   5635  O OD1 . ASP C 1 97  ? 23.581  57.680  58.813  1.00 42.62  ? 597 ASP C OD1 1 
ATOM   5636  O OD2 . ASP C 1 97  ? 24.435  56.868  60.663  1.00 46.17  ? 597 ASP C OD2 1 
ATOM   5637  N N   . ILE C 1 98  ? 20.031  59.587  61.938  1.00 25.52  ? 598 ILE C N   1 
ATOM   5638  C CA  . ILE C 1 98  ? 18.804  59.794  62.680  1.00 21.32  ? 598 ILE C CA  1 
ATOM   5639  C C   . ILE C 1 98  ? 17.820  60.665  61.905  1.00 22.74  ? 598 ILE C C   1 
ATOM   5640  O O   . ILE C 1 98  ? 16.622  60.423  61.905  1.00 29.44  ? 598 ILE C O   1 
ATOM   5641  C CB  . ILE C 1 98  ? 19.129  60.394  64.045  1.00 22.70  ? 598 ILE C CB  1 
ATOM   5642  C CG1 . ILE C 1 98  ? 19.701  59.283  64.935  1.00 24.95  ? 598 ILE C CG1 1 
ATOM   5643  C CG2 . ILE C 1 98  ? 17.890  61.060  64.665  1.00 11.20  ? 598 ILE C CG2 1 
ATOM   5644  C CD1 . ILE C 1 98  ? 20.490  59.797  66.093  1.00 33.47  ? 598 ILE C CD1 1 
ATOM   5645  N N   . ILE C 1 99  ? 18.348  61.669  61.231  1.00 21.63  ? 599 ILE C N   1 
ATOM   5646  C CA  . ILE C 1 99  ? 17.549  62.518  60.382  1.00 23.44  ? 599 ILE C CA  1 
ATOM   5647  C C   . ILE C 1 99  ? 17.001  61.737  59.169  1.00 23.75  ? 599 ILE C C   1 
ATOM   5648  O O   . ILE C 1 99  ? 15.812  61.777  58.895  1.00 18.13  ? 599 ILE C O   1 
ATOM   5649  C CB  . ILE C 1 99  ? 18.347  63.782  59.972  1.00 17.14  ? 599 ILE C CB  1 
ATOM   5650  C CG1 . ILE C 1 99  ? 18.460  64.727  61.170  1.00 17.51  ? 599 ILE C CG1 1 
ATOM   5651  C CG2 . ILE C 1 99  ? 17.674  64.488  58.838  1.00 12.14  ? 599 ILE C CG2 1 
ATOM   5652  C CD1 . ILE C 1 99  ? 19.582  65.742  61.062  1.00 15.68  ? 599 ILE C CD1 1 
ATOM   5653  N N   . GLU C 1 100 ? 17.855  61.009  58.456  1.00 18.25  ? 600 GLU C N   1 
ATOM   5654  C CA  . GLU C 1 100 ? 17.397  60.239  57.294  1.00 21.13  ? 600 GLU C CA  1 
ATOM   5655  C C   . GLU C 1 100 ? 16.252  59.280  57.655  1.00 27.81  ? 600 GLU C C   1 
ATOM   5656  O O   . GLU C 1 100 ? 15.213  59.253  56.986  1.00 32.45  ? 600 GLU C O   1 
ATOM   5657  C CB  . GLU C 1 100 ? 18.559  59.447  56.670  1.00 22.81  ? 600 GLU C CB  1 
ATOM   5658  C CG  . GLU C 1 100 ? 18.193  58.716  55.383  1.00 37.94  ? 600 GLU C CG  1 
ATOM   5659  C CD  . GLU C 1 100 ? 17.753  59.667  54.279  1.00 44.34  ? 600 GLU C CD  1 
ATOM   5660  O OE1 . GLU C 1 100 ? 18.555  60.554  53.923  1.00 43.73  ? 600 GLU C OE1 1 
ATOM   5661  O OE2 . GLU C 1 100 ? 16.609  59.534  53.776  1.00 41.54  ? 600 GLU C OE2 1 
ATOM   5662  N N   . ARG C 1 101 ? 16.462  58.498  58.714  1.00 21.43  ? 601 ARG C N   1 
ATOM   5663  C CA  . ARG C 1 101 ? 15.488  57.532  59.197  1.00 23.87  ? 601 ARG C CA  1 
ATOM   5664  C C   . ARG C 1 101 ? 14.149  58.158  59.547  1.00 30.41  ? 601 ARG C C   1 
ATOM   5665  O O   . ARG C 1 101 ? 13.097  57.587  59.268  1.00 24.96  ? 601 ARG C O   1 
ATOM   5666  C CB  . ARG C 1 101 ? 16.032  56.807  60.426  1.00 20.56  ? 601 ARG C CB  1 
ATOM   5667  C CG  . ARG C 1 101 ? 15.008  55.949  61.134  1.00 14.78  ? 601 ARG C CG  1 
ATOM   5668  C CD  . ARG C 1 101 ? 15.728  54.952  62.023  1.00 26.55  ? 601 ARG C CD  1 
ATOM   5669  N NE  . ARG C 1 101 ? 14.767  54.106  62.708  1.00 27.10  ? 601 ARG C NE  1 
ATOM   5670  C CZ  . ARG C 1 101 ? 14.221  53.023  62.166  1.00 31.97  ? 601 ARG C CZ  1 
ATOM   5671  N NH1 . ARG C 1 101 ? 14.557  52.662  60.933  1.00 22.20  ? 601 ARG C NH1 1 
ATOM   5672  N NH2 . ARG C 1 101 ? 13.342  52.304  62.856  1.00 28.55  ? 601 ARG C NH2 1 
ATOM   5673  N N   . HIS C 1 102 ? 14.197  59.325  60.176  1.00 30.95  ? 602 HIS C N   1 
ATOM   5674  C CA  . HIS C 1 102 ? 12.980  60.012  60.584  1.00 34.37  ? 602 HIS C CA  1 
ATOM   5675  C C   . HIS C 1 102 ? 12.187  60.494  59.368  1.00 31.29  ? 602 HIS C C   1 
ATOM   5676  O O   . HIS C 1 102 ? 10.965  60.340  59.311  1.00 31.54  ? 602 HIS C O   1 
ATOM   5677  C CB  . HIS C 1 102 ? 13.301  61.173  61.541  1.00 30.13  ? 602 HIS C CB  1 
ATOM   5678  C CG  . HIS C 1 102 ? 12.108  61.688  62.294  1.00 29.64  ? 602 HIS C CG  1 
ATOM   5679  N ND1 . HIS C 1 102 ? 11.318  62.719  61.829  1.00 21.69  ? 602 HIS C ND1 1 
ATOM   5680  C CD2 . HIS C 1 102 ? 11.580  61.321  63.485  1.00 27.02  ? 602 HIS C CD2 1 
ATOM   5681  C CE1 . HIS C 1 102 ? 10.356  62.964  62.701  1.00 16.36  ? 602 HIS C CE1 1 
ATOM   5682  N NE2 . HIS C 1 102 ? 10.497  62.135  63.718  1.00 23.48  ? 602 HIS C NE2 1 
ATOM   5683  N N   . ASN C 1 103 ? 12.883  61.066  58.392  1.00 26.76  ? 603 ASN C N   1 
ATOM   5684  C CA  . ASN C 1 103 ? 12.232  61.479  57.147  1.00 22.45  ? 603 ASN C CA  1 
ATOM   5685  C C   . ASN C 1 103 ? 11.661  60.290  56.400  1.00 30.46  ? 603 ASN C C   1 
ATOM   5686  O O   . ASN C 1 103 ? 10.490  60.287  56.008  1.00 32.68  ? 603 ASN C O   1 
ATOM   5687  C CB  . ASN C 1 103 ? 13.213  62.208  56.237  1.00 20.39  ? 603 ASN C CB  1 
ATOM   5688  C CG  . ASN C 1 103 ? 13.570  63.584  56.757  1.00 28.25  ? 603 ASN C CG  1 
ATOM   5689  O OD1 . ASN C 1 103 ? 12.753  64.263  57.383  1.00 29.07  ? 603 ASN C OD1 1 
ATOM   5690  N ND2 . ASN C 1 103 ? 14.799  63.999  56.504  1.00 30.86  ? 603 ASN C ND2 1 
ATOM   5691  N N   . THR C 1 104 ? 12.493  59.272  56.201  1.00 30.91  ? 604 THR C N   1 
ATOM   5692  C CA  . THR C 1 104 ? 12.059  58.112  55.438  1.00 24.99  ? 604 THR C CA  1 
ATOM   5693  C C   . THR C 1 104 ? 10.843  57.471  56.088  1.00 28.31  ? 604 THR C C   1 
ATOM   5694  O O   . THR C 1 104 ? 9.888   57.128  55.401  1.00 36.09  ? 604 THR C O   1 
ATOM   5695  C CB  . THR C 1 104 ? 13.195  57.103  55.218  1.00 27.80  ? 604 THR C CB  1 
ATOM   5696  O OG1 . THR C 1 104 ? 14.227  57.737  54.451  1.00 32.33  ? 604 THR C OG1 1 
ATOM   5697  C CG2 . THR C 1 104 ? 12.689  55.877  54.448  1.00 21.98  ? 604 THR C CG2 1 
ATOM   5698  N N   . MET C 1 105 ? 10.858  57.363  57.414  1.00 23.19  ? 605 MET C N   1 
ATOM   5699  C CA  . MET C 1 105 ? 9.739   56.777  58.144  1.00 19.63  ? 605 MET C CA  1 
ATOM   5700  C C   . MET C 1 105 ? 8.440   57.584  57.991  1.00 23.58  ? 605 MET C C   1 
ATOM   5701  O O   . MET C 1 105 ? 7.376   57.019  57.733  1.00 23.11  ? 605 MET C O   1 
ATOM   5702  C CB  . MET C 1 105 ? 10.084  56.587  59.623  1.00 22.80  ? 605 MET C CB  1 
ATOM   5703  C CG  . MET C 1 105 ? 8.943   55.987  60.444  1.00 28.69  ? 605 MET C CG  1 
ATOM   5704  S SD  . MET C 1 105 ? 9.481   55.371  62.051  1.00 54.44  ? 605 MET C SD  1 
ATOM   5705  C CE  . MET C 1 105 ? 10.989  54.511  61.588  1.00 46.05  ? 605 MET C CE  1 
ATOM   5706  N N   . ALA C 1 106 ? 8.522   58.902  58.134  1.00 26.54  ? 606 ALA C N   1 
ATOM   5707  C CA  . ALA C 1 106 ? 7.342   59.738  57.933  1.00 25.95  ? 606 ALA C CA  1 
ATOM   5708  C C   . ALA C 1 106 ? 6.775   59.602  56.512  1.00 27.06  ? 606 ALA C C   1 
ATOM   5709  O O   . ALA C 1 106 ? 5.580   59.402  56.334  1.00 26.95  ? 606 ALA C O   1 
ATOM   5710  C CB  . ALA C 1 106 ? 7.639   61.178  58.265  1.00 22.65  ? 606 ALA C CB  1 
ATOM   5711  N N   . ILE C 1 107 ? 7.632   59.677  55.503  1.00 27.69  ? 607 ILE C N   1 
ATOM   5712  C CA  . ILE C 1 107 ? 7.162   59.500  54.141  1.00 22.97  ? 607 ILE C CA  1 
ATOM   5713  C C   . ILE C 1 107 ? 6.456   58.164  53.998  1.00 25.88  ? 607 ILE C C   1 
ATOM   5714  O O   . ILE C 1 107 ? 5.425   58.067  53.351  1.00 25.47  ? 607 ILE C O   1 
ATOM   5715  C CB  . ILE C 1 107 ? 8.310   59.591  53.150  1.00 26.03  ? 607 ILE C CB  1 
ATOM   5716  C CG1 . ILE C 1 107 ? 8.866   61.019  53.160  1.00 29.81  ? 607 ILE C CG1 1 
ATOM   5717  C CG2 . ILE C 1 107 ? 7.843   59.190  51.757  1.00 22.39  ? 607 ILE C CG2 1 
ATOM   5718  C CD1 . ILE C 1 107 ? 10.173  61.207  52.398  1.00 25.33  ? 607 ILE C CD1 1 
ATOM   5719  N N   . GLY C 1 108 ? 7.008   57.137  54.632  1.00 39.47  ? 608 GLY C N   1 
ATOM   5720  C CA  . GLY C 1 108 ? 6.469   55.789  54.539  1.00 36.43  ? 608 GLY C CA  1 
ATOM   5721  C C   . GLY C 1 108 ? 5.047   55.678  55.051  1.00 36.57  ? 608 GLY C C   1 
ATOM   5722  O O   . GLY C 1 108 ? 4.172   55.143  54.368  1.00 28.36  ? 608 GLY C O   1 
ATOM   5723  N N   . ILE C 1 109 ? 4.826   56.180  56.263  1.00 39.42  ? 609 ILE C N   1 
ATOM   5724  C CA  . ILE C 1 109 ? 3.488   56.251  56.840  1.00 32.71  ? 609 ILE C CA  1 
ATOM   5725  C C   . ILE C 1 109 ? 2.515   56.960  55.882  1.00 29.97  ? 609 ILE C C   1 
ATOM   5726  O O   . ILE C 1 109 ? 1.473   56.415  55.537  1.00 34.55  ? 609 ILE C O   1 
ATOM   5727  C CB  . ILE C 1 109 ? 3.507   56.963  58.218  1.00 33.37  ? 609 ILE C CB  1 
ATOM   5728  C CG1 . ILE C 1 109 ? 4.619   56.395  59.108  1.00 31.66  ? 609 ILE C CG1 1 
ATOM   5729  C CG2 . ILE C 1 109 ? 2.179   56.804  58.921  1.00 29.24  ? 609 ILE C CG2 1 
ATOM   5730  C CD1 . ILE C 1 109 ? 4.346   55.014  59.577  1.00 32.99  ? 609 ILE C CD1 1 
ATOM   5731  N N   . ALA C 1 110 ? 2.858   58.166  55.438  1.00 28.13  ? 610 ALA C N   1 
ATOM   5732  C CA  . ALA C 1 110 ? 1.987   58.917  54.532  1.00 30.22  ? 610 ALA C CA  1 
ATOM   5733  C C   . ALA C 1 110 ? 1.660   58.110  53.277  1.00 42.83  ? 610 ALA C C   1 
ATOM   5734  O O   . ALA C 1 110 ? 0.535   58.138  52.781  1.00 39.16  ? 610 ALA C O   1 
ATOM   5735  C CB  . ALA C 1 110 ? 2.632   60.233  54.146  1.00 29.34  ? 610 ALA C CB  1 
ATOM   5736  N N   . VAL C 1 111 ? 2.659   57.400  52.757  1.00 47.85  ? 611 VAL C N   1 
ATOM   5737  C CA  . VAL C 1 111 ? 2.462   56.550  51.590  1.00 39.53  ? 611 VAL C CA  1 
ATOM   5738  C C   . VAL C 1 111 ? 1.510   55.406  51.907  1.00 41.95  ? 611 VAL C C   1 
ATOM   5739  O O   . VAL C 1 111 ? 0.785   54.938  51.032  1.00 37.89  ? 611 VAL C O   1 
ATOM   5740  C CB  . VAL C 1 111 ? 3.784   55.976  51.077  1.00 37.27  ? 611 VAL C CB  1 
ATOM   5741  C CG1 . VAL C 1 111 ? 3.526   54.785  50.169  1.00 24.56  ? 611 VAL C CG1 1 
ATOM   5742  C CG2 . VAL C 1 111 ? 4.588   57.059  50.350  1.00 45.98  ? 611 VAL C CG2 1 
ATOM   5743  N N   . ASP C 1 112 ? 1.503   54.960  53.160  1.00 41.31  ? 612 ASP C N   1 
ATOM   5744  C CA  . ASP C 1 112 ? 0.595   53.895  53.551  1.00 45.01  ? 612 ASP C CA  1 
ATOM   5745  C C   . ASP C 1 112 ? -0.865  54.355  53.544  1.00 44.76  ? 612 ASP C C   1 
ATOM   5746  O O   . ASP C 1 112 ? -1.770  53.577  53.250  1.00 45.57  ? 612 ASP C O   1 
ATOM   5747  C CB  . ASP C 1 112 ? 0.960   53.318  54.911  1.00 54.01  ? 612 ASP C CB  1 
ATOM   5748  C CG  . ASP C 1 112 ? 0.403   51.927  55.100  1.00 74.70  ? 612 ASP C CG  1 
ATOM   5749  O OD1 . ASP C 1 112 ? 1.149   50.950  54.861  1.00 85.96  ? 612 ASP C OD1 1 
ATOM   5750  O OD2 . ASP C 1 112 ? -0.790  51.810  55.452  1.00 78.06  ? 612 ASP C OD2 1 
ATOM   5751  N N   . ILE C 1 113 ? -1.095  55.618  53.875  1.00 33.68  ? 613 ILE C N   1 
ATOM   5752  C CA  . ILE C 1 113 ? -2.442  56.159  53.825  1.00 35.20  ? 613 ILE C CA  1 
ATOM   5753  C C   . ILE C 1 113 ? -2.830  56.518  52.392  1.00 39.36  ? 613 ILE C C   1 
ATOM   5754  O O   . ILE C 1 113 ? -3.906  56.148  51.925  1.00 36.56  ? 613 ILE C O   1 
ATOM   5755  C CB  . ILE C 1 113 ? -2.587  57.393  54.711  1.00 35.52  ? 613 ILE C CB  1 
ATOM   5756  C CG1 . ILE C 1 113 ? -2.205  57.057  56.161  1.00 47.05  ? 613 ILE C CG1 1 
ATOM   5757  C CG2 . ILE C 1 113 ? -4.008  57.923  54.630  1.00 28.86  ? 613 ILE C CG2 1 
ATOM   5758  C CD1 . ILE C 1 113 ? -1.820  58.284  57.037  1.00 22.37  ? 613 ILE C CD1 1 
ATOM   5759  N N   . LEU C 1 114 ? -1.938  57.222  51.696  1.00 41.08  ? 614 LEU C N   1 
ATOM   5760  C CA  . LEU C 1 114 ? -2.215  57.743  50.356  1.00 41.99  ? 614 LEU C CA  1 
ATOM   5761  C C   . LEU C 1 114 ? -2.034  56.737  49.208  1.00 49.78  ? 614 LEU C C   1 
ATOM   5762  O O   . LEU C 1 114 ? -2.304  57.067  48.053  1.00 61.97  ? 614 LEU C O   1 
ATOM   5763  C CB  . LEU C 1 114 ? -1.342  58.974  50.077  1.00 33.30  ? 614 LEU C CB  1 
ATOM   5764  C CG  . LEU C 1 114 ? -1.689  60.282  50.775  1.00 41.83  ? 614 LEU C CG  1 
ATOM   5765  C CD1 . LEU C 1 114 ? -0.566  61.312  50.594  1.00 49.34  ? 614 LEU C CD1 1 
ATOM   5766  C CD2 . LEU C 1 114 ? -3.021  60.806  50.255  1.00 43.84  ? 614 LEU C CD2 1 
ATOM   5767  N N   . GLY C 1 115 ? -1.575  55.527  49.515  1.00 48.45  ? 615 GLY C N   1 
ATOM   5768  C CA  . GLY C 1 115 ? -1.233  54.567  48.480  1.00 45.98  ? 615 GLY C CA  1 
ATOM   5769  C C   . GLY C 1 115 ? -1.768  53.164  48.692  1.00 63.40  ? 615 GLY C C   1 
ATOM   5770  O O   . GLY C 1 115 ? -2.372  52.594  47.789  1.00 63.24  ? 615 GLY C O   1 
ATOM   5771  N N   . CYS C 1 116 ? -1.546  52.608  49.883  1.00 90.77  ? 616 CYS C N   1 
ATOM   5772  C CA  . CYS C 1 116 ? -1.889  51.207  50.186  1.00 108.64 ? 616 CYS C CA  1 
ATOM   5773  C C   . CYS C 1 116 ? -3.360  50.995  50.536  1.00 112.29 ? 616 CYS C C   1 
ATOM   5774  O O   . CYS C 1 116 ? -3.691  50.132  51.358  1.00 115.55 ? 616 CYS C O   1 
ATOM   5775  C CB  . CYS C 1 116 ? -1.034  50.676  51.346  1.00 110.95 ? 616 CYS C CB  1 
ATOM   5776  S SG  . CYS C 1 116 ? 0.735   50.565  51.018  1.00 97.15  ? 616 CYS C SG  1 
ATOM   5777  N N   . THR C 1 117 ? -4.240  51.771  49.913  1.00 104.13 ? 617 THR C N   1 
ATOM   5778  C CA  . THR C 1 117 ? -5.648  51.729  50.274  1.00 89.44  ? 617 THR C CA  1 
ATOM   5779  C C   . THR C 1 117 ? -6.578  51.655  49.069  1.00 90.18  ? 617 THR C C   1 
ATOM   5780  O O   . THR C 1 117 ? -6.317  52.245  48.015  1.00 86.66  ? 617 THR C O   1 
ATOM   5781  C CB  . THR C 1 117 ? -6.019  52.923  51.153  1.00 70.94  ? 617 THR C CB  1 
ATOM   5782  O OG1 . THR C 1 117 ? -5.170  54.021  50.810  1.00 70.83  ? 617 THR C OG1 1 
ATOM   5783  C CG2 . THR C 1 117 ? -5.816  52.582  52.629  1.00 57.58  ? 617 THR C CG2 1 
ATOM   5784  N N   . GLY C 1 118 ? -7.660  50.903  49.245  1.00 87.89  ? 618 GLY C N   1 
ATOM   5785  C CA  . GLY C 1 118 ? -8.687  50.770  48.237  1.00 84.14  ? 618 GLY C CA  1 
ATOM   5786  C C   . GLY C 1 118 ? -9.863  51.680  48.536  1.00 80.38  ? 618 GLY C C   1 
ATOM   5787  O O   . GLY C 1 118 ? -9.995  52.743  47.930  1.00 89.06  ? 618 GLY C O   1 
ATOM   5788  N N   . THR C 1 119 ? -10.715 51.279  49.477  1.00 62.02  ? 619 THR C N   1 
ATOM   5789  C CA  . THR C 1 119 ? -11.941 52.027  49.731  1.00 53.96  ? 619 THR C CA  1 
ATOM   5790  C C   . THR C 1 119 ? -11.764 53.044  50.837  1.00 52.46  ? 619 THR C C   1 
ATOM   5791  O O   . THR C 1 119 ? -10.917 52.878  51.712  1.00 60.24  ? 619 THR C O   1 
ATOM   5792  C CB  . THR C 1 119 ? -13.121 51.108  50.113  1.00 52.35  ? 619 THR C CB  1 
ATOM   5793  O OG1 . THR C 1 119 ? -13.080 50.820  51.518  1.00 47.90  ? 619 THR C OG1 1 
ATOM   5794  C CG2 . THR C 1 119 ? -13.076 49.817  49.315  1.00 58.16  ? 619 THR C CG2 1 
ATOM   5795  N N   . LEU C 1 120 ? -12.584 54.089  50.795  1.00 42.43  ? 620 LEU C N   1 
ATOM   5796  C CA  . LEU C 1 120 ? -12.598 55.115  51.839  1.00 46.70  ? 620 LEU C CA  1 
ATOM   5797  C C   . LEU C 1 120 ? -12.580 54.522  53.252  1.00 46.12  ? 620 LEU C C   1 
ATOM   5798  O O   . LEU C 1 120 ? -11.791 54.945  54.091  1.00 47.50  ? 620 LEU C O   1 
ATOM   5799  C CB  . LEU C 1 120 ? -13.803 56.053  51.677  1.00 34.93  ? 620 LEU C CB  1 
ATOM   5800  C CG  . LEU C 1 120 ? -13.935 57.046  52.825  1.00 40.18  ? 620 LEU C CG  1 
ATOM   5801  C CD1 . LEU C 1 120 ? -12.854 58.129  52.743  1.00 36.39  ? 620 LEU C CD1 1 
ATOM   5802  C CD2 . LEU C 1 120 ? -15.311 57.644  52.821  1.00 39.32  ? 620 LEU C CD2 1 
ATOM   5803  N N   . GLU C 1 121 ? -13.450 53.549  53.508  1.00 53.85  ? 621 GLU C N   1 
ATOM   5804  C CA  . GLU C 1 121 ? -13.502 52.881  54.805  1.00 61.82  ? 621 GLU C CA  1 
ATOM   5805  C C   . GLU C 1 121 ? -12.169 52.243  55.193  1.00 55.02  ? 621 GLU C C   1 
ATOM   5806  O O   . GLU C 1 121 ? -11.722 52.389  56.329  1.00 50.27  ? 621 GLU C O   1 
ATOM   5807  C CB  . GLU C 1 121 ? -14.608 51.822  54.831  1.00 76.33  ? 621 GLU C CB  1 
ATOM   5808  C CG  . GLU C 1 121 ? -16.030 52.382  54.894  1.00 90.91  ? 621 GLU C CG  1 
ATOM   5809  C CD  . GLU C 1 121 ? -16.528 52.902  53.555  1.00 100.54 ? 621 GLU C CD  1 
ATOM   5810  O OE1 . GLU C 1 121 ? -15.723 52.964  52.600  1.00 102.49 ? 621 GLU C OE1 1 
ATOM   5811  O OE2 . GLU C 1 121 ? -17.729 53.244  53.456  1.00 103.17 ? 621 GLU C OE2 1 
ATOM   5812  N N   . ASP C 1 122 ? -11.547 51.531  54.255  1.00 53.37  ? 622 ASP C N   1 
ATOM   5813  C CA  . ASP C 1 122 ? -10.240 50.912  54.496  1.00 60.60  ? 622 ASP C CA  1 
ATOM   5814  C C   . ASP C 1 122 ? -9.218  51.965  54.888  1.00 54.63  ? 622 ASP C C   1 
ATOM   5815  O O   . ASP C 1 122 ? -8.376  51.751  55.759  1.00 54.84  ? 622 ASP C O   1 
ATOM   5816  C CB  . ASP C 1 122 ? -9.737  50.200  53.241  1.00 73.41  ? 622 ASP C CB  1 
ATOM   5817  C CG  . ASP C 1 122 ? -10.705 49.155  52.740  1.00 93.07  ? 622 ASP C CG  1 
ATOM   5818  O OD1 . ASP C 1 122 ? -11.351 48.491  53.583  1.00 95.31  ? 622 ASP C OD1 1 
ATOM   5819  O OD2 . ASP C 1 122 ? -10.824 49.003  51.502  1.00 99.41  ? 622 ASP C OD2 1 
ATOM   5820  N N   . ARG C 1 123 ? -9.297  53.101  54.213  1.00 36.91  ? 623 ARG C N   1 
ATOM   5821  C CA  . ARG C 1 123 ? -8.371  54.189  54.432  1.00 39.31  ? 623 ARG C CA  1 
ATOM   5822  C C   . ARG C 1 123 ? -8.549  54.781  55.830  1.00 39.33  ? 623 ARG C C   1 
ATOM   5823  O O   . ARG C 1 123 ? -7.571  55.077  56.518  1.00 46.15  ? 623 ARG C O   1 
ATOM   5824  C CB  . ARG C 1 123 ? -8.558  55.251  53.350  1.00 36.22  ? 623 ARG C CB  1 
ATOM   5825  C CG  . ARG C 1 123 ? -7.313  56.036  53.064  1.00 31.92  ? 623 ARG C CG  1 
ATOM   5826  C CD  . ARG C 1 123 ? -7.392  56.702  51.715  1.00 41.18  ? 623 ARG C CD  1 
ATOM   5827  N NE  . ARG C 1 123 ? -8.430  57.721  51.639  1.00 40.31  ? 623 ARG C NE  1 
ATOM   5828  C CZ  . ARG C 1 123 ? -9.478  57.652  50.826  1.00 49.58  ? 623 ARG C CZ  1 
ATOM   5829  N NH1 . ARG C 1 123 ? -9.626  56.596  50.035  1.00 49.49  ? 623 ARG C NH1 1 
ATOM   5830  N NH2 . ARG C 1 123 ? -10.379 58.632  50.809  1.00 53.75  ? 623 ARG C NH2 1 
ATOM   5831  N N   . ALA C 1 124 ? -9.796  54.951  56.256  1.00 34.28  ? 624 ALA C N   1 
ATOM   5832  C CA  . ALA C 1 124 ? -10.055 55.378  57.627  1.00 34.19  ? 624 ALA C CA  1 
ATOM   5833  C C   . ALA C 1 124 ? -9.456  54.361  58.599  1.00 33.50  ? 624 ALA C C   1 
ATOM   5834  O O   . ALA C 1 124 ? -8.857  54.727  59.604  1.00 38.77  ? 624 ALA C O   1 
ATOM   5835  C CB  . ALA C 1 124 ? -11.546 55.528  57.867  1.00 33.23  ? 624 ALA C CB  1 
ATOM   5836  N N   . ALA C 1 125 ? -9.623  53.081  58.281  1.00 32.71  ? 625 ALA C N   1 
ATOM   5837  C CA  . ALA C 1 125 ? -9.150  51.991  59.131  1.00 31.47  ? 625 ALA C CA  1 
ATOM   5838  C C   . ALA C 1 125 ? -7.614  51.976  59.242  1.00 30.15  ? 625 ALA C C   1 
ATOM   5839  O O   . ALA C 1 125 ? -7.069  51.690  60.308  1.00 32.72  ? 625 ALA C O   1 
ATOM   5840  C CB  . ALA C 1 125 ? -9.680  50.635  58.614  1.00 23.55  ? 625 ALA C CB  1 
ATOM   5841  N N   . THR C 1 126 ? -6.931  52.276  58.137  1.00 19.71  ? 626 THR C N   1 
ATOM   5842  C CA  . THR C 1 126 ? -5.482  52.416  58.123  1.00 25.72  ? 626 THR C CA  1 
ATOM   5843  C C   . THR C 1 126 ? -5.055  53.603  59.002  1.00 41.51  ? 626 THR C C   1 
ATOM   5844  O O   . THR C 1 126 ? -4.127  53.496  59.810  1.00 45.91  ? 626 THR C O   1 
ATOM   5845  C CB  . THR C 1 126 ? -4.965  52.665  56.697  1.00 33.29  ? 626 THR C CB  1 
ATOM   5846  O OG1 . THR C 1 126 ? -5.439  51.637  55.823  1.00 36.42  ? 626 THR C OG1 1 
ATOM   5847  C CG2 . THR C 1 126 ? -3.424  52.713  56.675  1.00 31.64  ? 626 THR C CG2 1 
ATOM   5848  N N   . LEU C 1 127 ? -5.738  54.732  58.832  1.00 33.77  ? 627 LEU C N   1 
ATOM   5849  C CA  . LEU C 1 127 ? -5.512  55.907  59.661  1.00 30.24  ? 627 LEU C CA  1 
ATOM   5850  C C   . LEU C 1 127 ? -5.665  55.575  61.154  1.00 33.38  ? 627 LEU C C   1 
ATOM   5851  O O   . LEU C 1 127 ? -4.838  55.956  61.994  1.00 33.47  ? 627 LEU C O   1 
ATOM   5852  C CB  . LEU C 1 127 ? -6.494  56.999  59.258  1.00 26.82  ? 627 LEU C CB  1 
ATOM   5853  C CG  . LEU C 1 127 ? -6.183  58.361  59.845  1.00 34.69  ? 627 LEU C CG  1 
ATOM   5854  C CD1 . LEU C 1 127 ? -4.734  58.698  59.542  1.00 39.59  ? 627 LEU C CD1 1 
ATOM   5855  C CD2 . LEU C 1 127 ? -7.121  59.406  59.272  1.00 29.99  ? 627 LEU C CD2 1 
ATOM   5856  N N   . SER C 1 128 ? -6.716  54.838  61.484  1.00 22.17  ? 628 SER C N   1 
ATOM   5857  C CA  . SER C 1 128 ? -6.923  54.417  62.863  1.00 35.24  ? 628 SER C CA  1 
ATOM   5858  C C   . SER C 1 128 ? -5.760  53.543  63.379  1.00 32.59  ? 628 SER C C   1 
ATOM   5859  O O   . SER C 1 128 ? -5.309  53.710  64.518  1.00 32.26  ? 628 SER C O   1 
ATOM   5860  C CB  . SER C 1 128 ? -8.265  53.678  62.994  1.00 36.54  ? 628 SER C CB  1 
ATOM   5861  O OG  . SER C 1 128 ? -8.605  53.450  64.351  1.00 37.58  ? 628 SER C OG  1 
ATOM   5862  N N   . LYS C 1 129 ? -5.286  52.613  62.545  1.00 23.15  ? 629 LYS C N   1 
ATOM   5863  C CA  . LYS C 1 129 ? -4.207  51.701  62.944  1.00 37.14  ? 629 LYS C CA  1 
ATOM   5864  C C   . LYS C 1 129 ? -2.955  52.513  63.285  1.00 34.25  ? 629 LYS C C   1 
ATOM   5865  O O   . LYS C 1 129 ? -2.310  52.305  64.318  1.00 31.97  ? 629 LYS C O   1 
ATOM   5866  C CB  . LYS C 1 129 ? -3.899  50.700  61.823  1.00 44.30  ? 629 LYS C CB  1 
ATOM   5867  C CG  . LYS C 1 129 ? -4.108  49.221  62.169  1.00 47.64  ? 629 LYS C CG  1 
ATOM   5868  C CD  . LYS C 1 129 ? -2.969  48.648  62.998  1.00 45.01  ? 629 LYS C CD  1 
ATOM   5869  C CE  . LYS C 1 129 ? -2.839  47.132  62.805  1.00 48.62  ? 629 LYS C CE  1 
ATOM   5870  N NZ  . LYS C 1 129 ? -4.005  46.332  63.284  1.00 55.95  ? 629 LYS C NZ  1 
ATOM   5871  N N   . ILE C 1 130 ? -2.641  53.455  62.404  1.00 27.16  ? 630 ILE C N   1 
ATOM   5872  C CA  . ILE C 1 130 ? -1.503  54.342  62.576  1.00 28.33  ? 630 ILE C CA  1 
ATOM   5873  C C   . ILE C 1 130 ? -1.570  55.115  63.891  1.00 31.47  ? 630 ILE C C   1 
ATOM   5874  O O   . ILE C 1 130 ? -0.577  55.204  64.618  1.00 25.51  ? 630 ILE C O   1 
ATOM   5875  C CB  . ILE C 1 130 ? -1.428  55.332  61.410  1.00 24.69  ? 630 ILE C CB  1 
ATOM   5876  C CG1 . ILE C 1 130 ? -1.220  54.584  60.093  1.00 19.18  ? 630 ILE C CG1 1 
ATOM   5877  C CG2 . ILE C 1 130 ? -0.321  56.338  61.625  1.00 19.86  ? 630 ILE C CG2 1 
ATOM   5878  C CD1 . ILE C 1 130 ? -1.453  55.447  58.892  1.00 25.52  ? 630 ILE C CD1 1 
ATOM   5879  N N   . ILE C 1 131 ? -2.736  55.680  64.193  1.00 25.17  ? 631 ILE C N   1 
ATOM   5880  C CA  . ILE C 1 131 ? -2.892  56.423  65.434  1.00 22.81  ? 631 ILE C CA  1 
ATOM   5881  C C   . ILE C 1 131 ? -2.704  55.491  66.626  1.00 28.53  ? 631 ILE C C   1 
ATOM   5882  O O   . ILE C 1 131 ? -2.055  55.843  67.619  1.00 26.39  ? 631 ILE C O   1 
ATOM   5883  C CB  . ILE C 1 131 ? -4.251  57.114  65.507  1.00 23.84  ? 631 ILE C CB  1 
ATOM   5884  C CG1 . ILE C 1 131 ? -4.327  58.206  64.443  1.00 25.37  ? 631 ILE C CG1 1 
ATOM   5885  C CG2 . ILE C 1 131 ? -4.504  57.670  66.919  1.00 11.87  ? 631 ILE C CG2 1 
ATOM   5886  C CD1 . ILE C 1 131 ? -5.693  58.849  64.328  1.00 21.89  ? 631 ILE C CD1 1 
ATOM   5887  N N   . GLN C 1 132 ? -3.257  54.290  66.511  1.00 30.40  ? 632 GLN C N   1 
ATOM   5888  C CA  . GLN C 1 132 ? -3.092  53.281  67.547  1.00 31.48  ? 632 GLN C CA  1 
ATOM   5889  C C   . GLN C 1 132 ? -1.637  52.882  67.770  1.00 29.05  ? 632 GLN C C   1 
ATOM   5890  O O   . GLN C 1 132 ? -1.223  52.621  68.901  1.00 28.70  ? 632 GLN C O   1 
ATOM   5891  C CB  . GLN C 1 132 ? -3.895  52.043  67.200  1.00 37.32  ? 632 GLN C CB  1 
ATOM   5892  C CG  . GLN C 1 132 ? -5.376  52.221  67.329  1.00 42.18  ? 632 GLN C CG  1 
ATOM   5893  C CD  . GLN C 1 132 ? -6.110  50.916  67.137  1.00 50.66  ? 632 GLN C CD  1 
ATOM   5894  O OE1 . GLN C 1 132 ? -5.917  50.221  66.136  1.00 47.28  ? 632 GLN C OE1 1 
ATOM   5895  N NE2 . GLN C 1 132 ? -6.944  50.561  68.107  1.00 55.85  ? 632 GLN C NE2 1 
ATOM   5896  N N   . VAL C 1 133 ? -0.858  52.816  66.698  1.00 29.49  ? 633 VAL C N   1 
ATOM   5897  C CA  . VAL C 1 133 ? 0.565   52.520  66.851  1.00 31.90  ? 633 VAL C CA  1 
ATOM   5898  C C   . VAL C 1 133 ? 1.272   53.683  67.522  1.00 26.28  ? 633 VAL C C   1 
ATOM   5899  O O   . VAL C 1 133 ? 2.171   53.481  68.328  1.00 28.65  ? 633 VAL C O   1 
ATOM   5900  C CB  . VAL C 1 133 ? 1.257   52.241  65.513  1.00 21.18  ? 633 VAL C CB  1 
ATOM   5901  C CG1 . VAL C 1 133 ? 2.751   52.113  65.726  1.00 17.69  ? 633 VAL C CG1 1 
ATOM   5902  C CG2 . VAL C 1 133 ? 0.701   51.002  64.914  1.00 24.58  ? 633 VAL C CG2 1 
ATOM   5903  N N   . ALA C 1 134 ? 0.864   54.899  67.170  1.00 25.45  ? 634 ALA C N   1 
ATOM   5904  C CA  . ALA C 1 134 ? 1.416   56.097  67.780  1.00 9.60   ? 634 ALA C CA  1 
ATOM   5905  C C   . ALA C 1 134 ? 1.219   56.043  69.288  1.00 21.80  ? 634 ALA C C   1 
ATOM   5906  O O   . ALA C 1 134 ? 2.163   56.264  70.051  1.00 21.39  ? 634 ALA C O   1 
ATOM   5907  C CB  . ALA C 1 134 ? 0.779   57.325  67.203  1.00 15.92  ? 634 ALA C CB  1 
ATOM   5908  N N   . VAL C 1 135 ? 0.000   55.719  69.715  1.00 23.69  ? 635 VAL C N   1 
ATOM   5909  C CA  . VAL C 1 135 ? -0.299  55.515  71.134  1.00 22.84  ? 635 VAL C CA  1 
ATOM   5910  C C   . VAL C 1 135 ? 0.601   54.484  71.832  1.00 30.36  ? 635 VAL C C   1 
ATOM   5911  O O   . VAL C 1 135 ? 1.065   54.719  72.950  1.00 29.10  ? 635 VAL C O   1 
ATOM   5912  C CB  . VAL C 1 135 ? -1.750  55.069  71.334  1.00 24.42  ? 635 VAL C CB  1 
ATOM   5913  C CG1 . VAL C 1 135 ? -1.951  54.559  72.759  1.00 14.96  ? 635 VAL C CG1 1 
ATOM   5914  C CG2 . VAL C 1 135 ? -2.691  56.208  71.025  1.00 24.02  ? 635 VAL C CG2 1 
ATOM   5915  N N   . GLU C 1 136 ? 0.816   53.334  71.196  1.00 24.08  ? 636 GLU C N   1 
ATOM   5916  C CA  . GLU C 1 136 ? 1.672   52.295  71.775  1.00 27.79  ? 636 GLU C CA  1 
ATOM   5917  C C   . GLU C 1 136 ? 3.121   52.759  71.873  1.00 26.10  ? 636 GLU C C   1 
ATOM   5918  O O   . GLU C 1 136 ? 3.804   52.518  72.873  1.00 27.75  ? 636 GLU C O   1 
ATOM   5919  C CB  . GLU C 1 136 ? 1.598   51.013  70.944  1.00 41.94  ? 636 GLU C CB  1 
ATOM   5920  C CG  . GLU C 1 136 ? 0.263   50.291  71.049  1.00 44.02  ? 636 GLU C CG  1 
ATOM   5921  C CD  . GLU C 1 136 ? 0.034   49.712  72.429  1.00 53.25  ? 636 GLU C CD  1 
ATOM   5922  O OE1 . GLU C 1 136 ? 0.958   49.039  72.939  1.00 55.65  ? 636 GLU C OE1 1 
ATOM   5923  O OE2 . GLU C 1 136 ? -1.057  49.939  73.004  1.00 53.98  ? 636 GLU C OE2 1 
ATOM   5924  N N   . LEU C 1 137 ? 3.582   53.434  70.827  1.00 19.19  ? 637 LEU C N   1 
ATOM   5925  C CA  . LEU C 1 137 ? 4.925   53.971  70.808  1.00 19.31  ? 637 LEU C CA  1 
ATOM   5926  C C   . LEU C 1 137 ? 5.143   54.909  71.974  1.00 22.94  ? 637 LEU C C   1 
ATOM   5927  O O   . LEU C 1 137 ? 6.224   54.926  72.574  1.00 23.84  ? 637 LEU C O   1 
ATOM   5928  C CB  . LEU C 1 137 ? 5.203   54.676  69.486  1.00 17.34  ? 637 LEU C CB  1 
ATOM   5929  C CG  . LEU C 1 137 ? 5.490   53.722  68.328  1.00 18.05  ? 637 LEU C CG  1 
ATOM   5930  C CD1 . LEU C 1 137 ? 5.650   54.473  66.982  1.00 13.98  ? 637 LEU C CD1 1 
ATOM   5931  C CD2 . LEU C 1 137 ? 6.734   52.885  68.653  1.00 14.28  ? 637 LEU C CD2 1 
ATOM   5932  N N   . LYS C 1 138 ? 4.103   55.665  72.314  1.00 20.10  ? 638 LYS C N   1 
ATOM   5933  C CA  . LYS C 1 138 ? 4.198   56.670  73.366  1.00 26.30  ? 638 LYS C CA  1 
ATOM   5934  C C   . LYS C 1 138 ? 4.063   56.052  74.761  1.00 26.09  ? 638 LYS C C   1 
ATOM   5935  O O   . LYS C 1 138 ? 4.962   56.173  75.611  1.00 14.74  ? 638 LYS C O   1 
ATOM   5936  C CB  . LYS C 1 138 ? 3.124   57.751  73.162  1.00 26.39  ? 638 LYS C CB  1 
ATOM   5937  C CG  . LYS C 1 138 ? 2.889   58.680  74.370  1.00 25.92  ? 638 LYS C CG  1 
ATOM   5938  C CD  . LYS C 1 138 ? 1.810   59.755  74.075  1.00 20.47  ? 638 LYS C CD  1 
ATOM   5939  C CE  . LYS C 1 138 ? 1.579   60.682  75.274  1.00 23.31  ? 638 LYS C CE  1 
ATOM   5940  N NZ  . LYS C 1 138 ? 0.659   60.092  76.305  1.00 19.57  ? 638 LYS C NZ  1 
ATOM   5941  N N   . ASP C 1 139 ? 2.935   55.371  74.962  1.00 11.88  ? 639 ASP C N   1 
ATOM   5942  C CA  . ASP C 1 139 ? 2.511   54.900  76.277  1.00 22.15  ? 639 ASP C CA  1 
ATOM   5943  C C   . ASP C 1 139 ? 3.089   53.525  76.661  1.00 24.85  ? 639 ASP C C   1 
ATOM   5944  O O   . ASP C 1 139 ? 3.154   53.201  77.846  1.00 27.75  ? 639 ASP C O   1 
ATOM   5945  C CB  . ASP C 1 139 ? 0.972   54.897  76.371  1.00 24.85  ? 639 ASP C CB  1 
ATOM   5946  C CG  . ASP C 1 139 ? 0.381   56.302  76.437  1.00 38.55  ? 639 ASP C CG  1 
ATOM   5947  O OD1 . ASP C 1 139 ? 1.152   57.282  76.327  1.00 41.65  ? 639 ASP C OD1 1 
ATOM   5948  O OD2 . ASP C 1 139 ? -0.855  56.430  76.599  1.00 43.59  ? 639 ASP C OD2 1 
ATOM   5949  N N   . SER C 1 140 ? 3.516   52.723  75.680  1.00 20.73  ? 640 SER C N   1 
ATOM   5950  C CA  . SER C 1 140 ? 4.062   51.390  75.997  1.00 22.82  ? 640 SER C CA  1 
ATOM   5951  C C   . SER C 1 140 ? 5.559   51.276  75.737  1.00 23.07  ? 640 SER C C   1 
ATOM   5952  O O   . SER C 1 140 ? 6.293   50.697  76.538  1.00 23.69  ? 640 SER C O   1 
ATOM   5953  C CB  . SER C 1 140 ? 3.336   50.282  75.228  1.00 16.12  ? 640 SER C CB  1 
ATOM   5954  O OG  . SER C 1 140 ? 1.965   50.249  75.566  1.00 27.89  ? 640 SER C OG  1 
ATOM   5955  N N   . MET C 1 141 ? 6.003   51.801  74.601  1.00 21.59  ? 641 MET C N   1 
ATOM   5956  C CA  . MET C 1 141 ? 7.421   51.750  74.262  1.00 24.93  ? 641 MET C CA  1 
ATOM   5957  C C   . MET C 1 141 ? 8.184   52.964  74.799  1.00 24.02  ? 641 MET C C   1 
ATOM   5958  O O   . MET C 1 141 ? 9.376   52.881  75.059  1.00 19.76  ? 641 MET C O   1 
ATOM   5959  C CB  . MET C 1 141 ? 7.617   51.606  72.749  1.00 22.42  ? 641 MET C CB  1 
ATOM   5960  C CG  . MET C 1 141 ? 6.828   50.455  72.123  1.00 30.05  ? 641 MET C CG  1 
ATOM   5961  S SD  . MET C 1 141 ? 7.093   48.857  72.935  1.00 26.56  ? 641 MET C SD  1 
ATOM   5962  C CE  . MET C 1 141 ? 5.418   48.218  72.849  1.00 31.16  ? 641 MET C CE  1 
ATOM   5963  N N   . GLY C 1 142 ? 7.494   54.086  74.983  1.00 27.82  ? 642 GLY C N   1 
ATOM   5964  C CA  . GLY C 1 142 ? 8.173   55.308  75.382  1.00 24.68  ? 642 GLY C CA  1 
ATOM   5965  C C   . GLY C 1 142 ? 9.236   55.659  74.359  1.00 24.01  ? 642 GLY C C   1 
ATOM   5966  O O   . GLY C 1 142 ? 10.329  56.050  74.721  1.00 25.31  ? 642 GLY C O   1 
ATOM   5967  N N   . ASP C 1 143 ? 8.913   55.481  73.078  1.00 19.05  ? 643 ASP C N   1 
ATOM   5968  C CA  . ASP C 1 143 ? 9.805   55.830  71.982  1.00 20.25  ? 643 ASP C CA  1 
ATOM   5969  C C   . ASP C 1 143 ? 9.252   57.115  71.357  1.00 23.10  ? 643 ASP C C   1 
ATOM   5970  O O   . ASP C 1 143 ? 8.357   57.064  70.527  1.00 19.14  ? 643 ASP C O   1 
ATOM   5971  C CB  . ASP C 1 143 ? 9.845   54.682  70.956  1.00 19.04  ? 643 ASP C CB  1 
ATOM   5972  C CG  . ASP C 1 143 ? 10.681  55.003  69.720  1.00 24.04  ? 643 ASP C CG  1 
ATOM   5973  O OD1 . ASP C 1 143 ? 11.198  56.129  69.595  1.00 33.10  ? 643 ASP C OD1 1 
ATOM   5974  O OD2 . ASP C 1 143 ? 10.809  54.120  68.850  1.00 27.73  ? 643 ASP C OD2 1 
ATOM   5975  N N   . LEU C 1 144 ? 9.791   58.263  71.770  1.00 20.94  ? 644 LEU C N   1 
ATOM   5976  C CA  . LEU C 1 144 ? 9.260   59.574  71.385  1.00 14.16  ? 644 LEU C CA  1 
ATOM   5977  C C   . LEU C 1 144 ? 9.644   59.939  69.946  1.00 22.21  ? 644 LEU C C   1 
ATOM   5978  O O   . LEU C 1 144 ? 8.862   60.538  69.189  1.00 16.29  ? 644 LEU C O   1 
ATOM   5979  C CB  . LEU C 1 144 ? 9.767   60.623  72.369  1.00 9.69   ? 644 LEU C CB  1 
ATOM   5980  C CG  . LEU C 1 144 ? 9.492   60.241  73.828  1.00 17.43  ? 644 LEU C CG  1 
ATOM   5981  C CD1 . LEU C 1 144 ? 9.787   61.409  74.751  1.00 17.71  ? 644 LEU C CD1 1 
ATOM   5982  C CD2 . LEU C 1 144 ? 8.043   59.786  74.025  1.00 15.28  ? 644 LEU C CD2 1 
ATOM   5983  N N   . TYR C 1 145 ? 10.855  59.545  69.581  1.00 24.58  ? 645 TYR C N   1 
ATOM   5984  C CA  . TYR C 1 145 ? 11.380  59.695  68.241  1.00 24.93  ? 645 TYR C CA  1 
ATOM   5985  C C   . TYR C 1 145 ? 10.446  59.118  67.169  1.00 26.34  ? 645 TYR C C   1 
ATOM   5986  O O   . TYR C 1 145 ? 9.933   59.854  66.330  1.00 29.38  ? 645 TYR C O   1 
ATOM   5987  C CB  . TYR C 1 145 ? 12.764  59.046  68.207  1.00 20.54  ? 645 TYR C CB  1 
ATOM   5988  C CG  . TYR C 1 145 ? 13.424  58.888  66.858  1.00 19.56  ? 645 TYR C CG  1 
ATOM   5989  C CD1 . TYR C 1 145 ? 13.857  59.990  66.119  1.00 16.99  ? 645 TYR C CD1 1 
ATOM   5990  C CD2 . TYR C 1 145 ? 13.683  57.619  66.355  1.00 15.44  ? 645 TYR C CD2 1 
ATOM   5991  C CE1 . TYR C 1 145 ? 14.513  59.823  64.883  1.00 18.84  ? 645 TYR C CE1 1 
ATOM   5992  C CE2 . TYR C 1 145 ? 14.333  57.440  65.130  1.00 24.57  ? 645 TYR C CE2 1 
ATOM   5993  C CZ  . TYR C 1 145 ? 14.752  58.535  64.399  1.00 27.03  ? 645 TYR C CZ  1 
ATOM   5994  O OH  . TYR C 1 145 ? 15.394  58.306  63.187  1.00 23.27  ? 645 TYR C OH  1 
ATOM   5995  N N   . SER C 1 146 ? 10.198  57.814  67.185  1.00 23.03  ? 646 SER C N   1 
ATOM   5996  C CA  . SER C 1 146 ? 9.340   57.260  66.135  1.00 25.26  ? 646 SER C CA  1 
ATOM   5997  C C   . SER C 1 146 ? 7.889   57.704  66.308  1.00 22.49  ? 646 SER C C   1 
ATOM   5998  O O   . SER C 1 146 ? 7.138   57.799  65.333  1.00 21.34  ? 646 SER C O   1 
ATOM   5999  C CB  . SER C 1 146 ? 9.468   55.735  66.017  1.00 24.85  ? 646 SER C CB  1 
ATOM   6000  O OG  . SER C 1 146 ? 10.501  55.422  65.098  1.00 26.51  ? 646 SER C OG  1 
ATOM   6001  N N   . PHE C 1 147 ? 7.501   57.988  67.547  1.00 17.77  ? 647 PHE C N   1 
ATOM   6002  C CA  . PHE C 1 147 ? 6.212   58.630  67.786  1.00 18.98  ? 647 PHE C CA  1 
ATOM   6003  C C   . PHE C 1 147 ? 6.117   59.911  66.970  1.00 22.16  ? 647 PHE C C   1 
ATOM   6004  O O   . PHE C 1 147 ? 5.132   60.128  66.273  1.00 24.21  ? 647 PHE C O   1 
ATOM   6005  C CB  . PHE C 1 147 ? 5.995   58.922  69.270  1.00 21.87  ? 647 PHE C CB  1 
ATOM   6006  C CG  . PHE C 1 147 ? 4.819   59.824  69.553  1.00 26.15  ? 647 PHE C CG  1 
ATOM   6007  C CD1 . PHE C 1 147 ? 3.533   59.307  69.642  1.00 20.59  ? 647 PHE C CD1 1 
ATOM   6008  C CD2 . PHE C 1 147 ? 5.003   61.193  69.747  1.00 25.47  ? 647 PHE C CD2 1 
ATOM   6009  C CE1 . PHE C 1 147 ? 2.439   60.140  69.904  1.00 20.98  ? 647 PHE C CE1 1 
ATOM   6010  C CE2 . PHE C 1 147 ? 3.913   62.039  70.022  1.00 25.99  ? 647 PHE C CE2 1 
ATOM   6011  C CZ  . PHE C 1 147 ? 2.629   61.510  70.092  1.00 22.22  ? 647 PHE C CZ  1 
ATOM   6012  N N   . SER C 1 148 ? 7.147   60.752  67.039  1.00 20.28  ? 648 SER C N   1 
ATOM   6013  C CA  . SER C 1 148 ? 7.078   62.039  66.365  1.00 20.76  ? 648 SER C CA  1 
ATOM   6014  C C   . SER C 1 148 ? 6.993   61.831  64.857  1.00 25.16  ? 648 SER C C   1 
ATOM   6015  O O   . SER C 1 148 ? 6.312   62.579  64.160  1.00 28.83  ? 648 SER C O   1 
ATOM   6016  C CB  . SER C 1 148 ? 8.237   62.985  66.768  1.00 16.55  ? 648 SER C CB  1 
ATOM   6017  O OG  . SER C 1 148 ? 9.472   62.659  66.132  1.00 20.28  ? 648 SER C OG  1 
ATOM   6018  N N   . ALA C 1 149 ? 7.664   60.797  64.363  1.00 7.54   ? 649 ALA C N   1 
ATOM   6019  C CA  . ALA C 1 149 ? 7.611   60.458  62.937  1.00 22.15  ? 649 ALA C CA  1 
ATOM   6020  C C   . ALA C 1 149 ? 6.187   60.194  62.444  1.00 25.09  ? 649 ALA C C   1 
ATOM   6021  O O   . ALA C 1 149 ? 5.821   60.640  61.351  1.00 26.88  ? 649 ALA C O   1 
ATOM   6022  C CB  . ALA C 1 149 ? 8.518   59.239  62.615  1.00 19.64  ? 649 ALA C CB  1 
ATOM   6023  N N   . LEU C 1 150 ? 5.399   59.443  63.217  1.00 19.48  ? 650 LEU C N   1 
ATOM   6024  C CA  . LEU C 1 150 ? 4.011   59.162  62.833  1.00 27.59  ? 650 LEU C CA  1 
ATOM   6025  C C   . LEU C 1 150 ? 3.158   60.432  62.868  1.00 29.86  ? 650 LEU C C   1 
ATOM   6026  O O   . LEU C 1 150 ? 2.394   60.703  61.936  1.00 22.06  ? 650 LEU C O   1 
ATOM   6027  C CB  . LEU C 1 150 ? 3.371   58.091  63.719  1.00 20.93  ? 650 LEU C CB  1 
ATOM   6028  C CG  . LEU C 1 150 ? 3.509   56.662  63.224  1.00 29.09  ? 650 LEU C CG  1 
ATOM   6029  C CD1 . LEU C 1 150 ? 4.991   56.335  63.112  1.00 25.74  ? 650 LEU C CD1 1 
ATOM   6030  C CD2 . LEU C 1 150 ? 2.774   55.662  64.146  1.00 23.90  ? 650 LEU C CD2 1 
ATOM   6031  N N   . MET C 1 151 ? 3.294   61.202  63.945  1.00 20.61  ? 651 MET C N   1 
ATOM   6032  C CA  . MET C 1 151 ? 2.586   62.469  64.062  1.00 23.82  ? 651 MET C CA  1 
ATOM   6033  C C   . MET C 1 151 ? 2.896   63.382  62.880  1.00 26.32  ? 651 MET C C   1 
ATOM   6034  O O   . MET C 1 151 ? 2.001   64.042  62.340  1.00 39.68  ? 651 MET C O   1 
ATOM   6035  C CB  . MET C 1 151 ? 2.908   63.170  65.392  1.00 16.52  ? 651 MET C CB  1 
ATOM   6036  C CG  . MET C 1 151 ? 2.477   62.375  66.636  1.00 25.87  ? 651 MET C CG  1 
ATOM   6037  S SD  . MET C 1 151 ? 0.705   61.992  66.727  1.00 28.83  ? 651 MET C SD  1 
ATOM   6038  C CE  . MET C 1 151 ? 0.029   63.538  67.334  1.00 17.26  ? 651 MET C CE  1 
ATOM   6039  N N   . LYS C 1 152 ? 4.159   63.427  62.478  1.00 18.54  ? 652 LYS C N   1 
ATOM   6040  C CA  . LYS C 1 152 ? 4.545   64.277  61.364  1.00 27.31  ? 652 LYS C CA  1 
ATOM   6041  C C   . LYS C 1 152 ? 3.798   63.844  60.098  1.00 33.69  ? 652 LYS C C   1 
ATOM   6042  O O   . LYS C 1 152 ? 3.273   64.679  59.363  1.00 37.30  ? 652 LYS C O   1 
ATOM   6043  C CB  . LYS C 1 152 ? 6.056   64.253  61.130  1.00 27.45  ? 652 LYS C CB  1 
ATOM   6044  C CG  . LYS C 1 152 ? 6.461   65.137  59.973  1.00 36.77  ? 652 LYS C CG  1 
ATOM   6045  C CD  . LYS C 1 152 ? 7.843   64.837  59.430  1.00 43.60  ? 652 LYS C CD  1 
ATOM   6046  C CE  . LYS C 1 152 ? 8.139   65.776  58.254  1.00 55.53  ? 652 LYS C CE  1 
ATOM   6047  N NZ  . LYS C 1 152 ? 9.350   65.410  57.476  1.00 56.01  ? 652 LYS C NZ  1 
ATOM   6048  N N   . ALA C 1 153 ? 3.740   62.539  59.850  1.00 29.75  ? 653 ALA C N   1 
ATOM   6049  C CA  . ALA C 1 153 ? 2.937   62.025  58.740  1.00 36.69  ? 653 ALA C CA  1 
ATOM   6050  C C   . ALA C 1 153 ? 1.489   62.551  58.794  1.00 39.83  ? 653 ALA C C   1 
ATOM   6051  O O   . ALA C 1 153 ? 0.981   63.120  57.820  1.00 38.97  ? 653 ALA C O   1 
ATOM   6052  C CB  . ALA C 1 153 ? 2.949   60.504  58.725  1.00 25.81  ? 653 ALA C CB  1 
ATOM   6053  N N   . LEU C 1 154 ? 0.841   62.356  59.939  1.00 31.58  ? 654 LEU C N   1 
ATOM   6054  C CA  . LEU C 1 154 ? -0.552  62.736  60.123  1.00 29.25  ? 654 LEU C CA  1 
ATOM   6055  C C   . LEU C 1 154 ? -0.776  64.254  59.975  1.00 33.65  ? 654 LEU C C   1 
ATOM   6056  O O   . LEU C 1 154 ? -1.908  64.700  59.824  1.00 34.60  ? 654 LEU C O   1 
ATOM   6057  C CB  . LEU C 1 154 ? -1.055  62.237  61.482  1.00 25.03  ? 654 LEU C CB  1 
ATOM   6058  C CG  . LEU C 1 154 ? -0.997  60.714  61.623  1.00 27.52  ? 654 LEU C CG  1 
ATOM   6059  C CD1 . LEU C 1 154 ? -1.453  60.248  62.990  1.00 20.37  ? 654 LEU C CD1 1 
ATOM   6060  C CD2 . LEU C 1 154 ? -1.832  60.073  60.559  1.00 31.29  ? 654 LEU C CD2 1 
ATOM   6061  N N   . GLU C 1 155 ? 0.300   65.039  60.009  1.00 27.78  ? 655 GLU C N   1 
ATOM   6062  C CA  . GLU C 1 155 ? 0.188   66.490  59.851  1.00 28.83  ? 655 GLU C CA  1 
ATOM   6063  C C   . GLU C 1 155 ? 0.590   66.973  58.455  1.00 22.82  ? 655 GLU C C   1 
ATOM   6064  O O   . GLU C 1 155 ? 0.557   68.163  58.194  1.00 26.78  ? 655 GLU C O   1 
ATOM   6065  C CB  . GLU C 1 155 ? 1.045   67.235  60.893  1.00 36.45  ? 655 GLU C CB  1 
ATOM   6066  C CG  . GLU C 1 155 ? 0.543   67.162  62.331  1.00 56.39  ? 655 GLU C CG  1 
ATOM   6067  C CD  . GLU C 1 155 ? 1.589   67.630  63.340  1.00 70.93  ? 655 GLU C CD  1 
ATOM   6068  O OE1 . GLU C 1 155 ? 1.564   67.146  64.496  1.00 71.72  ? 655 GLU C OE1 1 
ATOM   6069  O OE2 . GLU C 1 155 ? 2.437   68.479  62.978  1.00 73.98  ? 655 GLU C OE2 1 
ATOM   6070  N N   . MET C 1 156 ? 1.006   66.076  57.569  1.00 28.38  ? 656 MET C N   1 
ATOM   6071  C CA  . MET C 1 156 ? 1.346   66.494  56.211  1.00 32.59  ? 656 MET C CA  1 
ATOM   6072  C C   . MET C 1 156 ? 0.112   67.059  55.527  1.00 33.66  ? 656 MET C C   1 
ATOM   6073  O O   . MET C 1 156 ? -0.984  66.525  55.672  1.00 36.97  ? 656 MET C O   1 
ATOM   6074  C CB  . MET C 1 156 ? 1.905   65.337  55.388  1.00 37.95  ? 656 MET C CB  1 
ATOM   6075  C CG  . MET C 1 156 ? 3.334   64.941  55.727  1.00 40.32  ? 656 MET C CG  1 
ATOM   6076  S SD  . MET C 1 156 ? 3.907   63.468  54.831  1.00 48.71  ? 656 MET C SD  1 
ATOM   6077  C CE  . MET C 1 156 ? 5.419   63.141  55.748  1.00 31.79  ? 656 MET C CE  1 
ATOM   6078  N N   . PRO C 1 157 ? 0.279   68.165  54.797  1.00 40.08  ? 657 PRO C N   1 
ATOM   6079  C CA  . PRO C 1 157 ? -0.877  68.730  54.099  1.00 41.41  ? 657 PRO C CA  1 
ATOM   6080  C C   . PRO C 1 157 ? -1.496  67.729  53.121  1.00 35.67  ? 657 PRO C C   1 
ATOM   6081  O O   . PRO C 1 157 ? -2.699  67.773  52.894  1.00 38.04  ? 657 PRO C O   1 
ATOM   6082  C CB  . PRO C 1 157 ? -0.296  69.954  53.368  1.00 39.87  ? 657 PRO C CB  1 
ATOM   6083  C CG  . PRO C 1 157 ? 1.215   69.808  53.448  1.00 35.97  ? 657 PRO C CG  1 
ATOM   6084  C CD  . PRO C 1 157 ? 1.483   69.008  54.675  1.00 40.43  ? 657 PRO C CD  1 
ATOM   6085  N N   . GLN C 1 158 ? -0.699  66.823  52.564  1.00 30.84  ? 658 GLN C N   1 
ATOM   6086  C CA  . GLN C 1 158 ? -1.263  65.855  51.638  1.00 36.26  ? 658 GLN C CA  1 
ATOM   6087  C C   . GLN C 1 158 ? -2.200  64.911  52.370  1.00 40.06  ? 658 GLN C C   1 
ATOM   6088  O O   . GLN C 1 158 ? -3.059  64.285  51.763  1.00 42.12  ? 658 GLN C O   1 
ATOM   6089  C CB  . GLN C 1 158 ? -0.178  65.057  50.922  1.00 45.09  ? 658 GLN C CB  1 
ATOM   6090  C CG  . GLN C 1 158 ? 0.576   65.839  49.866  1.00 42.71  ? 658 GLN C CG  1 
ATOM   6091  C CD  . GLN C 1 158 ? 1.846   66.437  50.416  1.00 44.28  ? 658 GLN C CD  1 
ATOM   6092  O OE1 . GLN C 1 158 ? 1.909   66.813  51.593  1.00 36.92  ? 658 GLN C OE1 1 
ATOM   6093  N NE2 . GLN C 1 158 ? 2.880   66.513  49.576  1.00 47.78  ? 658 GLN C NE2 1 
ATOM   6094  N N   . ILE C 1 159 ? -2.022  64.824  53.682  1.00 41.54  ? 659 ILE C N   1 
ATOM   6095  C CA  . ILE C 1 159 ? -2.823  63.954  54.522  1.00 36.97  ? 659 ILE C CA  1 
ATOM   6096  C C   . ILE C 1 159 ? -3.938  64.736  55.201  1.00 33.12  ? 659 ILE C C   1 
ATOM   6097  O O   . ILE C 1 159 ? -5.085  64.296  55.282  1.00 35.86  ? 659 ILE C O   1 
ATOM   6098  C CB  . ILE C 1 159 ? -1.954  63.308  55.616  1.00 28.69  ? 659 ILE C CB  1 
ATOM   6099  C CG1 . ILE C 1 159 ? -0.791  62.535  54.987  1.00 36.11  ? 659 ILE C CG1 1 
ATOM   6100  C CG2 . ILE C 1 159 ? -2.800  62.397  56.499  1.00 20.85  ? 659 ILE C CG2 1 
ATOM   6101  C CD1 . ILE C 1 159 ? -1.189  61.237  54.336  1.00 37.79  ? 659 ILE C CD1 1 
ATOM   6102  N N   . THR C 1 160 ? -3.582  65.908  55.691  1.00 31.62  ? 660 THR C N   1 
ATOM   6103  C CA  . THR C 1 160 ? -4.477  66.690  56.517  1.00 38.08  ? 660 THR C CA  1 
ATOM   6104  C C   . THR C 1 160 ? -5.697  67.142  55.713  1.00 40.13  ? 660 THR C C   1 
ATOM   6105  O O   . THR C 1 160 ? -6.795  67.336  56.255  1.00 34.39  ? 660 THR C O   1 
ATOM   6106  C CB  . THR C 1 160 ? -3.724  67.898  57.069  1.00 44.67  ? 660 THR C CB  1 
ATOM   6107  O OG1 . THR C 1 160 ? -4.284  68.274  58.329  1.00 61.72  ? 660 THR C OG1 1 
ATOM   6108  C CG2 . THR C 1 160 ? -3.792  69.051  56.091  1.00 37.27  ? 660 THR C CG2 1 
ATOM   6109  N N   . ARG C 1 161 ? -5.503  67.285  54.408  1.00 36.16  ? 661 ARG C N   1 
ATOM   6110  C CA  . ARG C 1 161 ? -6.568  67.754  53.538  1.00 42.13  ? 661 ARG C CA  1 
ATOM   6111  C C   . ARG C 1 161 ? -7.513  66.636  53.094  1.00 50.83  ? 661 ARG C C   1 
ATOM   6112  O O   . ARG C 1 161 ? -8.465  66.892  52.362  1.00 44.70  ? 661 ARG C O   1 
ATOM   6113  C CB  . ARG C 1 161 ? -5.990  68.457  52.313  1.00 39.85  ? 661 ARG C CB  1 
ATOM   6114  C CG  . ARG C 1 161 ? -5.562  67.521  51.218  1.00 37.17  ? 661 ARG C CG  1 
ATOM   6115  C CD  . ARG C 1 161 ? -5.354  68.269  49.919  1.00 42.09  ? 661 ARG C CD  1 
ATOM   6116  N NE  . ARG C 1 161 ? -5.425  67.344  48.806  1.00 49.67  ? 661 ARG C NE  1 
ATOM   6117  C CZ  . ARG C 1 161 ? -6.509  67.161  48.067  1.00 58.78  ? 661 ARG C CZ  1 
ATOM   6118  N NH1 . ARG C 1 161 ? -7.599  67.874  48.311  1.00 56.27  ? 661 ARG C NH1 1 
ATOM   6119  N NH2 . ARG C 1 161 ? -6.494  66.278  47.076  1.00 63.99  ? 661 ARG C NH2 1 
ATOM   6120  N N   . LEU C 1 162 ? -7.249  65.403  53.528  1.00 55.66  ? 662 LEU C N   1 
ATOM   6121  C CA  . LEU C 1 162 ? -8.153  64.285  53.248  1.00 45.22  ? 662 LEU C CA  1 
ATOM   6122  C C   . LEU C 1 162 ? -9.411  64.333  54.126  1.00 44.45  ? 662 LEU C C   1 
ATOM   6123  O O   . LEU C 1 162 ? -9.663  63.418  54.915  1.00 34.24  ? 662 LEU C O   1 
ATOM   6124  C CB  . LEU C 1 162 ? -7.440  62.945  53.417  1.00 35.74  ? 662 LEU C CB  1 
ATOM   6125  C CG  . LEU C 1 162 ? -6.300  62.626  52.443  1.00 45.37  ? 662 LEU C CG  1 
ATOM   6126  C CD1 . LEU C 1 162 ? -5.729  61.226  52.702  1.00 37.07  ? 662 LEU C CD1 1 
ATOM   6127  C CD2 . LEU C 1 162 ? -6.736  62.750  50.983  1.00 39.74  ? 662 LEU C CD2 1 
ATOM   6128  N N   . GLU C 1 163 ? -10.200 65.399  53.967  1.00 46.13  ? 663 GLU C N   1 
ATOM   6129  C CA  . GLU C 1 163 ? -11.405 65.614  54.770  1.00 48.51  ? 663 GLU C CA  1 
ATOM   6130  C C   . GLU C 1 163 ? -12.349 64.406  54.806  1.00 44.99  ? 663 GLU C C   1 
ATOM   6131  O O   . GLU C 1 163 ? -12.793 63.998  55.871  1.00 49.61  ? 663 GLU C O   1 
ATOM   6132  C CB  . GLU C 1 163 ? -12.149 66.875  54.311  1.00 61.12  ? 663 GLU C CB  1 
ATOM   6133  C CG  . GLU C 1 163 ? -13.261 67.336  55.257  1.00 74.12  ? 663 GLU C CG  1 
ATOM   6134  C CD  . GLU C 1 163 ? -12.785 67.547  56.696  1.00 84.15  ? 663 GLU C CD  1 
ATOM   6135  O OE1 . GLU C 1 163 ? -11.561 67.680  56.929  1.00 81.98  ? 663 GLU C OE1 1 
ATOM   6136  O OE2 . GLU C 1 163 ? -13.644 67.576  57.603  1.00 89.85  ? 663 GLU C OE2 1 
ATOM   6137  N N   . LYS C 1 164 ? -12.661 63.831  53.655  1.00 44.66  ? 664 LYS C N   1 
ATOM   6138  C CA  . LYS C 1 164 ? -13.539 62.670  53.649  1.00 52.00  ? 664 LYS C CA  1 
ATOM   6139  C C   . LYS C 1 164 ? -12.972 61.557  54.538  1.00 54.78  ? 664 LYS C C   1 
ATOM   6140  O O   . LYS C 1 164 ? -13.704 60.906  55.290  1.00 49.52  ? 664 LYS C O   1 
ATOM   6141  C CB  . LYS C 1 164 ? -13.766 62.157  52.225  1.00 56.60  ? 664 LYS C CB  1 
ATOM   6142  C CG  . LYS C 1 164 ? -14.429 63.152  51.292  1.00 64.97  ? 664 LYS C CG  1 
ATOM   6143  C CD  . LYS C 1 164 ? -14.630 62.558  49.903  1.00 75.92  ? 664 LYS C CD  1 
ATOM   6144  C CE  . LYS C 1 164 ? -15.219 63.583  48.933  1.00 87.58  ? 664 LYS C CE  1 
ATOM   6145  N NZ  . LYS C 1 164 ? -15.465 63.003  47.578  1.00 91.22  ? 664 LYS C NZ  1 
ATOM   6146  N N   . THR C 1 165 ? -11.664 61.340  54.459  1.00 51.75  ? 665 THR C N   1 
ATOM   6147  C CA  . THR C 1 165 ? -11.044 60.287  55.260  1.00 46.14  ? 665 THR C CA  1 
ATOM   6148  C C   . THR C 1 165 ? -11.139 60.567  56.763  1.00 40.16  ? 665 THR C C   1 
ATOM   6149  O O   . THR C 1 165 ? -11.507 59.682  57.534  1.00 28.14  ? 665 THR C O   1 
ATOM   6150  C CB  . THR C 1 165 ? -9.581  60.055  54.874  1.00 38.03  ? 665 THR C CB  1 
ATOM   6151  O OG1 . THR C 1 165 ? -9.508  59.763  53.470  1.00 36.69  ? 665 THR C OG1 1 
ATOM   6152  C CG2 . THR C 1 165 ? -9.000  58.884  55.689  1.00 25.04  ? 665 THR C CG2 1 
ATOM   6153  N N   . TRP C 1 166 ? -10.818 61.797  57.166  1.00 35.89  ? 666 TRP C N   1 
ATOM   6154  C CA  . TRP C 1 166 ? -10.866 62.180  58.576  1.00 41.29  ? 666 TRP C CA  1 
ATOM   6155  C C   . TRP C 1 166 ? -12.284 62.136  59.131  1.00 46.42  ? 666 TRP C C   1 
ATOM   6156  O O   . TRP C 1 166 ? -12.509 61.719  60.265  1.00 51.05  ? 666 TRP C O   1 
ATOM   6157  C CB  . TRP C 1 166 ? -10.244 63.567  58.794  1.00 37.60  ? 666 TRP C CB  1 
ATOM   6158  C CG  . TRP C 1 166 ? -8.746  63.563  58.698  1.00 35.79  ? 666 TRP C CG  1 
ATOM   6159  C CD1 . TRP C 1 166 ? -7.994  63.875  57.604  1.00 41.51  ? 666 TRP C CD1 1 
ATOM   6160  C CD2 . TRP C 1 166 ? -7.822  63.214  59.730  1.00 33.64  ? 666 TRP C CD2 1 
ATOM   6161  N NE1 . TRP C 1 166 ? -6.657  63.754  57.894  1.00 42.17  ? 666 TRP C NE1 1 
ATOM   6162  C CE2 . TRP C 1 166 ? -6.527  63.347  59.193  1.00 42.21  ? 666 TRP C CE2 1 
ATOM   6163  C CE3 . TRP C 1 166 ? -7.962  62.804  61.054  1.00 27.00  ? 666 TRP C CE3 1 
ATOM   6164  C CZ2 . TRP C 1 166 ? -5.384  63.085  59.937  1.00 46.32  ? 666 TRP C CZ2 1 
ATOM   6165  C CZ3 . TRP C 1 166 ? -6.826  62.547  61.791  1.00 27.90  ? 666 TRP C CZ3 1 
ATOM   6166  C CH2 . TRP C 1 166 ? -5.555  62.688  61.234  1.00 41.52  ? 666 TRP C CH2 1 
ATOM   6167  N N   . THR C 1 167 ? -13.239 62.576  58.326  1.00 46.21  ? 667 THR C N   1 
ATOM   6168  C CA  . THR C 1 167 ? -14.637 62.518  58.711  1.00 46.10  ? 667 THR C CA  1 
ATOM   6169  C C   . THR C 1 167 ? -15.079 61.064  58.898  1.00 43.36  ? 667 THR C C   1 
ATOM   6170  O O   . THR C 1 167 ? -15.785 60.737  59.857  1.00 37.44  ? 667 THR C O   1 
ATOM   6171  C CB  . THR C 1 167 ? -15.510 63.221  57.671  1.00 38.68  ? 667 THR C CB  1 
ATOM   6172  O OG1 . THR C 1 167 ? -15.194 64.619  57.672  1.00 51.32  ? 667 THR C OG1 1 
ATOM   6173  C CG2 . THR C 1 167 ? -16.961 63.050  58.012  1.00 32.99  ? 667 THR C CG2 1 
ATOM   6174  N N   . ALA C 1 168 ? -14.649 60.195  57.985  1.00 37.83  ? 668 ALA C N   1 
ATOM   6175  C CA  . ALA C 1 168 ? -14.850 58.757  58.153  1.00 43.25  ? 668 ALA C CA  1 
ATOM   6176  C C   . ALA C 1 168 ? -14.263 58.279  59.481  1.00 42.45  ? 668 ALA C C   1 
ATOM   6177  O O   . ALA C 1 168 ? -14.897 57.509  60.202  1.00 42.25  ? 668 ALA C O   1 
ATOM   6178  C CB  . ALA C 1 168 ? -14.238 57.983  56.991  1.00 31.54  ? 668 ALA C CB  1 
ATOM   6179  N N   . LEU C 1 169 ? -13.056 58.749  59.797  1.00 32.01  ? 669 LEU C N   1 
ATOM   6180  C CA  . LEU C 1 169 ? -12.386 58.404  61.054  1.00 34.19  ? 669 LEU C CA  1 
ATOM   6181  C C   . LEU C 1 169 ? -13.165 58.861  62.288  1.00 27.27  ? 669 LEU C C   1 
ATOM   6182  O O   . LEU C 1 169 ? -13.320 58.103  63.238  1.00 26.16  ? 669 LEU C O   1 
ATOM   6183  C CB  . LEU C 1 169 ? -10.954 58.967  61.100  1.00 22.84  ? 669 LEU C CB  1 
ATOM   6184  C CG  . LEU C 1 169 ? -10.200 58.747  62.421  1.00 30.90  ? 669 LEU C CG  1 
ATOM   6185  C CD1 . LEU C 1 169 ? -9.634  57.337  62.483  1.00 34.06  ? 669 LEU C CD1 1 
ATOM   6186  C CD2 . LEU C 1 169 ? -9.077  59.783  62.629  1.00 23.97  ? 669 LEU C CD2 1 
ATOM   6187  N N   . ARG C 1 170 ? -13.637 60.105  62.274  1.00 33.49  ? 670 ARG C N   1 
ATOM   6188  C CA  . ARG C 1 170 ? -14.412 60.656  63.386  1.00 34.70  ? 670 ARG C CA  1 
ATOM   6189  C C   . ARG C 1 170 ? -15.703 59.873  63.651  1.00 37.54  ? 670 ARG C C   1 
ATOM   6190  O O   . ARG C 1 170 ? -16.198 59.841  64.773  1.00 39.60  ? 670 ARG C O   1 
ATOM   6191  C CB  . ARG C 1 170 ? -14.752 62.124  63.121  1.00 42.83  ? 670 ARG C CB  1 
ATOM   6192  C CG  . ARG C 1 170 ? -13.550 63.043  63.058  1.00 42.61  ? 670 ARG C CG  1 
ATOM   6193  C CD  . ARG C 1 170 ? -13.922 64.525  62.914  1.00 41.99  ? 670 ARG C CD  1 
ATOM   6194  N NE  . ARG C 1 170 ? -12.691 65.289  62.708  1.00 59.12  ? 670 ARG C NE  1 
ATOM   6195  C CZ  . ARG C 1 170 ? -12.228 65.679  61.520  1.00 66.93  ? 670 ARG C CZ  1 
ATOM   6196  N NH1 . ARG C 1 170 ? -12.920 65.417  60.414  1.00 74.30  ? 670 ARG C NH1 1 
ATOM   6197  N NH2 . ARG C 1 170 ? -11.080 66.350  61.437  1.00 56.70  ? 670 ARG C NH2 1 
ATOM   6198  N N   . HIS C 1 171 ? -16.235 59.222  62.625  1.00 33.61  ? 671 HIS C N   1 
ATOM   6199  C CA  . HIS C 1 171 ? -17.517 58.538  62.758  1.00 50.24  ? 671 HIS C CA  1 
ATOM   6200  C C   . HIS C 1 171 ? -17.468 57.007  62.956  1.00 47.47  ? 671 HIS C C   1 
ATOM   6201  O O   . HIS C 1 171 ? -18.410 56.432  63.503  1.00 47.07  ? 671 HIS C O   1 
ATOM   6202  C CB  . HIS C 1 171 ? -18.415 58.930  61.586  1.00 62.83  ? 671 HIS C CB  1 
ATOM   6203  C CG  . HIS C 1 171 ? -18.598 60.414  61.456  1.00 74.99  ? 671 HIS C CG  1 
ATOM   6204  N ND1 . HIS C 1 171 ? -18.466 61.085  60.258  1.00 75.97  ? 671 HIS C ND1 1 
ATOM   6205  C CD2 . HIS C 1 171 ? -18.889 61.358  62.383  1.00 72.43  ? 671 HIS C CD2 1 
ATOM   6206  C CE1 . HIS C 1 171 ? -18.671 62.375  60.453  1.00 73.05  ? 671 HIS C CE1 1 
ATOM   6207  N NE2 . HIS C 1 171 ? -18.930 62.567  61.733  1.00 72.90  ? 671 HIS C NE2 1 
ATOM   6208  N N   . GLN C 1 172 ? -16.379 56.365  62.526  1.00 37.18  ? 672 GLN C N   1 
ATOM   6209  C CA  . GLN C 1 172 ? -16.203 54.914  62.689  1.00 41.42  ? 672 GLN C CA  1 
ATOM   6210  C C   . GLN C 1 172 ? -15.292 54.577  63.864  1.00 48.30  ? 672 GLN C C   1 
ATOM   6211  O O   . GLN C 1 172 ? -15.474 53.550  64.524  1.00 46.54  ? 672 GLN C O   1 
ATOM   6212  C CB  . GLN C 1 172 ? -15.616 54.270  61.431  1.00 38.61  ? 672 GLN C CB  1 
ATOM   6213  C CG  . GLN C 1 172 ? -16.407 54.498  60.157  1.00 55.27  ? 672 GLN C CG  1 
ATOM   6214  C CD  . GLN C 1 172 ? -15.755 53.854  58.942  1.00 68.41  ? 672 GLN C CD  1 
ATOM   6215  O OE1 . GLN C 1 172 ? -15.065 52.836  59.052  1.00 74.83  ? 672 GLN C OE1 1 
ATOM   6216  N NE2 . GLN C 1 172 ? -15.968 54.449  57.777  1.00 71.50  ? 672 GLN C NE2 1 
ATOM   6217  N N   . TYR C 1 173 ? -14.295 55.428  64.107  1.00 45.77  ? 673 TYR C N   1 
ATOM   6218  C CA  . TYR C 1 173 ? -13.345 55.196  65.193  1.00 42.27  ? 673 TYR C CA  1 
ATOM   6219  C C   . TYR C 1 173 ? -13.262 56.449  66.051  1.00 42.31  ? 673 TYR C C   1 
ATOM   6220  O O   . TYR C 1 173 ? -12.193 57.039  66.221  1.00 45.05  ? 673 TYR C O   1 
ATOM   6221  C CB  . TYR C 1 173 ? -11.964 54.805  64.648  1.00 30.06  ? 673 TYR C CB  1 
ATOM   6222  C CG  . TYR C 1 173 ? -12.025 53.791  63.527  1.00 33.62  ? 673 TYR C CG  1 
ATOM   6223  C CD1 . TYR C 1 173 ? -12.085 54.197  62.202  1.00 39.32  ? 673 TYR C CD1 1 
ATOM   6224  C CD2 . TYR C 1 173 ? -12.031 52.424  63.794  1.00 36.22  ? 673 TYR C CD2 1 
ATOM   6225  C CE1 . TYR C 1 173 ? -12.155 53.269  61.169  1.00 45.94  ? 673 TYR C CE1 1 
ATOM   6226  C CE2 . TYR C 1 173 ? -12.093 51.489  62.772  1.00 42.39  ? 673 TYR C CE2 1 
ATOM   6227  C CZ  . TYR C 1 173 ? -12.155 51.917  61.460  1.00 48.82  ? 673 TYR C CZ  1 
ATOM   6228  O OH  . TYR C 1 173 ? -12.220 50.996  60.437  1.00 53.53  ? 673 TYR C OH  1 
ATOM   6229  N N   . THR C 1 174 ? -14.407 56.844  66.594  1.00 45.01  ? 674 THR C N   1 
ATOM   6230  C CA  . THR C 1 174 ? -14.516 58.076  67.374  1.00 35.06  ? 674 THR C CA  1 
ATOM   6231  C C   . THR C 1 174 ? -13.519 58.171  68.531  1.00 35.39  ? 674 THR C C   1 
ATOM   6232  O O   . THR C 1 174 ? -12.865 59.208  68.702  1.00 35.95  ? 674 THR C O   1 
ATOM   6233  C CB  . THR C 1 174 ? -15.954 58.308  67.858  1.00 29.42  ? 674 THR C CB  1 
ATOM   6234  O OG1 . THR C 1 174 ? -16.827 58.306  66.717  1.00 34.55  ? 674 THR C OG1 1 
ATOM   6235  C CG2 . THR C 1 174 ? -16.074 59.662  68.582  1.00 21.74  ? 674 THR C CG2 1 
ATOM   6236  N N   . GLN C 1 175 ? -13.380 57.108  69.317  1.00 28.16  ? 675 GLN C N   1 
ATOM   6237  C CA  . GLN C 1 175 ? -12.417 57.155  70.409  1.00 32.55  ? 675 GLN C CA  1 
ATOM   6238  C C   . GLN C 1 175 ? -10.981 57.423  69.903  1.00 30.62  ? 675 GLN C C   1 
ATOM   6239  O O   . GLN C 1 175 ? -10.251 58.231  70.460  1.00 24.49  ? 675 GLN C O   1 
ATOM   6240  C CB  . GLN C 1 175 ? -12.478 55.885  71.262  1.00 42.25  ? 675 GLN C CB  1 
ATOM   6241  C CG  . GLN C 1 175 ? -11.736 56.040  72.573  1.00 48.73  ? 675 GLN C CG  1 
ATOM   6242  C CD  . GLN C 1 175 ? -11.896 57.438  73.140  1.00 69.56  ? 675 GLN C CD  1 
ATOM   6243  O OE1 . GLN C 1 175 ? -10.926 58.060  73.579  1.00 78.36  ? 675 GLN C OE1 1 
ATOM   6244  N NE2 . GLN C 1 175 ? -13.124 57.946  73.121  1.00 74.60  ? 675 GLN C NE2 1 
ATOM   6245  N N   . THR C 1 176 ? -10.577 56.760  68.833  1.00 33.64  ? 676 THR C N   1 
ATOM   6246  C CA  . THR C 1 176 ? -9.233  56.973  68.336  1.00 34.67  ? 676 THR C CA  1 
ATOM   6247  C C   . THR C 1 176 ? -9.064  58.414  67.849  1.00 41.96  ? 676 THR C C   1 
ATOM   6248  O O   . THR C 1 176 ? -8.045  59.054  68.124  1.00 34.83  ? 676 THR C O   1 
ATOM   6249  C CB  . THR C 1 176 ? -8.882  55.976  67.238  1.00 34.54  ? 676 THR C CB  1 
ATOM   6250  O OG1 . THR C 1 176 ? -8.684  54.687  67.833  1.00 38.71  ? 676 THR C OG1 1 
ATOM   6251  C CG2 . THR C 1 176 ? -7.610  56.407  66.511  1.00 32.25  ? 676 THR C CG2 1 
ATOM   6252  N N   . ALA C 1 177 ? -10.072 58.918  67.138  1.00 35.51  ? 677 ALA C N   1 
ATOM   6253  C CA  . ALA C 1 177 ? -10.068 60.292  66.654  1.00 32.77  ? 677 ALA C CA  1 
ATOM   6254  C C   . ALA C 1 177 ? -9.939  61.295  67.801  1.00 33.64  ? 677 ALA C C   1 
ATOM   6255  O O   . ALA C 1 177 ? -9.145  62.239  67.724  1.00 34.63  ? 677 ALA C O   1 
ATOM   6256  C CB  . ALA C 1 177 ? -11.327 60.580  65.838  1.00 23.94  ? 677 ALA C CB  1 
ATOM   6257  N N   . ILE C 1 178 ? -10.712 61.099  68.866  1.00 25.84  ? 678 ILE C N   1 
ATOM   6258  C CA  . ILE C 1 178 ? -10.638 62.010  70.003  1.00 28.69  ? 678 ILE C CA  1 
ATOM   6259  C C   . ILE C 1 178 ? -9.273  61.923  70.709  1.00 32.84  ? 678 ILE C C   1 
ATOM   6260  O O   . ILE C 1 178 ? -8.668  62.930  71.073  1.00 28.65  ? 678 ILE C O   1 
ATOM   6261  C CB  . ILE C 1 178 ? -11.769 61.752  70.988  1.00 32.84  ? 678 ILE C CB  1 
ATOM   6262  C CG1 . ILE C 1 178 ? -13.108 62.122  70.344  1.00 42.39  ? 678 ILE C CG1 1 
ATOM   6263  C CG2 . ILE C 1 178 ? -11.562 62.561  72.251  1.00 23.62  ? 678 ILE C CG2 1 
ATOM   6264  C CD1 . ILE C 1 178 ? -14.313 61.620  71.109  1.00 40.13  ? 678 ILE C CD1 1 
ATOM   6265  N N   . LEU C 1 179 ? -8.794  60.705  70.897  1.00 42.22  ? 679 LEU C N   1 
ATOM   6266  C CA  . LEU C 1 179 ? -7.487  60.490  71.495  1.00 40.65  ? 679 LEU C CA  1 
ATOM   6267  C C   . LEU C 1 179 ? -6.388  61.255  70.733  1.00 36.43  ? 679 LEU C C   1 
ATOM   6268  O O   . LEU C 1 179 ? -5.588  61.979  71.339  1.00 23.54  ? 679 LEU C O   1 
ATOM   6269  C CB  . LEU C 1 179 ? -7.195  58.999  71.518  1.00 49.17  ? 679 LEU C CB  1 
ATOM   6270  C CG  . LEU C 1 179 ? -5.892  58.599  72.176  1.00 66.75  ? 679 LEU C CG  1 
ATOM   6271  C CD1 . LEU C 1 179 ? -6.172  57.856  73.473  1.00 76.11  ? 679 LEU C CD1 1 
ATOM   6272  C CD2 . LEU C 1 179 ? -5.114  57.745  71.203  1.00 69.30  ? 679 LEU C CD2 1 
ATOM   6273  N N   . TYR C 1 180 ? -6.361  61.097  69.408  1.00 30.05  ? 680 TYR C N   1 
ATOM   6274  C CA  . TYR C 1 180 ? -5.418  61.819  68.557  1.00 23.02  ? 680 TYR C CA  1 
ATOM   6275  C C   . TYR C 1 180 ? -5.521  63.318  68.768  1.00 29.19  ? 680 TYR C C   1 
ATOM   6276  O O   . TYR C 1 180 ? -4.514  63.997  68.999  1.00 29.05  ? 680 TYR C O   1 
ATOM   6277  C CB  . TYR C 1 180 ? -5.651  61.510  67.077  1.00 22.24  ? 680 TYR C CB  1 
ATOM   6278  C CG  . TYR C 1 180 ? -4.807  62.362  66.133  1.00 28.80  ? 680 TYR C CG  1 
ATOM   6279  C CD1 . TYR C 1 180 ? -3.424  62.213  66.070  1.00 24.47  ? 680 TYR C CD1 1 
ATOM   6280  C CD2 . TYR C 1 180 ? -5.397  63.315  65.300  1.00 27.68  ? 680 TYR C CD2 1 
ATOM   6281  C CE1 . TYR C 1 180 ? -2.654  62.993  65.204  1.00 25.11  ? 680 TYR C CE1 1 
ATOM   6282  C CE2 . TYR C 1 180 ? -4.631  64.098  64.434  1.00 21.85  ? 680 TYR C CE2 1 
ATOM   6283  C CZ  . TYR C 1 180 ? -3.264  63.931  64.392  1.00 30.68  ? 680 TYR C CZ  1 
ATOM   6284  O OH  . TYR C 1 180 ? -2.506  64.711  63.545  1.00 38.08  ? 680 TYR C OH  1 
ATOM   6285  N N   . GLU C 1 181 ? -6.744  63.829  68.698  1.00 32.14  ? 681 GLU C N   1 
ATOM   6286  C CA  . GLU C 1 181 ? -6.962  65.273  68.725  1.00 36.46  ? 681 GLU C CA  1 
ATOM   6287  C C   . GLU C 1 181 ? -6.751  65.889  70.109  1.00 26.39  ? 681 GLU C C   1 
ATOM   6288  O O   . GLU C 1 181 ? -6.230  66.997  70.229  1.00 28.38  ? 681 GLU C O   1 
ATOM   6289  C CB  . GLU C 1 181 ? -8.355  65.618  68.172  1.00 48.44  ? 681 GLU C CB  1 
ATOM   6290  C CG  . GLU C 1 181 ? -8.631  67.119  68.054  1.00 67.19  ? 681 GLU C CG  1 
ATOM   6291  C CD  . GLU C 1 181 ? -7.814  67.809  66.956  1.00 77.56  ? 681 GLU C CD  1 
ATOM   6292  O OE1 . GLU C 1 181 ? -7.325  67.121  66.029  1.00 78.29  ? 681 GLU C OE1 1 
ATOM   6293  O OE2 . GLU C 1 181 ? -7.667  69.051  67.021  1.00 78.24  ? 681 GLU C OE2 1 
ATOM   6294  N N   . LYS C 1 182 ? -7.139  65.178  71.160  1.00 22.39  ? 682 LYS C N   1 
ATOM   6295  C CA  . LYS C 1 182 ? -7.089  65.768  72.493  1.00 28.97  ? 682 LYS C CA  1 
ATOM   6296  C C   . LYS C 1 182 ? -5.913  65.344  73.368  1.00 34.71  ? 682 LYS C C   1 
ATOM   6297  O O   . LYS C 1 182 ? -5.546  66.059  74.299  1.00 43.95  ? 682 LYS C O   1 
ATOM   6298  C CB  . LYS C 1 182 ? -8.414  65.546  73.219  1.00 43.11  ? 682 LYS C CB  1 
ATOM   6299  C CG  . LYS C 1 182 ? -9.575  66.276  72.566  1.00 45.51  ? 682 LYS C CG  1 
ATOM   6300  C CD  . LYS C 1 182 ? -10.861 66.098  73.363  1.00 63.52  ? 682 LYS C CD  1 
ATOM   6301  C CE  . LYS C 1 182 ? -12.108 66.432  72.520  1.00 67.22  ? 682 LYS C CE  1 
ATOM   6302  N NZ  . LYS C 1 182 ? -13.389 65.905  73.097  1.00 59.42  ? 682 LYS C NZ  1 
ATOM   6303  N N   . GLN C 1 183 ? -5.325  64.190  73.071  1.00 34.84  ? 683 GLN C N   1 
ATOM   6304  C CA  . GLN C 1 183 ? -4.191  63.686  73.835  1.00 35.20  ? 683 GLN C CA  1 
ATOM   6305  C C   . GLN C 1 183 ? -2.895  63.852  73.043  1.00 33.35  ? 683 GLN C C   1 
ATOM   6306  O O   . GLN C 1 183 ? -1.947  64.527  73.470  1.00 31.17  ? 683 GLN C O   1 
ATOM   6307  C CB  . GLN C 1 183 ? -4.376  62.198  74.135  1.00 48.47  ? 683 GLN C CB  1 
ATOM   6308  C CG  . GLN C 1 183 ? -5.689  61.826  74.772  1.00 62.16  ? 683 GLN C CG  1 
ATOM   6309  C CD  . GLN C 1 183 ? -5.821  62.354  76.177  1.00 79.67  ? 683 GLN C CD  1 
ATOM   6310  O OE1 . GLN C 1 183 ? -6.294  61.651  77.070  1.00 86.21  ? 683 GLN C OE1 1 
ATOM   6311  N NE2 . GLN C 1 183 ? -5.409  63.602  76.386  1.00 86.51  ? 683 GLN C NE2 1 
ATOM   6312  N N   . LEU C 1 184 ? -2.876  63.221  71.879  1.00 26.19  ? 684 LEU C N   1 
ATOM   6313  C CA  . LEU C 1 184 ? -1.675  63.105  71.086  1.00 27.45  ? 684 LEU C CA  1 
ATOM   6314  C C   . LEU C 1 184 ? -1.108  64.437  70.596  1.00 37.97  ? 684 LEU C C   1 
ATOM   6315  O O   . LEU C 1 184 ? 0.063   64.731  70.823  1.00 32.31  ? 684 LEU C O   1 
ATOM   6316  C CB  . LEU C 1 184 ? -1.916  62.139  69.935  1.00 15.94  ? 684 LEU C CB  1 
ATOM   6317  C CG  . LEU C 1 184 ? -1.449  60.735  70.320  1.00 26.15  ? 684 LEU C CG  1 
ATOM   6318  C CD1 . LEU C 1 184 ? -1.946  60.348  71.706  1.00 26.94  ? 684 LEU C CD1 1 
ATOM   6319  C CD2 . LEU C 1 184 ? -1.835  59.692  69.261  1.00 20.51  ? 684 LEU C CD2 1 
ATOM   6320  N N   . LYS C 1 185 ? -1.934  65.246  69.941  1.00 43.78  ? 685 LYS C N   1 
ATOM   6321  C CA  . LYS C 1 185 ? -1.457  66.511  69.397  1.00 34.43  ? 685 LYS C CA  1 
ATOM   6322  C C   . LYS C 1 185 ? -0.897  67.456  70.463  1.00 30.34  ? 685 LYS C C   1 
ATOM   6323  O O   . LYS C 1 185 ? 0.203   67.989  70.311  1.00 32.16  ? 685 LYS C O   1 
ATOM   6324  C CB  . LYS C 1 185 ? -2.532  67.181  68.540  1.00 37.16  ? 685 LYS C CB  1 
ATOM   6325  C CG  . LYS C 1 185 ? -2.638  66.547  67.159  1.00 44.77  ? 685 LYS C CG  1 
ATOM   6326  C CD  . LYS C 1 185 ? -3.894  66.960  66.416  1.00 45.46  ? 685 LYS C CD  1 
ATOM   6327  C CE  . LYS C 1 185 ? -3.684  68.229  65.621  1.00 51.49  ? 685 LYS C CE  1 
ATOM   6328  N NZ  . LYS C 1 185 ? -4.809  68.421  64.649  1.00 56.95  ? 685 LYS C NZ  1 
ATOM   6329  N N   . PRO C 1 186 ? -1.639  67.660  71.556  1.00 26.33  ? 686 PRO C N   1 
ATOM   6330  C CA  . PRO C 1 186 ? -1.126  68.566  72.596  1.00 23.23  ? 686 PRO C CA  1 
ATOM   6331  C C   . PRO C 1 186 ? 0.189   68.054  73.188  1.00 26.75  ? 686 PRO C C   1 
ATOM   6332  O O   . PRO C 1 186 ? 1.096   68.852  73.464  1.00 24.21  ? 686 PRO C O   1 
ATOM   6333  C CB  . PRO C 1 186 ? -2.232  68.545  73.656  1.00 20.96  ? 686 PRO C CB  1 
ATOM   6334  C CG  . PRO C 1 186 ? -3.470  68.179  72.891  1.00 22.77  ? 686 PRO C CG  1 
ATOM   6335  C CD  . PRO C 1 186 ? -3.000  67.192  71.846  1.00 24.10  ? 686 PRO C CD  1 
ATOM   6336  N N   . PHE C 1 187 ? 0.286   66.738  73.377  1.00 18.59  ? 687 PHE C N   1 
ATOM   6337  C CA  . PHE C 1 187 ? 1.518   66.119  73.844  1.00 21.16  ? 687 PHE C CA  1 
ATOM   6338  C C   . PHE C 1 187 ? 2.659   66.356  72.842  1.00 29.45  ? 687 PHE C C   1 
ATOM   6339  O O   . PHE C 1 187 ? 3.764   66.730  73.233  1.00 24.82  ? 687 PHE C O   1 
ATOM   6340  C CB  . PHE C 1 187 ? 1.297   64.631  74.091  1.00 21.00  ? 687 PHE C CB  1 
ATOM   6341  C CG  . PHE C 1 187 ? 2.549   63.867  74.430  1.00 19.30  ? 687 PHE C CG  1 
ATOM   6342  C CD1 . PHE C 1 187 ? 3.060   63.873  75.723  1.00 18.96  ? 687 PHE C CD1 1 
ATOM   6343  C CD2 . PHE C 1 187 ? 3.193   63.107  73.467  1.00 18.91  ? 687 PHE C CD2 1 
ATOM   6344  C CE1 . PHE C 1 187 ? 4.205   63.139  76.045  1.00 20.49  ? 687 PHE C CE1 1 
ATOM   6345  C CE2 . PHE C 1 187 ? 4.340   62.370  73.784  1.00 20.57  ? 687 PHE C CE2 1 
ATOM   6346  C CZ  . PHE C 1 187 ? 4.845   62.390  75.078  1.00 13.30  ? 687 PHE C CZ  1 
ATOM   6347  N N   . SER C 1 188 ? 2.371   66.168  71.553  1.00 26.36  ? 688 SER C N   1 
ATOM   6348  C CA  . SER C 1 188 ? 3.332   66.435  70.488  1.00 19.73  ? 688 SER C CA  1 
ATOM   6349  C C   . SER C 1 188 ? 3.852   67.880  70.526  1.00 25.79  ? 688 SER C C   1 
ATOM   6350  O O   . SER C 1 188 ? 5.035   68.137  70.289  1.00 30.13  ? 688 SER C O   1 
ATOM   6351  C CB  . SER C 1 188 ? 2.712   66.128  69.124  1.00 30.87  ? 688 SER C CB  1 
ATOM   6352  O OG  . SER C 1 188 ? 3.617   66.399  68.063  1.00 36.39  ? 688 SER C OG  1 
ATOM   6353  N N   . LYS C 1 189 ? 2.967   68.818  70.830  1.00 24.30  ? 689 LYS C N   1 
ATOM   6354  C CA  . LYS C 1 189 ? 3.356   70.211  70.935  1.00 27.75  ? 689 LYS C CA  1 
ATOM   6355  C C   . LYS C 1 189 ? 4.326   70.426  72.100  1.00 32.08  ? 689 LYS C C   1 
ATOM   6356  O O   . LYS C 1 189 ? 5.375   71.055  71.926  1.00 33.45  ? 689 LYS C O   1 
ATOM   6357  C CB  . LYS C 1 189 ? 2.115   71.108  71.054  1.00 26.41  ? 689 LYS C CB  1 
ATOM   6358  C CG  . LYS C 1 189 ? 2.414   72.603  71.090  1.00 30.08  ? 689 LYS C CG  1 
ATOM   6359  C CD  . LYS C 1 189 ? 1.235   73.428  70.545  1.00 40.71  ? 689 LYS C CD  1 
ATOM   6360  C CE  . LYS C 1 189 ? 0.609   74.310  71.610  1.00 45.24  ? 689 LYS C CE  1 
ATOM   6361  N NZ  . LYS C 1 189 ? 1.642   75.117  72.310  1.00 49.48  ? 689 LYS C NZ  1 
ATOM   6362  N N   . LEU C 1 190 ? 3.982   69.904  73.278  1.00 24.47  ? 690 LEU C N   1 
ATOM   6363  C CA  . LEU C 1 190 ? 4.895   69.930  74.421  1.00 27.42  ? 690 LEU C CA  1 
ATOM   6364  C C   . LEU C 1 190 ? 6.296   69.415  74.078  1.00 31.94  ? 690 LEU C C   1 
ATOM   6365  O O   . LEU C 1 190 ? 7.297   70.028  74.464  1.00 32.56  ? 690 LEU C O   1 
ATOM   6366  C CB  . LEU C 1 190 ? 4.332   69.136  75.593  1.00 23.68  ? 690 LEU C CB  1 
ATOM   6367  C CG  . LEU C 1 190 ? 3.164   69.832  76.285  1.00 26.91  ? 690 LEU C CG  1 
ATOM   6368  C CD1 . LEU C 1 190 ? 2.535   68.910  77.307  1.00 27.83  ? 690 LEU C CD1 1 
ATOM   6369  C CD2 . LEU C 1 190 ? 3.652   71.104  76.942  1.00 24.04  ? 690 LEU C CD2 1 
ATOM   6370  N N   . LEU C 1 191 ? 6.373   68.298  73.358  1.00 19.60  ? 691 LEU C N   1 
ATOM   6371  C CA  . LEU C 1 191 ? 7.677   67.768  72.991  1.00 21.95  ? 691 LEU C CA  1 
ATOM   6372  C C   . LEU C 1 191 ? 8.418   68.752  72.099  1.00 27.00  ? 691 LEU C C   1 
ATOM   6373  O O   . LEU C 1 191 ? 9.629   68.917  72.216  1.00 17.81  ? 691 LEU C O   1 
ATOM   6374  C CB  . LEU C 1 191 ? 7.559   66.445  72.244  1.00 16.08  ? 691 LEU C CB  1 
ATOM   6375  C CG  . LEU C 1 191 ? 6.879   65.272  72.930  1.00 20.43  ? 691 LEU C CG  1 
ATOM   6376  C CD1 . LEU C 1 191 ? 7.060   64.045  72.060  1.00 12.91  ? 691 LEU C CD1 1 
ATOM   6377  C CD2 . LEU C 1 191 ? 7.462   65.072  74.309  1.00 17.08  ? 691 LEU C CD2 1 
ATOM   6378  N N   . HIS C 1 192 ? 7.699   69.370  71.169  1.00 25.26  ? 692 HIS C N   1 
ATOM   6379  C CA  . HIS C 1 192 ? 8.344   70.265  70.215  1.00 29.66  ? 692 HIS C CA  1 
ATOM   6380  C C   . HIS C 1 192 ? 8.856   71.521  70.939  1.00 30.32  ? 692 HIS C C   1 
ATOM   6381  O O   . HIS C 1 192 ? 9.807   72.157  70.500  1.00 34.17  ? 692 HIS C O   1 
ATOM   6382  C CB  . HIS C 1 192 ? 7.416   70.609  69.036  1.00 37.79  ? 692 HIS C CB  1 
ATOM   6383  C CG  . HIS C 1 192 ? 8.077   71.409  67.953  1.00 53.04  ? 692 HIS C CG  1 
ATOM   6384  N ND1 . HIS C 1 192 ? 9.063   70.889  67.138  1.00 56.14  ? 692 HIS C ND1 1 
ATOM   6385  C CD2 . HIS C 1 192 ? 7.900   72.694  67.554  1.00 51.58  ? 692 HIS C CD2 1 
ATOM   6386  C CE1 . HIS C 1 192 ? 9.466   71.819  66.289  1.00 57.20  ? 692 HIS C CE1 1 
ATOM   6387  N NE2 . HIS C 1 192 ? 8.775   72.923  66.518  1.00 56.29  ? 692 HIS C NE2 1 
ATOM   6388  N N   . GLU C 1 193 ? 8.244   71.854  72.070  1.00 13.97  ? 693 GLU C N   1 
ATOM   6389  C CA  . GLU C 1 193 ? 8.717   72.974  72.863  1.00 14.63  ? 693 GLU C CA  1 
ATOM   6390  C C   . GLU C 1 193 ? 9.851   72.564  73.792  1.00 26.35  ? 693 GLU C C   1 
ATOM   6391  O O   . GLU C 1 193 ? 10.274  73.358  74.638  1.00 24.80  ? 693 GLU C O   1 
ATOM   6392  C CB  . GLU C 1 193 ? 7.570   73.563  73.669  1.00 14.60  ? 693 GLU C CB  1 
ATOM   6393  C CG  . GLU C 1 193 ? 6.458   74.109  72.770  1.00 33.00  ? 693 GLU C CG  1 
ATOM   6394  C CD  . GLU C 1 193 ? 5.149   74.341  73.514  1.00 47.21  ? 693 GLU C CD  1 
ATOM   6395  O OE1 . GLU C 1 193 ? 5.101   74.151  74.755  1.00 49.75  ? 693 GLU C OE1 1 
ATOM   6396  O OE2 . GLU C 1 193 ? 4.164   74.713  72.848  1.00 52.68  ? 693 GLU C OE2 1 
ATOM   6397  N N   . GLY C 1 194 ? 10.326  71.323  73.641  1.00 16.15  ? 694 GLY C N   1 
ATOM   6398  C CA  . GLY C 1 194 ? 11.429  70.813  74.434  1.00 11.85  ? 694 GLY C CA  1 
ATOM   6399  C C   . GLY C 1 194 ? 11.112  70.547  75.902  1.00 22.69  ? 694 GLY C C   1 
ATOM   6400  O O   . GLY C 1 194 ? 11.985  70.709  76.774  1.00 17.08  ? 694 GLY C O   1 
ATOM   6401  N N   . ARG C 1 195 ? 9.881   70.121  76.178  1.00 13.20  ? 695 ARG C N   1 
ATOM   6402  C CA  . ARG C 1 195 ? 9.483   69.747  77.537  1.00 19.18  ? 695 ARG C CA  1 
ATOM   6403  C C   . ARG C 1 195 ? 9.386   68.227  77.758  1.00 23.20  ? 695 ARG C C   1 
ATOM   6404  O O   . ARG C 1 195 ? 8.699   67.788  78.684  1.00 20.73  ? 695 ARG C O   1 
ATOM   6405  C CB  . ARG C 1 195 ? 8.115   70.360  77.910  1.00 23.67  ? 695 ARG C CB  1 
ATOM   6406  C CG  . ARG C 1 195 ? 7.755   71.659  77.213  1.00 44.82  ? 695 ARG C CG  1 
ATOM   6407  C CD  . ARG C 1 195 ? 8.380   72.864  77.892  1.00 61.68  ? 695 ARG C CD  1 
ATOM   6408  N NE  . ARG C 1 195 ? 8.159   72.825  79.331  1.00 76.86  ? 695 ARG C NE  1 
ATOM   6409  C CZ  . ARG C 1 195 ? 6.998   73.102  79.914  1.00 90.54  ? 695 ARG C CZ  1 
ATOM   6410  N NH1 . ARG C 1 195 ? 5.945   73.445  79.177  1.00 88.37  ? 695 ARG C NH1 1 
ATOM   6411  N NH2 . ARG C 1 195 ? 6.889   73.030  81.236  1.00 96.56  ? 695 ARG C NH2 1 
ATOM   6412  N N   . GLU C 1 196 ? 10.040  67.419  76.927  1.00 23.88  ? 696 GLU C N   1 
ATOM   6413  C CA  . GLU C 1 196 ? 9.875   65.966  77.048  1.00 31.08  ? 696 GLU C CA  1 
ATOM   6414  C C   . GLU C 1 196 ? 10.232  65.421  78.447  1.00 32.82  ? 696 GLU C C   1 
ATOM   6415  O O   . GLU C 1 196 ? 9.690   64.415  78.902  1.00 31.60  ? 696 GLU C O   1 
ATOM   6416  C CB  . GLU C 1 196 ? 10.638  65.209  75.947  1.00 34.51  ? 696 GLU C CB  1 
ATOM   6417  C CG  . GLU C 1 196 ? 12.153  65.208  76.074  1.00 39.03  ? 696 GLU C CG  1 
ATOM   6418  C CD  . GLU C 1 196 ? 12.843  64.648  74.824  1.00 46.45  ? 696 GLU C CD  1 
ATOM   6419  O OE1 . GLU C 1 196 ? 12.944  63.406  74.686  1.00 46.23  ? 696 GLU C OE1 1 
ATOM   6420  O OE2 . GLU C 1 196 ? 13.283  65.454  73.976  1.00 39.64  ? 696 GLU C OE2 1 
ATOM   6421  N N   . SER C 1 197 ? 11.127  66.107  79.140  1.00 27.98  ? 697 SER C N   1 
ATOM   6422  C CA  . SER C 1 197 ? 11.624  65.612  80.407  1.00 27.49  ? 697 SER C CA  1 
ATOM   6423  C C   . SER C 1 197 ? 10.668  65.868  81.575  1.00 27.56  ? 697 SER C C   1 
ATOM   6424  O O   . SER C 1 197 ? 10.848  65.294  82.638  1.00 33.29  ? 697 SER C O   1 
ATOM   6425  C CB  . SER C 1 197 ? 13.008  66.207  80.697  1.00 30.49  ? 697 SER C CB  1 
ATOM   6426  O OG  . SER C 1 197 ? 12.929  67.621  80.783  1.00 30.46  ? 697 SER C OG  1 
ATOM   6427  N N   . THR C 1 198 ? 9.661   66.719  81.394  1.00 28.29  ? 698 THR C N   1 
ATOM   6428  C CA  . THR C 1 198 ? 8.680   66.952  82.470  1.00 29.11  ? 698 THR C CA  1 
ATOM   6429  C C   . THR C 1 198 ? 7.265   66.498  82.114  1.00 28.10  ? 698 THR C C   1 
ATOM   6430  O O   . THR C 1 198 ? 6.299   66.857  82.778  1.00 37.06  ? 698 THR C O   1 
ATOM   6431  C CB  . THR C 1 198 ? 8.653   68.429  82.991  1.00 32.92  ? 698 THR C CB  1 
ATOM   6432  O OG1 . THR C 1 198 ? 8.197   69.319  81.961  1.00 33.32  ? 698 THR C OG1 1 
ATOM   6433  C CG2 . THR C 1 198 ? 10.030  68.852  83.472  1.00 33.89  ? 698 THR C CG2 1 
ATOM   6434  N N   . CYS C 1 199 ? 7.137   65.707  81.060  1.00 29.12  ? 699 CYS C N   1 
ATOM   6435  C CA  . CYS C 1 199 ? 5.860   65.068  80.787  1.00 28.66  ? 699 CYS C CA  1 
ATOM   6436  C C   . CYS C 1 199 ? 6.068   63.634  80.289  1.00 28.50  ? 699 CYS C C   1 
ATOM   6437  O O   . CYS C 1 199 ? 5.717   63.282  79.152  1.00 30.65  ? 699 CYS C O   1 
ATOM   6438  C CB  . CYS C 1 199 ? 5.046   65.902  79.800  1.00 38.32  ? 699 CYS C CB  1 
ATOM   6439  S SG  . CYS C 1 199 ? 5.840   66.124  78.212  1.00 41.19  ? 699 CYS C SG  1 
ATOM   6440  N N   . VAL C 1 200 ? 6.635   62.794  81.147  1.00 25.54  ? 700 VAL C N   1 
ATOM   6441  C CA  . VAL C 1 200 ? 6.997   61.461  80.703  1.00 28.86  ? 700 VAL C CA  1 
ATOM   6442  C C   . VAL C 1 200 ? 5.767   60.560  80.681  1.00 22.30  ? 700 VAL C C   1 
ATOM   6443  O O   . VAL C 1 200 ? 4.937   60.615  81.582  1.00 21.51  ? 700 VAL C O   1 
ATOM   6444  C CB  . VAL C 1 200 ? 8.181   60.861  81.515  1.00 34.58  ? 700 VAL C CB  1 
ATOM   6445  C CG1 . VAL C 1 200 ? 9.101   61.984  82.035  1.00 26.95  ? 700 VAL C CG1 1 
ATOM   6446  C CG2 . VAL C 1 200 ? 7.684   59.990  82.622  1.00 26.66  ? 700 VAL C CG2 1 
ATOM   6447  N N   . PRO C 1 201 ? 5.628   59.753  79.616  1.00 23.21  ? 701 PRO C N   1 
ATOM   6448  C CA  . PRO C 1 201 ? 4.454   58.884  79.483  1.00 21.69  ? 701 PRO C CA  1 
ATOM   6449  C C   . PRO C 1 201 ? 4.494   57.763  80.532  1.00 24.93  ? 701 PRO C C   1 
ATOM   6450  O O   . PRO C 1 201 ? 5.477   57.648  81.259  1.00 25.31  ? 701 PRO C O   1 
ATOM   6451  C CB  . PRO C 1 201 ? 4.579   58.331  78.057  1.00 23.74  ? 701 PRO C CB  1 
ATOM   6452  C CG  . PRO C 1 201 ? 5.713   59.127  77.399  1.00 25.48  ? 701 PRO C CG  1 
ATOM   6453  C CD  . PRO C 1 201 ? 6.594   59.544  78.527  1.00 18.52  ? 701 PRO C CD  1 
ATOM   6454  N N   . PRO C 1 202 ? 3.431   56.953  80.618  1.00 26.18  ? 702 PRO C N   1 
ATOM   6455  C CA  . PRO C 1 202 ? 3.308   56.004  81.735  1.00 32.67  ? 702 PRO C CA  1 
ATOM   6456  C C   . PRO C 1 202 ? 4.330   54.855  81.781  1.00 32.27  ? 702 PRO C C   1 
ATOM   6457  O O   . PRO C 1 202 ? 4.407   54.214  82.822  1.00 31.56  ? 702 PRO C O   1 
ATOM   6458  C CB  . PRO C 1 202 ? 1.866   55.468  81.607  1.00 30.92  ? 702 PRO C CB  1 
ATOM   6459  C CG  . PRO C 1 202 ? 1.399   55.852  80.251  1.00 20.91  ? 702 PRO C CG  1 
ATOM   6460  C CD  . PRO C 1 202 ? 2.212   57.026  79.794  1.00 25.42  ? 702 PRO C CD  1 
ATOM   6461  N N   . ASN C 1 203 ? 5.085   54.602  80.711  1.00 26.77  ? 703 ASN C N   1 
ATOM   6462  C CA  . ASN C 1 203 ? 6.131   53.565  80.744  1.00 28.84  ? 703 ASN C CA  1 
ATOM   6463  C C   . ASN C 1 203 ? 7.542   54.159  80.708  1.00 27.16  ? 703 ASN C C   1 
ATOM   6464  O O   . ASN C 1 203 ? 8.505   53.458  80.394  1.00 28.38  ? 703 ASN C O   1 
ATOM   6465  C CB  . ASN C 1 203 ? 5.959   52.539  79.599  1.00 22.76  ? 703 ASN C CB  1 
ATOM   6466  C CG  . ASN C 1 203 ? 6.144   51.078  80.070  1.00 25.93  ? 703 ASN C CG  1 
ATOM   6467  O OD1 . ASN C 1 203 ? 6.237   50.797  81.270  1.00 23.87  ? 703 ASN C OD1 1 
ATOM   6468  N ND2 . ASN C 1 203 ? 6.181   50.152  79.119  1.00 18.01  ? 703 ASN C ND2 1 
ATOM   6469  N N   . ASN C 1 204 ? 7.646   55.448  81.042  1.00 21.35  ? 704 ASN C N   1 
ATOM   6470  C CA  . ASN C 1 204 ? 8.868   56.239  80.865  1.00 13.67  ? 704 ASN C CA  1 
ATOM   6471  C C   . ASN C 1 204 ? 9.349   56.304  79.435  1.00 17.44  ? 704 ASN C C   1 
ATOM   6472  O O   . ASN C 1 204 ? 8.628   55.943  78.496  1.00 14.93  ? 704 ASN C O   1 
ATOM   6473  C CB  . ASN C 1 204 ? 10.008  55.764  81.765  1.00 19.90  ? 704 ASN C CB  1 
ATOM   6474  C CG  . ASN C 1 204 ? 9.584   55.633  83.205  1.00 41.86  ? 704 ASN C CG  1 
ATOM   6475  O OD1 . ASN C 1 204 ? 8.525   56.118  83.595  1.00 32.61  ? 704 ASN C OD1 1 
ATOM   6476  N ND2 . ASN C 1 204 ? 10.405  54.966  84.008  1.00 59.21  ? 704 ASN C ND2 1 
ATOM   6477  N N   . VAL C 1 205 ? 10.585  56.767  79.283  1.00 19.38  ? 705 VAL C N   1 
ATOM   6478  C CA  . VAL C 1 205 ? 11.146  57.041  77.979  1.00 19.42  ? 705 VAL C CA  1 
ATOM   6479  C C   . VAL C 1 205 ? 12.298  56.091  77.680  1.00 24.35  ? 705 VAL C C   1 
ATOM   6480  O O   . VAL C 1 205 ? 13.167  55.884  78.519  1.00 23.78  ? 705 VAL C O   1 
ATOM   6481  C CB  . VAL C 1 205 ? 11.619  58.501  77.871  1.00 21.81  ? 705 VAL C CB  1 
ATOM   6482  C CG1 . VAL C 1 205 ? 12.137  58.780  76.454  1.00 8.71   ? 705 VAL C CG1 1 
ATOM   6483  C CG2 . VAL C 1 205 ? 10.470  59.448  78.235  1.00 22.08  ? 705 VAL C CG2 1 
ATOM   6484  N N   . SER C 1 206 ? 12.277  55.508  76.483  1.00 21.03  ? 706 SER C N   1 
ATOM   6485  C CA  . SER C 1 206 ? 13.333  54.616  76.018  1.00 20.79  ? 706 SER C CA  1 
ATOM   6486  C C   . SER C 1 206 ? 14.148  55.290  74.909  1.00 23.09  ? 706 SER C C   1 
ATOM   6487  O O   . SER C 1 206 ? 15.356  55.091  74.827  1.00 22.95  ? 706 SER C O   1 
ATOM   6488  C CB  . SER C 1 206 ? 12.750  53.285  75.524  1.00 17.43  ? 706 SER C CB  1 
ATOM   6489  O OG  . SER C 1 206 ? 11.769  52.810  76.417  1.00 24.89  ? 706 SER C OG  1 
ATOM   6490  N N   . VAL C 1 207 ? 13.478  56.076  74.061  1.00 21.15  ? 707 VAL C N   1 
ATOM   6491  C CA  . VAL C 1 207 ? 14.147  56.886  73.043  1.00 19.68  ? 707 VAL C CA  1 
ATOM   6492  C C   . VAL C 1 207 ? 13.638  58.306  73.169  1.00 21.68  ? 707 VAL C C   1 
ATOM   6493  O O   . VAL C 1 207 ? 12.440  58.539  73.087  1.00 25.73  ? 707 VAL C O   1 
ATOM   6494  C CB  . VAL C 1 207 ? 13.836  56.420  71.598  1.00 19.84  ? 707 VAL C CB  1 
ATOM   6495  C CG1 . VAL C 1 207 ? 14.734  57.134  70.593  1.00 16.70  ? 707 VAL C CG1 1 
ATOM   6496  C CG2 . VAL C 1 207 ? 13.996  54.929  71.455  1.00 13.28  ? 707 VAL C CG2 1 
ATOM   6497  N N   . PRO C 1 208 ? 14.545  59.263  73.390  1.00 21.22  ? 708 PRO C N   1 
ATOM   6498  C CA  . PRO C 1 208 ? 14.134  60.671  73.390  1.00 18.11  ? 708 PRO C CA  1 
ATOM   6499  C C   . PRO C 1 208 ? 13.635  61.101  72.021  1.00 22.02  ? 708 PRO C C   1 
ATOM   6500  O O   . PRO C 1 208 ? 13.849  60.404  71.035  1.00 21.59  ? 708 PRO C O   1 
ATOM   6501  C CB  . PRO C 1 208 ? 15.425  61.437  73.751  1.00 19.78  ? 708 PRO C CB  1 
ATOM   6502  C CG  . PRO C 1 208 ? 16.529  60.397  73.800  1.00 23.52  ? 708 PRO C CG  1 
ATOM   6503  C CD  . PRO C 1 208 ? 15.896  59.061  73.934  1.00 17.12  ? 708 PRO C CD  1 
ATOM   6504  N N   . LEU C 1 209 ? 12.979  62.256  71.981  1.00 24.58  ? 709 LEU C N   1 
ATOM   6505  C CA  . LEU C 1 209 ? 12.408  62.818  70.765  1.00 19.02  ? 709 LEU C CA  1 
ATOM   6506  C C   . LEU C 1 209 ? 13.452  63.009  69.674  1.00 20.73  ? 709 LEU C C   1 
ATOM   6507  O O   . LEU C 1 209 ? 13.206  62.686  68.502  1.00 23.84  ? 709 LEU C O   1 
ATOM   6508  C CB  . LEU C 1 209 ? 11.754  64.155  71.080  1.00 20.84  ? 709 LEU C CB  1 
ATOM   6509  C CG  . LEU C 1 209 ? 11.320  64.989  69.878  1.00 29.40  ? 709 LEU C CG  1 
ATOM   6510  C CD1 . LEU C 1 209 ? 10.157  64.332  69.150  1.00 21.46  ? 709 LEU C CD1 1 
ATOM   6511  C CD2 . LEU C 1 209 ? 10.950  66.386  70.340  1.00 31.22  ? 709 LEU C CD2 1 
ATOM   6512  N N   . LEU C 1 210 ? 14.594  63.569  70.074  1.00 13.08  ? 710 LEU C N   1 
ATOM   6513  C CA  . LEU C 1 210 ? 15.803  63.658  69.256  1.00 17.40  ? 710 LEU C CA  1 
ATOM   6514  C C   . LEU C 1 210 ? 15.786  64.628  68.096  1.00 18.13  ? 710 LEU C C   1 
ATOM   6515  O O   . LEU C 1 210 ? 16.757  65.364  67.907  1.00 22.39  ? 710 LEU C O   1 
ATOM   6516  C CB  . LEU C 1 210 ? 16.265  62.281  68.744  1.00 9.26   ? 710 LEU C CB  1 
ATOM   6517  C CG  . LEU C 1 210 ? 16.764  61.266  69.758  1.00 18.59  ? 710 LEU C CG  1 
ATOM   6518  C CD1 . LEU C 1 210 ? 17.225  60.007  69.036  1.00 17.34  ? 710 LEU C CD1 1 
ATOM   6519  C CD2 . LEU C 1 210 ? 17.890  61.855  70.592  1.00 20.12  ? 710 LEU C CD2 1 
ATOM   6520  N N   . MET C 1 211 ? 14.723  64.615  67.299  1.00 18.14  ? 711 MET C N   1 
ATOM   6521  C CA  . MET C 1 211 ? 14.742  65.352  66.024  1.00 28.06  ? 711 MET C CA  1 
ATOM   6522  C C   . MET C 1 211 ? 15.057  66.862  66.110  1.00 31.93  ? 711 MET C C   1 
ATOM   6523  O O   . MET C 1 211 ? 15.923  67.361  65.397  1.00 36.05  ? 711 MET C O   1 
ATOM   6524  C CB  . MET C 1 211 ? 13.468  65.098  65.212  1.00 22.31  ? 711 MET C CB  1 
ATOM   6525  C CG  . MET C 1 211 ? 13.557  63.842  64.381  1.00 32.21  ? 711 MET C CG  1 
ATOM   6526  S SD  . MET C 1 211 ? 14.957  63.874  63.225  1.00 29.98  ? 711 MET C SD  1 
ATOM   6527  C CE  . MET C 1 211 ? 14.303  64.951  61.955  1.00 20.76  ? 711 MET C CE  1 
ATOM   6528  N N   . PRO C 1 212 ? 14.339  67.595  66.961  1.00 23.76  ? 712 PRO C N   1 
ATOM   6529  C CA  . PRO C 1 212 ? 14.615  69.033  67.066  1.00 25.85  ? 712 PRO C CA  1 
ATOM   6530  C C   . PRO C 1 212 ? 16.049  69.326  67.492  1.00 26.24  ? 712 PRO C C   1 
ATOM   6531  O O   . PRO C 1 212 ? 16.699  70.190  66.912  1.00 26.03  ? 712 PRO C O   1 
ATOM   6532  C CB  . PRO C 1 212 ? 13.609  69.500  68.124  1.00 17.82  ? 712 PRO C CB  1 
ATOM   6533  C CG  . PRO C 1 212 ? 12.449  68.571  67.926  1.00 25.69  ? 712 PRO C CG  1 
ATOM   6534  C CD  . PRO C 1 212 ? 13.092  67.219  67.640  1.00 18.41  ? 712 PRO C CD  1 
ATOM   6535  N N   . LEU C 1 213 ? 16.543  68.609  68.493  1.00 26.65  ? 713 LEU C N   1 
ATOM   6536  C CA  . LEU C 1 213 ? 17.931  68.761  68.909  1.00 27.72  ? 713 LEU C CA  1 
ATOM   6537  C C   . LEU C 1 213 ? 18.896  68.519  67.749  1.00 28.39  ? 713 LEU C C   1 
ATOM   6538  O O   . LEU C 1 213 ? 19.808  69.316  67.486  1.00 20.07  ? 713 LEU C O   1 
ATOM   6539  C CB  . LEU C 1 213 ? 18.261  67.786  70.038  1.00 23.25  ? 713 LEU C CB  1 
ATOM   6540  C CG  . LEU C 1 213 ? 19.766  67.647  70.295  1.00 25.95  ? 713 LEU C CG  1 
ATOM   6541  C CD1 . LEU C 1 213 ? 20.323  68.939  70.898  1.00 20.77  ? 713 LEU C CD1 1 
ATOM   6542  C CD2 . LEU C 1 213 ? 20.061  66.467  71.204  1.00 17.80  ? 713 LEU C CD2 1 
ATOM   6543  N N   . VAL C 1 214 ? 18.689  67.403  67.061  1.00 21.57  ? 714 VAL C N   1 
ATOM   6544  C CA  . VAL C 1 214 ? 19.618  66.953  66.039  1.00 21.06  ? 714 VAL C CA  1 
ATOM   6545  C C   . VAL C 1 214 ? 19.613  67.895  64.846  1.00 25.14  ? 714 VAL C C   1 
ATOM   6546  O O   . VAL C 1 214 ? 20.631  68.142  64.209  1.00 27.07  ? 714 VAL C O   1 
ATOM   6547  C CB  . VAL C 1 214 ? 19.308  65.504  65.642  1.00 22.85  ? 714 VAL C CB  1 
ATOM   6548  C CG1 . VAL C 1 214 ? 19.769  65.219  64.253  1.00 38.72  ? 714 VAL C CG1 1 
ATOM   6549  C CG2 . VAL C 1 214 ? 19.977  64.577  66.638  1.00 20.75  ? 714 VAL C CG2 1 
ATOM   6550  N N   . THR C 1 215 ? 18.453  68.460  64.582  1.00 25.82  ? 715 THR C N   1 
ATOM   6551  C CA  . THR C 1 215 ? 18.264  69.289  63.415  1.00 31.84  ? 715 THR C CA  1 
ATOM   6552  C C   . THR C 1 215 ? 18.774  70.701  63.721  1.00 33.46  ? 715 THR C C   1 
ATOM   6553  O O   . THR C 1 215 ? 19.222  71.446  62.841  1.00 32.04  ? 715 THR C O   1 
ATOM   6554  C CB  . THR C 1 215 ? 16.781  69.278  63.041  1.00 32.74  ? 715 THR C CB  1 
ATOM   6555  O OG1 . THR C 1 215 ? 16.632  69.416  61.626  1.00 47.08  ? 715 THR C OG1 1 
ATOM   6556  C CG2 . THR C 1 215 ? 16.048  70.365  63.759  1.00 9.49   ? 715 THR C CG2 1 
ATOM   6557  N N   . LEU C 1 216 ? 18.723  71.049  64.995  1.00 28.41  ? 716 LEU C N   1 
ATOM   6558  C CA  . LEU C 1 216 ? 19.311  72.281  65.469  1.00 21.99  ? 716 LEU C CA  1 
ATOM   6559  C C   . LEU C 1 216 ? 20.844  72.215  65.343  1.00 31.74  ? 716 LEU C C   1 
ATOM   6560  O O   . LEU C 1 216 ? 21.488  73.172  64.927  1.00 31.28  ? 716 LEU C O   1 
ATOM   6561  C CB  . LEU C 1 216 ? 18.880  72.538  66.921  1.00 18.64  ? 716 LEU C CB  1 
ATOM   6562  C CG  . LEU C 1 216 ? 19.348  73.845  67.576  1.00 31.38  ? 716 LEU C CG  1 
ATOM   6563  C CD1 . LEU C 1 216 ? 18.782  75.102  66.873  1.00 27.20  ? 716 LEU C CD1 1 
ATOM   6564  C CD2 . LEU C 1 216 ? 18.974  73.837  69.049  1.00 31.11  ? 716 LEU C CD2 1 
ATOM   6565  N N   . MET C 1 217 ? 21.431  71.077  65.689  1.00 36.04  ? 717 MET C N   1 
ATOM   6566  C CA  . MET C 1 217 ? 22.887  70.948  65.646  1.00 27.34  ? 717 MET C CA  1 
ATOM   6567  C C   . MET C 1 217 ? 23.471  70.876  64.229  1.00 27.12  ? 717 MET C C   1 
ATOM   6568  O O   . MET C 1 217 ? 24.590  71.320  64.001  1.00 32.39  ? 717 MET C O   1 
ATOM   6569  C CB  . MET C 1 217 ? 23.334  69.736  66.444  1.00 19.59  ? 717 MET C CB  1 
ATOM   6570  C CG  . MET C 1 217 ? 22.910  69.737  67.893  1.00 17.00  ? 717 MET C CG  1 
ATOM   6571  S SD  . MET C 1 217 ? 23.675  68.311  68.713  1.00 34.98  ? 717 MET C SD  1 
ATOM   6572  C CE  . MET C 1 217 ? 25.404  68.747  68.494  1.00 22.43  ? 717 MET C CE  1 
ATOM   6573  N N   . GLU C 1 218 ? 22.710  70.319  63.290  1.00 24.56  ? 718 GLU C N   1 
ATOM   6574  C CA  . GLU C 1 218 ? 23.141  70.184  61.896  1.00 22.80  ? 718 GLU C CA  1 
ATOM   6575  C C   . GLU C 1 218 ? 22.488  71.241  61.011  1.00 33.78  ? 718 GLU C C   1 
ATOM   6576  O O   . GLU C 1 218 ? 21.354  71.063  60.538  1.00 33.79  ? 718 GLU C O   1 
ATOM   6577  C CB  . GLU C 1 218 ? 22.789  68.781  61.368  1.00 16.67  ? 718 GLU C CB  1 
ATOM   6578  C CG  . GLU C 1 218 ? 23.376  67.665  62.198  1.00 24.81  ? 718 GLU C CG  1 
ATOM   6579  C CD  . GLU C 1 218 ? 24.875  67.489  61.965  1.00 32.67  ? 718 GLU C CD  1 
ATOM   6580  O OE1 . GLU C 1 218 ? 25.360  67.943  60.906  1.00 35.78  ? 718 GLU C OE1 1 
ATOM   6581  O OE2 . GLU C 1 218 ? 25.565  66.894  62.831  1.00 23.79  ? 718 GLU C OE2 1 
ATOM   6582  N N   . ARG C 1 219 ? 23.203  72.334  60.769  1.00 34.03  ? 719 ARG C N   1 
ATOM   6583  C CA  . ARG C 1 219 ? 22.594  73.480  60.101  1.00 38.16  ? 719 ARG C CA  1 
ATOM   6584  C C   . ARG C 1 219 ? 22.276  73.226  58.625  1.00 34.83  ? 719 ARG C C   1 
ATOM   6585  O O   . ARG C 1 219 ? 21.426  73.896  58.051  1.00 34.29  ? 719 ARG C O   1 
ATOM   6586  C CB  . ARG C 1 219 ? 23.415  74.764  60.324  1.00 47.15  ? 719 ARG C CB  1 
ATOM   6587  C CG  . ARG C 1 219 ? 23.133  75.401  61.702  1.00 51.90  ? 719 ARG C CG  1 
ATOM   6588  C CD  . ARG C 1 219 ? 24.006  76.604  62.008  1.00 46.73  ? 719 ARG C CD  1 
ATOM   6589  N NE  . ARG C 1 219 ? 23.436  77.871  61.555  1.00 49.45  ? 719 ARG C NE  1 
ATOM   6590  C CZ  . ARG C 1 219 ? 23.594  78.363  60.329  1.00 55.38  ? 719 ARG C CZ  1 
ATOM   6591  N NH1 . ARG C 1 219 ? 24.295  77.684  59.419  1.00 45.28  ? 719 ARG C NH1 1 
ATOM   6592  N NH2 . ARG C 1 219 ? 23.044  79.528  60.009  1.00 55.86  ? 719 ARG C NH2 1 
ATOM   6593  N N   . GLN C 1 220 ? 22.931  72.239  58.028  1.00 30.20  ? 720 GLN C N   1 
ATOM   6594  C CA  . GLN C 1 220 ? 22.624  71.837  56.658  1.00 38.24  ? 720 GLN C CA  1 
ATOM   6595  C C   . GLN C 1 220 ? 21.667  70.644  56.558  1.00 41.01  ? 720 GLN C C   1 
ATOM   6596  O O   . GLN C 1 220 ? 21.538  70.045  55.494  1.00 37.16  ? 720 GLN C O   1 
ATOM   6597  C CB  . GLN C 1 220 ? 23.902  71.520  55.879  1.00 46.94  ? 720 GLN C CB  1 
ATOM   6598  C CG  . GLN C 1 220 ? 24.524  72.723  55.199  1.00 58.14  ? 720 GLN C CG  1 
ATOM   6599  C CD  . GLN C 1 220 ? 25.503  73.434  56.085  1.00 68.75  ? 720 GLN C CD  1 
ATOM   6600  O OE1 . GLN C 1 220 ? 26.269  72.797  56.813  1.00 68.21  ? 720 GLN C OE1 1 
ATOM   6601  N NE2 . GLN C 1 220 ? 25.485  74.765  56.041  1.00 75.23  ? 720 GLN C NE2 1 
ATOM   6602  N N   . ALA C 1 221 ? 20.999  70.303  57.655  1.00 39.78  ? 721 ALA C N   1 
ATOM   6603  C CA  . ALA C 1 221 ? 20.049  69.191  57.642  1.00 40.32  ? 721 ALA C CA  1 
ATOM   6604  C C   . ALA C 1 221 ? 18.922  69.408  56.637  1.00 42.53  ? 721 ALA C C   1 
ATOM   6605  O O   . ALA C 1 221 ? 18.305  70.471  56.596  1.00 45.29  ? 721 ALA C O   1 
ATOM   6606  C CB  . ALA C 1 221 ? 19.465  68.971  59.036  1.00 42.02  ? 721 ALA C CB  1 
ATOM   6607  N N   . VAL C 1 222 ? 18.652  68.394  55.829  1.00 43.40  ? 722 VAL C N   1 
ATOM   6608  C CA  . VAL C 1 222 ? 17.483  68.403  54.965  1.00 41.41  ? 722 VAL C CA  1 
ATOM   6609  C C   . VAL C 1 222 ? 16.405  67.497  55.553  1.00 41.44  ? 722 VAL C C   1 
ATOM   6610  O O   . VAL C 1 222 ? 16.687  66.353  55.902  1.00 43.53  ? 722 VAL C O   1 
ATOM   6611  C CB  . VAL C 1 222 ? 17.817  67.868  53.571  1.00 34.48  ? 722 VAL C CB  1 
ATOM   6612  C CG1 . VAL C 1 222 ? 16.623  68.060  52.639  1.00 30.99  ? 722 VAL C CG1 1 
ATOM   6613  C CG2 . VAL C 1 222 ? 19.075  68.533  53.031  1.00 21.71  ? 722 VAL C CG2 1 
ATOM   6614  N N   . THR C 1 223 ? 15.181  68.011  55.661  1.00 33.27  ? 723 THR C N   1 
ATOM   6615  C CA  . THR C 1 223 ? 14.032  67.219  56.085  1.00 35.46  ? 723 THR C CA  1 
ATOM   6616  C C   . THR C 1 223 ? 12.909  67.245  55.038  1.00 39.67  ? 723 THR C C   1 
ATOM   6617  O O   . THR C 1 223 ? 12.827  68.168  54.220  1.00 41.49  ? 723 THR C O   1 
ATOM   6618  C CB  . THR C 1 223 ? 13.458  67.737  57.408  1.00 37.72  ? 723 THR C CB  1 
ATOM   6619  O OG1 . THR C 1 223 ? 12.919  69.050  57.206  1.00 37.12  ? 723 THR C OG1 1 
ATOM   6620  C CG2 . THR C 1 223 ? 14.542  67.782  58.477  1.00 29.66  ? 723 THR C CG2 1 
ATOM   6621  N N   . PHE C 1 224 ? 12.045  66.231  55.065  1.00 34.84  ? 724 PHE C N   1 
ATOM   6622  C CA  . PHE C 1 224 ? 10.882  66.197  54.179  1.00 35.30  ? 724 PHE C CA  1 
ATOM   6623  C C   . PHE C 1 224 ? 9.912   67.332  54.479  1.00 44.82  ? 724 PHE C C   1 
ATOM   6624  O O   . PHE C 1 224 ? 9.615   67.606  55.639  1.00 43.68  ? 724 PHE C O   1 
ATOM   6625  C CB  . PHE C 1 224 ? 10.143  64.874  54.296  1.00 34.12  ? 724 PHE C CB  1 
ATOM   6626  C CG  . PHE C 1 224 ? 8.987   64.757  53.355  1.00 42.11  ? 724 PHE C CG  1 
ATOM   6627  C CD1 . PHE C 1 224 ? 7.689   64.933  53.804  1.00 40.50  ? 724 PHE C CD1 1 
ATOM   6628  C CD2 . PHE C 1 224 ? 9.201   64.494  52.012  1.00 46.53  ? 724 PHE C CD2 1 
ATOM   6629  C CE1 . PHE C 1 224 ? 6.630   64.828  52.935  1.00 47.15  ? 724 PHE C CE1 1 
ATOM   6630  C CE2 . PHE C 1 224 ? 8.142   64.393  51.132  1.00 48.30  ? 724 PHE C CE2 1 
ATOM   6631  C CZ  . PHE C 1 224 ? 6.855   64.559  51.591  1.00 48.18  ? 724 PHE C CZ  1 
ATOM   6632  N N   . GLU C 1 225 ? 9.418   67.979  53.427  1.00 56.57  ? 725 GLU C N   1 
ATOM   6633  C CA  . GLU C 1 225 ? 8.521   69.130  53.567  1.00 66.00  ? 725 GLU C CA  1 
ATOM   6634  C C   . GLU C 1 225 ? 9.011   70.151  54.586  1.00 61.67  ? 725 GLU C C   1 
ATOM   6635  O O   . GLU C 1 225 ? 8.222   70.927  55.122  1.00 53.22  ? 725 GLU C O   1 
ATOM   6636  C CB  . GLU C 1 225 ? 7.103   68.683  53.908  1.00 71.75  ? 725 GLU C CB  1 
ATOM   6637  C CG  . GLU C 1 225 ? 6.431   67.939  52.774  1.00 76.00  ? 725 GLU C CG  1 
ATOM   6638  C CD  . GLU C 1 225 ? 4.991   67.585  53.075  1.00 74.44  ? 725 GLU C CD  1 
ATOM   6639  O OE1 . GLU C 1 225 ? 4.620   67.525  54.269  1.00 70.31  ? 725 GLU C OE1 1 
ATOM   6640  O OE2 . GLU C 1 225 ? 4.230   67.374  52.107  1.00 75.13  ? 725 GLU C OE2 1 
ATOM   6641  N N   . GLY C 1 226 ? 10.315  70.120  54.852  1.00 63.95  ? 726 GLY C N   1 
ATOM   6642  C CA  . GLY C 1 226 ? 11.003  71.165  55.593  1.00 62.57  ? 726 GLY C CA  1 
ATOM   6643  C C   . GLY C 1 226 ? 10.578  71.430  57.026  1.00 56.81  ? 726 GLY C C   1 
ATOM   6644  O O   . GLY C 1 226 ? 10.626  72.571  57.485  1.00 53.77  ? 726 GLY C O   1 
ATOM   6645  N N   . THR C 1 227 ? 10.173  70.382  57.738  1.00 53.10  ? 727 THR C N   1 
ATOM   6646  C CA  . THR C 1 227 ? 9.816   70.496  59.154  1.00 47.19  ? 727 THR C CA  1 
ATOM   6647  C C   . THR C 1 227 ? 11.068  70.580  60.046  1.00 44.31  ? 727 THR C C   1 
ATOM   6648  O O   . THR C 1 227 ? 12.184  70.407  59.561  1.00 43.06  ? 727 THR C O   1 
ATOM   6649  C CB  . THR C 1 227 ? 8.875   69.341  59.583  1.00 47.83  ? 727 THR C CB  1 
ATOM   6650  O OG1 . THR C 1 227 ? 9.478   68.071  59.277  1.00 51.38  ? 727 THR C OG1 1 
ATOM   6651  C CG2 . THR C 1 227 ? 7.532   69.460  58.843  1.00 37.21  ? 727 THR C CG2 1 
ATOM   6652  N N   . ASP C 1 228 ? 10.880  70.853  61.337  1.00 51.81  ? 728 ASP C N   1 
ATOM   6653  C CA  . ASP C 1 228 ? 11.992  71.066  62.279  1.00 52.24  ? 728 ASP C CA  1 
ATOM   6654  C C   . ASP C 1 228 ? 13.040  72.020  61.699  1.00 56.03  ? 728 ASP C C   1 
ATOM   6655  O O   . ASP C 1 228 ? 14.230  71.908  62.002  1.00 50.20  ? 728 ASP C O   1 
ATOM   6656  C CB  . ASP C 1 228 ? 12.675  69.743  62.697  1.00 47.28  ? 728 ASP C CB  1 
ATOM   6657  C CG  . ASP C 1 228 ? 11.721  68.758  63.364  1.00 50.63  ? 728 ASP C CG  1 
ATOM   6658  O OD1 . ASP C 1 228 ? 11.237  69.033  64.484  1.00 49.91  ? 728 ASP C OD1 1 
ATOM   6659  O OD2 . ASP C 1 228 ? 11.468  67.689  62.765  1.00 53.19  ? 728 ASP C OD2 1 
ATOM   6660  N N   . MET C 1 229 ? 12.604  72.947  60.854  1.00 57.96  ? 729 MET C N   1 
ATOM   6661  C CA  . MET C 1 229 ? 13.540  73.885  60.238  1.00 61.01  ? 729 MET C CA  1 
ATOM   6662  C C   . MET C 1 229 ? 13.645  75.208  61.008  1.00 63.34  ? 729 MET C C   1 
ATOM   6663  O O   . MET C 1 229 ? 14.103  76.217  60.470  1.00 67.94  ? 729 MET C O   1 
ATOM   6664  C CB  . MET C 1 229 ? 13.198  74.128  58.763  1.00 56.60  ? 729 MET C CB  1 
ATOM   6665  C CG  . MET C 1 229 ? 13.605  72.991  57.826  1.00 59.40  ? 729 MET C CG  1 
ATOM   6666  S SD  . MET C 1 229 ? 15.378  72.634  57.832  1.00 53.39  ? 729 MET C SD  1 
ATOM   6667  C CE  . MET C 1 229 ? 15.550  71.845  59.436  1.00 65.67  ? 729 MET C CE  1 
ATOM   6668  N N   . TRP C 1 230 ? 13.213  75.196  62.265  1.00 53.23  ? 730 TRP C N   1 
ATOM   6669  C CA  . TRP C 1 230 ? 13.507  76.292  63.177  1.00 44.68  ? 730 TRP C CA  1 
ATOM   6670  C C   . TRP C 1 230 ? 13.293  77.667  62.547  1.00 45.98  ? 730 TRP C C   1 
ATOM   6671  O O   . TRP C 1 230 ? 14.176  78.528  62.576  1.00 51.98  ? 730 TRP C O   1 
ATOM   6672  C CB  . TRP C 1 230 ? 14.947  76.162  63.686  1.00 36.52  ? 730 TRP C CB  1 
ATOM   6673  C CG  . TRP C 1 230 ? 15.169  74.947  64.554  1.00 43.81  ? 730 TRP C CG  1 
ATOM   6674  C CD1 . TRP C 1 230 ? 15.667  73.719  64.164  1.00 33.38  ? 730 TRP C CD1 1 
ATOM   6675  C CD2 . TRP C 1 230 ? 14.902  74.839  65.960  1.00 35.87  ? 730 TRP C CD2 1 
ATOM   6676  N NE1 . TRP C 1 230 ? 15.720  72.868  65.244  1.00 26.02  ? 730 TRP C NE1 1 
ATOM   6677  C CE2 . TRP C 1 230 ? 15.259  73.526  66.356  1.00 32.47  ? 730 TRP C CE2 1 
ATOM   6678  C CE3 . TRP C 1 230 ? 14.398  75.724  66.921  1.00 24.53  ? 730 TRP C CE3 1 
ATOM   6679  C CZ2 . TRP C 1 230 ? 15.128  73.082  67.671  1.00 24.67  ? 730 TRP C CZ2 1 
ATOM   6680  C CZ3 . TRP C 1 230 ? 14.271  75.286  68.228  1.00 30.86  ? 730 TRP C CZ3 1 
ATOM   6681  C CH2 . TRP C 1 230 ? 14.639  73.976  68.593  1.00 31.66  ? 730 TRP C CH2 1 
ATOM   6682  N N   . GLU C 1 231 ? 12.116  77.869  61.974  1.00 52.60  ? 731 GLU C N   1 
ATOM   6683  C CA  . GLU C 1 231 ? 11.765  79.162  61.413  1.00 55.23  ? 731 GLU C CA  1 
ATOM   6684  C C   . GLU C 1 231 ? 10.633  79.757  62.247  1.00 58.12  ? 731 GLU C C   1 
ATOM   6685  O O   . GLU C 1 231 ? 10.129  79.105  63.166  1.00 50.39  ? 731 GLU C O   1 
ATOM   6686  C CB  . GLU C 1 231 ? 11.343  78.987  59.961  1.00 55.42  ? 731 GLU C CB  1 
ATOM   6687  C CG  . GLU C 1 231 ? 11.470  77.560  59.476  1.00 69.14  ? 731 GLU C CG  1 
ATOM   6688  C CD  . GLU C 1 231 ? 11.318  77.445  57.972  1.00 89.39  ? 731 GLU C CD  1 
ATOM   6689  O OE1 . GLU C 1 231 ? 11.791  78.363  57.271  1.00 99.21  ? 731 GLU C OE1 1 
ATOM   6690  O OE2 . GLU C 1 231 ? 10.726  76.450  57.489  1.00 90.40  ? 731 GLU C OE2 1 
ATOM   6691  N N   . LYS C 1 232 ? 10.239  80.989  61.941  1.00 59.24  ? 732 LYS C N   1 
ATOM   6692  C CA  . LYS C 1 232 ? 9.117   81.619  62.642  1.00 58.13  ? 732 LYS C CA  1 
ATOM   6693  C C   . LYS C 1 232 ? 9.180   81.436  64.158  1.00 50.02  ? 732 LYS C C   1 
ATOM   6694  O O   . LYS C 1 232 ? 10.152  81.826  64.802  1.00 47.19  ? 732 LYS C O   1 
ATOM   6695  C CB  . LYS C 1 232 ? 7.779   81.090  62.120  1.00 59.80  ? 732 LYS C CB  1 
ATOM   6696  C CG  . LYS C 1 232 ? 7.500   81.427  60.670  1.00 67.08  ? 732 LYS C CG  1 
ATOM   6697  C CD  . LYS C 1 232 ? 6.123   80.938  60.266  1.00 78.42  ? 732 LYS C CD  1 
ATOM   6698  C CE  . LYS C 1 232 ? 5.805   81.289  58.819  1.00 83.23  ? 732 LYS C CE  1 
ATOM   6699  N NZ  . LYS C 1 232 ? 4.441   80.837  58.427  1.00 79.73  ? 732 LYS C NZ  1 
ATOM   6700  N N   . ASN C 1 233 ? 8.146   80.826  64.724  1.00 49.22  ? 733 ASN C N   1 
ATOM   6701  C CA  . ASN C 1 233 ? 8.001   80.808  66.178  1.00 56.77  ? 733 ASN C CA  1 
ATOM   6702  C C   . ASN C 1 233 ? 8.819   79.777  66.968  1.00 53.57  ? 733 ASN C C   1 
ATOM   6703  O O   . ASN C 1 233 ? 8.795   79.778  68.199  1.00 46.36  ? 733 ASN C O   1 
ATOM   6704  C CB  . ASN C 1 233 ? 6.521   80.794  66.577  1.00 65.98  ? 733 ASN C CB  1 
ATOM   6705  C CG  . ASN C 1 233 ? 5.885   82.171  66.463  1.00 75.09  ? 733 ASN C CG  1 
ATOM   6706  O OD1 . ASN C 1 233 ? 5.770   82.899  67.448  1.00 76.48  ? 733 ASN C OD1 1 
ATOM   6707  N ND2 . ASN C 1 233 ? 5.498   82.546  65.250  1.00 84.47  ? 733 ASN C ND2 1 
ATOM   6708  N N   . ASP C 1 234 ? 9.558   78.920  66.267  1.00 59.31  ? 734 ASP C N   1 
ATOM   6709  C CA  . ASP C 1 234 ? 10.489  78.003  66.923  1.00 54.04  ? 734 ASP C CA  1 
ATOM   6710  C C   . ASP C 1 234 ? 11.811  78.706  67.205  1.00 52.59  ? 734 ASP C C   1 
ATOM   6711  O O   . ASP C 1 234 ? 12.697  78.147  67.858  1.00 52.23  ? 734 ASP C O   1 
ATOM   6712  C CB  . ASP C 1 234 ? 10.739  76.771  66.051  1.00 64.63  ? 734 ASP C CB  1 
ATOM   6713  C CG  . ASP C 1 234 ? 9.455   76.087  65.628  1.00 71.94  ? 734 ASP C CG  1 
ATOM   6714  O OD1 . ASP C 1 234 ? 8.469   76.201  66.390  1.00 67.00  ? 734 ASP C OD1 1 
ATOM   6715  O OD2 . ASP C 1 234 ? 9.433   75.446  64.542  1.00 72.70  ? 734 ASP C OD2 1 
ATOM   6716  N N   . GLN C 1 235 ? 11.946  79.927  66.691  1.00 50.55  ? 735 GLN C N   1 
ATOM   6717  C CA  . GLN C 1 235 ? 13.159  80.723  66.873  1.00 44.38  ? 735 GLN C CA  1 
ATOM   6718  C C   . GLN C 1 235 ? 13.100  81.466  68.178  1.00 34.30  ? 735 GLN C C   1 
ATOM   6719  O O   . GLN C 1 235 ? 13.073  82.705  68.178  1.00 28.88  ? 735 GLN C O   1 
ATOM   6720  C CB  . GLN C 1 235 ? 13.314  81.756  65.757  1.00 48.85  ? 735 GLN C CB  1 
ATOM   6721  C CG  . GLN C 1 235 ? 14.085  81.276  64.546  1.00 51.90  ? 735 GLN C CG  1 
ATOM   6722  C CD  . GLN C 1 235 ? 14.181  82.343  63.477  1.00 50.44  ? 735 GLN C CD  1 
ATOM   6723  O OE1 . GLN C 1 235 ? 13.489  83.361  63.538  1.00 49.68  ? 735 GLN C OE1 1 
ATOM   6724  N NE2 . GLN C 1 235 ? 15.038  82.118  62.489  1.00 48.97  ? 735 GLN C NE2 1 
ATOM   6725  N N   . SER C 1 236 ? 13.063  80.721  69.280  1.00 29.76  ? 736 SER C N   1 
ATOM   6726  C CA  . SER C 1 236 ? 13.076  81.317  70.612  1.00 29.85  ? 736 SER C CA  1 
ATOM   6727  C C   . SER C 1 236 ? 14.202  80.701  71.471  1.00 28.84  ? 736 SER C C   1 
ATOM   6728  O O   . SER C 1 236 ? 14.376  79.477  71.509  1.00 29.25  ? 736 SER C O   1 
ATOM   6729  C CB  . SER C 1 236 ? 11.697  81.193  71.278  1.00 25.76  ? 736 SER C CB  1 
ATOM   6730  O OG  . SER C 1 236 ? 11.702  80.284  72.375  1.00 36.32  ? 736 SER C OG  1 
ATOM   6731  N N   . CYS C 1 237 ? 14.987  81.543  72.137  1.00 21.24  ? 737 CYS C N   1 
ATOM   6732  C CA  . CYS C 1 237 ? 16.073  81.008  72.947  1.00 28.97  ? 737 CYS C CA  1 
ATOM   6733  C C   . CYS C 1 237 ? 15.521  80.066  73.994  1.00 24.04  ? 737 CYS C C   1 
ATOM   6734  O O   . CYS C 1 237 ? 16.104  79.013  74.253  1.00 21.35  ? 737 CYS C O   1 
ATOM   6735  C CB  . CYS C 1 237 ? 16.918  82.103  73.591  1.00 18.21  ? 737 CYS C CB  1 
ATOM   6736  S SG  . CYS C 1 237 ? 17.866  82.992  72.375  1.00 44.61  ? 737 CYS C SG  1 
ATOM   6737  N N   . GLU C 1 238 ? 14.393  80.453  74.580  1.00 21.63  ? 738 GLU C N   1 
ATOM   6738  C CA  . GLU C 1 238 ? 13.674  79.592  75.502  1.00 26.85  ? 738 GLU C CA  1 
ATOM   6739  C C   . GLU C 1 238 ? 13.531  78.136  75.000  1.00 22.32  ? 738 GLU C C   1 
ATOM   6740  O O   . GLU C 1 238 ? 13.887  77.203  75.703  1.00 24.43  ? 738 GLU C O   1 
ATOM   6741  C CB  . GLU C 1 238 ? 12.306  80.187  75.837  1.00 29.23  ? 738 GLU C CB  1 
ATOM   6742  C CG  . GLU C 1 238 ? 11.666  79.554  77.079  1.00 44.23  ? 738 GLU C CG  1 
ATOM   6743  C CD  . GLU C 1 238 ? 10.312  80.155  77.435  1.00 54.98  ? 738 GLU C CD  1 
ATOM   6744  O OE1 . GLU C 1 238 ? 10.013  81.296  77.002  1.00 55.88  ? 738 GLU C OE1 1 
ATOM   6745  O OE2 . GLU C 1 238 ? 9.543   79.474  78.147  1.00 54.68  ? 738 GLU C OE2 1 
ATOM   6746  N N   . ILE C 1 239 ? 13.022  77.945  73.788  1.00 20.89  ? 739 ILE C N   1 
ATOM   6747  C CA  . ILE C 1 239 ? 12.778  76.595  73.309  1.00 22.62  ? 739 ILE C CA  1 
ATOM   6748  C C   . ILE C 1 239 ? 14.101  75.903  72.993  1.00 28.71  ? 739 ILE C C   1 
ATOM   6749  O O   . ILE C 1 239 ? 14.296  74.730  73.312  1.00 26.44  ? 739 ILE C O   1 
ATOM   6750  C CB  . ILE C 1 239 ? 11.850  76.586  72.089  1.00 24.76  ? 739 ILE C CB  1 
ATOM   6751  C CG1 . ILE C 1 239 ? 10.416  76.864  72.535  1.00 26.42  ? 739 ILE C CG1 1 
ATOM   6752  C CG2 . ILE C 1 239 ? 11.901  75.239  71.370  1.00 22.91  ? 739 ILE C CG2 1 
ATOM   6753  C CD1 . ILE C 1 239 ? 9.509   77.252  71.396  1.00 25.71  ? 739 ILE C CD1 1 
ATOM   6754  N N   . MET C 1 240 ? 15.020  76.633  72.381  1.00 22.06  ? 740 MET C N   1 
ATOM   6755  C CA  . MET C 1 240 ? 16.304  76.053  72.064  1.00 21.15  ? 740 MET C CA  1 
ATOM   6756  C C   . MET C 1 240 ? 17.022  75.585  73.333  1.00 26.53  ? 740 MET C C   1 
ATOM   6757  O O   . MET C 1 240 ? 17.640  74.509  73.354  1.00 25.11  ? 740 MET C O   1 
ATOM   6758  C CB  . MET C 1 240 ? 17.153  77.042  71.277  1.00 15.46  ? 740 MET C CB  1 
ATOM   6759  C CG  . MET C 1 240 ? 16.710  77.189  69.831  1.00 22.52  ? 740 MET C CG  1 
ATOM   6760  S SD  . MET C 1 240 ? 17.531  78.581  68.992  1.00 29.93  ? 740 MET C SD  1 
ATOM   6761  C CE  . MET C 1 240 ? 16.830  79.965  69.885  1.00 166.80 ? 740 MET C CE  1 
ATOM   6762  N N   . LEU C 1 241 ? 16.917  76.384  74.391  1.00 22.27  ? 741 LEU C N   1 
ATOM   6763  C CA  . LEU C 1 241 ? 17.595  76.083  75.642  1.00 21.11  ? 741 LEU C CA  1 
ATOM   6764  C C   . LEU C 1 241 ? 16.967  74.839  76.276  1.00 24.04  ? 741 LEU C C   1 
ATOM   6765  O O   . LEU C 1 241 ? 17.657  74.035  76.886  1.00 24.14  ? 741 LEU C O   1 
ATOM   6766  C CB  . LEU C 1 241 ? 17.453  77.258  76.598  1.00 24.35  ? 741 LEU C CB  1 
ATOM   6767  C CG  . LEU C 1 241 ? 18.571  77.587  77.594  1.00 30.03  ? 741 LEU C CG  1 
ATOM   6768  C CD1 . LEU C 1 241 ? 18.002  78.017  78.948  1.00 18.67  ? 741 LEU C CD1 1 
ATOM   6769  C CD2 . LEU C 1 241 ? 19.505  76.438  77.753  1.00 26.94  ? 741 LEU C CD2 1 
ATOM   6770  N N   . ASN C 1 242 ? 15.648  74.698  76.156  1.00 19.15  ? 742 ASN C N   1 
ATOM   6771  C CA  . ASN C 1 242 ? 14.970  73.509  76.665  1.00 24.48  ? 742 ASN C CA  1 
ATOM   6772  C C   . ASN C 1 242 ? 15.563  72.242  76.038  1.00 33.84  ? 742 ASN C C   1 
ATOM   6773  O O   . ASN C 1 242 ? 15.814  71.243  76.724  1.00 24.95  ? 742 ASN C O   1 
ATOM   6774  C CB  . ASN C 1 242 ? 13.477  73.553  76.341  1.00 15.63  ? 742 ASN C CB  1 
ATOM   6775  C CG  . ASN C 1 242 ? 12.701  74.440  77.277  1.00 23.00  ? 742 ASN C CG  1 
ATOM   6776  O OD1 . ASN C 1 242 ? 13.199  74.861  78.320  1.00 22.25  ? 742 ASN C OD1 1 
ATOM   6777  N ND2 . ASN C 1 242 ? 11.456  74.703  76.925  1.00 16.73  ? 742 ASN C ND2 1 
ATOM   6778  N N   . HIS C 1 243 ? 15.771  72.295  74.722  1.00 24.51  ? 743 HIS C N   1 
ATOM   6779  C CA  . HIS C 1 243 ? 16.294  71.156  73.997  1.00 20.04  ? 743 HIS C CA  1 
ATOM   6780  C C   . HIS C 1 243 ? 17.769  70.895  74.338  1.00 23.65  ? 743 HIS C C   1 
ATOM   6781  O O   . HIS C 1 243 ? 18.160  69.743  74.533  1.00 18.97  ? 743 HIS C O   1 
ATOM   6782  C CB  . HIS C 1 243 ? 16.085  71.337  72.491  1.00 20.64  ? 743 HIS C CB  1 
ATOM   6783  C CG  . HIS C 1 243 ? 14.663  71.146  72.052  1.00 30.57  ? 743 HIS C CG  1 
ATOM   6784  N ND1 . HIS C 1 243 ? 14.111  69.902  71.832  1.00 27.15  ? 743 HIS C ND1 1 
ATOM   6785  C CD2 . HIS C 1 243 ? 13.682  72.043  71.798  1.00 39.18  ? 743 HIS C CD2 1 
ATOM   6786  C CE1 . HIS C 1 243 ? 12.852  70.038  71.459  1.00 27.59  ? 743 HIS C CE1 1 
ATOM   6787  N NE2 . HIS C 1 243 ? 12.565  71.326  71.434  1.00 38.65  ? 743 HIS C NE2 1 
ATOM   6788  N N   . LEU C 1 244 ? 18.582  71.951  74.433  1.00 11.08  ? 744 LEU C N   1 
ATOM   6789  C CA  . LEU C 1 244 ? 19.995  71.770  74.782  1.00 16.32  ? 744 LEU C CA  1 
ATOM   6790  C C   . LEU C 1 244 ? 20.230  71.354  76.228  1.00 22.72  ? 744 LEU C C   1 
ATOM   6791  O O   . LEU C 1 244 ? 21.064  70.486  76.498  1.00 29.15  ? 744 LEU C O   1 
ATOM   6792  C CB  . LEU C 1 244 ? 20.817  73.018  74.462  1.00 15.36  ? 744 LEU C CB  1 
ATOM   6793  C CG  . LEU C 1 244 ? 20.871  73.293  72.961  1.00 21.20  ? 744 LEU C CG  1 
ATOM   6794  C CD1 . LEU C 1 244 ? 21.545  74.615  72.725  1.00 31.68  ? 744 LEU C CD1 1 
ATOM   6795  C CD2 . LEU C 1 244 ? 21.636  72.193  72.277  1.00 26.84  ? 744 LEU C CD2 1 
ATOM   6796  N N   . ALA C 1 245 ? 19.510  71.974  77.160  1.00 19.32  ? 745 ALA C N   1 
ATOM   6797  C CA  . ALA C 1 245 ? 19.585  71.567  78.560  1.00 20.22  ? 745 ALA C CA  1 
ATOM   6798  C C   . ALA C 1 245 ? 19.133  70.116  78.693  1.00 24.08  ? 745 ALA C C   1 
ATOM   6799  O O   . ALA C 1 245 ? 19.697  69.343  79.475  1.00 26.37  ? 745 ALA C O   1 
ATOM   6800  C CB  . ALA C 1 245 ? 18.747  72.480  79.446  1.00 10.15  ? 745 ALA C CB  1 
ATOM   6801  N N   . THR C 1 246 ? 18.140  69.735  77.895  1.00 14.57  ? 746 THR C N   1 
ATOM   6802  C CA  . THR C 1 246 ? 17.708  68.348  77.882  1.00 18.18  ? 746 THR C CA  1 
ATOM   6803  C C   . THR C 1 246 ? 18.806  67.427  77.312  1.00 30.80  ? 746 THR C C   1 
ATOM   6804  O O   . THR C 1 246 ? 18.984  66.296  77.770  1.00 29.61  ? 746 THR C O   1 
ATOM   6805  C CB  . THR C 1 246 ? 16.330  68.187  77.179  1.00 23.67  ? 746 THR C CB  1 
ATOM   6806  O OG1 . THR C 1 246 ? 15.340  68.914  77.920  1.00 24.57  ? 746 THR C OG1 1 
ATOM   6807  C CG2 . THR C 1 246 ? 15.896  66.732  77.104  1.00 7.33   ? 746 THR C CG2 1 
ATOM   6808  N N   . ALA C 1 247 ? 19.566  67.917  76.343  1.00 27.28  ? 747 ALA C N   1 
ATOM   6809  C CA  . ALA C 1 247 ? 20.599  67.085  75.751  1.00 23.35  ? 747 ALA C CA  1 
ATOM   6810  C C   . ALA C 1 247 ? 21.741  66.869  76.728  1.00 25.59  ? 747 ALA C C   1 
ATOM   6811  O O   . ALA C 1 247 ? 22.352  65.804  76.759  1.00 30.43  ? 747 ALA C O   1 
ATOM   6812  C CB  . ALA C 1 247 ? 21.110  67.674  74.453  1.00 12.38  ? 747 ALA C CB  1 
ATOM   6813  N N   . ARG C 1 248 ? 22.043  67.878  77.527  1.00 26.65  ? 748 ARG C N   1 
ATOM   6814  C CA  . ARG C 1 248 ? 23.103  67.717  78.509  1.00 22.80  ? 748 ARG C CA  1 
ATOM   6815  C C   . ARG C 1 248 ? 22.671  66.628  79.482  1.00 23.85  ? 748 ARG C C   1 
ATOM   6816  O O   . ARG C 1 248 ? 23.455  65.755  79.843  1.00 28.72  ? 748 ARG C O   1 
ATOM   6817  C CB  . ARG C 1 248 ? 23.377  69.026  79.256  1.00 22.47  ? 748 ARG C CB  1 
ATOM   6818  C CG  . ARG C 1 248 ? 24.545  68.951  80.237  1.00 35.97  ? 748 ARG C CG  1 
ATOM   6819  C CD  . ARG C 1 248 ? 24.702  70.229  81.043  1.00 47.66  ? 748 ARG C CD  1 
ATOM   6820  N NE  . ARG C 1 248 ? 24.432  69.993  82.455  1.00 63.41  ? 748 ARG C NE  1 
ATOM   6821  C CZ  . ARG C 1 248 ? 23.587  70.711  83.185  1.00 76.47  ? 748 ARG C CZ  1 
ATOM   6822  N NH1 . ARG C 1 248 ? 22.936  71.728  82.638  1.00 76.53  ? 748 ARG C NH1 1 
ATOM   6823  N NH2 . ARG C 1 248 ? 23.394  70.412  84.465  1.00 82.99  ? 748 ARG C NH2 1 
ATOM   6824  N N   . PHE C 1 249 ? 21.409  66.685  79.892  1.00 23.49  ? 749 PHE C N   1 
ATOM   6825  C CA  . PHE C 1 249 ? 20.875  65.703  80.822  1.00 34.16  ? 749 PHE C CA  1 
ATOM   6826  C C   . PHE C 1 249 ? 20.905  64.299  80.205  1.00 27.36  ? 749 PHE C C   1 
ATOM   6827  O O   . PHE C 1 249 ? 21.406  63.352  80.812  1.00 32.53  ? 749 PHE C O   1 
ATOM   6828  C CB  . PHE C 1 249 ? 19.451  66.084  81.249  1.00 36.32  ? 749 PHE C CB  1 
ATOM   6829  C CG  . PHE C 1 249 ? 18.725  64.989  81.964  1.00 38.28  ? 749 PHE C CG  1 
ATOM   6830  C CD1 . PHE C 1 249 ? 18.825  64.856  83.337  1.00 37.84  ? 749 PHE C CD1 1 
ATOM   6831  C CD2 . PHE C 1 249 ? 17.951  64.080  81.261  1.00 48.98  ? 749 PHE C CD2 1 
ATOM   6832  C CE1 . PHE C 1 249 ? 18.162  63.839  83.999  1.00 46.03  ? 749 PHE C CE1 1 
ATOM   6833  C CE2 . PHE C 1 249 ? 17.283  63.060  81.917  1.00 57.20  ? 749 PHE C CE2 1 
ATOM   6834  C CZ  . PHE C 1 249 ? 17.386  62.943  83.293  1.00 48.61  ? 749 PHE C CZ  1 
ATOM   6835  N N   . MET C 1 250 ? 20.366  64.187  78.994  1.00 24.00  ? 750 MET C N   1 
ATOM   6836  C CA  . MET C 1 250 ? 20.332  62.937  78.241  1.00 18.35  ? 750 MET C CA  1 
ATOM   6837  C C   . MET C 1 250 ? 21.699  62.252  78.214  1.00 28.42  ? 750 MET C C   1 
ATOM   6838  O O   . MET C 1 250 ? 21.811  61.065  78.523  1.00 30.00  ? 750 MET C O   1 
ATOM   6839  C CB  . MET C 1 250 ? 19.866  63.215  76.814  1.00 18.46  ? 750 MET C CB  1 
ATOM   6840  C CG  . MET C 1 250 ? 19.846  62.021  75.918  1.00 23.88  ? 750 MET C CG  1 
ATOM   6841  S SD  . MET C 1 250 ? 19.579  62.448  74.193  1.00 23.18  ? 750 MET C SD  1 
ATOM   6842  C CE  . MET C 1 250 ? 20.972  63.516  73.844  1.00 10.70  ? 750 MET C CE  1 
ATOM   6843  N N   . ALA C 1 251 ? 22.734  63.010  77.856  1.00 25.86  ? 751 ALA C N   1 
ATOM   6844  C CA  . ALA C 1 251 ? 24.082  62.476  77.808  1.00 25.63  ? 751 ALA C CA  1 
ATOM   6845  C C   . ALA C 1 251 ? 24.480  61.923  79.167  1.00 25.32  ? 751 ALA C C   1 
ATOM   6846  O O   . ALA C 1 251 ? 25.030  60.830  79.250  1.00 34.56  ? 751 ALA C O   1 
ATOM   6847  C CB  . ALA C 1 251 ? 25.085  63.542  77.340  1.00 21.47  ? 751 ALA C CB  1 
ATOM   6848  N N   . GLU C 1 252 ? 24.208  62.669  80.234  1.00 16.30  ? 752 GLU C N   1 
ATOM   6849  C CA  . GLU C 1 252 ? 24.698  62.263  81.556  1.00 23.28  ? 752 GLU C CA  1 
ATOM   6850  C C   . GLU C 1 252 ? 23.920  61.065  82.041  1.00 24.78  ? 752 GLU C C   1 
ATOM   6851  O O   . GLU C 1 252 ? 24.391  60.298  82.867  1.00 31.27  ? 752 GLU C O   1 
ATOM   6852  C CB  . GLU C 1 252 ? 24.599  63.403  82.586  1.00 30.48  ? 752 GLU C CB  1 
ATOM   6853  C CG  . GLU C 1 252 ? 25.608  64.531  82.374  1.00 55.08  ? 752 GLU C CG  1 
ATOM   6854  C CD  . GLU C 1 252 ? 25.364  65.756  83.258  1.00 71.53  ? 752 GLU C CD  1 
ATOM   6855  O OE1 . GLU C 1 252 ? 26.059  66.779  83.052  1.00 71.32  ? 752 GLU C OE1 1 
ATOM   6856  O OE2 . GLU C 1 252 ? 24.488  65.702  84.152  1.00 79.56  ? 752 GLU C OE2 1 
ATOM   6857  N N   . ALA C 1 253 ? 22.709  60.915  81.526  1.00 27.26  ? 753 ALA C N   1 
ATOM   6858  C CA  . ALA C 1 253 ? 21.803  59.899  82.024  1.00 22.56  ? 753 ALA C CA  1 
ATOM   6859  C C   . ALA C 1 253 ? 21.542  58.862  80.950  1.00 29.47  ? 753 ALA C C   1 
ATOM   6860  O O   . ALA C 1 253 ? 20.494  58.226  80.943  1.00 36.61  ? 753 ALA C O   1 
ATOM   6861  C CB  . ALA C 1 253 ? 20.512  60.538  82.445  1.00 23.35  ? 753 ALA C CB  1 
ATOM   6862  N N   . ALA C 1 254 ? 22.498  58.694  80.045  1.00 27.37  ? 754 ALA C N   1 
ATOM   6863  C CA  . ALA C 1 254 ? 22.286  57.859  78.869  1.00 23.26  ? 754 ALA C CA  1 
ATOM   6864  C C   . ALA C 1 254 ? 21.947  56.403  79.211  1.00 27.26  ? 754 ALA C C   1 
ATOM   6865  O O   . ALA C 1 254 ? 21.287  55.718  78.434  1.00 27.98  ? 754 ALA C O   1 
ATOM   6866  C CB  . ALA C 1 254 ? 23.490  57.933  77.936  1.00 12.47  ? 754 ALA C CB  1 
ATOM   6867  N N   . ASP C 1 255 ? 22.381  55.925  80.371  1.00 26.58  ? 755 ASP C N   1 
ATOM   6868  C CA  . ASP C 1 255 ? 22.170  54.517  80.690  1.00 30.36  ? 755 ASP C CA  1 
ATOM   6869  C C   . ASP C 1 255 ? 20.730  54.224  81.121  1.00 34.42  ? 755 ASP C C   1 
ATOM   6870  O O   . ASP C 1 255 ? 20.243  53.091  81.001  1.00 38.82  ? 755 ASP C O   1 
ATOM   6871  C CB  . ASP C 1 255 ? 23.159  54.028  81.746  1.00 30.02  ? 755 ASP C CB  1 
ATOM   6872  C CG  . ASP C 1 255 ? 23.364  52.529  81.685  1.00 43.59  ? 755 ASP C CG  1 
ATOM   6873  O OD1 . ASP C 1 255 ? 23.176  51.854  82.728  1.00 51.05  ? 755 ASP C OD1 1 
ATOM   6874  O OD2 . ASP C 1 255 ? 23.699  52.028  80.584  1.00 37.87  ? 755 ASP C OD2 1 
ATOM   6875  N N   . SER C 1 256 ? 20.051  55.255  81.608  1.00 27.28  ? 756 SER C N   1 
ATOM   6876  C CA  . SER C 1 256 ? 18.680  55.102  82.064  1.00 27.99  ? 756 SER C CA  1 
ATOM   6877  C C   . SER C 1 256 ? 17.740  54.826  80.895  1.00 17.92  ? 756 SER C C   1 
ATOM   6878  O O   . SER C 1 256 ? 16.792  54.094  81.051  1.00 16.45  ? 756 SER C O   1 
ATOM   6879  C CB  . SER C 1 256 ? 18.222  56.342  82.815  1.00 33.06  ? 756 SER C CB  1 
ATOM   6880  O OG  . SER C 1 256 ? 17.991  57.392  81.892  1.00 45.41  ? 756 SER C OG  1 
ATOM   6881  N N   . TYR C 1 257 ? 17.996  55.416  79.729  1.00 20.91  ? 757 TYR C N   1 
ATOM   6882  C CA  . TYR C 1 257 ? 17.199  55.101  78.543  1.00 18.61  ? 757 TYR C CA  1 
ATOM   6883  C C   . TYR C 1 257 ? 17.421  53.637  78.173  1.00 26.09  ? 757 TYR C C   1 
ATOM   6884  O O   . TYR C 1 257 ? 16.476  52.887  77.871  1.00 22.21  ? 757 TYR C O   1 
ATOM   6885  C CB  . TYR C 1 257 ? 17.576  56.013  77.367  1.00 20.47  ? 757 TYR C CB  1 
ATOM   6886  C CG  . TYR C 1 257 ? 17.292  57.492  77.612  1.00 16.17  ? 757 TYR C CG  1 
ATOM   6887  C CD1 . TYR C 1 257 ? 15.993  58.012  77.495  1.00 16.19  ? 757 TYR C CD1 1 
ATOM   6888  C CD2 . TYR C 1 257 ? 18.312  58.358  77.979  1.00 13.62  ? 757 TYR C CD2 1 
ATOM   6889  C CE1 . TYR C 1 257 ? 15.740  59.357  77.720  1.00 26.61  ? 757 TYR C CE1 1 
ATOM   6890  C CE2 . TYR C 1 257 ? 18.074  59.691  78.206  1.00 22.93  ? 757 TYR C CE2 1 
ATOM   6891  C CZ  . TYR C 1 257 ? 16.791  60.190  78.076  1.00 35.56  ? 757 TYR C CZ  1 
ATOM   6892  O OH  . TYR C 1 257 ? 16.583  61.523  78.318  1.00 45.62  ? 757 TYR C OH  1 
ATOM   6893  N N   . ARG C 1 258 ? 18.682  53.226  78.222  1.00 18.43  ? 758 ARG C N   1 
ATOM   6894  C CA  . ARG C 1 258 ? 19.039  51.856  77.916  1.00 24.43  ? 758 ARG C CA  1 
ATOM   6895  C C   . ARG C 1 258 ? 18.273  50.898  78.837  1.00 29.42  ? 758 ARG C C   1 
ATOM   6896  O O   . ARG C 1 258 ? 17.660  49.927  78.373  1.00 22.01  ? 758 ARG C O   1 
ATOM   6897  C CB  . ARG C 1 258 ? 20.550  51.664  78.050  1.00 24.06  ? 758 ARG C CB  1 
ATOM   6898  C CG  . ARG C 1 258 ? 21.085  50.405  77.379  1.00 22.74  ? 758 ARG C CG  1 
ATOM   6899  C CD  . ARG C 1 258 ? 21.178  49.307  78.384  1.00 27.02  ? 758 ARG C CD  1 
ATOM   6900  N NE  . ARG C 1 258 ? 22.215  49.573  79.376  1.00 38.11  ? 758 ARG C NE  1 
ATOM   6901  C CZ  . ARG C 1 258 ? 22.222  49.043  80.598  1.00 50.35  ? 758 ARG C CZ  1 
ATOM   6902  N NH1 . ARG C 1 258 ? 21.249  48.225  80.978  1.00 50.34  ? 758 ARG C NH1 1 
ATOM   6903  N NH2 . ARG C 1 258 ? 23.197  49.328  81.449  1.00 51.74  ? 758 ARG C NH2 1 
ATOM   6904  N N   . MET C 1 259 ? 18.282  51.192  80.136  1.00 25.26  ? 759 MET C N   1 
ATOM   6905  C CA  . MET C 1 259 ? 17.651  50.312  81.111  1.00 30.27  ? 759 MET C CA  1 
ATOM   6906  C C   . MET C 1 259 ? 16.136  50.232  80.936  1.00 31.03  ? 759 MET C C   1 
ATOM   6907  O O   . MET C 1 259 ? 15.523  49.198  81.187  1.00 30.72  ? 759 MET C O   1 
ATOM   6908  C CB  . MET C 1 259 ? 18.023  50.730  82.529  1.00 23.99  ? 759 MET C CB  1 
ATOM   6909  C CG  . MET C 1 259 ? 19.363  50.180  82.957  1.00 23.42  ? 759 MET C CG  1 
ATOM   6910  S SD  . MET C 1 259 ? 19.789  50.722  84.614  1.00 48.24  ? 759 MET C SD  1 
ATOM   6911  C CE  . MET C 1 259 ? 19.591  52.490  84.419  1.00 31.95  ? 759 MET C CE  1 
ATOM   6912  N N   . ASN C 1 260 ? 15.546  51.325  80.476  1.00 21.38  ? 760 ASN C N   1 
ATOM   6913  C CA  . ASN C 1 260 ? 14.125  51.372  80.246  1.00 21.67  ? 760 ASN C CA  1 
ATOM   6914  C C   . ASN C 1 260 ? 13.752  50.499  79.068  1.00 24.93  ? 760 ASN C C   1 
ATOM   6915  O O   . ASN C 1 260 ? 12.767  49.760  79.120  1.00 23.24  ? 760 ASN C O   1 
ATOM   6916  C CB  . ASN C 1 260 ? 13.677  52.810  79.992  1.00 23.31  ? 760 ASN C CB  1 
ATOM   6917  C CG  . ASN C 1 260 ? 12.220  53.007  80.286  1.00 24.14  ? 760 ASN C CG  1 
ATOM   6918  O OD1 . ASN C 1 260 ? 11.812  52.962  81.457  1.00 20.42  ? 760 ASN C OD1 1 
ATOM   6919  N ND2 . ASN C 1 260 ? 11.409  53.210  79.230  1.00 13.37  ? 760 ASN C ND2 1 
ATOM   6920  N N   . ALA C 1 261 ? 14.548  50.576  78.006  1.00 23.64  ? 761 ALA C N   1 
ATOM   6921  C CA  . ALA C 1 261 ? 14.285  49.778  76.817  1.00 24.01  ? 761 ALA C CA  1 
ATOM   6922  C C   . ALA C 1 261 ? 14.550  48.285  77.061  1.00 32.93  ? 761 ALA C C   1 
ATOM   6923  O O   . ALA C 1 261 ? 13.850  47.426  76.526  1.00 29.69  ? 761 ALA C O   1 
ATOM   6924  C CB  . ALA C 1 261 ? 15.092  50.299  75.605  1.00 20.84  ? 761 ALA C CB  1 
ATOM   6925  N N   . GLU C 1 262 ? 15.553  47.972  77.873  1.00 27.00  ? 762 GLU C N   1 
ATOM   6926  C CA  . GLU C 1 262 ? 15.811  46.578  78.191  1.00 27.21  ? 762 GLU C CA  1 
ATOM   6927  C C   . GLU C 1 262 ? 14.653  45.985  78.963  1.00 34.43  ? 762 GLU C C   1 
ATOM   6928  O O   . GLU C 1 262 ? 14.278  44.833  78.737  1.00 38.98  ? 762 GLU C O   1 
ATOM   6929  C CB  . GLU C 1 262 ? 17.096  46.421  78.994  1.00 31.71  ? 762 GLU C CB  1 
ATOM   6930  C CG  . GLU C 1 262 ? 18.325  46.383  78.128  1.00 48.48  ? 762 GLU C CG  1 
ATOM   6931  C CD  . GLU C 1 262 ? 19.591  46.262  78.938  1.00 59.32  ? 762 GLU C CD  1 
ATOM   6932  O OE1 . GLU C 1 262 ? 19.498  46.234  80.190  1.00 64.05  ? 762 GLU C OE1 1 
ATOM   6933  O OE2 . GLU C 1 262 ? 20.673  46.193  78.316  1.00 59.55  ? 762 GLU C OE2 1 
ATOM   6934  N N   . ARG C 1 263 ? 14.108  46.764  79.895  1.00 32.91  ? 763 ARG C N   1 
ATOM   6935  C CA  . ARG C 1 263 ? 12.967  46.316  80.681  1.00 31.50  ? 763 ARG C CA  1 
ATOM   6936  C C   . ARG C 1 263 ? 11.771  46.075  79.753  1.00 31.68  ? 763 ARG C C   1 
ATOM   6937  O O   . ARG C 1 263 ? 11.122  45.021  79.803  1.00 26.74  ? 763 ARG C O   1 
ATOM   6938  C CB  . ARG C 1 263 ? 12.616  47.340  81.759  1.00 28.23  ? 763 ARG C CB  1 
ATOM   6939  C CG  . ARG C 1 263 ? 11.237  47.139  82.357  1.00 26.52  ? 763 ARG C CG  1 
ATOM   6940  C CD  . ARG C 1 263 ? 10.964  48.165  83.429  1.00 29.62  ? 763 ARG C CD  1 
ATOM   6941  N NE  . ARG C 1 263 ? 10.725  49.488  82.864  1.00 30.00  ? 763 ARG C NE  1 
ATOM   6942  C CZ  . ARG C 1 263 ? 9.545   49.882  82.380  1.00 29.58  ? 763 ARG C CZ  1 
ATOM   6943  N NH1 . ARG C 1 263 ? 8.509   49.050  82.381  1.00 19.26  ? 763 ARG C NH1 1 
ATOM   6944  N NH2 . ARG C 1 263 ? 9.402   51.101  81.882  1.00 28.19  ? 763 ARG C NH2 1 
ATOM   6945  N N   . ILE C 1 264 ? 11.517  47.035  78.870  1.00 20.36  ? 764 ILE C N   1 
ATOM   6946  C CA  . ILE C 1 264 ? 10.361  46.935  77.985  1.00 24.49  ? 764 ILE C CA  1 
ATOM   6947  C C   . ILE C 1 264 ? 10.522  45.843  76.928  1.00 24.18  ? 764 ILE C C   1 
ATOM   6948  O O   . ILE C 1 264 ? 9.545   45.246  76.500  1.00 36.50  ? 764 ILE C O   1 
ATOM   6949  C CB  . ILE C 1 264 ? 10.008  48.285  77.303  1.00 12.79  ? 764 ILE C CB  1 
ATOM   6950  C CG1 . ILE C 1 264 ? 9.499   49.313  78.325  1.00 11.53  ? 764 ILE C CG1 1 
ATOM   6951  C CG2 . ILE C 1 264 ? 8.976   48.077  76.208  1.00 24.49  ? 764 ILE C CG2 1 
ATOM   6952  C CD1 . ILE C 1 264 ? 9.502   50.711  77.780  1.00 6.89   ? 764 ILE C CD1 1 
ATOM   6953  N N   . LEU C 1 265 ? 11.748  45.569  76.514  1.00 29.85  ? 765 LEU C N   1 
ATOM   6954  C CA  . LEU C 1 265 ? 11.967  44.552  75.481  1.00 30.07  ? 765 LEU C CA  1 
ATOM   6955  C C   . LEU C 1 265 ? 12.374  43.167  76.000  1.00 22.80  ? 765 LEU C C   1 
ATOM   6956  O O   . LEU C 1 265 ? 12.702  42.290  75.210  1.00 29.32  ? 765 LEU C O   1 
ATOM   6957  C CB  . LEU C 1 265 ? 12.951  45.054  74.404  1.00 18.65  ? 765 LEU C CB  1 
ATOM   6958  C CG  . LEU C 1 265 ? 12.384  46.196  73.554  1.00 23.11  ? 765 LEU C CG  1 
ATOM   6959  C CD1 . LEU C 1 265 ? 13.399  46.746  72.566  1.00 21.89  ? 765 LEU C CD1 1 
ATOM   6960  C CD2 . LEU C 1 265 ? 11.106  45.770  72.832  1.00 15.99  ? 765 LEU C CD2 1 
ATOM   6961  N N   . ALA C 1 266 ? 12.337  42.956  77.312  1.00 26.94  ? 766 ALA C N   1 
ATOM   6962  C CA  . ALA C 1 266 ? 12.771  41.669  77.867  1.00 32.62  ? 766 ALA C CA  1 
ATOM   6963  C C   . ALA C 1 266 ? 11.957  40.531  77.283  1.00 35.18  ? 766 ALA C C   1 
ATOM   6964  O O   . ALA C 1 266 ? 10.737  40.574  77.278  1.00 35.62  ? 766 ALA C O   1 
ATOM   6965  C CB  . ALA C 1 266 ? 12.670  41.662  79.377  1.00 28.75  ? 766 ALA C CB  1 
ATOM   6966  N N   . GLY C 1 267 ? 12.640  39.516  76.780  1.00 33.66  ? 767 GLY C N   1 
ATOM   6967  C CA  . GLY C 1 267 ? 11.960  38.384  76.189  1.00 40.21  ? 767 GLY C CA  1 
ATOM   6968  C C   . GLY C 1 267 ? 11.155  38.717  74.946  1.00 44.91  ? 767 GLY C C   1 
ATOM   6969  O O   . GLY C 1 267 ? 10.228  37.984  74.596  1.00 42.88  ? 767 GLY C O   1 
ATOM   6970  N N   . PHE C 1 268 ? 11.491  39.821  74.279  1.00 38.05  ? 768 PHE C N   1 
ATOM   6971  C CA  . PHE C 1 268 ? 10.869  40.133  72.992  1.00 40.14  ? 768 PHE C CA  1 
ATOM   6972  C C   . PHE C 1 268 ? 11.489  39.277  71.892  1.00 34.00  ? 768 PHE C C   1 
ATOM   6973  O O   . PHE C 1 268 ? 12.711  39.177  71.801  1.00 33.66  ? 768 PHE C O   1 
ATOM   6974  C CB  . PHE C 1 268 ? 11.005  41.618  72.644  1.00 36.49  ? 768 PHE C CB  1 
ATOM   6975  C CG  . PHE C 1 268 ? 10.599  41.945  71.237  1.00 35.58  ? 768 PHE C CG  1 
ATOM   6976  C CD1 . PHE C 1 268 ? 9.313   41.673  70.792  1.00 29.16  ? 768 PHE C CD1 1 
ATOM   6977  C CD2 . PHE C 1 268 ? 11.508  42.516  70.350  1.00 35.84  ? 768 PHE C CD2 1 
ATOM   6978  C CE1 . PHE C 1 268 ? 8.942   41.967  69.481  1.00 30.65  ? 768 PHE C CE1 1 
ATOM   6979  C CE2 . PHE C 1 268 ? 11.142  42.825  69.038  1.00 26.48  ? 768 PHE C CE2 1 
ATOM   6980  C CZ  . PHE C 1 268 ? 9.868   42.547  68.601  1.00 24.44  ? 768 PHE C CZ  1 
ATOM   6981  N N   . GLN C 1 269 ? 10.656  38.639  71.074  1.00 32.12  ? 769 GLN C N   1 
ATOM   6982  C CA  . GLN C 1 269 ? 11.178  37.838  69.956  1.00 38.74  ? 769 GLN C CA  1 
ATOM   6983  C C   . GLN C 1 269 ? 10.682  38.354  68.608  1.00 35.27  ? 769 GLN C C   1 
ATOM   6984  O O   . GLN C 1 269 ? 9.575   38.036  68.178  1.00 34.68  ? 769 GLN C O   1 
ATOM   6985  C CB  . GLN C 1 269 ? 10.887  36.334  70.122  1.00 34.90  ? 769 GLN C CB  1 
ATOM   6986  C CG  . GLN C 1 269 ? 9.959   35.982  71.269  1.00 48.69  ? 769 GLN C CG  1 
ATOM   6987  C CD  . GLN C 1 269 ? 9.852   34.476  71.528  1.00 61.63  ? 769 GLN C CD  1 
ATOM   6988  O OE1 . GLN C 1 269 ? 10.836  33.815  71.866  1.00 61.77  ? 769 GLN C OE1 1 
ATOM   6989  N NE2 . GLN C 1 269 ? 8.647   33.936  71.377  1.00 68.14  ? 769 GLN C NE2 1 
ATOM   6990  N N   . PRO C 1 270 ? 11.516  39.157  67.935  1.00 30.90  ? 770 PRO C N   1 
ATOM   6991  C CA  . PRO C 1 270 ? 11.093  39.798  66.693  1.00 26.99  ? 770 PRO C CA  1 
ATOM   6992  C C   . PRO C 1 270 ? 10.755  38.790  65.602  1.00 34.93  ? 770 PRO C C   1 
ATOM   6993  O O   . PRO C 1 270 ? 11.323  37.697  65.515  1.00 36.75  ? 770 PRO C O   1 
ATOM   6994  C CB  . PRO C 1 270 ? 12.329  40.610  66.286  1.00 30.60  ? 770 PRO C CB  1 
ATOM   6995  C CG  . PRO C 1 270 ? 13.467  39.864  66.874  1.00 25.96  ? 770 PRO C CG  1 
ATOM   6996  C CD  . PRO C 1 270 ? 12.950  39.366  68.200  1.00 28.51  ? 770 PRO C CD  1 
ATOM   6997  N N   . ASP C 1 271 ? 9.794   39.168  64.777  1.00 37.41  ? 771 ASP C N   1 
ATOM   6998  C CA  . ASP C 1 271 ? 9.526   38.460  63.548  1.00 32.16  ? 771 ASP C CA  1 
ATOM   6999  C C   . ASP C 1 271 ? 10.520  38.983  62.512  1.00 32.17  ? 771 ASP C C   1 
ATOM   7000  O O   . ASP C 1 271 ? 10.703  40.196  62.354  1.00 24.22  ? 771 ASP C O   1 
ATOM   7001  C CB  . ASP C 1 271 ? 8.074   38.686  63.117  1.00 29.37  ? 771 ASP C CB  1 
ATOM   7002  C CG  . ASP C 1 271 ? 7.795   38.186  61.720  1.00 44.88  ? 771 ASP C CG  1 
ATOM   7003  O OD1 . ASP C 1 271 ? 7.529   36.975  61.570  1.00 52.92  ? 771 ASP C OD1 1 
ATOM   7004  O OD2 . ASP C 1 271 ? 7.841   39.000  60.771  1.00 45.43  ? 771 ASP C OD2 1 
ATOM   7005  N N   . GLU C 1 272 ? 11.181  38.054  61.836  1.00 32.78  ? 772 GLU C N   1 
ATOM   7006  C CA  . GLU C 1 272 ? 12.187  38.381  60.833  1.00 37.54  ? 772 GLU C CA  1 
ATOM   7007  C C   . GLU C 1 272 ? 11.726  39.370  59.765  1.00 43.32  ? 772 GLU C C   1 
ATOM   7008  O O   . GLU C 1 272 ? 12.455  40.301  59.410  1.00 32.57  ? 772 GLU C O   1 
ATOM   7009  C CB  . GLU C 1 272 ? 12.653  37.104  60.159  1.00 37.22  ? 772 GLU C CB  1 
ATOM   7010  C CG  . GLU C 1 272 ? 13.648  37.316  59.050  1.00 58.88  ? 772 GLU C CG  1 
ATOM   7011  C CD  . GLU C 1 272 ? 14.339  36.021  58.670  1.00 78.88  ? 772 GLU C CD  1 
ATOM   7012  O OE1 . GLU C 1 272 ? 15.044  35.461  59.536  1.00 84.38  ? 772 GLU C OE1 1 
ATOM   7013  O OE2 . GLU C 1 272 ? 14.164  35.550  57.523  1.00 85.12  ? 772 GLU C OE2 1 
ATOM   7014  N N   . GLU C 1 273 ? 10.525  39.164  59.235  1.00 46.53  ? 773 GLU C N   1 
ATOM   7015  C CA  . GLU C 1 273 ? 10.086  39.978  58.112  1.00 45.53  ? 773 GLU C CA  1 
ATOM   7016  C C   . GLU C 1 273 ? 9.711   41.365  58.588  1.00 39.92  ? 773 GLU C C   1 
ATOM   7017  O O   . GLU C 1 273 ? 9.974   42.359  57.913  1.00 39.28  ? 773 GLU C O   1 
ATOM   7018  C CB  . GLU C 1 273 ? 8.903   39.336  57.386  1.00 42.51  ? 773 GLU C CB  1 
ATOM   7019  C CG  . GLU C 1 273 ? 8.728   39.852  55.966  1.00 38.37  ? 773 GLU C CG  1 
ATOM   7020  C CD  . GLU C 1 273 ? 7.476   39.321  55.278  1.00 47.53  ? 773 GLU C CD  1 
ATOM   7021  O OE1 . GLU C 1 273 ? 6.821   38.405  55.825  1.00 45.53  ? 773 GLU C OE1 1 
ATOM   7022  O OE2 . GLU C 1 273 ? 7.147   39.830  54.185  1.00 54.48  ? 773 GLU C OE2 1 
ATOM   7023  N N   . MET C 1 274 ? 9.083   41.412  59.756  1.00 34.42  ? 774 MET C N   1 
ATOM   7024  C CA  . MET C 1 274 ? 8.610   42.657  60.335  1.00 34.34  ? 774 MET C CA  1 
ATOM   7025  C C   . MET C 1 274 ? 9.833   43.496  60.662  1.00 41.64  ? 774 MET C C   1 
ATOM   7026  O O   . MET C 1 274 ? 9.877   44.702  60.428  1.00 41.55  ? 774 MET C O   1 
ATOM   7027  C CB  . MET C 1 274 ? 7.813   42.365  61.607  1.00 31.40  ? 774 MET C CB  1 
ATOM   7028  C CG  . MET C 1 274 ? 7.281   43.603  62.292  1.00 44.33  ? 774 MET C CG  1 
ATOM   7029  S SD  . MET C 1 274 ? 5.682   44.159  61.673  1.00 69.66  ? 774 MET C SD  1 
ATOM   7030  C CE  . MET C 1 274 ? 4.603   43.271  62.792  1.00 38.61  ? 774 MET C CE  1 
ATOM   7031  N N   . ASN C 1 275 ? 10.844  42.827  61.187  1.00 46.06  ? 775 ASN C N   1 
ATOM   7032  C CA  . ASN C 1 275 ? 12.082  43.482  61.520  1.00 35.63  ? 775 ASN C CA  1 
ATOM   7033  C C   . ASN C 1 275 ? 12.778  44.042  60.282  1.00 37.80  ? 775 ASN C C   1 
ATOM   7034  O O   . ASN C 1 275 ? 13.266  45.170  60.318  1.00 44.87  ? 775 ASN C O   1 
ATOM   7035  C CB  . ASN C 1 275 ? 12.986  42.526  62.280  1.00 41.14  ? 775 ASN C CB  1 
ATOM   7036  C CG  . ASN C 1 275 ? 14.308  43.144  62.620  1.00 45.98  ? 775 ASN C CG  1 
ATOM   7037  O OD1 . ASN C 1 275 ? 15.302  42.933  61.923  1.00 50.51  ? 775 ASN C OD1 1 
ATOM   7038  N ND2 . ASN C 1 275 ? 14.331  43.929  63.687  1.00 38.38  ? 775 ASN C ND2 1 
ATOM   7039  N N   . GLU C 1 276 ? 12.807  43.285  59.182  1.00 33.13  ? 776 GLU C N   1 
ATOM   7040  C CA  . GLU C 1 276 ? 13.401  43.788  57.936  1.00 35.65  ? 776 GLU C CA  1 
ATOM   7041  C C   . GLU C 1 276 ? 12.734  45.087  57.448  1.00 34.82  ? 776 GLU C C   1 
ATOM   7042  O O   . GLU C 1 276 ? 13.403  46.078  57.142  1.00 33.03  ? 776 GLU C O   1 
ATOM   7043  C CB  . GLU C 1 276 ? 13.368  42.732  56.831  1.00 40.63  ? 776 GLU C CB  1 
ATOM   7044  C CG  . GLU C 1 276 ? 14.404  41.638  56.999  1.00 46.77  ? 776 GLU C CG  1 
ATOM   7045  C CD  . GLU C 1 276 ? 15.817  42.182  57.030  1.00 53.27  ? 776 GLU C CD  1 
ATOM   7046  O OE1 . GLU C 1 276 ? 16.276  42.707  55.999  1.00 55.33  ? 776 GLU C OE1 1 
ATOM   7047  O OE2 . GLU C 1 276 ? 16.469  42.093  58.089  1.00 57.02  ? 776 GLU C OE2 1 
ATOM   7048  N N   . ILE C 1 277 ? 11.412  45.085  57.400  1.00 34.29  ? 777 ILE C N   1 
ATOM   7049  C CA  . ILE C 1 277 ? 10.676  46.244  56.926  1.00 37.46  ? 777 ILE C CA  1 
ATOM   7050  C C   . ILE C 1 277 ? 10.913  47.458  57.817  1.00 35.12  ? 777 ILE C C   1 
ATOM   7051  O O   . ILE C 1 277 ? 10.682  48.587  57.404  1.00 35.49  ? 777 ILE C O   1 
ATOM   7052  C CB  . ILE C 1 277 ? 9.178   45.956  56.872  1.00 45.91  ? 777 ILE C CB  1 
ATOM   7053  C CG1 . ILE C 1 277 ? 8.468   46.996  56.021  1.00 51.72  ? 777 ILE C CG1 1 
ATOM   7054  C CG2 . ILE C 1 277 ? 8.587   45.957  58.269  1.00 53.09  ? 777 ILE C CG2 1 
ATOM   7055  C CD1 . ILE C 1 277 ? 6.969   46.932  56.157  1.00 60.28  ? 777 ILE C CD1 1 
ATOM   7056  N N   . CYS C 1 278 ? 11.366  47.229  59.045  1.00 31.61  ? 778 CYS C N   1 
ATOM   7057  C CA  . CYS C 1 278 ? 11.671  48.337  59.945  1.00 33.69  ? 778 CYS C CA  1 
ATOM   7058  C C   . CYS C 1 278 ? 13.037  48.979  59.673  1.00 37.01  ? 778 CYS C C   1 
ATOM   7059  O O   . CYS C 1 278 ? 13.354  50.032  60.226  1.00 43.25  ? 778 CYS C O   1 
ATOM   7060  C CB  . CYS C 1 278 ? 11.587  47.892  61.406  1.00 29.04  ? 778 CYS C CB  1 
ATOM   7061  S SG  . CYS C 1 278 ? 9.918   47.711  62.042  1.00 36.28  ? 778 CYS C SG  1 
ATOM   7062  N N   . LYS C 1 279 ? 13.850  48.341  58.840  1.00 30.18  ? 779 LYS C N   1 
ATOM   7063  C CA  . LYS C 1 279 ? 15.156  48.892  58.511  1.00 30.96  ? 779 LYS C CA  1 
ATOM   7064  C C   . LYS C 1 279 ? 15.017  50.042  57.517  1.00 37.00  ? 779 LYS C C   1 
ATOM   7065  O O   . LYS C 1 279 ? 14.298  49.932  56.508  1.00 31.46  ? 779 LYS C O   1 
ATOM   7066  C CB  . LYS C 1 279 ? 16.070  47.812  57.948  1.00 34.51  ? 779 LYS C CB  1 
ATOM   7067  C CG  . LYS C 1 279 ? 16.513  46.768  58.955  1.00 32.01  ? 779 LYS C CG  1 
ATOM   7068  C CD  . LYS C 1 279 ? 17.251  45.618  58.260  1.00 30.07  ? 779 LYS C CD  1 
ATOM   7069  C CE  . LYS C 1 279 ? 17.665  44.544  59.250  1.00 25.35  ? 779 LYS C CE  1 
ATOM   7070  N NZ  . LYS C 1 279 ? 18.966  43.964  58.857  1.00 30.04  ? 779 LYS C NZ  1 
ATOM   7071  N N   . THR C 1 280 ? 15.686  51.151  57.819  1.00 27.59  ? 780 THR C N   1 
ATOM   7072  C CA  . THR C 1 280 ? 15.654  52.322  56.951  1.00 30.91  ? 780 THR C CA  1 
ATOM   7073  C C   . THR C 1 280 ? 16.097  51.971  55.529  1.00 32.57  ? 780 THR C C   1 
ATOM   7074  O O   . THR C 1 280 ? 15.571  52.508  54.553  1.00 33.24  ? 780 THR C O   1 
ATOM   7075  C CB  . THR C 1 280 ? 16.528  53.449  57.520  1.00 28.81  ? 780 THR C CB  1 
ATOM   7076  O OG1 . THR C 1 280 ? 15.947  53.922  58.737  1.00 28.40  ? 780 THR C OG1 1 
ATOM   7077  C CG2 . THR C 1 280 ? 16.634  54.598  56.545  1.00 22.44  ? 780 THR C CG2 1 
ATOM   7078  N N   . GLU C 1 281 ? 17.042  51.040  55.418  1.00 31.31  ? 781 GLU C N   1 
ATOM   7079  C CA  A GLU C 1 281 ? 17.563  50.598  54.125  0.33 34.11  ? 781 GLU C CA  1 
ATOM   7080  C CA  B GLU C 1 281 ? 17.548  50.648  54.107  0.67 33.24  ? 781 GLU C CA  1 
ATOM   7081  C C   . GLU C 1 281 ? 16.434  49.979  53.314  1.00 32.38  ? 781 GLU C C   1 
ATOM   7082  O O   . GLU C 1 281 ? 16.291  50.213  52.123  1.00 33.36  ? 781 GLU C O   1 
ATOM   7083  C CB  A GLU C 1 281 ? 18.656  49.538  54.308  0.33 37.62  ? 781 GLU C CB  1 
ATOM   7084  C CB  B GLU C 1 281 ? 18.758  49.716  54.231  0.67 37.05  ? 781 GLU C CB  1 
ATOM   7085  C CG  A GLU C 1 281 ? 19.560  49.719  55.524  0.33 39.56  ? 781 GLU C CG  1 
ATOM   7086  C CG  B GLU C 1 281 ? 19.933  50.315  54.999  0.67 39.02  ? 781 GLU C CG  1 
ATOM   7087  C CD  A GLU C 1 281 ? 20.806  50.518  55.215  0.33 39.24  ? 781 GLU C CD  1 
ATOM   7088  C CD  B GLU C 1 281 ? 19.995  49.850  56.449  0.67 39.00  ? 781 GLU C CD  1 
ATOM   7089  O OE1 A GLU C 1 281 ? 21.554  50.848  56.161  0.33 38.97  ? 781 GLU C OE1 1 
ATOM   7090  O OE1 B GLU C 1 281 ? 18.949  49.856  57.140  0.67 24.22  ? 781 GLU C OE1 1 
ATOM   7091  O OE2 A GLU C 1 281 ? 21.044  50.807  54.024  0.33 41.35  ? 781 GLU C OE2 1 
ATOM   7092  O OE2 B GLU C 1 281 ? 21.101  49.468  56.893  0.67 46.57  ? 781 GLU C OE2 1 
ATOM   7093  H H   A GLU C 1 281 ? 17.404  50.642  56.089  0.33 37.46  ? 781 GLU C H   1 
ATOM   7094  H H   B GLU C 1 281 ? 17.402  50.625  56.079  0.67 37.46  ? 781 GLU C H   1 
ATOM   7095  H HA  A GLU C 1 281 ? 17.933  51.360  53.632  0.33 40.82  ? 781 GLU C HA  1 
ATOM   7096  H HA  B GLU C 1 281 ? 17.831  51.450  53.620  0.67 39.78  ? 781 GLU C HA  1 
ATOM   7097  H HB2 A GLU C 1 281 ? 18.230  48.671  54.391  0.33 45.04  ? 781 GLU C HB2 1 
ATOM   7098  H HB2 B GLU C 1 281 ? 18.483  48.909  54.695  0.67 44.35  ? 781 GLU C HB2 1 
ATOM   7099  H HB3 A GLU C 1 281 ? 19.224  49.544  53.522  0.33 45.04  ? 781 GLU C HB3 1 
ATOM   7100  H HB3 B GLU C 1 281 ? 19.071  49.491  53.341  0.67 44.35  ? 781 GLU C HB3 1 
ATOM   7101  H HG2 A GLU C 1 281 ? 19.068  50.188  56.217  0.33 47.36  ? 781 GLU C HG2 1 
ATOM   7102  H HG2 B GLU C 1 281 ? 20.760  50.054  54.565  0.67 46.72  ? 781 GLU C HG2 1 
ATOM   7103  H HG3 A GLU C 1 281 ? 19.836  48.847  55.846  0.33 47.36  ? 781 GLU C HG3 1 
ATOM   7104  H HG3 B GLU C 1 281 ? 19.849  51.282  54.998  0.67 46.72  ? 781 GLU C HG3 1 
ATOM   7105  N N   . PHE C 1 282 ? 15.642  49.160  53.987  1.00 36.34  ? 782 PHE C N   1 
ATOM   7106  C CA  . PHE C 1 282 ? 14.506  48.507  53.360  1.00 34.70  ? 782 PHE C CA  1 
ATOM   7107  C C   . PHE C 1 282 ? 13.473  49.562  52.950  1.00 34.57  ? 782 PHE C C   1 
ATOM   7108  O O   . PHE C 1 282 ? 12.960  49.546  51.828  1.00 37.61  ? 782 PHE C O   1 
ATOM   7109  C CB  . PHE C 1 282 ? 13.897  47.478  54.321  1.00 26.90  ? 782 PHE C CB  1 
ATOM   7110  C CG  . PHE C 1 282 ? 12.910  46.549  53.671  1.00 34.36  ? 782 PHE C CG  1 
ATOM   7111  C CD1 . PHE C 1 282 ? 13.278  45.258  53.325  1.00 32.33  ? 782 PHE C CD1 1 
ATOM   7112  C CD2 . PHE C 1 282 ? 11.615  46.968  53.400  1.00 44.65  ? 782 PHE C CD2 1 
ATOM   7113  C CE1 . PHE C 1 282 ? 12.372  44.400  52.727  1.00 41.09  ? 782 PHE C CE1 1 
ATOM   7114  C CE2 . PHE C 1 282 ? 10.699  46.113  52.800  1.00 43.15  ? 782 PHE C CE2 1 
ATOM   7115  C CZ  . PHE C 1 282 ? 11.080  44.827  52.462  1.00 42.09  ? 782 PHE C CZ  1 
ATOM   7116  N N   . GLN C 1 283 ? 13.189  50.492  53.855  1.00 23.59  ? 783 GLN C N   1 
ATOM   7117  C CA  . GLN C 1 283 ? 12.244  51.570  53.563  1.00 29.95  ? 783 GLN C CA  1 
ATOM   7118  C C   . GLN C 1 283 ? 12.664  52.450  52.375  1.00 32.99  ? 783 GLN C C   1 
ATOM   7119  O O   . GLN C 1 283 ? 11.833  52.820  51.552  1.00 35.29  ? 783 GLN C O   1 
ATOM   7120  C CB  . GLN C 1 283 ? 11.973  52.406  54.820  1.00 28.84  ? 783 GLN C CB  1 
ATOM   7121  C CG  . GLN C 1 283 ? 11.179  51.664  55.889  1.00 29.57  ? 783 GLN C CG  1 
ATOM   7122  C CD  . GLN C 1 283 ? 11.275  52.327  57.249  1.00 44.75  ? 783 GLN C CD  1 
ATOM   7123  O OE1 . GLN C 1 283 ? 11.270  53.552  57.356  1.00 50.84  ? 783 GLN C OE1 1 
ATOM   7124  N NE2 . GLN C 1 283 ? 11.386  51.519  58.297  1.00 48.70  ? 783 GLN C NE2 1 
ATOM   7125  N N   . MET C 1 284 ? 13.949  52.767  52.271  1.00 31.77  ? 784 MET C N   1 
ATOM   7126  C CA  . MET C 1 284 ? 14.431  53.578  51.154  1.00 28.91  ? 784 MET C CA  1 
ATOM   7127  C C   . MET C 1 284 ? 14.303  52.866  49.813  1.00 32.59  ? 784 MET C C   1 
ATOM   7128  O O   . MET C 1 284 ? 14.065  53.488  48.783  1.00 32.37  ? 784 MET C O   1 
ATOM   7129  C CB  . MET C 1 284 ? 15.887  53.985  51.377  1.00 29.03  ? 784 MET C CB  1 
ATOM   7130  C CG  . MET C 1 284 ? 16.094  54.829  52.617  1.00 29.39  ? 784 MET C CG  1 
ATOM   7131  S SD  . MET C 1 284 ? 17.823  55.202  52.929  1.00 43.42  ? 784 MET C SD  1 
ATOM   7132  C CE  . MET C 1 284 ? 18.086  56.432  51.670  1.00 30.82  ? 784 MET C CE  1 
ATOM   7133  N N   . ARG C 1 285 ? 14.476  51.553  49.827  1.00 38.22  ? 785 ARG C N   1 
ATOM   7134  C CA  . ARG C 1 285 ? 14.386  50.771  48.604  1.00 33.33  ? 785 ARG C CA  1 
ATOM   7135  C C   . ARG C 1 285 ? 12.936  50.628  48.145  1.00 31.75  ? 785 ARG C C   1 
ATOM   7136  O O   . ARG C 1 285 ? 12.631  50.721  46.950  1.00 36.16  ? 785 ARG C O   1 
ATOM   7137  C CB  . ARG C 1 285 ? 15.044  49.415  48.817  1.00 32.48  ? 785 ARG C CB  1 
ATOM   7138  C CG  . ARG C 1 285 ? 16.528  49.504  48.732  1.00 31.57  ? 785 ARG C CG  1 
ATOM   7139  C CD  . ARG C 1 285 ? 16.932  49.493  47.267  1.00 43.85  ? 785 ARG C CD  1 
ATOM   7140  N NE  . ARG C 1 285 ? 16.704  48.173  46.683  1.00 41.37  ? 785 ARG C NE  1 
ATOM   7141  C CZ  . ARG C 1 285 ? 17.504  47.124  46.877  1.00 39.95  ? 785 ARG C CZ  1 
ATOM   7142  N NH1 . ARG C 1 285 ? 18.586  47.245  47.635  1.00 37.53  ? 785 ARG C NH1 1 
ATOM   7143  N NH2 . ARG C 1 285 ? 17.222  45.949  46.321  1.00 33.16  ? 785 ARG C NH2 1 
ATOM   7144  N N   . LEU C 1 286 ? 12.043  50.417  49.103  1.00 30.77  ? 786 LEU C N   1 
ATOM   7145  C CA  . LEU C 1 286 ? 10.615  50.410  48.820  1.00 38.95  ? 786 LEU C CA  1 
ATOM   7146  C C   . LEU C 1 286 ? 10.210  51.718  48.174  1.00 42.03  ? 786 LEU C C   1 
ATOM   7147  O O   . LEU C 1 286 ? 9.469   51.736  47.193  1.00 48.00  ? 786 LEU C O   1 
ATOM   7148  C CB  . LEU C 1 286 ? 9.805   50.250  50.101  1.00 46.17  ? 786 LEU C CB  1 
ATOM   7149  C CG  . LEU C 1 286 ? 9.192   48.897  50.438  1.00 55.47  ? 786 LEU C CG  1 
ATOM   7150  C CD1 . LEU C 1 286 ? 7.958   49.148  51.285  1.00 47.62  ? 786 LEU C CD1 1 
ATOM   7151  C CD2 . LEU C 1 286 ? 8.844   48.104  49.179  1.00 62.62  ? 786 LEU C CD2 1 
ATOM   7152  N N   . LEU C 1 287 ? 10.693  52.818  48.733  1.00 34.69  ? 787 LEU C N   1 
ATOM   7153  C CA  . LEU C 1 287 ? 10.217  54.123  48.318  1.00 34.70  ? 787 LEU C CA  1 
ATOM   7154  C C   . LEU C 1 287 ? 10.854  54.622  47.026  1.00 35.04  ? 787 LEU C C   1 
ATOM   7155  O O   . LEU C 1 287 ? 10.160  55.125  46.146  1.00 39.17  ? 787 LEU C O   1 
ATOM   7156  C CB  . LEU C 1 287 ? 10.392  55.134  49.454  1.00 35.19  ? 787 LEU C CB  1 
ATOM   7157  C CG  . LEU C 1 287 ? 9.455   54.874  50.641  1.00 34.36  ? 787 LEU C CG  1 
ATOM   7158  C CD1 . LEU C 1 287 ? 9.926   55.611  51.882  1.00 23.32  ? 787 LEU C CD1 1 
ATOM   7159  C CD2 . LEU C 1 287 ? 8.018   55.252  50.306  1.00 33.65  ? 787 LEU C CD2 1 
ATOM   7160  N N   . TRP C 1 288 ? 12.166  54.477  46.901  1.00 39.45  ? 788 TRP C N   1 
ATOM   7161  C CA  . TRP C 1 288 ? 12.872  55.084  45.772  1.00 37.36  ? 788 TRP C CA  1 
ATOM   7162  C C   . TRP C 1 288 ? 13.491  54.079  44.791  1.00 39.66  ? 788 TRP C C   1 
ATOM   7163  O O   . TRP C 1 288 ? 14.111  54.475  43.804  1.00 36.96  ? 788 TRP C O   1 
ATOM   7164  C CB  . TRP C 1 288 ? 13.928  56.085  46.265  1.00 35.47  ? 788 TRP C CB  1 
ATOM   7165  C CG  . TRP C 1 288 ? 13.337  57.296  46.930  1.00 37.24  ? 788 TRP C CG  1 
ATOM   7166  C CD1 . TRP C 1 288 ? 12.726  58.348  46.317  1.00 35.85  ? 788 TRP C CD1 1 
ATOM   7167  C CD2 . TRP C 1 288 ? 13.301  57.575  48.338  1.00 37.25  ? 788 TRP C CD2 1 
ATOM   7168  N NE1 . TRP C 1 288 ? 12.304  59.265  47.251  1.00 40.79  ? 788 TRP C NE1 1 
ATOM   7169  C CE2 . TRP C 1 288 ? 12.649  58.820  48.500  1.00 40.01  ? 788 TRP C CE2 1 
ATOM   7170  C CE3 . TRP C 1 288 ? 13.771  56.902  49.475  1.00 29.98  ? 788 TRP C CE3 1 
ATOM   7171  C CZ2 . TRP C 1 288 ? 12.442  59.402  49.753  1.00 29.76  ? 788 TRP C CZ2 1 
ATOM   7172  C CZ3 . TRP C 1 288 ? 13.574  57.485  50.721  1.00 33.91  ? 788 TRP C CZ3 1 
ATOM   7173  C CH2 . TRP C 1 288 ? 12.912  58.725  50.846  1.00 37.42  ? 788 TRP C CH2 1 
ATOM   7174  N N   . GLY C 1 289 ? 13.318  52.787  45.054  1.00 40.22  ? 789 GLY C N   1 
ATOM   7175  C CA  . GLY C 1 289 ? 13.819  51.764  44.151  1.00 46.85  ? 789 GLY C CA  1 
ATOM   7176  C C   . GLY C 1 289 ? 15.321  51.562  44.223  1.00 46.59  ? 789 GLY C C   1 
ATOM   7177  O O   . GLY C 1 289 ? 16.045  52.387  44.776  1.00 48.64  ? 789 GLY C O   1 
ATOM   7178  N N   . SER C 1 290 ? 15.791  50.462  43.646  1.00 49.60  ? 790 SER C N   1 
ATOM   7179  C CA  . SER C 1 290 ? 17.182  50.040  43.798  1.00 58.40  ? 790 SER C CA  1 
ATOM   7180  C C   . SER C 1 290 ? 18.200  50.966  43.151  1.00 58.44  ? 790 SER C C   1 
ATOM   7181  O O   . SER C 1 290 ? 19.399  50.777  43.321  1.00 70.24  ? 790 SER C O   1 
ATOM   7182  C CB  . SER C 1 290 ? 17.372  48.639  43.226  1.00 68.00  ? 790 SER C CB  1 
ATOM   7183  O OG  . SER C 1 290 ? 17.127  48.643  41.830  1.00 72.37  ? 790 SER C OG  1 
ATOM   7184  N N   . LYS C 1 291 ? 17.744  51.957  42.401  1.00 53.05  ? 791 LYS C N   1 
ATOM   7185  C CA  . LYS C 1 291 ? 18.684  52.840  41.720  1.00 59.25  ? 791 LYS C CA  1 
ATOM   7186  C C   . LYS C 1 291 ? 18.592  54.269  42.242  1.00 61.12  ? 791 LYS C C   1 
ATOM   7187  O O   . LYS C 1 291 ? 19.611  54.907  42.522  1.00 61.51  ? 791 LYS C O   1 
ATOM   7188  C CB  . LYS C 1 291 ? 18.444  52.803  40.213  1.00 68.62  ? 791 LYS C CB  1 
ATOM   7189  C CG  . LYS C 1 291 ? 18.518  51.401  39.613  1.00 75.07  ? 791 LYS C CG  1 
ATOM   7190  C CD  . LYS C 1 291 ? 17.935  51.364  38.208  1.00 79.67  ? 791 LYS C CD  1 
ATOM   7191  C CE  . LYS C 1 291 ? 18.570  52.423  37.311  1.00 81.67  ? 791 LYS C CE  1 
ATOM   7192  N NZ  . LYS C 1 291 ? 20.052  52.268  37.231  1.00 80.81  ? 791 LYS C NZ  1 
ATOM   7193  N N   . GLY C 1 292 ? 17.361  54.752  42.393  1.00 57.92  ? 792 GLY C N   1 
ATOM   7194  C CA  . GLY C 1 292 ? 17.108  56.118  42.823  1.00 55.39  ? 792 GLY C CA  1 
ATOM   7195  C C   . GLY C 1 292 ? 17.233  56.348  44.319  1.00 52.95  ? 792 GLY C C   1 
ATOM   7196  O O   . GLY C 1 292 ? 17.205  57.490  44.784  1.00 48.74  ? 792 GLY C O   1 
ATOM   7197  N N   . ALA C 1 293 ? 17.380  55.264  45.076  1.00 48.26  ? 793 ALA C N   1 
ATOM   7198  C CA  . ALA C 1 293 ? 17.520  55.366  46.522  1.00 45.20  ? 793 ALA C CA  1 
ATOM   7199  C C   . ALA C 1 293 ? 18.814  56.074  46.932  1.00 59.85  ? 793 ALA C C   1 
ATOM   7200  O O   . ALA C 1 293 ? 18.962  56.471  48.093  1.00 54.88  ? 793 ALA C O   1 
ATOM   7201  C CB  . ALA C 1 293 ? 17.444  53.994  47.162  1.00 44.01  ? 793 ALA C CB  1 
ATOM   7202  N N   . GLN C 1 294 ? 19.750  56.230  45.993  1.00 66.05  ? 794 GLN C N   1 
ATOM   7203  C CA  . GLN C 1 294 ? 21.018  56.886  46.309  1.00 67.12  ? 794 GLN C CA  1 
ATOM   7204  C C   . GLN C 1 294 ? 21.133  58.314  45.759  1.00 62.76  ? 794 GLN C C   1 
ATOM   7205  O O   . GLN C 1 294 ? 22.193  58.933  45.830  1.00 60.04  ? 794 GLN C O   1 
ATOM   7206  C CB  . GLN C 1 294 ? 22.215  56.015  45.906  1.00 75.91  ? 794 GLN C CB  1 
ATOM   7207  C CG  . GLN C 1 294 ? 23.204  55.791  47.067  1.00 83.84  ? 794 GLN C CG  1 
ATOM   7208  C CD  . GLN C 1 294 ? 23.605  54.327  47.258  1.00 84.89  ? 794 GLN C CD  1 
ATOM   7209  O OE1 . GLN C 1 294 ? 23.441  53.753  48.344  1.00 66.20  ? 794 GLN C OE1 1 
ATOM   7210  N NE2 . GLN C 1 294 ? 24.146  53.722  46.202  1.00 96.10  ? 794 GLN C NE2 1 
ATOM   7211  N N   . VAL C 1 295 ? 20.026  58.832  45.231  1.00 60.68  ? 795 VAL C N   1 
ATOM   7212  C CA  . VAL C 1 295 ? 19.940  60.219  44.783  1.00 56.79  ? 795 VAL C CA  1 
ATOM   7213  C C   . VAL C 1 295 ? 19.935  61.145  45.993  1.00 56.23  ? 795 VAL C C   1 
ATOM   7214  O O   . VAL C 1 295 ? 19.440  60.778  47.060  1.00 60.86  ? 795 VAL C O   1 
ATOM   7215  C CB  . VAL C 1 295 ? 18.639  60.461  43.993  1.00 52.82  ? 795 VAL C CB  1 
ATOM   7216  C CG1 . VAL C 1 295 ? 18.553  61.908  43.532  1.00 50.42  ? 795 VAL C CG1 1 
ATOM   7217  C CG2 . VAL C 1 295 ? 18.550  59.508  42.819  1.00 47.91  ? 795 VAL C CG2 1 
ATOM   7218  N N   . ASN C 1 296 ? 20.463  62.351  45.833  1.00 47.10  ? 796 ASN C N   1 
ATOM   7219  C CA  . ASN C 1 296 ? 20.540  63.274  46.963  1.00 44.38  ? 796 ASN C CA  1 
ATOM   7220  C C   . ASN C 1 296 ? 19.185  63.452  47.663  1.00 42.96  ? 796 ASN C C   1 
ATOM   7221  O O   . ASN C 1 296 ? 18.132  63.351  47.028  1.00 40.72  ? 796 ASN C O   1 
ATOM   7222  C CB  . ASN C 1 296 ? 21.103  64.624  46.521  1.00 42.69  ? 796 ASN C CB  1 
ATOM   7223  C CG  . ASN C 1 296 ? 20.212  65.318  45.524  1.00 43.86  ? 796 ASN C CG  1 
ATOM   7224  O OD1 . ASN C 1 296 ? 19.228  65.950  45.900  1.00 49.18  ? 796 ASN C OD1 1 
ATOM   7225  N ND2 . ASN C 1 296 ? 20.535  65.187  44.242  1.00 40.26  ? 796 ASN C ND2 1 
ATOM   7226  N N   . GLN C 1 297 ? 19.223  63.715  48.971  1.00 41.20  ? 797 GLN C N   1 
ATOM   7227  C CA  . GLN C 1 297 ? 18.009  63.820  49.781  1.00 37.75  ? 797 GLN C CA  1 
ATOM   7228  C C   . GLN C 1 297 ? 17.003  64.829  49.244  1.00 40.64  ? 797 GLN C C   1 
ATOM   7229  O O   . GLN C 1 297 ? 15.800  64.564  49.229  1.00 43.83  ? 797 GLN C O   1 
ATOM   7230  C CB  . GLN C 1 297 ? 18.336  64.224  51.215  1.00 37.99  ? 797 GLN C CB  1 
ATOM   7231  C CG  . GLN C 1 297 ? 19.187  63.262  51.989  1.00 44.58  ? 797 GLN C CG  1 
ATOM   7232  C CD  . GLN C 1 297 ? 19.391  63.737  53.419  1.00 45.51  ? 797 GLN C CD  1 
ATOM   7233  O OE1 . GLN C 1 297 ? 19.977  64.796  53.660  1.00 44.67  ? 797 GLN C OE1 1 
ATOM   7234  N NE2 . GLN C 1 297 ? 18.877  62.972  54.371  1.00 42.65  ? 797 GLN C NE2 1 
ATOM   7235  N N   . THR C 1 298 ? 17.488  66.001  48.845  1.00 41.56  ? 798 THR C N   1 
ATOM   7236  C CA  . THR C 1 298 ? 16.590  67.108  48.518  1.00 50.78  ? 798 THR C CA  1 
ATOM   7237  C C   . THR C 1 298 ? 15.697  66.724  47.358  1.00 46.00  ? 798 THR C C   1 
ATOM   7238  O O   . THR C 1 298 ? 14.490  66.970  47.378  1.00 46.93  ? 798 THR C O   1 
ATOM   7239  C CB  . THR C 1 298 ? 17.357  68.384  48.151  1.00 51.95  ? 798 THR C CB  1 
ATOM   7240  O OG1 . THR C 1 298 ? 18.076  68.851  49.296  1.00 52.74  ? 798 THR C OG1 1 
ATOM   7241  C CG2 . THR C 1 298 ? 16.391  69.461  47.681  1.00 48.59  ? 798 THR C CG2 1 
ATOM   7242  N N   . GLU C 1 299 ? 16.314  66.104  46.357  1.00 43.19  ? 799 GLU C N   1 
ATOM   7243  C CA  . GLU C 1 299 ? 15.618  65.646  45.161  1.00 45.41  ? 799 GLU C CA  1 
ATOM   7244  C C   . GLU C 1 299 ? 14.742  64.432  45.453  1.00 38.20  ? 799 GLU C C   1 
ATOM   7245  O O   . GLU C 1 299 ? 13.716  64.234  44.813  1.00 40.98  ? 799 GLU C O   1 
ATOM   7246  C CB  . GLU C 1 299 ? 16.637  65.313  44.069  1.00 50.18  ? 799 GLU C CB  1 
ATOM   7247  C CG  . GLU C 1 299 ? 16.037  64.740  42.807  1.00 65.21  ? 799 GLU C CG  1 
ATOM   7248  C CD  . GLU C 1 299 ? 17.029  64.722  41.654  1.00 81.22  ? 799 GLU C CD  1 
ATOM   7249  O OE1 . GLU C 1 299 ? 16.915  63.825  40.789  1.00 82.03  ? 799 GLU C OE1 1 
ATOM   7250  O OE2 . GLU C 1 299 ? 17.916  65.608  41.612  1.00 87.29  ? 799 GLU C OE2 1 
ATOM   7251  N N   . ARG C 1 300 ? 15.163  63.613  46.412  1.00 34.18  ? 800 ARG C N   1 
ATOM   7252  C CA  . ARG C 1 300 ? 14.397  62.440  46.790  1.00 33.90  ? 800 ARG C CA  1 
ATOM   7253  C C   . ARG C 1 300 ? 13.123  62.847  47.515  1.00 30.95  ? 800 ARG C C   1 
ATOM   7254  O O   . ARG C 1 300 ? 12.078  62.219  47.342  1.00 35.80  ? 800 ARG C O   1 
ATOM   7255  C CB  . ARG C 1 300 ? 15.221  61.523  47.686  1.00 30.23  ? 800 ARG C CB  1 
ATOM   7256  C CG  . ARG C 1 300 ? 15.950  60.437  46.938  1.00 36.19  ? 800 ARG C CG  1 
ATOM   7257  C CD  . ARG C 1 300 ? 16.449  59.353  47.885  1.00 37.12  ? 800 ARG C CD  1 
ATOM   7258  N NE  . ARG C 1 300 ? 17.472  59.821  48.822  1.00 34.43  ? 800 ARG C NE  1 
ATOM   7259  C CZ  . ARG C 1 300 ? 17.318  59.865  50.148  1.00 38.11  ? 800 ARG C CZ  1 
ATOM   7260  N NH1 . ARG C 1 300 ? 16.174  59.482  50.715  1.00 26.44  ? 800 ARG C NH1 1 
ATOM   7261  N NH2 . ARG C 1 300 ? 18.317  60.296  50.914  1.00 36.73  ? 800 ARG C NH2 1 
ATOM   7262  N N   . TYR C 1 301 ? 13.215  63.894  48.330  1.00 29.08  ? 801 TYR C N   1 
ATOM   7263  C CA  . TYR C 1 301 ? 12.079  64.322  49.142  1.00 34.69  ? 801 TYR C CA  1 
ATOM   7264  C C   . TYR C 1 301 ? 11.091  65.133  48.329  1.00 35.17  ? 801 TYR C C   1 
ATOM   7265  O O   . TYR C 1 301 ? 9.876   64.961  48.470  1.00 30.93  ? 801 TYR C O   1 
ATOM   7266  C CB  . TYR C 1 301 ? 12.524  65.096  50.382  1.00 32.11  ? 801 TYR C CB  1 
ATOM   7267  C CG  . TYR C 1 301 ? 13.372  64.289  51.338  1.00 27.02  ? 801 TYR C CG  1 
ATOM   7268  C CD1 . TYR C 1 301 ? 13.368  62.897  51.306  1.00 25.41  ? 801 TYR C CD1 1 
ATOM   7269  C CD2 . TYR C 1 301 ? 14.194  64.919  52.257  1.00 23.66  ? 801 TYR C CD2 1 
ATOM   7270  C CE1 . TYR C 1 301 ? 14.155  62.160  52.176  1.00 29.56  ? 801 TYR C CE1 1 
ATOM   7271  C CE2 . TYR C 1 301 ? 14.984  64.194  53.133  1.00 27.34  ? 801 TYR C CE2 1 
ATOM   7272  C CZ  . TYR C 1 301 ? 14.960  62.816  53.093  1.00 34.44  ? 801 TYR C CZ  1 
ATOM   7273  O OH  . TYR C 1 301 ? 15.746  62.100  53.970  1.00 32.84  ? 801 TYR C OH  1 
ATOM   7274  N N   . GLU C 1 302 ? 11.619  66.001  47.470  1.00 38.75  ? 802 GLU C N   1 
ATOM   7275  C CA  . GLU C 1 302 ? 10.787  66.768  46.555  1.00 45.69  ? 802 GLU C CA  1 
ATOM   7276  C C   . GLU C 1 302 ? 9.989   65.818  45.662  1.00 49.40  ? 802 GLU C C   1 
ATOM   7277  O O   . GLU C 1 302 ? 8.805   66.043  45.397  1.00 48.98  ? 802 GLU C O   1 
ATOM   7278  C CB  . GLU C 1 302 ? 11.639  67.731  45.717  1.00 51.84  ? 802 GLU C CB  1 
ATOM   7279  C CG  . GLU C 1 302 ? 10.828  68.671  44.822  1.00 57.37  ? 802 GLU C CG  1 
ATOM   7280  C CD  . GLU C 1 302 ? 9.631   69.294  45.539  1.00 64.17  ? 802 GLU C CD  1 
ATOM   7281  O OE1 . GLU C 1 302 ? 9.800   69.820  46.664  1.00 63.69  ? 802 GLU C OE1 1 
ATOM   7282  O OE2 . GLU C 1 302 ? 8.515   69.245  44.974  1.00 67.11  ? 802 GLU C OE2 1 
ATOM   7283  N N   . LYS C 1 303 ? 10.640  64.750  45.214  1.00 49.95  ? 803 LYS C N   1 
ATOM   7284  C CA  . LYS C 1 303 ? 9.977   63.723  44.419  1.00 55.33  ? 803 LYS C CA  1 
ATOM   7285  C C   . LYS C 1 303 ? 8.725   63.200  45.129  1.00 47.35  ? 803 LYS C C   1 
ATOM   7286  O O   . LYS C 1 303 ? 7.681   63.014  44.512  1.00 51.46  ? 803 LYS C O   1 
ATOM   7287  C CB  . LYS C 1 303 ? 10.947  62.574  44.138  1.00 60.12  ? 803 LYS C CB  1 
ATOM   7288  C CG  . LYS C 1 303 ? 10.342  61.382  43.411  1.00 67.12  ? 803 LYS C CG  1 
ATOM   7289  C CD  . LYS C 1 303 ? 10.091  61.712  41.954  1.00 80.28  ? 803 LYS C CD  1 
ATOM   7290  C CE  . LYS C 1 303 ? 10.140  60.471  41.077  1.00 86.13  ? 803 LYS C CE  1 
ATOM   7291  N NZ  . LYS C 1 303 ? 10.110  60.852  39.635  1.00 89.58  ? 803 LYS C NZ  1 
ATOM   7292  N N   . PHE C 1 304 ? 8.827   62.965  46.431  1.00 38.48  ? 804 PHE C N   1 
ATOM   7293  C CA  . PHE C 1 304 ? 7.698   62.406  47.161  1.00 39.17  ? 804 PHE C CA  1 
ATOM   7294  C C   . PHE C 1 304 ? 6.714   63.459  47.613  1.00 34.29  ? 804 PHE C C   1 
ATOM   7295  O O   . PHE C 1 304 ? 5.545   63.164  47.852  1.00 37.65  ? 804 PHE C O   1 
ATOM   7296  C CB  . PHE C 1 304 ? 8.156   61.538  48.332  1.00 40.44  ? 804 PHE C CB  1 
ATOM   7297  C CG  . PHE C 1 304 ? 7.998   60.076  48.070  1.00 39.25  ? 804 PHE C CG  1 
ATOM   7298  C CD1 . PHE C 1 304 ? 6.830   59.422  48.423  1.00 33.06  ? 804 PHE C CD1 1 
ATOM   7299  C CD2 . PHE C 1 304 ? 8.996   59.366  47.425  1.00 43.87  ? 804 PHE C CD2 1 
ATOM   7300  C CE1 . PHE C 1 304 ? 6.662   58.078  48.158  1.00 39.13  ? 804 PHE C CE1 1 
ATOM   7301  C CE2 . PHE C 1 304 ? 8.837   58.019  47.154  1.00 49.19  ? 804 PHE C CE2 1 
ATOM   7302  C CZ  . PHE C 1 304 ? 7.667   57.372  47.522  1.00 46.63  ? 804 PHE C CZ  1 
ATOM   7303  N N   . ASN C 1 305 ? 7.190   64.692  47.729  1.00 36.15  ? 805 ASN C N   1 
ATOM   7304  C CA  . ASN C 1 305 ? 6.295   65.809  47.985  1.00 41.68  ? 805 ASN C CA  1 
ATOM   7305  C C   . ASN C 1 305 ? 5.292   65.846  46.840  1.00 41.57  ? 805 ASN C C   1 
ATOM   7306  O O   . ASN C 1 305 ? 4.080   65.960  47.059  1.00 43.04  ? 805 ASN C O   1 
ATOM   7307  C CB  . ASN C 1 305 ? 7.084   67.115  48.045  1.00 43.08  ? 805 ASN C CB  1 
ATOM   7308  C CG  . ASN C 1 305 ? 6.283   68.254  48.630  1.00 50.76  ? 805 ASN C CG  1 
ATOM   7309  O OD1 . ASN C 1 305 ? 6.850   69.192  49.188  1.00 62.83  ? 805 ASN C OD1 1 
ATOM   7310  N ND2 . ASN C 1 305 ? 4.961   68.176  48.522  1.00 46.38  ? 805 ASN C ND2 1 
ATOM   7311  N N   . GLN C 1 306 ? 5.819   65.711  45.621  1.00 35.61  ? 806 GLN C N   1 
ATOM   7312  C CA  . GLN C 1 306 ? 5.014   65.696  44.400  1.00 44.33  ? 806 GLN C CA  1 
ATOM   7313  C C   . GLN C 1 306 ? 4.213   64.410  44.241  1.00 46.09  ? 806 GLN C C   1 
ATOM   7314  O O   . GLN C 1 306 ? 3.028   64.439  43.901  1.00 47.80  ? 806 GLN C O   1 
ATOM   7315  C CB  . GLN C 1 306 ? 5.891   65.952  43.168  1.00 48.51  ? 806 GLN C CB  1 
ATOM   7316  C CG  . GLN C 1 306 ? 6.327   67.409  43.044  1.00 64.23  ? 806 GLN C CG  1 
ATOM   7317  C CD  . GLN C 1 306 ? 7.549   67.608  42.155  1.00 80.51  ? 806 GLN C CD  1 
ATOM   7318  O OE1 . GLN C 1 306 ? 8.000   66.686  41.471  1.00 86.71  ? 806 GLN C OE1 1 
ATOM   7319  N NE2 . GLN C 1 306 ? 8.092   68.824  42.167  1.00 81.81  ? 806 GLN C NE2 1 
ATOM   7320  N N   . ILE C 1 307 ? 4.839   63.273  44.500  1.00 42.72  ? 807 ILE C N   1 
ATOM   7321  C CA  . ILE C 1 307 ? 4.073   62.041  44.428  1.00 42.70  ? 807 ILE C CA  1 
ATOM   7322  C C   . ILE C 1 307 ? 2.876   62.068  45.380  1.00 38.28  ? 807 ILE C C   1 
ATOM   7323  O O   . ILE C 1 307 ? 1.761   61.819  44.964  1.00 41.44  ? 807 ILE C O   1 
ATOM   7324  C CB  . ILE C 1 307 ? 4.937   60.802  44.656  1.00 37.54  ? 807 ILE C CB  1 
ATOM   7325  C CG1 . ILE C 1 307 ? 5.767   60.529  43.398  1.00 33.51  ? 807 ILE C CG1 1 
ATOM   7326  C CG2 . ILE C 1 307 ? 4.054   59.620  44.983  1.00 31.31  ? 807 ILE C CG2 1 
ATOM   7327  C CD1 . ILE C 1 307 ? 6.763   59.410  43.535  1.00 37.50  ? 807 ILE C CD1 1 
ATOM   7328  N N   . LEU C 1 308 ? 3.108   62.401  46.646  1.00 40.92  ? 808 LEU C N   1 
ATOM   7329  C CA  . LEU C 1 308 ? 2.031   62.421  47.641  1.00 47.14  ? 808 LEU C CA  1 
ATOM   7330  C C   . LEU C 1 308 ? 0.943   63.444  47.326  1.00 46.92  ? 808 LEU C C   1 
ATOM   7331  O O   . LEU C 1 308 ? -0.235  63.197  47.570  1.00 42.75  ? 808 LEU C O   1 
ATOM   7332  C CB  . LEU C 1 308 ? 2.579   62.699  49.042  1.00 39.99  ? 808 LEU C CB  1 
ATOM   7333  C CG  . LEU C 1 308 ? 3.520   61.702  49.708  1.00 30.64  ? 808 LEU C CG  1 
ATOM   7334  C CD1 . LEU C 1 308 ? 3.937   62.296  51.040  1.00 31.91  ? 808 LEU C CD1 1 
ATOM   7335  C CD2 . LEU C 1 308 ? 2.845   60.338  49.905  1.00 19.60  ? 808 LEU C CD2 1 
ATOM   7336  N N   . THR C 1 309 ? 1.339   64.605  46.817  1.00 47.40  ? 809 THR C N   1 
ATOM   7337  C CA  . THR C 1 309 ? 0.365   65.612  46.435  1.00 50.16  ? 809 THR C CA  1 
ATOM   7338  C C   . THR C 1 309 ? -0.561  65.065  45.356  1.00 50.51  ? 809 THR C C   1 
ATOM   7339  O O   . THR C 1 309 ? -1.785  65.218  45.423  1.00 45.86  ? 809 THR C O   1 
ATOM   7340  C CB  . THR C 1 309 ? 1.046   66.867  45.889  1.00 50.05  ? 809 THR C CB  1 
ATOM   7341  O OG1 . THR C 1 309 ? 1.778   67.503  46.938  1.00 48.11  ? 809 THR C OG1 1 
ATOM   7342  C CG2 . THR C 1 309 ? 0.009   67.838  45.346  1.00 45.46  ? 809 THR C CG2 1 
ATOM   7343  N N   . ALA C 1 310 ? 0.033   64.424  44.357  1.00 51.93  ? 810 ALA C N   1 
ATOM   7344  C CA  . ALA C 1 310 ? -0.736  63.877  43.247  1.00 53.49  ? 810 ALA C CA  1 
ATOM   7345  C C   . ALA C 1 310 ? -1.707  62.816  43.743  1.00 46.42  ? 810 ALA C C   1 
ATOM   7346  O O   . ALA C 1 310 ? -2.878  62.805  43.369  1.00 50.51  ? 810 ALA C O   1 
ATOM   7347  C CB  . ALA C 1 310 ? 0.196   63.299  42.193  1.00 53.69  ? 810 ALA C CB  1 
ATOM   7348  N N   . LEU C 1 311 ? -1.204  61.928  44.592  1.00 46.69  ? 811 LEU C N   1 
ATOM   7349  C CA  . LEU C 1 311 ? -2.013  60.873  45.194  1.00 48.35  ? 811 LEU C CA  1 
ATOM   7350  C C   . LEU C 1 311 ? -3.170  61.425  46.013  1.00 44.68  ? 811 LEU C C   1 
ATOM   7351  O O   . LEU C 1 311 ? -4.269  60.877  46.000  1.00 44.32  ? 811 LEU C O   1 
ATOM   7352  C CB  . LEU C 1 311 ? -1.149  59.985  46.091  1.00 47.25  ? 811 LEU C CB  1 
ATOM   7353  C CG  . LEU C 1 311 ? -0.219  59.020  45.367  1.00 47.95  ? 811 LEU C CG  1 
ATOM   7354  C CD1 . LEU C 1 311 ? 0.589   58.190  46.362  1.00 37.36  ? 811 LEU C CD1 1 
ATOM   7355  C CD2 . LEU C 1 311 ? -1.047  58.132  44.455  1.00 53.59  ? 811 LEU C CD2 1 
ATOM   7356  N N   . SER C 1 312 ? -2.908  62.495  46.751  1.00 49.59  ? 812 SER C N   1 
ATOM   7357  C CA  . SER C 1 312 ? -3.922  63.073  47.614  1.00 50.02  ? 812 SER C CA  1 
ATOM   7358  C C   . SER C 1 312 ? -5.050  63.644  46.752  1.00 51.42  ? 812 SER C C   1 
ATOM   7359  O O   . SER C 1 312 ? -6.231  63.488  47.065  1.00 45.81  ? 812 SER C O   1 
ATOM   7360  C CB  . SER C 1 312 ? -3.301  64.150  48.506  1.00 41.85  ? 812 SER C CB  1 
ATOM   7361  O OG  . SER C 1 312 ? -4.212  64.562  49.507  1.00 45.56  ? 812 SER C OG  1 
ATOM   7362  N N   . ARG C 1 313 ? -4.670  64.276  45.647  1.00 51.01  ? 813 ARG C N   1 
ATOM   7363  C CA  . ARG C 1 313 ? -5.633  64.910  44.762  1.00 56.49  ? 813 ARG C CA  1 
ATOM   7364  C C   . ARG C 1 313 ? -6.412  63.899  43.933  1.00 57.83  ? 813 ARG C C   1 
ATOM   7365  O O   . ARG C 1 313 ? -7.555  64.157  43.563  1.00 57.74  ? 813 ARG C O   1 
ATOM   7366  C CB  . ARG C 1 313 ? -4.944  65.931  43.861  1.00 58.81  ? 813 ARG C CB  1 
ATOM   7367  C CG  . ARG C 1 313 ? -4.569  67.211  44.580  1.00 61.84  ? 813 ARG C CG  1 
ATOM   7368  C CD  . ARG C 1 313 ? -3.737  68.111  43.684  1.00 72.60  ? 813 ARG C CD  1 
ATOM   7369  N NE  . ARG C 1 313 ? -4.269  69.469  43.628  1.00 82.34  ? 813 ARG C NE  1 
ATOM   7370  C CZ  . ARG C 1 313 ? -5.256  69.850  42.823  1.00 92.76  ? 813 ARG C CZ  1 
ATOM   7371  N NH1 . ARG C 1 313 ? -5.828  68.973  42.005  1.00 94.68  ? 813 ARG C NH1 1 
ATOM   7372  N NH2 . ARG C 1 313 ? -5.677  71.109  42.835  1.00 96.81  ? 813 ARG C NH2 1 
ATOM   7373  N N   . LYS C 1 314 ? -5.803  62.754  43.639  1.00 57.41  ? 814 LYS C N   1 
ATOM   7374  C CA  . LYS C 1 314 ? -6.539  61.674  42.982  1.00 64.44  ? 814 LYS C CA  1 
ATOM   7375  C C   . LYS C 1 314 ? -7.573  61.083  43.940  1.00 56.96  ? 814 LYS C C   1 
ATOM   7376  O O   . LYS C 1 314 ? -8.763  61.026  43.626  1.00 55.22  ? 814 LYS C O   1 
ATOM   7377  C CB  . LYS C 1 314 ? -5.606  60.570  42.471  1.00 72.45  ? 814 LYS C CB  1 
ATOM   7378  C CG  . LYS C 1 314 ? -6.347  59.419  41.759  1.00 76.55  ? 814 LYS C CG  1 
ATOM   7379  C CD  . LYS C 1 314 ? -5.437  58.222  41.446  1.00 76.72  ? 814 LYS C CD  1 
ATOM   7380  C CE  . LYS C 1 314 ? -5.027  57.472  42.718  1.00 75.94  ? 814 LYS C CE  1 
ATOM   7381  N NZ  . LYS C 1 314 ? -3.995  56.408  42.491  1.00 70.87  ? 814 LYS C NZ  1 
ATOM   7382  N N   . LEU C 1 315 ? -7.102  60.648  45.107  1.00 47.81  ? 815 LEU C N   1 
ATOM   7383  C CA  . LEU C 1 315 ? -7.959  60.127  46.168  1.00 41.78  ? 815 LEU C CA  1 
ATOM   7384  C C   . LEU C 1 315 ? -9.165  60.999  46.509  1.00 46.04  ? 815 LEU C C   1 
ATOM   7385  O O   . LEU C 1 315 ? -10.256 60.486  46.702  1.00 42.84  ? 815 LEU C O   1 
ATOM   7386  C CB  . LEU C 1 315 ? -7.142  59.926  47.435  1.00 40.50  ? 815 LEU C CB  1 
ATOM   7387  C CG  . LEU C 1 315 ? -6.414  58.600  47.502  1.00 49.92  ? 815 LEU C CG  1 
ATOM   7388  C CD1 . LEU C 1 315 ? -5.835  58.402  48.896  1.00 58.31  ? 815 LEU C CD1 1 
ATOM   7389  C CD2 . LEU C 1 315 ? -7.405  57.510  47.169  1.00 44.16  ? 815 LEU C CD2 1 
ATOM   7390  N N   . GLU C 1 316 ? -8.953  62.310  46.628  1.00 56.04  ? 816 GLU C N   1 
ATOM   7391  C CA  . GLU C 1 316 ? -10.020 63.234  47.010  1.00 58.96  ? 816 GLU C CA  1 
ATOM   7392  C C   . GLU C 1 316 ? -9.817  64.591  46.374  1.00 61.34  ? 816 GLU C C   1 
ATOM   7393  O O   . GLU C 1 316 ? -9.273  65.494  47.002  1.00 62.04  ? 816 GLU C O   1 
ATOM   7394  C CB  . GLU C 1 316 ? -10.081 63.412  48.525  1.00 55.68  ? 816 GLU C CB  1 
ATOM   7395  C CG  . GLU C 1 316 ? -10.466 62.162  49.290  1.00 59.17  ? 816 GLU C CG  1 
ATOM   7396  C CD  . GLU C 1 316 ? -10.707 62.439  50.763  1.00 61.96  ? 816 GLU C CD  1 
ATOM   7397  O OE1 . GLU C 1 316 ? -11.016 63.601  51.107  1.00 57.29  ? 816 GLU C OE1 1 
ATOM   7398  O OE2 . GLU C 1 316 ? -10.590 61.498  51.577  1.00 70.77  ? 816 GLU C OE2 1 
ATOM   7399  N N   . PRO C 1 317 ? -10.269 64.747  45.124  1.00 62.45  ? 817 PRO C N   1 
ATOM   7400  C CA  . PRO C 1 317 ? -10.043 66.022  44.442  1.00 60.03  ? 817 PRO C CA  1 
ATOM   7401  C C   . PRO C 1 317 ? -10.826 67.150  45.100  1.00 56.41  ? 817 PRO C C   1 
ATOM   7402  O O   . PRO C 1 317 ? -11.707 66.908  45.931  1.00 57.98  ? 817 PRO C O   1 
ATOM   7403  C CB  . PRO C 1 317 ? -10.565 65.765  43.021  1.00 60.34  ? 817 PRO C CB  1 
ATOM   7404  C CG  . PRO C 1 317 ? -10.713 64.265  42.908  1.00 58.07  ? 817 PRO C CG  1 
ATOM   7405  C CD  . PRO C 1 317 ? -11.021 63.795  44.290  1.00 58.84  ? 817 PRO C CD  1 
ATOM   7406  N N   . PRO C 1 318 ? -10.485 68.386  44.742  1.00 59.85  ? 818 PRO C N   1 
ATOM   7407  C CA  . PRO C 1 318 ? -11.168 69.592  45.217  1.00 67.00  ? 818 PRO C CA  1 
ATOM   7408  C C   . PRO C 1 318 ? -12.233 70.071  44.231  1.00 67.02  ? 818 PRO C C   1 
ATOM   7409  O O   . PRO C 1 318 ? -12.936 71.034  44.539  1.00 73.08  ? 818 PRO C O   1 
ATOM   7410  C CB  . PRO C 1 318 ? -10.027 70.603  45.300  1.00 68.04  ? 818 PRO C CB  1 
ATOM   7411  C CG  . PRO C 1 318 ? -9.102  70.187  44.187  1.00 64.34  ? 818 PRO C CG  1 
ATOM   7412  C CD  . PRO C 1 318 ? -9.225  68.693  44.040  1.00 59.74  ? 818 PRO C CD  1 
ATOM   7413  N N   . THR D 1 11  ? 13.758  87.279  55.663  1.00 118.92 ? 511 THR D N   1 
ATOM   7414  C CA  . THR D 1 11  ? 13.828  88.627  55.097  1.00 124.78 ? 511 THR D CA  1 
ATOM   7415  C C   . THR D 1 11  ? 15.272  89.017  54.758  1.00 125.46 ? 511 THR D C   1 
ATOM   7416  O O   . THR D 1 11  ? 16.160  88.165  54.729  1.00 130.67 ? 511 THR D O   1 
ATOM   7417  C CB  . THR D 1 11  ? 13.230  89.675  56.062  1.00 121.78 ? 511 THR D CB  1 
ATOM   7418  O OG1 . THR D 1 11  ? 12.075  89.129  56.712  1.00 120.28 ? 511 THR D OG1 1 
ATOM   7419  C CG2 . THR D 1 11  ? 12.850  90.952  55.312  1.00 120.59 ? 511 THR D CG2 1 
ATOM   7420  N N   . VAL D 1 12  ? 15.498  90.301  54.491  1.00 116.40 ? 512 VAL D N   1 
ATOM   7421  C CA  . VAL D 1 12  ? 16.848  90.830  54.292  1.00 99.40  ? 512 VAL D CA  1 
ATOM   7422  C C   . VAL D 1 12  ? 17.134  91.805  55.441  1.00 78.00  ? 512 VAL D C   1 
ATOM   7423  O O   . VAL D 1 12  ? 16.276  92.005  56.304  1.00 70.33  ? 512 VAL D O   1 
ATOM   7424  C CB  . VAL D 1 12  ? 17.013  91.498  52.880  1.00 60.99  ? 512 VAL D CB  1 
ATOM   7425  C CG1 . VAL D 1 12  ? 16.036  92.676  52.681  1.00 50.41  ? 512 VAL D CG1 1 
ATOM   7426  C CG2 . VAL D 1 12  ? 18.467  91.911  52.628  1.00 65.90  ? 512 VAL D CG2 1 
ATOM   7427  N N   . SER D 1 13  ? 18.327  92.392  55.484  1.00 66.25  ? 513 SER D N   1 
ATOM   7428  C CA  . SER D 1 13  ? 18.587  93.409  56.500  1.00 57.22  ? 513 SER D CA  1 
ATOM   7429  C C   . SER D 1 13  ? 17.574  94.544  56.344  1.00 53.66  ? 513 SER D C   1 
ATOM   7430  O O   . SER D 1 13  ? 16.894  94.638  55.322  1.00 52.23  ? 513 SER D O   1 
ATOM   7431  C CB  . SER D 1 13  ? 20.039  93.926  56.460  1.00 54.72  ? 513 SER D CB  1 
ATOM   7432  O OG  . SER D 1 13  ? 20.534  94.109  55.140  1.00 55.19  ? 513 SER D OG  1 
ATOM   7433  N N   . SER D 1 14  ? 17.450  95.376  57.372  1.00 54.40  ? 514 SER D N   1 
ATOM   7434  C CA  . SER D 1 14  ? 16.566  96.535  57.326  1.00 52.04  ? 514 SER D CA  1 
ATOM   7435  C C   . SER D 1 14  ? 17.344  97.764  56.845  1.00 49.64  ? 514 SER D C   1 
ATOM   7436  O O   . SER D 1 14  ? 16.802  98.866  56.763  1.00 52.59  ? 514 SER D O   1 
ATOM   7437  C CB  . SER D 1 14  ? 15.949  96.788  58.703  1.00 46.08  ? 514 SER D CB  1 
ATOM   7438  O OG  . SER D 1 14  ? 16.922  97.259  59.612  1.00 48.32  ? 514 SER D OG  1 
ATOM   7439  N N   . PHE D 1 15  ? 18.620  97.565  56.526  1.00 44.03  ? 515 PHE D N   1 
ATOM   7440  C CA  . PHE D 1 15  ? 19.457  98.645  56.031  1.00 42.93  ? 515 PHE D CA  1 
ATOM   7441  C C   . PHE D 1 15  ? 19.056  98.949  54.597  1.00 56.08  ? 515 PHE D C   1 
ATOM   7442  O O   . PHE D 1 15  ? 18.789  98.033  53.825  1.00 61.60  ? 515 PHE D O   1 
ATOM   7443  C CB  . PHE D 1 15  ? 20.932  98.253  56.082  1.00 36.43  ? 515 PHE D CB  1 
ATOM   7444  C CG  . PHE D 1 15  ? 21.446  97.984  57.472  1.00 33.70  ? 515 PHE D CG  1 
ATOM   7445  C CD1 . PHE D 1 15  ? 21.822  96.701  57.855  1.00 28.06  ? 515 PHE D CD1 1 
ATOM   7446  C CD2 . PHE D 1 15  ? 21.554  99.010  58.398  1.00 33.18  ? 515 PHE D CD2 1 
ATOM   7447  C CE1 . PHE D 1 15  ? 22.309  96.444  59.145  1.00 31.70  ? 515 PHE D CE1 1 
ATOM   7448  C CE2 . PHE D 1 15  ? 22.035  98.765  59.689  1.00 32.75  ? 515 PHE D CE2 1 
ATOM   7449  C CZ  . PHE D 1 15  ? 22.417  97.473  60.061  1.00 33.90  ? 515 PHE D CZ  1 
ATOM   7450  N N   . ARG D 1 16  ? 19.006  100.232 54.246  1.00 57.48  ? 516 ARG D N   1 
ATOM   7451  C CA  . ARG D 1 16  ? 18.633  100.642 52.895  1.00 61.49  ? 516 ARG D CA  1 
ATOM   7452  C C   . ARG D 1 16  ? 19.708  101.551 52.281  1.00 60.01  ? 516 ARG D C   1 
ATOM   7453  O O   . ARG D 1 16  ? 19.529  102.765 52.208  1.00 62.04  ? 516 ARG D O   1 
ATOM   7454  C CB  . ARG D 1 16  ? 17.272  101.354 52.904  1.00 64.76  ? 516 ARG D CB  1 
ATOM   7455  C CG  . ARG D 1 16  ? 16.103  100.530 53.452  1.00 74.49  ? 516 ARG D CG  1 
ATOM   7456  C CD  . ARG D 1 16  ? 15.592  99.486  52.451  1.00 81.42  ? 516 ARG D CD  1 
ATOM   7457  N NE  . ARG D 1 16  ? 14.531  98.649  53.017  1.00 84.36  ? 516 ARG D NE  1 
ATOM   7458  C CZ  . ARG D 1 16  ? 14.735  97.464  53.589  1.00 84.82  ? 516 ARG D CZ  1 
ATOM   7459  N NH1 . ARG D 1 16  ? 15.963  96.971  53.665  1.00 82.81  ? 516 ARG D NH1 1 
ATOM   7460  N NH2 . ARG D 1 16  ? 13.717  96.767  54.083  1.00 82.50  ? 516 ARG D NH2 1 
ATOM   7461  N N   . PRO D 1 17  ? 20.829  100.962 51.837  1.00 54.93  ? 517 PRO D N   1 
ATOM   7462  C CA  . PRO D 1 17  ? 21.972  101.720 51.312  1.00 59.27  ? 517 PRO D CA  1 
ATOM   7463  C C   . PRO D 1 17  ? 21.655  102.587 50.092  1.00 66.50  ? 517 PRO D C   1 
ATOM   7464  O O   . PRO D 1 17  ? 22.143  103.717 50.015  1.00 64.82  ? 517 PRO D O   1 
ATOM   7465  C CB  . PRO D 1 17  ? 22.984  100.624 50.938  1.00 56.11  ? 517 PRO D CB  1 
ATOM   7466  C CG  . PRO D 1 17  ? 22.194  99.375  50.842  1.00 53.81  ? 517 PRO D CG  1 
ATOM   7467  C CD  . PRO D 1 17  ? 21.096  99.516  51.850  1.00 52.61  ? 517 PRO D CD  1 
ATOM   7468  N N   . ASN D 1 18  ? 20.864  102.076 49.154  1.00 68.94  ? 518 ASN D N   1 
ATOM   7469  C CA  . ASN D 1 18  ? 20.553  102.840 47.950  1.00 76.40  ? 518 ASN D CA  1 
ATOM   7470  C C   . ASN D 1 18  ? 19.768  104.111 48.251  1.00 73.28  ? 518 ASN D C   1 
ATOM   7471  O O   . ASN D 1 18  ? 19.765  105.048 47.457  1.00 72.66  ? 518 ASN D O   1 
ATOM   7472  C CB  . ASN D 1 18  ? 19.816  101.977 46.922  1.00 90.30  ? 518 ASN D CB  1 
ATOM   7473  C CG  . ASN D 1 18  ? 20.745  101.015 46.195  1.00 104.29 ? 518 ASN D CG  1 
ATOM   7474  O OD1 . ASN D 1 18  ? 21.902  100.835 46.585  1.00 109.05 ? 518 ASN D OD1 1 
ATOM   7475  N ND2 . ASN D 1 18  ? 20.240  100.388 45.134  1.00 107.82 ? 518 ASN D ND2 1 
ATOM   7476  N N   . GLU D 1 19  ? 19.117  104.137 49.409  1.00 75.44  ? 519 GLU D N   1 
ATOM   7477  C CA  . GLU D 1 19  ? 18.306  105.278 49.826  1.00 73.43  ? 519 GLU D CA  1 
ATOM   7478  C C   . GLU D 1 19  ? 18.985  106.061 50.944  1.00 66.25  ? 519 GLU D C   1 
ATOM   7479  O O   . GLU D 1 19  ? 18.362  106.925 51.566  1.00 65.97  ? 519 GLU D O   1 
ATOM   7480  C CB  . GLU D 1 19  ? 16.934  104.808 50.315  1.00 76.61  ? 519 GLU D CB  1 
ATOM   7481  C CG  . GLU D 1 19  ? 16.224  103.837 49.383  1.00 85.06  ? 519 GLU D CG  1 
ATOM   7482  C CD  . GLU D 1 19  ? 15.195  102.984 50.108  1.00 91.09  ? 519 GLU D CD  1 
ATOM   7483  O OE1 . GLU D 1 19  ? 14.820  103.339 51.249  1.00 91.65  ? 519 GLU D OE1 1 
ATOM   7484  O OE2 . GLU D 1 19  ? 14.772  101.953 49.542  1.00 92.09  ? 519 GLU D OE2 1 
ATOM   7485  N N   . PHE D 1 20  ? 20.254  105.750 51.205  1.00 55.22  ? 520 PHE D N   1 
ATOM   7486  C CA  . PHE D 1 20  ? 21.001  106.394 52.290  1.00 54.59  ? 520 PHE D CA  1 
ATOM   7487  C C   . PHE D 1 20  ? 21.694  107.678 51.808  1.00 53.48  ? 520 PHE D C   1 
ATOM   7488  O O   . PHE D 1 20  ? 22.296  107.710 50.731  1.00 56.19  ? 520 PHE D O   1 
ATOM   7489  C CB  . PHE D 1 20  ? 22.001  105.397 52.915  1.00 44.45  ? 520 PHE D CB  1 
ATOM   7490  C CG  . PHE D 1 20  ? 22.979  106.017 53.889  1.00 42.45  ? 520 PHE D CG  1 
ATOM   7491  C CD1 . PHE D 1 20  ? 22.620  106.248 55.210  1.00 44.63  ? 520 PHE D CD1 1 
ATOM   7492  C CD2 . PHE D 1 20  ? 24.271  106.343 53.487  1.00 43.32  ? 520 PHE D CD2 1 
ATOM   7493  C CE1 . PHE D 1 20  ? 23.526  106.814 56.113  1.00 42.91  ? 520 PHE D CE1 1 
ATOM   7494  C CE2 . PHE D 1 20  ? 25.186  106.903 54.384  1.00 41.13  ? 520 PHE D CE2 1 
ATOM   7495  C CZ  . PHE D 1 20  ? 24.810  107.139 55.698  1.00 40.14  ? 520 PHE D CZ  1 
ATOM   7496  N N   . GLU D 1 21  ? 21.588  108.741 52.601  1.00 47.37  ? 521 GLU D N   1 
ATOM   7497  C CA  . GLU D 1 21  ? 22.227  110.018 52.258  1.00 48.37  ? 521 GLU D CA  1 
ATOM   7498  C C   . GLU D 1 21  ? 23.222  110.476 53.325  1.00 48.91  ? 521 GLU D C   1 
ATOM   7499  O O   . GLU D 1 21  ? 22.980  110.324 54.522  1.00 55.03  ? 521 GLU D O   1 
ATOM   7500  C CB  . GLU D 1 21  ? 21.176  111.108 52.034  1.00 41.63  ? 521 GLU D CB  1 
ATOM   7501  C CG  . GLU D 1 21  ? 20.279  110.878 50.835  1.00 53.82  ? 521 GLU D CG  1 
ATOM   7502  C CD  . GLU D 1 21  ? 19.330  112.041 50.601  1.00 74.12  ? 521 GLU D CD  1 
ATOM   7503  O OE1 . GLU D 1 21  ? 19.813  113.197 50.513  1.00 80.27  ? 521 GLU D OE1 1 
ATOM   7504  O OE2 . GLU D 1 21  ? 18.104  111.801 50.516  1.00 79.19  ? 521 GLU D OE2 1 
ATOM   7505  N N   . SER D 1 22  ? 24.341  111.045 52.896  1.00 43.94  ? 522 SER D N   1 
ATOM   7506  C CA  . SER D 1 22  ? 25.335  111.508 53.853  1.00 46.80  ? 522 SER D CA  1 
ATOM   7507  C C   . SER D 1 22  ? 26.019  112.785 53.376  1.00 52.55  ? 522 SER D C   1 
ATOM   7508  O O   . SER D 1 22  ? 26.319  112.946 52.195  1.00 53.93  ? 522 SER D O   1 
ATOM   7509  C CB  . SER D 1 22  ? 26.370  110.407 54.137  1.00 44.11  ? 522 SER D CB  1 
ATOM   7510  O OG  . SER D 1 22  ? 27.337  110.824 55.095  1.00 33.59  ? 522 SER D OG  1 
ATOM   7511  N N   . LYS D 1 23  ? 26.244  113.705 54.302  1.00 57.90  ? 523 LYS D N   1 
ATOM   7512  C CA  . LYS D 1 23  ? 26.990  114.905 53.977  1.00 61.65  ? 523 LYS D CA  1 
ATOM   7513  C C   . LYS D 1 23  ? 28.366  114.502 53.428  1.00 63.13  ? 523 LYS D C   1 
ATOM   7514  O O   . LYS D 1 23  ? 28.971  115.235 52.641  1.00 62.01  ? 523 LYS D O   1 
ATOM   7515  C CB  . LYS D 1 23  ? 27.092  115.805 55.216  1.00 60.89  ? 523 LYS D CB  1 
ATOM   7516  C CG  . LYS D 1 23  ? 28.351  116.644 55.311  1.00 71.39  ? 523 LYS D CG  1 
ATOM   7517  C CD  . LYS D 1 23  ? 28.170  117.846 56.245  1.00 74.10  ? 523 LYS D CD  1 
ATOM   7518  C CE  . LYS D 1 23  ? 27.584  117.452 57.589  1.00 70.82  ? 523 LYS D CE  1 
ATOM   7519  N NZ  . LYS D 1 23  ? 27.195  118.642 58.404  1.00 71.87  ? 523 LYS D NZ  1 
ATOM   7520  N N   . PHE D 1 24  ? 28.820  113.305 53.811  1.00 60.66  ? 524 PHE D N   1 
ATOM   7521  C CA  . PHE D 1 24  ? 30.169  112.803 53.487  1.00 53.53  ? 524 PHE D CA  1 
ATOM   7522  C C   . PHE D 1 24  ? 30.227  111.836 52.299  1.00 53.04  ? 524 PHE D C   1 
ATOM   7523  O O   . PHE D 1 24  ? 31.302  111.364 51.919  1.00 45.68  ? 524 PHE D O   1 
ATOM   7524  C CB  . PHE D 1 24  ? 30.806  112.157 54.732  1.00 34.87  ? 524 PHE D CB  1 
ATOM   7525  C CG  . PHE D 1 24  ? 31.028  113.132 55.851  1.00 44.91  ? 524 PHE D CG  1 
ATOM   7526  C CD1 . PHE D 1 24  ? 32.169  113.927 55.880  1.00 48.17  ? 524 PHE D CD1 1 
ATOM   7527  C CD2 . PHE D 1 24  ? 30.081  113.294 56.846  1.00 52.20  ? 524 PHE D CD2 1 
ATOM   7528  C CE1 . PHE D 1 24  ? 32.371  114.843 56.893  1.00 47.11  ? 524 PHE D CE1 1 
ATOM   7529  C CE2 . PHE D 1 24  ? 30.272  114.209 57.862  1.00 56.99  ? 524 PHE D CE2 1 
ATOM   7530  C CZ  . PHE D 1 24  ? 31.423  114.987 57.888  1.00 55.29  ? 524 PHE D CZ  1 
ATOM   7531  N N   . LEU D 1 25  ? 29.069  111.560 51.711  1.00 59.26  ? 525 LEU D N   1 
ATOM   7532  C CA  . LEU D 1 25  ? 28.969  110.605 50.618  1.00 64.94  ? 525 LEU D CA  1 
ATOM   7533  C C   . LEU D 1 25  ? 28.396  111.251 49.357  1.00 69.87  ? 525 LEU D C   1 
ATOM   7534  O O   . LEU D 1 25  ? 27.423  112.005 49.412  1.00 75.67  ? 525 LEU D O   1 
ATOM   7535  C CB  . LEU D 1 25  ? 28.087  109.427 51.038  1.00 63.56  ? 525 LEU D CB  1 
ATOM   7536  C CG  . LEU D 1 25  ? 28.491  108.026 50.583  1.00 60.19  ? 525 LEU D CG  1 
ATOM   7537  C CD1 . LEU D 1 25  ? 29.905  107.704 51.042  1.00 50.60  ? 525 LEU D CD1 1 
ATOM   7538  C CD2 . LEU D 1 25  ? 27.505  107.016 51.130  1.00 56.73  ? 525 LEU D CD2 1 
ATOM   7539  N N   . PRO D 1 26  ? 29.012  110.966 48.211  1.00 65.21  ? 526 PRO D N   1 
ATOM   7540  C CA  . PRO D 1 26  ? 28.441  111.367 46.927  1.00 63.44  ? 526 PRO D CA  1 
ATOM   7541  C C   . PRO D 1 26  ? 27.150  110.601 46.673  1.00 67.33  ? 526 PRO D C   1 
ATOM   7542  O O   . PRO D 1 26  ? 27.111  109.378 46.838  1.00 71.64  ? 526 PRO D O   1 
ATOM   7543  C CB  . PRO D 1 26  ? 29.504  110.924 45.920  1.00 67.34  ? 526 PRO D CB  1 
ATOM   7544  C CG  . PRO D 1 26  ? 30.756  110.796 46.713  1.00 73.37  ? 526 PRO D CG  1 
ATOM   7545  C CD  . PRO D 1 26  ? 30.327  110.331 48.061  1.00 70.43  ? 526 PRO D CD  1 
ATOM   7546  N N   . PRO D 1 27  ? 26.098  111.320 46.279  1.00 60.56  ? 527 PRO D N   1 
ATOM   7547  C CA  . PRO D 1 27  ? 24.790  110.784 45.899  1.00 59.80  ? 527 PRO D CA  1 
ATOM   7548  C C   . PRO D 1 27  ? 24.891  109.625 44.911  1.00 67.01  ? 527 PRO D C   1 
ATOM   7549  O O   . PRO D 1 27  ? 24.253  108.602 45.122  1.00 73.53  ? 527 PRO D O   1 
ATOM   7550  C CB  . PRO D 1 27  ? 24.100  111.984 45.237  1.00 62.09  ? 527 PRO D CB  1 
ATOM   7551  C CG  . PRO D 1 27  ? 25.202  113.005 44.989  1.00 60.99  ? 527 PRO D CG  1 
ATOM   7552  C CD  . PRO D 1 27  ? 26.159  112.778 46.114  1.00 63.59  ? 527 PRO D CD  1 
ATOM   7553  N N   . GLU D 1 28  ? 25.645  109.788 43.831  1.00 74.78  ? 528 GLU D N   1 
ATOM   7554  C CA  . GLU D 1 28  ? 25.969  108.644 42.987  1.00 84.43  ? 528 GLU D CA  1 
ATOM   7555  C C   . GLU D 1 28  ? 27.288  108.129 43.508  1.00 72.27  ? 528 GLU D C   1 
ATOM   7556  O O   . GLU D 1 28  ? 28.167  108.910 43.871  1.00 75.58  ? 528 GLU D O   1 
ATOM   7557  C CB  . GLU D 1 28  ? 26.104  109.033 41.512  1.00 107.24 ? 528 GLU D CB  1 
ATOM   7558  C CG  . GLU D 1 28  ? 26.169  107.837 40.539  1.00 121.54 ? 528 GLU D CG  1 
ATOM   7559  C CD  . GLU D 1 28  ? 27.430  106.981 40.701  1.00 128.51 ? 528 GLU D CD  1 
ATOM   7560  O OE1 . GLU D 1 28  ? 28.544  107.550 40.745  1.00 132.82 ? 528 GLU D OE1 1 
ATOM   7561  O OE2 . GLU D 1 28  ? 27.302  105.739 40.773  1.00 126.67 ? 528 GLU D OE2 1 
ATOM   7562  N N   . ASN D 1 29  ? 27.441  106.820 43.547  1.00 59.18  ? 529 ASN D N   1 
ATOM   7563  C CA  . ASN D 1 29  ? 28.574  106.257 44.249  1.00 58.40  ? 529 ASN D CA  1 
ATOM   7564  C C   . ASN D 1 29  ? 29.064  105.028 43.520  1.00 55.63  ? 529 ASN D C   1 
ATOM   7565  O O   . ASN D 1 29  ? 28.278  104.134 43.227  1.00 61.37  ? 529 ASN D O   1 
ATOM   7566  C CB  . ASN D 1 29  ? 28.118  105.879 45.657  1.00 63.95  ? 529 ASN D CB  1 
ATOM   7567  C CG  . ASN D 1 29  ? 29.260  105.558 46.582  1.00 64.14  ? 529 ASN D CG  1 
ATOM   7568  O OD1 . ASN D 1 29  ? 30.243  104.922 46.195  1.00 62.72  ? 529 ASN D OD1 1 
ATOM   7569  N ND2 . ASN D 1 29  ? 29.132  105.993 47.829  1.00 68.97  ? 529 ASN D ND2 1 
ATOM   7570  N N   . LYS D 1 30  ? 30.351  104.979 43.205  1.00 50.65  ? 530 LYS D N   1 
ATOM   7571  C CA  . LYS D 1 30  ? 30.896  103.774 42.592  1.00 53.58  ? 530 LYS D CA  1 
ATOM   7572  C C   . LYS D 1 30  ? 31.496  102.894 43.675  1.00 48.08  ? 530 LYS D C   1 
ATOM   7573  O O   . LYS D 1 30  ? 31.878  103.392 44.732  1.00 46.60  ? 530 LYS D O   1 
ATOM   7574  C CB  . LYS D 1 30  ? 31.938  104.114 41.519  1.00 60.18  ? 530 LYS D CB  1 
ATOM   7575  C CG  . LYS D 1 30  ? 31.363  104.796 40.270  1.00 65.98  ? 530 LYS D CG  1 
ATOM   7576  C CD  . LYS D 1 30  ? 30.292  103.942 39.591  1.00 75.21  ? 530 LYS D CD  1 
ATOM   7577  C CE  . LYS D 1 30  ? 29.835  104.569 38.269  1.00 82.23  ? 530 LYS D CE  1 
ATOM   7578  N NZ  . LYS D 1 30  ? 30.933  104.660 37.250  1.00 79.35  ? 530 LYS D NZ  1 
ATOM   7579  N N   . PRO D 1 31  ? 31.563  101.576 43.428  1.00 51.21  ? 531 PRO D N   1 
ATOM   7580  C CA  . PRO D 1 31  ? 32.190  100.688 44.415  1.00 48.07  ? 531 PRO D CA  1 
ATOM   7581  C C   . PRO D 1 31  ? 33.664  101.006 44.605  1.00 53.16  ? 531 PRO D C   1 
ATOM   7582  O O   . PRO D 1 31  ? 34.396  101.186 43.624  1.00 53.99  ? 531 PRO D O   1 
ATOM   7583  C CB  . PRO D 1 31  ? 32.029  99.292  43.801  1.00 45.88  ? 531 PRO D CB  1 
ATOM   7584  C CG  . PRO D 1 31  ? 31.738  99.531  42.349  1.00 52.23  ? 531 PRO D CG  1 
ATOM   7585  C CD  . PRO D 1 31  ? 30.994  100.833 42.294  1.00 52.57  ? 531 PRO D CD  1 
ATOM   7586  N N   . LEU D 1 32  ? 34.083  101.093 45.863  1.00 48.79  ? 532 LEU D N   1 
ATOM   7587  C CA  . LEU D 1 32  ? 35.488  101.262 46.191  1.00 42.97  ? 532 LEU D CA  1 
ATOM   7588  C C   . LEU D 1 32  ? 36.071  102.521 45.543  1.00 44.99  ? 532 LEU D C   1 
ATOM   7589  O O   . LEU D 1 32  ? 37.248  102.568 45.203  1.00 39.67  ? 532 LEU D O   1 
ATOM   7590  C CB  . LEU D 1 32  ? 36.266  100.011 45.771  1.00 36.09  ? 532 LEU D CB  1 
ATOM   7591  C CG  . LEU D 1 32  ? 35.794  98.729  46.470  1.00 37.61  ? 532 LEU D CG  1 
ATOM   7592  C CD1 . LEU D 1 32  ? 36.412  97.492  45.850  1.00 34.60  ? 532 LEU D CD1 1 
ATOM   7593  C CD2 . LEU D 1 32  ? 36.098  98.783  47.968  1.00 33.59  ? 532 LEU D CD2 1 
ATOM   7594  N N   . GLU D 1 33  ? 35.244  103.545 45.375  1.00 50.72  ? 533 GLU D N   1 
ATOM   7595  C CA  . GLU D 1 33  ? 35.735  104.795 44.813  1.00 52.84  ? 533 GLU D CA  1 
ATOM   7596  C C   . GLU D 1 33  ? 37.008  105.192 45.536  1.00 55.74  ? 533 GLU D C   1 
ATOM   7597  O O   . GLU D 1 33  ? 37.018  105.465 46.741  1.00 51.94  ? 533 GLU D O   1 
ATOM   7598  C CB  . GLU D 1 33  ? 34.700  105.905 44.906  1.00 53.10  ? 533 GLU D CB  1 
ATOM   7599  C CG  . GLU D 1 33  ? 34.740  106.868 43.734  1.00 63.55  ? 533 GLU D CG  1 
ATOM   7600  C CD  . GLU D 1 33  ? 33.374  107.451 43.433  1.00 74.57  ? 533 GLU D CD  1 
ATOM   7601  O OE1 . GLU D 1 33  ? 32.691  107.888 44.381  1.00 82.49  ? 533 GLU D OE1 1 
ATOM   7602  O OE2 . GLU D 1 33  ? 32.968  107.458 42.253  1.00 79.88  ? 533 GLU D OE2 1 
ATOM   7603  N N   . THR D 1 34  ? 38.086  105.196 44.772  1.00 56.22  ? 534 THR D N   1 
ATOM   7604  C CA  . THR D 1 34  ? 39.408  105.474 45.282  1.00 54.25  ? 534 THR D CA  1 
ATOM   7605  C C   . THR D 1 34  ? 39.440  106.696 46.213  1.00 49.70  ? 534 THR D C   1 
ATOM   7606  O O   . THR D 1 34  ? 39.998  106.634 47.306  1.00 41.54  ? 534 THR D O   1 
ATOM   7607  C CB  . THR D 1 34  ? 40.375  105.654 44.107  1.00 58.89  ? 534 THR D CB  1 
ATOM   7608  O OG1 . THR D 1 34  ? 41.681  105.958 44.604  1.00 59.83  ? 534 THR D OG1 1 
ATOM   7609  C CG2 . THR D 1 34  ? 39.887  106.772 43.187  1.00 67.02  ? 534 THR D CG2 1 
ATOM   7610  N N   . ALA D 1 35  ? 38.832  107.798 45.784  1.00 50.52  ? 535 ALA D N   1 
ATOM   7611  C CA  . ALA D 1 35  ? 38.790  109.007 46.597  1.00 40.18  ? 535 ALA D CA  1 
ATOM   7612  C C   . ALA D 1 35  ? 38.104  108.774 47.941  1.00 39.47  ? 535 ALA D C   1 
ATOM   7613  O O   . ALA D 1 35  ? 38.626  109.160 48.981  1.00 43.28  ? 535 ALA D O   1 
ATOM   7614  C CB  . ALA D 1 35  ? 38.114  110.128 45.843  1.00 42.57  ? 535 ALA D CB  1 
ATOM   7615  N N   . LEU D 1 36  ? 36.939  108.136 47.925  1.00 42.19  ? 536 LEU D N   1 
ATOM   7616  C CA  . LEU D 1 36  ? 36.225  107.840 49.168  1.00 38.56  ? 536 LEU D CA  1 
ATOM   7617  C C   . LEU D 1 36  ? 37.050  106.998 50.133  1.00 45.30  ? 536 LEU D C   1 
ATOM   7618  O O   . LEU D 1 36  ? 37.063  107.262 51.334  1.00 49.23  ? 536 LEU D O   1 
ATOM   7619  C CB  . LEU D 1 36  ? 34.884  107.163 48.889  1.00 34.38  ? 536 LEU D CB  1 
ATOM   7620  C CG  . LEU D 1 36  ? 33.916  108.011 48.075  1.00 41.95  ? 536 LEU D CG  1 
ATOM   7621  C CD1 . LEU D 1 36  ? 32.514  107.512 48.270  1.00 43.59  ? 536 LEU D CD1 1 
ATOM   7622  C CD2 . LEU D 1 36  ? 34.018  109.460 48.520  1.00 49.28  ? 536 LEU D CD2 1 
ATOM   7623  N N   . LEU D 1 37  ? 37.737  105.987 49.608  1.00 44.51  ? 537 LEU D N   1 
ATOM   7624  C CA  . LEU D 1 37  ? 38.637  105.176 50.426  1.00 41.44  ? 537 LEU D CA  1 
ATOM   7625  C C   . LEU D 1 37  ? 39.806  105.998 51.002  1.00 42.94  ? 537 LEU D C   1 
ATOM   7626  O O   . LEU D 1 37  ? 40.165  105.843 52.173  1.00 36.87  ? 537 LEU D O   1 
ATOM   7627  C CB  . LEU D 1 37  ? 39.172  103.977 49.632  1.00 39.23  ? 537 LEU D CB  1 
ATOM   7628  C CG  . LEU D 1 37  ? 38.156  102.968 49.084  1.00 43.39  ? 537 LEU D CG  1 
ATOM   7629  C CD1 . LEU D 1 37  ? 38.868  101.769 48.487  1.00 44.02  ? 537 LEU D CD1 1 
ATOM   7630  C CD2 . LEU D 1 37  ? 37.197  102.502 50.155  1.00 32.86  ? 537 LEU D CD2 1 
ATOM   7631  N N   . LYS D 1 38  ? 40.404  106.861 50.182  1.00 40.49  ? 538 LYS D N   1 
ATOM   7632  C CA  . LYS D 1 38  ? 41.475  107.727 50.660  1.00 44.71  ? 538 LYS D CA  1 
ATOM   7633  C C   . LYS D 1 38  ? 40.979  108.531 51.865  1.00 47.80  ? 538 LYS D C   1 
ATOM   7634  O O   . LYS D 1 38  ? 41.671  108.643 52.885  1.00 43.95  ? 538 LYS D O   1 
ATOM   7635  C CB  . LYS D 1 38  ? 41.957  108.668 49.550  1.00 57.39  ? 538 LYS D CB  1 
ATOM   7636  C CG  . LYS D 1 38  ? 43.112  109.586 49.963  1.00 67.85  ? 538 LYS D CG  1 
ATOM   7637  C CD  . LYS D 1 38  ? 43.425  110.666 48.917  1.00 76.39  ? 538 LYS D CD  1 
ATOM   7638  C CE  . LYS D 1 38  ? 44.306  110.145 47.785  1.00 81.21  ? 538 LYS D CE  1 
ATOM   7639  N NZ  . LYS D 1 38  ? 44.740  111.243 46.867  1.00 83.42  ? 538 LYS D NZ  1 
ATOM   7640  N N   . ARG D 1 39  ? 39.768  109.070 51.740  1.00 46.48  ? 539 ARG D N   1 
ATOM   7641  C CA  . ARG D 1 39  ? 39.153  109.861 52.799  1.00 45.84  ? 539 ARG D CA  1 
ATOM   7642  C C   . ARG D 1 39  ? 38.904  109.047 54.069  1.00 45.53  ? 539 ARG D C   1 
ATOM   7643  O O   . ARG D 1 39  ? 39.121  109.533 55.178  1.00 45.53  ? 539 ARG D O   1 
ATOM   7644  C CB  . ARG D 1 39  ? 37.841  110.474 52.312  1.00 41.65  ? 539 ARG D CB  1 
ATOM   7645  C CG  . ARG D 1 39  ? 37.306  111.572 53.206  1.00 45.35  ? 539 ARG D CG  1 
ATOM   7646  C CD  . ARG D 1 39  ? 37.707  112.957 52.694  1.00 61.68  ? 539 ARG D CD  1 
ATOM   7647  N NE  . ARG D 1 39  ? 36.815  113.473 51.651  1.00 62.84  ? 539 ARG D NE  1 
ATOM   7648  C CZ  . ARG D 1 39  ? 35.525  113.169 51.545  1.00 48.99  ? 539 ARG D CZ  1 
ATOM   7649  N NH1 . ARG D 1 39  ? 34.959  112.352 52.416  1.00 51.72  ? 539 ARG D NH1 1 
ATOM   7650  N NH2 . ARG D 1 39  ? 34.798  113.685 50.571  1.00 41.34  ? 539 ARG D NH2 1 
ATOM   7651  N N   . ALA D 1 40  ? 38.434  107.815 53.913  1.00 41.55  ? 540 ALA D N   1 
ATOM   7652  C CA  . ALA D 1 40  ? 38.168  106.978 55.080  1.00 39.70  ? 540 ALA D CA  1 
ATOM   7653  C C   . ALA D 1 40  ? 39.476  106.568 55.772  1.00 46.71  ? 540 ALA D C   1 
ATOM   7654  O O   . ALA D 1 40  ? 39.569  106.550 57.005  1.00 48.46  ? 540 ALA D O   1 
ATOM   7655  C CB  . ALA D 1 40  ? 37.342  105.749 54.689  1.00 28.04  ? 540 ALA D CB  1 
ATOM   7656  N N   . LYS D 1 41  ? 40.484  106.244 54.970  1.00 42.34  ? 541 LYS D N   1 
ATOM   7657  C CA  . LYS D 1 41  ? 41.791  105.878 55.491  1.00 46.99  ? 541 LYS D CA  1 
ATOM   7658  C C   . LYS D 1 41  ? 42.404  107.027 56.299  1.00 45.15  ? 541 LYS D C   1 
ATOM   7659  O O   . LYS D 1 41  ? 42.917  106.823 57.400  1.00 35.82  ? 541 LYS D O   1 
ATOM   7660  C CB  . LYS D 1 41  ? 42.714  105.468 54.344  1.00 56.07  ? 541 LYS D CB  1 
ATOM   7661  C CG  . LYS D 1 41  ? 44.052  104.904 54.786  1.00 61.00  ? 541 LYS D CG  1 
ATOM   7662  C CD  . LYS D 1 41  ? 43.880  103.640 55.608  1.00 64.18  ? 541 LYS D CD  1 
ATOM   7663  C CE  . LYS D 1 41  ? 45.228  102.997 55.869  1.00 74.62  ? 541 LYS D CE  1 
ATOM   7664  N NZ  . LYS D 1 41  ? 45.108  101.782 56.711  1.00 83.61  ? 541 LYS D NZ  1 
ATOM   7665  N N   . GLU D 1 42  ? 42.347  108.237 55.756  1.00 35.23  ? 542 GLU D N   1 
ATOM   7666  C CA  . GLU D 1 42  ? 42.848  109.401 56.479  1.00 45.24  ? 542 GLU D CA  1 
ATOM   7667  C C   . GLU D 1 42  ? 42.105  109.678 57.796  1.00 37.77  ? 542 GLU D C   1 
ATOM   7668  O O   . GLU D 1 42  ? 42.705  110.128 58.775  1.00 31.89  ? 542 GLU D O   1 
ATOM   7669  C CB  . GLU D 1 42  ? 42.861  110.629 55.574  1.00 52.97  ? 542 GLU D CB  1 
ATOM   7670  C CG  . GLU D 1 42  ? 44.059  110.651 54.659  1.00 67.73  ? 542 GLU D CG  1 
ATOM   7671  C CD  . GLU D 1 42  ? 43.866  111.566 53.479  1.00 83.05  ? 542 GLU D CD  1 
ATOM   7672  O OE1 . GLU D 1 42  ? 43.042  112.503 53.579  1.00 86.05  ? 542 GLU D OE1 1 
ATOM   7673  O OE2 . GLU D 1 42  ? 44.533  111.338 52.446  1.00 87.58  ? 542 GLU D OE2 1 
ATOM   7674  N N   . LEU D 1 43  ? 40.808  109.395 57.816  1.00 39.52  ? 543 LEU D N   1 
ATOM   7675  C CA  . LEU D 1 43  ? 40.012  109.503 59.033  1.00 42.22  ? 543 LEU D CA  1 
ATOM   7676  C C   . LEU D 1 43  ? 40.570  108.585 60.128  1.00 44.37  ? 543 LEU D C   1 
ATOM   7677  O O   . LEU D 1 43  ? 40.767  109.009 61.267  1.00 47.62  ? 543 LEU D O   1 
ATOM   7678  C CB  . LEU D 1 43  ? 38.549  109.155 58.739  1.00 36.72  ? 543 LEU D CB  1 
ATOM   7679  C CG  . LEU D 1 43  ? 37.555  109.392 59.872  1.00 45.19  ? 543 LEU D CG  1 
ATOM   7680  C CD1 . LEU D 1 43  ? 37.699  110.811 60.418  1.00 43.80  ? 543 LEU D CD1 1 
ATOM   7681  C CD2 . LEU D 1 43  ? 36.126  109.122 59.400  1.00 52.12  ? 543 LEU D CD2 1 
ATOM   7682  N N   . PHE D 1 44  ? 40.838  107.332 59.771  1.00 41.99  ? 544 PHE D N   1 
ATOM   7683  C CA  . PHE D 1 44  ? 41.352  106.354 60.731  1.00 44.62  ? 544 PHE D CA  1 
ATOM   7684  C C   . PHE D 1 44  ? 42.792  106.656 61.114  1.00 39.22  ? 544 PHE D C   1 
ATOM   7685  O O   . PHE D 1 44  ? 43.228  106.356 62.225  1.00 38.44  ? 544 PHE D O   1 
ATOM   7686  C CB  . PHE D 1 44  ? 41.209  104.923 60.191  1.00 48.03  ? 544 PHE D CB  1 
ATOM   7687  C CG  . PHE D 1 44  ? 39.768  104.455 60.070  1.00 55.69  ? 544 PHE D CG  1 
ATOM   7688  C CD1 . PHE D 1 44  ? 38.813  104.834 61.011  1.00 57.47  ? 544 PHE D CD1 1 
ATOM   7689  C CD2 . PHE D 1 44  ? 39.366  103.647 59.010  1.00 54.62  ? 544 PHE D CD2 1 
ATOM   7690  C CE1 . PHE D 1 44  ? 37.491  104.407 60.905  1.00 54.30  ? 544 PHE D CE1 1 
ATOM   7691  C CE2 . PHE D 1 44  ? 38.041  103.218 58.897  1.00 45.29  ? 544 PHE D CE2 1 
ATOM   7692  C CZ  . PHE D 1 44  ? 37.107  103.599 59.846  1.00 51.12  ? 544 PHE D CZ  1 
ATOM   7693  N N   . THR D 1 45  ? 43.523  107.275 60.196  1.00 41.23  ? 545 THR D N   1 
ATOM   7694  C CA  . THR D 1 45  ? 44.904  107.660 60.459  1.00 45.76  ? 545 THR D CA  1 
ATOM   7695  C C   . THR D 1 45  ? 44.984  108.823 61.454  1.00 46.14  ? 545 THR D C   1 
ATOM   7696  O O   . THR D 1 45  ? 45.815  108.821 62.360  1.00 39.67  ? 545 THR D O   1 
ATOM   7697  C CB  . THR D 1 45  ? 45.640  108.030 59.156  1.00 51.05  ? 545 THR D CB  1 
ATOM   7698  O OG1 . THR D 1 45  ? 45.832  106.852 58.364  1.00 59.04  ? 545 THR D OG1 1 
ATOM   7699  C CG2 . THR D 1 45  ? 46.997  108.635 59.461  1.00 43.12  ? 545 THR D CG2 1 
ATOM   7700  N N   . ASN D 1 46  ? 44.104  109.805 61.292  1.00 46.50  ? 546 ASN D N   1 
ATOM   7701  C CA  . ASN D 1 46  ? 44.152  111.010 62.109  1.00 47.39  ? 546 ASN D CA  1 
ATOM   7702  C C   . ASN D 1 46  ? 43.570  110.827 63.498  1.00 50.05  ? 546 ASN D C   1 
ATOM   7703  O O   . ASN D 1 46  ? 43.624  111.735 64.324  1.00 50.44  ? 546 ASN D O   1 
ATOM   7704  C CB  . ASN D 1 46  ? 43.428  112.161 61.415  1.00 51.67  ? 546 ASN D CB  1 
ATOM   7705  C CG  . ASN D 1 46  ? 44.068  112.541 60.099  1.00 55.37  ? 546 ASN D CG  1 
ATOM   7706  O OD1 . ASN D 1 46  ? 45.222  112.185 59.826  1.00 57.26  ? 546 ASN D OD1 1 
ATOM   7707  N ND2 . ASN D 1 46  ? 43.323  113.277 59.269  1.00 48.25  ? 546 ASN D ND2 1 
ATOM   7708  N N   . ASN D 1 47  ? 43.005  109.658 63.760  1.00 49.11  ? 547 ASN D N   1 
ATOM   7709  C CA  . ASN D 1 47  ? 42.372  109.425 65.050  1.00 38.56  ? 547 ASN D CA  1 
ATOM   7710  C C   . ASN D 1 47  ? 43.011  108.288 65.846  1.00 28.74  ? 547 ASN D C   1 
ATOM   7711  O O   . ASN D 1 47  ? 43.470  107.305 65.275  1.00 43.63  ? 547 ASN D O   1 
ATOM   7712  C CB  . ASN D 1 47  ? 40.871  109.211 64.860  1.00 35.65  ? 547 ASN D CB  1 
ATOM   7713  C CG  . ASN D 1 47  ? 40.140  110.498 64.489  1.00 36.88  ? 547 ASN D CG  1 
ATOM   7714  O OD1 . ASN D 1 47  ? 39.891  111.350 65.349  1.00 29.03  ? 547 ASN D OD1 1 
ATOM   7715  N ND2 . ASN D 1 47  ? 39.779  110.637 63.209  1.00 29.50  ? 547 ASN D ND2 1 
ATOM   7716  N N   . ASP D 1 48  ? 43.040  108.429 67.167  1.00 29.43  ? 548 ASP D N   1 
ATOM   7717  C CA  . ASP D 1 48  ? 43.641  107.412 68.024  1.00 30.59  ? 548 ASP D CA  1 
ATOM   7718  C C   . ASP D 1 48  ? 42.672  106.257 68.304  1.00 32.06  ? 548 ASP D C   1 
ATOM   7719  O O   . ASP D 1 48  ? 41.459  106.436 68.245  1.00 33.51  ? 548 ASP D O   1 
ATOM   7720  C CB  . ASP D 1 48  ? 44.188  108.031 69.318  1.00 39.67  ? 548 ASP D CB  1 
ATOM   7721  C CG  . ASP D 1 48  ? 43.347  107.695 70.534  1.00 62.72  ? 548 ASP D CG  1 
ATOM   7722  O OD1 . ASP D 1 48  ? 42.273  108.308 70.684  1.00 72.81  ? 548 ASP D OD1 1 
ATOM   7723  O OD2 . ASP D 1 48  ? 43.762  106.832 71.347  1.00 70.01  ? 548 ASP D OD2 1 
ATOM   7724  N N   . PRO D 1 49  ? 43.221  105.067 68.604  1.00 27.46  ? 549 PRO D N   1 
ATOM   7725  C CA  . PRO D 1 49  ? 42.427  103.851 68.771  1.00 25.76  ? 549 PRO D CA  1 
ATOM   7726  C C   . PRO D 1 49  ? 41.215  104.014 69.687  1.00 33.48  ? 549 PRO D C   1 
ATOM   7727  O O   . PRO D 1 49  ? 40.143  103.527 69.333  1.00 33.66  ? 549 PRO D O   1 
ATOM   7728  C CB  . PRO D 1 49  ? 43.441  102.858 69.363  1.00 26.88  ? 549 PRO D CB  1 
ATOM   7729  C CG  . PRO D 1 49  ? 44.730  103.280 68.762  1.00 25.50  ? 549 PRO D CG  1 
ATOM   7730  C CD  . PRO D 1 49  ? 44.667  104.791 68.739  1.00 21.32  ? 549 PRO D CD  1 
ATOM   7731  N N   . LYS D 1 50  ? 41.367  104.680 70.827  1.00 25.43  ? 550 LYS D N   1 
ATOM   7732  C CA  . LYS D 1 50  ? 40.242  104.828 71.746  1.00 28.46  ? 550 LYS D CA  1 
ATOM   7733  C C   . LYS D 1 50  ? 39.064  105.616 71.135  1.00 32.36  ? 550 LYS D C   1 
ATOM   7734  O O   . LYS D 1 50  ? 37.905  105.231 71.291  1.00 32.39  ? 550 LYS D O   1 
ATOM   7735  C CB  . LYS D 1 50  ? 40.705  105.482 73.037  1.00 28.10  ? 550 LYS D CB  1 
ATOM   7736  C CG  . LYS D 1 50  ? 39.602  105.701 74.041  1.00 35.19  ? 550 LYS D CG  1 
ATOM   7737  C CD  . LYS D 1 50  ? 40.147  106.357 75.295  1.00 35.81  ? 550 LYS D CD  1 
ATOM   7738  C CE  . LYS D 1 50  ? 40.982  105.392 76.099  1.00 43.42  ? 550 LYS D CE  1 
ATOM   7739  N NZ  . LYS D 1 50  ? 40.139  104.254 76.532  1.00 50.24  ? 550 LYS D NZ  1 
ATOM   7740  N N   . VAL D 1 51  ? 39.360  106.708 70.436  1.00 28.21  ? 551 VAL D N   1 
ATOM   7741  C CA  . VAL D 1 51  ? 38.311  107.495 69.789  1.00 32.33  ? 551 VAL D CA  1 
ATOM   7742  C C   . VAL D 1 51  ? 37.567  106.692 68.721  1.00 29.40  ? 551 VAL D C   1 
ATOM   7743  O O   . VAL D 1 51  ? 36.341  106.748 68.637  1.00 34.48  ? 551 VAL D O   1 
ATOM   7744  C CB  . VAL D 1 51  ? 38.842  108.808 69.163  1.00 27.25  ? 551 VAL D CB  1 
ATOM   7745  C CG1 . VAL D 1 51  ? 37.702  109.548 68.477  1.00 16.98  ? 551 VAL D CG1 1 
ATOM   7746  C CG2 . VAL D 1 51  ? 39.486  109.684 70.215  1.00 18.44  ? 551 VAL D CG2 1 
ATOM   7747  N N   . ILE D 1 52  ? 38.305  105.951 67.904  1.00 25.52  ? 552 ILE D N   1 
ATOM   7748  C CA  . ILE D 1 52  ? 37.674  105.025 66.971  1.00 21.19  ? 552 ILE D CA  1 
ATOM   7749  C C   . ILE D 1 52  ? 36.787  104.039 67.752  1.00 15.46  ? 552 ILE D C   1 
ATOM   7750  O O   . ILE D 1 52  ? 35.626  103.833 67.424  1.00 16.04  ? 552 ILE D O   1 
ATOM   7751  C CB  . ILE D 1 52  ? 38.722  104.286 66.095  1.00 27.12  ? 552 ILE D CB  1 
ATOM   7752  C CG1 . ILE D 1 52  ? 39.503  105.289 65.245  1.00 22.10  ? 552 ILE D CG1 1 
ATOM   7753  C CG2 . ILE D 1 52  ? 38.058  103.283 65.155  1.00 18.83  ? 552 ILE D CG2 1 
ATOM   7754  C CD1 . ILE D 1 52  ? 40.794  104.754 64.662  1.00 19.51  ? 552 ILE D CD1 1 
ATOM   7755  N N   . ALA D 1 53  ? 37.318  103.465 68.820  1.00 27.11  ? 553 ALA D N   1 
ATOM   7756  C CA  . ALA D 1 53  ? 36.547  102.507 69.626  1.00 25.84  ? 553 ALA D CA  1 
ATOM   7757  C C   . ALA D 1 53  ? 35.281  103.102 70.287  1.00 29.24  ? 553 ALA D C   1 
ATOM   7758  O O   . ALA D 1 53  ? 34.267  102.421 70.406  1.00 34.68  ? 553 ALA D O   1 
ATOM   7759  C CB  . ALA D 1 53  ? 37.442  101.854 70.662  1.00 17.14  ? 553 ALA D CB  1 
ATOM   7760  N N   . GLN D 1 54  ? 35.336  104.361 70.712  1.00 24.93  ? 554 GLN D N   1 
ATOM   7761  C CA  . GLN D 1 54  ? 34.154  105.012 71.275  1.00 19.22  ? 554 GLN D CA  1 
ATOM   7762  C C   . GLN D 1 54  ? 33.036  105.134 70.244  1.00 23.57  ? 554 GLN D C   1 
ATOM   7763  O O   . GLN D 1 54  ? 31.858  104.902 70.546  1.00 16.19  ? 554 GLN D O   1 
ATOM   7764  C CB  . GLN D 1 54  ? 34.502  106.395 71.792  1.00 21.25  ? 554 GLN D CB  1 
ATOM   7765  C CG  . GLN D 1 54  ? 35.235  106.406 73.109  1.00 26.75  ? 554 GLN D CG  1 
ATOM   7766  C CD  . GLN D 1 54  ? 35.564  107.823 73.546  1.00 35.56  ? 554 GLN D CD  1 
ATOM   7767  O OE1 . GLN D 1 54  ? 36.122  108.612 72.772  1.00 34.44  ? 554 GLN D OE1 1 
ATOM   7768  N NE2 . GLN D 1 54  ? 35.202  108.162 74.783  1.00 34.57  ? 554 GLN D NE2 1 
ATOM   7769  N N   . HIS D 1 55  ? 33.413  105.510 69.026  1.00 20.30  ? 555 HIS D N   1 
ATOM   7770  C CA  . HIS D 1 55  ? 32.451  105.632 67.944  1.00 16.53  ? 555 HIS D CA  1 
ATOM   7771  C C   . HIS D 1 55  ? 31.834  104.283 67.560  1.00 23.77  ? 555 HIS D C   1 
ATOM   7772  O O   . HIS D 1 55  ? 30.624  104.194 67.354  1.00 27.95  ? 555 HIS D O   1 
ATOM   7773  C CB  . HIS D 1 55  ? 33.086  106.317 66.738  1.00 9.45   ? 555 HIS D CB  1 
ATOM   7774  C CG  . HIS D 1 55  ? 33.246  107.795 66.912  1.00 17.11  ? 555 HIS D CG  1 
ATOM   7775  N ND1 . HIS D 1 55  ? 34.348  108.360 67.515  1.00 23.78  ? 555 HIS D ND1 1 
ATOM   7776  C CD2 . HIS D 1 55  ? 32.429  108.824 66.581  1.00 24.00  ? 555 HIS D CD2 1 
ATOM   7777  C CE1 . HIS D 1 55  ? 34.207  109.674 67.546  1.00 29.15  ? 555 HIS D CE1 1 
ATOM   7778  N NE2 . HIS D 1 55  ? 33.050  109.981 66.988  1.00 31.33  ? 555 HIS D NE2 1 
ATOM   7779  N N   . VAL D 1 56  ? 32.657  103.237 67.491  1.00 18.14  ? 556 VAL D N   1 
ATOM   7780  C CA  . VAL D 1 56  ? 32.152  101.898 67.186  1.00 19.13  ? 556 VAL D CA  1 
ATOM   7781  C C   . VAL D 1 56  ? 31.207  101.406 68.290  1.00 16.87  ? 556 VAL D C   1 
ATOM   7782  O O   . VAL D 1 56  ? 30.117  100.927 68.005  1.00 16.78  ? 556 VAL D O   1 
ATOM   7783  C CB  . VAL D 1 56  ? 33.299  100.904 66.912  1.00 20.05  ? 556 VAL D CB  1 
ATOM   7784  C CG1 . VAL D 1 56  ? 32.782  99.473  66.808  1.00 14.62  ? 556 VAL D CG1 1 
ATOM   7785  C CG2 . VAL D 1 56  ? 34.017  101.305 65.639  1.00 17.04  ? 556 VAL D CG2 1 
ATOM   7786  N N   . LEU D 1 57  ? 31.601  101.576 69.546  1.00 11.87  ? 557 LEU D N   1 
ATOM   7787  C CA  . LEU D 1 57  ? 30.703  101.276 70.659  1.00 16.60  ? 557 LEU D CA  1 
ATOM   7788  C C   . LEU D 1 57  ? 29.357  102.009 70.552  1.00 21.65  ? 557 LEU D C   1 
ATOM   7789  O O   . LEU D 1 57  ? 28.295  101.419 70.739  1.00 32.43  ? 557 LEU D O   1 
ATOM   7790  C CB  . LEU D 1 57  ? 31.362  101.609 72.002  1.00 7.26   ? 557 LEU D CB  1 
ATOM   7791  C CG  . LEU D 1 57  ? 30.413  101.418 73.187  1.00 17.80  ? 557 LEU D CG  1 
ATOM   7792  C CD1 . LEU D 1 57  ? 29.989  99.956  73.311  1.00 20.39  ? 557 LEU D CD1 1 
ATOM   7793  C CD2 . LEU D 1 57  ? 31.083  101.864 74.448  1.00 12.65  ? 557 LEU D CD2 1 
ATOM   7794  N N   . SER D 1 58  ? 29.397  103.294 70.240  1.00 19.30  ? 558 SER D N   1 
ATOM   7795  C CA  . SER D 1 58  ? 28.161  104.059 70.185  1.00 25.60  ? 558 SER D CA  1 
ATOM   7796  C C   . SER D 1 58  ? 27.230  103.579 69.060  1.00 24.47  ? 558 SER D C   1 
ATOM   7797  O O   . SER D 1 58  ? 26.019  103.445 69.262  1.00 21.41  ? 558 SER D O   1 
ATOM   7798  C CB  . SER D 1 58  ? 28.443  105.560 70.064  1.00 20.73  ? 558 SER D CB  1 
ATOM   7799  O OG  . SER D 1 58  ? 27.232  106.299 70.064  1.00 37.17  ? 558 SER D OG  1 
ATOM   7800  N N   . MET D 1 59  ? 27.782  103.335 67.875  1.00 14.07  ? 559 MET D N   1 
ATOM   7801  C CA  . MET D 1 59  ? 26.960  102.842 66.781  1.00 17.19  ? 559 MET D CA  1 
ATOM   7802  C C   . MET D 1 59  ? 26.391  101.444 67.098  1.00 24.02  ? 559 MET D C   1 
ATOM   7803  O O   . MET D 1 59  ? 25.220  101.184 66.854  1.00 23.34  ? 559 MET D O   1 
ATOM   7804  C CB  . MET D 1 59  ? 27.727  102.826 65.455  1.00 18.15  ? 559 MET D CB  1 
ATOM   7805  C CG  . MET D 1 59  ? 26.801  102.668 64.230  1.00 20.38  ? 559 MET D CG  1 
ATOM   7806  S SD  . MET D 1 59  ? 25.544  103.969 64.215  1.00 41.29  ? 559 MET D SD  1 
ATOM   7807  C CE  . MET D 1 59  ? 24.711  103.635 62.666  1.00 165.42 ? 559 MET D CE  1 
ATOM   7808  N N   . ASP D 1 60  ? 27.213  100.558 67.656  1.00 18.84  ? 560 ASP D N   1 
ATOM   7809  C CA  . ASP D 1 60  ? 26.731  99.241  68.045  1.00 20.65  ? 560 ASP D CA  1 
ATOM   7810  C C   . ASP D 1 60  ? 25.565  99.335  69.002  1.00 21.17  ? 560 ASP D C   1 
ATOM   7811  O O   . ASP D 1 60  ? 24.564  98.622  68.837  1.00 21.59  ? 560 ASP D O   1 
ATOM   7812  C CB  . ASP D 1 60  ? 27.839  98.389  68.664  1.00 17.74  ? 560 ASP D CB  1 
ATOM   7813  C CG  . ASP D 1 60  ? 28.868  97.978  67.656  1.00 21.84  ? 560 ASP D CG  1 
ATOM   7814  O OD1 . ASP D 1 60  ? 28.535  97.991  66.451  1.00 25.60  ? 560 ASP D OD1 1 
ATOM   7815  O OD2 . ASP D 1 60  ? 30.004  97.657  68.064  1.00 25.32  ? 560 ASP D OD2 1 
ATOM   7816  N N   . CYS D 1 61  ? 25.680  100.197 70.007  1.00 13.29  ? 561 CYS D N   1 
ATOM   7817  C CA  . CYS D 1 61  ? 24.590  100.316 70.980  1.00 25.00  ? 561 CYS D CA  1 
ATOM   7818  C C   . CYS D 1 61  ? 23.300  100.818 70.340  1.00 30.01  ? 561 CYS D C   1 
ATOM   7819  O O   . CYS D 1 61  ? 22.209  100.492 70.797  1.00 33.93  ? 561 CYS D O   1 
ATOM   7820  C CB  . CYS D 1 61  ? 24.977  101.211 72.152  1.00 26.20  ? 561 CYS D CB  1 
ATOM   7821  S SG  . CYS D 1 61  ? 26.227  100.479 73.187  1.00 18.49  ? 561 CYS D SG  1 
ATOM   7822  N N   . ARG D 1 62  ? 23.421  101.601 69.276  1.00 19.73  ? 562 ARG D N   1 
ATOM   7823  C CA  . ARG D 1 62  ? 22.229  102.090 68.597  1.00 26.81  ? 562 ARG D CA  1 
ATOM   7824  C C   . ARG D 1 62  ? 21.592  101.023 67.709  1.00 19.82  ? 562 ARG D C   1 
ATOM   7825  O O   . ARG D 1 62  ? 20.366  100.873 67.702  1.00 18.21  ? 562 ARG D O   1 
ATOM   7826  C CB  . ARG D 1 62  ? 22.507  103.381 67.815  1.00 23.54  ? 562 ARG D CB  1 
ATOM   7827  C CG  . ARG D 1 62  ? 22.371  104.656 68.661  1.00 50.43  ? 562 ARG D CG  1 
ATOM   7828  C CD  . ARG D 1 62  ? 23.069  105.858 68.016  1.00 61.54  ? 562 ARG D CD  1 
ATOM   7829  N NE  . ARG D 1 62  ? 22.665  106.047 66.625  1.00 72.88  ? 562 ARG D NE  1 
ATOM   7830  C CZ  . ARG D 1 62  ? 23.192  106.956 65.807  1.00 86.91  ? 562 ARG D CZ  1 
ATOM   7831  N NH1 . ARG D 1 62  ? 24.153  107.764 66.242  1.00 87.47  ? 562 ARG D NH1 1 
ATOM   7832  N NH2 . ARG D 1 62  ? 22.762  107.054 64.551  1.00 90.53  ? 562 ARG D NH2 1 
ATOM   7833  N N   . VAL D 1 63  ? 22.414  100.292 66.961  1.00 21.99  ? 563 VAL D N   1 
ATOM   7834  C CA  . VAL D 1 63  ? 21.907  99.213  66.106  1.00 25.15  ? 563 VAL D CA  1 
ATOM   7835  C C   . VAL D 1 63  ? 21.258  98.093  66.952  1.00 24.40  ? 563 VAL D C   1 
ATOM   7836  O O   . VAL D 1 63  ? 20.190  97.588  66.615  1.00 21.49  ? 563 VAL D O   1 
ATOM   7837  C CB  . VAL D 1 63  ? 23.007  98.643  65.174  1.00 14.47  ? 563 VAL D CB  1 
ATOM   7838  C CG1 . VAL D 1 63  ? 22.509  97.395  64.434  1.00 15.91  ? 563 VAL D CG1 1 
ATOM   7839  C CG2 . VAL D 1 63  ? 23.465  99.705  64.157  1.00 10.24  ? 563 VAL D CG2 1 
ATOM   7840  N N   . ALA D 1 64  ? 21.908  97.737  68.058  1.00 18.38  ? 564 ALA D N   1 
ATOM   7841  C CA  . ALA D 1 64  ? 21.445  96.684  68.947  1.00 17.64  ? 564 ALA D CA  1 
ATOM   7842  C C   . ALA D 1 64  ? 20.333  97.167  69.892  1.00 25.23  ? 564 ALA D C   1 
ATOM   7843  O O   . ALA D 1 64  ? 19.784  96.396  70.681  1.00 22.88  ? 564 ALA D O   1 
ATOM   7844  C CB  . ALA D 1 64  ? 22.643  96.119  69.742  1.00 11.82  ? 564 ALA D CB  1 
ATOM   7845  N N   . ARG D 1 65  ? 20.010  98.454  69.800  1.00 26.90  ? 565 ARG D N   1 
ATOM   7846  C CA  . ARG D 1 65  ? 19.004  99.088  70.655  1.00 18.75  ? 565 ARG D CA  1 
ATOM   7847  C C   . ARG D 1 65  ? 19.308  98.915  72.145  1.00 19.64  ? 565 ARG D C   1 
ATOM   7848  O O   . ARG D 1 65  ? 18.446  98.544  72.939  1.00 34.42  ? 565 ARG D O   1 
ATOM   7849  C CB  . ARG D 1 65  ? 17.605  98.587  70.316  1.00 24.28  ? 565 ARG D CB  1 
ATOM   7850  C CG  . ARG D 1 65  ? 17.268  98.719  68.851  1.00 29.51  ? 565 ARG D CG  1 
ATOM   7851  C CD  . ARG D 1 65  ? 15.842  98.313  68.597  1.00 32.89  ? 565 ARG D CD  1 
ATOM   7852  N NE  . ARG D 1 65  ? 15.608  97.986  67.200  1.00 42.03  ? 565 ARG D NE  1 
ATOM   7853  C CZ  . ARG D 1 65  ? 14.426  97.607  66.730  1.00 51.82  ? 565 ARG D CZ  1 
ATOM   7854  N NH1 . ARG D 1 65  ? 13.391  97.526  67.555  1.00 48.25  ? 565 ARG D NH1 1 
ATOM   7855  N NH2 . ARG D 1 65  ? 14.277  97.311  65.443  1.00 55.42  ? 565 ARG D NH2 1 
ATOM   7856  N N   . ILE D 1 66  ? 20.547  99.196  72.506  1.00 18.39  ? 566 ILE D N   1 
ATOM   7857  C CA  . ILE D 1 66  ? 20.972  99.218  73.888  1.00 22.49  ? 566 ILE D CA  1 
ATOM   7858  C C   . ILE D 1 66  ? 20.832  100.661 74.356  1.00 23.24  ? 566 ILE D C   1 
ATOM   7859  O O   . ILE D 1 66  ? 20.365  100.931 75.465  1.00 20.85  ? 566 ILE D O   1 
ATOM   7860  C CB  . ILE D 1 66  ? 22.441  98.746  74.013  1.00 18.22  ? 566 ILE D CB  1 
ATOM   7861  C CG1 . ILE D 1 66  ? 22.570  97.292  73.542  1.00 23.85  ? 566 ILE D CG1 1 
ATOM   7862  C CG2 . ILE D 1 66  ? 22.944  98.908  75.432  1.00 18.30  ? 566 ILE D CG2 1 
ATOM   7863  C CD1 . ILE D 1 66  ? 23.975  96.703  73.701  1.00 19.53  ? 566 ILE D CD1 1 
ATOM   7864  N N   . LEU D 1 67  ? 21.219  101.585 73.481  1.00 27.67  ? 567 LEU D N   1 
ATOM   7865  C CA  . LEU D 1 67  ? 21.118  103.021 73.746  1.00 33.44  ? 567 LEU D CA  1 
ATOM   7866  C C   . LEU D 1 67  ? 20.323  103.723 72.649  1.00 32.89  ? 567 LEU D C   1 
ATOM   7867  O O   . LEU D 1 67  ? 20.140  103.181 71.550  1.00 27.95  ? 567 LEU D O   1 
ATOM   7868  C CB  . LEU D 1 67  ? 22.516  103.640 73.828  1.00 33.99  ? 567 LEU D CB  1 
ATOM   7869  C CG  . LEU D 1 67  ? 23.367  103.219 75.029  1.00 34.38  ? 567 LEU D CG  1 
ATOM   7870  C CD1 . LEU D 1 67  ? 24.802  103.673 74.883  1.00 21.88  ? 567 LEU D CD1 1 
ATOM   7871  C CD2 . LEU D 1 67  ? 22.765  103.778 76.299  1.00 35.32  ? 567 LEU D CD2 1 
ATOM   7872  N N   . GLY D 1 68  ? 19.860  104.936 72.940  1.00 37.89  ? 568 GLY D N   1 
ATOM   7873  C CA  . GLY D 1 68  ? 19.218  105.762 71.927  1.00 40.62  ? 568 GLY D CA  1 
ATOM   7874  C C   . GLY D 1 68  ? 17.890  105.190 71.465  1.00 41.46  ? 568 GLY D C   1 
ATOM   7875  O O   . GLY D 1 68  ? 17.416  105.477 70.357  1.00 32.52  ? 568 GLY D O   1 
ATOM   7876  N N   . VAL D 1 69  ? 17.304  104.358 72.320  1.00 35.86  ? 569 VAL D N   1 
ATOM   7877  C CA  . VAL D 1 69  ? 15.977  103.829 72.089  1.00 41.97  ? 569 VAL D CA  1 
ATOM   7878  C C   . VAL D 1 69  ? 14.950  104.921 72.422  1.00 48.12  ? 569 VAL D C   1 
ATOM   7879  O O   . VAL D 1 69  ? 14.847  105.363 73.572  1.00 46.55  ? 569 VAL D O   1 
ATOM   7880  C CB  . VAL D 1 69  ? 15.733  102.556 72.948  1.00 37.18  ? 569 VAL D CB  1 
ATOM   7881  C CG1 . VAL D 1 69  ? 14.282  102.065 72.821  1.00 31.75  ? 569 VAL D CG1 1 
ATOM   7882  C CG2 . VAL D 1 69  ? 16.725  101.457 72.574  1.00 23.02  ? 569 VAL D CG2 1 
ATOM   7883  N N   . SER D 1 70  ? 14.209  105.363 71.406  1.00 49.18  ? 570 SER D N   1 
ATOM   7884  C CA  . SER D 1 70  ? 13.152  106.362 71.585  1.00 53.45  ? 570 SER D CA  1 
ATOM   7885  C C   . SER D 1 70  ? 11.980  105.784 72.376  1.00 54.85  ? 570 SER D C   1 
ATOM   7886  O O   . SER D 1 70  ? 11.895  104.571 72.584  1.00 53.19  ? 570 SER D O   1 
ATOM   7887  C CB  . SER D 1 70  ? 12.656  106.871 70.227  1.00 54.46  ? 570 SER D CB  1 
ATOM   7888  O OG  . SER D 1 70  ? 11.878  105.886 69.562  1.00 50.30  ? 570 SER D OG  1 
ATOM   7889  N N   . GLU D 1 71  ? 11.071  106.645 72.819  1.00 58.37  ? 571 GLU D N   1 
ATOM   7890  C CA  . GLU D 1 71  ? 9.907   106.162 73.558  1.00 62.81  ? 571 GLU D CA  1 
ATOM   7891  C C   . GLU D 1 71  ? 8.920   105.461 72.628  1.00 57.87  ? 571 GLU D C   1 
ATOM   7892  O O   . GLU D 1 71  ? 8.316   104.456 73.001  1.00 56.27  ? 571 GLU D O   1 
ATOM   7893  C CB  . GLU D 1 71  ? 9.229   107.286 74.344  1.00 77.04  ? 571 GLU D CB  1 
ATOM   7894  C CG  . GLU D 1 71  ? 8.046   106.819 75.201  1.00 94.19  ? 571 GLU D CG  1 
ATOM   7895  C CD  . GLU D 1 71  ? 8.385   105.637 76.111  1.00 103.21 ? 571 GLU D CD  1 
ATOM   7896  O OE1 . GLU D 1 71  ? 9.435   105.681 76.792  1.00 105.37 ? 571 GLU D OE1 1 
ATOM   7897  O OE2 . GLU D 1 71  ? 7.598   104.663 76.145  1.00 104.46 ? 571 GLU D OE2 1 
ATOM   7898  N N   . GLU D 1 72  ? 8.761   105.989 71.416  1.00 61.60  ? 572 GLU D N   1 
ATOM   7899  C CA  . GLU D 1 72  ? 7.998   105.288 70.389  1.00 60.48  ? 572 GLU D CA  1 
ATOM   7900  C C   . GLU D 1 72  ? 8.540   103.870 70.278  1.00 51.91  ? 572 GLU D C   1 
ATOM   7901  O O   . GLU D 1 72  ? 7.788   102.896 70.366  1.00 45.64  ? 572 GLU D O   1 
ATOM   7902  C CB  . GLU D 1 72  ? 8.116   105.976 69.024  1.00 68.18  ? 572 GLU D CB  1 
ATOM   7903  C CG  . GLU D 1 72  ? 7.388   107.299 68.906  1.00 85.48  ? 572 GLU D CG  1 
ATOM   7904  C CD  . GLU D 1 72  ? 8.109   108.446 69.607  1.00 93.61  ? 572 GLU D CD  1 
ATOM   7905  O OE1 . GLU D 1 72  ? 9.361   108.402 69.724  1.00 81.16  ? 572 GLU D OE1 1 
ATOM   7906  O OE2 . GLU D 1 72  ? 7.410   109.394 70.040  1.00 100.77 ? 572 GLU D OE2 1 
ATOM   7907  N N   . MET D 1 73  ? 9.856   103.765 70.095  1.00 45.67  ? 573 MET D N   1 
ATOM   7908  C CA  . MET D 1 73  ? 10.489  102.474 69.877  1.00 37.92  ? 573 MET D CA  1 
ATOM   7909  C C   . MET D 1 73  ? 10.230  101.534 71.056  1.00 41.81  ? 573 MET D C   1 
ATOM   7910  O O   . MET D 1 73  ? 9.919   100.356 70.860  1.00 41.79  ? 573 MET D O   1 
ATOM   7911  C CB  . MET D 1 73  ? 11.988  102.626 69.605  1.00 40.78  ? 573 MET D CB  1 
ATOM   7912  C CG  . MET D 1 73  ? 12.614  101.431 68.865  1.00 48.07  ? 573 MET D CG  1 
ATOM   7913  S SD  . MET D 1 73  ? 14.422  101.372 68.936  1.00 166.08 ? 573 MET D SD  1 
ATOM   7914  C CE  . MET D 1 73  ? 14.888  102.804 67.969  1.00 47.73  ? 573 MET D CE  1 
ATOM   7915  N N   . ARG D 1 74  ? 10.326  102.049 72.278  1.00 43.56  ? 574 ARG D N   1 
ATOM   7916  C CA  . ARG D 1 74  ? 10.132  101.188 73.439  1.00 48.27  ? 574 ARG D CA  1 
ATOM   7917  C C   . ARG D 1 74  ? 8.709   100.651 73.511  1.00 49.25  ? 574 ARG D C   1 
ATOM   7918  O O   . ARG D 1 74  ? 8.508   99.460  73.766  1.00 43.46  ? 574 ARG D O   1 
ATOM   7919  C CB  . ARG D 1 74  ? 10.510  101.900 74.737  1.00 59.14  ? 574 ARG D CB  1 
ATOM   7920  C CG  . ARG D 1 74  ? 10.503  100.986 75.963  1.00 75.43  ? 574 ARG D CG  1 
ATOM   7921  C CD  . ARG D 1 74  ? 11.528  101.443 76.998  1.00 90.36  ? 574 ARG D CD  1 
ATOM   7922  N NE  . ARG D 1 74  ? 11.521  102.895 77.175  1.00 102.50 ? 574 ARG D NE  1 
ATOM   7923  C CZ  . ARG D 1 74  ? 12.377  103.733 76.591  1.00 102.87 ? 574 ARG D CZ  1 
ATOM   7924  N NH1 . ARG D 1 74  ? 13.328  103.270 75.789  1.00 101.38 ? 574 ARG D NH1 1 
ATOM   7925  N NH2 . ARG D 1 74  ? 12.286  105.039 76.813  1.00 101.07 ? 574 ARG D NH2 1 
ATOM   7926  N N   . ARG D 1 75  ? 7.729   101.528 73.283  1.00 53.25  ? 575 ARG D N   1 
ATOM   7927  C CA  . ARG D 1 75  ? 6.318   101.126 73.286  1.00 58.84  ? 575 ARG D CA  1 
ATOM   7928  C C   . ARG D 1 75  ? 6.052   100.054 72.226  1.00 56.27  ? 575 ARG D C   1 
ATOM   7929  O O   . ARG D 1 75  ? 5.451   99.016  72.504  1.00 56.46  ? 575 ARG D O   1 
ATOM   7930  C CB  . ARG D 1 75  ? 5.394   102.330 73.051  1.00 68.76  ? 575 ARG D CB  1 
ATOM   7931  C CG  . ARG D 1 75  ? 5.292   103.301 74.221  1.00 80.46  ? 575 ARG D CG  1 
ATOM   7932  C CD  . ARG D 1 75  ? 4.244   104.400 73.969  1.00 89.67  ? 575 ARG D CD  1 
ATOM   7933  N NE  . ARG D 1 75  ? 4.643   105.358 72.932  1.00 95.01  ? 575 ARG D NE  1 
ATOM   7934  C CZ  . ARG D 1 75  ? 4.253   105.303 71.659  1.00 95.58  ? 575 ARG D CZ  1 
ATOM   7935  N NH1 . ARG D 1 75  ? 3.448   104.331 71.247  1.00 99.17  ? 575 ARG D NH1 1 
ATOM   7936  N NH2 . ARG D 1 75  ? 4.666   106.221 70.793  1.00 89.18  ? 575 ARG D NH2 1 
ATOM   7937  N N   . ASN D 1 76  ? 6.507   100.314 71.008  1.00 49.13  ? 576 ASN D N   1 
ATOM   7938  C CA  . ASN D 1 76  ? 6.328   99.374  69.917  1.00 43.67  ? 576 ASN D CA  1 
ATOM   7939  C C   . ASN D 1 76  ? 7.141   98.102  70.091  1.00 48.84  ? 576 ASN D C   1 
ATOM   7940  O O   . ASN D 1 76  ? 6.827   97.072  69.499  1.00 56.01  ? 576 ASN D O   1 
ATOM   7941  C CB  . ASN D 1 76  ? 6.704   100.035 68.599  1.00 46.16  ? 576 ASN D CB  1 
ATOM   7942  C CG  . ASN D 1 76  ? 5.844   101.223 68.297  1.00 53.28  ? 576 ASN D CG  1 
ATOM   7943  O OD1 . ASN D 1 76  ? 4.951   101.567 69.072  1.00 63.11  ? 576 ASN D OD1 1 
ATOM   7944  N ND2 . ASN D 1 76  ? 6.112   101.875 67.176  1.00 52.89  ? 576 ASN D ND2 1 
ATOM   7945  N N   . MET D 1 77  ? 8.213   98.171  70.868  1.00 47.48  ? 577 MET D N   1 
ATOM   7946  C CA  . MET D 1 77  ? 8.966   96.959  71.136  1.00 48.03  ? 577 MET D CA  1 
ATOM   7947  C C   . MET D 1 77  ? 8.252   96.216  72.247  1.00 51.42  ? 577 MET D C   1 
ATOM   7948  O O   . MET D 1 77  ? 8.015   95.017  72.136  1.00 50.41  ? 577 MET D O   1 
ATOM   7949  C CB  . MET D 1 77  ? 10.415  97.251  71.530  1.00 40.28  ? 577 MET D CB  1 
ATOM   7950  C CG  . MET D 1 77  ? 11.374  97.316  70.360  1.00 35.34  ? 577 MET D CG  1 
ATOM   7951  S SD  . MET D 1 77  ? 13.050  96.840  70.837  1.00 52.24  ? 577 MET D SD  1 
ATOM   7952  C CE  . MET D 1 77  ? 13.563  98.158  71.947  1.00 25.56  ? 577 MET D CE  1 
ATOM   7953  N N   . GLY D 1 78  ? 7.877   96.945  73.298  1.00 49.36  ? 578 GLY D N   1 
ATOM   7954  C CA  . GLY D 1 78  ? 7.345   96.332  74.502  1.00 51.07  ? 578 GLY D CA  1 
ATOM   7955  C C   . GLY D 1 78  ? 8.449   95.774  75.392  1.00 48.07  ? 578 GLY D C   1 
ATOM   7956  O O   . GLY D 1 78  ? 8.189   95.082  76.381  1.00 40.49  ? 578 GLY D O   1 
ATOM   7957  N N   . VAL D 1 79  ? 9.693   96.066  75.023  1.00 42.17  ? 579 VAL D N   1 
ATOM   7958  C CA  . VAL D 1 79  ? 10.849  95.774  75.867  1.00 34.16  ? 579 VAL D CA  1 
ATOM   7959  C C   . VAL D 1 79  ? 11.830  96.929  75.739  1.00 36.37  ? 579 VAL D C   1 
ATOM   7960  O O   . VAL D 1 79  ? 11.848  97.629  74.720  1.00 38.10  ? 579 VAL D O   1 
ATOM   7961  C CB  . VAL D 1 79  ? 11.534  94.442  75.499  1.00 31.62  ? 579 VAL D CB  1 
ATOM   7962  C CG1 . VAL D 1 79  ? 10.627  93.254  75.835  1.00 33.25  ? 579 VAL D CG1 1 
ATOM   7963  C CG2 . VAL D 1 79  ? 11.938  94.428  74.033  1.00 22.64  ? 579 VAL D CG2 1 
ATOM   7964  N N   . SER D 1 80  ? 12.630  97.143  76.777  1.00 34.81  ? 580 SER D N   1 
ATOM   7965  C CA  . SER D 1 80  ? 13.540  98.281  76.809  1.00 39.30  ? 580 SER D CA  1 
ATOM   7966  C C   . SER D 1 80  ? 14.818  98.034  75.986  1.00 38.11  ? 580 SER D C   1 
ATOM   7967  O O   . SER D 1 80  ? 15.535  98.964  75.625  1.00 45.06  ? 580 SER D O   1 
ATOM   7968  C CB  . SER D 1 80  ? 13.897  98.622  78.257  1.00 49.51  ? 580 SER D CB  1 
ATOM   7969  O OG  . SER D 1 80  ? 14.751  97.635  78.826  1.00 58.29  ? 580 SER D OG  1 
ATOM   7970  N N   . SER D 1 81  ? 15.110  96.780  75.683  1.00 29.22  ? 581 SER D N   1 
ATOM   7971  C CA  . SER D 1 81  ? 16.369  96.491  75.027  1.00 26.24  ? 581 SER D CA  1 
ATOM   7972  C C   . SER D 1 81  ? 16.197  95.538  73.856  1.00 22.39  ? 581 SER D C   1 
ATOM   7973  O O   . SER D 1 81  ? 15.463  94.576  73.949  1.00 22.20  ? 581 SER D O   1 
ATOM   7974  C CB  . SER D 1 81  ? 17.360  95.913  76.038  1.00 20.28  ? 581 SER D CB  1 
ATOM   7975  O OG  . SER D 1 81  ? 18.521  95.446  75.373  1.00 26.75  ? 581 SER D OG  1 
ATOM   7976  N N   . GLY D 1 82  ? 16.869  95.830  72.750  1.00 23.53  ? 582 GLY D N   1 
ATOM   7977  C CA  . GLY D 1 82  ? 17.005  94.881  71.661  1.00 20.90  ? 582 GLY D CA  1 
ATOM   7978  C C   . GLY D 1 82  ? 17.639  93.556  72.090  1.00 22.08  ? 582 GLY D C   1 
ATOM   7979  O O   . GLY D 1 82  ? 17.343  92.500  71.515  1.00 22.10  ? 582 GLY D O   1 
ATOM   7980  N N   . LEU D 1 83  ? 18.519  93.603  73.088  1.00 22.19  ? 583 LEU D N   1 
ATOM   7981  C CA  . LEU D 1 83  ? 19.156  92.391  73.574  1.00 24.57  ? 583 LEU D CA  1 
ATOM   7982  C C   . LEU D 1 83  ? 18.080  91.438  74.072  1.00 25.22  ? 583 LEU D C   1 
ATOM   7983  O O   . LEU D 1 83  ? 18.247  90.220  74.037  1.00 27.07  ? 583 LEU D O   1 
ATOM   7984  C CB  . LEU D 1 83  ? 20.171  92.688  74.676  1.00 25.78  ? 583 LEU D CB  1 
ATOM   7985  C CG  . LEU D 1 83  ? 21.415  93.500  74.295  1.00 26.33  ? 583 LEU D CG  1 
ATOM   7986  C CD1 . LEU D 1 83  ? 22.362  93.596  75.477  1.00 24.04  ? 583 LEU D CD1 1 
ATOM   7987  C CD2 . LEU D 1 83  ? 22.124  92.915  73.089  1.00 17.44  ? 583 LEU D CD2 1 
ATOM   7988  N N   . GLU D 1 84  ? 16.953  91.982  74.505  1.00 22.27  ? 584 GLU D N   1 
ATOM   7989  C CA  . GLU D 1 84  ? 15.875  91.104  74.920  1.00 26.16  ? 584 GLU D CA  1 
ATOM   7990  C C   . GLU D 1 84  ? 15.056  90.622  73.723  1.00 30.08  ? 584 GLU D C   1 
ATOM   7991  O O   . GLU D 1 84  ? 14.690  89.450  73.637  1.00 41.30  ? 584 GLU D O   1 
ATOM   7992  C CB  . GLU D 1 84  ? 14.988  91.755  75.974  1.00 26.69  ? 584 GLU D CB  1 
ATOM   7993  C CG  . GLU D 1 84  ? 13.861  90.845  76.422  1.00 45.34  ? 584 GLU D CG  1 
ATOM   7994  C CD  . GLU D 1 84  ? 13.103  91.384  77.619  1.00 59.43  ? 584 GLU D CD  1 
ATOM   7995  O OE1 . GLU D 1 84  ? 13.527  92.423  78.184  1.00 59.86  ? 584 GLU D OE1 1 
ATOM   7996  O OE2 . GLU D 1 84  ? 12.084  90.761  77.993  1.00 57.91  ? 584 GLU D OE2 1 
ATOM   7997  N N   . LEU D 1 85  ? 14.785  91.523  72.793  1.00 20.07  ? 585 LEU D N   1 
ATOM   7998  C CA  . LEU D 1 85  ? 14.073  91.172  71.573  1.00 18.90  ? 585 LEU D CA  1 
ATOM   7999  C C   . LEU D 1 85  ? 14.779  90.086  70.738  1.00 26.09  ? 585 LEU D C   1 
ATOM   8000  O O   . LEU D 1 85  ? 14.126  89.225  70.166  1.00 21.01  ? 585 LEU D O   1 
ATOM   8001  C CB  . LEU D 1 85  ? 13.890  92.412  70.722  1.00 24.40  ? 585 LEU D CB  1 
ATOM   8002  C CG  . LEU D 1 85  ? 13.016  92.229  69.490  1.00 26.18  ? 585 LEU D CG  1 
ATOM   8003  C CD1 . LEU D 1 85  ? 11.615  91.900  69.930  1.00 33.40  ? 585 LEU D CD1 1 
ATOM   8004  C CD2 . LEU D 1 85  ? 13.038  93.515  68.666  1.00 24.45  ? 585 LEU D CD2 1 
ATOM   8005  N N   . ILE D 1 86  ? 16.107  90.120  70.654  1.00 22.54  ? 586 ILE D N   1 
ATOM   8006  C CA  . ILE D 1 86  ? 16.795  89.107  69.863  1.00 22.17  ? 586 ILE D CA  1 
ATOM   8007  C C   . ILE D 1 86  ? 16.644  87.634  70.355  1.00 21.98  ? 586 ILE D C   1 
ATOM   8008  O O   . ILE D 1 86  ? 16.852  86.702  69.584  1.00 22.87  ? 586 ILE D O   1 
ATOM   8009  C CB  . ILE D 1 86  ? 18.279  89.458  69.609  1.00 23.57  ? 586 ILE D CB  1 
ATOM   8010  C CG1 . ILE D 1 86  ? 19.028  89.562  70.912  1.00 27.76  ? 586 ILE D CG1 1 
ATOM   8011  C CG2 . ILE D 1 86  ? 18.403  90.759  68.836  1.00 17.30  ? 586 ILE D CG2 1 
ATOM   8012  C CD1 . ILE D 1 86  ? 20.467  89.293  70.716  1.00 46.89  ? 586 ILE D CD1 1 
ATOM   8013  N N   . THR D 1 87  ? 16.249  87.429  71.609  1.00 19.31  ? 587 THR D N   1 
ATOM   8014  C CA  . THR D 1 87  ? 16.020  86.079  72.134  1.00 18.92  ? 587 THR D CA  1 
ATOM   8015  C C   . THR D 1 87  ? 14.600  85.555  71.878  1.00 22.84  ? 587 THR D C   1 
ATOM   8016  O O   . THR D 1 87  ? 14.273  84.435  72.264  1.00 23.11  ? 587 THR D O   1 
ATOM   8017  C CB  . THR D 1 87  ? 16.305  85.998  73.649  1.00 19.18  ? 587 THR D CB  1 
ATOM   8018  O OG1 . THR D 1 87  ? 15.255  86.655  74.357  1.00 27.20  ? 587 THR D OG1 1 
ATOM   8019  C CG2 . THR D 1 87  ? 17.632  86.684  73.989  1.00 22.47  ? 587 THR D CG2 1 
ATOM   8020  N N   . LEU D 1 88  ? 13.772  86.371  71.228  1.00 17.46  ? 588 LEU D N   1 
ATOM   8021  C CA  . LEU D 1 88  ? 12.404  86.004  70.851  1.00 13.04  ? 588 LEU D CA  1 
ATOM   8022  C C   . LEU D 1 88  ? 12.304  85.862  69.333  1.00 18.07  ? 588 LEU D C   1 
ATOM   8023  O O   . LEU D 1 88  ? 13.160  86.363  68.604  1.00 25.06  ? 588 LEU D O   1 
ATOM   8024  C CB  . LEU D 1 88  ? 11.453  87.119  71.273  1.00 18.08  ? 588 LEU D CB  1 
ATOM   8025  C CG  . LEU D 1 88  ? 11.658  87.631  72.692  1.00 30.10  ? 588 LEU D CG  1 
ATOM   8026  C CD1 . LEU D 1 88  ? 10.846  88.882  72.903  1.00 30.66  ? 588 LEU D CD1 1 
ATOM   8027  C CD2 . LEU D 1 88  ? 11.296  86.553  73.706  1.00 24.30  ? 588 LEU D CD2 1 
ATOM   8028  N N   . PRO D 1 89  ? 11.260  85.180  68.848  1.00 20.82  ? 589 PRO D N   1 
ATOM   8029  C CA  . PRO D 1 89  ? 11.048  85.038  67.397  1.00 19.71  ? 589 PRO D CA  1 
ATOM   8030  C C   . PRO D 1 89  ? 11.022  86.384  66.703  1.00 24.90  ? 589 PRO D C   1 
ATOM   8031  O O   . PRO D 1 89  ? 11.565  86.557  65.604  1.00 22.70  ? 589 PRO D O   1 
ATOM   8032  C CB  . PRO D 1 89  ? 9.643   84.400  67.310  1.00 13.92  ? 589 PRO D CB  1 
ATOM   8033  C CG  . PRO D 1 89  ? 9.552   83.585  68.598  1.00 21.98  ? 589 PRO D CG  1 
ATOM   8034  C CD  . PRO D 1 89  ? 10.264  84.424  69.644  1.00 19.14  ? 589 PRO D CD  1 
ATOM   8035  N N   . HIS D 1 90  ? 10.356  87.334  67.348  1.00 24.32  ? 590 HIS D N   1 
ATOM   8036  C CA  . HIS D 1 90  ? 10.156  88.653  66.776  1.00 29.35  ? 590 HIS D CA  1 
ATOM   8037  C C   . HIS D 1 90  ? 11.437  89.443  66.564  1.00 25.90  ? 590 HIS D C   1 
ATOM   8038  O O   . HIS D 1 90  ? 11.425  90.446  65.869  1.00 36.20  ? 590 HIS D O   1 
ATOM   8039  C CB  . HIS D 1 90  ? 9.167   89.421  67.636  1.00 34.01  ? 590 HIS D CB  1 
ATOM   8040  C CG  . HIS D 1 90  ? 7.878   88.697  67.811  1.00 53.74  ? 590 HIS D CG  1 
ATOM   8041  N ND1 . HIS D 1 90  ? 7.656   87.817  68.850  1.00 61.26  ? 590 HIS D ND1 1 
ATOM   8042  C CD2 . HIS D 1 90  ? 6.760   88.667  67.047  1.00 59.79  ? 590 HIS D CD2 1 
ATOM   8043  C CE1 . HIS D 1 90  ? 6.444   87.306  68.736  1.00 64.12  ? 590 HIS D CE1 1 
ATOM   8044  N NE2 . HIS D 1 90  ? 5.879   87.804  67.648  1.00 61.59  ? 590 HIS D NE2 1 
ATOM   8045  N N   . GLY D 1 91  ? 12.538  88.987  67.156  1.00 27.68  ? 591 GLY D N   1 
ATOM   8046  C CA  . GLY D 1 91  ? 13.836  89.595  66.938  1.00 23.93  ? 591 GLY D CA  1 
ATOM   8047  C C   . GLY D 1 91  ? 14.475  89.160  65.632  1.00 24.28  ? 591 GLY D C   1 
ATOM   8048  O O   . GLY D 1 91  ? 15.659  89.402  65.400  1.00 27.20  ? 591 GLY D O   1 
ATOM   8049  N N   . HIS D 1 92  ? 13.692  88.524  64.770  1.00 17.05  ? 592 HIS D N   1 
ATOM   8050  C CA  . HIS D 1 92  ? 14.241  87.944  63.552  1.00 19.99  ? 592 HIS D CA  1 
ATOM   8051  C C   . HIS D 1 92  ? 14.945  88.996  62.684  1.00 25.38  ? 592 HIS D C   1 
ATOM   8052  O O   . HIS D 1 92  ? 16.080  88.796  62.243  1.00 29.67  ? 592 HIS D O   1 
ATOM   8053  C CB  . HIS D 1 92  ? 13.144  87.207  62.764  1.00 22.57  ? 592 HIS D CB  1 
ATOM   8054  C CG  . HIS D 1 92  ? 13.608  86.669  61.445  1.00 28.25  ? 592 HIS D CG  1 
ATOM   8055  N ND1 . HIS D 1 92  ? 14.664  85.789  61.329  1.00 26.15  ? 592 HIS D ND1 1 
ATOM   8056  C CD2 . HIS D 1 92  ? 13.181  86.909  60.182  1.00 27.27  ? 592 HIS D CD2 1 
ATOM   8057  C CE1 . HIS D 1 92  ? 14.866  85.509  60.052  1.00 27.53  ? 592 HIS D CE1 1 
ATOM   8058  N NE2 . HIS D 1 92  ? 13.977  86.172  59.337  1.00 31.37  ? 592 HIS D NE2 1 
ATOM   8059  N N   . GLN D 1 93  ? 14.261  90.114  62.449  1.00 26.55  ? 593 GLN D N   1 
ATOM   8060  C CA  . GLN D 1 93  ? 14.799  91.226  61.676  1.00 26.47  ? 593 GLN D CA  1 
ATOM   8061  C C   . GLN D 1 93  ? 16.068  91.797  62.310  1.00 29.24  ? 593 GLN D C   1 
ATOM   8062  O O   . GLN D 1 93  ? 17.076  92.007  61.628  1.00 26.60  ? 593 GLN D O   1 
ATOM   8063  C CB  . GLN D 1 93  ? 13.750  92.336  61.574  1.00 28.47  ? 593 GLN D CB  1 
ATOM   8064  C CG  . GLN D 1 93  ? 14.147  93.488  60.667  1.00 33.84  ? 593 GLN D CG  1 
ATOM   8065  C CD  . GLN D 1 93  ? 14.608  93.017  59.297  1.00 43.12  ? 593 GLN D CD  1 
ATOM   8066  O OE1 . GLN D 1 93  ? 13.816  92.916  58.361  1.00 44.16  ? 593 GLN D OE1 1 
ATOM   8067  N NE2 . GLN D 1 93  ? 15.898  92.719  59.178  1.00 45.80  ? 593 GLN D NE2 1 
ATOM   8068  N N   . LEU D 1 94  ? 16.000  92.051  63.617  1.00 24.22  ? 594 LEU D N   1 
ATOM   8069  C CA  . LEU D 1 94  ? 17.126  92.578  64.364  1.00 19.43  ? 594 LEU D CA  1 
ATOM   8070  C C   . LEU D 1 94  ? 18.322  91.641  64.231  1.00 22.49  ? 594 LEU D C   1 
ATOM   8071  O O   . LEU D 1 94  ? 19.446  92.084  64.002  1.00 27.36  ? 594 LEU D O   1 
ATOM   8072  C CB  . LEU D 1 94  ? 16.773  92.742  65.837  1.00 21.36  ? 594 LEU D CB  1 
ATOM   8073  C CG  . LEU D 1 94  ? 17.265  94.038  66.486  1.00 29.17  ? 594 LEU D CG  1 
ATOM   8074  C CD1 . LEU D 1 94  ? 17.690  93.805  67.917  1.00 19.64  ? 594 LEU D CD1 1 
ATOM   8075  C CD2 . LEU D 1 94  ? 18.383  94.681  65.686  1.00 20.55  ? 594 LEU D CD2 1 
ATOM   8076  N N   . ARG D 1 95  ? 18.076  90.343  64.372  1.00 16.16  ? 595 ARG D N   1 
ATOM   8077  C CA  . ARG D 1 95  ? 19.138  89.355  64.223  1.00 17.88  ? 595 ARG D CA  1 
ATOM   8078  C C   . ARG D 1 95  ? 19.827  89.460  62.859  1.00 21.62  ? 595 ARG D C   1 
ATOM   8079  O O   . ARG D 1 95  ? 21.063  89.409  62.781  1.00 19.55  ? 595 ARG D O   1 
ATOM   8080  C CB  . ARG D 1 95  ? 18.608  87.931  64.467  1.00 15.01  ? 595 ARG D CB  1 
ATOM   8081  C CG  . ARG D 1 95  ? 18.364  87.627  65.930  1.00 12.21  ? 595 ARG D CG  1 
ATOM   8082  C CD  . ARG D 1 95  ? 18.095  86.149  66.142  1.00 15.18  ? 595 ARG D CD  1 
ATOM   8083  N NE  . ARG D 1 95  ? 16.815  85.738  65.572  1.00 13.41  ? 595 ARG D NE  1 
ATOM   8084  C CZ  . ARG D 1 95  ? 15.667  85.824  66.229  1.00 26.06  ? 595 ARG D CZ  1 
ATOM   8085  N NH1 . ARG D 1 95  ? 15.660  86.302  67.473  1.00 23.52  ? 595 ARG D NH1 1 
ATOM   8086  N NH2 . ARG D 1 95  ? 14.533  85.430  65.653  1.00 22.98  ? 595 ARG D NH2 1 
ATOM   8087  N N   . LEU D 1 96  ? 19.030  89.612  61.796  1.00 18.43  ? 596 LEU D N   1 
ATOM   8088  C CA  . LEU D 1 96  ? 19.572  89.737  60.436  1.00 22.48  ? 596 LEU D CA  1 
ATOM   8089  C C   . LEU D 1 96  ? 20.377  91.024  60.264  1.00 26.02  ? 596 LEU D C   1 
ATOM   8090  O O   . LEU D 1 96  ? 21.417  91.009  59.617  1.00 25.89  ? 596 LEU D O   1 
ATOM   8091  C CB  . LEU D 1 96  ? 18.478  89.630  59.371  1.00 24.65  ? 596 LEU D CB  1 
ATOM   8092  C CG  . LEU D 1 96  ? 17.612  88.360  59.393  1.00 30.25  ? 596 LEU D CG  1 
ATOM   8093  C CD1 . LEU D 1 96  ? 16.431  88.530  58.450  1.00 34.56  ? 596 LEU D CD1 1 
ATOM   8094  C CD2 . LEU D 1 96  ? 18.406  87.080  59.064  1.00 22.47  ? 596 LEU D CD2 1 
ATOM   8095  N N   . ASP D 1 97  ? 19.921  92.123  60.868  1.00 19.94  ? 597 ASP D N   1 
ATOM   8096  C CA  . ASP D 1 97  ? 20.681  93.383  60.819  1.00 22.40  ? 597 ASP D CA  1 
ATOM   8097  C C   . ASP D 1 97  ? 22.013  93.267  61.550  1.00 17.40  ? 597 ASP D C   1 
ATOM   8098  O O   . ASP D 1 97  ? 23.020  93.823  61.130  1.00 14.96  ? 597 ASP D O   1 
ATOM   8099  C CB  . ASP D 1 97  ? 19.884  94.556  61.414  1.00 21.58  ? 597 ASP D CB  1 
ATOM   8100  C CG  . ASP D 1 97  ? 18.569  94.794  60.698  1.00 29.48  ? 597 ASP D CG  1 
ATOM   8101  O OD1 . ASP D 1 97  ? 18.415  94.286  59.569  1.00 33.31  ? 597 ASP D OD1 1 
ATOM   8102  O OD2 . ASP D 1 97  ? 17.692  95.487  61.266  1.00 36.64  ? 597 ASP D OD2 1 
ATOM   8103  N N   . ILE D 1 98  ? 22.008  92.548  62.661  1.00 20.99  ? 598 ILE D N   1 
ATOM   8104  C CA  . ILE D 1 98  ? 23.227  92.345  63.428  1.00 20.38  ? 598 ILE D CA  1 
ATOM   8105  C C   . ILE D 1 98  ? 24.243  91.503  62.672  1.00 20.68  ? 598 ILE D C   1 
ATOM   8106  O O   . ILE D 1 98  ? 25.454  91.707  62.780  1.00 21.03  ? 598 ILE D O   1 
ATOM   8107  C CB  . ILE D 1 98  ? 22.904  91.716  64.777  1.00 18.23  ? 598 ILE D CB  1 
ATOM   8108  C CG1 . ILE D 1 98  ? 22.460  92.826  65.727  1.00 15.35  ? 598 ILE D CG1 1 
ATOM   8109  C CG2 . ILE D 1 98  ? 24.097  90.923  65.320  1.00 8.80   ? 598 ILE D CG2 1 
ATOM   8110  C CD1 . ILE D 1 98  ? 21.817  92.320  66.978  1.00 35.04  ? 598 ILE D CD1 1 
ATOM   8111  N N   . ILE D 1 99  ? 23.744  90.565  61.886  1.00 23.77  ? 599 ILE D N   1 
ATOM   8112  C CA  . ILE D 1 99  ? 24.621  89.713  61.107  1.00 26.98  ? 599 ILE D CA  1 
ATOM   8113  C C   . ILE D 1 99  ? 25.192  90.505  59.944  1.00 25.83  ? 599 ILE D C   1 
ATOM   8114  O O   . ILE D 1 99  ? 26.393  90.446  59.658  1.00 19.26  ? 599 ILE D O   1 
ATOM   8115  C CB  . ILE D 1 99  ? 23.866  88.485  60.593  1.00 21.99  ? 599 ILE D CB  1 
ATOM   8116  C CG1 . ILE D 1 99  ? 23.588  87.531  61.761  1.00 21.23  ? 599 ILE D CG1 1 
ATOM   8117  C CG2 . ILE D 1 99  ? 24.638  87.824  59.484  1.00 15.38  ? 599 ILE D CG2 1 
ATOM   8118  C CD1 . ILE D 1 99  ? 22.568  86.444  61.437  1.00 18.38  ? 599 ILE D CD1 1 
ATOM   8119  N N   . GLU D 1 100 ? 24.324  91.263  59.282  1.00 25.02  ? 600 GLU D N   1 
ATOM   8120  C CA  . GLU D 1 100 ? 24.734  92.059  58.129  1.00 19.09  ? 600 GLU D CA  1 
ATOM   8121  C C   . GLU D 1 100 ? 25.804  93.066  58.536  1.00 21.67  ? 600 GLU D C   1 
ATOM   8122  O O   . GLU D 1 100 ? 26.768  93.284  57.799  1.00 28.30  ? 600 GLU D O   1 
ATOM   8123  C CB  . GLU D 1 100 ? 23.539  92.786  57.516  1.00 28.51  ? 600 GLU D CB  1 
ATOM   8124  C CG  . GLU D 1 100 ? 23.920  93.731  56.395  1.00 39.16  ? 600 GLU D CG  1 
ATOM   8125  C CD  . GLU D 1 100 ? 24.267  92.987  55.126  1.00 44.96  ? 600 GLU D CD  1 
ATOM   8126  O OE1 . GLU D 1 100 ? 23.335  92.425  54.510  1.00 46.81  ? 600 GLU D OE1 1 
ATOM   8127  O OE2 . GLU D 1 100 ? 25.462  92.959  54.748  1.00 42.52  ? 600 GLU D OE2 1 
ATOM   8128  N N   . ARG D 1 101 ? 25.650  93.665  59.716  1.00 14.24  ? 601 ARG D N   1 
ATOM   8129  C CA  . ARG D 1 101 ? 26.590  94.705  60.150  1.00 27.61  ? 601 ARG D CA  1 
ATOM   8130  C C   . ARG D 1 101 ? 27.952  94.104  60.469  1.00 21.21  ? 601 ARG D C   1 
ATOM   8131  O O   . ARG D 1 101 ? 28.997  94.659  60.137  1.00 21.17  ? 601 ARG D O   1 
ATOM   8132  C CB  . ARG D 1 101 ? 26.040  95.482  61.358  1.00 23.86  ? 601 ARG D CB  1 
ATOM   8133  C CG  . ARG D 1 101 ? 27.090  96.255  62.136  1.00 20.69  ? 601 ARG D CG  1 
ATOM   8134  C CD  . ARG D 1 101 ? 26.429  97.084  63.209  1.00 21.92  ? 601 ARG D CD  1 
ATOM   8135  N NE  . ARG D 1 101 ? 27.392  97.951  63.858  1.00 24.56  ? 601 ARG D NE  1 
ATOM   8136  C CZ  . ARG D 1 101 ? 27.825  99.092  63.337  1.00 27.45  ? 601 ARG D CZ  1 
ATOM   8137  N NH1 . ARG D 1 101 ? 27.378  99.494  62.154  1.00 24.50  ? 601 ARG D NH1 1 
ATOM   8138  N NH2 . ARG D 1 101 ? 28.705  99.832  63.996  1.00 24.90  ? 601 ARG D NH2 1 
ATOM   8139  N N   . HIS D 1 102 ? 27.924  92.952  61.115  1.00 25.34  ? 602 HIS D N   1 
ATOM   8140  C CA  . HIS D 1 102 ? 29.141  92.225  61.438  1.00 25.90  ? 602 HIS D CA  1 
ATOM   8141  C C   . HIS D 1 102 ? 29.923  91.854  60.181  1.00 30.57  ? 602 HIS D C   1 
ATOM   8142  O O   . HIS D 1 102 ? 31.103  92.180  60.061  1.00 32.26  ? 602 HIS D O   1 
ATOM   8143  C CB  . HIS D 1 102 ? 28.801  90.965  62.223  1.00 20.26  ? 602 HIS D CB  1 
ATOM   8144  C CG  . HIS D 1 102 ? 29.967  90.382  62.950  1.00 26.89  ? 602 HIS D CG  1 
ATOM   8145  N ND1 . HIS D 1 102 ? 30.848  89.503  62.358  1.00 17.93  ? 602 HIS D ND1 1 
ATOM   8146  C CD2 . HIS D 1 102 ? 30.396  90.552  64.225  1.00 20.46  ? 602 HIS D CD2 1 
ATOM   8147  C CE1 . HIS D 1 102 ? 31.760  89.144  63.246  1.00 21.29  ? 602 HIS D CE1 1 
ATOM   8148  N NE2 . HIS D 1 102 ? 31.507  89.765  64.385  1.00 17.67  ? 602 HIS D NE2 1 
ATOM   8149  N N   . ASN D 1 103 ? 29.269  91.169  59.245  1.00 25.58  ? 603 ASN D N   1 
ATOM   8150  C CA  . ASN D 1 103 ? 29.918  90.827  57.978  1.00 24.27  ? 603 ASN D CA  1 
ATOM   8151  C C   . ASN D 1 103 ? 30.550  92.029  57.289  1.00 25.07  ? 603 ASN D C   1 
ATOM   8152  O O   . ASN D 1 103 ? 31.699  91.975  56.857  1.00 30.36  ? 603 ASN D O   1 
ATOM   8153  C CB  . ASN D 1 103 ? 28.923  90.210  57.007  1.00 20.96  ? 603 ASN D CB  1 
ATOM   8154  C CG  . ASN D 1 103 ? 28.426  88.882  57.460  1.00 31.69  ? 603 ASN D CG  1 
ATOM   8155  O OD1 . ASN D 1 103 ? 29.157  88.099  58.078  1.00 33.87  ? 603 ASN D OD1 1 
ATOM   8156  N ND2 . ASN D 1 103 ? 27.167  88.603  57.154  1.00 34.61  ? 603 ASN D ND2 1 
ATOM   8157  N N   . THR D 1 104 ? 29.777  93.103  57.168  1.00 19.23  ? 604 THR D N   1 
ATOM   8158  C CA  . THR D 1 104 ? 30.207  94.268  56.421  1.00 19.19  ? 604 THR D CA  1 
ATOM   8159  C C   . THR D 1 104 ? 31.414  94.897  57.103  1.00 25.74  ? 604 THR D C   1 
ATOM   8160  O O   . THR D 1 104 ? 32.374  95.265  56.433  1.00 25.76  ? 604 THR D O   1 
ATOM   8161  C CB  . THR D 1 104 ? 29.051  95.285  56.254  1.00 23.84  ? 604 THR D CB  1 
ATOM   8162  O OG1 . THR D 1 104 ? 28.106  94.759  55.319  1.00 30.97  ? 604 THR D OG1 1 
ATOM   8163  C CG2 . THR D 1 104 ? 29.550  96.630  55.740  1.00 21.00  ? 604 THR D CG2 1 
ATOM   8164  N N   . MET D 1 105 ? 31.380  94.989  58.431  1.00 19.42  ? 605 MET D N   1 
ATOM   8165  C CA  . MET D 1 105 ? 32.489  95.588  59.168  1.00 18.05  ? 605 MET D CA  1 
ATOM   8166  C C   . MET D 1 105 ? 33.763  94.755  59.001  1.00 28.13  ? 605 MET D C   1 
ATOM   8167  O O   . MET D 1 105 ? 34.853  95.302  58.807  1.00 23.11  ? 605 MET D O   1 
ATOM   8168  C CB  . MET D 1 105 ? 32.134  95.736  60.645  1.00 28.60  ? 605 MET D CB  1 
ATOM   8169  C CG  . MET D 1 105 ? 33.120  96.595  61.427  1.00 33.08  ? 605 MET D CG  1 
ATOM   8170  S SD  . MET D 1 105 ? 32.819  96.526  63.204  1.00 48.66  ? 605 MET D SD  1 
ATOM   8171  C CE  . MET D 1 105 ? 31.060  96.890  63.258  1.00 74.82  ? 605 MET D CE  1 
ATOM   8172  N N   . ALA D 1 106 ? 33.630  93.429  59.057  1.00 22.91  ? 606 ALA D N   1 
ATOM   8173  C CA  . ALA D 1 106 ? 34.793  92.575  58.884  1.00 21.65  ? 606 ALA D CA  1 
ATOM   8174  C C   . ALA D 1 106 ? 35.332  92.681  57.458  1.00 27.96  ? 606 ALA D C   1 
ATOM   8175  O O   . ALA D 1 106 ? 36.540  92.637  57.253  1.00 26.56  ? 606 ALA D O   1 
ATOM   8176  C CB  . ALA D 1 106 ? 34.485  91.121  59.244  1.00 15.36  ? 606 ALA D CB  1 
ATOM   8177  N N   . ILE D 1 107 ? 34.448  92.829  56.472  1.00 31.51  ? 607 ILE D N   1 
ATOM   8178  C CA  . ILE D 1 107 ? 34.909  92.995  55.091  1.00 28.82  ? 607 ILE D CA  1 
ATOM   8179  C C   . ILE D 1 107 ? 35.649  94.339  54.937  1.00 32.87  ? 607 ILE D C   1 
ATOM   8180  O O   . ILE D 1 107 ? 36.732  94.394  54.363  1.00 32.41  ? 607 ILE D O   1 
ATOM   8181  C CB  . ILE D 1 107 ? 33.767  92.831  54.064  1.00 26.13  ? 607 ILE D CB  1 
ATOM   8182  C CG1 . ILE D 1 107 ? 33.252  91.393  54.085  1.00 28.79  ? 607 ILE D CG1 1 
ATOM   8183  C CG2 . ILE D 1 107 ? 34.252  93.140  52.654  1.00 32.42  ? 607 ILE D CG2 1 
ATOM   8184  C CD1 . ILE D 1 107 ? 32.130  91.139  53.125  1.00 30.32  ? 607 ILE D CD1 1 
ATOM   8185  N N   . GLY D 1 108 ? 35.075  95.407  55.489  1.00 28.47  ? 608 GLY D N   1 
ATOM   8186  C CA  . GLY D 1 108 ? 35.712  96.707  55.496  1.00 22.25  ? 608 GLY D CA  1 
ATOM   8187  C C   . GLY D 1 108 ? 37.119  96.674  56.062  1.00 22.91  ? 608 GLY D C   1 
ATOM   8188  O O   . GLY D 1 108 ? 38.046  97.158  55.424  1.00 35.82  ? 608 GLY D O   1 
ATOM   8189  N N   . ILE D 1 109 ? 37.287  96.110  57.255  1.00 21.84  ? 609 ILE D N   1 
ATOM   8190  C CA  . ILE D 1 109 ? 38.613  95.997  57.860  1.00 24.65  ? 609 ILE D CA  1 
ATOM   8191  C C   . ILE D 1 109 ? 39.616  95.309  56.938  1.00 33.15  ? 609 ILE D C   1 
ATOM   8192  O O   . ILE D 1 109 ? 40.774  95.696  56.889  1.00 38.65  ? 609 ILE D O   1 
ATOM   8193  C CB  . ILE D 1 109 ? 38.603  95.209  59.179  1.00 30.94  ? 609 ILE D CB  1 
ATOM   8194  C CG1 . ILE D 1 109 ? 37.445  95.649  60.078  1.00 30.06  ? 609 ILE D CG1 1 
ATOM   8195  C CG2 . ILE D 1 109 ? 39.960  95.358  59.880  1.00 20.67  ? 609 ILE D CG2 1 
ATOM   8196  C CD1 . ILE D 1 109 ? 37.812  96.720  61.008  1.00 33.79  ? 609 ILE D CD1 1 
ATOM   8197  N N   . ALA D 1 110 ? 39.182  94.277  56.223  1.00 38.49  ? 610 ALA D N   1 
ATOM   8198  C CA  . ALA D 1 110 ? 40.088  93.548  55.341  1.00 32.22  ? 610 ALA D CA  1 
ATOM   8199  C C   . ALA D 1 110 ? 40.543  94.448  54.201  1.00 36.52  ? 610 ALA D C   1 
ATOM   8200  O O   . ALA D 1 110 ? 41.720  94.467  53.843  1.00 34.99  ? 610 ALA D O   1 
ATOM   8201  C CB  . ALA D 1 110 ? 39.424  92.288  54.803  1.00 28.24  ? 610 ALA D CB  1 
ATOM   8202  N N   . VAL D 1 111 ? 39.595  95.201  53.649  1.00 40.00  ? 611 VAL D N   1 
ATOM   8203  C CA  . VAL D 1 111 ? 39.850  96.146  52.571  1.00 39.60  ? 611 VAL D CA  1 
ATOM   8204  C C   . VAL D 1 111 ? 40.838  97.228  53.008  1.00 43.47  ? 611 VAL D C   1 
ATOM   8205  O O   . VAL D 1 111 ? 41.621  97.733  52.201  1.00 45.94  ? 611 VAL D O   1 
ATOM   8206  C CB  . VAL D 1 111 ? 38.524  96.801  52.110  1.00 43.11  ? 611 VAL D CB  1 
ATOM   8207  C CG1 . VAL D 1 111 ? 38.775  97.904  51.073  1.00 33.20  ? 611 VAL D CG1 1 
ATOM   8208  C CG2 . VAL D 1 111 ? 37.572  95.739  51.566  1.00 44.62  ? 611 VAL D CG2 1 
ATOM   8209  N N   . ASP D 1 112 ? 40.799  97.573  54.292  1.00 39.50  ? 612 ASP D N   1 
ATOM   8210  C CA  . ASP D 1 112 ? 41.685  98.589  54.855  1.00 48.83  ? 612 ASP D CA  1 
ATOM   8211  C C   . ASP D 1 112 ? 43.158  98.169  54.787  1.00 52.17  ? 612 ASP D C   1 
ATOM   8212  O O   . ASP D 1 112 ? 44.047  99.006  54.641  1.00 51.78  ? 612 ASP D O   1 
ATOM   8213  C CB  . ASP D 1 112 ? 41.287  98.874  56.307  1.00 54.09  ? 612 ASP D CB  1 
ATOM   8214  C CG  . ASP D 1 112 ? 41.826  100.189 56.811  1.00 64.31  ? 612 ASP D CG  1 
ATOM   8215  O OD1 . ASP D 1 112 ? 41.333  101.241 56.351  1.00 82.54  ? 612 ASP D OD1 1 
ATOM   8216  O OD2 . ASP D 1 112 ? 42.727  100.177 57.673  1.00 60.79  ? 612 ASP D OD2 1 
ATOM   8217  N N   . ILE D 1 113 ? 43.402  96.868  54.912  1.00 49.77  ? 613 ILE D N   1 
ATOM   8218  C CA  . ILE D 1 113 ? 44.750  96.314  54.856  1.00 44.93  ? 613 ILE D CA  1 
ATOM   8219  C C   . ILE D 1 113 ? 45.097  95.981  53.422  1.00 38.04  ? 613 ILE D C   1 
ATOM   8220  O O   . ILE D 1 113 ? 46.158  96.332  52.941  1.00 42.58  ? 613 ILE D O   1 
ATOM   8221  C CB  . ILE D 1 113 ? 44.862  95.004  55.674  1.00 44.81  ? 613 ILE D CB  1 
ATOM   8222  C CG1 . ILE D 1 113 ? 44.512  95.238  57.145  1.00 44.96  ? 613 ILE D CG1 1 
ATOM   8223  C CG2 . ILE D 1 113 ? 46.257  94.416  55.545  1.00 39.33  ? 613 ILE D CG2 1 
ATOM   8224  C CD1 . ILE D 1 113 ? 44.074  93.976  57.890  1.00 37.96  ? 613 ILE D CD1 1 
ATOM   8225  N N   . LEU D 1 114 ? 44.184  95.291  52.750  1.00 42.77  ? 614 LEU D N   1 
ATOM   8226  C CA  . LEU D 1 114 ? 44.406  94.786  51.399  1.00 47.42  ? 614 LEU D CA  1 
ATOM   8227  C C   . LEU D 1 114 ? 44.233  95.845  50.306  1.00 54.82  ? 614 LEU D C   1 
ATOM   8228  O O   . LEU D 1 114 ? 44.550  95.604  49.136  1.00 58.46  ? 614 LEU D O   1 
ATOM   8229  C CB  . LEU D 1 114 ? 43.477  93.602  51.135  1.00 40.17  ? 614 LEU D CB  1 
ATOM   8230  C CG  . LEU D 1 114 ? 43.918  92.284  51.767  1.00 44.43  ? 614 LEU D CG  1 
ATOM   8231  C CD1 . LEU D 1 114 ? 42.827  91.223  51.675  1.00 48.21  ? 614 LEU D CD1 1 
ATOM   8232  C CD2 . LEU D 1 114 ? 45.190  91.818  51.093  1.00 41.15  ? 614 LEU D CD2 1 
ATOM   8233  N N   . GLY D 1 115 ? 43.734  97.015  50.689  1.00 51.73  ? 615 GLY D N   1 
ATOM   8234  C CA  . GLY D 1 115 ? 43.465  98.073  49.734  1.00 55.80  ? 615 GLY D CA  1 
ATOM   8235  C C   . GLY D 1 115 ? 44.143  99.392  50.054  1.00 61.50  ? 615 GLY D C   1 
ATOM   8236  O O   . GLY D 1 115 ? 45.151  99.733  49.445  1.00 67.44  ? 615 GLY D O   1 
ATOM   8237  N N   . CYS D 1 116 ? 43.589  100.116 51.026  1.00 71.59  ? 616 CYS D N   1 
ATOM   8238  C CA  . CYS D 1 116 ? 43.991  101.490 51.358  1.00 78.17  ? 616 CYS D CA  1 
ATOM   8239  C C   . CYS D 1 116 ? 45.413  101.631 51.901  1.00 79.65  ? 616 CYS D C   1 
ATOM   8240  O O   . CYS D 1 116 ? 45.630  102.291 52.918  1.00 76.49  ? 616 CYS D O   1 
ATOM   8241  C CB  . CYS D 1 116 ? 43.015  102.082 52.381  1.00 76.42  ? 616 CYS D CB  1 
ATOM   8242  S SG  . CYS D 1 116 ? 41.271  101.740 52.039  1.00 69.89  ? 616 CYS D SG  1 
ATOM   8243  N N   . THR D 1 117 ? 46.379  101.034 51.211  1.00 81.87  ? 617 THR D N   1 
ATOM   8244  C CA  . THR D 1 117 ? 47.749  101.014 51.698  1.00 79.22  ? 617 THR D CA  1 
ATOM   8245  C C   . THR D 1 117 ? 48.776  101.247 50.592  1.00 82.41  ? 617 THR D C   1 
ATOM   8246  O O   . THR D 1 117 ? 48.530  100.941 49.424  1.00 85.14  ? 617 THR D O   1 
ATOM   8247  C CB  . THR D 1 117 ? 48.041  99.694  52.397  1.00 73.05  ? 617 THR D CB  1 
ATOM   8248  O OG1 . THR D 1 117 ? 47.279  98.663  51.758  1.00 72.53  ? 617 THR D OG1 1 
ATOM   8249  C CG2 . THR D 1 117 ? 47.633  99.775  53.859  1.00 68.05  ? 617 THR D CG2 1 
ATOM   8250  N N   . GLY D 1 118 ? 49.920  101.806 50.981  1.00 75.58  ? 618 GLY D N   1 
ATOM   8251  C CA  . GLY D 1 118 ? 51.023  102.048 50.073  1.00 65.32  ? 618 GLY D CA  1 
ATOM   8252  C C   . GLY D 1 118 ? 52.162  101.070 50.317  1.00 67.29  ? 618 GLY D C   1 
ATOM   8253  O O   . GLY D 1 118 ? 52.348  100.108 49.569  1.00 62.17  ? 618 GLY D O   1 
ATOM   8254  N N   . THR D 1 119 ? 52.920  101.303 51.383  1.00 65.89  ? 619 THR D N   1 
ATOM   8255  C CA  . THR D 1 119 ? 54.128  100.529 51.650  1.00 59.40  ? 619 THR D CA  1 
ATOM   8256  C C   . THR D 1 119 ? 53.877  99.259  52.462  1.00 59.72  ? 619 THR D C   1 
ATOM   8257  O O   . THR D 1 119 ? 52.884  99.157  53.188  1.00 63.61  ? 619 THR D O   1 
ATOM   8258  C CB  . THR D 1 119 ? 55.168  101.389 52.392  1.00 59.30  ? 619 THR D CB  1 
ATOM   8259  O OG1 . THR D 1 119 ? 56.208  100.553 52.902  1.00 73.52  ? 619 THR D OG1 1 
ATOM   8260  C CG2 . THR D 1 119 ? 54.533  102.086 53.545  1.00 53.31  ? 619 THR D CG2 1 
ATOM   8261  N N   . LEU D 1 120 ? 54.777  98.288  52.337  1.00 54.32  ? 620 LEU D N   1 
ATOM   8262  C CA  . LEU D 1 120 ? 54.751  97.149  53.238  1.00 51.83  ? 620 LEU D CA  1 
ATOM   8263  C C   . LEU D 1 120 ? 54.774  97.705  54.649  1.00 51.74  ? 620 LEU D C   1 
ATOM   8264  O O   . LEU D 1 120 ? 54.060  97.222  55.521  1.00 55.65  ? 620 LEU D O   1 
ATOM   8265  C CB  . LEU D 1 120 ? 55.948  96.228  53.020  1.00 55.25  ? 620 LEU D CB  1 
ATOM   8266  C CG  . LEU D 1 120 ? 56.026  95.043  53.992  1.00 61.13  ? 620 LEU D CG  1 
ATOM   8267  C CD1 . LEU D 1 120 ? 54.802  94.142  53.879  1.00 48.10  ? 620 LEU D CD1 1 
ATOM   8268  C CD2 . LEU D 1 120 ? 57.296  94.240  53.779  1.00 64.93  ? 620 LEU D CD2 1 
ATOM   8269  N N   . GLU D 1 121 ? 55.579  98.743  54.857  1.00 50.79  ? 621 GLU D N   1 
ATOM   8270  C CA  . GLU D 1 121 ? 55.659  99.427  56.146  1.00 54.07  ? 621 GLU D CA  1 
ATOM   8271  C C   . GLU D 1 121 ? 54.313  99.996  56.605  1.00 46.95  ? 621 GLU D C   1 
ATOM   8272  O O   . GLU D 1 121 ? 53.946  99.866  57.773  1.00 38.96  ? 621 GLU D O   1 
ATOM   8273  C CB  . GLU D 1 121 ? 56.699  100.550 56.101  1.00 64.50  ? 621 GLU D CB  1 
ATOM   8274  C CG  . GLU D 1 121 ? 58.149  100.074 55.992  1.00 86.68  ? 621 GLU D CG  1 
ATOM   8275  C CD  . GLU D 1 121 ? 58.560  99.694  54.571  1.00 97.22  ? 621 GLU D CD  1 
ATOM   8276  O OE1 . GLU D 1 121 ? 58.786  100.610 53.744  1.00 98.81  ? 621 GLU D OE1 1 
ATOM   8277  O OE2 . GLU D 1 121 ? 58.670  98.479  54.289  1.00 97.09  ? 621 GLU D OE2 1 
ATOM   8278  N N   . ASP D 1 122 ? 53.596  100.642 55.690  1.00 45.34  ? 622 ASP D N   1 
ATOM   8279  C CA  A ASP D 1 122 ? 52.318  101.246 56.027  0.52 43.08  ? 622 ASP D CA  1 
ATOM   8280  C CA  B ASP D 1 122 ? 52.305  101.249 55.998  0.48 43.54  ? 622 ASP D CA  1 
ATOM   8281  C C   . ASP D 1 122 ? 51.269  100.178 56.310  1.00 44.68  ? 622 ASP D C   1 
ATOM   8282  O O   . ASP D 1 122 ? 50.313  100.417 57.045  1.00 45.00  ? 622 ASP D O   1 
ATOM   8283  C CB  A ASP D 1 122 ? 51.848  102.192 54.919  0.52 44.89  ? 622 ASP D CB  1 
ATOM   8284  C CB  B ASP D 1 122 ? 51.832  102.133 54.835  0.48 44.89  ? 622 ASP D CB  1 
ATOM   8285  C CG  A ASP D 1 122 ? 52.644  103.482 54.880  0.52 48.17  ? 622 ASP D CG  1 
ATOM   8286  C CG  B ASP D 1 122 ? 50.312  102.237 54.746  0.48 49.04  ? 622 ASP D CG  1 
ATOM   8287  O OD1 A ASP D 1 122 ? 52.724  104.105 53.799  0.52 47.40  ? 622 ASP D OD1 1 
ATOM   8288  O OD1 B ASP D 1 122 ? 49.724  103.151 55.369  0.48 51.43  ? 622 ASP D OD1 1 
ATOM   8289  O OD2 A ASP D 1 122 ? 53.202  103.864 55.931  0.52 50.93  ? 622 ASP D OD2 1 
ATOM   8290  O OD2 B ASP D 1 122 ? 49.704  101.405 54.041  0.48 49.70  ? 622 ASP D OD2 1 
ATOM   8291  N N   . ARG D 1 123 ? 51.463  98.998  55.735  1.00 42.83  ? 623 ARG D N   1 
ATOM   8292  C CA  . ARG D 1 123 ? 50.533  97.897  55.937  1.00 38.34  ? 623 ARG D CA  1 
ATOM   8293  C C   . ARG D 1 123 ? 50.696  97.326  57.340  1.00 39.50  ? 623 ARG D C   1 
ATOM   8294  O O   . ARG D 1 123 ? 49.720  97.020  58.014  1.00 40.21  ? 623 ARG D O   1 
ATOM   8295  C CB  . ARG D 1 123 ? 50.758  96.817  54.880  1.00 46.92  ? 623 ARG D CB  1 
ATOM   8296  C CG  . ARG D 1 123 ? 49.511  96.437  54.108  1.00 52.28  ? 623 ARG D CG  1 
ATOM   8297  C CD  . ARG D 1 123 ? 49.843  95.985  52.697  1.00 53.34  ? 623 ARG D CD  1 
ATOM   8298  N NE  . ARG D 1 123 ? 50.755  94.846  52.688  1.00 56.56  ? 623 ARG D NE  1 
ATOM   8299  C CZ  . ARG D 1 123 ? 51.766  94.715  51.834  1.00 55.45  ? 623 ARG D CZ  1 
ATOM   8300  N NH1 . ARG D 1 123 ? 51.993  95.650  50.925  1.00 52.16  ? 623 ARG D NH1 1 
ATOM   8301  N NH2 . ARG D 1 123 ? 52.553  93.652  51.890  1.00 59.02  ? 623 ARG D NH2 1 
ATOM   8302  N N   . ALA D 1 124 ? 51.937  97.181  57.781  1.00 42.02  ? 624 ALA D N   1 
ATOM   8303  C CA  . ALA D 1 124 ? 52.198  96.777  59.155  1.00 37.01  ? 624 ALA D CA  1 
ATOM   8304  C C   . ALA D 1 124 ? 51.625  97.845  60.088  1.00 34.27  ? 624 ALA D C   1 
ATOM   8305  O O   . ALA D 1 124 ? 50.936  97.533  61.061  1.00 33.04  ? 624 ALA D O   1 
ATOM   8306  C CB  . ALA D 1 124 ? 53.690  96.604  59.379  1.00 26.38  ? 624 ALA D CB  1 
ATOM   8307  N N   . ALA D 1 125 ? 51.910  99.110  59.780  1.00 27.81  ? 625 ALA D N   1 
ATOM   8308  C CA  . ALA D 1 125 ? 51.369  100.224 60.556  1.00 31.03  ? 625 ALA D CA  1 
ATOM   8309  C C   . ALA D 1 125 ? 49.850  100.093 60.719  1.00 34.47  ? 625 ALA D C   1 
ATOM   8310  O O   . ALA D 1 125 ? 49.322  100.263 61.814  1.00 42.42  ? 625 ALA D O   1 
ATOM   8311  C CB  . ALA D 1 125 ? 51.724  101.554 59.905  1.00 23.89  ? 625 ALA D CB  1 
ATOM   8312  N N   . THR D 1 126 ? 49.161  99.774  59.625  1.00 33.74  ? 626 THR D N   1 
ATOM   8313  C CA  . THR D 1 126 ? 47.708  99.623  59.631  1.00 35.59  ? 626 THR D CA  1 
ATOM   8314  C C   . THR D 1 126 ? 47.263  98.426  60.466  1.00 41.64  ? 626 THR D C   1 
ATOM   8315  O O   . THR D 1 126 ? 46.352  98.530  61.288  1.00 37.15  ? 626 THR D O   1 
ATOM   8316  C CB  . THR D 1 126 ? 47.164  99.460  58.207  1.00 44.01  ? 626 THR D CB  1 
ATOM   8317  O OG1 . THR D 1 126 ? 47.469  100.632 57.447  1.00 50.94  ? 626 THR D OG1 1 
ATOM   8318  C CG2 . THR D 1 126 ? 45.650  99.256  58.231  1.00 47.38  ? 626 THR D CG2 1 
ATOM   8319  N N   . LEU D 1 127 ? 47.911  97.288  60.239  1.00 39.36  ? 627 LEU D N   1 
ATOM   8320  C CA  . LEU D 1 127 ? 47.625  96.070  60.988  1.00 30.43  ? 627 LEU D CA  1 
ATOM   8321  C C   . LEU D 1 127 ? 47.767  96.353  62.480  1.00 31.07  ? 627 LEU D C   1 
ATOM   8322  O O   . LEU D 1 127 ? 46.962  95.901  63.298  1.00 26.99  ? 627 LEU D O   1 
ATOM   8323  C CB  . LEU D 1 127 ? 48.588  94.960  60.567  1.00 28.67  ? 627 LEU D CB  1 
ATOM   8324  C CG  . LEU D 1 127 ? 48.214  93.575  61.068  1.00 40.60  ? 627 LEU D CG  1 
ATOM   8325  C CD1 . LEU D 1 127 ? 46.843  93.223  60.515  1.00 43.19  ? 627 LEU D CD1 1 
ATOM   8326  C CD2 . LEU D 1 127 ? 49.257  92.550  60.648  1.00 35.74  ? 627 LEU D CD2 1 
ATOM   8327  N N   . SER D 1 128 ? 48.786  97.131  62.824  1.00 34.05  ? 628 SER D N   1 
ATOM   8328  C CA  . SER D 1 128 ? 49.031  97.486  64.212  1.00 37.20  ? 628 SER D CA  1 
ATOM   8329  C C   . SER D 1 128 ? 47.875  98.338  64.780  1.00 40.15  ? 628 SER D C   1 
ATOM   8330  O O   . SER D 1 128 ? 47.444  98.132  65.923  1.00 34.88  ? 628 SER D O   1 
ATOM   8331  C CB  . SER D 1 128 ? 50.384  98.203  64.341  1.00 34.86  ? 628 SER D CB  1 
ATOM   8332  O OG  . SER D 1 128 ? 50.758  98.395  65.698  1.00 36.84  ? 628 SER D OG  1 
ATOM   8333  N N   . LYS D 1 129 ? 47.345  99.274  63.991  1.00 33.32  ? 629 LYS D N   1 
ATOM   8334  C CA  . LYS D 1 129 ? 46.296  100.138 64.535  1.00 28.93  ? 629 LYS D CA  1 
ATOM   8335  C C   . LYS D 1 129 ? 45.015  99.352  64.744  1.00 26.49  ? 629 LYS D C   1 
ATOM   8336  O O   . LYS D 1 129 ? 44.306  99.557  65.726  1.00 25.08  ? 629 LYS D O   1 
ATOM   8337  C CB  . LYS D 1 129 ? 46.030  101.390 63.689  1.00 32.01  ? 629 LYS D CB  1 
ATOM   8338  C CG  . LYS D 1 129 ? 45.474  102.564 64.534  1.00 37.50  ? 629 LYS D CG  1 
ATOM   8339  C CD  . LYS D 1 129 ? 44.544  103.464 63.756  1.00 45.31  ? 629 LYS D CD  1 
ATOM   8340  C CE  . LYS D 1 129 ? 45.168  104.826 63.486  1.00 47.79  ? 629 LYS D CE  1 
ATOM   8341  N NZ  . LYS D 1 129 ? 45.357  105.622 64.723  1.00 49.32  ? 629 LYS D NZ  1 
ATOM   8342  N N   . ILE D 1 130 ? 44.732  98.442  63.820  1.00 24.64  ? 630 ILE D N   1 
ATOM   8343  C CA  . ILE D 1 130 ? 43.605  97.533  63.969  1.00 15.63  ? 630 ILE D CA  1 
ATOM   8344  C C   . ILE D 1 130 ? 43.687  96.750  65.284  1.00 24.40  ? 630 ILE D C   1 
ATOM   8345  O O   . ILE D 1 130 ? 42.708  96.671  66.033  1.00 23.43  ? 630 ILE D O   1 
ATOM   8346  C CB  . ILE D 1 130 ? 43.454  96.604  62.750  1.00 20.57  ? 630 ILE D CB  1 
ATOM   8347  C CG1 . ILE D 1 130 ? 43.084  97.434  61.516  1.00 23.74  ? 630 ILE D CG1 1 
ATOM   8348  C CG2 . ILE D 1 130 ? 42.399  95.514  63.010  1.00 13.37  ? 630 ILE D CG2 1 
ATOM   8349  C CD1 . ILE D 1 130 ? 43.327  96.732  60.196  1.00 29.12  ? 630 ILE D CD1 1 
ATOM   8350  N N   . ILE D 1 131 ? 44.854  96.195  65.585  1.00 30.88  ? 631 ILE D N   1 
ATOM   8351  C CA  . ILE D 1 131 ? 45.003  95.465  66.841  1.00 26.81  ? 631 ILE D CA  1 
ATOM   8352  C C   . ILE D 1 131 ? 44.809  96.403  68.041  1.00 28.47  ? 631 ILE D C   1 
ATOM   8353  O O   . ILE D 1 131 ? 44.207  96.032  69.040  1.00 28.66  ? 631 ILE D O   1 
ATOM   8354  C CB  . ILE D 1 131 ? 46.349  94.749  66.912  1.00 25.66  ? 631 ILE D CB  1 
ATOM   8355  C CG1 . ILE D 1 131 ? 46.454  93.733  65.769  1.00 24.00  ? 631 ILE D CG1 1 
ATOM   8356  C CG2 . ILE D 1 131 ? 46.529  94.073  68.275  1.00 29.42  ? 631 ILE D CG2 1 
ATOM   8357  C CD1 . ILE D 1 131 ? 47.821  93.010  65.700  1.00 18.29  ? 631 ILE D CD1 1 
ATOM   8358  N N   . GLN D 1 132 ? 45.285  97.635  67.923  1.00 34.19  ? 632 GLN D N   1 
ATOM   8359  C CA  . GLN D 1 132 ? 45.120  98.605  69.000  1.00 31.44  ? 632 GLN D CA  1 
ATOM   8360  C C   . GLN D 1 132 ? 43.658  98.949  69.247  1.00 29.74  ? 632 GLN D C   1 
ATOM   8361  O O   . GLN D 1 132 ? 43.205  98.977  70.392  1.00 25.95  ? 632 GLN D O   1 
ATOM   8362  C CB  . GLN D 1 132 ? 45.886  99.885  68.701  1.00 26.98  ? 632 GLN D CB  1 
ATOM   8363  C CG  . GLN D 1 132 ? 47.378  99.692  68.610  1.00 29.65  ? 632 GLN D CG  1 
ATOM   8364  C CD  . GLN D 1 132 ? 48.103  101.017 68.569  1.00 35.96  ? 632 GLN D CD  1 
ATOM   8365  O OE1 . GLN D 1 132 ? 47.856  101.872 67.696  1.00 33.71  ? 632 GLN D OE1 1 
ATOM   8366  N NE2 . GLN D 1 132 ? 48.980  101.219 69.538  1.00 35.23  ? 632 GLN D NE2 1 
ATOM   8367  N N   . VAL D 1 133 ? 42.934  99.233  68.170  1.00 25.94  ? 633 VAL D N   1 
ATOM   8368  C CA  . VAL D 1 133 ? 41.503  99.490  68.255  1.00 25.98  ? 633 VAL D CA  1 
ATOM   8369  C C   . VAL D 1 133 ? 40.744  98.312  68.885  1.00 27.16  ? 633 VAL D C   1 
ATOM   8370  O O   . VAL D 1 133 ? 39.831  98.515  69.694  1.00 28.34  ? 633 VAL D O   1 
ATOM   8371  C CB  . VAL D 1 133 ? 40.902  99.839  66.873  1.00 20.92  ? 633 VAL D CB  1 
ATOM   8372  C CG1 . VAL D 1 133 ? 39.413  99.967  66.982  1.00 13.79  ? 633 VAL D CG1 1 
ATOM   8373  C CG2 . VAL D 1 133 ? 41.495  101.157 66.343  1.00 9.75   ? 633 VAL D CG2 1 
ATOM   8374  N N   . ALA D 1 134 ? 41.135  97.092  68.523  1.00 28.01  ? 634 ALA D N   1 
ATOM   8375  C CA  . ALA D 1 134 ? 40.527  95.886  69.081  1.00 26.01  ? 634 ALA D CA  1 
ATOM   8376  C C   . ALA D 1 134 ? 40.817  95.728  70.574  1.00 30.01  ? 634 ALA D C   1 
ATOM   8377  O O   . ALA D 1 134 ? 39.947  95.284  71.323  1.00 19.48  ? 634 ALA D O   1 
ATOM   8378  C CB  . ALA D 1 134 ? 40.977  94.647  68.322  1.00 26.77  ? 634 ALA D CB  1 
ATOM   8379  N N   . VAL D 1 135 ? 42.033  96.073  71.007  1.00 30.06  ? 635 VAL D N   1 
ATOM   8380  C CA  . VAL D 1 135 ? 42.345  96.083  72.440  1.00 23.52  ? 635 VAL D CA  1 
ATOM   8381  C C   . VAL D 1 135 ? 41.419  97.071  73.150  1.00 24.69  ? 635 VAL D C   1 
ATOM   8382  O O   . VAL D 1 135 ? 40.906  96.793  74.235  1.00 23.39  ? 635 VAL D O   1 
ATOM   8383  C CB  . VAL D 1 135 ? 43.814  96.481  72.729  1.00 26.34  ? 635 VAL D CB  1 
ATOM   8384  C CG1 . VAL D 1 135 ? 44.013  96.805  74.224  1.00 18.06  ? 635 VAL D CG1 1 
ATOM   8385  C CG2 . VAL D 1 135 ? 44.774  95.387  72.274  1.00 29.16  ? 635 VAL D CG2 1 
ATOM   8386  N N   . GLU D 1 136 ? 41.206  98.226  72.526  1.00 27.93  ? 636 GLU D N   1 
ATOM   8387  C CA  . GLU D 1 136 ? 40.306  99.244  73.070  1.00 29.36  ? 636 GLU D CA  1 
ATOM   8388  C C   . GLU D 1 136 ? 38.854  98.782  73.186  1.00 22.43  ? 636 GLU D C   1 
ATOM   8389  O O   . GLU D 1 136 ? 38.215  99.021  74.204  1.00 27.13  ? 636 GLU D O   1 
ATOM   8390  C CB  . GLU D 1 136 ? 40.394  100.539 72.265  1.00 21.80  ? 636 GLU D CB  1 
ATOM   8391  C CG  . GLU D 1 136 ? 41.694  101.307 72.486  1.00 35.05  ? 636 GLU D CG  1 
ATOM   8392  C CD  . GLU D 1 136 ? 41.787  101.974 73.856  1.00 52.63  ? 636 GLU D CD  1 
ATOM   8393  O OE1 . GLU D 1 136 ? 40.771  102.516 74.331  1.00 60.94  ? 636 GLU D OE1 1 
ATOM   8394  O OE2 . GLU D 1 136 ? 42.883  101.965 74.458  1.00 61.99  ? 636 GLU D OE2 1 
ATOM   8395  N N   . LEU D 1 137 ? 38.344  98.125  72.147  1.00 27.33  ? 637 LEU D N   1 
ATOM   8396  C CA  . LEU D 1 137 ? 36.995  97.557  72.176  1.00 22.35  ? 637 LEU D CA  1 
ATOM   8397  C C   . LEU D 1 137 ? 36.809  96.580  73.332  1.00 25.75  ? 637 LEU D C   1 
ATOM   8398  O O   . LEU D 1 137 ? 35.799  96.631  74.042  1.00 27.10  ? 637 LEU D O   1 
ATOM   8399  C CB  . LEU D 1 137 ? 36.653  96.879  70.847  1.00 13.84  ? 637 LEU D CB  1 
ATOM   8400  C CG  . LEU D 1 137 ? 36.527  97.860  69.678  1.00 20.18  ? 637 LEU D CG  1 
ATOM   8401  C CD1 . LEU D 1 137 ? 36.513  97.156  68.323  1.00 16.59  ? 637 LEU D CD1 1 
ATOM   8402  C CD2 . LEU D 1 137 ? 35.287  98.731  69.853  1.00 12.80  ? 637 LEU D CD2 1 
ATOM   8403  N N   . LYS D 1 138 ? 37.781  95.689  73.520  1.00 19.42  ? 638 LYS D N   1 
ATOM   8404  C CA  . LYS D 1 138 ? 37.734  94.712  74.605  1.00 19.59  ? 638 LYS D CA  1 
ATOM   8405  C C   . LYS D 1 138 ? 37.854  95.367  75.987  1.00 21.81  ? 638 LYS D C   1 
ATOM   8406  O O   . LYS D 1 138 ? 36.926  95.315  76.794  1.00 23.12  ? 638 LYS D O   1 
ATOM   8407  C CB  . LYS D 1 138 ? 38.840  93.672  74.429  1.00 23.38  ? 638 LYS D CB  1 
ATOM   8408  C CG  . LYS D 1 138 ? 38.977  92.682  75.573  1.00 24.01  ? 638 LYS D CG  1 
ATOM   8409  C CD  . LYS D 1 138 ? 40.103  91.670  75.260  1.00 30.11  ? 638 LYS D CD  1 
ATOM   8410  C CE  . LYS D 1 138 ? 40.483  90.788  76.458  1.00 26.33  ? 638 LYS D CE  1 
ATOM   8411  N NZ  . LYS D 1 138 ? 41.397  91.480  77.416  1.00 28.93  ? 638 LYS D NZ  1 
ATOM   8412  N N   . ASP D 1 139 ? 38.988  96.020  76.225  1.00 19.19  ? 639 ASP D N   1 
ATOM   8413  C CA  . ASP D 1 139 ? 39.362  96.513  77.551  1.00 23.13  ? 639 ASP D CA  1 
ATOM   8414  C C   . ASP D 1 139 ? 38.780  97.880  77.970  1.00 27.85  ? 639 ASP D C   1 
ATOM   8415  O O   . ASP D 1 139 ? 38.646  98.143  79.153  1.00 28.51  ? 639 ASP D O   1 
ATOM   8416  C CB  . ASP D 1 139 ? 40.893  96.515  77.698  1.00 23.58  ? 639 ASP D CB  1 
ATOM   8417  C CG  . ASP D 1 139 ? 41.487  95.101  77.720  1.00 47.64  ? 639 ASP D CG  1 
ATOM   8418  O OD1 . ASP D 1 139 ? 40.694  94.126  77.776  1.00 49.16  ? 639 ASP D OD1 1 
ATOM   8419  O OD2 . ASP D 1 139 ? 42.742  94.964  77.691  1.00 48.92  ? 639 ASP D OD2 1 
ATOM   8420  N N   . SER D 1 140 ? 38.434  98.750  77.024  1.00 29.34  ? 640 SER D N   1 
ATOM   8421  C CA  . SER D 1 140 ? 37.883  100.053 77.405  1.00 26.14  ? 640 SER D CA  1 
ATOM   8422  C C   . SER D 1 140 ? 36.370  100.144 77.202  1.00 31.71  ? 640 SER D C   1 
ATOM   8423  O O   . SER D 1 140 ? 35.645  100.583 78.094  1.00 26.26  ? 640 SER D O   1 
ATOM   8424  C CB  . SER D 1 140 ? 38.564  101.171 76.636  1.00 28.79  ? 640 SER D CB  1 
ATOM   8425  O OG  . SER D 1 140 ? 39.969  101.033 76.704  1.00 47.58  ? 640 SER D OG  1 
ATOM   8426  N N   . MET D 1 141 ? 35.909  99.731  76.023  1.00 24.95  ? 641 MET D N   1 
ATOM   8427  C CA  . MET D 1 141 ? 34.501  99.814  75.646  1.00 24.48  ? 641 MET D CA  1 
ATOM   8428  C C   . MET D 1 141 ? 33.668  98.598  76.082  1.00 32.31  ? 641 MET D C   1 
ATOM   8429  O O   . MET D 1 141 ? 32.439  98.681  76.178  1.00 32.29  ? 641 MET D O   1 
ATOM   8430  C CB  . MET D 1 141 ? 34.379  99.956  74.128  1.00 18.93  ? 641 MET D CB  1 
ATOM   8431  C CG  . MET D 1 141 ? 35.227  101.050 73.538  1.00 25.31  ? 641 MET D CG  1 
ATOM   8432  S SD  . MET D 1 141 ? 34.788  102.660 74.198  1.00 24.79  ? 641 MET D SD  1 
ATOM   8433  C CE  . MET D 1 141 ? 36.419  103.327 74.521  1.00 29.36  ? 641 MET D CE  1 
ATOM   8434  N N   . GLY D 1 142 ? 34.325  97.466  76.312  1.00 34.29  ? 642 GLY D N   1 
ATOM   8435  C CA  . GLY D 1 142 ? 33.612  96.225  76.573  1.00 30.77  ? 642 GLY D CA  1 
ATOM   8436  C C   . GLY D 1 142 ? 32.610  95.880  75.477  1.00 24.29  ? 642 GLY D C   1 
ATOM   8437  O O   . GLY D 1 142 ? 31.498  95.444  75.760  1.00 18.46  ? 642 GLY D O   1 
ATOM   8438  N N   . ASP D 1 143 ? 33.013  96.083  74.225  1.00 22.88  ? 643 ASP D N   1 
ATOM   8439  C CA  . ASP D 1 143 ? 32.182  95.817  73.058  1.00 17.02  ? 643 ASP D CA  1 
ATOM   8440  C C   . ASP D 1 143 ? 32.676  94.534  72.386  1.00 20.71  ? 643 ASP D C   1 
ATOM   8441  O O   . ASP D 1 143 ? 33.496  94.598  71.474  1.00 16.85  ? 643 ASP D O   1 
ATOM   8442  C CB  . ASP D 1 143 ? 32.288  96.979  72.055  1.00 6.77   ? 643 ASP D CB  1 
ATOM   8443  C CG  . ASP D 1 143 ? 31.343  96.828  70.851  1.00 26.09  ? 643 ASP D CG  1 
ATOM   8444  O OD1 . ASP D 1 143 ? 30.842  95.707  70.561  1.00 24.66  ? 643 ASP D OD1 1 
ATOM   8445  O OD2 . ASP D 1 143 ? 31.096  97.853  70.188  1.00 17.95  ? 643 ASP D OD2 1 
ATOM   8446  N N   . LEU D 1 144 ? 32.159  93.382  72.811  1.00 16.57  ? 644 LEU D N   1 
ATOM   8447  C CA  . LEU D 1 144 ? 32.668  92.105  72.321  1.00 20.76  ? 644 LEU D CA  1 
ATOM   8448  C C   . LEU D 1 144 ? 32.214  91.824  70.879  1.00 18.25  ? 644 LEU D C   1 
ATOM   8449  O O   . LEU D 1 144 ? 32.904  91.166  70.115  1.00 17.49  ? 644 LEU D O   1 
ATOM   8450  C CB  . LEU D 1 144 ? 32.265  90.973  73.270  1.00 24.32  ? 644 LEU D CB  1 
ATOM   8451  C CG  . LEU D 1 144 ? 32.583  91.219  74.756  1.00 18.39  ? 644 LEU D CG  1 
ATOM   8452  C CD1 . LEU D 1 144 ? 32.026  90.106  75.648  1.00 20.15  ? 644 LEU D CD1 1 
ATOM   8453  C CD2 . LEU D 1 144 ? 34.076  91.406  74.987  1.00 18.77  ? 644 LEU D CD2 1 
ATOM   8454  N N   . TYR D 1 145 ? 31.071  92.367  70.496  1.00 14.75  ? 645 TYR D N   1 
ATOM   8455  C CA  . TYR D 1 145 ? 30.561  92.194  69.142  1.00 14.45  ? 645 TYR D CA  1 
ATOM   8456  C C   . TYR D 1 145 ? 31.538  92.737  68.084  1.00 23.89  ? 645 TYR D C   1 
ATOM   8457  O O   . TYR D 1 145 ? 32.030  91.977  67.233  1.00 17.92  ? 645 TYR D O   1 
ATOM   8458  C CB  . TYR D 1 145 ? 29.182  92.835  69.067  1.00 12.30  ? 645 TYR D CB  1 
ATOM   8459  C CG  . TYR D 1 145 ? 28.562  93.006  67.706  1.00 20.84  ? 645 TYR D CG  1 
ATOM   8460  C CD1 . TYR D 1 145 ? 28.150  91.913  66.952  1.00 11.38  ? 645 TYR D CD1 1 
ATOM   8461  C CD2 . TYR D 1 145 ? 28.308  94.288  67.208  1.00 17.48  ? 645 TYR D CD2 1 
ATOM   8462  C CE1 . TYR D 1 145 ? 27.520  92.099  65.708  1.00 13.81  ? 645 TYR D CE1 1 
ATOM   8463  C CE2 . TYR D 1 145 ? 27.688  94.481  65.994  1.00 15.20  ? 645 TYR D CE2 1 
ATOM   8464  C CZ  . TYR D 1 145 ? 27.293  93.394  65.245  1.00 23.07  ? 645 TYR D CZ  1 
ATOM   8465  O OH  . TYR D 1 145 ? 26.686  93.635  64.033  1.00 22.40  ? 645 TYR D OH  1 
ATOM   8466  N N   . SER D 1 146 ? 31.851  94.033  68.147  1.00 24.25  ? 646 SER D N   1 
ATOM   8467  C CA  . SER D 1 146 ? 32.829  94.599  67.207  1.00 27.93  ? 646 SER D CA  1 
ATOM   8468  C C   . SER D 1 146 ? 34.277  94.136  67.451  1.00 21.50  ? 646 SER D C   1 
ATOM   8469  O O   . SER D 1 146 ? 35.061  94.079  66.519  1.00 23.97  ? 646 SER D O   1 
ATOM   8470  C CB  . SER D 1 146 ? 32.733  96.121  67.123  1.00 24.65  ? 646 SER D CB  1 
ATOM   8471  O OG  . SER D 1 146 ? 31.689  96.476  66.247  1.00 28.62  ? 646 SER D OG  1 
ATOM   8472  N N   . PHE D 1 147 ? 34.621  93.792  68.689  1.00 14.29  ? 647 PHE D N   1 
ATOM   8473  C CA  . PHE D 1 147 ? 35.870  93.088  68.935  1.00 21.87  ? 647 PHE D CA  1 
ATOM   8474  C C   . PHE D 1 147 ? 35.980  91.829  68.067  1.00 24.87  ? 647 PHE D C   1 
ATOM   8475  O O   . PHE D 1 147 ? 37.002  91.606  67.430  1.00 26.66  ? 647 PHE D O   1 
ATOM   8476  C CB  . PHE D 1 147 ? 36.051  92.729  70.415  1.00 22.37  ? 647 PHE D CB  1 
ATOM   8477  C CG  . PHE D 1 147 ? 37.216  91.802  70.677  1.00 18.26  ? 647 PHE D CG  1 
ATOM   8478  C CD1 . PHE D 1 147 ? 38.511  92.295  70.749  1.00 16.52  ? 647 PHE D CD1 1 
ATOM   8479  C CD2 . PHE D 1 147 ? 37.015  90.432  70.847  1.00 19.03  ? 647 PHE D CD2 1 
ATOM   8480  C CE1 . PHE D 1 147 ? 39.602  91.436  70.985  1.00 13.79  ? 647 PHE D CE1 1 
ATOM   8481  C CE2 . PHE D 1 147 ? 38.096  89.561  71.086  1.00 20.05  ? 647 PHE D CE2 1 
ATOM   8482  C CZ  . PHE D 1 147 ? 39.387  90.066  71.161  1.00 19.86  ? 647 PHE D CZ  1 
ATOM   8483  N N   . SER D 1 148 ? 34.940  91.003  68.033  1.00 24.83  ? 648 SER D N   1 
ATOM   8484  C CA  . SER D 1 148 ? 35.011  89.786  67.219  1.00 25.49  ? 648 SER D CA  1 
ATOM   8485  C C   . SER D 1 148 ? 35.092  90.070  65.702  1.00 26.24  ? 648 SER D C   1 
ATOM   8486  O O   . SER D 1 148 ? 35.737  89.331  64.964  1.00 37.59  ? 648 SER D O   1 
ATOM   8487  C CB  . SER D 1 148 ? 33.872  88.802  67.559  1.00 23.85  ? 648 SER D CB  1 
ATOM   8488  O OG  . SER D 1 148 ? 32.609  89.317  67.184  1.00 25.71  ? 648 SER D OG  1 
ATOM   8489  N N   . ALA D 1 149 ? 34.446  91.142  65.250  1.00 19.84  ? 649 ALA D N   1 
ATOM   8490  C CA  . ALA D 1 149 ? 34.523  91.561  63.853  1.00 22.44  ? 649 ALA D CA  1 
ATOM   8491  C C   . ALA D 1 149 ? 35.963  91.865  63.411  1.00 32.68  ? 649 ALA D C   1 
ATOM   8492  O O   . ALA D 1 149 ? 36.397  91.408  62.355  1.00 36.16  ? 649 ALA D O   1 
ATOM   8493  C CB  . ALA D 1 149 ? 33.635  92.765  63.609  1.00 21.05  ? 649 ALA D CB  1 
ATOM   8494  N N   . LEU D 1 150 ? 36.692  92.650  64.203  1.00 23.80  ? 650 LEU D N   1 
ATOM   8495  C CA  . LEU D 1 150 ? 38.094  92.929  63.901  1.00 23.57  ? 650 LEU D CA  1 
ATOM   8496  C C   . LEU D 1 150 ? 38.929  91.645  63.905  1.00 31.09  ? 650 LEU D C   1 
ATOM   8497  O O   . LEU D 1 150 ? 39.708  91.417  62.979  1.00 27.45  ? 650 LEU D O   1 
ATOM   8498  C CB  . LEU D 1 150 ? 38.685  93.983  64.850  1.00 14.82  ? 650 LEU D CB  1 
ATOM   8499  C CG  . LEU D 1 150 ? 38.381  95.438  64.463  1.00 19.77  ? 650 LEU D CG  1 
ATOM   8500  C CD1 . LEU D 1 150 ? 36.874  95.716  64.403  1.00 19.87  ? 650 LEU D CD1 1 
ATOM   8501  C CD2 . LEU D 1 150 ? 39.076  96.416  65.397  1.00 16.13  ? 650 LEU D CD2 1 
ATOM   8502  N N   . MET D 1 151 ? 38.749  90.809  64.932  1.00 25.03  ? 651 MET D N   1 
ATOM   8503  C CA  . MET D 1 151 ? 39.423  89.508  65.022  1.00 21.49  ? 651 MET D CA  1 
ATOM   8504  C C   . MET D 1 151 ? 39.124  88.612  63.827  1.00 29.33  ? 651 MET D C   1 
ATOM   8505  O O   . MET D 1 151 ? 39.988  87.862  63.372  1.00 38.21  ? 651 MET D O   1 
ATOM   8506  C CB  . MET D 1 151 ? 39.044  88.778  66.320  1.00 16.29  ? 651 MET D CB  1 
ATOM   8507  C CG  . MET D 1 151 ? 39.455  89.533  67.580  1.00 23.42  ? 651 MET D CG  1 
ATOM   8508  S SD  . MET D 1 151 ? 41.254  89.791  67.707  1.00 27.22  ? 651 MET D SD  1 
ATOM   8509  C CE  . MET D 1 151 ? 41.745  88.073  67.967  1.00 20.02  ? 651 MET D CE  1 
ATOM   8510  N N   . LYS D 1 152 ? 37.898  88.685  63.323  1.00 31.92  ? 652 LYS D N   1 
ATOM   8511  C CA  . LYS D 1 152 ? 37.512  87.894  62.165  1.00 32.45  ? 652 LYS D CA  1 
ATOM   8512  C C   . LYS D 1 152 ? 38.301  88.304  60.918  1.00 33.48  ? 652 LYS D C   1 
ATOM   8513  O O   . LYS D 1 152 ? 38.643  87.470  60.081  1.00 42.29  ? 652 LYS D O   1 
ATOM   8514  C CB  . LYS D 1 152 ? 36.022  88.030  61.883  1.00 30.44  ? 652 LYS D CB  1 
ATOM   8515  C CG  . LYS D 1 152 ? 35.604  87.166  60.725  1.00 36.13  ? 652 LYS D CG  1 
ATOM   8516  C CD  . LYS D 1 152 ? 34.246  87.504  60.153  1.00 40.52  ? 652 LYS D CD  1 
ATOM   8517  C CE  . LYS D 1 152 ? 33.960  86.559  58.986  1.00 52.81  ? 652 LYS D CE  1 
ATOM   8518  N NZ  . LYS D 1 152 ? 32.806  86.967  58.151  1.00 57.86  ? 652 LYS D NZ  1 
ATOM   8519  N N   . ALA D 1 153 ? 38.592  89.593  60.805  1.00 28.34  ? 653 ALA D N   1 
ATOM   8520  C CA  . ALA D 1 153 ? 39.344  90.107  59.662  1.00 28.49  ? 653 ALA D CA  1 
ATOM   8521  C C   . ALA D 1 153 ? 40.828  89.719  59.697  1.00 32.68  ? 653 ALA D C   1 
ATOM   8522  O O   . ALA D 1 153 ? 41.388  89.300  58.681  1.00 40.73  ? 653 ALA D O   1 
ATOM   8523  C CB  . ALA D 1 153 ? 39.188  91.602  59.558  1.00 18.75  ? 653 ALA D CB  1 
ATOM   8524  N N   . LEU D 1 154 ? 41.463  89.867  60.857  1.00 23.84  ? 654 LEU D N   1 
ATOM   8525  C CA  . LEU D 1 154 ? 42.830  89.390  61.040  1.00 35.36  ? 654 LEU D CA  1 
ATOM   8526  C C   . LEU D 1 154 ? 42.987  87.875  60.812  1.00 41.31  ? 654 LEU D C   1 
ATOM   8527  O O   . LEU D 1 154 ? 44.095  87.387  60.616  1.00 46.86  ? 654 LEU D O   1 
ATOM   8528  C CB  . LEU D 1 154 ? 43.320  89.767  62.436  1.00 37.38  ? 654 LEU D CB  1 
ATOM   8529  C CG  . LEU D 1 154 ? 43.100  91.251  62.750  1.00 32.05  ? 654 LEU D CG  1 
ATOM   8530  C CD1 . LEU D 1 154 ? 43.497  91.588  64.175  1.00 26.63  ? 654 LEU D CD1 1 
ATOM   8531  C CD2 . LEU D 1 154 ? 43.888  92.100  61.771  1.00 24.77  ? 654 LEU D CD2 1 
ATOM   8532  N N   . GLU D 1 155 ? 41.884  87.135  60.855  1.00 42.36  ? 655 GLU D N   1 
ATOM   8533  C CA  . GLU D 1 155 ? 41.943  85.680  60.736  1.00 49.89  ? 655 GLU D CA  1 
ATOM   8534  C C   . GLU D 1 155 ? 41.597  85.246  59.328  1.00 41.55  ? 655 GLU D C   1 
ATOM   8535  O O   . GLU D 1 155 ? 41.787  84.093  58.975  1.00 41.05  ? 655 GLU D O   1 
ATOM   8536  C CB  . GLU D 1 155 ? 40.956  84.995  61.689  1.00 60.41  ? 655 GLU D CB  1 
ATOM   8537  C CG  . GLU D 1 155 ? 41.265  85.098  63.175  1.00 70.52  ? 655 GLU D CG  1 
ATOM   8538  C CD  . GLU D 1 155 ? 40.270  84.308  64.020  1.00 75.58  ? 655 GLU D CD  1 
ATOM   8539  O OE1 . GLU D 1 155 ? 39.882  84.774  65.116  1.00 75.06  ? 655 GLU D OE1 1 
ATOM   8540  O OE2 . GLU D 1 155 ? 39.871  83.212  63.576  1.00 81.22  ? 655 GLU D OE2 1 
ATOM   8541  N N   . MET D 1 156 ? 41.052  86.155  58.530  1.00 29.86  ? 656 MET D N   1 
ATOM   8542  C CA  . MET D 1 156 ? 40.704  85.808  57.157  1.00 36.82  ? 656 MET D CA  1 
ATOM   8543  C C   . MET D 1 156 ? 41.885  85.223  56.387  1.00 49.88  ? 656 MET D C   1 
ATOM   8544  O O   . MET D 1 156 ? 43.031  85.651  56.561  1.00 51.89  ? 656 MET D O   1 
ATOM   8545  C CB  . MET D 1 156 ? 40.185  87.028  56.420  1.00 45.74  ? 656 MET D CB  1 
ATOM   8546  C CG  . MET D 1 156 ? 38.841  87.516  56.891  1.00 38.95  ? 656 MET D CG  1 
ATOM   8547  S SD  . MET D 1 156 ? 38.277  88.741  55.707  1.00 53.46  ? 656 MET D SD  1 
ATOM   8548  C CE  . MET D 1 156 ? 36.777  89.312  56.496  1.00 23.46  ? 656 MET D CE  1 
ATOM   8549  N N   . PRO D 1 157 ? 41.605  84.244  55.519  1.00 58.49  ? 657 PRO D N   1 
ATOM   8550  C CA  . PRO D 1 157 ? 42.662  83.606  54.723  1.00 60.70  ? 657 PRO D CA  1 
ATOM   8551  C C   . PRO D 1 157 ? 43.428  84.612  53.859  1.00 56.56  ? 657 PRO D C   1 
ATOM   8552  O O   . PRO D 1 157 ? 44.654  84.534  53.793  1.00 51.75  ? 657 PRO D O   1 
ATOM   8553  C CB  . PRO D 1 157 ? 41.898  82.596  53.853  1.00 57.55  ? 657 PRO D CB  1 
ATOM   8554  C CG  . PRO D 1 157 ? 40.477  83.035  53.893  1.00 60.41  ? 657 PRO D CG  1 
ATOM   8555  C CD  . PRO D 1 157 ? 40.275  83.691  55.224  1.00 57.92  ? 657 PRO D CD  1 
ATOM   8556  N N   . GLN D 1 158 ? 42.723  85.549  53.226  1.00 50.92  ? 658 GLN D N   1 
ATOM   8557  C CA  . GLN D 1 158 ? 43.380  86.555  52.396  1.00 47.65  ? 658 GLN D CA  1 
ATOM   8558  C C   . GLN D 1 158 ? 44.352  87.405  53.213  1.00 41.08  ? 658 GLN D C   1 
ATOM   8559  O O   . GLN D 1 158 ? 45.263  88.008  52.664  1.00 39.64  ? 658 GLN D O   1 
ATOM   8560  C CB  . GLN D 1 158 ? 42.356  87.466  51.707  1.00 55.34  ? 658 GLN D CB  1 
ATOM   8561  C CG  . GLN D 1 158 ? 41.487  86.789  50.657  1.00 53.61  ? 658 GLN D CG  1 
ATOM   8562  C CD  . GLN D 1 158 ? 40.284  86.095  51.252  1.00 53.69  ? 658 GLN D CD  1 
ATOM   8563  O OE1 . GLN D 1 158 ? 39.389  85.651  50.530  1.00 56.00  ? 658 GLN D OE1 1 
ATOM   8564  N NE2 . GLN D 1 158 ? 40.249  86.000  52.576  1.00 46.39  ? 658 GLN D NE2 1 
ATOM   8565  N N   . ILE D 1 159 ? 44.144  87.459  54.525  1.00 43.94  ? 659 ILE D N   1 
ATOM   8566  C CA  . ILE D 1 159 ? 44.966  88.291  55.396  1.00 38.28  ? 659 ILE D CA  1 
ATOM   8567  C C   . ILE D 1 159 ? 46.083  87.528  56.102  1.00 43.83  ? 659 ILE D C   1 
ATOM   8568  O O   . ILE D 1 159 ? 47.166  88.069  56.291  1.00 46.30  ? 659 ILE D O   1 
ATOM   8569  C CB  . ILE D 1 159 ? 44.136  88.999  56.483  1.00 38.11  ? 659 ILE D CB  1 
ATOM   8570  C CG1 . ILE D 1 159 ? 43.179  90.037  55.877  1.00 37.66  ? 659 ILE D CG1 1 
ATOM   8571  C CG2 . ILE D 1 159 ? 45.070  89.648  57.493  1.00 28.88  ? 659 ILE D CG2 1 
ATOM   8572  C CD1 . ILE D 1 159 ? 43.863  91.264  55.312  1.00 32.31  ? 659 ILE D CD1 1 
ATOM   8573  N N   . THR D 1 160 ? 45.827  86.286  56.511  1.00 45.76  ? 660 THR D N   1 
ATOM   8574  C CA  . THR D 1 160 ? 46.847  85.512  57.225  1.00 46.50  ? 660 THR D CA  1 
ATOM   8575  C C   . THR D 1 160 ? 48.083  85.178  56.363  1.00 50.10  ? 660 THR D C   1 
ATOM   8576  O O   . THR D 1 160 ? 49.203  85.039  56.876  1.00 44.36  ? 660 THR D O   1 
ATOM   8577  C CB  . THR D 1 160 ? 46.274  84.220  57.812  1.00 49.47  ? 660 THR D CB  1 
ATOM   8578  O OG1 . THR D 1 160 ? 45.677  83.441  56.767  1.00 60.41  ? 660 THR D OG1 1 
ATOM   8579  C CG2 . THR D 1 160 ? 45.231  84.534  58.857  1.00 41.80  ? 660 THR D CG2 1 
ATOM   8580  N N   . ARG D 1 161 ? 47.881  85.060  55.055  1.00 51.64  ? 661 ARG D N   1 
ATOM   8581  C CA  . ARG D 1 161 ? 48.986  84.737  54.157  1.00 55.38  ? 661 ARG D CA  1 
ATOM   8582  C C   . ARG D 1 161 ? 49.900  85.929  53.866  1.00 59.67  ? 661 ARG D C   1 
ATOM   8583  O O   . ARG D 1 161 ? 50.937  85.769  53.214  1.00 59.95  ? 661 ARG D O   1 
ATOM   8584  C CB  . ARG D 1 161 ? 48.481  84.110  52.851  1.00 59.49  ? 661 ARG D CB  1 
ATOM   8585  C CG  . ARG D 1 161 ? 47.624  85.011  51.970  1.00 58.69  ? 661 ARG D CG  1 
ATOM   8586  C CD  . ARG D 1 161 ? 47.179  84.262  50.713  1.00 62.52  ? 661 ARG D CD  1 
ATOM   8587  N NE  . ARG D 1 161 ? 47.525  84.987  49.498  1.00 68.67  ? 661 ARG D NE  1 
ATOM   8588  C CZ  . ARG D 1 161 ? 48.649  84.809  48.815  1.00 79.29  ? 661 ARG D CZ  1 
ATOM   8589  N NH1 . ARG D 1 161 ? 49.538  83.911  49.220  1.00 82.84  ? 661 ARG D NH1 1 
ATOM   8590  N NH2 . ARG D 1 161 ? 48.880  85.529  47.723  1.00 81.23  ? 661 ARG D NH2 1 
ATOM   8591  N N   . LEU D 1 162 ? 49.530  87.114  54.353  1.00 52.85  ? 662 LEU D N   1 
ATOM   8592  C CA  . LEU D 1 162 ? 50.390  88.287  54.196  1.00 53.73  ? 662 LEU D CA  1 
ATOM   8593  C C   . LEU D 1 162 ? 51.628  88.203  55.102  1.00 52.02  ? 662 LEU D C   1 
ATOM   8594  O O   . LEU D 1 162 ? 51.858  89.056  55.962  1.00 48.24  ? 662 LEU D O   1 
ATOM   8595  C CB  . LEU D 1 162 ? 49.610  89.588  54.409  1.00 48.89  ? 662 LEU D CB  1 
ATOM   8596  C CG  . LEU D 1 162 ? 48.383  89.750  53.506  1.00 44.81  ? 662 LEU D CG  1 
ATOM   8597  C CD1 . LEU D 1 162 ? 47.696  91.082  53.742  1.00 49.37  ? 662 LEU D CD1 1 
ATOM   8598  C CD2 . LEU D 1 162 ? 48.756  89.608  52.053  1.00 35.61  ? 662 LEU D CD2 1 
ATOM   8599  N N   . GLU D 1 163 ? 52.427  87.165  54.870  1.00 55.37  ? 663 GLU D N   1 
ATOM   8600  C CA  . GLU D 1 163 ? 53.582  86.844  55.701  1.00 61.96  ? 663 GLU D CA  1 
ATOM   8601  C C   . GLU D 1 163 ? 54.594  87.983  55.812  1.00 63.39  ? 663 GLU D C   1 
ATOM   8602  O O   . GLU D 1 163 ? 55.168  88.207  56.876  1.00 64.30  ? 663 GLU D O   1 
ATOM   8603  C CB  . GLU D 1 163 ? 54.271  85.580  55.177  1.00 76.35  ? 663 GLU D CB  1 
ATOM   8604  C CG  . GLU D 1 163 ? 55.372  85.040  56.084  1.00 88.85  ? 663 GLU D CG  1 
ATOM   8605  C CD  . GLU D 1 163 ? 54.847  84.540  57.425  1.00 94.82  ? 663 GLU D CD  1 
ATOM   8606  O OE1 . GLU D 1 163 ? 53.648  84.746  57.726  1.00 88.27  ? 663 GLU D OE1 1 
ATOM   8607  O OE2 . GLU D 1 163 ? 55.637  83.934  58.181  1.00 100.34 ? 663 GLU D OE2 1 
ATOM   8608  N N   . LYS D 1 164 ? 54.831  88.696  54.719  1.00 59.56  ? 664 LYS D N   1 
ATOM   8609  C CA  . LYS D 1 164 ? 55.768  89.804  54.783  1.00 67.26  ? 664 LYS D CA  1 
ATOM   8610  C C   . LYS D 1 164 ? 55.195  90.925  55.656  1.00 64.73  ? 664 LYS D C   1 
ATOM   8611  O O   . LYS D 1 164 ? 55.915  91.531  56.450  1.00 67.19  ? 664 LYS D O   1 
ATOM   8612  C CB  . LYS D 1 164 ? 56.139  90.292  53.382  1.00 72.81  ? 664 LYS D CB  1 
ATOM   8613  C CG  . LYS D 1 164 ? 56.697  89.191  52.492  1.00 75.68  ? 664 LYS D CG  1 
ATOM   8614  C CD  . LYS D 1 164 ? 56.807  89.638  51.045  1.00 82.47  ? 664 LYS D CD  1 
ATOM   8615  C CE  . LYS D 1 164 ? 56.974  88.441  50.117  1.00 89.14  ? 664 LYS D CE  1 
ATOM   8616  N NZ  . LYS D 1 164 ? 57.110  88.848  48.690  1.00 89.70  ? 664 LYS D NZ  1 
ATOM   8617  N N   . THR D 1 165 ? 53.895  91.183  55.530  1.00 59.87  ? 665 THR D N   1 
ATOM   8618  C CA  . THR D 1 165 ? 53.240  92.157  56.403  1.00 55.27  ? 665 THR D CA  1 
ATOM   8619  C C   . THR D 1 165 ? 53.309  91.715  57.876  1.00 48.49  ? 665 THR D C   1 
ATOM   8620  O O   . THR D 1 165 ? 53.807  92.454  58.728  1.00 46.04  ? 665 THR D O   1 
ATOM   8621  C CB  . THR D 1 165 ? 51.774  92.425  55.987  1.00 55.36  ? 665 THR D CB  1 
ATOM   8622  O OG1 . THR D 1 165 ? 51.710  92.691  54.581  1.00 59.66  ? 665 THR D OG1 1 
ATOM   8623  C CG2 . THR D 1 165 ? 51.211  93.622  56.751  1.00 41.94  ? 665 THR D CG2 1 
ATOM   8624  N N   . TRP D 1 166 ? 52.830  90.506  58.168  1.00 41.64  ? 666 TRP D N   1 
ATOM   8625  C CA  . TRP D 1 166 ? 52.855  89.970  59.537  1.00 46.70  ? 666 TRP D CA  1 
ATOM   8626  C C   . TRP D 1 166 ? 54.252  89.932  60.139  1.00 53.47  ? 666 TRP D C   1 
ATOM   8627  O O   . TRP D 1 166 ? 54.426  90.037  61.355  1.00 54.12  ? 666 TRP D O   1 
ATOM   8628  C CB  . TRP D 1 166 ? 52.258  88.562  59.585  1.00 39.40  ? 666 TRP D CB  1 
ATOM   8629  C CG  . TRP D 1 166 ? 50.755  88.532  59.524  1.00 40.97  ? 666 TRP D CG  1 
ATOM   8630  C CD1 . TRP D 1 166 ? 49.979  88.133  58.468  1.00 42.66  ? 666 TRP D CD1 1 
ATOM   8631  C CD2 . TRP D 1 166 ? 49.851  88.921  60.560  1.00 36.44  ? 666 TRP D CD2 1 
ATOM   8632  N NE1 . TRP D 1 166 ? 48.650  88.236  58.792  1.00 39.67  ? 666 TRP D NE1 1 
ATOM   8633  C CE2 . TRP D 1 166 ? 48.544  88.719  60.071  1.00 40.07  ? 666 TRP D CE2 1 
ATOM   8634  C CE3 . TRP D 1 166 ? 50.019  89.401  61.861  1.00 38.80  ? 666 TRP D CE3 1 
ATOM   8635  C CZ2 . TRP D 1 166 ? 47.413  88.992  60.836  1.00 38.36  ? 666 TRP D CZ2 1 
ATOM   8636  C CZ3 . TRP D 1 166 ? 48.895  89.666  62.622  1.00 34.97  ? 666 TRP D CZ3 1 
ATOM   8637  C CH2 . TRP D 1 166 ? 47.610  89.460  62.108  1.00 37.76  ? 666 TRP D CH2 1 
ATOM   8638  N N   . THR D 1 167 ? 55.242  89.758  59.272  1.00 55.68  ? 667 THR D N   1 
ATOM   8639  C CA  . THR D 1 167 ? 56.629  89.680  59.690  1.00 52.80  ? 667 THR D CA  1 
ATOM   8640  C C   . THR D 1 167 ? 57.132  91.085  59.977  1.00 50.58  ? 667 THR D C   1 
ATOM   8641  O O   . THR D 1 167 ? 57.861  91.305  60.943  1.00 53.05  ? 667 THR D O   1 
ATOM   8642  C CB  . THR D 1 167 ? 57.490  88.972  58.622  1.00 54.94  ? 667 THR D CB  1 
ATOM   8643  O OG1 . THR D 1 167 ? 57.060  87.612  58.508  1.00 54.39  ? 667 THR D OG1 1 
ATOM   8644  C CG2 . THR D 1 167 ? 58.962  88.991  59.000  1.00 40.44  ? 667 THR D CG2 1 
ATOM   8645  N N   . ALA D 1 168 ? 56.719  92.035  59.141  1.00 43.91  ? 668 ALA D N   1 
ATOM   8646  C CA  . ALA D 1 168 ? 56.977  93.445  59.400  1.00 43.20  ? 668 ALA D CA  1 
ATOM   8647  C C   . ALA D 1 168 ? 56.393  93.874  60.750  1.00 51.69  ? 668 ALA D C   1 
ATOM   8648  O O   . ALA D 1 168 ? 57.053  94.582  61.514  1.00 57.94  ? 668 ALA D O   1 
ATOM   8649  C CB  . ALA D 1 168 ? 56.415  94.309  58.272  1.00 38.64  ? 668 ALA D CB  1 
ATOM   8650  N N   . LEU D 1 169 ? 55.161  93.446  61.039  1.00 44.02  ? 669 LEU D N   1 
ATOM   8651  C CA  . LEU D 1 169 ? 54.512  93.754  62.319  1.00 41.33  ? 669 LEU D CA  1 
ATOM   8652  C C   . LEU D 1 169 ? 55.336  93.196  63.472  1.00 42.24  ? 669 LEU D C   1 
ATOM   8653  O O   . LEU D 1 169 ? 55.615  93.897  64.447  1.00 33.51  ? 669 LEU D O   1 
ATOM   8654  C CB  . LEU D 1 169 ? 53.088  93.174  62.379  1.00 26.42  ? 669 LEU D CB  1 
ATOM   8655  C CG  . LEU D 1 169 ? 52.308  93.358  63.693  1.00 34.86  ? 669 LEU D CG  1 
ATOM   8656  C CD1 . LEU D 1 169 ? 51.385  94.571  63.636  1.00 22.24  ? 669 LEU D CD1 1 
ATOM   8657  C CD2 . LEU D 1 169 ? 51.495  92.112  64.041  1.00 34.25  ? 669 LEU D CD2 1 
ATOM   8658  N N   . ARG D 1 170 ? 55.715  91.925  63.358  1.00 44.75  ? 670 ARG D N   1 
ATOM   8659  C CA  . ARG D 1 170 ? 56.488  91.267  64.402  1.00 46.49  ? 670 ARG D CA  1 
ATOM   8660  C C   . ARG D 1 170 ? 57.737  92.077  64.710  1.00 43.62  ? 670 ARG D C   1 
ATOM   8661  O O   . ARG D 1 170 ? 58.071  92.295  65.868  1.00 50.61  ? 670 ARG D O   1 
ATOM   8662  C CB  . ARG D 1 170 ? 56.857  89.837  63.991  1.00 47.05  ? 670 ARG D CB  1 
ATOM   8663  C CG  . ARG D 1 170 ? 55.706  88.837  64.109  1.00 56.06  ? 670 ARG D CG  1 
ATOM   8664  C CD  . ARG D 1 170 ? 56.039  87.463  63.500  1.00 66.90  ? 670 ARG D CD  1 
ATOM   8665  N NE  . ARG D 1 170 ? 54.861  86.589  63.473  1.00 77.76  ? 670 ARG D NE  1 
ATOM   8666  C CZ  . ARG D 1 170 ? 54.012  86.492  62.450  1.00 79.42  ? 670 ARG D CZ  1 
ATOM   8667  N NH1 . ARG D 1 170 ? 54.211  87.213  61.358  1.00 93.24  ? 670 ARG D NH1 1 
ATOM   8668  N NH2 . ARG D 1 170 ? 52.962  85.679  62.514  1.00 64.92  ? 670 ARG D NH2 1 
ATOM   8669  N N   . HIS D 1 171 ? 58.403  92.552  63.665  1.00 37.23  ? 671 HIS D N   1 
ATOM   8670  C CA  . HIS D 1 171 ? 59.689  93.230  63.815  1.00 52.09  ? 671 HIS D CA  1 
ATOM   8671  C C   . HIS D 1 171 ? 59.618  94.667  64.350  1.00 55.29  ? 671 HIS D C   1 
ATOM   8672  O O   . HIS D 1 171 ? 60.520  95.108  65.064  1.00 59.53  ? 671 HIS D O   1 
ATOM   8673  C CB  . HIS D 1 171 ? 60.460  93.188  62.486  1.00 65.74  ? 671 HIS D CB  1 
ATOM   8674  C CG  . HIS D 1 171 ? 60.690  91.799  61.962  1.00 73.48  ? 671 HIS D CG  1 
ATOM   8675  N ND1 . HIS D 1 171 ? 60.519  90.668  62.738  1.00 69.49  ? 671 HIS D ND1 1 
ATOM   8676  C CD2 . HIS D 1 171 ? 61.077  91.357  60.740  1.00 73.45  ? 671 HIS D CD2 1 
ATOM   8677  C CE1 . HIS D 1 171 ? 60.794  89.596  62.018  1.00 68.15  ? 671 HIS D CE1 1 
ATOM   8678  N NE2 . HIS D 1 171 ? 61.133  89.986  60.800  1.00 68.28  ? 671 HIS D NE2 1 
ATOM   8679  N N   . GLN D 1 172 ? 58.552  95.390  64.009  1.00 58.30  ? 672 GLN D N   1 
ATOM   8680  C CA  . GLN D 1 172 ? 58.453  96.821  64.313  1.00 58.32  ? 672 GLN D CA  1 
ATOM   8681  C C   . GLN D 1 172 ? 57.386  97.172  65.354  1.00 52.57  ? 672 GLN D C   1 
ATOM   8682  O O   . GLN D 1 172 ? 57.484  98.188  66.041  1.00 55.46  ? 672 GLN D O   1 
ATOM   8683  C CB  . GLN D 1 172 ? 58.170  97.602  63.035  1.00 64.57  ? 672 GLN D CB  1 
ATOM   8684  C CG  . GLN D 1 172 ? 58.904  97.082  61.825  1.00 78.77  ? 672 GLN D CG  1 
ATOM   8685  C CD  . GLN D 1 172 ? 58.622  97.912  60.599  1.00 94.21  ? 672 GLN D CD  1 
ATOM   8686  O OE1 . GLN D 1 172 ? 57.466  98.103  60.216  1.00 94.06  ? 672 GLN D OE1 1 
ATOM   8687  N NE2 . GLN D 1 172 ? 59.680  98.432  59.982  1.00 105.83 ? 672 GLN D NE2 1 
ATOM   8688  N N   . TYR D 1 173 ? 56.355  96.345  65.447  1.00 43.39  ? 673 TYR D N   1 
ATOM   8689  C CA  . TYR D 1 173 ? 55.306  96.545  66.439  1.00 45.33  ? 673 TYR D CA  1 
ATOM   8690  C C   . TYR D 1 173 ? 55.206  95.285  67.295  1.00 43.66  ? 673 TYR D C   1 
ATOM   8691  O O   . TYR D 1 173 ? 54.126  94.756  67.545  1.00 41.17  ? 673 TYR D O   1 
ATOM   8692  C CB  . TYR D 1 173 ? 53.977  96.892  65.759  1.00 39.42  ? 673 TYR D CB  1 
ATOM   8693  C CG  . TYR D 1 173 ? 54.106  98.065  64.821  1.00 37.78  ? 673 TYR D CG  1 
ATOM   8694  C CD1 . TYR D 1 173 ? 54.331  97.870  63.460  1.00 48.88  ? 673 TYR D CD1 1 
ATOM   8695  C CD2 . TYR D 1 173 ? 54.044  99.370  65.296  1.00 40.39  ? 673 TYR D CD2 1 
ATOM   8696  C CE1 . TYR D 1 173 ? 54.472  98.944  62.588  1.00 54.94  ? 673 TYR D CE1 1 
ATOM   8697  C CE2 . TYR D 1 173 ? 54.175  100.457 64.434  1.00 45.98  ? 673 TYR D CE2 1 
ATOM   8698  C CZ  . TYR D 1 173 ? 54.389  100.238 63.078  1.00 52.63  ? 673 TYR D CZ  1 
ATOM   8699  O OH  . TYR D 1 173 ? 54.530  101.306 62.213  1.00 45.01  ? 673 TYR D OH  1 
ATOM   8700  N N   . THR D 1 174 ? 56.370  94.837  67.750  1.00 43.70  ? 674 THR D N   1 
ATOM   8701  C CA  . THR D 1 174 ? 56.521  93.607  68.506  1.00 38.89  ? 674 THR D CA  1 
ATOM   8702  C C   . THR D 1 174 ? 55.555  93.430  69.684  1.00 42.20  ? 674 THR D C   1 
ATOM   8703  O O   . THR D 1 174 ? 55.074  92.319  69.934  1.00 48.07  ? 674 THR D O   1 
ATOM   8704  C CB  . THR D 1 174 ? 57.975  93.469  68.985  1.00 41.46  ? 674 THR D CB  1 
ATOM   8705  O OG1 . THR D 1 174 ? 58.836  93.414  67.842  1.00 51.55  ? 674 THR D OG1 1 
ATOM   8706  C CG2 . THR D 1 174 ? 58.157  92.204  69.818  1.00 35.30  ? 674 THR D CG2 1 
ATOM   8707  N N   . GLN D 1 175 ? 55.284  94.514  70.407  1.00 40.27  ? 675 GLN D N   1 
ATOM   8708  C CA  . GLN D 1 175 ? 54.392  94.477  71.558  1.00 36.54  ? 675 GLN D CA  1 
ATOM   8709  C C   . GLN D 1 175 ? 52.956  94.209  71.105  1.00 43.75  ? 675 GLN D C   1 
ATOM   8710  O O   . GLN D 1 175 ? 52.226  93.435  71.720  1.00 49.22  ? 675 GLN D O   1 
ATOM   8711  C CB  . GLN D 1 175 ? 54.455  95.801  72.311  1.00 42.79  ? 675 GLN D CB  1 
ATOM   8712  C CG  . GLN D 1 175 ? 53.227  96.084  73.152  1.00 55.42  ? 675 GLN D CG  1 
ATOM   8713  C CD  . GLN D 1 175 ? 53.195  95.248  74.403  1.00 76.06  ? 675 GLN D CD  1 
ATOM   8714  O OE1 . GLN D 1 175 ? 52.391  94.325  74.529  1.00 94.23  ? 675 GLN D OE1 1 
ATOM   8715  N NE2 . GLN D 1 175 ? 54.073  95.563  75.343  1.00 74.66  ? 675 GLN D NE2 1 
ATOM   8716  N N   . THR D 1 176 ? 52.561  94.844  70.013  1.00 40.84  ? 676 THR D N   1 
ATOM   8717  C CA  . THR D 1 176 ? 51.222  94.663  69.488  1.00 43.67  ? 676 THR D CA  1 
ATOM   8718  C C   . THR D 1 176 ? 51.041  93.263  68.907  1.00 45.47  ? 676 THR D C   1 
ATOM   8719  O O   . THR D 1 176 ? 49.988  92.642  69.079  1.00 42.51  ? 676 THR D O   1 
ATOM   8720  C CB  . THR D 1 176 ? 50.894  95.724  68.435  1.00 46.44  ? 676 THR D CB  1 
ATOM   8721  O OG1 . THR D 1 176 ? 50.608  96.962  69.096  1.00 42.25  ? 676 THR D OG1 1 
ATOM   8722  C CG2 . THR D 1 176 ? 49.690  95.303  67.607  1.00 53.82  ? 676 THR D CG2 1 
ATOM   8723  N N   . ALA D 1 177 ? 52.072  92.759  68.235  1.00 42.83  ? 677 ALA D N   1 
ATOM   8724  C CA  . ALA D 1 177 ? 52.006  91.424  67.634  1.00 44.75  ? 677 ALA D CA  1 
ATOM   8725  C C   . ALA D 1 177 ? 51.894  90.322  68.690  1.00 50.90  ? 677 ALA D C   1 
ATOM   8726  O O   . ALA D 1 177 ? 51.317  89.263  68.437  1.00 54.07  ? 677 ALA D O   1 
ATOM   8727  C CB  . ALA D 1 177 ? 53.211  91.175  66.719  1.00 40.57  ? 677 ALA D CB  1 
ATOM   8728  N N   . ILE D 1 178 ? 52.438  90.570  69.876  1.00 47.44  ? 678 ILE D N   1 
ATOM   8729  C CA  . ILE D 1 178 ? 52.402  89.559  70.928  1.00 49.15  ? 678 ILE D CA  1 
ATOM   8730  C C   . ILE D 1 178 ? 51.100  89.650  71.705  1.00 45.39  ? 678 ILE D C   1 
ATOM   8731  O O   . ILE D 1 178 ? 50.504  88.647  72.084  1.00 48.91  ? 678 ILE D O   1 
ATOM   8732  C CB  . ILE D 1 178 ? 53.615  89.686  71.868  1.00 46.02  ? 678 ILE D CB  1 
ATOM   8733  C CG1 . ILE D 1 178 ? 54.848  89.080  71.193  1.00 40.12  ? 678 ILE D CG1 1 
ATOM   8734  C CG2 . ILE D 1 178 ? 53.328  89.003  73.193  1.00 39.89  ? 678 ILE D CG2 1 
ATOM   8735  C CD1 . ILE D 1 178 ? 56.150  89.752  71.559  1.00 40.71  ? 678 ILE D CD1 1 
ATOM   8736  N N   . LEU D 1 179 ? 50.658  90.875  71.923  1.00 48.26  ? 679 LEU D N   1 
ATOM   8737  C CA  . LEU D 1 179 ? 49.378  91.126  72.552  1.00 43.80  ? 679 LEU D CA  1 
ATOM   8738  C C   . LEU D 1 179 ? 48.294  90.404  71.768  1.00 36.31  ? 679 LEU D C   1 
ATOM   8739  O O   . LEU D 1 179 ? 47.404  89.771  72.329  1.00 32.56  ? 679 LEU D O   1 
ATOM   8740  C CB  . LEU D 1 179 ? 49.121  92.620  72.518  1.00 50.51  ? 679 LEU D CB  1 
ATOM   8741  C CG  . LEU D 1 179 ? 48.069  93.198  73.438  1.00 55.27  ? 679 LEU D CG  1 
ATOM   8742  C CD1 . LEU D 1 179 ? 48.190  92.565  74.813  1.00 47.87  ? 679 LEU D CD1 1 
ATOM   8743  C CD2 . LEU D 1 179 ? 48.291  94.712  73.478  1.00 54.81  ? 679 LEU D CD2 1 
ATOM   8744  N N   . TYR D 1 180 ? 48.381  90.497  70.454  1.00 32.30  ? 680 TYR D N   1 
ATOM   8745  C CA  . TYR D 1 180 ? 47.383  89.892  69.607  1.00 25.41  ? 680 TYR D CA  1 
ATOM   8746  C C   . TYR D 1 180 ? 47.441  88.377  69.735  1.00 35.93  ? 680 TYR D C   1 
ATOM   8747  O O   . TYR D 1 180 ? 46.402  87.716  69.868  1.00 31.00  ? 680 TYR D O   1 
ATOM   8748  C CB  . TYR D 1 180 ? 47.613  90.302  68.161  1.00 26.06  ? 680 TYR D CB  1 
ATOM   8749  C CG  . TYR D 1 180 ? 46.812  89.498  67.183  1.00 32.47  ? 680 TYR D CG  1 
ATOM   8750  C CD1 . TYR D 1 180 ? 45.447  89.706  67.033  1.00 32.65  ? 680 TYR D CD1 1 
ATOM   8751  C CD2 . TYR D 1 180 ? 47.417  88.520  66.416  1.00 35.93  ? 680 TYR D CD2 1 
ATOM   8752  C CE1 . TYR D 1 180 ? 44.710  88.963  66.133  1.00 37.60  ? 680 TYR D CE1 1 
ATOM   8753  C CE2 . TYR D 1 180 ? 46.690  87.774  65.517  1.00 41.33  ? 680 TYR D CE2 1 
ATOM   8754  C CZ  . TYR D 1 180 ? 45.340  87.997  65.378  1.00 44.01  ? 680 TYR D CZ  1 
ATOM   8755  O OH  . TYR D 1 180 ? 44.632  87.242  64.478  1.00 46.29  ? 680 TYR D OH  1 
ATOM   8756  N N   . GLU D 1 181 ? 48.656  87.828  69.708  1.00 39.82  ? 681 GLU D N   1 
ATOM   8757  C CA  . GLU D 1 181 ? 48.843  86.378  69.762  1.00 48.54  ? 681 GLU D CA  1 
ATOM   8758  C C   . GLU D 1 181 ? 48.499  85.719  71.101  1.00 48.13  ? 681 GLU D C   1 
ATOM   8759  O O   . GLU D 1 181 ? 47.839  84.683  71.124  1.00 45.51  ? 681 GLU D O   1 
ATOM   8760  C CB  . GLU D 1 181 ? 50.265  85.994  69.347  1.00 61.42  ? 681 GLU D CB  1 
ATOM   8761  C CG  . GLU D 1 181 ? 50.438  85.816  67.851  1.00 73.24  ? 681 GLU D CG  1 
ATOM   8762  C CD  . GLU D 1 181 ? 49.635  84.649  67.313  1.00 88.39  ? 681 GLU D CD  1 
ATOM   8763  O OE1 . GLU D 1 181 ? 49.162  83.825  68.127  1.00 93.74  ? 681 GLU D OE1 1 
ATOM   8764  O OE2 . GLU D 1 181 ? 49.472  84.559  66.077  1.00 93.06  ? 681 GLU D OE2 1 
ATOM   8765  N N   . LYS D 1 182 ? 48.936  86.319  72.206  1.00 45.87  ? 682 LYS D N   1 
ATOM   8766  C CA  . LYS D 1 182 ? 48.876  85.653  73.508  1.00 46.40  ? 682 LYS D CA  1 
ATOM   8767  C C   . LYS D 1 182 ? 47.759  86.142  74.435  1.00 45.98  ? 682 LYS D C   1 
ATOM   8768  O O   . LYS D 1 182 ? 47.440  85.493  75.430  1.00 55.68  ? 682 LYS D O   1 
ATOM   8769  C CB  . LYS D 1 182 ? 50.226  85.782  74.227  1.00 49.84  ? 682 LYS D CB  1 
ATOM   8770  C CG  . LYS D 1 182 ? 51.428  85.375  73.391  1.00 56.28  ? 682 LYS D CG  1 
ATOM   8771  C CD  . LYS D 1 182 ? 51.472  83.879  73.151  1.00 74.52  ? 682 LYS D CD  1 
ATOM   8772  C CE  . LYS D 1 182 ? 51.488  83.103  74.466  1.00 89.14  ? 682 LYS D CE  1 
ATOM   8773  N NZ  . LYS D 1 182 ? 51.431  81.619  74.274  1.00 91.37  ? 682 LYS D NZ  1 
ATOM   8774  N N   . GLN D 1 183 ? 47.186  87.298  74.128  1.00 45.10  ? 683 GLN D N   1 
ATOM   8775  C CA  . GLN D 1 183 ? 46.129  87.865  74.954  1.00 43.55  ? 683 GLN D CA  1 
ATOM   8776  C C   . GLN D 1 183 ? 44.818  87.775  74.196  1.00 39.85  ? 683 GLN D C   1 
ATOM   8777  O O   . GLN D 1 183 ? 43.869  87.117  74.640  1.00 31.86  ? 683 GLN D O   1 
ATOM   8778  C CB  . GLN D 1 183 ? 46.408  89.334  75.267  1.00 42.95  ? 683 GLN D CB  1 
ATOM   8779  C CG  . GLN D 1 183 ? 47.766  89.607  75.869  1.00 59.85  ? 683 GLN D CG  1 
ATOM   8780  C CD  . GLN D 1 183 ? 47.809  89.300  77.339  1.00 73.24  ? 683 GLN D CD  1 
ATOM   8781  O OE1 . GLN D 1 183 ? 48.472  89.997  78.102  1.00 80.92  ? 683 GLN D OE1 1 
ATOM   8782  N NE2 . GLN D 1 183 ? 47.102  88.250  77.752  1.00 75.26  ? 683 GLN D NE2 1 
ATOM   8783  N N   . LEU D 1 184 ? 44.804  88.443  73.044  1.00 34.30  ? 684 LEU D N   1 
ATOM   8784  C CA  . LEU D 1 184 ? 43.621  88.625  72.222  1.00 30.11  ? 684 LEU D CA  1 
ATOM   8785  C C   . LEU D 1 184 ? 43.112  87.318  71.626  1.00 40.78  ? 684 LEU D C   1 
ATOM   8786  O O   . LEU D 1 184 ? 41.934  86.994  71.763  1.00 35.82  ? 684 LEU D O   1 
ATOM   8787  C CB  . LEU D 1 184 ? 43.897  89.654  71.125  1.00 22.29  ? 684 LEU D CB  1 
ATOM   8788  C CG  . LEU D 1 184 ? 43.304  91.032  71.388  1.00 30.65  ? 684 LEU D CG  1 
ATOM   8789  C CD1 . LEU D 1 184 ? 43.526  91.486  72.844  1.00 28.00  ? 684 LEU D CD1 1 
ATOM   8790  C CD2 . LEU D 1 184 ? 43.829  92.051  70.376  1.00 18.72  ? 684 LEU D CD2 1 
ATOM   8791  N N   . LYS D 1 185 ? 43.993  86.560  70.980  1.00 43.95  ? 685 LYS D N   1 
ATOM   8792  C CA  . LYS D 1 185 ? 43.576  85.312  70.337  1.00 42.35  ? 685 LYS D CA  1 
ATOM   8793  C C   . LYS D 1 185 ? 42.916  84.294  71.287  1.00 38.10  ? 685 LYS D C   1 
ATOM   8794  O O   . LYS D 1 185 ? 41.859  83.749  70.971  1.00 35.96  ? 685 LYS D O   1 
ATOM   8795  C CB  . LYS D 1 185 ? 44.737  84.673  69.579  1.00 42.60  ? 685 LYS D CB  1 
ATOM   8796  C CG  . LYS D 1 185 ? 44.660  84.849  68.070  1.00 47.36  ? 685 LYS D CG  1 
ATOM   8797  C CD  . LYS D 1 185 ? 45.871  84.205  67.396  1.00 54.11  ? 685 LYS D CD  1 
ATOM   8798  C CE  . LYS D 1 185 ? 45.696  84.136  65.894  1.00 52.22  ? 685 LYS D CE  1 
ATOM   8799  N NZ  . LYS D 1 185 ? 46.949  83.708  65.228  1.00 52.39  ? 685 LYS D NZ  1 
ATOM   8800  N N   . PRO D 1 186 ? 43.550  84.007  72.437  1.00 36.54  ? 686 PRO D N   1 
ATOM   8801  C CA  . PRO D 1 186 ? 42.885  83.098  73.379  1.00 32.81  ? 686 PRO D CA  1 
ATOM   8802  C C   . PRO D 1 186 ? 41.578  83.640  73.959  1.00 37.60  ? 686 PRO D C   1 
ATOM   8803  O O   . PRO D 1 186 ? 40.672  82.837  74.211  1.00 26.68  ? 686 PRO D O   1 
ATOM   8804  C CB  . PRO D 1 186 ? 43.941  82.879  74.472  1.00 27.45  ? 686 PRO D CB  1 
ATOM   8805  C CG  . PRO D 1 186 ? 45.234  83.006  73.728  1.00 33.22  ? 686 PRO D CG  1 
ATOM   8806  C CD  . PRO D 1 186 ? 44.989  84.137  72.730  1.00 37.01  ? 686 PRO D CD  1 
ATOM   8807  N N   . PHE D 1 187 ? 41.472  84.956  74.156  1.00 37.23  ? 687 PHE D N   1 
ATOM   8808  C CA  . PHE D 1 187 ? 40.216  85.563  74.616  1.00 25.21  ? 687 PHE D CA  1 
ATOM   8809  C C   . PHE D 1 187 ? 39.114  85.326  73.584  1.00 26.89  ? 687 PHE D C   1 
ATOM   8810  O O   . PHE D 1 187 ? 37.990  84.947  73.931  1.00 26.56  ? 687 PHE D O   1 
ATOM   8811  C CB  . PHE D 1 187 ? 40.407  87.054  74.891  1.00 34.08  ? 687 PHE D CB  1 
ATOM   8812  C CG  . PHE D 1 187 ? 39.172  87.756  75.400  1.00 29.55  ? 687 PHE D CG  1 
ATOM   8813  C CD1 . PHE D 1 187 ? 38.716  87.543  76.700  1.00 29.61  ? 687 PHE D CD1 1 
ATOM   8814  C CD2 . PHE D 1 187 ? 38.490  88.661  74.591  1.00 23.23  ? 687 PHE D CD2 1 
ATOM   8815  C CE1 . PHE D 1 187 ? 37.580  88.198  77.182  1.00 27.23  ? 687 PHE D CE1 1 
ATOM   8816  C CE2 . PHE D 1 187 ? 37.349  89.330  75.063  1.00 23.93  ? 687 PHE D CE2 1 
ATOM   8817  C CZ  . PHE D 1 187 ? 36.898  89.099  76.360  1.00 27.78  ? 687 PHE D CZ  1 
ATOM   8818  N N   . SER D 1 188 ? 39.462  85.502  72.311  1.00 22.81  ? 688 SER D N   1 
ATOM   8819  C CA  . SER D 1 188 ? 38.538  85.268  71.203  1.00 22.56  ? 688 SER D CA  1 
ATOM   8820  C C   . SER D 1 188 ? 37.998  83.824  71.218  1.00 34.73  ? 688 SER D C   1 
ATOM   8821  O O   . SER D 1 188 ? 36.824  83.573  70.895  1.00 35.78  ? 688 SER D O   1 
ATOM   8822  C CB  . SER D 1 188 ? 39.230  85.580  69.866  1.00 18.50  ? 688 SER D CB  1 
ATOM   8823  O OG  . SER D 1 188 ? 38.293  85.854  68.837  1.00 40.91  ? 688 SER D OG  1 
ATOM   8824  N N   . LYS D 1 189 ? 38.867  82.892  71.606  1.00 27.02  ? 689 LYS D N   1 
ATOM   8825  C CA  . LYS D 1 189 ? 38.545  81.472  71.693  1.00 25.71  ? 689 LYS D CA  1 
ATOM   8826  C C   . LYS D 1 189 ? 37.621  81.166  72.875  1.00 34.21  ? 689 LYS D C   1 
ATOM   8827  O O   . LYS D 1 189 ? 36.710  80.344  72.746  1.00 36.88  ? 689 LYS D O   1 
ATOM   8828  C CB  . LYS D 1 189 ? 39.835  80.655  71.805  1.00 33.61  ? 689 LYS D CB  1 
ATOM   8829  C CG  . LYS D 1 189 ? 39.637  79.162  72.031  1.00 45.39  ? 689 LYS D CG  1 
ATOM   8830  C CD  . LYS D 1 189 ? 40.827  78.571  72.787  1.00 64.58  ? 689 LYS D CD  1 
ATOM   8831  C CE  . LYS D 1 189 ? 40.780  77.050  72.845  1.00 71.67  ? 689 LYS D CE  1 
ATOM   8832  N NZ  . LYS D 1 189 ? 41.122  76.452  71.524  1.00 71.90  ? 689 LYS D NZ  1 
ATOM   8833  N N   . LEU D 1 190 ? 37.853  81.824  74.016  1.00 29.99  ? 690 LEU D N   1 
ATOM   8834  C CA  . LEU D 1 190 ? 36.930  81.736  75.156  1.00 33.21  ? 690 LEU D CA  1 
ATOM   8835  C C   . LEU D 1 190 ? 35.537  82.284  74.823  1.00 26.88  ? 690 LEU D C   1 
ATOM   8836  O O   . LEU D 1 190 ? 34.529  81.679  75.164  1.00 31.31  ? 690 LEU D O   1 
ATOM   8837  C CB  . LEU D 1 190 ? 37.471  82.472  76.382  1.00 31.58  ? 690 LEU D CB  1 
ATOM   8838  C CG  . LEU D 1 190 ? 38.572  81.768  77.161  1.00 42.51  ? 690 LEU D CG  1 
ATOM   8839  C CD1 . LEU D 1 190 ? 38.821  82.480  78.486  1.00 39.00  ? 690 LEU D CD1 1 
ATOM   8840  C CD2 . LEU D 1 190 ? 38.202  80.304  77.377  1.00 49.13  ? 690 LEU D CD2 1 
ATOM   8841  N N   . LEU D 1 191 ? 35.490  83.440  74.177  1.00 13.32  ? 691 LEU D N   1 
ATOM   8842  C CA  . LEU D 1 191 ? 34.218  84.003  73.752  1.00 23.33  ? 691 LEU D CA  1 
ATOM   8843  C C   . LEU D 1 191 ? 33.454  83.029  72.856  1.00 22.36  ? 691 LEU D C   1 
ATOM   8844  O O   . LEU D 1 191 ? 32.260  82.809  73.029  1.00 26.70  ? 691 LEU D O   1 
ATOM   8845  C CB  . LEU D 1 191 ? 34.431  85.328  73.017  1.00 21.45  ? 691 LEU D CB  1 
ATOM   8846  C CG  . LEU D 1 191 ? 35.084  86.467  73.804  1.00 24.51  ? 691 LEU D CG  1 
ATOM   8847  C CD1 . LEU D 1 191 ? 34.918  87.789  73.062  1.00 27.28  ? 691 LEU D CD1 1 
ATOM   8848  C CD2 . LEU D 1 191 ? 34.496  86.559  75.198  1.00 25.53  ? 691 LEU D CD2 1 
ATOM   8849  N N   . HIS D 1 192 ? 34.166  82.438  71.910  1.00 22.24  ? 692 HIS D N   1 
ATOM   8850  C CA  . HIS D 1 192 ? 33.547  81.619  70.886  1.00 24.66  ? 692 HIS D CA  1 
ATOM   8851  C C   . HIS D 1 192 ? 33.049  80.310  71.515  1.00 25.20  ? 692 HIS D C   1 
ATOM   8852  O O   . HIS D 1 192 ? 32.110  79.679  71.019  1.00 28.35  ? 692 HIS D O   1 
ATOM   8853  C CB  . HIS D 1 192 ? 34.536  81.381  69.733  1.00 31.15  ? 692 HIS D CB  1 
ATOM   8854  C CG  . HIS D 1 192 ? 33.922  80.752  68.516  1.00 51.40  ? 692 HIS D CG  1 
ATOM   8855  N ND1 . HIS D 1 192 ? 34.161  79.439  68.152  1.00 53.98  ? 692 HIS D ND1 1 
ATOM   8856  C CD2 . HIS D 1 192 ? 33.080  81.253  67.580  1.00 55.25  ? 692 HIS D CD2 1 
ATOM   8857  C CE1 . HIS D 1 192 ? 33.489  79.161  67.049  1.00 58.45  ? 692 HIS D CE1 1 
ATOM   8858  N NE2 . HIS D 1 192 ? 32.825  80.244  66.680  1.00 59.13  ? 692 HIS D NE2 1 
ATOM   8859  N N   . GLU D 1 193 ? 33.655  79.933  72.636  1.00 18.25  ? 693 GLU D N   1 
ATOM   8860  C CA  . GLU D 1 193 ? 33.228  78.754  73.366  1.00 21.96  ? 693 GLU D CA  1 
ATOM   8861  C C   . GLU D 1 193 ? 32.029  79.055  74.269  1.00 32.68  ? 693 GLU D C   1 
ATOM   8862  O O   . GLU D 1 193 ? 31.541  78.160  74.977  1.00 27.28  ? 693 GLU D O   1 
ATOM   8863  C CB  . GLU D 1 193 ? 34.382  78.171  74.185  1.00 26.28  ? 693 GLU D CB  1 
ATOM   8864  C CG  . GLU D 1 193 ? 35.397  77.382  73.366  1.00 45.10  ? 693 GLU D CG  1 
ATOM   8865  C CD  . GLU D 1 193 ? 36.719  77.178  74.112  1.00 61.12  ? 693 GLU D CD  1 
ATOM   8866  O OE1 . GLU D 1 193 ? 36.739  77.307  75.361  1.00 66.33  ? 693 GLU D OE1 1 
ATOM   8867  O OE2 . GLU D 1 193 ? 37.741  76.898  73.447  1.00 60.57  ? 693 GLU D OE2 1 
ATOM   8868  N N   . GLY D 1 194 ? 31.561  80.307  74.241  1.00 22.94  ? 694 GLY D N   1 
ATOM   8869  C CA  . GLY D 1 194 ? 30.376  80.700  74.980  1.00 16.20  ? 694 GLY D CA  1 
ATOM   8870  C C   . GLY D 1 194 ? 30.654  80.990  76.440  1.00 25.86  ? 694 GLY D C   1 
ATOM   8871  O O   . GLY D 1 194 ? 29.760  80.824  77.288  1.00 22.34  ? 694 GLY D O   1 
ATOM   8872  N N   . ARG D 1 195 ? 31.882  81.435  76.725  1.00 24.08  ? 695 ARG D N   1 
ATOM   8873  C CA  . ARG D 1 195 ? 32.324  81.767  78.084  1.00 31.83  ? 695 ARG D CA  1 
ATOM   8874  C C   . ARG D 1 195 ? 32.285  83.252  78.425  1.00 35.77  ? 695 ARG D C   1 
ATOM   8875  O O   . ARG D 1 195 ? 32.796  83.642  79.469  1.00 35.43  ? 695 ARG D O   1 
ATOM   8876  C CB  . ARG D 1 195 ? 33.769  81.316  78.310  1.00 34.58  ? 695 ARG D CB  1 
ATOM   8877  C CG  . ARG D 1 195 ? 34.144  80.044  77.602  1.00 54.04  ? 695 ARG D CG  1 
ATOM   8878  C CD  . ARG D 1 195 ? 33.231  78.937  78.028  1.00 62.84  ? 695 ARG D CD  1 
ATOM   8879  N NE  . ARG D 1 195 ? 33.197  78.812  79.480  1.00 70.02  ? 695 ARG D NE  1 
ATOM   8880  C CZ  . ARG D 1 195 ? 34.000  78.013  80.170  1.00 80.67  ? 695 ARG D CZ  1 
ATOM   8881  N NH1 . ARG D 1 195 ? 34.903  77.269  79.536  1.00 81.33  ? 695 ARG D NH1 1 
ATOM   8882  N NH2 . ARG D 1 195 ? 33.896  77.957  81.491  1.00 85.12  ? 695 ARG D NH2 1 
ATOM   8883  N N   . GLU D 1 196 ? 31.712  84.084  77.562  1.00 35.70  ? 696 GLU D N   1 
ATOM   8884  C CA  . GLU D 1 196 ? 31.806  85.541  77.753  1.00 36.34  ? 696 GLU D CA  1 
ATOM   8885  C C   . GLU D 1 196 ? 31.306  86.032  79.116  1.00 43.73  ? 696 GLU D C   1 
ATOM   8886  O O   . GLU D 1 196 ? 31.651  87.131  79.544  1.00 48.77  ? 696 GLU D O   1 
ATOM   8887  C CB  . GLU D 1 196 ? 31.074  86.297  76.640  1.00 33.52  ? 696 GLU D CB  1 
ATOM   8888  C CG  . GLU D 1 196 ? 29.559  85.994  76.561  1.00 40.59  ? 696 GLU D CG  1 
ATOM   8889  C CD  . GLU D 1 196 ? 28.851  86.698  75.396  1.00 45.41  ? 696 GLU D CD  1 
ATOM   8890  O OE1 . GLU D 1 196 ? 28.948  87.943  75.297  1.00 37.15  ? 696 GLU D OE1 1 
ATOM   8891  O OE2 . GLU D 1 196 ? 28.195  86.003  74.586  1.00 46.56  ? 696 GLU D OE2 1 
ATOM   8892  N N   . SER D 1 197 ? 30.492  85.228  79.793  1.00 39.82  ? 697 SER D N   1 
ATOM   8893  C CA  . SER D 1 197 ? 29.825  85.692  81.007  1.00 42.35  ? 697 SER D CA  1 
ATOM   8894  C C   . SER D 1 197 ? 30.754  85.626  82.208  1.00 36.78  ? 697 SER D C   1 
ATOM   8895  O O   . SER D 1 197 ? 30.494  86.228  83.255  1.00 29.42  ? 697 SER D O   1 
ATOM   8896  C CB  . SER D 1 197 ? 28.581  84.840  81.285  1.00 51.58  ? 697 SER D CB  1 
ATOM   8897  O OG  . SER D 1 197 ? 28.954  83.516  81.645  1.00 52.44  ? 697 SER D OG  1 
ATOM   8898  N N   . THR D 1 198 ? 31.848  84.897  82.039  1.00 37.36  ? 698 THR D N   1 
ATOM   8899  C CA  . THR D 1 198 ? 32.667  84.468  83.154  1.00 35.72  ? 698 THR D CA  1 
ATOM   8900  C C   . THR D 1 198 ? 34.115  84.951  83.033  1.00 40.01  ? 698 THR D C   1 
ATOM   8901  O O   . THR D 1 198 ? 34.989  84.567  83.812  1.00 46.85  ? 698 THR D O   1 
ATOM   8902  C CB  . THR D 1 198 ? 32.652  82.936  83.230  1.00 35.10  ? 698 THR D CB  1 
ATOM   8903  O OG1 . THR D 1 198 ? 32.600  82.525  84.596  1.00 46.66  ? 698 THR D OG1 1 
ATOM   8904  C CG2 . THR D 1 198 ? 33.888  82.333  82.527  1.00 25.35  ? 698 THR D CG2 1 
ATOM   8905  N N   . CYS D 1 199 ? 34.380  85.786  82.046  1.00 38.09  ? 699 CYS D N   1 
ATOM   8906  C CA  . CYS D 1 199 ? 35.730  86.286  81.887  1.00 54.91  ? 699 CYS D CA  1 
ATOM   8907  C C   . CYS D 1 199 ? 35.687  87.731  81.439  1.00 50.81  ? 699 CYS D C   1 
ATOM   8908  O O   . CYS D 1 199 ? 36.185  88.067  80.366  1.00 63.08  ? 699 CYS D O   1 
ATOM   8909  C CB  . CYS D 1 199 ? 36.462  85.441  80.851  1.00 62.85  ? 699 CYS D CB  1 
ATOM   8910  S SG  . CYS D 1 199 ? 35.647  85.461  79.250  1.00 83.91  ? 699 CYS D SG  1 
ATOM   8911  N N   . VAL D 1 200 ? 35.086  88.594  82.248  1.00 36.22  ? 700 VAL D N   1 
ATOM   8912  C CA  . VAL D 1 200 ? 34.812  89.945  81.753  1.00 38.05  ? 700 VAL D CA  1 
ATOM   8913  C C   . VAL D 1 200 ? 36.068  90.810  81.660  1.00 33.11  ? 700 VAL D C   1 
ATOM   8914  O O   . VAL D 1 200 ? 37.004  90.678  82.459  1.00 32.01  ? 700 VAL D O   1 
ATOM   8915  C CB  . VAL D 1 200 ? 33.655  90.656  82.512  1.00 48.75  ? 700 VAL D CB  1 
ATOM   8916  C CG1 . VAL D 1 200 ? 32.604  89.625  82.969  1.00 41.63  ? 700 VAL D CG1 1 
ATOM   8917  C CG2 . VAL D 1 200 ? 34.181  91.484  83.684  1.00 51.05  ? 700 VAL D CG2 1 
ATOM   8918  N N   . PRO D 1 201 ? 36.108  91.668  80.642  1.00 26.34  ? 701 PRO D N   1 
ATOM   8919  C CA  . PRO D 1 201 ? 37.250  92.549  80.452  1.00 34.97  ? 701 PRO D CA  1 
ATOM   8920  C C   . PRO D 1 201 ? 37.267  93.500  81.623  1.00 35.90  ? 701 PRO D C   1 
ATOM   8921  O O   . PRO D 1 201 ? 36.323  93.510  82.407  1.00 33.22  ? 701 PRO D O   1 
ATOM   8922  C CB  . PRO D 1 201 ? 36.905  93.307  79.166  1.00 34.40  ? 701 PRO D CB  1 
ATOM   8923  C CG  . PRO D 1 201 ? 35.782  92.544  78.552  1.00 33.89  ? 701 PRO D CG  1 
ATOM   8924  C CD  . PRO D 1 201 ? 35.038  91.936  79.673  1.00 26.18  ? 701 PRO D CD  1 
ATOM   8925  N N   . PRO D 1 202 ? 38.324  94.304  81.733  1.00 32.03  ? 702 PRO D N   1 
ATOM   8926  C CA  . PRO D 1 202 ? 38.524  95.161  82.906  1.00 31.45  ? 702 PRO D CA  1 
ATOM   8927  C C   . PRO D 1 202 ? 37.511  96.316  83.038  1.00 35.36  ? 702 PRO D C   1 
ATOM   8928  O O   . PRO D 1 202 ? 37.402  96.879  84.126  1.00 41.55  ? 702 PRO D O   1 
ATOM   8929  C CB  . PRO D 1 202 ? 39.959  95.670  82.725  1.00 28.69  ? 702 PRO D CB  1 
ATOM   8930  C CG  . PRO D 1 202 ? 40.223  95.545  81.240  1.00 29.55  ? 702 PRO D CG  1 
ATOM   8931  C CD  . PRO D 1 202 ? 39.466  94.330  80.805  1.00 30.21  ? 702 PRO D CD  1 
ATOM   8932  N N   . ASN D 1 203 ? 36.775  96.646  81.979  1.00 28.26  ? 703 ASN D N   1 
ATOM   8933  C CA  . ASN D 1 203 ? 35.714  97.656  82.079  1.00 28.45  ? 703 ASN D CA  1 
ATOM   8934  C C   . ASN D 1 203 ? 34.311  97.056  81.974  1.00 31.20  ? 703 ASN D C   1 
ATOM   8935  O O   . ASN D 1 203 ? 33.321  97.768  81.758  1.00 31.88  ? 703 ASN D O   1 
ATOM   8936  C CB  . ASN D 1 203 ? 35.910  98.759  81.034  1.00 28.69  ? 703 ASN D CB  1 
ATOM   8937  C CG  . ASN D 1 203 ? 35.598  100.131 81.579  1.00 26.54  ? 703 ASN D CG  1 
ATOM   8938  O OD1 . ASN D 1 203 ? 35.383  100.295 82.771  1.00 37.60  ? 703 ASN D OD1 1 
ATOM   8939  N ND2 . ASN D 1 203 ? 35.566  101.122 80.711  1.00 40.54  ? 703 ASN D ND2 1 
ATOM   8940  N N   . ASN D 1 204 ? 34.244  95.734  82.134  1.00 38.10  ? 704 ASN D N   1 
ATOM   8941  C CA  . ASN D 1 204 ? 33.009  94.967  81.991  1.00 27.46  ? 704 ASN D CA  1 
ATOM   8942  C C   . ASN D 1 204 ? 32.429  94.976  80.565  1.00 29.24  ? 704 ASN D C   1 
ATOM   8943  O O   . ASN D 1 204 ? 33.128  95.316  79.600  1.00 29.63  ? 704 ASN D O   1 
ATOM   8944  C CB  . ASN D 1 204 ? 31.974  95.402  83.026  1.00 29.79  ? 704 ASN D CB  1 
ATOM   8945  C CG  . ASN D 1 204 ? 31.154  94.225  83.548  1.00 49.14  ? 704 ASN D CG  1 
ATOM   8946  O OD1 . ASN D 1 204 ? 30.406  93.595  82.793  1.00 50.50  ? 704 ASN D OD1 1 
ATOM   8947  N ND2 . ASN D 1 204 ? 31.297  93.919  84.840  1.00 46.34  ? 704 ASN D ND2 1 
ATOM   8948  N N   . VAL D 1 205 ? 31.157  94.604  80.427  1.00 27.98  ? 705 VAL D N   1 
ATOM   8949  C CA  . VAL D 1 205 ? 30.569  94.385  79.096  1.00 17.13  ? 705 VAL D CA  1 
ATOM   8950  C C   . VAL D 1 205 ? 29.415  95.322  78.710  1.00 16.67  ? 705 VAL D C   1 
ATOM   8951  O O   . VAL D 1 205 ? 28.473  95.510  79.469  1.00 17.30  ? 705 VAL D O   1 
ATOM   8952  C CB  . VAL D 1 205 ? 30.125  92.914  78.926  1.00 16.51  ? 705 VAL D CB  1 
ATOM   8953  C CG1 . VAL D 1 205 ? 29.591  92.678  77.508  1.00 12.69  ? 705 VAL D CG1 1 
ATOM   8954  C CG2 . VAL D 1 205 ? 31.294  91.998  79.216  1.00 9.24   ? 705 VAL D CG2 1 
ATOM   8955  N N   . SER D 1 206 ? 29.491  95.886  77.507  1.00 16.55  ? 706 SER D N   1 
ATOM   8956  C CA  . SER D 1 206 ? 28.506  96.850  77.043  1.00 24.03  ? 706 SER D CA  1 
ATOM   8957  C C   . SER D 1 206 ? 27.707  96.241  75.913  1.00 23.50  ? 706 SER D C   1 
ATOM   8958  O O   . SER D 1 206 ? 26.512  96.465  75.795  1.00 29.80  ? 706 SER D O   1 
ATOM   8959  C CB  . SER D 1 206 ? 29.193  98.131  76.536  1.00 20.30  ? 706 SER D CB  1 
ATOM   8960  O OG  . SER D 1 206 ? 30.000  98.709  77.551  1.00 21.49  ? 706 SER D OG  1 
ATOM   8961  N N   . VAL D 1 207 ? 28.393  95.511  75.049  1.00 24.15  ? 707 VAL D N   1 
ATOM   8962  C CA  . VAL D 1 207 ? 27.743  94.817  73.953  1.00 22.73  ? 707 VAL D CA  1 
ATOM   8963  C C   . VAL D 1 207 ? 28.233  93.398  73.965  1.00 28.03  ? 707 VAL D C   1 
ATOM   8964  O O   . VAL D 1 207 ? 29.422  93.143  73.760  1.00 29.75  ? 707 VAL D O   1 
ATOM   8965  C CB  . VAL D 1 207 ? 28.111  95.361  72.576  1.00 16.98  ? 707 VAL D CB  1 
ATOM   8966  C CG1 . VAL D 1 207 ? 27.171  94.741  71.534  1.00 10.86  ? 707 VAL D CG1 1 
ATOM   8967  C CG2 . VAL D 1 207 ? 28.062  96.888  72.541  1.00 13.45  ? 707 VAL D CG2 1 
ATOM   8968  N N   . PRO D 1 208 ? 27.316  92.462  74.201  1.00 23.28  ? 708 PRO D N   1 
ATOM   8969  C CA  . PRO D 1 208 ? 27.716  91.056  74.180  1.00 13.58  ? 708 PRO D CA  1 
ATOM   8970  C C   . PRO D 1 208 ? 28.248  90.645  72.810  1.00 15.16  ? 708 PRO D C   1 
ATOM   8971  O O   . PRO D 1 208 ? 28.131  91.412  71.850  1.00 12.98  ? 708 PRO D O   1 
ATOM   8972  C CB  . PRO D 1 208 ? 26.425  90.309  74.552  1.00 15.51  ? 708 PRO D CB  1 
ATOM   8973  C CG  . PRO D 1 208 ? 25.314  91.316  74.404  1.00 22.99  ? 708 PRO D CG  1 
ATOM   8974  C CD  . PRO D 1 208 ? 25.907  92.665  74.574  1.00 18.22  ? 708 PRO D CD  1 
ATOM   8975  N N   . LEU D 1 209 ? 28.816  89.438  72.738  1.00 14.67  ? 709 LEU D N   1 
ATOM   8976  C CA  . LEU D 1 209 ? 29.383  88.863  71.516  1.00 15.71  ? 709 LEU D CA  1 
ATOM   8977  C C   . LEU D 1 209 ? 28.351  88.741  70.396  1.00 25.03  ? 709 LEU D C   1 
ATOM   8978  O O   . LEU D 1 209 ? 28.629  89.107  69.232  1.00 19.13  ? 709 LEU D O   1 
ATOM   8979  C CB  . LEU D 1 209 ? 29.972  87.481  71.816  1.00 14.67  ? 709 LEU D CB  1 
ATOM   8980  C CG  . LEU D 1 209 ? 30.523  86.722  70.612  1.00 21.64  ? 709 LEU D CG  1 
ATOM   8981  C CD1 . LEU D 1 209 ? 31.635  87.511  69.954  1.00 20.27  ? 709 LEU D CD1 1 
ATOM   8982  C CD2 . LEU D 1 209 ? 31.016  85.354  71.033  1.00 20.24  ? 709 LEU D CD2 1 
ATOM   8983  N N   . LEU D 1 210 ? 27.181  88.192  70.757  1.00 14.83  ? 710 LEU D N   1 
ATOM   8984  C CA  . LEU D 1 210 ? 25.992  88.153  69.892  1.00 17.49  ? 710 LEU D CA  1 
ATOM   8985  C C   . LEU D 1 210 ? 26.053  87.168  68.726  1.00 21.35  ? 710 LEU D C   1 
ATOM   8986  O O   . LEU D 1 210 ? 25.117  86.389  68.487  1.00 23.00  ? 710 LEU D O   1 
ATOM   8987  C CB  . LEU D 1 210 ? 25.651  89.546  69.360  1.00 6.87   ? 710 LEU D CB  1 
ATOM   8988  C CG  . LEU D 1 210 ? 25.034  90.572  70.330  1.00 18.49  ? 710 LEU D CG  1 
ATOM   8989  C CD1 . LEU D 1 210 ? 24.692  91.822  69.582  1.00 11.76  ? 710 LEU D CD1 1 
ATOM   8990  C CD2 . LEU D 1 210 ? 23.769  90.066  70.994  1.00 17.88  ? 710 LEU D CD2 1 
ATOM   8991  N N   . MET D 1 211 ? 27.158  87.225  68.000  1.00 16.98  ? 711 MET D N   1 
ATOM   8992  C CA  . MET D 1 211 ? 27.292  86.565  66.712  1.00 24.48  ? 711 MET D CA  1 
ATOM   8993  C C   . MET D 1 211 ? 27.013  85.049  66.705  1.00 25.02  ? 711 MET D C   1 
ATOM   8994  O O   . MET D 1 211 ? 26.225  84.582  65.884  1.00 27.28  ? 711 MET D O   1 
ATOM   8995  C CB  . MET D 1 211 ? 28.670  86.886  66.133  1.00 33.00  ? 711 MET D CB  1 
ATOM   8996  C CG  . MET D 1 211 ? 28.675  87.278  64.668  1.00 41.59  ? 711 MET D CG  1 
ATOM   8997  S SD  . MET D 1 211 ? 27.218  88.134  64.012  1.00 32.05  ? 711 MET D SD  1 
ATOM   8998  C CE  . MET D 1 211 ? 27.402  87.500  62.344  1.00 16.23  ? 711 MET D CE  1 
ATOM   8999  N N   . PRO D 1 212 ? 27.663  84.274  67.599  1.00 24.17  ? 712 PRO D N   1 
ATOM   9000  C CA  . PRO D 1 212 ? 27.333  82.836  67.614  1.00 24.84  ? 712 PRO D CA  1 
ATOM   9001  C C   . PRO D 1 212 ? 25.873  82.534  67.972  1.00 18.41  ? 712 PRO D C   1 
ATOM   9002  O O   . PRO D 1 212 ? 25.292  81.681  67.323  1.00 24.23  ? 712 PRO D O   1 
ATOM   9003  C CB  . PRO D 1 212 ? 28.301  82.251  68.657  1.00 21.02  ? 712 PRO D CB  1 
ATOM   9004  C CG  . PRO D 1 212 ? 29.474  83.196  68.640  1.00 25.65  ? 712 PRO D CG  1 
ATOM   9005  C CD  . PRO D 1 212 ? 28.882  84.574  68.377  1.00 20.49  ? 712 PRO D CD  1 
ATOM   9006  N N   . LEU D 1 213 ? 25.309  83.206  68.975  1.00 20.94  ? 713 LEU D N   1 
ATOM   9007  C CA  . LEU D 1 213 ? 23.887  83.086  69.305  1.00 20.18  ? 713 LEU D CA  1 
ATOM   9008  C C   . LEU D 1 213 ? 22.993  83.334  68.094  1.00 22.56  ? 713 LEU D C   1 
ATOM   9009  O O   . LEU D 1 213 ? 22.111  82.529  67.757  1.00 21.38  ? 713 LEU D O   1 
ATOM   9010  C CB  . LEU D 1 213 ? 23.499  84.086  70.402  1.00 17.81  ? 713 LEU D CB  1 
ATOM   9011  C CG  . LEU D 1 213 ? 21.998  84.130  70.746  1.00 20.83  ? 713 LEU D CG  1 
ATOM   9012  C CD1 . LEU D 1 213 ? 21.511  82.755  71.221  1.00 14.10  ? 713 LEU D CD1 1 
ATOM   9013  C CD2 . LEU D 1 213 ? 21.676  85.180  71.805  1.00 15.44  ? 713 LEU D CD2 1 
ATOM   9014  N N   . VAL D 1 214 ? 23.223  84.475  67.459  1.00 15.63  ? 714 VAL D N   1 
ATOM   9015  C CA  . VAL D 1 214 ? 22.403  84.943  66.342  1.00 15.72  ? 714 VAL D CA  1 
ATOM   9016  C C   . VAL D 1 214 ? 22.420  83.999  65.114  1.00 24.02  ? 714 VAL D C   1 
ATOM   9017  O O   . VAL D 1 214 ? 21.393  83.776  64.479  1.00 26.70  ? 714 VAL D O   1 
ATOM   9018  C CB  . VAL D 1 214 ? 22.813  86.406  65.987  1.00 24.83  ? 714 VAL D CB  1 
ATOM   9019  C CG1 . VAL D 1 214 ? 22.673  86.681  64.524  1.00 41.50  ? 714 VAL D CG1 1 
ATOM   9020  C CG2 . VAL D 1 214 ? 22.004  87.387  66.815  1.00 19.72  ? 714 VAL D CG2 1 
ATOM   9021  N N   . THR D 1 215 ? 23.577  83.441  64.777  1.00 24.75  ? 715 THR D N   1 
ATOM   9022  C CA  . THR D 1 215 ? 23.647  82.535  63.633  1.00 29.71  ? 715 THR D CA  1 
ATOM   9023  C C   . THR D 1 215 ? 23.110  81.175  64.017  1.00 27.06  ? 715 THR D C   1 
ATOM   9024  O O   . THR D 1 215 ? 22.654  80.414  63.161  1.00 29.57  ? 715 THR D O   1 
ATOM   9025  C CB  . THR D 1 215 ? 25.081  82.352  63.117  1.00 30.27  ? 715 THR D CB  1 
ATOM   9026  O OG1 . THR D 1 215 ? 25.925  81.946  64.204  1.00 33.81  ? 715 THR D OG1 1 
ATOM   9027  C CG2 . THR D 1 215 ? 25.601  83.655  62.495  1.00 23.27  ? 715 THR D CG2 1 
ATOM   9028  N N   . LEU D 1 216 ? 23.184  80.860  65.307  1.00 16.07  ? 716 LEU D N   1 
ATOM   9029  C CA  . LEU D 1 216 ? 22.591  79.624  65.794  1.00 16.48  ? 716 LEU D CA  1 
ATOM   9030  C C   . LEU D 1 216 ? 21.076  79.666  65.591  1.00 22.24  ? 716 LEU D C   1 
ATOM   9031  O O   . LEU D 1 216 ? 20.464  78.676  65.194  1.00 19.86  ? 716 LEU D O   1 
ATOM   9032  C CB  . LEU D 1 216 ? 22.933  79.376  67.270  1.00 22.42  ? 716 LEU D CB  1 
ATOM   9033  C CG  . LEU D 1 216 ? 22.518  77.967  67.743  1.00 32.33  ? 716 LEU D CG  1 
ATOM   9034  C CD1 . LEU D 1 216 ? 23.105  76.892  66.832  1.00 33.40  ? 716 LEU D CD1 1 
ATOM   9035  C CD2 . LEU D 1 216 ? 22.892  77.677  69.197  1.00 26.03  ? 716 LEU D CD2 1 
ATOM   9036  N N   . MET D 1 217 ? 20.481  80.828  65.850  1.00 24.31  ? 717 MET D N   1 
ATOM   9037  C CA  . MET D 1 217 ? 19.040  80.978  65.733  1.00 24.43  ? 717 MET D CA  1 
ATOM   9038  C C   . MET D 1 217 ? 18.600  81.135  64.278  1.00 26.30  ? 717 MET D C   1 
ATOM   9039  O O   . MET D 1 217 ? 17.463  80.851  63.948  1.00 25.39  ? 717 MET D O   1 
ATOM   9040  C CB  . MET D 1 217 ? 18.556  82.169  66.558  1.00 26.43  ? 717 MET D CB  1 
ATOM   9041  C CG  . MET D 1 217 ? 18.943  82.108  68.030  1.00 28.32  ? 717 MET D CG  1 
ATOM   9042  S SD  . MET D 1 217 ? 18.210  83.473  68.956  1.00 25.91  ? 717 MET D SD  1 
ATOM   9043  C CE  . MET D 1 217 ? 16.469  83.118  68.678  1.00 19.38  ? 717 MET D CE  1 
ATOM   9044  N N   . GLU D 1 218 ? 19.507  81.572  63.410  1.00 27.85  ? 718 GLU D N   1 
ATOM   9045  C CA  . GLU D 1 218 ? 19.165  81.877  62.015  1.00 26.79  ? 718 GLU D CA  1 
ATOM   9046  C C   . GLU D 1 218 ? 19.827  80.928  61.012  1.00 23.89  ? 718 GLU D C   1 
ATOM   9047  O O   . GLU D 1 218 ? 20.867  81.255  60.432  1.00 31.35  ? 718 GLU D O   1 
ATOM   9048  C CB  . GLU D 1 218 ? 19.565  83.323  61.678  1.00 20.69  ? 718 GLU D CB  1 
ATOM   9049  C CG  . GLU D 1 218 ? 18.856  84.380  62.506  1.00 29.52  ? 718 GLU D CG  1 
ATOM   9050  C CD  . GLU D 1 218 ? 17.387  84.539  62.149  1.00 35.01  ? 718 GLU D CD  1 
ATOM   9051  O OE1 . GLU D 1 218 ? 16.963  84.029  61.087  1.00 39.69  ? 718 GLU D OE1 1 
ATOM   9052  O OE2 . GLU D 1 218 ? 16.651  85.174  62.933  1.00 30.31  ? 718 GLU D OE2 1 
ATOM   9053  N N   . ARG D 1 219 ? 19.201  79.777  60.782  1.00 31.86  ? 719 ARG D N   1 
ATOM   9054  C CA  . ARG D 1 219 ? 19.776  78.713  59.949  1.00 41.02  ? 719 ARG D CA  1 
ATOM   9055  C C   . ARG D 1 219 ? 19.979  79.139  58.492  1.00 46.10  ? 719 ARG D C   1 
ATOM   9056  O O   . ARG D 1 219 ? 20.791  78.557  57.781  1.00 57.15  ? 719 ARG D O   1 
ATOM   9057  C CB  . ARG D 1 219 ? 18.935  77.421  60.062  1.00 44.93  ? 719 ARG D CB  1 
ATOM   9058  C CG  . ARG D 1 219 ? 18.823  76.931  61.516  1.00 53.08  ? 719 ARG D CG  1 
ATOM   9059  C CD  . ARG D 1 219 ? 17.905  75.729  61.709  1.00 54.81  ? 719 ARG D CD  1 
ATOM   9060  N NE  . ARG D 1 219 ? 18.533  74.442  61.414  1.00 51.48  ? 719 ARG D NE  1 
ATOM   9061  C CZ  . ARG D 1 219 ? 18.419  73.816  60.245  1.00 55.10  ? 719 ARG D CZ  1 
ATOM   9062  N NH1 . ARG D 1 219 ? 17.719  74.370  59.259  1.00 54.77  ? 719 ARG D NH1 1 
ATOM   9063  N NH2 . ARG D 1 219 ? 19.008  72.644  60.055  1.00 49.81  ? 719 ARG D NH2 1 
ATOM   9064  N N   . GLN D 1 220 ? 19.265  80.177  58.063  1.00 41.68  ? 720 GLN D N   1 
ATOM   9065  C CA  . GLN D 1 220 ? 19.399  80.688  56.700  1.00 41.01  ? 720 GLN D CA  1 
ATOM   9066  C C   . GLN D 1 220 ? 20.372  81.862  56.610  1.00 44.66  ? 720 GLN D C   1 
ATOM   9067  O O   . GLN D 1 220 ? 20.516  82.474  55.555  1.00 50.05  ? 720 GLN D O   1 
ATOM   9068  C CB  . GLN D 1 220 ? 18.030  81.092  56.147  1.00 44.02  ? 720 GLN D CB  1 
ATOM   9069  C CG  . GLN D 1 220 ? 16.999  79.982  56.236  1.00 50.36  ? 720 GLN D CG  1 
ATOM   9070  C CD  . GLN D 1 220 ? 17.465  78.733  55.510  1.00 66.83  ? 720 GLN D CD  1 
ATOM   9071  O OE1 . GLN D 1 220 ? 18.007  78.819  54.406  1.00 70.64  ? 720 GLN D OE1 1 
ATOM   9072  N NE2 . GLN D 1 220 ? 17.277  77.566  56.133  1.00 70.45  ? 720 GLN D NE2 1 
ATOM   9073  N N   . ALA D 1 221 ? 21.045  82.166  57.718  1.00 44.50  ? 721 ALA D N   1 
ATOM   9074  C CA  . ALA D 1 221 ? 21.986  83.292  57.773  1.00 46.46  ? 721 ALA D CA  1 
ATOM   9075  C C   . ALA D 1 221 ? 23.159  83.123  56.824  1.00 47.53  ? 721 ALA D C   1 
ATOM   9076  O O   . ALA D 1 221 ? 23.796  82.069  56.788  1.00 51.00  ? 721 ALA D O   1 
ATOM   9077  C CB  . ALA D 1 221 ? 22.509  83.469  59.178  1.00 45.31  ? 721 ALA D CB  1 
ATOM   9078  N N   . VAL D 1 222 ? 23.463  84.176  56.077  1.00 45.42  ? 722 VAL D N   1 
ATOM   9079  C CA  . VAL D 1 222 ? 24.632  84.180  55.207  1.00 41.69  ? 722 VAL D CA  1 
ATOM   9080  C C   . VAL D 1 222 ? 25.745  85.010  55.841  1.00 44.86  ? 722 VAL D C   1 
ATOM   9081  O O   . VAL D 1 222 ? 25.555  86.198  56.118  1.00 49.63  ? 722 VAL D O   1 
ATOM   9082  C CB  . VAL D 1 222 ? 24.299  84.769  53.818  1.00 41.82  ? 722 VAL D CB  1 
ATOM   9083  C CG1 . VAL D 1 222 ? 25.490  84.637  52.879  1.00 42.90  ? 722 VAL D CG1 1 
ATOM   9084  C CG2 . VAL D 1 222 ? 23.072  84.098  53.233  1.00 39.96  ? 722 VAL D CG2 1 
ATOM   9085  N N   . THR D 1 223 ? 26.898  84.387  56.074  1.00 43.52  ? 723 THR D N   1 
ATOM   9086  C CA  . THR D 1 223 ? 28.080  85.103  56.556  1.00 46.66  ? 723 THR D CA  1 
ATOM   9087  C C   . THR D 1 223 ? 29.186  85.118  55.520  1.00 45.54  ? 723 THR D C   1 
ATOM   9088  O O   . THR D 1 223 ? 29.278  84.220  54.686  1.00 49.48  ? 723 THR D O   1 
ATOM   9089  C CB  . THR D 1 223 ? 28.661  84.444  57.794  1.00 44.68  ? 723 THR D CB  1 
ATOM   9090  O OG1 . THR D 1 223 ? 28.498  83.026  57.666  1.00 46.37  ? 723 THR D OG1 1 
ATOM   9091  C CG2 . THR D 1 223 ? 27.943  84.943  59.040  1.00 40.99  ? 723 THR D CG2 1 
ATOM   9092  N N   . PHE D 1 224 ? 30.038  86.133  55.590  1.00 40.91  ? 724 PHE D N   1 
ATOM   9093  C CA  . PHE D 1 224 ? 31.186  86.220  54.701  1.00 50.04  ? 724 PHE D CA  1 
ATOM   9094  C C   . PHE D 1 224 ? 32.189  85.100  54.999  1.00 58.09  ? 724 PHE D C   1 
ATOM   9095  O O   . PHE D 1 224 ? 32.627  84.937  56.139  1.00 55.85  ? 724 PHE D O   1 
ATOM   9096  C CB  . PHE D 1 224 ? 31.862  87.584  54.832  1.00 45.69  ? 724 PHE D CB  1 
ATOM   9097  C CG  . PHE D 1 224 ? 33.047  87.749  53.935  1.00 44.38  ? 724 PHE D CG  1 
ATOM   9098  C CD1 . PHE D 1 224 ? 34.328  87.750  54.452  1.00 46.43  ? 724 PHE D CD1 1 
ATOM   9099  C CD2 . PHE D 1 224 ? 32.879  87.882  52.569  1.00 35.59  ? 724 PHE D CD2 1 
ATOM   9100  C CE1 . PHE D 1 224 ? 35.418  87.894  53.619  1.00 55.57  ? 724 PHE D CE1 1 
ATOM   9101  C CE2 . PHE D 1 224 ? 33.966  88.020  51.734  1.00 46.11  ? 724 PHE D CE2 1 
ATOM   9102  C CZ  . PHE D 1 224 ? 35.237  88.028  52.257  1.00 52.17  ? 724 PHE D CZ  1 
ATOM   9103  N N   . GLU D 1 225 ? 32.541  84.331  53.970  1.00 62.87  ? 725 GLU D N   1 
ATOM   9104  C CA  . GLU D 1 225 ? 33.464  83.201  54.117  1.00 69.24  ? 725 GLU D CA  1 
ATOM   9105  C C   . GLU D 1 225 ? 32.978  82.125  55.095  1.00 70.76  ? 725 GLU D C   1 
ATOM   9106  O O   . GLU D 1 225 ? 33.781  81.450  55.746  1.00 62.59  ? 725 GLU D O   1 
ATOM   9107  C CB  . GLU D 1 225 ? 34.869  83.683  54.486  1.00 72.43  ? 725 GLU D CB  1 
ATOM   9108  C CG  . GLU D 1 225 ? 35.535  84.478  53.370  1.00 82.65  ? 725 GLU D CG  1 
ATOM   9109  C CD  . GLU D 1 225 ? 36.993  84.780  53.649  1.00 84.76  ? 725 GLU D CD  1 
ATOM   9110  O OE1 . GLU D 1 225 ? 37.490  84.395  54.730  1.00 86.65  ? 725 GLU D OE1 1 
ATOM   9111  O OE2 . GLU D 1 225 ? 37.640  85.402  52.782  1.00 82.99  ? 725 GLU D OE2 1 
ATOM   9112  N N   . GLY D 1 226 ? 31.657  81.980  55.189  1.00 76.40  ? 726 GLY D N   1 
ATOM   9113  C CA  . GLY D 1 226 ? 31.029  80.891  55.921  1.00 74.82  ? 726 GLY D CA  1 
ATOM   9114  C C   . GLY D 1 226 ? 31.462  80.709  57.365  1.00 66.73  ? 726 GLY D C   1 
ATOM   9115  O O   . GLY D 1 226 ? 31.495  79.579  57.876  1.00 59.76  ? 726 GLY D O   1 
ATOM   9116  N N   . THR D 1 227 ? 31.791  81.815  58.027  1.00 54.67  ? 727 THR D N   1 
ATOM   9117  C CA  . THR D 1 227 ? 32.169  81.773  59.435  1.00 47.42  ? 727 THR D CA  1 
ATOM   9118  C C   . THR D 1 227 ? 30.925  81.666  60.320  1.00 42.33  ? 727 THR D C   1 
ATOM   9119  O O   . THR D 1 227 ? 29.827  81.979  59.876  1.00 38.56  ? 727 THR D O   1 
ATOM   9120  C CB  . THR D 1 227 ? 33.021  82.995  59.814  1.00 44.24  ? 727 THR D CB  1 
ATOM   9121  O OG1 . THR D 1 227 ? 32.308  84.205  59.503  1.00 44.01  ? 727 THR D OG1 1 
ATOM   9122  C CG2 . THR D 1 227 ? 34.334  82.958  59.039  1.00 27.68  ? 727 THR D CG2 1 
ATOM   9123  N N   . ASP D 1 228 ? 31.089  81.199  61.555  1.00 51.16  ? 728 ASP D N   1 
ATOM   9124  C CA  . ASP D 1 228 ? 29.957  81.006  62.471  1.00 56.32  ? 728 ASP D CA  1 
ATOM   9125  C C   . ASP D 1 228 ? 28.891  80.104  61.856  1.00 53.11  ? 728 ASP D C   1 
ATOM   9126  O O   . ASP D 1 228 ? 27.712  80.256  62.163  1.00 48.07  ? 728 ASP D O   1 
ATOM   9127  C CB  . ASP D 1 228 ? 29.287  82.344  62.865  1.00 59.73  ? 728 ASP D CB  1 
ATOM   9128  C CG  . ASP D 1 228 ? 30.229  83.301  63.585  1.00 66.80  ? 728 ASP D CG  1 
ATOM   9129  O OD1 . ASP D 1 228 ? 30.421  83.147  64.815  1.00 57.18  ? 728 ASP D OD1 1 
ATOM   9130  O OD2 . ASP D 1 228 ? 30.760  84.224  62.919  1.00 75.41  ? 728 ASP D OD2 1 
ATOM   9131  N N   . MET D 1 229 ? 29.293  79.185  60.979  1.00 55.32  ? 729 MET D N   1 
ATOM   9132  C CA  . MET D 1 229 ? 28.341  78.249  60.369  1.00 56.74  ? 729 MET D CA  1 
ATOM   9133  C C   . MET D 1 229 ? 28.271  76.915  61.132  1.00 60.23  ? 729 MET D C   1 
ATOM   9134  O O   . MET D 1 229 ? 27.770  75.908  60.625  1.00 63.08  ? 729 MET D O   1 
ATOM   9135  C CB  . MET D 1 229 ? 28.627  78.034  58.877  1.00 56.09  ? 729 MET D CB  1 
ATOM   9136  C CG  . MET D 1 229 ? 28.362  79.266  57.986  1.00 54.10  ? 729 MET D CG  1 
ATOM   9137  S SD  . MET D 1 229 ? 26.636  79.826  57.826  1.00 67.72  ? 729 MET D SD  1 
ATOM   9138  C CE  . MET D 1 229 ? 26.349  80.629  59.403  1.00 58.08  ? 729 MET D CE  1 
ATOM   9139  N N   . TRP D 1 230 ? 28.777  76.922  62.360  1.00 52.59  ? 730 TRP D N   1 
ATOM   9140  C CA  . TRP D 1 230 ? 28.561  75.817  63.273  1.00 44.04  ? 730 TRP D CA  1 
ATOM   9141  C C   . TRP D 1 230 ? 28.825  74.440  62.652  1.00 51.64  ? 730 TRP D C   1 
ATOM   9142  O O   . TRP D 1 230 ? 28.036  73.506  62.817  1.00 47.43  ? 730 TRP D O   1 
ATOM   9143  C CB  . TRP D 1 230 ? 27.142  75.891  63.836  1.00 36.29  ? 730 TRP D CB  1 
ATOM   9144  C CG  . TRP D 1 230 ? 26.906  77.059  64.753  1.00 36.07  ? 730 TRP D CG  1 
ATOM   9145  C CD1 . TRP D 1 230 ? 26.424  78.296  64.407  1.00 34.21  ? 730 TRP D CD1 1 
ATOM   9146  C CD2 . TRP D 1 230 ? 27.115  77.095  66.170  1.00 29.07  ? 730 TRP D CD2 1 
ATOM   9147  N NE1 . TRP D 1 230 ? 26.332  79.097  65.519  1.00 31.64  ? 730 TRP D NE1 1 
ATOM   9148  C CE2 . TRP D 1 230 ? 26.750  78.388  66.614  1.00 27.04  ? 730 TRP D CE2 1 
ATOM   9149  C CE3 . TRP D 1 230 ? 27.570  76.162  67.109  1.00 24.88  ? 730 TRP D CE3 1 
ATOM   9150  C CZ2 . TRP D 1 230 ? 26.823  78.766  67.954  1.00 17.73  ? 730 TRP D CZ2 1 
ATOM   9151  C CZ3 . TRP D 1 230 ? 27.649  76.538  68.441  1.00 20.49  ? 730 TRP D CZ3 1 
ATOM   9152  C CH2 . TRP D 1 230 ? 27.276  77.829  68.851  1.00 26.64  ? 730 TRP D CH2 1 
ATOM   9153  N N   . GLU D 1 231 ? 29.948  74.319  61.950  1.00 70.53  ? 731 GLU D N   1 
ATOM   9154  C CA  . GLU D 1 231 ? 30.392  73.032  61.417  1.00 75.26  ? 731 GLU D CA  1 
ATOM   9155  C C   . GLU D 1 231 ? 31.491  72.448  62.307  1.00 67.86  ? 731 GLU D C   1 
ATOM   9156  O O   . GLU D 1 231 ? 31.974  73.111  63.229  1.00 55.96  ? 731 GLU D O   1 
ATOM   9157  C CB  . GLU D 1 231 ? 30.906  73.196  59.983  1.00 75.38  ? 731 GLU D CB  1 
ATOM   9158  C CG  . GLU D 1 231 ? 29.841  73.608  58.985  1.00 80.53  ? 731 GLU D CG  1 
ATOM   9159  C CD  . GLU D 1 231 ? 30.315  74.711  58.061  1.00 93.67  ? 731 GLU D CD  1 
ATOM   9160  O OE1 . GLU D 1 231 ? 29.573  75.066  57.120  1.00 96.50  ? 731 GLU D OE1 1 
ATOM   9161  O OE2 . GLU D 1 231 ? 31.432  75.230  58.278  1.00 99.93  ? 731 GLU D OE2 1 
ATOM   9162  N N   . LYS D 1 232 ? 31.881  71.207  62.032  1.00 65.52  ? 732 LYS D N   1 
ATOM   9163  C CA  . LYS D 1 232 ? 33.031  70.612  62.707  1.00 64.75  ? 732 LYS D CA  1 
ATOM   9164  C C   . LYS D 1 232 ? 32.916  70.672  64.227  1.00 59.81  ? 732 LYS D C   1 
ATOM   9165  O O   . LYS D 1 232 ? 31.849  70.444  64.799  1.00 62.74  ? 732 LYS D O   1 
ATOM   9166  C CB  . LYS D 1 232 ? 34.327  71.304  62.267  1.00 71.71  ? 732 LYS D CB  1 
ATOM   9167  C CG  . LYS D 1 232 ? 34.687  71.119  60.795  1.00 80.50  ? 732 LYS D CG  1 
ATOM   9168  C CD  . LYS D 1 232 ? 34.819  69.642  60.434  1.00 89.53  ? 732 LYS D CD  1 
ATOM   9169  C CE  . LYS D 1 232 ? 35.689  69.434  59.193  1.00 92.43  ? 732 LYS D CE  1 
ATOM   9170  N NZ  . LYS D 1 232 ? 35.139  70.069  57.958  1.00 90.23  ? 732 LYS D NZ  1 
ATOM   9171  N N   . ASN D 1 233 ? 34.022  71.002  64.881  1.00 56.75  ? 733 ASN D N   1 
ATOM   9172  C CA  . ASN D 1 233 ? 34.081  70.980  66.341  1.00 60.53  ? 733 ASN D CA  1 
ATOM   9173  C C   . ASN D 1 233 ? 33.178  71.994  67.065  1.00 62.87  ? 733 ASN D C   1 
ATOM   9174  O O   . ASN D 1 233 ? 33.028  71.936  68.287  1.00 62.65  ? 733 ASN D O   1 
ATOM   9175  C CB  . ASN D 1 233 ? 35.535  71.075  66.821  1.00 61.07  ? 733 ASN D CB  1 
ATOM   9176  C CG  . ASN D 1 233 ? 36.259  69.734  66.754  1.00 73.80  ? 733 ASN D CG  1 
ATOM   9177  O OD1 . ASN D 1 233 ? 36.661  69.179  67.779  1.00 75.79  ? 733 ASN D OD1 1 
ATOM   9178  N ND2 . ASN D 1 233 ? 36.411  69.201  65.545  1.00 79.25  ? 733 ASN D ND2 1 
ATOM   9179  N N   . ASP D 1 234 ? 32.570  72.913  66.321  1.00 61.66  ? 734 ASP D N   1 
ATOM   9180  C CA  . ASP D 1 234 ? 31.578  73.803  66.915  1.00 59.32  ? 734 ASP D CA  1 
ATOM   9181  C C   . ASP D 1 234 ? 30.285  73.046  67.236  1.00 51.47  ? 734 ASP D C   1 
ATOM   9182  O O   . ASP D 1 234 ? 29.512  73.490  68.070  1.00 50.53  ? 734 ASP D O   1 
ATOM   9183  C CB  . ASP D 1 234 ? 31.272  74.995  66.001  1.00 69.84  ? 734 ASP D CB  1 
ATOM   9184  C CG  . ASP D 1 234 ? 32.472  75.901  65.793  1.00 82.39  ? 734 ASP D CG  1 
ATOM   9185  O OD1 . ASP D 1 234 ? 33.347  75.925  66.684  1.00 84.52  ? 734 ASP D OD1 1 
ATOM   9186  O OD2 . ASP D 1 234 ? 32.536  76.587  64.741  1.00 83.77  ? 734 ASP D OD2 1 
ATOM   9187  N N   . GLN D 1 235 ? 30.052  71.910  66.574  1.00 50.65  ? 735 GLN D N   1 
ATOM   9188  C CA  . GLN D 1 235 ? 28.810  71.153  66.774  1.00 46.80  ? 735 GLN D CA  1 
ATOM   9189  C C   . GLN D 1 235 ? 28.830  70.387  68.089  1.00 41.27  ? 735 GLN D C   1 
ATOM   9190  O O   . GLN D 1 235 ? 28.872  69.150  68.107  1.00 38.86  ? 735 GLN D O   1 
ATOM   9191  C CB  . GLN D 1 235 ? 28.542  70.195  65.609  1.00 49.57  ? 735 GLN D CB  1 
ATOM   9192  C CG  . GLN D 1 235 ? 28.223  70.886  64.295  1.00 56.53  ? 735 GLN D CG  1 
ATOM   9193  C CD  . GLN D 1 235 ? 28.174  69.929  63.117  1.00 55.97  ? 735 GLN D CD  1 
ATOM   9194  O OE1 . GLN D 1 235 ? 29.022  69.043  62.987  1.00 58.69  ? 735 GLN D OE1 1 
ATOM   9195  N NE2 . GLN D 1 235 ? 27.176  70.104  62.250  1.00 49.40  ? 735 GLN D NE2 1 
ATOM   9196  N N   . SER D 1 236 ? 28.797  71.144  69.180  1.00 33.48  ? 736 SER D N   1 
ATOM   9197  C CA  . SER D 1 236 ? 28.916  70.612  70.532  1.00 30.71  ? 736 SER D CA  1 
ATOM   9198  C C   . SER D 1 236 ? 27.756  71.122  71.372  1.00 31.31  ? 736 SER D C   1 
ATOM   9199  O O   . SER D 1 236 ? 27.564  72.338  71.510  1.00 29.46  ? 736 SER D O   1 
ATOM   9200  C CB  . SER D 1 236 ? 30.235  71.077  71.149  1.00 31.29  ? 736 SER D CB  1 
ATOM   9201  O OG  . SER D 1 236 ? 30.230  70.950  72.562  1.00 41.31  ? 736 SER D OG  1 
ATOM   9202  N N   . CYS D 1 237 ? 26.967  70.207  71.923  1.00 19.67  ? 737 CYS D N   1 
ATOM   9203  C CA  . CYS D 1 237 ? 25.861  70.636  72.764  1.00 18.67  ? 737 CYS D CA  1 
ATOM   9204  C C   . CYS D 1 237 ? 26.394  71.537  73.845  1.00 24.13  ? 737 CYS D C   1 
ATOM   9205  O O   . CYS D 1 237 ? 25.755  72.519  74.216  1.00 19.95  ? 737 CYS D O   1 
ATOM   9206  C CB  . CYS D 1 237 ? 25.134  69.459  73.398  1.00 12.53  ? 737 CYS D CB  1 
ATOM   9207  S SG  . CYS D 1 237 ? 24.075  68.642  72.227  1.00 39.46  ? 737 CYS D SG  1 
ATOM   9208  N N   . GLU D 1 238 ? 27.578  71.206  74.348  1.00 28.88  ? 738 GLU D N   1 
ATOM   9209  C CA  . GLU D 1 238 ? 28.141  71.964  75.456  1.00 28.29  ? 738 GLU D CA  1 
ATOM   9210  C C   . GLU D 1 238 ? 28.304  73.439  75.076  1.00 21.38  ? 738 GLU D C   1 
ATOM   9211  O O   . GLU D 1 238 ? 27.969  74.341  75.846  1.00 19.03  ? 738 GLU D O   1 
ATOM   9212  C CB  . GLU D 1 238 ? 29.482  71.376  75.912  1.00 35.76  ? 738 GLU D CB  1 
ATOM   9213  C CG  . GLU D 1 238 ? 29.864  71.835  77.318  1.00 48.82  ? 738 GLU D CG  1 
ATOM   9214  C CD  . GLU D 1 238 ? 31.273  71.467  77.713  1.00 63.64  ? 738 GLU D CD  1 
ATOM   9215  O OE1 . GLU D 1 238 ? 31.692  70.315  77.446  1.00 69.00  ? 738 GLU D OE1 1 
ATOM   9216  O OE2 . GLU D 1 238 ? 31.960  72.340  78.290  1.00 65.94  ? 738 GLU D OE2 1 
ATOM   9217  N N   . ILE D 1 239 ? 28.824  73.681  73.882  1.00 17.63  ? 739 ILE D N   1 
ATOM   9218  C CA  . ILE D 1 239 ? 29.077  75.040  73.463  1.00 20.18  ? 739 ILE D CA  1 
ATOM   9219  C C   . ILE D 1 239 ? 27.766  75.751  73.165  1.00 17.56  ? 739 ILE D C   1 
ATOM   9220  O O   . ILE D 1 239 ? 27.571  76.879  73.592  1.00 21.11  ? 739 ILE D O   1 
ATOM   9221  C CB  . ILE D 1 239 ? 30.068  75.087  72.290  1.00 26.80  ? 739 ILE D CB  1 
ATOM   9222  C CG1 . ILE D 1 239 ? 31.446  74.660  72.798  1.00 32.64  ? 739 ILE D CG1 1 
ATOM   9223  C CG2 . ILE D 1 239 ? 30.164  76.476  71.723  1.00 21.57  ? 739 ILE D CG2 1 
ATOM   9224  C CD1 . ILE D 1 239 ? 32.464  74.470  71.722  1.00 35.73  ? 739 ILE D CD1 1 
ATOM   9225  N N   . MET D 1 240 ? 26.859  75.073  72.468  1.00 17.89  ? 740 MET D N   1 
ATOM   9226  C CA  . MET D 1 240 ? 25.541  75.629  72.170  1.00 22.17  ? 740 MET D CA  1 
ATOM   9227  C C   . MET D 1 240 ? 24.793  75.971  73.449  1.00 23.00  ? 740 MET D C   1 
ATOM   9228  O O   . MET D 1 240 ? 24.204  77.048  73.562  1.00 19.83  ? 740 MET D O   1 
ATOM   9229  C CB  . MET D 1 240 ? 24.711  74.676  71.314  1.00 17.16  ? 740 MET D CB  1 
ATOM   9230  C CG  . MET D 1 240 ? 25.115  74.678  69.854  1.00 19.35  ? 740 MET D CG  1 
ATOM   9231  S SD  . MET D 1 240 ? 24.442  73.301  68.897  1.00 38.83  ? 740 MET D SD  1 
ATOM   9232  C CE  . MET D 1 240 ? 22.703  73.411  69.304  1.00 154.47 ? 740 MET D CE  1 
ATOM   9233  N N   . LEU D 1 241 ? 24.833  75.061  74.416  1.00 9.60   ? 741 LEU D N   1 
ATOM   9234  C CA  . LEU D 1 241 ? 24.217  75.313  75.711  1.00 16.93  ? 741 LEU D CA  1 
ATOM   9235  C C   . LEU D 1 241 ? 24.828  76.531  76.425  1.00 19.05  ? 741 LEU D C   1 
ATOM   9236  O O   . LEU D 1 241 ? 24.131  77.290  77.098  1.00 20.23  ? 741 LEU D O   1 
ATOM   9237  C CB  . LEU D 1 241 ? 24.335  74.072  76.582  1.00 18.33  ? 741 LEU D CB  1 
ATOM   9238  C CG  . LEU D 1 241 ? 23.728  74.146  77.978  1.00 22.77  ? 741 LEU D CG  1 
ATOM   9239  C CD1 . LEU D 1 241 ? 22.272  74.544  77.875  1.00 26.30  ? 741 LEU D CD1 1 
ATOM   9240  C CD2 . LEU D 1 241 ? 23.864  72.794  78.657  1.00 27.45  ? 741 LEU D CD2 1 
ATOM   9241  N N   . ASN D 1 242 ? 26.132  76.728  76.283  1.00 19.92  ? 742 ASN D N   1 
ATOM   9242  C CA  . ASN D 1 242 ? 26.761  77.907  76.881  1.00 23.57  ? 742 ASN D CA  1 
ATOM   9243  C C   . ASN D 1 242 ? 26.167  79.212  76.354  1.00 21.73  ? 742 ASN D C   1 
ATOM   9244  O O   . ASN D 1 242 ? 25.835  80.114  77.121  1.00 18.34  ? 742 ASN D O   1 
ATOM   9245  C CB  . ASN D 1 242 ? 28.268  77.910  76.636  1.00 23.16  ? 742 ASN D CB  1 
ATOM   9246  C CG  . ASN D 1 242 ? 28.993  76.899  77.491  1.00 27.37  ? 742 ASN D CG  1 
ATOM   9247  O OD1 . ASN D 1 242 ? 28.413  76.310  78.394  1.00 33.21  ? 742 ASN D OD1 1 
ATOM   9248  N ND2 . ASN D 1 242 ? 30.271  76.704  77.219  1.00 24.92  ? 742 ASN D ND2 1 
ATOM   9249  N N   . HIS D 1 243 ? 26.069  79.302  75.031  1.00 17.76  ? 743 HIS D N   1 
ATOM   9250  C CA  . HIS D 1 243 ? 25.556  80.482  74.361  1.00 17.68  ? 743 HIS D CA  1 
ATOM   9251  C C   . HIS D 1 243 ? 24.070  80.707  74.676  1.00 24.81  ? 743 HIS D C   1 
ATOM   9252  O O   . HIS D 1 243 ? 23.671  81.821  75.009  1.00 20.06  ? 743 HIS D O   1 
ATOM   9253  C CB  . HIS D 1 243 ? 25.808  80.392  72.853  1.00 6.46   ? 743 HIS D CB  1 
ATOM   9254  C CG  . HIS D 1 243 ? 27.237  80.636  72.460  1.00 28.51  ? 743 HIS D CG  1 
ATOM   9255  N ND1 . HIS D 1 243 ? 27.803  81.896  72.439  1.00 26.19  ? 743 HIS D ND1 1 
ATOM   9256  C CD2 . HIS D 1 243 ? 28.211  79.781  72.063  1.00 21.61  ? 743 HIS D CD2 1 
ATOM   9257  C CE1 . HIS D 1 243 ? 29.063  81.804  72.049  1.00 29.75  ? 743 HIS D CE1 1 
ATOM   9258  N NE2 . HIS D 1 243 ? 29.337  80.532  71.820  1.00 28.82  ? 743 HIS D NE2 1 
ATOM   9259  N N   . LEU D 1 244 ? 23.263  79.650  74.602  1.00 21.94  ? 744 LEU D N   1 
ATOM   9260  C CA  . LEU D 1 244 ? 21.839  79.792  74.877  1.00 19.27  ? 744 LEU D CA  1 
ATOM   9261  C C   . LEU D 1 244 ? 21.541  80.100  76.334  1.00 17.02  ? 744 LEU D C   1 
ATOM   9262  O O   . LEU D 1 244 ? 20.686  80.921  76.597  1.00 24.41  ? 744 LEU D O   1 
ATOM   9263  C CB  . LEU D 1 244 ? 21.051  78.579  74.418  1.00 23.93  ? 744 LEU D CB  1 
ATOM   9264  C CG  . LEU D 1 244 ? 20.957  78.506  72.904  1.00 26.04  ? 744 LEU D CG  1 
ATOM   9265  C CD1 . LEU D 1 244 ? 20.474  77.135  72.544  1.00 40.91  ? 744 LEU D CD1 1 
ATOM   9266  C CD2 . LEU D 1 244 ? 19.998  79.558  72.415  1.00 27.66  ? 744 LEU D CD2 1 
ATOM   9267  N N   . ALA D 1 245 ? 22.241  79.478  77.283  1.00 13.19  ? 745 ALA D N   1 
ATOM   9268  C CA  . ALA D 1 245 ? 22.083  79.882  78.691  1.00 16.29  ? 745 ALA D CA  1 
ATOM   9269  C C   . ALA D 1 245 ? 22.528  81.315  78.908  1.00 26.13  ? 745 ALA D C   1 
ATOM   9270  O O   . ALA D 1 245 ? 21.928  82.038  79.699  1.00 31.07  ? 745 ALA D O   1 
ATOM   9271  C CB  . ALA D 1 245 ? 22.860  78.982  79.639  1.00 10.58  ? 745 ALA D CB  1 
ATOM   9272  N N   . THR D 1 246 ? 23.614  81.706  78.246  1.00 25.08  ? 746 THR D N   1 
ATOM   9273  C CA  . THR D 1 246 ? 24.089  83.081  78.336  1.00 25.72  ? 746 THR D CA  1 
ATOM   9274  C C   . THR D 1 246 ? 23.031  84.027  77.756  1.00 23.12  ? 746 THR D C   1 
ATOM   9275  O O   . THR D 1 246 ? 22.749  85.071  78.341  1.00 17.61  ? 746 THR D O   1 
ATOM   9276  C CB  . THR D 1 246 ? 25.468  83.264  77.642  1.00 26.84  ? 746 THR D CB  1 
ATOM   9277  O OG1 . THR D 1 246 ? 26.443  82.470  78.323  1.00 26.96  ? 746 THR D OG1 1 
ATOM   9278  C CG2 . THR D 1 246 ? 25.919  84.725  77.665  1.00 14.72  ? 746 THR D CG2 1 
ATOM   9279  N N   . ALA D 1 247 ? 22.434  83.646  76.625  1.00 19.60  ? 747 ALA D N   1 
ATOM   9280  C CA  . ALA D 1 247 ? 21.343  84.419  76.040  1.00 19.53  ? 747 ALA D CA  1 
ATOM   9281  C C   . ALA D 1 247 ? 20.183  84.579  77.017  1.00 22.63  ? 747 ALA D C   1 
ATOM   9282  O O   . ALA D 1 247 ? 19.621  85.665  77.138  1.00 18.15  ? 747 ALA D O   1 
ATOM   9283  C CB  . ALA D 1 247 ? 20.855  83.791  74.744  1.00 18.50  ? 747 ALA D CB  1 
ATOM   9284  N N   . ARG D 1 248 ? 19.810  83.511  77.714  1.00 21.63  ? 748 ARG D N   1 
ATOM   9285  C CA  . ARG D 1 248 ? 18.738  83.652  78.692  1.00 23.98  ? 748 ARG D CA  1 
ATOM   9286  C C   . ARG D 1 248 ? 19.105  84.750  79.689  1.00 31.06  ? 748 ARG D C   1 
ATOM   9287  O O   . ARG D 1 248 ? 18.314  85.665  79.939  1.00 26.46  ? 748 ARG D O   1 
ATOM   9288  C CB  . ARG D 1 248 ? 18.416  82.357  79.441  1.00 25.44  ? 748 ARG D CB  1 
ATOM   9289  C CG  . ARG D 1 248 ? 17.393  82.600  80.564  1.00 40.56  ? 748 ARG D CG  1 
ATOM   9290  C CD  . ARG D 1 248 ? 16.949  81.353  81.306  1.00 55.41  ? 748 ARG D CD  1 
ATOM   9291  N NE  . ARG D 1 248 ? 18.055  80.663  81.964  1.00 72.78  ? 748 ARG D NE  1 
ATOM   9292  C CZ  . ARG D 1 248 ? 17.913  79.546  82.677  1.00 78.09  ? 748 ARG D CZ  1 
ATOM   9293  N NH1 . ARG D 1 248 ? 16.707  79.010  82.827  1.00 77.74  ? 748 ARG D NH1 1 
ATOM   9294  N NH2 . ARG D 1 248 ? 18.971  78.966  83.241  1.00 73.24  ? 748 ARG D NH2 1 
ATOM   9295  N N   . PHE D 1 249 ? 20.308  84.657  80.254  1.00 28.37  ? 749 PHE D N   1 
ATOM   9296  C CA  . PHE D 1 249 ? 20.797  85.659  81.207  1.00 32.64  ? 749 PHE D CA  1 
ATOM   9297  C C   . PHE D 1 249 ? 20.830  87.080  80.608  1.00 25.00  ? 749 PHE D C   1 
ATOM   9298  O O   . PHE D 1 249 ? 20.348  88.041  81.216  1.00 22.32  ? 749 PHE D O   1 
ATOM   9299  C CB  . PHE D 1 249 ? 22.179  85.261  81.707  1.00 30.15  ? 749 PHE D CB  1 
ATOM   9300  C CG  . PHE D 1 249 ? 22.799  86.259  82.630  1.00 32.81  ? 749 PHE D CG  1 
ATOM   9301  C CD1 . PHE D 1 249 ? 22.251  86.500  83.875  1.00 36.27  ? 749 PHE D CD1 1 
ATOM   9302  C CD2 . PHE D 1 249 ? 23.945  86.939  82.263  1.00 34.33  ? 749 PHE D CD2 1 
ATOM   9303  C CE1 . PHE D 1 249 ? 22.834  87.420  84.740  1.00 46.59  ? 749 PHE D CE1 1 
ATOM   9304  C CE2 . PHE D 1 249 ? 24.531  87.856  83.124  1.00 40.34  ? 749 PHE D CE2 1 
ATOM   9305  C CZ  . PHE D 1 249 ? 23.977  88.095  84.362  1.00 36.71  ? 749 PHE D CZ  1 
ATOM   9306  N N   . MET D 1 250 ? 21.390  87.194  79.409  1.00 16.76  ? 750 MET D N   1 
ATOM   9307  C CA  . MET D 1 250 ? 21.477  88.471  78.699  1.00 26.35  ? 750 MET D CA  1 
ATOM   9308  C C   . MET D 1 250 ? 20.117  89.178  78.564  1.00 29.17  ? 750 MET D C   1 
ATOM   9309  O O   . MET D 1 250 ? 20.021  90.378  78.784  1.00 35.02  ? 750 MET D O   1 
ATOM   9310  C CB  . MET D 1 250 ? 22.151  88.285  77.331  1.00 19.55  ? 750 MET D CB  1 
ATOM   9311  C CG  . MET D 1 250 ? 21.897  89.423  76.367  1.00 18.48  ? 750 MET D CG  1 
ATOM   9312  S SD  . MET D 1 250 ? 22.434  89.051  74.703  1.00 23.96  ? 750 MET D SD  1 
ATOM   9313  C CE  . MET D 1 250 ? 21.012  88.202  74.042  1.00 13.96  ? 750 MET D CE  1 
ATOM   9314  N N   . ALA D 1 251 ? 19.076  88.429  78.221  1.00 24.84  ? 751 ALA D N   1 
ATOM   9315  C CA  . ALA D 1 251 ? 17.723  88.970  78.139  1.00 21.84  ? 751 ALA D CA  1 
ATOM   9316  C C   . ALA D 1 251 ? 17.230  89.518  79.475  1.00 26.39  ? 751 ALA D C   1 
ATOM   9317  O O   . ALA D 1 251 ? 16.755  90.656  79.544  1.00 36.35  ? 751 ALA D O   1 
ATOM   9318  C CB  . ALA D 1 251 ? 16.740  87.911  77.615  1.00 13.22  ? 751 ALA D CB  1 
ATOM   9319  N N   . GLU D 1 252 ? 17.328  88.707  80.525  1.00 20.40  ? 752 GLU D N   1 
ATOM   9320  C CA  . GLU D 1 252 ? 16.875  89.099  81.863  1.00 27.12  ? 752 GLU D CA  1 
ATOM   9321  C C   . GLU D 1 252 ? 17.687  90.245  82.463  1.00 33.19  ? 752 GLU D C   1 
ATOM   9322  O O   . GLU D 1 252 ? 17.183  91.006  83.297  1.00 32.98  ? 752 GLU D O   1 
ATOM   9323  C CB  . GLU D 1 252 ? 16.877  87.906  82.832  1.00 32.41  ? 752 GLU D CB  1 
ATOM   9324  C CG  . GLU D 1 252 ? 15.721  86.926  82.634  1.00 47.95  ? 752 GLU D CG  1 
ATOM   9325  C CD  . GLU D 1 252 ? 15.645  85.848  83.719  1.00 64.02  ? 752 GLU D CD  1 
ATOM   9326  O OE1 . GLU D 1 252 ? 15.390  84.668  83.380  1.00 59.42  ? 752 GLU D OE1 1 
ATOM   9327  O OE2 . GLU D 1 252 ? 15.826  86.178  84.913  1.00 76.86  ? 752 GLU D OE2 1 
ATOM   9328  N N   . ALA D 1 253 ? 18.944  90.369  82.050  1.00 28.53  ? 753 ALA D N   1 
ATOM   9329  C CA  . ALA D 1 253 ? 19.795  91.444  82.555  1.00 22.76  ? 753 ALA D CA  1 
ATOM   9330  C C   . ALA D 1 253 ? 20.101  92.492  81.494  1.00 24.18  ? 753 ALA D C   1 
ATOM   9331  O O   . ALA D 1 253 ? 21.106  93.174  81.592  1.00 18.92  ? 753 ALA D O   1 
ATOM   9332  C CB  . ALA D 1 253 ? 21.097  90.877  83.105  1.00 20.95  ? 753 ALA D CB  1 
ATOM   9333  N N   . ALA D 1 254 ? 19.239  92.615  80.487  1.00 21.75  ? 754 ALA D N   1 
ATOM   9334  C CA  . ALA D 1 254 ? 19.490  93.511  79.357  1.00 25.23  ? 754 ALA D CA  1 
ATOM   9335  C C   . ALA D 1 254 ? 19.868  94.945  79.764  1.00 27.05  ? 754 ALA D C   1 
ATOM   9336  O O   . ALA D 1 254 ? 20.575  95.642  79.037  1.00 19.31  ? 754 ALA D O   1 
ATOM   9337  C CB  . ALA D 1 254 ? 18.279  93.538  78.425  1.00 18.38  ? 754 ALA D CB  1 
ATOM   9338  N N   . ASP D 1 255 ? 19.390  95.398  80.914  1.00 17.21  ? 755 ASP D N   1 
ATOM   9339  C CA  . ASP D 1 255 ? 19.570  96.792  81.249  1.00 22.00  ? 755 ASP D CA  1 
ATOM   9340  C C   . ASP D 1 255 ? 20.962  97.079  81.804  1.00 28.06  ? 755 ASP D C   1 
ATOM   9341  O O   . ASP D 1 255 ? 21.466  98.196  81.699  1.00 24.43  ? 755 ASP D O   1 
ATOM   9342  C CB  . ASP D 1 255 ? 18.467  97.282  82.186  1.00 35.62  ? 755 ASP D CB  1 
ATOM   9343  C CG  . ASP D 1 255 ? 18.287  98.787  82.124  1.00 56.79  ? 755 ASP D CG  1 
ATOM   9344  O OD1 . ASP D 1 255 ? 17.815  99.303  81.075  1.00 53.89  ? 755 ASP D OD1 1 
ATOM   9345  O OD2 . ASP D 1 255 ? 18.630  99.452  83.127  1.00 66.48  ? 755 ASP D OD2 1 
ATOM   9346  N N   . SER D 1 256 ? 21.598  96.064  82.369  1.00 29.98  ? 756 SER D N   1 
ATOM   9347  C CA  . SER D 1 256 ? 22.959  96.231  82.850  1.00 34.03  ? 756 SER D CA  1 
ATOM   9348  C C   . SER D 1 256 ? 23.951  96.593  81.717  1.00 33.75  ? 756 SER D C   1 
ATOM   9349  O O   . SER D 1 256 ? 24.913  97.342  81.940  1.00 25.55  ? 756 SER D O   1 
ATOM   9350  C CB  . SER D 1 256 ? 23.413  94.993  83.628  1.00 30.08  ? 756 SER D CB  1 
ATOM   9351  O OG  . SER D 1 256 ? 23.493  93.880  82.779  1.00 31.46  ? 756 SER D OG  1 
ATOM   9352  N N   . TYR D 1 257 ? 23.721  96.083  80.506  1.00 27.20  ? 757 TYR D N   1 
ATOM   9353  C CA  . TYR D 1 257 ? 24.585  96.461  79.376  1.00 25.35  ? 757 TYR D CA  1 
ATOM   9354  C C   . TYR D 1 257 ? 24.400  97.932  79.003  1.00 23.40  ? 757 TYR D C   1 
ATOM   9355  O O   . TYR D 1 257 ? 25.347  98.604  78.578  1.00 28.50  ? 757 TYR D O   1 
ATOM   9356  C CB  . TYR D 1 257 ? 24.354  95.579  78.142  1.00 19.08  ? 757 TYR D CB  1 
ATOM   9357  C CG  . TYR D 1 257 ? 24.508  94.104  78.384  1.00 22.14  ? 757 TYR D CG  1 
ATOM   9358  C CD1 . TYR D 1 257 ? 25.751  93.474  78.267  1.00 19.29  ? 757 TYR D CD1 1 
ATOM   9359  C CD2 . TYR D 1 257 ? 23.405  93.330  78.733  1.00 25.07  ? 757 TYR D CD2 1 
ATOM   9360  C CE1 . TYR D 1 257 ? 25.881  92.097  78.496  1.00 15.74  ? 757 TYR D CE1 1 
ATOM   9361  C CE2 . TYR D 1 257 ? 23.523  91.977  78.959  1.00 18.40  ? 757 TYR D CE2 1 
ATOM   9362  C CZ  . TYR D 1 257 ? 24.757  91.359  78.840  1.00 22.48  ? 757 TYR D CZ  1 
ATOM   9363  O OH  . TYR D 1 257 ? 24.836  90.000  79.072  1.00 30.64  ? 757 TYR D OH  1 
ATOM   9364  N N   . ARG D 1 258 ? 23.171  98.415  79.158  1.00 17.22  ? 758 ARG D N   1 
ATOM   9365  C CA  . ARG D 1 258 ? 22.826  99.816  78.938  1.00 17.12  ? 758 ARG D CA  1 
ATOM   9366  C C   . ARG D 1 258 ? 23.499  100.710 80.021  1.00 28.78  ? 758 ARG D C   1 
ATOM   9367  O O   . ARG D 1 258 ? 24.072  101.755 79.719  1.00 27.83  ? 758 ARG D O   1 
ATOM   9368  C CB  . ARG D 1 258 ? 21.296  99.953  78.953  1.00 25.69  ? 758 ARG D CB  1 
ATOM   9369  C CG  . ARG D 1 258 ? 20.729  101.230 78.327  1.00 35.61  ? 758 ARG D CG  1 
ATOM   9370  C CD  . ARG D 1 258 ? 20.501  102.301 79.361  1.00 33.75  ? 758 ARG D CD  1 
ATOM   9371  N NE  . ARG D 1 258 ? 19.478  101.918 80.330  1.00 43.04  ? 758 ARG D NE  1 
ATOM   9372  C CZ  . ARG D 1 258 ? 19.274  102.548 81.488  1.00 52.41  ? 758 ARG D CZ  1 
ATOM   9373  N NH1 . ARG D 1 258 ? 20.019  103.596 81.826  1.00 45.00  ? 758 ARG D NH1 1 
ATOM   9374  N NH2 . ARG D 1 258 ? 18.324  102.129 82.319  1.00 57.44  ? 758 ARG D NH2 1 
ATOM   9375  N N   . MET D 1 259 ? 23.430  100.269 81.276  1.00 27.48  ? 759 MET D N   1 
ATOM   9376  C CA  . MET D 1 259 ? 24.124  100.898 82.399  1.00 30.40  ? 759 MET D CA  1 
ATOM   9377  C C   . MET D 1 259 ? 25.597  101.079 82.064  1.00 32.32  ? 759 MET D C   1 
ATOM   9378  O O   . MET D 1 259 ? 26.145  102.164 82.176  1.00 28.43  ? 759 MET D O   1 
ATOM   9379  C CB  . MET D 1 259 ? 24.041  99.974  83.618  1.00 37.29  ? 759 MET D CB  1 
ATOM   9380  C CG  . MET D 1 259 ? 23.486  100.584 84.869  1.00 47.03  ? 759 MET D CG  1 
ATOM   9381  S SD  . MET D 1 259 ? 21.824  101.193 84.645  1.00 36.25  ? 759 MET D SD  1 
ATOM   9382  C CE  . MET D 1 259 ? 21.012  100.569 86.104  1.00 34.74  ? 759 MET D CE  1 
ATOM   9383  N N   . ASN D 1 260 ? 26.227  99.983  81.655  1.00 29.03  ? 760 ASN D N   1 
ATOM   9384  C CA  . ASN D 1 260 ? 27.653  99.961  81.388  1.00 34.33  ? 760 ASN D CA  1 
ATOM   9385  C C   . ASN D 1 260 ? 28.042  100.922 80.279  1.00 25.01  ? 760 ASN D C   1 
ATOM   9386  O O   . ASN D 1 260 ? 28.945  101.742 80.448  1.00 25.64  ? 760 ASN D O   1 
ATOM   9387  C CB  . ASN D 1 260 ? 28.099  98.539  81.030  1.00 28.03  ? 760 ASN D CB  1 
ATOM   9388  C CG  . ASN D 1 260 ? 29.502  98.250  81.473  1.00 23.94  ? 760 ASN D CG  1 
ATOM   9389  O OD1 . ASN D 1 260 ? 29.788  98.257  82.671  1.00 30.48  ? 760 ASN D OD1 1 
ATOM   9390  N ND2 . ASN D 1 260 ? 30.396  97.996  80.517  1.00 19.18  ? 760 ASN D ND2 1 
ATOM   9391  N N   . ALA D 1 261 ? 27.341  100.818 79.155  1.00 16.60  ? 761 ALA D N   1 
ATOM   9392  C CA  . ALA D 1 261 ? 27.629  101.648 77.998  1.00 20.14  ? 761 ALA D CA  1 
ATOM   9393  C C   . ALA D 1 261 ? 27.464  103.129 78.336  1.00 31.23  ? 761 ALA D C   1 
ATOM   9394  O O   . ALA D 1 261 ? 28.275  103.960 77.925  1.00 31.56  ? 761 ALA D O   1 
ATOM   9395  C CB  . ALA D 1 261 ? 26.722  101.265 76.833  1.00 17.76  ? 761 ALA D CB  1 
ATOM   9396  N N   . GLU D 1 262 ? 26.404  103.456 79.073  1.00 33.70  ? 762 GLU D N   1 
ATOM   9397  C CA  . GLU D 1 262 ? 26.171  104.834 79.494  1.00 30.33  ? 762 GLU D CA  1 
ATOM   9398  C C   . GLU D 1 262 ? 27.294  105.329 80.395  1.00 28.75  ? 762 GLU D C   1 
ATOM   9399  O O   . GLU D 1 262 ? 27.669  106.483 80.328  1.00 20.39  ? 762 GLU D O   1 
ATOM   9400  C CB  . GLU D 1 262 ? 24.832  104.978 80.217  1.00 28.95  ? 762 GLU D CB  1 
ATOM   9401  C CG  . GLU D 1 262 ? 23.638  105.142 79.287  1.00 37.16  ? 762 GLU D CG  1 
ATOM   9402  C CD  . GLU D 1 262 ? 22.311  105.283 80.035  1.00 45.87  ? 762 GLU D CD  1 
ATOM   9403  O OE1 . GLU D 1 262 ? 22.335  105.382 81.289  1.00 42.39  ? 762 GLU D OE1 1 
ATOM   9404  O OE2 . GLU D 1 262 ? 21.245  105.295 79.365  1.00 43.11  ? 762 GLU D OE2 1 
ATOM   9405  N N   . ARG D 1 263 ? 27.834  104.462 81.242  1.00 29.77  ? 763 ARG D N   1 
ATOM   9406  C CA  . ARG D 1 263 ? 28.929  104.885 82.100  1.00 29.47  ? 763 ARG D CA  1 
ATOM   9407  C C   . ARG D 1 263 ? 30.190  105.190 81.269  1.00 25.34  ? 763 ARG D C   1 
ATOM   9408  O O   . ARG D 1 263 ? 30.885  106.180 81.489  1.00 26.50  ? 763 ARG D O   1 
ATOM   9409  C CB  . ARG D 1 263 ? 29.215  103.837 83.171  1.00 15.06  ? 763 ARG D CB  1 
ATOM   9410  C CG  . ARG D 1 263 ? 30.419  104.167 84.039  1.00 17.70  ? 763 ARG D CG  1 
ATOM   9411  C CD  . ARG D 1 263 ? 30.705  103.062 85.058  1.00 27.62  ? 763 ARG D CD  1 
ATOM   9412  N NE  . ARG D 1 263 ? 30.894  101.768 84.404  1.00 31.73  ? 763 ARG D NE  1 
ATOM   9413  C CZ  . ARG D 1 263 ? 32.048  101.329 83.912  1.00 29.16  ? 763 ARG D CZ  1 
ATOM   9414  N NH1 . ARG D 1 263 ? 33.146  102.071 84.007  1.00 31.35  ? 763 ARG D NH1 1 
ATOM   9415  N NH2 . ARG D 1 263 ? 32.106  100.137 83.333  1.00 30.68  ? 763 ARG D NH2 1 
ATOM   9416  N N   . ILE D 1 264 ? 30.447  104.346 80.283  1.00 29.24  ? 764 ILE D N   1 
ATOM   9417  C CA  . ILE D 1 264 ? 31.653  104.449 79.481  1.00 24.04  ? 764 ILE D CA  1 
ATOM   9418  C C   . ILE D 1 264 ? 31.601  105.631 78.515  1.00 28.81  ? 764 ILE D C   1 
ATOM   9419  O O   . ILE D 1 264 ? 32.615  106.265 78.245  1.00 26.44  ? 764 ILE D O   1 
ATOM   9420  C CB  . ILE D 1 264 ? 31.930  103.103 78.760  1.00 39.80  ? 764 ILE D CB  1 
ATOM   9421  C CG1 . ILE D 1 264 ? 32.443  102.075 79.777  1.00 29.37  ? 764 ILE D CG1 1 
ATOM   9422  C CG2 . ILE D 1 264 ? 32.917  103.276 77.609  1.00 34.32  ? 764 ILE D CG2 1 
ATOM   9423  C CD1 . ILE D 1 264 ? 32.240  100.654 79.363  1.00 27.53  ? 764 ILE D CD1 1 
ATOM   9424  N N   . LEU D 1 265 ? 30.411  105.948 78.024  1.00 34.16  ? 765 LEU D N   1 
ATOM   9425  C CA  . LEU D 1 265 ? 30.261  107.017 77.040  1.00 32.29  ? 765 LEU D CA  1 
ATOM   9426  C C   . LEU D 1 265 ? 29.834  108.341 77.673  1.00 29.41  ? 765 LEU D C   1 
ATOM   9427  O O   . LEU D 1 265 ? 29.405  109.268 76.986  1.00 22.38  ? 765 LEU D O   1 
ATOM   9428  C CB  . LEU D 1 265 ? 29.284  106.591 75.932  1.00 19.33  ? 765 LEU D CB  1 
ATOM   9429  C CG  . LEU D 1 265 ? 29.834  105.428 75.096  1.00 30.19  ? 765 LEU D CG  1 
ATOM   9430  C CD1 . LEU D 1 265 ? 28.820  104.900 74.095  1.00 34.58  ? 765 LEU D CD1 1 
ATOM   9431  C CD2 . LEU D 1 265 ? 31.133  105.825 74.397  1.00 19.69  ? 765 LEU D CD2 1 
ATOM   9432  N N   . ALA D 1 266 ? 29.959  108.427 78.987  1.00 25.49  ? 766 ALA D N   1 
ATOM   9433  C CA  . ALA D 1 266 ? 29.463  109.588 79.722  1.00 27.44  ? 766 ALA D CA  1 
ATOM   9434  C C   . ALA D 1 266 ? 29.793  110.971 79.091  1.00 53.78  ? 766 ALA D C   1 
ATOM   9435  O O   . ALA D 1 266 ? 28.884  111.751 78.777  1.00 63.48  ? 766 ALA D O   1 
ATOM   9436  C CB  . ALA D 1 266 ? 29.925  109.514 81.176  1.00 26.10  ? 766 ALA D CB  1 
ATOM   9437  N N   . GLY D 1 267 ? 31.071  111.280 78.895  1.00 39.23  ? 767 GLY D N   1 
ATOM   9438  C CA  . GLY D 1 267 ? 31.433  112.573 78.332  1.00 46.27  ? 767 GLY D CA  1 
ATOM   9439  C C   . GLY D 1 267 ? 31.582  112.633 76.815  1.00 48.67  ? 767 GLY D C   1 
ATOM   9440  O O   . GLY D 1 267 ? 31.828  113.700 76.247  1.00 52.64  ? 767 GLY D O   1 
ATOM   9441  N N   . PHE D 1 268 ? 31.412  111.487 76.162  1.00 46.06  ? 768 PHE D N   1 
ATOM   9442  C CA  . PHE D 1 268 ? 31.669  111.324 74.732  1.00 40.92  ? 768 PHE D CA  1 
ATOM   9443  C C   . PHE D 1 268 ? 30.902  112.305 73.846  1.00 36.47  ? 768 PHE D C   1 
ATOM   9444  O O   . PHE D 1 268 ? 29.698  112.459 73.969  1.00 32.50  ? 768 PHE D O   1 
ATOM   9445  C CB  . PHE D 1 268 ? 31.391  109.868 74.305  1.00 39.68  ? 768 PHE D CB  1 
ATOM   9446  C CG  . PHE D 1 268 ? 31.556  109.610 72.824  1.00 38.94  ? 768 PHE D CG  1 
ATOM   9447  C CD1 . PHE D 1 268 ? 32.800  109.761 72.206  1.00 34.73  ? 768 PHE D CD1 1 
ATOM   9448  C CD2 . PHE D 1 268 ? 30.470  109.192 72.054  1.00 31.36  ? 768 PHE D CD2 1 
ATOM   9449  C CE1 . PHE D 1 268 ? 32.957  109.519 70.845  1.00 32.92  ? 768 PHE D CE1 1 
ATOM   9450  C CE2 . PHE D 1 268 ? 30.617  108.939 70.691  1.00 32.58  ? 768 PHE D CE2 1 
ATOM   9451  C CZ  . PHE D 1 268 ? 31.861  109.106 70.085  1.00 35.74  ? 768 PHE D CZ  1 
ATOM   9452  N N   . GLN D 1 269 ? 31.630  112.961 72.951  1.00 38.28  ? 769 GLN D N   1 
ATOM   9453  C CA  . GLN D 1 269 ? 31.045  113.840 71.952  1.00 39.38  ? 769 GLN D CA  1 
ATOM   9454  C C   . GLN D 1 269 ? 31.440  113.313 70.571  1.00 40.09  ? 769 GLN D C   1 
ATOM   9455  O O   . GLN D 1 269 ? 32.613  113.362 70.196  1.00 38.45  ? 769 GLN D O   1 
ATOM   9456  C CB  . GLN D 1 269 ? 31.548  115.279 72.144  1.00 35.84  ? 769 GLN D CB  1 
ATOM   9457  C CG  . GLN D 1 269 ? 31.325  115.834 73.534  1.00 34.81  ? 769 GLN D CG  1 
ATOM   9458  C CD  . GLN D 1 269 ? 29.867  116.114 73.825  1.00 44.06  ? 769 GLN D CD  1 
ATOM   9459  O OE1 . GLN D 1 269 ? 29.067  116.298 72.911  1.00 44.51  ? 769 GLN D OE1 1 
ATOM   9460  N NE2 . GLN D 1 269 ? 29.513  116.152 75.109  1.00 52.73  ? 769 GLN D NE2 1 
ATOM   9461  N N   . PRO D 1 270 ? 30.466  112.787 69.814  1.00 39.94  ? 770 PRO D N   1 
ATOM   9462  C CA  . PRO D 1 270 ? 30.793  112.151 68.532  1.00 36.27  ? 770 PRO D CA  1 
ATOM   9463  C C   . PRO D 1 270 ? 31.257  113.141 67.486  1.00 34.35  ? 770 PRO D C   1 
ATOM   9464  O O   . PRO D 1 270 ? 30.735  114.248 67.391  1.00 36.00  ? 770 PRO D O   1 
ATOM   9465  C CB  . PRO D 1 270 ? 29.470  111.517 68.098  1.00 30.01  ? 770 PRO D CB  1 
ATOM   9466  C CG  . PRO D 1 270 ? 28.427  112.265 68.827  1.00 35.36  ? 770 PRO D CG  1 
ATOM   9467  C CD  . PRO D 1 270 ? 29.029  112.712 70.125  1.00 39.81  ? 770 PRO D CD  1 
ATOM   9468  N N   . ASP D 1 271 ? 32.260  112.739 66.720  1.00 37.07  ? 771 ASP D N   1 
ATOM   9469  C CA  . ASP D 1 271 ? 32.680  113.504 65.559  1.00 35.26  ? 771 ASP D CA  1 
ATOM   9470  C C   . ASP D 1 271 ? 31.804  113.102 64.380  1.00 34.22  ? 771 ASP D C   1 
ATOM   9471  O O   . ASP D 1 271 ? 31.690  111.918 64.074  1.00 33.58  ? 771 ASP D O   1 
ATOM   9472  C CB  . ASP D 1 271 ? 34.147  113.226 65.231  1.00 26.23  ? 771 ASP D CB  1 
ATOM   9473  C CG  . ASP D 1 271 ? 34.559  113.829 63.902  1.00 41.94  ? 771 ASP D CG  1 
ATOM   9474  O OD1 . ASP D 1 271 ? 34.690  115.073 63.838  1.00 44.70  ? 771 ASP D OD1 1 
ATOM   9475  O OD2 . ASP D 1 271 ? 34.731  113.070 62.920  1.00 45.20  ? 771 ASP D OD2 1 
ATOM   9476  N N   . GLU D 1 272 ? 31.190  114.074 63.716  1.00 27.47  ? 772 GLU D N   1 
ATOM   9477  C CA  . GLU D 1 272 ? 30.252  113.760 62.634  1.00 37.37  ? 772 GLU D CA  1 
ATOM   9478  C C   . GLU D 1 272 ? 30.768  112.706 61.643  1.00 33.50  ? 772 GLU D C   1 
ATOM   9479  O O   . GLU D 1 272 ? 30.107  111.697 61.399  1.00 43.86  ? 772 GLU D O   1 
ATOM   9480  C CB  . GLU D 1 272 ? 29.818  115.023 61.885  1.00 37.88  ? 772 GLU D CB  1 
ATOM   9481  C CG  . GLU D 1 272 ? 28.727  114.780 60.847  1.00 53.11  ? 772 GLU D CG  1 
ATOM   9482  C CD  . GLU D 1 272 ? 28.067  116.075 60.375  1.00 63.85  ? 772 GLU D CD  1 
ATOM   9483  O OE1 . GLU D 1 272 ? 26.996  115.997 59.730  1.00 61.76  ? 772 GLU D OE1 1 
ATOM   9484  O OE2 . GLU D 1 272 ? 28.616  117.167 60.655  1.00 63.16  ? 772 GLU D OE2 1 
ATOM   9485  N N   . GLU D 1 273 ? 31.946  112.944 61.082  1.00 31.92  ? 773 GLU D N   1 
ATOM   9486  C CA  . GLU D 1 273 ? 32.495  112.087 60.029  1.00 35.19  ? 773 GLU D CA  1 
ATOM   9487  C C   . GLU D 1 273 ? 32.787  110.661 60.520  1.00 26.11  ? 773 GLU D C   1 
ATOM   9488  O O   . GLU D 1 273 ? 32.485  109.678 59.846  1.00 23.45  ? 773 GLU D O   1 
ATOM   9489  C CB  . GLU D 1 273 ? 33.771  112.714 59.458  1.00 37.19  ? 773 GLU D CB  1 
ATOM   9490  C CG  . GLU D 1 273 ? 34.175  112.185 58.093  1.00 49.76  ? 773 GLU D CG  1 
ATOM   9491  C CD  . GLU D 1 273 ? 35.514  112.727 57.632  1.00 60.90  ? 773 GLU D CD  1 
ATOM   9492  O OE1 . GLU D 1 273 ? 35.992  113.710 58.233  1.00 68.82  ? 773 GLU D OE1 1 
ATOM   9493  O OE2 . GLU D 1 273 ? 36.097  112.169 56.679  1.00 63.31  ? 773 GLU D OE2 1 
ATOM   9494  N N   . MET D 1 274 ? 33.395  110.561 61.692  1.00 25.88  ? 774 MET D N   1 
ATOM   9495  C CA  . MET D 1 274 ? 33.716  109.274 62.271  1.00 28.08  ? 774 MET D CA  1 
ATOM   9496  C C   . MET D 1 274 ? 32.426  108.497 62.502  1.00 32.90  ? 774 MET D C   1 
ATOM   9497  O O   . MET D 1 274 ? 32.371  107.282 62.334  1.00 30.33  ? 774 MET D O   1 
ATOM   9498  C CB  . MET D 1 274 ? 34.449  109.461 63.596  1.00 34.46  ? 774 MET D CB  1 
ATOM   9499  C CG  . MET D 1 274 ? 34.947  108.157 64.183  1.00 44.83  ? 774 MET D CG  1 
ATOM   9500  S SD  . MET D 1 274 ? 36.173  107.401 63.099  1.00 43.66  ? 774 MET D SD  1 
ATOM   9501  C CE  . MET D 1 274 ? 37.572  108.449 63.491  1.00 33.09  ? 774 MET D CE  1 
ATOM   9502  N N   . ASN D 1 275 ? 31.388  109.228 62.884  1.00 26.42  ? 775 ASN D N   1 
ATOM   9503  C CA  . ASN D 1 275 ? 30.114  108.645 63.219  1.00 31.03  ? 775 ASN D CA  1 
ATOM   9504  C C   . ASN D 1 275 ? 29.374  108.163 61.967  1.00 34.29  ? 775 ASN D C   1 
ATOM   9505  O O   . ASN D 1 275 ? 28.552  107.258 62.045  1.00 31.02  ? 775 ASN D O   1 
ATOM   9506  C CB  . ASN D 1 275 ? 29.282  109.667 63.998  1.00 41.89  ? 775 ASN D CB  1 
ATOM   9507  C CG  . ASN D 1 275 ? 28.076  109.047 64.670  1.00 45.89  ? 775 ASN D CG  1 
ATOM   9508  O OD1 . ASN D 1 275 ? 26.983  109.047 64.119  1.00 47.61  ? 775 ASN D OD1 1 
ATOM   9509  N ND2 . ASN D 1 275 ? 28.272  108.521 65.872  1.00 51.06  ? 775 ASN D ND2 1 
ATOM   9510  N N   . GLU D 1 276 ? 29.674  108.763 60.818  1.00 28.07  ? 776 GLU D N   1 
ATOM   9511  C CA  . GLU D 1 276 ? 29.073  108.340 59.559  1.00 22.32  ? 776 GLU D CA  1 
ATOM   9512  C C   . GLU D 1 276 ? 29.688  107.061 59.059  1.00 32.21  ? 776 GLU D C   1 
ATOM   9513  O O   . GLU D 1 276 ? 28.980  106.178 58.577  1.00 41.85  ? 776 GLU D O   1 
ATOM   9514  C CB  . GLU D 1 276 ? 29.236  109.405 58.481  1.00 30.01  ? 776 GLU D CB  1 
ATOM   9515  C CG  . GLU D 1 276 ? 28.273  110.572 58.638  1.00 48.89  ? 776 GLU D CG  1 
ATOM   9516  C CD  . GLU D 1 276 ? 26.819  110.165 58.424  1.00 51.14  ? 776 GLU D CD  1 
ATOM   9517  O OE1 . GLU D 1 276 ? 26.490  109.679 57.317  1.00 54.19  ? 776 GLU D OE1 1 
ATOM   9518  O OE2 . GLU D 1 276 ? 26.010  110.330 59.362  1.00 43.03  ? 776 GLU D OE2 1 
ATOM   9519  N N   . ILE D 1 277 ? 31.008  106.959 59.156  1.00 30.85  ? 777 ILE D N   1 
ATOM   9520  C CA  . ILE D 1 277 ? 31.694  105.802 58.594  1.00 33.55  ? 777 ILE D CA  1 
ATOM   9521  C C   . ILE D 1 277 ? 31.383  104.550 59.410  1.00 29.52  ? 777 ILE D C   1 
ATOM   9522  O O   . ILE D 1 277 ? 31.447  103.439 58.900  1.00 28.65  ? 777 ILE D O   1 
ATOM   9523  C CB  . ILE D 1 277 ? 33.220  106.013 58.485  1.00 32.61  ? 777 ILE D CB  1 
ATOM   9524  C CG1 . ILE D 1 277 ? 33.791  105.120 57.388  1.00 39.55  ? 777 ILE D CG1 1 
ATOM   9525  C CG2 . ILE D 1 277 ? 33.911  105.722 59.807  1.00 25.08  ? 777 ILE D CG2 1 
ATOM   9526  C CD1 . ILE D 1 277 ? 35.259  104.846 57.551  1.00 44.61  ? 777 ILE D CD1 1 
ATOM   9527  N N   . CYS D 1 278 ? 31.049  104.755 60.679  1.00 24.73  ? 778 CYS D N   1 
ATOM   9528  C CA  . CYS D 1 278 ? 30.565  103.692 61.550  1.00 29.11  ? 778 CYS D CA  1 
ATOM   9529  C C   . CYS D 1 278 ? 29.168  103.176 61.199  1.00 34.26  ? 778 CYS D C   1 
ATOM   9530  O O   . CYS D 1 278 ? 28.728  102.180 61.769  1.00 35.47  ? 778 CYS D O   1 
ATOM   9531  C CB  . CYS D 1 278 ? 30.562  104.162 63.007  1.00 22.60  ? 778 CYS D CB  1 
ATOM   9532  S SG  . CYS D 1 278 ? 32.192  104.147 63.779  1.00 34.07  ? 778 CYS D SG  1 
ATOM   9533  N N   . LYS D 1 279 ? 28.457  103.862 60.300  1.00 29.49  ? 779 LYS D N   1 
ATOM   9534  C CA  . LYS D 1 279 ? 27.126  103.401 59.897  1.00 28.79  ? 779 LYS D CA  1 
ATOM   9535  C C   . LYS D 1 279 ? 27.253  102.310 58.850  1.00 31.24  ? 779 LYS D C   1 
ATOM   9536  O O   . LYS D 1 279 ? 28.083  102.411 57.932  1.00 29.91  ? 779 LYS D O   1 
ATOM   9537  C CB  . LYS D 1 279 ? 26.262  104.542 59.366  1.00 33.25  ? 779 LYS D CB  1 
ATOM   9538  C CG  . LYS D 1 279 ? 25.721  105.511 60.422  1.00 31.14  ? 779 LYS D CG  1 
ATOM   9539  C CD  . LYS D 1 279 ? 25.261  106.800 59.749  1.00 34.67  ? 779 LYS D CD  1 
ATOM   9540  C CE  . LYS D 1 279 ? 24.322  107.613 60.622  1.00 41.73  ? 779 LYS D CE  1 
ATOM   9541  N NZ  . LYS D 1 279 ? 23.043  107.821 59.895  1.00 47.28  ? 779 LYS D NZ  1 
ATOM   9542  N N   . THR D 1 280 ? 26.437  101.267 58.993  1.00 25.99  ? 780 THR D N   1 
ATOM   9543  C CA  . THR D 1 280 ? 26.512  100.114 58.100  1.00 24.91  ? 780 THR D CA  1 
ATOM   9544  C C   . THR D 1 280 ? 26.169  100.486 56.662  1.00 26.56  ? 780 THR D C   1 
ATOM   9545  O O   . THR D 1 280 ? 26.785  99.991  55.721  1.00 31.12  ? 780 THR D O   1 
ATOM   9546  C CB  . THR D 1 280 ? 25.587  98.979  58.569  1.00 27.14  ? 780 THR D CB  1 
ATOM   9547  O OG1 . THR D 1 280 ? 26.071  98.455  59.807  1.00 21.95  ? 780 THR D OG1 1 
ATOM   9548  C CG2 . THR D 1 280 ? 25.561  97.857  57.525  1.00 25.80  ? 780 THR D CG2 1 
ATOM   9549  N N   . GLU D 1 281 ? 25.165  101.345 56.513  1.00 22.51  ? 781 GLU D N   1 
ATOM   9550  C CA  A GLU D 1 281 ? 24.755  101.849 55.203  0.41 29.52  ? 781 GLU D CA  1 
ATOM   9551  C CA  B GLU D 1 281 ? 24.760  101.839 55.200  0.59 28.52  ? 781 GLU D CA  1 
ATOM   9552  C C   . GLU D 1 281 ? 25.928  102.554 54.528  1.00 27.67  ? 781 GLU D C   1 
ATOM   9553  O O   . GLU D 1 281 ? 26.167  102.392 53.335  1.00 27.97  ? 781 GLU D O   1 
ATOM   9554  C CB  A GLU D 1 281 ? 23.574  102.837 55.304  0.41 34.43  ? 781 GLU D CB  1 
ATOM   9555  C CB  B GLU D 1 281 ? 23.573  102.802 55.322  0.59 34.38  ? 781 GLU D CB  1 
ATOM   9556  C CG  A GLU D 1 281 ? 22.860  102.957 56.667  0.41 38.94  ? 781 GLU D CG  1 
ATOM   9557  C CG  B GLU D 1 281 ? 22.456  102.335 56.261  0.59 40.26  ? 781 GLU D CG  1 
ATOM   9558  C CD  A GLU D 1 281 ? 21.604  102.100 56.772  0.41 34.99  ? 781 GLU D CD  1 
ATOM   9559  C CD  B GLU D 1 281 ? 22.645  102.818 57.696  0.59 39.23  ? 781 GLU D CD  1 
ATOM   9560  O OE1 A GLU D 1 281 ? 21.082  101.935 57.904  0.41 15.41  ? 781 GLU D OE1 1 
ATOM   9561  O OE1 B GLU D 1 281 ? 23.499  102.249 58.408  0.59 15.30  ? 781 GLU D OE1 1 
ATOM   9562  O OE2 A GLU D 1 281 ? 21.129  101.608 55.723  0.41 37.28  ? 781 GLU D OE2 1 
ATOM   9563  O OE2 B GLU D 1 281 ? 21.940  103.772 58.105  0.59 47.96  ? 781 GLU D OE2 1 
ATOM   9564  H H   A GLU D 1 281 ? 24.698  101.657 57.164  0.41 26.91  ? 781 GLU D H   1 
ATOM   9565  H H   B GLU D 1 281 ? 24.697  101.660 57.162  0.59 26.91  ? 781 GLU D H   1 
ATOM   9566  H HA  A GLU D 1 281 ? 24.480  101.097 54.638  0.41 35.32  ? 781 GLU D HA  1 
ATOM   9567  H HA  B GLU D 1 281 ? 24.492  101.084 54.636  0.59 34.12  ? 781 GLU D HA  1 
ATOM   9568  H HB2 A GLU D 1 281 ? 23.902  103.721 55.077  0.41 41.21  ? 781 GLU D HB2 1 
ATOM   9569  H HB2 B GLU D 1 281 ? 23.898  103.653 55.655  0.59 41.14  ? 781 GLU D HB2 1 
ATOM   9570  H HB3 A GLU D 1 281 ? 22.904  102.570 54.656  0.41 41.21  ? 781 GLU D HB3 1 
ATOM   9571  H HB3 B GLU D 1 281 ? 23.183  102.925 54.442  0.59 41.14  ? 781 GLU D HB3 1 
ATOM   9572  H HG2 A GLU D 1 281 ? 23.471  102.677 57.367  0.41 46.62  ? 781 GLU D HG2 1 
ATOM   9573  H HG2 B GLU D 1 281 ? 21.608  102.680 55.939  0.59 48.20  ? 781 GLU D HG2 1 
ATOM   9574  H HG3 A GLU D 1 281 ? 22.602  103.881 56.805  0.41 46.62  ? 781 GLU D HG3 1 
ATOM   9575  H HG3 B GLU D 1 281 ? 22.437  101.366 56.271  0.59 48.20  ? 781 GLU D HG3 1 
ATOM   9576  N N   . PHE D 1 282 ? 26.663  103.343 55.300  1.00 25.16  ? 782 PHE D N   1 
ATOM   9577  C CA  . PHE D 1 282 ? 27.800  104.053 54.739  1.00 26.96  ? 782 PHE D CA  1 
ATOM   9578  C C   . PHE D 1 282 ? 28.832  103.041 54.225  1.00 23.05  ? 782 PHE D C   1 
ATOM   9579  O O   . PHE D 1 282 ? 29.230  103.086 53.061  1.00 27.69  ? 782 PHE D O   1 
ATOM   9580  C CB  . PHE D 1 282 ? 28.395  105.010 55.775  1.00 17.85  ? 782 PHE D CB  1 
ATOM   9581  C CG  . PHE D 1 282 ? 29.468  105.910 55.232  1.00 26.70  ? 782 PHE D CG  1 
ATOM   9582  C CD1 . PHE D 1 282 ? 29.280  107.285 55.178  1.00 38.20  ? 782 PHE D CD1 1 
ATOM   9583  C CD2 . PHE D 1 282 ? 30.672  105.388 54.781  1.00 34.48  ? 782 PHE D CD2 1 
ATOM   9584  C CE1 . PHE D 1 282 ? 30.276  108.122 54.686  1.00 48.53  ? 782 PHE D CE1 1 
ATOM   9585  C CE2 . PHE D 1 282 ? 31.679  106.220 54.285  1.00 41.35  ? 782 PHE D CE2 1 
ATOM   9586  C CZ  . PHE D 1 282 ? 31.479  107.585 54.235  1.00 46.93  ? 782 PHE D CZ  1 
ATOM   9587  N N   . GLN D 1 283 ? 29.244  102.114 55.081  1.00 18.40  ? 783 GLN D N   1 
ATOM   9588  C CA  . GLN D 1 283 ? 30.191  101.060 54.673  1.00 27.09  ? 783 GLN D CA  1 
ATOM   9589  C C   . GLN D 1 283 ? 29.762  100.247 53.438  1.00 33.63  ? 783 GLN D C   1 
ATOM   9590  O O   . GLN D 1 283 ? 30.593  99.917  52.589  1.00 34.71  ? 783 GLN D O   1 
ATOM   9591  C CB  . GLN D 1 283 ? 30.475  100.102 55.831  1.00 27.04  ? 783 GLN D CB  1 
ATOM   9592  C CG  . GLN D 1 283 ? 31.088  100.769 57.034  1.00 34.03  ? 783 GLN D CG  1 
ATOM   9593  C CD  . GLN D 1 283 ? 30.936  99.949  58.298  1.00 30.89  ? 783 GLN D CD  1 
ATOM   9594  O OE1 . GLN D 1 283 ? 30.811  98.724  58.258  1.00 32.01  ? 783 GLN D OE1 1 
ATOM   9595  N NE2 . GLN D 1 283 ? 30.947  100.625 59.430  1.00 29.39  ? 783 GLN D NE2 1 
ATOM   9596  N N   . MET D 1 284 ? 28.480  99.897  53.354  1.00 31.47  ? 784 MET D N   1 
ATOM   9597  C CA  . MET D 1 284 ? 27.992  99.117  52.226  1.00 27.27  ? 784 MET D CA  1 
ATOM   9598  C C   . MET D 1 284 ? 28.139  99.925  50.951  1.00 30.99  ? 784 MET D C   1 
ATOM   9599  O O   . MET D 1 284 ? 28.507  99.390  49.904  1.00 31.92  ? 784 MET D O   1 
ATOM   9600  C CB  . MET D 1 284 ? 26.533  98.697  52.433  1.00 24.33  ? 784 MET D CB  1 
ATOM   9601  C CG  . MET D 1 284 ? 26.325  97.788  53.648  1.00 24.80  ? 784 MET D CG  1 
ATOM   9602  S SD  . MET D 1 284 ? 24.593  97.372  53.967  1.00 39.72  ? 784 MET D SD  1 
ATOM   9603  C CE  . MET D 1 284 ? 24.241  96.308  52.575  1.00 50.36  ? 784 MET D CE  1 
ATOM   9604  N N   . ARG D 1 285 ? 27.862  101.224 51.054  1.00 31.35  ? 785 ARG D N   1 
ATOM   9605  C CA  . ARG D 1 285 ? 27.942  102.125 49.904  1.00 32.21  ? 785 ARG D CA  1 
ATOM   9606  C C   . ARG D 1 285 ? 29.383  102.296 49.415  1.00 33.44  ? 785 ARG D C   1 
ATOM   9607  O O   . ARG D 1 285 ? 29.616  102.326 48.210  1.00 33.98  ? 785 ARG D O   1 
ATOM   9608  C CB  . ARG D 1 285 ? 27.284  103.474 50.213  1.00 26.30  ? 785 ARG D CB  1 
ATOM   9609  C CG  . ARG D 1 285 ? 25.777  103.462 50.086  1.00 39.27  ? 785 ARG D CG  1 
ATOM   9610  C CD  . ARG D 1 285 ? 25.366  103.782 48.662  1.00 50.61  ? 785 ARG D CD  1 
ATOM   9611  N NE  . ARG D 1 285 ? 25.877  105.093 48.290  1.00 60.14  ? 785 ARG D NE  1 
ATOM   9612  C CZ  . ARG D 1 285 ? 25.152  106.203 48.293  1.00 69.02  ? 785 ARG D CZ  1 
ATOM   9613  N NH1 . ARG D 1 285 ? 23.867  106.152 48.618  1.00 74.24  ? 785 ARG D NH1 1 
ATOM   9614  N NH2 . ARG D 1 285 ? 25.709  107.358 47.959  1.00 66.39  ? 785 ARG D NH2 1 
ATOM   9615  N N   . LEU D 1 286 ? 30.341  102.389 50.343  1.00 33.77  ? 786 LEU D N   1 
ATOM   9616  C CA  . LEU D 1 286 ? 31.775  102.353 50.002  1.00 29.37  ? 786 LEU D CA  1 
ATOM   9617  C C   . LEU D 1 286 ? 32.172  101.053 49.306  1.00 37.58  ? 786 LEU D C   1 
ATOM   9618  O O   . LEU D 1 286 ? 32.690  101.075 48.190  1.00 43.52  ? 786 LEU D O   1 
ATOM   9619  C CB  . LEU D 1 286 ? 32.645  102.499 51.248  1.00 24.13  ? 786 LEU D CB  1 
ATOM   9620  C CG  . LEU D 1 286 ? 32.780  103.893 51.836  1.00 37.57  ? 786 LEU D CG  1 
ATOM   9621  C CD1 . LEU D 1 286 ? 33.631  103.849 53.098  1.00 30.36  ? 786 LEU D CD1 1 
ATOM   9622  C CD2 . LEU D 1 286 ? 33.371  104.824 50.787  1.00 39.88  ? 786 LEU D CD2 1 
ATOM   9623  N N   . LEU D 1 287 ? 31.937  99.923  49.973  1.00 24.53  ? 787 LEU D N   1 
ATOM   9624  C CA  . LEU D 1 287 ? 32.340  98.624  49.444  1.00 34.42  ? 787 LEU D CA  1 
ATOM   9625  C C   . LEU D 1 287 ? 31.656  98.223  48.123  1.00 39.65  ? 787 LEU D C   1 
ATOM   9626  O O   . LEU D 1 287 ? 32.327  97.793  47.180  1.00 42.78  ? 787 LEU D O   1 
ATOM   9627  C CB  . LEU D 1 287 ? 32.116  97.534  50.493  1.00 33.44  ? 787 LEU D CB  1 
ATOM   9628  C CG  . LEU D 1 287 ? 32.807  97.767  51.835  1.00 33.58  ? 787 LEU D CG  1 
ATOM   9629  C CD1 . LEU D 1 287 ? 32.329  96.731  52.832  1.00 24.69  ? 787 LEU D CD1 1 
ATOM   9630  C CD2 . LEU D 1 287 ? 34.328  97.748  51.683  1.00 33.88  ? 787 LEU D CD2 1 
ATOM   9631  N N   . TRP D 1 288 ? 30.331  98.352  48.060  1.00 30.27  ? 788 TRP D N   1 
ATOM   9632  C CA  . TRP D 1 288 ? 29.584  97.831  46.916  1.00 38.07  ? 788 TRP D CA  1 
ATOM   9633  C C   . TRP D 1 288 ? 29.018  98.903  45.979  1.00 47.90  ? 788 TRP D C   1 
ATOM   9634  O O   . TRP D 1 288 ? 28.314  98.584  45.018  1.00 45.31  ? 788 TRP D O   1 
ATOM   9635  C CB  . TRP D 1 288 ? 28.471  96.876  47.380  1.00 36.34  ? 788 TRP D CB  1 
ATOM   9636  C CG  . TRP D 1 288 ? 28.995  95.546  47.893  1.00 41.93  ? 788 TRP D CG  1 
ATOM   9637  C CD1 . TRP D 1 288 ? 29.420  94.487  47.143  1.00 46.14  ? 788 TRP D CD1 1 
ATOM   9638  C CD2 . TRP D 1 288 ? 29.148  95.148  49.268  1.00 42.00  ? 788 TRP D CD2 1 
ATOM   9639  N NE1 . TRP D 1 288 ? 29.829  93.457  47.963  1.00 47.11  ? 788 TRP D NE1 1 
ATOM   9640  C CE2 . TRP D 1 288 ? 29.672  93.838  49.269  1.00 40.73  ? 788 TRP D CE2 1 
ATOM   9641  C CE3 . TRP D 1 288 ? 28.894  95.772  50.495  1.00 36.76  ? 788 TRP D CE3 1 
ATOM   9642  C CZ2 . TRP D 1 288 ? 29.947  93.146  50.443  1.00 37.36  ? 788 TRP D CZ2 1 
ATOM   9643  C CZ3 . TRP D 1 288 ? 29.165  95.076  51.660  1.00 35.13  ? 788 TRP D CZ3 1 
ATOM   9644  C CH2 . TRP D 1 288 ? 29.692  93.781  51.626  1.00 27.17  ? 788 TRP D CH2 1 
ATOM   9645  N N   . GLY D 1 289 ? 29.334  100.167 46.254  1.00 52.17  ? 789 GLY D N   1 
ATOM   9646  C CA  . GLY D 1 289 ? 28.844  101.268 45.444  1.00 49.92  ? 789 GLY D CA  1 
ATOM   9647  C C   . GLY D 1 289 ? 27.355  101.425 45.649  1.00 52.10  ? 789 GLY D C   1 
ATOM   9648  O O   . GLY D 1 289 ? 26.732  100.556 46.246  1.00 46.75  ? 789 GLY D O   1 
ATOM   9649  N N   . SER D 1 290 ? 26.784  102.520 45.149  1.00 65.07  ? 790 SER D N   1 
ATOM   9650  C CA  . SER D 1 290 ? 25.375  102.847 45.398  1.00 73.59  ? 790 SER D CA  1 
ATOM   9651  C C   . SER D 1 290 ? 24.388  102.044 44.552  1.00 74.62  ? 790 SER D C   1 
ATOM   9652  O O   . SER D 1 290 ? 23.178  102.158 44.730  1.00 79.56  ? 790 SER D O   1 
ATOM   9653  C CB  . SER D 1 290 ? 25.117  104.350 45.218  1.00 78.64  ? 790 SER D CB  1 
ATOM   9654  O OG  . SER D 1 290 ? 25.522  104.800 43.934  1.00 77.15  ? 790 SER D OG  1 
ATOM   9655  N N   . LYS D 1 291 ? 24.898  101.237 43.632  1.00 69.28  ? 791 LYS D N   1 
ATOM   9656  C CA  . LYS D 1 291 ? 24.027  100.404 42.822  1.00 77.69  ? 791 LYS D CA  1 
ATOM   9657  C C   . LYS D 1 291 ? 24.104  98.970  43.331  1.00 77.12  ? 791 LYS D C   1 
ATOM   9658  O O   . LYS D 1 291 ? 23.081  98.300  43.508  1.00 83.27  ? 791 LYS D O   1 
ATOM   9659  C CB  . LYS D 1 291 ? 24.439  100.481 41.345  1.00 90.16  ? 791 LYS D CB  1 
ATOM   9660  C CG  . LYS D 1 291 ? 23.409  99.936  40.339  1.00 98.66  ? 791 LYS D CG  1 
ATOM   9661  C CD  . LYS D 1 291 ? 22.328  100.966 39.996  1.00 98.88  ? 791 LYS D CD  1 
ATOM   9662  C CE  . LYS D 1 291 ? 21.350  100.442 38.939  1.00 96.27  ? 791 LYS D CE  1 
ATOM   9663  N NZ  . LYS D 1 291 ? 21.907  100.438 37.552  1.00 93.64  ? 791 LYS D NZ  1 
ATOM   9664  N N   . GLY D 1 292 ? 25.326  98.517  43.589  1.00 68.67  ? 792 GLY D N   1 
ATOM   9665  C CA  . GLY D 1 292 ? 25.574  97.126  43.912  1.00 66.94  ? 792 GLY D CA  1 
ATOM   9666  C C   . GLY D 1 292 ? 25.383  96.751  45.367  1.00 66.83  ? 792 GLY D C   1 
ATOM   9667  O O   . GLY D 1 292 ? 25.494  95.572  45.713  1.00 61.94  ? 792 GLY D O   1 
ATOM   9668  N N   . ALA D 1 293 ? 25.099  97.742  46.214  1.00 66.16  ? 793 ALA D N   1 
ATOM   9669  C CA  . ALA D 1 293 ? 24.903  97.506  47.649  1.00 62.61  ? 793 ALA D CA  1 
ATOM   9670  C C   . ALA D 1 293 ? 23.521  96.936  47.972  1.00 71.96  ? 793 ALA D C   1 
ATOM   9671  O O   . ALA D 1 293 ? 23.236  96.587  49.120  1.00 67.86  ? 793 ALA D O   1 
ATOM   9672  C CB  . ALA D 1 293 ? 25.148  98.776  48.443  1.00 49.21  ? 793 ALA D CB  1 
ATOM   9673  N N   . GLN D 1 294 ? 22.661  96.846  46.962  1.00 81.88  ? 794 GLN D N   1 
ATOM   9674  C CA  . GLN D 1 294 ? 21.327  96.303  47.173  1.00 84.59  ? 794 GLN D CA  1 
ATOM   9675  C C   . GLN D 1 294 ? 21.167  94.949  46.491  1.00 71.43  ? 794 GLN D C   1 
ATOM   9676  O O   . GLN D 1 294 ? 20.056  94.495  46.248  1.00 73.53  ? 794 GLN D O   1 
ATOM   9677  C CB  . GLN D 1 294 ? 20.253  97.292  46.709  1.00 99.02  ? 794 GLN D CB  1 
ATOM   9678  C CG  . GLN D 1 294 ? 19.033  97.331  47.629  1.00 108.14 ? 794 GLN D CG  1 
ATOM   9679  C CD  . GLN D 1 294 ? 18.522  98.740  47.886  1.00 115.01 ? 794 GLN D CD  1 
ATOM   9680  O OE1 . GLN D 1 294 ? 18.763  99.321  48.948  1.00 110.46 ? 794 GLN D OE1 1 
ATOM   9681  N NE2 . GLN D 1 294 ? 17.805  99.295  46.914  1.00 123.46 ? 794 GLN D NE2 1 
ATOM   9682  N N   . VAL D 1 295 ? 22.290  94.311  46.184  1.00 61.14  ? 795 VAL D N   1 
ATOM   9683  C CA  . VAL D 1 295 ? 22.278  92.961  45.639  1.00 57.77  ? 795 VAL D CA  1 
ATOM   9684  C C   . VAL D 1 295 ? 22.318  91.936  46.761  1.00 56.72  ? 795 VAL D C   1 
ATOM   9685  O O   . VAL D 1 295 ? 22.892  92.190  47.819  1.00 53.18  ? 795 VAL D O   1 
ATOM   9686  C CB  . VAL D 1 295 ? 23.487  92.704  44.730  1.00 52.51  ? 795 VAL D CB  1 
ATOM   9687  C CG1 . VAL D 1 295 ? 23.730  91.194  44.602  1.00 50.70  ? 795 VAL D CG1 1 
ATOM   9688  C CG2 . VAL D 1 295 ? 23.285  93.370  43.361  1.00 45.66  ? 795 VAL D CG2 1 
ATOM   9689  N N   . ASN D 1 296 ? 21.726  90.772  46.527  1.00 54.11  ? 796 ASN D N   1 
ATOM   9690  C CA  . ASN D 1 296 ? 21.709  89.732  47.542  1.00 53.94  ? 796 ASN D CA  1 
ATOM   9691  C C   . ASN D 1 296 ? 23.075  89.528  48.212  1.00 49.74  ? 796 ASN D C   1 
ATOM   9692  O O   . ASN D 1 296 ? 24.127  89.650  47.571  1.00 41.67  ? 796 ASN D O   1 
ATOM   9693  C CB  . ASN D 1 296 ? 21.193  88.417  46.956  1.00 57.04  ? 796 ASN D CB  1 
ATOM   9694  C CG  . ASN D 1 296 ? 22.088  87.879  45.869  1.00 57.85  ? 796 ASN D CG  1 
ATOM   9695  O OD1 . ASN D 1 296 ? 23.092  87.226  46.154  1.00 50.55  ? 796 ASN D OD1 1 
ATOM   9696  N ND2 . ASN D 1 296 ? 21.737  88.153  44.609  1.00 59.60  ? 796 ASN D ND2 1 
ATOM   9697  N N   . GLN D 1 297 ? 23.035  89.231  49.510  1.00 42.83  ? 797 GLN D N   1 
ATOM   9698  C CA  . GLN D 1 297 ? 24.228  89.019  50.312  1.00 42.16  ? 797 GLN D CA  1 
ATOM   9699  C C   . GLN D 1 297 ? 25.150  87.979  49.710  1.00 46.34  ? 797 GLN D C   1 
ATOM   9700  O O   . GLN D 1 297 ? 26.356  88.195  49.628  1.00 50.20  ? 797 GLN D O   1 
ATOM   9701  C CB  . GLN D 1 297 ? 23.858  88.529  51.712  1.00 44.68  ? 797 GLN D CB  1 
ATOM   9702  C CG  . GLN D 1 297 ? 23.025  89.462  52.547  1.00 45.25  ? 797 GLN D CG  1 
ATOM   9703  C CD  . GLN D 1 297 ? 22.839  88.913  53.944  1.00 49.50  ? 797 GLN D CD  1 
ATOM   9704  O OE1 . GLN D 1 297 ? 22.375  87.784  54.118  1.00 49.04  ? 797 GLN D OE1 1 
ATOM   9705  N NE2 . GLN D 1 297 ? 23.231  89.691  54.947  1.00 45.88  ? 797 GLN D NE2 1 
ATOM   9706  N N   . THR D 1 298 ? 24.587  86.834  49.328  1.00 46.96  ? 798 THR D N   1 
ATOM   9707  C CA  . THR D 1 298 ? 25.407  85.711  48.898  1.00 49.27  ? 798 THR D CA  1 
ATOM   9708  C C   . THR D 1 298 ? 26.382  86.169  47.815  1.00 53.11  ? 798 THR D C   1 
ATOM   9709  O O   . THR D 1 298 ? 27.559  85.800  47.828  1.00 50.66  ? 798 THR D O   1 
ATOM   9710  C CB  . THR D 1 298 ? 24.558  84.487  48.421  1.00 52.33  ? 798 THR D CB  1 
ATOM   9711  O OG1 . THR D 1 298 ? 23.744  83.991  49.495  1.00 36.98  ? 798 THR D OG1 1 
ATOM   9712  C CG2 . THR D 1 298 ? 25.471  83.364  47.959  1.00 54.94  ? 798 THR D CG2 1 
ATOM   9713  N N   . GLU D 1 299 ? 25.890  87.009  46.908  1.00 58.91  ? 799 GLU D N   1 
ATOM   9714  C CA  . GLU D 1 299 ? 26.694  87.519  45.795  1.00 63.24  ? 799 GLU D CA  1 
ATOM   9715  C C   . GLU D 1 299 ? 27.684  88.595  46.231  1.00 59.23  ? 799 GLU D C   1 
ATOM   9716  O O   . GLU D 1 299 ? 28.867  88.545  45.884  1.00 58.08  ? 799 GLU D O   1 
ATOM   9717  C CB  . GLU D 1 299 ? 25.787  88.072  44.698  1.00 66.87  ? 799 GLU D CB  1 
ATOM   9718  C CG  . GLU D 1 299 ? 26.076  87.514  43.324  1.00 77.28  ? 799 GLU D CG  1 
ATOM   9719  C CD  . GLU D 1 299 ? 24.879  87.623  42.402  1.00 85.93  ? 799 GLU D CD  1 
ATOM   9720  O OE1 . GLU D 1 299 ? 24.579  88.751  41.956  1.00 88.31  ? 799 GLU D OE1 1 
ATOM   9721  O OE2 . GLU D 1 299 ? 24.231  86.583  42.135  1.00 84.54  ? 799 GLU D OE2 1 
ATOM   9722  N N   . ARG D 1 300 ? 27.189  89.576  46.977  1.00 54.60  ? 800 ARG D N   1 
ATOM   9723  C CA  . ARG D 1 300 ? 28.043  90.641  47.478  1.00 52.36  ? 800 ARG D CA  1 
ATOM   9724  C C   . ARG D 1 300 ? 29.189  90.063  48.283  1.00 52.53  ? 800 ARG D C   1 
ATOM   9725  O O   . ARG D 1 300 ? 30.279  90.625  48.311  1.00 60.90  ? 800 ARG D O   1 
ATOM   9726  C CB  . ARG D 1 300 ? 27.250  91.610  48.349  1.00 45.26  ? 800 ARG D CB  1 
ATOM   9727  C CG  . ARG D 1 300 ? 26.263  92.442  47.584  1.00 38.59  ? 800 ARG D CG  1 
ATOM   9728  C CD  . ARG D 1 300 ? 25.699  93.529  48.464  1.00 42.89  ? 800 ARG D CD  1 
ATOM   9729  N NE  . ARG D 1 300 ? 24.863  92.992  49.532  1.00 46.97  ? 800 ARG D NE  1 
ATOM   9730  C CZ  . ARG D 1 300 ? 25.209  92.961  50.814  1.00 51.51  ? 800 ARG D CZ  1 
ATOM   9731  N NH1 . ARG D 1 300 ? 26.386  93.442  51.201  1.00 50.74  ? 800 ARG D NH1 1 
ATOM   9732  N NH2 . ARG D 1 300 ? 24.373  92.456  51.713  1.00 48.24  ? 800 ARG D NH2 1 
ATOM   9733  N N   . TYR D 1 301 ? 28.945  88.936  48.942  1.00 49.03  ? 801 TYR D N   1 
ATOM   9734  C CA  . TYR D 1 301 ? 29.989  88.324  49.748  1.00 44.09  ? 801 TYR D CA  1 
ATOM   9735  C C   . TYR D 1 301 ? 30.984  87.580  48.879  1.00 44.69  ? 801 TYR D C   1 
ATOM   9736  O O   . TYR D 1 301 ? 32.187  87.731  49.055  1.00 52.87  ? 801 TYR D O   1 
ATOM   9737  C CB  . TYR D 1 301 ? 29.419  87.431  50.854  1.00 38.39  ? 801 TYR D CB  1 
ATOM   9738  C CG  . TYR D 1 301 ? 28.633  88.195  51.904  1.00 35.89  ? 801 TYR D CG  1 
ATOM   9739  C CD1 . TYR D 1 301 ? 28.546  89.580  51.861  1.00 37.46  ? 801 TYR D CD1 1 
ATOM   9740  C CD2 . TYR D 1 301 ? 27.981  87.535  52.933  1.00 38.03  ? 801 TYR D CD2 1 
ATOM   9741  C CE1 . TYR D 1 301 ? 27.834  90.282  52.805  1.00 35.12  ? 801 TYR D CE1 1 
ATOM   9742  C CE2 . TYR D 1 301 ? 27.261  88.231  53.884  1.00 40.87  ? 801 TYR D CE2 1 
ATOM   9743  C CZ  . TYR D 1 301 ? 27.193  89.605  53.815  1.00 37.70  ? 801 TYR D CZ  1 
ATOM   9744  O OH  . TYR D 1 301 ? 26.481  90.306  54.753  1.00 35.01  ? 801 TYR D OH  1 
ATOM   9745  N N   . GLU D 1 302 ? 30.501  86.798  47.923  1.00 41.27  ? 802 GLU D N   1 
ATOM   9746  C CA  . GLU D 1 302 ? 31.429  86.099  47.045  1.00 49.31  ? 802 GLU D CA  1 
ATOM   9747  C C   . GLU D 1 302 ? 32.287  87.095  46.270  1.00 57.19  ? 802 GLU D C   1 
ATOM   9748  O O   . GLU D 1 302 ? 33.513  86.948  46.174  1.00 53.87  ? 802 GLU D O   1 
ATOM   9749  C CB  . GLU D 1 302 ? 30.699  85.161  46.083  1.00 50.86  ? 802 GLU D CB  1 
ATOM   9750  C CG  . GLU D 1 302 ? 31.649  84.394  45.156  1.00 64.45  ? 802 GLU D CG  1 
ATOM   9751  C CD  . GLU D 1 302 ? 32.773  83.665  45.900  1.00 70.54  ? 802 GLU D CD  1 
ATOM   9752  O OE1 . GLU D 1 302 ? 32.648  83.429  47.126  1.00 67.47  ? 802 GLU D OE1 1 
ATOM   9753  O OE2 . GLU D 1 302 ? 33.788  83.330  45.250  1.00 73.39  ? 802 GLU D OE2 1 
ATOM   9754  N N   . LYS D 1 303 ? 31.632  88.115  45.726  1.00 60.74  ? 803 LYS D N   1 
ATOM   9755  C CA  . LYS D 1 303 ? 32.327  89.143  44.972  1.00 61.07  ? 803 LYS D CA  1 
ATOM   9756  C C   . LYS D 1 303 ? 33.527  89.690  45.744  1.00 52.60  ? 803 LYS D C   1 
ATOM   9757  O O   . LYS D 1 303 ? 34.570  89.961  45.158  1.00 54.17  ? 803 LYS D O   1 
ATOM   9758  C CB  . LYS D 1 303 ? 31.367  90.272  44.606  1.00 72.59  ? 803 LYS D CB  1 
ATOM   9759  C CG  . LYS D 1 303 ? 31.835  91.129  43.455  1.00 79.79  ? 803 LYS D CG  1 
ATOM   9760  C CD  . LYS D 1 303 ? 30.950  92.342  43.320  1.00 86.17  ? 803 LYS D CD  1 
ATOM   9761  C CE  . LYS D 1 303 ? 31.384  93.208  42.161  1.00 90.37  ? 803 LYS D CE  1 
ATOM   9762  N NZ  . LYS D 1 303 ? 30.600  94.464  42.150  1.00 91.35  ? 803 LYS D NZ  1 
ATOM   9763  N N   . PHE D 1 304 ? 33.391  89.845  47.058  1.00 49.32  ? 804 PHE D N   1 
ATOM   9764  C CA  . PHE D 1 304 ? 34.506  90.349  47.860  1.00 47.11  ? 804 PHE D CA  1 
ATOM   9765  C C   . PHE D 1 304 ? 35.502  89.275  48.249  1.00 48.77  ? 804 PHE D C   1 
ATOM   9766  O O   . PHE D 1 304 ? 36.678  89.562  48.484  1.00 48.87  ? 804 PHE D O   1 
ATOM   9767  C CB  . PHE D 1 304 ? 34.026  91.118  49.092  1.00 42.98  ? 804 PHE D CB  1 
ATOM   9768  C CG  . PHE D 1 304 ? 34.071  92.590  48.910  1.00 41.50  ? 804 PHE D CG  1 
ATOM   9769  C CD1 . PHE D 1 304 ? 35.226  93.297  49.195  1.00 46.20  ? 804 PHE D CD1 1 
ATOM   9770  C CD2 . PHE D 1 304 ? 32.977  93.273  48.407  1.00 46.66  ? 804 PHE D CD2 1 
ATOM   9771  C CE1 . PHE D 1 304 ? 35.290  94.669  48.998  1.00 43.88  ? 804 PHE D CE1 1 
ATOM   9772  C CE2 . PHE D 1 304 ? 33.033  94.646  48.208  1.00 48.47  ? 804 PHE D CE2 1 
ATOM   9773  C CZ  . PHE D 1 304 ? 34.194  95.345  48.504  1.00 44.19  ? 804 PHE D CZ  1 
ATOM   9774  N N   . ASN D 1 305 ? 35.029  88.039  48.325  1.00 54.45  ? 805 ASN D N   1 
ATOM   9775  C CA  . ASN D 1 305 ? 35.916  86.926  48.599  1.00 50.54  ? 805 ASN D CA  1 
ATOM   9776  C C   . ASN D 1 305 ? 36.969  86.851  47.497  1.00 50.17  ? 805 ASN D C   1 
ATOM   9777  O O   . ASN D 1 305 ? 38.154  86.647  47.763  1.00 42.25  ? 805 ASN D O   1 
ATOM   9778  C CB  . ASN D 1 305 ? 35.134  85.622  48.690  1.00 51.84  ? 805 ASN D CB  1 
ATOM   9779  C CG  . ASN D 1 305 ? 36.022  84.443  49.017  1.00 61.86  ? 805 ASN D CG  1 
ATOM   9780  O OD1 . ASN D 1 305 ? 36.901  84.544  49.876  1.00 61.81  ? 805 ASN D OD1 1 
ATOM   9781  N ND2 . ASN D 1 305 ? 35.821  83.325  48.315  1.00 57.62  ? 805 ASN D ND2 1 
ATOM   9782  N N   . GLN D 1 306 ? 36.531  87.049  46.258  1.00 56.70  ? 806 GLN D N   1 
ATOM   9783  C CA  . GLN D 1 306 ? 37.435  87.054  45.116  1.00 60.53  ? 806 GLN D CA  1 
ATOM   9784  C C   . GLN D 1 306 ? 38.234  88.350  45.045  1.00 57.70  ? 806 GLN D C   1 
ATOM   9785  O O   . GLN D 1 306 ? 39.454  88.327  44.872  1.00 56.64  ? 806 GLN D O   1 
ATOM   9786  C CB  . GLN D 1 306 ? 36.648  86.858  43.830  1.00 69.72  ? 806 GLN D CB  1 
ATOM   9787  C CG  . GLN D 1 306 ? 35.891  85.555  43.785  1.00 78.30  ? 806 GLN D CG  1 
ATOM   9788  C CD  . GLN D 1 306 ? 34.862  85.531  42.681  1.00 86.17  ? 806 GLN D CD  1 
ATOM   9789  O OE1 . GLN D 1 306 ? 34.610  86.547  42.027  1.00 90.78  ? 806 GLN D OE1 1 
ATOM   9790  N NE2 . GLN D 1 306 ? 34.255  84.369  42.466  1.00 86.46  ? 806 GLN D NE2 1 
ATOM   9791  N N   . ILE D 1 307 ? 37.540  89.477  45.177  1.00 53.28  ? 807 ILE D N   1 
ATOM   9792  C CA  . ILE D 1 307 ? 38.200  90.780  45.193  1.00 56.20  ? 807 ILE D CA  1 
ATOM   9793  C C   . ILE D 1 307 ? 39.332  90.789  46.222  1.00 57.75  ? 807 ILE D C   1 
ATOM   9794  O O   . ILE D 1 307 ? 40.422  91.296  45.959  1.00 59.86  ? 807 ILE D O   1 
ATOM   9795  C CB  . ILE D 1 307 ? 37.204  91.933  45.496  1.00 46.59  ? 807 ILE D CB  1 
ATOM   9796  C CG1 . ILE D 1 307 ? 36.307  92.217  44.292  1.00 51.38  ? 807 ILE D CG1 1 
ATOM   9797  C CG2 . ILE D 1 307 ? 37.933  93.196  45.865  1.00 36.22  ? 807 ILE D CG2 1 
ATOM   9798  C CD1 . ILE D 1 307 ? 35.320  93.344  44.527  1.00 47.78  ? 807 ILE D CD1 1 
ATOM   9799  N N   . LEU D 1 308 ? 39.072  90.213  47.392  1.00 53.57  ? 808 LEU D N   1 
ATOM   9800  C CA  . LEU D 1 308 ? 40.063  90.192  48.458  1.00 48.88  ? 808 LEU D CA  1 
ATOM   9801  C C   . LEU D 1 308 ? 41.212  89.227  48.158  1.00 52.02  ? 808 LEU D C   1 
ATOM   9802  O O   . LEU D 1 308 ? 42.377  89.570  48.350  1.00 51.18  ? 808 LEU D O   1 
ATOM   9803  C CB  . LEU D 1 308 ? 39.405  89.858  49.803  1.00 46.33  ? 808 LEU D CB  1 
ATOM   9804  C CG  . LEU D 1 308 ? 38.675  90.988  50.536  1.00 42.56  ? 808 LEU D CG  1 
ATOM   9805  C CD1 . LEU D 1 308 ? 38.054  90.471  51.808  1.00 46.14  ? 808 LEU D CD1 1 
ATOM   9806  C CD2 . LEU D 1 308 ? 39.628  92.114  50.859  1.00 31.73  ? 808 LEU D CD2 1 
ATOM   9807  N N   . THR D 1 309 ? 40.894  88.020  47.694  1.00 47.06  ? 809 THR D N   1 
ATOM   9808  C CA  . THR D 1 309 ? 41.949  87.081  47.342  1.00 51.41  ? 809 THR D CA  1 
ATOM   9809  C C   . THR D 1 309 ? 42.847  87.694  46.274  1.00 60.74  ? 809 THR D C   1 
ATOM   9810  O O   . THR D 1 309 ? 44.066  87.518  46.299  1.00 64.24  ? 809 THR D O   1 
ATOM   9811  C CB  . THR D 1 309 ? 41.417  85.741  46.804  1.00 46.30  ? 809 THR D CB  1 
ATOM   9812  O OG1 . THR D 1 309 ? 40.867  84.959  47.876  1.00 43.97  ? 809 THR D OG1 1 
ATOM   9813  C CG2 . THR D 1 309 ? 42.559  84.972  46.192  1.00 40.74  ? 809 THR D CG2 1 
ATOM   9814  N N   . ALA D 1 310 ? 42.233  88.411  45.337  1.00 55.13  ? 810 ALA D N   1 
ATOM   9815  C CA  . ALA D 1 310 ? 42.971  89.047  44.253  1.00 61.31  ? 810 ALA D CA  1 
ATOM   9816  C C   . ALA D 1 310 ? 43.952  90.099  44.772  1.00 64.56  ? 810 ALA D C   1 
ATOM   9817  O O   . ALA D 1 310 ? 45.134  90.075  44.437  1.00 68.54  ? 810 ALA D O   1 
ATOM   9818  C CB  . ALA D 1 310 ? 42.012  89.658  43.244  1.00 62.74  ? 810 ALA D CB  1 
ATOM   9819  N N   . LEU D 1 311 ? 43.466  91.026  45.588  1.00 63.23  ? 811 LEU D N   1 
ATOM   9820  C CA  . LEU D 1 311 ? 44.347  92.016  46.199  1.00 57.59  ? 811 LEU D CA  1 
ATOM   9821  C C   . LEU D 1 311 ? 45.491  91.342  46.949  1.00 55.81  ? 811 LEU D C   1 
ATOM   9822  O O   . LEU D 1 311 ? 46.624  91.808  46.918  1.00 62.09  ? 811 LEU D O   1 
ATOM   9823  C CB  . LEU D 1 311 ? 43.563  92.927  47.141  1.00 51.56  ? 811 LEU D CB  1 
ATOM   9824  C CG  . LEU D 1 311 ? 42.540  93.824  46.448  1.00 45.83  ? 811 LEU D CG  1 
ATOM   9825  C CD1 . LEU D 1 311 ? 41.453  94.290  47.409  1.00 40.12  ? 811 LEU D CD1 1 
ATOM   9826  C CD2 . LEU D 1 311 ? 43.240  94.997  45.797  1.00 38.83  ? 811 LEU D CD2 1 
ATOM   9827  N N   . SER D 1 312 ? 45.197  90.236  47.619  1.00 56.74  ? 812 SER D N   1 
ATOM   9828  C CA  . SER D 1 312 ? 46.216  89.564  48.413  1.00 60.91  ? 812 SER D CA  1 
ATOM   9829  C C   . SER D 1 312 ? 47.304  88.994  47.512  1.00 67.46  ? 812 SER D C   1 
ATOM   9830  O O   . SER D 1 312 ? 48.479  88.973  47.876  1.00 65.20  ? 812 SER D O   1 
ATOM   9831  C CB  . SER D 1 312 ? 45.607  88.458  49.271  1.00 56.55  ? 812 SER D CB  1 
ATOM   9832  O OG  . SER D 1 312 ? 46.548  88.023  50.235  1.00 56.57  ? 812 SER D OG  1 
ATOM   9833  N N   . ARG D 1 313 ? 46.900  88.531  46.335  1.00 73.33  ? 813 ARG D N   1 
ATOM   9834  C CA  . ARG D 1 313 ? 47.840  88.012  45.349  1.00 77.02  ? 813 ARG D CA  1 
ATOM   9835  C C   . ARG D 1 313 ? 48.683  89.125  44.726  1.00 76.11  ? 813 ARG D C   1 
ATOM   9836  O O   . ARG D 1 313 ? 49.883  88.959  44.521  1.00 71.81  ? 813 ARG D O   1 
ATOM   9837  C CB  . ARG D 1 313 ? 47.098  87.228  44.266  1.00 78.60  ? 813 ARG D CB  1 
ATOM   9838  C CG  . ARG D 1 313 ? 46.515  85.922  44.764  1.00 80.09  ? 813 ARG D CG  1 
ATOM   9839  C CD  . ARG D 1 313 ? 45.880  85.136  43.635  1.00 87.84  ? 813 ARG D CD  1 
ATOM   9840  N NE  . ARG D 1 313 ? 45.603  83.753  44.012  1.00 92.48  ? 813 ARG D NE  1 
ATOM   9841  C CZ  . ARG D 1 313 ? 46.344  83.037  44.853  1.00 102.69 ? 813 ARG D CZ  1 
ATOM   9842  N NH1 . ARG D 1 313 ? 47.423  83.563  45.415  1.00 104.83 ? 813 ARG D NH1 1 
ATOM   9843  N NH2 . ARG D 1 313 ? 46.009  81.783  45.130  1.00 109.12 ? 813 ARG D NH2 1 
ATOM   9844  N N   . LYS D 1 314 ? 48.053  90.260  44.438  1.00 77.49  ? 814 LYS D N   1 
ATOM   9845  C CA  . LYS D 1 314 ? 48.767  91.402  43.878  1.00 74.82  ? 814 LYS D CA  1 
ATOM   9846  C C   . LYS D 1 314 ? 49.820  91.915  44.858  1.00 74.41  ? 814 LYS D C   1 
ATOM   9847  O O   . LYS D 1 314 ? 50.941  92.216  44.461  1.00 82.51  ? 814 LYS D O   1 
ATOM   9848  C CB  . LYS D 1 314 ? 47.789  92.517  43.473  1.00 74.87  ? 814 LYS D CB  1 
ATOM   9849  C CG  . LYS D 1 314 ? 48.434  93.740  42.818  1.00 73.68  ? 814 LYS D CG  1 
ATOM   9850  C CD  . LYS D 1 314 ? 47.432  94.538  41.970  1.00 74.66  ? 814 LYS D CD  1 
ATOM   9851  C CE  . LYS D 1 314 ? 46.217  95.029  42.776  1.00 68.90  ? 814 LYS D CE  1 
ATOM   9852  N NZ  . LYS D 1 314 ? 46.456  96.280  43.573  1.00 58.05  ? 814 LYS D NZ  1 
ATOM   9853  N N   . LEU D 1 315 ? 49.470  91.998  46.137  1.00 66.90  ? 815 LEU D N   1 
ATOM   9854  C CA  . LEU D 1 315 ? 50.386  92.536  47.143  1.00 60.91  ? 815 LEU D CA  1 
ATOM   9855  C C   . LEU D 1 315 ? 51.540  91.597  47.468  1.00 64.23  ? 815 LEU D C   1 
ATOM   9856  O O   . LEU D 1 315 ? 52.670  92.041  47.677  1.00 60.46  ? 815 LEU D O   1 
ATOM   9857  C CB  . LEU D 1 315 ? 49.636  92.868  48.429  1.00 52.59  ? 815 LEU D CB  1 
ATOM   9858  C CG  . LEU D 1 315 ? 48.679  94.049  48.365  1.00 46.73  ? 815 LEU D CG  1 
ATOM   9859  C CD1 . LEU D 1 315 ? 47.938  94.209  49.690  1.00 43.22  ? 815 LEU D CD1 1 
ATOM   9860  C CD2 . LEU D 1 315 ? 49.458  95.296  48.023  1.00 40.98  ? 815 LEU D CD2 1 
ATOM   9861  N N   . GLU D 1 316 ? 51.242  90.303  47.539  1.00 70.26  ? 816 GLU D N   1 
ATOM   9862  C CA  . GLU D 1 316 ? 52.251  89.290  47.831  1.00 73.05  ? 816 GLU D CA  1 
ATOM   9863  C C   . GLU D 1 316 ? 51.944  87.997  47.087  1.00 72.20  ? 816 GLU D C   1 
ATOM   9864  O O   . GLU D 1 316 ? 51.166  87.162  47.559  1.00 70.29  ? 816 GLU D O   1 
ATOM   9865  C CB  . GLU D 1 316 ? 52.338  89.022  49.336  1.00 74.24  ? 816 GLU D CB  1 
ATOM   9866  C CG  . GLU D 1 316 ? 52.685  90.248  50.172  1.00 78.63  ? 816 GLU D CG  1 
ATOM   9867  C CD  . GLU D 1 316 ? 52.966  89.912  51.632  1.00 79.65  ? 816 GLU D CD  1 
ATOM   9868  O OE1 . GLU D 1 316 ? 53.194  88.722  51.940  1.00 82.88  ? 816 GLU D OE1 1 
ATOM   9869  O OE2 . GLU D 1 316 ? 52.966  90.839  52.472  1.00 74.14  ? 816 GLU D OE2 1 
ATOM   9870  N N   . PRO D 1 317 ? 52.538  87.838  45.901  1.00 72.87  ? 817 PRO D N   1 
ATOM   9871  C CA  . PRO D 1 317 ? 52.385  86.597  45.133  1.00 71.00  ? 817 PRO D CA  1 
ATOM   9872  C C   . PRO D 1 317 ? 53.045  85.425  45.846  1.00 64.30  ? 817 PRO D C   1 
ATOM   9873  O O   . PRO D 1 317 ? 53.902  85.661  46.697  1.00 62.90  ? 817 PRO D O   1 
ATOM   9874  C CB  . PRO D 1 317 ? 53.120  86.911  43.826  1.00 68.39  ? 817 PRO D CB  1 
ATOM   9875  C CG  . PRO D 1 317 ? 53.029  88.404  43.703  1.00 66.00  ? 817 PRO D CG  1 
ATOM   9876  C CD  . PRO D 1 317 ? 53.174  88.905  45.110  1.00 67.48  ? 817 PRO D CD  1 
ATOM   9877  N N   . PRO D 1 318 ? 52.629  84.188  45.525  1.00 67.83  ? 818 PRO D N   1 
ATOM   9878  C CA  . PRO D 1 318 ? 53.275  82.955  46.004  1.00 76.74  ? 818 PRO D CA  1 
ATOM   9879  C C   . PRO D 1 318 ? 54.468  82.529  45.138  1.00 80.90  ? 818 PRO D C   1 
ATOM   9880  O O   . PRO D 1 318 ? 54.930  81.383  45.230  1.00 83.12  ? 818 PRO D O   1 
ATOM   9881  C CB  . PRO D 1 318 ? 52.153  81.916  45.909  1.00 71.46  ? 818 PRO D CB  1 
ATOM   9882  C CG  . PRO D 1 318 ? 51.287  82.412  44.803  1.00 66.37  ? 818 PRO D CG  1 
ATOM   9883  C CD  . PRO D 1 318 ? 51.343  83.918  44.856  1.00 59.82  ? 818 PRO D CD  1 
HETATM 9884  O O3  . POG E 2 .   ? 23.441  67.126  86.986  1.00 70.00  ? 834 POG A O3  1 
HETATM 9885  C C7  . POG E 2 .   ? 23.104  67.856  88.138  1.00 73.24  ? 834 POG A C7  1 
HETATM 9886  C C8  . POG E 2 .   ? 21.893  68.800  88.079  1.00 74.30  ? 834 POG A C8  1 
HETATM 9887  O O4  . POG E 2 .   ? 20.847  68.339  87.192  1.00 75.32  ? 834 POG A O4  1 
HETATM 9888  C C9  . POG E 2 .   ? 19.974  69.261  86.587  1.00 69.49  ? 834 POG A C9  1 
HETATM 9889  C C10 . POG E 2 .   ? 18.537  68.806  86.303  1.00 54.72  ? 834 POG A C10 1 
HETATM 9890  O O5  . POG E 2 .   ? 18.275  68.583  84.959  1.00 54.27  ? 834 POG A O5  1 
HETATM 9891  C C11 . POG E 2 .   ? 17.014  68.788  84.379  1.00 53.08  ? 834 POG A C11 1 
HETATM 9892  C C12 . POG E 2 .   ? 16.910  69.643  83.106  1.00 56.22  ? 834 POG A C12 1 
HETATM 9893  O O6  . POG E 2 .   ? 15.616  69.751  82.586  1.00 54.78  ? 834 POG A O6  1 
HETATM 9894  C C13 . POG E 2 .   ? 15.403  70.370  81.349  1.00 48.35  ? 834 POG A C13 1 
HETATM 9895  C C14 . POG E 2 .   ? 14.259  71.421  81.226  1.00 23.61  ? 834 POG A C14 1 
HETATM 9896  C C17 . POG E 2 .   ? 14.735  72.854  81.301  1.00 30.16  ? 834 POG A C17 1 
HETATM 9897  C C18 . POG E 2 .   ? 17.618  71.002  83.195  1.00 59.69  ? 834 POG A C18 1 
HETATM 9898  C C19 . POG E 2 .   ? 18.133  67.710  87.243  1.00 42.31  ? 834 POG A C19 1 
HETATM 9899  C C20 . POG E 2 .   ? 22.283  70.231  87.907  1.00 70.00  ? 834 POG A C20 1 
HETATM 9900  O O2  . POG F 2 .   ? 19.470  83.334  88.218  1.00 37.98  ? 834 POG B O2  1 
HETATM 9901  C C5  . POG F 2 .   ? 20.848  83.571  88.328  1.00 47.80  ? 834 POG B C5  1 
HETATM 9902  O O4  . POG F 2 .   ? 25.955  76.598  81.767  1.00 55.29  ? 834 POG B O4  1 
HETATM 9903  C C9  . POG F 2 .   ? 26.156  77.890  82.309  1.00 64.63  ? 834 POG B C9  1 
HETATM 9904  C C10 . POG F 2 .   ? 26.713  79.072  81.466  1.00 59.54  ? 834 POG B C10 1 
HETATM 9905  O O5  . POG F 2 .   ? 26.740  80.303  82.111  1.00 62.44  ? 834 POG B O5  1 
HETATM 9906  C C11 . POG F 2 .   ? 25.589  81.096  82.142  1.00 49.32  ? 834 POG B C11 1 
HETATM 9907  C C12 . POG F 2 .   ? 25.529  82.218  83.167  1.00 50.50  ? 834 POG B C12 1 
HETATM 9908  O O6  . POG F 2 .   ? 24.433  82.131  84.013  1.00 58.39  ? 834 POG B O6  1 
HETATM 9909  C C13 . POG F 2 .   ? 24.365  83.023  85.089  1.00 63.59  ? 834 POG B C13 1 
HETATM 9910  C C14 . POG F 2 .   ? 23.553  82.598  86.340  1.00 62.94  ? 834 POG B C14 1 
HETATM 9911  O O7  . POG F 2 .   ? 22.991  83.681  87.013  1.00 54.58  ? 834 POG B O7  1 
HETATM 9912  C C15 . POG F 2 .   ? 21.581  83.763  86.979  1.00 51.63  ? 834 POG B C15 1 
HETATM 9913  C C16 . POG F 2 .   ? 21.566  82.608  89.200  1.00 62.28  ? 834 POG B C16 1 
HETATM 9914  C C17 . POG F 2 .   ? 22.557  81.495  86.069  1.00 67.92  ? 834 POG B C17 1 
HETATM 9915  C C18 . POG F 2 .   ? 25.703  83.619  82.593  1.00 54.95  ? 834 POG B C18 1 
HETATM 9916  C C19 . POG F 2 .   ? 27.978  78.811  80.691  1.00 53.51  ? 834 POG B C19 1 
HETATM 9917  X UNK . UNX G 3 .   ? 43.331  102.734 60.947  1.00 51.73  ? 834 UNX D UNK 1 
HETATM 9918  X UNK . UNX H 3 .   ? 41.618  101.328 61.360  1.00 42.68  ? 835 UNX D UNK 1 
HETATM 9919  X UNK . UNX I 3 .   ? 39.571  100.638 61.942  1.00 39.34  ? 836 UNX D UNK 1 
HETATM 9920  X UNK . UNX J 3 .   ? 37.253  100.528 62.512  1.00 43.63  ? 837 UNX D UNK 1 
HETATM 9921  X UNK . UNX K 3 .   ? 35.194  100.480 61.575  1.00 35.16  ? 838 UNX D UNK 1 
HETATM 9922  X UNK . UNX L 3 .   ? 34.837  100.422 59.195  1.00 33.40  ? 839 UNX D UNK 1 
HETATM 9923  X UNK . UNX M 3 .   ? 35.158  100.616 56.686  1.00 41.38  ? 840 UNX D UNK 1 
HETATM 9924  X UNK . UNX N 3 .   ? 36.799  101.286 54.724  1.00 47.02  ? 841 UNX D UNK 1 
HETATM 9925  O O   . HOH O 4 .   ? 20.280  63.121  95.019  1.00 23.47  ? 835 HOH A O   1 
HETATM 9926  O O   . HOH O 4 .   ? 14.646  51.418  90.428  1.00 13.97  ? 836 HOH A O   1 
HETATM 9927  O O   . HOH O 4 .   ? 2.623   54.296  84.832  1.00 22.20  ? 837 HOH A O   1 
HETATM 9928  O O   . HOH O 4 .   ? 27.644  34.531  99.381  1.00 13.66  ? 838 HOH A O   1 
HETATM 9929  O O   . HOH O 4 .   ? 2.026   68.836  91.376  1.00 27.74  ? 839 HOH A O   1 
HETATM 9930  O O   . HOH O 4 .   ? 30.129  57.338  94.846  1.00 31.41  ? 840 HOH A O   1 
HETATM 9931  O O   . HOH O 4 .   ? 14.155  65.979  94.655  1.00 28.99  ? 841 HOH A O   1 
HETATM 9932  O O   . HOH O 4 .   ? 20.378  65.260  90.932  1.00 25.05  ? 842 HOH A O   1 
HETATM 9933  O O   . HOH O 4 .   ? 0.498   57.442  107.968 1.00 47.47  ? 843 HOH A O   1 
HETATM 9934  O O   . HOH O 4 .   ? 2.498   71.413  103.910 1.00 26.16  ? 844 HOH A O   1 
HETATM 9935  O O   . HOH O 4 .   ? 6.572   54.074  84.599  1.00 29.53  ? 845 HOH A O   1 
HETATM 9936  O O   . HOH O 4 .   ? 25.027  52.620  104.793 1.00 30.26  ? 846 HOH A O   1 
HETATM 9937  O O   . HOH O 4 .   ? -5.743  62.390  100.770 1.00 31.94  ? 847 HOH A O   1 
HETATM 9938  O O   . HOH O 4 .   ? 19.041  37.450  104.013 1.00 36.00  ? 848 HOH A O   1 
HETATM 9939  O O   . HOH O 4 .   ? 23.314  34.047  110.144 1.00 53.26  ? 849 HOH A O   1 
HETATM 9940  O O   . HOH O 4 .   ? 30.700  75.348  96.172  1.00 26.29  ? 850 HOH A O   1 
HETATM 9941  O O   . HOH O 4 .   ? 10.374  38.107  95.763  1.00 31.59  ? 851 HOH A O   1 
HETATM 9942  O O   . HOH O 4 .   ? 25.076  36.770  100.247 1.00 18.80  ? 852 HOH A O   1 
HETATM 9943  O O   . HOH O 4 .   ? 8.406   56.194  110.191 1.00 22.36  ? 853 HOH A O   1 
HETATM 9944  O O   . HOH O 4 .   ? 14.802  61.538  92.062  1.00 31.65  ? 854 HOH A O   1 
HETATM 9945  O O   . HOH O 4 .   ? 24.654  67.260  105.595 1.00 45.97  ? 855 HOH A O   1 
HETATM 9946  O O   . HOH O 4 .   ? 25.297  66.813  113.533 1.00 47.45  ? 856 HOH A O   1 
HETATM 9947  O O   . HOH O 4 .   ? 9.821   76.790  95.074  1.00 34.17  ? 857 HOH A O   1 
HETATM 9948  O O   . HOH O 4 .   ? 13.208  41.493  91.999  1.00 40.81  ? 858 HOH A O   1 
HETATM 9949  O O   . HOH O 4 .   ? -1.992  61.400  112.705 1.00 52.43  ? 859 HOH A O   1 
HETATM 9950  O O   . HOH O 4 .   ? 12.568  68.535  112.760 1.00 29.87  ? 860 HOH A O   1 
HETATM 9951  O O   . HOH O 4 .   ? 15.738  38.405  121.185 1.00 46.40  ? 861 HOH A O   1 
HETATM 9952  O O   . HOH O 4 .   ? 9.625   57.228  125.485 1.00 52.00  ? 862 HOH A O   1 
HETATM 9953  O O   . HOH O 4 .   ? 30.834  33.327  111.297 1.00 45.93  ? 863 HOH A O   1 
HETATM 9954  O O   . HOH O 4 .   ? 27.368  30.747  103.766 1.00 30.89  ? 864 HOH A O   1 
HETATM 9955  O O   . HOH O 4 .   ? 27.622  41.111  95.168  1.00 28.34  ? 865 HOH A O   1 
HETATM 9956  O O   . HOH O 4 .   ? 21.445  56.888  84.271  1.00 38.83  ? 866 HOH A O   1 
HETATM 9957  O O   . HOH O 4 .   ? 32.294  56.168  96.329  1.00 45.27  ? 867 HOH A O   1 
HETATM 9958  O O   . HOH O 4 .   ? 7.977   46.266  88.112  1.00 36.66  ? 868 HOH A O   1 
HETATM 9959  O O   . HOH O 4 .   ? 4.378   78.464  106.219 1.00 44.79  ? 869 HOH A O   1 
HETATM 9960  O O   . HOH O 4 .   ? 32.898  54.213  94.194  1.00 36.34  ? 870 HOH A O   1 
HETATM 9961  O O   . HOH O 4 .   ? 15.721  60.829  89.939  1.00 40.00  ? 871 HOH A O   1 
HETATM 9962  O O   . HOH O 4 .   ? 3.896   69.725  88.168  1.00 44.58  ? 872 HOH A O   1 
HETATM 9963  O O   . HOH O 4 .   ? 22.629  37.147  101.778 1.00 40.70  ? 873 HOH A O   1 
HETATM 9964  O O   . HOH O 4 .   ? 18.769  67.579  114.570 1.00 38.23  ? 874 HOH A O   1 
HETATM 9965  O O   . HOH O 4 .   ? 18.973  57.783  91.327  1.00 25.90  ? 875 HOH A O   1 
HETATM 9966  O O   . HOH O 4 .   ? 16.300  42.313  94.968  1.00 31.32  ? 876 HOH A O   1 
HETATM 9967  O O   . HOH O 4 .   ? 4.874   70.551  84.498  1.00 31.89  ? 877 HOH A O   1 
HETATM 9968  O O   . HOH O 4 .   ? 1.970   49.796  103.030 1.00 39.71  ? 878 HOH A O   1 
HETATM 9969  O O   . HOH O 4 .   ? 2.610   73.884  106.025 1.00 30.25  ? 879 HOH A O   1 
HETATM 9970  O O   . HOH O 4 .   ? 12.882  69.186  119.378 1.00 40.74  ? 880 HOH A O   1 
HETATM 9971  O O   . HOH O 4 .   ? 3.346   62.805  92.552  1.00 31.67  ? 881 HOH A O   1 
HETATM 9972  O O   . HOH O 4 .   ? 32.910  51.193  99.643  1.00 40.44  ? 882 HOH A O   1 
HETATM 9973  O O   . HOH O 4 .   ? 30.952  30.634  104.121 1.00 31.37  ? 883 HOH A O   1 
HETATM 9974  O O   . HOH O 4 .   ? 18.011  36.821  106.217 1.00 35.13  ? 884 HOH A O   1 
HETATM 9975  O O   . HOH O 4 .   ? 2.410   47.750  85.464  1.00 39.57  ? 885 HOH A O   1 
HETATM 9976  O O   . HOH O 4 .   ? 15.139  36.813  102.751 1.00 38.50  ? 886 HOH A O   1 
HETATM 9977  O O   . HOH O 4 .   ? 2.539   76.826  105.807 1.00 43.20  ? 887 HOH A O   1 
HETATM 9978  O O   . HOH O 4 .   ? 10.091  63.420  129.124 1.00 43.84  ? 888 HOH A O   1 
HETATM 9979  O O   . HOH O 4 .   ? 25.656  33.820  100.879 1.00 31.54  ? 889 HOH A O   1 
HETATM 9980  O O   . HOH O 4 .   ? 18.335  66.118  95.202  1.00 39.83  ? 890 HOH A O   1 
HETATM 9981  O O   . HOH O 4 .   ? 13.598  37.019  97.609  1.00 41.42  ? 891 HOH A O   1 
HETATM 9982  O O   . HOH O 4 .   ? 16.137  67.515  95.475  1.00 28.87  ? 892 HOH A O   1 
HETATM 9983  O O   . HOH O 4 .   ? 14.134  64.154  92.109  1.00 37.78  ? 893 HOH A O   1 
HETATM 9984  O O   . HOH O 4 .   ? 10.301  66.870  112.025 1.00 36.71  ? 894 HOH A O   1 
HETATM 9985  O O   . HOH O 4 .   ? 15.680  39.703  97.927  1.00 42.16  ? 895 HOH A O   1 
HETATM 9986  O O   . HOH O 4 .   ? 10.345  59.442  87.932  1.00 37.59  ? 896 HOH A O   1 
HETATM 9987  O O   . HOH O 4 .   ? 17.294  65.492  98.440  1.00 31.90  ? 897 HOH A O   1 
HETATM 9988  O O   . HOH O 4 .   ? 15.739  64.652  96.440  1.00 22.60  ? 898 HOH A O   1 
HETATM 9989  O O   . HOH O 4 .   ? 19.772  41.277  96.959  1.00 26.52  ? 899 HOH A O   1 
HETATM 9990  O O   . HOH O 4 .   ? 13.381  57.868  87.307  1.00 31.45  ? 900 HOH A O   1 
HETATM 9991  O O   . HOH O 4 .   ? 23.115  47.688  128.447 1.00 41.54  ? 901 HOH A O   1 
HETATM 9992  O O   . HOH O 4 .   ? 4.630   66.595  85.939  1.00 33.89  ? 902 HOH A O   1 
HETATM 9993  O O   . HOH O 4 .   ? 13.116  39.661  96.931  1.00 51.08  ? 903 HOH A O   1 
HETATM 9994  O O   . HOH O 4 .   ? 9.806   60.263  125.009 1.00 48.49  ? 904 HOH A O   1 
HETATM 9995  O O   . HOH O 4 .   ? 35.136  46.133  108.501 1.00 47.16  ? 905 HOH A O   1 
HETATM 9996  O O   . HOH O 4 .   ? 20.939  57.849  104.626 1.00 38.25  ? 906 HOH A O   1 
HETATM 9997  O O   . HOH O 4 .   ? 25.981  66.772  109.002 1.00 48.17  ? 907 HOH A O   1 
HETATM 9998  O O   . HOH O 4 .   ? 16.926  60.799  109.398 1.00 39.18  ? 908 HOH A O   1 
HETATM 9999  O O   . HOH O 4 .   ? 27.990  50.631  107.699 1.00 35.34  ? 909 HOH A O   1 
HETATM 10000 O O   . HOH O 4 .   ? -10.563 69.242  104.513 1.00 41.28  ? 910 HOH A O   1 
HETATM 10001 O O   . HOH O 4 .   ? 16.303  72.536  87.332  1.00 44.53  ? 911 HOH A O   1 
HETATM 10002 O O   . HOH O 4 .   ? 29.704  44.794  104.100 1.00 32.31  ? 912 HOH A O   1 
HETATM 10003 O O   . HOH O 4 .   ? 28.729  43.873  94.258  1.00 45.16  ? 913 HOH A O   1 
HETATM 10004 O O   . HOH O 4 .   ? 27.043  51.761  92.914  1.00 34.64  ? 914 HOH A O   1 
HETATM 10005 O O   . HOH O 4 .   ? 15.749  44.521  93.204  1.00 37.18  ? 915 HOH A O   1 
HETATM 10006 O O   . HOH O 4 .   ? 3.776   36.230  110.714 1.00 49.02  ? 916 HOH A O   1 
HETATM 10007 O O   . HOH O 4 .   ? 29.387  64.631  92.825  1.00 42.73  ? 917 HOH A O   1 
HETATM 10008 O O   . HOH O 4 .   ? 16.086  61.250  86.209  1.00 38.06  ? 918 HOH A O   1 
HETATM 10009 O O   . HOH O 4 .   ? 21.989  51.532  89.903  1.00 38.70  ? 919 HOH A O   1 
HETATM 10010 O O   . HOH O 4 .   ? 22.175  61.088  101.428 1.00 41.03  ? 920 HOH A O   1 
HETATM 10011 O O   . HOH O 4 .   ? 15.706  45.494  88.713  1.00 34.28  ? 921 HOH A O   1 
HETATM 10012 O O   . HOH O 4 .   ? 23.092  53.617  89.584  1.00 44.49  ? 922 HOH A O   1 
HETATM 10013 O O   . HOH O 4 .   ? 31.314  44.623  93.229  1.00 45.07  ? 923 HOH A O   1 
HETATM 10014 O O   . HOH O 4 .   ? 32.650  36.849  114.111 1.00 34.41  ? 924 HOH A O   1 
HETATM 10015 O O   . HOH O 4 .   ? 17.047  41.945  97.331  1.00 22.27  ? 925 HOH A O   1 
HETATM 10016 O O   . HOH O 4 .   ? 30.694  48.461  107.505 1.00 29.06  ? 926 HOH A O   1 
HETATM 10017 O O   . HOH O 4 .   ? 26.259  34.050  96.993  1.00 35.67  ? 927 HOH A O   1 
HETATM 10018 O O   . HOH P 4 .   ? 26.274  100.858 91.163  1.00 15.69  ? 500 HOH B O   1 
HETATM 10019 O O   . HOH P 4 .   ? 18.206  80.734  87.543  1.00 35.68  ? 835 HOH B O   1 
HETATM 10020 O O   . HOH P 4 .   ? 19.867  88.719  94.770  1.00 16.65  ? 836 HOH B O   1 
HETATM 10021 O O   . HOH P 4 .   ? 36.497  95.147  110.716 1.00 42.77  ? 837 HOH B O   1 
HETATM 10022 O O   . HOH P 4 .   ? 15.968  85.171  101.577 1.00 40.73  ? 838 HOH B O   1 
HETATM 10023 O O   . HOH P 4 .   ? 22.004  85.941  95.377  1.00 37.96  ? 839 HOH B O   1 
HETATM 10024 O O   . HOH P 4 .   ? 20.555  86.905  90.803  1.00 21.15  ? 840 HOH B O   1 
HETATM 10025 O O   . HOH P 4 .   ? 29.350  95.766  111.805 1.00 29.06  ? 841 HOH B O   1 
HETATM 10026 O O   . HOH P 4 .   ? 21.203  91.150  109.831 1.00 26.46  ? 842 HOH B O   1 
HETATM 10027 O O   . HOH P 4 .   ? 13.790  99.063  103.946 1.00 34.29  ? 843 HOH B O   1 
HETATM 10028 O O   . HOH P 4 .   ? 7.893   78.873  94.232  1.00 46.36  ? 844 HOH B O   1 
HETATM 10029 O O   . HOH P 4 .   ? 12.762  75.628  91.621  1.00 45.47  ? 845 HOH B O   1 
HETATM 10030 O O   . HOH P 4 .   ? 18.992  100.221 89.533  1.00 28.76  ? 846 HOH B O   1 
HETATM 10031 O O   . HOH P 4 .   ? 25.844  111.008 93.630  1.00 30.72  ? 847 HOH B O   1 
HETATM 10032 O O   . HOH P 4 .   ? 24.054  84.630  95.953  1.00 23.08  ? 848 HOH B O   1 
HETATM 10033 O O   . HOH P 4 .   ? 28.193  100.612 84.855  1.00 12.97  ? 849 HOH B O   1 
HETATM 10034 O O   . HOH P 4 .   ? 19.537  114.549 104.543 1.00 30.85  ? 850 HOH B O   1 
HETATM 10035 O O   . HOH P 4 .   ? 38.629  83.500  93.896  1.00 32.75  ? 851 HOH B O   1 
HETATM 10036 O O   . HOH P 4 .   ? 9.973   94.457  93.542  1.00 37.65  ? 852 HOH B O   1 
HETATM 10037 O O   . HOH P 4 .   ? 36.586  81.218  106.615 1.00 29.31  ? 853 HOH B O   1 
HETATM 10038 O O   . HOH P 4 .   ? 12.137  111.036 94.537  1.00 36.00  ? 854 HOH B O   1 
HETATM 10039 O O   . HOH P 4 .   ? 24.270  107.806 93.945  1.00 31.16  ? 855 HOH B O   1 
HETATM 10040 O O   . HOH P 4 .   ? 19.373  113.497 97.964  1.00 37.98  ? 856 HOH B O   1 
HETATM 10041 O O   . HOH P 4 .   ? 39.007  104.727 88.132  1.00 54.78  ? 857 HOH B O   1 
HETATM 10042 O O   . HOH P 4 .   ? 11.870  108.683 92.994  1.00 39.13  ? 858 HOH B O   1 
HETATM 10043 O O   . HOH P 4 .   ? 7.843   104.549 103.509 1.00 33.56  ? 859 HOH B O   1 
HETATM 10044 O O   . HOH P 4 .   ? 17.544  104.172 93.311  1.00 37.53  ? 860 HOH B O   1 
HETATM 10045 O O   . HOH P 4 .   ? 34.621  94.461  86.592  1.00 26.98  ? 861 HOH B O   1 
HETATM 10046 O O   . HOH P 4 .   ? 19.443  90.794  103.519 1.00 38.61  ? 862 HOH B O   1 
HETATM 10047 O O   . HOH P 4 .   ? 24.935  90.789  86.605  1.00 31.08  ? 863 HOH B O   1 
HETATM 10048 O O   . HOH P 4 .   ? 8.850   106.937 102.610 1.00 31.20  ? 864 HOH B O   1 
HETATM 10049 O O   . HOH P 4 .   ? 17.015  92.964  100.648 1.00 49.36  ? 865 HOH B O   1 
HETATM 10050 O O   . HOH P 4 .   ? 27.884  84.884  113.240 1.00 36.00  ? 866 HOH B O   1 
HETATM 10051 O O   . HOH P 4 .   ? 14.279  117.979 109.569 1.00 40.38  ? 867 HOH B O   1 
HETATM 10052 O O   . HOH P 4 .   ? 20.795  94.283  85.055  1.00 45.44  ? 868 HOH B O   1 
HETATM 10053 O O   . HOH P 4 .   ? 9.364   97.865  105.421 1.00 46.48  ? 869 HOH B O   1 
HETATM 10054 O O   . HOH P 4 .   ? 37.166  85.828  87.735  1.00 33.23  ? 870 HOH B O   1 
HETATM 10055 O O   . HOH P 4 .   ? 14.600  84.802  104.574 1.00 49.69  ? 871 HOH B O   1 
HETATM 10056 O O   . HOH P 4 .   ? 14.736  114.911 99.600  1.00 40.67  ? 872 HOH B O   1 
HETATM 10057 O O   . HOH P 4 .   ? 27.004  91.484  89.041  1.00 30.92  ? 873 HOH B O   1 
HETATM 10058 O O   . HOH P 4 .   ? 17.364  94.184  103.729 1.00 32.12  ? 874 HOH B O   1 
HETATM 10059 O O   . HOH P 4 .   ? 43.286  91.753  96.740  1.00 39.28  ? 875 HOH B O   1 
HETATM 10060 O O   . HOH P 4 .   ? 25.750  83.558  113.669 1.00 33.11  ? 876 HOH B O   1 
HETATM 10061 O O   . HOH P 4 .   ? 17.710  98.163  89.124  1.00 36.91  ? 877 HOH B O   1 
HETATM 10062 O O   . HOH P 4 .   ? 21.689  94.439  91.578  1.00 43.80  ? 878 HOH B O   1 
HETATM 10063 O O   . HOH P 4 .   ? 11.040  96.193  90.969  1.00 48.74  ? 879 HOH B O   1 
HETATM 10064 O O   . HOH P 4 .   ? 30.994  93.938  88.646  1.00 39.81  ? 880 HOH B O   1 
HETATM 10065 O O   . HOH P 4 .   ? 42.267  78.101  93.703  1.00 38.34  ? 881 HOH B O   1 
HETATM 10066 O O   . HOH P 4 .   ? 37.922  106.989 94.064  1.00 39.98  ? 882 HOH B O   1 
HETATM 10067 O O   . HOH P 4 .   ? 26.734  87.665  93.089  1.00 37.14  ? 883 HOH B O   1 
HETATM 10068 O O   . HOH P 4 .   ? 8.320   122.377 106.763 1.00 45.45  ? 884 HOH B O   1 
HETATM 10069 O O   . HOH P 4 .   ? 20.255  115.057 107.158 1.00 32.54  ? 885 HOH B O   1 
HETATM 10070 O O   . HOH P 4 .   ? 19.461  110.451 97.031  1.00 35.29  ? 886 HOH B O   1 
HETATM 10071 O O   . HOH P 4 .   ? 17.196  114.164 101.435 1.00 29.30  ? 887 HOH B O   1 
HETATM 10072 O O   . HOH P 4 .   ? 41.359  91.771  102.655 1.00 27.42  ? 888 HOH B O   1 
HETATM 10073 O O   . HOH P 4 .   ? 13.622  97.707  91.616  1.00 35.97  ? 889 HOH B O   1 
HETATM 10074 O O   . HOH P 4 .   ? 27.182  94.203  85.489  1.00 34.29  ? 890 HOH B O   1 
HETATM 10075 O O   . HOH P 4 .   ? 39.888  98.250  88.219  1.00 46.38  ? 891 HOH B O   1 
HETATM 10076 O O   . HOH P 4 .   ? 14.947  94.871  104.035 1.00 48.20  ? 892 HOH B O   1 
HETATM 10077 O O   . HOH P 4 .   ? 16.796  100.423 90.442  1.00 29.15  ? 893 HOH B O   1 
HETATM 10078 O O   . HOH P 4 .   ? 35.937  77.606  112.040 1.00 49.06  ? 894 HOH B O   1 
HETATM 10079 O O   . HOH P 4 .   ? 28.220  94.097  88.170  1.00 36.42  ? 895 HOH B O   1 
HETATM 10080 O O   . HOH P 4 .   ? 17.792  90.408  101.379 1.00 32.57  ? 896 HOH B O   1 
HETATM 10081 O O   . HOH P 4 .   ? 25.966  90.294  92.714  1.00 31.71  ? 897 HOH B O   1 
HETATM 10082 O O   . HOH P 4 .   ? 41.759  101.820 93.505  1.00 39.23  ? 898 HOH B O   1 
HETATM 10083 O O   . HOH P 4 .   ? 8.383   102.763 105.382 1.00 29.26  ? 899 HOH B O   1 
HETATM 10084 O O   . HOH P 4 .   ? 11.137  95.840  100.763 1.00 32.45  ? 900 HOH B O   1 
HETATM 10085 O O   . HOH P 4 .   ? 24.470  87.675  97.329  1.00 22.70  ? 901 HOH B O   1 
HETATM 10086 O O   . HOH P 4 .   ? 35.024  104.373 130.061 1.00 56.68  ? 902 HOH B O   1 
HETATM 10087 O O   . HOH P 4 .   ? 4.701   113.957 111.688 1.00 51.99  ? 903 HOH B O   1 
HETATM 10088 O O   . HOH P 4 .   ? 33.088  107.383 119.840 1.00 43.98  ? 904 HOH B O   1 
HETATM 10089 O O   . HOH P 4 .   ? 29.297  106.006 86.930  1.00 40.59  ? 905 HOH B O   1 
HETATM 10090 O O   . HOH P 4 .   ? 36.845  89.431  94.414  1.00 32.72  ? 906 HOH B O   1 
HETATM 10091 O O   . HOH P 4 .   ? 37.498  88.865  107.261 1.00 32.04  ? 907 HOH B O   1 
HETATM 10092 O O   . HOH P 4 .   ? 20.311  97.210  85.487  1.00 30.45  ? 908 HOH B O   1 
HETATM 10093 O O   . HOH P 4 .   ? 34.647  105.469 87.377  1.00 31.42  ? 909 HOH B O   1 
HETATM 10094 O O   . HOH P 4 .   ? 10.184  100.930 106.054 1.00 39.42  ? 910 HOH B O   1 
HETATM 10095 O O   . HOH P 4 .   ? 26.684  96.092  83.887  1.00 32.72  ? 911 HOH B O   1 
HETATM 10096 O O   . HOH P 4 .   ? 11.813  118.294 100.358 1.00 30.43  ? 912 HOH B O   1 
HETATM 10097 O O   . HOH P 4 .   ? 28.671  114.122 97.038  1.00 34.65  ? 913 HOH B O   1 
HETATM 10098 O O   . HOH P 4 .   ? 30.921  77.698  92.337  1.00 40.97  ? 914 HOH B O   1 
HETATM 10099 O O   . HOH P 4 .   ? 22.700  86.333  98.766  1.00 38.00  ? 915 HOH B O   1 
HETATM 10100 O O   . HOH P 4 .   ? 25.758  105.854 108.558 1.00 41.08  ? 916 HOH B O   1 
HETATM 10101 O O   . HOH P 4 .   ? 25.513  82.820  118.909 1.00 34.97  ? 917 HOH B O   1 
HETATM 10102 O O   . HOH P 4 .   ? 10.972  89.358  90.533  1.00 42.83  ? 918 HOH B O   1 
HETATM 10103 O O   . HOH P 4 .   ? 27.080  103.924 108.715 1.00 43.51  ? 919 HOH B O   1 
HETATM 10104 O O   . HOH P 4 .   ? 6.610   103.534 106.664 1.00 46.82  ? 920 HOH B O   1 
HETATM 10105 O O   . HOH P 4 .   ? 10.313  113.254 93.592  1.00 32.76  ? 921 HOH B O   1 
HETATM 10106 O O   . HOH P 4 .   ? 12.165  115.374 92.460  1.00 41.47  ? 922 HOH B O   1 
HETATM 10107 O O   . HOH P 4 .   ? 5.764   107.915 97.287  1.00 43.75  ? 923 HOH B O   1 
HETATM 10108 O O   . HOH P 4 .   ? 19.176  117.466 107.235 1.00 49.09  ? 924 HOH B O   1 
HETATM 10109 O O   . HOH P 4 .   ? 14.267  93.911  109.004 1.00 40.51  ? 925 HOH B O   1 
HETATM 10110 O O   . HOH P 4 .   ? 40.908  111.293 111.500 1.00 33.89  ? 926 HOH B O   1 
HETATM 10111 O O   . HOH P 4 .   ? 43.376  110.712 108.280 1.00 48.63  ? 927 HOH B O   1 
HETATM 10112 O O   . HOH P 4 .   ? 23.013  112.600 99.000  1.00 43.33  ? 928 HOH B O   1 
HETATM 10113 O O   . HOH P 4 .   ? 33.020  77.020  94.114  1.00 45.56  ? 929 HOH B O   1 
HETATM 10114 O O   . HOH P 4 .   ? 11.300  86.640  91.875  1.00 46.81  ? 930 HOH B O   1 
HETATM 10115 O O   . HOH P 4 .   ? 40.029  91.113  114.894 1.00 41.89  ? 931 HOH B O   1 
HETATM 10116 O O   . HOH P 4 .   ? 12.596  113.162 122.413 1.00 36.09  ? 932 HOH B O   1 
HETATM 10117 O O   . HOH P 4 .   ? 45.182  76.331  96.125  1.00 46.77  ? 933 HOH B O   1 
HETATM 10118 O O   . HOH P 4 .   ? 22.399  110.133 97.895  1.00 26.96  ? 934 HOH B O   1 
HETATM 10119 O O   . HOH P 4 .   ? 7.763   113.028 92.728  1.00 36.08  ? 935 HOH B O   1 
HETATM 10120 O O   . HOH P 4 .   ? 7.597   101.343 92.624  1.00 47.70  ? 936 HOH B O   1 
HETATM 10121 O O   . HOH P 4 .   ? 14.137  77.386  107.818 1.00 55.23  ? 937 HOH B O   1 
HETATM 10122 O O   . HOH P 4 .   ? 31.448  88.278  120.647 1.00 48.79  ? 938 HOH B O   1 
HETATM 10123 O O   . HOH Q 4 .   ? 5.835   55.442  78.189  1.00 16.55  ? 834 HOH C O   1 
HETATM 10124 O O   . HOH Q 4 .   ? 11.070  67.754  74.159  1.00 13.29  ? 835 HOH C O   1 
HETATM 10125 O O   . HOH Q 4 .   ? 13.335  54.996  58.210  1.00 31.07  ? 836 HOH C O   1 
HETATM 10126 O O   . HOH Q 4 .   ? 28.735  59.948  64.130  1.00 23.68  ? 837 HOH C O   1 
HETATM 10127 O O   . HOH Q 4 .   ? 12.719  68.364  78.364  1.00 22.31  ? 838 HOH C O   1 
HETATM 10128 O O   . HOH Q 4 .   ? 0.223   64.966  64.264  1.00 32.04  ? 839 HOH C O   1 
HETATM 10129 O O   . HOH Q 4 .   ? 21.617  54.767  76.098  1.00 22.77  ? 840 HOH C O   1 
HETATM 10130 O O   . HOH Q 4 .   ? -1.698  64.877  76.249  1.00 33.19  ? 841 HOH C O   1 
HETATM 10131 O O   . HOH Q 4 .   ? 23.785  53.785  63.978  1.00 29.03  ? 842 HOH C O   1 
HETATM 10132 O O   . HOH Q 4 .   ? 16.008  47.632  83.453  1.00 33.31  ? 843 HOH C O   1 
HETATM 10133 O O   . HOH Q 4 .   ? 16.002  63.239  76.925  1.00 26.93  ? 844 HOH C O   1 
HETATM 10134 O O   . HOH Q 4 .   ? -9.172  67.259  59.561  1.00 48.82  ? 845 HOH C O   1 
HETATM 10135 O O   . HOH Q 4 .   ? 24.622  57.471  81.943  1.00 36.81  ? 846 HOH C O   1 
HETATM 10136 O O   . HOH Q 4 .   ? 26.709  59.068  80.521  1.00 35.26  ? 847 HOH C O   1 
HETATM 10137 O O   . HOH Q 4 .   ? 8.845   36.379  59.241  1.00 33.96  ? 848 HOH C O   1 
HETATM 10138 O O   . HOH Q 4 .   ? 15.004  67.133  70.768  1.00 30.20  ? 849 HOH C O   1 
HETATM 10139 O O   . HOH Q 4 .   ? 14.413  67.814  74.016  1.00 28.61  ? 850 HOH C O   1 
HETATM 10140 O O   . HOH Q 4 .   ? -21.341 56.863  62.428  1.00 33.49  ? 851 HOH C O   1 
HETATM 10141 O O   . HOH Q 4 .   ? -6.975  66.283  62.976  1.00 41.30  ? 852 HOH C O   1 
HETATM 10142 O O   . HOH Q 4 .   ? 1.114   61.220  79.082  1.00 44.91  ? 853 HOH C O   1 
HETATM 10143 O O   . HOH Q 4 .   ? -2.269  59.779  75.545  1.00 45.12  ? 854 HOH C O   1 
HETATM 10144 O O   . HOH Q 4 .   ? 23.430  52.473  75.592  1.00 32.82  ? 855 HOH C O   1 
HETATM 10145 O O   . HOH Q 4 .   ? 9.459   66.003  64.803  1.00 32.95  ? 856 HOH C O   1 
HETATM 10146 O O   . HOH Q 4 .   ? -17.266 64.884  62.008  1.00 35.13  ? 857 HOH C O   1 
HETATM 10147 O O   . HOH Q 4 .   ? -0.928  68.482  48.394  1.00 34.20  ? 858 HOH C O   1 
HETATM 10148 O O   . HOH Q 4 .   ? 17.032  67.369  73.588  1.00 27.22  ? 859 HOH C O   1 
HETATM 10149 O O   . HOH Q 4 .   ? 6.394   63.715  83.846  1.00 36.24  ? 860 HOH C O   1 
HETATM 10150 O O   . HOH Q 4 .   ? 39.266  52.416  70.650  1.00 40.51  ? 861 HOH C O   1 
HETATM 10151 O O   . HOH Q 4 .   ? 20.470  63.261  57.046  1.00 27.81  ? 862 HOH C O   1 
HETATM 10152 O O   . HOH Q 4 .   ? 17.771  41.999  48.272  1.00 39.22  ? 863 HOH C O   1 
HETATM 10153 O O   . HOH Q 4 .   ? 8.019   62.644  77.685  1.00 25.75  ? 864 HOH C O   1 
HETATM 10154 O O   . HOH Q 4 .   ? -12.472 66.442  49.876  1.00 39.24  ? 865 HOH C O   1 
HETATM 10155 O O   . HOH Q 4 .   ? -18.593 56.104  66.043  1.00 47.01  ? 866 HOH C O   1 
HETATM 10156 O O   . HOH Q 4 .   ? 11.494  43.440  82.072  1.00 42.69  ? 867 HOH C O   1 
HETATM 10157 O O   . HOH Q 4 .   ? 28.580  68.175  74.115  1.00 31.21  ? 868 HOH C O   1 
HETATM 10158 O O   . HOH Q 4 .   ? 5.616   64.489  67.214  1.00 32.12  ? 869 HOH C O   1 
HETATM 10159 O O   . HOH Q 4 .   ? 32.171  53.161  76.746  1.00 47.12  ? 870 HOH C O   1 
HETATM 10160 O O   . HOH Q 4 .   ? 8.412   35.447  63.207  1.00 41.13  ? 871 HOH C O   1 
HETATM 10161 O O   . HOH Q 4 .   ? -3.509  66.211  61.305  1.00 41.55  ? 872 HOH C O   1 
HETATM 10162 O O   . HOH Q 4 .   ? 13.495  62.241  76.950  1.00 27.51  ? 873 HOH C O   1 
HETATM 10163 O O   . HOH Q 4 .   ? 27.356  57.287  77.002  1.00 39.65  ? 874 HOH C O   1 
HETATM 10164 O O   . HOH Q 4 .   ? 23.434  50.251  54.870  1.00 48.37  ? 875 HOH C O   1 
HETATM 10165 O O   . HOH Q 4 .   ? 11.837  62.664  79.035  1.00 35.83  ? 876 HOH C O   1 
HETATM 10166 O O   . HOH Q 4 .   ? 10.802  68.140  50.015  1.00 38.55  ? 877 HOH C O   1 
HETATM 10167 O O   . HOH Q 4 .   ? 11.701  73.205  65.193  1.00 43.99  ? 878 HOH C O   1 
HETATM 10168 O O   . HOH Q 4 .   ? -11.821 54.338  68.206  1.00 44.56  ? 879 HOH C O   1 
HETATM 10169 O O   . HOH Q 4 .   ? 24.755  69.999  58.785  1.00 40.92  ? 880 HOH C O   1 
HETATM 10170 O O   . HOH Q 4 .   ? 17.397  64.667  74.506  1.00 28.37  ? 881 HOH C O   1 
HETATM 10171 O O   . HOH Q 4 .   ? 8.778   67.731  67.220  1.00 36.86  ? 882 HOH C O   1 
HETATM 10172 O O   . HOH Q 4 .   ? 6.484   65.376  64.688  1.00 49.99  ? 883 HOH C O   1 
HETATM 10173 O O   . HOH Q 4 .   ? -2.690  68.691  62.170  1.00 45.69  ? 884 HOH C O   1 
HETATM 10174 O O   . HOH Q 4 .   ? 27.279  47.205  67.399  1.00 32.21  ? 885 HOH C O   1 
HETATM 10175 O O   . HOH Q 4 .   ? 23.847  52.804  78.041  1.00 28.65  ? 886 HOH C O   1 
HETATM 10176 O O   . HOH Q 4 .   ? 23.863  48.414  74.537  1.00 31.36  ? 887 HOH C O   1 
HETATM 10177 O O   . HOH Q 4 .   ? 11.956  58.403  81.297  1.00 37.71  ? 888 HOH C O   1 
HETATM 10178 O O   . HOH Q 4 .   ? 15.202  64.863  72.340  1.00 23.57  ? 889 HOH C O   1 
HETATM 10179 O O   . HOH Q 4 .   ? 8.090   46.204  82.734  1.00 37.42  ? 890 HOH C O   1 
HETATM 10180 O O   . HOH Q 4 .   ? -3.146  63.808  40.436  1.00 37.84  ? 891 HOH C O   1 
HETATM 10181 O O   . HOH Q 4 .   ? 22.936  67.222  55.323  1.00 34.54  ? 892 HOH C O   1 
HETATM 10182 O O   . HOH Q 4 .   ? 12.596  62.880  83.073  1.00 38.53  ? 893 HOH C O   1 
HETATM 10183 O O   . HOH Q 4 .   ? 21.997  64.479  49.921  1.00 49.72  ? 894 HOH C O   1 
HETATM 10184 O O   . HOH Q 4 .   ? 25.027  68.220  56.722  1.00 47.13  ? 895 HOH C O   1 
HETATM 10185 O O   . HOH Q 4 .   ? -4.688  43.703  65.223  1.00 57.37  ? 896 HOH C O   1 
HETATM 10186 O O   . HOH Q 4 .   ? 6.747   67.039  68.509  1.00 43.18  ? 897 HOH C O   1 
HETATM 10187 O O   . HOH Q 4 .   ? 3.282   50.531  82.270  1.00 36.46  ? 898 HOH C O   1 
HETATM 10188 O O   . HOH Q 4 .   ? 7.743   38.628  71.611  1.00 32.90  ? 899 HOH C O   1 
HETATM 10189 O O   . HOH Q 4 .   ? 4.201   44.159  42.052  1.00 51.89  ? 900 HOH C O   1 
HETATM 10190 O O   . HOH Q 4 .   ? 15.005  52.247  40.892  1.00 30.53  ? 901 HOH C O   1 
HETATM 10191 O O   . HOH Q 4 .   ? 18.878  73.115  56.861  1.00 37.60  ? 902 HOH C O   1 
HETATM 10192 O O   . HOH Q 4 .   ? 5.874   40.327  70.105  1.00 38.81  ? 903 HOH C O   1 
HETATM 10193 O O   . HOH Q 4 .   ? 17.998  71.351  49.835  1.00 40.97  ? 904 HOH C O   1 
HETATM 10194 O O   . HOH Q 4 .   ? 15.450  39.450  76.990  1.00 43.43  ? 905 HOH C O   1 
HETATM 10195 O O   . HOH Q 4 .   ? 22.192  62.911  42.846  1.00 53.74  ? 906 HOH C O   1 
HETATM 10196 O O   . HOH Q 4 .   ? 6.877   73.215  64.227  1.00 53.85  ? 907 HOH C O   1 
HETATM 10197 O O   . HOH Q 4 .   ? 7.592   76.220  76.588  1.00 45.60  ? 908 HOH C O   1 
HETATM 10198 O O   . HOH Q 4 .   ? 13.027  60.930  80.872  1.00 34.65  ? 909 HOH C O   1 
HETATM 10199 O O   . HOH Q 4 .   ? 22.195  43.991  53.805  1.00 36.85  ? 910 HOH C O   1 
HETATM 10200 O O   . HOH Q 4 .   ? 32.051  60.740  79.406  1.00 46.04  ? 911 HOH C O   1 
HETATM 10201 O O   . HOH Q 4 .   ? 11.570  77.623  80.636  1.00 56.67  ? 912 HOH C O   1 
HETATM 10202 O O   . HOH Q 4 .   ? 9.654   76.819  78.470  1.00 44.98  ? 913 HOH C O   1 
HETATM 10203 O O   . HOH Q 4 .   ? -7.133  66.644  60.609  1.00 33.02  ? 914 HOH C O   1 
HETATM 10204 O O   . HOH Q 4 .   ? 4.158   66.843  64.314  1.00 47.62  ? 915 HOH C O   1 
HETATM 10205 O O   . HOH Q 4 .   ? 28.321  65.353  76.198  1.00 44.60  ? 916 HOH C O   1 
HETATM 10206 O O   . HOH Q 4 .   ? 7.025   45.333  75.261  1.00 39.60  ? 917 HOH C O   1 
HETATM 10207 O O   . HOH Q 4 .   ? 28.573  58.230  54.895  1.00 49.31  ? 918 HOH C O   1 
HETATM 10208 O O   . HOH Q 4 .   ? 22.729  67.679  83.980  1.00 44.45  ? 919 HOH C O   1 
HETATM 10209 O O   . HOH Q 4 .   ? 17.610  50.748  59.953  1.00 30.82  ? 920 HOH C O   1 
HETATM 10210 O O   . HOH R 4 .   ? 13.397  92.092  64.657  1.00 25.04  ? 842 HOH D O   1 
HETATM 10211 O O   . HOH R 4 .   ? 28.631  97.195  59.299  1.00 18.84  ? 843 HOH D O   1 
HETATM 10212 O O   . HOH R 4 .   ? 35.875  95.963  79.423  1.00 19.20  ? 844 HOH D O   1 
HETATM 10213 O O   . HOH R 4 .   ? 25.558  103.741 84.199  1.00 16.69  ? 845 HOH D O   1 
HETATM 10214 O O   . HOH R 4 .   ? 18.207  98.418  64.555  1.00 22.10  ? 846 HOH D O   1 
HETATM 10215 O O   . HOH R 4 .   ? 28.961  83.102  78.706  1.00 36.64  ? 847 HOH D O   1 
HETATM 10216 O O   . HOH R 4 .   ? 41.925  86.947  65.017  1.00 36.67  ? 848 HOH D O   1 
HETATM 10217 O O   . HOH R 4 .   ? 26.590  111.204 61.805  1.00 35.81  ? 849 HOH D O   1 
HETATM 10218 O O   . HOH R 4 .   ? 30.402  78.324  64.093  1.00 48.61  ? 850 HOH D O   1 
HETATM 10219 O O   . HOH R 4 .   ? 18.745  101.956 56.551  1.00 46.93  ? 851 HOH D O   1 
HETATM 10220 O O   . HOH R 4 .   ? 27.730  89.227  77.099  1.00 41.30  ? 852 HOH D O   1 
HETATM 10221 O O   . HOH R 4 .   ? 40.546  89.832  79.905  1.00 31.38  ? 853 HOH D O   1 
HETATM 10222 O O   . HOH R 4 .   ? 14.583  94.444  77.399  1.00 36.45  ? 854 HOH D O   1 
HETATM 10223 O O   . HOH R 4 .   ? 3.265   86.774  67.758  1.00 42.92  ? 855 HOH D O   1 
HETATM 10224 O O   . HOH R 4 .   ? 34.989  115.542 74.296  1.00 46.43  ? 856 HOH D O   1 
HETATM 10225 O O   . HOH R 4 .   ? 30.570  87.853  60.136  1.00 49.19  ? 857 HOH D O   1 
HETATM 10226 O O   . HOH R 4 .   ? 20.271  96.914  76.651  1.00 26.67  ? 858 HOH D O   1 
HETATM 10227 O O   . HOH R 4 .   ? 12.786  94.530  64.434  1.00 24.46  ? 859 HOH D O   1 
HETATM 10228 O O   . HOH R 4 .   ? 24.624  84.410  74.075  1.00 28.59  ? 860 HOH D O   1 
HETATM 10229 O O   . HOH R 4 .   ? 31.214  67.738  61.830  1.00 43.68  ? 861 HOH D O   1 
HETATM 10230 O O   . HOH R 4 .   ? 26.965  84.662  71.199  1.00 22.40  ? 862 HOH D O   1 
HETATM 10231 O O   . HOH R 4 .   ? 27.368  83.760  74.637  1.00 40.24  ? 863 HOH D O   1 
HETATM 10232 O O   . HOH R 4 .   ? 26.593  91.647  81.983  1.00 38.28  ? 864 HOH D O   1 
HETATM 10233 O O   . HOH R 4 .   ? 18.456  99.112  76.876  1.00 30.00  ? 865 HOH D O   1 
HETATM 10234 O O   . HOH R 4 .   ? 27.971  94.818  82.178  1.00 33.62  ? 866 HOH D O   1 
HETATM 10235 O O   . HOH R 4 .   ? 44.285  104.262 72.791  1.00 42.79  ? 867 HOH D O   1 
HETATM 10236 O O   . HOH R 4 .   ? 21.874  89.106  57.595  1.00 24.21  ? 868 HOH D O   1 
HETATM 10237 O O   . HOH R 4 .   ? 18.832  102.588 69.202  1.00 24.83  ? 869 HOH D O   1 
HETATM 10238 O O   . HOH R 4 .   ? 24.877  111.111 49.897  1.00 44.38  ? 870 HOH D O   1 
HETATM 10239 O O   . HOH R 4 .   ? 44.158  91.406  76.531  1.00 38.93  ? 871 HOH D O   1 
HETATM 10240 O O   . HOH R 4 .   ? 44.236  97.168  77.829  1.00 32.19  ? 872 HOH D O   1 
HETATM 10241 O O   . HOH R 4 .   ? 14.153  99.009  55.900  1.00 63.54  ? 873 HOH D O   1 
HETATM 10242 O O   . HOH R 4 .   ? 25.597  73.123  61.873  1.00 41.32  ? 874 HOH D O   1 
HETATM 10243 O O   . HOH R 4 .   ? 30.278  69.503  59.988  1.00 47.15  ? 875 HOH D O   1 
HETATM 10244 O O   . HOH R 4 .   ? 14.779  92.544  80.527  1.00 42.40  ? 876 HOH D O   1 
HETATM 10245 O O   . HOH R 4 .   ? 13.341  83.373  74.657  1.00 34.54  ? 877 HOH D O   1 
HETATM 10246 O O   . HOH R 4 .   ? 34.207  104.999 84.397  1.00 36.35  ? 878 HOH D O   1 
HETATM 10247 O O   . HOH R 4 .   ? 19.640  90.781  43.712  1.00 42.00  ? 879 HOH D O   1 
HETATM 10248 O O   . HOH R 4 .   ? 17.434  93.989  82.815  1.00 34.79  ? 880 HOH D O   1 
HETATM 10249 O O   . HOH R 4 .   ? 35.263  112.140 69.500  1.00 29.85  ? 881 HOH D O   1 
HETATM 10250 O O   . HOH R 4 .   ? 24.723  86.798  75.076  1.00 23.48  ? 882 HOH D O   1 
HETATM 10251 O O   . HOH R 4 .   ? 49.813  85.958  63.839  1.00 49.41  ? 883 HOH D O   1 
HETATM 10252 O O   . HOH R 4 .   ? 23.051  104.633 84.033  1.00 29.76  ? 884 HOH D O   1 
HETATM 10253 O O   . HOH R 4 .   ? 39.351  87.398  80.455  1.00 38.43  ? 885 HOH D O   1 
HETATM 10254 O O   . HOH R 4 .   ? 40.719  112.766 59.201  1.00 46.35  ? 886 HOH D O   1 
HETATM 10255 O O   . HOH R 4 .   ? 31.534  78.334  60.974  1.00 42.94  ? 887 HOH D O   1 
HETATM 10256 O O   . HOH R 4 .   ? 33.126  103.996 47.136  1.00 45.40  ? 888 HOH D O   1 
HETATM 10257 O O   . HOH R 4 .   ? 30.154  118.864 58.743  1.00 118.03 ? 889 HOH D O   1 
HETATM 10258 O O   . HOH R 4 .   ? 30.458  79.326  67.401  1.00 34.78  ? 890 HOH D O   1 
HETATM 10259 O O   . HOH R 4 .   ? 12.639  96.073  62.651  1.00 36.41  ? 891 HOH D O   1 
HETATM 10260 O O   . HOH R 4 .   ? 40.986  83.043  68.519  1.00 48.63  ? 892 HOH D O   1 
HETATM 10261 O O   . HOH R 4 .   ? 34.942  107.883 53.250  1.00 34.47  ? 893 HOH D O   1 
HETATM 10262 O O   . HOH R 4 .   ? 27.037  105.760 85.217  1.00 34.67  ? 894 HOH D O   1 
HETATM 10263 O O   . HOH R 4 .   ? 23.968  110.552 56.848  1.00 48.84  ? 895 HOH D O   1 
HETATM 10264 O O   . HOH R 4 .   ? 21.802  86.362  56.445  1.00 35.75  ? 896 HOH D O   1 
HETATM 10265 O O   . HOH R 4 .   ? 33.563  71.285  71.071  1.00 43.98  ? 897 HOH D O   1 
HETATM 10266 O O   . HOH R 4 .   ? 19.766  105.731 76.169  1.00 41.57  ? 898 HOH D O   1 
HETATM 10267 O O   . HOH R 4 .   ? 26.706  86.965  72.936  1.00 20.77  ? 899 HOH D O   1 
HETATM 10268 O O   . HOH R 4 .   ? 30.683  83.801  74.926  1.00 35.04  ? 900 HOH D O   1 
HETATM 10269 O O   . HOH R 4 .   ? 48.713  103.608 57.999  1.00 39.81  ? 901 HOH D O   1 
HETATM 10270 O O   . HOH R 4 .   ? 35.078  84.622  68.958  1.00 26.42  ? 902 HOH D O   1 
HETATM 10271 O O   . HOH R 4 .   ? 27.855  70.814  59.234  1.00 48.25  ? 903 HOH D O   1 
HETATM 10272 O O   . HOH R 4 .   ? 36.358  86.784  65.825  1.00 30.42  ? 904 HOH D O   1 
HETATM 10273 O O   . HOH R 4 .   ? 33.359  115.427 61.521  1.00 38.53  ? 905 HOH D O   1 
HETATM 10274 O O   . HOH R 4 .   ? 29.531  89.107  78.955  1.00 42.40  ? 906 HOH D O   1 
HETATM 10275 O O   . HOH R 4 .   ? 31.807  85.766  66.061  1.00 34.97  ? 907 HOH D O   1 
HETATM 10276 O O   . HOH R 4 .   ? 33.115  83.870  67.908  1.00 24.32  ? 908 HOH D O   1 
HETATM 10277 O O   . HOH R 4 .   ? 42.219  111.031 68.160  1.00 40.71  ? 909 HOH D O   1 
HETATM 10278 O O   . HOH R 4 .   ? 14.522  105.161 68.925  1.00 40.76  ? 910 HOH D O   1 
HETATM 10279 O O   . HOH R 4 .   ? 32.817  109.104 79.570  1.00 56.25  ? 911 HOH D O   1 
HETATM 10280 O O   . HOH R 4 .   ? 51.068  81.537  49.075  1.00 42.79  ? 912 HOH D O   1 
HETATM 10281 O O   . HOH R 4 .   ? 49.373  85.108  61.211  1.00 48.73  ? 913 HOH D O   1 
HETATM 10282 O O   . HOH R 4 .   ? 46.912  107.187 66.601  1.00 45.34  ? 914 HOH D O   1 
HETATM 10283 O O   . HOH R 4 .   ? 9.092   103.101 78.454  1.00 46.99  ? 915 HOH D O   1 
HETATM 10284 O O   . HOH R 4 .   ? 34.998  67.619  63.449  1.00 51.26  ? 916 HOH D O   1 
HETATM 10285 O O   . HOH R 4 .   ? 54.009  97.150  69.310  1.00 45.19  ? 917 HOH D O   1 
HETATM 10286 O O   . HOH R 4 .   ? 34.843  74.731  62.086  1.00 32.70  ? 918 HOH D O   1 
HETATM 10287 O O   . HOH R 4 .   ? 5.499   94.596  77.432  1.00 43.86  ? 919 HOH D O   1 
HETATM 10288 O O   . HOH R 4 .   ? 15.303  85.157  79.680  1.00 45.34  ? 920 HOH D O   1 
HETATM 10289 O O   . HOH R 4 .   ? 42.174  80.093  74.930  1.00 43.26  ? 921 HOH D O   1 
HETATM 10290 O O   . HOH R 4 .   ? 35.898  73.428  64.277  1.00 50.32  ? 922 HOH D O   1 
HETATM 10291 O O   . HOH R 4 .   ? 35.677  104.076 81.860  1.00 39.19  ? 923 HOH D O   1 
HETATM 10292 O O   . HOH R 4 .   ? 34.740  112.573 73.599  1.00 30.79  ? 924 HOH D O   1 
HETATM 10293 O O   . HOH R 4 .   ? 32.480  74.956  78.305  1.00 51.81  ? 925 HOH D O   1 
HETATM 10294 O O   . HOH R 4 .   ? 36.126  111.466 71.817  1.00 34.24  ? 926 HOH D O   1 
HETATM 10295 O O   . HOH R 4 .   ? 17.370  82.027  59.189  1.00 40.45  ? 927 HOH D O   1 
HETATM 10296 O O   . HOH R 4 .   ? 24.420  101.396 61.016  1.00 34.34  ? 928 HOH D O   1 
HETATM 10297 O O   . HOH R 4 .   ? 32.213  95.345  87.045  1.00 51.32  ? 929 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 11  ? 1.0724 0.8000 0.9982 0.2206  0.3530  0.1110  511 THR A N   
2    C CA  . THR A 11  ? 1.2407 0.9658 1.1744 0.2221  0.3701  0.1113  511 THR A CA  
3    C C   . THR A 11  ? 1.3287 1.0423 1.2368 0.2101  0.3602  0.1048  511 THR A C   
4    O O   . THR A 11  ? 1.3444 1.0376 1.2169 0.2030  0.3466  0.0992  511 THR A O   
5    C CB  . THR A 11  ? 1.3498 1.1138 1.3355 0.2277  0.3769  0.1186  511 THR A CB  
6    O OG1 . THR A 11  ? 1.2848 1.0631 1.2948 0.2380  0.3796  0.1250  511 THR A OG1 
7    C CG2 . THR A 11  ? 1.3515 1.1111 1.3467 0.2318  0.4006  0.1196  511 THR A CG2 
8    N N   . VAL A 12  ? 1.3490 1.0759 1.2751 0.2078  0.3671  0.1055  512 VAL A N   
9    C CA  . VAL A 12  ? 1.3393 1.0559 1.2434 0.1971  0.3588  0.0996  512 VAL A CA  
10   C C   . VAL A 12  ? 1.2582 1.0114 1.1934 0.1906  0.3452  0.1010  512 VAL A C   
11   O O   . VAL A 12  ? 1.2219 1.0061 1.1907 0.1936  0.3387  0.1062  512 VAL A O   
12   C CB  . VAL A 12  ? 1.1988 0.8926 1.0895 0.1987  0.3807  0.0979  512 VAL A CB  
13   C CG1 . VAL A 12  ? 1.1649 0.8873 1.0986 0.2029  0.3973  0.1032  512 VAL A CG1 
14   C CG2 . VAL A 12  ? 1.1912 0.8643 1.0482 0.1884  0.3714  0.0913  512 VAL A CG2 
15   N N   . SER A 13  ? 1.2106 0.9599 1.1344 0.1819  0.3405  0.0966  513 SER A N   
16   C CA  . SER A 13  ? 1.1177 0.9015 1.0722 0.1757  0.3308  0.0980  513 SER A CA  
17   C C   . SER A 13  ? 1.0699 0.8789 1.0658 0.1809  0.3505  0.1043  513 SER A C   
18   O O   . SER A 13  ? 1.1393 0.9327 1.1321 0.1873  0.3726  0.1055  513 SER A O   
19   C CB  . SER A 13  ? 1.0600 0.8305 0.9895 0.1651  0.3221  0.0913  513 SER A CB  
20   O OG  . SER A 13  ? 1.0303 0.7750 0.9197 0.1604  0.3057  0.0855  513 SER A OG  
21   N N   . SER A 14  ? 0.9380 0.7868 0.9727 0.1776  0.3423  0.1082  514 SER A N   
22   C CA  . SER A 14  ? 0.8327 0.7093 0.9082 0.1799  0.3589  0.1141  514 SER A CA  
23   C C   . SER A 14  ? 0.8764 0.7426 0.9394 0.1716  0.3682  0.1099  514 SER A C   
24   O O   . SER A 14  ? 0.9444 0.8170 1.0253 0.1734  0.3891  0.1128  514 SER A O   
25   C CB  . SER A 14  ? 0.6844 0.6078 0.8057 0.1781  0.3457  0.1202  514 SER A CB  
26   O OG  . SER A 14  ? 0.6868 0.6233 0.8077 0.1660  0.3291  0.1169  514 SER A OG  
27   N N   . PHE A 15  ? 0.8925 0.7417 0.9236 0.1624  0.3529  0.1031  515 PHE A N   
28   C CA  . PHE A 15  ? 0.8997 0.7347 0.9130 0.1541  0.3595  0.0986  515 PHE A CA  
29   C C   . PHE A 15  ? 0.9937 0.7961 0.9848 0.1589  0.3841  0.0974  515 PHE A C   
30   O O   . PHE A 15  ? 1.0949 0.8612 1.0484 0.1628  0.3846  0.0936  515 PHE A O   
31   C CB  . PHE A 15  ? 0.7852 0.5985 0.7598 0.1460  0.3385  0.0907  515 PHE A CB  
32   C CG  . PHE A 15  ? 0.6723 0.5150 0.6645 0.1399  0.3144  0.0907  515 PHE A CG  
33   C CD1 . PHE A 15  ? 0.6431 0.4755 0.6128 0.1390  0.2931  0.0868  515 PHE A CD1 
34   C CD2 . PHE A 15  ? 0.6516 0.5325 0.6824 0.1341  0.3128  0.0946  515 PHE A CD2 
35   C CE1 . PHE A 15  ? 0.6313 0.4903 0.6162 0.1333  0.2712  0.0864  515 PHE A CE1 
36   C CE2 . PHE A 15  ? 0.6508 0.5584 0.6969 0.1281  0.2903  0.0946  515 PHE A CE2 
37   C CZ  . PHE A 15  ? 0.6714 0.5676 0.6941 0.1282  0.2697  0.0903  515 PHE A CZ  
38   N N   . ARG A 16  ? 1.0087 0.8242 1.0228 0.1580  0.4043  0.1008  516 ARG A N   
39   C CA  . ARG A 16  ? 1.0664 0.8507 1.0581 0.1612  0.4284  0.0992  516 ARG A CA  
40   C C   . ARG A 16  ? 1.0374 0.8141 1.0170 0.1504  0.4349  0.0961  516 ARG A C   
41   O O   . ARG A 16  ? 1.0082 0.8102 1.0195 0.1462  0.4481  0.1001  516 ARG A O   
42   C CB  . ARG A 16  ? 1.0835 0.8841 1.1089 0.1710  0.4510  0.1058  516 ARG A CB  
43   C CG  . ARG A 16  ? 1.1776 0.9773 1.2072 0.1825  0.4467  0.1085  516 ARG A CG  
44   C CD  . ARG A 16  ? 1.3118 1.1364 1.3834 0.1925  0.4656  0.1158  516 ARG A CD  
45   N NE  . ARG A 16  ? 1.5129 1.3126 1.5708 0.1978  0.4928  0.1151  516 ARG A NE  
46   C CZ  . ARG A 16  ? 1.5955 1.4135 1.6872 0.2053  0.5141  0.1204  516 ARG A CZ  
47   N NH1 . ARG A 16  ? 1.5843 1.4463 1.7263 0.2086  0.5107  0.1272  516 ARG A NH1 
48   N NH2 . ARG A 16  ? 1.6312 1.4238 1.7065 0.2096  0.5386  0.1190  516 ARG A NH2 
49   N N   . PRO A 17  ? 0.9959 0.7379 0.9294 0.1453  0.4245  0.0890  517 PRO A N   
50   C CA  . PRO A 17  ? 1.0637 0.7901 0.9753 0.1351  0.4272  0.0850  517 PRO A CA  
51   C C   . PRO A 17  ? 1.1634 0.8723 1.0678 0.1354  0.4561  0.0860  517 PRO A C   
52   O O   . PRO A 17  ? 1.1801 0.8988 1.0939 0.1263  0.4642  0.0868  517 PRO A O   
53   C CB  . PRO A 17  ? 1.0508 0.7389 0.9118 0.1338  0.4090  0.0775  517 PRO A CB  
54   C CG  . PRO A 17  ? 1.0057 0.6831 0.8584 0.1436  0.4039  0.0780  517 PRO A CG  
55   C CD  . PRO A 17  ? 0.9853 0.7043 0.8870 0.1485  0.4051  0.0848  517 PRO A CD  
56   N N   . ASN A 18  ? 1.2136 0.8967 1.1010 0.1448  0.4717  0.0860  518 ASN A N   
57   C CA  . ASN A 18  ? 1.2243 0.8877 1.1012 0.1454  0.4997  0.0865  518 ASN A CA  
58   C C   . ASN A 18  ? 1.1009 0.8029 1.0270 0.1428  0.5181  0.0929  518 ASN A C   
59   O O   . ASN A 18  ? 1.1394 0.8313 1.0619 0.1402  0.5412  0.0936  518 ASN A O   
60   C CB  . ASN A 18  ? 1.4045 1.0366 1.2583 0.1568  0.5130  0.0858  518 ASN A CB  
61   C CG  . ASN A 18  ? 1.4835 1.0724 1.2842 0.1577  0.4980  0.0795  518 ASN A CG  
62   O OD1 . ASN A 18  ? 1.4856 1.0616 1.2614 0.1498  0.4817  0.0750  518 ASN A OD1 
63   N ND2 . ASN A 18  ? 1.4863 1.0531 1.2700 0.1671  0.5033  0.0794  518 ASN A ND2 
64   N N   . GLU A 19  ? 1.0405 0.7870 1.0126 0.1432  0.5077  0.0978  519 GLU A N   
65   C CA  . GLU A 19  ? 1.0645 0.8520 1.0887 0.1417  0.5231  0.1046  519 GLU A CA  
66   C C   . GLU A 19  ? 1.0518 0.8774 1.1072 0.1300  0.5079  0.1068  519 GLU A C   
67   O O   . GLU A 19  ? 1.0413 0.9050 1.1428 0.1268  0.5168  0.1125  519 GLU A O   
68   C CB  . GLU A 19  ? 1.1193 0.9285 1.1770 0.1548  0.5277  0.1099  519 GLU A CB  
69   C CG  . GLU A 19  ? 1.2136 0.9853 1.2405 0.1666  0.5409  0.1077  519 GLU A CG  
70   C CD  . GLU A 19  ? 1.2886 1.0705 1.3301 0.1785  0.5315  0.1106  519 GLU A CD  
71   O OE1 . GLU A 19  ? 1.2517 1.0760 1.3397 0.1804  0.5251  0.1163  519 GLU A OE1 
72   O OE2 . GLU A 19  ? 1.3528 1.0999 1.3588 0.1855  0.5301  0.1073  519 GLU A OE2 
73   N N   . PHE A 20  ? 1.0570 0.8722 1.0873 0.1235  0.4845  0.1022  520 PHE A N   
74   C CA  . PHE A 20  ? 0.9411 0.7871 0.9939 0.1113  0.4686  0.1033  520 PHE A CA  
75   C C   . PHE A 20  ? 0.9449 0.7854 0.9924 0.0988  0.4827  0.1028  520 PHE A C   
76   O O   . PHE A 20  ? 0.9298 0.7292 0.9330 0.0969  0.4911  0.0980  520 PHE A O   
77   C CB  . PHE A 20  ? 0.7978 0.6302 0.8210 0.1089  0.4403  0.0976  520 PHE A CB  
78   C CG  . PHE A 20  ? 0.7394 0.5932 0.7736 0.0954  0.4241  0.0970  520 PHE A CG  
79   C CD1 . PHE A 20  ? 0.7602 0.6604 0.8402 0.0925  0.4107  0.1019  520 PHE A CD1 
80   C CD2 . PHE A 20  ? 0.6753 0.5015 0.6726 0.0859  0.4213  0.0916  520 PHE A CD2 
81   C CE1 . PHE A 20  ? 0.8038 0.7229 0.8932 0.0796  0.3954  0.1012  520 PHE A CE1 
82   C CE2 . PHE A 20  ? 0.7334 0.5777 0.7395 0.0734  0.4063  0.0909  520 PHE A CE2 
83   C CZ  . PHE A 20  ? 0.7941 0.6850 0.8464 0.0699  0.3935  0.0957  520 PHE A CZ  
84   N N   . GLU A 21  ? 0.9056 0.7867 0.9978 0.0901  0.4852  0.1079  521 GLU A N   
85   C CA  . GLU A 21  ? 0.9416 0.8206 1.0320 0.0762  0.4971  0.1079  521 GLU A CA  
86   C C   . GLU A 21  ? 0.9466 0.8432 1.0430 0.0632  0.4747  0.1068  521 GLU A C   
87   O O   . GLU A 21  ? 0.9903 0.9145 1.1091 0.0646  0.4533  0.1081  521 GLU A O   
88   C CB  . GLU A 21  ? 0.9370 0.8474 1.0738 0.0743  0.5203  0.1142  521 GLU A CB  
89   C CG  . GLU A 21  ? 1.0506 0.9416 1.1800 0.0855  0.5464  0.1150  521 GLU A CG  
90   C CD  . GLU A 21  ? 1.2145 1.1018 1.3488 0.0772  0.5739  0.1164  521 GLU A CD  
91   O OE1 . GLU A 21  ? 1.2319 1.1531 1.4031 0.0656  0.5761  0.1199  521 GLU A OE1 
92   O OE2 . GLU A 21  ? 1.2835 1.1334 1.3840 0.0817  0.5933  0.1139  521 GLU A OE2 
93   N N   . SER A 22  ? 0.8338 0.7132 0.9088 0.0506  0.4796  0.1045  522 SER A N   
94   C CA  . SER A 22  ? 0.7879 0.6825 0.8683 0.0372  0.4603  0.1035  522 SER A CA  
95   C C   . SER A 22  ? 0.8838 0.7640 0.9505 0.0227  0.4733  0.1029  522 SER A C   
96   O O   . SER A 22  ? 0.8543 0.6936 0.8808 0.0231  0.4887  0.0999  522 SER A O   
97   C CB  . SER A 22  ? 0.7584 0.6313 0.8015 0.0401  0.4343  0.0973  522 SER A CB  
98   O OG  . SER A 22  ? 0.7306 0.6156 0.7760 0.0271  0.4166  0.0959  522 SER A OG  
99   N N   . LYS A 23  ? 0.9272 0.8411 1.0278 0.0096  0.4666  0.1057  523 LYS A N   
100  C CA  . LYS A 23  ? 0.9723 0.8759 1.0630 -0.0063 0.4754  0.1053  523 LYS A CA  
101  C C   . LYS A 23  ? 0.9886 0.8456 1.0196 -0.0097 0.4646  0.0987  523 LYS A C   
102  O O   . LYS A 23  ? 1.0628 0.8982 1.0721 -0.0209 0.4737  0.0976  523 LYS A O   
103  C CB  . LYS A 23  ? 1.0532 1.0038 1.1923 -0.0192 0.4645  0.1089  523 LYS A CB  
104  C CG  . LYS A 23  ? 1.1812 1.1226 1.3092 -0.0373 0.4663  0.1076  523 LYS A CG  
105  C CD  . LYS A 23  ? 1.2059 1.1972 1.3908 -0.0496 0.4649  0.1121  523 LYS A CD  
106  C CE  . LYS A 23  ? 1.1567 1.1893 1.3783 -0.0452 0.4397  0.1136  523 LYS A CE  
107  N NZ  . LYS A 23  ? 1.1148 1.1958 1.3911 -0.0569 0.4367  0.1174  523 LYS A NZ  
108  N N   . PHE A 24  ? 0.9668 0.8077 0.9710 0.0004  0.4453  0.0942  524 PHE A N   
109  C CA  . PHE A 24  ? 0.9847 0.7855 0.9354 -0.0017 0.4311  0.0873  524 PHE A CA  
110  C C   . PHE A 24  ? 1.0145 0.7686 0.9156 0.0112  0.4358  0.0820  524 PHE A C   
111  O O   . PHE A 24  ? 0.9962 0.7193 0.8547 0.0132  0.4199  0.0754  524 PHE A O   
112  C CB  . PHE A 24  ? 0.9032 0.7237 0.8611 -0.0035 0.4003  0.0848  524 PHE A CB  
113  C CG  . PHE A 24  ? 0.8456 0.7057 0.8443 -0.0179 0.3929  0.0887  524 PHE A CG  
114  C CD1 . PHE A 24  ? 0.8777 0.7252 0.8622 -0.0325 0.3947  0.0877  524 PHE A CD1 
115  C CD2 . PHE A 24  ? 0.7002 0.6090 0.7509 -0.0168 0.3838  0.0932  524 PHE A CD2 
116  C CE1 . PHE A 24  ? 0.8134 0.6960 0.8354 -0.0459 0.3870  0.0904  524 PHE A CE1 
117  C CE2 . PHE A 24  ? 0.6410 0.5859 0.7293 -0.0299 0.3758  0.0962  524 PHE A CE2 
118  C CZ  . PHE A 24  ? 0.7423 0.6740 0.8165 -0.0446 0.3772  0.0945  524 PHE A CZ  
119  N N   . LEU A 25  ? 1.0145 0.7637 0.9217 0.0199  0.4573  0.0846  525 LEU A N   
120  C CA  . LEU A 25  ? 1.0377 0.7454 0.9025 0.0327  0.4621  0.0800  525 LEU A CA  
121  C C   . LEU A 25  ? 1.1226 0.8110 0.9800 0.0345  0.4933  0.0824  525 LEU A C   
122  O O   . LEU A 25  ? 1.1563 0.8744 1.0554 0.0347  0.5104  0.0884  525 LEU A O   
123  C CB  . LEU A 25  ? 1.0267 0.7507 0.9079 0.0461  0.4506  0.0801  525 LEU A CB  
124  C CG  . LEU A 25  ? 1.0154 0.7013 0.8503 0.0565  0.4367  0.0729  525 LEU A CG  
125  C CD1 . LEU A 25  ? 0.9368 0.6133 0.7475 0.0503  0.4110  0.0671  525 LEU A CD1 
126  C CD2 . LEU A 25  ? 0.9524 0.6546 0.8069 0.0689  0.4299  0.0743  525 LEU A CD2 
127  N N   . PRO A 26  ? 1.1062 0.7449 0.9108 0.0361  0.5009  0.0777  526 PRO A N   
128  C CA  . PRO A 26  ? 1.1460 0.7624 0.9388 0.0383  0.5309  0.0795  526 PRO A CA  
129  C C   . PRO A 26  ? 1.1970 0.8210 1.0063 0.0525  0.5405  0.0814  526 PRO A C   
130  O O   . PRO A 26  ? 1.3290 0.9503 1.1310 0.0626  0.5232  0.0784  526 PRO A O   
131  C CB  . PRO A 26  ? 1.1739 0.7333 0.9019 0.0396  0.5296  0.0730  526 PRO A CB  
132  C CG  . PRO A 26  ? 1.1413 0.6986 0.8540 0.0331  0.5024  0.0688  526 PRO A CG  
133  C CD  . PRO A 26  ? 1.0766 0.6772 0.8300 0.0362  0.4819  0.0702  526 PRO A CD  
134  N N   . PRO A 27  ? 1.1772 0.8109 1.0093 0.0531  0.5681  0.0861  527 PRO A N   
135  C CA  . PRO A 27  ? 1.1134 0.7556 0.9641 0.0665  0.5800  0.0883  527 PRO A CA  
136  C C   . PRO A 27  ? 1.1125 0.7105 0.9152 0.0789  0.5755  0.0827  527 PRO A C   
137  O O   . PRO A 27  ? 0.8884 0.4938 0.7012 0.0904  0.5690  0.0829  527 PRO A O   
138  C CB  . PRO A 27  ? 1.1586 0.8026 1.0236 0.0627  0.6129  0.0924  527 PRO A CB  
139  C CG  . PRO A 27  ? 1.1385 0.7994 1.0189 0.0458  0.6142  0.0947  527 PRO A CG  
140  C CD  . PRO A 27  ? 1.2209 0.8570 1.0617 0.0405  0.5903  0.0895  527 PRO A CD  
141  N N   . GLU A 28  ? 1.3884 0.9402 1.1390 0.0761  0.5787  0.0780  528 GLU A N   
142  C CA  . GLU A 28  ? 1.6148 1.1210 1.3164 0.0865  0.5747  0.0725  528 GLU A CA  
143  C C   . GLU A 28  ? 1.5800 1.0570 1.2384 0.0824  0.5514  0.0662  528 GLU A C   
144  O O   . GLU A 28  ? 1.6605 1.1045 1.2823 0.0764  0.5583  0.0638  528 GLU A O   
145  C CB  . GLU A 28  ? 1.8797 1.3525 1.5557 0.0889  0.6042  0.0727  528 GLU A CB  
146  C CG  . GLU A 28  ? 2.0791 1.4990 1.6979 0.0972  0.6009  0.0669  528 GLU A CG  
147  C CD  . GLU A 28  ? 2.2237 1.6083 1.8133 0.0974  0.6302  0.0670  528 GLU A CD  
148  O OE1 . GLU A 28  ? 2.2799 1.6424 1.8431 0.0882  0.6369  0.0659  528 GLU A OE1 
149  O OE2 . GLU A 28  ? 2.2373 1.6161 1.8300 0.1068  0.6468  0.0683  528 GLU A OE2 
150  N N   . ASN A 29  ? 1.4461 0.9354 1.1092 0.0856  0.5237  0.0636  529 ASN A N   
151  C CA  . ASN A 29  ? 1.3760 0.8408 1.0018 0.0825  0.4996  0.0574  529 ASN A CA  
152  C C   . ASN A 29  ? 1.3267 0.7569 0.9149 0.0929  0.4869  0.0526  529 ASN A C   
153  O O   . ASN A 29  ? 1.2438 0.6828 0.8457 0.1019  0.4865  0.0542  529 ASN A O   
154  C CB  . ASN A 29  ? 1.3223 0.8249 0.9778 0.0761  0.4756  0.0575  529 ASN A CB  
155  C CG  . ASN A 29  ? 1.2116 0.7350 0.8860 0.0844  0.4558  0.0571  529 ASN A CG  
156  O OD1 . ASN A 29  ? 1.2077 0.7121 0.8551 0.0879  0.4340  0.0520  529 ASN A OD1 
157  N ND2 . ASN A 29  ? 1.1190 0.6821 0.8408 0.0872  0.4628  0.0629  529 ASN A ND2 
158  N N   . LYS A 30  ? 1.3360 0.7268 0.8771 0.0912  0.4768  0.0475  530 LYS A N   
159  C CA  . LYS A 30  ? 1.3898 0.7476 0.8943 0.0991  0.4623  0.0438  530 LYS A CA  
160  C C   . LYS A 30  ? 1.3040 0.6777 0.8150 0.0985  0.4295  0.0413  530 LYS A C   
161  O O   . LYS A 30  ? 1.1734 0.5766 0.7089 0.0916  0.4181  0.0410  530 LYS A O   
162  C CB  . LYS A 30  ? 1.4989 0.8059 0.9497 0.0979  0.4676  0.0406  530 LYS A CB  
163  C CG  . LYS A 30  ? 1.5893 0.8916 1.0289 0.0876  0.4631  0.0385  530 LYS A CG  
164  C CD  . LYS A 30  ? 1.6805 0.9390 1.0778 0.0856  0.4826  0.0377  530 LYS A CD  
165  C CE  . LYS A 30  ? 1.6991 0.9617 1.1112 0.0866  0.5160  0.0421  530 LYS A CE  
166  N NZ  . LYS A 30  ? 1.7038 0.9197 1.0706 0.0863  0.5357  0.0412  530 LYS A NZ  
167  N N   . PRO A 31  ? 1.3239 0.6801 0.8144 0.1051  0.4145  0.0400  531 PRO A N   
168  C CA  . PRO A 31  ? 1.2905 0.6616 0.7862 0.1035  0.3834  0.0382  531 PRO A CA  
169  C C   . PRO A 31  ? 1.2446 0.6041 0.7197 0.0961  0.3665  0.0344  531 PRO A C   
170  O O   . PRO A 31  ? 1.2261 0.5499 0.6645 0.0945  0.3725  0.0327  531 PRO A O   
171  C CB  . PRO A 31  ? 1.2816 0.6311 0.7534 0.1109  0.3740  0.0387  531 PRO A CB  
172  C CG  . PRO A 31  ? 1.2764 0.5950 0.7255 0.1163  0.3997  0.0399  531 PRO A CG  
173  C CD  . PRO A 31  ? 1.3065 0.6406 0.7806 0.1140  0.4257  0.0416  531 PRO A CD  
174  N N   . LEU A 32  ? 1.1426 0.5330 0.6420 0.0917  0.3453  0.0334  532 LEU A N   
175  C CA  . LEU A 32  ? 1.1285 0.5124 0.6127 0.0851  0.3259  0.0299  532 LEU A CA  
176  C C   . LEU A 32  ? 1.1432 0.5046 0.6064 0.0794  0.3415  0.0282  532 LEU A C   
177  O O   . LEU A 32  ? 1.1712 0.5048 0.6015 0.0768  0.3308  0.0257  532 LEU A O   
178  C CB  . LEU A 32  ? 1.1243 0.4844 0.5772 0.0883  0.3033  0.0294  532 LEU A CB  
179  C CG  . LEU A 32  ? 1.0768 0.4595 0.5480 0.0924  0.2857  0.0314  532 LEU A CG  
180  C CD1 . LEU A 32  ? 0.9499 0.3131 0.3919 0.0941  0.2631  0.0316  532 LEU A CD1 
181  C CD2 . LEU A 32  ? 1.0971 0.5251 0.6109 0.0881  0.2736  0.0308  532 LEU A CD2 
182  N N   . GLU A 33  ? 1.0966 0.4711 0.5797 0.0771  0.3669  0.0306  533 GLU A N   
183  C CA  . GLU A 33  ? 1.1407 0.5001 0.6092 0.0695  0.3829  0.0302  533 GLU A CA  
184  C C   . GLU A 33  ? 1.1553 0.5173 0.6172 0.0616  0.3624  0.0266  533 GLU A C   
185  O O   . GLU A 33  ? 1.0460 0.4443 0.5393 0.0578  0.3467  0.0262  533 GLU A O   
186  C CB  . GLU A 33  ? 1.1603 0.5502 0.6662 0.0650  0.4080  0.0354  533 GLU A CB  
187  C CG  . GLU A 33  ? 1.2959 0.6621 0.7875 0.0685  0.4378  0.0382  533 GLU A CG  
188  C CD  . GLU A 33  ? 1.4532 0.8496 0.9825 0.0617  0.4624  0.0445  533 GLU A CD  
189  O OE1 . GLU A 33  ? 1.5112 0.9341 1.0637 0.0513  0.4585  0.0464  533 GLU A OE1 
190  O OE2 . GLU A 33  ? 1.5362 0.9309 1.0735 0.0664  0.4855  0.0481  533 GLU A OE2 
191  N N   . THR A 34  ? 1.2427 0.5647 0.6623 0.0594  0.3626  0.0240  534 THR A N   
192  C CA  . THR A 34  ? 1.2475 0.5637 0.6533 0.0534  0.3417  0.0203  534 THR A CA  
193  C C   . THR A 34  ? 1.2745 0.6222 0.7085 0.0419  0.3455  0.0208  534 THR A C   
194  O O   . THR A 34  ? 1.1578 0.5253 0.6045 0.0375  0.3240  0.0184  534 THR A O   
195  C CB  . THR A 34  ? 1.2536 0.5166 0.6056 0.0548  0.3425  0.0185  534 THR A CB  
196  O OG1 . THR A 34  ? 1.2569 0.5134 0.5972 0.0461  0.3355  0.0160  534 THR A OG1 
197  C CG2 . THR A 34  ? 1.3194 0.5557 0.6517 0.0569  0.3731  0.0207  534 THR A CG2 
198  N N   . ALA A 35  ? 1.2558 0.6097 0.7010 0.0364  0.3726  0.0252  535 ALA A N   
199  C CA  . ALA A 35  ? 1.1270 0.5131 0.6026 0.0237  0.3781  0.0288  535 ALA A CA  
200  C C   . ALA A 35  ? 1.0832 0.5228 0.6109 0.0228  0.3671  0.0314  535 ALA A C   
201  O O   . ALA A 35  ? 1.0605 0.5269 0.6093 0.0138  0.3555  0.0320  535 ALA A O   
202  C CB  . ALA A 35  ? 1.1139 0.4968 0.5950 0.0175  0.4103  0.0352  535 ALA A CB  
203  N N   . LEU A 36  ? 1.1112 0.5654 0.6589 0.0320  0.3710  0.0334  536 LEU A N   
204  C CA  . LEU A 36  ? 1.1044 0.6077 0.7006 0.0326  0.3614  0.0364  536 LEU A CA  
205  C C   . LEU A 36  ? 1.0346 0.5468 0.6297 0.0354  0.3296  0.0308  536 LEU A C   
206  O O   . LEU A 36  ? 0.9845 0.5360 0.6141 0.0306  0.3176  0.0324  536 LEU A O   
207  C CB  . LEU A 36  ? 1.1879 0.7027 0.8052 0.0418  0.3765  0.0407  536 LEU A CB  
208  C CG  . LEU A 36  ? 1.3030 0.8310 0.9445 0.0368  0.4067  0.0481  536 LEU A CG  
209  C CD1 . LEU A 36  ? 1.2168 0.7506 0.8745 0.0473  0.4222  0.0516  536 LEU A CD1 
210  C CD2 . LEU A 36  ? 1.3776 0.9519 1.0657 0.0250  0.4054  0.0537  536 LEU A CD2 
211  N N   . LEU A 37  ? 1.1021 0.5788 0.6595 0.0426  0.3156  0.0253  537 LEU A N   
212  C CA  . LEU A 37  ? 1.0675 0.5497 0.6223 0.0436  0.2849  0.0207  537 LEU A CA  
213  C C   . LEU A 37  ? 1.0107 0.4953 0.5603 0.0334  0.2740  0.0177  537 LEU A C   
214  O O   . LEU A 37  ? 0.8986 0.4070 0.4647 0.0304  0.2523  0.0154  537 LEU A O   
215  C CB  . LEU A 37  ? 0.9759 0.4191 0.4928 0.0515  0.2730  0.0186  537 LEU A CB  
216  C CG  . LEU A 37  ? 1.0345 0.4684 0.5489 0.0611  0.2836  0.0218  537 LEU A CG  
217  C CD1 . LEU A 37  ? 1.0578 0.4532 0.5322 0.0668  0.2717  0.0217  537 LEU A CD1 
218  C CD2 . LEU A 37  ? 0.9814 0.4556 0.5357 0.0642  0.2762  0.0239  537 LEU A CD2 
219  N N   . LYS A 38  ? 1.0617 0.5205 0.5870 0.0278  0.2894  0.0179  538 LYS A N   
220  C CA  . LYS A 38  ? 1.1065 0.5648 0.6247 0.0172  0.2824  0.0159  538 LYS A CA  
221  C C   . LYS A 38  ? 1.0283 0.5376 0.5939 0.0078  0.2822  0.0203  538 LYS A C   
222  O O   . LYS A 38  ? 0.9567 0.4854 0.5335 0.0034  0.2612  0.0175  538 LYS A O   
223  C CB  . LYS A 38  ? 1.1526 0.5748 0.6383 0.0122  0.3033  0.0171  538 LYS A CB  
224  C CG  . LYS A 38  ? 1.2994 0.7110 0.7682 0.0020  0.2951  0.0147  538 LYS A CG  
225  C CD  . LYS A 38  ? 1.3988 0.7689 0.8300 -0.0020 0.3158  0.0159  538 LYS A CD  
226  C CE  . LYS A 38  ? 1.4050 0.7588 0.8140 -0.0115 0.3064  0.0133  538 LYS A CE  
227  N NZ  . LYS A 38  ? 1.4461 0.7503 0.8086 -0.0132 0.3229  0.0134  538 LYS A NZ  
228  N N   . ARG A 39  ? 0.9348 0.4663 0.5302 0.0047  0.3050  0.0281  539 ARG A N   
229  C CA  . ARG A 39  ? 0.9214 0.5015 0.5662 -0.0052 0.3062  0.0348  539 ARG A CA  
230  C C   . ARG A 39  ? 0.9475 0.5636 0.6213 -0.0011 0.2836  0.0334  539 ARG A C   
231  O O   . ARG A 39  ? 1.0075 0.6533 0.7053 -0.0098 0.2704  0.0346  539 ARG A O   
232  C CB  . ARG A 39  ? 0.9592 0.5562 0.6343 -0.0076 0.3346  0.0437  539 ARG A CB  
233  C CG  . ARG A 39  ? 0.9797 0.6256 0.7085 -0.0194 0.3377  0.0516  539 ARG A CG  
234  C CD  . ARG A 39  ? 1.0771 0.7278 0.8034 -0.0324 0.3226  0.0502  539 ARG A CD  
235  N NE  . ARG A 39  ? 1.1695 0.8681 0.9486 -0.0439 0.3221  0.0570  539 ARG A NE  
236  C CZ  . ARG A 39  ? 1.2595 0.9753 1.0495 -0.0542 0.3044  0.0563  539 ARG A CZ  
237  N NH1 . ARG A 39  ? 1.2873 0.9769 1.0390 -0.0540 0.2862  0.0490  539 ARG A NH1 
238  N NH2 . ARG A 39  ? 1.2820 1.0414 1.1223 -0.0641 0.3036  0.0618  539 ARG A NH2 
239  N N   . ALA A 40  ? 0.8556 0.4679 0.5268 0.0115  0.2789  0.0309  540 ALA A N   
240  C CA  . ALA A 40  ? 0.8893 0.5318 0.5844 0.0158  0.2575  0.0294  540 ALA A CA  
241  C C   . ALA A 40  ? 0.9316 0.5704 0.6113 0.0121  0.2304  0.0222  540 ALA A C   
242  O O   . ALA A 40  ? 0.9507 0.6238 0.6577 0.0053  0.2177  0.0234  540 ALA A O   
243  C CB  . ALA A 40  ? 0.8308 0.4610 0.5181 0.0293  0.2563  0.0277  540 ALA A CB  
244  N N   . LYS A 41  ? 0.9057 0.5031 0.5436 0.0166  0.2212  0.0155  541 LYS A N   
245  C CA  . LYS A 41  ? 0.9673 0.5576 0.5908 0.0136  0.1956  0.0094  541 LYS A CA  
246  C C   . LYS A 41  ? 0.9865 0.5988 0.6242 0.0008  0.1933  0.0100  541 LYS A C   
247  O O   . LYS A 41  ? 0.9837 0.6233 0.6407 -0.0029 0.1739  0.0082  541 LYS A O   
248  C CB  . LYS A 41  ? 1.0915 0.6311 0.6689 0.0172  0.1922  0.0063  541 LYS A CB  
249  C CG  . LYS A 41  ? 1.1128 0.6437 0.6778 0.0154  0.1650  0.0033  541 LYS A CG  
250  C CD  . LYS A 41  ? 1.1314 0.6679 0.7028 0.0234  0.1461  0.0056  541 LYS A CD  
251  C CE  . LYS A 41  ? 1.1496 0.6852 0.7153 0.0218  0.1204  0.0056  541 LYS A CE  
252  N NZ  . LYS A 41  ? 1.2110 0.7842 0.8091 0.0146  0.1069  0.0034  541 LYS A NZ  
253  N N   . GLU A 42  ? 1.0028 0.6027 0.6312 -0.0067 0.2133  0.0137  542 GLU A N   
254  C CA  . GLU A 42  ? 1.0358 0.6530 0.6775 -0.0209 0.2138  0.0169  542 GLU A CA  
255  C C   . GLU A 42  ? 1.0103 0.6809 0.7025 -0.0272 0.2068  0.0227  542 GLU A C   
256  O O   . GLU A 42  ? 0.9474 0.6350 0.6493 -0.0360 0.1918  0.0218  542 GLU A O   
257  C CB  . GLU A 42  ? 1.1492 0.7514 0.7852 -0.0287 0.2409  0.0234  542 GLU A CB  
258  C CG  . GLU A 42  ? 1.2978 0.8478 0.8821 -0.0279 0.2459  0.0185  542 GLU A CG  
259  C CD  . GLU A 42  ? 1.4227 0.9611 1.0045 -0.0381 0.2723  0.0255  542 GLU A CD  
260  O OE1 . GLU A 42  ? 1.3716 0.9374 0.9839 -0.0516 0.2761  0.0316  542 GLU A OE1 
261  O OE2 . GLU A 42  ? 1.5122 1.0142 1.0632 -0.0331 0.2890  0.0251  542 GLU A OE2 
262  N N   . LEU A 43  ? 0.9885 0.6844 0.7128 -0.0226 0.2178  0.0288  543 LEU A N   
263  C CA  . LEU A 43  ? 0.9142 0.6605 0.6883 -0.0271 0.2113  0.0348  543 LEU A CA  
264  C C   . LEU A 43  ? 0.8226 0.5841 0.5985 -0.0240 0.1830  0.0287  543 LEU A C   
265  O O   . LEU A 43  ? 0.7909 0.5788 0.5873 -0.0335 0.1700  0.0302  543 LEU A O   
266  C CB  . LEU A 43  ? 0.9125 0.6782 0.7164 -0.0197 0.2271  0.0413  543 LEU A CB  
267  C CG  . LEU A 43  ? 0.9250 0.7105 0.7630 -0.0278 0.2505  0.0509  543 LEU A CG  
268  C CD1 . LEU A 43  ? 0.9971 0.8028 0.8642 -0.0180 0.2622  0.0559  543 LEU A CD1 
269  C CD2 . LEU A 43  ? 0.8722 0.6945 0.7474 -0.0421 0.2420  0.0550  543 LEU A CD2 
270  N N   . PHE A 44  ? 0.6805 0.4251 0.4365 -0.0114 0.1735  0.0221  544 PHE A N   
271  C CA  . PHE A 44  ? 0.8221 0.5784 0.5798 -0.0080 0.1469  0.0156  544 PHE A CA  
272  C C   . PHE A 44  ? 0.8308 0.5706 0.5647 -0.0142 0.1288  0.0082  544 PHE A C   
273  O O   . PHE A 44  ? 0.7715 0.5336 0.5191 -0.0184 0.1088  0.0055  544 PHE A O   
274  C CB  . PHE A 44  ? 0.9364 0.6741 0.6806 0.0056  0.1428  0.0118  544 PHE A CB  
275  C CG  . PHE A 44  ? 1.0980 0.8263 0.8304 0.0087  0.1162  0.0050  544 PHE A CG  
276  C CD1 . PHE A 44  ? 1.1325 0.8896 0.8894 0.0114  0.1003  0.0048  544 PHE A CD1 
277  C CD2 . PHE A 44  ? 1.1594 0.8505 0.8593 0.0085  0.1079  0.0016  544 PHE A CD2 
278  C CE1 . PHE A 44  ? 1.1452 0.8963 0.8978 0.0132  0.0775  0.0021  544 PHE A CE1 
279  C CE2 . PHE A 44  ? 1.1724 0.8592 0.8696 0.0108  0.0849  0.0012  544 PHE A CE2 
280  C CZ  . PHE A 44  ? 1.1870 0.9048 0.9121 0.0130  0.0703  0.0016  544 PHE A CZ  
281  N N   . THR A 45  ? 0.7848 0.4849 0.4838 -0.0150 0.1364  0.0053  545 THR A N   
282  C CA  . THR A 45  ? 0.8011 0.4814 0.4771 -0.0209 0.1220  -0.0002 545 THR A CA  
283  C C   . THR A 45  ? 0.8182 0.5262 0.5128 -0.0349 0.1203  0.0029  545 THR A C   
284  O O   . THR A 45  ? 0.8299 0.5466 0.5266 -0.0391 0.0996  -0.0016 545 THR A O   
285  C CB  . THR A 45  ? 0.8654 0.4967 0.5003 -0.0192 0.1340  -0.0017 545 THR A CB  
286  O OG1 . THR A 45  ? 0.8965 0.4996 0.5122 -0.0078 0.1270  -0.0027 545 THR A OG1 
287  C CG2 . THR A 45  ? 0.8200 0.4335 0.4342 -0.0278 0.1248  -0.0050 545 THR A CG2 
288  N N   . ASN A 46  ? 0.7314 0.4535 0.4450 -0.0430 0.1416  0.0125  546 ASN A N   
289  C CA  . ASN A 46  ? 0.7765 0.5221 0.5133 -0.0585 0.1414  0.0185  546 ASN A CA  
290  C C   . ASN A 46  ? 0.7745 0.5712 0.5619 -0.0632 0.1320  0.0236  546 ASN A C   
291  O O   . ASN A 46  ? 0.8691 0.6886 0.6843 -0.0754 0.1295  0.0266  546 ASN A O   
292  C CB  . ASN A 46  ? 0.9125 0.6487 0.6541 -0.0676 0.1672  0.0264  546 ASN A CB  
293  C CG  . ASN A 46  ? 0.9736 0.6582 0.6652 -0.0643 0.1773  0.0217  546 ASN A CG  
294  O OD1 . ASN A 46  ? 1.0005 0.6559 0.6548 -0.0565 0.1629  0.0121  546 ASN A OD1 
295  N ND2 . ASN A 46  ? 0.9837 0.6568 0.6763 -0.0703 0.2019  0.0281  546 ASN A ND2 
296  N N   . ASN A 47  ? 0.6116 0.4264 0.4127 -0.0533 0.1262  0.0237  547 ASN A N   
297  C CA  . ASN A 47  ? 0.4937 0.3561 0.3428 -0.0564 0.1155  0.0276  547 ASN A CA  
298  C C   . ASN A 47  ? 0.4699 0.3429 0.3134 -0.0530 0.0895  0.0210  547 ASN A C   
299  O O   . ASN A 47  ? 0.5193 0.3681 0.3314 -0.0429 0.0804  0.0125  547 ASN A O   
300  C CB  . ASN A 47  ? 0.5861 0.4703 0.4675 -0.0498 0.1301  0.0349  547 ASN A CB  
301  C CG  . ASN A 47  ? 0.5971 0.4934 0.5074 -0.0577 0.1514  0.0429  547 ASN A CG  
302  O OD1 . ASN A 47  ? 0.6388 0.5711 0.5903 -0.0667 0.1483  0.0475  547 ASN A OD1 
303  N ND2 . ASN A 47  ? 0.5288 0.3957 0.4179 -0.0543 0.1732  0.0444  547 ASN A ND2 
304  N N   . ASP A 48  ? 0.3502 0.2597 0.2282 -0.0611 0.0756  0.0228  548 ASP A N   
305  C CA  . ASP A 48  ? 0.3328 0.2597 0.2135 -0.0593 0.0513  0.0176  548 ASP A CA  
306  C C   . ASP A 48  ? 0.4953 0.4334 0.3838 -0.0471 0.0495  0.0184  548 ASP A C   
307  O O   . ASP A 48  ? 0.3505 0.3057 0.2671 -0.0438 0.0631  0.0259  548 ASP A O   
308  C CB  . ASP A 48  ? 0.2898 0.2565 0.2113 -0.0709 0.0405  0.0211  548 ASP A CB  
309  C CG  . ASP A 48  ? 0.5705 0.5561 0.4956 -0.0703 0.0155  0.0159  548 ASP A CG  
310  O OD1 . ASP A 48  ? 0.5590 0.5671 0.5037 -0.0636 0.0105  0.0181  548 ASP A OD1 
311  O OD2 . ASP A 48  ? 0.5760 0.5534 0.4839 -0.0764 0.0013  0.0095  548 ASP A OD2 
312  N N   . PRO A 49  ? 0.4195 0.3483 0.2886 -0.0401 0.0311  0.0089  549 PRO A N   
313  C CA  . PRO A 49  ? 0.4310 0.3670 0.3099 -0.0288 0.0267  0.0073  549 PRO A CA  
314  C C   . PRO A 49  ? 0.3412 0.3209 0.2573 -0.0305 0.0265  0.0173  549 PRO A C   
315  O O   . PRO A 49  ? 0.3224 0.3070 0.2482 -0.0216 0.0338  0.0206  549 PRO A O   
316  C CB  . PRO A 49  ? 0.4284 0.3535 0.3069 -0.0266 0.0065  -0.0008 549 PRO A CB  
317  C CG  . PRO A 49  ? 0.4260 0.3241 0.2838 -0.0323 0.0049  -0.0030 549 PRO A CG  
318  C CD  . PRO A 49  ? 0.3903 0.2996 0.2439 -0.0431 0.0137  -0.0006 549 PRO A CD  
319  N N   . LYS A 50  ? 0.2371 0.2470 0.1816 -0.0407 0.0161  0.0202  550 LYS A N   
320  C CA  . LYS A 50  ? 0.1618 0.2129 0.1518 -0.0414 0.0133  0.0277  550 LYS A CA  
321  C C   . LYS A 50  ? 0.2652 0.3253 0.2821 -0.0405 0.0355  0.0371  550 LYS A C   
322  O O   . LYS A 50  ? 0.2895 0.3686 0.3310 -0.0337 0.0403  0.0429  550 LYS A O   
323  C CB  . LYS A 50  ? 0.1374 0.2192 0.1521 -0.0526 -0.0040 0.0278  550 LYS A CB  
324  C CG  . LYS A 50  ? 0.2550 0.3727 0.3088 -0.0498 -0.0077 0.0359  550 LYS A CG  
325  C CD  . LYS A 50  ? 0.2891 0.4167 0.3436 -0.0538 -0.0214 0.0371  550 LYS A CD  
326  C CE  . LYS A 50  ? 0.2742 0.3822 0.2976 -0.0497 -0.0280 0.0331  550 LYS A CE  
327  N NZ  . LYS A 50  ? 0.3561 0.4618 0.3777 -0.0411 -0.0259 0.0341  550 LYS A NZ  
328  N N   . VAL A 51  ? 0.2452 0.2905 0.2563 -0.0472 0.0492  0.0383  551 VAL A N   
329  C CA  . VAL A 51  ? 0.3793 0.4319 0.4148 -0.0474 0.0718  0.0466  551 VAL A CA  
330  C C   . VAL A 51  ? 0.3671 0.3988 0.3873 -0.0343 0.0876  0.0478  551 VAL A C   
331  O O   . VAL A 51  ? 0.4201 0.4695 0.4690 -0.0294 0.1001  0.0549  551 VAL A O   
332  C CB  . VAL A 51  ? 0.2625 0.2993 0.2901 -0.0580 0.0840  0.0468  551 VAL A CB  
333  C CG1 . VAL A 51  ? 0.1403 0.1813 0.1892 -0.0572 0.1089  0.0545  551 VAL A CG1 
334  C CG2 . VAL A 51  ? 0.1424 0.2039 0.1914 -0.0715 0.0701  0.0466  551 VAL A CG2 
335  N N   . ILE A 52  ? 0.3465 0.3400 0.3208 -0.0285 0.0869  0.0404  552 ILE A N   
336  C CA  . ILE A 52  ? 0.4364 0.4077 0.3912 -0.0159 0.0990  0.0399  552 ILE A CA  
337  C C   . ILE A 52  ? 0.3611 0.3568 0.3381 -0.0076 0.0912  0.0424  552 ILE A C   
338  O O   . ILE A 52  ? 0.3552 0.3557 0.3473 0.0001  0.1056  0.0479  552 ILE A O   
339  C CB  . ILE A 52  ? 0.4189 0.3465 0.3215 -0.0107 0.0932  0.0291  552 ILE A CB  
340  C CG1 . ILE A 52  ? 0.3852 0.2855 0.2643 -0.0178 0.1032  0.0275  552 ILE A CG1 
341  C CG2 . ILE A 52  ? 0.3541 0.2593 0.2409 0.0032  0.1006  0.0265  552 ILE A CG2 
342  C CD1 . ILE A 52  ? 0.4185 0.2770 0.2518 -0.0137 0.0928  0.0155  552 ILE A CD1 
343  N N   . ALA A 53  ? 0.2944 0.3056 0.2737 -0.0093 0.0689  0.0385  553 ALA A N   
344  C CA  . ALA A 53  ? 0.1721 0.2034 0.1676 -0.0020 0.0597  0.0401  553 ALA A CA  
345  C C   . ALA A 53  ? 0.2315 0.3016 0.2771 -0.0025 0.0648  0.0505  553 ALA A C   
346  O O   . ALA A 53  ? 0.2623 0.3422 0.3213 0.0063  0.0674  0.0542  553 ALA A O   
347  C CB  . ALA A 53  ? 0.1245 0.1631 0.1098 -0.0050 0.0348  0.0332  553 ALA A CB  
348  N N   . GLN A 54  ? 0.3132 0.4052 0.3863 -0.0128 0.0658  0.0548  554 GLN A N   
349  C CA  . GLN A 54  ? 0.1978 0.3249 0.3178 -0.0129 0.0701  0.0641  554 GLN A CA  
350  C C   . GLN A 54  ? 0.2377 0.3575 0.3667 -0.0051 0.0949  0.0700  554 GLN A C   
351  O O   . GLN A 54  ? 0.2547 0.3942 0.4120 0.0020  0.0975  0.0765  554 GLN A O   
352  C CB  . GLN A 54  ? 0.1957 0.3437 0.3389 -0.0256 0.0648  0.0661  554 GLN A CB  
353  C CG  . GLN A 54  ? 0.1980 0.3564 0.3363 -0.0320 0.0387  0.0613  554 GLN A CG  
354  C CD  . GLN A 54  ? 0.2352 0.4041 0.3849 -0.0451 0.0352  0.0612  554 GLN A CD  
355  O OE1 . GLN A 54  ? 0.0838 0.2430 0.2332 -0.0518 0.0518  0.0619  554 GLN A OE1 
356  N NE2 . GLN A 54  ? 0.1126 0.2969 0.2673 -0.0484 0.0149  0.0607  554 GLN A NE2 
357  N N   . HIS A 55  ? 0.1679 0.2570 0.2705 -0.0061 0.1123  0.0676  555 HIS A N   
358  C CA  . HIS A 55  ? 0.1869 0.2648 0.2928 0.0017  0.1366  0.0722  555 HIS A CA  
359  C C   . HIS A 55  ? 0.2785 0.3406 0.3678 0.0161  0.1378  0.0707  555 HIS A C   
360  O O   . HIS A 55  ? 0.2917 0.3626 0.4017 0.0245  0.1495  0.0766  555 HIS A O   
361  C CB  . HIS A 55  ? 0.1396 0.1845 0.2173 -0.0027 0.1534  0.0695  555 HIS A CB  
362  C CG  . HIS A 55  ? 0.3373 0.3995 0.4399 -0.0153 0.1598  0.0734  555 HIS A CG  
363  N ND1 . HIS A 55  ? 0.2968 0.3676 0.4002 -0.0275 0.1443  0.0704  555 HIS A ND1 
364  C CD2 . HIS A 55  ? 0.3696 0.4424 0.4979 -0.0180 0.1802  0.0796  555 HIS A CD2 
365  C CE1 . HIS A 55  ? 0.3199 0.4051 0.4475 -0.0375 0.1550  0.0746  555 HIS A CE1 
366  N NE2 . HIS A 55  ? 0.3761 0.4634 0.5197 -0.0322 0.1768  0.0802  555 HIS A NE2 
367  N N   . VAL A 56  ? 0.3432 0.3817 0.3954 0.0188  0.1251  0.0626  556 VAL A N   
368  C CA  . VAL A 56  ? 0.3902 0.4119 0.4248 0.0313  0.1247  0.0602  556 VAL A CA  
369  C C   . VAL A 56  ? 0.3414 0.3958 0.4103 0.0360  0.1153  0.0661  556 VAL A C   
370  O O   . VAL A 56  ? 0.3511 0.4064 0.4318 0.0455  0.1259  0.0711  556 VAL A O   
371  C CB  . VAL A 56  ? 0.3303 0.3211 0.3199 0.0326  0.1098  0.0492  556 VAL A CB  
372  C CG1 . VAL A 56  ? 0.1757 0.1528 0.1518 0.0441  0.1056  0.0467  556 VAL A CG1 
373  C CG2 . VAL A 56  ? 0.2854 0.2386 0.2400 0.0308  0.1199  0.0438  556 VAL A CG2 
374  N N   . LEU A 57  ? 0.2930 0.3727 0.3769 0.0292  0.0950  0.0657  557 LEU A N   
375  C CA  . LEU A 57  ? 0.2059 0.3145 0.3198 0.0326  0.0832  0.0716  557 LEU A CA  
376  C C   . LEU A 57  ? 0.1704 0.3010 0.3236 0.0358  0.0967  0.0822  557 LEU A C   
377  O O   . LEU A 57  ? 0.2431 0.3800 0.4092 0.0446  0.0986  0.0876  557 LEU A O   
378  C CB  . LEU A 57  ? 0.0849 0.2145 0.2068 0.0230  0.0594  0.0700  557 LEU A CB  
379  C CG  . LEU A 57  ? 0.1795 0.3361 0.3298 0.0233  0.0476  0.0779  557 LEU A CG  
380  C CD1 . LEU A 57  ? 0.1134 0.2622 0.2548 0.0327  0.0457  0.0794  557 LEU A CD1 
381  C CD2 . LEU A 57  ? 0.2414 0.4080 0.3872 0.0130  0.0262  0.0753  557 LEU A CD2 
382  N N   . SER A 58  ? 0.1045 0.2467 0.2765 0.0282  0.1056  0.0850  558 SER A N   
383  C CA  . SER A 58  ? 0.1345 0.2998 0.3456 0.0302  0.1186  0.0943  558 SER A CA  
384  C C   . SER A 58  ? 0.1588 0.3069 0.3658 0.0420  0.1409  0.0970  558 SER A C   
385  O O   . SER A 58  ? 0.1924 0.3573 0.4271 0.0493  0.1468  0.1044  558 SER A O   
386  C CB  . SER A 58  ? 0.0652 0.2407 0.2912 0.0185  0.1258  0.0950  558 SER A CB  
387  O OG  . SER A 58  ? 0.2047 0.3923 0.4594 0.0210  0.1460  0.1020  558 SER A OG  
388  N N   . MET A 59  ? 0.2982 0.2705 0.4215 0.0581  0.1000  0.0264  559 MET A N   
389  C CA  . MET A 59  ? 0.3718 0.3338 0.4871 0.0614  0.1111  0.0250  559 MET A CA  
390  C C   . MET A 59  ? 0.4077 0.3632 0.5108 0.0614  0.1094  0.0216  559 MET A C   
391  O O   . MET A 59  ? 0.3978 0.3470 0.5024 0.0646  0.1161  0.0215  559 MET A O   
392  C CB  . MET A 59  ? 0.2729 0.2280 0.3730 0.0614  0.1170  0.0233  559 MET A CB  
393  C CG  . MET A 59  ? 0.3189 0.2605 0.4068 0.0647  0.1292  0.0214  559 MET A CG  
394  S SD  . MET A 59  ? 0.5045 0.4453 0.6118 0.0696  0.1426  0.0253  559 MET A SD  
395  C CE  . MET A 59  ? 1.4318 1.3531 1.5156 0.0727  0.1556  0.0214  559 MET A CE  
396  N N   . ASP A 60  ? 0.3414 0.2983 0.4330 0.0580  0.1007  0.0189  560 ASP A N   
397  C CA  . ASP A 60  ? 0.3051 0.2569 0.3864 0.0576  0.0981  0.0159  560 ASP A CA  
398  C C   . ASP A 60  ? 0.3465 0.3013 0.4420 0.0590  0.0961  0.0178  560 ASP A C   
399  O O   . ASP A 60  ? 0.2748 0.2223 0.3655 0.0608  0.0987  0.0163  560 ASP A O   
400  C CB  . ASP A 60  ? 0.2864 0.2415 0.3572 0.0536  0.0889  0.0131  560 ASP A CB  
401  C CG  . ASP A 60  ? 0.3132 0.2628 0.3678 0.0526  0.0905  0.0104  560 ASP A CG  
402  O OD1 . ASP A 60  ? 0.4021 0.3423 0.4489 0.0548  0.0988  0.0098  560 ASP A OD1 
403  O OD2 . ASP A 60  ? 0.3878 0.3420 0.4375 0.0497  0.0834  0.0087  560 ASP A OD2 
404  N N   . CYS A 61  ? 0.2865 0.2508 0.3990 0.0582  0.0910  0.0210  561 CYS A N   
405  C CA  . CYS A 61  ? 0.2887 0.2551 0.4149 0.0595  0.0878  0.0229  561 CYS A CA  
406  C C   . CYS A 61  ? 0.4311 0.3934 0.5688 0.0643  0.0971  0.0250  561 CYS A C   
407  O O   . CYS A 61  ? 0.3955 0.3551 0.5390 0.0663  0.0966  0.0253  561 CYS A O   
408  C CB  . CYS A 61  ? 0.2366 0.2124 0.3768 0.0574  0.0790  0.0258  561 CYS A CB  
409  S SG  . CYS A 61  ? 0.3252 0.3039 0.4524 0.0527  0.0683  0.0229  561 CYS A SG  
410  N N   . ARG A 62  ? 0.3893 0.3507 0.5305 0.0662  0.1059  0.0265  562 ARG A N   
411  C CA  . ARG A 62  ? 0.4696 0.4264 0.6210 0.0712  0.1167  0.0281  562 ARG A CA  
412  C C   . ARG A 62  ? 0.4180 0.3617 0.5506 0.0733  0.1232  0.0242  562 ARG A C   
413  O O   . ARG A 62  ? 0.3789 0.3180 0.5173 0.0767  0.1267  0.0243  562 ARG A O   
414  C CB  . ARG A 62  ? 0.5174 0.4764 0.6785 0.0729  0.1256  0.0309  562 ARG A CB  
415  C CG  . ARG A 62  ? 0.6414 0.6126 0.8262 0.0718  0.1199  0.0356  562 ARG A CG  
416  C CD  . ARG A 62  ? 0.8357 0.8090 1.0365 0.0749  0.1306  0.0393  562 ARG A CD  
417  N NE  . ARG A 62  ? 1.0080 0.9767 1.1931 0.0740  0.1370  0.0377  562 ARG A NE  
418  C CZ  . ARG A 62  ? 1.0905 1.0647 1.2744 0.0708  0.1318  0.0386  562 ARG A CZ  
419  N NH1 . ARG A 62  ? 1.1019 1.0859 1.2985 0.0680  0.1204  0.0410  562 ARG A NH1 
420  N NH2 . ARG A 62  ? 1.0769 1.0457 1.2459 0.0704  0.1378  0.0369  562 ARG A NH2 
421  N N   . VAL A 63  ? 0.3971 0.3342 0.5073 0.0712  0.1241  0.0207  563 VAL A N   
422  C CA  . VAL A 63  ? 0.3906 0.3129 0.4808 0.0730  0.1307  0.0169  563 VAL A CA  
423  C C   . VAL A 63  ? 0.4359 0.3549 0.5208 0.0724  0.1243  0.0148  563 VAL A C   
424  O O   . VAL A 63  ? 0.5248 0.4331 0.6042 0.0756  0.1301  0.0134  563 VAL A O   
425  C CB  . VAL A 63  ? 0.3282 0.2430 0.3953 0.0705  0.1318  0.0136  563 VAL A CB  
426  C CG1 . VAL A 63  ? 0.4340 0.3330 0.4794 0.0714  0.1351  0.0095  563 VAL A CG1 
427  C CG2 . VAL A 63  ? 0.2941 0.2065 0.3618 0.0722  0.1415  0.0151  563 VAL A CG2 
428  N N   . ALA A 64  ? 0.3350 0.2621 0.4211 0.0685  0.1127  0.0146  564 ALA A N   
429  C CA  . ALA A 64  ? 0.3764 0.3005 0.4575 0.0675  0.1061  0.0128  564 ALA A CA  
430  C C   . ALA A 64  ? 0.3517 0.2802 0.4527 0.0698  0.1036  0.0158  564 ALA A C   
431  O O   . ALA A 64  ? 0.3797 0.3051 0.4783 0.0694  0.0982  0.0148  564 ALA A O   
432  C CB  . ALA A 64  ? 0.2169 0.1467 0.2897 0.0623  0.0957  0.0110  564 ALA A CB  
433  N N   . ARG A 65  ? 0.3109 0.2460 0.4317 0.0723  0.1075  0.0196  565 ARG A N   
434  C CA  . ARG A 65  ? 0.3190 0.2587 0.4618 0.0747  0.1049  0.0230  565 ARG A CA  
435  C C   . ARG A 65  ? 0.3689 0.3149 0.5164 0.0712  0.0917  0.0238  565 ARG A C   
436  O O   . ARG A 65  ? 0.3846 0.3278 0.5377 0.0724  0.0871  0.0243  565 ARG A O   
437  C CB  . ARG A 65  ? 0.4040 0.3333 0.5469 0.0795  0.1113  0.0221  565 ARG A CB  
438  C CG  . ARG A 65  ? 0.4692 0.3916 0.6100 0.0838  0.1257  0.0218  565 ARG A CG  
439  C CD  . ARG A 65  ? 0.5340 0.4446 0.6725 0.0887  0.1324  0.0204  565 ARG A CD  
440  N NE  . ARG A 65  ? 0.6515 0.5490 0.7710 0.0909  0.1444  0.0174  565 ARG A NE  
441  C CZ  . ARG A 65  ? 0.6500 0.5340 0.7627 0.0955  0.1526  0.0155  565 ARG A CZ  
442  N NH1 . ARG A 65  ? 0.7174 0.6003 0.8421 0.0986  0.1500  0.0164  565 ARG A NH1 
443  N NH2 . ARG A 65  ? 0.6045 0.4748 0.6972 0.0971  0.1632  0.0126  565 ARG A NH2 
444  N N   . ILE A 66  ? 0.3985 0.3517 0.5426 0.0670  0.0857  0.0238  566 ILE A N   
445  C CA  . ILE A 66  ? 0.3260 0.2849 0.4749 0.0638  0.0740  0.0249  566 ILE A CA  
446  C C   . ILE A 66  ? 0.3372 0.3044 0.5090 0.0644  0.0714  0.0296  566 ILE A C   
447  O O   . ILE A 66  ? 0.3362 0.3051 0.5187 0.0639  0.0631  0.0317  566 ILE A O   
448  C CB  . ILE A 66  ? 0.3890 0.3507 0.5224 0.0592  0.0691  0.0223  566 ILE A CB  
449  C CG1 . ILE A 66  ? 0.3682 0.3218 0.4811 0.0583  0.0704  0.0180  566 ILE A CG1 
450  C CG2 . ILE A 66  ? 0.3797 0.3464 0.5178 0.0562  0.0582  0.0235  566 ILE A CG2 
451  C CD1 . ILE A 66  ? 0.3914 0.3476 0.4904 0.0544  0.0672  0.0153  566 ILE A CD1 
452  N N   . LEU A 67  ? 0.4102 0.3814 0.5893 0.0655  0.0783  0.0313  567 LEU A N   
453  C CA  . LEU A 67  ? 0.3237 0.3025 0.5263 0.0663  0.0769  0.0362  567 LEU A CA  
454  C C   . LEU A 67  ? 0.3792 0.3574 0.5966 0.0712  0.0886  0.0386  567 LEU A C   
455  O O   . LEU A 67  ? 0.4084 0.3802 0.6141 0.0734  0.0989  0.0362  567 LEU A O   
456  C CB  . LEU A 67  ? 0.1751 0.1602 0.3752 0.0628  0.0736  0.0368  567 LEU A CB  
457  C CG  . LEU A 67  ? 0.2707 0.2578 0.4613 0.0583  0.0619  0.0353  567 LEU A CG  
458  C CD1 . LEU A 67  ? 0.2113 0.2032 0.3967 0.0553  0.0599  0.0351  567 LEU A CD1 
459  C CD2 . LEU A 67  ? 0.2874 0.2759 0.4934 0.0582  0.0526  0.0384  567 LEU A CD2 
460  N N   . GLY A 68  ? 0.4759 0.4598 0.7191 0.0730  0.0872  0.0433  568 GLY A N   
461  C CA  . GLY A 68  ? 0.4988 0.4842 0.7602 0.0776  0.0989  0.0463  568 GLY A CA  
462  C C   . GLY A 68  ? 0.6545 0.6333 0.9210 0.0830  0.1070  0.0457  568 GLY A C   
463  O O   . GLY A 68  ? 0.7057 0.6830 0.9812 0.0874  0.1199  0.0469  568 GLY A O   
464  N N   . VAL A 69  ? 0.6701 0.6441 0.9303 0.0829  0.0998  0.0439  569 VAL A N   
465  C CA  . VAL A 69  ? 0.6320 0.5982 0.8945 0.0879  0.1062  0.0429  569 VAL A CA  
466  C C   . VAL A 69  ? 0.6241 0.5956 0.9197 0.0921  0.1065  0.0480  569 VAL A C   
467  O O   . VAL A 69  ? 0.6256 0.6009 0.9348 0.0906  0.0943  0.0506  569 VAL A O   
468  C CB  . VAL A 69  ? 0.5615 0.5203 0.8061 0.0860  0.0974  0.0394  569 VAL A CB  
469  C CG1 . VAL A 69  ? 0.4782 0.4266 0.7195 0.0912  0.1051  0.0374  569 VAL A CG1 
470  C CG2 . VAL A 69  ? 0.5573 0.5136 0.7737 0.0811  0.0948  0.0351  569 VAL A CG2 
471  N N   . SER A 70  ? 0.6580 0.6292 0.9668 0.0973  0.1206  0.0495  570 SER A N   
472  C CA  . SER A 70  ? 0.6797 0.6560 1.0224 0.1022  0.1227  0.0544  570 SER A CA  
473  C C   . SER A 70  ? 0.6745 0.6444 1.0199 0.1049  0.1171  0.0535  570 SER A C   
474  O O   . SER A 70  ? 0.6437 0.6040 0.9635 0.1038  0.1152  0.0489  570 SER A O   
475  C CB  . SER A 70  ? 0.6641 0.6393 1.0170 0.1079  0.1415  0.0553  570 SER A CB  
476  O OG  . SER A 70  ? 0.5511 0.5135 0.8846 0.1117  0.1518  0.0507  570 SER A OG  
477  N N   . GLU A 71  ? 0.7591 0.7338 1.1359 0.1085  0.1141  0.0582  571 GLU A N   
478  C CA  . GLU A 71  ? 0.8313 0.7991 1.2124 0.1116  0.1086  0.0577  571 GLU A CA  
479  C C   . GLU A 71  ? 0.7054 0.6625 1.0769 0.1178  0.1235  0.0541  571 GLU A C   
480  O O   . GLU A 71  ? 0.4679 0.4148 0.8254 0.1189  0.1199  0.0510  571 GLU A O   
481  C CB  . GLU A 71  ? 0.9109 0.8862 1.3298 0.1140  0.1006  0.0639  571 GLU A CB  
482  C CG  . GLU A 71  ? 0.9847 0.9526 1.4061 0.1156  0.0896  0.0638  571 GLU A CG  
483  C CD  . GLU A 71  ? 1.0341 0.9961 1.4282 0.1088  0.0745  0.0610  571 GLU A CD  
484  O OE1 . GLU A 71  ? 1.0774 1.0448 1.4634 0.1029  0.0676  0.0614  571 GLU A OE1 
485  O OE2 . GLU A 71  ? 0.9662 0.9178 1.3468 0.1096  0.0698  0.0583  571 GLU A OE2 
486  N N   . GLU A 72  ? 0.7807 0.7389 1.1588 0.1218  0.1402  0.0545  572 GLU A N   
487  C CA  . GLU A 72  ? 0.6967 0.6430 1.0616 0.1275  0.1562  0.0507  572 GLU A CA  
488  C C   . GLU A 72  ? 0.6546 0.5890 0.9780 0.1236  0.1549  0.0444  572 GLU A C   
489  O O   . GLU A 72  ? 0.5291 0.4511 0.8372 0.1262  0.1570  0.0409  572 GLU A O   
490  C CB  . GLU A 72  ? 0.8094 0.7590 1.1853 0.1310  0.1741  0.0523  572 GLU A CB  
491  C CG  . GLU A 72  ? 1.0150 0.9508 1.3758 0.1369  0.1928  0.0484  572 GLU A CG  
492  C CD  . GLU A 72  ? 1.2177 1.1568 1.5907 0.1402  0.2106  0.0505  572 GLU A CD  
493  O OE1 . GLU A 72  ? 1.2288 1.1821 1.6336 0.1402  0.2096  0.0561  572 GLU A OE1 
494  O OE2 . GLU A 72  ? 1.3224 1.2491 1.6727 0.1424  0.2255  0.0467  572 GLU A OE2 
495  N N   . MET A 73  ? 0.7605 0.6986 1.0667 0.1173  0.1508  0.0433  573 MET A N   
496  C CA  . MET A 73  ? 0.7677 0.6962 1.0371 0.1131  0.1485  0.0379  573 MET A CA  
497  C C   . MET A 73  ? 0.6065 0.5299 0.8644 0.1105  0.1346  0.0359  573 MET A C   
498  O O   . MET A 73  ? 0.5129 0.4240 0.7459 0.1104  0.1361  0.0314  573 MET A O   
499  C CB  . MET A 73  ? 0.8282 0.7632 1.0854 0.1070  0.1454  0.0376  573 MET A CB  
500  C CG  . MET A 73  ? 0.8622 0.7882 1.0839 0.1027  0.1428  0.0323  573 MET A CG  
501  S SD  . MET A 73  ? 0.9762 0.8844 1.1726 0.1066  0.1592  0.0275  573 MET A SD  
502  C CE  . MET A 73  ? 0.8596 0.7717 1.0547 0.1057  0.1697  0.0287  573 MET A CE  
503  N N   . ARG A 74  ? 0.5720 0.5038 0.8474 0.1083  0.1210  0.0392  574 ARG A N   
504  C CA  . ARG A 74  ? 0.5157 0.4423 0.7813 0.1056  0.1073  0.0379  574 ARG A CA  
505  C C   . ARG A 74  ? 0.4969 0.4129 0.7658 0.1111  0.1093  0.0371  574 ARG A C   
506  O O   . ARG A 74  ? 0.4983 0.4034 0.7454 0.1097  0.1052  0.0335  574 ARG A O   
507  C CB  . ARG A 74  ? 0.6156 0.5522 0.8989 0.1019  0.0925  0.0421  574 ARG A CB  
508  C CG  . ARG A 74  ? 0.7010 0.6316 0.9747 0.0987  0.0778  0.0413  574 ARG A CG  
509  C CD  . ARG A 74  ? 0.8100 0.7490 1.0905 0.0933  0.0641  0.0442  574 ARG A CD  
510  N NE  . ARG A 74  ? 0.9797 0.9302 1.2879 0.0946  0.0661  0.0490  574 ARG A NE  
511  C CZ  . ARG A 74  ? 1.0070 0.9653 1.3148 0.0928  0.0722  0.0493  574 ARG A CZ  
512  N NH1 . ARG A 74  ? 1.0310 0.9872 1.3125 0.0898  0.0766  0.0450  574 ARG A NH1 
513  N NH2 . ARG A 74  ? 0.9181 0.8862 1.2524 0.0940  0.0735  0.0541  574 ARG A NH2 
514  N N   . ARG A 75  ? 0.5956 0.5147 0.8929 0.1173  0.1153  0.0405  575 ARG A N   
515  C CA  . ARG A 75  ? 0.7756 0.6842 1.0777 0.1234  0.1187  0.0397  575 ARG A CA  
516  C C   . ARG A 75  ? 0.7782 0.6731 1.0532 0.1258  0.1319  0.0344  575 ARG A C   
517  O O   . ARG A 75  ? 0.7752 0.6571 1.0391 0.1288  0.1326  0.0318  575 ARG A O   
518  C CB  . ARG A 75  ? 0.8603 0.7758 1.2001 0.1303  0.1251  0.0445  575 ARG A CB  
519  C CG  . ARG A 75  ? 1.0128 0.9377 1.3809 0.1289  0.1099  0.0499  575 ARG A CG  
520  C CD  . ARG A 75  ? 1.1620 1.0925 1.5690 0.1364  0.1162  0.0545  575 ARG A CD  
521  N NE  . ARG A 75  ? 1.2769 1.2168 1.6993 0.1387  0.1307  0.0566  575 ARG A NE  
522  C CZ  . ARG A 75  ? 1.3216 1.2569 1.7452 0.1451  0.1498  0.0550  575 ARG A CZ  
523  N NH1 . ARG A 75  ? 1.3172 1.2384 1.7275 0.1501  0.1564  0.0511  575 ARG A NH1 
524  N NH2 . ARG A 75  ? 1.2933 1.2368 1.7306 0.1465  0.1624  0.0572  575 ARG A NH2 
525  N N   . ASN A 76  ? 0.7662 0.6631 1.0295 0.1242  0.1416  0.0330  576 ASN A N   
526  C CA  . ASN A 76  ? 0.7111 0.5947 0.9482 0.1261  0.1547  0.0283  576 ASN A CA  
527  C C   . ASN A 76  ? 0.6275 0.5018 0.8304 0.1203  0.1468  0.0238  576 ASN A C   
528  O O   . ASN A 76  ? 0.5791 0.4378 0.7590 0.1220  0.1529  0.0196  576 ASN A O   
529  C CB  . ASN A 76  ? 0.7645 0.6537 1.0029 0.1260  0.1666  0.0291  576 ASN A CB  
530  C CG  . ASN A 76  ? 0.7889 0.6625 1.0036 0.1292  0.1825  0.0249  576 ASN A CG  
531  O OD1 . ASN A 76  ? 0.7715 0.6322 0.9551 0.1266  0.1807  0.0204  576 ASN A OD1 
532  N ND2 . ASN A 76  ? 0.7138 0.5876 0.9427 0.1347  0.1982  0.0266  576 ASN A ND2 
533  N N   . MET A 77  ? 0.5658 0.4489 0.7652 0.1135  0.1334  0.0245  577 MET A N   
534  C CA  . MET A 77  ? 0.4861 0.3622 0.6560 0.1077  0.1258  0.0206  577 MET A CA  
535  C C   . MET A 77  ? 0.5918 0.4603 0.7577 0.1071  0.1151  0.0200  577 MET A C   
536  O O   . MET A 77  ? 0.5844 0.4402 0.7257 0.1053  0.1137  0.0162  577 MET A O   
537  C CB  . MET A 77  ? 0.4657 0.3537 0.6323 0.1008  0.1174  0.0214  577 MET A CB  
538  C CG  . MET A 77  ? 0.3707 0.2650 0.5364 0.1000  0.1262  0.0217  577 MET A CG  
539  S SD  . MET A 77  ? 0.6034 0.5083 0.7587 0.0918  0.1155  0.0214  577 MET A SD  
540  C CE  . MET A 77  ? 0.6116 0.5290 0.7927 0.0902  0.1022  0.0261  577 MET A CE  
541  N N   . GLY A 78  ? 0.6156 0.4909 0.8055 0.1084  0.1071  0.0239  578 GLY A N   
542  C CA  . GLY A 78  ? 0.5698 0.4379 0.7568 0.1072  0.0953  0.0239  578 GLY A CA  
543  C C   . GLY A 78  ? 0.6136 0.4877 0.7941 0.0997  0.0811  0.0247  578 GLY A C   
544  O O   . GLY A 78  ? 0.5720 0.4409 0.7498 0.0975  0.0698  0.0253  578 GLY A O   
545  N N   . VAL A 79  ? 0.5068 0.3912 0.6844 0.0959  0.0821  0.0247  579 VAL A N   
546  C CA  . VAL A 79  ? 0.4664 0.3564 0.6362 0.0891  0.0708  0.0249  579 VAL A CA  
547  C C   . VAL A 79  ? 0.5361 0.4408 0.7211 0.0878  0.0714  0.0277  579 VAL A C   
548  O O   . VAL A 79  ? 0.6685 0.5782 0.8658 0.0915  0.0816  0.0288  579 VAL A O   
549  C CB  . VAL A 79  ? 0.4882 0.3719 0.6283 0.0844  0.0712  0.0204  579 VAL A CB  
550  C CG1 . VAL A 79  ? 0.4735 0.3424 0.5976 0.0837  0.0668  0.0182  579 VAL A CG1 
551  C CG2 . VAL A 79  ? 0.5081 0.3907 0.6390 0.0863  0.0840  0.0179  579 VAL A CG2 
552  N N   . SER A 80  ? 0.4290 0.3397 0.6122 0.0825  0.0609  0.0287  580 SER A N   
553  C CA  . SER A 80  ? 0.4872 0.4108 0.6850 0.0811  0.0602  0.0316  580 SER A CA  
554  C C   . SER A 80  ? 0.5202 0.4484 0.7043 0.0788  0.0671  0.0291  580 SER A C   
555  O O   . SER A 80  ? 0.5187 0.4555 0.7150 0.0796  0.0721  0.0311  580 SER A O   
556  C CB  . SER A 80  ? 0.6308 0.5576 0.8331 0.0769  0.0459  0.0340  580 SER A CB  
557  O OG  . SER A 80  ? 0.7951 0.7203 1.0177 0.0796  0.0396  0.0378  580 SER A OG  
558  N N   . SER A 81  ? 0.5016 0.4236 0.6612 0.0758  0.0672  0.0249  581 SER A N   
559  C CA  . SER A 81  ? 0.4123 0.3381 0.5582 0.0730  0.0713  0.0226  581 SER A CA  
560  C C   . SER A 81  ? 0.3743 0.2904 0.5001 0.0739  0.0796  0.0186  581 SER A C   
561  O O   . SER A 81  ? 0.2681 0.1735 0.3816 0.0740  0.0783  0.0163  581 SER A O   
562  C CB  . SER A 81  ? 0.4597 0.3888 0.5953 0.0673  0.0615  0.0216  581 SER A CB  
563  O OG  . SER A 81  ? 0.5087 0.4369 0.6255 0.0647  0.0647  0.0181  581 SER A OG  
564  N N   . GLY A 82  ? 0.2424 0.1610 0.3638 0.0741  0.0875  0.0177  582 GLY A N   
565  C CA  . GLY A 82  ? 0.2633 0.1717 0.3634 0.0742  0.0943  0.0138  582 GLY A CA  
566  C C   . GLY A 82  ? 0.3412 0.2447 0.4211 0.0695  0.0875  0.0104  582 GLY A C   
567  O O   . GLY A 82  ? 0.4178 0.3098 0.4799 0.0693  0.0908  0.0073  582 GLY A O   
568  N N   . LEU A 83  ? 0.2568 0.1683 0.3391 0.0654  0.0781  0.0111  583 LEU A N   
569  C CA  . LEU A 83  ? 0.3928 0.3020 0.4578 0.0598  0.0718  0.0085  583 LEU A CA  
570  C C   . LEU A 83  ? 0.5205 0.4197 0.5780 0.0587  0.0681  0.0079  583 LEU A C   
571  O O   . LEU A 83  ? 0.4869 0.3809 0.5275 0.0542  0.0653  0.0055  583 LEU A O   
572  C CB  . LEU A 83  ? 0.2800 0.1998 0.3500 0.0560  0.0638  0.0096  583 LEU A CB  
573  C CG  . LEU A 83  ? 0.2540 0.1836 0.3289 0.0559  0.0656  0.0100  583 LEU A CG  
574  C CD1 . LEU A 83  ? 0.3266 0.2645 0.4033 0.0519  0.0574  0.0106  583 LEU A CD1 
575  C CD2 . LEU A 83  ? 0.3204 0.2467 0.3801 0.0545  0.0708  0.0071  583 LEU A CD2 
576  N N   . GLU A 84  ? 0.5768 0.4734 0.6478 0.0628  0.0675  0.0102  584 GLU A N   
577  C CA  . GLU A 84  ? 0.5632 0.4488 0.6281 0.0628  0.0648  0.0097  584 GLU A CA  
578  C C   . GLU A 84  ? 0.4695 0.3439 0.5251 0.0664  0.0739  0.0075  584 GLU A C   
579  O O   . GLU A 84  ? 0.4399 0.3036 0.4781 0.0640  0.0730  0.0052  584 GLU A O   
580  C CB  . GLU A 84  ? 0.6376 0.5241 0.7216 0.0662  0.0601  0.0132  584 GLU A CB  
581  C CG  . GLU A 84  ? 0.8115 0.6861 0.8904 0.0665  0.0566  0.0130  584 GLU A CG  
582  C CD  . GLU A 84  ? 0.9386 0.8140 1.0285 0.0655  0.0462  0.0161  584 GLU A CD  
583  O OE1 . GLU A 84  ? 0.9279 0.8130 1.0291 0.0645  0.0419  0.0184  584 GLU A OE1 
584  O OE2 . GLU A 84  ? 0.9457 0.8110 1.0319 0.0655  0.0417  0.0164  584 GLU A OE2 
585  N N   . LEU A 85  ? 0.4786 0.3549 0.5446 0.0719  0.0829  0.0083  585 LEU A N   
586  C CA  . LEU A 85  ? 0.5104 0.3747 0.5689 0.0763  0.0930  0.0065  585 LEU A CA  
587  C C   . LEU A 85  ? 0.4929 0.3480 0.5255 0.0724  0.0952  0.0029  585 LEU A C   
588  O O   . LEU A 85  ? 0.4090 0.2497 0.4282 0.0741  0.0996  0.0009  585 LEU A O   
589  C CB  . LEU A 85  ? 0.4084 0.2771 0.4826 0.0822  0.1033  0.0082  585 LEU A CB  
590  C CG  . LEU A 85  ? 0.3309 0.1855 0.3964 0.0874  0.1153  0.0063  585 LEU A CG  
591  C CD1 . LEU A 85  ? 0.3127 0.1582 0.3843 0.0917  0.1151  0.0067  585 LEU A CD1 
592  C CD2 . LEU A 85  ? 0.2449 0.1048 0.3225 0.0912  0.1263  0.0081  585 LEU A CD2 
593  N N   . ILE A 86  ? 0.3828 0.2455 0.4083 0.0674  0.0918  0.0021  586 ILE A N   
594  C CA  . ILE A 86  ? 0.4613 0.3156 0.4638 0.0636  0.0933  -0.0009 586 ILE A CA  
595  C C   . ILE A 86  ? 0.5315 0.3777 0.5175 0.0583  0.0861  -0.0027 586 ILE A C   
596  O O   . ILE A 86  ? 0.5433 0.3800 0.5099 0.0552  0.0868  -0.0050 586 ILE A O   
597  C CB  . ILE A 86  ? 0.4731 0.3370 0.4734 0.0601  0.0922  -0.0012 586 ILE A CB  
598  C CG1 . ILE A 86  ? 0.4735 0.3518 0.4844 0.0563  0.0832  0.0003  586 ILE A CG1 
599  C CG2 . ILE A 86  ? 0.5888 0.4555 0.5980 0.0648  0.1010  -0.0002 586 ILE A CG2 
600  C CD1 . ILE A 86  ? 0.6128 0.4979 0.6168 0.0518  0.0804  -0.0008 586 ILE A CD1 
601  N N   . THR A 87  ? 0.4388 0.2880 0.4321 0.0569  0.0791  -0.0013 587 THR A N   
602  C CA  . THR A 87  ? 0.4089 0.2502 0.3875 0.0517  0.0728  -0.0026 587 THR A CA  
603  C C   . THR A 87  ? 0.4667 0.2927 0.4400 0.0555  0.0756  -0.0032 587 THR A C   
604  O O   . THR A 87  ? 0.4624 0.2788 0.4223 0.0518  0.0709  -0.0042 587 THR A O   
605  C CB  . THR A 87  ? 0.4261 0.2761 0.4122 0.0477  0.0638  -0.0009 587 THR A CB  
606  O OG1 . THR A 87  ? 0.3894 0.2398 0.3913 0.0523  0.0627  0.0015  587 THR A OG1 
607  C CG2 . THR A 87  ? 0.2698 0.1348 0.2625 0.0448  0.0614  -0.0003 587 THR A CG2 
608  N N   . LEU A 88  ? 0.4075 0.2311 0.3920 0.0629  0.0834  -0.0024 588 LEU A N   
609  C CA  . LEU A 88  ? 0.4008 0.2103 0.3836 0.0680  0.0874  -0.0028 588 LEU A CA  
610  C C   . LEU A 88  ? 0.4986 0.2945 0.4676 0.0717  0.0979  -0.0052 588 LEU A C   
611  O O   . LEU A 88  ? 0.4301 0.2294 0.3978 0.0724  0.1039  -0.0056 588 LEU A O   
612  C CB  . LEU A 88  ? 0.3575 0.1734 0.3657 0.0743  0.0885  0.0002  588 LEU A CB  
613  C CG  . LEU A 88  ? 0.4517 0.2794 0.4737 0.0711  0.0781  0.0029  588 LEU A CG  
614  C CD1 . LEU A 88  ? 0.3417 0.1741 0.3891 0.0775  0.0788  0.0061  588 LEU A CD1 
615  C CD2 . LEU A 88  ? 0.4191 0.2396 0.4271 0.0653  0.0687  0.0022  588 LEU A CD2 
616  N N   . PRO A 89  ? 0.7382 0.5171 0.6955 0.0740  0.1002  -0.0067 589 PRO A N   
617  C CA  . PRO A 89  ? 0.7037 0.4663 0.6453 0.0778  0.1106  -0.0092 589 PRO A CA  
618  C C   . PRO A 89  ? 0.5596 0.3267 0.5145 0.0844  0.1225  -0.0084 589 PRO A C   
619  O O   . PRO A 89  ? 0.5543 0.3162 0.4958 0.0838  0.1286  -0.0099 589 PRO A O   
620  C CB  . PRO A 89  ? 0.6460 0.3929 0.5827 0.0814  0.1111  -0.0100 589 PRO A CB  
621  C CG  . PRO A 89  ? 0.6418 0.3922 0.5768 0.0750  0.0981  -0.0092 589 PRO A CG  
622  C CD  . PRO A 89  ? 0.6275 0.3995 0.5821 0.0724  0.0925  -0.0065 589 PRO A CD  
623  N N   . HIS A 90  ? 0.4467 0.2228 0.4275 0.0904  0.1254  -0.0058 590 HIS A N   
624  C CA  . HIS A 90  ? 0.5161 0.2964 0.5111 0.0967  0.1375  -0.0047 590 HIS A CA  
625  C C   . HIS A 90  ? 0.5855 0.3821 0.5890 0.0938  0.1369  -0.0031 590 HIS A C   
626  O O   . HIS A 90  ? 0.5369 0.3408 0.5574 0.0984  0.1453  -0.0013 590 HIS A O   
627  C CB  . HIS A 90  ? 0.6176 0.4023 0.6399 0.1043  0.1412  -0.0020 590 HIS A CB  
628  C CG  . HIS A 90  ? 0.7640 0.5610 0.8045 0.1022  0.1286  0.0008  590 HIS A CG  
629  N ND1 . HIS A 90  ? 0.8405 0.6527 0.9111 0.1054  0.1277  0.0046  590 HIS A ND1 
630  C CD2 . HIS A 90  ? 0.8440 0.6389 0.8761 0.0969  0.1164  0.0005  590 HIS A CD2 
631  C CE1 . HIS A 90  ? 0.8874 0.7053 0.9659 0.1022  0.1149  0.0065  590 HIS A CE1 
632  N NE2 . HIS A 90  ? 0.9199 0.7275 0.9752 0.0971  0.1084  0.0040  590 HIS A NE2 
633  N N   . GLY A 91  ? 0.5326 0.3349 0.5251 0.0861  0.1273  -0.0038 591 GLY A N   
634  C CA  . GLY A 91  ? 0.5619 0.3775 0.5590 0.0832  0.1265  -0.0028 591 GLY A CA  
635  C C   . GLY A 91  ? 0.5577 0.3626 0.5308 0.0808  0.1315  -0.0055 591 GLY A C   
636  O O   . GLY A 91  ? 0.5412 0.3542 0.5121 0.0771  0.1293  -0.0053 591 GLY A O   
637  N N   . HIS A 92  ? 0.4784 0.2636 0.4324 0.0828  0.1377  -0.0079 592 HIS A N   
638  C CA  . HIS A 92  ? 0.5051 0.2756 0.4322 0.0802  0.1413  -0.0106 592 HIS A CA  
639  C C   . HIS A 92  ? 0.5695 0.3442 0.5000 0.0820  0.1498  -0.0098 592 HIS A C   
640  O O   . HIS A 92  ? 0.5800 0.3549 0.4977 0.0771  0.1466  -0.0106 592 HIS A O   
641  C CB  . HIS A 92  ? 0.5361 0.2829 0.4437 0.0836  0.1483  -0.0131 592 HIS A CB  
642  C CG  . HIS A 92  ? 0.5633 0.2914 0.4407 0.0809  0.1519  -0.0157 592 HIS A CG  
643  N ND1 . HIS A 92  ? 0.6675 0.3941 0.5276 0.0730  0.1419  -0.0168 592 HIS A ND1 
644  C CD2 . HIS A 92  ? 0.5249 0.2338 0.3858 0.0850  0.1642  -0.0175 592 HIS A CD2 
645  C CE1 . HIS A 92  ? 0.7171 0.4241 0.5512 0.0721  0.1468  -0.0189 592 HIS A CE1 
646  N NE2 . HIS A 92  ? 0.6314 0.3265 0.4641 0.0792  0.1606  -0.0194 592 HIS A NE2 
647  N N   . GLN A 93  ? 0.5824 0.3601 0.5307 0.0889  0.1606  -0.0082 593 GLN A N   
648  C CA  . GLN A 93  ? 0.5755 0.3573 0.5286 0.0907  0.1696  -0.0070 593 GLN A CA  
649  C C   . GLN A 93  ? 0.5723 0.3737 0.5371 0.0859  0.1608  -0.0051 593 GLN A C   
650  O O   . GLN A 93  ? 0.5170 0.3172 0.4702 0.0828  0.1615  -0.0057 593 GLN A O   
651  C CB  . GLN A 93  ? 0.6142 0.4002 0.5912 0.0987  0.1813  -0.0048 593 GLN A CB  
652  C CG  . GLN A 93  ? 0.7331 0.5238 0.7172 0.1007  0.1916  -0.0032 593 GLN A CG  
653  C CD  . GLN A 93  ? 0.8566 0.6251 0.8152 0.1026  0.2047  -0.0057 593 GLN A CD  
654  O OE1 . GLN A 93  ? 0.9745 0.7416 0.9403 0.1070  0.2181  -0.0045 593 GLN A OE1 
655  N NE2 . GLN A 93  ? 0.8391 0.5892 0.7670 0.0991  0.2011  -0.0091 593 GLN A NE2 
656  N N   . LEU A 94  ? 0.5500 0.3682 0.5369 0.0854  0.1523  -0.0029 594 LEU A N   
657  C CA  . LEU A 94  ? 0.4256 0.2621 0.4245 0.0813  0.1435  -0.0011 594 LEU A CA  
658  C C   . LEU A 94  ? 0.4442 0.2777 0.4215 0.0743  0.1355  -0.0033 594 LEU A C   
659  O O   . LEU A 94  ? 0.3894 0.2280 0.3640 0.0718  0.1350  -0.0031 594 LEU A O   
660  C CB  . LEU A 94  ? 0.3436 0.1932 0.3629 0.0811  0.1343  0.0011  594 LEU A CB  
661  C CG  . LEU A 94  ? 0.5428 0.4114 0.5874 0.0812  0.1317  0.0051  594 LEU A CG  
662  C CD1 . LEU A 94  ? 0.5394 0.4182 0.5957 0.0785  0.1196  0.0065  594 LEU A CD1 
663  C CD2 . LEU A 94  ? 0.4162 0.2913 0.4560 0.0778  0.1314  0.0051  594 LEU A CD2 
664  N N   . ARG A 95  ? 0.4342 0.2591 0.3967 0.0710  0.1292  -0.0053 595 ARG A N   
665  C CA  . ARG A 95  ? 0.3988 0.2195 0.3413 0.0643  0.1217  -0.0074 595 ARG A CA  
666  C C   . ARG A 95  ? 0.4999 0.3093 0.4240 0.0636  0.1274  -0.0087 595 ARG A C   
667  O O   . ARG A 95  ? 0.4342 0.2488 0.3531 0.0591  0.1218  -0.0089 595 ARG A O   
668  C CB  . ARG A 95  ? 0.3123 0.1216 0.2398 0.0614  0.1160  -0.0092 595 ARG A CB  
669  C CG  . ARG A 95  ? 0.3340 0.1554 0.2752 0.0591  0.1066  -0.0080 595 ARG A CG  
670  C CD  . ARG A 95  ? 0.4319 0.2423 0.3567 0.0548  0.1000  -0.0097 595 ARG A CD  
671  N NE  . ARG A 95  ? 0.4210 0.2135 0.3356 0.0588  0.1062  -0.0109 595 ARG A NE  
672  C CZ  . ARG A 95  ? 0.4800 0.2714 0.4057 0.0631  0.1076  -0.0100 595 ARG A CZ  
673  N NH1 . ARG A 95  ? 0.4523 0.2589 0.3987 0.0633  0.1026  -0.0077 595 ARG A NH1 
674  N NH2 . ARG A 95  ? 0.5779 0.3520 0.4934 0.0672  0.1138  -0.0114 595 ARG A NH2 
675  N N   . LEU A 96  ? 0.4279 0.2210 0.3417 0.0681  0.1386  -0.0096 596 LEU A N   
676  C CA  . LEU A 96  ? 0.4761 0.2555 0.3698 0.0674  0.1447  -0.0108 596 LEU A CA  
677  C C   . LEU A 96  ? 0.5533 0.3459 0.4607 0.0682  0.1478  -0.0088 596 LEU A C   
678  O O   . LEU A 96  ? 0.6316 0.4206 0.5257 0.0645  0.1457  -0.0093 596 LEU A O   
679  C CB  . LEU A 96  ? 0.5659 0.3240 0.4453 0.0725  0.1576  -0.0123 596 LEU A CB  
680  C CG  . LEU A 96  ? 0.6864 0.4273 0.5483 0.0721  0.1554  -0.0146 596 LEU A CG  
681  C CD1 . LEU A 96  ? 0.7417 0.4628 0.5937 0.0787  0.1699  -0.0158 596 LEU A CD1 
682  C CD2 . LEU A 96  ? 0.4900 0.2193 0.3258 0.0647  0.1455  -0.0166 596 LEU A CD2 
683  N N   . ASP A 97  ? 0.5305 0.3372 0.4641 0.0727  0.1523  -0.0062 597 ASP A N   
684  C CA  . ASP A 97  ? 0.4192 0.2395 0.3682 0.0733  0.1546  -0.0038 597 ASP A CA  
685  C C   . ASP A 97  ? 0.4647 0.2988 0.4162 0.0675  0.1416  -0.0036 597 ASP A C   
686  O O   . ASP A 97  ? 0.4670 0.3026 0.4130 0.0651  0.1408  -0.0034 597 ASP A O   
687  C CB  . ASP A 97  ? 0.3872 0.2212 0.3663 0.0787  0.1595  -0.0007 597 ASP A CB  
688  C CG  . ASP A 97  ? 0.5297 0.3522 0.5105 0.0853  0.1744  -0.0005 597 ASP A CG  
689  O OD1 . ASP A 97  ? 0.4915 0.2959 0.4503 0.0859  0.1833  -0.0024 597 ASP A OD1 
690  O OD2 . ASP A 97  ? 0.6536 0.4845 0.6581 0.0898  0.1772  0.0018  597 ASP A OD2 
691  N N   . ILE A 98  ? 0.4040 0.2473 0.3634 0.0652  0.1318  -0.0036 598 ILE A N   
692  C CA  . ILE A 98  ? 0.3270 0.1832 0.2895 0.0600  0.1202  -0.0035 598 ILE A CA  
693  C C   . ILE A 98  ? 0.3622 0.2094 0.3024 0.0551  0.1161  -0.0056 598 ILE A C   
694  O O   . ILE A 98  ? 0.3486 0.2043 0.2910 0.0524  0.1114  -0.0052 598 ILE A O   
695  C CB  . ILE A 98  ? 0.3202 0.1843 0.2911 0.0581  0.1114  -0.0035 598 ILE A CB  
696  C CG1 . ILE A 98  ? 0.3697 0.2472 0.3660 0.0618  0.1119  -0.0007 598 ILE A CG1 
697  C CG2 . ILE A 98  ? 0.2635 0.1361 0.2307 0.0520  0.1006  -0.0043 598 ILE A CG2 
698  C CD1 . ILE A 98  ? 0.5847 0.4641 0.5871 0.0614  0.1062  -0.0005 598 ILE A CD1 
699  N N   . ILE A 99  ? 0.4591 0.2880 0.3778 0.0540  0.1177  -0.0078 599 ILE A N   
700  C CA  . ILE A 99  ? 0.5330 0.3501 0.4288 0.0492  0.1133  -0.0095 599 ILE A CA  
701  C C   . ILE A 99  ? 0.4996 0.3101 0.3869 0.0500  0.1193  -0.0092 599 ILE A C   
702  O O   . ILE A 99  ? 0.4653 0.2776 0.3463 0.0460  0.1128  -0.0094 599 ILE A O   
703  C CB  . ILE A 99  ? 0.4929 0.2897 0.3664 0.0479  0.1133  -0.0117 599 ILE A CB  
704  C CG1 . ILE A 99  ? 0.5023 0.3063 0.3816 0.0448  0.1043  -0.0120 599 ILE A CG1 
705  C CG2 . ILE A 99  ? 0.4254 0.2061 0.2734 0.0434  0.1100  -0.0132 599 ILE A CG2 
706  C CD1 . ILE A 99  ? 0.5581 0.3441 0.4214 0.0451  0.1057  -0.0136 599 ILE A CD1 
707  N N   . GLU A 100 ? 0.3639 0.1666 0.2515 0.0552  0.1319  -0.0086 600 GLU A N   
708  C CA  . GLU A 100 ? 0.5155 0.3099 0.3935 0.0559  0.1391  -0.0081 600 GLU A CA  
709  C C   . GLU A 100 ? 0.5063 0.3192 0.4017 0.0549  0.1355  -0.0060 600 GLU A C   
710  O O   . GLU A 100 ? 0.5057 0.3141 0.3896 0.0520  0.1333  -0.0061 600 GLU A O   
711  C CB  . GLU A 100 ? 0.5031 0.2866 0.3806 0.0619  0.1547  -0.0077 600 GLU A CB  
712  C CG  . GLU A 100 ? 0.6258 0.3982 0.4912 0.0626  0.1642  -0.0072 600 GLU A CG  
713  C CD  . GLU A 100 ? 0.7436 0.4915 0.5739 0.0586  0.1625  -0.0096 600 GLU A CD  
714  O OE1 . GLU A 100 ? 0.7621 0.4893 0.5728 0.0600  0.1686  -0.0115 600 GLU A OE1 
715  O OE2 . GLU A 100 ? 0.7356 0.4840 0.5576 0.0540  0.1548  -0.0094 600 GLU A OE2 
716  N N   . ARG A 101 ? 0.4615 0.2939 0.3836 0.0573  0.1344  -0.0040 601 ARG A N   
717  C CA  . ARG A 101 ? 0.4516 0.3006 0.3905 0.0568  0.1314  -0.0018 601 ARG A CA  
718  C C   . ARG A 101 ? 0.4681 0.3235 0.4021 0.0514  0.1186  -0.0028 601 ARG A C   
719  O O   . ARG A 101 ? 0.3903 0.2496 0.3241 0.0498  0.1164  -0.0021 601 ARG A O   
720  C CB  . ARG A 101 ? 0.4097 0.2762 0.3767 0.0601  0.1315  0.0005  601 ARG A CB  
721  C CG  . ARG A 101 ? 0.3996 0.2842 0.3838 0.0587  0.1248  0.0024  601 ARG A CG  
722  C CD  . ARG A 101 ? 0.4238 0.3219 0.4344 0.0624  0.1269  0.0054  601 ARG A CD  
723  N NE  . ARG A 101 ? 0.4123 0.3259 0.4369 0.0602  0.1194  0.0077  601 ARG A NE  
724  C CZ  . ARG A 101 ? 0.4453 0.3633 0.4777 0.0608  0.1229  0.0102  601 ARG A CZ  
725  N NH1 . ARG A 101 ? 0.3689 0.2776 0.3974 0.0637  0.1346  0.0107  601 ARG A NH1 
726  N NH2 . ARG A 101 ? 0.4839 0.4149 0.5276 0.0585  0.1151  0.0120  601 ARG A NH2 
727  N N   . HIS A 102 ? 0.3825 0.2386 0.3126 0.0486  0.1106  -0.0044 602 HIS A N   
728  C CA  . HIS A 102 ? 0.3493 0.2125 0.2774 0.0436  0.0989  -0.0053 602 HIS A CA  
729  C C   . HIS A 102 ? 0.4365 0.2856 0.3427 0.0402  0.0967  -0.0065 602 HIS A C   
730  O O   . HIS A 102 ? 0.5222 0.3774 0.4302 0.0381  0.0914  -0.0061 602 HIS A O   
731  C CB  . HIS A 102 ? 0.3418 0.2075 0.2705 0.0413  0.0924  -0.0065 602 HIS A CB  
732  C CG  . HIS A 102 ? 0.4061 0.2832 0.3391 0.0367  0.0813  -0.0070 602 HIS A CG  
733  N ND1 . HIS A 102 ? 0.2925 0.1626 0.2109 0.0322  0.0748  -0.0083 602 HIS A ND1 
734  C CD2 . HIS A 102 ? 0.4134 0.3079 0.3637 0.0361  0.0759  -0.0064 602 HIS A CD2 
735  C CE1 . HIS A 102 ? 0.3880 0.2721 0.3167 0.0292  0.0664  -0.0084 602 HIS A CE1 
736  N NE2 . HIS A 102 ? 0.2997 0.1981 0.2467 0.0315  0.0674  -0.0074 602 HIS A NE2 
737  N N   . ASN A 103 ? 0.4162 0.2450 0.3009 0.0398  0.1004  -0.0079 603 ASN A N   
738  C CA  . ASN A 103 ? 0.4650 0.2762 0.3255 0.0364  0.0982  -0.0089 603 ASN A CA  
739  C C   . ASN A 103 ? 0.4611 0.2698 0.3194 0.0377  0.1036  -0.0077 603 ASN A C   
740  O O   . ASN A 103 ? 0.4206 0.2262 0.2702 0.0343  0.0971  -0.0077 603 ASN A O   
741  C CB  . ASN A 103 ? 0.5401 0.3272 0.3768 0.0368  0.1039  -0.0105 603 ASN A CB  
742  C CG  . ASN A 103 ? 0.6095 0.3935 0.4409 0.0338  0.0965  -0.0119 603 ASN A CG  
743  O OD1 . ASN A 103 ? 0.6989 0.4918 0.5344 0.0293  0.0851  -0.0121 603 ASN A OD1 
744  N ND2 . ASN A 103 ? 0.4971 0.2681 0.3195 0.0362  0.1031  -0.0129 603 ASN A ND2 
745  N N   . THR A 104 ? 0.4085 0.2176 0.2748 0.0426  0.1156  -0.0064 604 THR A N   
746  C CA  . THR A 104 ? 0.4767 0.2826 0.3412 0.0439  0.1225  -0.0049 604 THR A CA  
747  C C   . THR A 104 ? 0.5275 0.3530 0.4098 0.0426  0.1148  -0.0034 604 THR A C   
748  O O   . THR A 104 ? 0.4050 0.2261 0.2789 0.0406  0.1129  -0.0028 604 THR A O   
749  C CB  . THR A 104 ? 0.4659 0.2701 0.3390 0.0496  0.1374  -0.0036 604 THR A CB  
750  O OG1 . THR A 104 ? 0.5504 0.3320 0.4015 0.0507  0.1454  -0.0053 604 THR A OG1 
751  C CG2 . THR A 104 ? 0.3837 0.1894 0.2609 0.0508  0.1445  -0.0014 604 THR A CG2 
752  N N   . MET A 105 ? 0.4693 0.3149 0.3748 0.0436  0.1101  -0.0027 605 MET A N   
753  C CA  . MET A 105 ? 0.3910 0.2547 0.3134 0.0426  0.1027  -0.0015 605 MET A CA  
754  C C   . MET A 105 ? 0.4941 0.3569 0.4065 0.0378  0.0909  -0.0029 605 MET A C   
755  O O   . MET A 105 ? 0.4692 0.3347 0.3817 0.0365  0.0872  -0.0022 605 MET A O   
756  C CB  . MET A 105 ? 0.3397 0.2221 0.2861 0.0446  0.1004  -0.0006 605 MET A CB  
757  C CG  . MET A 105 ? 0.3781 0.2781 0.3411 0.0438  0.0932  0.0006  605 MET A CG  
758  S SD  . MET A 105 ? 0.5789 0.4973 0.5673 0.0462  0.0912  0.0019  605 MET A SD  
759  C CE  . MET A 105 ? 0.8890 0.8006 0.8823 0.0509  0.1037  0.0035  605 MET A CE  
760  N N   . ALA A 106 ? 0.4344 0.2932 0.3388 0.0351  0.0847  -0.0047 606 ALA A N   
761  C CA  . ALA A 106 ? 0.2812 0.1391 0.1779 0.0305  0.0734  -0.0058 606 ALA A CA  
762  C C   . ALA A 106 ? 0.4945 0.3346 0.3700 0.0285  0.0734  -0.0058 606 ALA A C   
763  O O   . ALA A 106 ? 0.5061 0.3493 0.3816 0.0263  0.0658  -0.0055 606 ALA A O   
764  C CB  . ALA A 106 ? 0.3171 0.1714 0.2076 0.0276  0.0677  -0.0074 606 ALA A CB  
765  N N   . ILE A 107 ? 0.4885 0.3088 0.3451 0.0294  0.0819  -0.0061 607 ILE A N   
766  C CA  . ILE A 107 ? 0.4922 0.2927 0.3256 0.0274  0.0828  -0.0061 607 ILE A CA  
767  C C   . ILE A 107 ? 0.5604 0.3677 0.4018 0.0288  0.0854  -0.0042 607 ILE A C   
768  O O   . ILE A 107 ? 0.5628 0.3636 0.3938 0.0258  0.0788  -0.0040 607 ILE A O   
769  C CB  . ILE A 107 ? 0.4847 0.2616 0.2957 0.0287  0.0935  -0.0068 607 ILE A CB  
770  C CG1 . ILE A 107 ? 0.4788 0.2466 0.2792 0.0269  0.0897  -0.0087 607 ILE A CG1 
771  C CG2 . ILE A 107 ? 0.5004 0.2552 0.2853 0.0262  0.0943  -0.0067 607 ILE A CG2 
772  C CD1 . ILE A 107 ? 0.4800 0.2252 0.2600 0.0292  0.1014  -0.0097 607 ILE A CD1 
773  N N   . GLY A 108 ? 0.4377 0.2578 0.2980 0.0330  0.0940  -0.0027 608 GLY A N   
774  C CA  . GLY A 108 ? 0.4062 0.2329 0.2750 0.0341  0.0968  -0.0006 608 GLY A CA  
775  C C   . GLY A 108 ? 0.4436 0.2852 0.3243 0.0320  0.0847  -0.0003 608 GLY A C   
776  O O   . GLY A 108 ? 0.4369 0.2748 0.3120 0.0306  0.0822  0.0006  608 GLY A O   
777  N N   . ILE A 109 ? 0.4245 0.2822 0.3211 0.0319  0.0773  -0.0011 609 ILE A N   
778  C CA  . ILE A 109 ? 0.4371 0.3085 0.3448 0.0302  0.0661  -0.0013 609 ILE A CA  
779  C C   . ILE A 109 ? 0.4119 0.2702 0.3014 0.0262  0.0575  -0.0021 609 ILE A C   
780  O O   . ILE A 109 ? 0.5181 0.3772 0.4075 0.0254  0.0532  -0.0013 609 ILE A O   
781  C CB  . ILE A 109 ? 0.4386 0.3259 0.3624 0.0302  0.0604  -0.0024 609 ILE A CB  
782  C CG1 . ILE A 109 ? 0.4479 0.3467 0.3890 0.0339  0.0676  -0.0014 609 ILE A CG1 
783  C CG2 . ILE A 109 ? 0.3422 0.2433 0.2779 0.0289  0.0502  -0.0027 609 ILE A CG2 
784  C CD1 . ILE A 109 ? 0.4333 0.3426 0.3892 0.0365  0.0706  0.0008  609 ILE A CD1 
785  N N   . ALA A 110 ? 0.4125 0.2580 0.2864 0.0234  0.0542  -0.0036 610 ALA A N   
786  C CA  . ALA A 110 ? 0.5152 0.3452 0.3698 0.0192  0.0453  -0.0041 610 ALA A CA  
787  C C   . ALA A 110 ? 0.6291 0.4428 0.4664 0.0187  0.0491  -0.0029 610 ALA A C   
788  O O   . ALA A 110 ? 0.6785 0.4877 0.5095 0.0161  0.0403  -0.0026 610 ALA A O   
789  C CB  . ALA A 110 ? 0.4674 0.2817 0.3045 0.0165  0.0438  -0.0055 610 ALA A CB  
790  N N   . VAL A 111 ? 0.5208 0.3249 0.3503 0.0212  0.0622  -0.0023 611 VAL A N   
791  C CA  . VAL A 111 ? 0.6172 0.4039 0.4281 0.0204  0.0673  -0.0011 611 VAL A CA  
792  C C   . VAL A 111 ? 0.6906 0.4917 0.5177 0.0216  0.0657  0.0007  611 VAL A C   
793  O O   . VAL A 111 ? 0.5581 0.3479 0.3724 0.0199  0.0651  0.0018  611 VAL A O   
794  C CB  . VAL A 111 ? 0.5894 0.3632 0.3900 0.0231  0.0834  -0.0007 611 VAL A CB  
795  C CG1 . VAL A 111 ? 0.4742 0.2392 0.2670 0.0236  0.0918  0.0013  611 VAL A CG1 
796  C CG2 . VAL A 111 ? 0.6286 0.3788 0.4026 0.0209  0.0841  -0.0025 611 VAL A CG2 
797  N N   . ASP A 112 ? 0.6995 0.5247 0.5538 0.0243  0.0646  0.0010  612 ASP A N   
798  C CA  . ASP A 112 ? 0.5708 0.4103 0.4416 0.0256  0.0631  0.0027  612 ASP A CA  
799  C C   . ASP A 112 ? 0.5995 0.4425 0.4710 0.0230  0.0489  0.0021  612 ASP A C   
800  O O   . ASP A 112 ? 0.6062 0.4505 0.4793 0.0228  0.0462  0.0034  612 ASP A O   
801  C CB  . ASP A 112 ? 0.6375 0.4992 0.5352 0.0293  0.0665  0.0032  612 ASP A CB  
802  C CG  . ASP A 112 ? 0.8197 0.6953 0.7339 0.0306  0.0644  0.0050  612 ASP A CG  
803  O OD1 . ASP A 112 ? 0.9563 0.8230 0.8615 0.0297  0.0662  0.0066  612 ASP A OD1 
804  O OD2 . ASP A 112 ? 0.8710 0.7649 0.8057 0.0323  0.0606  0.0049  612 ASP A OD2 
805  N N   . ILE A 113 ? 0.5319 0.3766 0.4031 0.0210  0.0398  0.0003  613 ILE A N   
806  C CA  . ILE A 113 ? 0.5045 0.3514 0.3766 0.0185  0.0262  -0.0002 613 ILE A CA  
807  C C   . ILE A 113 ? 0.5385 0.3613 0.3840 0.0147  0.0216  0.0000  613 ILE A C   
808  O O   . ILE A 113 ? 0.5835 0.4036 0.4263 0.0134  0.0142  0.0008  613 ILE A O   
809  C CB  . ILE A 113 ? 0.4346 0.2922 0.3174 0.0175  0.0181  -0.0019 613 ILE A CB  
810  C CG1 . ILE A 113 ? 0.4788 0.3589 0.3863 0.0209  0.0221  -0.0022 613 ILE A CG1 
811  C CG2 . ILE A 113 ? 0.4012 0.2606 0.2863 0.0150  0.0042  -0.0022 613 ILE A CG2 
812  C CD1 . ILE A 113 ? 0.4810 0.3696 0.3968 0.0199  0.0181  -0.0038 613 ILE A CD1 
813  N N   . LEU A 114 ? 0.6411 0.4450 0.4657 0.0129  0.0256  -0.0005 614 LEU A N   
814  C CA  . LEU A 114 ? 0.5703 0.3489 0.3669 0.0085  0.0192  -0.0005 614 LEU A CA  
815  C C   . LEU A 114 ? 0.6552 0.4131 0.4295 0.0080  0.0275  0.0008  614 LEU A C   
816  O O   . LEU A 114 ? 0.7468 0.4827 0.4969 0.0042  0.0215  0.0011  614 LEU A O   
817  C CB  . LEU A 114 ? 0.5409 0.3067 0.3233 0.0063  0.0183  -0.0019 614 LEU A CB  
818  C CG  . LEU A 114 ? 0.5489 0.3233 0.3411 0.0037  0.0051  -0.0030 614 LEU A CG  
819  C CD1 . LEU A 114 ? 0.5470 0.3129 0.3298 0.0027  0.0081  -0.0042 614 LEU A CD1 
820  C CD2 . LEU A 114 ? 0.5657 0.3272 0.3454 -0.0008 -0.0095 -0.0024 614 LEU A CD2 
821  N N   . GLY A 115 ? 0.7387 0.5027 0.5207 0.0116  0.0413  0.0018  615 GLY A N   
822  C CA  . GLY A 115 ? 0.8567 0.6010 0.6180 0.0111  0.0515  0.0032  615 GLY A CA  
823  C C   . GLY A 115 ? 1.0272 0.7833 0.8028 0.0132  0.0563  0.0054  615 GLY A C   
824  O O   . GLY A 115 ? 1.0269 0.7681 0.7863 0.0112  0.0578  0.0068  615 GLY A O   
825  N N   . CYS A 116 ? 1.1673 0.9491 0.9724 0.0169  0.0585  0.0057  616 CYS A N   
826  C CA  . CYS A 116 ? 1.2846 1.0788 1.1056 0.0190  0.0637  0.0080  616 CYS A CA  
827  C C   . CYS A 116 ? 1.2916 1.0961 1.1227 0.0180  0.0506  0.0084  616 CYS A C   
828  O O   . CYS A 116 ? 1.2712 1.0912 1.1211 0.0201  0.0517  0.0099  616 CYS A O   
829  C CB  . CYS A 116 ? 1.3308 1.1457 1.1777 0.0234  0.0721  0.0084  616 CYS A CB  
830  S SG  . CYS A 116 ? 1.6197 1.4244 1.4588 0.0255  0.0881  0.0081  616 CYS A SG  
831  N N   . THR A 117 ? 1.2848 1.0803 1.1038 0.0149  0.0379  0.0071  617 THR A N   
832  C CA  . THR A 117 ? 1.2437 1.0478 1.0720 0.0142  0.0249  0.0073  617 THR A CA  
833  C C   . THR A 117 ? 1.3305 1.1124 1.1343 0.0100  0.0165  0.0078  617 THR A C   
834  O O   . THR A 117 ? 1.2569 1.0164 1.0353 0.0069  0.0167  0.0074  617 THR A O   
835  C CB  . THR A 117 ? 1.0680 0.8898 0.9149 0.0151  0.0147  0.0052  617 THR A CB  
836  O OG1 . THR A 117 ? 1.1343 0.9453 0.9684 0.0128  0.0121  0.0037  617 THR A OG1 
837  C CG2 . THR A 117 ? 0.9011 0.7463 0.7742 0.0192  0.0209  0.0051  617 THR A CG2 
838  N N   . GLY A 118 ? 1.3523 1.1396 1.1630 0.0099  0.0087  0.0089  618 GLY A N   
839  C CA  . GLY A 118 ? 1.3086 1.0769 1.0992 0.0061  -0.0013 0.0096  618 GLY A CA  
840  C C   . GLY A 118 ? 1.2176 0.9930 1.0176 0.0053  -0.0184 0.0083  618 GLY A C   
841  O O   . GLY A 118 ? 1.3842 1.1473 1.1713 0.0024  -0.0261 0.0073  618 GLY A O   
842  N N   . THR A 119 ? 0.9328 0.7275 0.7556 0.0080  -0.0243 0.0082  619 THR A N   
843  C CA  . THR A 119 ? 0.8487 0.6508 0.6825 0.0078  -0.0400 0.0071  619 THR A CA  
844  C C   . THR A 119 ? 0.8622 0.6836 0.7172 0.0098  -0.0421 0.0050  619 THR A C   
845  O O   . THR A 119 ? 0.9119 0.7435 0.7754 0.0118  -0.0317 0.0043  619 THR A O   
846  C CB  . THR A 119 ? 0.7632 0.5760 0.6112 0.0099  -0.0460 0.0078  619 THR A CB  
847  O OG1 . THR A 119 ? 0.7699 0.6058 0.6420 0.0143  -0.0386 0.0073  619 THR A OG1 
848  C CG2 . THR A 119 ? 0.7610 0.5555 0.5891 0.0077  -0.0438 0.0101  619 THR A CG2 
849  N N   . LEU A 120 ? 0.7174 0.5431 0.5808 0.0090  -0.0557 0.0041  620 LEU A N   
850  C CA  . LEU A 120 ? 0.6359 0.4806 0.5210 0.0106  -0.0587 0.0022  620 LEU A CA  
851  C C   . LEU A 120 ? 0.6232 0.4920 0.5330 0.0155  -0.0516 0.0014  620 LEU A C   
852  O O   . LEU A 120 ? 0.5495 0.4310 0.4710 0.0171  -0.0451 0.0003  620 LEU A O   
853  C CB  . LEU A 120 ? 0.5598 0.4063 0.4532 0.0094  -0.0747 0.0018  620 LEU A CB  
854  C CG  . LEU A 120 ? 0.6215 0.4887 0.5395 0.0110  -0.0777 0.0001  620 LEU A CG  
855  C CD1 . LEU A 120 ? 0.5590 0.4200 0.4686 0.0080  -0.0754 -0.0003 620 LEU A CD1 
856  C CD2 . LEU A 120 ? 0.6675 0.5402 0.5994 0.0109  -0.0924 0.0000  620 LEU A CD2 
857  N N   . GLU A 121 ? 0.4922 0.3660 0.4089 0.0177  -0.0534 0.0021  621 GLU A N   
858  C CA  . GLU A 121 ? 0.5350 0.4290 0.4728 0.0221  -0.0478 0.0016  621 GLU A CA  
859  C C   . GLU A 121 ? 0.6060 0.5022 0.5422 0.0232  -0.0336 0.0023  621 GLU A C   
860  O O   . GLU A 121 ? 0.6158 0.5283 0.5686 0.0260  -0.0283 0.0014  621 GLU A O   
861  C CB  . GLU A 121 ? 0.7010 0.5964 0.6430 0.0238  -0.0530 0.0024  621 GLU A CB  
862  C CG  . GLU A 121 ? 0.8905 0.7881 0.8404 0.0241  -0.0671 0.0015  621 GLU A CG  
863  C CD  . GLU A 121 ? 1.0315 0.9087 0.9622 0.0196  -0.0767 0.0024  621 GLU A CD  
864  O OE1 . GLU A 121 ? 1.1260 0.9841 1.0333 0.0164  -0.0729 0.0040  621 GLU A OE1 
865  O OE2 . GLU A 121 ? 0.9639 0.8434 0.9026 0.0192  -0.0882 0.0015  621 GLU A OE2 
866  N N   . ASP A 122 ? 0.5569 0.4360 0.4731 0.0210  -0.0273 0.0040  622 ASP A N   
867  C CA  . ASP A 122 ? 0.6539 0.5335 0.5686 0.0219  -0.0136 0.0050  622 ASP A CA  
868  C C   . ASP A 122 ? 0.5983 0.4817 0.5153 0.0218  -0.0095 0.0034  622 ASP A C   
869  O O   . ASP A 122 ? 0.5193 0.4135 0.4474 0.0241  -0.0011 0.0033  622 ASP A O   
870  C CB  . ASP A 122 ? 0.9162 0.7747 0.8076 0.0193  -0.0077 0.0071  622 ASP A CB  
871  C CG  . ASP A 122 ? 1.1646 1.0258 1.0590 0.0210  0.0067  0.0088  622 ASP A CG  
872  O OD1 . ASP A 122 ? 1.2597 1.1371 1.1731 0.0239  0.0089  0.0094  622 ASP A OD1 
873  O OD2 . ASP A 122 ? 1.2335 1.0801 1.1115 0.0195  0.0156  0.0095  622 ASP A OD2 
874  N N   . ARG A 123 ? 0.5626 0.4361 0.4688 0.0189  -0.0163 0.0024  623 ARG A N   
875  C CA  . ARG A 123 ? 0.5125 0.3879 0.4193 0.0183  -0.0135 0.0010  623 ARG A CA  
876  C C   . ARG A 123 ? 0.5589 0.4573 0.4909 0.0210  -0.0150 -0.0005 623 ARG A C   
877  O O   . ARG A 123 ? 0.5332 0.4401 0.4729 0.0226  -0.0073 -0.0010 623 ARG A O   
878  C CB  . ARG A 123 ? 0.4216 0.2808 0.3117 0.0142  -0.0224 0.0005  623 ARG A CB  
879  C CG  . ARG A 123 ? 0.5703 0.4149 0.4427 0.0122  -0.0157 0.0003  623 ARG A CG  
880  C CD  . ARG A 123 ? 0.6045 0.4243 0.4510 0.0075  -0.0231 0.0006  623 ARG A CD  
881  N NE  . ARG A 123 ? 0.6134 0.4358 0.4662 0.0053  -0.0385 0.0002  623 ARG A NE  
882  C CZ  . ARG A 123 ? 0.6844 0.4938 0.5260 0.0028  -0.0489 0.0012  623 ARG A CZ  
883  N NH1 . ARG A 123 ? 0.7090 0.5012 0.5308 0.0019  -0.0452 0.0026  623 ARG A NH1 
884  N NH2 . ARG A 123 ? 0.6489 0.4623 0.4995 0.0011  -0.0631 0.0010  623 ARG A NH2 
885  N N   . ALA A 124 ? 0.5024 0.4100 0.4465 0.0216  -0.0249 -0.0012 624 ALA A N   
886  C CA  . ALA A 124 ? 0.4504 0.3787 0.4173 0.0242  -0.0262 -0.0027 624 ALA A CA  
887  C C   . ALA A 124 ? 0.4795 0.4204 0.4588 0.0278  -0.0176 -0.0024 624 ALA A C   
888  O O   . ALA A 124 ? 0.4807 0.4335 0.4718 0.0292  -0.0136 -0.0034 624 ALA A O   
889  C CB  . ALA A 124 ? 0.3472 0.2816 0.3246 0.0246  -0.0376 -0.0034 624 ALA A CB  
890  N N   . ALA A 125 ? 0.2802 0.2177 0.2565 0.0290  -0.0153 -0.0008 625 ALA A N   
891  C CA  . ALA A 125 ? 0.3372 0.2845 0.3240 0.0319  -0.0079 0.0001  625 ALA A CA  
892  C C   . ALA A 125 ? 0.4386 0.3847 0.4230 0.0320  0.0023  0.0006  625 ALA A C   
893  O O   . ALA A 125 ? 0.4612 0.4188 0.4583 0.0341  0.0069  0.0006  625 ALA A O   
894  C CB  . ALA A 125 ? 0.1590 0.1001 0.1408 0.0323  -0.0071 0.0022  625 ALA A CB  
895  N N   . THR A 126 ? 0.3668 0.2979 0.3342 0.0295  0.0056  0.0011  626 THR A N   
896  C CA  . THR A 126 ? 0.4697 0.3972 0.4329 0.0297  0.0154  0.0016  626 THR A CA  
897  C C   . THR A 126 ? 0.4573 0.3939 0.4290 0.0298  0.0145  -0.0003 626 THR A C   
898  O O   . THR A 126 ? 0.4285 0.3718 0.4081 0.0315  0.0210  -0.0002 626 THR A O   
899  C CB  . THR A 126 ? 0.4329 0.3397 0.3731 0.0269  0.0184  0.0021  626 THR A CB  
900  O OG1 . THR A 126 ? 0.4307 0.3282 0.3623 0.0267  0.0213  0.0042  626 THR A OG1 
901  C CG2 . THR A 126 ? 0.3183 0.2207 0.2540 0.0274  0.0283  0.0021  626 THR A CG2 
902  N N   . LEU A 127 ? 0.3705 0.3070 0.3411 0.0278  0.0059  -0.0019 627 LEU A N   
903  C CA  . LEU A 127 ? 0.3811 0.3253 0.3589 0.0272  0.0043  -0.0036 627 LEU A CA  
904  C C   . LEU A 127 ? 0.4403 0.4027 0.4379 0.0300  0.0055  -0.0042 627 LEU A C   
905  O O   . LEU A 127 ? 0.5022 0.4708 0.5056 0.0304  0.0095  -0.0048 627 LEU A O   
906  C CB  . LEU A 127 ? 0.3689 0.3102 0.3441 0.0244  -0.0062 -0.0046 627 LEU A CB  
907  C CG  . LEU A 127 ? 0.4235 0.3652 0.3986 0.0218  -0.0087 -0.0058 627 LEU A CG  
908  C CD1 . LEU A 127 ? 0.4494 0.3755 0.4065 0.0201  -0.0030 -0.0054 627 LEU A CD1 
909  C CD2 . LEU A 127 ? 0.4056 0.3450 0.3807 0.0192  -0.0203 -0.0062 627 LEU A CD2 
910  N N   . SER A 128 ? 0.3768 0.3464 0.3832 0.0319  0.0019  -0.0040 628 SER A N   
911  C CA  . SER A 128 ? 0.3099 0.2942 0.3325 0.0346  0.0029  -0.0046 628 SER A CA  
912  C C   . SER A 128 ? 0.3584 0.3440 0.3832 0.0363  0.0111  -0.0031 628 SER A C   
913  O O   . SER A 128 ? 0.3307 0.3244 0.3640 0.0372  0.0138  -0.0036 628 SER A O   
914  C CB  . SER A 128 ? 0.3121 0.3012 0.3414 0.0364  -0.0028 -0.0047 628 SER A CB  
915  O OG  . SER A 128 ? 0.4106 0.4120 0.4535 0.0390  -0.0019 -0.0054 628 SER A OG  
916  N N   . LYS A 129 ? 0.3717 0.3491 0.3894 0.0365  0.0150  -0.0010 629 LYS A N   
917  C CA  . LYS A 129 ? 0.2976 0.2763 0.3195 0.0381  0.0228  0.0009  629 LYS A CA  
918  C C   . LYS A 129 ? 0.3681 0.3456 0.3885 0.0376  0.0281  0.0004  629 LYS A C   
919  O O   . LYS A 129 ? 0.2676 0.2518 0.2973 0.0391  0.0317  0.0011  629 LYS A O   
920  C CB  . LYS A 129 ? 0.2407 0.2092 0.2539 0.0378  0.0269  0.0033  629 LYS A CB  
921  C CG  . LYS A 129 ? 0.3304 0.3006 0.3503 0.0395  0.0350  0.0059  629 LYS A CG  
922  C CD  . LYS A 129 ? 0.4653 0.4480 0.5012 0.0415  0.0326  0.0066  629 LYS A CD  
923  C CE  . LYS A 129 ? 0.5629 0.5458 0.6050 0.0426  0.0369  0.0100  629 LYS A CE  
924  N NZ  . LYS A 129 ? 0.5597 0.5365 0.5953 0.0416  0.0349  0.0113  629 LYS A NZ  
925  N N   . ILE A 130 ? 0.2567 0.2246 0.2646 0.0354  0.0279  -0.0006 630 ILE A N   
926  C CA  . ILE A 130 ? 0.2303 0.1955 0.2349 0.0347  0.0321  -0.0013 630 ILE A CA  
927  C C   . ILE A 130 ? 0.2291 0.2061 0.2449 0.0347  0.0293  -0.0028 630 ILE A C   
928  O O   . ILE A 130 ? 0.2839 0.2641 0.3047 0.0357  0.0336  -0.0025 630 ILE A O   
929  C CB  . ILE A 130 ? 0.2483 0.1991 0.2354 0.0319  0.0311  -0.0021 630 ILE A CB  
930  C CG1 . ILE A 130 ? 0.3035 0.2403 0.2774 0.0320  0.0368  -0.0005 630 ILE A CG1 
931  C CG2 . ILE A 130 ? 0.2819 0.2306 0.2660 0.0307  0.0334  -0.0033 630 ILE A CG2 
932  C CD1 . ILE A 130 ? 0.3088 0.2286 0.2623 0.0288  0.0341  -0.0012 630 ILE A CD1 
933  N N   . ILE A 131 ? 0.2670 0.2505 0.2874 0.0338  0.0223  -0.0043 631 ILE A N   
934  C CA  . ILE A 131 ? 0.2911 0.2859 0.3224 0.0339  0.0206  -0.0057 631 ILE A CA  
935  C C   . ILE A 131 ? 0.2526 0.2560 0.2949 0.0365  0.0231  -0.0050 631 ILE A C   
936  O O   . ILE A 131 ? 0.3386 0.3471 0.3862 0.0366  0.0247  -0.0054 631 ILE A O   
937  C CB  . ILE A 131 ? 0.3102 0.3106 0.3461 0.0327  0.0134  -0.0074 631 ILE A CB  
938  C CG1 . ILE A 131 ? 0.2810 0.2723 0.3065 0.0296  0.0094  -0.0078 631 ILE A CG1 
939  C CG2 . ILE A 131 ? 0.2251 0.2369 0.2720 0.0328  0.0133  -0.0088 631 ILE A CG2 
940  C CD1 . ILE A 131 ? 0.2020 0.1989 0.2339 0.0283  0.0015  -0.0091 631 ILE A CD1 
941  N N   . GLN A 132 ? 0.2688 0.2725 0.3137 0.0384  0.0228  -0.0036 632 GLN A N   
942  C CA  . GLN A 132 ? 0.2882 0.2981 0.3418 0.0398  0.0238  -0.0023 632 GLN A CA  
943  C C   . GLN A 132 ? 0.2628 0.2694 0.3157 0.0392  0.0293  -0.0001 632 GLN A C   
944  O O   . GLN A 132 ? 0.3140 0.3239 0.3709 0.0377  0.0292  0.0009  632 GLN A O   
945  C CB  . GLN A 132 ? 0.2623 0.2722 0.3175 0.0408  0.0215  -0.0008 632 GLN A CB  
946  C CG  . GLN A 132 ? 0.3320 0.3451 0.3889 0.0416  0.0154  -0.0028 632 GLN A CG  
947  C CD  . GLN A 132 ? 0.3135 0.3262 0.3717 0.0424  0.0128  -0.0014 632 GLN A CD  
948  O OE1 . GLN A 132 ? 0.3379 0.3444 0.3924 0.0434  0.0146  0.0004  632 GLN A OE1 
949  N NE2 . GLN A 132 ? 0.4393 0.4574 0.5018 0.0418  0.0089  -0.0022 632 GLN A NE2 
950  N N   . VAL A 133 ? 0.1875 0.1862 0.2348 0.0406  0.0343  0.0005  633 VAL A N   
951  C CA  . VAL A 133 ? 0.1639 0.1591 0.2115 0.0405  0.0402  0.0025  633 VAL A CA  
952  C C   . VAL A 133 ? 0.2776 0.2736 0.3242 0.0393  0.0404  0.0011  633 VAL A C   
953  O O   . VAL A 133 ? 0.2601 0.2575 0.3111 0.0385  0.0418  0.0027  633 VAL A O   
954  C CB  . VAL A 133 ? 0.2021 0.1868 0.2414 0.0416  0.0465  0.0034  633 VAL A CB  
955  C CG1 . VAL A 133 ? 0.0983 0.0800 0.1400 0.0428  0.0535  0.0048  633 VAL A CG1 
956  C CG2 . VAL A 133 ? 0.2469 0.2311 0.2884 0.0425  0.0470  0.0055  633 VAL A CG2 
957  N N   . ALA A 134 ? 0.2418 0.2367 0.2826 0.0382  0.0380  -0.0017 634 ALA A N   
958  C CA  . ALA A 134 ? 0.2002 0.1953 0.2394 0.0366  0.0382  -0.0031 634 ALA A CA  
959  C