data_3U8Z
# 
_entry.id   3U8Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3U8Z         
RCSB  RCSB068456   
WWPDB D_1000068456 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3U8Z 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yogesha, S.D.'  1 
'Sharff, A.J.'   2 
'Giovannini, M.' 3 
'Bricogne, G.'   4 
'Izard, T.'      5 
# 
_citation.id                        primary 
_citation.title                     
'Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            20 
_citation.page_first                2113 
_citation.page_last                 2120 
_citation.year                      2011 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22012890 
_citation.pdbx_database_id_DOI      10.1002/pro.751 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yogesha, S.D.'  1 
primary 'Sharff, A.J.'   2 
primary 'Giovannini, M.' 3 
primary 'Bricogne, G.'   4 
primary 'Izard, T.'      5 
# 
_cell.entry_id           3U8Z 
_cell.length_a           105.446 
_cell.length_b           105.446 
_cell.length_c           329.997 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3U8Z 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Merlin 35443.957 4   ? ? 'FERM domain (UNP residues 20-312)' ? 
2 water   nat water  18.015    537 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Moesin-ezrin-radixin-like protein, Neurofibromin-2, Schwannomerlin, Schwannomin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPV
TFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKR
VINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTP
KISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPV
TFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKR
VINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTP
KISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   GLN n 
1 7   PRO n 
1 8   LYS n 
1 9   THR n 
1 10  PHE n 
1 11  THR n 
1 12  VAL n 
1 13  ARG n 
1 14  ILE n 
1 15  VAL n 
1 16  THR n 
1 17  MET n 
1 18  ASP n 
1 19  ALA n 
1 20  GLU n 
1 21  MET n 
1 22  GLU n 
1 23  PHE n 
1 24  ASN n 
1 25  CYS n 
1 26  GLU n 
1 27  MET n 
1 28  LYS n 
1 29  TRP n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  ASP n 
1 34  LEU n 
1 35  PHE n 
1 36  ASP n 
1 37  LEU n 
1 38  VAL n 
1 39  CYS n 
1 40  ARG n 
1 41  THR n 
1 42  LEU n 
1 43  GLY n 
1 44  LEU n 
1 45  ARG n 
1 46  GLU n 
1 47  THR n 
1 48  TRP n 
1 49  PHE n 
1 50  PHE n 
1 51  GLY n 
1 52  LEU n 
1 53  GLN n 
1 54  TYR n 
1 55  THR n 
1 56  ILE n 
1 57  LYS n 
1 58  ASP n 
1 59  THR n 
1 60  VAL n 
1 61  ALA n 
1 62  TRP n 
1 63  LEU n 
1 64  LYS n 
1 65  MET n 
1 66  ASP n 
1 67  LYS n 
1 68  LYS n 
1 69  VAL n 
1 70  LEU n 
1 71  ASP n 
1 72  HIS n 
1 73  ASP n 
1 74  VAL n 
1 75  SER n 
1 76  LYS n 
1 77  GLU n 
1 78  GLU n 
1 79  PRO n 
1 80  VAL n 
1 81  THR n 
1 82  PHE n 
1 83  HIS n 
1 84  PHE n 
1 85  LEU n 
1 86  ALA n 
1 87  LYS n 
1 88  PHE n 
1 89  TYR n 
1 90  PRO n 
1 91  GLU n 
1 92  ASN n 
1 93  ALA n 
1 94  GLU n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  VAL n 
1 99  GLN n 
1 100 GLU n 
1 101 ILE n 
1 102 THR n 
1 103 GLN n 
1 104 HIS n 
1 105 LEU n 
1 106 PHE n 
1 107 PHE n 
1 108 LEU n 
1 109 GLN n 
1 110 VAL n 
1 111 LYS n 
1 112 LYS n 
1 113 GLN n 
1 114 ILE n 
1 115 LEU n 
1 116 ASP n 
1 117 GLU n 
1 118 LYS n 
1 119 ILE n 
1 120 TYR n 
1 121 CYS n 
1 122 PRO n 
1 123 PRO n 
1 124 GLU n 
1 125 ALA n 
1 126 SER n 
1 127 VAL n 
1 128 LEU n 
1 129 LEU n 
1 130 ALA n 
1 131 SER n 
1 132 TYR n 
1 133 ALA n 
1 134 VAL n 
1 135 GLN n 
1 136 ALA n 
1 137 LYS n 
1 138 TYR n 
1 139 GLY n 
1 140 ASP n 
1 141 TYR n 
1 142 ASP n 
1 143 PRO n 
1 144 SER n 
1 145 VAL n 
1 146 HIS n 
1 147 LYS n 
1 148 ARG n 
1 149 GLY n 
1 150 PHE n 
1 151 LEU n 
1 152 ALA n 
1 153 GLN n 
1 154 GLU n 
1 155 GLU n 
1 156 LEU n 
1 157 LEU n 
1 158 PRO n 
1 159 LYS n 
1 160 ARG n 
1 161 VAL n 
1 162 ILE n 
1 163 ASN n 
1 164 LEU n 
1 165 TYR n 
1 166 GLN n 
1 167 MET n 
1 168 THR n 
1 169 PRO n 
1 170 GLU n 
1 171 MET n 
1 172 TRP n 
1 173 GLU n 
1 174 GLU n 
1 175 ARG n 
1 176 ILE n 
1 177 THR n 
1 178 ALA n 
1 179 TRP n 
1 180 TYR n 
1 181 ALA n 
1 182 GLU n 
1 183 HIS n 
1 184 ARG n 
1 185 GLY n 
1 186 ARG n 
1 187 ALA n 
1 188 ARG n 
1 189 ASP n 
1 190 GLU n 
1 191 ALA n 
1 192 GLU n 
1 193 MET n 
1 194 GLU n 
1 195 TYR n 
1 196 LEU n 
1 197 LYS n 
1 198 ILE n 
1 199 ALA n 
1 200 GLN n 
1 201 ASP n 
1 202 LEU n 
1 203 GLU n 
1 204 MET n 
1 205 TYR n 
1 206 GLY n 
1 207 VAL n 
1 208 ASN n 
1 209 TYR n 
1 210 PHE n 
1 211 ALA n 
1 212 ILE n 
1 213 ARG n 
1 214 ASN n 
1 215 LYS n 
1 216 LYS n 
1 217 GLY n 
1 218 THR n 
1 219 GLU n 
1 220 LEU n 
1 221 LEU n 
1 222 LEU n 
1 223 GLY n 
1 224 VAL n 
1 225 ASP n 
1 226 ALA n 
1 227 LEU n 
1 228 GLY n 
1 229 LEU n 
1 230 HIS n 
1 231 ILE n 
1 232 TYR n 
1 233 ASP n 
1 234 PRO n 
1 235 GLU n 
1 236 ASN n 
1 237 ARG n 
1 238 LEU n 
1 239 THR n 
1 240 PRO n 
1 241 LYS n 
1 242 ILE n 
1 243 SER n 
1 244 PHE n 
1 245 PRO n 
1 246 TRP n 
1 247 ASN n 
1 248 GLU n 
1 249 ILE n 
1 250 ARG n 
1 251 ASN n 
1 252 ILE n 
1 253 SER n 
1 254 TYR n 
1 255 SER n 
1 256 ASP n 
1 257 LYS n 
1 258 GLU n 
1 259 PHE n 
1 260 THR n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 LEU n 
1 265 ASP n 
1 266 LYS n 
1 267 LYS n 
1 268 ILE n 
1 269 ASP n 
1 270 VAL n 
1 271 PHE n 
1 272 LYS n 
1 273 PHE n 
1 274 ASN n 
1 275 SER n 
1 276 SER n 
1 277 LYS n 
1 278 LEU n 
1 279 ARG n 
1 280 VAL n 
1 281 ASN n 
1 282 LYS n 
1 283 LEU n 
1 284 ILE n 
1 285 LEU n 
1 286 GLN n 
1 287 LEU n 
1 288 CYS n 
1 289 ILE n 
1 290 GLY n 
1 291 ASN n 
1 292 HIS n 
1 293 ASP n 
1 294 LEU n 
1 295 PHE n 
1 296 MET n 
1 297 ARG n 
1 298 ARG n 
1 299 ARG n 
1 300 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NF2, SCH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MERL_HUMAN 
_struct_ref.pdbx_db_accession          P35240 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFL
AKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLY
QMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFP
WNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
;
_struct_ref.pdbx_align_begin           18 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3U8Z A 6 ? 300 ? P35240 18 ? 312 ? 18 312 
2 1 3U8Z B 6 ? 300 ? P35240 18 ? 312 ? 18 312 
3 1 3U8Z C 6 ? 300 ? P35240 18 ? 312 ? 18 312 
4 1 3U8Z D 6 ? 300 ? P35240 18 ? 312 ? 18 312 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3U8Z GLY A 1 ? UNP P35240 ? ? 'EXPRESSION TAG' 13 1  
1 3U8Z PRO A 2 ? UNP P35240 ? ? 'EXPRESSION TAG' 14 2  
1 3U8Z LEU A 3 ? UNP P35240 ? ? 'EXPRESSION TAG' 15 3  
1 3U8Z GLY A 4 ? UNP P35240 ? ? 'EXPRESSION TAG' 16 4  
1 3U8Z SER A 5 ? UNP P35240 ? ? 'EXPRESSION TAG' 17 5  
2 3U8Z GLY B 1 ? UNP P35240 ? ? 'EXPRESSION TAG' 13 6  
2 3U8Z PRO B 2 ? UNP P35240 ? ? 'EXPRESSION TAG' 14 7  
2 3U8Z LEU B 3 ? UNP P35240 ? ? 'EXPRESSION TAG' 15 8  
2 3U8Z GLY B 4 ? UNP P35240 ? ? 'EXPRESSION TAG' 16 9  
2 3U8Z SER B 5 ? UNP P35240 ? ? 'EXPRESSION TAG' 17 10 
3 3U8Z GLY C 1 ? UNP P35240 ? ? 'EXPRESSION TAG' 13 11 
3 3U8Z PRO C 2 ? UNP P35240 ? ? 'EXPRESSION TAG' 14 12 
3 3U8Z LEU C 3 ? UNP P35240 ? ? 'EXPRESSION TAG' 15 13 
3 3U8Z GLY C 4 ? UNP P35240 ? ? 'EXPRESSION TAG' 16 14 
3 3U8Z SER C 5 ? UNP P35240 ? ? 'EXPRESSION TAG' 17 15 
4 3U8Z GLY D 1 ? UNP P35240 ? ? 'EXPRESSION TAG' 13 16 
4 3U8Z PRO D 2 ? UNP P35240 ? ? 'EXPRESSION TAG' 14 17 
4 3U8Z LEU D 3 ? UNP P35240 ? ? 'EXPRESSION TAG' 15 18 
4 3U8Z GLY D 4 ? UNP P35240 ? ? 'EXPRESSION TAG' 16 19 
4 3U8Z SER D 5 ? UNP P35240 ? ? 'EXPRESSION TAG' 17 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3U8Z 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.28 
_exptl_crystal.density_percent_sol   62.45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;protein in 50 mM Tris, pH 8.0, 300 mM sodium chloride, reservoir:  4.5% PEG4000, 0.2 M ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-10-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Kohzu Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.999990 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.999990 
# 
_reflns.entry_id                     3U8Z 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             105.45 
_reflns.d_resolution_high            2.64 
_reflns.number_obs                   52570 
_reflns.number_all                   55821 
_reflns.percent_possible_obs         95.2 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.9 
_reflns.B_iso_Wilson_estimate        65.13 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.64 
_reflns_shell.d_res_low              2.78 
_reflns_shell.percent_possible_all   79.7 
_reflns_shell.Rmerge_I_obs           0.377 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6182 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3U8Z 
_refine.ls_number_reflns_obs                     52476 
_refine.ls_number_reflns_all                     55821 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.36 
_refine.ls_d_res_high                            2.64 
_refine.ls_percent_reflns_obs                    94.14 
_refine.ls_R_factor_obs                          0.2017 
_refine.ls_R_factor_all                          0.2017 
_refine.ls_R_factor_R_work                       0.2003 
_refine.ls_R_factor_R_free                       0.2294 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_number_reflns_R_free                  2666 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9246 
_refine.correlation_coeff_Fo_to_Fc_free          0.9030 
_refine.B_iso_mean                               64.50 
_refine.aniso_B[1][1]                            0.6162 
_refine.aniso_B[2][2]                            0.6162 
_refine.aniso_B[3][3]                            -1.2324 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H4R' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.4030 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.2560 
_refine.pdbx_overall_SU_R_Blow_DPI               0.4430 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.2600 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.entry_id                        3U8Z 
_refine_analyze.Luzzati_coordinate_error_obs    0.353 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8540 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             537 
_refine_hist.number_atoms_total               9077 
_refine_hist.d_res_high                       2.64 
_refine_hist.d_res_low                        26.36 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' t_dihedral_angle_d        4132  ?     ? 2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' t_trig_c_planes           223   ?     ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_gen_planes              1246  ?     ? 5.000  HARMONIC     
'X-RAY DIFFRACTION' t_it                      8736  ?     ? 20.000 HARMONIC     
'X-RAY DIFFRACTION' t_nbd                     ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_improper_torsion        ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_pseud_angle             ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_chiral_improper_torsion 1099  ?     ? 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_sum_occupancies         ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_utility_distance        ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_utility_angle           ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_utility_torsion         ?     ?     ? ?      ?            
'X-RAY DIFFRACTION' t_ideal_dist_contact      9706  ?     ? 4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' t_bond_d                  8736  0.008 ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_angle_deg               11757 0.870 ? 2.000  HARMONIC     
'X-RAY DIFFRACTION' t_omega_torsion           ?     5.910 ? ?      ?            
'X-RAY DIFFRACTION' t_other_torsion           ?     3.030 ? ?      ?            
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.64 
_refine_ls_shell.d_res_low                        2.71 
_refine_ls_shell.number_reflns_R_work             2626 
_refine_ls_shell.R_factor_R_work                  0.2340 
_refine_ls_shell.percent_reflns_obs               94.14 
_refine_ls_shell.R_factor_R_free                  0.2703 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.65 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                2754 
_refine_ls_shell.R_factor_all                     0.2356 
_refine_ls_shell.number_reflns_obs                2754 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3U8Z 
_struct.title                     'human merlin FERM domain' 
_struct.pdbx_descriptor           Merlin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3U8Z 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'neurofibromatosis, tumor suppressor, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 30  ? LEU A 42  ? LYS A 42  LEU A 54  1 ? 13 
HELX_P HELX_P2  2  GLU A 46  ? TRP A 48  ? GLU A 58  TRP A 60  5 ? 3  
HELX_P HELX_P3  3  ASN A 92  ? LEU A 97  ? ASN A 104 LEU A 109 1 ? 6  
HELX_P HELX_P4  4  GLN A 99  ? ASP A 116 ? GLN A 111 ASP A 128 1 ? 18 
HELX_P HELX_P5  5  PRO A 122 ? TYR A 138 ? PRO A 134 TYR A 150 1 ? 17 
HELX_P HELX_P6  6  THR A 168 ? HIS A 183 ? THR A 180 HIS A 195 1 ? 16 
HELX_P HELX_P7  7  ASP A 189 ? GLN A 200 ? ASP A 201 GLN A 212 1 ? 12 
HELX_P HELX_P8  8  LYS A 277 ? ARG A 298 ? LYS A 289 ARG A 310 1 ? 22 
HELX_P HELX_P9  9  LYS B 30  ? LEU B 42  ? LYS B 42  LEU B 54  1 ? 13 
HELX_P HELX_P10 10 GLU B 46  ? TRP B 48  ? GLU B 58  TRP B 60  5 ? 3  
HELX_P HELX_P11 11 ASN B 92  ? LEU B 97  ? ASN B 104 LEU B 109 1 ? 6  
HELX_P HELX_P12 12 GLN B 99  ? ASP B 116 ? GLN B 111 ASP B 128 1 ? 18 
HELX_P HELX_P13 13 PRO B 122 ? TYR B 138 ? PRO B 134 TYR B 150 1 ? 17 
HELX_P HELX_P14 14 THR B 168 ? HIS B 183 ? THR B 180 HIS B 195 1 ? 16 
HELX_P HELX_P15 15 ASP B 189 ? GLN B 200 ? ASP B 201 GLN B 212 1 ? 12 
HELX_P HELX_P16 16 LYS B 277 ? ARG B 298 ? LYS B 289 ARG B 310 1 ? 22 
HELX_P HELX_P17 17 LYS C 30  ? LEU C 42  ? LYS C 42  LEU C 54  1 ? 13 
HELX_P HELX_P18 18 GLU C 46  ? TRP C 48  ? GLU C 58  TRP C 60  5 ? 3  
HELX_P HELX_P19 19 ASN C 92  ? LEU C 97  ? ASN C 104 LEU C 109 1 ? 6  
HELX_P HELX_P20 20 GLN C 99  ? ASP C 116 ? GLN C 111 ASP C 128 1 ? 18 
HELX_P HELX_P21 21 PRO C 122 ? GLY C 139 ? PRO C 134 GLY C 151 1 ? 18 
HELX_P HELX_P22 22 THR C 168 ? HIS C 183 ? THR C 180 HIS C 195 1 ? 16 
HELX_P HELX_P23 23 ASP C 189 ? GLN C 200 ? ASP C 201 GLN C 212 1 ? 12 
HELX_P HELX_P24 24 LYS C 277 ? ARG C 299 ? LYS C 289 ARG C 311 1 ? 23 
HELX_P HELX_P25 25 LYS D 30  ? LEU D 42  ? LYS D 42  LEU D 54  1 ? 13 
HELX_P HELX_P26 26 GLU D 46  ? TRP D 48  ? GLU D 58  TRP D 60  5 ? 3  
HELX_P HELX_P27 27 ASN D 92  ? LEU D 97  ? ASN D 104 LEU D 109 1 ? 6  
HELX_P HELX_P28 28 GLN D 99  ? ASP D 116 ? GLN D 111 ASP D 128 1 ? 18 
HELX_P HELX_P29 29 PRO D 122 ? TYR D 138 ? PRO D 134 TYR D 150 1 ? 17 
HELX_P HELX_P30 30 ARG D 188 ? GLN D 200 ? ARG D 200 GLN D 212 1 ? 13 
HELX_P HELX_P31 31 LYS D 277 ? ARG D 298 ? LYS D 289 ARG D 310 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 7  ? 
C ? 10 ? 
D ? 7  ? 
E ? 7  ? 
F ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? parallel      
A 4 5  ? anti-parallel 
A 5 6  ? anti-parallel 
A 6 7  ? anti-parallel 
A 7 8  ? parallel      
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? anti-parallel 
B 5 6  ? anti-parallel 
B 6 7  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? parallel      
C 4 5  ? anti-parallel 
C 5 6  ? anti-parallel 
C 6 7  ? anti-parallel 
C 7 8  ? parallel      
C 8 9  ? anti-parallel 
C 9 10 ? anti-parallel 
D 1 2  ? anti-parallel 
D 2 3  ? anti-parallel 
D 3 4  ? anti-parallel 
D 4 5  ? anti-parallel 
D 5 6  ? anti-parallel 
D 6 7  ? anti-parallel 
E 1 2  ? anti-parallel 
E 2 3  ? anti-parallel 
E 3 4  ? anti-parallel 
E 4 5  ? anti-parallel 
E 5 6  ? anti-parallel 
E 6 7  ? anti-parallel 
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
F 3 4  ? anti-parallel 
F 4 5  ? anti-parallel 
F 5 6  ? anti-parallel 
F 6 7  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  THR A 59  ? TRP A 62  ? THR A 71  TRP A 74  
A 2  PHE A 50  ? ILE A 56  ? PHE A 62  ILE A 68  
A 3  VAL A 80  ? ALA A 86  ? VAL A 92  ALA A 98  
A 4  THR A 9   ? VAL A 15  ? THR A 21  VAL A 27  
A 5  GLU A 20  ? GLU A 26  ? GLU A 32  GLU A 38  
A 6  ALA C 19  ? GLU C 26  ? ALA C 31  GLU C 38  
A 7  THR C 9   ? VAL C 15  ? THR C 21  VAL C 27  
A 8  VAL C 80  ? ALA C 86  ? VAL C 92  ALA C 98  
A 9  PHE C 50  ? ILE C 56  ? PHE C 62  ILE C 68  
A 10 THR C 59  ? TRP C 62  ? THR C 71  TRP C 74  
B 1  ILE A 242 ? PRO A 245 ? ILE A 254 PRO A 257 
B 2  GLY A 228 ? TYR A 232 ? GLY A 240 TYR A 244 
B 3  GLU A 219 ? VAL A 224 ? GLU A 231 VAL A 236 
B 4  ASN A 208 ? ASN A 214 ? ASN A 220 ASN A 226 
B 5  PHE A 271 ? ASN A 274 ? PHE A 283 ASN A 286 
B 6  GLU A 258 ? PRO A 263 ? GLU A 270 PRO A 275 
B 7  ILE A 249 ? SER A 255 ? ILE A 261 SER A 267 
C 1  THR B 59  ? TRP B 62  ? THR B 71  TRP B 74  
C 2  PHE B 50  ? ILE B 56  ? PHE B 62  ILE B 68  
C 3  VAL B 80  ? ALA B 86  ? VAL B 92  ALA B 98  
C 4  THR B 9   ? VAL B 15  ? THR B 21  VAL B 27  
C 5  GLU B 20  ? GLU B 26  ? GLU B 32  GLU B 38  
C 6  GLU D 20  ? GLU D 26  ? GLU D 32  GLU D 38  
C 7  THR D 9   ? VAL D 15  ? THR D 21  VAL D 27  
C 8  VAL D 80  ? ALA D 86  ? VAL D 92  ALA D 98  
C 9  PHE D 50  ? ILE D 56  ? PHE D 62  ILE D 68  
C 10 THR D 59  ? TRP D 62  ? THR D 71  TRP D 74  
D 1  ILE B 242 ? PRO B 245 ? ILE B 254 PRO B 257 
D 2  GLY B 228 ? TYR B 232 ? GLY B 240 TYR B 244 
D 3  GLU B 219 ? VAL B 224 ? GLU B 231 VAL B 236 
D 4  ASN B 208 ? ASN B 214 ? ASN B 220 ASN B 226 
D 5  PHE B 271 ? ASN B 274 ? PHE B 283 ASN B 286 
D 6  GLU B 258 ? PRO B 263 ? GLU B 270 PRO B 275 
D 7  ILE B 249 ? SER B 255 ? ILE B 261 SER B 267 
E 1  ILE C 242 ? PRO C 245 ? ILE C 254 PRO C 257 
E 2  GLY C 228 ? TYR C 232 ? GLY C 240 TYR C 244 
E 3  GLU C 219 ? VAL C 224 ? GLU C 231 VAL C 236 
E 4  ASN C 208 ? ASN C 214 ? ASN C 220 ASN C 226 
E 5  PHE C 271 ? ASN C 274 ? PHE C 283 ASN C 286 
E 6  GLU C 258 ? PRO C 263 ? GLU C 270 PRO C 275 
E 7  ILE C 249 ? SER C 255 ? ILE C 261 SER C 267 
F 1  ILE D 242 ? PRO D 245 ? ILE D 254 PRO D 257 
F 2  GLY D 228 ? TYR D 232 ? GLY D 240 TYR D 244 
F 3  GLU D 219 ? VAL D 224 ? GLU D 231 VAL D 236 
F 4  ASN D 208 ? ASN D 214 ? ASN D 220 ASN D 226 
F 5  PHE D 271 ? ASN D 274 ? PHE D 283 ASN D 286 
F 6  GLU D 258 ? PRO D 263 ? GLU D 270 PRO D 275 
F 7  ILE D 249 ? SER D 255 ? ILE D 261 SER D 267 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O THR A 59  ? O THR A 71  N ILE A 56  ? N ILE A 68  
A 2 3  N GLN A 53  ? N GLN A 65  O HIS A 83  ? O HIS A 95  
A 3 4  O VAL A 80  ? O VAL A 92  N ARG A 13  ? N ARG A 25  
A 4 5  N ILE A 14  ? N ILE A 26  O MET A 21  ? O MET A 33  
A 5 6  N GLU A 20  ? N GLU A 32  O GLU C 22  ? O GLU C 34  
A 6 7  O MET C 21  ? O MET C 33  N ILE C 14  ? N ILE C 26  
A 7 8  N ARG C 13  ? N ARG C 25  O VAL C 80  ? O VAL C 92  
A 8 9  O HIS C 83  ? O HIS C 95  N GLN C 53  ? N GLN C 65  
A 9 10 N ILE C 56  ? N ILE C 68  O THR C 59  ? O THR C 71  
B 1 2  O PHE A 244 ? O PHE A 256 N LEU A 229 ? N LEU A 241 
B 2 3  O HIS A 230 ? O HIS A 242 N GLY A 223 ? N GLY A 235 
B 3 4  O LEU A 220 ? O LEU A 232 N ILE A 212 ? N ILE A 224 
B 4 5  N ARG A 213 ? N ARG A 225 O ASN A 274 ? O ASN A 286 
B 5 6  O PHE A 273 ? O PHE A 285 N PHE A 259 ? N PHE A 271 
B 6 7  O LYS A 262 ? O LYS A 274 N ASN A 251 ? N ASN A 263 
C 1 2  O THR B 59  ? O THR B 71  N ILE B 56  ? N ILE B 68  
C 2 3  N GLN B 53  ? N GLN B 65  O HIS B 83  ? O HIS B 95  
C 3 4  O VAL B 80  ? O VAL B 92  N ARG B 13  ? N ARG B 25  
C 4 5  N ILE B 14  ? N ILE B 26  O MET B 21  ? O MET B 33  
C 5 6  N GLU B 22  ? N GLU B 34  O GLU D 20  ? O GLU D 32  
C 6 7  O MET D 21  ? O MET D 33  N ILE D 14  ? N ILE D 26  
C 7 8  N ARG D 13  ? N ARG D 25  O VAL D 80  ? O VAL D 92  
C 8 9  O HIS D 83  ? O HIS D 95  N GLN D 53  ? N GLN D 65  
C 9 10 N ILE D 56  ? N ILE D 68  O THR D 59  ? O THR D 71  
D 1 2  O PHE B 244 ? O PHE B 256 N LEU B 229 ? N LEU B 241 
D 2 3  O HIS B 230 ? O HIS B 242 N GLY B 223 ? N GLY B 235 
D 3 4  O LEU B 220 ? O LEU B 232 N ILE B 212 ? N ILE B 224 
D 4 5  N ARG B 213 ? N ARG B 225 O ASN B 274 ? O ASN B 286 
D 5 6  O PHE B 273 ? O PHE B 285 N PHE B 259 ? N PHE B 271 
D 6 7  O GLU B 258 ? O GLU B 270 N SER B 255 ? N SER B 267 
E 1 2  O PHE C 244 ? O PHE C 256 N LEU C 229 ? N LEU C 241 
E 2 3  O HIS C 230 ? O HIS C 242 N GLY C 223 ? N GLY C 235 
E 3 4  O LEU C 220 ? O LEU C 232 N ILE C 212 ? N ILE C 224 
E 4 5  N ARG C 213 ? N ARG C 225 O ASN C 274 ? O ASN C 286 
E 5 6  O PHE C 273 ? O PHE C 285 N PHE C 259 ? N PHE C 271 
E 6 7  O LYS C 262 ? O LYS C 274 N ASN C 251 ? N ASN C 263 
F 1 2  O PHE D 244 ? O PHE D 256 N LEU D 229 ? N LEU D 241 
F 2 3  O HIS D 230 ? O HIS D 242 N GLY D 223 ? N GLY D 235 
F 3 4  O LEU D 220 ? O LEU D 232 N ILE D 212 ? N ILE D 224 
F 4 5  N ARG D 213 ? N ARG D 225 O ASN D 274 ? O ASN D 286 
F 5 6  O PHE D 271 ? O PHE D 283 N ILE D 261 ? N ILE D 273 
F 6 7  O GLU D 258 ? O GLU D 270 N SER D 255 ? N SER D 267 
# 
_database_PDB_matrix.entry_id          3U8Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3U8Z 
_atom_sites.fract_transf_matrix[1][1]   0.009484 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009484 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003030 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 8   ? -0.721  -14.613 -20.845 1.00 68.33  ? 20  LYS A N   1 
ATOM   2    C CA  . LYS A 1 8   ? -0.495  -13.788 -19.654 1.00 66.66  ? 20  LYS A CA  1 
ATOM   3    C C   . LYS A 1 8   ? -0.045  -12.344 -20.019 1.00 65.77  ? 20  LYS A C   1 
ATOM   4    O O   . LYS A 1 8   ? -0.564  -11.400 -19.420 1.00 63.95  ? 20  LYS A O   1 
ATOM   5    C CB  . LYS A 1 8   ? 0.514   -14.480 -18.718 1.00 70.47  ? 20  LYS A CB  1 
ATOM   6    C CG  . LYS A 1 8   ? 0.996   -13.666 -17.507 1.00 87.54  ? 20  LYS A CG  1 
ATOM   7    C CD  . LYS A 1 8   ? 0.155   -13.946 -16.256 1.00 101.33 ? 20  LYS A CD  1 
ATOM   8    C CE  . LYS A 1 8   ? 0.908   -13.661 -14.982 1.00 112.87 ? 20  LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 8   ? 1.910   -14.718 -14.685 1.00 120.92 ? 20  LYS A NZ  1 
ATOM   10   N N   . THR A 1 9   ? 0.926   -12.181 -20.951 1.00 59.34  ? 21  THR A N   1 
ATOM   11   C CA  . THR A 1 9   ? 1.350   -10.874 -21.471 1.00 56.08  ? 21  THR A CA  1 
ATOM   12   C C   . THR A 1 9   ? 1.410   -10.847 -23.013 1.00 57.59  ? 21  THR A C   1 
ATOM   13   O O   . THR A 1 9   ? 1.516   -11.894 -23.643 1.00 58.72  ? 21  THR A O   1 
ATOM   14   C CB  . THR A 1 9   ? 2.709   -10.445 -20.896 1.00 60.12  ? 21  THR A CB  1 
ATOM   15   O OG1 . THR A 1 9   ? 3.692   -11.428 -21.194 1.00 64.74  ? 21  THR A OG1 1 
ATOM   16   C CG2 . THR A 1 9   ? 2.664   -10.143 -19.400 1.00 56.07  ? 21  THR A CG2 1 
ATOM   17   N N   . PHE A 1 10  ? 1.328   -9.640  -23.606 1.00 50.35  ? 22  PHE A N   1 
ATOM   18   C CA  . PHE A 1 10  ? 1.550   -9.391  -25.033 1.00 48.64  ? 22  PHE A CA  1 
ATOM   19   C C   . PHE A 1 10  ? 2.492   -8.199  -25.216 1.00 50.28  ? 22  PHE A C   1 
ATOM   20   O O   . PHE A 1 10  ? 2.554   -7.336  -24.345 1.00 47.52  ? 22  PHE A O   1 
ATOM   21   C CB  . PHE A 1 10  ? 0.223   -9.167  -25.779 1.00 49.96  ? 22  PHE A CB  1 
ATOM   22   C CG  . PHE A 1 10  ? -0.586  -7.965  -25.346 1.00 49.31  ? 22  PHE A CG  1 
ATOM   23   C CD1 . PHE A 1 10  ? -1.442  -8.042  -24.254 1.00 52.09  ? 22  PHE A CD1 1 
ATOM   24   C CD2 . PHE A 1 10  ? -0.535  -6.770  -26.071 1.00 49.05  ? 22  PHE A CD2 1 
ATOM   25   C CE1 . PHE A 1 10  ? -2.205  -6.939  -23.870 1.00 51.73  ? 22  PHE A CE1 1 
ATOM   26   C CE2 . PHE A 1 10  ? -1.298  -5.668  -25.689 1.00 50.66  ? 22  PHE A CE2 1 
ATOM   27   C CZ  . PHE A 1 10  ? -2.118  -5.757  -24.583 1.00 49.28  ? 22  PHE A CZ  1 
ATOM   28   N N   . THR A 1 11  ? 3.212   -8.149  -26.350 1.00 48.13  ? 23  THR A N   1 
ATOM   29   C CA  . THR A 1 11  ? 4.217   -7.123  -26.634 1.00 46.48  ? 23  THR A CA  1 
ATOM   30   C C   . THR A 1 11  ? 3.542   -5.829  -27.130 1.00 49.58  ? 23  THR A C   1 
ATOM   31   O O   . THR A 1 11  ? 2.670   -5.864  -28.006 1.00 50.01  ? 23  THR A O   1 
ATOM   32   C CB  . THR A 1 11  ? 5.262   -7.664  -27.625 1.00 49.77  ? 23  THR A CB  1 
ATOM   33   O OG1 . THR A 1 11  ? 5.919   -8.772  -27.009 1.00 53.08  ? 23  THR A OG1 1 
ATOM   34   C CG2 . THR A 1 11  ? 6.318   -6.635  -27.998 1.00 44.45  ? 23  THR A CG2 1 
ATOM   35   N N   . VAL A 1 12  ? 3.956   -4.694  -26.534 1.00 44.97  ? 24  VAL A N   1 
ATOM   36   C CA  . VAL A 1 12  ? 3.570   -3.347  -26.959 1.00 43.90  ? 24  VAL A CA  1 
ATOM   37   C C   . VAL A 1 12  ? 4.839   -2.549  -27.303 1.00 46.79  ? 24  VAL A C   1 
ATOM   38   O O   . VAL A 1 12  ? 5.760   -2.477  -26.488 1.00 45.91  ? 24  VAL A O   1 
ATOM   39   C CB  . VAL A 1 12  ? 2.688   -2.606  -25.909 1.00 46.45  ? 24  VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 12  ? 2.279   -1.221  -26.411 1.00 45.26  ? 24  VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 12  ? 1.452   -3.420  -25.548 1.00 47.02  ? 24  VAL A CG2 1 
ATOM   42   N N   . ARG A 1 13  ? 4.885   -1.978  -28.521 1.00 42.72  ? 25  ARG A N   1 
ATOM   43   C CA  . ARG A 1 13  ? 5.910   -1.026  -28.945 1.00 40.73  ? 25  ARG A CA  1 
ATOM   44   C C   . ARG A 1 13  ? 5.544   0.356   -28.410 1.00 41.92  ? 25  ARG A C   1 
ATOM   45   O O   . ARG A 1 13  ? 4.441   0.839   -28.665 1.00 39.72  ? 25  ARG A O   1 
ATOM   46   C CB  . ARG A 1 13  ? 6.051   -1.021  -30.480 1.00 40.61  ? 25  ARG A CB  1 
ATOM   47   C CG  . ARG A 1 13  ? 7.350   -0.408  -31.021 1.00 52.14  ? 25  ARG A CG  1 
ATOM   48   C CD  . ARG A 1 13  ? 7.507   -0.634  -32.517 1.00 66.46  ? 25  ARG A CD  1 
ATOM   49   N NE  . ARG A 1 13  ? 7.680   -2.059  -32.825 1.00 89.23  ? 25  ARG A NE  1 
ATOM   50   C CZ  . ARG A 1 13  ? 7.735   -2.582  -34.047 1.00 109.41 ? 25  ARG A CZ  1 
ATOM   51   N NH1 . ARG A 1 13  ? 7.902   -3.887  -34.209 1.00 97.45  ? 25  ARG A NH1 1 
ATOM   52   N NH2 . ARG A 1 13  ? 7.598   -1.806  -35.118 1.00 99.71  ? 25  ARG A NH2 1 
ATOM   53   N N   . ILE A 1 14  ? 6.441   0.956   -27.608 1.00 37.99  ? 26  ILE A N   1 
ATOM   54   C CA  . ILE A 1 14  ? 6.291   2.332   -27.126 1.00 36.52  ? 26  ILE A CA  1 
ATOM   55   C C   . ILE A 1 14  ? 7.411   3.156   -27.739 1.00 40.31  ? 26  ILE A C   1 
ATOM   56   O O   . ILE A 1 14  ? 8.584   2.865   -27.518 1.00 39.56  ? 26  ILE A O   1 
ATOM   57   C CB  . ILE A 1 14  ? 6.239   2.443   -25.566 1.00 38.77  ? 26  ILE A CB  1 
ATOM   58   C CG1 . ILE A 1 14  ? 5.080   1.600   -24.939 1.00 39.22  ? 26  ILE A CG1 1 
ATOM   59   C CG2 . ILE A 1 14  ? 6.215   3.905   -25.082 1.00 37.26  ? 26  ILE A CG2 1 
ATOM   60   C CD1 . ILE A 1 14  ? 3.641   1.998   -25.236 1.00 46.00  ? 26  ILE A CD1 1 
ATOM   61   N N   . VAL A 1 15  ? 7.048   4.188   -28.513 1.00 37.29  ? 27  VAL A N   1 
ATOM   62   C CA  . VAL A 1 15  ? 8.028   5.060   -29.157 1.00 36.84  ? 27  VAL A CA  1 
ATOM   63   C C   . VAL A 1 15  ? 8.101   6.373   -28.369 1.00 40.50  ? 27  VAL A C   1 
ATOM   64   O O   . VAL A 1 15  ? 7.105   7.102   -28.283 1.00 38.54  ? 27  VAL A O   1 
ATOM   65   C CB  . VAL A 1 15  ? 7.721   5.267   -30.661 1.00 40.55  ? 27  VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 15  ? 8.729   6.213   -31.305 1.00 39.91  ? 27  VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 15  ? 7.689   3.929   -31.399 1.00 41.58  ? 27  VAL A CG2 1 
ATOM   68   N N   . THR A 1 16  ? 9.265   6.622   -27.723 1.00 37.64  ? 28  THR A N   1 
ATOM   69   C CA  . THR A 1 16  ? 9.565   7.920   -27.105 1.00 36.63  ? 28  THR A CA  1 
ATOM   70   C C   . THR A 1 16  ? 10.354  8.749   -28.126 1.00 40.90  ? 28  THR A C   1 
ATOM   71   O O   . THR A 1 16  ? 10.690  8.228   -29.191 1.00 41.61  ? 28  THR A O   1 
ATOM   72   C CB  . THR A 1 16  ? 10.304  7.744   -25.772 1.00 43.09  ? 28  THR A CB  1 
ATOM   73   O OG1 . THR A 1 16  ? 11.627  7.277   -26.016 1.00 50.13  ? 28  THR A OG1 1 
ATOM   74   C CG2 . THR A 1 16  ? 9.594   6.807   -24.812 1.00 38.50  ? 28  THR A CG2 1 
ATOM   75   N N   . MET A 1 17  ? 10.649  10.019  -27.826 1.00 37.65  ? 29  MET A N   1 
ATOM   76   C CA  . MET A 1 17  ? 11.497  10.847  -28.698 1.00 38.47  ? 29  MET A CA  1 
ATOM   77   C C   . MET A 1 17  ? 12.915  10.249  -28.820 1.00 44.71  ? 29  MET A C   1 
ATOM   78   O O   . MET A 1 17  ? 13.569  10.440  -29.838 1.00 45.69  ? 29  MET A O   1 
ATOM   79   C CB  . MET A 1 17  ? 11.585  12.294  -28.168 1.00 39.84  ? 29  MET A CB  1 
ATOM   80   C CG  . MET A 1 17  ? 10.288  13.098  -28.247 1.00 42.16  ? 29  MET A CG  1 
ATOM   81   S SD  . MET A 1 17  ? 9.524   13.297  -29.883 1.00 46.14  ? 29  MET A SD  1 
ATOM   82   C CE  . MET A 1 17  ? 10.798  14.098  -30.785 1.00 42.83  ? 29  MET A CE  1 
ATOM   83   N N   . ASP A 1 18  ? 13.368  9.522   -27.770 1.00 41.82  ? 30  ASP A N   1 
ATOM   84   C CA  . ASP A 1 18  ? 14.664  8.846   -27.645 1.00 41.91  ? 30  ASP A CA  1 
ATOM   85   C C   . ASP A 1 18  ? 14.738  7.537   -28.423 1.00 47.57  ? 30  ASP A C   1 
ATOM   86   O O   . ASP A 1 18  ? 15.671  7.327   -29.191 1.00 50.40  ? 30  ASP A O   1 
ATOM   87   C CB  . ASP A 1 18  ? 14.936  8.511   -26.171 1.00 43.20  ? 30  ASP A CB  1 
ATOM   88   C CG  . ASP A 1 18  ? 15.229  9.679   -25.269 1.00 53.58  ? 30  ASP A CG  1 
ATOM   89   O OD1 . ASP A 1 18  ? 16.346  10.236  -25.368 1.00 55.16  ? 30  ASP A OD1 1 
ATOM   90   O OD2 . ASP A 1 18  ? 14.391  9.966   -24.381 1.00 57.70  ? 30  ASP A OD2 1 
ATOM   91   N N   . ALA A 1 19  ? 13.780  6.633   -28.192 1.00 42.36  ? 31  ALA A N   1 
ATOM   92   C CA  . ALA A 1 19  ? 13.934  5.256   -28.605 1.00 42.13  ? 31  ALA A CA  1 
ATOM   93   C C   . ALA A 1 19  ? 12.607  4.589   -28.907 1.00 45.65  ? 31  ALA A C   1 
ATOM   94   O O   . ALA A 1 19  ? 11.547  5.058   -28.503 1.00 44.24  ? 31  ALA A O   1 
ATOM   95   C CB  . ALA A 1 19  ? 14.668  4.474   -27.518 1.00 42.97  ? 31  ALA A CB  1 
ATOM   96   N N   . GLU A 1 20  ? 12.699  3.492   -29.660 1.00 44.00  ? 32  GLU A N   1 
ATOM   97   C CA  . GLU A 1 20  ? 11.689  2.478   -29.877 1.00 44.92  ? 32  GLU A CA  1 
ATOM   98   C C   . GLU A 1 20  ? 11.827  1.458   -28.746 1.00 48.16  ? 32  GLU A C   1 
ATOM   99   O O   . GLU A 1 20  ? 12.869  0.811   -28.636 1.00 49.12  ? 32  GLU A O   1 
ATOM   100  C CB  . GLU A 1 20  ? 11.942  1.852   -31.265 1.00 48.42  ? 32  GLU A CB  1 
ATOM   101  C CG  . GLU A 1 20  ? 10.911  0.847   -31.756 1.00 68.04  ? 32  GLU A CG  1 
ATOM   102  C CD  . GLU A 1 20  ? 11.459  -0.149  -32.766 1.00 99.83  ? 32  GLU A CD  1 
ATOM   103  O OE1 . GLU A 1 20  ? 11.929  0.289   -33.841 1.00 100.93 ? 32  GLU A OE1 1 
ATOM   104  O OE2 . GLU A 1 20  ? 11.464  -1.364  -32.460 1.00 94.95  ? 32  GLU A OE2 1 
ATOM   105  N N   . MET A 1 21  ? 10.809  1.346   -27.883 1.00 43.09  ? 33  MET A N   1 
ATOM   106  C CA  . MET A 1 21  ? 10.846  0.450   -26.731 1.00 42.27  ? 33  MET A CA  1 
ATOM   107  C C   . MET A 1 21  ? 9.819   -0.645  -26.870 1.00 46.16  ? 33  MET A C   1 
ATOM   108  O O   . MET A 1 21  ? 8.850   -0.494  -27.618 1.00 45.53  ? 33  MET A O   1 
ATOM   109  C CB  . MET A 1 21  ? 10.612  1.210   -25.423 1.00 43.67  ? 33  MET A CB  1 
ATOM   110  C CG  . MET A 1 21  ? 11.599  2.299   -25.176 1.00 46.92  ? 33  MET A CG  1 
ATOM   111  S SD  . MET A 1 21  ? 11.301  3.123   -23.605 1.00 50.53  ? 33  MET A SD  1 
ATOM   112  C CE  . MET A 1 21  ? 12.443  4.445   -23.746 1.00 47.59  ? 33  MET A CE  1 
ATOM   113  N N   . GLU A 1 22  ? 10.031  -1.755  -26.156 1.00 43.54  ? 34  GLU A N   1 
ATOM   114  C CA  . GLU A 1 22  ? 9.065   -2.832  -26.110 1.00 43.93  ? 34  GLU A CA  1 
ATOM   115  C C   . GLU A 1 22  ? 8.825   -3.252  -24.673 1.00 45.09  ? 34  GLU A C   1 
ATOM   116  O O   . GLU A 1 22  ? 9.768   -3.434  -23.892 1.00 44.24  ? 34  GLU A O   1 
ATOM   117  C CB  . GLU A 1 22  ? 9.498   -4.011  -26.987 1.00 47.26  ? 34  GLU A CB  1 
ATOM   118  C CG  . GLU A 1 22  ? 8.947   -3.899  -28.398 1.00 60.68  ? 34  GLU A CG  1 
ATOM   119  C CD  . GLU A 1 22  ? 9.491   -4.856  -29.440 1.00 95.22  ? 34  GLU A CD  1 
ATOM   120  O OE1 . GLU A 1 22  ? 9.220   -4.621  -30.640 1.00 97.32  ? 34  GLU A OE1 1 
ATOM   121  O OE2 . GLU A 1 22  ? 10.184  -5.833  -29.070 1.00 94.52  ? 34  GLU A OE2 1 
ATOM   122  N N   . PHE A 1 23  ? 7.538   -3.372  -24.334 1.00 39.89  ? 35  PHE A N   1 
ATOM   123  C CA  . PHE A 1 23  ? 7.047   -3.768  -23.026 1.00 38.63  ? 35  PHE A CA  1 
ATOM   124  C C   . PHE A 1 23  ? 6.146   -4.963  -23.116 1.00 45.78  ? 35  PHE A C   1 
ATOM   125  O O   . PHE A 1 23  ? 5.457   -5.149  -24.125 1.00 46.20  ? 35  PHE A O   1 
ATOM   126  C CB  . PHE A 1 23  ? 6.275   -2.628  -22.366 1.00 38.17  ? 35  PHE A CB  1 
ATOM   127  C CG  . PHE A 1 23  ? 7.109   -1.445  -22.014 1.00 37.51  ? 35  PHE A CG  1 
ATOM   128  C CD1 . PHE A 1 23  ? 7.733   -1.364  -20.773 1.00 39.10  ? 35  PHE A CD1 1 
ATOM   129  C CD2 . PHE A 1 23  ? 7.276   -0.406  -22.921 1.00 37.51  ? 35  PHE A CD2 1 
ATOM   130  C CE1 . PHE A 1 23  ? 8.513   -0.264  -20.441 1.00 38.03  ? 35  PHE A CE1 1 
ATOM   131  C CE2 . PHE A 1 23  ? 8.051   0.712   -22.592 1.00 38.33  ? 35  PHE A CE2 1 
ATOM   132  C CZ  . PHE A 1 23  ? 8.664   0.779   -21.349 1.00 35.40  ? 35  PHE A CZ  1 
ATOM   133  N N   . ASN A 1 24  ? 6.163   -5.783  -22.061 1.00 43.41  ? 36  ASN A N   1 
ATOM   134  C CA  . ASN A 1 24  ? 5.240   -6.879  -21.905 1.00 44.35  ? 36  ASN A CA  1 
ATOM   135  C C   . ASN A 1 24  ? 4.052   -6.377  -21.093 1.00 48.16  ? 36  ASN A C   1 
ATOM   136  O O   . ASN A 1 24  ? 4.151   -6.152  -19.880 1.00 47.95  ? 36  ASN A O   1 
ATOM   137  C CB  . ASN A 1 24  ? 5.934   -8.086  -21.271 1.00 45.21  ? 36  ASN A CB  1 
ATOM   138  C CG  . ASN A 1 24  ? 6.937   -8.719  -22.192 1.00 65.62  ? 36  ASN A CG  1 
ATOM   139  O OD1 . ASN A 1 24  ? 6.594   -9.335  -23.217 1.00 69.25  ? 36  ASN A OD1 1 
ATOM   140  N ND2 . ASN A 1 24  ? 8.201   -8.539  -21.863 1.00 54.19  ? 36  ASN A ND2 1 
ATOM   141  N N   . CYS A 1 25  ? 2.945   -6.140  -21.793 1.00 44.21  ? 37  CYS A N   1 
ATOM   142  C CA  . CYS A 1 25  ? 1.697   -5.663  -21.217 1.00 43.30  ? 37  CYS A CA  1 
ATOM   143  C C   . CYS A 1 25  ? 0.833   -6.855  -20.838 1.00 48.43  ? 37  CYS A C   1 
ATOM   144  O O   . CYS A 1 25  ? 0.616   -7.733  -21.685 1.00 48.62  ? 37  CYS A O   1 
ATOM   145  C CB  . CYS A 1 25  ? 0.994   -4.751  -22.218 1.00 42.83  ? 37  CYS A CB  1 
ATOM   146  S SG  . CYS A 1 25  ? -0.566  -4.052  -21.631 1.00 46.36  ? 37  CYS A SG  1 
ATOM   147  N N   . GLU A 1 26  ? 0.364   -6.907  -19.563 1.00 44.93  ? 38  GLU A N   1 
ATOM   148  C CA  . GLU A 1 26  ? -0.535  -7.966  -19.086 1.00 46.29  ? 38  GLU A CA  1 
ATOM   149  C C   . GLU A 1 26  ? -1.863  -7.925  -19.844 1.00 54.29  ? 38  GLU A C   1 
ATOM   150  O O   . GLU A 1 26  ? -2.319  -6.846  -20.224 1.00 53.71  ? 38  GLU A O   1 
ATOM   151  C CB  . GLU A 1 26  ? -0.780  -7.856  -17.578 1.00 46.80  ? 38  GLU A CB  1 
ATOM   152  C CG  . GLU A 1 26  ? 0.343   -8.422  -16.733 1.00 52.36  ? 38  GLU A CG  1 
ATOM   153  C CD  . GLU A 1 26  ? 0.074   -8.453  -15.237 1.00 63.24  ? 38  GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 26  ? 0.859   -7.820  -14.502 1.00 42.49  ? 38  GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 26  ? -0.889  -9.119  -14.793 1.00 63.46  ? 38  GLU A OE2 1 
ATOM   156  N N   . MET A 1 27  ? -2.476  -9.100  -20.055 1.00 53.98  ? 39  MET A N   1 
ATOM   157  C CA  . MET A 1 27  ? -3.675  -9.276  -20.873 1.00 55.76  ? 39  MET A CA  1 
ATOM   158  C C   . MET A 1 27  ? -4.853  -8.411  -20.402 1.00 58.16  ? 39  MET A C   1 
ATOM   159  O O   . MET A 1 27  ? -5.552  -7.833  -21.238 1.00 57.90  ? 39  MET A O   1 
ATOM   160  C CB  . MET A 1 27  ? -4.100  -10.758 -20.892 1.00 60.83  ? 39  MET A CB  1 
ATOM   161  C CG  . MET A 1 27  ? -3.118  -11.680 -21.595 1.00 66.52  ? 39  MET A CG  1 
ATOM   162  S SD  . MET A 1 27  ? -2.928  -11.327 -23.361 1.00 72.68  ? 39  MET A SD  1 
ATOM   163  C CE  . MET A 1 27  ? -1.763  -12.567 -23.791 1.00 70.84  ? 39  MET A CE  1 
ATOM   164  N N   . LYS A 1 28  ? -5.064  -8.312  -19.077 1.00 53.69  ? 40  LYS A N   1 
ATOM   165  C CA  . LYS A 1 28  ? -6.240  -7.635  -18.524 1.00 53.11  ? 40  LYS A CA  1 
ATOM   166  C C   . LYS A 1 28  ? -5.923  -6.196  -18.058 1.00 51.93  ? 40  LYS A C   1 
ATOM   167  O O   . LYS A 1 28  ? -6.782  -5.540  -17.457 1.00 51.64  ? 40  LYS A O   1 
ATOM   168  C CB  . LYS A 1 28  ? -6.848  -8.474  -17.382 1.00 57.47  ? 40  LYS A CB  1 
ATOM   169  C CG  . LYS A 1 28  ? -7.897  -9.476  -17.878 1.00 74.32  ? 40  LYS A CG  1 
ATOM   170  C CD  . LYS A 1 28  ? -8.437  -10.337 -16.751 1.00 86.80  ? 40  LYS A CD  1 
ATOM   171  C CE  . LYS A 1 28  ? -9.627  -11.156 -17.176 1.00 99.64  ? 40  LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 28  ? -10.100 -12.031 -16.070 1.00 109.06 ? 40  LYS A NZ  1 
ATOM   173  N N   . TRP A 1 29  ? -4.712  -5.698  -18.379 1.00 44.17  ? 41  TRP A N   1 
ATOM   174  C CA  . TRP A 1 29  ? -4.270  -4.340  -18.054 1.00 40.66  ? 41  TRP A CA  1 
ATOM   175  C C   . TRP A 1 29  ? -5.031  -3.280  -18.836 1.00 45.12  ? 41  TRP A C   1 
ATOM   176  O O   . TRP A 1 29  ? -5.334  -3.456  -20.021 1.00 45.07  ? 41  TRP A O   1 
ATOM   177  C CB  . TRP A 1 29  ? -2.768  -4.174  -18.321 1.00 37.09  ? 41  TRP A CB  1 
ATOM   178  C CG  . TRP A 1 29  ? -1.876  -4.422  -17.138 1.00 36.58  ? 41  TRP A CG  1 
ATOM   179  C CD1 . TRP A 1 29  ? -2.220  -4.974  -15.937 1.00 39.81  ? 41  TRP A CD1 1 
ATOM   180  C CD2 . TRP A 1 29  ? -0.478  -4.145  -17.066 1.00 35.12  ? 41  TRP A CD2 1 
ATOM   181  N NE1 . TRP A 1 29  ? -1.123  -5.048  -15.117 1.00 38.23  ? 41  TRP A NE1 1 
ATOM   182  C CE2 . TRP A 1 29  ? -0.041  -4.523  -15.775 1.00 38.69  ? 41  TRP A CE2 1 
ATOM   183  C CE3 . TRP A 1 29  ? 0.450   -3.587  -17.962 1.00 35.57  ? 41  TRP A CE3 1 
ATOM   184  C CZ2 . TRP A 1 29  ? 1.289   -4.365  -15.357 1.00 37.33  ? 41  TRP A CZ2 1 
ATOM   185  C CZ3 . TRP A 1 29  ? 1.768   -3.453  -17.555 1.00 36.35  ? 41  TRP A CZ3 1 
ATOM   186  C CH2 . TRP A 1 29  ? 2.177   -3.834  -16.266 1.00 36.88  ? 41  TRP A CH2 1 
ATOM   187  N N   . LYS A 1 30  ? -5.334  -2.176  -18.147 1.00 41.59  ? 42  LYS A N   1 
ATOM   188  C CA  . LYS A 1 30  ? -5.950  -0.975  -18.709 1.00 40.66  ? 42  LYS A CA  1 
ATOM   189  C C   . LYS A 1 30  ? -4.856  -0.026  -19.198 1.00 44.03  ? 42  LYS A C   1 
ATOM   190  O O   . LYS A 1 30  ? -3.672  -0.269  -18.948 1.00 43.72  ? 42  LYS A O   1 
ATOM   191  C CB  . LYS A 1 30  ? -6.861  -0.306  -17.659 1.00 42.41  ? 42  LYS A CB  1 
ATOM   192  C CG  . LYS A 1 30  ? -8.101  -1.145  -17.326 1.00 59.62  ? 42  LYS A CG  1 
ATOM   193  C CD  . LYS A 1 30  ? -8.906  -0.588  -16.158 1.00 71.47  ? 42  LYS A CD  1 
ATOM   194  C CE  . LYS A 1 30  ? -10.214 -1.330  -15.983 1.00 83.92  ? 42  LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 30  ? -11.196 -0.554  -15.179 1.00 94.80  ? 42  LYS A NZ  1 
ATOM   196  N N   . GLY A 1 31  ? -5.249  1.027   -19.910 1.00 40.22  ? 43  GLY A N   1 
ATOM   197  C CA  . GLY A 1 31  ? -4.335  2.053   -20.405 1.00 38.49  ? 43  GLY A CA  1 
ATOM   198  C C   . GLY A 1 31  ? -3.419  2.618   -19.337 1.00 40.89  ? 43  GLY A C   1 
ATOM   199  O O   . GLY A 1 31  ? -2.225  2.782   -19.583 1.00 40.15  ? 43  GLY A O   1 
ATOM   200  N N   . LYS A 1 32  ? -3.968  2.871   -18.123 1.00 36.83  ? 44  LYS A N   1 
ATOM   201  C CA  . LYS A 1 32  ? -3.250  3.418   -16.969 1.00 34.82  ? 44  LYS A CA  1 
ATOM   202  C C   . LYS A 1 32  ? -2.129  2.476   -16.497 1.00 38.62  ? 44  LYS A C   1 
ATOM   203  O O   . LYS A 1 32  ? -1.070  2.951   -16.075 1.00 37.53  ? 44  LYS A O   1 
ATOM   204  C CB  . LYS A 1 32  ? -4.231  3.718   -15.821 1.00 36.73  ? 44  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 32  ? -3.718  4.711   -14.771 1.00 48.24  ? 44  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 32  ? -3.366  6.103   -15.330 1.00 54.64  ? 44  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 32  ? -3.119  7.142   -14.261 1.00 59.68  ? 44  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 32  ? -2.814  8.474   -14.857 1.00 69.02  ? 44  LYS A NZ  1 
ATOM   209  N N   . ASP A 1 33  ? -2.335  1.155   -16.602 1.00 34.93  ? 45  ASP A N   1 
ATOM   210  C CA  . ASP A 1 33  ? -1.326  0.204   -16.163 1.00 34.42  ? 45  ASP A CA  1 
ATOM   211  C C   . ASP A 1 33  ? -0.131  0.187   -17.124 1.00 38.70  ? 45  ASP A C   1 
ATOM   212  O O   . ASP A 1 33  ? 1.016   0.149   -16.660 1.00 38.51  ? 45  ASP A O   1 
ATOM   213  C CB  . ASP A 1 33  ? -1.932  -1.181  -15.993 1.00 37.13  ? 45  ASP A CB  1 
ATOM   214  C CG  . ASP A 1 33  ? -3.118  -1.200  -15.045 1.00 45.13  ? 45  ASP A CG  1 
ATOM   215  O OD1 . ASP A 1 33  ? -2.939  -0.834  -13.864 1.00 44.56  ? 45  ASP A OD1 1 
ATOM   216  O OD2 . ASP A 1 33  ? -4.232  -1.557  -15.493 1.00 51.33  ? 45  ASP A OD2 1 
ATOM   217  N N   . LEU A 1 34  ? -0.394  0.264   -18.451 1.00 34.41  ? 46  LEU A N   1 
ATOM   218  C CA  . LEU A 1 34  ? 0.648   0.343   -19.474 1.00 33.14  ? 46  LEU A CA  1 
ATOM   219  C C   . LEU A 1 34  ? 1.386   1.669   -19.361 1.00 35.90  ? 46  LEU A C   1 
ATOM   220  O O   . LEU A 1 34  ? 2.620   1.677   -19.383 1.00 35.46  ? 46  LEU A O   1 
ATOM   221  C CB  . LEU A 1 34  ? 0.035   0.156   -20.879 1.00 33.33  ? 46  LEU A CB  1 
ATOM   222  C CG  . LEU A 1 34  ? 0.956   0.352   -22.095 1.00 36.68  ? 46  LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 34  ? 2.198   -0.570  -22.036 1.00 36.20  ? 46  LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 34  ? 0.171   0.167   -23.384 1.00 38.83  ? 46  LEU A CD2 1 
ATOM   225  N N   . PHE A 1 35  ? 0.629   2.782   -19.224 1.00 31.06  ? 47  PHE A N   1 
ATOM   226  C CA  . PHE A 1 35  ? 1.176   4.132   -19.105 1.00 29.42  ? 47  PHE A CA  1 
ATOM   227  C C   . PHE A 1 35  ? 2.106   4.255   -17.886 1.00 34.93  ? 47  PHE A C   1 
ATOM   228  O O   . PHE A 1 35  ? 3.207   4.765   -18.028 1.00 34.29  ? 47  PHE A O   1 
ATOM   229  C CB  . PHE A 1 35  ? 0.041   5.170   -19.041 1.00 30.20  ? 47  PHE A CB  1 
ATOM   230  C CG  . PHE A 1 35  ? 0.488   6.592   -18.842 1.00 30.25  ? 47  PHE A CG  1 
ATOM   231  C CD1 . PHE A 1 35  ? 1.111   7.291   -19.868 1.00 32.34  ? 47  PHE A CD1 1 
ATOM   232  C CD2 . PHE A 1 35  ? 0.265   7.243   -17.634 1.00 30.13  ? 47  PHE A CD2 1 
ATOM   233  C CE1 . PHE A 1 35  ? 1.514   8.608   -19.687 1.00 31.58  ? 47  PHE A CE1 1 
ATOM   234  C CE2 . PHE A 1 35  ? 0.689   8.552   -17.446 1.00 31.76  ? 47  PHE A CE2 1 
ATOM   235  C CZ  . PHE A 1 35  ? 1.308   9.230   -18.475 1.00 29.60  ? 47  PHE A CZ  1 
ATOM   236  N N   . ASP A 1 36  ? 1.686   3.758   -16.711 1.00 33.94  ? 48  ASP A N   1 
ATOM   237  C CA  . ASP A 1 36  ? 2.453   3.922   -15.489 1.00 33.80  ? 48  ASP A CA  1 
ATOM   238  C C   . ASP A 1 36  ? 3.701   3.036   -15.484 1.00 40.11  ? 48  ASP A C   1 
ATOM   239  O O   . ASP A 1 36  ? 4.701   3.414   -14.860 1.00 41.71  ? 48  ASP A O   1 
ATOM   240  C CB  . ASP A 1 36  ? 1.581   3.697   -14.260 1.00 35.87  ? 48  ASP A CB  1 
ATOM   241  C CG  . ASP A 1 36  ? 0.819   4.952   -13.873 1.00 47.23  ? 48  ASP A CG  1 
ATOM   242  O OD1 . ASP A 1 36  ? 1.447   5.885   -13.334 1.00 46.64  ? 48  ASP A OD1 1 
ATOM   243  O OD2 . ASP A 1 36  ? -0.401  5.005   -14.115 1.00 56.24  ? 48  ASP A OD2 1 
ATOM   244  N N   . LEU A 1 37  ? 3.669   1.899   -16.209 1.00 35.82  ? 49  LEU A N   1 
ATOM   245  C CA  . LEU A 1 37  ? 4.845   1.057   -16.443 1.00 34.72  ? 49  LEU A CA  1 
ATOM   246  C C   . LEU A 1 37  ? 5.925   1.807   -17.241 1.00 38.31  ? 49  LEU A C   1 
ATOM   247  O O   . LEU A 1 37  ? 7.100   1.715   -16.884 1.00 38.35  ? 49  LEU A O   1 
ATOM   248  C CB  . LEU A 1 37  ? 4.455   -0.221  -17.182 1.00 35.06  ? 49  LEU A CB  1 
ATOM   249  C CG  . LEU A 1 37  ? 5.585   -1.190  -17.561 1.00 38.86  ? 49  LEU A CG  1 
ATOM   250  C CD1 . LEU A 1 37  ? 6.282   -1.770  -16.307 1.00 38.16  ? 49  LEU A CD1 1 
ATOM   251  C CD2 . LEU A 1 37  ? 5.067   -2.276  -18.461 1.00 40.38  ? 49  LEU A CD2 1 
ATOM   252  N N   . VAL A 1 38  ? 5.526   2.540   -18.311 1.00 34.35  ? 50  VAL A N   1 
ATOM   253  C CA  . VAL A 1 38  ? 6.419   3.349   -19.150 1.00 33.16  ? 50  VAL A CA  1 
ATOM   254  C C   . VAL A 1 38  ? 7.048   4.436   -18.289 1.00 36.37  ? 50  VAL A C   1 
ATOM   255  O O   . VAL A 1 38  ? 8.265   4.596   -18.307 1.00 37.05  ? 50  VAL A O   1 
ATOM   256  C CB  . VAL A 1 38  ? 5.691   3.927   -20.403 1.00 37.07  ? 50  VAL A CB  1 
ATOM   257  C CG1 . VAL A 1 38  ? 6.626   4.791   -21.251 1.00 36.15  ? 50  VAL A CG1 1 
ATOM   258  C CG2 . VAL A 1 38  ? 5.088   2.819   -21.261 1.00 37.74  ? 50  VAL A CG2 1 
ATOM   259  N N   . CYS A 1 39  ? 6.224   5.147   -17.509 1.00 32.25  ? 51  CYS A N   1 
ATOM   260  C CA  . CYS A 1 39  ? 6.650   6.231   -16.626 1.00 30.46  ? 51  CYS A CA  1 
ATOM   261  C C   . CYS A 1 39  ? 7.656   5.730   -15.572 1.00 35.09  ? 51  CYS A C   1 
ATOM   262  O O   . CYS A 1 39  ? 8.700   6.366   -15.393 1.00 35.28  ? 51  CYS A O   1 
ATOM   263  C CB  . CYS A 1 39  ? 5.434   6.881   -15.974 1.00 30.23  ? 51  CYS A CB  1 
ATOM   264  S SG  . CYS A 1 39  ? 4.306   7.689   -17.143 1.00 33.69  ? 51  CYS A SG  1 
ATOM   265  N N   . ARG A 1 40  ? 7.356   4.592   -14.902 1.00 30.83  ? 52  ARG A N   1 
ATOM   266  C CA  . ARG A 1 40  ? 8.225   3.999   -13.895 1.00 30.99  ? 52  ARG A CA  1 
ATOM   267  C C   . ARG A 1 40  ? 9.561   3.565   -14.509 1.00 37.33  ? 52  ARG A C   1 
ATOM   268  O O   . ARG A 1 40  ? 10.588  3.702   -13.845 1.00 38.53  ? 52  ARG A O   1 
ATOM   269  C CB  . ARG A 1 40  ? 7.525   2.822   -13.208 1.00 32.00  ? 52  ARG A CB  1 
ATOM   270  C CG  . ARG A 1 40  ? 8.064   2.510   -11.798 1.00 30.40  ? 52  ARG A CG  1 
ATOM   271  C CD  . ARG A 1 40  ? 7.040   1.786   -10.921 1.00 34.78  ? 52  ARG A CD  1 
ATOM   272  N NE  . ARG A 1 40  ? 6.466   0.593   -11.560 1.00 41.72  ? 52  ARG A NE  1 
ATOM   273  C CZ  . ARG A 1 40  ? 5.170   0.332   -11.680 1.00 48.22  ? 52  ARG A CZ  1 
ATOM   274  N NH1 . ARG A 1 40  ? 4.268   1.164   -11.176 1.00 34.10  ? 52  ARG A NH1 1 
ATOM   275  N NH2 . ARG A 1 40  ? 4.764   -0.772  -12.296 1.00 46.33  ? 52  ARG A NH2 1 
ATOM   276  N N   . THR A 1 41  ? 9.553   3.081   -15.781 1.00 34.42  ? 53  THR A N   1 
ATOM   277  C CA  . THR A 1 41  ? 10.749  2.659   -16.527 1.00 33.84  ? 53  THR A CA  1 
ATOM   278  C C   . THR A 1 41  ? 11.685  3.852   -16.756 1.00 36.80  ? 53  THR A C   1 
ATOM   279  O O   . THR A 1 41  ? 12.902  3.675   -16.757 1.00 38.43  ? 53  THR A O   1 
ATOM   280  C CB  . THR A 1 41  ? 10.338  1.985   -17.855 1.00 33.74  ? 53  THR A CB  1 
ATOM   281  O OG1 . THR A 1 41  ? 9.522   0.851   -17.566 1.00 27.73  ? 53  THR A OG1 1 
ATOM   282  C CG2 . THR A 1 41  ? 11.545  1.532   -18.713 1.00 26.35  ? 53  THR A CG2 1 
ATOM   283  N N   . LEU A 1 42  ? 11.122  5.049   -16.936 1.00 31.56  ? 54  LEU A N   1 
ATOM   284  C CA  . LEU A 1 42  ? 11.887  6.264   -17.227 1.00 30.77  ? 54  LEU A CA  1 
ATOM   285  C C   . LEU A 1 42  ? 12.127  7.089   -15.956 1.00 34.16  ? 54  LEU A C   1 
ATOM   286  O O   . LEU A 1 42  ? 12.753  8.146   -16.021 1.00 33.86  ? 54  LEU A O   1 
ATOM   287  C CB  . LEU A 1 42  ? 11.166  7.108   -18.299 1.00 30.19  ? 54  LEU A CB  1 
ATOM   288  C CG  . LEU A 1 42  ? 10.811  6.398   -19.624 1.00 34.12  ? 54  LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 42  ? 9.908   7.276   -20.487 1.00 33.42  ? 54  LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 42  ? 12.060  5.955   -20.374 1.00 38.40  ? 54  LEU A CD2 1 
ATOM   291  N N   . GLY A 1 43  ? 11.652  6.571   -14.821 1.00 29.78  ? 55  GLY A N   1 
ATOM   292  C CA  . GLY A 1 43  ? 11.746  7.200   -13.508 1.00 28.44  ? 55  GLY A CA  1 
ATOM   293  C C   . GLY A 1 43  ? 10.976  8.492   -13.413 1.00 31.33  ? 55  GLY A C   1 
ATOM   294  O O   . GLY A 1 43  ? 11.346  9.365   -12.635 1.00 30.36  ? 55  GLY A O   1 
ATOM   295  N N   . LEU A 1 44  ? 9.873   8.596   -14.181 1.00 29.39  ? 56  LEU A N   1 
ATOM   296  C CA  . LEU A 1 44  ? 9.091   9.813   -14.379 1.00 28.65  ? 56  LEU A CA  1 
ATOM   297  C C   . LEU A 1 44  ? 7.898   9.857   -13.432 1.00 30.46  ? 56  LEU A C   1 
ATOM   298  O O   . LEU A 1 44  ? 7.064   8.950   -13.439 1.00 29.88  ? 56  LEU A O   1 
ATOM   299  C CB  . LEU A 1 44  ? 8.640   9.886   -15.851 1.00 29.07  ? 56  LEU A CB  1 
ATOM   300  C CG  . LEU A 1 44  ? 7.645   10.981  -16.215 1.00 34.84  ? 56  LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 44  ? 8.332   12.292  -16.355 1.00 35.14  ? 56  LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 44  ? 6.936   10.648  -17.512 1.00 37.37  ? 56  LEU A CD2 1 
ATOM   303  N N   . ARG A 1 45  ? 7.827   10.910  -12.618 1.00 27.36  ? 57  ARG A N   1 
ATOM   304  C CA  . ARG A 1 45  ? 6.737   11.142  -11.657 1.00 26.69  ? 57  ARG A CA  1 
ATOM   305  C C   . ARG A 1 45  ? 5.800   12.244  -12.123 1.00 30.94  ? 57  ARG A C   1 
ATOM   306  O O   . ARG A 1 45  ? 4.613   12.204  -11.811 1.00 32.73  ? 57  ARG A O   1 
ATOM   307  C CB  . ARG A 1 45  ? 7.302   11.488  -10.281 1.00 24.90  ? 57  ARG A CB  1 
ATOM   308  C CG  . ARG A 1 45  ? 7.873   10.282  -9.550  1.00 26.30  ? 57  ARG A CG  1 
ATOM   309  C CD  . ARG A 1 45  ? 8.361   10.644  -8.155  1.00 26.86  ? 57  ARG A CD  1 
ATOM   310  N NE  . ARG A 1 45  ? 9.282   11.783  -8.151  1.00 30.19  ? 57  ARG A NE  1 
ATOM   311  C CZ  . ARG A 1 45  ? 10.586  11.712  -8.408  1.00 39.38  ? 57  ARG A CZ  1 
ATOM   312  N NH1 . ARG A 1 45  ? 11.152  10.547  -8.704  1.00 30.43  ? 57  ARG A NH1 1 
ATOM   313  N NH2 . ARG A 1 45  ? 11.330  12.802  -8.377  1.00 27.71  ? 57  ARG A NH2 1 
ATOM   314  N N   . GLU A 1 46  ? 6.325   13.218  -12.888 1.00 27.11  ? 58  GLU A N   1 
ATOM   315  C CA  . GLU A 1 46  ? 5.575   14.351  -13.444 1.00 26.54  ? 58  GLU A CA  1 
ATOM   316  C C   . GLU A 1 46  ? 4.817   13.863  -14.691 1.00 32.98  ? 58  GLU A C   1 
ATOM   317  O O   . GLU A 1 46  ? 5.091   14.289  -15.816 1.00 33.01  ? 58  GLU A O   1 
ATOM   318  C CB  . GLU A 1 46  ? 6.540   15.530  -13.737 1.00 27.03  ? 58  GLU A CB  1 
ATOM   319  C CG  . GLU A 1 46  ? 7.281   15.976  -12.478 1.00 35.41  ? 58  GLU A CG  1 
ATOM   320  C CD  . GLU A 1 46  ? 8.367   17.025  -12.567 1.00 46.22  ? 58  GLU A CD  1 
ATOM   321  O OE1 . GLU A 1 46  ? 9.209   16.943  -13.482 1.00 33.43  ? 58  GLU A OE1 1 
ATOM   322  O OE2 . GLU A 1 46  ? 8.429   17.888  -11.665 1.00 48.45  ? 58  GLU A OE2 1 
ATOM   323  N N   . THR A 1 47  ? 3.835   12.973  -14.475 1.00 31.30  ? 59  THR A N   1 
ATOM   324  C CA  . THR A 1 47  ? 3.274   12.137  -15.545 1.00 31.20  ? 59  THR A CA  1 
ATOM   325  C C   . THR A 1 47  ? 2.081   12.798  -16.243 1.00 32.62  ? 59  THR A C   1 
ATOM   326  O O   . THR A 1 47  ? 1.779   12.410  -17.373 1.00 32.43  ? 59  THR A O   1 
ATOM   327  C CB  . THR A 1 47  ? 2.885   10.739  -15.012 1.00 36.65  ? 59  THR A CB  1 
ATOM   328  O OG1 . THR A 1 47  ? 1.893   10.880  -14.010 1.00 36.00  ? 59  THR A OG1 1 
ATOM   329  C CG2 . THR A 1 47  ? 4.059   9.972   -14.441 1.00 32.72  ? 59  THR A CG2 1 
ATOM   330  N N   . TRP A 1 48  ? 1.431   13.797  -15.595 1.00 27.67  ? 60  TRP A N   1 
ATOM   331  C CA  . TRP A 1 48  ? 0.197   14.471  -16.064 1.00 27.30  ? 60  TRP A CA  1 
ATOM   332  C C   . TRP A 1 48  ? 0.362   15.145  -17.424 1.00 31.23  ? 60  TRP A C   1 
ATOM   333  O O   . TRP A 1 48  ? -0.639  15.357  -18.105 1.00 32.58  ? 60  TRP A O   1 
ATOM   334  C CB  . TRP A 1 48  ? -0.322  15.518  -15.040 1.00 25.84  ? 60  TRP A CB  1 
ATOM   335  C CG  . TRP A 1 48  ? 0.740   16.467  -14.551 1.00 26.30  ? 60  TRP A CG  1 
ATOM   336  C CD1 . TRP A 1 48  ? 1.141   17.629  -15.145 1.00 28.52  ? 60  TRP A CD1 1 
ATOM   337  C CD2 . TRP A 1 48  ? 1.583   16.292  -13.400 1.00 26.09  ? 60  TRP A CD2 1 
ATOM   338  N NE1 . TRP A 1 48  ? 2.172   18.195  -14.431 1.00 27.66  ? 60  TRP A NE1 1 
ATOM   339  C CE2 . TRP A 1 48  ? 2.463   17.401  -13.352 1.00 29.11  ? 60  TRP A CE2 1 
ATOM   340  C CE3 . TRP A 1 48  ? 1.661   15.324  -12.388 1.00 27.46  ? 60  TRP A CE3 1 
ATOM   341  C CZ2 . TRP A 1 48  ? 3.427   17.555  -12.352 1.00 27.89  ? 60  TRP A CZ2 1 
ATOM   342  C CZ3 . TRP A 1 48  ? 2.600   15.493  -11.384 1.00 29.10  ? 60  TRP A CZ3 1 
ATOM   343  C CH2 . TRP A 1 48  ? 3.477   16.593  -11.379 1.00 29.25  ? 60  TRP A CH2 1 
ATOM   344  N N   . PHE A 1 49  ? 1.608   15.500  -17.808 1.00 27.07  ? 61  PHE A N   1 
ATOM   345  C CA  . PHE A 1 49  ? 1.928   16.088  -19.110 1.00 26.69  ? 61  PHE A CA  1 
ATOM   346  C C   . PHE A 1 49  ? 1.770   15.085  -20.250 1.00 32.78  ? 61  PHE A C   1 
ATOM   347  O O   . PHE A 1 49  ? 1.488   15.480  -21.380 1.00 34.87  ? 61  PHE A O   1 
ATOM   348  C CB  . PHE A 1 49  ? 3.360   16.616  -19.120 1.00 27.66  ? 61  PHE A CB  1 
ATOM   349  C CG  . PHE A 1 49  ? 3.653   17.750  -18.169 1.00 28.95  ? 61  PHE A CG  1 
ATOM   350  C CD1 . PHE A 1 49  ? 3.010   18.981  -18.303 1.00 31.51  ? 61  PHE A CD1 1 
ATOM   351  C CD2 . PHE A 1 49  ? 4.628   17.618  -17.187 1.00 30.08  ? 61  PHE A CD2 1 
ATOM   352  C CE1 . PHE A 1 49  ? 3.309   20.041  -17.436 1.00 31.99  ? 61  PHE A CE1 1 
ATOM   353  C CE2 . PHE A 1 49  ? 4.930   18.683  -16.322 1.00 32.42  ? 61  PHE A CE2 1 
ATOM   354  C CZ  . PHE A 1 49  ? 4.280   19.886  -16.461 1.00 30.67  ? 61  PHE A CZ  1 
ATOM   355  N N   . PHE A 1 50  ? 1.914   13.794  -19.951 1.00 27.63  ? 62  PHE A N   1 
ATOM   356  C CA  . PHE A 1 50  ? 2.159   12.781  -20.971 1.00 26.33  ? 62  PHE A CA  1 
ATOM   357  C C   . PHE A 1 50  ? 0.955   11.886  -21.212 1.00 32.72  ? 62  PHE A C   1 
ATOM   358  O O   . PHE A 1 50  ? 0.040   11.804  -20.389 1.00 33.74  ? 62  PHE A O   1 
ATOM   359  C CB  . PHE A 1 50  ? 3.391   11.939  -20.590 1.00 26.49  ? 62  PHE A CB  1 
ATOM   360  C CG  . PHE A 1 50  ? 4.634   12.782  -20.460 1.00 26.15  ? 62  PHE A CG  1 
ATOM   361  C CD1 . PHE A 1 50  ? 5.404   13.091  -21.579 1.00 27.32  ? 62  PHE A CD1 1 
ATOM   362  C CD2 . PHE A 1 50  ? 5.004   13.315  -19.233 1.00 27.52  ? 62  PHE A CD2 1 
ATOM   363  C CE1 . PHE A 1 50  ? 6.532   13.902  -21.466 1.00 27.69  ? 62  PHE A CE1 1 
ATOM   364  C CE2 . PHE A 1 50  ? 6.132   14.131  -19.124 1.00 29.53  ? 62  PHE A CE2 1 
ATOM   365  C CZ  . PHE A 1 50  ? 6.887   14.419  -20.242 1.00 26.76  ? 62  PHE A CZ  1 
ATOM   366  N N   . GLY A 1 51  ? 0.964   11.252  -22.372 1.00 29.61  ? 63  GLY A N   1 
ATOM   367  C CA  . GLY A 1 51  ? 0.011   10.223  -22.742 1.00 29.66  ? 63  GLY A CA  1 
ATOM   368  C C   . GLY A 1 51  ? 0.606   9.295   -23.768 1.00 33.66  ? 63  GLY A C   1 
ATOM   369  O O   . GLY A 1 51  ? 1.767   9.462   -24.161 1.00 31.09  ? 63  GLY A O   1 
ATOM   370  N N   . LEU A 1 52  ? -0.198  8.304   -24.199 1.00 33.55  ? 64  LEU A N   1 
ATOM   371  C CA  . LEU A 1 52  ? 0.161   7.352   -25.259 1.00 34.05  ? 64  LEU A CA  1 
ATOM   372  C C   . LEU A 1 52  ? -0.701  7.625   -26.488 1.00 39.26  ? 64  LEU A C   1 
ATOM   373  O O   . LEU A 1 52  ? -1.916  7.406   -26.479 1.00 38.59  ? 64  LEU A O   1 
ATOM   374  C CB  . LEU A 1 52  ? 0.029   5.889   -24.778 1.00 34.36  ? 64  LEU A CB  1 
ATOM   375  C CG  . LEU A 1 52  ? 0.973   5.467   -23.649 1.00 38.96  ? 64  LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 52  ? 0.515   4.174   -23.021 1.00 39.78  ? 64  LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 52  ? 2.432   5.363   -24.121 1.00 41.91  ? 64  LEU A CD2 1 
ATOM   378  N N   . GLN A 1 53  ? -0.060  8.126   -27.538 1.00 37.73  ? 65  GLN A N   1 
ATOM   379  C CA  . GLN A 1 53  ? -0.722  8.586   -28.752 1.00 38.43  ? 65  GLN A CA  1 
ATOM   380  C C   . GLN A 1 53  ? -0.680  7.522   -29.873 1.00 45.52  ? 65  GLN A C   1 
ATOM   381  O O   . GLN A 1 53  ? 0.269   6.741   -29.979 1.00 45.27  ? 65  GLN A O   1 
ATOM   382  C CB  . GLN A 1 53  ? -0.070  9.890   -29.222 1.00 38.50  ? 65  GLN A CB  1 
ATOM   383  C CG  . GLN A 1 53  ? -0.914  10.706  -30.181 1.00 49.71  ? 65  GLN A CG  1 
ATOM   384  C CD  . GLN A 1 53  ? -0.065  11.689  -30.933 1.00 59.31  ? 65  GLN A CD  1 
ATOM   385  O OE1 . GLN A 1 53  ? -0.015  12.877  -30.599 1.00 55.17  ? 65  GLN A OE1 1 
ATOM   386  N NE2 . GLN A 1 53  ? 0.646   11.204  -31.948 1.00 44.25  ? 65  GLN A NE2 1 
ATOM   387  N N   . TYR A 1 54  ? -1.741  7.501   -30.685 1.00 44.51  ? 66  TYR A N   1 
ATOM   388  C CA  . TYR A 1 54  ? -1.882  6.732   -31.923 1.00 46.41  ? 66  TYR A CA  1 
ATOM   389  C C   . TYR A 1 54  ? -2.745  7.566   -32.913 1.00 53.00  ? 66  TYR A C   1 
ATOM   390  O O   . TYR A 1 54  ? -3.212  8.646   -32.545 1.00 49.55  ? 66  TYR A O   1 
ATOM   391  C CB  . TYR A 1 54  ? -2.464  5.327   -31.641 1.00 48.31  ? 66  TYR A CB  1 
ATOM   392  C CG  . TYR A 1 54  ? -3.843  5.318   -31.014 1.00 50.43  ? 66  TYR A CG  1 
ATOM   393  C CD1 . TYR A 1 54  ? -4.020  5.614   -29.664 1.00 51.83  ? 66  TYR A CD1 1 
ATOM   394  C CD2 . TYR A 1 54  ? -4.959  4.929   -31.745 1.00 52.38  ? 66  TYR A CD2 1 
ATOM   395  C CE1 . TYR A 1 54  ? -5.283  5.600   -29.081 1.00 53.48  ? 66  TYR A CE1 1 
ATOM   396  C CE2 . TYR A 1 54  ? -6.227  4.888   -31.166 1.00 53.94  ? 66  TYR A CE2 1 
ATOM   397  C CZ  . TYR A 1 54  ? -6.386  5.235   -29.834 1.00 61.31  ? 66  TYR A CZ  1 
ATOM   398  O OH  . TYR A 1 54  ? -7.636  5.212   -29.256 1.00 61.51  ? 66  TYR A OH  1 
ATOM   399  N N   . THR A 1 55  ? -2.915  7.103   -34.164 1.00 55.33  ? 67  THR A N   1 
ATOM   400  C CA  . THR A 1 55  ? -3.688  7.872   -35.147 1.00 57.68  ? 67  THR A CA  1 
ATOM   401  C C   . THR A 1 55  ? -4.856  7.057   -35.704 1.00 68.07  ? 67  THR A C   1 
ATOM   402  O O   . THR A 1 55  ? -4.662  5.931   -36.172 1.00 69.31  ? 67  THR A O   1 
ATOM   403  C CB  . THR A 1 55  ? -2.807  8.437   -36.284 1.00 64.97  ? 67  THR A CB  1 
ATOM   404  O OG1 . THR A 1 55  ? -1.983  7.403   -36.810 1.00 69.11  ? 67  THR A OG1 1 
ATOM   405  C CG2 . THR A 1 55  ? -1.938  9.607   -35.832 1.00 60.73  ? 67  THR A CG2 1 
ATOM   406  N N   . ILE A 1 56  ? -6.078  7.628   -35.616 1.00 68.02  ? 68  ILE A N   1 
ATOM   407  C CA  . ILE A 1 56  ? -7.284  7.083   -36.246 1.00 71.01  ? 68  ILE A CA  1 
ATOM   408  C C   . ILE A 1 56  ? -7.542  7.887   -37.527 1.00 78.94  ? 68  ILE A C   1 
ATOM   409  O O   . ILE A 1 56  ? -7.738  9.105   -37.468 1.00 78.08  ? 68  ILE A O   1 
ATOM   410  C CB  . ILE A 1 56  ? -8.514  7.048   -35.289 1.00 74.55  ? 68  ILE A CB  1 
ATOM   411  C CG1 . ILE A 1 56  ? -8.194  6.259   -33.990 1.00 74.78  ? 68  ILE A CG1 1 
ATOM   412  C CG2 . ILE A 1 56  ? -9.748  6.460   -36.005 1.00 76.89  ? 68  ILE A CG2 1 
ATOM   413  C CD1 . ILE A 1 56  ? -9.216  6.432   -32.818 1.00 81.84  ? 68  ILE A CD1 1 
ATOM   414  N N   . LYS A 1 57  ? -7.544  7.180   -38.679 1.00 79.25  ? 69  LYS A N   1 
ATOM   415  C CA  . LYS A 1 57  ? -7.572  7.716   -40.047 1.00 80.44  ? 69  LYS A CA  1 
ATOM   416  C C   . LYS A 1 57  ? -6.392  8.691   -40.265 1.00 83.34  ? 69  LYS A C   1 
ATOM   417  O O   . LYS A 1 57  ? -5.337  8.258   -40.738 1.00 84.11  ? 69  LYS A O   1 
ATOM   418  C CB  . LYS A 1 57  ? -8.932  8.358   -40.406 1.00 83.87  ? 69  LYS A CB  1 
ATOM   419  C CG  . LYS A 1 57  ? -9.975  7.354   -40.882 1.00 101.54 ? 69  LYS A CG  1 
ATOM   420  C CD  . LYS A 1 57  ? -11.030 8.039   -41.743 1.00 112.18 ? 69  LYS A CD  1 
ATOM   421  C CE  . LYS A 1 57  ? -12.012 7.077   -42.357 1.00 121.93 ? 69  LYS A CE  1 
ATOM   422  N NZ  . LYS A 1 57  ? -12.989 7.785   -43.226 1.00 128.43 ? 69  LYS A NZ  1 
ATOM   423  N N   . ASP A 1 58  ? -6.566  9.971   -39.892 1.00 77.25  ? 70  ASP A N   1 
ATOM   424  C CA  . ASP A 1 58  ? -5.547  11.005  -40.026 1.00 75.52  ? 70  ASP A CA  1 
ATOM   425  C C   . ASP A 1 58  ? -5.554  11.929  -38.797 1.00 74.44  ? 70  ASP A C   1 
ATOM   426  O O   . ASP A 1 58  ? -4.829  12.927  -38.774 1.00 73.27  ? 70  ASP A O   1 
ATOM   427  C CB  . ASP A 1 58  ? -5.790  11.804  -41.325 1.00 78.70  ? 70  ASP A CB  1 
ATOM   428  C CG  . ASP A 1 58  ? -4.538  12.278  -42.040 1.00 95.92  ? 70  ASP A CG  1 
ATOM   429  O OD1 . ASP A 1 58  ? -4.602  13.336  -42.704 1.00 96.89  ? 70  ASP A OD1 1 
ATOM   430  O OD2 . ASP A 1 58  ? -3.489  11.602  -41.919 1.00 104.83 ? 70  ASP A OD2 1 
ATOM   431  N N   . THR A 1 59  ? -6.357  11.581  -37.770 1.00 68.06  ? 71  THR A N   1 
ATOM   432  C CA  . THR A 1 59  ? -6.517  12.366  -36.542 1.00 65.19  ? 71  THR A CA  1 
ATOM   433  C C   . THR A 1 59  ? -5.677  11.772  -35.398 1.00 63.45  ? 71  THR A C   1 
ATOM   434  O O   . THR A 1 59  ? -5.558  10.553  -35.275 1.00 62.51  ? 71  THR A O   1 
ATOM   435  C CB  . THR A 1 59  ? -8.010  12.447  -36.150 1.00 72.69  ? 71  THR A CB  1 
ATOM   436  O OG1 . THR A 1 59  ? -8.785  12.762  -37.305 1.00 72.30  ? 71  THR A OG1 1 
ATOM   437  C CG2 . THR A 1 59  ? -8.282  13.485  -35.045 1.00 70.91  ? 71  THR A CG2 1 
ATOM   438  N N   . VAL A 1 60  ? -5.112  12.653  -34.564 1.00 56.50  ? 72  VAL A N   1 
ATOM   439  C CA  . VAL A 1 60  ? -4.447  12.312  -33.305 1.00 54.70  ? 72  VAL A CA  1 
ATOM   440  C C   . VAL A 1 60  ? -5.480  11.700  -32.334 1.00 56.91  ? 72  VAL A C   1 
ATOM   441  O O   . VAL A 1 60  ? -6.574  12.246  -32.150 1.00 57.40  ? 72  VAL A O   1 
ATOM   442  C CB  . VAL A 1 60  ? -3.734  13.562  -32.710 1.00 57.23  ? 72  VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 60  ? -3.411  13.395  -31.228 1.00 56.56  ? 72  VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 60  ? -2.477  13.899  -33.501 1.00 56.80  ? 72  VAL A CG2 1 
ATOM   445  N N   . ALA A 1 61  ? -5.128  10.540  -31.760 1.00 50.91  ? 73  ALA A N   1 
ATOM   446  C CA  . ALA A 1 61  ? -5.894  9.868   -30.718 1.00 48.99  ? 73  ALA A CA  1 
ATOM   447  C C   . ALA A 1 61  ? -4.997  9.551   -29.529 1.00 48.95  ? 73  ALA A C   1 
ATOM   448  O O   . ALA A 1 61  ? -3.845  9.163   -29.709 1.00 47.53  ? 73  ALA A O   1 
ATOM   449  C CB  . ALA A 1 61  ? -6.512  8.597   -31.266 1.00 50.70  ? 73  ALA A CB  1 
ATOM   450  N N   . TRP A 1 62  ? -5.517  9.740   -28.316 1.00 43.85  ? 74  TRP A N   1 
ATOM   451  C CA  . TRP A 1 62  ? -4.821  9.392   -27.086 1.00 42.38  ? 74  TRP A CA  1 
ATOM   452  C C   . TRP A 1 62  ? -5.493  8.178   -26.458 1.00 46.93  ? 74  TRP A C   1 
ATOM   453  O O   . TRP A 1 62  ? -6.726  8.133   -26.370 1.00 49.49  ? 74  TRP A O   1 
ATOM   454  C CB  . TRP A 1 62  ? -4.788  10.591  -26.117 1.00 40.45  ? 74  TRP A CB  1 
ATOM   455  C CG  . TRP A 1 62  ? -4.032  11.773  -26.651 1.00 40.64  ? 74  TRP A CG  1 
ATOM   456  C CD1 . TRP A 1 62  ? -4.538  12.797  -27.397 1.00 43.49  ? 74  TRP A CD1 1 
ATOM   457  C CD2 . TRP A 1 62  ? -2.623  12.017  -26.538 1.00 39.87  ? 74  TRP A CD2 1 
ATOM   458  N NE1 . TRP A 1 62  ? -3.538  13.681  -27.731 1.00 42.44  ? 74  TRP A NE1 1 
ATOM   459  C CE2 . TRP A 1 62  ? -2.347  13.220  -27.227 1.00 43.59  ? 74  TRP A CE2 1 
ATOM   460  C CE3 . TRP A 1 62  ? -1.564  11.342  -25.914 1.00 41.16  ? 74  TRP A CE3 1 
ATOM   461  C CZ2 . TRP A 1 62  ? -1.058  13.774  -27.292 1.00 42.22  ? 74  TRP A CZ2 1 
ATOM   462  C CZ3 . TRP A 1 62  ? -0.285  11.891  -25.984 1.00 42.10  ? 74  TRP A CZ3 1 
ATOM   463  C CH2 . TRP A 1 62  ? -0.045  13.091  -26.664 1.00 42.29  ? 74  TRP A CH2 1 
ATOM   464  N N   . LEU A 1 63  ? -4.688  7.188   -26.037 1.00 41.34  ? 75  LEU A N   1 
ATOM   465  C CA  . LEU A 1 63  ? -5.152  5.956   -25.404 1.00 40.47  ? 75  LEU A CA  1 
ATOM   466  C C   . LEU A 1 63  ? -5.918  6.264   -24.119 1.00 43.58  ? 75  LEU A C   1 
ATOM   467  O O   . LEU A 1 63  ? -5.491  7.113   -23.335 1.00 41.78  ? 75  LEU A O   1 
ATOM   468  C CB  . LEU A 1 63  ? -3.954  5.030   -25.131 1.00 40.06  ? 75  LEU A CB  1 
ATOM   469  C CG  . LEU A 1 63  ? -4.238  3.651   -24.509 1.00 45.32  ? 75  LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 63  ? -4.871  2.688   -25.519 1.00 46.26  ? 75  LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 63  ? -2.964  3.043   -23.919 1.00 47.43  ? 75  LEU A CD2 1 
ATOM   472  N N   . LYS A 1 64  ? -7.076  5.614   -23.942 1.00 42.37  ? 76  LYS A N   1 
ATOM   473  C CA  . LYS A 1 64  ? -7.914  5.753   -22.751 1.00 43.42  ? 76  LYS A CA  1 
ATOM   474  C C   . LYS A 1 64  ? -7.351  4.906   -21.605 1.00 47.85  ? 76  LYS A C   1 
ATOM   475  O O   . LYS A 1 64  ? -6.980  3.739   -21.796 1.00 47.44  ? 76  LYS A O   1 
ATOM   476  C CB  . LYS A 1 64  ? -9.384  5.385   -23.044 1.00 47.91  ? 76  LYS A CB  1 
ATOM   477  C CG  . LYS A 1 64  ? -10.143 6.476   -23.803 1.00 79.34  ? 76  LYS A CG  1 
ATOM   478  C CD  . LYS A 1 64  ? -11.064 7.325   -22.911 1.00 97.38  ? 76  LYS A CD  1 
ATOM   479  C CE  . LYS A 1 64  ? -11.862 8.338   -23.709 1.00 111.29 ? 76  LYS A CE  1 
ATOM   480  N NZ  . LYS A 1 64  ? -12.592 9.286   -22.828 1.00 120.14 ? 76  LYS A NZ  1 
ATOM   481  N N   . MET A 1 65  ? -7.294  5.515   -20.414 1.00 44.22  ? 77  MET A N   1 
ATOM   482  C CA  . MET A 1 65  ? -6.663  4.947   -19.227 1.00 43.90  ? 77  MET A CA  1 
ATOM   483  C C   . MET A 1 65  ? -7.544  3.904   -18.542 1.00 51.59  ? 77  MET A C   1 
ATOM   484  O O   . MET A 1 65  ? -6.992  3.031   -17.878 1.00 51.91  ? 77  MET A O   1 
ATOM   485  C CB  . MET A 1 65  ? -6.275  6.066   -18.240 1.00 44.68  ? 77  MET A CB  1 
ATOM   486  C CG  . MET A 1 65  ? -5.266  7.040   -18.811 1.00 46.66  ? 77  MET A CG  1 
ATOM   487  S SD  . MET A 1 65  ? -3.590  6.370   -19.042 1.00 50.40  ? 77  MET A SD  1 
ATOM   488  C CE  . MET A 1 65  ? -3.527  6.142   -20.789 1.00 46.70  ? 77  MET A CE  1 
ATOM   489  N N   . ASP A 1 66  ? -8.892  3.987   -18.704 1.00 51.11  ? 78  ASP A N   1 
ATOM   490  C CA  . ASP A 1 66  ? -9.882  3.069   -18.114 1.00 53.47  ? 78  ASP A CA  1 
ATOM   491  C C   . ASP A 1 66  ? -10.196 1.871   -19.017 1.00 58.74  ? 78  ASP A C   1 
ATOM   492  O O   . ASP A 1 66  ? -10.681 0.856   -18.515 1.00 60.23  ? 78  ASP A O   1 
ATOM   493  C CB  . ASP A 1 66  ? -11.200 3.801   -17.787 1.00 56.93  ? 78  ASP A CB  1 
ATOM   494  C CG  . ASP A 1 66  ? -11.130 4.723   -16.588 1.00 80.72  ? 78  ASP A CG  1 
ATOM   495  O OD1 . ASP A 1 66  ? -10.220 5.595   -16.557 1.00 82.20  ? 78  ASP A OD1 1 
ATOM   496  O OD2 . ASP A 1 66  ? -12.022 4.624   -15.708 1.00 92.61  ? 78  ASP A OD2 1 
ATOM   497  N N   . LYS A 1 67  ? -9.982  1.993   -20.338 1.00 54.36  ? 79  LYS A N   1 
ATOM   498  C CA  . LYS A 1 67  ? -10.199 0.879   -21.261 1.00 54.38  ? 79  LYS A CA  1 
ATOM   499  C C   . LYS A 1 67  ? -9.011  -0.077  -21.240 1.00 57.18  ? 79  LYS A C   1 
ATOM   500  O O   . LYS A 1 67  ? -7.868  0.373   -21.140 1.00 55.61  ? 79  LYS A O   1 
ATOM   501  C CB  . LYS A 1 67  ? -10.429 1.396   -22.687 1.00 56.62  ? 79  LYS A CB  1 
ATOM   502  C CG  . LYS A 1 67  ? -11.814 1.986   -22.946 1.00 75.32  ? 79  LYS A CG  1 
ATOM   503  C CD  . LYS A 1 67  ? -12.398 1.558   -24.318 1.00 87.99  ? 79  LYS A CD  1 
ATOM   504  C CE  . LYS A 1 67  ? -11.963 2.403   -25.503 1.00 96.52  ? 79  LYS A CE  1 
ATOM   505  N NZ  . LYS A 1 67  ? -12.574 1.936   -26.776 1.00 106.38 ? 79  LYS A NZ  1 
ATOM   506  N N   . LYS A 1 68  ? -9.282  -1.394  -21.332 1.00 55.21  ? 80  LYS A N   1 
ATOM   507  C CA  . LYS A 1 68  ? -8.270  -2.440  -21.502 1.00 55.39  ? 80  LYS A CA  1 
ATOM   508  C C   . LYS A 1 68  ? -7.495  -2.220  -22.798 1.00 60.81  ? 80  LYS A C   1 
ATOM   509  O O   . LYS A 1 68  ? -8.099  -1.899  -23.824 1.00 60.84  ? 80  LYS A O   1 
ATOM   510  C CB  . LYS A 1 68  ? -8.904  -3.842  -21.511 1.00 58.46  ? 80  LYS A CB  1 
ATOM   511  C CG  . LYS A 1 68  ? -9.322  -4.368  -20.149 1.00 71.06  ? 80  LYS A CG  1 
ATOM   512  C CD  . LYS A 1 68  ? -9.856  -5.795  -20.255 1.00 83.90  ? 80  LYS A CD  1 
ATOM   513  C CE  . LYS A 1 68  ? -10.398 -6.311  -18.941 1.00 101.62 ? 80  LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 68  ? -10.998 -7.671  -19.069 1.00 114.82 ? 80  LYS A NZ  1 
ATOM   515  N N   . VAL A 1 69  ? -6.160  -2.349  -22.741 1.00 57.66  ? 81  VAL A N   1 
ATOM   516  C CA  . VAL A 1 69  ? -5.295  -2.295  -23.924 1.00 57.08  ? 81  VAL A CA  1 
ATOM   517  C C   . VAL A 1 69  ? -5.568  -3.578  -24.735 1.00 65.62  ? 81  VAL A C   1 
ATOM   518  O O   . VAL A 1 69  ? -5.158  -4.665  -24.313 1.00 67.75  ? 81  VAL A O   1 
ATOM   519  C CB  . VAL A 1 69  ? -3.793  -2.114  -23.545 1.00 58.39  ? 81  VAL A CB  1 
ATOM   520  C CG1 . VAL A 1 69  ? -2.922  -1.955  -24.787 1.00 57.73  ? 81  VAL A CG1 1 
ATOM   521  C CG2 . VAL A 1 69  ? -3.597  -0.937  -22.600 1.00 56.55  ? 81  VAL A CG2 1 
ATOM   522  N N   . LEU A 1 70  ? -6.334  -3.440  -25.846 1.00 62.84  ? 82  LEU A N   1 
ATOM   523  C CA  . LEU A 1 70  ? -6.791  -4.466  -26.817 1.00 88.31  ? 82  LEU A CA  1 
ATOM   524  C C   . LEU A 1 70  ? -8.046  -3.969  -27.538 1.00 126.60 ? 82  LEU A C   1 
ATOM   525  O O   . LEU A 1 70  ? -8.332  -4.394  -28.655 1.00 93.83  ? 82  LEU A O   1 
ATOM   526  C CB  . LEU A 1 70  ? -7.065  -5.867  -26.209 1.00 89.67  ? 82  LEU A CB  1 
ATOM   527  C CG  . LEU A 1 70  ? -5.921  -6.892  -26.289 1.00 94.81  ? 82  LEU A CG  1 
ATOM   528  C CD1 . LEU A 1 70  ? -6.131  -8.026  -25.309 1.00 95.75  ? 82  LEU A CD1 1 
ATOM   529  C CD2 . LEU A 1 70  ? -5.735  -7.435  -27.701 1.00 99.15  ? 82  LEU A CD2 1 
ATOM   530  N N   . PRO A 1 79  ? 1.911   -5.737  -34.413 1.00 78.33  ? 91  PRO A N   1 
ATOM   531  C CA  . PRO A 1 79  ? 2.630   -5.155  -33.263 1.00 76.16  ? 91  PRO A CA  1 
ATOM   532  C C   . PRO A 1 79  ? 1.969   -3.850  -32.806 1.00 75.59  ? 91  PRO A C   1 
ATOM   533  O O   . PRO A 1 79  ? 1.999   -2.844  -33.539 1.00 74.83  ? 91  PRO A O   1 
ATOM   534  C CB  . PRO A 1 79  ? 4.059   -4.933  -33.798 1.00 77.86  ? 91  PRO A CB  1 
ATOM   535  C CG  . PRO A 1 79  ? 4.040   -5.410  -35.258 1.00 84.04  ? 91  PRO A CG  1 
ATOM   536  C CD  . PRO A 1 79  ? 2.609   -5.472  -35.683 1.00 80.26  ? 91  PRO A CD  1 
ATOM   537  N N   . VAL A 1 80  ? 1.354   -3.876  -31.597 1.00 67.85  ? 92  VAL A N   1 
ATOM   538  C CA  . VAL A 1 80  ? 0.610   -2.740  -31.024 1.00 64.06  ? 92  VAL A CA  1 
ATOM   539  C C   . VAL A 1 80  ? 1.597   -1.608  -30.718 1.00 60.53  ? 92  VAL A C   1 
ATOM   540  O O   . VAL A 1 80  ? 2.547   -1.837  -29.965 1.00 59.80  ? 92  VAL A O   1 
ATOM   541  C CB  . VAL A 1 80  ? -0.210  -3.139  -29.762 1.00 67.80  ? 92  VAL A CB  1 
ATOM   542  C CG1 . VAL A 1 80  ? -1.140  -2.003  -29.352 1.00 66.51  ? 92  VAL A CG1 1 
ATOM   543  C CG2 . VAL A 1 80  ? -0.993  -4.435  -29.967 1.00 69.34  ? 92  VAL A CG2 1 
ATOM   544  N N   . THR A 1 81  ? 1.380   -0.405  -31.305 1.00 51.33  ? 93  THR A N   1 
ATOM   545  C CA  . THR A 1 81  ? 2.327   0.706   -31.185 1.00 47.92  ? 93  THR A CA  1 
ATOM   546  C C   . THR A 1 81  ? 1.656   1.988   -30.674 1.00 49.35  ? 93  THR A C   1 
ATOM   547  O O   . THR A 1 81  ? 0.649   2.424   -31.225 1.00 49.30  ? 93  THR A O   1 
ATOM   548  C CB  . THR A 1 81  ? 3.053   0.955   -32.517 1.00 46.65  ? 93  THR A CB  1 
ATOM   549  O OG1 . THR A 1 81  ? 3.684   -0.264  -32.927 1.00 48.57  ? 93  THR A OG1 1 
ATOM   550  C CG2 . THR A 1 81  ? 4.114   2.076   -32.421 1.00 39.30  ? 93  THR A CG2 1 
ATOM   551  N N   . PHE A 1 82  ? 2.236   2.589   -29.612 1.00 43.64  ? 94  PHE A N   1 
ATOM   552  C CA  . PHE A 1 82  ? 1.869   3.921   -29.110 1.00 41.18  ? 94  PHE A CA  1 
ATOM   553  C C   . PHE A 1 82  ? 3.082   4.835   -29.071 1.00 43.31  ? 94  PHE A C   1 
ATOM   554  O O   . PHE A 1 82  ? 4.206   4.361   -28.928 1.00 43.46  ? 94  PHE A O   1 
ATOM   555  C CB  . PHE A 1 82  ? 1.231   3.840   -27.716 1.00 41.71  ? 94  PHE A CB  1 
ATOM   556  C CG  . PHE A 1 82  ? 0.017   2.955   -27.663 1.00 43.22  ? 94  PHE A CG  1 
ATOM   557  C CD1 . PHE A 1 82  ? -1.215  3.410   -28.132 1.00 45.60  ? 94  PHE A CD1 1 
ATOM   558  C CD2 . PHE A 1 82  ? 0.105   1.656   -27.161 1.00 45.41  ? 94  PHE A CD2 1 
ATOM   559  C CE1 . PHE A 1 82  ? -2.334  2.571   -28.121 1.00 47.42  ? 94  PHE A CE1 1 
ATOM   560  C CE2 . PHE A 1 82  ? -1.022  0.828   -27.110 1.00 48.78  ? 94  PHE A CE2 1 
ATOM   561  C CZ  . PHE A 1 82  ? -2.232  1.286   -27.603 1.00 47.21  ? 94  PHE A CZ  1 
ATOM   562  N N   . HIS A 1 83  ? 2.854   6.142   -29.214 1.00 37.93  ? 95  HIS A N   1 
ATOM   563  C CA  . HIS A 1 83  ? 3.893   7.153   -29.085 1.00 36.50  ? 95  HIS A CA  1 
ATOM   564  C C   . HIS A 1 83  ? 3.769   7.858   -27.747 1.00 38.62  ? 95  HIS A C   1 
ATOM   565  O O   . HIS A 1 83  ? 2.740   8.474   -27.458 1.00 38.07  ? 95  HIS A O   1 
ATOM   566  C CB  . HIS A 1 83  ? 3.833   8.157   -30.244 1.00 37.37  ? 95  HIS A CB  1 
ATOM   567  C CG  . HIS A 1 83  ? 4.365   7.597   -31.526 1.00 41.77  ? 95  HIS A CG  1 
ATOM   568  N ND1 . HIS A 1 83  ? 3.695   6.589   -32.215 1.00 44.48  ? 95  HIS A ND1 1 
ATOM   569  C CD2 . HIS A 1 83  ? 5.490   7.915   -32.201 1.00 43.49  ? 95  HIS A CD2 1 
ATOM   570  C CE1 . HIS A 1 83  ? 4.436   6.332   -33.278 1.00 44.49  ? 95  HIS A CE1 1 
ATOM   571  N NE2 . HIS A 1 83  ? 5.524   7.103   -33.313 1.00 44.40  ? 95  HIS A NE2 1 
ATOM   572  N N   . PHE A 1 84  ? 4.807   7.733   -26.913 1.00 33.52  ? 96  PHE A N   1 
ATOM   573  C CA  . PHE A 1 84  ? 4.849   8.408   -25.628 1.00 31.95  ? 96  PHE A CA  1 
ATOM   574  C C   . PHE A 1 84  ? 5.231   9.864   -25.876 1.00 35.48  ? 96  PHE A C   1 
ATOM   575  O O   . PHE A 1 84  ? 6.359   10.155  -26.266 1.00 35.78  ? 96  PHE A O   1 
ATOM   576  C CB  . PHE A 1 84  ? 5.814   7.697   -24.658 1.00 33.03  ? 96  PHE A CB  1 
ATOM   577  C CG  . PHE A 1 84  ? 5.792   8.253   -23.253 1.00 33.20  ? 96  PHE A CG  1 
ATOM   578  C CD1 . PHE A 1 84  ? 4.824   7.849   -22.344 1.00 35.37  ? 96  PHE A CD1 1 
ATOM   579  C CD2 . PHE A 1 84  ? 6.744   9.175   -22.838 1.00 33.84  ? 96  PHE A CD2 1 
ATOM   580  C CE1 . PHE A 1 84  ? 4.804   8.361   -21.052 1.00 35.85  ? 96  PHE A CE1 1 
ATOM   581  C CE2 . PHE A 1 84  ? 6.733   9.674   -21.537 1.00 36.10  ? 96  PHE A CE2 1 
ATOM   582  C CZ  . PHE A 1 84  ? 5.762   9.266   -20.656 1.00 34.84  ? 96  PHE A CZ  1 
ATOM   583  N N   . LEU A 1 85  ? 4.267   10.767  -25.694 1.00 31.22  ? 97  LEU A N   1 
ATOM   584  C CA  . LEU A 1 85  ? 4.423   12.190  -25.985 1.00 30.89  ? 97  LEU A CA  1 
ATOM   585  C C   . LEU A 1 85  ? 3.756   13.055  -24.935 1.00 34.29  ? 97  LEU A C   1 
ATOM   586  O O   . LEU A 1 85  ? 2.841   12.605  -24.248 1.00 34.37  ? 97  LEU A O   1 
ATOM   587  C CB  . LEU A 1 85  ? 3.804   12.525  -27.363 1.00 31.44  ? 97  LEU A CB  1 
ATOM   588  C CG  . LEU A 1 85  ? 4.489   11.984  -28.625 1.00 36.03  ? 97  LEU A CG  1 
ATOM   589  C CD1 . LEU A 1 85  ? 3.559   12.086  -29.816 1.00 35.43  ? 97  LEU A CD1 1 
ATOM   590  C CD2 . LEU A 1 85  ? 5.878   12.662  -28.868 1.00 37.65  ? 97  LEU A CD2 1 
ATOM   591  N N   . ALA A 1 86  ? 4.209   14.306  -24.824 1.00 30.31  ? 98  ALA A N   1 
ATOM   592  C CA  . ALA A 1 86  ? 3.532   15.338  -24.047 1.00 29.25  ? 98  ALA A CA  1 
ATOM   593  C C   . ALA A 1 86  ? 2.235   15.748  -24.741 1.00 31.20  ? 98  ALA A C   1 
ATOM   594  O O   . ALA A 1 86  ? 2.253   16.103  -25.924 1.00 29.52  ? 98  ALA A O   1 
ATOM   595  C CB  . ALA A 1 86  ? 4.439   16.538  -23.857 1.00 29.50  ? 98  ALA A CB  1 
ATOM   596  N N   . LYS A 1 87  ? 1.109   15.634  -24.004 1.00 26.57  ? 99  LYS A N   1 
ATOM   597  C CA  . LYS A 1 87  ? -0.218  16.096  -24.391 1.00 26.79  ? 99  LYS A CA  1 
ATOM   598  C C   . LYS A 1 87  ? -0.398  17.555  -23.925 1.00 33.25  ? 99  LYS A C   1 
ATOM   599  O O   . LYS A 1 87  ? -1.074  18.352  -24.582 1.00 32.29  ? 99  LYS A O   1 
ATOM   600  C CB  . LYS A 1 87  ? -1.288  15.177  -23.764 1.00 28.92  ? 99  LYS A CB  1 
ATOM   601  C CG  . LYS A 1 87  ? -2.684  15.378  -24.335 1.00 33.89  ? 99  LYS A CG  1 
ATOM   602  C CD  . LYS A 1 87  ? -3.649  14.408  -23.739 1.00 39.94  ? 99  LYS A CD  1 
ATOM   603  C CE  . LYS A 1 87  ? -5.035  14.563  -24.287 1.00 39.98  ? 99  LYS A CE  1 
ATOM   604  N NZ  . LYS A 1 87  ? -5.989  13.652  -23.607 1.00 44.81  ? 99  LYS A NZ  1 
ATOM   605  N N   . PHE A 1 88  ? 0.223   17.889  -22.781 1.00 30.43  ? 100 PHE A N   1 
ATOM   606  C CA  . PHE A 1 88  ? 0.148   19.200  -22.147 1.00 29.83  ? 100 PHE A CA  1 
ATOM   607  C C   . PHE A 1 88  ? 1.543   19.758  -21.900 1.00 32.98  ? 100 PHE A C   1 
ATOM   608  O O   . PHE A 1 88  ? 2.501   18.992  -21.699 1.00 32.83  ? 100 PHE A O   1 
ATOM   609  C CB  . PHE A 1 88  ? -0.634  19.117  -20.823 1.00 31.62  ? 100 PHE A CB  1 
ATOM   610  C CG  . PHE A 1 88  ? -1.992  18.486  -20.961 1.00 33.45  ? 100 PHE A CG  1 
ATOM   611  C CD1 . PHE A 1 88  ? -3.056  19.200  -21.505 1.00 35.68  ? 100 PHE A CD1 1 
ATOM   612  C CD2 . PHE A 1 88  ? -2.208  17.164  -20.569 1.00 35.17  ? 100 PHE A CD2 1 
ATOM   613  C CE1 . PHE A 1 88  ? -4.304  18.605  -21.654 1.00 36.30  ? 100 PHE A CE1 1 
ATOM   614  C CE2 . PHE A 1 88  ? -3.466  16.576  -20.707 1.00 37.19  ? 100 PHE A CE2 1 
ATOM   615  C CZ  . PHE A 1 88  ? -4.502  17.298  -21.246 1.00 35.36  ? 100 PHE A CZ  1 
ATOM   616  N N   . TYR A 1 89  ? 1.643   21.098  -21.893 1.00 27.95  ? 101 TYR A N   1 
ATOM   617  C CA  . TYR A 1 89  ? 2.906   21.824  -21.772 1.00 27.28  ? 101 TYR A CA  1 
ATOM   618  C C   . TYR A 1 89  ? 2.944   22.627  -20.464 1.00 31.87  ? 101 TYR A C   1 
ATOM   619  O O   . TYR A 1 89  ? 1.897   23.088  -19.991 1.00 29.63  ? 101 TYR A O   1 
ATOM   620  C CB  . TYR A 1 89  ? 3.110   22.747  -22.988 1.00 27.60  ? 101 TYR A CB  1 
ATOM   621  C CG  . TYR A 1 89  ? 3.434   21.983  -24.256 1.00 30.54  ? 101 TYR A CG  1 
ATOM   622  C CD1 . TYR A 1 89  ? 2.428   21.371  -25.005 1.00 32.52  ? 101 TYR A CD1 1 
ATOM   623  C CD2 . TYR A 1 89  ? 4.749   21.843  -24.693 1.00 32.01  ? 101 TYR A CD2 1 
ATOM   624  C CE1 . TYR A 1 89  ? 2.727   20.636  -26.154 1.00 32.99  ? 101 TYR A CE1 1 
ATOM   625  C CE2 . TYR A 1 89  ? 5.057   21.117  -25.847 1.00 33.04  ? 101 TYR A CE2 1 
ATOM   626  C CZ  . TYR A 1 89  ? 4.043   20.514  -26.571 1.00 39.07  ? 101 TYR A CZ  1 
ATOM   627  O OH  . TYR A 1 89  ? 4.341   19.816  -27.717 1.00 41.51  ? 101 TYR A OH  1 
ATOM   628  N N   . PRO A 1 90  ? 4.134   22.789  -19.833 1.00 29.61  ? 102 PRO A N   1 
ATOM   629  C CA  . PRO A 1 90  ? 4.204   23.671  -18.660 1.00 29.72  ? 102 PRO A CA  1 
ATOM   630  C C   . PRO A 1 90  ? 4.037   25.142  -19.046 1.00 37.08  ? 102 PRO A C   1 
ATOM   631  O O   . PRO A 1 90  ? 4.343   25.510  -20.183 1.00 37.67  ? 102 PRO A O   1 
ATOM   632  C CB  . PRO A 1 90  ? 5.594   23.385  -18.096 1.00 30.38  ? 102 PRO A CB  1 
ATOM   633  C CG  . PRO A 1 90  ? 6.377   22.892  -19.226 1.00 33.70  ? 102 PRO A CG  1 
ATOM   634  C CD  . PRO A 1 90  ? 5.447   22.172  -20.124 1.00 29.48  ? 102 PRO A CD  1 
ATOM   635  N N   . GLU A 1 91  ? 3.515   25.970  -18.122 1.00 35.27  ? 103 GLU A N   1 
ATOM   636  C CA  . GLU A 1 91  ? 3.510   27.426  -18.290 1.00 36.64  ? 103 GLU A CA  1 
ATOM   637  C C   . GLU A 1 91  ? 4.917   27.966  -18.063 1.00 41.70  ? 103 GLU A C   1 
ATOM   638  O O   . GLU A 1 91  ? 5.337   28.914  -18.738 1.00 43.13  ? 103 GLU A O   1 
ATOM   639  C CB  . GLU A 1 91  ? 2.538   28.073  -17.301 1.00 39.00  ? 103 GLU A CB  1 
ATOM   640  C CG  . GLU A 1 91  ? 1.413   28.853  -17.945 1.00 54.98  ? 103 GLU A CG  1 
ATOM   641  C CD  . GLU A 1 91  ? 0.216   29.046  -17.024 1.00 88.51  ? 103 GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 91  ? 0.102   30.147  -16.437 1.00 93.14  ? 103 GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 91  ? -0.596  28.101  -16.874 1.00 75.03  ? 103 GLU A OE2 1 
ATOM   644  N N   . ASN A 1 92  ? 5.644   27.350  -17.101 1.00 35.24  ? 104 ASN A N   1 
ATOM   645  C CA  . ASN A 1 92  ? 6.992   27.718  -16.709 1.00 34.08  ? 104 ASN A CA  1 
ATOM   646  C C   . ASN A 1 92  ? 7.845   26.448  -16.620 1.00 37.80  ? 104 ASN A C   1 
ATOM   647  O O   . ASN A 1 92  ? 7.764   25.723  -15.630 1.00 36.27  ? 104 ASN A O   1 
ATOM   648  C CB  . ASN A 1 92  ? 6.953   28.472  -15.372 1.00 30.22  ? 104 ASN A CB  1 
ATOM   649  C CG  . ASN A 1 92  ? 8.266   29.065  -14.917 1.00 45.76  ? 104 ASN A CG  1 
ATOM   650  O OD1 . ASN A 1 92  ? 9.349   28.494  -15.071 1.00 45.83  ? 104 ASN A OD1 1 
ATOM   651  N ND2 . ASN A 1 92  ? 8.186   30.196  -14.268 1.00 35.68  ? 104 ASN A ND2 1 
ATOM   652  N N   . ALA A 1 93  ? 8.681   26.198  -17.648 1.00 34.46  ? 105 ALA A N   1 
ATOM   653  C CA  . ALA A 1 93  ? 9.507   24.990  -17.753 1.00 32.97  ? 105 ALA A CA  1 
ATOM   654  C C   . ALA A 1 93  ? 10.440  24.813  -16.538 1.00 37.46  ? 105 ALA A C   1 
ATOM   655  O O   . ALA A 1 93  ? 10.483  23.718  -15.986 1.00 37.10  ? 105 ALA A O   1 
ATOM   656  C CB  . ALA A 1 93  ? 10.312  25.013  -19.035 1.00 32.98  ? 105 ALA A CB  1 
ATOM   657  N N   . GLU A 1 94  ? 11.129  25.887  -16.088 1.00 34.10  ? 106 GLU A N   1 
ATOM   658  C CA  . GLU A 1 94  ? 12.114  25.805  -15.010 1.00 34.17  ? 106 GLU A CA  1 
ATOM   659  C C   . GLU A 1 94  ? 11.453  25.444  -13.674 1.00 40.41  ? 106 GLU A C   1 
ATOM   660  O O   . GLU A 1 94  ? 12.008  24.643  -12.931 1.00 41.81  ? 106 GLU A O   1 
ATOM   661  C CB  . GLU A 1 94  ? 12.929  27.107  -14.887 1.00 35.51  ? 106 GLU A CB  1 
ATOM   662  C CG  . GLU A 1 94  ? 14.160  26.985  -13.996 1.00 43.45  ? 106 GLU A CG  1 
ATOM   663  C CD  . GLU A 1 94  ? 15.263  27.998  -14.250 1.00 80.80  ? 106 GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 94  ? 15.006  29.216  -14.114 1.00 83.05  ? 106 GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 94  ? 16.399  27.568  -14.555 1.00 84.97  ? 106 GLU A OE2 1 
ATOM   666  N N   . GLU A 1 95  ? 10.285  26.024  -13.375 1.00 37.05  ? 107 GLU A N   1 
ATOM   667  C CA  . GLU A 1 95  ? 9.547   25.747  -12.136 1.00 36.50  ? 107 GLU A CA  1 
ATOM   668  C C   . GLU A 1 95  ? 8.923   24.360  -12.144 1.00 37.02  ? 107 GLU A C   1 
ATOM   669  O O   . GLU A 1 95  ? 8.933   23.689  -11.119 1.00 36.25  ? 107 GLU A O   1 
ATOM   670  C CB  . GLU A 1 95  ? 8.446   26.788  -11.907 1.00 38.40  ? 107 GLU A CB  1 
ATOM   671  C CG  . GLU A 1 95  ? 8.958   28.159  -11.500 1.00 54.37  ? 107 GLU A CG  1 
ATOM   672  C CD  . GLU A 1 95  ? 7.892   29.151  -11.076 1.00 85.79  ? 107 GLU A CD  1 
ATOM   673  O OE1 . GLU A 1 95  ? 6.767   29.094  -11.624 1.00 77.94  ? 107 GLU A OE1 1 
ATOM   674  O OE2 . GLU A 1 95  ? 8.190   30.002  -10.206 1.00 91.72  ? 107 GLU A OE2 1 
ATOM   675  N N   . GLU A 1 96  ? 8.408   23.922  -13.306 1.00 31.94  ? 108 GLU A N   1 
ATOM   676  C CA  . GLU A 1 96  ? 7.545   22.747  -13.411 1.00 30.01  ? 108 GLU A CA  1 
ATOM   677  C C   . GLU A 1 96  ? 8.302   21.485  -13.764 1.00 33.85  ? 108 GLU A C   1 
ATOM   678  O O   . GLU A 1 96  ? 7.889   20.425  -13.317 1.00 34.83  ? 108 GLU A O   1 
ATOM   679  C CB  . GLU A 1 96  ? 6.418   22.977  -14.423 1.00 30.21  ? 108 GLU A CB  1 
ATOM   680  C CG  . GLU A 1 96  ? 5.433   24.046  -13.991 1.00 28.64  ? 108 GLU A CG  1 
ATOM   681  C CD  . GLU A 1 96  ? 4.301   24.274  -14.963 1.00 42.66  ? 108 GLU A CD  1 
ATOM   682  O OE1 . GLU A 1 96  ? 3.606   23.293  -15.304 1.00 43.45  ? 108 GLU A OE1 1 
ATOM   683  O OE2 . GLU A 1 96  ? 4.098   25.437  -15.378 1.00 45.88  ? 108 GLU A OE2 1 
ATOM   684  N N   . LEU A 1 97  ? 9.376   21.571  -14.568 1.00 29.69  ? 109 LEU A N   1 
ATOM   685  C CA  . LEU A 1 97  ? 10.144  20.386  -14.982 1.00 28.90  ? 109 LEU A CA  1 
ATOM   686  C C   . LEU A 1 97  ? 11.337  20.202  -14.021 1.00 35.64  ? 109 LEU A C   1 
ATOM   687  O O   . LEU A 1 97  ? 12.466  20.627  -14.285 1.00 36.49  ? 109 LEU A O   1 
ATOM   688  C CB  . LEU A 1 97  ? 10.574  20.456  -16.471 1.00 27.92  ? 109 LEU A CB  1 
ATOM   689  C CG  . LEU A 1 97  ? 9.476   20.836  -17.526 1.00 30.50  ? 109 LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 97  ? 10.031  20.828  -18.934 1.00 30.01  ? 109 LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 97  ? 8.253   19.917  -17.465 1.00 28.16  ? 109 LEU A CD2 1 
ATOM   692  N N   . VAL A 1 98  ? 11.044  19.599  -12.867 1.00 32.32  ? 110 VAL A N   1 
ATOM   693  C CA  . VAL A 1 98  ? 11.982  19.431  -11.754 1.00 31.48  ? 110 VAL A CA  1 
ATOM   694  C C   . VAL A 1 98  ? 12.898  18.219  -12.021 1.00 34.68  ? 110 VAL A C   1 
ATOM   695  O O   . VAL A 1 98  ? 14.099  18.306  -11.751 1.00 36.15  ? 110 VAL A O   1 
ATOM   696  C CB  . VAL A 1 98  ? 11.214  19.317  -10.410 1.00 34.28  ? 110 VAL A CB  1 
ATOM   697  C CG1 . VAL A 1 98  ? 12.144  19.024  -9.241  1.00 33.86  ? 110 VAL A CG1 1 
ATOM   698  C CG2 . VAL A 1 98  ? 10.425  20.584  -10.139 1.00 34.15  ? 110 VAL A CG2 1 
ATOM   699  N N   . GLN A 1 99  ? 12.339  17.099  -12.528 1.00 27.32  ? 111 GLN A N   1 
ATOM   700  C CA  . GLN A 1 99  ? 13.097  15.920  -12.936 1.00 25.26  ? 111 GLN A CA  1 
ATOM   701  C C   . GLN A 1 99  ? 13.754  16.113  -14.281 1.00 30.98  ? 111 GLN A C   1 
ATOM   702  O O   . GLN A 1 99  ? 13.137  16.666  -15.189 1.00 32.67  ? 111 GLN A O   1 
ATOM   703  C CB  . GLN A 1 99  ? 12.184  14.707  -13.032 1.00 26.17  ? 111 GLN A CB  1 
ATOM   704  C CG  . GLN A 1 99  ? 11.402  14.364  -11.790 1.00 27.76  ? 111 GLN A CG  1 
ATOM   705  C CD  . GLN A 1 99  ? 10.747  13.042  -12.030 1.00 38.66  ? 111 GLN A CD  1 
ATOM   706  O OE1 . GLN A 1 99  ? 9.598   12.979  -12.486 1.00 30.74  ? 111 GLN A OE1 1 
ATOM   707  N NE2 . GLN A 1 99  ? 11.506  11.960  -11.808 1.00 20.25  ? 111 GLN A NE2 1 
ATOM   708  N N   . GLU A 1 100 ? 14.978  15.619  -14.439 1.00 29.07  ? 112 GLU A N   1 
ATOM   709  C CA  . GLU A 1 100 ? 15.723  15.699  -15.689 1.00 29.76  ? 112 GLU A CA  1 
ATOM   710  C C   . GLU A 1 100 ? 15.024  14.936  -16.838 1.00 33.61  ? 112 GLU A C   1 
ATOM   711  O O   . GLU A 1 100 ? 15.060  15.426  -17.975 1.00 33.42  ? 112 GLU A O   1 
ATOM   712  C CB  . GLU A 1 100 ? 17.141  15.170  -15.490 1.00 32.07  ? 112 GLU A CB  1 
ATOM   713  C CG  . GLU A 1 100 ? 18.075  15.574  -16.614 1.00 46.24  ? 112 GLU A CG  1 
ATOM   714  C CD  . GLU A 1 100 ? 19.514  15.130  -16.502 1.00 67.38  ? 112 GLU A CD  1 
ATOM   715  O OE1 . GLU A 1 100 ? 19.780  14.068  -15.895 1.00 55.90  ? 112 GLU A OE1 1 
ATOM   716  O OE2 . GLU A 1 100 ? 20.373  15.810  -17.106 1.00 66.68  ? 112 GLU A OE2 1 
ATOM   717  N N   . ILE A 1 101 ? 14.398  13.754  -16.562 1.00 28.79  ? 113 ILE A N   1 
ATOM   718  C CA  . ILE A 1 101 ? 13.737  12.990  -17.635 1.00 27.50  ? 113 ILE A CA  1 
ATOM   719  C C   . ILE A 1 101 ? 12.638  13.854  -18.309 1.00 32.67  ? 113 ILE A C   1 
ATOM   720  O O   . ILE A 1 101 ? 12.567  13.878  -19.537 1.00 32.53  ? 113 ILE A O   1 
ATOM   721  C CB  . ILE A 1 101 ? 13.216  11.569  -17.220 1.00 29.08  ? 113 ILE A CB  1 
ATOM   722  C CG1 . ILE A 1 101 ? 12.776  10.707  -18.443 1.00 28.48  ? 113 ILE A CG1 1 
ATOM   723  C CG2 . ILE A 1 101 ? 12.139  11.582  -16.116 1.00 26.57  ? 113 ILE A CG2 1 
ATOM   724  C CD1 . ILE A 1 101 ? 13.771  10.538  -19.535 1.00 24.64  ? 113 ILE A CD1 1 
ATOM   725  N N   . THR A 1 102 ? 11.844  14.597  -17.511 1.00 29.45  ? 114 THR A N   1 
ATOM   726  C CA  . THR A 1 102 ? 10.725  15.409  -18.004 1.00 29.09  ? 114 THR A CA  1 
ATOM   727  C C   . THR A 1 102 ? 11.311  16.558  -18.846 1.00 32.82  ? 114 THR A C   1 
ATOM   728  O O   . THR A 1 102 ? 10.856  16.802  -19.956 1.00 32.97  ? 114 THR A O   1 
ATOM   729  C CB  . THR A 1 102 ? 9.816   15.870  -16.834 1.00 34.75  ? 114 THR A CB  1 
ATOM   730  O OG1 . THR A 1 102 ? 10.406  16.978  -16.187 1.00 48.30  ? 114 THR A OG1 1 
ATOM   731  C CG2 . THR A 1 102 ? 9.700   14.853  -15.779 1.00 29.72  ? 114 THR A CG2 1 
ATOM   732  N N   . GLN A 1 103 ? 12.339  17.231  -18.320 1.00 29.15  ? 115 GLN A N   1 
ATOM   733  C CA  . GLN A 1 103 ? 13.115  18.241  -19.033 1.00 29.22  ? 115 GLN A CA  1 
ATOM   734  C C   . GLN A 1 103 ? 13.662  17.681  -20.374 1.00 33.16  ? 115 GLN A C   1 
ATOM   735  O O   . GLN A 1 103 ? 13.564  18.350  -21.399 1.00 33.48  ? 115 GLN A O   1 
ATOM   736  C CB  . GLN A 1 103 ? 14.259  18.732  -18.129 1.00 30.42  ? 115 GLN A CB  1 
ATOM   737  C CG  . GLN A 1 103 ? 15.202  19.708  -18.797 1.00 41.03  ? 115 GLN A CG  1 
ATOM   738  C CD  . GLN A 1 103 ? 16.497  19.778  -18.052 1.00 54.58  ? 115 GLN A CD  1 
ATOM   739  O OE1 . GLN A 1 103 ? 17.491  19.136  -18.433 1.00 45.76  ? 115 GLN A OE1 1 
ATOM   740  N NE2 . GLN A 1 103 ? 16.483  20.500  -16.937 1.00 42.44  ? 115 GLN A NE2 1 
ATOM   741  N N   . HIS A 1 104 ? 14.198  16.449  -20.358 1.00 29.25  ? 116 HIS A N   1 
ATOM   742  C CA  . HIS A 1 104 ? 14.776  15.786  -21.526 1.00 28.61  ? 116 HIS A CA  1 
ATOM   743  C C   . HIS A 1 104 ? 13.706  15.495  -22.583 1.00 34.76  ? 116 HIS A C   1 
ATOM   744  O O   . HIS A 1 104 ? 13.897  15.829  -23.754 1.00 36.08  ? 116 HIS A O   1 
ATOM   745  C CB  . HIS A 1 104 ? 15.494  14.494  -21.100 1.00 28.69  ? 116 HIS A CB  1 
ATOM   746  C CG  . HIS A 1 104 ? 16.141  13.757  -22.227 1.00 32.09  ? 116 HIS A CG  1 
ATOM   747  N ND1 . HIS A 1 104 ? 17.076  14.371  -23.056 1.00 33.93  ? 116 HIS A ND1 1 
ATOM   748  C CD2 . HIS A 1 104 ? 15.984  12.473  -22.624 1.00 33.08  ? 116 HIS A CD2 1 
ATOM   749  C CE1 . HIS A 1 104 ? 17.442  13.448  -23.929 1.00 33.08  ? 116 HIS A CE1 1 
ATOM   750  N NE2 . HIS A 1 104 ? 16.816  12.290  -23.706 1.00 33.27  ? 116 HIS A NE2 1 
ATOM   751  N N   . LEU A 1 105 ? 12.576  14.897  -22.166 1.00 31.08  ? 117 LEU A N   1 
ATOM   752  C CA  . LEU A 1 105 ? 11.488  14.509  -23.063 1.00 29.74  ? 117 LEU A CA  1 
ATOM   753  C C   . LEU A 1 105 ? 10.830  15.726  -23.701 1.00 33.33  ? 117 LEU A C   1 
ATOM   754  O O   . LEU A 1 105 ? 10.533  15.689  -24.890 1.00 34.18  ? 117 LEU A O   1 
ATOM   755  C CB  . LEU A 1 105 ? 10.443  13.667  -22.329 1.00 29.26  ? 117 LEU A CB  1 
ATOM   756  C CG  . LEU A 1 105 ? 10.863  12.244  -21.922 1.00 31.81  ? 117 LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 105 ? 9.861   11.660  -20.949 1.00 31.61  ? 117 LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 105 ? 11.046  11.348  -23.124 1.00 29.06  ? 117 LEU A CD2 1 
ATOM   759  N N   . PHE A 1 106 ? 10.615  16.797  -22.935 1.00 29.61  ? 118 PHE A N   1 
ATOM   760  C CA  . PHE A 1 106 ? 10.102  18.058  -23.474 1.00 29.57  ? 118 PHE A CA  1 
ATOM   761  C C   . PHE A 1 106 ? 11.097  18.687  -24.438 1.00 34.51  ? 118 PHE A C   1 
ATOM   762  O O   . PHE A 1 106 ? 10.692  19.117  -25.517 1.00 36.23  ? 118 PHE A O   1 
ATOM   763  C CB  . PHE A 1 106 ? 9.739   19.061  -22.359 1.00 30.48  ? 118 PHE A CB  1 
ATOM   764  C CG  . PHE A 1 106 ? 8.305   18.934  -21.920 1.00 30.67  ? 118 PHE A CG  1 
ATOM   765  C CD1 . PHE A 1 106 ? 7.275   19.458  -22.692 1.00 33.31  ? 118 PHE A CD1 1 
ATOM   766  C CD2 . PHE A 1 106 ? 7.978   18.262  -20.757 1.00 31.64  ? 118 PHE A CD2 1 
ATOM   767  C CE1 . PHE A 1 106 ? 5.943   19.327  -22.293 1.00 33.81  ? 118 PHE A CE1 1 
ATOM   768  C CE2 . PHE A 1 106 ? 6.647   18.140  -20.354 1.00 33.81  ? 118 PHE A CE2 1 
ATOM   769  C CZ  . PHE A 1 106 ? 5.640   18.666  -21.128 1.00 31.93  ? 118 PHE A CZ  1 
ATOM   770  N N   . PHE A 1 107 ? 12.387  18.712  -24.071 1.00 28.88  ? 119 PHE A N   1 
ATOM   771  C CA  . PHE A 1 107 ? 13.435  19.268  -24.920 1.00 28.58  ? 119 PHE A CA  1 
ATOM   772  C C   . PHE A 1 107 ? 13.398  18.639  -26.323 1.00 34.35  ? 119 PHE A C   1 
ATOM   773  O O   . PHE A 1 107 ? 13.413  19.375  -27.309 1.00 35.00  ? 119 PHE A O   1 
ATOM   774  C CB  . PHE A 1 107 ? 14.828  19.084  -24.277 1.00 29.47  ? 119 PHE A CB  1 
ATOM   775  C CG  . PHE A 1 107 ? 15.986  19.322  -25.213 1.00 29.63  ? 119 PHE A CG  1 
ATOM   776  C CD1 . PHE A 1 107 ? 16.305  20.607  -25.636 1.00 31.38  ? 119 PHE A CD1 1 
ATOM   777  C CD2 . PHE A 1 107 ? 16.749  18.263  -25.682 1.00 29.99  ? 119 PHE A CD2 1 
ATOM   778  C CE1 . PHE A 1 107 ? 17.380  20.823  -26.496 1.00 31.84  ? 119 PHE A CE1 1 
ATOM   779  C CE2 . PHE A 1 107 ? 17.817  18.483  -26.554 1.00 32.22  ? 119 PHE A CE2 1 
ATOM   780  C CZ  . PHE A 1 107 ? 18.124  19.759  -26.951 1.00 30.36  ? 119 PHE A CZ  1 
ATOM   781  N N   . LEU A 1 108 ? 13.332  17.300  -26.409 1.00 30.21  ? 120 LEU A N   1 
ATOM   782  C CA  . LEU A 1 108 ? 13.396  16.601  -27.687 1.00 30.91  ? 120 LEU A CA  1 
ATOM   783  C C   . LEU A 1 108 ? 12.133  16.826  -28.522 1.00 36.13  ? 120 LEU A C   1 
ATOM   784  O O   . LEU A 1 108 ? 12.228  16.981  -29.744 1.00 37.09  ? 120 LEU A O   1 
ATOM   785  C CB  . LEU A 1 108 ? 13.629  15.098  -27.478 1.00 31.07  ? 120 LEU A CB  1 
ATOM   786  C CG  . LEU A 1 108 ? 15.000  14.655  -26.905 1.00 34.92  ? 120 LEU A CG  1 
ATOM   787  C CD1 . LEU A 1 108 ? 14.999  13.172  -26.597 1.00 34.53  ? 120 LEU A CD1 1 
ATOM   788  C CD2 . LEU A 1 108 ? 16.132  14.992  -27.845 1.00 34.51  ? 120 LEU A CD2 1 
ATOM   789  N N   . GLN A 1 109 ? 10.959  16.871  -27.868 1.00 30.71  ? 121 GLN A N   1 
ATOM   790  C CA  . GLN A 1 109 ? 9.683   17.064  -28.542 1.00 29.59  ? 121 GLN A CA  1 
ATOM   791  C C   . GLN A 1 109 ? 9.580   18.479  -29.096 1.00 33.44  ? 121 GLN A C   1 
ATOM   792  O O   . GLN A 1 109 ? 9.152   18.647  -30.240 1.00 32.98  ? 121 GLN A O   1 
ATOM   793  C CB  . GLN A 1 109 ? 8.520   16.769  -27.588 1.00 30.44  ? 121 GLN A CB  1 
ATOM   794  C CG  . GLN A 1 109 ? 7.187   16.554  -28.307 1.00 40.25  ? 121 GLN A CG  1 
ATOM   795  C CD  . GLN A 1 109 ? 6.078   16.166  -27.378 1.00 39.47  ? 121 GLN A CD  1 
ATOM   796  O OE1 . GLN A 1 109 ? 6.201   15.255  -26.561 1.00 39.10  ? 121 GLN A OE1 1 
ATOM   797  N NE2 . GLN A 1 109 ? 4.957   16.827  -27.504 1.00 26.20  ? 121 GLN A NE2 1 
ATOM   798  N N   . VAL A 1 110 ? 9.964   19.494  -28.282 1.00 30.01  ? 122 VAL A N   1 
ATOM   799  C CA  . VAL A 1 110 ? 9.940   20.914  -28.661 1.00 29.62  ? 122 VAL A CA  1 
ATOM   800  C C   . VAL A 1 110 ? 10.989  21.174  -29.766 1.00 34.44  ? 122 VAL A C   1 
ATOM   801  O O   . VAL A 1 110 ? 10.674  21.867  -30.737 1.00 36.25  ? 122 VAL A O   1 
ATOM   802  C CB  . VAL A 1 110 ? 10.118  21.848  -27.437 1.00 33.07  ? 122 VAL A CB  1 
ATOM   803  C CG1 . VAL A 1 110 ? 10.305  23.301  -27.857 1.00 33.23  ? 122 VAL A CG1 1 
ATOM   804  C CG2 . VAL A 1 110 ? 8.933   21.734  -26.493 1.00 32.23  ? 122 VAL A CG2 1 
ATOM   805  N N   . LYS A 1 111 ? 12.200  20.595  -29.642 1.00 28.36  ? 123 LYS A N   1 
ATOM   806  C CA  . LYS A 1 111 ? 13.262  20.754  -30.633 1.00 28.00  ? 123 LYS A CA  1 
ATOM   807  C C   . LYS A 1 111 ? 12.808  20.248  -32.010 1.00 33.46  ? 123 LYS A C   1 
ATOM   808  O O   . LYS A 1 111 ? 13.071  20.925  -33.007 1.00 34.58  ? 123 LYS A O   1 
ATOM   809  C CB  . LYS A 1 111 ? 14.562  20.054  -30.180 1.00 29.35  ? 123 LYS A CB  1 
ATOM   810  C CG  . LYS A 1 111 ? 15.745  20.210  -31.143 1.00 22.68  ? 123 LYS A CG  1 
ATOM   811  C CD  . LYS A 1 111 ? 17.073  19.807  -30.520 1.00 25.61  ? 123 LYS A CD  1 
ATOM   812  C CE  . LYS A 1 111 ? 17.240  18.323  -30.316 1.00 23.10  ? 123 LYS A CE  1 
ATOM   813  N NZ  . LYS A 1 111 ? 17.363  17.585  -31.593 1.00 37.27  ? 123 LYS A NZ  1 
ATOM   814  N N   . LYS A 1 112 ? 12.124  19.081  -32.072 1.00 29.79  ? 124 LYS A N   1 
ATOM   815  C CA  . LYS A 1 112 ? 11.598  18.539  -33.335 1.00 29.28  ? 124 LYS A CA  1 
ATOM   816  C C   . LYS A 1 112 ? 10.625  19.519  -33.970 1.00 32.21  ? 124 LYS A C   1 
ATOM   817  O O   . LYS A 1 112 ? 10.692  19.723  -35.172 1.00 31.91  ? 124 LYS A O   1 
ATOM   818  C CB  . LYS A 1 112 ? 10.921  17.174  -33.140 1.00 31.78  ? 124 LYS A CB  1 
ATOM   819  C CG  . LYS A 1 112 ? 10.915  16.339  -34.405 1.00 50.15  ? 124 LYS A CG  1 
ATOM   820  C CD  . LYS A 1 112 ? 9.656   15.476  -34.495 1.00 63.00  ? 124 LYS A CD  1 
ATOM   821  C CE  . LYS A 1 112 ? 9.681   14.521  -35.666 1.00 72.37  ? 124 LYS A CE  1 
ATOM   822  N NZ  . LYS A 1 112 ? 9.815   15.206  -36.986 1.00 85.72  ? 124 LYS A NZ  1 
ATOM   823  N N   . GLN A 1 113 ? 9.764   20.163  -33.161 1.00 29.14  ? 125 GLN A N   1 
ATOM   824  C CA  . GLN A 1 113 ? 8.788   21.155  -33.620 1.00 29.39  ? 125 GLN A CA  1 
ATOM   825  C C   . GLN A 1 113 ? 9.478   22.438  -34.132 1.00 35.35  ? 125 GLN A C   1 
ATOM   826  O O   . GLN A 1 113 ? 8.972   23.074  -35.057 1.00 35.67  ? 125 GLN A O   1 
ATOM   827  C CB  . GLN A 1 113 ? 7.795   21.492  -32.497 1.00 29.85  ? 125 GLN A CB  1 
ATOM   828  C CG  . GLN A 1 113 ? 6.793   20.381  -32.204 1.00 40.24  ? 125 GLN A CG  1 
ATOM   829  C CD  . GLN A 1 113 ? 6.165   20.432  -30.821 1.00 49.60  ? 125 GLN A CD  1 
ATOM   830  O OE1 . GLN A 1 113 ? 6.224   21.423  -30.095 1.00 44.29  ? 125 GLN A OE1 1 
ATOM   831  N NE2 . GLN A 1 113 ? 5.533   19.349  -30.426 1.00 40.41  ? 125 GLN A NE2 1 
ATOM   832  N N   . ILE A 1 114 ? 10.620  22.814  -33.532 1.00 32.27  ? 126 ILE A N   1 
ATOM   833  C CA  . ILE A 1 114 ? 11.428  23.968  -33.956 1.00 32.26  ? 126 ILE A CA  1 
ATOM   834  C C   . ILE A 1 114 ? 12.075  23.654  -35.304 1.00 37.07  ? 126 ILE A C   1 
ATOM   835  O O   . ILE A 1 114 ? 11.958  24.448  -36.236 1.00 37.60  ? 126 ILE A O   1 
ATOM   836  C CB  . ILE A 1 114 ? 12.488  24.343  -32.865 1.00 34.57  ? 126 ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 114 ? 11.834  24.890  -31.551 1.00 32.35  ? 126 ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 114 ? 13.629  25.252  -33.401 1.00 35.42  ? 126 ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 114 ? 11.192  26.238  -31.616 1.00 30.79  ? 126 ILE A CD1 1 
ATOM   840  N N   . LEU A 1 115 ? 12.735  22.490  -35.411 1.00 33.84  ? 127 LEU A N   1 
ATOM   841  C CA  . LEU A 1 115 ? 13.447  22.094  -36.624 1.00 34.58  ? 127 LEU A CA  1 
ATOM   842  C C   . LEU A 1 115 ? 12.486  21.816  -37.795 1.00 38.25  ? 127 LEU A C   1 
ATOM   843  O O   . LEU A 1 115 ? 12.829  22.133  -38.919 1.00 37.34  ? 127 LEU A O   1 
ATOM   844  C CB  . LEU A 1 115 ? 14.360  20.891  -36.358 1.00 35.08  ? 127 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 115 ? 15.490  21.107  -35.316 1.00 40.64  ? 127 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 115 ? 16.360  19.875  -35.188 1.00 41.49  ? 127 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 115 ? 16.385  22.320  -35.642 1.00 41.48  ? 127 LEU A CD2 1 
ATOM   848  N N   . ASP A 1 116 ? 11.283  21.262  -37.530 1.00 36.63  ? 128 ASP A N   1 
ATOM   849  C CA  . ASP A 1 116 ? 10.215  21.007  -38.516 1.00 37.01  ? 128 ASP A CA  1 
ATOM   850  C C   . ASP A 1 116 ? 9.490   22.290  -38.935 1.00 41.18  ? 128 ASP A C   1 
ATOM   851  O O   . ASP A 1 116 ? 8.746   22.273  -39.915 1.00 42.18  ? 128 ASP A O   1 
ATOM   852  C CB  . ASP A 1 116 ? 9.171   20.027  -37.930 1.00 38.87  ? 128 ASP A CB  1 
ATOM   853  C CG  . ASP A 1 116 ? 9.597   18.571  -37.854 1.00 56.77  ? 128 ASP A CG  1 
ATOM   854  O OD1 . ASP A 1 116 ? 10.740  18.254  -38.282 1.00 57.66  ? 128 ASP A OD1 1 
ATOM   855  O OD2 . ASP A 1 116 ? 8.800   17.747  -37.344 1.00 64.86  ? 128 ASP A OD2 1 
ATOM   856  N N   . GLU A 1 117 ? 9.666   23.377  -38.158 1.00 36.53  ? 129 GLU A N   1 
ATOM   857  C CA  . GLU A 1 117 ? 9.035   24.690  -38.324 1.00 35.73  ? 129 GLU A CA  1 
ATOM   858  C C   . GLU A 1 117 ? 7.527   24.614  -38.053 1.00 41.90  ? 129 GLU A C   1 
ATOM   859  O O   . GLU A 1 117 ? 6.754   25.405  -38.597 1.00 42.91  ? 129 GLU A O   1 
ATOM   860  C CB  . GLU A 1 117 ? 9.336   25.302  -39.700 1.00 37.21  ? 129 GLU A CB  1 
ATOM   861  C CG  . GLU A 1 117 ? 10.813  25.549  -39.894 1.00 39.01  ? 129 GLU A CG  1 
ATOM   862  C CD  . GLU A 1 117 ? 11.232  25.822  -41.310 1.00 42.77  ? 129 GLU A CD  1 
ATOM   863  O OE1 . GLU A 1 117 ? 10.950  26.924  -41.824 1.00 38.64  ? 129 GLU A OE1 1 
ATOM   864  O OE2 . GLU A 1 117 ? 11.886  24.936  -41.894 1.00 49.31  ? 129 GLU A OE2 1 
ATOM   865  N N   . LYS A 1 118 ? 7.117   23.677  -37.186 1.00 38.38  ? 130 LYS A N   1 
ATOM   866  C CA  . LYS A 1 118 ? 5.756   23.614  -36.654 1.00 37.73  ? 130 LYS A CA  1 
ATOM   867  C C   . LYS A 1 118 ? 5.521   24.770  -35.681 1.00 43.91  ? 130 LYS A C   1 
ATOM   868  O O   . LYS A 1 118 ? 4.415   25.306  -35.642 1.00 45.91  ? 130 LYS A O   1 
ATOM   869  C CB  . LYS A 1 118 ? 5.491   22.255  -35.998 1.00 39.25  ? 130 LYS A CB  1 
ATOM   870  C CG  . LYS A 1 118 ? 5.197   21.171  -37.032 1.00 61.28  ? 130 LYS A CG  1 
ATOM   871  C CD  . LYS A 1 118 ? 5.320   19.774  -36.460 1.00 81.05  ? 130 LYS A CD  1 
ATOM   872  C CE  . LYS A 1 118 ? 5.065   18.712  -37.501 1.00 100.49 ? 130 LYS A CE  1 
ATOM   873  N NZ  . LYS A 1 118 ? 5.285   17.346  -36.952 1.00 115.44 ? 130 LYS A NZ  1 
ATOM   874  N N   . ILE A 1 119 ? 6.556   25.141  -34.893 1.00 39.72  ? 131 ILE A N   1 
ATOM   875  C CA  . ILE A 1 119 ? 6.633   26.367  -34.085 1.00 39.11  ? 131 ILE A CA  1 
ATOM   876  C C   . ILE A 1 119 ? 7.435   27.390  -34.888 1.00 40.48  ? 131 ILE A C   1 
ATOM   877  O O   . ILE A 1 119 ? 8.608   27.134  -35.172 1.00 39.70  ? 131 ILE A O   1 
ATOM   878  C CB  . ILE A 1 119 ? 7.292   26.119  -32.678 1.00 42.81  ? 131 ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 119 ? 6.547   25.057  -31.842 1.00 43.34  ? 131 ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 119 ? 7.472   27.436  -31.883 1.00 44.12  ? 131 ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 119 ? 7.323   24.607  -30.531 1.00 43.85  ? 131 ILE A CD1 1 
ATOM   882  N N   . TYR A 1 120 ? 6.829   28.542  -35.247 1.00 35.63  ? 132 TYR A N   1 
ATOM   883  C CA  . TYR A 1 120 ? 7.598   29.629  -35.857 1.00 35.07  ? 132 TYR A CA  1 
ATOM   884  C C   . TYR A 1 120 ? 8.664   30.141  -34.873 1.00 39.86  ? 132 TYR A C   1 
ATOM   885  O O   . TYR A 1 120 ? 8.395   30.310  -33.679 1.00 39.41  ? 132 TYR A O   1 
ATOM   886  C CB  . TYR A 1 120 ? 6.705   30.787  -36.354 1.00 35.18  ? 132 TYR A CB  1 
ATOM   887  C CG  . TYR A 1 120 ? 7.495   32.032  -36.701 1.00 35.83  ? 132 TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 120 ? 8.229   32.109  -37.881 1.00 37.86  ? 132 TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 120 ? 7.595   33.094  -35.800 1.00 35.99  ? 132 TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 120 ? 9.009   33.226  -38.175 1.00 39.03  ? 132 TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 120 ? 8.376   34.214  -36.082 1.00 37.10  ? 132 TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 120 ? 9.074   34.282  -37.275 1.00 45.11  ? 132 TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 120 ? 9.837   35.398  -37.545 1.00 45.17  ? 132 TYR A OH  1 
ATOM   894  N N   . CYS A 1 121 ? 9.860   30.409  -35.404 1.00 37.38  ? 133 CYS A N   1 
ATOM   895  C CA  . CYS A 1 121 ? 11.001  30.870  -34.634 1.00 37.85  ? 133 CYS A CA  1 
ATOM   896  C C   . CYS A 1 121 ? 11.715  32.017  -35.399 1.00 41.38  ? 133 CYS A C   1 
ATOM   897  O O   . CYS A 1 121 ? 12.040  31.851  -36.576 1.00 41.37  ? 133 CYS A O   1 
ATOM   898  C CB  . CYS A 1 121 ? 11.933  29.694  -34.361 1.00 38.92  ? 133 CYS A CB  1 
ATOM   899  S SG  . CYS A 1 121 ? 13.230  30.039  -33.165 1.00 43.72  ? 133 CYS A SG  1 
ATOM   900  N N   . PRO A 1 122 ? 11.932  33.201  -34.774 1.00 38.43  ? 134 PRO A N   1 
ATOM   901  C CA  . PRO A 1 122 ? 12.668  34.277  -35.469 1.00 38.92  ? 134 PRO A CA  1 
ATOM   902  C C   . PRO A 1 122 ? 14.172  33.957  -35.599 1.00 45.31  ? 134 PRO A C   1 
ATOM   903  O O   . PRO A 1 122 ? 14.658  33.054  -34.901 1.00 44.75  ? 134 PRO A O   1 
ATOM   904  C CB  . PRO A 1 122 ? 12.431  35.511  -34.582 1.00 40.32  ? 134 PRO A CB  1 
ATOM   905  C CG  . PRO A 1 122 ? 11.469  35.100  -33.533 1.00 43.82  ? 134 PRO A CG  1 
ATOM   906  C CD  . PRO A 1 122 ? 11.535  33.625  -33.417 1.00 39.13  ? 134 PRO A CD  1 
ATOM   907  N N   . PRO A 1 123 ? 14.934  34.674  -36.475 1.00 43.32  ? 135 PRO A N   1 
ATOM   908  C CA  . PRO A 1 123 ? 16.340  34.299  -36.716 1.00 43.56  ? 135 PRO A CA  1 
ATOM   909  C C   . PRO A 1 123 ? 17.252  34.268  -35.478 1.00 47.34  ? 135 PRO A C   1 
ATOM   910  O O   . PRO A 1 123 ? 18.031  33.323  -35.350 1.00 47.31  ? 135 PRO A O   1 
ATOM   911  C CB  . PRO A 1 123 ? 16.816  35.358  -37.712 1.00 46.38  ? 135 PRO A CB  1 
ATOM   912  C CG  . PRO A 1 123 ? 15.591  35.811  -38.392 1.00 50.71  ? 135 PRO A CG  1 
ATOM   913  C CD  . PRO A 1 123 ? 14.544  35.813  -37.335 1.00 45.29  ? 135 PRO A CD  1 
ATOM   914  N N   . GLU A 1 124 ? 17.180  35.269  -34.581 1.00 43.49  ? 136 GLU A N   1 
ATOM   915  C CA  . GLU A 1 124 ? 18.068  35.315  -33.412 1.00 43.15  ? 136 GLU A CA  1 
ATOM   916  C C   . GLU A 1 124 ? 17.786  34.144  -32.463 1.00 46.04  ? 136 GLU A C   1 
ATOM   917  O O   . GLU A 1 124 ? 18.730  33.498  -32.010 1.00 46.81  ? 136 GLU A O   1 
ATOM   918  C CB  . GLU A 1 124 ? 17.944  36.650  -32.668 1.00 44.80  ? 136 GLU A CB  1 
ATOM   919  C CG  . GLU A 1 124 ? 18.886  36.779  -31.478 1.00 54.37  ? 136 GLU A CG  1 
ATOM   920  C CD  . GLU A 1 124 ? 18.947  38.149  -30.833 1.00 75.64  ? 136 GLU A CD  1 
ATOM   921  O OE1 . GLU A 1 124 ? 18.674  39.154  -31.533 1.00 73.38  ? 136 GLU A OE1 1 
ATOM   922  O OE2 . GLU A 1 124 ? 19.328  38.221  -29.640 1.00 58.93  ? 136 GLU A OE2 1 
ATOM   923  N N   . ALA A 1 125 ? 16.495  33.869  -32.180 1.00 39.63  ? 137 ALA A N   1 
ATOM   924  C CA  . ALA A 1 125 ? 16.073  32.742  -31.352 1.00 37.42  ? 137 ALA A CA  1 
ATOM   925  C C   . ALA A 1 125 ? 16.514  31.414  -31.967 1.00 38.73  ? 137 ALA A C   1 
ATOM   926  O O   . ALA A 1 125 ? 16.988  30.557  -31.225 1.00 38.36  ? 137 ALA A O   1 
ATOM   927  C CB  . ALA A 1 125 ? 14.563  32.764  -31.156 1.00 37.31  ? 137 ALA A CB  1 
ATOM   928  N N   . SER A 1 126 ? 16.391  31.253  -33.316 1.00 33.97  ? 138 SER A N   1 
ATOM   929  C CA  . SER A 1 126 ? 16.866  30.071  -34.065 1.00 33.31  ? 138 SER A CA  1 
ATOM   930  C C   . SER A 1 126 ? 18.341  29.743  -33.776 1.00 36.39  ? 138 SER A C   1 
ATOM   931  O O   . SER A 1 126 ? 18.637  28.605  -33.394 1.00 34.76  ? 138 SER A O   1 
ATOM   932  C CB  . SER A 1 126 ? 16.669  30.254  -35.566 1.00 36.54  ? 138 SER A CB  1 
ATOM   933  O OG  . SER A 1 126 ? 15.382  29.824  -35.980 1.00 50.41  ? 138 SER A OG  1 
ATOM   934  N N   . VAL A 1 127 ? 19.251  30.748  -33.896 1.00 33.59  ? 139 VAL A N   1 
ATOM   935  C CA  . VAL A 1 127 ? 20.689  30.504  -33.719 1.00 34.50  ? 139 VAL A CA  1 
ATOM   936  C C   . VAL A 1 127 ? 21.013  30.268  -32.231 1.00 38.81  ? 139 VAL A C   1 
ATOM   937  O O   . VAL A 1 127 ? 21.925  29.505  -31.903 1.00 38.83  ? 139 VAL A O   1 
ATOM   938  C CB  . VAL A 1 127 ? 21.616  31.581  -34.354 1.00 39.31  ? 139 VAL A CB  1 
ATOM   939  C CG1 . VAL A 1 127 ? 21.329  31.735  -35.835 1.00 39.72  ? 139 VAL A CG1 1 
ATOM   940  C CG2 . VAL A 1 127 ? 21.532  32.930  -33.645 1.00 39.07  ? 139 VAL A CG2 1 
ATOM   941  N N   . LEU A 1 128 ? 20.247  30.909  -31.345 1.00 34.57  ? 140 LEU A N   1 
ATOM   942  C CA  . LEU A 1 128 ? 20.428  30.789  -29.917 1.00 34.12  ? 140 LEU A CA  1 
ATOM   943  C C   . LEU A 1 128 ? 19.970  29.404  -29.439 1.00 36.13  ? 140 LEU A C   1 
ATOM   944  O O   . LEU A 1 128 ? 20.687  28.764  -28.668 1.00 36.39  ? 140 LEU A O   1 
ATOM   945  C CB  . LEU A 1 128 ? 19.662  31.918  -29.230 1.00 34.26  ? 140 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 128 ? 20.254  32.511  -27.965 1.00 39.89  ? 140 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 128 ? 21.780  32.596  -28.013 1.00 40.62  ? 140 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 128 ? 19.679  33.882  -27.725 1.00 44.30  ? 140 LEU A CD2 1 
ATOM   949  N N   . LEU A 1 129 ? 18.799  28.933  -29.914 1.00 30.20  ? 141 LEU A N   1 
ATOM   950  C CA  . LEU A 1 129 ? 18.315  27.571  -29.660 1.00 28.88  ? 141 LEU A CA  1 
ATOM   951  C C   . LEU A 1 129 ? 19.273  26.517  -30.209 1.00 33.26  ? 141 LEU A C   1 
ATOM   952  O O   . LEU A 1 129 ? 19.548  25.538  -29.535 1.00 33.17  ? 141 LEU A O   1 
ATOM   953  C CB  . LEU A 1 129 ? 16.927  27.358  -30.285 1.00 28.27  ? 141 LEU A CB  1 
ATOM   954  C CG  . LEU A 1 129 ? 15.731  28.008  -29.619 1.00 31.58  ? 141 LEU A CG  1 
ATOM   955  C CD1 . LEU A 1 129 ? 14.518  27.808  -30.446 1.00 30.16  ? 141 LEU A CD1 1 
ATOM   956  C CD2 . LEU A 1 129 ? 15.510  27.463  -28.229 1.00 34.27  ? 141 LEU A CD2 1 
ATOM   957  N N   . ALA A 1 130 ? 19.786  26.723  -31.428 1.00 30.92  ? 142 ALA A N   1 
ATOM   958  C CA  . ALA A 1 130 ? 20.690  25.793  -32.080 1.00 31.45  ? 142 ALA A CA  1 
ATOM   959  C C   . ALA A 1 130 ? 21.968  25.609  -31.269 1.00 37.62  ? 142 ALA A C   1 
ATOM   960  O O   . ALA A 1 130 ? 22.458  24.484  -31.202 1.00 38.82  ? 142 ALA A O   1 
ATOM   961  C CB  . ALA A 1 130 ? 21.015  26.280  -33.478 1.00 32.97  ? 142 ALA A CB  1 
ATOM   962  N N   . SER A 1 131 ? 22.493  26.694  -30.633 1.00 34.02  ? 143 SER A N   1 
ATOM   963  C CA  . SER A 1 131 ? 23.710  26.673  -29.799 1.00 33.88  ? 143 SER A CA  1 
ATOM   964  C C   . SER A 1 131 ? 23.522  25.830  -28.541 1.00 35.57  ? 143 SER A C   1 
ATOM   965  O O   . SER A 1 131 ? 24.432  25.095  -28.155 1.00 35.43  ? 143 SER A O   1 
ATOM   966  C CB  . SER A 1 131 ? 24.155  28.087  -29.423 1.00 36.70  ? 143 SER A CB  1 
ATOM   967  O OG  . SER A 1 131 ? 23.293  28.749  -28.514 1.00 39.97  ? 143 SER A OG  1 
ATOM   968  N N   . TYR A 1 132 ? 22.345  25.926  -27.911 1.00 31.46  ? 144 TYR A N   1 
ATOM   969  C CA  . TYR A 1 132 ? 22.024  25.127  -26.725 1.00 30.50  ? 144 TYR A CA  1 
ATOM   970  C C   . TYR A 1 132 ? 21.816  23.661  -27.087 1.00 35.68  ? 144 TYR A C   1 
ATOM   971  O O   . TYR A 1 132 ? 22.237  22.794  -26.326 1.00 36.59  ? 144 TYR A O   1 
ATOM   972  C CB  . TYR A 1 132 ? 20.813  25.692  -25.983 1.00 29.45  ? 144 TYR A CB  1 
ATOM   973  C CG  . TYR A 1 132 ? 21.169  26.936  -25.206 1.00 30.39  ? 144 TYR A CG  1 
ATOM   974  C CD1 . TYR A 1 132 ? 22.103  26.893  -24.176 1.00 32.19  ? 144 TYR A CD1 1 
ATOM   975  C CD2 . TYR A 1 132 ? 20.607  28.170  -25.529 1.00 31.16  ? 144 TYR A CD2 1 
ATOM   976  C CE1 . TYR A 1 132 ? 22.471  28.046  -23.488 1.00 33.92  ? 144 TYR A CE1 1 
ATOM   977  C CE2 . TYR A 1 132 ? 20.972  29.332  -24.849 1.00 32.02  ? 144 TYR A CE2 1 
ATOM   978  C CZ  . TYR A 1 132 ? 21.896  29.262  -23.824 1.00 38.84  ? 144 TYR A CZ  1 
ATOM   979  O OH  . TYR A 1 132 ? 22.246  30.401  -23.150 1.00 42.75  ? 144 TYR A OH  1 
ATOM   980  N N   . ALA A 1 133 ? 21.206  23.385  -28.254 1.00 31.45  ? 145 ALA A N   1 
ATOM   981  C CA  . ALA A 1 133 ? 21.069  22.031  -28.783 1.00 31.09  ? 145 ALA A CA  1 
ATOM   982  C C   . ALA A 1 133 ? 22.448  21.378  -29.005 1.00 37.27  ? 145 ALA A C   1 
ATOM   983  O O   . ALA A 1 133 ? 22.609  20.211  -28.650 1.00 38.70  ? 145 ALA A O   1 
ATOM   984  C CB  . ALA A 1 133 ? 20.272  22.054  -30.074 1.00 31.70  ? 145 ALA A CB  1 
ATOM   985  N N   . VAL A 1 134 ? 23.450  22.133  -29.557 1.00 33.63  ? 146 VAL A N   1 
ATOM   986  C CA  . VAL A 1 134 ? 24.827  21.657  -29.720 1.00 33.85  ? 146 VAL A CA  1 
ATOM   987  C C   . VAL A 1 134 ? 25.389  21.238  -28.347 1.00 38.39  ? 146 VAL A C   1 
ATOM   988  O O   . VAL A 1 134 ? 25.921  20.132  -28.220 1.00 38.74  ? 146 VAL A O   1 
ATOM   989  C CB  . VAL A 1 134 ? 25.756  22.679  -30.435 1.00 38.32  ? 146 VAL A CB  1 
ATOM   990  C CG1 . VAL A 1 134 ? 27.227  22.235  -30.411 1.00 38.98  ? 146 VAL A CG1 1 
ATOM   991  C CG2 . VAL A 1 134 ? 25.306  22.919  -31.861 1.00 38.20  ? 146 VAL A CG2 1 
ATOM   992  N N   . GLN A 1 135 ? 25.242  22.102  -27.328 1.00 34.36  ? 147 GLN A N   1 
ATOM   993  C CA  . GLN A 1 135 ? 25.746  21.857  -25.972 1.00 33.88  ? 147 GLN A CA  1 
ATOM   994  C C   . GLN A 1 135 ? 25.024  20.684  -25.312 1.00 38.66  ? 147 GLN A C   1 
ATOM   995  O O   . GLN A 1 135 ? 25.666  19.918  -24.590 1.00 39.91  ? 147 GLN A O   1 
ATOM   996  C CB  . GLN A 1 135 ? 25.623  23.118  -25.109 1.00 34.26  ? 147 GLN A CB  1 
ATOM   997  C CG  . GLN A 1 135 ? 26.675  24.161  -25.472 1.00 28.85  ? 147 GLN A CG  1 
ATOM   998  C CD  . GLN A 1 135 ? 26.273  25.582  -25.220 1.00 36.95  ? 147 GLN A CD  1 
ATOM   999  O OE1 . GLN A 1 135 ? 26.915  26.507  -25.695 1.00 33.35  ? 147 GLN A OE1 1 
ATOM   1000 N NE2 . GLN A 1 135 ? 25.255  25.806  -24.420 1.00 35.93  ? 147 GLN A NE2 1 
ATOM   1001 N N   . ALA A 1 136 ? 23.714  20.524  -25.572 1.00 34.28  ? 148 ALA A N   1 
ATOM   1002 C CA  . ALA A 1 136 ? 22.924  19.397  -25.058 1.00 33.49  ? 148 ALA A CA  1 
ATOM   1003 C C   . ALA A 1 136 ? 23.361  18.059  -25.687 1.00 41.23  ? 148 ALA A C   1 
ATOM   1004 O O   . ALA A 1 136 ? 23.290  17.022  -25.019 1.00 41.80  ? 148 ALA A O   1 
ATOM   1005 C CB  . ALA A 1 136 ? 21.446  19.629  -25.305 1.00 32.49  ? 148 ALA A CB  1 
ATOM   1006 N N   . LYS A 1 137 ? 23.823  18.089  -26.952 1.00 39.04  ? 149 LYS A N   1 
ATOM   1007 C CA  . LYS A 1 137 ? 24.282  16.922  -27.710 1.00 40.36  ? 149 LYS A CA  1 
ATOM   1008 C C   . LYS A 1 137 ? 25.649  16.402  -27.213 1.00 49.59  ? 149 LYS A C   1 
ATOM   1009 O O   . LYS A 1 137 ? 25.848  15.191  -27.195 1.00 50.11  ? 149 LYS A O   1 
ATOM   1010 C CB  . LYS A 1 137 ? 24.356  17.271  -29.206 1.00 42.21  ? 149 LYS A CB  1 
ATOM   1011 C CG  . LYS A 1 137 ? 24.550  16.082  -30.139 1.00 47.03  ? 149 LYS A CG  1 
ATOM   1012 C CD  . LYS A 1 137 ? 24.680  16.516  -31.584 1.00 60.55  ? 149 LYS A CD  1 
ATOM   1013 C CE  . LYS A 1 137 ? 25.013  15.374  -32.504 1.00 70.73  ? 149 LYS A CE  1 
ATOM   1014 N NZ  . LYS A 1 137 ? 24.999  15.802  -33.927 1.00 88.80  ? 149 LYS A NZ  1 
ATOM   1015 N N   . TYR A 1 138 ? 26.567  17.296  -26.783 1.00 49.87  ? 150 TYR A N   1 
ATOM   1016 C CA  . TYR A 1 138 ? 27.949  16.925  -26.468 1.00 52.53  ? 150 TYR A CA  1 
ATOM   1017 C C   . TYR A 1 138 ? 28.336  17.165  -24.989 1.00 64.15  ? 150 TYR A C   1 
ATOM   1018 O O   . TYR A 1 138 ? 28.371  18.307  -24.509 1.00 64.98  ? 150 TYR A O   1 
ATOM   1019 C CB  . TYR A 1 138 ? 28.923  17.661  -27.400 1.00 53.95  ? 150 TYR A CB  1 
ATOM   1020 C CG  . TYR A 1 138 ? 28.741  17.326  -28.867 1.00 55.45  ? 150 TYR A CG  1 
ATOM   1021 C CD1 . TYR A 1 138 ? 29.094  16.075  -29.365 1.00 57.72  ? 150 TYR A CD1 1 
ATOM   1022 C CD2 . TYR A 1 138 ? 28.257  18.272  -29.766 1.00 55.94  ? 150 TYR A CD2 1 
ATOM   1023 C CE1 . TYR A 1 138 ? 28.977  15.776  -30.718 1.00 57.78  ? 150 TYR A CE1 1 
ATOM   1024 C CE2 . TYR A 1 138 ? 28.109  17.974  -31.120 1.00 57.19  ? 150 TYR A CE2 1 
ATOM   1025 C CZ  . TYR A 1 138 ? 28.467  16.722  -31.590 1.00 64.69  ? 150 TYR A CZ  1 
ATOM   1026 O OH  . TYR A 1 138 ? 28.318  16.422  -32.924 1.00 67.51  ? 150 TYR A OH  1 
ATOM   1027 N N   . GLY A 1 139 ? 28.641  16.051  -24.308 1.00 64.66  ? 151 GLY A N   1 
ATOM   1028 C CA  . GLY A 1 139 ? 29.264  16.004  -22.985 1.00 65.85  ? 151 GLY A CA  1 
ATOM   1029 C C   . GLY A 1 139 ? 30.691  15.453  -22.996 1.00 73.48  ? 151 GLY A C   1 
ATOM   1030 O O   . GLY A 1 139 ? 30.906  14.267  -22.714 1.00 74.39  ? 151 GLY A O   1 
ATOM   1031 N N   . ASP A 1 140 ? 31.674  16.305  -23.373 1.00 70.39  ? 152 ASP A N   1 
ATOM   1032 C CA  . ASP A 1 140 ? 33.116  16.101  -23.184 1.00 92.39  ? 152 ASP A CA  1 
ATOM   1033 C C   . ASP A 1 140 ? 33.792  17.460  -23.023 1.00 103.82 ? 152 ASP A C   1 
ATOM   1034 O O   . ASP A 1 140 ? 33.588  18.349  -23.850 1.00 62.58  ? 152 ASP A O   1 
ATOM   1035 C CB  . ASP A 1 140 ? 33.753  15.306  -24.348 1.00 95.54  ? 152 ASP A CB  1 
ATOM   1036 C CG  . ASP A 1 140 ? 35.177  14.811  -24.083 1.00 104.93 ? 152 ASP A CG  1 
ATOM   1037 O OD1 . ASP A 1 140 ? 36.113  15.650  -24.068 1.00 104.83 ? 152 ASP A OD1 1 
ATOM   1038 O OD2 . ASP A 1 140 ? 35.361  13.583  -23.934 1.00 111.46 ? 152 ASP A OD2 1 
ATOM   1039 N N   . GLN A 1 166 ? 47.273  -9.983  -17.468 1.00 92.40  ? 178 GLN A N   1 
ATOM   1040 C CA  . GLN A 1 166 ? 48.313  -9.627  -16.501 1.00 92.41  ? 178 GLN A CA  1 
ATOM   1041 C C   . GLN A 1 166 ? 47.924  -8.365  -15.713 1.00 92.78  ? 178 GLN A C   1 
ATOM   1042 O O   . GLN A 1 166 ? 47.242  -7.487  -16.255 1.00 91.11  ? 178 GLN A O   1 
ATOM   1043 C CB  . GLN A 1 166 ? 49.657  -9.411  -17.220 1.00 95.97  ? 178 GLN A CB  1 
ATOM   1044 C CG  . GLN A 1 166 ? 50.880  -9.436  -16.298 1.00 115.00 ? 178 GLN A CG  1 
ATOM   1045 C CD  . GLN A 1 166 ? 52.172  -9.054  -16.984 1.00 138.67 ? 178 GLN A CD  1 
ATOM   1046 O OE1 . GLN A 1 166 ? 52.311  -9.103  -18.213 1.00 137.72 ? 178 GLN A OE1 1 
ATOM   1047 N NE2 . GLN A 1 166 ? 53.162  -8.682  -16.190 1.00 129.55 ? 178 GLN A NE2 1 
ATOM   1048 N N   . MET A 1 167 ? 48.347  -8.298  -14.427 1.00 87.66  ? 179 MET A N   1 
ATOM   1049 C CA  . MET A 1 167 ? 48.271  -7.104  -13.581 1.00 85.29  ? 179 MET A CA  1 
ATOM   1050 C C   . MET A 1 167 ? 49.312  -7.166  -12.461 1.00 89.48  ? 179 MET A C   1 
ATOM   1051 O O   . MET A 1 167 ? 49.193  -7.980  -11.544 1.00 89.11  ? 179 MET A O   1 
ATOM   1052 C CB  . MET A 1 167 ? 46.861  -6.908  -12.998 1.00 84.83  ? 179 MET A CB  1 
ATOM   1053 C CG  . MET A 1 167 ? 46.680  -5.565  -12.321 1.00 86.85  ? 179 MET A CG  1 
ATOM   1054 S SD  . MET A 1 167 ? 45.184  -5.434  -11.315 1.00 88.12  ? 179 MET A SD  1 
ATOM   1055 C CE  . MET A 1 167 ? 45.579  -6.551  -9.997  1.00 85.53  ? 179 MET A CE  1 
ATOM   1056 N N   . THR A 1 168 ? 50.327  -6.294  -12.542 1.00 86.64  ? 180 THR A N   1 
ATOM   1057 C CA  . THR A 1 168 ? 51.366  -6.141  -11.513 1.00 87.58  ? 180 THR A CA  1 
ATOM   1058 C C   . THR A 1 168 ? 50.836  -5.221  -10.389 1.00 89.03  ? 180 THR A C   1 
ATOM   1059 O O   . THR A 1 168 ? 49.822  -4.549  -10.621 1.00 86.48  ? 180 THR A O   1 
ATOM   1060 C CB  . THR A 1 168 ? 52.672  -5.610  -12.141 1.00 97.89  ? 180 THR A CB  1 
ATOM   1061 O OG1 . THR A 1 168 ? 52.417  -4.367  -12.793 1.00 98.95  ? 180 THR A OG1 1 
ATOM   1062 C CG2 . THR A 1 168 ? 53.299  -6.599  -13.114 1.00 97.28  ? 180 THR A CG2 1 
ATOM   1063 N N   . PRO A 1 169 ? 51.448  -5.186  -9.165  1.00 85.78  ? 181 PRO A N   1 
ATOM   1064 C CA  . PRO A 1 169 ? 50.970  -4.248  -8.128  1.00 84.29  ? 181 PRO A CA  1 
ATOM   1065 C C   . PRO A 1 169 ? 50.980  -2.777  -8.561  1.00 89.26  ? 181 PRO A C   1 
ATOM   1066 O O   . PRO A 1 169 ? 50.117  -2.013  -8.121  1.00 87.18  ? 181 PRO A O   1 
ATOM   1067 C CB  . PRO A 1 169 ? 51.933  -4.481  -6.965  1.00 87.25  ? 181 PRO A CB  1 
ATOM   1068 C CG  . PRO A 1 169 ? 52.412  -5.866  -7.155  1.00 93.19  ? 181 PRO A CG  1 
ATOM   1069 C CD  . PRO A 1 169 ? 52.539  -6.031  -8.639  1.00 89.34  ? 181 PRO A CD  1 
ATOM   1070 N N   . GLU A 1 170 ? 51.939  -2.392  -9.426  1.00 87.96  ? 182 GLU A N   1 
ATOM   1071 C CA  . GLU A 1 170 ? 52.035  -1.056  -10.022 1.00 87.40  ? 182 GLU A CA  1 
ATOM   1072 C C   . GLU A 1 170 ? 50.884  -0.815  -11.010 1.00 87.96  ? 182 GLU A C   1 
ATOM   1073 O O   . GLU A 1 170 ? 50.340  0.291   -11.034 1.00 86.69  ? 182 GLU A O   1 
ATOM   1074 C CB  . GLU A 1 170 ? 53.406  -0.811  -10.701 1.00 91.55  ? 182 GLU A CB  1 
ATOM   1075 C CG  . GLU A 1 170 ? 54.244  -2.049  -11.014 1.00 108.30 ? 182 GLU A CG  1 
ATOM   1076 C CD  . GLU A 1 170 ? 55.172  -2.507  -9.902  1.00 138.20 ? 182 GLU A CD  1 
ATOM   1077 O OE1 . GLU A 1 170 ? 56.274  -1.927  -9.771  1.00 138.67 ? 182 GLU A OE1 1 
ATOM   1078 O OE2 . GLU A 1 170 ? 54.802  -3.453  -9.169  1.00 134.63 ? 182 GLU A OE2 1 
ATOM   1079 N N   . MET A 1 171 ? 50.509  -1.842  -11.813 1.00 82.95  ? 183 MET A N   1 
ATOM   1080 C CA  . MET A 1 171 ? 49.355  -1.784  -12.728 1.00 80.20  ? 183 MET A CA  1 
ATOM   1081 C C   . MET A 1 171 ? 48.042  -1.665  -11.958 1.00 80.17  ? 183 MET A C   1 
ATOM   1082 O O   . MET A 1 171 ? 47.122  -1.003  -12.433 1.00 78.59  ? 183 MET A O   1 
ATOM   1083 C CB  . MET A 1 171 ? 49.306  -3.021  -13.643 1.00 83.26  ? 183 MET A CB  1 
ATOM   1084 C CG  . MET A 1 171 ? 50.248  -2.942  -14.829 1.00 88.64  ? 183 MET A CG  1 
ATOM   1085 S SD  . MET A 1 171 ? 50.590  -4.578  -15.555 1.00 94.27  ? 183 MET A SD  1 
ATOM   1086 C CE  . MET A 1 171 ? 49.273  -4.699  -16.743 1.00 89.41  ? 183 MET A CE  1 
ATOM   1087 N N   . TRP A 1 172 ? 47.953  -2.319  -10.780 1.00 75.05  ? 184 TRP A N   1 
ATOM   1088 C CA  . TRP A 1 172 ? 46.798  -2.243  -9.884  1.00 71.99  ? 184 TRP A CA  1 
ATOM   1089 C C   . TRP A 1 172 ? 46.625  -0.809  -9.378  1.00 74.52  ? 184 TRP A C   1 
ATOM   1090 O O   . TRP A 1 172 ? 45.501  -0.313  -9.370  1.00 72.49  ? 184 TRP A O   1 
ATOM   1091 C CB  . TRP A 1 172 ? 46.936  -3.259  -8.729  1.00 70.74  ? 184 TRP A CB  1 
ATOM   1092 C CG  . TRP A 1 172 ? 46.143  -2.975  -7.478  1.00 69.76  ? 184 TRP A CG  1 
ATOM   1093 C CD1 . TRP A 1 172 ? 46.632  -2.465  -6.312  1.00 73.00  ? 184 TRP A CD1 1 
ATOM   1094 C CD2 . TRP A 1 172 ? 44.743  -3.213  -7.256  1.00 67.26  ? 184 TRP A CD2 1 
ATOM   1095 N NE1 . TRP A 1 172 ? 45.627  -2.370  -5.377  1.00 70.70  ? 184 TRP A NE1 1 
ATOM   1096 C CE2 . TRP A 1 172 ? 44.459  -2.832  -5.925  1.00 70.26  ? 184 TRP A CE2 1 
ATOM   1097 C CE3 . TRP A 1 172 ? 43.704  -3.745  -8.040  1.00 67.14  ? 184 TRP A CE3 1 
ATOM   1098 C CZ2 . TRP A 1 172 ? 43.170  -2.901  -5.383  1.00 67.40  ? 184 TRP A CZ2 1 
ATOM   1099 C CZ3 . TRP A 1 172 ? 42.429  -3.833  -7.493  1.00 66.55  ? 184 TRP A CZ3 1 
ATOM   1100 C CH2 . TRP A 1 172 ? 42.174  -3.419  -6.180  1.00 66.33  ? 184 TRP A CH2 1 
ATOM   1101 N N   . GLU A 1 173 ? 47.733  -0.138  -9.005  1.00 71.70  ? 185 GLU A N   1 
ATOM   1102 C CA  . GLU A 1 173 ? 47.731  1.240   -8.523  1.00 71.15  ? 185 GLU A CA  1 
ATOM   1103 C C   . GLU A 1 173 ? 47.293  2.224   -9.616  1.00 75.35  ? 185 GLU A C   1 
ATOM   1104 O O   . GLU A 1 173 ? 46.500  3.134   -9.334  1.00 74.20  ? 185 GLU A O   1 
ATOM   1105 C CB  . GLU A 1 173 ? 49.112  1.616   -7.980  1.00 74.58  ? 185 GLU A CB  1 
ATOM   1106 C CG  . GLU A 1 173 ? 49.068  2.216   -6.584  1.00 87.18  ? 185 GLU A CG  1 
ATOM   1107 C CD  . GLU A 1 173 ? 48.412  1.367   -5.508  1.00 110.42 ? 185 GLU A CD  1 
ATOM   1108 O OE1 . GLU A 1 173 ? 47.378  1.812   -4.960  1.00 103.72 ? 185 GLU A OE1 1 
ATOM   1109 O OE2 . GLU A 1 173 ? 48.918  0.256   -5.221  1.00 104.11 ? 185 GLU A OE2 1 
ATOM   1110 N N   . GLU A 1 174 ? 47.784  2.025   -10.857 1.00 73.12  ? 186 GLU A N   1 
ATOM   1111 C CA  . GLU A 1 174 ? 47.428  2.830   -12.034 1.00 72.87  ? 186 GLU A CA  1 
ATOM   1112 C C   . GLU A 1 174 ? 45.950  2.675   -12.389 1.00 74.51  ? 186 GLU A C   1 
ATOM   1113 O O   . GLU A 1 174 ? 45.309  3.665   -12.740 1.00 73.79  ? 186 GLU A O   1 
ATOM   1114 C CB  . GLU A 1 174 ? 48.298  2.447   -13.249 1.00 76.41  ? 186 GLU A CB  1 
ATOM   1115 C CG  . GLU A 1 174 ? 49.745  2.910   -13.157 1.00 92.03  ? 186 GLU A CG  1 
ATOM   1116 C CD  . GLU A 1 174 ? 50.769  2.103   -13.943 1.00 122.06 ? 186 GLU A CD  1 
ATOM   1117 O OE1 . GLU A 1 174 ? 51.917  1.979   -13.456 1.00 110.88 ? 186 GLU A OE1 1 
ATOM   1118 O OE2 . GLU A 1 174 ? 50.436  1.608   -15.044 1.00 123.90 ? 186 GLU A OE2 1 
ATOM   1119 N N   . ARG A 1 175 ? 45.411  1.442   -12.276 1.00 70.13  ? 187 ARG A N   1 
ATOM   1120 C CA  . ARG A 1 175 ? 44.022  1.127   -12.614 1.00 68.29  ? 187 ARG A CA  1 
ATOM   1121 C C   . ARG A 1 175 ? 43.035  1.677   -11.569 1.00 71.82  ? 187 ARG A C   1 
ATOM   1122 O O   . ARG A 1 175 ? 41.912  2.037   -11.936 1.00 69.96  ? 187 ARG A O   1 
ATOM   1123 C CB  . ARG A 1 175 ? 43.837  -0.381  -12.806 1.00 68.24  ? 187 ARG A CB  1 
ATOM   1124 C CG  . ARG A 1 175 ? 44.223  -0.828  -14.214 1.00 76.90  ? 187 ARG A CG  1 
ATOM   1125 C CD  . ARG A 1 175 ? 44.556  -2.302  -14.314 1.00 86.16  ? 187 ARG A CD  1 
ATOM   1126 N NE  . ARG A 1 175 ? 43.372  -3.167  -14.293 1.00 92.91  ? 187 ARG A NE  1 
ATOM   1127 C CZ  . ARG A 1 175 ? 42.827  -3.744  -15.362 1.00 110.12 ? 187 ARG A CZ  1 
ATOM   1128 N NH1 . ARG A 1 175 ? 43.312  -3.508  -16.576 1.00 107.82 ? 187 ARG A NH1 1 
ATOM   1129 N NH2 . ARG A 1 175 ? 41.770  -4.535  -15.228 1.00 88.30  ? 187 ARG A NH2 1 
ATOM   1130 N N   . ILE A 1 176 ? 43.453  1.743   -10.280 1.00 69.64  ? 188 ILE A N   1 
ATOM   1131 C CA  . ILE A 1 176 ? 42.729  2.434   -9.199  1.00 68.11  ? 188 ILE A CA  1 
ATOM   1132 C C   . ILE A 1 176 ? 42.548  3.914   -9.567  1.00 69.54  ? 188 ILE A C   1 
ATOM   1133 O O   . ILE A 1 176 ? 41.417  4.388   -9.611  1.00 67.50  ? 188 ILE A O   1 
ATOM   1134 C CB  . ILE A 1 176 ? 43.467  2.293   -7.823  1.00 72.62  ? 188 ILE A CB  1 
ATOM   1135 C CG1 . ILE A 1 176 ? 43.407  0.873   -7.256  1.00 72.56  ? 188 ILE A CG1 1 
ATOM   1136 C CG2 . ILE A 1 176 ? 42.963  3.323   -6.780  1.00 74.03  ? 188 ILE A CG2 1 
ATOM   1137 C CD1 . ILE A 1 176 ? 44.298  0.707   -6.065  1.00 76.90  ? 188 ILE A CD1 1 
ATOM   1138 N N   . THR A 1 177 ? 43.669  4.632   -9.838  1.00 66.43  ? 189 THR A N   1 
ATOM   1139 C CA  . THR A 1 177 ? 43.694  6.087   -10.049 1.00 65.75  ? 189 THR A CA  1 
ATOM   1140 C C   . THR A 1 177 ? 42.849  6.467   -11.285 1.00 68.47  ? 189 THR A C   1 
ATOM   1141 O O   . THR A 1 177 ? 42.079  7.436   -11.239 1.00 67.61  ? 189 THR A O   1 
ATOM   1142 C CB  . THR A 1 177 ? 45.157  6.584   -10.186 1.00 73.46  ? 189 THR A CB  1 
ATOM   1143 O OG1 . THR A 1 177 ? 45.999  5.940   -9.223  1.00 70.74  ? 189 THR A OG1 1 
ATOM   1144 C CG2 . THR A 1 177 ? 45.284  8.096   -10.060 1.00 72.80  ? 189 THR A CG2 1 
ATOM   1145 N N   . ALA A 1 178 ? 42.995  5.681   -12.373 1.00 64.30  ? 190 ALA A N   1 
ATOM   1146 C CA  . ALA A 1 178 ? 42.308  5.886   -13.644 1.00 62.64  ? 190 ALA A CA  1 
ATOM   1147 C C   . ALA A 1 178 ? 40.783  5.753   -13.503 1.00 63.96  ? 190 ALA A C   1 
ATOM   1148 O O   . ALA A 1 178 ? 40.040  6.504   -14.152 1.00 63.82  ? 190 ALA A O   1 
ATOM   1149 C CB  . ALA A 1 178 ? 42.827  4.893   -14.680 1.00 64.37  ? 190 ALA A CB  1 
ATOM   1150 N N   . TRP A 1 179 ? 40.327  4.808   -12.647 1.00 57.51  ? 191 TRP A N   1 
ATOM   1151 C CA  . TRP A 1 179 ? 38.912  4.468   -12.516 1.00 54.61  ? 191 TRP A CA  1 
ATOM   1152 C C   . TRP A 1 179 ? 38.104  5.641   -11.944 1.00 57.88  ? 191 TRP A C   1 
ATOM   1153 O O   . TRP A 1 179 ? 36.990  5.877   -12.415 1.00 56.39  ? 191 TRP A O   1 
ATOM   1154 C CB  . TRP A 1 179 ? 38.725  3.205   -11.661 1.00 52.71  ? 191 TRP A CB  1 
ATOM   1155 C CG  . TRP A 1 179 ? 37.362  2.575   -11.781 1.00 51.89  ? 191 TRP A CG  1 
ATOM   1156 C CD1 . TRP A 1 179 ? 37.002  1.559   -12.616 1.00 54.89  ? 191 TRP A CD1 1 
ATOM   1157 C CD2 . TRP A 1 179 ? 36.178  2.925   -11.040 1.00 49.68  ? 191 TRP A CD2 1 
ATOM   1158 N NE1 . TRP A 1 179 ? 35.661  1.275   -12.466 1.00 52.82  ? 191 TRP A NE1 1 
ATOM   1159 C CE2 . TRP A 1 179 ? 35.137  2.088   -11.495 1.00 52.90  ? 191 TRP A CE2 1 
ATOM   1160 C CE3 . TRP A 1 179 ? 35.895  3.869   -10.038 1.00 49.76  ? 191 TRP A CE3 1 
ATOM   1161 C CZ2 . TRP A 1 179 ? 33.835  2.170   -10.986 1.00 50.72  ? 191 TRP A CZ2 1 
ATOM   1162 C CZ3 . TRP A 1 179 ? 34.604  3.955   -9.540  1.00 49.62  ? 191 TRP A CZ3 1 
ATOM   1163 C CH2 . TRP A 1 179 ? 33.592  3.113   -10.012 1.00 49.58  ? 191 TRP A CH2 1 
ATOM   1164 N N   . TYR A 1 180 ? 38.667  6.383   -10.956 1.00 54.82  ? 192 TYR A N   1 
ATOM   1165 C CA  . TYR A 1 180 ? 37.979  7.502   -10.293 1.00 53.21  ? 192 TYR A CA  1 
ATOM   1166 C C   . TYR A 1 180 ? 37.503  8.565   -11.294 1.00 59.09  ? 192 TYR A C   1 
ATOM   1167 O O   . TYR A 1 180 ? 36.334  8.928   -11.282 1.00 57.01  ? 192 TYR A O   1 
ATOM   1168 C CB  . TYR A 1 180 ? 38.879  8.156   -9.234  1.00 54.14  ? 192 TYR A CB  1 
ATOM   1169 C CG  . TYR A 1 180 ? 39.110  7.319   -7.998  1.00 54.81  ? 192 TYR A CG  1 
ATOM   1170 C CD1 . TYR A 1 180 ? 38.064  7.023   -7.126  1.00 55.63  ? 192 TYR A CD1 1 
ATOM   1171 C CD2 . TYR A 1 180 ? 40.388  6.893   -7.652  1.00 56.30  ? 192 TYR A CD2 1 
ATOM   1172 C CE1 . TYR A 1 180 ? 38.278  6.284   -5.965  1.00 56.17  ? 192 TYR A CE1 1 
ATOM   1173 C CE2 . TYR A 1 180 ? 40.613  6.149   -6.496  1.00 56.95  ? 192 TYR A CE2 1 
ATOM   1174 C CZ  . TYR A 1 180 ? 39.554  5.839   -5.661  1.00 61.60  ? 192 TYR A CZ  1 
ATOM   1175 O OH  . TYR A 1 180 ? 39.772  5.106   -4.527  1.00 62.01  ? 192 TYR A OH  1 
ATOM   1176 N N   . ALA A 1 181 ? 38.405  9.037   -12.172 1.00 59.15  ? 193 ALA A N   1 
ATOM   1177 C CA  . ALA A 1 181 ? 38.099  10.087  -13.147 1.00 58.79  ? 193 ALA A CA  1 
ATOM   1178 C C   . ALA A 1 181 ? 37.168  9.578   -14.238 1.00 62.02  ? 193 ALA A C   1 
ATOM   1179 O O   . ALA A 1 181 ? 36.325  10.337  -14.723 1.00 60.58  ? 193 ALA A O   1 
ATOM   1180 C CB  . ALA A 1 181 ? 39.385  10.606  -13.767 1.00 61.37  ? 193 ALA A CB  1 
ATOM   1181 N N   . GLU A 1 182 ? 37.312  8.290   -14.615 1.00 59.39  ? 194 GLU A N   1 
ATOM   1182 C CA  . GLU A 1 182 ? 36.531  7.664   -15.681 1.00 58.98  ? 194 GLU A CA  1 
ATOM   1183 C C   . GLU A 1 182 ? 35.079  7.358   -15.255 1.00 61.97  ? 194 GLU A C   1 
ATOM   1184 O O   . GLU A 1 182 ? 34.240  7.146   -16.130 1.00 61.62  ? 194 GLU A O   1 
ATOM   1185 C CB  . GLU A 1 182 ? 37.215  6.376   -16.162 1.00 61.71  ? 194 GLU A CB  1 
ATOM   1186 C CG  . GLU A 1 182 ? 38.235  6.599   -17.260 1.00 74.86  ? 194 GLU A CG  1 
ATOM   1187 C CD  . GLU A 1 182 ? 39.501  5.759   -17.197 1.00 106.72 ? 194 GLU A CD  1 
ATOM   1188 O OE1 . GLU A 1 182 ? 40.593  6.368   -17.248 1.00 105.99 ? 194 GLU A OE1 1 
ATOM   1189 O OE2 . GLU A 1 182 ? 39.416  4.512   -17.098 1.00 101.17 ? 194 GLU A OE2 1 
ATOM   1190 N N   . HIS A 1 183 ? 34.775  7.343   -13.935 1.00 57.66  ? 195 HIS A N   1 
ATOM   1191 C CA  . HIS A 1 183 ? 33.459  6.941   -13.431 1.00 56.29  ? 195 HIS A CA  1 
ATOM   1192 C C   . HIS A 1 183 ? 32.942  7.925   -12.348 1.00 62.56  ? 195 HIS A C   1 
ATOM   1193 O O   . HIS A 1 183 ? 32.956  7.599   -11.162 1.00 64.15  ? 195 HIS A O   1 
ATOM   1194 C CB  . HIS A 1 183 ? 33.515  5.495   -12.893 1.00 56.90  ? 195 HIS A CB  1 
ATOM   1195 C CG  . HIS A 1 183 ? 34.009  4.503   -13.900 1.00 60.93  ? 195 HIS A CG  1 
ATOM   1196 N ND1 . HIS A 1 183 ? 33.143  3.859   -14.757 1.00 62.07  ? 195 HIS A ND1 1 
ATOM   1197 C CD2 . HIS A 1 183 ? 35.273  4.106   -14.178 1.00 63.89  ? 195 HIS A CD2 1 
ATOM   1198 C CE1 . HIS A 1 183 ? 33.898  3.082   -15.516 1.00 62.72  ? 195 HIS A CE1 1 
ATOM   1199 N NE2 . HIS A 1 183 ? 35.188  3.199   -15.204 1.00 64.22  ? 195 HIS A NE2 1 
ATOM   1200 N N   . ARG A 1 184 ? 32.487  9.124   -12.758 1.00 57.82  ? 196 ARG A N   1 
ATOM   1201 C CA  . ARG A 1 184 ? 31.978  10.144  -11.822 1.00 56.57  ? 196 ARG A CA  1 
ATOM   1202 C C   . ARG A 1 184 ? 30.471  10.458  -12.035 1.00 57.89  ? 196 ARG A C   1 
ATOM   1203 O O   . ARG A 1 184 ? 29.871  11.177  -11.226 1.00 56.04  ? 196 ARG A O   1 
ATOM   1204 C CB  . ARG A 1 184 ? 32.797  11.449  -11.917 1.00 57.27  ? 196 ARG A CB  1 
ATOM   1205 C CG  . ARG A 1 184 ? 34.210  11.354  -11.369 1.00 62.52  ? 196 ARG A CG  1 
ATOM   1206 C CD  . ARG A 1 184 ? 34.691  12.678  -10.815 1.00 69.52  ? 196 ARG A CD  1 
ATOM   1207 N NE  . ARG A 1 184 ? 36.130  12.877  -11.013 1.00 84.57  ? 196 ARG A NE  1 
ATOM   1208 C CZ  . ARG A 1 184 ? 37.083  12.462  -10.177 1.00 98.83  ? 196 ARG A CZ  1 
ATOM   1209 N NH1 . ARG A 1 184 ? 36.766  11.798  -9.069  1.00 80.20  ? 196 ARG A NH1 1 
ATOM   1210 N NH2 . ARG A 1 184 ? 38.360  12.699  -10.449 1.00 86.74  ? 196 ARG A NH2 1 
ATOM   1211 N N   . GLY A 1 185 ? 29.886  9.916   -13.105 1.00 53.93  ? 197 GLY A N   1 
ATOM   1212 C CA  . GLY A 1 185 ? 28.471  10.090  -13.404 1.00 52.12  ? 197 GLY A CA  1 
ATOM   1213 C C   . GLY A 1 185 ? 28.166  11.239  -14.340 1.00 54.49  ? 197 GLY A C   1 
ATOM   1214 O O   . GLY A 1 185 ? 29.001  12.128  -14.526 1.00 56.37  ? 197 GLY A O   1 
ATOM   1215 N N   . ARG A 1 186 ? 26.970  11.216  -14.953 1.00 47.09  ? 198 ARG A N   1 
ATOM   1216 C CA  . ARG A 1 186 ? 26.475  12.269  -15.839 1.00 45.37  ? 198 ARG A CA  1 
ATOM   1217 C C   . ARG A 1 186 ? 26.102  13.510  -15.060 1.00 49.48  ? 198 ARG A C   1 
ATOM   1218 O O   . ARG A 1 186 ? 25.400  13.414  -14.045 1.00 48.54  ? 198 ARG A O   1 
ATOM   1219 C CB  . ARG A 1 186 ? 25.222  11.787  -16.563 1.00 43.14  ? 198 ARG A CB  1 
ATOM   1220 C CG  . ARG A 1 186 ? 25.373  11.223  -17.953 1.00 47.17  ? 198 ARG A CG  1 
ATOM   1221 C CD  . ARG A 1 186 ? 23.997  10.897  -18.524 1.00 43.67  ? 198 ARG A CD  1 
ATOM   1222 N NE  . ARG A 1 186 ? 23.237  12.123  -18.722 1.00 48.94  ? 198 ARG A NE  1 
ATOM   1223 C CZ  . ARG A 1 186 ? 22.146  12.462  -18.049 1.00 61.12  ? 198 ARG A CZ  1 
ATOM   1224 N NH1 . ARG A 1 186 ? 21.625  11.632  -17.157 1.00 50.58  ? 198 ARG A NH1 1 
ATOM   1225 N NH2 . ARG A 1 186 ? 21.560  13.623  -18.269 1.00 47.00  ? 198 ARG A NH2 1 
ATOM   1226 N N   . ALA A 1 187 ? 26.564  14.683  -15.518 1.00 46.09  ? 199 ALA A N   1 
ATOM   1227 C CA  . ALA A 1 187 ? 26.045  15.963  -15.029 1.00 44.53  ? 199 ALA A CA  1 
ATOM   1228 C C   . ALA A 1 187 ? 24.646  16.210  -15.605 1.00 45.60  ? 199 ALA A C   1 
ATOM   1229 O O   . ALA A 1 187 ? 24.312  15.673  -16.664 1.00 44.03  ? 199 ALA A O   1 
ATOM   1230 C CB  . ALA A 1 187 ? 26.984  17.097  -15.409 1.00 45.89  ? 199 ALA A CB  1 
ATOM   1231 N N   . ARG A 1 188 ? 23.824  16.984  -14.886 1.00 41.49  ? 200 ARG A N   1 
ATOM   1232 C CA  . ARG A 1 188 ? 22.519  17.391  -15.377 1.00 40.64  ? 200 ARG A CA  1 
ATOM   1233 C C   . ARG A 1 188 ? 22.684  18.339  -16.580 1.00 46.33  ? 200 ARG A C   1 
ATOM   1234 O O   . ARG A 1 188 ? 23.534  19.239  -16.570 1.00 46.50  ? 200 ARG A O   1 
ATOM   1235 C CB  . ARG A 1 188 ? 21.691  18.026  -14.264 1.00 39.22  ? 200 ARG A CB  1 
ATOM   1236 C CG  . ARG A 1 188 ? 20.222  18.103  -14.597 1.00 45.23  ? 200 ARG A CG  1 
ATOM   1237 C CD  . ARG A 1 188 ? 19.460  18.833  -13.525 1.00 52.15  ? 200 ARG A CD  1 
ATOM   1238 N NE  . ARG A 1 188 ? 18.106  19.123  -13.979 1.00 62.94  ? 200 ARG A NE  1 
ATOM   1239 C CZ  . ARG A 1 188 ? 17.004  18.656  -13.401 1.00 77.20  ? 200 ARG A CZ  1 
ATOM   1240 N NH1 . ARG A 1 188 ? 17.088  17.902  -12.307 1.00 59.95  ? 200 ARG A NH1 1 
ATOM   1241 N NH2 . ARG A 1 188 ? 15.807  18.955  -13.900 1.00 57.93  ? 200 ARG A NH2 1 
ATOM   1242 N N   . ASP A 1 189 ? 21.872  18.100  -17.621 1.00 42.69  ? 201 ASP A N   1 
ATOM   1243 C CA  . ASP A 1 189 ? 21.940  18.769  -18.912 1.00 41.72  ? 201 ASP A CA  1 
ATOM   1244 C C   . ASP A 1 189 ? 21.170  20.107  -18.854 1.00 43.57  ? 201 ASP A C   1 
ATOM   1245 O O   . ASP A 1 189 ? 20.040  20.224  -19.319 1.00 43.30  ? 201 ASP A O   1 
ATOM   1246 C CB  . ASP A 1 189 ? 21.394  17.821  -19.986 1.00 43.10  ? 201 ASP A CB  1 
ATOM   1247 C CG  . ASP A 1 189 ? 21.836  18.109  -21.402 1.00 56.43  ? 201 ASP A CG  1 
ATOM   1248 O OD1 . ASP A 1 189 ? 22.244  19.262  -21.677 1.00 57.22  ? 201 ASP A OD1 1 
ATOM   1249 O OD2 . ASP A 1 189 ? 21.736  17.194  -22.248 1.00 64.57  ? 201 ASP A OD2 1 
ATOM   1250 N N   . GLU A 1 190 ? 21.811  21.114  -18.274 1.00 39.16  ? 202 GLU A N   1 
ATOM   1251 C CA  . GLU A 1 190 ? 21.282  22.458  -18.117 1.00 38.19  ? 202 GLU A CA  1 
ATOM   1252 C C   . GLU A 1 190 ? 20.953  23.136  -19.467 1.00 39.84  ? 202 GLU A C   1 
ATOM   1253 O O   . GLU A 1 190 ? 20.013  23.921  -19.521 1.00 39.40  ? 202 GLU A O   1 
ATOM   1254 C CB  . GLU A 1 190 ? 22.259  23.312  -17.299 1.00 40.43  ? 202 GLU A CB  1 
ATOM   1255 C CG  . GLU A 1 190 ? 21.675  23.752  -15.972 1.00 55.10  ? 202 GLU A CG  1 
ATOM   1256 C CD  . GLU A 1 190 ? 20.512  24.725  -16.105 1.00 87.25  ? 202 GLU A CD  1 
ATOM   1257 O OE1 . GLU A 1 190 ? 19.379  24.345  -15.725 1.00 81.94  ? 202 GLU A OE1 1 
ATOM   1258 O OE2 . GLU A 1 190 ? 20.719  25.846  -16.629 1.00 84.11  ? 202 GLU A OE2 1 
ATOM   1259 N N   . ALA A 1 191 ? 21.681  22.795  -20.550 1.00 35.51  ? 203 ALA A N   1 
ATOM   1260 C CA  . ALA A 1 191 ? 21.446  23.335  -21.899 1.00 34.30  ? 203 ALA A CA  1 
ATOM   1261 C C   . ALA A 1 191 ? 20.010  23.085  -22.367 1.00 36.14  ? 203 ALA A C   1 
ATOM   1262 O O   . ALA A 1 191 ? 19.410  23.978  -22.976 1.00 35.60  ? 203 ALA A O   1 
ATOM   1263 C CB  . ALA A 1 191 ? 22.435  22.742  -22.896 1.00 35.42  ? 203 ALA A CB  1 
ATOM   1264 N N   . GLU A 1 192 ? 19.456  21.885  -22.060 1.00 31.29  ? 204 GLU A N   1 
ATOM   1265 C CA  . GLU A 1 192 ? 18.073  21.491  -22.363 1.00 29.87  ? 204 GLU A CA  1 
ATOM   1266 C C   . GLU A 1 192 ? 17.066  22.440  -21.719 1.00 35.40  ? 204 GLU A C   1 
ATOM   1267 O O   . GLU A 1 192 ? 16.061  22.759  -22.353 1.00 36.35  ? 204 GLU A O   1 
ATOM   1268 C CB  . GLU A 1 192 ? 17.789  20.055  -21.891 1.00 30.32  ? 204 GLU A CB  1 
ATOM   1269 C CG  . GLU A 1 192 ? 18.568  18.992  -22.637 1.00 33.72  ? 204 GLU A CG  1 
ATOM   1270 C CD  . GLU A 1 192 ? 18.226  17.556  -22.294 1.00 46.53  ? 204 GLU A CD  1 
ATOM   1271 O OE1 . GLU A 1 192 ? 17.920  17.266  -21.113 1.00 34.25  ? 204 GLU A OE1 1 
ATOM   1272 O OE2 . GLU A 1 192 ? 18.307  16.707  -23.209 1.00 40.29  ? 204 GLU A OE2 1 
ATOM   1273 N N   . MET A 1 193 ? 17.329  22.888  -20.470 1.00 31.87  ? 205 MET A N   1 
ATOM   1274 C CA  . MET A 1 193 ? 16.486  23.844  -19.757 1.00 32.10  ? 205 MET A CA  1 
ATOM   1275 C C   . MET A 1 193 ? 16.605  25.238  -20.364 1.00 36.67  ? 205 MET A C   1 
ATOM   1276 O O   . MET A 1 193 ? 15.590  25.915  -20.544 1.00 37.23  ? 205 MET A O   1 
ATOM   1277 C CB  . MET A 1 193 ? 16.820  23.871  -18.252 1.00 35.06  ? 205 MET A CB  1 
ATOM   1278 C CG  . MET A 1 193 ? 15.777  24.618  -17.389 1.00 38.60  ? 205 MET A CG  1 
ATOM   1279 S SD  . MET A 1 193 ? 14.058  24.219  -17.794 1.00 41.52  ? 205 MET A SD  1 
ATOM   1280 C CE  . MET A 1 193 ? 13.897  22.679  -17.007 1.00 37.06  ? 205 MET A CE  1 
ATOM   1281 N N   . GLU A 1 194 ? 17.829  25.651  -20.701 1.00 33.62  ? 206 GLU A N   1 
ATOM   1282 C CA  . GLU A 1 194 ? 18.110  26.926  -21.367 1.00 33.54  ? 206 GLU A CA  1 
ATOM   1283 C C   . GLU A 1 194 ? 17.406  27.000  -22.713 1.00 35.24  ? 206 GLU A C   1 
ATOM   1284 O O   . GLU A 1 194 ? 16.883  28.057  -23.062 1.00 35.32  ? 206 GLU A O   1 
ATOM   1285 C CB  . GLU A 1 194 ? 19.624  27.135  -21.534 1.00 36.17  ? 206 GLU A CB  1 
ATOM   1286 C CG  . GLU A 1 194 ? 20.390  27.339  -20.233 1.00 49.71  ? 206 GLU A CG  1 
ATOM   1287 C CD  . GLU A 1 194 ? 19.855  28.439  -19.332 1.00 84.24  ? 206 GLU A CD  1 
ATOM   1288 O OE1 . GLU A 1 194 ? 19.815  29.611  -19.774 1.00 79.18  ? 206 GLU A OE1 1 
ATOM   1289 O OE2 . GLU A 1 194 ? 19.450  28.121  -18.190 1.00 85.69  ? 206 GLU A OE2 1 
ATOM   1290 N N   . TYR A 1 195 ? 17.376  25.869  -23.455 1.00 31.44  ? 207 TYR A N   1 
ATOM   1291 C CA  . TYR A 1 195 ? 16.642  25.697  -24.717 1.00 29.86  ? 207 TYR A CA  1 
ATOM   1292 C C   . TYR A 1 195 ? 15.156  25.936  -24.497 1.00 33.03  ? 207 TYR A C   1 
ATOM   1293 O O   . TYR A 1 195 ? 14.560  26.759  -25.199 1.00 32.13  ? 207 TYR A O   1 
ATOM   1294 C CB  . TYR A 1 195 ? 16.876  24.291  -25.297 1.00 30.14  ? 207 TYR A CB  1 
ATOM   1295 C CG  . TYR A 1 195 ? 16.394  24.116  -26.726 1.00 30.89  ? 207 TYR A CG  1 
ATOM   1296 C CD1 . TYR A 1 195 ? 15.056  23.831  -27.007 1.00 31.53  ? 207 TYR A CD1 1 
ATOM   1297 C CD2 . TYR A 1 195 ? 17.283  24.170  -27.793 1.00 31.59  ? 207 TYR A CD2 1 
ATOM   1298 C CE1 . TYR A 1 195 ? 14.608  23.665  -28.317 1.00 29.94  ? 207 TYR A CE1 1 
ATOM   1299 C CE2 . TYR A 1 195 ? 16.848  23.996  -29.105 1.00 32.83  ? 207 TYR A CE2 1 
ATOM   1300 C CZ  . TYR A 1 195 ? 15.508  23.742  -29.362 1.00 37.64  ? 207 TYR A CZ  1 
ATOM   1301 O OH  . TYR A 1 195 ? 15.080  23.565  -30.656 1.00 36.98  ? 207 TYR A OH  1 
ATOM   1302 N N   . LEU A 1 196 ? 14.561  25.246  -23.497 1.00 29.93  ? 208 LEU A N   1 
ATOM   1303 C CA  . LEU A 1 196 ? 13.116  25.303  -23.251 1.00 28.57  ? 208 LEU A CA  1 
ATOM   1304 C C   . LEU A 1 196 ? 12.675  26.692  -22.797 1.00 33.60  ? 208 LEU A C   1 
ATOM   1305 O O   . LEU A 1 196 ? 11.577  27.109  -23.151 1.00 34.35  ? 208 LEU A O   1 
ATOM   1306 C CB  . LEU A 1 196 ? 12.674  24.238  -22.245 1.00 27.67  ? 208 LEU A CB  1 
ATOM   1307 C CG  . LEU A 1 196 ? 12.738  22.781  -22.731 1.00 30.77  ? 208 LEU A CG  1 
ATOM   1308 C CD1 . LEU A 1 196 ? 12.678  21.810  -21.549 1.00 29.91  ? 208 LEU A CD1 1 
ATOM   1309 C CD2 . LEU A 1 196 ? 11.669  22.484  -23.800 1.00 31.58  ? 208 LEU A CD2 1 
ATOM   1310 N N   . LYS A 1 197 ? 13.536  27.419  -22.065 1.00 30.50  ? 209 LYS A N   1 
ATOM   1311 C CA  . LYS A 1 197 ? 13.263  28.772  -21.576 1.00 30.71  ? 209 LYS A CA  1 
ATOM   1312 C C   . LYS A 1 197 ? 13.153  29.787  -22.726 1.00 36.92  ? 209 LYS A C   1 
ATOM   1313 O O   . LYS A 1 197 ? 12.331  30.708  -22.646 1.00 38.63  ? 209 LYS A O   1 
ATOM   1314 C CB  . LYS A 1 197 ? 14.345  29.204  -20.588 1.00 33.73  ? 209 LYS A CB  1 
ATOM   1315 C CG  . LYS A 1 197 ? 14.107  28.661  -19.185 1.00 45.53  ? 209 LYS A CG  1 
ATOM   1316 C CD  . LYS A 1 197 ? 15.396  28.492  -18.388 1.00 48.49  ? 209 LYS A CD  1 
ATOM   1317 C CE  . LYS A 1 197 ? 15.927  29.757  -17.783 1.00 55.13  ? 209 LYS A CE  1 
ATOM   1318 N NZ  . LYS A 1 197 ? 17.194  29.505  -17.056 1.00 67.12  ? 209 LYS A NZ  1 
ATOM   1319 N N   . ILE A 1 198 ? 13.970  29.621  -23.786 1.00 32.25  ? 210 ILE A N   1 
ATOM   1320 C CA  . ILE A 1 198 ? 13.861  30.427  -25.006 1.00 31.89  ? 210 ILE A CA  1 
ATOM   1321 C C   . ILE A 1 198 ? 12.604  29.990  -25.764 1.00 35.45  ? 210 ILE A C   1 
ATOM   1322 O O   . ILE A 1 198 ? 11.798  30.845  -26.132 1.00 36.09  ? 210 ILE A O   1 
ATOM   1323 C CB  . ILE A 1 198 ? 15.143  30.361  -25.901 1.00 35.25  ? 210 ILE A CB  1 
ATOM   1324 C CG1 . ILE A 1 198 ? 16.375  30.930  -25.171 1.00 36.02  ? 210 ILE A CG1 1 
ATOM   1325 C CG2 . ILE A 1 198 ? 14.929  31.076  -27.259 1.00 35.80  ? 210 ILE A CG2 1 
ATOM   1326 C CD1 . ILE A 1 198 ? 17.705  30.514  -25.744 1.00 42.36  ? 210 ILE A CD1 1 
ATOM   1327 N N   . ALA A 1 199 ? 12.433  28.666  -25.975 1.00 31.08  ? 211 ALA A N   1 
ATOM   1328 C CA  . ALA A 1 199 ? 11.340  28.101  -26.775 1.00 30.49  ? 211 ALA A CA  1 
ATOM   1329 C C   . ALA A 1 199 ? 9.968   28.481  -26.225 1.00 34.60  ? 211 ALA A C   1 
ATOM   1330 O O   . ALA A 1 199 ? 9.100   28.842  -27.015 1.00 34.55  ? 211 ALA A O   1 
ATOM   1331 C CB  . ALA A 1 199 ? 11.466  26.589  -26.861 1.00 30.60  ? 211 ALA A CB  1 
ATOM   1332 N N   . GLN A 1 200 ? 9.784   28.460  -24.886 1.00 31.47  ? 212 GLN A N   1 
ATOM   1333 C CA  . GLN A 1 200 ? 8.481   28.702  -24.254 1.00 31.06  ? 212 GLN A CA  1 
ATOM   1334 C C   . GLN A 1 200 ? 7.981   30.153  -24.448 1.00 38.78  ? 212 GLN A C   1 
ATOM   1335 O O   . GLN A 1 200 ? 6.777   30.401  -24.284 1.00 39.18  ? 212 GLN A O   1 
ATOM   1336 C CB  . GLN A 1 200 ? 8.482   28.324  -22.763 1.00 31.39  ? 212 GLN A CB  1 
ATOM   1337 C CG  . GLN A 1 200 ? 9.263   29.283  -21.862 1.00 33.47  ? 212 GLN A CG  1 
ATOM   1338 C CD  . GLN A 1 200 ? 9.329   28.855  -20.426 1.00 42.94  ? 212 GLN A CD  1 
ATOM   1339 O OE1 . GLN A 1 200 ? 8.703   27.870  -20.008 1.00 38.27  ? 212 GLN A OE1 1 
ATOM   1340 N NE2 . GLN A 1 200 ? 10.096  29.597  -19.636 1.00 25.25  ? 212 GLN A NE2 1 
ATOM   1341 N N   . ASP A 1 201 ? 8.894   31.087  -24.805 1.00 36.46  ? 213 ASP A N   1 
ATOM   1342 C CA  . ASP A 1 201 ? 8.569   32.491  -25.076 1.00 36.98  ? 213 ASP A CA  1 
ATOM   1343 C C   . ASP A 1 201 ? 8.127   32.710  -26.534 1.00 40.31  ? 213 ASP A C   1 
ATOM   1344 O O   . ASP A 1 201 ? 7.798   33.839  -26.903 1.00 41.47  ? 213 ASP A O   1 
ATOM   1345 C CB  . ASP A 1 201 ? 9.772   33.392  -24.745 1.00 39.92  ? 213 ASP A CB  1 
ATOM   1346 C CG  . ASP A 1 201 ? 10.046  33.587  -23.261 1.00 54.57  ? 213 ASP A CG  1 
ATOM   1347 O OD1 . ASP A 1 201 ? 9.171   33.217  -22.435 1.00 54.13  ? 213 ASP A OD1 1 
ATOM   1348 O OD2 . ASP A 1 201 ? 11.125  34.132  -22.923 1.00 63.71  ? 213 ASP A OD2 1 
ATOM   1349 N N   . LEU A 1 202 ? 8.125   31.649  -27.360 1.00 34.78  ? 214 LEU A N   1 
ATOM   1350 C CA  . LEU A 1 202 ? 7.670   31.741  -28.744 1.00 33.65  ? 214 LEU A CA  1 
ATOM   1351 C C   . LEU A 1 202 ? 6.163   31.652  -28.779 1.00 36.77  ? 214 LEU A C   1 
ATOM   1352 O O   . LEU A 1 202 ? 5.586   30.804  -28.105 1.00 35.69  ? 214 LEU A O   1 
ATOM   1353 C CB  . LEU A 1 202 ? 8.313   30.660  -29.631 1.00 33.19  ? 214 LEU A CB  1 
ATOM   1354 C CG  . LEU A 1 202 ? 9.834   30.712  -29.727 1.00 37.36  ? 214 LEU A CG  1 
ATOM   1355 C CD1 . LEU A 1 202 ? 10.373  29.438  -30.288 1.00 37.18  ? 214 LEU A CD1 1 
ATOM   1356 C CD2 . LEU A 1 202 ? 10.298  31.901  -30.534 1.00 39.10  ? 214 LEU A CD2 1 
ATOM   1357 N N   . GLU A 1 203 ? 5.527   32.527  -29.566 1.00 34.65  ? 215 GLU A N   1 
ATOM   1358 C CA  . GLU A 1 203 ? 4.070   32.693  -29.610 1.00 34.95  ? 215 GLU A CA  1 
ATOM   1359 C C   . GLU A 1 203 ? 3.333   31.370  -29.900 1.00 38.30  ? 215 GLU A C   1 
ATOM   1360 O O   . GLU A 1 203 ? 2.274   31.145  -29.330 1.00 37.76  ? 215 GLU A O   1 
ATOM   1361 C CB  . GLU A 1 203 ? 3.685   33.759  -30.650 1.00 36.78  ? 215 GLU A CB  1 
ATOM   1362 C CG  . GLU A 1 203 ? 4.095   35.168  -30.244 1.00 48.33  ? 215 GLU A CG  1 
ATOM   1363 C CD  . GLU A 1 203 ? 4.144   36.181  -31.369 1.00 66.60  ? 215 GLU A CD  1 
ATOM   1364 O OE1 . GLU A 1 203 ? 5.012   36.039  -32.262 1.00 54.97  ? 215 GLU A OE1 1 
ATOM   1365 O OE2 . GLU A 1 203 ? 3.325   37.129  -31.346 1.00 60.31  ? 215 GLU A OE2 1 
ATOM   1366 N N   . MET A 1 204 ? 3.918   30.489  -30.741 1.00 34.20  ? 216 MET A N   1 
ATOM   1367 C CA  . MET A 1 204 ? 3.300   29.243  -31.200 1.00 33.03  ? 216 MET A CA  1 
ATOM   1368 C C   . MET A 1 204 ? 3.597   28.042  -30.296 1.00 37.86  ? 216 MET A C   1 
ATOM   1369 O O   . MET A 1 204 ? 3.039   26.966  -30.520 1.00 39.11  ? 216 MET A O   1 
ATOM   1370 C CB  . MET A 1 204 ? 3.747   28.914  -32.628 1.00 35.03  ? 216 MET A CB  1 
ATOM   1371 C CG  . MET A 1 204 ? 3.124   29.800  -33.650 1.00 38.25  ? 216 MET A CG  1 
ATOM   1372 S SD  . MET A 1 204 ? 3.462   29.217  -35.305 1.00 42.00  ? 216 MET A SD  1 
ATOM   1373 C CE  . MET A 1 204 ? 2.348   27.889  -35.436 1.00 37.94  ? 216 MET A CE  1 
ATOM   1374 N N   . TYR A 1 205 ? 4.458   28.213  -29.288 1.00 33.56  ? 217 TYR A N   1 
ATOM   1375 C CA  . TYR A 1 205 ? 4.858   27.143  -28.372 1.00 31.99  ? 217 TYR A CA  1 
ATOM   1376 C C   . TYR A 1 205 ? 3.666   26.636  -27.542 1.00 35.58  ? 217 TYR A C   1 
ATOM   1377 O O   . TYR A 1 205 ? 2.966   27.430  -26.898 1.00 35.53  ? 217 TYR A O   1 
ATOM   1378 C CB  . TYR A 1 205 ? 5.972   27.655  -27.451 1.00 32.06  ? 217 TYR A CB  1 
ATOM   1379 C CG  . TYR A 1 205 ? 6.362   26.712  -26.336 1.00 31.07  ? 217 TYR A CG  1 
ATOM   1380 C CD1 . TYR A 1 205 ? 5.705   26.747  -25.102 1.00 32.38  ? 217 TYR A CD1 1 
ATOM   1381 C CD2 . TYR A 1 205 ? 7.435   25.843  -26.480 1.00 30.17  ? 217 TYR A CD2 1 
ATOM   1382 C CE1 . TYR A 1 205 ? 6.073   25.896  -24.065 1.00 31.81  ? 217 TYR A CE1 1 
ATOM   1383 C CE2 . TYR A 1 205 ? 7.827   25.007  -25.439 1.00 30.85  ? 217 TYR A CE2 1 
ATOM   1384 C CZ  . TYR A 1 205 ? 7.150   25.047  -24.230 1.00 37.91  ? 217 TYR A CZ  1 
ATOM   1385 O OH  . TYR A 1 205 ? 7.539   24.243  -23.200 1.00 41.27  ? 217 TYR A OH  1 
ATOM   1386 N N   . GLY A 1 206 ? 3.459   25.321  -27.577 1.00 31.14  ? 218 GLY A N   1 
ATOM   1387 C CA  . GLY A 1 206 ? 2.457   24.639  -26.762 1.00 30.22  ? 218 GLY A CA  1 
ATOM   1388 C C   . GLY A 1 206 ? 1.013   24.951  -27.096 1.00 33.48  ? 218 GLY A C   1 
ATOM   1389 O O   . GLY A 1 206 ? 0.112   24.660  -26.294 1.00 33.66  ? 218 GLY A O   1 
ATOM   1390 N N   . VAL A 1 207 ? 0.779   25.535  -28.285 1.00 28.92  ? 219 VAL A N   1 
ATOM   1391 C CA  . VAL A 1 207 ? -0.566  25.866  -28.758 1.00 28.09  ? 219 VAL A CA  1 
ATOM   1392 C C   . VAL A 1 207 ? -1.016  24.750  -29.679 1.00 32.32  ? 219 VAL A C   1 
ATOM   1393 O O   . VAL A 1 207 ? -0.280  24.369  -30.583 1.00 32.62  ? 219 VAL A O   1 
ATOM   1394 C CB  . VAL A 1 207 ? -0.663  27.269  -29.436 1.00 30.73  ? 219 VAL A CB  1 
ATOM   1395 C CG1 . VAL A 1 207 ? -2.090  27.580  -29.869 1.00 30.83  ? 219 VAL A CG1 1 
ATOM   1396 C CG2 . VAL A 1 207 ? -0.139  28.372  -28.524 1.00 29.43  ? 219 VAL A CG2 1 
ATOM   1397 N N   . ASN A 1 208 ? -2.206  24.198  -29.417 1.00 29.47  ? 220 ASN A N   1 
ATOM   1398 C CA  . ASN A 1 208 ? -2.883  23.239  -30.289 1.00 28.98  ? 220 ASN A CA  1 
ATOM   1399 C C   . ASN A 1 208 ? -3.834  23.999  -31.203 1.00 33.98  ? 220 ASN A C   1 
ATOM   1400 O O   . ASN A 1 208 ? -4.743  24.684  -30.710 1.00 34.58  ? 220 ASN A O   1 
ATOM   1401 C CB  . ASN A 1 208 ? -3.648  22.217  -29.453 1.00 27.88  ? 220 ASN A CB  1 
ATOM   1402 C CG  . ASN A 1 208 ? -2.799  21.438  -28.501 1.00 38.21  ? 220 ASN A CG  1 
ATOM   1403 O OD1 . ASN A 1 208 ? -2.175  20.431  -28.872 1.00 26.49  ? 220 ASN A OD1 1 
ATOM   1404 N ND2 . ASN A 1 208 ? -2.801  21.870  -27.244 1.00 30.06  ? 220 ASN A ND2 1 
ATOM   1405 N N   . TYR A 1 209 ? -3.621  23.904  -32.526 1.00 28.92  ? 221 TYR A N   1 
ATOM   1406 C CA  . TYR A 1 209 ? -4.428  24.627  -33.503 1.00 27.49  ? 221 TYR A CA  1 
ATOM   1407 C C   . TYR A 1 209 ? -5.438  23.732  -34.174 1.00 33.49  ? 221 TYR A C   1 
ATOM   1408 O O   . TYR A 1 209 ? -5.129  22.588  -34.547 1.00 35.62  ? 221 TYR A O   1 
ATOM   1409 C CB  . TYR A 1 209 ? -3.559  25.284  -34.570 1.00 27.66  ? 221 TYR A CB  1 
ATOM   1410 C CG  . TYR A 1 209 ? -2.641  26.359  -34.040 1.00 26.97  ? 221 TYR A CG  1 
ATOM   1411 C CD1 . TYR A 1 209 ? -3.057  27.689  -33.967 1.00 28.36  ? 221 TYR A CD1 1 
ATOM   1412 C CD2 . TYR A 1 209 ? -1.331  26.064  -33.678 1.00 26.18  ? 221 TYR A CD2 1 
ATOM   1413 C CE1 . TYR A 1 209 ? -2.201  28.689  -33.507 1.00 27.52  ? 221 TYR A CE1 1 
ATOM   1414 C CE2 . TYR A 1 209 ? -0.471  27.053  -33.209 1.00 26.38  ? 221 TYR A CE2 1 
ATOM   1415 C CZ  . TYR A 1 209 ? -0.906  28.365  -33.137 1.00 31.98  ? 221 TYR A CZ  1 
ATOM   1416 O OH  . TYR A 1 209 ? -0.044  29.326  -32.682 1.00 30.33  ? 221 TYR A OH  1 
ATOM   1417 N N   . PHE A 1 210 ? -6.652  24.271  -34.360 1.00 28.81  ? 222 PHE A N   1 
ATOM   1418 C CA  . PHE A 1 210 ? -7.761  23.560  -34.985 1.00 28.12  ? 222 PHE A CA  1 
ATOM   1419 C C   . PHE A 1 210 ? -8.473  24.488  -35.926 1.00 32.48  ? 222 PHE A C   1 
ATOM   1420 O O   . PHE A 1 210 ? -8.731  25.632  -35.567 1.00 33.30  ? 222 PHE A O   1 
ATOM   1421 C CB  . PHE A 1 210 ? -8.722  23.011  -33.913 1.00 29.60  ? 222 PHE A CB  1 
ATOM   1422 C CG  . PHE A 1 210 ? -8.043  22.109  -32.905 1.00 30.27  ? 222 PHE A CG  1 
ATOM   1423 C CD1 . PHE A 1 210 ? -7.801  20.769  -33.195 1.00 32.80  ? 222 PHE A CD1 1 
ATOM   1424 C CD2 . PHE A 1 210 ? -7.614  22.607  -31.682 1.00 31.32  ? 222 PHE A CD2 1 
ATOM   1425 C CE1 . PHE A 1 210 ? -7.180  19.933  -32.261 1.00 32.84  ? 222 PHE A CE1 1 
ATOM   1426 C CE2 . PHE A 1 210 ? -6.979  21.775  -30.756 1.00 33.04  ? 222 PHE A CE2 1 
ATOM   1427 C CZ  . PHE A 1 210 ? -6.766  20.446  -31.051 1.00 31.08  ? 222 PHE A CZ  1 
ATOM   1428 N N   . ALA A 1 211 ? -8.769  24.016  -37.145 1.00 28.87  ? 223 ALA A N   1 
ATOM   1429 C CA  . ALA A 1 211 ? -9.567  24.794  -38.094 1.00 28.79  ? 223 ALA A CA  1 
ATOM   1430 C C   . ALA A 1 211 ? -11.004 24.832  -37.615 1.00 34.87  ? 223 ALA A C   1 
ATOM   1431 O O   . ALA A 1 211 ? -11.558 23.788  -37.261 1.00 33.49  ? 223 ALA A O   1 
ATOM   1432 C CB  . ALA A 1 211 ? -9.473  24.208  -39.500 1.00 29.39  ? 223 ALA A CB  1 
ATOM   1433 N N   . ILE A 1 212 ? -11.575 26.055  -37.540 1.00 33.68  ? 224 ILE A N   1 
ATOM   1434 C CA  . ILE A 1 212 ? -12.939 26.338  -37.073 1.00 34.40  ? 224 ILE A CA  1 
ATOM   1435 C C   . ILE A 1 212 ? -13.626 27.357  -37.981 1.00 41.96  ? 224 ILE A C   1 
ATOM   1436 O O   . ILE A 1 212 ? -12.973 28.098  -38.728 1.00 41.56  ? 224 ILE A O   1 
ATOM   1437 C CB  . ILE A 1 212 ? -12.989 26.830  -35.595 1.00 36.75  ? 224 ILE A CB  1 
ATOM   1438 C CG1 . ILE A 1 212 ? -12.290 28.206  -35.416 1.00 36.43  ? 224 ILE A CG1 1 
ATOM   1439 C CG2 . ILE A 1 212 ? -12.426 25.776  -34.645 1.00 38.09  ? 224 ILE A CG2 1 
ATOM   1440 C CD1 . ILE A 1 212 ? -12.828 29.120  -34.339 1.00 43.88  ? 224 ILE A CD1 1 
ATOM   1441 N N   . ARG A 1 213 ? -14.958 27.404  -37.879 1.00 40.04  ? 225 ARG A N   1 
ATOM   1442 C CA  . ARG A 1 213 ? -15.791 28.412  -38.517 1.00 39.81  ? 225 ARG A CA  1 
ATOM   1443 C C   . ARG A 1 213 ? -16.666 29.057  -37.460 1.00 44.71  ? 225 ARG A C   1 
ATOM   1444 O O   . ARG A 1 213 ? -17.205 28.349  -36.611 1.00 44.80  ? 225 ARG A O   1 
ATOM   1445 C CB  . ARG A 1 213 ? -16.636 27.781  -39.634 1.00 37.58  ? 225 ARG A CB  1 
ATOM   1446 C CG  . ARG A 1 213 ? -16.044 27.978  -41.013 1.00 43.90  ? 225 ARG A CG  1 
ATOM   1447 C CD  . ARG A 1 213 ? -16.785 27.200  -42.086 1.00 44.66  ? 225 ARG A CD  1 
ATOM   1448 N NE  . ARG A 1 213 ? -16.290 25.825  -42.171 1.00 52.94  ? 225 ARG A NE  1 
ATOM   1449 C CZ  . ARG A 1 213 ? -15.684 25.294  -43.229 1.00 62.04  ? 225 ARG A CZ  1 
ATOM   1450 N NH1 . ARG A 1 213 ? -15.539 25.997  -44.345 1.00 51.52  ? 225 ARG A NH1 1 
ATOM   1451 N NH2 . ARG A 1 213 ? -15.232 24.050  -43.184 1.00 42.48  ? 225 ARG A NH2 1 
ATOM   1452 N N   . ASN A 1 214 ? -16.787 30.388  -37.474 1.00 41.09  ? 226 ASN A N   1 
ATOM   1453 C CA  . ASN A 1 214 ? -17.705 31.079  -36.575 1.00 41.54  ? 226 ASN A CA  1 
ATOM   1454 C C   . ASN A 1 214 ? -19.152 30.969  -37.121 1.00 49.89  ? 226 ASN A C   1 
ATOM   1455 O O   . ASN A 1 214 ? -19.353 30.361  -38.173 1.00 51.38  ? 226 ASN A O   1 
ATOM   1456 C CB  . ASN A 1 214 ? -17.272 32.544  -36.372 1.00 38.56  ? 226 ASN A CB  1 
ATOM   1457 C CG  . ASN A 1 214 ? -17.441 33.477  -37.555 1.00 48.11  ? 226 ASN A CG  1 
ATOM   1458 O OD1 . ASN A 1 214 ? -18.191 33.221  -38.510 1.00 36.03  ? 226 ASN A OD1 1 
ATOM   1459 N ND2 . ASN A 1 214 ? -16.777 34.620  -37.481 1.00 35.18  ? 226 ASN A ND2 1 
ATOM   1460 N N   . LYS A 1 215 ? -20.139 31.585  -36.439 1.00 47.88  ? 227 LYS A N   1 
ATOM   1461 C CA  . LYS A 1 215 ? -21.550 31.514  -36.825 1.00 49.02  ? 227 LYS A CA  1 
ATOM   1462 C C   . LYS A 1 215 ? -21.835 32.181  -38.185 1.00 54.29  ? 227 LYS A C   1 
ATOM   1463 O O   . LYS A 1 215 ? -22.754 31.747  -38.867 1.00 55.66  ? 227 LYS A O   1 
ATOM   1464 C CB  . LYS A 1 215 ? -22.440 32.111  -35.728 1.00 51.85  ? 227 LYS A CB  1 
ATOM   1465 C CG  . LYS A 1 215 ? -22.687 31.141  -34.565 1.00 63.16  ? 227 LYS A CG  1 
ATOM   1466 C CD  . LYS A 1 215 ? -24.034 30.422  -34.724 1.00 76.34  ? 227 LYS A CD  1 
ATOM   1467 C CE  . LYS A 1 215 ? -24.206 29.241  -33.799 1.00 91.37  ? 227 LYS A CE  1 
ATOM   1468 N NZ  . LYS A 1 215 ? -25.457 28.486  -34.087 1.00 99.32  ? 227 LYS A NZ  1 
ATOM   1469 N N   . LYS A 1 216 ? -21.049 33.198  -38.589 1.00 50.95  ? 228 LYS A N   1 
ATOM   1470 C CA  . LYS A 1 216 ? -21.137 33.835  -39.922 1.00 51.03  ? 228 LYS A CA  1 
ATOM   1471 C C   . LYS A 1 216 ? -20.463 32.982  -41.027 1.00 53.71  ? 228 LYS A C   1 
ATOM   1472 O O   . LYS A 1 216 ? -20.566 33.328  -42.201 1.00 54.40  ? 228 LYS A O   1 
ATOM   1473 C CB  . LYS A 1 216 ? -20.492 35.237  -39.914 1.00 53.49  ? 228 LYS A CB  1 
ATOM   1474 C CG  . LYS A 1 216 ? -21.309 36.313  -39.218 1.00 74.65  ? 228 LYS A CG  1 
ATOM   1475 C CD  . LYS A 1 216 ? -20.513 37.611  -39.095 1.00 89.48  ? 228 LYS A CD  1 
ATOM   1476 C CE  . LYS A 1 216 ? -21.272 38.685  -38.353 1.00 107.50 ? 228 LYS A CE  1 
ATOM   1477 N NZ  . LYS A 1 216 ? -21.290 38.449  -36.881 1.00 118.98 ? 228 LYS A NZ  1 
ATOM   1478 N N   . GLY A 1 217 ? -19.770 31.908  -40.642 1.00 47.85  ? 229 GLY A N   1 
ATOM   1479 C CA  . GLY A 1 217 ? -19.116 30.990  -41.569 1.00 46.89  ? 229 GLY A CA  1 
ATOM   1480 C C   . GLY A 1 217 ? -17.708 31.402  -41.960 1.00 50.08  ? 229 GLY A C   1 
ATOM   1481 O O   . GLY A 1 217 ? -17.107 30.791  -42.858 1.00 49.96  ? 229 GLY A O   1 
ATOM   1482 N N   . THR A 1 218 ? -17.189 32.484  -41.313 1.00 44.34  ? 230 THR A N   1 
ATOM   1483 C CA  . THR A 1 218 ? -15.801 32.936  -41.414 1.00 41.47  ? 230 THR A CA  1 
ATOM   1484 C C   . THR A 1 218 ? -14.892 31.837  -40.864 1.00 41.71  ? 230 THR A C   1 
ATOM   1485 O O   . THR A 1 218 ? -15.108 31.353  -39.753 1.00 40.24  ? 230 THR A O   1 
ATOM   1486 C CB  . THR A 1 218 ? -15.611 34.283  -40.678 1.00 45.76  ? 230 THR A CB  1 
ATOM   1487 O OG1 . THR A 1 218 ? -16.484 35.258  -41.245 1.00 51.52  ? 230 THR A OG1 1 
ATOM   1488 C CG2 . THR A 1 218 ? -14.169 34.800  -40.727 1.00 38.79  ? 230 THR A CG2 1 
ATOM   1489 N N   . GLU A 1 219 ? -13.889 31.444  -41.669 1.00 36.58  ? 231 GLU A N   1 
ATOM   1490 C CA  . GLU A 1 219 ? -12.845 30.497  -41.316 1.00 34.12  ? 231 GLU A CA  1 
ATOM   1491 C C   . GLU A 1 219 ? -11.854 31.141  -40.370 1.00 39.46  ? 231 GLU A C   1 
ATOM   1492 O O   . GLU A 1 219 ? -11.370 32.246  -40.625 1.00 39.37  ? 231 GLU A O   1 
ATOM   1493 C CB  . GLU A 1 219 ? -12.146 29.986  -42.577 1.00 34.62  ? 231 GLU A CB  1 
ATOM   1494 C CG  . GLU A 1 219 ? -13.034 29.072  -43.402 1.00 37.77  ? 231 GLU A CG  1 
ATOM   1495 C CD  . GLU A 1 219 ? -12.417 28.504  -44.657 1.00 45.18  ? 231 GLU A CD  1 
ATOM   1496 O OE1 . GLU A 1 219 ? -11.186 28.619  -44.843 1.00 48.76  ? 231 GLU A OE1 1 
ATOM   1497 O OE2 . GLU A 1 219 ? -13.172 27.887  -45.437 1.00 34.63  ? 231 GLU A OE2 1 
ATOM   1498 N N   . LEU A 1 220 ? -11.564 30.446  -39.262 1.00 36.18  ? 232 LEU A N   1 
ATOM   1499 C CA  . LEU A 1 220 ? -10.629 30.883  -38.223 1.00 34.80  ? 232 LEU A CA  1 
ATOM   1500 C C   . LEU A 1 220 ? -9.855  29.687  -37.717 1.00 37.54  ? 232 LEU A C   1 
ATOM   1501 O O   . LEU A 1 220 ? -10.073 28.564  -38.176 1.00 38.17  ? 232 LEU A O   1 
ATOM   1502 C CB  . LEU A 1 220 ? -11.392 31.562  -37.043 1.00 35.04  ? 232 LEU A CB  1 
ATOM   1503 C CG  . LEU A 1 220 ? -12.251 32.798  -37.361 1.00 40.19  ? 232 LEU A CG  1 
ATOM   1504 C CD1 . LEU A 1 220 ? -13.385 32.932  -36.378 1.00 40.53  ? 232 LEU A CD1 1 
ATOM   1505 C CD2 . LEU A 1 220 ? -11.398 34.072  -37.449 1.00 41.30  ? 232 LEU A CD2 1 
ATOM   1506 N N   . LEU A 1 221 ? -8.959  29.929  -36.761 1.00 32.62  ? 233 LEU A N   1 
ATOM   1507 C CA  . LEU A 1 221 ? -8.267  28.906  -35.996 1.00 31.43  ? 233 LEU A CA  1 
ATOM   1508 C C   . LEU A 1 221 ? -8.588  29.032  -34.516 1.00 36.39  ? 233 LEU A C   1 
ATOM   1509 O O   . LEU A 1 221 ? -8.755  30.142  -34.005 1.00 35.35  ? 233 LEU A O   1 
ATOM   1510 C CB  . LEU A 1 221 ? -6.749  28.986  -36.191 1.00 30.66  ? 233 LEU A CB  1 
ATOM   1511 C CG  . LEU A 1 221 ? -6.196  28.675  -37.580 1.00 35.30  ? 233 LEU A CG  1 
ATOM   1512 C CD1 . LEU A 1 221 ? -4.766  29.118  -37.672 1.00 34.74  ? 233 LEU A CD1 1 
ATOM   1513 C CD2 . LEU A 1 221 ? -6.295  27.191  -37.910 1.00 36.63  ? 233 LEU A CD2 1 
ATOM   1514 N N   . LEU A 1 222 ? -8.674  27.884  -33.832 1.00 34.09  ? 234 LEU A N   1 
ATOM   1515 C CA  . LEU A 1 222 ? -8.756  27.812  -32.384 1.00 32.91  ? 234 LEU A CA  1 
ATOM   1516 C C   . LEU A 1 222 ? -7.418  27.363  -31.848 1.00 36.86  ? 234 LEU A C   1 
ATOM   1517 O O   . LEU A 1 222 ? -6.891  26.354  -32.291 1.00 37.46  ? 234 LEU A O   1 
ATOM   1518 C CB  . LEU A 1 222 ? -9.883  26.856  -31.944 1.00 32.75  ? 234 LEU A CB  1 
ATOM   1519 C CG  . LEU A 1 222 ? -9.965  26.522  -30.454 1.00 35.47  ? 234 LEU A CG  1 
ATOM   1520 C CD1 . LEU A 1 222 ? -10.630 27.647  -29.665 1.00 35.09  ? 234 LEU A CD1 1 
ATOM   1521 C CD2 . LEU A 1 222 ? -10.682 25.214  -30.236 1.00 36.24  ? 234 LEU A CD2 1 
ATOM   1522 N N   . GLY A 1 223 ? -6.872  28.136  -30.920 1.00 33.61  ? 235 GLY A N   1 
ATOM   1523 C CA  . GLY A 1 223 ? -5.709  27.749  -30.138 1.00 32.35  ? 235 GLY A CA  1 
ATOM   1524 C C   . GLY A 1 223 ? -6.099  27.298  -28.746 1.00 34.90  ? 235 GLY A C   1 
ATOM   1525 O O   . GLY A 1 223 ? -6.719  28.060  -28.007 1.00 33.94  ? 235 GLY A O   1 
ATOM   1526 N N   . VAL A 1 224 ? -5.767  26.038  -28.397 1.00 30.86  ? 236 VAL A N   1 
ATOM   1527 C CA  . VAL A 1 224 ? -5.914  25.513  -27.040 1.00 30.55  ? 236 VAL A CA  1 
ATOM   1528 C C   . VAL A 1 224 ? -4.515  25.383  -26.437 1.00 34.55  ? 236 VAL A C   1 
ATOM   1529 O O   . VAL A 1 224 ? -3.687  24.626  -26.961 1.00 34.31  ? 236 VAL A O   1 
ATOM   1530 C CB  . VAL A 1 224 ? -6.708  24.172  -26.964 1.00 34.95  ? 236 VAL A CB  1 
ATOM   1531 C CG1 . VAL A 1 224 ? -7.019  23.802  -25.516 1.00 34.81  ? 236 VAL A CG1 1 
ATOM   1532 C CG2 . VAL A 1 224 ? -7.995  24.215  -27.793 1.00 35.01  ? 236 VAL A CG2 1 
ATOM   1533 N N   . ASP A 1 225 ? -4.248  26.144  -25.349 1.00 31.65  ? 237 ASP A N   1 
ATOM   1534 C CA  . ASP A 1 225 ? -2.965  26.106  -24.640 1.00 30.95  ? 237 ASP A CA  1 
ATOM   1535 C C   . ASP A 1 225 ? -3.142  26.287  -23.117 1.00 36.17  ? 237 ASP A C   1 
ATOM   1536 O O   . ASP A 1 225 ? -4.284  26.338  -22.618 1.00 35.91  ? 237 ASP A O   1 
ATOM   1537 C CB  . ASP A 1 225 ? -1.971  27.150  -25.217 1.00 32.01  ? 237 ASP A CB  1 
ATOM   1538 C CG  . ASP A 1 225 ? -2.218  28.624  -24.949 1.00 39.03  ? 237 ASP A CG  1 
ATOM   1539 O OD1 . ASP A 1 225 ? -3.127  28.944  -24.164 1.00 39.41  ? 237 ASP A OD1 1 
ATOM   1540 O OD2 . ASP A 1 225 ? -1.459  29.460  -25.490 1.00 46.27  ? 237 ASP A OD2 1 
ATOM   1541 N N   . ALA A 1 226 ? -1.988  26.432  -22.396 1.00 32.39  ? 238 ALA A N   1 
ATOM   1542 C CA  . ALA A 1 226 ? -1.884  26.549  -20.940 1.00 31.78  ? 238 ALA A CA  1 
ATOM   1543 C C   . ALA A 1 226 ? -2.656  27.750  -20.407 1.00 38.66  ? 238 ALA A C   1 
ATOM   1544 O O   . ALA A 1 226 ? -3.172  27.708  -19.290 1.00 39.96  ? 238 ALA A O   1 
ATOM   1545 C CB  . ALA A 1 226 ? -0.428  26.644  -20.531 1.00 31.61  ? 238 ALA A CB  1 
ATOM   1546 N N   . LEU A 1 227 ? -2.783  28.793  -21.223 1.00 36.01  ? 239 LEU A N   1 
ATOM   1547 C CA  . LEU A 1 227 ? -3.282  30.091  -20.789 1.00 35.80  ? 239 LEU A CA  1 
ATOM   1548 C C   . LEU A 1 227 ? -4.778  30.269  -21.014 1.00 42.10  ? 239 LEU A C   1 
ATOM   1549 O O   . LEU A 1 227 ? -5.405  31.048  -20.291 1.00 43.99  ? 239 LEU A O   1 
ATOM   1550 C CB  . LEU A 1 227 ? -2.502  31.201  -21.502 1.00 35.13  ? 239 LEU A CB  1 
ATOM   1551 C CG  . LEU A 1 227 ? -1.030  31.362  -21.078 1.00 38.10  ? 239 LEU A CG  1 
ATOM   1552 C CD1 . LEU A 1 227 ? -0.421  32.568  -21.732 1.00 38.36  ? 239 LEU A CD1 1 
ATOM   1553 C CD2 . LEU A 1 227 ? -0.888  31.482  -19.566 1.00 37.94  ? 239 LEU A CD2 1 
ATOM   1554 N N   . GLY A 1 228 ? -5.329  29.563  -22.000 1.00 37.81  ? 240 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 228 ? -6.749  29.605  -22.310 1.00 37.52  ? 240 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 228 ? -7.070  29.192  -23.723 1.00 41.51  ? 240 GLY A C   1 
ATOM   1557 O O   . GLY A 1 228 ? -6.383  28.359  -24.316 1.00 40.83  ? 240 GLY A O   1 
ATOM   1558 N N   . LEU A 1 229 ? -8.160  29.743  -24.240 1.00 39.41  ? 241 LEU A N   1 
ATOM   1559 C CA  . LEU A 1 229 ? -8.610  29.564  -25.616 1.00 39.04  ? 241 LEU A CA  1 
ATOM   1560 C C   . LEU A 1 229 ? -8.342  30.831  -26.408 1.00 42.64  ? 241 LEU A C   1 
ATOM   1561 O O   . LEU A 1 229 ? -8.498  31.933  -25.886 1.00 42.99  ? 241 LEU A O   1 
ATOM   1562 C CB  . LEU A 1 229 ? -10.104 29.204  -25.665 1.00 39.77  ? 241 LEU A CB  1 
ATOM   1563 C CG  . LEU A 1 229 ? -10.533 27.895  -24.996 1.00 44.11  ? 241 LEU A CG  1 
ATOM   1564 C CD1 . LEU A 1 229 ? -12.022 27.743  -25.047 1.00 44.74  ? 241 LEU A CD1 1 
ATOM   1565 C CD2 . LEU A 1 229 ? -9.858  26.685  -25.633 1.00 46.25  ? 241 LEU A CD2 1 
ATOM   1566 N N   . HIS A 1 230 ? -7.926  30.676  -27.659 1.00 39.14  ? 242 HIS A N   1 
ATOM   1567 C CA  . HIS A 1 230 ? -7.528  31.788  -28.515 1.00 39.05  ? 242 HIS A CA  1 
ATOM   1568 C C   . HIS A 1 230 ? -8.128  31.617  -29.902 1.00 42.16  ? 242 HIS A C   1 
ATOM   1569 O O   . HIS A 1 230 ? -8.177  30.496  -30.416 1.00 42.61  ? 242 HIS A O   1 
ATOM   1570 C CB  . HIS A 1 230 ? -5.996  31.887  -28.595 1.00 39.48  ? 242 HIS A CB  1 
ATOM   1571 C CG  . HIS A 1 230 ? -5.319  31.791  -27.264 1.00 42.87  ? 242 HIS A CG  1 
ATOM   1572 N ND1 . HIS A 1 230 ? -5.307  32.858  -26.384 1.00 45.08  ? 242 HIS A ND1 1 
ATOM   1573 C CD2 . HIS A 1 230 ? -4.706  30.734  -26.680 1.00 43.99  ? 242 HIS A CD2 1 
ATOM   1574 C CE1 . HIS A 1 230 ? -4.678  32.426  -25.305 1.00 43.99  ? 242 HIS A CE1 1 
ATOM   1575 N NE2 . HIS A 1 230 ? -4.278  31.162  -25.445 1.00 43.72  ? 242 HIS A NE2 1 
ATOM   1576 N N   . ILE A 1 231 ? -8.612  32.717  -30.487 1.00 36.77  ? 243 ILE A N   1 
ATOM   1577 C CA  . ILE A 1 231 ? -9.184  32.725  -31.833 1.00 36.45  ? 243 ILE A CA  1 
ATOM   1578 C C   . ILE A 1 231 ? -8.225  33.483  -32.745 1.00 41.01  ? 243 ILE A C   1 
ATOM   1579 O O   . ILE A 1 231 ? -7.844  34.618  -32.450 1.00 41.36  ? 243 ILE A O   1 
ATOM   1580 C CB  . ILE A 1 231 ? -10.639 33.297  -31.864 1.00 39.80  ? 243 ILE A CB  1 
ATOM   1581 C CG1 . ILE A 1 231 ? -11.583 32.588  -30.850 1.00 39.90  ? 243 ILE A CG1 1 
ATOM   1582 C CG2 . ILE A 1 231 ? -11.233 33.309  -33.275 1.00 40.25  ? 243 ILE A CG2 1 
ATOM   1583 C CD1 . ILE A 1 231 ? -11.667 31.030  -30.906 1.00 40.72  ? 243 ILE A CD1 1 
ATOM   1584 N N   . TYR A 1 232 ? -7.816  32.831  -33.835 1.00 37.25  ? 244 TYR A N   1 
ATOM   1585 C CA  . TYR A 1 232 ? -6.852  33.381  -34.781 1.00 37.01  ? 244 TYR A CA  1 
ATOM   1586 C C   . TYR A 1 232 ? -7.468  33.565  -36.134 1.00 43.51  ? 244 TYR A C   1 
ATOM   1587 O O   . TYR A 1 232 ? -8.333  32.785  -36.520 1.00 43.21  ? 244 TYR A O   1 
ATOM   1588 C CB  . TYR A 1 232 ? -5.644  32.448  -34.932 1.00 36.91  ? 244 TYR A CB  1 
ATOM   1589 C CG  . TYR A 1 232 ? -4.853  32.178  -33.677 1.00 36.17  ? 244 TYR A CG  1 
ATOM   1590 C CD1 . TYR A 1 232 ? -5.178  31.117  -32.839 1.00 37.27  ? 244 TYR A CD1 1 
ATOM   1591 C CD2 . TYR A 1 232 ? -3.716  32.919  -33.377 1.00 36.29  ? 244 TYR A CD2 1 
ATOM   1592 C CE1 . TYR A 1 232 ? -4.430  30.840  -31.698 1.00 37.16  ? 244 TYR A CE1 1 
ATOM   1593 C CE2 . TYR A 1 232 ? -2.962  32.653  -32.236 1.00 36.57  ? 244 TYR A CE2 1 
ATOM   1594 C CZ  . TYR A 1 232 ? -3.315  31.603  -31.407 1.00 41.91  ? 244 TYR A CZ  1 
ATOM   1595 O OH  . TYR A 1 232 ? -2.563  31.313  -30.300 1.00 45.14  ? 244 TYR A OH  1 
ATOM   1596 N N   . ASP A 1 233 ? -7.040  34.610  -36.852 1.00 42.92  ? 245 ASP A N   1 
ATOM   1597 C CA  . ASP A 1 233 ? -7.164  34.661  -38.309 1.00 44.27  ? 245 ASP A CA  1 
ATOM   1598 C C   . ASP A 1 233 ? -6.367  33.503  -38.886 1.00 48.50  ? 245 ASP A C   1 
ATOM   1599 O O   . ASP A 1 233 ? -5.261  33.250  -38.393 1.00 47.76  ? 245 ASP A O   1 
ATOM   1600 C CB  . ASP A 1 233 ? -6.651  35.999  -38.862 1.00 47.18  ? 245 ASP A CB  1 
ATOM   1601 C CG  . ASP A 1 233 ? -7.632  37.142  -38.746 1.00 65.94  ? 245 ASP A CG  1 
ATOM   1602 O OD1 . ASP A 1 233 ? -8.785  36.995  -39.234 1.00 68.16  ? 245 ASP A OD1 1 
ATOM   1603 O OD2 . ASP A 1 233 ? -7.262  38.181  -38.155 1.00 75.57  ? 245 ASP A OD2 1 
ATOM   1604 N N   . PRO A 1 234 ? -6.896  32.773  -39.900 1.00 45.68  ? 246 PRO A N   1 
ATOM   1605 C CA  . PRO A 1 234 ? -6.210  31.553  -40.376 1.00 45.60  ? 246 PRO A CA  1 
ATOM   1606 C C   . PRO A 1 234 ? -4.804  31.803  -40.923 1.00 51.75  ? 246 PRO A C   1 
ATOM   1607 O O   . PRO A 1 234 ? -4.016  30.863  -41.002 1.00 50.99  ? 246 PRO A O   1 
ATOM   1608 C CB  . PRO A 1 234 ? -7.139  31.024  -41.481 1.00 47.65  ? 246 PRO A CB  1 
ATOM   1609 C CG  . PRO A 1 234 ? -7.999  32.163  -41.862 1.00 52.01  ? 246 PRO A CG  1 
ATOM   1610 C CD  . PRO A 1 234 ? -8.148  33.011  -40.643 1.00 47.39  ? 246 PRO A CD  1 
ATOM   1611 N N   . GLU A 1 235 ? -4.488  33.062  -41.286 1.00 51.02  ? 247 GLU A N   1 
ATOM   1612 C CA  . GLU A 1 235 ? -3.176  33.424  -41.835 1.00 51.73  ? 247 GLU A CA  1 
ATOM   1613 C C   . GLU A 1 235 ? -2.323  34.237  -40.819 1.00 57.35  ? 247 GLU A C   1 
ATOM   1614 O O   . GLU A 1 235 ? -1.475  35.034  -41.219 1.00 58.56  ? 247 GLU A O   1 
ATOM   1615 C CB  . GLU A 1 235 ? -3.335  34.177  -43.164 1.00 53.49  ? 247 GLU A CB  1 
ATOM   1616 C CG  . GLU A 1 235 ? -4.078  33.387  -44.240 1.00 61.65  ? 247 GLU A CG  1 
ATOM   1617 C CD  . GLU A 1 235 ? -3.678  31.939  -44.472 1.00 75.59  ? 247 GLU A CD  1 
ATOM   1618 O OE1 . GLU A 1 235 ? -2.471  31.671  -44.679 1.00 70.52  ? 247 GLU A OE1 1 
ATOM   1619 O OE2 . GLU A 1 235 ? -4.588  31.076  -44.510 1.00 59.76  ? 247 GLU A OE2 1 
ATOM   1620 N N   . ASN A 1 236 ? -2.582  34.058  -39.510 1.00 51.87  ? 248 ASN A N   1 
ATOM   1621 C CA  . ASN A 1 236 ? -1.728  34.575  -38.443 1.00 50.66  ? 248 ASN A CA  1 
ATOM   1622 C C   . ASN A 1 236 ? -1.889  33.699  -37.213 1.00 52.73  ? 248 ASN A C   1 
ATOM   1623 O O   . ASN A 1 236 ? -2.806  33.894  -36.417 1.00 53.20  ? 248 ASN A O   1 
ATOM   1624 C CB  . ASN A 1 236 ? -1.999  36.065  -38.131 1.00 53.13  ? 248 ASN A CB  1 
ATOM   1625 C CG  . ASN A 1 236 ? -1.014  36.718  -37.171 1.00 79.10  ? 248 ASN A CG  1 
ATOM   1626 O OD1 . ASN A 1 236 ? 0.054   36.187  -36.853 1.00 72.33  ? 248 ASN A OD1 1 
ATOM   1627 N ND2 . ASN A 1 236 ? -1.342  37.914  -36.709 1.00 73.62  ? 248 ASN A ND2 1 
ATOM   1628 N N   . ARG A 1 237 ? -0.998  32.710  -37.075 1.00 47.53  ? 249 ARG A N   1 
ATOM   1629 C CA  . ARG A 1 237 ? -0.970  31.773  -35.951 1.00 45.48  ? 249 ARG A CA  1 
ATOM   1630 C C   . ARG A 1 237 ? -0.165  32.351  -34.780 1.00 48.99  ? 249 ARG A C   1 
ATOM   1631 O O   . ARG A 1 237 ? -0.057  31.706  -33.738 1.00 48.47  ? 249 ARG A O   1 
ATOM   1632 C CB  . ARG A 1 237 ? -0.382  30.413  -36.383 1.00 42.91  ? 249 ARG A CB  1 
ATOM   1633 C CG  . ARG A 1 237 ? -1.130  29.733  -37.518 1.00 44.97  ? 249 ARG A CG  1 
ATOM   1634 C CD  . ARG A 1 237 ? -0.895  28.239  -37.582 1.00 42.79  ? 249 ARG A CD  1 
ATOM   1635 N NE  . ARG A 1 237 ? -1.784  27.629  -38.572 1.00 49.13  ? 249 ARG A NE  1 
ATOM   1636 C CZ  . ARG A 1 237 ? -2.213  26.373  -38.535 1.00 59.74  ? 249 ARG A CZ  1 
ATOM   1637 N NH1 . ARG A 1 237 ? -1.825  25.560  -37.562 1.00 47.49  ? 249 ARG A NH1 1 
ATOM   1638 N NH2 . ARG A 1 237 ? -3.033  25.919  -39.470 1.00 50.72  ? 249 ARG A NH2 1 
ATOM   1639 N N   . LEU A 1 238 ? 0.371   33.576  -34.935 1.00 45.44  ? 250 LEU A N   1 
ATOM   1640 C CA  . LEU A 1 238 ? 1.248   34.194  -33.942 1.00 44.44  ? 250 LEU A CA  1 
ATOM   1641 C C   . LEU A 1 238 ? 0.475   35.063  -32.956 1.00 47.95  ? 250 LEU A C   1 
ATOM   1642 O O   . LEU A 1 238 ? 0.698   34.935  -31.751 1.00 47.79  ? 250 LEU A O   1 
ATOM   1643 C CB  . LEU A 1 238 ? 2.360   35.019  -34.615 1.00 44.68  ? 250 LEU A CB  1 
ATOM   1644 C CG  . LEU A 1 238 ? 3.298   34.276  -35.576 1.00 49.06  ? 250 LEU A CG  1 
ATOM   1645 C CD1 . LEU A 1 238 ? 4.270   35.237  -36.213 1.00 49.24  ? 250 LEU A CD1 1 
ATOM   1646 C CD2 . LEU A 1 238 ? 4.047   33.152  -34.874 1.00 50.65  ? 250 LEU A CD2 1 
ATOM   1647 N N   . THR A 1 239 ? -0.430  35.927  -33.450 1.00 44.87  ? 251 THR A N   1 
ATOM   1648 C CA  . THR A 1 239 ? -1.160  36.885  -32.617 1.00 45.04  ? 251 THR A CA  1 
ATOM   1649 C C   . THR A 1 239 ? -2.671  36.590  -32.690 1.00 47.90  ? 251 THR A C   1 
ATOM   1650 O O   . THR A 1 239 ? -3.284  36.765  -33.755 1.00 46.52  ? 251 THR A O   1 
ATOM   1651 C CB  . THR A 1 239 ? -0.817  38.339  -33.029 1.00 56.50  ? 251 THR A CB  1 
ATOM   1652 O OG1 . THR A 1 239 ? 0.600   38.514  -32.983 1.00 58.64  ? 251 THR A OG1 1 
ATOM   1653 C CG2 . THR A 1 239 ? -1.484  39.381  -32.127 1.00 54.71  ? 251 THR A CG2 1 
ATOM   1654 N N   . PRO A 1 240 ? -3.281  36.129  -31.570 1.00 44.40  ? 252 PRO A N   1 
ATOM   1655 C CA  . PRO A 1 240 ? -4.739  35.906  -31.578 1.00 44.52  ? 252 PRO A CA  1 
ATOM   1656 C C   . PRO A 1 240 ? -5.534  37.198  -31.723 1.00 49.67  ? 252 PRO A C   1 
ATOM   1657 O O   . PRO A 1 240 ? -5.092  38.259  -31.293 1.00 50.22  ? 252 PRO A O   1 
ATOM   1658 C CB  . PRO A 1 240 ? -5.016  35.223  -30.237 1.00 45.35  ? 252 PRO A CB  1 
ATOM   1659 C CG  . PRO A 1 240 ? -3.864  35.557  -29.385 1.00 49.08  ? 252 PRO A CG  1 
ATOM   1660 C CD  . PRO A 1 240 ? -2.682  35.744  -30.276 1.00 44.70  ? 252 PRO A CD  1 
ATOM   1661 N N   . LYS A 1 241 ? -6.690  37.097  -32.381 1.00 46.55  ? 253 LYS A N   1 
ATOM   1662 C CA  . LYS A 1 241 ? -7.698  38.146  -32.474 1.00 47.37  ? 253 LYS A CA  1 
ATOM   1663 C C   . LYS A 1 241 ? -8.420  38.304  -31.132 1.00 50.24  ? 253 LYS A C   1 
ATOM   1664 O O   . LYS A 1 241 ? -8.658  39.421  -30.690 1.00 50.72  ? 253 LYS A O   1 
ATOM   1665 C CB  . LYS A 1 241 ? -8.710  37.786  -33.571 1.00 51.04  ? 253 LYS A CB  1 
ATOM   1666 C CG  . LYS A 1 241 ? -8.454  38.379  -34.942 1.00 71.40  ? 253 LYS A CG  1 
ATOM   1667 C CD  . LYS A 1 241 ? -9.563  37.909  -35.890 1.00 85.09  ? 253 LYS A CD  1 
ATOM   1668 C CE  . LYS A 1 241 ? -10.764 38.839  -35.945 1.00 98.39  ? 253 LYS A CE  1 
ATOM   1669 N NZ  . LYS A 1 241 ? -11.864 38.290  -36.783 1.00 106.63 ? 253 LYS A NZ  1 
ATOM   1670 N N   . ILE A 1 242 ? -8.804  37.171  -30.513 1.00 45.18  ? 254 ILE A N   1 
ATOM   1671 C CA  . ILE A 1 242 ? -9.506  37.095  -29.230 1.00 44.32  ? 254 ILE A CA  1 
ATOM   1672 C C   . ILE A 1 242 ? -8.804  36.060  -28.355 1.00 45.60  ? 254 ILE A C   1 
ATOM   1673 O O   . ILE A 1 242 ? -8.371  35.025  -28.852 1.00 44.01  ? 254 ILE A O   1 
ATOM   1674 C CB  . ILE A 1 242 ? -11.034 36.763  -29.375 1.00 47.38  ? 254 ILE A CB  1 
ATOM   1675 C CG1 . ILE A 1 242 ? -11.702 37.472  -30.567 1.00 47.86  ? 254 ILE A CG1 1 
ATOM   1676 C CG2 . ILE A 1 242 ? -11.780 37.079  -28.085 1.00 48.70  ? 254 ILE A CG2 1 
ATOM   1677 C CD1 . ILE A 1 242 ? -12.940 36.741  -31.165 1.00 53.38  ? 254 ILE A CD1 1 
ATOM   1678 N N   . SER A 1 243 ? -8.688  36.345  -27.059 1.00 42.31  ? 255 SER A N   1 
ATOM   1679 C CA  . SER A 1 243 ? -8.226  35.383  -26.063 1.00 41.22  ? 255 SER A CA  1 
ATOM   1680 C C   . SER A 1 243 ? -9.247  35.255  -24.937 1.00 47.29  ? 255 SER A C   1 
ATOM   1681 O O   . SER A 1 243 ? -9.817  36.252  -24.488 1.00 48.48  ? 255 SER A O   1 
ATOM   1682 C CB  . SER A 1 243 ? -6.869  35.793  -25.510 1.00 42.71  ? 255 SER A CB  1 
ATOM   1683 O OG  . SER A 1 243 ? -5.856  35.644  -26.491 1.00 50.17  ? 255 SER A OG  1 
ATOM   1684 N N   . PHE A 1 244 ? -9.508  34.016  -24.517 1.00 43.14  ? 256 PHE A N   1 
ATOM   1685 C CA  . PHE A 1 244 ? -10.335 33.704  -23.355 1.00 42.78  ? 256 PHE A CA  1 
ATOM   1686 C C   . PHE A 1 244 ? -9.452  32.966  -22.338 1.00 45.35  ? 256 PHE A C   1 
ATOM   1687 O O   . PHE A 1 244 ? -9.237  31.758  -22.486 1.00 44.36  ? 256 PHE A O   1 
ATOM   1688 C CB  . PHE A 1 244 ? -11.567 32.868  -23.757 1.00 44.61  ? 256 PHE A CB  1 
ATOM   1689 C CG  . PHE A 1 244 ? -12.434 33.468  -24.838 1.00 46.32  ? 256 PHE A CG  1 
ATOM   1690 C CD1 . PHE A 1 244 ? -13.461 34.356  -24.518 1.00 49.77  ? 256 PHE A CD1 1 
ATOM   1691 C CD2 . PHE A 1 244 ? -12.256 33.116  -26.172 1.00 47.63  ? 256 PHE A CD2 1 
ATOM   1692 C CE1 . PHE A 1 244 ? -14.267 34.911  -25.519 1.00 50.79  ? 256 PHE A CE1 1 
ATOM   1693 C CE2 . PHE A 1 244 ? -13.067 33.668  -27.173 1.00 50.84  ? 256 PHE A CE2 1 
ATOM   1694 C CZ  . PHE A 1 244 ? -14.068 34.558  -26.838 1.00 49.55  ? 256 PHE A CZ  1 
ATOM   1695 N N   . PRO A 1 245 ? -8.852  33.680  -21.350 1.00 40.62  ? 257 PRO A N   1 
ATOM   1696 C CA  . PRO A 1 245 ? -8.072  32.987  -20.307 1.00 39.38  ? 257 PRO A CA  1 
ATOM   1697 C C   . PRO A 1 245 ? -8.942  32.032  -19.489 1.00 44.20  ? 257 PRO A C   1 
ATOM   1698 O O   . PRO A 1 245 ? -10.131 32.316  -19.297 1.00 45.12  ? 257 PRO A O   1 
ATOM   1699 C CB  . PRO A 1 245 ? -7.532  34.142  -19.456 1.00 40.90  ? 257 PRO A CB  1 
ATOM   1700 C CG  . PRO A 1 245 ? -7.575  35.334  -20.341 1.00 44.99  ? 257 PRO A CG  1 
ATOM   1701 C CD  . PRO A 1 245 ? -8.812  35.142  -21.152 1.00 41.73  ? 257 PRO A CD  1 
ATOM   1702 N N   . TRP A 1 246 ? -8.363  30.902  -19.011 1.00 40.10  ? 258 TRP A N   1 
ATOM   1703 C CA  . TRP A 1 246 ? -9.129  29.834  -18.337 1.00 40.41  ? 258 TRP A CA  1 
ATOM   1704 C C   . TRP A 1 246 ? -9.928  30.349  -17.111 1.00 47.35  ? 258 TRP A C   1 
ATOM   1705 O O   . TRP A 1 246 ? -11.048 29.880  -16.872 1.00 48.26  ? 258 TRP A O   1 
ATOM   1706 C CB  . TRP A 1 246 ? -8.231  28.651  -17.931 1.00 37.76  ? 258 TRP A CB  1 
ATOM   1707 C CG  . TRP A 1 246 ? -7.694  27.842  -19.076 1.00 38.12  ? 258 TRP A CG  1 
ATOM   1708 C CD1 . TRP A 1 246 ? -6.381  27.619  -19.372 1.00 40.54  ? 258 TRP A CD1 1 
ATOM   1709 C CD2 . TRP A 1 246 ? -8.458  27.105  -20.051 1.00 38.11  ? 258 TRP A CD2 1 
ATOM   1710 N NE1 . TRP A 1 246 ? -6.274  26.796  -20.477 1.00 39.90  ? 258 TRP A NE1 1 
ATOM   1711 C CE2 . TRP A 1 246 ? -7.534  26.469  -20.914 1.00 41.47  ? 258 TRP A CE2 1 
ATOM   1712 C CE3 . TRP A 1 246 ? -9.839  26.916  -20.275 1.00 40.04  ? 258 TRP A CE3 1 
ATOM   1713 C CZ2 . TRP A 1 246 ? -7.943  25.681  -21.997 1.00 40.78  ? 258 TRP A CZ2 1 
ATOM   1714 C CZ3 . TRP A 1 246 ? -10.243 26.128  -21.339 1.00 41.49  ? 258 TRP A CZ3 1 
ATOM   1715 C CH2 . TRP A 1 246 ? -9.302  25.527  -22.193 1.00 41.48  ? 258 TRP A CH2 1 
ATOM   1716 N N   . ASN A 1 247 ? -9.362  31.327  -16.371 1.00 44.41  ? 259 ASN A N   1 
ATOM   1717 C CA  . ASN A 1 247 ? -9.973  31.969  -15.207 1.00 45.49  ? 259 ASN A CA  1 
ATOM   1718 C C   . ASN A 1 247 ? -11.151 32.892  -15.608 1.00 54.01  ? 259 ASN A C   1 
ATOM   1719 O O   . ASN A 1 247 ? -11.996 33.205  -14.759 1.00 56.20  ? 259 ASN A O   1 
ATOM   1720 C CB  . ASN A 1 247 ? -8.913  32.755  -14.403 1.00 41.54  ? 259 ASN A CB  1 
ATOM   1721 C CG  . ASN A 1 247 ? -8.217  33.870  -15.152 1.00 61.60  ? 259 ASN A CG  1 
ATOM   1722 O OD1 . ASN A 1 247 ? -7.718  33.706  -16.254 1.00 53.44  ? 259 ASN A OD1 1 
ATOM   1723 N ND2 . ASN A 1 247 ? -8.097  35.020  -14.535 1.00 63.87  ? 259 ASN A ND2 1 
ATOM   1724 N N   . GLU A 1 248 ? -11.205 33.314  -16.892 1.00 50.46  ? 260 GLU A N   1 
ATOM   1725 C CA  . GLU A 1 248 ? -12.226 34.213  -17.436 1.00 51.21  ? 260 GLU A CA  1 
ATOM   1726 C C   . GLU A 1 248 ? -13.314 33.458  -18.250 1.00 53.75  ? 260 GLU A C   1 
ATOM   1727 O O   . GLU A 1 248 ? -14.141 34.095  -18.908 1.00 54.74  ? 260 GLU A O   1 
ATOM   1728 C CB  . GLU A 1 248 ? -11.556 35.288  -18.306 1.00 52.74  ? 260 GLU A CB  1 
ATOM   1729 C CG  . GLU A 1 248 ? -10.997 36.459  -17.512 1.00 67.21  ? 260 GLU A CG  1 
ATOM   1730 C CD  . GLU A 1 248 ? -9.996  37.337  -18.247 1.00 94.20  ? 260 GLU A CD  1 
ATOM   1731 O OE1 . GLU A 1 248 ? -10.327 37.848  -19.344 1.00 89.78  ? 260 GLU A OE1 1 
ATOM   1732 O OE2 . GLU A 1 248 ? -8.888  37.548  -17.702 1.00 91.55  ? 260 GLU A OE2 1 
ATOM   1733 N N   . ILE A 1 249 ? -13.319 32.118  -18.197 1.00 47.99  ? 261 ILE A N   1 
ATOM   1734 C CA  . ILE A 1 249 ? -14.333 31.288  -18.861 1.00 47.09  ? 261 ILE A CA  1 
ATOM   1735 C C   . ILE A 1 249 ? -15.301 30.744  -17.793 1.00 52.44  ? 261 ILE A C   1 
ATOM   1736 O O   . ILE A 1 249 ? -14.876 30.028  -16.880 1.00 51.30  ? 261 ILE A O   1 
ATOM   1737 C CB  . ILE A 1 249 ? -13.680 30.147  -19.722 1.00 48.29  ? 261 ILE A CB  1 
ATOM   1738 C CG1 . ILE A 1 249 ? -12.874 30.725  -20.916 1.00 47.48  ? 261 ILE A CG1 1 
ATOM   1739 C CG2 . ILE A 1 249 ? -14.725 29.127  -20.205 1.00 48.61  ? 261 ILE A CG2 1 
ATOM   1740 C CD1 . ILE A 1 249 ? -11.825 29.795  -21.547 1.00 49.93  ? 261 ILE A CD1 1 
ATOM   1741 N N   . ARG A 1 250 ? -16.597 31.096  -17.907 1.00 51.66  ? 262 ARG A N   1 
ATOM   1742 C CA  . ARG A 1 250 ? -17.649 30.586  -17.013 1.00 52.87  ? 262 ARG A CA  1 
ATOM   1743 C C   . ARG A 1 250 ? -17.872 29.086  -17.282 1.00 56.25  ? 262 ARG A C   1 
ATOM   1744 O O   . ARG A 1 250 ? -17.880 28.288  -16.338 1.00 56.78  ? 262 ARG A O   1 
ATOM   1745 C CB  . ARG A 1 250 ? -18.953 31.389  -17.169 1.00 54.80  ? 262 ARG A CB  1 
ATOM   1746 C CG  . ARG A 1 250 ? -20.020 31.083  -16.117 1.00 69.66  ? 262 ARG A CG  1 
ATOM   1747 C CD  . ARG A 1 250 ? -21.246 31.963  -16.279 1.00 85.72  ? 262 ARG A CD  1 
ATOM   1748 N NE  . ARG A 1 250 ? -22.464 31.177  -16.491 1.00 107.20 ? 262 ARG A NE  1 
ATOM   1749 C CZ  . ARG A 1 250 ? -23.289 30.780  -15.525 1.00 131.48 ? 262 ARG A CZ  1 
ATOM   1750 N NH1 . ARG A 1 250 ? -23.039 31.091  -14.257 1.00 124.87 ? 262 ARG A NH1 1 
ATOM   1751 N NH2 . ARG A 1 250 ? -24.371 30.070  -15.819 1.00 119.34 ? 262 ARG A NH2 1 
ATOM   1752 N N   . ASN A 1 251 ? -18.044 28.714  -18.569 1.00 50.49  ? 263 ASN A N   1 
ATOM   1753 C CA  . ASN A 1 251 ? -18.147 27.327  -19.020 1.00 48.76  ? 263 ASN A CA  1 
ATOM   1754 C C   . ASN A 1 251 ? -17.876 27.208  -20.516 1.00 49.12  ? 263 ASN A C   1 
ATOM   1755 O O   . ASN A 1 251 ? -17.938 28.196  -21.251 1.00 48.08  ? 263 ASN A O   1 
ATOM   1756 C CB  . ASN A 1 251 ? -19.523 26.706  -18.678 1.00 49.77  ? 263 ASN A CB  1 
ATOM   1757 C CG  . ASN A 1 251 ? -20.715 27.384  -19.304 1.00 69.35  ? 263 ASN A CG  1 
ATOM   1758 O OD1 . ASN A 1 251 ? -20.961 27.295  -20.517 1.00 70.93  ? 263 ASN A OD1 1 
ATOM   1759 N ND2 . ASN A 1 251 ? -21.524 28.006  -18.473 1.00 58.04  ? 263 ASN A ND2 1 
ATOM   1760 N N   . ILE A 1 252 ? -17.557 25.986  -20.943 1.00 44.22  ? 264 ILE A N   1 
ATOM   1761 C CA  . ILE A 1 252 ? -17.557 25.565  -22.336 1.00 43.87  ? 264 ILE A CA  1 
ATOM   1762 C C   . ILE A 1 252 ? -18.651 24.499  -22.469 1.00 49.42  ? 264 ILE A C   1 
ATOM   1763 O O   . ILE A 1 252 ? -18.819 23.689  -21.562 1.00 49.78  ? 264 ILE A O   1 
ATOM   1764 C CB  . ILE A 1 252 ? -16.138 25.079  -22.781 1.00 45.18  ? 264 ILE A CB  1 
ATOM   1765 C CG1 . ILE A 1 252 ? -15.173 26.271  -22.863 1.00 45.10  ? 264 ILE A CG1 1 
ATOM   1766 C CG2 . ILE A 1 252 ? -16.168 24.333  -24.123 1.00 44.80  ? 264 ILE A CG2 1 
ATOM   1767 C CD1 . ILE A 1 252 ? -13.851 26.006  -22.335 1.00 55.48  ? 264 ILE A CD1 1 
ATOM   1768 N N   . SER A 1 253 ? -19.416 24.536  -23.565 1.00 46.05  ? 265 SER A N   1 
ATOM   1769 C CA  . SER A 1 253 ? -20.395 23.503  -23.915 1.00 46.56  ? 265 SER A CA  1 
ATOM   1770 C C   . SER A 1 253 ? -20.205 23.053  -25.371 1.00 50.14  ? 265 SER A C   1 
ATOM   1771 O O   . SER A 1 253 ? -19.678 23.814  -26.194 1.00 49.60  ? 265 SER A O   1 
ATOM   1772 C CB  . SER A 1 253 ? -21.823 23.990  -23.677 1.00 50.36  ? 265 SER A CB  1 
ATOM   1773 O OG  . SER A 1 253 ? -22.041 25.320  -24.118 1.00 55.49  ? 265 SER A OG  1 
ATOM   1774 N N   . TYR A 1 254 ? -20.633 21.816  -25.679 1.00 45.89  ? 266 TYR A N   1 
ATOM   1775 C CA  . TYR A 1 254 ? -20.487 21.236  -27.007 1.00 45.08  ? 266 TYR A CA  1 
ATOM   1776 C C   . TYR A 1 254 ? -21.722 20.432  -27.393 1.00 52.67  ? 266 TYR A C   1 
ATOM   1777 O O   . TYR A 1 254 ? -22.113 19.499  -26.687 1.00 53.89  ? 266 TYR A O   1 
ATOM   1778 C CB  . TYR A 1 254 ? -19.221 20.358  -27.122 1.00 43.56  ? 266 TYR A CB  1 
ATOM   1779 C CG  . TYR A 1 254 ? -19.161 19.635  -28.451 1.00 43.70  ? 266 TYR A CG  1 
ATOM   1780 C CD1 . TYR A 1 254 ? -18.712 20.284  -29.601 1.00 44.43  ? 266 TYR A CD1 1 
ATOM   1781 C CD2 . TYR A 1 254 ? -19.655 18.340  -28.585 1.00 44.98  ? 266 TYR A CD2 1 
ATOM   1782 C CE1 . TYR A 1 254 ? -18.696 19.640  -30.836 1.00 44.94  ? 266 TYR A CE1 1 
ATOM   1783 C CE2 . TYR A 1 254 ? -19.664 17.692  -29.820 1.00 46.31  ? 266 TYR A CE2 1 
ATOM   1784 C CZ  . TYR A 1 254 ? -19.176 18.343  -30.943 1.00 52.40  ? 266 TYR A CZ  1 
ATOM   1785 O OH  . TYR A 1 254 ? -19.163 17.696  -32.157 1.00 52.77  ? 266 TYR A OH  1 
ATOM   1786 N N   . SER A 1 255 ? -22.308 20.769  -28.539 1.00 50.91  ? 267 SER A N   1 
ATOM   1787 C CA  . SER A 1 255 ? -23.478 20.068  -29.064 1.00 52.97  ? 267 SER A CA  1 
ATOM   1788 C C   . SER A 1 255 ? -23.478 20.117  -30.574 1.00 58.43  ? 267 SER A C   1 
ATOM   1789 O O   . SER A 1 255 ? -23.354 21.197  -31.156 1.00 57.49  ? 267 SER A O   1 
ATOM   1790 C CB  . SER A 1 255 ? -24.771 20.670  -28.512 1.00 57.44  ? 267 SER A CB  1 
ATOM   1791 O OG  . SER A 1 255 ? -25.916 19.974  -28.981 1.00 66.96  ? 267 SER A OG  1 
ATOM   1792 N N   . ASP A 1 256 ? -23.567 18.935  -31.206 1.00 56.89  ? 268 ASP A N   1 
ATOM   1793 C CA  . ASP A 1 256 ? -23.844 18.782  -32.639 1.00 57.47  ? 268 ASP A CA  1 
ATOM   1794 C C   . ASP A 1 256 ? -22.896 19.676  -33.475 1.00 57.68  ? 268 ASP A C   1 
ATOM   1795 O O   . ASP A 1 256 ? -23.336 20.561  -34.218 1.00 58.25  ? 268 ASP A O   1 
ATOM   1796 C CB  . ASP A 1 256 ? -25.343 19.079  -32.925 1.00 61.20  ? 268 ASP A CB  1 
ATOM   1797 C CG  . ASP A 1 256 ? -25.842 18.679  -34.299 1.00 78.32  ? 268 ASP A CG  1 
ATOM   1798 O OD1 . ASP A 1 256 ? -25.160 17.863  -34.972 1.00 79.17  ? 268 ASP A OD1 1 
ATOM   1799 O OD2 . ASP A 1 256 ? -26.924 19.169  -34.701 1.00 88.67  ? 268 ASP A OD2 1 
ATOM   1800 N N   . LYS A 1 257 ? -21.585 19.464  -33.272 1.00 50.32  ? 269 LYS A N   1 
ATOM   1801 C CA  . LYS A 1 257 ? -20.440 20.084  -33.955 1.00 47.92  ? 269 LYS A CA  1 
ATOM   1802 C C   . LYS A 1 257 ? -20.225 21.576  -33.580 1.00 48.52  ? 269 LYS A C   1 
ATOM   1803 O O   . LYS A 1 257 ? -19.250 22.176  -34.056 1.00 46.91  ? 269 LYS A O   1 
ATOM   1804 C CB  . LYS A 1 257 ? -20.502 19.888  -35.482 1.00 50.89  ? 269 LYS A CB  1 
ATOM   1805 C CG  . LYS A 1 257 ? -20.080 18.482  -35.902 1.00 70.84  ? 269 LYS A CG  1 
ATOM   1806 C CD  . LYS A 1 257 ? -20.133 18.276  -37.409 1.00 86.12  ? 269 LYS A CD  1 
ATOM   1807 C CE  . LYS A 1 257 ? -20.234 16.812  -37.779 1.00 102.06 ? 269 LYS A CE  1 
ATOM   1808 N NZ  . LYS A 1 257 ? -20.126 16.601  -39.248 1.00 114.93 ? 269 LYS A NZ  1 
ATOM   1809 N N   . GLU A 1 258 ? -21.072 22.148  -32.684 1.00 43.87  ? 270 GLU A N   1 
ATOM   1810 C CA  . GLU A 1 258 ? -20.948 23.551  -32.263 1.00 42.65  ? 270 GLU A CA  1 
ATOM   1811 C C   . GLU A 1 258 ? -20.428 23.669  -30.827 1.00 45.62  ? 270 GLU A C   1 
ATOM   1812 O O   . GLU A 1 258 ? -20.975 23.034  -29.918 1.00 46.45  ? 270 GLU A O   1 
ATOM   1813 C CB  . GLU A 1 258 ? -22.281 24.302  -32.410 1.00 44.97  ? 270 GLU A CB  1 
ATOM   1814 C CG  . GLU A 1 258 ? -22.151 25.812  -32.589 1.00 54.02  ? 270 GLU A CG  1 
ATOM   1815 C CD  . GLU A 1 258 ? -21.627 26.334  -33.921 1.00 79.89  ? 270 GLU A CD  1 
ATOM   1816 O OE1 . GLU A 1 258 ? -21.533 25.549  -34.893 1.00 62.04  ? 270 GLU A OE1 1 
ATOM   1817 O OE2 . GLU A 1 258 ? -21.334 27.548  -33.996 1.00 81.96  ? 270 GLU A OE2 1 
ATOM   1818 N N   . PHE A 1 259 ? -19.351 24.466  -30.641 1.00 39.04  ? 271 PHE A N   1 
ATOM   1819 C CA  . PHE A 1 259 ? -18.804 24.818  -29.326 1.00 37.64  ? 271 PHE A CA  1 
ATOM   1820 C C   . PHE A 1 259 ? -19.295 26.190  -28.903 1.00 44.21  ? 271 PHE A C   1 
ATOM   1821 O O   . PHE A 1 259 ? -19.419 27.097  -29.736 1.00 43.46  ? 271 PHE A O   1 
ATOM   1822 C CB  . PHE A 1 259 ? -17.263 24.812  -29.312 1.00 36.87  ? 271 PHE A CB  1 
ATOM   1823 C CG  . PHE A 1 259 ? -16.565 23.504  -29.601 1.00 37.38  ? 271 PHE A CG  1 
ATOM   1824 C CD1 . PHE A 1 259 ? -16.462 23.021  -30.904 1.00 39.89  ? 271 PHE A CD1 1 
ATOM   1825 C CD2 . PHE A 1 259 ? -15.931 22.799  -28.586 1.00 37.85  ? 271 PHE A CD2 1 
ATOM   1826 C CE1 . PHE A 1 259 ? -15.809 21.818  -31.170 1.00 39.71  ? 271 PHE A CE1 1 
ATOM   1827 C CE2 . PHE A 1 259 ? -15.260 21.604  -28.859 1.00 39.78  ? 271 PHE A CE2 1 
ATOM   1828 C CZ  . PHE A 1 259 ? -15.201 21.126  -30.147 1.00 38.19  ? 271 PHE A CZ  1 
ATOM   1829 N N   . THR A 1 260 ? -19.550 26.349  -27.603 1.00 42.56  ? 272 THR A N   1 
ATOM   1830 C CA  . THR A 1 260 ? -19.964 27.625  -27.033 1.00 43.52  ? 272 THR A CA  1 
ATOM   1831 C C   . THR A 1 260 ? -19.013 27.948  -25.890 1.00 49.89  ? 272 THR A C   1 
ATOM   1832 O O   . THR A 1 260 ? -18.905 27.166  -24.948 1.00 50.18  ? 272 THR A O   1 
ATOM   1833 C CB  . THR A 1 260 ? -21.456 27.581  -26.602 1.00 48.18  ? 272 THR A CB  1 
ATOM   1834 O OG1 . THR A 1 260 ? -22.265 27.044  -27.658 1.00 44.94  ? 272 THR A OG1 1 
ATOM   1835 C CG2 . THR A 1 260 ? -21.996 28.951  -26.188 1.00 45.73  ? 272 THR A CG2 1 
ATOM   1836 N N   . ILE A 1 261 ? -18.282 29.070  -26.004 1.00 48.20  ? 273 ILE A N   1 
ATOM   1837 C CA  . ILE A 1 261 ? -17.479 29.622  -24.911 1.00 48.78  ? 273 ILE A CA  1 
ATOM   1838 C C   . ILE A 1 261 ? -18.319 30.689  -24.216 1.00 55.40  ? 273 ILE A C   1 
ATOM   1839 O O   . ILE A 1 261 ? -18.645 31.712  -24.827 1.00 55.35  ? 273 ILE A O   1 
ATOM   1840 C CB  . ILE A 1 261 ? -16.094 30.176  -25.372 1.00 51.27  ? 273 ILE A CB  1 
ATOM   1841 C CG1 . ILE A 1 261 ? -15.347 29.194  -26.303 1.00 51.01  ? 273 ILE A CG1 1 
ATOM   1842 C CG2 . ILE A 1 261 ? -15.225 30.568  -24.156 1.00 51.43  ? 273 ILE A CG2 1 
ATOM   1843 C CD1 . ILE A 1 261 ? -14.269 29.853  -27.187 1.00 60.36  ? 273 ILE A CD1 1 
ATOM   1844 N N   . LYS A 1 262 ? -18.702 30.433  -22.956 1.00 54.12  ? 274 LYS A N   1 
ATOM   1845 C CA  . LYS A 1 262 ? -19.441 31.409  -22.151 1.00 55.34  ? 274 LYS A CA  1 
ATOM   1846 C C   . LYS A 1 262 ? -18.441 32.145  -21.245 1.00 58.69  ? 274 LYS A C   1 
ATOM   1847 O O   . LYS A 1 262 ? -17.871 31.525  -20.342 1.00 56.91  ? 274 LYS A O   1 
ATOM   1848 C CB  . LYS A 1 262 ? -20.588 30.749  -21.351 1.00 59.19  ? 274 LYS A CB  1 
ATOM   1849 C CG  . LYS A 1 262 ? -21.687 30.151  -22.235 1.00 78.31  ? 274 LYS A CG  1 
ATOM   1850 C CD  . LYS A 1 262 ? -22.950 29.802  -21.448 1.00 86.61  ? 274 LYS A CD  1 
ATOM   1851 C CE  . LYS A 1 262 ? -23.836 28.827  -22.186 1.00 90.10  ? 274 LYS A CE  1 
ATOM   1852 N NZ  . LYS A 1 262 ? -24.908 28.293  -21.309 1.00 95.45  ? 274 LYS A NZ  1 
ATOM   1853 N N   . PRO A 1 263 ? -18.162 33.445  -21.512 1.00 56.70  ? 275 PRO A N   1 
ATOM   1854 C CA  . PRO A 1 263 ? -17.229 34.191  -20.646 1.00 56.65  ? 275 PRO A CA  1 
ATOM   1855 C C   . PRO A 1 263 ? -17.807 34.479  -19.264 1.00 63.11  ? 275 PRO A C   1 
ATOM   1856 O O   . PRO A 1 263 ? -19.028 34.493  -19.090 1.00 63.81  ? 275 PRO A O   1 
ATOM   1857 C CB  . PRO A 1 263 ? -16.991 35.499  -21.416 1.00 58.44  ? 275 PRO A CB  1 
ATOM   1858 C CG  . PRO A 1 263 ? -17.530 35.264  -22.796 1.00 62.77  ? 275 PRO A CG  1 
ATOM   1859 C CD  . PRO A 1 263 ? -18.647 34.292  -22.621 1.00 58.83  ? 275 PRO A CD  1 
ATOM   1860 N N   . LEU A 1 264 ? -16.920 34.708  -18.280 1.00 60.53  ? 276 LEU A N   1 
ATOM   1861 C CA  . LEU A 1 264 ? -17.288 35.037  -16.902 1.00 61.69  ? 276 LEU A CA  1 
ATOM   1862 C C   . LEU A 1 264 ? -17.941 36.432  -16.835 1.00 68.47  ? 276 LEU A C   1 
ATOM   1863 O O   . LEU A 1 264 ? -18.978 36.591  -16.182 1.00 69.91  ? 276 LEU A O   1 
ATOM   1864 C CB  . LEU A 1 264 ? -16.042 34.972  -16.013 1.00 60.89  ? 276 LEU A CB  1 
ATOM   1865 C CG  . LEU A 1 264 ? -16.253 34.625  -14.550 1.00 66.45  ? 276 LEU A CG  1 
ATOM   1866 C CD1 . LEU A 1 264 ? -16.547 33.140  -14.367 1.00 66.29  ? 276 LEU A CD1 1 
ATOM   1867 C CD2 . LEU A 1 264 ? -15.019 34.989  -13.744 1.00 69.04  ? 276 LEU A CD2 1 
ATOM   1868 N N   . ASP A 1 265 ? -17.339 37.426  -17.526 1.00 65.14  ? 277 ASP A N   1 
ATOM   1869 C CA  . ASP A 1 265 ? -17.870 38.778  -17.689 1.00 66.92  ? 277 ASP A CA  1 
ATOM   1870 C C   . ASP A 1 265 ? -19.052 38.760  -18.666 1.00 73.65  ? 277 ASP A C   1 
ATOM   1871 O O   . ASP A 1 265 ? -18.917 38.268  -19.789 1.00 72.66  ? 277 ASP A O   1 
ATOM   1872 C CB  . ASP A 1 265 ? -16.755 39.735  -18.173 1.00 68.20  ? 277 ASP A CB  1 
ATOM   1873 C CG  . ASP A 1 265 ? -17.136 41.193  -18.415 1.00 82.86  ? 277 ASP A CG  1 
ATOM   1874 O OD1 . ASP A 1 265 ? -18.164 41.649  -17.852 1.00 85.43  ? 277 ASP A OD1 1 
ATOM   1875 O OD2 . ASP A 1 265 ? -16.383 41.890  -19.126 1.00 89.48  ? 277 ASP A OD2 1 
ATOM   1876 N N   . LYS A 1 266 ? -20.206 39.301  -18.232 1.00 73.42  ? 278 LYS A N   1 
ATOM   1877 C CA  . LYS A 1 266 ? -21.432 39.348  -19.032 1.00 74.90  ? 278 LYS A CA  1 
ATOM   1878 C C   . LYS A 1 266 ? -21.378 40.432  -20.135 1.00 80.19  ? 278 LYS A C   1 
ATOM   1879 O O   . LYS A 1 266 ? -22.194 40.394  -21.062 1.00 79.63  ? 278 LYS A O   1 
ATOM   1880 C CB  . LYS A 1 266 ? -22.655 39.561  -18.132 1.00 79.05  ? 278 LYS A CB  1 
ATOM   1881 C CG  . LYS A 1 266 ? -23.622 38.381  -18.135 1.00 91.70  ? 278 LYS A CG  1 
ATOM   1882 C CD  . LYS A 1 266 ? -23.294 37.343  -17.059 1.00 96.78  ? 278 LYS A CD  1 
ATOM   1883 C CE  . LYS A 1 266 ? -24.331 36.244  -17.028 1.00 102.95 ? 278 LYS A CE  1 
ATOM   1884 N NZ  . LYS A 1 266 ? -24.075 35.255  -15.947 1.00 108.62 ? 278 LYS A NZ  1 
ATOM   1885 N N   . LYS A 1 267 ? -20.422 41.384  -20.034 1.00 77.66  ? 279 LYS A N   1 
ATOM   1886 C CA  . LYS A 1 267 ? -20.193 42.428  -21.039 1.00 78.05  ? 279 LYS A CA  1 
ATOM   1887 C C   . LYS A 1 267 ? -19.588 41.842  -22.319 1.00 80.32  ? 279 LYS A C   1 
ATOM   1888 O O   . LYS A 1 267 ? -19.881 42.333  -23.413 1.00 79.85  ? 279 LYS A O   1 
ATOM   1889 C CB  . LYS A 1 267 ? -19.290 43.540  -20.480 1.00 81.39  ? 279 LYS A CB  1 
ATOM   1890 C CG  . LYS A 1 267 ? -20.065 44.777  -20.024 1.00 99.03  ? 279 LYS A CG  1 
ATOM   1891 C CD  . LYS A 1 267 ? -19.142 45.904  -19.574 1.00 110.87 ? 279 LYS A CD  1 
ATOM   1892 C CE  . LYS A 1 267 ? -18.964 45.958  -18.075 1.00 123.27 ? 279 LYS A CE  1 
ATOM   1893 N NZ  . LYS A 1 267 ? -18.141 47.125  -17.662 1.00 132.46 ? 279 LYS A NZ  1 
ATOM   1894 N N   . ILE A 1 268 ? -18.736 40.799  -22.170 1.00 75.11  ? 280 ILE A N   1 
ATOM   1895 C CA  . ILE A 1 268 ? -18.158 40.045  -23.281 1.00 73.16  ? 280 ILE A CA  1 
ATOM   1896 C C   . ILE A 1 268 ? -19.219 39.052  -23.799 1.00 74.81  ? 280 ILE A C   1 
ATOM   1897 O O   . ILE A 1 268 ? -19.834 38.322  -23.012 1.00 74.64  ? 280 ILE A O   1 
ATOM   1898 C CB  . ILE A 1 268 ? -16.823 39.347  -22.870 1.00 75.33  ? 280 ILE A CB  1 
ATOM   1899 C CG1 . ILE A 1 268 ? -15.829 40.363  -22.246 1.00 75.79  ? 280 ILE A CG1 1 
ATOM   1900 C CG2 . ILE A 1 268 ? -16.175 38.615  -24.068 1.00 75.23  ? 280 ILE A CG2 1 
ATOM   1901 C CD1 . ILE A 1 268 ? -14.717 39.751  -21.353 1.00 83.65  ? 280 ILE A CD1 1 
ATOM   1902 N N   . ASP A 1 269 ? -19.443 39.064  -25.126 1.00 69.42  ? 281 ASP A N   1 
ATOM   1903 C CA  . ASP A 1 269 ? -20.402 38.202  -25.830 1.00 68.54  ? 281 ASP A CA  1 
ATOM   1904 C C   . ASP A 1 269 ? -19.956 36.737  -25.815 1.00 64.70  ? 281 ASP A C   1 
ATOM   1905 O O   . ASP A 1 269 ? -18.745 36.471  -25.775 1.00 61.65  ? 281 ASP A O   1 
ATOM   1906 C CB  . ASP A 1 269 ? -20.565 38.677  -27.291 1.00 71.54  ? 281 ASP A CB  1 
ATOM   1907 C CG  . ASP A 1 269 ? -21.167 40.066  -27.482 1.00 90.65  ? 281 ASP A CG  1 
ATOM   1908 O OD1 . ASP A 1 269 ? -21.180 40.860  -26.500 1.00 93.52  ? 281 ASP A OD1 1 
ATOM   1909 O OD2 . ASP A 1 269 ? -21.596 40.371  -28.612 1.00 97.68  ? 281 ASP A OD2 1 
ATOM   1910 N N   . VAL A 1 270 ? -20.933 35.787  -25.845 1.00 57.28  ? 282 VAL A N   1 
ATOM   1911 C CA  . VAL A 1 270 ? -20.611 34.356  -25.949 1.00 54.23  ? 282 VAL A CA  1 
ATOM   1912 C C   . VAL A 1 270 ? -20.002 34.093  -27.323 1.00 54.25  ? 282 VAL A C   1 
ATOM   1913 O O   . VAL A 1 270 ? -20.384 34.752  -28.294 1.00 54.92  ? 282 VAL A O   1 
ATOM   1914 C CB  . VAL A 1 270 ? -21.768 33.362  -25.627 1.00 57.98  ? 282 VAL A CB  1 
ATOM   1915 C CG1 . VAL A 1 270 ? -22.333 33.590  -24.230 1.00 58.47  ? 282 VAL A CG1 1 
ATOM   1916 C CG2 . VAL A 1 270 ? -22.868 33.384  -26.675 1.00 58.56  ? 282 VAL A CG2 1 
ATOM   1917 N N   . PHE A 1 271 ? -19.020 33.182  -27.391 1.00 46.48  ? 283 PHE A N   1 
ATOM   1918 C CA  . PHE A 1 271 ? -18.390 32.837  -28.655 1.00 44.36  ? 283 PHE A CA  1 
ATOM   1919 C C   . PHE A 1 271 ? -18.796 31.428  -29.057 1.00 46.98  ? 283 PHE A C   1 
ATOM   1920 O O   . PHE A 1 271 ? -18.459 30.453  -28.380 1.00 46.16  ? 283 PHE A O   1 
ATOM   1921 C CB  . PHE A 1 271 ? -16.864 33.003  -28.596 1.00 44.60  ? 283 PHE A CB  1 
ATOM   1922 C CG  . PHE A 1 271 ? -16.211 33.014  -29.958 1.00 45.63  ? 283 PHE A CG  1 
ATOM   1923 C CD1 . PHE A 1 271 ? -16.160 34.182  -30.715 1.00 48.54  ? 283 PHE A CD1 1 
ATOM   1924 C CD2 . PHE A 1 271 ? -15.647 31.857  -30.487 1.00 47.17  ? 283 PHE A CD2 1 
ATOM   1925 C CE1 . PHE A 1 271 ? -15.573 34.189  -31.985 1.00 48.77  ? 283 PHE A CE1 1 
ATOM   1926 C CE2 . PHE A 1 271 ? -15.067 31.864  -31.757 1.00 49.42  ? 283 PHE A CE2 1 
ATOM   1927 C CZ  . PHE A 1 271 ? -15.028 33.033  -32.496 1.00 47.50  ? 283 PHE A CZ  1 
ATOM   1928 N N   . LYS A 1 272 ? -19.567 31.336  -30.146 1.00 43.21  ? 284 LYS A N   1 
ATOM   1929 C CA  . LYS A 1 272 ? -19.966 30.063  -30.738 1.00 42.61  ? 284 LYS A CA  1 
ATOM   1930 C C   . LYS A 1 272 ? -19.117 29.784  -31.994 1.00 44.32  ? 284 LYS A C   1 
ATOM   1931 O O   . LYS A 1 272 ? -18.917 30.682  -32.823 1.00 44.24  ? 284 LYS A O   1 
ATOM   1932 C CB  . LYS A 1 272 ? -21.473 30.054  -31.058 1.00 45.78  ? 284 LYS A CB  1 
ATOM   1933 C CG  . LYS A 1 272 ? -22.358 30.047  -29.813 1.00 48.90  ? 284 LYS A CG  1 
ATOM   1934 C CD  . LYS A 1 272 ? -23.849 30.102  -30.169 1.00 55.47  ? 284 LYS A CD  1 
ATOM   1935 C CE  . LYS A 1 272 ? -24.732 29.386  -29.179 1.00 69.87  ? 284 LYS A CE  1 
ATOM   1936 N NZ  . LYS A 1 272 ? -24.856 30.135  -27.903 1.00 87.54  ? 284 LYS A NZ  1 
ATOM   1937 N N   . PHE A 1 273 ? -18.587 28.555  -32.108 1.00 38.34  ? 285 PHE A N   1 
ATOM   1938 C CA  . PHE A 1 273 ? -17.869 28.145  -33.313 1.00 37.24  ? 285 PHE A CA  1 
ATOM   1939 C C   . PHE A 1 273 ? -18.138 26.676  -33.668 1.00 44.05  ? 285 PHE A C   1 
ATOM   1940 O O   . PHE A 1 273 ? -18.569 25.889  -32.827 1.00 43.79  ? 285 PHE A O   1 
ATOM   1941 C CB  . PHE A 1 273 ? -16.359 28.417  -33.205 1.00 36.76  ? 285 PHE A CB  1 
ATOM   1942 C CG  . PHE A 1 273 ? -15.623 27.678  -32.113 1.00 35.68  ? 285 PHE A CG  1 
ATOM   1943 C CD1 . PHE A 1 273 ? -15.048 26.439  -32.357 1.00 36.15  ? 285 PHE A CD1 1 
ATOM   1944 C CD2 . PHE A 1 273 ? -15.487 28.232  -30.845 1.00 36.37  ? 285 PHE A CD2 1 
ATOM   1945 C CE1 . PHE A 1 273 ? -14.350 25.759  -31.353 1.00 36.09  ? 285 PHE A CE1 1 
ATOM   1946 C CE2 . PHE A 1 273 ? -14.804 27.546  -29.837 1.00 37.92  ? 285 PHE A CE2 1 
ATOM   1947 C CZ  . PHE A 1 273 ? -14.226 26.319  -30.101 1.00 35.02  ? 285 PHE A CZ  1 
ATOM   1948 N N   . ASN A 1 274 ? -17.870 26.329  -34.931 1.00 42.93  ? 286 ASN A N   1 
ATOM   1949 C CA  . ASN A 1 274 ? -18.120 25.021  -35.526 1.00 44.36  ? 286 ASN A CA  1 
ATOM   1950 C C   . ASN A 1 274 ? -16.799 24.343  -35.878 1.00 49.26  ? 286 ASN A C   1 
ATOM   1951 O O   . ASN A 1 274 ? -15.893 25.001  -36.388 1.00 48.12  ? 286 ASN A O   1 
ATOM   1952 C CB  . ASN A 1 274 ? -18.991 25.188  -36.788 1.00 45.58  ? 286 ASN A CB  1 
ATOM   1953 C CG  . ASN A 1 274 ? -19.254 23.915  -37.541 1.00 67.73  ? 286 ASN A CG  1 
ATOM   1954 O OD1 . ASN A 1 274 ? -20.114 23.114  -37.168 1.00 70.87  ? 286 ASN A OD1 1 
ATOM   1955 N ND2 . ASN A 1 274 ? -18.524 23.705  -38.624 1.00 54.38  ? 286 ASN A ND2 1 
ATOM   1956 N N   . SER A 1 275 ? -16.694 23.040  -35.595 1.00 47.19  ? 287 SER A N   1 
ATOM   1957 C CA  . SER A 1 275 ? -15.618 22.194  -36.115 1.00 47.33  ? 287 SER A CA  1 
ATOM   1958 C C   . SER A 1 275 ? -16.238 20.944  -36.750 1.00 53.70  ? 287 SER A C   1 
ATOM   1959 O O   . SER A 1 275 ? -17.096 20.298  -36.134 1.00 53.68  ? 287 SER A O   1 
ATOM   1960 C CB  . SER A 1 275 ? -14.615 21.848  -35.018 1.00 50.42  ? 287 SER A CB  1 
ATOM   1961 O OG  . SER A 1 275 ? -13.639 20.896  -35.420 1.00 57.17  ? 287 SER A OG  1 
ATOM   1962 N N   . SER A 1 276 ? -15.805 20.624  -37.986 1.00 51.74  ? 288 SER A N   1 
ATOM   1963 C CA  . SER A 1 276 ? -16.442 19.650  -38.872 1.00 53.49  ? 288 SER A CA  1 
ATOM   1964 C C   . SER A 1 276 ? -16.249 18.188  -38.440 1.00 59.55  ? 288 SER A C   1 
ATOM   1965 O O   . SER A 1 276 ? -17.171 17.391  -38.631 1.00 62.28  ? 288 SER A O   1 
ATOM   1966 C CB  . SER A 1 276 ? -15.943 19.825  -40.302 1.00 57.84  ? 288 SER A CB  1 
ATOM   1967 O OG  . SER A 1 276 ? -14.526 19.785  -40.393 1.00 67.03  ? 288 SER A OG  1 
ATOM   1968 N N   . LYS A 1 277 ? -15.073 17.825  -37.885 1.00 53.99  ? 289 LYS A N   1 
ATOM   1969 C CA  . LYS A 1 277 ? -14.744 16.430  -37.568 1.00 53.43  ? 289 LYS A CA  1 
ATOM   1970 C C   . LYS A 1 277 ? -15.005 16.121  -36.095 1.00 58.09  ? 289 LYS A C   1 
ATOM   1971 O O   . LYS A 1 277 ? -14.494 16.823  -35.223 1.00 57.80  ? 289 LYS A O   1 
ATOM   1972 C CB  . LYS A 1 277 ? -13.283 16.114  -37.924 1.00 54.36  ? 289 LYS A CB  1 
ATOM   1973 C CG  . LYS A 1 277 ? -12.935 16.168  -39.405 1.00 58.14  ? 289 LYS A CG  1 
ATOM   1974 C CD  . LYS A 1 277 ? -11.424 16.060  -39.589 1.00 66.89  ? 289 LYS A CD  1 
ATOM   1975 C CE  . LYS A 1 277 ? -11.016 15.837  -41.020 1.00 83.62  ? 289 LYS A CE  1 
ATOM   1976 N NZ  . LYS A 1 277 ? -9.537  15.750  -41.155 1.00 96.18  ? 289 LYS A NZ  1 
ATOM   1977 N N   . LEU A 1 278 ? -15.779 15.059  -35.821 1.00 56.45  ? 290 LEU A N   1 
ATOM   1978 C CA  . LEU A 1 278 ? -16.178 14.653  -34.470 1.00 57.07  ? 290 LEU A CA  1 
ATOM   1979 C C   . LEU A 1 278 ? -14.992 14.144  -33.640 1.00 58.11  ? 290 LEU A C   1 
ATOM   1980 O O   . LEU A 1 278 ? -14.912 14.444  -32.447 1.00 56.65  ? 290 LEU A O   1 
ATOM   1981 C CB  . LEU A 1 278 ? -17.275 13.575  -34.531 1.00 59.65  ? 290 LEU A CB  1 
ATOM   1982 C CG  . LEU A 1 278 ? -17.895 13.147  -33.191 1.00 66.17  ? 290 LEU A CG  1 
ATOM   1983 C CD1 . LEU A 1 278 ? -18.756 14.255  -32.603 1.00 67.15  ? 290 LEU A CD1 1 
ATOM   1984 C CD2 . LEU A 1 278 ? -18.691 11.865  -33.345 1.00 70.19  ? 290 LEU A CD2 1 
ATOM   1985 N N   . ARG A 1 279 ? -14.093 13.354  -34.267 1.00 53.24  ? 291 ARG A N   1 
ATOM   1986 C CA  . ARG A 1 279 ? -12.900 12.800  -33.612 1.00 50.63  ? 291 ARG A CA  1 
ATOM   1987 C C   . ARG A 1 279 ? -11.927 13.926  -33.195 1.00 48.53  ? 291 ARG A C   1 
ATOM   1988 O O   . ARG A 1 279 ? -11.286 13.806  -32.151 1.00 47.36  ? 291 ARG A O   1 
ATOM   1989 C CB  . ARG A 1 279 ? -12.209 11.733  -34.490 1.00 51.53  ? 291 ARG A CB  1 
ATOM   1990 C CG  . ARG A 1 279 ? -11.852 12.183  -35.900 1.00 67.27  ? 291 ARG A CG  1 
ATOM   1991 C CD  . ARG A 1 279 ? -12.081 11.079  -36.910 1.00 84.17  ? 291 ARG A CD  1 
ATOM   1992 N NE  . ARG A 1 279 ? -11.608 11.464  -38.241 1.00 98.54  ? 291 ARG A NE  1 
ATOM   1993 C CZ  . ARG A 1 279 ? -12.353 12.069  -39.161 1.00 117.81 ? 291 ARG A CZ  1 
ATOM   1994 N NH1 . ARG A 1 279 ? -13.625 12.364  -38.908 1.00 109.65 ? 291 ARG A NH1 1 
ATOM   1995 N NH2 . ARG A 1 279 ? -11.835 12.380  -40.342 1.00 103.58 ? 291 ARG A NH2 1 
ATOM   1996 N N   . VAL A 1 280 ? -11.858 15.023  -33.980 1.00 42.01  ? 292 VAL A N   1 
ATOM   1997 C CA  . VAL A 1 280 ? -11.099 16.234  -33.634 1.00 39.61  ? 292 VAL A CA  1 
ATOM   1998 C C   . VAL A 1 280 ? -11.785 16.961  -32.447 1.00 42.02  ? 292 VAL A C   1 
ATOM   1999 O O   . VAL A 1 280 ? -11.089 17.420  -31.545 1.00 40.71  ? 292 VAL A O   1 
ATOM   2000 C CB  . VAL A 1 280 ? -10.907 17.177  -34.857 1.00 42.63  ? 292 VAL A CB  1 
ATOM   2001 C CG1 . VAL A 1 280 ? -10.161 18.449  -34.474 1.00 40.90  ? 292 VAL A CG1 1 
ATOM   2002 C CG2 . VAL A 1 280 ? -10.187 16.470  -36.002 1.00 42.45  ? 292 VAL A CG2 1 
ATOM   2003 N N   . ASN A 1 281 ? -13.132 17.039  -32.438 1.00 38.81  ? 293 ASN A N   1 
ATOM   2004 C CA  . ASN A 1 281 ? -13.903 17.731  -31.387 1.00 38.30  ? 293 ASN A CA  1 
ATOM   2005 C C   . ASN A 1 281 ? -13.725 17.114  -29.995 1.00 40.60  ? 293 ASN A C   1 
ATOM   2006 O O   . ASN A 1 281 ? -13.731 17.849  -29.006 1.00 38.19  ? 293 ASN A O   1 
ATOM   2007 C CB  . ASN A 1 281 ? -15.393 17.761  -31.737 1.00 38.48  ? 293 ASN A CB  1 
ATOM   2008 C CG  . ASN A 1 281 ? -15.686 18.560  -32.965 1.00 58.84  ? 293 ASN A CG  1 
ATOM   2009 O OD1 . ASN A 1 281 ? -14.832 19.296  -33.470 1.00 49.98  ? 293 ASN A OD1 1 
ATOM   2010 N ND2 . ASN A 1 281 ? -16.884 18.397  -33.500 1.00 54.54  ? 293 ASN A ND2 1 
ATOM   2011 N N   . LYS A 1 282 ? -13.619 15.769  -29.928 1.00 38.71  ? 294 LYS A N   1 
ATOM   2012 C CA  . LYS A 1 282 ? -13.324 14.990  -28.719 1.00 38.31  ? 294 LYS A CA  1 
ATOM   2013 C C   . LYS A 1 282 ? -11.948 15.358  -28.199 1.00 40.53  ? 294 LYS A C   1 
ATOM   2014 O O   . LYS A 1 282 ? -11.790 15.554  -26.992 1.00 41.04  ? 294 LYS A O   1 
ATOM   2015 C CB  . LYS A 1 282 ? -13.414 13.477  -28.990 1.00 40.98  ? 294 LYS A CB  1 
ATOM   2016 C CG  . LYS A 1 282 ? -14.845 12.969  -29.129 1.00 51.19  ? 294 LYS A CG  1 
ATOM   2017 C CD  . LYS A 1 282 ? -14.903 11.550  -29.663 1.00 57.65  ? 294 LYS A CD  1 
ATOM   2018 C CE  . LYS A 1 282 ? -16.312 11.050  -29.835 1.00 64.15  ? 294 LYS A CE  1 
ATOM   2019 N NZ  . LYS A 1 282 ? -16.331 9.729   -30.516 1.00 74.17  ? 294 LYS A NZ  1 
ATOM   2020 N N   . LEU A 1 283 ? -10.963 15.485  -29.108 1.00 35.12  ? 295 LEU A N   1 
ATOM   2021 C CA  . LEU A 1 283 ? -9.598  15.903  -28.772 1.00 34.01  ? 295 LEU A CA  1 
ATOM   2022 C C   . LEU A 1 283 ? -9.570  17.340  -28.202 1.00 38.74  ? 295 LEU A C   1 
ATOM   2023 O O   . LEU A 1 283 ? -8.944  17.544  -27.163 1.00 39.31  ? 295 LEU A O   1 
ATOM   2024 C CB  . LEU A 1 283 ? -8.674  15.779  -29.997 1.00 33.54  ? 295 LEU A CB  1 
ATOM   2025 C CG  . LEU A 1 283 ? -7.200  16.170  -29.835 1.00 37.35  ? 295 LEU A CG  1 
ATOM   2026 C CD1 . LEU A 1 283 ? -6.547  15.467  -28.647 1.00 36.76  ? 295 LEU A CD1 1 
ATOM   2027 C CD2 . LEU A 1 283 ? -6.435  15.882  -31.114 1.00 38.49  ? 295 LEU A CD2 1 
ATOM   2028 N N   . ILE A 1 284 ? -10.239 18.315  -28.867 1.00 33.58  ? 296 ILE A N   1 
ATOM   2029 C CA  . ILE A 1 284 ? -10.351 19.699  -28.401 1.00 32.23  ? 296 ILE A CA  1 
ATOM   2030 C C   . ILE A 1 284 ? -10.830 19.724  -26.938 1.00 36.35  ? 296 ILE A C   1 
ATOM   2031 O O   . ILE A 1 284 ? -10.182 20.361  -26.105 1.00 36.01  ? 296 ILE A O   1 
ATOM   2032 C CB  . ILE A 1 284 ? -11.265 20.554  -29.330 1.00 36.02  ? 296 ILE A CB  1 
ATOM   2033 C CG1 . ILE A 1 284 ? -10.617 20.743  -30.728 1.00 35.47  ? 296 ILE A CG1 1 
ATOM   2034 C CG2 . ILE A 1 284 ? -11.631 21.920  -28.685 1.00 37.52  ? 296 ILE A CG2 1 
ATOM   2035 C CD1 . ILE A 1 284 ? -11.550 21.269  -31.810 1.00 40.84  ? 296 ILE A CD1 1 
ATOM   2036 N N   . LEU A 1 285 ? -11.920 19.000  -26.617 1.00 33.09  ? 297 LEU A N   1 
ATOM   2037 C CA  . LEU A 1 285 ? -12.519 19.018  -25.278 1.00 32.37  ? 297 LEU A CA  1 
ATOM   2038 C C   . LEU A 1 285 ? -11.578 18.419  -24.236 1.00 35.19  ? 297 LEU A C   1 
ATOM   2039 O O   . LEU A 1 285 ? -11.470 18.977  -23.145 1.00 33.92  ? 297 LEU A O   1 
ATOM   2040 C CB  . LEU A 1 285 ? -13.872 18.305  -25.256 1.00 33.09  ? 297 LEU A CB  1 
ATOM   2041 C CG  . LEU A 1 285 ? -15.007 18.981  -26.034 1.00 37.66  ? 297 LEU A CG  1 
ATOM   2042 C CD1 . LEU A 1 285 ? -16.221 18.073  -26.127 1.00 38.03  ? 297 LEU A CD1 1 
ATOM   2043 C CD2 . LEU A 1 285 ? -15.373 20.339  -25.437 1.00 40.87  ? 297 LEU A CD2 1 
ATOM   2044 N N   . GLN A 1 286 ? -10.876 17.314  -24.590 1.00 31.94  ? 298 GLN A N   1 
ATOM   2045 C CA  . GLN A 1 286 ? -9.848  16.677  -23.765 1.00 31.03  ? 298 GLN A CA  1 
ATOM   2046 C C   . GLN A 1 286 ? -8.769  17.685  -23.369 1.00 36.38  ? 298 GLN A C   1 
ATOM   2047 O O   . GLN A 1 286 ? -8.385  17.759  -22.198 1.00 36.46  ? 298 GLN A O   1 
ATOM   2048 C CB  . GLN A 1 286 ? -9.196  15.497  -24.519 1.00 31.66  ? 298 GLN A CB  1 
ATOM   2049 C CG  . GLN A 1 286 ? -10.007 14.204  -24.517 1.00 36.15  ? 298 GLN A CG  1 
ATOM   2050 C CD  . GLN A 1 286 ? -9.348  13.086  -25.309 1.00 51.19  ? 298 GLN A CD  1 
ATOM   2051 O OE1 . GLN A 1 286 ? -8.211  13.183  -25.787 1.00 53.27  ? 298 GLN A OE1 1 
ATOM   2052 N NE2 . GLN A 1 286 ? -10.041 11.978  -25.456 1.00 37.40  ? 298 GLN A NE2 1 
ATOM   2053 N N   . LEU A 1 287 ? -8.290  18.462  -24.356 1.00 33.11  ? 299 LEU A N   1 
ATOM   2054 C CA  . LEU A 1 287 ? -7.255  19.475  -24.166 1.00 31.62  ? 299 LEU A CA  1 
ATOM   2055 C C   . LEU A 1 287 ? -7.783  20.670  -23.377 1.00 35.35  ? 299 LEU A C   1 
ATOM   2056 O O   . LEU A 1 287 ? -7.031  21.264  -22.620 1.00 35.91  ? 299 LEU A O   1 
ATOM   2057 C CB  . LEU A 1 287 ? -6.681  19.932  -25.522 1.00 31.06  ? 299 LEU A CB  1 
ATOM   2058 C CG  . LEU A 1 287 ? -5.971  18.866  -26.365 1.00 34.02  ? 299 LEU A CG  1 
ATOM   2059 C CD1 . LEU A 1 287 ? -5.738  19.362  -27.765 1.00 33.71  ? 299 LEU A CD1 1 
ATOM   2060 C CD2 . LEU A 1 287 ? -4.676  18.412  -25.734 1.00 33.39  ? 299 LEU A CD2 1 
ATOM   2061 N N   . CYS A 1 288 ? -9.061  21.019  -23.536 1.00 32.75  ? 300 CYS A N   1 
ATOM   2062 C CA  . CYS A 1 288 ? -9.690  22.097  -22.764 1.00 32.63  ? 300 CYS A CA  1 
ATOM   2063 C C   . CYS A 1 288 ? -9.714  21.750  -21.272 1.00 35.15  ? 300 CYS A C   1 
ATOM   2064 O O   . CYS A 1 288 ? -9.343  22.592  -20.455 1.00 34.00  ? 300 CYS A O   1 
ATOM   2065 C CB  . CYS A 1 288 ? -11.094 22.411  -23.285 1.00 33.87  ? 300 CYS A CB  1 
ATOM   2066 S SG  . CYS A 1 288 ? -11.121 23.214  -24.909 1.00 37.55  ? 300 CYS A SG  1 
ATOM   2067 N N   . ILE A 1 289 ? -10.121 20.509  -20.923 1.00 31.78  ? 301 ILE A N   1 
ATOM   2068 C CA  . ILE A 1 289 ? -10.267 20.067  -19.530 1.00 31.88  ? 301 ILE A CA  1 
ATOM   2069 C C   . ILE A 1 289 ? -8.897  20.040  -18.819 1.00 36.52  ? 301 ILE A C   1 
ATOM   2070 O O   . ILE A 1 289 ? -8.760  20.657  -17.759 1.00 36.84  ? 301 ILE A O   1 
ATOM   2071 C CB  . ILE A 1 289 ? -11.016 18.713  -19.444 1.00 35.09  ? 301 ILE A CB  1 
ATOM   2072 C CG1 . ILE A 1 289 ? -12.526 18.926  -19.797 1.00 36.99  ? 301 ILE A CG1 1 
ATOM   2073 C CG2 . ILE A 1 289 ? -10.867 18.075  -18.057 1.00 33.63  ? 301 ILE A CG2 1 
ATOM   2074 C CD1 . ILE A 1 289 ? -13.101 17.837  -20.570 1.00 45.59  ? 301 ILE A CD1 1 
ATOM   2075 N N   . GLY A 1 290 ? -7.919  19.362  -19.421 1.00 32.05  ? 302 GLY A N   1 
ATOM   2076 C CA  . GLY A 1 290 ? -6.573  19.228  -18.886 1.00 30.96  ? 302 GLY A CA  1 
ATOM   2077 C C   . GLY A 1 290 ? -5.877  20.558  -18.685 1.00 36.09  ? 302 GLY A C   1 
ATOM   2078 O O   . GLY A 1 290 ? -5.341  20.816  -17.608 1.00 35.68  ? 302 GLY A O   1 
ATOM   2079 N N   . ASN A 1 291 ? -5.907  21.432  -19.709 1.00 33.12  ? 303 ASN A N   1 
ATOM   2080 C CA  . ASN A 1 291 ? -5.247  22.739  -19.653 1.00 32.23  ? 303 ASN A CA  1 
ATOM   2081 C C   . ASN A 1 291 ? -5.920  23.663  -18.659 1.00 36.45  ? 303 ASN A C   1 
ATOM   2082 O O   . ASN A 1 291 ? -5.219  24.393  -17.973 1.00 37.80  ? 303 ASN A O   1 
ATOM   2083 C CB  . ASN A 1 291 ? -5.185  23.396  -21.022 1.00 31.43  ? 303 ASN A CB  1 
ATOM   2084 C CG  . ASN A 1 291 ? -4.100  22.824  -21.895 1.00 38.34  ? 303 ASN A CG  1 
ATOM   2085 O OD1 . ASN A 1 291 ? -2.901  22.932  -21.608 1.00 32.83  ? 303 ASN A OD1 1 
ATOM   2086 N ND2 . ASN A 1 291 ? -4.500  22.218  -22.991 1.00 23.61  ? 303 ASN A ND2 1 
ATOM   2087 N N   . HIS A 1 292 ? -7.261  23.625  -18.567 1.00 32.78  ? 304 HIS A N   1 
ATOM   2088 C CA  . HIS A 1 292 ? -8.024  24.363  -17.562 1.00 32.56  ? 304 HIS A CA  1 
ATOM   2089 C C   . HIS A 1 292 ? -7.568  24.001  -16.155 1.00 35.19  ? 304 HIS A C   1 
ATOM   2090 O O   . HIS A 1 292 ? -7.311  24.893  -15.348 1.00 35.42  ? 304 HIS A O   1 
ATOM   2091 C CB  . HIS A 1 292 ? -9.526  24.097  -17.705 1.00 34.64  ? 304 HIS A CB  1 
ATOM   2092 C CG  . HIS A 1 292 ? -10.338 24.714  -16.605 1.00 39.56  ? 304 HIS A CG  1 
ATOM   2093 N ND1 . HIS A 1 292 ? -10.601 24.028  -15.433 1.00 42.08  ? 304 HIS A ND1 1 
ATOM   2094 C CD2 . HIS A 1 292 ? -10.878 25.951  -16.519 1.00 42.08  ? 304 HIS A CD2 1 
ATOM   2095 C CE1 . HIS A 1 292 ? -11.284 24.869  -14.674 1.00 42.52  ? 304 HIS A CE1 1 
ATOM   2096 N NE2 . HIS A 1 292 ? -11.488 26.032  -15.294 1.00 43.00  ? 304 HIS A NE2 1 
ATOM   2097 N N   . ASP A 1 293 ? -7.453  22.696  -15.873 1.00 30.84  ? 305 ASP A N   1 
ATOM   2098 C CA  . ASP A 1 293 ? -7.159  22.167  -14.551 1.00 30.62  ? 305 ASP A CA  1 
ATOM   2099 C C   . ASP A 1 293 ? -5.719  22.393  -14.150 1.00 35.25  ? 305 ASP A C   1 
ATOM   2100 O O   . ASP A 1 293 ? -5.457  22.695  -12.986 1.00 35.44  ? 305 ASP A O   1 
ATOM   2101 C CB  . ASP A 1 293 ? -7.505  20.683  -14.499 1.00 32.52  ? 305 ASP A CB  1 
ATOM   2102 C CG  . ASP A 1 293 ? -8.997  20.403  -14.328 1.00 37.70  ? 305 ASP A CG  1 
ATOM   2103 O OD1 . ASP A 1 293 ? -9.818  21.307  -14.627 1.00 38.35  ? 305 ASP A OD1 1 
ATOM   2104 O OD2 . ASP A 1 293 ? -9.341  19.291  -13.899 1.00 36.66  ? 305 ASP A OD2 1 
ATOM   2105 N N   . LEU A 1 294 ? -4.786  22.265  -15.098 1.00 32.90  ? 306 LEU A N   1 
ATOM   2106 C CA  . LEU A 1 294 ? -3.380  22.547  -14.825 1.00 32.95  ? 306 LEU A CA  1 
ATOM   2107 C C   . LEU A 1 294 ? -3.169  24.041  -14.612 1.00 36.97  ? 306 LEU A C   1 
ATOM   2108 O O   . LEU A 1 294 ? -2.355  24.411  -13.766 1.00 38.90  ? 306 LEU A O   1 
ATOM   2109 C CB  . LEU A 1 294 ? -2.453  22.010  -15.929 1.00 32.29  ? 306 LEU A CB  1 
ATOM   2110 C CG  . LEU A 1 294 ? -2.389  20.491  -16.108 1.00 35.64  ? 306 LEU A CG  1 
ATOM   2111 C CD1 . LEU A 1 294 ? -1.635  20.130  -17.379 1.00 35.48  ? 306 LEU A CD1 1 
ATOM   2112 C CD2 . LEU A 1 294 ? -1.774  19.815  -14.900 1.00 36.43  ? 306 LEU A CD2 1 
ATOM   2113 N N   . PHE A 1 295 ? -3.915  24.891  -15.340 1.00 30.63  ? 307 PHE A N   1 
ATOM   2114 C CA  . PHE A 1 295 ? -3.933  26.347  -15.131 1.00 29.68  ? 307 PHE A CA  1 
ATOM   2115 C C   . PHE A 1 295 ? -4.333  26.697  -13.703 1.00 36.64  ? 307 PHE A C   1 
ATOM   2116 O O   . PHE A 1 295 ? -3.702  27.553  -13.094 1.00 38.88  ? 307 PHE A O   1 
ATOM   2117 C CB  . PHE A 1 295 ? -4.896  27.029  -16.127 1.00 30.49  ? 307 PHE A CB  1 
ATOM   2118 C CG  . PHE A 1 295 ? -5.089  28.521  -15.971 1.00 30.54  ? 307 PHE A CG  1 
ATOM   2119 C CD1 . PHE A 1 295 ? -6.034  29.030  -15.079 1.00 32.19  ? 307 PHE A CD1 1 
ATOM   2120 C CD2 . PHE A 1 295 ? -4.379  29.415  -16.762 1.00 31.33  ? 307 PHE A CD2 1 
ATOM   2121 C CE1 . PHE A 1 295 ? -6.230  30.410  -14.945 1.00 32.82  ? 307 PHE A CE1 1 
ATOM   2122 C CE2 . PHE A 1 295 ? -4.582  30.799  -16.636 1.00 34.15  ? 307 PHE A CE2 1 
ATOM   2123 C CZ  . PHE A 1 295 ? -5.505  31.286  -15.723 1.00 32.14  ? 307 PHE A CZ  1 
ATOM   2124 N N   . MET A 1 296 ? -5.388  26.052  -13.177 1.00 33.52  ? 308 MET A N   1 
ATOM   2125 C CA  . MET A 1 296 ? -5.935  26.334  -11.840 1.00 33.26  ? 308 MET A CA  1 
ATOM   2126 C C   . MET A 1 296 ? -4.958  25.907  -10.722 1.00 36.71  ? 308 MET A C   1 
ATOM   2127 O O   . MET A 1 296 ? -4.788  26.643  -9.753  1.00 35.93  ? 308 MET A O   1 
ATOM   2128 C CB  . MET A 1 296 ? -7.312  25.659  -11.650 1.00 35.44  ? 308 MET A CB  1 
ATOM   2129 C CG  . MET A 1 296 ? -8.423  26.210  -12.551 1.00 38.75  ? 308 MET A CG  1 
ATOM   2130 S SD  . MET A 1 296 ? -8.675  28.019  -12.566 1.00 43.36  ? 308 MET A SD  1 
ATOM   2131 C CE  . MET A 1 296 ? -9.058  28.313  -10.843 1.00 41.90  ? 308 MET A CE  1 
ATOM   2132 N N   . ARG A 1 297 ? -4.316  24.728  -10.872 1.00 34.07  ? 309 ARG A N   1 
ATOM   2133 C CA  . ARG A 1 297 ? -3.310  24.208  -9.932  1.00 34.11  ? 309 ARG A CA  1 
ATOM   2134 C C   . ARG A 1 297 ? -2.096  25.138  -9.805  1.00 41.03  ? 309 ARG A C   1 
ATOM   2135 O O   . ARG A 1 297 ? -1.523  25.242  -8.725  1.00 40.79  ? 309 ARG A O   1 
ATOM   2136 C CB  . ARG A 1 297 ? -2.821  22.832  -10.380 1.00 29.55  ? 309 ARG A CB  1 
ATOM   2137 C CG  . ARG A 1 297 ? -3.746  21.695  -10.079 1.00 26.83  ? 309 ARG A CG  1 
ATOM   2138 C CD  . ARG A 1 297 ? -3.022  20.404  -10.361 1.00 29.13  ? 309 ARG A CD  1 
ATOM   2139 N NE  . ARG A 1 297 ? -3.857  19.233  -10.090 1.00 35.86  ? 309 ARG A NE  1 
ATOM   2140 C CZ  . ARG A 1 297 ? -3.635  18.017  -10.582 1.00 46.94  ? 309 ARG A CZ  1 
ATOM   2141 N NH1 . ARG A 1 297 ? -2.610  17.800  -11.405 1.00 30.87  ? 309 ARG A NH1 1 
ATOM   2142 N NH2 . ARG A 1 297 ? -4.444  17.012  -10.273 1.00 34.63  ? 309 ARG A NH2 1 
ATOM   2143 N N   . ARG A 1 298 ? -1.702  25.790  -10.916 1.00 39.48  ? 310 ARG A N   1 
ATOM   2144 C CA  . ARG A 1 298 ? -0.584  26.733  -10.983 1.00 39.91  ? 310 ARG A CA  1 
ATOM   2145 C C   . ARG A 1 298 ? -0.906  28.044  -10.262 1.00 49.47  ? 310 ARG A C   1 
ATOM   2146 O O   . ARG A 1 298 ? 0.011   28.807  -9.933  1.00 51.12  ? 310 ARG A O   1 
ATOM   2147 C CB  . ARG A 1 298 ? -0.218  27.024  -12.444 1.00 34.92  ? 310 ARG A CB  1 
ATOM   2148 C CG  . ARG A 1 298 ? 0.515   25.888  -13.100 1.00 32.95  ? 310 ARG A CG  1 
ATOM   2149 C CD  . ARG A 1 298 ? 0.703   26.136  -14.570 1.00 35.56  ? 310 ARG A CD  1 
ATOM   2150 N NE  . ARG A 1 298 ? 1.079   24.907  -15.268 1.00 30.24  ? 310 ARG A NE  1 
ATOM   2151 C CZ  . ARG A 1 298 ? 0.501   24.461  -16.372 1.00 34.92  ? 310 ARG A CZ  1 
ATOM   2152 N NH1 . ARG A 1 298 ? -0.487  25.146  -16.936 1.00 35.07  ? 310 ARG A NH1 1 
ATOM   2153 N NH2 . ARG A 1 298 ? 0.916   23.338  -16.933 1.00 29.16  ? 310 ARG A NH2 1 
ATOM   2154 N N   . ARG A 1 299 ? -2.202  28.319  -10.044 1.00 47.44  ? 311 ARG A N   1 
ATOM   2155 C CA  . ARG A 1 299 ? -2.657  29.499  -9.323  1.00 48.51  ? 311 ARG A CA  1 
ATOM   2156 C C   . ARG A 1 299 ? -3.042  29.121  -7.895  1.00 54.35  ? 311 ARG A C   1 
ATOM   2157 O O   . ARG A 1 299 ? -3.707  29.893  -7.207  1.00 55.90  ? 311 ARG A O   1 
ATOM   2158 C CB  . ARG A 1 299 ? -3.806  30.163  -10.082 1.00 51.13  ? 311 ARG A CB  1 
ATOM   2159 C CG  . ARG A 1 299 ? -3.276  31.223  -11.043 1.00 68.65  ? 311 ARG A CG  1 
ATOM   2160 C CD  . ARG A 1 299 ? -3.965  31.209  -12.384 1.00 76.47  ? 311 ARG A CD  1 
ATOM   2161 N NE  . ARG A 1 299 ? -3.129  31.776  -13.449 1.00 82.83  ? 311 ARG A NE  1 
ATOM   2162 C CZ  . ARG A 1 299 ? -2.271  31.076  -14.193 1.00 94.74  ? 311 ARG A CZ  1 
ATOM   2163 N NH1 . ARG A 1 299 ? -2.114  29.774  -13.993 1.00 75.71  ? 311 ARG A NH1 1 
ATOM   2164 N NH2 . ARG A 1 299 ? -1.575  31.672  -15.150 1.00 83.49  ? 311 ARG A NH2 1 
ATOM   2165 N N   . LYS A 1 300 ? -2.574  27.930  -7.445  1.00 51.24  ? 312 LYS A N   1 
ATOM   2166 C CA  . LYS A 1 300 ? -2.687  27.336  -6.100  1.00 60.88  ? 312 LYS A CA  1 
ATOM   2167 C C   . LYS A 1 300 ? -4.156  27.086  -5.737  1.00 109.89 ? 312 LYS A C   1 
ATOM   2168 O O   . LYS A 1 300 ? -4.770  26.142  -6.236  1.00 74.15  ? 312 LYS A O   1 
ATOM   2169 C CB  . LYS A 1 300 ? -1.991  28.201  -5.018  1.00 63.29  ? 312 LYS A CB  1 
ATOM   2170 C CG  . LYS A 1 300 ? -0.544  28.600  -5.318  1.00 81.82  ? 312 LYS A CG  1 
ATOM   2171 C CD  . LYS A 1 300 ? 0.498   27.552  -4.891  1.00 98.19  ? 312 LYS A CD  1 
ATOM   2172 C CE  . LYS A 1 300 ? 1.863   28.162  -4.697  1.00 108.13 ? 312 LYS A CE  1 
ATOM   2173 N NZ  . LYS A 1 300 ? 2.839   27.152  -4.230  1.00 113.29 ? 312 LYS A NZ  1 
ATOM   2174 C CA  . LYS B 1 8   ? 0.827   -16.071 -57.313 1.00 139.65 ? 20  LYS B CA  1 
ATOM   2175 C C   . LYS B 1 8   ? 0.275   -14.642 -57.252 1.00 138.55 ? 20  LYS B C   1 
ATOM   2176 O O   . LYS B 1 8   ? 0.746   -13.775 -57.994 1.00 136.74 ? 20  LYS B O   1 
ATOM   2177 C CB  . LYS B 1 8   ? 0.118   -16.870 -58.405 1.00 143.82 ? 20  LYS B CB  1 
ATOM   2178 C CG  . LYS B 1 8   ? -1.169  -17.480 -57.918 1.00 158.19 ? 20  LYS B CG  1 
ATOM   2179 C CD  . LYS B 1 8   ? -2.225  -17.439 -58.986 1.00 168.05 ? 20  LYS B CD  1 
ATOM   2180 C CE  . LYS B 1 8   ? -3.400  -18.305 -58.617 1.00 181.03 ? 20  LYS B CE  1 
ATOM   2181 N NZ  . LYS B 1 8   ? -4.198  -17.738 -57.495 1.00 185.18 ? 20  LYS B NZ  1 
ATOM   2182 N N   . THR B 1 9   ? -0.734  -14.402 -56.384 1.00 132.12 ? 21  THR B N   1 
ATOM   2183 C CA  . THR B 1 9   ? -1.286  -13.064 -56.124 1.00 126.59 ? 21  THR B CA  1 
ATOM   2184 C C   . THR B 1 9   ? -1.406  -12.781 -54.619 1.00 127.88 ? 21  THR B C   1 
ATOM   2185 O O   . THR B 1 9   ? -1.449  -13.711 -53.810 1.00 130.27 ? 21  THR B O   1 
ATOM   2186 C CB  . THR B 1 9   ? -2.660  -12.860 -56.797 1.00 133.02 ? 21  THR B CB  1 
ATOM   2187 O OG1 . THR B 1 9   ? -3.576  -13.857 -56.350 1.00 135.37 ? 21  THR B OG1 1 
ATOM   2188 C CG2 . THR B 1 9   ? -2.588  -12.823 -58.319 1.00 132.07 ? 21  THR B CG2 1 
ATOM   2189 N N   . PHE B 1 10  ? -1.453  -11.486 -54.258 1.00 119.32 ? 22  PHE B N   1 
ATOM   2190 C CA  . PHE B 1 10  ? -1.744  -11.008 -52.905 1.00 116.74 ? 22  PHE B CA  1 
ATOM   2191 C C   . PHE B 1 10  ? -2.785  -9.885  -52.969 1.00 113.92 ? 22  PHE B C   1 
ATOM   2192 O O   . PHE B 1 10  ? -2.875  -9.190  -53.983 1.00 111.53 ? 22  PHE B O   1 
ATOM   2193 C CB  . PHE B 1 10  ? -0.460  -10.551 -52.185 1.00 118.85 ? 22  PHE B CB  1 
ATOM   2194 C CG  . PHE B 1 10  ? 0.277   -9.386  -52.806 1.00 118.06 ? 22  PHE B CG  1 
ATOM   2195 C CD1 . PHE B 1 10  ? 1.174   -9.584  -53.848 1.00 122.67 ? 22  PHE B CD1 1 
ATOM   2196 C CD2 . PHE B 1 10  ? 0.120   -8.100  -52.309 1.00 116.99 ? 22  PHE B CD2 1 
ATOM   2197 C CE1 . PHE B 1 10  ? 1.866   -8.510  -54.412 1.00 121.60 ? 22  PHE B CE1 1 
ATOM   2198 C CE2 . PHE B 1 10  ? 0.819   -7.027  -52.869 1.00 117.91 ? 22  PHE B CE2 1 
ATOM   2199 C CZ  . PHE B 1 10  ? 1.681   -7.238  -53.921 1.00 117.47 ? 22  PHE B CZ  1 
ATOM   2200 N N   . THR B 1 11  ? -3.571  -9.716  -51.893 1.00 107.46 ? 23  THR B N   1 
ATOM   2201 C CA  . THR B 1 11  ? -4.660  -8.738  -51.839 1.00 102.57 ? 23  THR B CA  1 
ATOM   2202 C C   . THR B 1 11  ? -4.094  -7.344  -51.552 1.00 100.60 ? 23  THR B C   1 
ATOM   2203 O O   . THR B 1 11  ? -3.251  -7.186  -50.662 1.00 101.14 ? 23  THR B O   1 
ATOM   2204 C CB  . THR B 1 11  ? -5.724  -9.174  -50.811 1.00 110.45 ? 23  THR B CB  1 
ATOM   2205 O OG1 . THR B 1 11  ? -6.263  -10.429 -51.222 1.00 112.68 ? 23  THR B OG1 1 
ATOM   2206 C CG2 . THR B 1 11  ? -6.867  -8.173  -50.668 1.00 105.38 ? 23  THR B CG2 1 
ATOM   2207 N N   . VAL B 1 12  ? -4.544  -6.345  -52.341 1.00 91.25  ? 24  VAL B N   1 
ATOM   2208 C CA  . VAL B 1 12  ? -4.231  -4.927  -52.139 1.00 86.38  ? 24  VAL B CA  1 
ATOM   2209 C C   . VAL B 1 12  ? -5.542  -4.162  -51.950 1.00 83.97  ? 24  VAL B C   1 
ATOM   2210 O O   . VAL B 1 12  ? -6.444  -4.266  -52.781 1.00 82.86  ? 24  VAL B O   1 
ATOM   2211 C CB  . VAL B 1 12  ? -3.362  -4.312  -53.275 1.00 89.28  ? 24  VAL B CB  1 
ATOM   2212 C CG1 . VAL B 1 12  ? -3.018  -2.863  -52.977 1.00 86.02  ? 24  VAL B CG1 1 
ATOM   2213 C CG2 . VAL B 1 12  ? -2.081  -5.098  -53.474 1.00 92.25  ? 24  VAL B CG2 1 
ATOM   2214 N N   . ARG B 1 13  ? -5.644  -3.424  -50.834 1.00 76.48  ? 25  ARG B N   1 
ATOM   2215 C CA  . ARG B 1 13  ? -6.713  -2.470  -50.574 1.00 72.47  ? 25  ARG B CA  1 
ATOM   2216 C C   . ARG B 1 13  ? -6.380  -1.157  -51.286 1.00 71.60  ? 25  ARG B C   1 
ATOM   2217 O O   . ARG B 1 13  ? -5.305  -0.599  -51.074 1.00 70.53  ? 25  ARG B O   1 
ATOM   2218 C CB  . ARG B 1 13  ? -6.885  -2.264  -49.062 1.00 72.34  ? 25  ARG B CB  1 
ATOM   2219 C CG  . ARG B 1 13  ? -8.213  -1.642  -48.644 1.00 81.72  ? 25  ARG B CG  1 
ATOM   2220 C CD  . ARG B 1 13  ? -8.396  -1.665  -47.132 1.00 96.93  ? 25  ARG B CD  1 
ATOM   2221 N NE  . ARG B 1 13  ? -8.549  -3.030  -46.625 1.00 115.99 ? 25  ARG B NE  1 
ATOM   2222 C CZ  . ARG B 1 13  ? -8.603  -3.370  -45.341 1.00 133.71 ? 25  ARG B CZ  1 
ATOM   2223 N NH1 . ARG B 1 13  ? -8.747  -4.640  -44.991 1.00 124.65 ? 25  ARG B NH1 1 
ATOM   2224 N NH2 . ARG B 1 13  ? -8.503  -2.443  -44.394 1.00 120.01 ? 25  ARG B NH2 1 
ATOM   2225 N N   . ILE B 1 14  ? -7.271  -0.701  -52.176 1.00 65.38  ? 26  ILE B N   1 
ATOM   2226 C CA  . ILE B 1 14  ? -7.154  0.605   -52.829 1.00 61.59  ? 26  ILE B CA  1 
ATOM   2227 C C   . ILE B 1 14  ? -8.319  1.464   -52.359 1.00 62.02  ? 26  ILE B C   1 
ATOM   2228 O O   . ILE B 1 14  ? -9.475  1.103   -52.571 1.00 60.79  ? 26  ILE B O   1 
ATOM   2229 C CB  . ILE B 1 14  ? -7.068  0.514   -54.385 1.00 64.50  ? 26  ILE B CB  1 
ATOM   2230 C CG1 . ILE B 1 14  ? -5.880  -0.375  -54.876 1.00 66.94  ? 26  ILE B CG1 1 
ATOM   2231 C CG2 . ILE B 1 14  ? -7.091  1.913   -55.052 1.00 62.05  ? 26  ILE B CG2 1 
ATOM   2232 C CD1 . ILE B 1 14  ? -4.456  0.116   -54.612 1.00 71.59  ? 26  ILE B CD1 1 
ATOM   2233 N N   . VAL B 1 15  ? -8.007  2.606   -51.723 1.00 56.62  ? 27  VAL B N   1 
ATOM   2234 C CA  . VAL B 1 15  ? -9.016  3.514   -51.187 1.00 53.66  ? 27  VAL B CA  1 
ATOM   2235 C C   . VAL B 1 15  ? -9.110  4.719   -52.110 1.00 55.86  ? 27  VAL B C   1 
ATOM   2236 O O   . VAL B 1 15  ? -8.130  5.452   -52.272 1.00 55.37  ? 27  VAL B O   1 
ATOM   2237 C CB  . VAL B 1 15  ? -8.729  3.903   -49.710 1.00 56.50  ? 27  VAL B CB  1 
ATOM   2238 C CG1 . VAL B 1 15  ? -9.760  4.891   -49.185 1.00 54.41  ? 27  VAL B CG1 1 
ATOM   2239 C CG2 . VAL B 1 15  ? -8.688  2.666   -48.819 1.00 58.58  ? 27  VAL B CG2 1 
ATOM   2240 N N   . THR B 1 16  ? -10.277 4.890   -52.759 1.00 51.53  ? 28  THR B N   1 
ATOM   2241 C CA  . THR B 1 16  ? -10.599 6.121   -53.499 1.00 49.66  ? 28  THR B CA  1 
ATOM   2242 C C   . THR B 1 16  ? -11.402 7.048   -52.555 1.00 54.48  ? 28  THR B C   1 
ATOM   2243 O O   . THR B 1 16  ? -11.726 6.633   -51.437 1.00 55.44  ? 28  THR B O   1 
ATOM   2244 C CB  . THR B 1 16  ? -11.335 5.798   -54.815 1.00 50.98  ? 28  THR B CB  1 
ATOM   2245 O OG1 . THR B 1 16  ? -12.657 5.346   -54.527 1.00 51.16  ? 28  THR B OG1 1 
ATOM   2246 C CG2 . THR B 1 16  ? -10.594 4.771   -55.680 1.00 46.03  ? 28  THR B CG2 1 
ATOM   2247 N N   . MET B 1 17  ? -11.718 8.290   -52.980 1.00 50.06  ? 29  MET B N   1 
ATOM   2248 C CA  . MET B 1 17  ? -12.576 9.188   -52.189 1.00 49.14  ? 29  MET B CA  1 
ATOM   2249 C C   . MET B 1 17  ? -13.977 8.556   -51.986 1.00 57.38  ? 29  MET B C   1 
ATOM   2250 O O   . MET B 1 17  ? -14.635 8.828   -50.982 1.00 58.12  ? 29  MET B O   1 
ATOM   2251 C CB  . MET B 1 17  ? -12.713 10.586  -52.846 1.00 49.29  ? 29  MET B CB  1 
ATOM   2252 C CG  . MET B 1 17  ? -11.427 11.410  -52.912 1.00 51.54  ? 29  MET B CG  1 
ATOM   2253 S SD  . MET B 1 17  ? -10.623 11.819  -51.340 1.00 54.80  ? 29  MET B SD  1 
ATOM   2254 C CE  . MET B 1 17  ? -11.925 12.729  -50.483 1.00 50.39  ? 29  MET B CE  1 
ATOM   2255 N N   . ASP B 1 18  ? -14.417 7.715   -52.955 1.00 55.37  ? 30  ASP B N   1 
ATOM   2256 C CA  . ASP B 1 18  ? -15.699 7.014   -52.998 1.00 56.12  ? 30  ASP B CA  1 
ATOM   2257 C C   . ASP B 1 18  ? -15.732 5.759   -52.117 1.00 62.38  ? 30  ASP B C   1 
ATOM   2258 O O   . ASP B 1 18  ? -16.636 5.600   -51.296 1.00 63.56  ? 30  ASP B O   1 
ATOM   2259 C CB  . ASP B 1 18  ? -15.986 6.556   -54.438 1.00 58.41  ? 30  ASP B CB  1 
ATOM   2260 C CG  . ASP B 1 18  ? -16.316 7.634   -55.421 1.00 67.02  ? 30  ASP B CG  1 
ATOM   2261 O OD1 . ASP B 1 18  ? -17.431 8.187   -55.337 1.00 67.31  ? 30  ASP B OD1 1 
ATOM   2262 O OD2 . ASP B 1 18  ? -15.515 7.841   -56.355 1.00 76.77  ? 30  ASP B OD2 1 
ATOM   2263 N N   . ALA B 1 19  ? -14.771 4.843   -52.331 1.00 58.16  ? 31  ALA B N   1 
ATOM   2264 C CA  . ALA B 1 19  ? -14.892 3.485   -51.839 1.00 59.68  ? 31  ALA B CA  1 
ATOM   2265 C C   . ALA B 1 19  ? -13.562 2.864   -51.471 1.00 64.06  ? 31  ALA B C   1 
ATOM   2266 O O   . ALA B 1 19  ? -12.499 3.314   -51.898 1.00 61.79  ? 31  ALA B O   1 
ATOM   2267 C CB  . ALA B 1 19  ? -15.575 2.619   -52.887 1.00 61.69  ? 31  ALA B CB  1 
ATOM   2268 N N   . GLU B 1 20  ? -13.661 1.830   -50.638 1.00 63.86  ? 32  GLU B N   1 
ATOM   2269 C CA  . GLU B 1 20  ? -12.624 0.879   -50.269 1.00 66.22  ? 32  GLU B CA  1 
ATOM   2270 C C   . GLU B 1 20  ? -12.706 -0.270  -51.265 1.00 72.26  ? 32  GLU B C   1 
ATOM   2271 O O   . GLU B 1 20  ? -13.736 -0.935  -51.348 1.00 73.51  ? 32  GLU B O   1 
ATOM   2272 C CB  . GLU B 1 20  ? -12.894 0.424   -48.824 1.00 69.22  ? 32  GLU B CB  1 
ATOM   2273 C CG  . GLU B 1 20  ? -11.809 -0.400  -48.163 1.00 86.69  ? 32  GLU B CG  1 
ATOM   2274 C CD  . GLU B 1 20  ? -11.950 -0.452  -46.651 1.00 119.78 ? 32  GLU B CD  1 
ATOM   2275 O OE1 . GLU B 1 20  ? -12.970 -0.988  -46.157 1.00 122.57 ? 32  GLU B OE1 1 
ATOM   2276 O OE2 . GLU B 1 20  ? -11.036 0.048   -45.957 1.00 117.95 ? 32  GLU B OE2 1 
ATOM   2277 N N   . MET B 1 21  ? -11.658 -0.467  -52.065 1.00 69.26  ? 33  MET B N   1 
ATOM   2278 C CA  . MET B 1 21  ? -11.629 -1.516  -53.095 1.00 70.64  ? 33  MET B CA  1 
ATOM   2279 C C   . MET B 1 21  ? -10.562 -2.554  -52.782 1.00 75.90  ? 33  MET B C   1 
ATOM   2280 O O   . MET B 1 21  ? -9.617  -2.265  -52.050 1.00 74.24  ? 33  MET B O   1 
ATOM   2281 C CB  . MET B 1 21  ? -11.377 -0.918  -54.488 1.00 71.93  ? 33  MET B CB  1 
ATOM   2282 C CG  . MET B 1 21  ? -12.373 0.144   -54.877 1.00 73.60  ? 33  MET B CG  1 
ATOM   2283 S SD  . MET B 1 21  ? -11.997 0.885   -56.472 1.00 76.91  ? 33  MET B SD  1 
ATOM   2284 C CE  . MET B 1 21  ? -13.245 2.152   -56.500 1.00 71.42  ? 33  MET B CE  1 
ATOM   2285 N N   . GLU B 1 22  ? -10.723 -3.768  -53.325 1.00 75.72  ? 34  GLU B N   1 
ATOM   2286 C CA  . GLU B 1 22  ? -9.719  -4.817  -53.186 1.00 78.76  ? 34  GLU B CA  1 
ATOM   2287 C C   . GLU B 1 22  ? -9.407  -5.453  -54.528 1.00 83.75  ? 34  GLU B C   1 
ATOM   2288 O O   . GLU B 1 22  ? -10.312 -5.774  -55.297 1.00 83.71  ? 34  GLU B O   1 
ATOM   2289 C CB  . GLU B 1 22  ? -10.139 -5.869  -52.157 1.00 82.73  ? 34  GLU B CB  1 
ATOM   2290 C CG  . GLU B 1 22  ? -9.628  -5.531  -50.766 1.00 96.98  ? 34  GLU B CG  1 
ATOM   2291 C CD  . GLU B 1 22  ? -10.156 -6.349  -49.603 1.00 127.18 ? 34  GLU B CD  1 
ATOM   2292 O OE1 . GLU B 1 22  ? -9.936  -5.922  -48.447 1.00 126.19 ? 34  GLU B OE1 1 
ATOM   2293 O OE2 . GLU B 1 22  ? -10.784 -7.408  -49.836 1.00 126.48 ? 34  GLU B OE2 1 
ATOM   2294 N N   . PHE B 1 23  ? -8.108  -5.596  -54.810 1.00 81.17  ? 35  PHE B N   1 
ATOM   2295 C CA  . PHE B 1 23  ? -7.570  -6.170  -56.040 1.00 82.77  ? 35  PHE B CA  1 
ATOM   2296 C C   . PHE B 1 23  ? -6.603  -7.297  -55.721 1.00 91.84  ? 35  PHE B C   1 
ATOM   2297 O O   . PHE B 1 23  ? -5.937  -7.266  -54.682 1.00 91.33  ? 35  PHE B O   1 
ATOM   2298 C CB  . PHE B 1 23  ? -6.849  -5.090  -56.870 1.00 82.30  ? 35  PHE B CB  1 
ATOM   2299 C CG  . PHE B 1 23  ? -7.715  -3.953  -57.367 1.00 80.21  ? 35  PHE B CG  1 
ATOM   2300 C CD1 . PHE B 1 23  ? -8.344  -4.026  -58.600 1.00 82.88  ? 35  PHE B CD1 1 
ATOM   2301 C CD2 . PHE B 1 23  ? -7.873  -2.795  -56.614 1.00 79.22  ? 35  PHE B CD2 1 
ATOM   2302 C CE1 . PHE B 1 23  ? -9.122  -2.964  -59.070 1.00 81.14  ? 35  PHE B CE1 1 
ATOM   2303 C CE2 . PHE B 1 23  ? -8.661  -1.737  -57.081 1.00 79.41  ? 35  PHE B CE2 1 
ATOM   2304 C CZ  . PHE B 1 23  ? -9.282  -1.830  -58.306 1.00 77.55  ? 35  PHE B CZ  1 
ATOM   2305 N N   . ASN B 1 24  ? -6.543  -8.304  -56.604 1.00 93.21  ? 36  ASN B N   1 
ATOM   2306 C CA  . ASN B 1 24  ? -5.525  -9.347  -56.529 1.00 97.42  ? 36  ASN B CA  1 
ATOM   2307 C C   . ASN B 1 24  ? -4.337  -8.925  -57.377 1.00 102.12 ? 36  ASN B C   1 
ATOM   2308 O O   . ASN B 1 24  ? -4.405  -8.932  -58.610 1.00 102.16 ? 36  ASN B O   1 
ATOM   2309 C CB  . ASN B 1 24  ? -6.079  -10.712 -56.943 1.00 102.69 ? 36  ASN B CB  1 
ATOM   2310 C CG  . ASN B 1 24  ? -7.064  -11.267 -55.951 1.00 125.90 ? 36  ASN B CG  1 
ATOM   2311 O OD1 . ASN B 1 24  ? -6.700  -11.709 -54.854 1.00 119.66 ? 36  ASN B OD1 1 
ATOM   2312 N ND2 . ASN B 1 24  ? -8.339  -11.227 -56.303 1.00 117.36 ? 36  ASN B ND2 1 
ATOM   2313 N N   . CYS B 1 25  ? -3.273  -8.492  -56.701 1.00 98.49  ? 37  CYS B N   1 
ATOM   2314 C CA  . CYS B 1 25  ? -2.045  -8.017  -57.320 1.00 98.54  ? 37  CYS B CA  1 
ATOM   2315 C C   . CYS B 1 25  ? -1.080  -9.184  -57.461 1.00 107.63 ? 37  CYS B C   1 
ATOM   2316 O O   . CYS B 1 25  ? -0.818  -9.871  -56.473 1.00 109.56 ? 37  CYS B O   1 
ATOM   2317 C CB  . CYS B 1 25  ? -1.448  -6.888  -56.487 1.00 96.22  ? 37  CYS B CB  1 
ATOM   2318 S SG  . CYS B 1 25  ? 0.074   -6.179  -57.163 1.00 100.12 ? 37  CYS B SG  1 
ATOM   2319 N N   . GLU B 1 26  ? -0.567  -9.421  -58.686 1.00 106.14 ? 38  GLU B N   1 
ATOM   2320 C CA  . GLU B 1 26  ? 0.426   -10.469 -58.956 1.00 110.45 ? 38  GLU B CA  1 
ATOM   2321 C C   . GLU B 1 26  ? 1.729   -10.189 -58.200 1.00 115.61 ? 38  GLU B C   1 
ATOM   2322 O O   . GLU B 1 26  ? 2.085   -9.025  -58.003 1.00 112.56 ? 38  GLU B O   1 
ATOM   2323 C CB  . GLU B 1 26  ? 0.696   -10.604 -60.462 1.00 113.12 ? 38  GLU B CB  1 
ATOM   2324 C CG  . GLU B 1 26  ? -0.382  -11.375 -61.205 1.00 123.80 ? 38  GLU B CG  1 
ATOM   2325 C CD  . GLU B 1 26  ? -0.084  -11.645 -62.667 1.00 144.06 ? 38  GLU B CD  1 
ATOM   2326 O OE1 . GLU B 1 26  ? -0.861  -11.170 -63.527 1.00 134.44 ? 38  GLU B OE1 1 
ATOM   2327 O OE2 . GLU B 1 26  ? 0.912   -12.348 -62.955 1.00 143.05 ? 38  GLU B OE2 1 
ATOM   2328 N N   . MET B 1 27  ? 2.427   -11.258 -57.776 1.00 116.18 ? 39  MET B N   1 
ATOM   2329 C CA  . MET B 1 27  ? 3.618   -11.185 -56.922 1.00 117.54 ? 39  MET B CA  1 
ATOM   2330 C C   . MET B 1 27  ? 4.745   -10.333 -57.528 1.00 119.12 ? 39  MET B C   1 
ATOM   2331 O O   . MET B 1 27  ? 5.379   -9.567  -56.802 1.00 116.89 ? 39  MET B O   1 
ATOM   2332 C CB  . MET B 1 27  ? 4.160   -12.594 -56.617 1.00 125.23 ? 39  MET B CB  1 
ATOM   2333 C CG  . MET B 1 27  ? 3.241   -13.444 -55.759 1.00 130.58 ? 39  MET B CG  1 
ATOM   2334 S SD  . MET B 1 27  ? 2.957   -12.788 -54.099 1.00 133.18 ? 39  MET B SD  1 
ATOM   2335 C CE  . MET B 1 27  ? 1.876   -14.035 -53.459 1.00 132.23 ? 39  MET B CE  1 
ATOM   2336 N N   . LYS B 1 28  ? 4.979   -10.459 -58.845 1.00 116.15 ? 40  LYS B N   1 
ATOM   2337 C CA  . LYS B 1 28  ? 6.104   -9.809  -59.519 1.00 115.78 ? 40  LYS B CA  1 
ATOM   2338 C C   . LYS B 1 28  ? 5.682   -8.504  -60.237 1.00 114.40 ? 40  LYS B C   1 
ATOM   2339 O O   . LYS B 1 28  ? 6.493   -7.909  -60.955 1.00 114.08 ? 40  LYS B O   1 
ATOM   2340 C CB  . LYS B 1 28  ? 6.774   -10.788 -60.497 1.00 122.43 ? 40  LYS B CB  1 
ATOM   2341 C CG  . LYS B 1 28  ? 7.879   -11.623 -59.857 1.00 140.06 ? 40  LYS B CG  1 
ATOM   2342 C CD  . LYS B 1 28  ? 8.509   -12.574 -60.871 1.00 153.64 ? 40  LYS B CD  1 
ATOM   2343 C CE  . LYS B 1 28  ? 9.801   -13.190 -60.399 1.00 165.10 ? 40  LYS B CE  1 
ATOM   2344 N NZ  . LYS B 1 28  ? 10.430  -14.017 -61.465 1.00 177.45 ? 40  LYS B NZ  1 
ATOM   2345 N N   . TRP B 1 29  ? 4.431   -8.047  -60.008 1.00 106.34 ? 41  TRP B N   1 
ATOM   2346 C CA  . TRP B 1 29  ? 3.894   -6.806  -60.573 1.00 101.71 ? 41  TRP B CA  1 
ATOM   2347 C C   . TRP B 1 29  ? 4.571   -5.567  -60.000 1.00 101.45 ? 41  TRP B C   1 
ATOM   2348 O O   . TRP B 1 29  ? 4.868   -5.504  -58.805 1.00 100.34 ? 41  TRP B O   1 
ATOM   2349 C CB  . TRP B 1 29  ? 2.382   -6.706  -60.336 1.00 97.60  ? 41  TRP B CB  1 
ATOM   2350 C CG  . TRP B 1 29  ? 1.523   -7.210  -61.460 1.00 98.93  ? 41  TRP B CG  1 
ATOM   2351 C CD1 . TRP B 1 29  ? 1.921   -7.933  -62.546 1.00 104.76 ? 41  TRP B CD1 1 
ATOM   2352 C CD2 . TRP B 1 29  ? 0.107   -7.037  -61.589 1.00 96.57  ? 41  TRP B CD2 1 
ATOM   2353 N NE1 . TRP B 1 29  ? 0.840   -8.212  -63.349 1.00 103.90 ? 41  TRP B NE1 1 
ATOM   2354 C CE2 . TRP B 1 29  ? -0.286  -7.668  -62.789 1.00 102.18 ? 41  TRP B CE2 1 
ATOM   2355 C CE3 . TRP B 1 29  ? -0.869  -6.378  -60.820 1.00 94.74  ? 41  TRP B CE3 1 
ATOM   2356 C CZ2 . TRP B 1 29  ? -1.614  -7.674  -63.231 1.00 100.32 ? 41  TRP B CZ2 1 
ATOM   2357 C CZ3 . TRP B 1 29  ? -2.184  -6.382  -61.258 1.00 95.03  ? 41  TRP B CZ3 1 
ATOM   2358 C CH2 . TRP B 1 29  ? -2.547  -7.022  -62.451 1.00 97.45  ? 41  TRP B CH2 1 
ATOM   2359 N N   . LYS B 1 30  ? 4.818   -4.590  -60.878 1.00 95.65  ? 42  LYS B N   1 
ATOM   2360 C CA  . LYS B 1 30  ? 5.365   -3.284  -60.530 1.00 92.96  ? 42  LYS B CA  1 
ATOM   2361 C C   . LYS B 1 30  ? 4.210   -2.318  -60.221 1.00 92.41  ? 42  LYS B C   1 
ATOM   2362 O O   . LYS B 1 30  ? 3.046   -2.662  -60.448 1.00 91.57  ? 42  LYS B O   1 
ATOM   2363 C CB  . LYS B 1 30  ? 6.254   -2.758  -61.675 1.00 96.51  ? 42  LYS B CB  1 
ATOM   2364 C CG  . LYS B 1 30  ? 7.544   -3.553  -61.861 1.00 116.37 ? 42  LYS B CG  1 
ATOM   2365 C CD  . LYS B 1 30  ? 8.274   -3.179  -63.146 1.00 127.75 ? 42  LYS B CD  1 
ATOM   2366 C CE  . LYS B 1 30  ? 9.634   -3.835  -63.231 1.00 137.52 ? 42  LYS B CE  1 
ATOM   2367 N NZ  . LYS B 1 30  ? 10.509  -3.173  -64.235 1.00 144.36 ? 42  LYS B NZ  1 
ATOM   2368 N N   . GLY B 1 31  ? 4.541   -1.138  -59.694 1.00 85.68  ? 43  GLY B N   1 
ATOM   2369 C CA  . GLY B 1 31  ? 3.584   -0.079  -59.392 1.00 81.53  ? 43  GLY B CA  1 
ATOM   2370 C C   . GLY B 1 31  ? 2.667   0.285   -60.546 1.00 83.48  ? 43  GLY B C   1 
ATOM   2371 O O   . GLY B 1 31  ? 1.470   0.510   -60.334 1.00 80.61  ? 43  GLY B O   1 
ATOM   2372 N N   . LYS B 1 32  ? 3.223   0.314   -61.780 1.00 81.13  ? 44  LYS B N   1 
ATOM   2373 C CA  . LYS B 1 32  ? 2.509   0.649   -63.013 1.00 79.98  ? 44  LYS B CA  1 
ATOM   2374 C C   . LYS B 1 32  ? 1.419   -0.371  -63.333 1.00 82.51  ? 44  LYS B C   1 
ATOM   2375 O O   . LYS B 1 32  ? 0.360   0.014   -63.827 1.00 81.21  ? 44  LYS B O   1 
ATOM   2376 C CB  . LYS B 1 32  ? 3.486   0.757   -64.191 1.00 85.36  ? 44  LYS B CB  1 
ATOM   2377 C CG  . LYS B 1 32  ? 2.970   1.650   -65.328 1.00 106.94 ? 44  LYS B CG  1 
ATOM   2378 C CD  . LYS B 1 32  ? 3.957   1.762   -66.498 1.00 122.90 ? 44  LYS B CD  1 
ATOM   2379 C CE  . LYS B 1 32  ? 4.924   2.930   -66.356 1.00 134.19 ? 44  LYS B CE  1 
ATOM   2380 N NZ  . LYS B 1 32  ? 6.217   2.708   -67.071 1.00 147.74 ? 44  LYS B NZ  1 
ATOM   2381 N N   . ASP B 1 33  ? 1.672   -1.660  -63.042 1.00 79.36  ? 45  ASP B N   1 
ATOM   2382 C CA  . ASP B 1 33  ? 0.733   -2.748  -63.307 1.00 79.49  ? 45  ASP B CA  1 
ATOM   2383 C C   . ASP B 1 33  ? -0.491  -2.618  -62.402 1.00 79.48  ? 45  ASP B C   1 
ATOM   2384 O O   . ASP B 1 33  ? -1.619  -2.689  -62.898 1.00 78.10  ? 45  ASP B O   1 
ATOM   2385 C CB  . ASP B 1 33  ? 1.417   -4.115  -63.128 1.00 84.81  ? 45  ASP B CB  1 
ATOM   2386 C CG  . ASP B 1 33  ? 2.568   -4.383  -64.084 1.00 92.11  ? 45  ASP B CG  1 
ATOM   2387 O OD1 . ASP B 1 33  ? 2.317   -4.468  -65.306 1.00 92.91  ? 45  ASP B OD1 1 
ATOM   2388 O OD2 . ASP B 1 33  ? 3.717   -4.529  -63.606 1.00 95.47  ? 45  ASP B OD2 1 
ATOM   2389 N N   . LEU B 1 34  ? -0.265  -2.388  -61.086 1.00 73.77  ? 46  LEU B N   1 
ATOM   2390 C CA  . LEU B 1 34  ? -1.317  -2.161  -60.093 1.00 70.42  ? 46  LEU B CA  1 
ATOM   2391 C C   . LEU B 1 34  ? -2.075  -0.871  -60.394 1.00 70.31  ? 46  LEU B C   1 
ATOM   2392 O O   . LEU B 1 34  ? -3.308  -0.894  -60.372 1.00 69.52  ? 46  LEU B O   1 
ATOM   2393 C CB  . LEU B 1 34  ? -0.732  -2.139  -58.664 1.00 69.97  ? 46  LEU B CB  1 
ATOM   2394 C CG  . LEU B 1 34  ? -1.677  -1.829  -57.491 1.00 71.77  ? 46  LEU B CG  1 
ATOM   2395 C CD1 . LEU B 1 34  ? -2.833  -2.817  -57.401 1.00 72.27  ? 46  LEU B CD1 1 
ATOM   2396 C CD2 . LEU B 1 34  ? -0.917  -1.804  -56.190 1.00 75.12  ? 46  LEU B CD2 1 
ATOM   2397 N N   . PHE B 1 35  ? -1.353  0.237   -60.690 1.00 64.77  ? 47  PHE B N   1 
ATOM   2398 C CA  . PHE B 1 35  ? -1.952  1.543   -60.994 1.00 61.71  ? 47  PHE B CA  1 
ATOM   2399 C C   . PHE B 1 35  ? -2.874  1.479   -62.218 1.00 66.02  ? 47  PHE B C   1 
ATOM   2400 O O   . PHE B 1 35  ? -3.997  1.976   -62.144 1.00 63.07  ? 47  PHE B O   1 
ATOM   2401 C CB  . PHE B 1 35  ? -0.876  2.624   -61.195 1.00 62.63  ? 47  PHE B CB  1 
ATOM   2402 C CG  . PHE B 1 35  ? -1.391  4.003   -61.566 1.00 61.25  ? 47  PHE B CG  1 
ATOM   2403 C CD1 . PHE B 1 35  ? -2.031  4.806   -60.622 1.00 60.94  ? 47  PHE B CD1 1 
ATOM   2404 C CD2 . PHE B 1 35  ? -1.213  4.507   -62.851 1.00 62.89  ? 47  PHE B CD2 1 
ATOM   2405 C CE1 . PHE B 1 35  ? -2.490  6.079   -60.962 1.00 59.22  ? 47  PHE B CE1 1 
ATOM   2406 C CE2 . PHE B 1 35  ? -1.681  5.778   -63.190 1.00 62.98  ? 47  PHE B CE2 1 
ATOM   2407 C CZ  . PHE B 1 35  ? -2.309  6.557   -62.240 1.00 58.55  ? 47  PHE B CZ  1 
ATOM   2408 N N   . ASP B 1 36  ? -2.418  0.858   -63.317 1.00 66.75  ? 48  ASP B N   1 
ATOM   2409 C CA  . ASP B 1 36  ? -3.204  0.791   -64.550 1.00 68.14  ? 48  ASP B CA  1 
ATOM   2410 C C   . ASP B 1 36  ? -4.436  -0.122  -64.414 1.00 71.84  ? 48  ASP B C   1 
ATOM   2411 O O   . ASP B 1 36  ? -5.431  0.125   -65.092 1.00 71.00  ? 48  ASP B O   1 
ATOM   2412 C CB  . ASP B 1 36  ? -2.336  0.393   -65.755 1.00 73.46  ? 48  ASP B CB  1 
ATOM   2413 C CG  . ASP B 1 36  ? -1.552  1.589   -66.295 1.00 90.85  ? 48  ASP B CG  1 
ATOM   2414 O OD1 . ASP B 1 36  ? -2.192  2.524   -66.855 1.00 90.26  ? 48  ASP B OD1 1 
ATOM   2415 O OD2 . ASP B 1 36  ? -0.313  1.623   -66.109 1.00 99.08  ? 48  ASP B OD2 1 
ATOM   2416 N N   . LEU B 1 37  ? -4.386  -1.129  -63.516 1.00 68.69  ? 49  LEU B N   1 
ATOM   2417 C CA  . LEU B 1 37  ? -5.526  -1.976  -63.159 1.00 68.53  ? 49  LEU B CA  1 
ATOM   2418 C C   . LEU B 1 37  ? -6.627  -1.160  -62.473 1.00 68.94  ? 49  LEU B C   1 
ATOM   2419 O O   . LEU B 1 37  ? -7.799  -1.334  -62.802 1.00 69.06  ? 49  LEU B O   1 
ATOM   2420 C CB  . LEU B 1 37  ? -5.064  -3.137  -62.253 1.00 70.93  ? 49  LEU B CB  1 
ATOM   2421 C CG  . LEU B 1 37  ? -6.136  -4.111  -61.729 1.00 76.56  ? 49  LEU B CG  1 
ATOM   2422 C CD1 . LEU B 1 37  ? -6.810  -4.875  -62.862 1.00 78.72  ? 49  LEU B CD1 1 
ATOM   2423 C CD2 . LEU B 1 37  ? -5.540  -5.073  -60.728 1.00 80.42  ? 49  LEU B CD2 1 
ATOM   2424 N N   . VAL B 1 38  ? -6.249  -0.274  -61.532 1.00 62.69  ? 50  VAL B N   1 
ATOM   2425 C CA  . VAL B 1 38  ? -7.172  0.615   -60.814 1.00 59.30  ? 50  VAL B CA  1 
ATOM   2426 C C   . VAL B 1 38  ? -7.829  1.573   -61.813 1.00 60.73  ? 50  VAL B C   1 
ATOM   2427 O O   . VAL B 1 38  ? -9.050  1.721   -61.796 1.00 59.89  ? 50  VAL B O   1 
ATOM   2428 C CB  . VAL B 1 38  ? -6.469  1.375   -59.651 1.00 61.75  ? 50  VAL B CB  1 
ATOM   2429 C CG1 . VAL B 1 38  ? -7.438  2.315   -58.932 1.00 58.90  ? 50  VAL B CG1 1 
ATOM   2430 C CG2 . VAL B 1 38  ? -5.842  0.398   -58.655 1.00 63.37  ? 50  VAL B CG2 1 
ATOM   2431 N N   . CYS B 1 39  ? -7.021  2.195   -62.693 1.00 56.28  ? 51  CYS B N   1 
ATOM   2432 C CA  . CYS B 1 39  ? -7.480  3.140   -63.714 1.00 54.43  ? 51  CYS B CA  1 
ATOM   2433 C C   . CYS B 1 39  ? -8.459  2.481   -64.696 1.00 59.31  ? 51  CYS B C   1 
ATOM   2434 O O   . CYS B 1 39  ? -9.512  3.057   -64.980 1.00 57.13  ? 51  CYS B O   1 
ATOM   2435 C CB  . CYS B 1 39  ? -6.291  3.748   -64.445 1.00 54.91  ? 51  CYS B CB  1 
ATOM   2436 S SG  . CYS B 1 39  ? -5.225  4.754   -63.387 1.00 57.05  ? 51  CYS B SG  1 
ATOM   2437 N N   . ARG B 1 40  ? -8.126  1.270   -65.184 1.00 59.07  ? 52  ARG B N   1 
ATOM   2438 C CA  . ARG B 1 40  ? -8.978  0.492   -66.089 1.00 60.64  ? 52  ARG B CA  1 
ATOM   2439 C C   . ARG B 1 40  ? -10.316 0.128   -65.421 1.00 63.21  ? 52  ARG B C   1 
ATOM   2440 O O   . ARG B 1 40  ? -11.345 0.161   -66.099 1.00 63.38  ? 52  ARG B O   1 
ATOM   2441 C CB  . ARG B 1 40  ? -8.241  -0.768  -66.575 1.00 65.04  ? 52  ARG B CB  1 
ATOM   2442 C CG  . ARG B 1 40  ? -8.722  -1.272  -67.935 1.00 83.19  ? 52  ARG B CG  1 
ATOM   2443 C CD  . ARG B 1 40  ? -7.669  -2.073  -68.690 1.00 100.59 ? 52  ARG B CD  1 
ATOM   2444 N NE  . ARG B 1 40  ? -7.139  -3.188  -67.897 1.00 118.53 ? 52  ARG B NE  1 
ATOM   2445 C CZ  . ARG B 1 40  ? -5.845  -3.439  -67.724 1.00 137.29 ? 52  ARG B CZ  1 
ATOM   2446 N NH1 . ARG B 1 40  ? -4.930  -2.679  -68.311 1.00 129.12 ? 52  ARG B NH1 1 
ATOM   2447 N NH2 . ARG B 1 40  ? -5.456  -4.460  -66.973 1.00 122.95 ? 52  ARG B NH2 1 
ATOM   2448 N N   . THR B 1 41  ? -10.301 -0.177  -64.098 1.00 58.42  ? 53  THR B N   1 
ATOM   2449 C CA  . THR B 1 41  ? -11.485 -0.501  -63.281 1.00 57.43  ? 53  THR B CA  1 
ATOM   2450 C C   . THR B 1 41  ? -12.438 0.698   -63.220 1.00 59.65  ? 53  THR B C   1 
ATOM   2451 O O   . THR B 1 41  ? -13.650 0.504   -63.167 1.00 60.32  ? 53  THR B O   1 
ATOM   2452 C CB  . THR B 1 41  ? -11.050 -0.956  -61.864 1.00 62.50  ? 53  THR B CB  1 
ATOM   2453 O OG1 . THR B 1 41  ? -10.212 -2.098  -61.976 1.00 58.16  ? 53  THR B OG1 1 
ATOM   2454 C CG2 . THR B 1 41  ? -12.229 -1.284  -60.939 1.00 62.96  ? 53  THR B CG2 1 
ATOM   2455 N N   . LEU B 1 42  ? -11.894 1.926   -63.231 1.00 54.44  ? 54  LEU B N   1 
ATOM   2456 C CA  . LEU B 1 42  ? -12.690 3.150   -63.117 1.00 51.92  ? 54  LEU B CA  1 
ATOM   2457 C C   . LEU B 1 42  ? -12.952 3.774   -64.491 1.00 54.33  ? 54  LEU B C   1 
ATOM   2458 O O   . LEU B 1 42  ? -13.618 4.806   -64.583 1.00 52.09  ? 54  LEU B O   1 
ATOM   2459 C CB  . LEU B 1 42  ? -11.994 4.159   -62.179 1.00 50.34  ? 54  LEU B CB  1 
ATOM   2460 C CG  . LEU B 1 42  ? -11.649 3.662   -60.767 1.00 54.70  ? 54  LEU B CG  1 
ATOM   2461 C CD1 . LEU B 1 42  ? -10.798 4.664   -60.036 1.00 52.93  ? 54  LEU B CD1 1 
ATOM   2462 C CD2 . LEU B 1 42  ? -12.905 3.355   -59.962 1.00 55.56  ? 54  LEU B CD2 1 
ATOM   2463 N N   . GLY B 1 43  ? -12.462 3.115   -65.538 1.00 53.10  ? 55  GLY B N   1 
ATOM   2464 C CA  . GLY B 1 43  ? -12.582 3.557   -66.922 1.00 54.09  ? 55  GLY B CA  1 
ATOM   2465 C C   . GLY B 1 43  ? -11.867 4.868   -67.185 1.00 57.12  ? 55  GLY B C   1 
ATOM   2466 O O   . GLY B 1 43  ? -12.289 5.656   -68.041 1.00 56.87  ? 55  GLY B O   1 
ATOM   2467 N N   . LEU B 1 44  ? -10.756 5.087   -66.457 1.00 51.95  ? 56  LEU B N   1 
ATOM   2468 C CA  . LEU B 1 44  ? -10.044 6.354   -66.396 1.00 49.64  ? 56  LEU B CA  1 
ATOM   2469 C C   . LEU B 1 44  ? -8.869  6.341   -67.352 1.00 53.29  ? 56  LEU B C   1 
ATOM   2470 O O   . LEU B 1 44  ? -7.990  5.475   -67.258 1.00 53.54  ? 56  LEU B O   1 
ATOM   2471 C CB  . LEU B 1 44  ? -9.589  6.616   -64.944 1.00 48.37  ? 56  LEU B CB  1 
ATOM   2472 C CG  . LEU B 1 44  ? -8.694  7.811   -64.683 1.00 52.59  ? 56  LEU B CG  1 
ATOM   2473 C CD1 . LEU B 1 44  ? -9.474  9.100   -64.698 1.00 51.42  ? 56  LEU B CD1 1 
ATOM   2474 C CD2 . LEU B 1 44  ? -7.995  7.671   -63.368 1.00 54.95  ? 56  LEU B CD2 1 
ATOM   2475 N N   . ARG B 1 45  ? -8.864  7.315   -68.278 1.00 49.59  ? 57  ARG B N   1 
ATOM   2476 C CA  . ARG B 1 45  ? -7.799  7.498   -69.267 1.00 51.11  ? 57  ARG B CA  1 
ATOM   2477 C C   . ARG B 1 45  ? -6.918  8.670   -68.905 1.00 52.94  ? 57  ARG B C   1 
ATOM   2478 O O   . ARG B 1 45  ? -5.724  8.624   -69.192 1.00 54.66  ? 57  ARG B O   1 
ATOM   2479 C CB  . ARG B 1 45  ? -8.367  7.695   -70.675 1.00 54.11  ? 57  ARG B CB  1 
ATOM   2480 C CG  . ARG B 1 45  ? -8.963  6.437   -71.279 1.00 73.15  ? 57  ARG B CG  1 
ATOM   2481 C CD  . ARG B 1 45  ? -9.487  6.682   -72.692 1.00 90.97  ? 57  ARG B CD  1 
ATOM   2482 N NE  . ARG B 1 45  ? -10.424 7.807   -72.776 1.00 101.23 ? 57  ARG B NE  1 
ATOM   2483 C CZ  . ARG B 1 45  ? -11.720 7.733   -72.487 1.00 115.49 ? 57  ARG B CZ  1 
ATOM   2484 N NH1 . ARG B 1 45  ? -12.254 6.586   -72.085 1.00 106.82 ? 57  ARG B NH1 1 
ATOM   2485 N NH2 . ARG B 1 45  ? -12.489 8.809   -72.581 1.00 97.84  ? 57  ARG B NH2 1 
ATOM   2486 N N   . GLU B 1 46  ? -7.492  9.707   -68.263 1.00 45.74  ? 58  GLU B N   1 
ATOM   2487 C CA  . GLU B 1 46  ? -6.781  10.912  -67.822 1.00 43.69  ? 58  GLU B CA  1 
ATOM   2488 C C   . GLU B 1 46  ? -6.009  10.600  -66.525 1.00 45.76  ? 58  GLU B C   1 
ATOM   2489 O O   . GLU B 1 46  ? -6.292  11.165  -65.467 1.00 43.88  ? 58  GLU B O   1 
ATOM   2490 C CB  . GLU B 1 46  ? -7.777  12.090  -67.664 1.00 42.91  ? 58  GLU B CB  1 
ATOM   2491 C CG  . GLU B 1 46  ? -8.523  12.374  -68.965 1.00 51.84  ? 58  GLU B CG  1 
ATOM   2492 C CD  . GLU B 1 46  ? -9.597  13.437  -68.971 1.00 67.22  ? 58  GLU B CD  1 
ATOM   2493 O OE1 . GLU B 1 46  ? -10.422 13.448  -68.035 1.00 51.41  ? 58  GLU B OE1 1 
ATOM   2494 O OE2 . GLU B 1 46  ? -9.676  14.197  -69.961 1.00 68.76  ? 58  GLU B OE2 1 
ATOM   2495 N N   . THR B 1 47  ? -5.004  9.711   -66.632 1.00 42.79  ? 59  THR B N   1 
ATOM   2496 C CA  . THR B 1 47  ? -4.408  9.031   -65.478 1.00 42.47  ? 59  THR B CA  1 
ATOM   2497 C C   . THR B 1 47  ? -3.235  9.813   -64.872 1.00 47.26  ? 59  THR B C   1 
ATOM   2498 O O   . THR B 1 47  ? -2.908  9.575   -63.705 1.00 46.57  ? 59  THR B O   1 
ATOM   2499 C CB  . THR B 1 47  ? -3.949  7.600   -65.854 1.00 50.58  ? 59  THR B CB  1 
ATOM   2500 O OG1 . THR B 1 47  ? -2.932  7.660   -66.846 1.00 50.93  ? 59  THR B OG1 1 
ATOM   2501 C CG2 . THR B 1 47  ? -5.072  6.733   -66.373 1.00 48.10  ? 59  THR B CG2 1 
ATOM   2502 N N   . TRP B 1 48  ? -2.617  10.750  -65.648 1.00 44.25  ? 60  TRP B N   1 
ATOM   2503 C CA  . TRP B 1 48  ? -1.406  11.512  -65.276 1.00 43.66  ? 60  TRP B CA  1 
ATOM   2504 C C   . TRP B 1 48  ? -1.580  12.357  -64.009 1.00 45.40  ? 60  TRP B C   1 
ATOM   2505 O O   . TRP B 1 48  ? -0.582  12.683  -63.361 1.00 46.41  ? 60  TRP B O   1 
ATOM   2506 C CB  . TRP B 1 48  ? -0.935  12.410  -66.429 1.00 43.11  ? 60  TRP B CB  1 
ATOM   2507 C CG  . TRP B 1 48  ? -2.017  13.259  -67.023 1.00 42.68  ? 60  TRP B CG  1 
ATOM   2508 C CD1 . TRP B 1 48  ? -2.433  14.478  -66.585 1.00 43.86  ? 60  TRP B CD1 1 
ATOM   2509 C CD2 . TRP B 1 48  ? -2.854  12.927  -68.140 1.00 42.78  ? 60  TRP B CD2 1 
ATOM   2510 N NE1 . TRP B 1 48  ? -3.479  14.930  -67.361 1.00 42.49  ? 60  TRP B NE1 1 
ATOM   2511 C CE2 . TRP B 1 48  ? -3.757  13.998  -68.321 1.00 44.97  ? 60  TRP B CE2 1 
ATOM   2512 C CE3 . TRP B 1 48  ? -2.917  11.834  -69.019 1.00 45.42  ? 60  TRP B CE3 1 
ATOM   2513 C CZ2 . TRP B 1 48  ? -4.719  14.005  -69.341 1.00 44.58  ? 60  TRP B CZ2 1 
ATOM   2514 C CZ3 . TRP B 1 48  ? -3.866  11.845  -70.034 1.00 46.75  ? 60  TRP B CZ3 1 
ATOM   2515 C CH2 . TRP B 1 48  ? -4.757  12.917  -70.184 1.00 45.90  ? 60  TRP B CH2 1 
ATOM   2516 N N   . PHE B 1 49  ? -2.830  12.705  -63.652 1.00 38.89  ? 61  PHE B N   1 
ATOM   2517 C CA  . PHE B 1 49  ? -3.151  13.435  -62.422 1.00 36.04  ? 61  PHE B CA  1 
ATOM   2518 C C   . PHE B 1 49  ? -2.980  12.581  -61.179 1.00 40.83  ? 61  PHE B C   1 
ATOM   2519 O O   . PHE B 1 49  ? -2.719  13.114  -60.104 1.00 40.83  ? 61  PHE B O   1 
ATOM   2520 C CB  . PHE B 1 49  ? -4.590  13.943  -62.461 1.00 35.89  ? 61  PHE B CB  1 
ATOM   2521 C CG  . PHE B 1 49  ? -4.895  14.950  -63.541 1.00 37.18  ? 61  PHE B CG  1 
ATOM   2522 C CD1 . PHE B 1 49  ? -4.256  16.190  -63.563 1.00 39.04  ? 61  PHE B CD1 1 
ATOM   2523 C CD2 . PHE B 1 49  ? -5.865  14.686  -64.507 1.00 38.49  ? 61  PHE B CD2 1 
ATOM   2524 C CE1 . PHE B 1 49  ? -4.558  17.133  -64.554 1.00 39.32  ? 61  PHE B CE1 1 
ATOM   2525 C CE2 . PHE B 1 49  ? -6.165  15.630  -65.495 1.00 40.27  ? 61  PHE B CE2 1 
ATOM   2526 C CZ  . PHE B 1 49  ? -5.521  16.851  -65.502 1.00 37.73  ? 61  PHE B CZ  1 
ATOM   2527 N N   . PHE B 1 50  ? -3.092  11.261  -61.324 1.00 37.95  ? 62  PHE B N   1 
ATOM   2528 C CA  . PHE B 1 50  ? -3.304  10.370  -60.189 1.00 37.31  ? 62  PHE B CA  1 
ATOM   2529 C C   . PHE B 1 50  ? -2.070  9.547   -59.841 1.00 43.74  ? 62  PHE B C   1 
ATOM   2530 O O   . PHE B 1 50  ? -1.150  9.401   -60.646 1.00 45.75  ? 62  PHE B O   1 
ATOM   2531 C CB  . PHE B 1 50  ? -4.511  9.456   -60.463 1.00 38.81  ? 62  PHE B CB  1 
ATOM   2532 C CG  . PHE B 1 50  ? -5.783  10.246  -60.691 1.00 38.08  ? 62  PHE B CG  1 
ATOM   2533 C CD1 . PHE B 1 50  ? -6.555  10.678  -59.619 1.00 38.70  ? 62  PHE B CD1 1 
ATOM   2534 C CD2 . PHE B 1 50  ? -6.176  10.610  -61.975 1.00 39.82  ? 62  PHE B CD2 1 
ATOM   2535 C CE1 . PHE B 1 50  ? -7.709  11.442  -59.827 1.00 37.61  ? 62  PHE B CE1 1 
ATOM   2536 C CE2 . PHE B 1 50  ? -7.326  11.385  -62.180 1.00 40.29  ? 62  PHE B CE2 1 
ATOM   2537 C CZ  . PHE B 1 50  ? -8.079  11.796  -61.104 1.00 36.50  ? 62  PHE B CZ  1 
ATOM   2538 N N   . GLY B 1 51  ? -2.059  9.062   -58.614 1.00 40.29  ? 63  GLY B N   1 
ATOM   2539 C CA  . GLY B 1 51  ? -1.078  8.113   -58.116 1.00 42.32  ? 63  GLY B CA  1 
ATOM   2540 C C   . GLY B 1 51  ? -1.662  7.301   -56.982 1.00 49.12  ? 63  GLY B C   1 
ATOM   2541 O O   . GLY B 1 51  ? -2.828  7.494   -56.604 1.00 47.96  ? 63  GLY B O   1 
ATOM   2542 N N   . LEU B 1 52  ? -0.854  6.383   -56.439 1.00 49.19  ? 64  LEU B N   1 
ATOM   2543 C CA  . LEU B 1 52  ? -1.191  5.565   -55.270 1.00 49.83  ? 64  LEU B CA  1 
ATOM   2544 C C   . LEU B 1 52  ? -0.340  6.007   -54.076 1.00 55.70  ? 64  LEU B C   1 
ATOM   2545 O O   . LEU B 1 52  ? 0.880   5.825   -54.068 1.00 57.53  ? 64  LEU B O   1 
ATOM   2546 C CB  . LEU B 1 52  ? -1.017  4.063   -55.568 1.00 52.07  ? 64  LEU B CB  1 
ATOM   2547 C CG  . LEU B 1 52  ? -1.936  3.478   -56.645 1.00 56.52  ? 64  LEU B CG  1 
ATOM   2548 C CD1 . LEU B 1 52  ? -1.435  2.126   -57.106 1.00 59.79  ? 64  LEU B CD1 1 
ATOM   2549 C CD2 . LEU B 1 52  ? -3.378  3.386   -56.158 1.00 56.12  ? 64  LEU B CD2 1 
ATOM   2550 N N   . GLN B 1 53  ? -0.995  6.610   -53.083 1.00 51.44  ? 65  GLN B N   1 
ATOM   2551 C CA  . GLN B 1 53  ? -0.346  7.227   -51.937 1.00 51.37  ? 65  GLN B CA  1 
ATOM   2552 C C   . GLN B 1 53  ? -0.360  6.311   -50.702 1.00 60.63  ? 65  GLN B C   1 
ATOM   2553 O O   . GLN B 1 53  ? -1.294  5.533   -50.494 1.00 60.33  ? 65  GLN B O   1 
ATOM   2554 C CB  . GLN B 1 53  ? -1.035  8.563   -51.619 1.00 49.74  ? 65  GLN B CB  1 
ATOM   2555 C CG  . GLN B 1 53  ? -0.210  9.514   -50.769 1.00 52.27  ? 65  GLN B CG  1 
ATOM   2556 C CD  . GLN B 1 53  ? -1.081  10.557  -50.143 1.00 64.42  ? 65  GLN B CD  1 
ATOM   2557 O OE1 . GLN B 1 53  ? -1.148  11.693  -50.605 1.00 58.15  ? 65  GLN B OE1 1 
ATOM   2558 N NE2 . GLN B 1 53  ? -1.787  10.185  -49.088 1.00 58.19  ? 65  GLN B NE2 1 
ATOM   2559 N N   . TYR B 1 54  ? 0.707   6.414   -49.896 1.00 61.52  ? 66  TYR B N   1 
ATOM   2560 C CA  . TYR B 1 54  ? 0.871   5.801   -48.576 1.00 64.29  ? 66  TYR B CA  1 
ATOM   2561 C C   . TYR B 1 54  ? 1.713   6.760   -47.696 1.00 72.03  ? 66  TYR B C   1 
ATOM   2562 O O   . TYR B 1 54  ? 2.140   7.805   -48.193 1.00 70.08  ? 66  TYR B O   1 
ATOM   2563 C CB  . TYR B 1 54  ? 1.498   4.391   -48.698 1.00 68.28  ? 66  TYR B CB  1 
ATOM   2564 C CG  . TYR B 1 54  ? 2.874   4.348   -49.333 1.00 71.59  ? 66  TYR B CG  1 
ATOM   2565 C CD1 . TYR B 1 54  ? 3.033   4.480   -50.710 1.00 73.33  ? 66  TYR B CD1 1 
ATOM   2566 C CD2 . TYR B 1 54  ? 4.007   4.086   -48.571 1.00 74.48  ? 66  TYR B CD2 1 
ATOM   2567 C CE1 . TYR B 1 54  ? 4.294   4.428   -51.301 1.00 75.47  ? 66  TYR B CE1 1 
ATOM   2568 C CE2 . TYR B 1 54  ? 5.271   4.006   -49.156 1.00 77.12  ? 66  TYR B CE2 1 
ATOM   2569 C CZ  . TYR B 1 54  ? 5.409   4.182   -50.521 1.00 83.54  ? 66  TYR B CZ  1 
ATOM   2570 O OH  . TYR B 1 54  ? 6.649   4.114   -51.104 1.00 86.80  ? 66  TYR B OH  1 
ATOM   2571 N N   . THR B 1 55  ? 1.935   6.437   -46.402 1.00 73.21  ? 67  THR B N   1 
ATOM   2572 C CA  . THR B 1 55  ? 2.708   7.334   -45.526 1.00 74.00  ? 67  THR B CA  1 
ATOM   2573 C C   . THR B 1 55  ? 3.911   6.623   -44.898 1.00 83.43  ? 67  THR B C   1 
ATOM   2574 O O   . THR B 1 55  ? 3.761   5.552   -44.307 1.00 85.01  ? 67  THR B O   1 
ATOM   2575 C CB  . THR B 1 55  ? 1.824   7.995   -44.449 1.00 79.59  ? 67  THR B CB  1 
ATOM   2576 O OG1 . THR B 1 55  ? 1.040   6.999   -43.793 1.00 79.78  ? 67  THR B OG1 1 
ATOM   2577 C CG2 . THR B 1 55  ? 0.908   9.089   -45.021 1.00 75.59  ? 67  THR B CG2 1 
ATOM   2578 N N   . ILE B 1 56  ? 5.110   7.216   -45.066 1.00 82.70  ? 68  ILE B N   1 
ATOM   2579 C CA  . ILE B 1 56  ? 6.342   6.780   -44.395 1.00 86.45  ? 68  ILE B CA  1 
ATOM   2580 C C   . ILE B 1 56  ? 6.600   7.739   -43.224 1.00 91.43  ? 68  ILE B C   1 
ATOM   2581 O O   . ILE B 1 56  ? 6.750   8.944   -43.434 1.00 89.47  ? 68  ILE B O   1 
ATOM   2582 C CB  . ILE B 1 56  ? 7.567   6.655   -45.355 1.00 91.33  ? 68  ILE B CB  1 
ATOM   2583 C CG1 . ILE B 1 56  ? 7.252   5.723   -46.552 1.00 92.54  ? 68  ILE B CG1 1 
ATOM   2584 C CG2 . ILE B 1 56  ? 8.811   6.157   -44.594 1.00 94.88  ? 68  ILE B CG2 1 
ATOM   2585 C CD1 . ILE B 1 56  ? 8.249   5.799   -47.752 1.00 99.21  ? 68  ILE B CD1 1 
ATOM   2586 N N   . LYS B 1 57  ? 6.663   7.181   -41.995 1.00 90.70  ? 69  LYS B N   1 
ATOM   2587 C CA  . LYS B 1 57  ? 6.694   7.881   -40.701 1.00 90.59  ? 69  LYS B CA  1 
ATOM   2588 C C   . LYS B 1 57  ? 5.481   8.815   -40.579 1.00 91.94  ? 69  LYS B C   1 
ATOM   2589 O O   . LYS B 1 57  ? 4.452   8.399   -40.040 1.00 92.41  ? 69  LYS B O   1 
ATOM   2590 C CB  . LYS B 1 57  ? 8.019   8.627   -40.452 1.00 94.13  ? 69  LYS B CB  1 
ATOM   2591 C CG  . LYS B 1 57  ? 9.148   7.739   -39.925 1.00 111.76 ? 69  LYS B CG  1 
ATOM   2592 C CD  . LYS B 1 57  ? 10.317  8.570   -39.386 1.00 122.28 ? 69  LYS B CD  1 
ATOM   2593 C CE  . LYS B 1 57  ? 11.643  7.857   -39.519 1.00 134.05 ? 69  LYS B CE  1 
ATOM   2594 N NZ  . LYS B 1 57  ? 12.796  8.781   -39.330 1.00 141.57 ? 69  LYS B NZ  1 
ATOM   2595 N N   . ASP B 1 58  ? 5.586   10.051  -41.093 1.00 85.87  ? 70  ASP B N   1 
ATOM   2596 C CA  . ASP B 1 58  ? 4.499   11.038  -41.086 1.00 82.93  ? 70  ASP B CA  1 
ATOM   2597 C C   . ASP B 1 58  ? 4.469   11.826  -42.406 1.00 82.70  ? 70  ASP B C   1 
ATOM   2598 O O   . ASP B 1 58  ? 3.709   12.790  -42.536 1.00 80.80  ? 70  ASP B O   1 
ATOM   2599 C CB  . ASP B 1 58  ? 4.646   11.998  -39.887 1.00 85.06  ? 70  ASP B CB  1 
ATOM   2600 C CG  . ASP B 1 58  ? 4.114   11.472  -38.563 1.00 102.19 ? 70  ASP B CG  1 
ATOM   2601 O OD1 . ASP B 1 58  ? 2.971   10.953  -38.540 1.00 102.90 ? 70  ASP B OD1 1 
ATOM   2602 O OD2 . ASP B 1 58  ? 4.807   11.648  -37.533 1.00 112.28 ? 70  ASP B OD2 1 
ATOM   2603 N N   . THR B 1 59  ? 5.285   11.395  -43.389 1.00 77.86  ? 71  THR B N   1 
ATOM   2604 C CA  . THR B 1 59  ? 5.422   12.037  -44.699 1.00 75.63  ? 71  THR B CA  1 
ATOM   2605 C C   . THR B 1 59  ? 4.601   11.288  -45.758 1.00 75.95  ? 71  THR B C   1 
ATOM   2606 O O   . THR B 1 59  ? 4.513   10.059  -45.730 1.00 77.42  ? 71  THR B O   1 
ATOM   2607 C CB  . THR B 1 59  ? 6.909   12.111  -45.100 1.00 88.94  ? 71  THR B CB  1 
ATOM   2608 O OG1 . THR B 1 59  ? 7.658   12.607  -43.998 1.00 92.38  ? 71  THR B OG1 1 
ATOM   2609 C CG2 . THR B 1 59  ? 7.160   13.002  -46.314 1.00 85.96  ? 71  THR B CG2 1 
ATOM   2610 N N   . VAL B 1 60  ? 4.004   12.049  -46.687 1.00 67.66  ? 72  VAL B N   1 
ATOM   2611 C CA  . VAL B 1 60  ? 3.322   11.546  -47.881 1.00 65.28  ? 72  VAL B CA  1 
ATOM   2612 C C   . VAL B 1 60  ? 4.358   10.835  -48.773 1.00 67.06  ? 72  VAL B C   1 
ATOM   2613 O O   . VAL B 1 60  ? 5.446   11.356  -49.011 1.00 66.34  ? 72  VAL B O   1 
ATOM   2614 C CB  . VAL B 1 60  ? 2.575   12.705  -48.611 1.00 66.29  ? 72  VAL B CB  1 
ATOM   2615 C CG1 . VAL B 1 60  ? 2.241   12.366  -50.060 1.00 66.07  ? 72  VAL B CG1 1 
ATOM   2616 C CG2 . VAL B 1 60  ? 1.314   13.091  -47.857 1.00 64.37  ? 72  VAL B CG2 1 
ATOM   2617 N N   . ALA B 1 61  ? 4.021   9.625   -49.210 1.00 62.88  ? 73  ALA B N   1 
ATOM   2618 C CA  . ALA B 1 61  ? 4.801   8.867   -50.174 1.00 64.03  ? 73  ALA B CA  1 
ATOM   2619 C C   . ALA B 1 61  ? 3.907   8.392   -51.303 1.00 66.28  ? 73  ALA B C   1 
ATOM   2620 O O   . ALA B 1 61  ? 2.761   8.002   -51.069 1.00 64.85  ? 73  ALA B O   1 
ATOM   2621 C CB  . ALA B 1 61  ? 5.465   7.685   -49.497 1.00 67.27  ? 73  ALA B CB  1 
ATOM   2622 N N   . TRP B 1 62  ? 4.425   8.445   -52.530 1.00 62.40  ? 74  TRP B N   1 
ATOM   2623 C CA  . TRP B 1 62  ? 3.732   7.934   -53.705 1.00 61.68  ? 74  TRP B CA  1 
ATOM   2624 C C   . TRP B 1 62  ? 4.429   6.679   -54.196 1.00 67.83  ? 74  TRP B C   1 
ATOM   2625 O O   . TRP B 1 62  ? 5.656   6.644   -54.265 1.00 69.14  ? 74  TRP B O   1 
ATOM   2626 C CB  . TRP B 1 62  ? 3.662   8.994   -54.806 1.00 58.88  ? 74  TRP B CB  1 
ATOM   2627 C CG  . TRP B 1 62  ? 2.882   10.210  -54.407 1.00 57.26  ? 74  TRP B CG  1 
ATOM   2628 C CD1 . TRP B 1 62  ? 3.367   11.330  -53.799 1.00 59.09  ? 74  TRP B CD1 1 
ATOM   2629 C CD2 . TRP B 1 62  ? 1.468   10.407  -54.542 1.00 55.30  ? 74  TRP B CD2 1 
ATOM   2630 N NE1 . TRP B 1 62  ? 2.353   12.225  -53.575 1.00 56.06  ? 74  TRP B NE1 1 
ATOM   2631 C CE2 . TRP B 1 62  ? 1.171   11.679  -54.010 1.00 57.20  ? 74  TRP B CE2 1 
ATOM   2632 C CE3 . TRP B 1 62  ? 0.421   9.633   -55.075 1.00 56.55  ? 74  TRP B CE3 1 
ATOM   2633 C CZ2 . TRP B 1 62  ? -0.130  12.202  -54.004 1.00 54.80  ? 74  TRP B CZ2 1 
ATOM   2634 C CZ3 . TRP B 1 62  ? -0.864  10.153  -55.070 1.00 56.26  ? 74  TRP B CZ3 1 
ATOM   2635 C CH2 . TRP B 1 62  ? -1.131  11.421  -54.539 1.00 55.06  ? 74  TRP B CH2 1 
ATOM   2636 N N   . LEU B 1 63  ? 3.645   5.638   -54.509 1.00 64.36  ? 75  LEU B N   1 
ATOM   2637 C CA  . LEU B 1 63  ? 4.148   4.368   -55.016 1.00 66.80  ? 75  LEU B CA  1 
ATOM   2638 C C   . LEU B 1 63  ? 4.892   4.576   -56.347 1.00 71.79  ? 75  LEU B C   1 
ATOM   2639 O O   . LEU B 1 63  ? 4.412   5.298   -57.222 1.00 69.80  ? 75  LEU B O   1 
ATOM   2640 C CB  . LEU B 1 63  ? 2.984   3.368   -55.165 1.00 66.92  ? 75  LEU B CB  1 
ATOM   2641 C CG  . LEU B 1 63  ? 3.322   1.947   -55.626 1.00 73.95  ? 75  LEU B CG  1 
ATOM   2642 C CD1 . LEU B 1 63  ? 3.986   1.149   -54.522 1.00 75.71  ? 75  LEU B CD1 1 
ATOM   2643 C CD2 . LEU B 1 63  ? 2.081   1.236   -56.091 1.00 75.28  ? 75  LEU B CD2 1 
ATOM   2644 N N   . LYS B 1 64  ? 6.087   3.986   -56.460 1.00 71.60  ? 76  LYS B N   1 
ATOM   2645 C CA  . LYS B 1 64  ? 6.920   4.070   -57.658 1.00 73.10  ? 76  LYS B CA  1 
ATOM   2646 C C   . LYS B 1 64  ? 6.426   3.060   -58.685 1.00 78.44  ? 76  LYS B C   1 
ATOM   2647 O O   . LYS B 1 64  ? 6.117   1.916   -58.338 1.00 78.46  ? 76  LYS B O   1 
ATOM   2648 C CB  . LYS B 1 64  ? 8.404   3.859   -57.324 1.00 78.28  ? 76  LYS B CB  1 
ATOM   2649 C CG  . LYS B 1 64  ? 9.047   5.128   -56.789 1.00 90.40  ? 76  LYS B CG  1 
ATOM   2650 C CD  . LYS B 1 64  ? 10.454  4.944   -56.342 1.00 106.76 ? 76  LYS B CD  1 
ATOM   2651 C CE  . LYS B 1 64  ? 11.025  6.228   -55.779 1.00 121.03 ? 76  LYS B CE  1 
ATOM   2652 N NZ  . LYS B 1 64  ? 12.370  6.018   -55.167 1.00 134.02 ? 76  LYS B NZ  1 
ATOM   2653 N N   . MET B 1 65  ? 6.362   3.488   -59.950 1.00 76.41  ? 77  MET B N   1 
ATOM   2654 C CA  . MET B 1 65  ? 5.768   2.709   -61.034 1.00 78.36  ? 77  MET B CA  1 
ATOM   2655 C C   . MET B 1 65  ? 6.715   1.616   -61.555 1.00 90.80  ? 77  MET B C   1 
ATOM   2656 O O   . MET B 1 65  ? 6.229   0.602   -62.059 1.00 92.25  ? 77  MET B O   1 
ATOM   2657 C CB  . MET B 1 65  ? 5.320   3.632   -62.177 1.00 78.85  ? 77  MET B CB  1 
ATOM   2658 C CG  . MET B 1 65  ? 4.263   4.662   -61.763 1.00 78.31  ? 77  MET B CG  1 
ATOM   2659 S SD  . MET B 1 65  ? 2.601   3.997   -61.448 1.00 80.17  ? 77  MET B SD  1 
ATOM   2660 C CE  . MET B 1 65  ? 2.565   4.001   -59.667 1.00 75.30  ? 77  MET B CE  1 
ATOM   2661 N N   . ASP B 1 66  ? 8.051   1.806   -61.425 1.00 92.10  ? 78  ASP B N   1 
ATOM   2662 C CA  . ASP B 1 66  ? 9.059   0.833   -61.878 1.00 97.16  ? 78  ASP B CA  1 
ATOM   2663 C C   . ASP B 1 66  ? 9.431   -0.181  -60.789 1.00 103.89 ? 78  ASP B C   1 
ATOM   2664 O O   . ASP B 1 66  ? 9.944   -1.248  -61.117 1.00 106.74 ? 78  ASP B O   1 
ATOM   2665 C CB  . ASP B 1 66  ? 10.344  1.539   -62.356 1.00 101.13 ? 78  ASP B CB  1 
ATOM   2666 C CG  . ASP B 1 66  ? 10.236  2.301   -63.663 1.00 116.32 ? 78  ASP B CG  1 
ATOM   2667 O OD1 . ASP B 1 66  ? 9.340   3.172   -63.770 1.00 115.07 ? 78  ASP B OD1 1 
ATOM   2668 O OD2 . ASP B 1 66  ? 11.101  2.090   -64.547 1.00 125.83 ? 78  ASP B OD2 1 
ATOM   2669 N N   . LYS B 1 67  ? 9.225   0.158   -59.508 1.00 99.76  ? 79  LYS B N   1 
ATOM   2670 C CA  . LYS B 1 67  ? 9.501   -0.761  -58.399 1.00 102.01 ? 79  LYS B CA  1 
ATOM   2671 C C   . LYS B 1 67  ? 8.354   -1.751  -58.216 1.00 107.28 ? 79  LYS B C   1 
ATOM   2672 O O   . LYS B 1 67  ? 7.191   -1.386  -58.398 1.00 104.23 ? 79  LYS B O   1 
ATOM   2673 C CB  . LYS B 1 67  ? 9.746   -0.003  -57.088 1.00 102.97 ? 79  LYS B CB  1 
ATOM   2674 C CG  . LYS B 1 67  ? 11.093  0.671   -57.008 1.00 118.45 ? 79  LYS B CG  1 
ATOM   2675 C CD  . LYS B 1 67  ? 11.326  1.164   -55.613 1.00 127.28 ? 79  LYS B CD  1 
ATOM   2676 C CE  . LYS B 1 67  ? 12.561  2.009   -55.568 1.00 138.07 ? 79  LYS B CE  1 
ATOM   2677 N NZ  . LYS B 1 67  ? 12.627  2.795   -54.310 1.00 144.52 ? 79  LYS B NZ  1 
ATOM   2678 N N   . LYS B 1 68  ? 8.688   -3.003  -57.855 1.00 108.10 ? 80  LYS B N   1 
ATOM   2679 C CA  . LYS B 1 68  ? 7.720   -4.051  -57.519 1.00 109.08 ? 80  LYS B CA  1 
ATOM   2680 C C   . LYS B 1 68  ? 6.898   -3.658  -56.295 1.00 111.97 ? 80  LYS B C   1 
ATOM   2681 O O   . LYS B 1 68  ? 7.444   -3.109  -55.335 1.00 111.54 ? 80  LYS B O   1 
ATOM   2682 C CB  . LYS B 1 68  ? 8.430   -5.391  -57.252 1.00 115.88 ? 80  LYS B CB  1 
ATOM   2683 C CG  . LYS B 1 68  ? 8.911   -6.116  -58.501 1.00 133.60 ? 80  LYS B CG  1 
ATOM   2684 C CD  . LYS B 1 68  ? 9.550   -7.449  -58.149 1.00 147.95 ? 80  LYS B CD  1 
ATOM   2685 C CE  . LYS B 1 68  ? 10.151  -8.130  -59.351 1.00 162.04 ? 80  LYS B CE  1 
ATOM   2686 N NZ  . LYS B 1 68  ? 10.850  -9.385  -58.973 1.00 175.67 ? 80  LYS B NZ  1 
ATOM   2687 N N   . VAL B 1 69  ? 5.582   -3.914  -56.345 1.00 107.79 ? 81  VAL B N   1 
ATOM   2688 C CA  . VAL B 1 69  ? 4.674   -3.732  -55.208 1.00 105.76 ? 81  VAL B CA  1 
ATOM   2689 C C   . VAL B 1 69  ? 5.005   -4.831  -54.179 1.00 113.97 ? 81  VAL B C   1 
ATOM   2690 O O   . VAL B 1 69  ? 4.659   -5.997  -54.396 1.00 116.03 ? 81  VAL B O   1 
ATOM   2691 C CB  . VAL B 1 69  ? 3.180   -3.751  -55.645 1.00 107.24 ? 81  VAL B CB  1 
ATOM   2692 C CG1 . VAL B 1 69  ? 2.249   -3.493  -54.462 1.00 105.02 ? 81  VAL B CG1 1 
ATOM   2693 C CG2 . VAL B 1 69  ? 2.913   -2.757  -56.771 1.00 104.60 ? 81  VAL B CG2 1 
ATOM   2694 N N   . LEU B 1 70  ? 5.740   -4.439  -53.103 1.00 110.80 ? 82  LEU B N   1 
ATOM   2695 C CA  . LEU B 1 70  ? 6.217   -5.208  -51.935 1.00 134.75 ? 82  LEU B CA  1 
ATOM   2696 C C   . LEU B 1 70  ? 7.411   -4.491  -51.304 1.00 144.84 ? 82  LEU B C   1 
ATOM   2697 O O   . LEU B 1 70  ? 7.721   -4.702  -50.133 1.00 101.75 ? 82  LEU B O   1 
ATOM   2698 C CB  . LEU B 1 70  ? 6.593   -6.675  -52.249 1.00 139.13 ? 82  LEU B CB  1 
ATOM   2699 C CG  . LEU B 1 70  ? 5.512   -7.739  -51.984 1.00 145.16 ? 82  LEU B CG  1 
ATOM   2700 C CD1 . LEU B 1 70  ? 5.826   -9.024  -52.721 1.00 149.31 ? 82  LEU B CD1 1 
ATOM   2701 C CD2 . LEU B 1 70  ? 5.325   -8.006  -50.495 1.00 148.49 ? 82  LEU B CD2 1 
ATOM   2702 N N   . PRO B 1 79  ? -2.664  -6.186  -44.401 1.00 104.13 ? 91  PRO B N   1 
ATOM   2703 C CA  . PRO B 1 79  ? -3.375  -5.786  -45.628 1.00 101.29 ? 91  PRO B CA  1 
ATOM   2704 C C   . PRO B 1 79  ? -2.744  -4.537  -46.249 1.00 100.73 ? 91  PRO B C   1 
ATOM   2705 O O   . PRO B 1 79  ? -2.829  -3.447  -45.672 1.00 98.13  ? 91  PRO B O   1 
ATOM   2706 C CB  . PRO B 1 79  ? -4.822  -5.542  -45.156 1.00 101.76 ? 91  PRO B CB  1 
ATOM   2707 C CG  . PRO B 1 79  ? -4.834  -5.830  -43.664 1.00 108.16 ? 91  PRO B CG  1 
ATOM   2708 C CD  . PRO B 1 79  ? -3.416  -5.822  -43.189 1.00 105.12 ? 91  PRO B CD  1 
ATOM   2709 N N   . VAL B 1 80  ? -2.095  -4.704  -47.424 1.00 95.99  ? 92  VAL B N   1 
ATOM   2710 C CA  . VAL B 1 80  ? -1.387  -3.631  -48.140 1.00 92.72  ? 92  VAL B CA  1 
ATOM   2711 C C   . VAL B 1 80  ? -2.412  -2.610  -48.639 1.00 90.71  ? 92  VAL B C   1 
ATOM   2712 O O   . VAL B 1 80  ? -3.331  -2.984  -49.373 1.00 90.61  ? 92  VAL B O   1 
ATOM   2713 C CB  . VAL B 1 80  ? -0.501  -4.163  -49.303 1.00 98.41  ? 92  VAL B CB  1 
ATOM   2714 C CG1 . VAL B 1 80  ? 0.373   -3.054  -49.880 1.00 96.31  ? 92  VAL B CG1 1 
ATOM   2715 C CG2 . VAL B 1 80  ? 0.361   -5.341  -48.856 1.00 102.08 ? 92  VAL B CG2 1 
ATOM   2716 N N   . THR B 1 81  ? -2.255  -1.331  -48.242 1.00 81.75  ? 93  THR B N   1 
ATOM   2717 C CA  . THR B 1 81  ? -3.242  -0.293  -48.539 1.00 76.68  ? 93  THR B CA  1 
ATOM   2718 C C   . THR B 1 81  ? -2.584  0.914   -49.214 1.00 75.12  ? 93  THR B C   1 
ATOM   2719 O O   . THR B 1 81  ? -1.579  1.435   -48.722 1.00 75.34  ? 93  THR B O   1 
ATOM   2720 C CB  . THR B 1 81  ? -4.012  0.104   -47.260 1.00 79.71  ? 93  THR B CB  1 
ATOM   2721 O OG1 . THR B 1 81  ? -4.608  -1.064  -46.695 1.00 81.73  ? 93  THR B OG1 1 
ATOM   2722 C CG2 . THR B 1 81  ? -5.105  1.135   -47.519 1.00 72.79  ? 93  THR B CG2 1 
ATOM   2723 N N   . PHE B 1 82  ? -3.158  1.339   -50.353 1.00 66.60  ? 94  PHE B N   1 
ATOM   2724 C CA  . PHE B 1 82  ? -2.821  2.593   -51.023 1.00 62.59  ? 94  PHE B CA  1 
ATOM   2725 C C   . PHE B 1 82  ? -4.057  3.450   -51.186 1.00 60.72  ? 94  PHE B C   1 
ATOM   2726 O O   . PHE B 1 82  ? -5.163  2.924   -51.285 1.00 59.06  ? 94  PHE B O   1 
ATOM   2727 C CB  . PHE B 1 82  ? -2.166  2.350   -52.393 1.00 65.22  ? 94  PHE B CB  1 
ATOM   2728 C CG  . PHE B 1 82  ? -0.920  1.506   -52.333 1.00 69.58  ? 94  PHE B CG  1 
ATOM   2729 C CD1 . PHE B 1 82  ? 0.294   2.055   -51.943 1.00 73.26  ? 94  PHE B CD1 1 
ATOM   2730 C CD2 . PHE B 1 82  ? -0.961  0.155   -52.652 1.00 74.05  ? 94  PHE B CD2 1 
ATOM   2731 C CE1 . PHE B 1 82  ? 1.441   1.263   -51.863 1.00 77.03  ? 94  PHE B CE1 1 
ATOM   2732 C CE2 . PHE B 1 82  ? 0.189   -0.633  -52.585 1.00 79.57  ? 94  PHE B CE2 1 
ATOM   2733 C CZ  . PHE B 1 82  ? 1.381   -0.075  -52.189 1.00 78.13  ? 94  PHE B CZ  1 
ATOM   2734 N N   . HIS B 1 83  ? -3.866  4.779   -51.199 1.00 54.34  ? 95  HIS B N   1 
ATOM   2735 C CA  . HIS B 1 83  ? -4.929  5.739   -51.455 1.00 51.13  ? 95  HIS B CA  1 
ATOM   2736 C C   . HIS B 1 83  ? -4.810  6.269   -52.868 1.00 52.03  ? 95  HIS B C   1 
ATOM   2737 O O   . HIS B 1 83  ? -3.798  6.876   -53.218 1.00 50.52  ? 95  HIS B O   1 
ATOM   2738 C CB  . HIS B 1 83  ? -4.906  6.874   -50.427 1.00 50.48  ? 95  HIS B CB  1 
ATOM   2739 C CG  . HIS B 1 83  ? -5.445  6.462   -49.097 1.00 54.83  ? 95  HIS B CG  1 
ATOM   2740 N ND1 . HIS B 1 83  ? -4.758  5.576   -48.281 1.00 59.11  ? 95  HIS B ND1 1 
ATOM   2741 C CD2 . HIS B 1 83  ? -6.600  6.814   -48.487 1.00 55.93  ? 95  HIS B CD2 1 
ATOM   2742 C CE1 . HIS B 1 83  ? -5.515  5.416   -47.207 1.00 58.85  ? 95  HIS B CE1 1 
ATOM   2743 N NE2 . HIS B 1 83  ? -6.633  6.144   -47.284 1.00 57.37  ? 95  HIS B NE2 1 
ATOM   2744 N N   . PHE B 1 84  ? -5.834  5.999   -53.695 1.00 47.90  ? 96  PHE B N   1 
ATOM   2745 C CA  . PHE B 1 84  ? -5.896  6.525   -55.052 1.00 46.77  ? 96  PHE B CA  1 
ATOM   2746 C C   . PHE B 1 84  ? -6.323  7.992   -54.979 1.00 49.93  ? 96  PHE B C   1 
ATOM   2747 O O   . PHE B 1 84  ? -7.463  8.302   -54.613 1.00 49.44  ? 96  PHE B O   1 
ATOM   2748 C CB  . PHE B 1 84  ? -6.834  5.683   -55.928 1.00 48.64  ? 96  PHE B CB  1 
ATOM   2749 C CG  . PHE B 1 84  ? -6.812  6.059   -57.388 1.00 49.10  ? 96  PHE B CG  1 
ATOM   2750 C CD1 . PHE B 1 84  ? -5.822  5.567   -58.237 1.00 52.66  ? 96  PHE B CD1 1 
ATOM   2751 C CD2 . PHE B 1 84  ? -7.789  6.896   -57.921 1.00 48.76  ? 96  PHE B CD2 1 
ATOM   2752 C CE1 . PHE B 1 84  ? -5.803  5.912   -59.590 1.00 53.09  ? 96  PHE B CE1 1 
ATOM   2753 C CE2 . PHE B 1 84  ? -7.774  7.235   -59.274 1.00 50.91  ? 96  PHE B CE2 1 
ATOM   2754 C CZ  . PHE B 1 84  ? -6.781  6.737   -60.099 1.00 50.40  ? 96  PHE B CZ  1 
ATOM   2755 N N   . LEU B 1 85  ? -5.379  8.891   -55.267 1.00 44.66  ? 97  LEU B N   1 
ATOM   2756 C CA  . LEU B 1 85  ? -5.569  10.337  -55.137 1.00 41.66  ? 97  LEU B CA  1 
ATOM   2757 C C   . LEU B 1 85  ? -4.922  11.084  -56.286 1.00 43.11  ? 97  LEU B C   1 
ATOM   2758 O O   . LEU B 1 85  ? -3.994  10.578  -56.912 1.00 45.84  ? 97  LEU B O   1 
ATOM   2759 C CB  . LEU B 1 85  ? -4.958  10.849  -53.805 1.00 41.29  ? 97  LEU B CB  1 
ATOM   2760 C CG  . LEU B 1 85  ? -5.627  10.443  -52.490 1.00 45.79  ? 97  LEU B CG  1 
ATOM   2761 C CD1 . LEU B 1 85  ? -4.712  10.721  -51.318 1.00 45.47  ? 97  LEU B CD1 1 
ATOM   2762 C CD2 . LEU B 1 85  ? -7.017  11.101  -52.318 1.00 47.04  ? 97  LEU B CD2 1 
ATOM   2763 N N   . ALA B 1 86  ? -5.396  12.295  -56.546 1.00 35.93  ? 98  ALA B N   1 
ATOM   2764 C CA  . ALA B 1 86  ? -4.736  13.244  -57.432 1.00 35.43  ? 98  ALA B CA  1 
ATOM   2765 C C   . ALA B 1 86  ? -3.449  13.755  -56.794 1.00 40.48  ? 98  ALA B C   1 
ATOM   2766 O O   . ALA B 1 86  ? -3.470  14.256  -55.663 1.00 38.41  ? 98  ALA B O   1 
ATOM   2767 C CB  . ALA B 1 86  ? -5.664  14.406  -57.741 1.00 34.48  ? 98  ALA B CB  1 
ATOM   2768 N N   . LYS B 1 87  ? -2.325  13.568  -57.508 1.00 39.58  ? 99  LYS B N   1 
ATOM   2769 C CA  . LYS B 1 87  ? -0.997  14.099  -57.174 1.00 39.74  ? 99  LYS B CA  1 
ATOM   2770 C C   . LYS B 1 87  ? -0.835  15.479  -57.805 1.00 43.81  ? 99  LYS B C   1 
ATOM   2771 O O   . LYS B 1 87  ? -0.176  16.350  -57.240 1.00 44.12  ? 99  LYS B O   1 
ATOM   2772 C CB  . LYS B 1 87  ? 0.086   13.130  -57.684 1.00 43.58  ? 99  LYS B CB  1 
ATOM   2773 C CG  . LYS B 1 87  ? 1.482   13.400  -57.159 1.00 49.03  ? 99  LYS B CG  1 
ATOM   2774 C CD  . LYS B 1 87  ? 2.460   12.349  -57.633 1.00 58.67  ? 99  LYS B CD  1 
ATOM   2775 C CE  . LYS B 1 87  ? 3.863   12.577  -57.114 1.00 63.87  ? 99  LYS B CE  1 
ATOM   2776 N NZ  . LYS B 1 87  ? 4.828   11.596  -57.682 1.00 63.97  ? 99  LYS B NZ  1 
ATOM   2777 N N   . PHE B 1 88  ? -1.450  15.666  -58.976 1.00 40.95  ? 100 PHE B N   1 
ATOM   2778 C CA  . PHE B 1 88  ? -1.389  16.890  -59.768 1.00 40.98  ? 100 PHE B CA  1 
ATOM   2779 C C   . PHE B 1 88  ? -2.786  17.405  -60.076 1.00 44.19  ? 100 PHE B C   1 
ATOM   2780 O O   . PHE B 1 88  ? -3.737  16.619  -60.177 1.00 44.35  ? 100 PHE B O   1 
ATOM   2781 C CB  . PHE B 1 88  ? -0.605  16.656  -61.065 1.00 44.78  ? 100 PHE B CB  1 
ATOM   2782 C CG  . PHE B 1 88  ? 0.762   16.046  -60.843 1.00 48.12  ? 100 PHE B CG  1 
ATOM   2783 C CD1 . PHE B 1 88  ? 1.824   16.819  -60.370 1.00 50.98  ? 100 PHE B CD1 1 
ATOM   2784 C CD2 . PHE B 1 88  ? 0.986   14.697  -61.093 1.00 51.81  ? 100 PHE B CD2 1 
ATOM   2785 C CE1 . PHE B 1 88  ? 3.078   16.249  -60.143 1.00 53.45  ? 100 PHE B CE1 1 
ATOM   2786 C CE2 . PHE B 1 88  ? 2.244   14.130  -60.875 1.00 55.92  ? 100 PHE B CE2 1 
ATOM   2787 C CZ  . PHE B 1 88  ? 3.280   14.911  -60.399 1.00 54.20  ? 100 PHE B CZ  1 
ATOM   2788 N N   . TYR B 1 89  ? -2.900  18.731  -60.229 1.00 39.30  ? 101 TYR B N   1 
ATOM   2789 C CA  . TYR B 1 89  ? -4.170  19.425  -60.423 1.00 37.81  ? 101 TYR B CA  1 
ATOM   2790 C C   . TYR B 1 89  ? -4.224  20.069  -61.804 1.00 44.60  ? 101 TYR B C   1 
ATOM   2791 O O   . TYR B 1 89  ? -3.186  20.497  -62.315 1.00 46.15  ? 101 TYR B O   1 
ATOM   2792 C CB  . TYR B 1 89  ? -4.366  20.484  -59.324 1.00 36.98  ? 101 TYR B CB  1 
ATOM   2793 C CG  . TYR B 1 89  ? -4.676  19.883  -57.968 1.00 36.57  ? 101 TYR B CG  1 
ATOM   2794 C CD1 . TYR B 1 89  ? -3.665  19.370  -57.160 1.00 38.24  ? 101 TYR B CD1 1 
ATOM   2795 C CD2 . TYR B 1 89  ? -5.986  19.783  -57.512 1.00 36.19  ? 101 TYR B CD2 1 
ATOM   2796 C CE1 . TYR B 1 89  ? -3.952  18.771  -55.933 1.00 38.06  ? 101 TYR B CE1 1 
ATOM   2797 C CE2 . TYR B 1 89  ? -6.284  19.199  -56.280 1.00 36.25  ? 101 TYR B CE2 1 
ATOM   2798 C CZ  . TYR B 1 89  ? -5.265  18.694  -55.494 1.00 42.83  ? 101 TYR B CZ  1 
ATOM   2799 O OH  . TYR B 1 89  ? -5.569  18.113  -54.283 1.00 41.27  ? 101 TYR B OH  1 
ATOM   2800 N N   . PRO B 1 90  ? -5.409  20.132  -62.454 1.00 41.40  ? 102 PRO B N   1 
ATOM   2801 C CA  . PRO B 1 90  ? -5.485  20.859  -63.731 1.00 42.54  ? 102 PRO B CA  1 
ATOM   2802 C C   . PRO B 1 90  ? -5.346  22.365  -63.523 1.00 46.81  ? 102 PRO B C   1 
ATOM   2803 O O   . PRO B 1 90  ? -5.674  22.863  -62.454 1.00 45.42  ? 102 PRO B O   1 
ATOM   2804 C CB  . PRO B 1 90  ? -6.876  20.483  -64.264 1.00 43.60  ? 102 PRO B CB  1 
ATOM   2805 C CG  . PRO B 1 90  ? -7.655  20.119  -63.077 1.00 45.73  ? 102 PRO B CG  1 
ATOM   2806 C CD  . PRO B 1 90  ? -6.714  19.540  -62.086 1.00 41.09  ? 102 PRO B CD  1 
ATOM   2807 N N   . GLU B 1 91  ? -4.847  23.076  -64.527 1.00 46.01  ? 103 GLU B N   1 
ATOM   2808 C CA  . GLU B 1 91  ? -4.870  24.542  -64.537 1.00 47.25  ? 103 GLU B CA  1 
ATOM   2809 C C   . GLU B 1 91  ? -6.283  25.043  -64.819 1.00 52.05  ? 103 GLU B C   1 
ATOM   2810 O O   . GLU B 1 91  ? -6.712  26.057  -64.258 1.00 52.65  ? 103 GLU B O   1 
ATOM   2811 C CB  . GLU B 1 91  ? -3.901  25.095  -65.589 1.00 51.18  ? 103 GLU B CB  1 
ATOM   2812 C CG  . GLU B 1 91  ? -2.853  26.039  -65.037 1.00 67.75  ? 103 GLU B CG  1 
ATOM   2813 C CD  . GLU B 1 91  ? -3.394  27.357  -64.503 1.00 95.82  ? 103 GLU B CD  1 
ATOM   2814 O OE1 . GLU B 1 91  ? -3.539  28.321  -65.291 1.00 91.50  ? 103 GLU B OE1 1 
ATOM   2815 O OE2 . GLU B 1 91  ? -3.649  27.428  -63.280 1.00 95.21  ? 103 GLU B OE2 1 
ATOM   2816 N N   . ASN B 1 92  ? -6.998  24.326  -65.697 1.00 47.69  ? 104 ASN B N   1 
ATOM   2817 C CA  . ASN B 1 92  ? -8.361  24.624  -66.112 1.00 46.53  ? 104 ASN B CA  1 
ATOM   2818 C C   . ASN B 1 92  ? -9.196  23.338  -66.057 1.00 49.00  ? 104 ASN B C   1 
ATOM   2819 O O   . ASN B 1 92  ? -9.108  22.502  -66.961 1.00 49.20  ? 104 ASN B O   1 
ATOM   2820 C CB  . ASN B 1 92  ? -8.347  25.228  -67.519 1.00 46.18  ? 104 ASN B CB  1 
ATOM   2821 C CG  . ASN B 1 92  ? -9.679  25.737  -68.027 1.00 63.11  ? 104 ASN B CG  1 
ATOM   2822 O OD1 . ASN B 1 92  ? -10.756 25.173  -67.780 1.00 51.07  ? 104 ASN B OD1 1 
ATOM   2823 N ND2 . ASN B 1 92  ? -9.622  26.781  -68.829 1.00 57.18  ? 104 ASN B ND2 1 
ATOM   2824 N N   . ALA B 1 93  ? -10.016 23.195  -65.003 1.00 43.85  ? 105 ALA B N   1 
ATOM   2825 C CA  . ALA B 1 93  ? -10.814 21.993  -64.744 1.00 42.65  ? 105 ALA B CA  1 
ATOM   2826 C C   . ALA B 1 93  ? -11.757 21.660  -65.920 1.00 45.93  ? 105 ALA B C   1 
ATOM   2827 O O   . ALA B 1 93  ? -11.776 20.508  -66.350 1.00 45.47  ? 105 ALA B O   1 
ATOM   2828 C CB  . ALA B 1 93  ? -11.603 22.150  -63.456 1.00 41.67  ? 105 ALA B CB  1 
ATOM   2829 N N   . GLU B 1 94  ? -12.472 22.661  -66.476 1.00 42.24  ? 106 GLU B N   1 
ATOM   2830 C CA  . GLU B 1 94  ? -13.472 22.440  -67.527 1.00 43.44  ? 106 GLU B CA  1 
ATOM   2831 C C   . GLU B 1 94  ? -12.824 21.938  -68.823 1.00 50.27  ? 106 GLU B C   1 
ATOM   2832 O O   . GLU B 1 94  ? -13.375 21.036  -69.461 1.00 51.39  ? 106 GLU B O   1 
ATOM   2833 C CB  . GLU B 1 94  ? -14.304 23.709  -67.791 1.00 45.16  ? 106 GLU B CB  1 
ATOM   2834 C CG  . GLU B 1 94  ? -15.543 23.482  -68.646 1.00 57.62  ? 106 GLU B CG  1 
ATOM   2835 C CD  . GLU B 1 94  ? -16.644 24.519  -68.497 1.00 94.09  ? 106 GLU B CD  1 
ATOM   2836 O OE1 . GLU B 1 94  ? -16.393 25.709  -68.801 1.00 85.69  ? 106 GLU B OE1 1 
ATOM   2837 O OE2 . GLU B 1 94  ? -17.771 24.134  -68.107 1.00 98.29  ? 106 GLU B OE2 1 
ATOM   2838 N N   . GLU B 1 95  ? -11.665 22.502  -69.202 1.00 47.90  ? 107 GLU B N   1 
ATOM   2839 C CA  . GLU B 1 95  ? -10.923 22.094  -70.398 1.00 49.63  ? 107 GLU B CA  1 
ATOM   2840 C C   . GLU B 1 95  ? -10.292 20.715  -70.234 1.00 52.90  ? 107 GLU B C   1 
ATOM   2841 O O   . GLU B 1 95  ? -10.333 19.914  -71.173 1.00 54.49  ? 107 GLU B O   1 
ATOM   2842 C CB  . GLU B 1 95  ? -9.830  23.110  -70.747 1.00 52.18  ? 107 GLU B CB  1 
ATOM   2843 C CG  . GLU B 1 95  ? -10.360 24.414  -71.314 1.00 69.41  ? 107 GLU B CG  1 
ATOM   2844 C CD  . GLU B 1 95  ? -9.309  25.361  -71.858 1.00 102.37 ? 107 GLU B CD  1 
ATOM   2845 O OE1 . GLU B 1 95  ? -8.195  25.419  -71.289 1.00 101.37 ? 107 GLU B OE1 1 
ATOM   2846 O OE2 . GLU B 1 95  ? -9.606  26.054  -72.857 1.00 105.67 ? 107 GLU B OE2 1 
ATOM   2847 N N   . GLU B 1 96  ? -9.745  20.429  -69.035 1.00 46.66  ? 108 GLU B N   1 
ATOM   2848 C CA  . GLU B 1 96  ? -8.855  19.288  -68.822 1.00 45.84  ? 108 GLU B CA  1 
ATOM   2849 C C   . GLU B 1 96  ? -9.583  18.050  -68.309 1.00 46.86  ? 108 GLU B C   1 
ATOM   2850 O O   . GLU B 1 96  ? -9.158  16.950  -68.639 1.00 46.44  ? 108 GLU B O   1 
ATOM   2851 C CB  . GLU B 1 96  ? -7.716  19.659  -67.861 1.00 46.05  ? 108 GLU B CB  1 
ATOM   2852 C CG  . GLU B 1 96  ? -6.744  20.689  -68.417 1.00 52.86  ? 108 GLU B CG  1 
ATOM   2853 C CD  . GLU B 1 96  ? -5.598  21.043  -67.491 1.00 73.40  ? 108 GLU B CD  1 
ATOM   2854 O OE1 . GLU B 1 96  ? -4.887  20.115  -67.041 1.00 73.66  ? 108 GLU B OE1 1 
ATOM   2855 O OE2 . GLU B 1 96  ? -5.405  22.249  -67.216 1.00 63.12  ? 108 GLU B OE2 1 
ATOM   2856 N N   . LEU B 1 97  ? -10.646 18.215  -67.496 1.00 41.73  ? 109 LEU B N   1 
ATOM   2857 C CA  . LEU B 1 97  ? -11.388 17.077  -66.939 1.00 40.85  ? 109 LEU B CA  1 
ATOM   2858 C C   . LEU B 1 97  ? -12.591 16.762  -67.855 1.00 46.88  ? 109 LEU B C   1 
ATOM   2859 O O   . LEU B 1 97  ? -13.725 17.198  -67.627 1.00 45.45  ? 109 LEU B O   1 
ATOM   2860 C CB  . LEU B 1 97  ? -11.806 17.305  -65.464 1.00 38.66  ? 109 LEU B CB  1 
ATOM   2861 C CG  . LEU B 1 97  ? -10.729 17.835  -64.469 1.00 40.91  ? 109 LEU B CG  1 
ATOM   2862 C CD1 . LEU B 1 97  ? -11.294 17.957  -63.070 1.00 37.46  ? 109 LEU B CD1 1 
ATOM   2863 C CD2 . LEU B 1 97  ? -9.488  16.952  -64.445 1.00 43.07  ? 109 LEU B CD2 1 
ATOM   2864 N N   . VAL B 1 98  ? -12.300 16.015  -68.927 1.00 45.60  ? 110 VAL B N   1 
ATOM   2865 C CA  . VAL B 1 98  ? -13.250 15.665  -69.975 1.00 46.73  ? 110 VAL B CA  1 
ATOM   2866 C C   . VAL B 1 98  ? -14.126 14.465  -69.515 1.00 49.91  ? 110 VAL B C   1 
ATOM   2867 O O   . VAL B 1 98  ? -15.332 14.476  -69.764 1.00 50.45  ? 110 VAL B O   1 
ATOM   2868 C CB  . VAL B 1 98  ? -12.498 15.399  -71.311 1.00 52.67  ? 110 VAL B CB  1 
ATOM   2869 C CG1 . VAL B 1 98  ? -13.447 14.912  -72.412 1.00 53.89  ? 110 VAL B CG1 1 
ATOM   2870 C CG2 . VAL B 1 98  ? -11.736 16.652  -71.759 1.00 52.74  ? 110 VAL B CG2 1 
ATOM   2871 N N   . GLN B 1 99  ? -13.527 13.461  -68.835 1.00 45.13  ? 111 GLN B N   1 
ATOM   2872 C CA  . GLN B 1 99  ? -14.228 12.289  -68.285 1.00 43.96  ? 111 GLN B CA  1 
ATOM   2873 C C   . GLN B 1 99  ? -14.953 12.632  -66.995 1.00 47.80  ? 111 GLN B C   1 
ATOM   2874 O O   . GLN B 1 99  ? -14.480 13.455  -66.215 1.00 46.58  ? 111 GLN B O   1 
ATOM   2875 C CB  . GLN B 1 99  ? -13.268 11.121  -68.024 1.00 45.31  ? 111 GLN B CB  1 
ATOM   2876 C CG  . GLN B 1 99  ? -12.558 10.562  -69.256 1.00 39.29  ? 111 GLN B CG  1 
ATOM   2877 C CD  . GLN B 1 99  ? -11.717 9.368   -68.887 1.00 53.31  ? 111 GLN B CD  1 
ATOM   2878 O OE1 . GLN B 1 99  ? -10.498 9.459   -68.694 1.00 47.23  ? 111 GLN B OE1 1 
ATOM   2879 N NE2 . GLN B 1 99  ? -12.358 8.225   -68.754 1.00 45.44  ? 111 GLN B NE2 1 
ATOM   2880 N N   . GLU B 1 100 ? -16.107 12.003  -66.765 1.00 45.95  ? 112 GLU B N   1 
ATOM   2881 C CA  . GLU B 1 100 ? -16.880 12.266  -65.554 1.00 44.49  ? 112 GLU B CA  1 
ATOM   2882 C C   . GLU B 1 100 ? -16.181 11.710  -64.322 1.00 47.00  ? 112 GLU B C   1 
ATOM   2883 O O   . GLU B 1 100 ? -16.204 12.379  -63.286 1.00 45.53  ? 112 GLU B O   1 
ATOM   2884 C CB  . GLU B 1 100 ? -18.304 11.711  -65.648 1.00 46.73  ? 112 GLU B CB  1 
ATOM   2885 C CG  . GLU B 1 100 ? -19.225 12.363  -64.631 1.00 57.85  ? 112 GLU B CG  1 
ATOM   2886 C CD  . GLU B 1 100 ? -20.678 11.958  -64.667 1.00 80.24  ? 112 GLU B CD  1 
ATOM   2887 O OE1 . GLU B 1 100 ? -20.979 10.831  -65.123 1.00 74.38  ? 112 GLU B OE1 1 
ATOM   2888 O OE2 . GLU B 1 100 ? -21.512 12.745  -64.164 1.00 74.90  ? 112 GLU B OE2 1 
ATOM   2889 N N   . ILE B 1 101 ? -15.543 10.508  -64.432 1.00 43.14  ? 113 ILE B N   1 
ATOM   2890 C CA  . ILE B 1 101 ? -14.836 9.880   -63.314 1.00 41.77  ? 113 ILE B CA  1 
ATOM   2891 C C   . ILE B 1 101 ? -13.763 10.835  -62.757 1.00 44.77  ? 113 ILE B C   1 
ATOM   2892 O O   . ILE B 1 101 ? -13.742 11.061  -61.548 1.00 42.88  ? 113 ILE B O   1 
ATOM   2893 C CB  . ILE B 1 101 ? -14.272 8.451   -63.608 1.00 45.81  ? 113 ILE B CB  1 
ATOM   2894 C CG1 . ILE B 1 101 ? -13.783 7.742   -62.322 1.00 44.91  ? 113 ILE B CG1 1 
ATOM   2895 C CG2 . ILE B 1 101 ? -13.235 8.395   -64.747 1.00 47.41  ? 113 ILE B CG2 1 
ATOM   2896 C CD1 . ILE B 1 101 ? -14.831 7.705   -61.201 1.00 39.21  ? 113 ILE B CD1 1 
ATOM   2897 N N   . THR B 1 102 ? -12.943 11.440  -63.638 1.00 42.52  ? 114 THR B N   1 
ATOM   2898 C CA  . THR B 1 102 ? -11.887 12.379  -63.264 1.00 41.20  ? 114 THR B CA  1 
ATOM   2899 C C   . THR B 1 102 ? -12.503 13.639  -62.593 1.00 41.02  ? 114 THR B C   1 
ATOM   2900 O O   . THR B 1 102 ? -12.060 14.013  -61.504 1.00 39.44  ? 114 THR B O   1 
ATOM   2901 C CB  . THR B 1 102 ? -10.989 12.668  -64.461 1.00 52.84  ? 114 THR B CB  1 
ATOM   2902 O OG1 . THR B 1 102 ? -9.849  13.385  -64.011 1.00 57.53  ? 114 THR B OG1 1 
ATOM   2903 C CG2 . THR B 1 102 ? -11.671 13.446  -65.532 1.00 53.05  ? 114 THR B CG2 1 
ATOM   2904 N N   . GLN B 1 103 ? -13.559 14.219  -63.193 1.00 37.17  ? 115 GLN B N   1 
ATOM   2905 C CA  . GLN B 1 103 ? -14.327 15.351  -62.644 1.00 36.07  ? 115 GLN B CA  1 
ATOM   2906 C C   . GLN B 1 103 ? -14.903 15.006  -61.243 1.00 40.96  ? 115 GLN B C   1 
ATOM   2907 O O   . GLN B 1 103 ? -14.807 15.830  -60.332 1.00 40.66  ? 115 GLN B O   1 
ATOM   2908 C CB  . GLN B 1 103 ? -15.440 15.757  -63.631 1.00 37.57  ? 115 GLN B CB  1 
ATOM   2909 C CG  . GLN B 1 103 ? -16.408 16.828  -63.121 1.00 52.90  ? 115 GLN B CG  1 
ATOM   2910 C CD  . GLN B 1 103 ? -17.815 16.633  -63.667 1.00 71.01  ? 115 GLN B CD  1 
ATOM   2911 O OE1 . GLN B 1 103 ? -18.715 16.102  -62.987 1.00 60.44  ? 115 GLN B OE1 1 
ATOM   2912 N NE2 . GLN B 1 103 ? -18.034 17.049  -64.910 1.00 59.09  ? 115 GLN B NE2 1 
ATOM   2913 N N   . HIS B 1 104 ? -15.455 13.780  -61.072 1.00 37.60  ? 116 HIS B N   1 
ATOM   2914 C CA  . HIS B 1 104 ? -16.000 13.263  -59.815 1.00 36.58  ? 116 HIS B CA  1 
ATOM   2915 C C   . HIS B 1 104 ? -14.907 13.090  -58.743 1.00 41.02  ? 116 HIS B C   1 
ATOM   2916 O O   . HIS B 1 104 ? -15.083 13.550  -57.610 1.00 40.06  ? 116 HIS B O   1 
ATOM   2917 C CB  . HIS B 1 104 ? -16.715 11.926  -60.061 1.00 38.15  ? 116 HIS B CB  1 
ATOM   2918 C CG  . HIS B 1 104 ? -17.344 11.333  -58.838 1.00 41.13  ? 116 HIS B CG  1 
ATOM   2919 N ND1 . HIS B 1 104 ? -18.273 12.037  -58.086 1.00 41.89  ? 116 HIS B ND1 1 
ATOM   2920 C CD2 . HIS B 1 104 ? -17.163 10.115  -58.279 1.00 43.13  ? 116 HIS B CD2 1 
ATOM   2921 C CE1 . HIS B 1 104 ? -18.625 11.230  -57.101 1.00 41.54  ? 116 HIS B CE1 1 
ATOM   2922 N NE2 . HIS B 1 104 ? -17.981 10.065  -57.173 1.00 42.78  ? 116 HIS B NE2 1 
ATOM   2923 N N   . LEU B 1 105 ? -13.784 12.436  -59.107 1.00 38.10  ? 117 LEU B N   1 
ATOM   2924 C CA  . LEU B 1 105 ? -12.657 12.181  -58.205 1.00 37.19  ? 117 LEU B CA  1 
ATOM   2925 C C   . LEU B 1 105 ? -12.022 13.483  -57.721 1.00 39.48  ? 117 LEU B C   1 
ATOM   2926 O O   . LEU B 1 105 ? -11.721 13.597  -56.524 1.00 39.04  ? 117 LEU B O   1 
ATOM   2927 C CB  . LEU B 1 105 ? -11.590 11.285  -58.865 1.00 38.05  ? 117 LEU B CB  1 
ATOM   2928 C CG  . LEU B 1 105 ? -11.981 9.815   -59.115 1.00 43.87  ? 117 LEU B CG  1 
ATOM   2929 C CD1 . LEU B 1 105 ? -10.962 9.122   -60.019 1.00 45.20  ? 117 LEU B CD1 1 
ATOM   2930 C CD2 . LEU B 1 105 ? -12.169 9.042   -57.818 1.00 45.68  ? 117 LEU B CD2 1 
ATOM   2931 N N   . PHE B 1 106 ? -11.841 14.469  -58.631 1.00 34.33  ? 118 PHE B N   1 
ATOM   2932 C CA  . PHE B 1 106 ? -11.324 15.783  -58.242 1.00 32.63  ? 118 PHE B CA  1 
ATOM   2933 C C   . PHE B 1 106 ? -12.314 16.515  -57.339 1.00 36.11  ? 118 PHE B C   1 
ATOM   2934 O O   . PHE B 1 106 ? -11.907 17.073  -56.318 1.00 36.61  ? 118 PHE B O   1 
ATOM   2935 C CB  . PHE B 1 106 ? -10.977 16.637  -59.460 1.00 33.86  ? 118 PHE B CB  1 
ATOM   2936 C CG  . PHE B 1 106 ? -9.541  16.473  -59.887 1.00 36.10  ? 118 PHE B CG  1 
ATOM   2937 C CD1 . PHE B 1 106 ? -8.514  17.124  -59.201 1.00 39.00  ? 118 PHE B CD1 1 
ATOM   2938 C CD2 . PHE B 1 106 ? -9.209  15.673  -60.977 1.00 38.91  ? 118 PHE B CD2 1 
ATOM   2939 C CE1 . PHE B 1 106 ? -7.181  16.972  -59.599 1.00 40.97  ? 118 PHE B CE1 1 
ATOM   2940 C CE2 . PHE B 1 106 ? -7.876  15.530  -61.382 1.00 42.94  ? 118 PHE B CE2 1 
ATOM   2941 C CZ  . PHE B 1 106 ? -6.873  16.178  -60.689 1.00 41.12  ? 118 PHE B CZ  1 
ATOM   2942 N N   . PHE B 1 107 ? -13.612 16.477  -57.689 1.00 30.19  ? 119 PHE B N   1 
ATOM   2943 C CA  . PHE B 1 107 ? -14.649 17.135  -56.907 1.00 27.63  ? 119 PHE B CA  1 
ATOM   2944 C C   . PHE B 1 107 ? -14.592 16.690  -55.437 1.00 33.58  ? 119 PHE B C   1 
ATOM   2945 O O   . PHE B 1 107 ? -14.593 17.547  -54.555 1.00 32.53  ? 119 PHE B O   1 
ATOM   2946 C CB  . PHE B 1 107 ? -16.044 16.874  -57.508 1.00 27.77  ? 119 PHE B CB  1 
ATOM   2947 C CG  . PHE B 1 107 ? -17.198 17.224  -56.591 1.00 26.24  ? 119 PHE B CG  1 
ATOM   2948 C CD1 . PHE B 1 107 ? -17.517 18.550  -56.322 1.00 25.37  ? 119 PHE B CD1 1 
ATOM   2949 C CD2 . PHE B 1 107 ? -17.946 16.225  -55.980 1.00 27.36  ? 119 PHE B CD2 1 
ATOM   2950 C CE1 . PHE B 1 107 ? -18.579 18.867  -55.488 1.00 25.80  ? 119 PHE B CE1 1 
ATOM   2951 C CE2 . PHE B 1 107 ? -19.014 16.547  -55.140 1.00 29.76  ? 119 PHE B CE2 1 
ATOM   2952 C CZ  . PHE B 1 107 ? -19.328 17.864  -54.905 1.00 26.73  ? 119 PHE B CZ  1 
ATOM   2953 N N   . LEU B 1 108 ? -14.531 15.368  -55.185 1.00 32.35  ? 120 LEU B N   1 
ATOM   2954 C CA  . LEU B 1 108 ? -14.569 14.824  -53.831 1.00 33.12  ? 120 LEU B CA  1 
ATOM   2955 C C   . LEU B 1 108 ? -13.295 15.164  -53.044 1.00 38.15  ? 120 LEU B C   1 
ATOM   2956 O O   . LEU B 1 108 ? -13.378 15.474  -51.853 1.00 37.10  ? 120 LEU B O   1 
ATOM   2957 C CB  . LEU B 1 108 ? -14.786 13.307  -53.859 1.00 34.45  ? 120 LEU B CB  1 
ATOM   2958 C CG  . LEU B 1 108 ? -16.153 12.783  -54.349 1.00 39.28  ? 120 LEU B CG  1 
ATOM   2959 C CD1 . LEU B 1 108 ? -16.146 11.268  -54.455 1.00 40.37  ? 120 LEU B CD1 1 
ATOM   2960 C CD2 . LEU B 1 108 ? -17.294 13.226  -53.440 1.00 40.02  ? 120 LEU B CD2 1 
ATOM   2961 N N   . GLN B 1 109 ? -12.132 15.129  -53.712 1.00 36.00  ? 121 GLN B N   1 
ATOM   2962 C CA  . GLN B 1 109 ? -10.851 15.422  -53.080 1.00 36.28  ? 121 GLN B CA  1 
ATOM   2963 C C   . GLN B 1 109 ? -10.752 16.907  -52.711 1.00 40.93  ? 121 GLN B C   1 
ATOM   2964 O O   . GLN B 1 109 ? -10.320 17.223  -51.600 1.00 41.53  ? 121 GLN B O   1 
ATOM   2965 C CB  . GLN B 1 109 ? -9.695  15.023  -54.000 1.00 38.11  ? 121 GLN B CB  1 
ATOM   2966 C CG  . GLN B 1 109 ? -8.359  14.905  -53.275 1.00 41.40  ? 121 GLN B CG  1 
ATOM   2967 C CD  . GLN B 1 109 ? -7.264  14.431  -54.194 1.00 54.50  ? 121 GLN B CD  1 
ATOM   2968 O OE1 . GLN B 1 109 ? -7.395  13.422  -54.903 1.00 50.32  ? 121 GLN B OE1 1 
ATOM   2969 N NE2 . GLN B 1 109 ? -6.144  15.129  -54.176 1.00 45.59  ? 121 GLN B NE2 1 
ATOM   2970 N N   . VAL B 1 110 ? -11.155 17.808  -53.636 1.00 36.17  ? 122 VAL B N   1 
ATOM   2971 C CA  . VAL B 1 110 ? -11.132 19.264  -53.431 1.00 35.10  ? 122 VAL B CA  1 
ATOM   2972 C C   . VAL B 1 110 ? -12.174 19.664  -52.359 1.00 37.47  ? 122 VAL B C   1 
ATOM   2973 O O   . VAL B 1 110 ? -11.865 20.488  -51.491 1.00 37.40  ? 122 VAL B O   1 
ATOM   2974 C CB  . VAL B 1 110 ? -11.325 20.042  -54.760 1.00 39.13  ? 122 VAL B CB  1 
ATOM   2975 C CG1 . VAL B 1 110 ? -11.511 21.536  -54.517 1.00 38.50  ? 122 VAL B CG1 1 
ATOM   2976 C CG2 . VAL B 1 110 ? -10.155 19.806  -55.704 1.00 39.33  ? 122 VAL B CG2 1 
ATOM   2977 N N   . LYS B 1 111 ? -13.384 19.066  -52.404 1.00 32.35  ? 123 LYS B N   1 
ATOM   2978 C CA  . LYS B 1 111 ? -14.442 19.331  -51.421 1.00 31.06  ? 123 LYS B CA  1 
ATOM   2979 C C   . LYS B 1 111 ? -13.962 19.002  -49.997 1.00 36.43  ? 123 LYS B C   1 
ATOM   2980 O O   . LYS B 1 111 ? -14.203 19.799  -49.092 1.00 36.43  ? 123 LYS B O   1 
ATOM   2981 C CB  . LYS B 1 111 ? -15.727 18.560  -51.765 1.00 32.06  ? 123 LYS B CB  1 
ATOM   2982 C CG  . LYS B 1 111 ? -16.900 18.819  -50.819 1.00 24.53  ? 123 LYS B CG  1 
ATOM   2983 C CD  . LYS B 1 111 ? -18.232 18.329  -51.376 1.00 23.29  ? 123 LYS B CD  1 
ATOM   2984 C CE  . LYS B 1 111 ? -18.387 16.822  -51.399 1.00 34.78  ? 123 LYS B CE  1 
ATOM   2985 N NZ  . LYS B 1 111 ? -18.490 16.251  -50.041 1.00 55.25  ? 123 LYS B NZ  1 
ATOM   2986 N N   . LYS B 1 112 ? -13.268 17.856  -49.805 1.00 34.10  ? 124 LYS B N   1 
ATOM   2987 C CA  . LYS B 1 112 ? -12.724 17.483  -48.495 1.00 34.73  ? 124 LYS B CA  1 
ATOM   2988 C C   . LYS B 1 112 ? -11.750 18.552  -47.992 1.00 36.99  ? 124 LYS B C   1 
ATOM   2989 O O   . LYS B 1 112 ? -11.813 18.903  -46.821 1.00 37.18  ? 124 LYS B O   1 
ATOM   2990 C CB  . LYS B 1 112 ? -12.036 16.106  -48.520 1.00 38.46  ? 124 LYS B CB  1 
ATOM   2991 C CG  . LYS B 1 112 ? -11.991 15.446  -47.151 1.00 48.35  ? 124 LYS B CG  1 
ATOM   2992 C CD  . LYS B 1 112 ? -10.743 14.601  -47.009 1.00 61.17  ? 124 LYS B CD  1 
ATOM   2993 C CE  . LYS B 1 112 ? -10.707 13.815  -45.722 1.00 72.44  ? 124 LYS B CE  1 
ATOM   2994 N NZ  . LYS B 1 112 ? -9.501  12.945  -45.667 1.00 79.74  ? 124 LYS B NZ  1 
ATOM   2995 N N   . GLN B 1 113 ? -10.900 19.093  -48.880 1.00 31.31  ? 125 GLN B N   1 
ATOM   2996 C CA  . GLN B 1 113 ? -9.929  20.137  -48.554 1.00 30.79  ? 125 GLN B CA  1 
ATOM   2997 C C   . GLN B 1 113 ? -10.613 21.471  -48.195 1.00 36.60  ? 125 GLN B C   1 
ATOM   2998 O O   . GLN B 1 113 ? -10.093 22.221  -47.366 1.00 36.66  ? 125 GLN B O   1 
ATOM   2999 C CB  . GLN B 1 113 ? -8.960  20.339  -49.723 1.00 31.60  ? 125 GLN B CB  1 
ATOM   3000 C CG  . GLN B 1 113 ? -7.946  19.205  -49.873 1.00 49.80  ? 125 GLN B CG  1 
ATOM   3001 C CD  . GLN B 1 113 ? -7.344  19.076  -51.260 1.00 71.83  ? 125 GLN B CD  1 
ATOM   3002 O OE1 . GLN B 1 113 ? -7.416  19.975  -52.101 1.00 67.25  ? 125 GLN B OE1 1 
ATOM   3003 N NE2 . GLN B 1 113 ? -6.707  17.947  -51.525 1.00 71.55  ? 125 GLN B NE2 1 
ATOM   3004 N N   . ILE B 1 114 ? -11.774 21.765  -48.828 1.00 33.25  ? 126 ILE B N   1 
ATOM   3005 C CA  . ILE B 1 114 ? -12.576 22.956  -48.544 1.00 32.22  ? 126 ILE B CA  1 
ATOM   3006 C C   . ILE B 1 114 ? -13.201 22.815  -47.162 1.00 37.53  ? 126 ILE B C   1 
ATOM   3007 O O   . ILE B 1 114 ? -13.066 23.721  -46.339 1.00 38.82  ? 126 ILE B O   1 
ATOM   3008 C CB  . ILE B 1 114 ? -13.641 23.189  -49.659 1.00 34.31  ? 126 ILE B CB  1 
ATOM   3009 C CG1 . ILE B 1 114 ? -12.996 23.577  -51.021 1.00 32.44  ? 126 ILE B CG1 1 
ATOM   3010 C CG2 . ILE B 1 114 ? -14.781 24.165  -49.229 1.00 34.86  ? 126 ILE B CG2 1 
ATOM   3011 C CD1 . ILE B 1 114 ? -12.347 24.935  -51.105 1.00 25.57  ? 126 ILE B CD1 1 
ATOM   3012 N N   . LEU B 1 115 ? -13.855 21.677  -46.903 1.00 34.27  ? 127 LEU B N   1 
ATOM   3013 C CA  . LEU B 1 115 ? -14.561 21.439  -45.653 1.00 35.02  ? 127 LEU B CA  1 
ATOM   3014 C C   . LEU B 1 115 ? -13.598 21.324  -44.470 1.00 39.73  ? 127 LEU B C   1 
ATOM   3015 O O   . LEU B 1 115 ? -13.946 21.785  -43.388 1.00 39.73  ? 127 LEU B O   1 
ATOM   3016 C CB  . LEU B 1 115 ? -15.472 20.195  -45.753 1.00 35.97  ? 127 LEU B CB  1 
ATOM   3017 C CG  . LEU B 1 115 ? -16.605 20.252  -46.805 1.00 40.99  ? 127 LEU B CG  1 
ATOM   3018 C CD1 . LEU B 1 115 ? -17.426 18.990  -46.774 1.00 42.46  ? 127 LEU B CD1 1 
ATOM   3019 C CD2 . LEU B 1 115 ? -17.514 21.486  -46.637 1.00 42.68  ? 127 LEU B CD2 1 
ATOM   3020 N N   . ASP B 1 116 ? -12.390 20.738  -44.677 1.00 37.79  ? 128 ASP B N   1 
ATOM   3021 C CA  . ASP B 1 116 ? -11.320 20.596  -43.665 1.00 38.21  ? 128 ASP B CA  1 
ATOM   3022 C C   . ASP B 1 116 ? -10.596 21.910  -43.406 1.00 41.66  ? 128 ASP B C   1 
ATOM   3023 O O   . ASP B 1 116 ? -9.847  22.014  -42.435 1.00 43.91  ? 128 ASP B O   1 
ATOM   3024 C CB  . ASP B 1 116 ? -10.280 19.552  -44.114 1.00 40.78  ? 128 ASP B CB  1 
ATOM   3025 C CG  . ASP B 1 116 ? -10.713 18.096  -44.026 1.00 62.02  ? 128 ASP B CG  1 
ATOM   3026 O OD1 . ASP B 1 116 ? -11.860 17.834  -43.569 1.00 62.97  ? 128 ASP B OD1 1 
ATOM   3027 O OD2 . ASP B 1 116 ? -9.914  17.214  -44.432 1.00 72.43  ? 128 ASP B OD2 1 
ATOM   3028 N N   . GLU B 1 117 ? -10.788 22.898  -44.295 1.00 35.08  ? 129 GLU B N   1 
ATOM   3029 C CA  . GLU B 1 117 ? -10.159 24.222  -44.280 1.00 33.73  ? 129 GLU B CA  1 
ATOM   3030 C C   . GLU B 1 117 ? -8.647  24.122  -44.542 1.00 39.90  ? 129 GLU B C   1 
ATOM   3031 O O   . GLU B 1 117 ? -7.874  24.979  -44.092 1.00 40.71  ? 129 GLU B O   1 
ATOM   3032 C CB  . GLU B 1 117 ? -10.456 24.989  -42.984 1.00 34.53  ? 129 GLU B CB  1 
ATOM   3033 C CG  . GLU B 1 117 ? -11.933 25.230  -42.780 1.00 35.06  ? 129 GLU B CG  1 
ATOM   3034 C CD  . GLU B 1 117 ? -12.296 25.702  -41.401 1.00 36.74  ? 129 GLU B CD  1 
ATOM   3035 O OE1 . GLU B 1 117 ? -12.083 26.898  -41.113 1.00 39.61  ? 129 GLU B OE1 1 
ATOM   3036 O OE2 . GLU B 1 117 ? -12.773 24.874  -40.597 1.00 34.27  ? 129 GLU B OE2 1 
ATOM   3037 N N   . LYS B 1 118 ? -8.238  23.082  -45.299 1.00 36.44  ? 130 LYS B N   1 
ATOM   3038 C CA  . LYS B 1 118 ? -6.884  22.949  -45.831 1.00 36.10  ? 130 LYS B CA  1 
ATOM   3039 C C   . LYS B 1 118 ? -6.660  23.990  -46.923 1.00 40.87  ? 130 LYS B C   1 
ATOM   3040 O O   . LYS B 1 118 ? -5.560  24.527  -47.012 1.00 42.02  ? 130 LYS B O   1 
ATOM   3041 C CB  . LYS B 1 118 ? -6.632  21.524  -46.331 1.00 38.05  ? 130 LYS B CB  1 
ATOM   3042 C CG  . LYS B 1 118 ? -6.319  20.576  -45.182 1.00 60.59  ? 130 LYS B CG  1 
ATOM   3043 C CD  . LYS B 1 118 ? -6.447  19.117  -45.564 1.00 82.67  ? 130 LYS B CD  1 
ATOM   3044 C CE  . LYS B 1 118 ? -6.186  18.218  -44.375 1.00 102.48 ? 130 LYS B CE  1 
ATOM   3045 N NZ  . LYS B 1 118 ? -6.408  16.784  -44.705 1.00 118.84 ? 130 LYS B NZ  1 
ATOM   3046 N N   . ILE B 1 119 ? -7.704  24.267  -47.745 1.00 36.60  ? 131 ILE B N   1 
ATOM   3047 C CA  . ILE B 1 119 ? -7.784  25.384  -48.696 1.00 35.79  ? 131 ILE B CA  1 
ATOM   3048 C C   . ILE B 1 119 ? -8.582  26.500  -48.014 1.00 39.37  ? 131 ILE B C   1 
ATOM   3049 O O   . ILE B 1 119 ? -9.759  26.283  -47.708 1.00 40.68  ? 131 ILE B O   1 
ATOM   3050 C CB  . ILE B 1 119 ? -8.454  24.966  -50.060 1.00 38.67  ? 131 ILE B CB  1 
ATOM   3051 C CG1 . ILE B 1 119 ? -7.713  23.814  -50.774 1.00 39.67  ? 131 ILE B CG1 1 
ATOM   3052 C CG2 . ILE B 1 119 ? -8.638  26.167  -50.995 1.00 39.30  ? 131 ILE B CG2 1 
ATOM   3053 C CD1 . ILE B 1 119 ? -8.486  23.189  -52.025 1.00 42.35  ? 131 ILE B CD1 1 
ATOM   3054 N N   . TYR B 1 120 ? -7.970  27.681  -47.776 1.00 33.18  ? 132 TYR B N   1 
ATOM   3055 C CA  . TYR B 1 120 ? -8.735  28.832  -47.298 1.00 32.00  ? 132 TYR B CA  1 
ATOM   3056 C C   . TYR B 1 120 ? -9.803  29.225  -48.335 1.00 37.88  ? 132 TYR B C   1 
ATOM   3057 O O   . TYR B 1 120 ? -9.534  29.256  -49.542 1.00 37.56  ? 132 TYR B O   1 
ATOM   3058 C CB  . TYR B 1 120 ? -7.840  30.043  -46.948 1.00 31.66  ? 132 TYR B CB  1 
ATOM   3059 C CG  . TYR B 1 120 ? -8.632  31.321  -46.746 1.00 31.23  ? 132 TYR B CG  1 
ATOM   3060 C CD1 . TYR B 1 120 ? -9.351  31.541  -45.574 1.00 33.23  ? 132 TYR B CD1 1 
ATOM   3061 C CD2 . TYR B 1 120 ? -8.741  32.267  -47.765 1.00 31.29  ? 132 TYR B CD2 1 
ATOM   3062 C CE1 . TYR B 1 120 ? -10.148 32.677  -45.414 1.00 34.43  ? 132 TYR B CE1 1 
ATOM   3063 C CE2 . TYR B 1 120 ? -9.524  33.413  -47.610 1.00 32.25  ? 132 TYR B CE2 1 
ATOM   3064 C CZ  . TYR B 1 120 ? -10.224 33.614  -46.432 1.00 41.03  ? 132 TYR B CZ  1 
ATOM   3065 O OH  . TYR B 1 120 ? -10.993 34.743  -46.278 1.00 43.28  ? 132 TYR B OH  1 
ATOM   3066 N N   . CYS B 1 121 ? -11.003 29.550  -47.834 1.00 34.89  ? 133 CYS B N   1 
ATOM   3067 C CA  . CYS B 1 121 ? -12.148 29.919  -48.646 1.00 35.06  ? 133 CYS B CA  1 
ATOM   3068 C C   . CYS B 1 121 ? -12.854 31.124  -48.003 1.00 37.37  ? 133 CYS B C   1 
ATOM   3069 O O   . CYS B 1 121 ? -13.172 31.067  -46.811 1.00 36.10  ? 133 CYS B O   1 
ATOM   3070 C CB  . CYS B 1 121 ? -13.079 28.716  -48.783 1.00 36.39  ? 133 CYS B CB  1 
ATOM   3071 S SG  . CYS B 1 121 ? -14.372 28.927  -50.015 1.00 41.40  ? 133 CYS B SG  1 
ATOM   3072 N N   . PRO B 1 122 ? -13.090 32.244  -48.743 1.00 34.53  ? 134 PRO B N   1 
ATOM   3073 C CA  . PRO B 1 122 ? -13.840 33.380  -48.150 1.00 33.82  ? 134 PRO B CA  1 
ATOM   3074 C C   . PRO B 1 122 ? -15.327 33.047  -47.957 1.00 38.18  ? 134 PRO B C   1 
ATOM   3075 O O   . PRO B 1 122 ? -15.801 32.084  -48.573 1.00 38.32  ? 134 PRO B O   1 
ATOM   3076 C CB  . PRO B 1 122 ? -13.652 34.515  -49.167 1.00 35.24  ? 134 PRO B CB  1 
ATOM   3077 C CG  . PRO B 1 122 ? -12.691 34.019  -50.172 1.00 39.39  ? 134 PRO B CG  1 
ATOM   3078 C CD  . PRO B 1 122 ? -12.715 32.531  -50.142 1.00 35.44  ? 134 PRO B CD  1 
ATOM   3079 N N   . PRO B 1 123 ? -16.088 33.799  -47.117 1.00 34.88  ? 135 PRO B N   1 
ATOM   3080 C CA  . PRO B 1 123 ? -17.482 33.391  -46.813 1.00 34.69  ? 135 PRO B CA  1 
ATOM   3081 C C   . PRO B 1 123 ? -18.421 33.248  -48.021 1.00 39.23  ? 135 PRO B C   1 
ATOM   3082 O O   . PRO B 1 123 ? -19.186 32.280  -48.043 1.00 39.24  ? 135 PRO B O   1 
ATOM   3083 C CB  . PRO B 1 123 ? -17.974 34.490  -45.876 1.00 37.18  ? 135 PRO B CB  1 
ATOM   3084 C CG  . PRO B 1 123 ? -16.729 35.043  -45.266 1.00 41.09  ? 135 PRO B CG  1 
ATOM   3085 C CD  . PRO B 1 123 ? -15.709 35.001  -46.347 1.00 36.24  ? 135 PRO B CD  1 
ATOM   3086 N N   . GLU B 1 124 ? -18.371 34.166  -49.021 1.00 36.29  ? 136 GLU B N   1 
ATOM   3087 C CA  . GLU B 1 124 ? -19.281 34.076  -50.177 1.00 36.59  ? 136 GLU B CA  1 
ATOM   3088 C C   . GLU B 1 124 ? -18.981 32.833  -51.021 1.00 40.35  ? 136 GLU B C   1 
ATOM   3089 O O   . GLU B 1 124 ? -19.915 32.116  -51.407 1.00 40.42  ? 136 GLU B O   1 
ATOM   3090 C CB  . GLU B 1 124 ? -19.226 35.337  -51.039 1.00 38.88  ? 136 GLU B CB  1 
ATOM   3091 C CG  . GLU B 1 124 ? -20.216 35.339  -52.195 1.00 44.48  ? 136 GLU B CG  1 
ATOM   3092 C CD  . GLU B 1 124 ? -20.227 36.581  -53.065 1.00 61.37  ? 136 GLU B CD  1 
ATOM   3093 O OE1 . GLU B 1 124 ? -19.634 37.612  -52.665 1.00 55.32  ? 136 GLU B OE1 1 
ATOM   3094 O OE2 . GLU B 1 124 ? -20.841 36.520  -54.154 1.00 47.85  ? 136 GLU B OE2 1 
ATOM   3095 N N   . ALA B 1 125 ? -17.687 32.576  -51.300 1.00 35.83  ? 137 ALA B N   1 
ATOM   3096 C CA  . ALA B 1 125 ? -17.261 31.386  -52.046 1.00 34.94  ? 137 ALA B CA  1 
ATOM   3097 C C   . ALA B 1 125 ? -17.664 30.108  -51.313 1.00 37.35  ? 137 ALA B C   1 
ATOM   3098 O O   . ALA B 1 125 ? -18.085 29.152  -51.973 1.00 37.20  ? 137 ALA B O   1 
ATOM   3099 C CB  . ALA B 1 125 ? -15.757 31.409  -52.276 1.00 35.47  ? 137 ALA B CB  1 
ATOM   3100 N N   . SER B 1 126 ? -17.562 30.105  -49.953 1.00 32.08  ? 138 SER B N   1 
ATOM   3101 C CA  . SER B 1 126 ? -17.998 29.009  -49.081 1.00 31.13  ? 138 SER B CA  1 
ATOM   3102 C C   . SER B 1 126 ? -19.472 28.634  -49.302 1.00 35.72  ? 138 SER B C   1 
ATOM   3103 O O   . SER B 1 126 ? -19.771 27.454  -49.536 1.00 35.79  ? 138 SER B O   1 
ATOM   3104 C CB  . SER B 1 126 ? -17.778 29.373  -47.623 1.00 34.80  ? 138 SER B CB  1 
ATOM   3105 O OG  . SER B 1 126 ? -16.400 29.485  -47.301 1.00 46.66  ? 138 SER B OG  1 
ATOM   3106 N N   . VAL B 1 127 ? -20.386 29.624  -49.288 1.00 32.53  ? 139 VAL B N   1 
ATOM   3107 C CA  . VAL B 1 127 ? -21.823 29.327  -49.434 1.00 32.84  ? 139 VAL B CA  1 
ATOM   3108 C C   . VAL B 1 127 ? -22.134 28.929  -50.886 1.00 35.84  ? 139 VAL B C   1 
ATOM   3109 O O   . VAL B 1 127 ? -23.027 28.108  -51.101 1.00 36.71  ? 139 VAL B O   1 
ATOM   3110 C CB  . VAL B 1 127 ? -22.787 30.433  -48.907 1.00 36.91  ? 139 VAL B CB  1 
ATOM   3111 C CG1 . VAL B 1 127 ? -22.536 30.735  -47.437 1.00 36.44  ? 139 VAL B CG1 1 
ATOM   3112 C CG2 . VAL B 1 127 ? -22.694 31.704  -49.731 1.00 37.12  ? 139 VAL B CG2 1 
ATOM   3113 N N   . LEU B 1 128 ? -21.391 29.476  -51.875 1.00 31.45  ? 140 LEU B N   1 
ATOM   3114 C CA  . LEU B 1 128 ? -21.567 29.075  -53.278 1.00 30.54  ? 140 LEU B CA  1 
ATOM   3115 C C   . LEU B 1 128 ? -21.094 27.669  -53.524 1.00 33.84  ? 140 LEU B C   1 
ATOM   3116 O O   . LEU B 1 128 ? -21.803 26.910  -54.176 1.00 35.39  ? 140 LEU B O   1 
ATOM   3117 C CB  . LEU B 1 128 ? -20.871 30.028  -54.230 1.00 30.44  ? 140 LEU B CB  1 
ATOM   3118 C CG  . LEU B 1 128 ? -21.744 31.171  -54.662 1.00 36.00  ? 140 LEU B CG  1 
ATOM   3119 C CD1 . LEU B 1 128 ? -20.923 32.268  -55.248 1.00 36.34  ? 140 LEU B CD1 1 
ATOM   3120 C CD2 . LEU B 1 128 ? -22.819 30.700  -55.610 1.00 39.11  ? 140 LEU B CD2 1 
ATOM   3121 N N   . LEU B 1 129 ? -19.922 27.296  -52.984 1.00 28.52  ? 141 LEU B N   1 
ATOM   3122 C CA  . LEU B 1 129 ? -19.442 25.923  -53.071 1.00 27.41  ? 141 LEU B CA  1 
ATOM   3123 C C   . LEU B 1 129 ? -20.420 24.949  -52.402 1.00 33.01  ? 141 LEU B C   1 
ATOM   3124 O O   . LEU B 1 129 ? -20.774 23.933  -53.004 1.00 33.40  ? 141 LEU B O   1 
ATOM   3125 C CB  . LEU B 1 129 ? -18.053 25.812  -52.458 1.00 26.59  ? 141 LEU B CB  1 
ATOM   3126 C CG  . LEU B 1 129 ? -16.907 26.396  -53.299 1.00 29.42  ? 141 LEU B CG  1 
ATOM   3127 C CD1 . LEU B 1 129 ? -15.635 26.484  -52.491 1.00 27.02  ? 141 LEU B CD1 1 
ATOM   3128 C CD2 . LEU B 1 129 ? -16.705 25.603  -54.580 1.00 29.27  ? 141 LEU B CD2 1 
ATOM   3129 N N   . ALA B 1 130 ? -20.925 25.302  -51.202 1.00 29.78  ? 142 ALA B N   1 
ATOM   3130 C CA  . ALA B 1 130 ? -21.851 24.465  -50.444 1.00 29.33  ? 142 ALA B CA  1 
ATOM   3131 C C   . ALA B 1 130 ? -23.115 24.186  -51.238 1.00 34.81  ? 142 ALA B C   1 
ATOM   3132 O O   . ALA B 1 130 ? -23.613 23.060  -51.174 1.00 35.75  ? 142 ALA B O   1 
ATOM   3133 C CB  . ALA B 1 130 ? -22.196 25.121  -49.128 1.00 30.26  ? 142 ALA B CB  1 
ATOM   3134 N N   . SER B 1 131 ? -23.614 25.184  -52.014 1.00 30.74  ? 143 SER B N   1 
ATOM   3135 C CA  . SER B 1 131 ? -24.847 25.063  -52.816 1.00 30.79  ? 143 SER B CA  1 
ATOM   3136 C C   . SER B 1 131 ? -24.684 24.081  -53.958 1.00 35.16  ? 143 SER B C   1 
ATOM   3137 O O   . SER B 1 131 ? -25.601 23.308  -54.234 1.00 36.26  ? 143 SER B O   1 
ATOM   3138 C CB  . SER B 1 131 ? -25.292 26.418  -53.359 1.00 32.98  ? 143 SER B CB  1 
ATOM   3139 O OG  . SER B 1 131 ? -24.412 26.947  -54.335 1.00 36.42  ? 143 SER B OG  1 
ATOM   3140 N N   . TYR B 1 132 ? -23.515 24.096  -54.624 1.00 31.20  ? 144 TYR B N   1 
ATOM   3141 C CA  . TYR B 1 132 ? -23.228 23.157  -55.710 1.00 30.34  ? 144 TYR B CA  1 
ATOM   3142 C C   . TYR B 1 132 ? -23.027 21.746  -55.184 1.00 35.42  ? 144 TYR B C   1 
ATOM   3143 O O   . TYR B 1 132 ? -23.460 20.797  -55.835 1.00 36.50  ? 144 TYR B O   1 
ATOM   3144 C CB  . TYR B 1 132 ? -22.029 23.626  -56.538 1.00 29.92  ? 144 TYR B CB  1 
ATOM   3145 C CG  . TYR B 1 132 ? -22.393 24.778  -57.454 1.00 30.68  ? 144 TYR B CG  1 
ATOM   3146 C CD1 . TYR B 1 132 ? -23.350 24.622  -58.458 1.00 32.73  ? 144 TYR B CD1 1 
ATOM   3147 C CD2 . TYR B 1 132 ? -21.821 26.042  -57.284 1.00 30.40  ? 144 TYR B CD2 1 
ATOM   3148 C CE1 . TYR B 1 132 ? -23.731 25.691  -59.267 1.00 33.08  ? 144 TYR B CE1 1 
ATOM   3149 C CE2 . TYR B 1 132 ? -22.203 27.121  -58.085 1.00 32.03  ? 144 TYR B CE2 1 
ATOM   3150 C CZ  . TYR B 1 132 ? -23.151 26.936  -59.080 1.00 39.88  ? 144 TYR B CZ  1 
ATOM   3151 O OH  . TYR B 1 132 ? -23.509 27.989  -59.883 1.00 42.69  ? 144 TYR B OH  1 
ATOM   3152 N N   . ALA B 1 133 ? -22.400 21.604  -53.996 1.00 31.75  ? 145 ALA B N   1 
ATOM   3153 C CA  . ALA B 1 133 ? -22.257 20.317  -53.314 1.00 31.44  ? 145 ALA B CA  1 
ATOM   3154 C C   . ALA B 1 133 ? -23.639 19.699  -53.001 1.00 36.33  ? 145 ALA B C   1 
ATOM   3155 O O   . ALA B 1 133 ? -23.822 18.492  -53.216 1.00 36.43  ? 145 ALA B O   1 
ATOM   3156 C CB  . ALA B 1 133 ? -21.451 20.486  -52.038 1.00 31.61  ? 145 ALA B CB  1 
ATOM   3157 N N   . VAL B 1 134 ? -24.616 20.529  -52.527 1.00 31.67  ? 146 VAL B N   1 
ATOM   3158 C CA  . VAL B 1 134 ? -26.000 20.085  -52.275 1.00 32.06  ? 146 VAL B CA  1 
ATOM   3159 C C   . VAL B 1 134 ? -26.584 19.509  -53.575 1.00 37.22  ? 146 VAL B C   1 
ATOM   3160 O O   . VAL B 1 134 ? -27.114 18.401  -53.553 1.00 37.51  ? 146 VAL B O   1 
ATOM   3161 C CB  . VAL B 1 134 ? -26.922 21.188  -51.665 1.00 34.94  ? 146 VAL B CB  1 
ATOM   3162 C CG1 . VAL B 1 134 ? -28.379 20.741  -51.611 1.00 35.82  ? 146 VAL B CG1 1 
ATOM   3163 C CG2 . VAL B 1 134 ? -26.462 21.587  -50.282 1.00 34.10  ? 146 VAL B CG2 1 
ATOM   3164 N N   . GLN B 1 135 ? -26.460 20.249  -54.695 1.00 33.29  ? 147 GLN B N   1 
ATOM   3165 C CA  . GLN B 1 135 ? -26.982 19.856  -56.005 1.00 33.16  ? 147 GLN B CA  1 
ATOM   3166 C C   . GLN B 1 135 ? -26.286 18.597  -56.530 1.00 38.93  ? 147 GLN B C   1 
ATOM   3167 O O   . GLN B 1 135 ? -26.952 17.753  -57.135 1.00 39.23  ? 147 GLN B O   1 
ATOM   3168 C CB  . GLN B 1 135 ? -26.867 21.003  -57.008 1.00 33.65  ? 147 GLN B CB  1 
ATOM   3169 C CG  . GLN B 1 135 ? -27.915 22.079  -56.750 1.00 29.67  ? 147 GLN B CG  1 
ATOM   3170 C CD  . GLN B 1 135 ? -27.516 23.478  -57.140 1.00 42.64  ? 147 GLN B CD  1 
ATOM   3171 O OE1 . GLN B 1 135 ? -28.120 24.449  -56.694 1.00 36.42  ? 147 GLN B OE1 1 
ATOM   3172 N NE2 . GLN B 1 135 ? -26.517 23.628  -57.981 1.00 40.00  ? 147 GLN B NE2 1 
ATOM   3173 N N   . ALA B 1 136 ? -24.968 18.456  -56.287 1.00 36.80  ? 148 ALA B N   1 
ATOM   3174 C CA  . ALA B 1 136 ? -24.198 17.274  -56.671 1.00 37.49  ? 148 ALA B CA  1 
ATOM   3175 C C   . ALA B 1 136 ? -24.649 16.022  -55.885 1.00 45.52  ? 148 ALA B C   1 
ATOM   3176 O O   . ALA B 1 136 ? -24.615 14.925  -56.434 1.00 46.98  ? 148 ALA B O   1 
ATOM   3177 C CB  . ALA B 1 136 ? -22.711 17.528  -56.466 1.00 37.05  ? 148 ALA B CB  1 
ATOM   3178 N N   . LYS B 1 137 ? -25.077 16.194  -54.628 1.00 44.46  ? 149 LYS B N   1 
ATOM   3179 C CA  . LYS B 1 137 ? -25.539 15.133  -53.721 1.00 46.59  ? 149 LYS B CA  1 
ATOM   3180 C C   . LYS B 1 137 ? -26.936 14.589  -54.107 1.00 57.31  ? 149 LYS B C   1 
ATOM   3181 O O   . LYS B 1 137 ? -27.164 13.394  -53.964 1.00 58.49  ? 149 LYS B O   1 
ATOM   3182 C CB  . LYS B 1 137 ? -25.561 15.664  -52.270 1.00 48.24  ? 149 LYS B CB  1 
ATOM   3183 C CG  . LYS B 1 137 ? -25.733 14.600  -51.194 1.00 57.26  ? 149 LYS B CG  1 
ATOM   3184 C CD  . LYS B 1 137 ? -25.796 15.199  -49.805 1.00 64.09  ? 149 LYS B CD  1 
ATOM   3185 C CE  . LYS B 1 137 ? -26.129 14.162  -48.760 1.00 77.68  ? 149 LYS B CE  1 
ATOM   3186 N NZ  . LYS B 1 137 ? -26.071 14.724  -47.387 1.00 91.27  ? 149 LYS B NZ  1 
ATOM   3187 N N   . TYR B 1 138 ? -27.853 15.447  -54.603 1.00 58.43  ? 150 TYR B N   1 
ATOM   3188 C CA  . TYR B 1 138 ? -29.257 15.083  -54.849 1.00 61.90  ? 150 TYR B CA  1 
ATOM   3189 C C   . TYR B 1 138 ? -29.648 15.227  -56.351 1.00 73.74  ? 150 TYR B C   1 
ATOM   3190 O O   . TYR B 1 138 ? -29.773 16.344  -56.870 1.00 73.97  ? 150 TYR B O   1 
ATOM   3191 C CB  . TYR B 1 138 ? -30.183 15.934  -53.957 1.00 62.78  ? 150 TYR B CB  1 
ATOM   3192 C CG  . TYR B 1 138 ? -29.957 15.751  -52.472 1.00 63.86  ? 150 TYR B CG  1 
ATOM   3193 C CD1 . TYR B 1 138 ? -30.320 14.570  -51.832 1.00 67.19  ? 150 TYR B CD1 1 
ATOM   3194 C CD2 . TYR B 1 138 ? -29.423 16.776  -51.696 1.00 63.44  ? 150 TYR B CD2 1 
ATOM   3195 C CE1 . TYR B 1 138 ? -30.142 14.405  -50.460 1.00 68.07  ? 150 TYR B CE1 1 
ATOM   3196 C CE2 . TYR B 1 138 ? -29.230 16.619  -50.323 1.00 64.40  ? 150 TYR B CE2 1 
ATOM   3197 C CZ  . TYR B 1 138 ? -29.594 15.432  -49.708 1.00 72.28  ? 150 TYR B CZ  1 
ATOM   3198 O OH  . TYR B 1 138 ? -29.426 15.276  -48.353 1.00 71.31  ? 150 TYR B OH  1 
ATOM   3199 N N   . GLY B 1 139 ? -29.799 14.090  -57.027 1.00 75.26  ? 151 GLY B N   1 
ATOM   3200 C CA  . GLY B 1 139 ? -30.086 14.026  -58.459 1.00 77.53  ? 151 GLY B CA  1 
ATOM   3201 C C   . GLY B 1 139 ? -31.396 14.653  -58.904 1.00 86.75  ? 151 GLY B C   1 
ATOM   3202 O O   . GLY B 1 139 ? -31.464 15.216  -60.002 1.00 86.99  ? 151 GLY B O   1 
ATOM   3203 N N   . ASP B 1 140 ? -32.453 14.567  -58.058 1.00 86.14  ? 152 ASP B N   1 
ATOM   3204 C CA  . ASP B 1 140 ? -33.795 15.032  -58.422 1.00 124.87 ? 152 ASP B CA  1 
ATOM   3205 C C   . ASP B 1 140 ? -34.416 15.927  -57.326 1.00 123.76 ? 152 ASP B C   1 
ATOM   3206 O O   . ASP B 1 140 ? -34.894 15.464  -56.289 1.00 74.12  ? 152 ASP B O   1 
ATOM   3207 C CB  . ASP B 1 140 ? -34.702 13.835  -58.742 1.00 128.91 ? 152 ASP B CB  1 
ATOM   3208 C CG  . ASP B 1 140 ? -34.042 12.827  -59.667 1.00 142.36 ? 152 ASP B CG  1 
ATOM   3209 O OD1 . ASP B 1 140 ? -34.120 13.014  -60.903 1.00 143.71 ? 152 ASP B OD1 1 
ATOM   3210 O OD2 . ASP B 1 140 ? -33.362 11.910  -59.154 1.00 148.47 ? 152 ASP B OD2 1 
ATOM   3211 N N   . GLN B 1 166 ? -48.592 -12.431 -61.083 1.00 124.89 ? 178 GLN B N   1 
ATOM   3212 C CA  . GLN B 1 166 ? -49.616 -12.255 -62.114 1.00 126.02 ? 178 GLN B CA  1 
ATOM   3213 C C   . GLN B 1 166 ? -49.237 -11.116 -63.070 1.00 126.84 ? 178 GLN B C   1 
ATOM   3214 O O   . GLN B 1 166 ? -48.560 -10.176 -62.652 1.00 123.13 ? 178 GLN B O   1 
ATOM   3215 C CB  . GLN B 1 166 ? -50.974 -11.964 -61.453 1.00 129.28 ? 178 GLN B CB  1 
ATOM   3216 C CG  . GLN B 1 166 ? -52.196 -12.066 -62.381 1.00 146.60 ? 178 GLN B CG  1 
ATOM   3217 C CD  . GLN B 1 166 ? -53.479 -11.620 -61.716 1.00 169.62 ? 178 GLN B CD  1 
ATOM   3218 O OE1 . GLN B 1 166 ? -53.645 -11.714 -60.494 1.00 168.36 ? 178 GLN B OE1 1 
ATOM   3219 N NE2 . GLN B 1 166 ? -54.429 -11.135 -62.506 1.00 163.94 ? 178 GLN B NE2 1 
ATOM   3220 N N   . MET B 1 167 ? -49.657 -11.218 -64.355 1.00 124.54 ? 179 MET B N   1 
ATOM   3221 C CA  . MET B 1 167 ? -49.557 -10.150 -65.356 1.00 122.17 ? 179 MET B CA  1 
ATOM   3222 C C   . MET B 1 167 ? -50.605 -10.328 -66.461 1.00 128.93 ? 179 MET B C   1 
ATOM   3223 O O   . MET B 1 167 ? -50.516 -11.262 -67.260 1.00 130.42 ? 179 MET B O   1 
ATOM   3224 C CB  . MET B 1 167 ? -48.153 -10.074 -65.974 1.00 121.80 ? 179 MET B CB  1 
ATOM   3225 C CG  . MET B 1 167 ? -47.933 -8.801  -66.776 1.00 122.69 ? 179 MET B CG  1 
ATOM   3226 S SD  . MET B 1 167 ? -46.506 -8.841  -67.878 1.00 124.87 ? 179 MET B SD  1 
ATOM   3227 C CE  . MET B 1 167 ? -45.233 -8.815  -66.728 1.00 119.07 ? 179 MET B CE  1 
ATOM   3228 N N   . THR B 1 168 ? -51.586 -9.419  -66.504 1.00 126.25 ? 180 THR B N   1 
ATOM   3229 C CA  . THR B 1 168 ? -52.605 -9.363  -67.560 1.00 128.59 ? 180 THR B CA  1 
ATOM   3230 C C   . THR B 1 168 ? -52.031 -8.583  -68.775 1.00 130.18 ? 180 THR B C   1 
ATOM   3231 O O   . THR B 1 168 ? -51.011 -7.906  -68.606 1.00 125.92 ? 180 THR B O   1 
ATOM   3232 C CB  . THR B 1 168 ? -53.907 -8.741  -67.010 1.00 139.33 ? 180 THR B CB  1 
ATOM   3233 O OG1 . THR B 1 168 ? -53.629 -7.437  -66.496 1.00 137.88 ? 180 THR B OG1 1 
ATOM   3234 C CG2 . THR B 1 168 ? -54.565 -9.603  -65.928 1.00 140.04 ? 180 THR B CG2 1 
ATOM   3235 N N   . PRO B 1 169 ? -52.616 -8.675  -70.005 1.00 128.86 ? 181 PRO B N   1 
ATOM   3236 C CA  . PRO B 1 169 ? -52.099 -7.862  -71.131 1.00 126.87 ? 181 PRO B CA  1 
ATOM   3237 C C   . PRO B 1 169 ? -52.099 -6.350  -70.865 1.00 128.73 ? 181 PRO B C   1 
ATOM   3238 O O   . PRO B 1 169 ? -51.229 -5.644  -71.379 1.00 125.45 ? 181 PRO B O   1 
ATOM   3239 C CB  . PRO B 1 169 ? -53.048 -8.212  -72.279 1.00 131.65 ? 181 PRO B CB  1 
ATOM   3240 C CG  . PRO B 1 169 ? -53.558 -9.562  -71.942 1.00 139.11 ? 181 PRO B CG  1 
ATOM   3241 C CD  . PRO B 1 169 ? -53.714 -9.556  -70.454 1.00 134.26 ? 181 PRO B CD  1 
ATOM   3242 N N   . GLU B 1 170 ? -53.070 -5.861  -70.065 1.00 126.99 ? 182 GLU B N   1 
ATOM   3243 C CA  . GLU B 1 170 ? -53.155 -4.466  -69.613 1.00 124.88 ? 182 GLU B CA  1 
ATOM   3244 C C   . GLU B 1 170 ? -52.015 -4.135  -68.634 1.00 125.01 ? 182 GLU B C   1 
ATOM   3245 O O   . GLU B 1 170 ? -51.453 -3.041  -68.715 1.00 121.84 ? 182 GLU B O   1 
ATOM   3246 C CB  . GLU B 1 170 ? -54.533 -4.128  -68.991 1.00 128.70 ? 182 GLU B CB  1 
ATOM   3247 C CG  . GLU B 1 170 ? -55.392 -5.312  -68.556 1.00 145.09 ? 182 GLU B CG  1 
ATOM   3248 C CD  . GLU B 1 170 ? -56.315 -5.887  -69.616 1.00 171.59 ? 182 GLU B CD  1 
ATOM   3249 O OE1 . GLU B 1 170 ? -57.429 -5.343  -69.791 1.00 168.10 ? 182 GLU B OE1 1 
ATOM   3250 O OE2 . GLU B 1 170 ? -55.942 -6.906  -70.242 1.00 165.38 ? 182 GLU B OE2 1 
ATOM   3251 N N   . MET B 1 171 ? -51.668 -5.077  -67.723 1.00 122.11 ? 183 MET B N   1 
ATOM   3252 C CA  . MET B 1 171 ? -50.523 -4.945  -66.807 1.00 119.34 ? 183 MET B CA  1 
ATOM   3253 C C   . MET B 1 171 ? -49.196 -4.934  -67.568 1.00 122.17 ? 183 MET B C   1 
ATOM   3254 O O   . MET B 1 171 ? -48.264 -4.250  -67.147 1.00 118.60 ? 183 MET B O   1 
ATOM   3255 C CB  . MET B 1 171 ? -50.510 -6.072  -65.763 1.00 123.12 ? 183 MET B CB  1 
ATOM   3256 C CG  . MET B 1 171 ? -51.445 -5.834  -64.603 1.00 127.87 ? 183 MET B CG  1 
ATOM   3257 S SD  . MET B 1 171 ? -51.837 -7.356  -63.704 1.00 135.10 ? 183 MET B SD  1 
ATOM   3258 C CE  . MET B 1 171 ? -50.550 -7.353  -62.492 1.00 128.96 ? 183 MET B CE  1 
ATOM   3259 N N   . TRP B 1 172 ? -49.109 -5.699  -68.677 1.00 121.63 ? 184 TRP B N   1 
ATOM   3260 C CA  . TRP B 1 172 ? -47.949 -5.716  -69.568 1.00 120.40 ? 184 TRP B CA  1 
ATOM   3261 C C   . TRP B 1 172 ? -47.744 -4.344  -70.209 1.00 121.49 ? 184 TRP B C   1 
ATOM   3262 O O   . TRP B 1 172 ? -46.612 -3.872  -70.272 1.00 118.74 ? 184 TRP B O   1 
ATOM   3263 C CB  . TRP B 1 172 ? -48.089 -6.812  -70.636 1.00 122.37 ? 184 TRP B CB  1 
ATOM   3264 C CG  . TRP B 1 172 ? -46.927 -6.889  -71.580 1.00 122.54 ? 184 TRP B CG  1 
ATOM   3265 C CD1 . TRP B 1 172 ? -45.689 -7.406  -71.319 1.00 124.19 ? 184 TRP B CD1 1 
ATOM   3266 C CD2 . TRP B 1 172 ? -46.909 -6.483  -72.950 1.00 122.82 ? 184 TRP B CD2 1 
ATOM   3267 N NE1 . TRP B 1 172 ? -44.885 -7.298  -72.429 1.00 123.12 ? 184 TRP B NE1 1 
ATOM   3268 C CE2 . TRP B 1 172 ? -45.610 -6.740  -73.449 1.00 125.66 ? 184 TRP B CE2 1 
ATOM   3269 C CE3 . TRP B 1 172 ? -47.850 -5.882  -73.797 1.00 125.57 ? 184 TRP B CE3 1 
ATOM   3270 C CZ2 . TRP B 1 172 ? -45.251 -6.473  -74.776 1.00 125.18 ? 184 TRP B CZ2 1 
ATOM   3271 C CZ3 . TRP B 1 172 ? -47.484 -5.589  -75.101 1.00 127.14 ? 184 TRP B CZ3 1 
ATOM   3272 C CH2 . TRP B 1 172 ? -46.206 -5.904  -75.587 1.00 126.59 ? 184 TRP B CH2 1 
ATOM   3273 N N   . GLU B 1 173 ? -48.835 -3.696  -70.654 1.00 118.53 ? 185 GLU B N   1 
ATOM   3274 C CA  . GLU B 1 173 ? -48.810 -2.359  -71.254 1.00 116.60 ? 185 GLU B CA  1 
ATOM   3275 C C   . GLU B 1 173 ? -48.354 -1.284  -70.243 1.00 117.11 ? 185 GLU B C   1 
ATOM   3276 O O   . GLU B 1 173 ? -47.554 -0.408  -70.592 1.00 113.48 ? 185 GLU B O   1 
ATOM   3277 C CB  . GLU B 1 173 ? -50.198 -2.015  -71.818 1.00 120.59 ? 185 GLU B CB  1 
ATOM   3278 C CG  . GLU B 1 173 ? -50.179 -1.532  -73.257 1.00 132.31 ? 185 GLU B CG  1 
ATOM   3279 C CD  . GLU B 1 173 ? -49.528 -2.471  -74.254 1.00 154.72 ? 185 GLU B CD  1 
ATOM   3280 O OE1 . GLU B 1 173 ? -48.482 -2.095  -74.832 1.00 149.87 ? 185 GLU B OE1 1 
ATOM   3281 O OE2 . GLU B 1 173 ? -50.054 -3.592  -74.440 1.00 151.25 ? 185 GLU B OE2 1 
ATOM   3282 N N   . GLU B 1 174 ? -48.854 -1.369  -68.994 1.00 114.42 ? 186 GLU B N   1 
ATOM   3283 C CA  . GLU B 1 174 ? -48.494 -0.476  -67.887 1.00 111.63 ? 186 GLU B CA  1 
ATOM   3284 C C   . GLU B 1 174 ? -47.022 -0.636  -67.499 1.00 111.88 ? 186 GLU B C   1 
ATOM   3285 O O   . GLU B 1 174 ? -46.361 0.365   -67.203 1.00 109.18 ? 186 GLU B O   1 
ATOM   3286 C CB  . GLU B 1 174 ? -49.393 -0.734  -66.661 1.00 114.62 ? 186 GLU B CB  1 
ATOM   3287 C CG  . GLU B 1 174 ? -50.822 -0.234  -66.825 1.00 127.07 ? 186 GLU B CG  1 
ATOM   3288 C CD  . GLU B 1 174 ? -51.885 -0.940  -66.002 1.00 148.98 ? 186 GLU B CD  1 
ATOM   3289 O OE1 . GLU B 1 174 ? -53.020 -1.086  -66.510 1.00 141.98 ? 186 GLU B OE1 1 
ATOM   3290 O OE2 . GLU B 1 174 ? -51.592 -1.336  -64.851 1.00 144.06 ? 186 GLU B OE2 1 
ATOM   3291 N N   . ARG B 1 175 ? -46.507 -1.885  -67.517 1.00 108.05 ? 187 ARG B N   1 
ATOM   3292 C CA  . ARG B 1 175 ? -45.123 -2.197  -67.136 1.00 105.04 ? 187 ARG B CA  1 
ATOM   3293 C C   . ARG B 1 175 ? -44.121 -1.757  -68.217 1.00 105.55 ? 187 ARG B C   1 
ATOM   3294 O O   . ARG B 1 175 ? -42.996 -1.395  -67.872 1.00 102.00 ? 187 ARG B O   1 
ATOM   3295 C CB  . ARG B 1 175 ? -44.964 -3.686  -66.792 1.00 106.58 ? 187 ARG B CB  1 
ATOM   3296 C CG  . ARG B 1 175 ? -45.404 -3.994  -65.364 1.00 116.97 ? 187 ARG B CG  1 
ATOM   3297 C CD  . ARG B 1 175 ? -45.744 -5.448  -65.177 1.00 130.88 ? 187 ARG B CD  1 
ATOM   3298 N NE  . ARG B 1 175 ? -44.541 -6.227  -64.920 1.00 139.62 ? 187 ARG B NE  1 
ATOM   3299 C CZ  . ARG B 1 175 ? -44.328 -6.932  -63.819 1.00 155.10 ? 187 ARG B CZ  1 
ATOM   3300 N NH1 . ARG B 1 175 ? -45.279 -7.044  -62.901 1.00 148.46 ? 187 ARG B NH1 1 
ATOM   3301 N NH2 . ARG B 1 175 ? -43.189 -7.596  -63.661 1.00 137.09 ? 187 ARG B NH2 1 
ATOM   3302 N N   . ILE B 1 176 ? -44.532 -1.783  -69.510 1.00 103.64 ? 188 ILE B N   1 
ATOM   3303 C CA  . ILE B 1 176 ? -43.799 -1.186  -70.640 1.00 102.18 ? 188 ILE B CA  1 
ATOM   3304 C C   . ILE B 1 176 ? -43.595 0.318   -70.385 1.00 103.50 ? 188 ILE B C   1 
ATOM   3305 O O   . ILE B 1 176 ? -42.456 0.780   -70.376 1.00 101.10 ? 188 ILE B O   1 
ATOM   3306 C CB  . ILE B 1 176 ? -44.531 -1.419  -72.009 1.00 107.76 ? 188 ILE B CB  1 
ATOM   3307 C CG1 . ILE B 1 176 ? -44.520 -2.891  -72.467 1.00 110.24 ? 188 ILE B CG1 1 
ATOM   3308 C CG2 . ILE B 1 176 ? -44.001 -0.486  -73.128 1.00 107.50 ? 188 ILE B CG2 1 
ATOM   3309 C CD1 . ILE B 1 176 ? -45.404 -3.064  -73.631 1.00 118.56 ? 188 ILE B CD1 1 
ATOM   3310 N N   . THR B 1 177 ? -44.699 1.073   -70.174 1.00 100.36 ? 189 THR B N   1 
ATOM   3311 C CA  . THR B 1 177 ? -44.696 2.539   -70.073 1.00 98.08  ? 189 THR B CA  1 
ATOM   3312 C C   . THR B 1 177 ? -43.868 2.992   -68.861 1.00 98.61  ? 189 THR B C   1 
ATOM   3313 O O   . THR B 1 177 ? -43.092 3.949   -68.971 1.00 96.70  ? 189 THR B O   1 
ATOM   3314 C CB  . THR B 1 177 ? -46.143 3.083   -70.005 1.00 108.82 ? 189 THR B CB  1 
ATOM   3315 O OG1 . THR B 1 177 ? -47.010 2.366   -70.899 1.00 109.44 ? 189 THR B OG1 1 
ATOM   3316 C CG2 . THR B 1 177 ? -46.221 4.572   -70.296 1.00 107.16 ? 189 THR B CG2 1 
ATOM   3317 N N   . ALA B 1 178 ? -44.024 2.286   -67.720 1.00 94.61  ? 190 ALA B N   1 
ATOM   3318 C CA  . ALA B 1 178 ? -43.329 2.573   -66.463 1.00 91.99  ? 190 ALA B CA  1 
ATOM   3319 C C   . ALA B 1 178 ? -41.811 2.398   -66.592 1.00 93.37  ? 190 ALA B C   1 
ATOM   3320 O O   . ALA B 1 178 ? -41.058 3.177   -65.993 1.00 91.27  ? 190 ALA B O   1 
ATOM   3321 C CB  . ALA B 1 178 ? -43.861 1.677   -65.353 1.00 94.08  ? 190 ALA B CB  1 
ATOM   3322 N N   . TRP B 1 179 ? -41.368 1.393   -67.383 1.00 89.55  ? 191 TRP B N   1 
ATOM   3323 C CA  . TRP B 1 179 ? -39.957 1.031   -67.504 1.00 87.36  ? 191 TRP B CA  1 
ATOM   3324 C C   . TRP B 1 179 ? -39.138 2.156   -68.160 1.00 88.55  ? 191 TRP B C   1 
ATOM   3325 O O   . TRP B 1 179 ? -38.021 2.406   -67.711 1.00 85.41  ? 191 TRP B O   1 
ATOM   3326 C CB  . TRP B 1 179 ? -39.789 -0.288  -68.274 1.00 87.68  ? 191 TRP B CB  1 
ATOM   3327 C CG  . TRP B 1 179 ? -38.441 -0.928  -68.112 1.00 87.42  ? 191 TRP B CG  1 
ATOM   3328 C CD1 . TRP B 1 179 ? -38.096 -1.883  -67.204 1.00 90.71  ? 191 TRP B CD1 1 
ATOM   3329 C CD2 . TRP B 1 179 ? -37.256 -0.651  -68.875 1.00 85.69  ? 191 TRP B CD2 1 
ATOM   3330 N NE1 . TRP B 1 179 ? -36.766 -2.208  -67.339 1.00 89.23  ? 191 TRP B NE1 1 
ATOM   3331 C CE2 . TRP B 1 179 ? -36.226 -1.471  -68.360 1.00 89.50  ? 191 TRP B CE2 1 
ATOM   3332 C CE3 . TRP B 1 179 ? -36.958 0.223   -69.936 1.00 86.11  ? 191 TRP B CE3 1 
ATOM   3333 C CZ2 . TRP B 1 179 ? -34.922 -1.448  -68.873 1.00 87.71  ? 191 TRP B CZ2 1 
ATOM   3334 C CZ3 . TRP B 1 179 ? -35.666 0.243   -70.445 1.00 86.54  ? 191 TRP B CZ3 1 
ATOM   3335 C CH2 . TRP B 1 179 ? -34.664 -0.581  -69.911 1.00 86.88  ? 191 TRP B CH2 1 
ATOM   3336 N N   . TYR B 1 180 ? -39.695 2.840   -69.192 1.00 85.93  ? 192 TYR B N   1 
ATOM   3337 C CA  . TYR B 1 180 ? -39.003 3.909   -69.928 1.00 84.21  ? 192 TYR B CA  1 
ATOM   3338 C C   . TYR B 1 180 ? -38.525 5.032   -69.003 1.00 87.00  ? 192 TYR B C   1 
ATOM   3339 O O   . TYR B 1 180 ? -37.350 5.398   -69.049 1.00 84.70  ? 192 TYR B O   1 
ATOM   3340 C CB  . TYR B 1 180 ? -39.891 4.498   -71.035 1.00 86.70  ? 192 TYR B CB  1 
ATOM   3341 C CG  . TYR B 1 180 ? -40.131 3.573   -72.209 1.00 90.75  ? 192 TYR B CG  1 
ATOM   3342 C CD1 . TYR B 1 180 ? -39.088 3.205   -73.058 1.00 92.44  ? 192 TYR B CD1 1 
ATOM   3343 C CD2 . TYR B 1 180 ? -41.412 3.126   -72.520 1.00 93.98  ? 192 TYR B CD2 1 
ATOM   3344 C CE1 . TYR B 1 180 ? -39.305 2.369   -74.152 1.00 95.13  ? 192 TYR B CE1 1 
ATOM   3345 C CE2 . TYR B 1 180 ? -41.642 2.295   -73.615 1.00 97.08  ? 192 TYR B CE2 1 
ATOM   3346 C CZ  . TYR B 1 180 ? -40.584 1.914   -74.426 1.00 103.23 ? 192 TYR B CZ  1 
ATOM   3347 O OH  . TYR B 1 180 ? -40.805 1.088   -75.499 1.00 104.29 ? 192 TYR B OH  1 
ATOM   3348 N N   . ALA B 1 181 ? -39.428 5.556   -68.148 1.00 84.36  ? 193 ALA B N   1 
ATOM   3349 C CA  . ALA B 1 181 ? -39.127 6.655   -67.229 1.00 81.95  ? 193 ALA B CA  1 
ATOM   3350 C C   . ALA B 1 181 ? -38.190 6.209   -66.110 1.00 83.52  ? 193 ALA B C   1 
ATOM   3351 O O   . ALA B 1 181 ? -37.346 6.997   -65.676 1.00 81.50  ? 193 ALA B O   1 
ATOM   3352 C CB  . ALA B 1 181 ? -40.415 7.209   -66.640 1.00 83.85  ? 193 ALA B CB  1 
ATOM   3353 N N   . GLU B 1 182 ? -38.323 4.949   -65.662 1.00 80.47  ? 194 GLU B N   1 
ATOM   3354 C CA  . GLU B 1 182 ? -37.535 4.387   -64.565 1.00 79.19  ? 194 GLU B CA  1 
ATOM   3355 C C   . GLU B 1 182 ? -36.089 4.041   -64.978 1.00 81.06  ? 194 GLU B C   1 
ATOM   3356 O O   . GLU B 1 182 ? -35.245 3.868   -64.095 1.00 79.61  ? 194 GLU B O   1 
ATOM   3357 C CB  . GLU B 1 182 ? -38.221 3.138   -63.994 1.00 82.75  ? 194 GLU B CB  1 
ATOM   3358 C CG  . GLU B 1 182 ? -39.247 3.448   -62.917 1.00 95.92  ? 194 GLU B CG  1 
ATOM   3359 C CD  . GLU B 1 182 ? -40.505 2.595   -62.904 1.00 124.96 ? 194 GLU B CD  1 
ATOM   3360 O OE1 . GLU B 1 182 ? -40.502 1.490   -63.496 1.00 119.70 ? 194 GLU B OE1 1 
ATOM   3361 O OE2 . GLU B 1 182 ? -41.503 3.045   -62.296 1.00 122.95 ? 194 GLU B OE2 1 
ATOM   3362 N N   . HIS B 1 183 ? -35.797 3.939   -66.298 1.00 76.98  ? 195 HIS B N   1 
ATOM   3363 C CA  . HIS B 1 183 ? -34.491 3.492   -66.788 1.00 75.77  ? 195 HIS B CA  1 
ATOM   3364 C C   . HIS B 1 183 ? -33.997 4.407   -67.934 1.00 79.64  ? 195 HIS B C   1 
ATOM   3365 O O   . HIS B 1 183 ? -34.019 4.008   -69.097 1.00 81.21  ? 195 HIS B O   1 
ATOM   3366 C CB  . HIS B 1 183 ? -34.557 2.008   -67.223 1.00 78.45  ? 195 HIS B CB  1 
ATOM   3367 C CG  . HIS B 1 183 ? -35.049 1.084   -66.147 1.00 82.74  ? 195 HIS B CG  1 
ATOM   3368 N ND1 . HIS B 1 183 ? -34.181 0.500   -65.244 1.00 83.87  ? 195 HIS B ND1 1 
ATOM   3369 C CD2 . HIS B 1 183 ? -36.314 0.716   -65.837 1.00 86.06  ? 195 HIS B CD2 1 
ATOM   3370 C CE1 . HIS B 1 183 ? -34.939 -0.219  -64.432 1.00 84.70  ? 195 HIS B CE1 1 
ATOM   3371 N NE2 . HIS B 1 183 ? -36.229 -0.121  -64.752 1.00 86.45  ? 195 HIS B NE2 1 
ATOM   3372 N N   . ARG B 1 184 ? -33.559 5.647   -67.591 1.00 74.03  ? 196 ARG B N   1 
ATOM   3373 C CA  . ARG B 1 184 ? -33.099 6.684   -68.538 1.00 72.66  ? 196 ARG B CA  1 
ATOM   3374 C C   . ARG B 1 184 ? -31.586 6.977   -68.394 1.00 73.41  ? 196 ARG B C   1 
ATOM   3375 O O   . ARG B 1 184 ? -31.015 7.749   -69.174 1.00 71.90  ? 196 ARG B O   1 
ATOM   3376 C CB  . ARG B 1 184 ? -33.899 7.992   -68.339 1.00 72.29  ? 196 ARG B CB  1 
ATOM   3377 C CG  . ARG B 1 184 ? -35.273 8.004   -69.002 1.00 87.89  ? 196 ARG B CG  1 
ATOM   3378 C CD  . ARG B 1 184 ? -35.254 8.600   -70.401 1.00 99.16  ? 196 ARG B CD  1 
ATOM   3379 N NE  . ARG B 1 184 ? -36.144 7.878   -71.317 1.00 110.07 ? 196 ARG B NE  1 
ATOM   3380 C CZ  . ARG B 1 184 ? -37.418 8.192   -71.544 1.00 120.82 ? 196 ARG B CZ  1 
ATOM   3381 N NH1 . ARG B 1 184 ? -37.976 9.225   -70.921 1.00 104.78 ? 196 ARG B NH1 1 
ATOM   3382 N NH2 . ARG B 1 184 ? -38.143 7.475   -72.396 1.00 102.48 ? 196 ARG B NH2 1 
ATOM   3383 N N   . GLY B 1 185 ? -30.964 6.367   -67.393 1.00 68.37  ? 197 GLY B N   1 
ATOM   3384 C CA  . GLY B 1 185 ? -29.553 6.562   -67.110 1.00 66.62  ? 197 GLY B CA  1 
ATOM   3385 C C   . GLY B 1 185 ? -29.259 7.836   -66.346 1.00 68.54  ? 197 GLY B C   1 
ATOM   3386 O O   . GLY B 1 185 ? -30.092 8.748   -66.284 1.00 68.69  ? 197 GLY B O   1 
ATOM   3387 N N   . ARG B 1 186 ? -28.066 7.890   -65.748 1.00 62.25  ? 198 ARG B N   1 
ATOM   3388 C CA  . ARG B 1 186 ? -27.561 9.041   -65.013 1.00 59.76  ? 198 ARG B CA  1 
ATOM   3389 C C   . ARG B 1 186 ? -27.172 10.165  -65.952 1.00 63.68  ? 198 ARG B C   1 
ATOM   3390 O O   . ARG B 1 186 ? -26.482 9.923   -66.939 1.00 64.24  ? 198 ARG B O   1 
ATOM   3391 C CB  . ARG B 1 186 ? -26.320 8.628   -64.221 1.00 58.14  ? 198 ARG B CB  1 
ATOM   3392 C CG  . ARG B 1 186 ? -26.528 8.254   -62.767 1.00 68.16  ? 198 ARG B CG  1 
ATOM   3393 C CD  . ARG B 1 186 ? -25.189 8.043   -62.088 1.00 81.68  ? 198 ARG B CD  1 
ATOM   3394 N NE  . ARG B 1 186 ? -24.419 9.286   -62.078 1.00 91.88  ? 198 ARG B NE  1 
ATOM   3395 C CZ  . ARG B 1 186 ? -23.300 9.497   -62.763 1.00 103.02 ? 198 ARG B CZ  1 
ATOM   3396 N NH1 . ARG B 1 186 ? -22.766 8.526   -63.493 1.00 87.83  ? 198 ARG B NH1 1 
ATOM   3397 N NH2 . ARG B 1 186 ? -22.700 10.676  -62.711 1.00 88.92  ? 198 ARG B NH2 1 
ATOM   3398 N N   . ALA B 1 187 ? -27.607 11.396  -65.657 1.00 59.12  ? 199 ALA B N   1 
ATOM   3399 C CA  . ALA B 1 187 ? -27.091 12.596  -66.324 1.00 57.64  ? 199 ALA B CA  1 
ATOM   3400 C C   . ALA B 1 187 ? -25.687 12.933  -65.807 1.00 58.34  ? 199 ALA B C   1 
ATOM   3401 O O   . ALA B 1 187 ? -25.319 12.496  -64.708 1.00 56.43  ? 199 ALA B O   1 
ATOM   3402 C CB  . ALA B 1 187 ? -28.031 13.768  -66.080 1.00 58.25  ? 199 ALA B CB  1 
ATOM   3403 N N   . ARG B 1 188 ? -24.901 13.700  -66.604 1.00 53.91  ? 200 ARG B N   1 
ATOM   3404 C CA  . ARG B 1 188 ? -23.612 14.264  -66.187 1.00 51.93  ? 200 ARG B CA  1 
ATOM   3405 C C   . ARG B 1 188 ? -23.822 15.236  -65.034 1.00 54.60  ? 200 ARG B C   1 
ATOM   3406 O O   . ARG B 1 188 ? -24.727 16.075  -65.101 1.00 53.71  ? 200 ARG B O   1 
ATOM   3407 C CB  . ARG B 1 188 ? -22.887 14.967  -67.350 1.00 51.97  ? 200 ARG B CB  1 
ATOM   3408 C CG  . ARG B 1 188 ? -22.167 14.024  -68.303 1.00 63.06  ? 200 ARG B CG  1 
ATOM   3409 C CD  . ARG B 1 188 ? -21.477 14.752  -69.448 1.00 67.68  ? 200 ARG B CD  1 
ATOM   3410 N NE  . ARG B 1 188 ? -20.559 13.877  -70.186 1.00 65.84  ? 200 ARG B NE  1 
ATOM   3411 C CZ  . ARG B 1 188 ? -19.268 13.726  -69.894 1.00 76.63  ? 200 ARG B CZ  1 
ATOM   3412 N NH1 . ARG B 1 188 ? -18.725 14.394  -68.879 1.00 60.27  ? 200 ARG B NH1 1 
ATOM   3413 N NH2 . ARG B 1 188 ? -18.513 12.902  -70.609 1.00 63.16  ? 200 ARG B NH2 1 
ATOM   3414 N N   . ASP B 1 189 ? -22.998 15.111  -63.972 1.00 50.64  ? 201 ASP B N   1 
ATOM   3415 C CA  . ASP B 1 189 ? -23.142 15.907  -62.748 1.00 49.41  ? 201 ASP B CA  1 
ATOM   3416 C C   . ASP B 1 189 ? -22.433 17.262  -62.928 1.00 50.94  ? 201 ASP B C   1 
ATOM   3417 O O   . ASP B 1 189 ? -21.295 17.451  -62.476 1.00 50.11  ? 201 ASP B O   1 
ATOM   3418 C CB  . ASP B 1 189 ? -22.595 15.122  -61.534 1.00 51.09  ? 201 ASP B CB  1 
ATOM   3419 C CG  . ASP B 1 189 ? -23.107 15.554  -60.169 1.00 64.21  ? 201 ASP B CG  1 
ATOM   3420 O OD1 . ASP B 1 189 ? -23.444 16.747  -60.008 1.00 62.85  ? 201 ASP B OD1 1 
ATOM   3421 O OD2 . ASP B 1 189 ? -23.131 14.702  -59.247 1.00 76.34  ? 201 ASP B OD2 1 
ATOM   3422 N N   . GLU B 1 190 ? -23.122 18.203  -63.596 1.00 45.96  ? 202 GLU B N   1 
ATOM   3423 C CA  . GLU B 1 190 ? -22.601 19.525  -63.921 1.00 44.78  ? 202 GLU B CA  1 
ATOM   3424 C C   . GLU B 1 190 ? -22.250 20.350  -62.675 1.00 44.80  ? 202 GLU B C   1 
ATOM   3425 O O   . GLU B 1 190 ? -21.323 21.161  -62.727 1.00 43.47  ? 202 GLU B O   1 
ATOM   3426 C CB  . GLU B 1 190 ? -23.597 20.281  -64.800 1.00 47.64  ? 202 GLU B CB  1 
ATOM   3427 C CG  . GLU B 1 190 ? -23.032 20.590  -66.177 1.00 66.13  ? 202 GLU B CG  1 
ATOM   3428 C CD  . GLU B 1 190 ? -21.833 21.528  -66.184 1.00 91.52  ? 202 GLU B CD  1 
ATOM   3429 O OE1 . GLU B 1 190 ? -20.720 21.074  -66.541 1.00 94.62  ? 202 GLU B OE1 1 
ATOM   3430 O OE2 . GLU B 1 190 ? -22.000 22.709  -65.802 1.00 76.03  ? 202 GLU B OE2 1 
ATOM   3431 N N   . ALA B 1 191 ? -22.974 20.114  -61.553 1.00 39.99  ? 203 ALA B N   1 
ATOM   3432 C CA  . ALA B 1 191 ? -22.741 20.756  -60.260 1.00 38.25  ? 203 ALA B CA  1 
ATOM   3433 C C   . ALA B 1 191 ? -21.299 20.524  -59.744 1.00 41.14  ? 203 ALA B C   1 
ATOM   3434 O O   . ALA B 1 191 ? -20.722 21.434  -59.143 1.00 41.22  ? 203 ALA B O   1 
ATOM   3435 C CB  . ALA B 1 191 ? -23.757 20.269  -59.241 1.00 38.87  ? 203 ALA B CB  1 
ATOM   3436 N N   . GLU B 1 192 ? -20.705 19.340  -60.017 1.00 36.70  ? 204 GLU B N   1 
ATOM   3437 C CA  . GLU B 1 192 ? -19.304 19.039  -59.658 1.00 35.06  ? 204 GLU B CA  1 
ATOM   3438 C C   . GLU B 1 192 ? -18.325 19.934  -60.398 1.00 38.10  ? 204 GLU B C   1 
ATOM   3439 O O   . GLU B 1 192 ? -17.346 20.364  -59.800 1.00 36.48  ? 204 GLU B O   1 
ATOM   3440 C CB  . GLU B 1 192 ? -18.948 17.575  -59.922 1.00 36.28  ? 204 GLU B CB  1 
ATOM   3441 C CG  . GLU B 1 192 ? -19.752 16.614  -59.071 1.00 40.67  ? 204 GLU B CG  1 
ATOM   3442 C CD  . GLU B 1 192 ? -19.356 15.162  -59.206 1.00 53.64  ? 204 GLU B CD  1 
ATOM   3443 O OE1 . GLU B 1 192 ? -18.980 14.737  -60.324 1.00 46.75  ? 204 GLU B OE1 1 
ATOM   3444 O OE2 . GLU B 1 192 ? -19.474 14.436  -58.195 1.00 48.30  ? 204 GLU B OE2 1 
ATOM   3445 N N   . MET B 1 193 ? -18.596 20.224  -61.689 1.00 36.10  ? 205 MET B N   1 
ATOM   3446 C CA  . MET B 1 193 ? -17.756 21.084  -62.522 1.00 36.62  ? 205 MET B CA  1 
ATOM   3447 C C   . MET B 1 193 ? -17.873 22.546  -62.087 1.00 40.85  ? 205 MET B C   1 
ATOM   3448 O O   . MET B 1 193 ? -16.862 23.244  -62.002 1.00 39.93  ? 205 MET B O   1 
ATOM   3449 C CB  . MET B 1 193 ? -18.106 20.914  -64.011 1.00 40.39  ? 205 MET B CB  1 
ATOM   3450 C CG  . MET B 1 193 ? -17.072 21.532  -64.964 1.00 44.99  ? 205 MET B CG  1 
ATOM   3451 S SD  . MET B 1 193 ? -15.338 21.174  -64.520 1.00 48.38  ? 205 MET B SD  1 
ATOM   3452 C CE  . MET B 1 193 ? -15.169 19.566  -65.124 1.00 45.38  ? 205 MET B CE  1 
ATOM   3453 N N   . GLU B 1 194 ? -19.101 22.992  -61.788 1.00 39.12  ? 206 GLU B N   1 
ATOM   3454 C CA  . GLU B 1 194 ? -19.378 24.337  -61.283 1.00 38.76  ? 206 GLU B CA  1 
ATOM   3455 C C   . GLU B 1 194 ? -18.659 24.579  -59.953 1.00 38.79  ? 206 GLU B C   1 
ATOM   3456 O O   . GLU B 1 194 ? -18.131 25.677  -59.731 1.00 36.71  ? 206 GLU B O   1 
ATOM   3457 C CB  . GLU B 1 194 ? -20.894 24.551  -61.132 1.00 40.93  ? 206 GLU B CB  1 
ATOM   3458 C CG  . GLU B 1 194 ? -21.669 24.606  -62.437 1.00 53.62  ? 206 GLU B CG  1 
ATOM   3459 C CD  . GLU B 1 194 ? -21.147 25.595  -63.466 1.00 89.22  ? 206 GLU B CD  1 
ATOM   3460 O OE1 . GLU B 1 194 ? -21.114 26.813  -63.173 1.00 84.84  ? 206 GLU B OE1 1 
ATOM   3461 O OE2 . GLU B 1 194 ? -20.748 25.142  -64.563 1.00 93.31  ? 206 GLU B OE2 1 
ATOM   3462 N N   . TYR B 1 195 ? -18.625 23.536  -59.086 1.00 34.20  ? 207 TYR B N   1 
ATOM   3463 C CA  . TYR B 1 195 ? -17.878 23.515  -57.820 1.00 32.84  ? 207 TYR B CA  1 
ATOM   3464 C C   . TYR B 1 195 ? -16.392 23.722  -58.073 1.00 36.25  ? 207 TYR B C   1 
ATOM   3465 O O   . TYR B 1 195 ? -15.792 24.619  -57.477 1.00 36.53  ? 207 TYR B O   1 
ATOM   3466 C CB  . TYR B 1 195 ? -18.106 22.183  -57.076 1.00 33.21  ? 207 TYR B CB  1 
ATOM   3467 C CG  . TYR B 1 195 ? -17.616 22.173  -55.646 1.00 32.62  ? 207 TYR B CG  1 
ATOM   3468 C CD1 . TYR B 1 195 ? -16.276 21.927  -55.346 1.00 32.93  ? 207 TYR B CD1 1 
ATOM   3469 C CD2 . TYR B 1 195 ? -18.498 22.349  -54.588 1.00 32.84  ? 207 TYR B CD2 1 
ATOM   3470 C CE1 . TYR B 1 195 ? -15.817 21.924  -54.029 1.00 29.81  ? 207 TYR B CE1 1 
ATOM   3471 C CE2 . TYR B 1 195 ? -18.053 22.333  -53.266 1.00 33.17  ? 207 TYR B CE2 1 
ATOM   3472 C CZ  . TYR B 1 195 ? -16.712 22.128  -52.993 1.00 35.16  ? 207 TYR B CZ  1 
ATOM   3473 O OH  . TYR B 1 195 ? -16.292 22.113  -51.694 1.00 31.25  ? 207 TYR B OH  1 
ATOM   3474 N N   . LEU B 1 196 ? -15.802 22.915  -58.981 1.00 32.06  ? 208 LEU B N   1 
ATOM   3475 C CA  . LEU B 1 196 ? -14.354 22.954  -59.240 1.00 31.38  ? 208 LEU B CA  1 
ATOM   3476 C C   . LEU B 1 196 ? -13.923 24.284  -59.852 1.00 34.83  ? 208 LEU B C   1 
ATOM   3477 O O   . LEU B 1 196 ? -12.831 24.747  -59.552 1.00 34.38  ? 208 LEU B O   1 
ATOM   3478 C CB  . LEU B 1 196 ? -13.910 21.778  -60.130 1.00 31.41  ? 208 LEU B CB  1 
ATOM   3479 C CG  . LEU B 1 196 ? -13.974 20.381  -59.487 1.00 33.52  ? 208 LEU B CG  1 
ATOM   3480 C CD1 . LEU B 1 196 ? -13.900 19.293  -60.545 1.00 33.74  ? 208 LEU B CD1 1 
ATOM   3481 C CD2 . LEU B 1 196 ? -12.911 20.202  -58.409 1.00 32.13  ? 208 LEU B CD2 1 
ATOM   3482 N N   . LYS B 1 197 ? -14.790 24.910  -60.668 1.00 32.49  ? 209 LYS B N   1 
ATOM   3483 C CA  . LYS B 1 197 ? -14.536 26.195  -61.316 1.00 33.13  ? 209 LYS B CA  1 
ATOM   3484 C C   . LYS B 1 197 ? -14.408 27.339  -60.293 1.00 38.97  ? 209 LYS B C   1 
ATOM   3485 O O   . LYS B 1 197 ? -13.585 28.243  -60.490 1.00 40.29  ? 209 LYS B O   1 
ATOM   3486 C CB  . LYS B 1 197 ? -15.632 26.496  -62.344 1.00 35.71  ? 209 LYS B CB  1 
ATOM   3487 C CG  . LYS B 1 197 ? -15.400 25.784  -63.682 1.00 41.93  ? 209 LYS B CG  1 
ATOM   3488 C CD  . LYS B 1 197 ? -16.691 25.526  -64.445 1.00 50.06  ? 209 LYS B CD  1 
ATOM   3489 C CE  . LYS B 1 197 ? -17.232 26.726  -65.186 1.00 63.96  ? 209 LYS B CE  1 
ATOM   3490 N NZ  . LYS B 1 197 ? -18.515 26.410  -65.864 1.00 76.83  ? 209 LYS B NZ  1 
ATOM   3491 N N   . ILE B 1 198 ? -15.211 27.293  -59.203 1.00 34.17  ? 210 ILE B N   1 
ATOM   3492 C CA  . ILE B 1 198 ? -15.103 28.250  -58.097 1.00 32.54  ? 210 ILE B CA  1 
ATOM   3493 C C   . ILE B 1 198 ? -13.837 27.931  -57.307 1.00 35.39  ? 210 ILE B C   1 
ATOM   3494 O O   . ILE B 1 198 ? -13.024 28.829  -57.064 1.00 35.64  ? 210 ILE B O   1 
ATOM   3495 C CB  . ILE B 1 198 ? -16.378 28.275  -57.195 1.00 35.02  ? 210 ILE B CB  1 
ATOM   3496 C CG1 . ILE B 1 198 ? -17.610 28.762  -57.979 1.00 35.81  ? 210 ILE B CG1 1 
ATOM   3497 C CG2 . ILE B 1 198 ? -16.173 29.124  -55.929 1.00 35.29  ? 210 ILE B CG2 1 
ATOM   3498 C CD1 . ILE B 1 198 ? -18.951 28.425  -57.339 1.00 39.59  ? 210 ILE B CD1 1 
ATOM   3499 N N   . ALA B 1 199 ? -13.660 26.651  -56.933 1.00 31.95  ? 211 ALA B N   1 
ATOM   3500 C CA  . ALA B 1 199 ? -12.553 26.189  -56.081 1.00 30.62  ? 211 ALA B CA  1 
ATOM   3501 C C   . ALA B 1 199 ? -11.187 26.506  -56.691 1.00 35.78  ? 211 ALA B C   1 
ATOM   3502 O O   . ALA B 1 199 ? -10.310 26.972  -55.965 1.00 36.50  ? 211 ALA B O   1 
ATOM   3503 C CB  . ALA B 1 199 ? -12.676 24.697  -55.819 1.00 30.59  ? 211 ALA B CB  1 
ATOM   3504 N N   . GLN B 1 200 ? -11.021 26.318  -58.025 1.00 32.27  ? 212 GLN B N   1 
ATOM   3505 C CA  . GLN B 1 200 ? -9.729  26.490  -58.699 1.00 32.68  ? 212 GLN B CA  1 
ATOM   3506 C C   . GLN B 1 200 ? -9.231  27.968  -58.688 1.00 38.13  ? 212 GLN B C   1 
ATOM   3507 O O   . GLN B 1 200 ? -8.044  28.207  -58.906 1.00 37.40  ? 212 GLN B O   1 
ATOM   3508 C CB  . GLN B 1 200 ? -9.752  25.925  -60.139 1.00 34.42  ? 212 GLN B CB  1 
ATOM   3509 C CG  . GLN B 1 200 ? -10.544 26.757  -61.146 1.00 39.55  ? 212 GLN B CG  1 
ATOM   3510 C CD  . GLN B 1 200 ? -10.642 26.126  -62.504 1.00 45.75  ? 212 GLN B CD  1 
ATOM   3511 O OE1 . GLN B 1 200 ? -10.047 25.080  -62.795 1.00 41.73  ? 212 GLN B OE1 1 
ATOM   3512 N NE2 . GLN B 1 200 ? -11.417 26.750  -63.371 1.00 26.27  ? 212 GLN B NE2 1 
ATOM   3513 N N   . ASP B 1 201 ? -10.132 28.931  -58.432 1.00 36.41  ? 213 ASP B N   1 
ATOM   3514 C CA  . ASP B 1 201 ? -9.802  30.352  -58.352 1.00 37.16  ? 213 ASP B CA  1 
ATOM   3515 C C   . ASP B 1 201 ? -9.336  30.750  -56.937 1.00 39.31  ? 213 ASP B C   1 
ATOM   3516 O O   . ASP B 1 201 ? -8.976  31.915  -56.724 1.00 41.39  ? 213 ASP B O   1 
ATOM   3517 C CB  . ASP B 1 201 ? -11.011 31.204  -58.774 1.00 40.25  ? 213 ASP B CB  1 
ATOM   3518 C CG  . ASP B 1 201 ? -11.326 31.205  -60.259 1.00 56.18  ? 213 ASP B CG  1 
ATOM   3519 O OD1 . ASP B 1 201 ? -10.471 30.736  -61.053 1.00 56.62  ? 213 ASP B OD1 1 
ATOM   3520 O OD2 . ASP B 1 201 ? -12.416 31.704  -60.633 1.00 66.80  ? 213 ASP B OD2 1 
ATOM   3521 N N   . LEU B 1 202 ? -9.326  29.800  -55.984 1.00 30.73  ? 214 LEU B N   1 
ATOM   3522 C CA  . LEU B 1 202 ? -8.861  30.079  -54.630 1.00 29.41  ? 214 LEU B CA  1 
ATOM   3523 C C   . LEU B 1 202 ? -7.351  30.004  -54.581 1.00 36.67  ? 214 LEU B C   1 
ATOM   3524 O O   . LEU B 1 202 ? -6.771  29.075  -55.148 1.00 37.88  ? 214 LEU B O   1 
ATOM   3525 C CB  . LEU B 1 202 ? -9.494  29.118  -53.608 1.00 27.85  ? 214 LEU B CB  1 
ATOM   3526 C CG  . LEU B 1 202 ? -11.014 29.173  -53.502 1.00 29.25  ? 214 LEU B CG  1 
ATOM   3527 C CD1 . LEU B 1 202 ? -11.528 27.979  -52.779 1.00 27.34  ? 214 LEU B CD1 1 
ATOM   3528 C CD2 . LEU B 1 202 ? -11.469 30.464  -52.848 1.00 28.23  ? 214 LEU B CD2 1 
ATOM   3529 N N   . GLU B 1 203 ? -6.711  30.977  -53.903 1.00 33.68  ? 215 GLU B N   1 
ATOM   3530 C CA  . GLU B 1 203 ? -5.251  31.147  -53.882 1.00 33.90  ? 215 GLU B CA  1 
ATOM   3531 C C   . GLU B 1 203 ? -4.517  29.870  -53.440 1.00 38.94  ? 215 GLU B C   1 
ATOM   3532 O O   . GLU B 1 203 ? -3.450  29.583  -53.977 1.00 41.40  ? 215 GLU B O   1 
ATOM   3533 C CB  . GLU B 1 203 ? -4.846  32.326  -52.981 1.00 35.22  ? 215 GLU B CB  1 
ATOM   3534 C CG  . GLU B 1 203 ? -5.264  33.680  -53.522 1.00 45.71  ? 215 GLU B CG  1 
ATOM   3535 C CD  . GLU B 1 203 ? -5.310  34.803  -52.504 1.00 66.45  ? 215 GLU B CD  1 
ATOM   3536 O OE1 . GLU B 1 203 ? -6.179  34.752  -51.603 1.00 53.98  ? 215 GLU B OE1 1 
ATOM   3537 O OE2 . GLU B 1 203 ? -4.500  35.752  -52.624 1.00 61.62  ? 215 GLU B OE2 1 
ATOM   3538 N N   . MET B 1 204 ? -5.101  29.091  -52.503 1.00 32.98  ? 216 MET B N   1 
ATOM   3539 C CA  . MET B 1 204 ? -4.471  27.904  -51.906 1.00 31.32  ? 216 MET B CA  1 
ATOM   3540 C C   . MET B 1 204 ? -4.774  26.604  -52.664 1.00 37.75  ? 216 MET B C   1 
ATOM   3541 O O   . MET B 1 204 ? -4.210  25.563  -52.319 1.00 39.30  ? 216 MET B O   1 
ATOM   3542 C CB  . MET B 1 204 ? -4.907  27.742  -50.446 1.00 31.81  ? 216 MET B CB  1 
ATOM   3543 C CG  . MET B 1 204 ? -4.279  28.740  -49.539 1.00 33.62  ? 216 MET B CG  1 
ATOM   3544 S SD  . MET B 1 204 ? -4.625  28.352  -47.828 1.00 35.75  ? 216 MET B SD  1 
ATOM   3545 C CE  . MET B 1 204 ? -3.493  27.030  -47.532 1.00 32.58  ? 216 MET B CE  1 
ATOM   3546 N N   . TYR B 1 205 ? -5.646  26.655  -53.684 1.00 34.33  ? 217 TYR B N   1 
ATOM   3547 C CA  . TYR B 1 205 ? -6.042  25.487  -54.467 1.00 34.43  ? 217 TYR B CA  1 
ATOM   3548 C C   . TYR B 1 205 ? -4.847  24.883  -55.230 1.00 41.31  ? 217 TYR B C   1 
ATOM   3549 O O   . TYR B 1 205 ? -4.138  25.593  -55.958 1.00 43.01  ? 217 TYR B O   1 
ATOM   3550 C CB  . TYR B 1 205 ? -7.158  25.879  -55.444 1.00 34.94  ? 217 TYR B CB  1 
ATOM   3551 C CG  . TYR B 1 205 ? -7.562  24.803  -56.431 1.00 35.76  ? 217 TYR B CG  1 
ATOM   3552 C CD1 . TYR B 1 205 ? -6.936  24.697  -57.671 1.00 38.43  ? 217 TYR B CD1 1 
ATOM   3553 C CD2 . TYR B 1 205 ? -8.625  23.945  -56.161 1.00 35.24  ? 217 TYR B CD2 1 
ATOM   3554 C CE1 . TYR B 1 205 ? -7.317  23.725  -58.595 1.00 39.71  ? 217 TYR B CE1 1 
ATOM   3555 C CE2 . TYR B 1 205 ? -9.035  22.988  -57.089 1.00 36.64  ? 217 TYR B CE2 1 
ATOM   3556 C CZ  . TYR B 1 205 ? -8.383  22.887  -58.311 1.00 46.33  ? 217 TYR B CZ  1 
ATOM   3557 O OH  . TYR B 1 205 ? -8.791  21.960  -59.246 1.00 49.33  ? 217 TYR B OH  1 
ATOM   3558 N N   . GLY B 1 206 ? -4.643  23.582  -55.045 1.00 37.24  ? 218 GLY B N   1 
ATOM   3559 C CA  . GLY B 1 206 ? -3.645  22.809  -55.784 1.00 37.83  ? 218 GLY B CA  1 
ATOM   3560 C C   . GLY B 1 206 ? -2.198  23.157  -55.491 1.00 40.43  ? 218 GLY B C   1 
ATOM   3561 O O   . GLY B 1 206 ? -1.309  22.754  -56.242 1.00 41.55  ? 218 GLY B O   1 
ATOM   3562 N N   . VAL B 1 207 ? -1.951  23.915  -54.404 1.00 34.17  ? 219 VAL B N   1 
ATOM   3563 C CA  . VAL B 1 207 ? -0.607  24.285  -53.957 1.00 32.55  ? 219 VAL B CA  1 
ATOM   3564 C C   . VAL B 1 207 ? -0.154  23.267  -52.899 1.00 34.29  ? 219 VAL B C   1 
ATOM   3565 O O   . VAL B 1 207 ? -0.887  22.984  -51.954 1.00 32.01  ? 219 VAL B O   1 
ATOM   3566 C CB  . VAL B 1 207 ? -0.515  25.752  -53.436 1.00 33.90  ? 219 VAL B CB  1 
ATOM   3567 C CG1 . VAL B 1 207 ? 0.911   26.113  -53.040 1.00 33.72  ? 219 VAL B CG1 1 
ATOM   3568 C CG2 . VAL B 1 207 ? -1.049  26.743  -54.467 1.00 33.17  ? 219 VAL B CG2 1 
ATOM   3569 N N   . ASN B 1 208 ? 1.043   22.706  -53.096 1.00 31.87  ? 220 ASN B N   1 
ATOM   3570 C CA  . ASN B 1 208 ? 1.741   21.859  -52.134 1.00 31.90  ? 220 ASN B CA  1 
ATOM   3571 C C   . ASN B 1 208 ? 2.688   22.715  -51.320 1.00 35.22  ? 220 ASN B C   1 
ATOM   3572 O O   . ASN B 1 208 ? 3.581   23.345  -51.897 1.00 33.99  ? 220 ASN B O   1 
ATOM   3573 C CB  . ASN B 1 208 ? 2.508   20.752  -52.853 1.00 32.77  ? 220 ASN B CB  1 
ATOM   3574 C CG  . ASN B 1 208 ? 1.644   19.863  -53.704 1.00 47.41  ? 220 ASN B CG  1 
ATOM   3575 O OD1 . ASN B 1 208 ? 0.993   18.923  -53.216 1.00 35.29  ? 220 ASN B OD1 1 
ATOM   3576 N ND2 . ASN B 1 208 ? 1.637   20.136  -54.998 1.00 37.74  ? 220 ASN B ND2 1 
ATOM   3577 N N   . TYR B 1 209 ? 2.487   22.759  -49.983 1.00 31.81  ? 221 TYR B N   1 
ATOM   3578 C CA  . TYR B 1 209 ? 3.296   23.599  -49.099 1.00 31.48  ? 221 TYR B CA  1 
ATOM   3579 C C   . TYR B 1 209 ? 4.334   22.799  -48.339 1.00 37.09  ? 221 TYR B C   1 
ATOM   3580 O O   . TYR B 1 209 ? 4.052   21.704  -47.845 1.00 38.17  ? 221 TYR B O   1 
ATOM   3581 C CB  . TYR B 1 209 ? 2.429   24.375  -48.113 1.00 30.58  ? 221 TYR B CB  1 
ATOM   3582 C CG  . TYR B 1 209 ? 1.503   25.379  -48.760 1.00 29.15  ? 221 TYR B CG  1 
ATOM   3583 C CD1 . TYR B 1 209 ? 1.913   26.691  -48.987 1.00 29.95  ? 221 TYR B CD1 1 
ATOM   3584 C CD2 . TYR B 1 209 ? 0.191   25.037  -49.081 1.00 28.97  ? 221 TYR B CD2 1 
ATOM   3585 C CE1 . TYR B 1 209 ? 1.050   27.629  -49.557 1.00 30.34  ? 221 TYR B CE1 1 
ATOM   3586 C CE2 . TYR B 1 209 ? -0.679  25.964  -49.655 1.00 29.02  ? 221 TYR B CE2 1 
ATOM   3587 C CZ  . TYR B 1 209 ? -0.247  27.259  -49.884 1.00 35.66  ? 221 TYR B CZ  1 
ATOM   3588 O OH  . TYR B 1 209 ? -1.107  28.163  -50.448 1.00 35.46  ? 221 TYR B OH  1 
ATOM   3589 N N   . PHE B 1 210 ? 5.537   23.366  -48.230 1.00 33.10  ? 222 PHE B N   1 
ATOM   3590 C CA  . PHE B 1 210 ? 6.660   22.749  -47.538 1.00 33.82  ? 222 PHE B CA  1 
ATOM   3591 C C   . PHE B 1 210 ? 7.379   23.792  -46.711 1.00 39.01  ? 222 PHE B C   1 
ATOM   3592 O O   . PHE B 1 210 ? 7.632   24.891  -47.209 1.00 39.05  ? 222 PHE B O   1 
ATOM   3593 C CB  . PHE B 1 210 ? 7.619   22.093  -48.543 1.00 36.88  ? 222 PHE B CB  1 
ATOM   3594 C CG  . PHE B 1 210 ? 6.955   21.075  -49.446 1.00 38.08  ? 222 PHE B CG  1 
ATOM   3595 C CD1 . PHE B 1 210 ? 6.738   19.774  -49.012 1.00 40.48  ? 222 PHE B CD1 1 
ATOM   3596 C CD2 . PHE B 1 210 ? 6.515   21.430  -50.720 1.00 38.67  ? 222 PHE B CD2 1 
ATOM   3597 C CE1 . PHE B 1 210 ? 6.112   18.839  -49.840 1.00 40.89  ? 222 PHE B CE1 1 
ATOM   3598 C CE2 . PHE B 1 210 ? 5.887   20.493  -51.545 1.00 40.77  ? 222 PHE B CE2 1 
ATOM   3599 C CZ  . PHE B 1 210 ? 5.683   19.207  -51.096 1.00 38.90  ? 222 PHE B CZ  1 
ATOM   3600 N N   . ALA B 1 211 ? 7.684   23.474  -45.438 1.00 35.58  ? 223 ALA B N   1 
ATOM   3601 C CA  . ALA B 1 211 ? 8.473   24.376  -44.596 1.00 35.57  ? 223 ALA B CA  1 
ATOM   3602 C C   . ALA B 1 211 ? 9.915   24.393  -45.079 1.00 39.90  ? 223 ALA B C   1 
ATOM   3603 O O   . ALA B 1 211 ? 10.495  23.333  -45.319 1.00 39.12  ? 223 ALA B O   1 
ATOM   3604 C CB  . ALA B 1 211 ? 8.394   23.961  -43.135 1.00 36.54  ? 223 ALA B CB  1 
ATOM   3605 N N   . ILE B 1 212 ? 10.462  25.604  -45.293 1.00 37.98  ? 224 ILE B N   1 
ATOM   3606 C CA  . ILE B 1 212 ? 11.849  25.817  -45.754 1.00 39.42  ? 224 ILE B CA  1 
ATOM   3607 C C   . ILE B 1 212 ? 12.537  26.901  -44.940 1.00 42.60  ? 224 ILE B C   1 
ATOM   3608 O O   . ILE B 1 212 ? 11.885  27.669  -44.219 1.00 40.52  ? 224 ILE B O   1 
ATOM   3609 C CB  . ILE B 1 212 ? 11.947  26.158  -47.272 1.00 42.59  ? 224 ILE B CB  1 
ATOM   3610 C CG1 . ILE B 1 212 ? 11.316  27.549  -47.598 1.00 42.22  ? 224 ILE B CG1 1 
ATOM   3611 C CG2 . ILE B 1 212 ? 11.385  25.027  -48.133 1.00 42.79  ? 224 ILE B CG2 1 
ATOM   3612 C CD1 . ILE B 1 212 ? 11.517  28.112  -49.048 1.00 49.91  ? 224 ILE B CD1 1 
ATOM   3613 N N   . ARG B 1 213 ? 13.865  26.964  -45.090 1.00 40.53  ? 225 ARG B N   1 
ATOM   3614 C CA  . ARG B 1 213 ? 14.706  28.040  -44.583 1.00 41.21  ? 225 ARG B CA  1 
ATOM   3615 C C   . ARG B 1 213 ? 15.583  28.544  -45.711 1.00 49.44  ? 225 ARG B C   1 
ATOM   3616 O O   . ARG B 1 213 ? 16.137  27.731  -46.452 1.00 51.32  ? 225 ARG B O   1 
ATOM   3617 C CB  . ARG B 1 213 ? 15.557  27.549  -43.400 1.00 40.04  ? 225 ARG B CB  1 
ATOM   3618 C CG  . ARG B 1 213 ? 14.962  27.921  -42.053 1.00 46.41  ? 225 ARG B CG  1 
ATOM   3619 C CD  . ARG B 1 213 ? 15.720  27.300  -40.892 1.00 50.59  ? 225 ARG B CD  1 
ATOM   3620 N NE  . ARG B 1 213 ? 15.252  25.941  -40.622 1.00 54.52  ? 225 ARG B NE  1 
ATOM   3621 C CZ  . ARG B 1 213 ? 14.664  25.549  -39.496 1.00 65.42  ? 225 ARG B CZ  1 
ATOM   3622 N NH1 . ARG B 1 213 ? 14.494  26.401  -38.493 1.00 56.86  ? 225 ARG B NH1 1 
ATOM   3623 N NH2 . ARG B 1 213 ? 14.266  24.296  -39.355 1.00 51.16  ? 225 ARG B NH2 1 
ATOM   3624 N N   . ASN B 1 214 ? 15.702  29.872  -45.880 1.00 47.13  ? 226 ASN B N   1 
ATOM   3625 C CA  . ASN B 1 214 ? 16.651  30.422  -46.864 1.00 48.50  ? 226 ASN B CA  1 
ATOM   3626 C C   . ASN B 1 214 ? 18.072  30.419  -46.267 1.00 55.88  ? 226 ASN B C   1 
ATOM   3627 O O   . ASN B 1 214 ? 18.240  30.056  -45.102 1.00 55.74  ? 226 ASN B O   1 
ATOM   3628 C CB  . ASN B 1 214 ? 16.225  31.825  -47.353 1.00 44.82  ? 226 ASN B CB  1 
ATOM   3629 C CG  . ASN B 1 214 ? 16.261  32.953  -46.340 1.00 61.60  ? 226 ASN B CG  1 
ATOM   3630 O OD1 . ASN B 1 214 ? 16.937  32.907  -45.304 1.00 62.27  ? 226 ASN B OD1 1 
ATOM   3631 N ND2 . ASN B 1 214 ? 15.574  34.038  -46.657 1.00 48.86  ? 226 ASN B ND2 1 
ATOM   3632 N N   . LYS B 1 215 ? 19.081  30.854  -47.045 1.00 55.78  ? 227 LYS B N   1 
ATOM   3633 C CA  . LYS B 1 215 ? 20.492  30.811  -46.652 1.00 58.07  ? 227 LYS B CA  1 
ATOM   3634 C C   . LYS B 1 215 ? 20.800  31.666  -45.395 1.00 63.57  ? 227 LYS B C   1 
ATOM   3635 O O   . LYS B 1 215 ? 21.754  31.351  -44.679 1.00 65.27  ? 227 LYS B O   1 
ATOM   3636 C CB  . LYS B 1 215 ? 21.374  31.230  -47.825 1.00 62.00  ? 227 LYS B CB  1 
ATOM   3637 C CG  . LYS B 1 215 ? 21.572  30.110  -48.847 1.00 69.09  ? 227 LYS B CG  1 
ATOM   3638 C CD  . LYS B 1 215 ? 22.908  29.388  -48.618 1.00 75.63  ? 227 LYS B CD  1 
ATOM   3639 C CE  . LYS B 1 215 ? 23.102  28.168  -49.484 1.00 80.33  ? 227 LYS B CE  1 
ATOM   3640 N NZ  . LYS B 1 215 ? 24.399  27.489  -49.196 1.00 84.42  ? 227 LYS B NZ  1 
ATOM   3641 N N   . LYS B 1 216 ? 19.994  32.718  -45.122 1.00 59.39  ? 228 LYS B N   1 
ATOM   3642 C CA  . LYS B 1 216 ? 20.097  33.528  -43.900 1.00 59.83  ? 228 LYS B CA  1 
ATOM   3643 C C   . LYS B 1 216 ? 19.441  32.834  -42.683 1.00 64.01  ? 228 LYS B C   1 
ATOM   3644 O O   . LYS B 1 216 ? 19.607  33.295  -41.552 1.00 64.63  ? 228 LYS B O   1 
ATOM   3645 C CB  . LYS B 1 216 ? 19.463  34.913  -44.114 1.00 61.62  ? 228 LYS B CB  1 
ATOM   3646 C CG  . LYS B 1 216 ? 20.364  35.907  -44.844 1.00 81.20  ? 228 LYS B CG  1 
ATOM   3647 C CD  . LYS B 1 216 ? 19.701  37.287  -44.992 1.00 90.23  ? 228 LYS B CD  1 
ATOM   3648 C CE  . LYS B 1 216 ? 20.464  38.437  -44.345 1.00 102.39 ? 228 LYS B CE  1 
ATOM   3649 N NZ  . LYS B 1 216 ? 21.759  38.717  -45.026 1.00 114.47 ? 228 LYS B NZ  1 
ATOM   3650 N N   . GLY B 1 217 ? 18.708  31.750  -42.927 1.00 59.17  ? 229 GLY B N   1 
ATOM   3651 C CA  . GLY B 1 217 ? 18.065  30.965  -41.879 1.00 57.84  ? 229 GLY B CA  1 
ATOM   3652 C C   . GLY B 1 217 ? 16.648  31.403  -41.572 1.00 59.39  ? 229 GLY B C   1 
ATOM   3653 O O   . GLY B 1 217 ? 16.056  30.945  -40.583 1.00 59.28  ? 229 GLY B O   1 
ATOM   3654 N N   . THR B 1 218 ? 16.084  32.278  -42.430 1.00 52.88  ? 230 THR B N   1 
ATOM   3655 C CA  . THR B 1 218 ? 14.736  32.815  -42.270 1.00 49.21  ? 230 THR B CA  1 
ATOM   3656 C C   . THR B 1 218 ? 13.752  31.746  -42.686 1.00 49.35  ? 230 THR B C   1 
ATOM   3657 O O   . THR B 1 218 ? 13.852  31.202  -43.791 1.00 50.12  ? 230 THR B O   1 
ATOM   3658 C CB  . THR B 1 218 ? 14.581  34.142  -43.039 1.00 52.37  ? 230 THR B CB  1 
ATOM   3659 O OG1 . THR B 1 218 ? 15.233  35.164  -42.286 1.00 55.86  ? 230 THR B OG1 1 
ATOM   3660 C CG2 . THR B 1 218 ? 13.126  34.548  -43.245 1.00 45.97  ? 230 THR B CG2 1 
ATOM   3661 N N   . GLU B 1 219 ? 12.808  31.444  -41.790 1.00 41.62  ? 231 GLU B N   1 
ATOM   3662 C CA  . GLU B 1 219 ? 11.769  30.455  -42.012 1.00 39.13  ? 231 GLU B CA  1 
ATOM   3663 C C   . GLU B 1 219 ? 10.756  30.944  -43.028 1.00 41.83  ? 231 GLU B C   1 
ATOM   3664 O O   . GLU B 1 219 ? 10.288  32.076  -42.940 1.00 41.44  ? 231 GLU B O   1 
ATOM   3665 C CB  . GLU B 1 219 ? 11.086  30.110  -40.689 1.00 39.29  ? 231 GLU B CB  1 
ATOM   3666 C CG  . GLU B 1 219 ? 11.995  29.309  -39.770 1.00 39.88  ? 231 GLU B CG  1 
ATOM   3667 C CD  . GLU B 1 219 ? 11.393  28.895  -38.450 1.00 42.50  ? 231 GLU B CD  1 
ATOM   3668 O OE1 . GLU B 1 219 ? 10.155  29.002  -38.286 1.00 38.19  ? 231 GLU B OE1 1 
ATOM   3669 O OE2 . GLU B 1 219 ? 12.164  28.416  -37.589 1.00 30.05  ? 231 GLU B OE2 1 
ATOM   3670 N N   . LEU B 1 220 ? 10.432  30.086  -43.998 1.00 37.81  ? 232 LEU B N   1 
ATOM   3671 C CA  . LEU B 1 220 ? 9.518   30.398  -45.102 1.00 36.54  ? 232 LEU B CA  1 
ATOM   3672 C C   . LEU B 1 220 ? 8.721   29.154  -45.490 1.00 40.57  ? 232 LEU B C   1 
ATOM   3673 O O   . LEU B 1 220 ? 8.895   28.090  -44.887 1.00 40.71  ? 232 LEU B O   1 
ATOM   3674 C CB  . LEU B 1 220 ? 10.300  30.923  -46.343 1.00 37.47  ? 232 LEU B CB  1 
ATOM   3675 C CG  . LEU B 1 220 ? 11.214  32.149  -46.197 1.00 42.42  ? 232 LEU B CG  1 
ATOM   3676 C CD1 . LEU B 1 220 ? 12.260  32.165  -47.281 1.00 43.70  ? 232 LEU B CD1 1 
ATOM   3677 C CD2 . LEU B 1 220 ? 10.420  33.450  -46.154 1.00 41.43  ? 232 LEU B CD2 1 
ATOM   3678 N N   . LEU B 1 221 ? 7.861   29.291  -46.511 1.00 36.26  ? 233 LEU B N   1 
ATOM   3679 C CA  . LEU B 1 221 ? 7.149   28.183  -47.143 1.00 35.72  ? 233 LEU B CA  1 
ATOM   3680 C C   . LEU B 1 221 ? 7.451   28.130  -48.624 1.00 41.46  ? 233 LEU B C   1 
ATOM   3681 O O   . LEU B 1 221 ? 7.611   29.176  -49.254 1.00 42.48  ? 233 LEU B O   1 
ATOM   3682 C CB  . LEU B 1 221 ? 5.619   28.277  -46.941 1.00 33.84  ? 233 LEU B CB  1 
ATOM   3683 C CG  . LEU B 1 221 ? 5.076   28.125  -45.520 1.00 37.12  ? 233 LEU B CG  1 
ATOM   3684 C CD1 . LEU B 1 221 ? 3.649   28.556  -45.471 1.00 36.05  ? 233 LEU B CD1 1 
ATOM   3685 C CD2 . LEU B 1 221 ? 5.176   26.696  -45.025 1.00 37.17  ? 233 LEU B CD2 1 
ATOM   3686 N N   . LEU B 1 222 ? 7.524   26.909  -49.175 1.00 37.33  ? 234 LEU B N   1 
ATOM   3687 C CA  . LEU B 1 222 ? 7.598   26.671  -50.606 1.00 36.60  ? 234 LEU B CA  1 
ATOM   3688 C C   . LEU B 1 222 ? 6.255   26.159  -51.075 1.00 40.48  ? 234 LEU B C   1 
ATOM   3689 O O   . LEU B 1 222 ? 5.732   25.203  -50.515 1.00 40.09  ? 234 LEU B O   1 
ATOM   3690 C CB  . LEU B 1 222 ? 8.732   25.679  -50.950 1.00 37.84  ? 234 LEU B CB  1 
ATOM   3691 C CG  . LEU B 1 222 ? 8.805   25.170  -52.391 1.00 42.56  ? 234 LEU B CG  1 
ATOM   3692 C CD1 . LEU B 1 222 ? 9.466   26.171  -53.291 1.00 44.24  ? 234 LEU B CD1 1 
ATOM   3693 C CD2 . LEU B 1 222 ? 9.532   23.867  -52.469 1.00 45.23  ? 234 LEU B CD2 1 
ATOM   3694 N N   . GLY B 1 223 ? 5.700   26.816  -52.084 1.00 37.38  ? 235 GLY B N   1 
ATOM   3695 C CA  . GLY B 1 223 ? 4.538   26.331  -52.806 1.00 35.38  ? 235 GLY B CA  1 
ATOM   3696 C C   . GLY B 1 223 ? 4.912   25.731  -54.142 1.00 38.18  ? 235 GLY B C   1 
ATOM   3697 O O   . GLY B 1 223 ? 5.524   26.408  -54.959 1.00 37.49  ? 235 GLY B O   1 
ATOM   3698 N N   . VAL B 1 224 ? 4.583   24.446  -54.354 1.00 35.04  ? 236 VAL B N   1 
ATOM   3699 C CA  . VAL B 1 224 ? 4.719   23.766  -55.647 1.00 35.12  ? 236 VAL B CA  1 
ATOM   3700 C C   . VAL B 1 224 ? 3.300   23.569  -56.221 1.00 39.96  ? 236 VAL B C   1 
ATOM   3701 O O   . VAL B 1 224 ? 2.480   22.879  -55.607 1.00 39.00  ? 236 VAL B O   1 
ATOM   3702 C CB  . VAL B 1 224 ? 5.506   22.421  -55.560 1.00 38.87  ? 236 VAL B CB  1 
ATOM   3703 C CG1 . VAL B 1 224 ? 5.802   21.864  -56.944 1.00 39.86  ? 236 VAL B CG1 1 
ATOM   3704 C CG2 . VAL B 1 224 ? 6.790   22.565  -54.757 1.00 39.69  ? 236 VAL B CG2 1 
ATOM   3705 N N   . ASP B 1 225 ? 3.001   24.190  -57.371 1.00 37.73  ? 237 ASP B N   1 
ATOM   3706 C CA  . ASP B 1 225 ? 1.696   24.041  -58.021 1.00 36.61  ? 237 ASP B CA  1 
ATOM   3707 C C   . ASP B 1 225 ? 1.838   23.982  -59.556 1.00 41.35  ? 237 ASP B C   1 
ATOM   3708 O O   . ASP B 1 225 ? 2.957   23.854  -60.065 1.00 41.69  ? 237 ASP B O   1 
ATOM   3709 C CB  . ASP B 1 225 ? 0.721   25.157  -57.579 1.00 36.83  ? 237 ASP B CB  1 
ATOM   3710 C CG  . ASP B 1 225 ? 1.055   26.581  -57.992 1.00 45.06  ? 237 ASP B CG  1 
ATOM   3711 O OD1 . ASP B 1 225 ? 2.004   26.770  -58.792 1.00 47.27  ? 237 ASP B OD1 1 
ATOM   3712 O OD2 . ASP B 1 225 ? 0.347   27.508  -57.543 1.00 47.55  ? 237 ASP B OD2 1 
ATOM   3713 N N   . ALA B 1 226 ? 0.694   24.062  -60.278 1.00 37.93  ? 238 ALA B N   1 
ATOM   3714 C CA  . ALA B 1 226 ? 0.603   23.989  -61.742 1.00 38.78  ? 238 ALA B CA  1 
ATOM   3715 C C   . ALA B 1 226 ? 1.318   25.163  -62.433 1.00 46.13  ? 238 ALA B C   1 
ATOM   3716 O O   . ALA B 1 226 ? 1.788   25.006  -63.567 1.00 48.11  ? 238 ALA B O   1 
ATOM   3717 C CB  . ALA B 1 226 ? -0.860  23.950  -62.171 1.00 38.16  ? 238 ALA B CB  1 
ATOM   3718 N N   . LEU B 1 227 ? 1.410   26.329  -61.750 1.00 42.63  ? 239 LEU B N   1 
ATOM   3719 C CA  . LEU B 1 227 ? 1.908   27.577  -62.345 1.00 43.55  ? 239 LEU B CA  1 
ATOM   3720 C C   . LEU B 1 227 ? 3.420   27.739  -62.206 1.00 50.82  ? 239 LEU B C   1 
ATOM   3721 O O   . LEU B 1 227 ? 4.054   28.326  -63.086 1.00 52.97  ? 239 LEU B O   1 
ATOM   3722 C CB  . LEU B 1 227 ? 1.188   28.788  -61.735 1.00 41.85  ? 239 LEU B CB  1 
ATOM   3723 C CG  . LEU B 1 227 ? -0.344  28.831  -61.955 1.00 44.64  ? 239 LEU B CG  1 
ATOM   3724 C CD1 . LEU B 1 227 ? -0.974  29.944  -61.164 1.00 44.27  ? 239 LEU B CD1 1 
ATOM   3725 C CD2 . LEU B 1 227 ? -0.696  28.993  -63.412 1.00 46.00  ? 239 LEU B CD2 1 
ATOM   3726 N N   . GLY B 1 228 ? 3.974   27.204  -61.121 1.00 47.68  ? 240 GLY B N   1 
ATOM   3727 C CA  . GLY B 1 228 ? 5.396   27.279  -60.809 1.00 48.57  ? 240 GLY B CA  1 
ATOM   3728 C C   . GLY B 1 228 ? 5.718   27.101  -59.339 1.00 50.55  ? 240 GLY B C   1 
ATOM   3729 O O   . GLY B 1 228 ? 4.938   26.499  -58.592 1.00 46.51  ? 240 GLY B O   1 
ATOM   3730 N N   . LEU B 1 229 ? 6.902   27.609  -58.927 1.00 49.41  ? 241 LEU B N   1 
ATOM   3731 C CA  . LEU B 1 229 ? 7.370   27.609  -57.541 1.00 48.63  ? 241 LEU B CA  1 
ATOM   3732 C C   . LEU B 1 229 ? 7.108   28.957  -56.904 1.00 52.28  ? 241 LEU B C   1 
ATOM   3733 O O   . LEU B 1 229 ? 7.265   29.986  -57.558 1.00 53.22  ? 241 LEU B O   1 
ATOM   3734 C CB  . LEU B 1 229 ? 8.861   27.252  -57.447 1.00 50.75  ? 241 LEU B CB  1 
ATOM   3735 C CG  . LEU B 1 229 ? 9.280   25.875  -57.960 1.00 56.88  ? 241 LEU B CG  1 
ATOM   3736 C CD1 . LEU B 1 229 ? 10.773  25.724  -57.898 1.00 59.41  ? 241 LEU B CD1 1 
ATOM   3737 C CD2 . LEU B 1 229 ? 8.626   24.751  -57.177 1.00 57.11  ? 241 LEU B CD2 1 
ATOM   3738 N N   . HIS B 1 230 ? 6.702   28.951  -55.631 1.00 48.16  ? 242 HIS B N   1 
ATOM   3739 C CA  . HIS B 1 230 ? 6.317   30.156  -54.907 1.00 47.59  ? 242 HIS B CA  1 
ATOM   3740 C C   . HIS B 1 230 ? 6.931   30.147  -53.519 1.00 50.20  ? 242 HIS B C   1 
ATOM   3741 O O   . HIS B 1 230 ? 6.989   29.095  -52.882 1.00 49.74  ? 242 HIS B O   1 
ATOM   3742 C CB  . HIS B 1 230 ? 4.789   30.267  -54.827 1.00 47.51  ? 242 HIS B CB  1 
ATOM   3743 C CG  . HIS B 1 230 ? 4.101   30.023  -56.138 1.00 51.74  ? 242 HIS B CG  1 
ATOM   3744 N ND1 . HIS B 1 230 ? 4.080   30.987  -57.133 1.00 54.58  ? 242 HIS B ND1 1 
ATOM   3745 C CD2 . HIS B 1 230 ? 3.486   28.907  -56.596 1.00 53.44  ? 242 HIS B CD2 1 
ATOM   3746 C CE1 . HIS B 1 230 ? 3.445   30.434  -58.153 1.00 54.37  ? 242 HIS B CE1 1 
ATOM   3747 N NE2 . HIS B 1 230 ? 3.063   29.186  -57.876 1.00 53.84  ? 242 HIS B NE2 1 
ATOM   3748 N N   . ILE B 1 231 ? 7.422   31.311  -53.068 1.00 45.84  ? 243 ILE B N   1 
ATOM   3749 C CA  . ILE B 1 231 ? 8.001   31.476  -51.737 1.00 44.96  ? 243 ILE B CA  1 
ATOM   3750 C C   . ILE B 1 231 ? 7.050   32.336  -50.910 1.00 48.44  ? 243 ILE B C   1 
ATOM   3751 O O   . ILE B 1 231 ? 6.668   33.428  -51.331 1.00 47.82  ? 243 ILE B O   1 
ATOM   3752 C CB  . ILE B 1 231 ? 9.447   32.042  -51.785 1.00 49.48  ? 243 ILE B CB  1 
ATOM   3753 C CG1 . ILE B 1 231 ? 10.380  31.217  -52.715 1.00 51.14  ? 243 ILE B CG1 1 
ATOM   3754 C CG2 . ILE B 1 231 ? 10.048  32.202  -50.395 1.00 50.00  ? 243 ILE B CG2 1 
ATOM   3755 C CD1 . ILE B 1 231 ? 10.476  29.663  -52.486 1.00 53.83  ? 243 ILE B CD1 1 
ATOM   3756 N N   . TYR B 1 232 ? 6.648   31.817  -49.747 1.00 44.49  ? 244 TYR B N   1 
ATOM   3757 C CA  . TYR B 1 232 ? 5.700   32.474  -48.858 1.00 43.25  ? 244 TYR B CA  1 
ATOM   3758 C C   . TYR B 1 232 ? 6.339   32.820  -47.543 1.00 51.16  ? 244 TYR B C   1 
ATOM   3759 O O   . TYR B 1 232 ? 7.224   32.098  -47.075 1.00 51.91  ? 244 TYR B O   1 
ATOM   3760 C CB  . TYR B 1 232 ? 4.498   31.558  -48.585 1.00 42.44  ? 244 TYR B CB  1 
ATOM   3761 C CG  . TYR B 1 232 ? 3.695   31.142  -49.800 1.00 42.33  ? 244 TYR B CG  1 
ATOM   3762 C CD1 . TYR B 1 232 ? 4.016   29.990  -50.510 1.00 44.50  ? 244 TYR B CD1 1 
ATOM   3763 C CD2 . TYR B 1 232 ? 2.553   31.833  -50.172 1.00 42.25  ? 244 TYR B CD2 1 
ATOM   3764 C CE1 . TYR B 1 232 ? 3.257   29.577  -51.604 1.00 45.35  ? 244 TYR B CE1 1 
ATOM   3765 C CE2 . TYR B 1 232 ? 1.791   31.437  -51.273 1.00 43.12  ? 244 TYR B CE2 1 
ATOM   3766 C CZ  . TYR B 1 232 ? 2.140   30.300  -51.982 1.00 50.01  ? 244 TYR B CZ  1 
ATOM   3767 O OH  . TYR B 1 232 ? 1.384   29.890  -53.054 1.00 48.94  ? 244 TYR B OH  1 
ATOM   3768 N N   . ASP B 1 233 ? 5.911   33.944  -46.949 1.00 50.35  ? 245 ASP B N   1 
ATOM   3769 C CA  . ASP B 1 233 ? 6.047   34.172  -45.506 1.00 50.80  ? 245 ASP B CA  1 
ATOM   3770 C C   . ASP B 1 233 ? 5.273   33.078  -44.784 1.00 52.48  ? 245 ASP B C   1 
ATOM   3771 O O   . ASP B 1 233 ? 4.163   32.752  -45.233 1.00 51.98  ? 245 ASP B O   1 
ATOM   3772 C CB  . ASP B 1 233 ? 5.512   35.556  -45.107 1.00 53.68  ? 245 ASP B CB  1 
ATOM   3773 C CG  . ASP B 1 233 ? 6.459   36.709  -45.360 1.00 77.06  ? 245 ASP B CG  1 
ATOM   3774 O OD1 . ASP B 1 233 ? 7.609   36.662  -44.855 1.00 80.94  ? 245 ASP B OD1 1 
ATOM   3775 O OD2 . ASP B 1 233 ? 6.065   37.653  -46.083 1.00 85.73  ? 245 ASP B OD2 1 
ATOM   3776 N N   . PRO B 1 234 ? 5.824   32.496  -43.686 1.00 46.90  ? 246 PRO B N   1 
ATOM   3777 C CA  . PRO B 1 234 ? 5.176   31.327  -43.060 1.00 45.90  ? 246 PRO B CA  1 
ATOM   3778 C C   . PRO B 1 234 ? 3.773   31.606  -42.521 1.00 51.40  ? 246 PRO B C   1 
ATOM   3779 O O   . PRO B 1 234 ? 3.026   30.657  -42.279 1.00 49.33  ? 246 PRO B O   1 
ATOM   3780 C CB  . PRO B 1 234 ? 6.133   30.958  -41.917 1.00 47.91  ? 246 PRO B CB  1 
ATOM   3781 C CG  . PRO B 1 234 ? 6.940   32.170  -41.667 1.00 52.22  ? 246 PRO B CG  1 
ATOM   3782 C CD  . PRO B 1 234 ? 7.063   32.867  -42.970 1.00 48.39  ? 246 PRO B CD  1 
ATOM   3783 N N   . GLU B 1 235 ? 3.418   32.899  -42.345 1.00 51.48  ? 247 GLU B N   1 
ATOM   3784 C CA  . GLU B 1 235 ? 2.118   33.317  -41.819 1.00 52.20  ? 247 GLU B CA  1 
ATOM   3785 C C   . GLU B 1 235 ? 1.226   33.957  -42.917 1.00 57.83  ? 247 GLU B C   1 
ATOM   3786 O O   . GLU B 1 235 ? 0.344   34.752  -42.600 1.00 60.02  ? 247 GLU B O   1 
ATOM   3787 C CB  . GLU B 1 235 ? 2.304   34.280  -40.630 1.00 54.43  ? 247 GLU B CB  1 
ATOM   3788 C CG  . GLU B 1 235 ? 3.101   33.707  -39.461 1.00 64.62  ? 247 GLU B CG  1 
ATOM   3789 C CD  . GLU B 1 235 ? 2.722   32.319  -38.980 1.00 78.10  ? 247 GLU B CD  1 
ATOM   3790 O OE1 . GLU B 1 235 ? 1.527   32.102  -38.683 1.00 62.56  ? 247 GLU B OE1 1 
ATOM   3791 O OE2 . GLU B 1 235 ? 3.631   31.470  -38.830 1.00 72.96  ? 247 GLU B OE2 1 
ATOM   3792 N N   . ASN B 1 236 ? 1.477   33.637  -44.197 1.00 51.55  ? 248 ASN B N   1 
ATOM   3793 C CA  . ASN B 1 236 ? 0.602   34.026  -45.304 1.00 49.77  ? 248 ASN B CA  1 
ATOM   3794 C C   . ASN B 1 236 ? 0.760   33.019  -46.438 1.00 51.83  ? 248 ASN B C   1 
ATOM   3795 O O   . ASN B 1 236 ? 1.665   33.134  -47.263 1.00 52.18  ? 248 ASN B O   1 
ATOM   3796 C CB  . ASN B 1 236 ? 0.851   35.473  -45.777 1.00 50.90  ? 248 ASN B CB  1 
ATOM   3797 C CG  . ASN B 1 236 ? -0.137  36.004  -46.803 1.00 78.63  ? 248 ASN B CG  1 
ATOM   3798 O OD1 . ASN B 1 236 ? -1.206  35.434  -47.056 1.00 65.20  ? 248 ASN B OD1 1 
ATOM   3799 N ND2 . ASN B 1 236 ? 0.193   37.139  -47.396 1.00 79.37  ? 248 ASN B ND2 1 
ATOM   3800 N N   . ARG B 1 237 ? -0.128  32.016  -46.454 1.00 46.76  ? 249 ARG B N   1 
ATOM   3801 C CA  . ARG B 1 237 ? -0.168  30.960  -47.469 1.00 45.81  ? 249 ARG B CA  1 
ATOM   3802 C C   . ARG B 1 237 ? -0.981  31.404  -48.699 1.00 50.11  ? 249 ARG B C   1 
ATOM   3803 O O   . ARG B 1 237 ? -1.098  30.645  -49.662 1.00 48.75  ? 249 ARG B O   1 
ATOM   3804 C CB  . ARG B 1 237 ? -0.758  29.656  -46.883 1.00 41.49  ? 249 ARG B CB  1 
ATOM   3805 C CG  . ARG B 1 237 ? 0.008   29.112  -45.700 1.00 39.94  ? 249 ARG B CG  1 
ATOM   3806 C CD  . ARG B 1 237 ? -0.239  27.634  -45.448 1.00 31.52  ? 249 ARG B CD  1 
ATOM   3807 N NE  . ARG B 1 237 ? 0.664   27.150  -44.398 1.00 40.83  ? 249 ARG B NE  1 
ATOM   3808 C CZ  . ARG B 1 237 ? 1.115   25.904  -44.307 1.00 57.84  ? 249 ARG B CZ  1 
ATOM   3809 N NH1 . ARG B 1 237 ? 0.721   24.986  -45.178 1.00 45.91  ? 249 ARG B NH1 1 
ATOM   3810 N NH2 . ARG B 1 237 ? 1.953   25.562  -43.338 1.00 45.98  ? 249 ARG B NH2 1 
ATOM   3811 N N   . LEU B 1 238 ? -1.518  32.636  -48.677 1.00 48.33  ? 250 LEU B N   1 
ATOM   3812 C CA  . LEU B 1 238 ? -2.403  33.135  -49.734 1.00 47.83  ? 250 LEU B CA  1 
ATOM   3813 C C   . LEU B 1 238 ? -1.637  33.895  -50.815 1.00 53.27  ? 250 LEU B C   1 
ATOM   3814 O O   . LEU B 1 238 ? -1.863  33.631  -51.997 1.00 53.31  ? 250 LEU B O   1 
ATOM   3815 C CB  . LEU B 1 238 ? -3.517  34.022  -49.155 1.00 46.97  ? 250 LEU B CB  1 
ATOM   3816 C CG  . LEU B 1 238 ? -4.443  33.398  -48.120 1.00 49.47  ? 250 LEU B CG  1 
ATOM   3817 C CD1 . LEU B 1 238 ? -5.414  34.437  -47.597 1.00 49.21  ? 250 LEU B CD1 1 
ATOM   3818 C CD2 . LEU B 1 238 ? -5.198  32.207  -48.698 1.00 50.14  ? 250 LEU B CD2 1 
ATOM   3819 N N   . THR B 1 239 ? -0.737  34.817  -50.418 1.00 51.33  ? 251 THR B N   1 
ATOM   3820 C CA  . THR B 1 239 ? -0.013  35.685  -51.346 1.00 53.08  ? 251 THR B CA  1 
ATOM   3821 C C   . THR B 1 239 ? 1.505   35.406  -51.252 1.00 57.31  ? 251 THR B C   1 
ATOM   3822 O O   . THR B 1 239 ? 2.124   35.702  -50.219 1.00 56.51  ? 251 THR B O   1 
ATOM   3823 C CB  . THR B 1 239 ? -0.359  37.163  -51.088 1.00 67.57  ? 251 THR B CB  1 
ATOM   3824 O OG1 . THR B 1 239 ? -1.777  37.318  -51.167 1.00 72.26  ? 251 THR B OG1 1 
ATOM   3825 C CG2 . THR B 1 239 ? 0.311   38.109  -52.082 1.00 68.39  ? 251 THR B CG2 1 
ATOM   3826 N N   . PRO B 1 240 ? 2.109   34.822  -52.319 1.00 53.55  ? 252 PRO B N   1 
ATOM   3827 C CA  . PRO B 1 240 ? 3.562   34.604  -52.302 1.00 53.83  ? 252 PRO B CA  1 
ATOM   3828 C C   . PRO B 1 240 ? 4.351   35.902  -52.322 1.00 58.73  ? 252 PRO B C   1 
ATOM   3829 O O   . PRO B 1 240 ? 3.901   36.901  -52.870 1.00 59.22  ? 252 PRO B O   1 
ATOM   3830 C CB  . PRO B 1 240 ? 3.824   33.772  -53.563 1.00 56.06  ? 252 PRO B CB  1 
ATOM   3831 C CG  . PRO B 1 240 ? 2.669   34.012  -54.442 1.00 60.33  ? 252 PRO B CG  1 
ATOM   3832 C CD  . PRO B 1 240 ? 1.496   34.296  -53.559 1.00 54.71  ? 252 PRO B CD  1 
ATOM   3833 N N   . LYS B 1 241 ? 5.516   35.880  -51.671 1.00 55.80  ? 253 LYS B N   1 
ATOM   3834 C CA  . LYS B 1 241 ? 6.528   36.933  -51.709 1.00 56.60  ? 253 LYS B CA  1 
ATOM   3835 C C   . LYS B 1 241 ? 7.240   36.932  -53.070 1.00 60.00  ? 253 LYS B C   1 
ATOM   3836 O O   . LYS B 1 241 ? 7.472   37.991  -53.644 1.00 60.84  ? 253 LYS B O   1 
ATOM   3837 C CB  . LYS B 1 241 ? 7.546   36.708  -50.584 1.00 58.74  ? 253 LYS B CB  1 
ATOM   3838 C CG  . LYS B 1 241 ? 7.284   37.468  -49.302 1.00 73.91  ? 253 LYS B CG  1 
ATOM   3839 C CD  . LYS B 1 241 ? 8.381   37.124  -48.296 1.00 87.64  ? 253 LYS B CD  1 
ATOM   3840 C CE  . LYS B 1 241 ? 9.583   38.050  -48.332 1.00 99.46  ? 253 LYS B CE  1 
ATOM   3841 N NZ  . LYS B 1 241 ? 10.670  37.578  -47.437 1.00 103.70 ? 253 LYS B NZ  1 
ATOM   3842 N N   . ILE B 1 242 ? 7.618   35.735  -53.556 1.00 54.99  ? 254 ILE B N   1 
ATOM   3843 C CA  . ILE B 1 242 ? 8.304   35.516  -54.829 1.00 55.86  ? 254 ILE B CA  1 
ATOM   3844 C C   . ILE B 1 242 ? 7.594   34.384  -55.573 1.00 58.11  ? 254 ILE B C   1 
ATOM   3845 O O   . ILE B 1 242 ? 7.159   33.416  -54.952 1.00 55.31  ? 254 ILE B O   1 
ATOM   3846 C CB  . ILE B 1 242 ? 9.829   35.199  -54.657 1.00 60.42  ? 254 ILE B CB  1 
ATOM   3847 C CG1 . ILE B 1 242 ? 10.507  36.031  -53.550 1.00 61.05  ? 254 ILE B CG1 1 
ATOM   3848 C CG2 . ILE B 1 242 ? 10.573  35.347  -55.985 1.00 63.77  ? 254 ILE B CG2 1 
ATOM   3849 C CD1 . ILE B 1 242 ? 11.752  35.368  -52.903 1.00 68.39  ? 254 ILE B CD1 1 
ATOM   3850 N N   . SER B 1 243 ? 7.482   34.511  -56.899 1.00 56.68  ? 255 SER B N   1 
ATOM   3851 C CA  . SER B 1 243 ? 7.003   33.445  -57.776 1.00 56.34  ? 255 SER B CA  1 
ATOM   3852 C C   . SER B 1 243 ? 8.005   33.186  -58.888 1.00 64.21  ? 255 SER B C   1 
ATOM   3853 O O   . SER B 1 243 ? 8.578   34.127  -59.450 1.00 66.64  ? 255 SER B O   1 
ATOM   3854 C CB  . SER B 1 243 ? 5.636   33.787  -58.356 1.00 57.92  ? 255 SER B CB  1 
ATOM   3855 O OG  . SER B 1 243 ? 4.637   33.766  -57.348 1.00 63.19  ? 255 SER B OG  1 
ATOM   3856 N N   . PHE B 1 244 ? 8.248   31.902  -59.169 1.00 60.86  ? 256 PHE B N   1 
ATOM   3857 C CA  . PHE B 1 244 ? 9.073   31.446  -60.285 1.00 62.74  ? 256 PHE B CA  1 
ATOM   3858 C C   . PHE B 1 244 ? 8.180   30.595  -61.202 1.00 67.03  ? 256 PHE B C   1 
ATOM   3859 O O   . PHE B 1 244 ? 7.950   29.417  -60.901 1.00 66.45  ? 256 PHE B O   1 
ATOM   3860 C CB  . PHE B 1 244 ? 10.310  30.663  -59.789 1.00 65.20  ? 256 PHE B CB  1 
ATOM   3861 C CG  . PHE B 1 244 ? 11.183  31.380  -58.784 1.00 67.12  ? 256 PHE B CG  1 
ATOM   3862 C CD1 . PHE B 1 244 ? 12.206  32.218  -59.202 1.00 72.38  ? 256 PHE B CD1 1 
ATOM   3863 C CD2 . PHE B 1 244 ? 11.012  31.179  -57.418 1.00 67.45  ? 256 PHE B CD2 1 
ATOM   3864 C CE1 . PHE B 1 244 ? 13.021  32.870  -58.273 1.00 73.49  ? 256 PHE B CE1 1 
ATOM   3865 C CE2 . PHE B 1 244 ? 11.830  31.835  -56.487 1.00 70.52  ? 256 PHE B CE2 1 
ATOM   3866 C CZ  . PHE B 1 244 ? 12.829  32.671  -56.922 1.00 70.61  ? 256 PHE B CZ  1 
ATOM   3867 N N   . PRO B 1 245 ? 7.591   31.180  -62.276 1.00 63.41  ? 257 PRO B N   1 
ATOM   3868 C CA  . PRO B 1 245 ? 6.794   30.360  -63.216 1.00 62.38  ? 257 PRO B CA  1 
ATOM   3869 C C   . PRO B 1 245 ? 7.651   29.302  -63.916 1.00 66.29  ? 257 PRO B C   1 
ATOM   3870 O O   . PRO B 1 245 ? 8.832   29.562  -64.154 1.00 67.52  ? 257 PRO B O   1 
ATOM   3871 C CB  . PRO B 1 245 ? 6.251   31.393  -64.203 1.00 65.14  ? 257 PRO B CB  1 
ATOM   3872 C CG  . PRO B 1 245 ? 6.329   32.705  -63.474 1.00 69.36  ? 257 PRO B CG  1 
ATOM   3873 C CD  . PRO B 1 245 ? 7.574   32.605  -62.664 1.00 65.59  ? 257 PRO B CD  1 
ATOM   3874 N N   . TRP B 1 246 ? 7.073   28.114  -64.236 1.00 61.35  ? 258 TRP B N   1 
ATOM   3875 C CA  . TRP B 1 246 ? 7.834   26.973  -64.780 1.00 62.50  ? 258 TRP B CA  1 
ATOM   3876 C C   . TRP B 1 246 ? 8.616   27.327  -66.064 1.00 70.97  ? 258 TRP B C   1 
ATOM   3877 O O   . TRP B 1 246 ? 9.731   26.821  -66.256 1.00 73.21  ? 258 TRP B O   1 
ATOM   3878 C CB  . TRP B 1 246 ? 6.935   25.746  -65.045 1.00 59.56  ? 258 TRP B CB  1 
ATOM   3879 C CG  . TRP B 1 246 ? 6.403   25.075  -63.810 1.00 57.44  ? 258 TRP B CG  1 
ATOM   3880 C CD1 . TRP B 1 246 ? 5.093   24.880  -63.485 1.00 57.89  ? 258 TRP B CD1 1 
ATOM   3881 C CD2 . TRP B 1 246 ? 7.172   24.468  -62.759 1.00 56.92  ? 258 TRP B CD2 1 
ATOM   3882 N NE1 . TRP B 1 246 ? 4.996   24.199  -62.294 1.00 55.55  ? 258 TRP B NE1 1 
ATOM   3883 C CE2 . TRP B 1 246 ? 6.257   23.936  -61.824 1.00 58.14  ? 258 TRP B CE2 1 
ATOM   3884 C CE3 . TRP B 1 246 ? 8.553   24.321  -62.516 1.00 59.58  ? 258 TRP B CE3 1 
ATOM   3885 C CZ2 . TRP B 1 246 ? 6.674   23.292  -60.655 1.00 56.84  ? 258 TRP B CZ2 1 
ATOM   3886 C CZ3 . TRP B 1 246 ? 8.965   23.672  -61.364 1.00 60.24  ? 258 TRP B CZ3 1 
ATOM   3887 C CH2 . TRP B 1 246 ? 8.033   23.172  -60.446 1.00 58.81  ? 258 TRP B CH2 1 
ATOM   3888 N N   . ASN B 1 247 ? 8.042   28.207  -66.917 1.00 68.38  ? 259 ASN B N   1 
ATOM   3889 C CA  . ASN B 1 247 ? 8.652   28.685  -68.163 1.00 71.16  ? 259 ASN B CA  1 
ATOM   3890 C C   . ASN B 1 247 ? 9.839   29.642  -67.894 1.00 77.44  ? 259 ASN B C   1 
ATOM   3891 O O   . ASN B 1 247 ? 10.680  29.825  -68.779 1.00 80.62  ? 259 ASN B O   1 
ATOM   3892 C CB  . ASN B 1 247 ? 7.601   29.369  -69.058 1.00 69.14  ? 259 ASN B CB  1 
ATOM   3893 C CG  . ASN B 1 247 ? 6.895   30.565  -68.447 1.00 79.61  ? 259 ASN B CG  1 
ATOM   3894 O OD1 . ASN B 1 247 ? 6.386   30.527  -67.324 1.00 61.68  ? 259 ASN B OD1 1 
ATOM   3895 N ND2 . ASN B 1 247 ? 6.774   31.632  -69.216 1.00 75.41  ? 259 ASN B ND2 1 
ATOM   3896 N N   . GLU B 1 248 ? 9.905   30.229  -66.679 1.00 71.73  ? 260 GLU B N   1 
ATOM   3897 C CA  . GLU B 1 248 ? 10.931  31.185  -66.262 1.00 72.79  ? 260 GLU B CA  1 
ATOM   3898 C C   . GLU B 1 248 ? 12.013  30.536  -65.363 1.00 77.35  ? 260 GLU B C   1 
ATOM   3899 O O   . GLU B 1 248 ? 12.850  31.252  -64.799 1.00 78.27  ? 260 GLU B O   1 
ATOM   3900 C CB  . GLU B 1 248 ? 10.274  32.368  -65.536 1.00 72.72  ? 260 GLU B CB  1 
ATOM   3901 C CG  . GLU B 1 248 ? 9.710   33.420  -66.476 1.00 86.42  ? 260 GLU B CG  1 
ATOM   3902 C CD  . GLU B 1 248 ? 8.719   34.390  -65.861 1.00 109.28 ? 260 GLU B CD  1 
ATOM   3903 O OE1 . GLU B 1 248 ? 9.061   35.039  -64.844 1.00 102.63 ? 260 GLU B OE1 1 
ATOM   3904 O OE2 . GLU B 1 248 ? 7.607   34.526  -66.425 1.00 102.09 ? 260 GLU B OE2 1 
ATOM   3905 N N   . ILE B 1 249 ? 12.007  29.194  -65.237 1.00 73.29  ? 261 ILE B N   1 
ATOM   3906 C CA  . ILE B 1 249 ? 13.017  28.456  -64.468 1.00 73.76  ? 261 ILE B CA  1 
ATOM   3907 C C   . ILE B 1 249 ? 13.971  27.767  -65.452 1.00 82.58  ? 261 ILE B C   1 
ATOM   3908 O O   . ILE B 1 249 ? 13.529  26.939  -66.252 1.00 83.16  ? 261 ILE B O   1 
ATOM   3909 C CB  . ILE B 1 249 ? 12.368  27.448  -63.458 1.00 74.00  ? 261 ILE B CB  1 
ATOM   3910 C CG1 . ILE B 1 249 ? 11.575  28.185  -62.353 1.00 71.14  ? 261 ILE B CG1 1 
ATOM   3911 C CG2 . ILE B 1 249 ? 13.416  26.497  -62.843 1.00 75.85  ? 261 ILE B CG2 1 
ATOM   3912 C CD1 . ILE B 1 249 ? 10.539  27.335  -61.613 1.00 69.87  ? 261 ILE B CD1 1 
ATOM   3913 N N   . ARG B 1 250 ? 15.269  28.120  -65.400 1.00 83.04  ? 262 ARG B N   1 
ATOM   3914 C CA  . ARG B 1 250 ? 16.305  27.489  -66.226 1.00 86.74  ? 262 ARG B CA  1 
ATOM   3915 C C   . ARG B 1 250 ? 16.513  26.037  -65.762 1.00 91.05  ? 262 ARG B C   1 
ATOM   3916 O O   . ARG B 1 250 ? 16.486  25.124  -66.589 1.00 92.61  ? 262 ARG B O   1 
ATOM   3917 C CB  . ARG B 1 250 ? 17.616  28.296  -66.184 1.00 89.88  ? 262 ARG B CB  1 
ATOM   3918 C CG  . ARG B 1 250 ? 18.662  27.848  -67.205 1.00 105.64 ? 262 ARG B CG  1 
ATOM   3919 C CD  . ARG B 1 250 ? 19.900  28.725  -67.160 1.00 119.79 ? 262 ARG B CD  1 
ATOM   3920 N NE  . ARG B 1 250 ? 21.109  27.948  -66.880 1.00 133.88 ? 262 ARG B NE  1 
ATOM   3921 C CZ  . ARG B 1 250 ? 21.919  27.452  -67.811 1.00 154.66 ? 262 ARG B CZ  1 
ATOM   3922 N NH1 . ARG B 1 250 ? 21.663  27.650  -69.099 1.00 145.18 ? 262 ARG B NH1 1 
ATOM   3923 N NH2 . ARG B 1 250 ? 22.994  26.758  -67.462 1.00 143.88 ? 262 ARG B NH2 1 
ATOM   3924 N N   . ASN B 1 251 ? 16.706  25.833  -64.444 1.00 85.64  ? 263 ASN B N   1 
ATOM   3925 C CA  . ASN B 1 251 ? 16.805  24.514  -63.820 1.00 84.98  ? 263 ASN B CA  1 
ATOM   3926 C C   . ASN B 1 251 ? 16.558  24.589  -62.317 1.00 86.02  ? 263 ASN B C   1 
ATOM   3927 O O   . ASN B 1 251 ? 16.641  25.663  -61.709 1.00 84.55  ? 263 ASN B O   1 
ATOM   3928 C CB  . ASN B 1 251 ? 18.170  23.847  -64.093 1.00 90.72  ? 263 ASN B CB  1 
ATOM   3929 C CG  . ASN B 1 251 ? 19.378  24.595  -63.567 1.00 116.94 ? 263 ASN B CG  1 
ATOM   3930 O OD1 . ASN B 1 251 ? 19.634  24.659  -62.356 1.00 109.75 ? 263 ASN B OD1 1 
ATOM   3931 N ND2 . ASN B 1 251 ? 20.186  25.119  -64.479 1.00 111.27 ? 263 ASN B ND2 1 
ATOM   3932 N N   . ILE B 1 252 ? 16.230  23.433  -61.735 1.00 81.41  ? 264 ILE B N   1 
ATOM   3933 C CA  . ILE B 1 252 ? 16.243  23.195  -60.296 1.00 79.58  ? 264 ILE B CA  1 
ATOM   3934 C C   . ILE B 1 252 ? 17.310  22.135  -60.030 1.00 85.11  ? 264 ILE B C   1 
ATOM   3935 O O   . ILE B 1 252 ? 17.448  21.195  -60.820 1.00 87.03  ? 264 ILE B O   1 
ATOM   3936 C CB  . ILE B 1 252 ? 14.834  22.798  -59.781 1.00 79.73  ? 264 ILE B CB  1 
ATOM   3937 C CG1 . ILE B 1 252 ? 13.881  23.999  -59.859 1.00 78.27  ? 264 ILE B CG1 1 
ATOM   3938 C CG2 . ILE B 1 252 ? 14.875  22.236  -58.345 1.00 79.42  ? 264 ILE B CG2 1 
ATOM   3939 C CD1 . ILE B 1 252 ? 12.559  23.667  -60.401 1.00 87.86  ? 264 ILE B CD1 1 
ATOM   3940 N N   . SER B 1 253 ? 18.096  22.321  -58.957 1.00 80.36  ? 265 SER B N   1 
ATOM   3941 C CA  . SER B 1 253 ? 19.076  21.335  -58.499 1.00 81.17  ? 265 SER B CA  1 
ATOM   3942 C C   . SER B 1 253 ? 18.916  21.078  -56.997 1.00 80.74  ? 265 SER B C   1 
ATOM   3943 O O   . SER B 1 253 ? 18.425  21.939  -56.264 1.00 76.89  ? 265 SER B O   1 
ATOM   3944 C CB  . SER B 1 253 ? 20.499  21.777  -58.830 1.00 87.16  ? 265 SER B CB  1 
ATOM   3945 O OG  . SER B 1 253 ? 20.721  23.150  -58.550 1.00 94.88  ? 265 SER B OG  1 
ATOM   3946 N N   . TYR B 1 254 ? 19.292  19.873  -56.559 1.00 77.63  ? 266 TYR B N   1 
ATOM   3947 C CA  . TYR B 1 254 ? 19.265  19.481  -55.156 1.00 75.94  ? 266 TYR B CA  1 
ATOM   3948 C C   . TYR B 1 254 ? 20.580  18.778  -54.773 1.00 84.12  ? 266 TYR B C   1 
ATOM   3949 O O   . TYR B 1 254 ? 21.002  17.837  -55.453 1.00 86.33  ? 266 TYR B O   1 
ATOM   3950 C CB  . TYR B 1 254 ? 18.047  18.585  -54.864 1.00 73.80  ? 266 TYR B CB  1 
ATOM   3951 C CG  . TYR B 1 254 ? 18.036  18.039  -53.456 1.00 73.81  ? 266 TYR B CG  1 
ATOM   3952 C CD1 . TYR B 1 254 ? 17.622  18.825  -52.386 1.00 73.23  ? 266 TYR B CD1 1 
ATOM   3953 C CD2 . TYR B 1 254 ? 18.466  16.742  -53.187 1.00 76.19  ? 266 TYR B CD2 1 
ATOM   3954 C CE1 . TYR B 1 254 ? 17.645  18.339  -51.081 1.00 73.50  ? 266 TYR B CE1 1 
ATOM   3955 C CE2 . TYR B 1 254 ? 18.491  16.244  -51.886 1.00 76.80  ? 266 TYR B CE2 1 
ATOM   3956 C CZ  . TYR B 1 254 ? 18.080  17.047  -50.836 1.00 80.79  ? 266 TYR B CZ  1 
ATOM   3957 O OH  . TYR B 1 254 ? 18.109  16.556  -49.554 1.00 80.18  ? 266 TYR B OH  1 
ATOM   3958 N N   . SER B 1 255 ? 21.216  19.245  -53.683 1.00 81.26  ? 267 SER B N   1 
ATOM   3959 C CA  . SER B 1 255 ? 22.433  18.659  -53.116 1.00 84.17  ? 267 SER B CA  1 
ATOM   3960 C C   . SER B 1 255 ? 22.433  18.778  -51.590 1.00 87.44  ? 267 SER B C   1 
ATOM   3961 O O   . SER B 1 255 ? 22.070  19.826  -51.056 1.00 84.89  ? 267 SER B O   1 
ATOM   3962 C CB  . SER B 1 255 ? 23.676  19.323  -53.696 1.00 90.53  ? 267 SER B CB  1 
ATOM   3963 O OG  . SER B 1 255 ? 24.849  18.692  -53.208 1.00 104.07 ? 267 SER B OG  1 
ATOM   3964 N N   . ASP B 1 256 ? 22.871  17.701  -50.902 1.00 86.19  ? 268 ASP B N   1 
ATOM   3965 C CA  . ASP B 1 256 ? 22.880  17.524  -49.441 1.00 85.78  ? 268 ASP B CA  1 
ATOM   3966 C C   . ASP B 1 256 ? 21.452  17.678  -48.904 1.00 84.98  ? 268 ASP B C   1 
ATOM   3967 O O   . ASP B 1 256 ? 20.716  16.690  -48.888 1.00 84.91  ? 268 ASP B O   1 
ATOM   3968 C CB  . ASP B 1 256 ? 23.878  18.478  -48.740 1.00 89.15  ? 268 ASP B CB  1 
ATOM   3969 C CG  . ASP B 1 256 ? 24.635  17.876  -47.562 1.00 102.17 ? 268 ASP B CG  1 
ATOM   3970 O OD1 . ASP B 1 256 ? 23.976  17.339  -46.638 1.00 100.78 ? 268 ASP B OD1 1 
ATOM   3971 O OD2 . ASP B 1 256 ? 25.881  17.999  -47.532 1.00 113.04 ? 268 ASP B OD2 1 
ATOM   3972 N N   . LYS B 1 257 ? 21.057  18.901  -48.492 1.00 77.48  ? 269 LYS B N   1 
ATOM   3973 C CA  . LYS B 1 257 ? 19.678  19.242  -48.104 1.00 72.89  ? 269 LYS B CA  1 
ATOM   3974 C C   . LYS B 1 257 ? 19.250  20.577  -48.732 1.00 71.03  ? 269 LYS B C   1 
ATOM   3975 O O   . LYS B 1 257 ? 18.179  21.100  -48.399 1.00 68.36  ? 269 LYS B O   1 
ATOM   3976 C CB  . LYS B 1 257 ? 19.534  19.309  -46.572 1.00 75.41  ? 269 LYS B CB  1 
ATOM   3977 C CG  . LYS B 1 257 ? 19.354  17.969  -45.878 1.00 95.55  ? 269 LYS B CG  1 
ATOM   3978 C CD  . LYS B 1 257 ? 19.006  18.191  -44.415 1.00 107.03 ? 269 LYS B CD  1 
ATOM   3979 C CE  . LYS B 1 257 ? 19.417  17.059  -43.511 1.00 119.25 ? 269 LYS B CE  1 
ATOM   3980 N NZ  . LYS B 1 257 ? 18.909  17.278  -42.133 1.00 123.43 ? 269 LYS B NZ  1 
ATOM   3981 N N   . GLU B 1 258 ? 20.089  21.128  -49.632 1.00 66.02  ? 270 GLU B N   1 
ATOM   3982 C CA  . GLU B 1 258 ? 19.855  22.432  -50.241 1.00 63.58  ? 270 GLU B CA  1 
ATOM   3983 C C   . GLU B 1 258 ? 19.323  22.289  -51.658 1.00 65.90  ? 270 GLU B C   1 
ATOM   3984 O O   . GLU B 1 258 ? 19.849  21.508  -52.451 1.00 67.72  ? 270 GLU B O   1 
ATOM   3985 C CB  . GLU B 1 258 ? 21.125  23.305  -50.234 1.00 66.66  ? 270 GLU B CB  1 
ATOM   3986 C CG  . GLU B 1 258 ? 20.855  24.807  -50.195 1.00 73.77  ? 270 GLU B CG  1 
ATOM   3987 C CD  . GLU B 1 258 ? 20.418  25.404  -48.864 1.00 97.32  ? 270 GLU B CD  1 
ATOM   3988 O OE1 . GLU B 1 258 ? 20.492  24.698  -47.832 1.00 94.69  ? 270 GLU B OE1 1 
ATOM   3989 O OE2 . GLU B 1 258 ? 20.014  26.589  -48.848 1.00 92.09  ? 270 GLU B OE2 1 
ATOM   3990 N N   . PHE B 1 259 ? 18.248  23.036  -51.942 1.00 58.48  ? 271 PHE B N   1 
ATOM   3991 C CA  . PHE B 1 259 ? 17.683  23.268  -53.264 1.00 56.99  ? 271 PHE B CA  1 
ATOM   3992 C C   . PHE B 1 259 ? 18.206  24.567  -53.835 1.00 62.10  ? 271 PHE B C   1 
ATOM   3993 O O   . PHE B 1 259 ? 18.466  25.512  -53.088 1.00 59.97  ? 271 PHE B O   1 
ATOM   3994 C CB  . PHE B 1 259 ? 16.152  23.343  -53.184 1.00 55.47  ? 271 PHE B CB  1 
ATOM   3995 C CG  . PHE B 1 259 ? 15.420  22.054  -52.916 1.00 55.87  ? 271 PHE B CG  1 
ATOM   3996 C CD1 . PHE B 1 259 ? 15.230  21.601  -51.616 1.00 58.07  ? 271 PHE B CD1 1 
ATOM   3997 C CD2 . PHE B 1 259 ? 14.873  21.317  -53.960 1.00 57.65  ? 271 PHE B CD2 1 
ATOM   3998 C CE1 . PHE B 1 259 ? 14.526  20.421  -51.366 1.00 58.49  ? 271 PHE B CE1 1 
ATOM   3999 C CE2 . PHE B 1 259 ? 14.185  20.129  -53.711 1.00 59.87  ? 271 PHE B CE2 1 
ATOM   4000 C CZ  . PHE B 1 259 ? 14.013  19.690  -52.415 1.00 57.56  ? 271 PHE B CZ  1 
ATOM   4001 N N   . THR B 1 260 ? 18.332  24.623  -55.165 1.00 62.91  ? 272 THR B N   1 
ATOM   4002 C CA  . THR B 1 260 ? 18.729  25.818  -55.908 1.00 64.71  ? 272 THR B CA  1 
ATOM   4003 C C   . THR B 1 260 ? 17.767  25.999  -57.088 1.00 70.63  ? 272 THR B C   1 
ATOM   4004 O O   . THR B 1 260 ? 17.652  25.105  -57.931 1.00 71.02  ? 272 THR B O   1 
ATOM   4005 C CB  . THR B 1 260 ? 20.207  25.717  -56.353 1.00 69.36  ? 272 THR B CB  1 
ATOM   4006 O OG1 . THR B 1 260 ? 21.023  25.312  -55.252 1.00 66.09  ? 272 THR B OG1 1 
ATOM   4007 C CG2 . THR B 1 260 ? 20.739  27.026  -56.928 1.00 68.75  ? 272 THR B CG2 1 
ATOM   4008 N N   . ILE B 1 261 ? 17.041  27.131  -57.108 1.00 67.54  ? 273 ILE B N   1 
ATOM   4009 C CA  . ILE B 1 261 ? 16.224  27.541  -58.251 1.00 67.61  ? 273 ILE B CA  1 
ATOM   4010 C C   . ILE B 1 261 ? 17.064  28.507  -59.081 1.00 77.47  ? 273 ILE B C   1 
ATOM   4011 O O   . ILE B 1 261 ? 17.397  29.597  -58.605 1.00 76.68  ? 273 ILE B O   1 
ATOM   4012 C CB  . ILE B 1 261 ? 14.840  28.153  -57.856 1.00 67.03  ? 273 ILE B CB  1 
ATOM   4013 C CG1 . ILE B 1 261 ? 14.102  27.302  -56.802 1.00 64.78  ? 273 ILE B CG1 1 
ATOM   4014 C CG2 . ILE B 1 261 ? 13.965  28.395  -59.103 1.00 66.34  ? 273 ILE B CG2 1 
ATOM   4015 C CD1 . ILE B 1 261 ? 13.045  28.062  -56.010 1.00 69.85  ? 273 ILE B CD1 1 
ATOM   4016 N N   . LYS B 1 262 ? 17.433  28.092  -60.304 1.00 79.38  ? 274 LYS B N   1 
ATOM   4017 C CA  . LYS B 1 262 ? 18.154  28.952  -61.238 1.00 83.11  ? 274 LYS B CA  1 
ATOM   4018 C C   . LYS B 1 262 ? 17.145  29.568  -62.222 1.00 89.58  ? 274 LYS B C   1 
ATOM   4019 O O   . LYS B 1 262 ? 16.572  28.841  -63.040 1.00 88.93  ? 274 LYS B O   1 
ATOM   4020 C CB  . LYS B 1 262 ? 19.282  28.187  -61.958 1.00 89.09  ? 274 LYS B CB  1 
ATOM   4021 C CG  . LYS B 1 262 ? 20.397  27.714  -61.011 1.00 104.30 ? 274 LYS B CG  1 
ATOM   4022 C CD  . LYS B 1 262 ? 21.647  27.251  -61.741 1.00 116.03 ? 274 LYS B CD  1 
ATOM   4023 C CE  . LYS B 1 262 ? 22.522  26.348  -60.900 1.00 126.75 ? 274 LYS B CE  1 
ATOM   4024 N NZ  . LYS B 1 262 ? 23.490  27.082  -60.032 1.00 136.99 ? 274 LYS B NZ  1 
ATOM   4025 N N   . PRO B 1 263 ? 16.862  30.891  -62.116 1.00 88.17  ? 275 PRO B N   1 
ATOM   4026 C CA  . PRO B 1 263 ? 15.929  31.522  -63.069 1.00 88.75  ? 275 PRO B CA  1 
ATOM   4027 C C   . PRO B 1 263 ? 16.505  31.629  -64.482 1.00 98.67  ? 275 PRO B C   1 
ATOM   4028 O O   . PRO B 1 263 ? 17.726  31.606  -64.659 1.00 100.92 ? 275 PRO B O   1 
ATOM   4029 C CB  . PRO B 1 263 ? 15.692  32.915  -62.468 1.00 89.62  ? 275 PRO B CB  1 
ATOM   4030 C CG  . PRO B 1 263 ? 16.240  32.856  -61.070 1.00 92.56  ? 275 PRO B CG  1 
ATOM   4031 C CD  . PRO B 1 263 ? 17.348  31.871  -61.125 1.00 89.68  ? 275 PRO B CD  1 
ATOM   4032 N N   . LEU B 1 264 ? 15.618  31.742  -65.488 1.00 97.26  ? 276 LEU B N   1 
ATOM   4033 C CA  . LEU B 1 264 ? 15.989  31.895  -66.900 1.00 101.02 ? 276 LEU B CA  1 
ATOM   4034 C C   . LEU B 1 264 ? 16.652  33.264  -67.143 1.00 109.77 ? 276 LEU B C   1 
ATOM   4035 O O   . LEU B 1 264 ? 17.689  33.333  -67.806 1.00 112.28 ? 276 LEU B O   1 
ATOM   4036 C CB  . LEU B 1 264 ? 14.738  31.729  -67.777 1.00 99.99  ? 276 LEU B CB  1 
ATOM   4037 C CG  . LEU B 1 264 ? 14.939  31.194  -69.189 1.00 106.96 ? 276 LEU B CG  1 
ATOM   4038 C CD1 . LEU B 1 264 ? 15.211  29.695  -69.182 1.00 106.90 ? 276 LEU B CD1 1 
ATOM   4039 C CD2 . LEU B 1 264 ? 13.711  31.464  -70.033 1.00 108.54 ? 276 LEU B CD2 1 
ATOM   4040 N N   . ASP B 1 265 ? 16.057  34.340  -66.581 1.00 106.93 ? 277 ASP B N   1 
ATOM   4041 C CA  . ASP B 1 265 ? 16.598  35.701  -66.587 1.00 109.38 ? 277 ASP B CA  1 
ATOM   4042 C C   . ASP B 1 265 ? 17.772  35.797  -65.601 1.00 114.86 ? 277 ASP B C   1 
ATOM   4043 O O   . ASP B 1 265 ? 17.626  35.449  -64.425 1.00 112.37 ? 277 ASP B O   1 
ATOM   4044 C CB  . ASP B 1 265 ? 15.481  36.717  -66.237 1.00 109.51 ? 277 ASP B CB  1 
ATOM   4045 C CG  . ASP B 1 265 ? 15.874  38.192  -66.169 1.00 122.59 ? 277 ASP B CG  1 
ATOM   4046 O OD1 . ASP B 1 265 ? 16.903  38.569  -66.780 1.00 126.35 ? 277 ASP B OD1 1 
ATOM   4047 O OD2 . ASP B 1 265 ? 15.122  38.978  -65.547 1.00 126.87 ? 277 ASP B OD2 1 
ATOM   4048 N N   . LYS B 1 266 ? 18.928  36.273  -66.086 1.00 115.38 ? 278 LYS B N   1 
ATOM   4049 C CA  . LYS B 1 266 ? 20.148  36.418  -65.289 1.00 116.84 ? 278 LYS B CA  1 
ATOM   4050 C C   . LYS B 1 266 ? 20.091  37.635  -64.337 1.00 121.67 ? 278 LYS B C   1 
ATOM   4051 O O   . LYS B 1 266 ? 20.900  37.713  -63.409 1.00 121.78 ? 278 LYS B O   1 
ATOM   4052 C CB  . LYS B 1 266 ? 21.379  36.510  -66.201 1.00 122.99 ? 278 LYS B CB  1 
ATOM   4053 C CG  . LYS B 1 266 ? 22.346  35.342  -66.033 1.00 135.18 ? 278 LYS B CG  1 
ATOM   4054 C CD  . LYS B 1 266 ? 22.015  34.148  -66.930 1.00 144.08 ? 278 LYS B CD  1 
ATOM   4055 C CE  . LYS B 1 266 ? 22.994  33.020  -66.719 1.00 155.29 ? 278 LYS B CE  1 
ATOM   4056 N NZ  . LYS B 1 266 ? 22.780  31.917  -67.688 1.00 164.49 ? 278 LYS B NZ  1 
ATOM   4057 N N   . LYS B 1 267 ? 19.140  38.570  -64.565 1.00 118.24 ? 279 LYS B N   1 
ATOM   4058 C CA  . LYS B 1 267 ? 18.905  39.735  -63.700 1.00 117.37 ? 279 LYS B CA  1 
ATOM   4059 C C   . LYS B 1 267 ? 18.293  39.314  -62.364 1.00 117.84 ? 279 LYS B C   1 
ATOM   4060 O O   . LYS B 1 267 ? 18.575  39.941  -61.340 1.00 117.11 ? 279 LYS B O   1 
ATOM   4061 C CB  . LYS B 1 267 ? 18.004  40.771  -64.396 1.00 120.42 ? 279 LYS B CB  1 
ATOM   4062 C CG  . LYS B 1 267 ? 18.787  41.953  -64.961 1.00 141.72 ? 279 LYS B CG  1 
ATOM   4063 C CD  . LYS B 1 267 ? 17.898  42.985  -65.647 1.00 153.40 ? 279 LYS B CD  1 
ATOM   4064 C CE  . LYS B 1 267 ? 17.886  42.820  -67.148 1.00 167.37 ? 279 LYS B CE  1 
ATOM   4065 N NZ  . LYS B 1 267 ? 17.204  43.954  -67.821 1.00 178.71 ? 279 LYS B NZ  1 
ATOM   4066 N N   . ILE B 1 268 ? 17.449  38.262  -62.381 1.00 112.10 ? 280 ILE B N   1 
ATOM   4067 C CA  . ILE B 1 268 ? 16.862  37.657  -61.184 1.00 108.49 ? 280 ILE B CA  1 
ATOM   4068 C C   . ILE B 1 268 ? 17.916  36.740  -60.541 1.00 111.04 ? 280 ILE B C   1 
ATOM   4069 O O   . ILE B 1 268 ? 18.528  35.916  -61.233 1.00 112.20 ? 280 ILE B O   1 
ATOM   4070 C CB  . ILE B 1 268 ? 15.528  36.915  -61.505 1.00 109.56 ? 280 ILE B CB  1 
ATOM   4071 C CG1 . ILE B 1 268 ? 14.535  37.845  -62.262 1.00 110.23 ? 280 ILE B CG1 1 
ATOM   4072 C CG2 . ILE B 1 268 ? 14.884  36.350  -60.221 1.00 107.39 ? 280 ILE B CG2 1 
ATOM   4073 C CD1 . ILE B 1 268 ? 13.435  37.138  -63.090 1.00 116.78 ? 280 ILE B CD1 1 
ATOM   4074 N N   . ASP B 1 269 ? 18.141  36.917  -59.221 1.00 104.78 ? 281 ASP B N   1 
ATOM   4075 C CA  . ASP B 1 269 ? 19.116  36.158  -58.427 1.00 103.92 ? 281 ASP B CA  1 
ATOM   4076 C C   . ASP B 1 269 ? 18.682  34.699  -58.267 1.00 101.44 ? 281 ASP B C   1 
ATOM   4077 O O   . ASP B 1 269 ? 17.475  34.428  -58.260 1.00 99.26  ? 281 ASP B O   1 
ATOM   4078 C CB  . ASP B 1 269 ? 19.299  36.811  -57.038 1.00 105.18 ? 281 ASP B CB  1 
ATOM   4079 C CG  . ASP B 1 269 ? 19.947  38.191  -57.052 1.00 120.75 ? 281 ASP B CG  1 
ATOM   4080 O OD1 . ASP B 1 269 ? 19.751  38.933  -58.040 1.00 123.69 ? 281 ASP B OD1 1 
ATOM   4081 O OD2 . ASP B 1 269 ? 20.630  38.538  -56.061 1.00 127.46 ? 281 ASP B OD2 1 
ATOM   4082 N N   . VAL B 1 270 ? 19.659  33.759  -58.149 1.00 94.57  ? 282 VAL B N   1 
ATOM   4083 C CA  . VAL B 1 270 ? 19.348  32.352  -57.850 1.00 90.42  ? 282 VAL B CA  1 
ATOM   4084 C C   . VAL B 1 270 ? 18.766  32.269  -56.434 1.00 86.33  ? 282 VAL B C   1 
ATOM   4085 O O   . VAL B 1 270 ? 19.167  33.038  -55.547 1.00 85.72  ? 282 VAL B O   1 
ATOM   4086 C CB  . VAL B 1 270 ? 20.508  31.334  -58.057 1.00 96.22  ? 282 VAL B CB  1 
ATOM   4087 C CG1 . VAL B 1 270 ? 21.046  31.377  -59.482 1.00 98.65  ? 282 VAL B CG1 1 
ATOM   4088 C CG2 . VAL B 1 270 ? 21.627  31.513  -57.038 1.00 97.43  ? 282 VAL B CG2 1 
ATOM   4089 N N   . PHE B 1 271 ? 17.787  31.375  -56.243 1.00 76.34  ? 283 PHE B N   1 
ATOM   4090 C CA  . PHE B 1 271 ? 17.176  31.189  -54.935 1.00 71.15  ? 283 PHE B CA  1 
ATOM   4091 C C   . PHE B 1 271 ? 17.593  29.843  -54.364 1.00 70.19  ? 283 PHE B C   1 
ATOM   4092 O O   . PHE B 1 271 ? 17.257  28.794  -54.915 1.00 68.86  ? 283 PHE B O   1 
ATOM   4093 C CB  . PHE B 1 271 ? 15.648  31.339  -55.005 1.00 69.75  ? 283 PHE B CB  1 
ATOM   4094 C CG  . PHE B 1 271 ? 15.001  31.514  -53.654 1.00 68.88  ? 283 PHE B CG  1 
ATOM   4095 C CD1 . PHE B 1 271 ? 14.953  32.762  -53.046 1.00 71.64  ? 283 PHE B CD1 1 
ATOM   4096 C CD2 . PHE B 1 271 ? 14.449  30.428  -52.981 1.00 68.71  ? 283 PHE B CD2 1 
ATOM   4097 C CE1 . PHE B 1 271 ? 14.369  32.919  -51.784 1.00 70.71  ? 283 PHE B CE1 1 
ATOM   4098 C CE2 . PHE B 1 271 ? 13.874  30.583  -51.721 1.00 69.29  ? 283 PHE B CE2 1 
ATOM   4099 C CZ  . PHE B 1 271 ? 13.824  31.829  -51.136 1.00 67.50  ? 283 PHE B CZ  1 
ATOM   4100 N N   . LYS B 1 272 ? 18.371  29.891  -53.280 1.00 64.82  ? 284 LYS B N   1 
ATOM   4101 C CA  . LYS B 1 272 ? 18.789  28.711  -52.533 1.00 63.93  ? 284 LYS B CA  1 
ATOM   4102 C C   . LYS B 1 272 ? 17.963  28.588  -51.241 1.00 62.38  ? 284 LYS B C   1 
ATOM   4103 O O   . LYS B 1 272 ? 17.775  29.579  -50.526 1.00 60.56  ? 284 LYS B O   1 
ATOM   4104 C CB  . LYS B 1 272 ? 20.298  28.764  -52.231 1.00 68.85  ? 284 LYS B CB  1 
ATOM   4105 C CG  . LYS B 1 272 ? 21.169  28.555  -53.478 1.00 86.98  ? 284 LYS B CG  1 
ATOM   4106 C CD  . LYS B 1 272 ? 22.656  28.654  -53.169 1.00 96.17  ? 284 LYS B CD  1 
ATOM   4107 C CE  . LYS B 1 272 ? 23.513  27.867  -54.131 1.00 102.91 ? 284 LYS B CE  1 
ATOM   4108 N NZ  . LYS B 1 272 ? 23.721  26.462  -53.692 1.00 105.45 ? 284 LYS B NZ  1 
ATOM   4109 N N   . PHE B 1 273 ? 17.443  27.382  -50.968 1.00 55.99  ? 285 PHE B N   1 
ATOM   4110 C CA  . PHE B 1 273 ? 16.729  27.118  -49.719 1.00 53.19  ? 285 PHE B CA  1 
ATOM   4111 C C   . PHE B 1 273 ? 17.006  25.700  -49.193 1.00 59.76  ? 285 PHE B C   1 
ATOM   4112 O O   . PHE B 1 273 ? 17.418  24.809  -49.938 1.00 59.78  ? 285 PHE B O   1 
ATOM   4113 C CB  . PHE B 1 273 ? 15.211  27.369  -49.851 1.00 51.02  ? 285 PHE B CB  1 
ATOM   4114 C CG  . PHE B 1 273 ? 14.480  26.498  -50.843 1.00 50.46  ? 285 PHE B CG  1 
ATOM   4115 C CD1 . PHE B 1 273 ? 13.910  25.293  -50.448 1.00 51.35  ? 285 PHE B CD1 1 
ATOM   4116 C CD2 . PHE B 1 273 ? 14.337  26.892  -52.168 1.00 51.36  ? 285 PHE B CD2 1 
ATOM   4117 C CE1 . PHE B 1 273 ? 13.218  24.495  -51.362 1.00 51.11  ? 285 PHE B CE1 1 
ATOM   4118 C CE2 . PHE B 1 273 ? 13.665  26.083  -53.085 1.00 53.38  ? 285 PHE B CE2 1 
ATOM   4119 C CZ  . PHE B 1 273 ? 13.097  24.896  -52.673 1.00 50.58  ? 285 PHE B CZ  1 
ATOM   4120 N N   . ASN B 1 274 ? 16.769  25.514  -47.892 1.00 57.89  ? 286 ASN B N   1 
ATOM   4121 C CA  . ASN B 1 274 ? 17.027  24.290  -47.141 1.00 59.06  ? 286 ASN B CA  1 
ATOM   4122 C C   . ASN B 1 274 ? 15.716  23.661  -46.700 1.00 62.76  ? 286 ASN B C   1 
ATOM   4123 O O   . ASN B 1 274 ? 14.800  24.369  -46.280 1.00 60.54  ? 286 ASN B O   1 
ATOM   4124 C CB  . ASN B 1 274 ? 17.904  24.617  -45.919 1.00 59.45  ? 286 ASN B CB  1 
ATOM   4125 C CG  . ASN B 1 274 ? 18.173  23.443  -45.012 1.00 82.00  ? 286 ASN B CG  1 
ATOM   4126 O OD1 . ASN B 1 274 ? 19.036  22.605  -45.281 1.00 83.27  ? 286 ASN B OD1 1 
ATOM   4127 N ND2 . ASN B 1 274 ? 17.445  23.365  -43.906 1.00 69.68  ? 286 ASN B ND2 1 
ATOM   4128 N N   . SER B 1 275 ? 15.625  22.334  -46.808 1.00 61.81  ? 287 SER B N   1 
ATOM   4129 C CA  . SER B 1 275 ? 14.548  21.552  -46.195 1.00 61.29  ? 287 SER B CA  1 
ATOM   4130 C C   . SER B 1 275 ? 15.170  20.389  -45.418 1.00 69.25  ? 287 SER B C   1 
ATOM   4131 O O   . SER B 1 275 ? 16.036  19.678  -45.951 1.00 70.86  ? 287 SER B O   1 
ATOM   4132 C CB  . SER B 1 275 ? 13.549  21.074  -47.247 1.00 63.90  ? 287 SER B CB  1 
ATOM   4133 O OG  . SER B 1 275 ? 12.551  20.220  -46.708 1.00 71.30  ? 287 SER B OG  1 
ATOM   4134 N N   . SER B 1 276 ? 14.733  20.213  -44.153 1.00 66.78  ? 288 SER B N   1 
ATOM   4135 C CA  . SER B 1 276 ? 15.386  19.340  -43.166 1.00 69.32  ? 288 SER B CA  1 
ATOM   4136 C C   . SER B 1 276 ? 15.174  17.835  -43.422 1.00 76.28  ? 288 SER B C   1 
ATOM   4137 O O   . SER B 1 276 ? 16.086  17.054  -43.152 1.00 79.20  ? 288 SER B O   1 
ATOM   4138 C CB  . SER B 1 276 ? 14.924  19.683  -41.753 1.00 71.62  ? 288 SER B CB  1 
ATOM   4139 O OG  . SER B 1 276 ? 13.512  19.693  -41.631 1.00 78.56  ? 288 SER B OG  1 
ATOM   4140 N N   . LYS B 1 277 ? 13.990  17.427  -43.921 1.00 71.49  ? 289 LYS B N   1 
ATOM   4141 C CA  . LYS B 1 277 ? 13.642  16.010  -44.097 1.00 72.07  ? 289 LYS B CA  1 
ATOM   4142 C C   . LYS B 1 277 ? 13.906  15.558  -45.542 1.00 77.69  ? 289 LYS B C   1 
ATOM   4143 O O   . LYS B 1 277 ? 13.384  16.164  -46.484 1.00 76.38  ? 289 LYS B O   1 
ATOM   4144 C CB  . LYS B 1 277 ? 12.173  15.757  -43.724 1.00 72.33  ? 289 LYS B CB  1 
ATOM   4145 C CG  . LYS B 1 277 ? 11.801  16.026  -42.269 1.00 85.00  ? 289 LYS B CG  1 
ATOM   4146 C CD  . LYS B 1 277 ? 10.277  16.040  -42.096 1.00 93.10  ? 289 LYS B CD  1 
ATOM   4147 C CE  . LYS B 1 277 ? 9.837   16.032  -40.654 1.00 103.21 ? 289 LYS B CE  1 
ATOM   4148 N NZ  . LYS B 1 277 ? 8.355   16.051  -40.548 1.00 108.99 ? 289 LYS B NZ  1 
ATOM   4149 N N   . LEU B 1 278 ? 14.713  14.494  -45.711 1.00 76.47  ? 290 LEU B N   1 
ATOM   4150 C CA  . LEU B 1 278 ? 15.110  13.943  -47.018 1.00 77.51  ? 290 LEU B CA  1 
ATOM   4151 C C   . LEU B 1 278 ? 13.912  13.352  -47.793 1.00 78.26  ? 290 LEU B C   1 
ATOM   4152 O O   . LEU B 1 278 ? 13.854  13.467  -49.020 1.00 77.25  ? 290 LEU B O   1 
ATOM   4153 C CB  . LEU B 1 278 ? 16.221  12.883  -46.867 1.00 81.33  ? 290 LEU B CB  1 
ATOM   4154 C CG  . LEU B 1 278 ? 16.060  11.839  -45.750 1.00 88.01  ? 290 LEU B CG  1 
ATOM   4155 C CD1 . LEU B 1 278 ? 15.686  10.471  -46.318 1.00 89.75  ? 290 LEU B CD1 1 
ATOM   4156 C CD2 . LEU B 1 278 ? 17.334  11.733  -44.927 1.00 93.36  ? 290 LEU B CD2 1 
ATOM   4157 N N   . ARG B 1 279 ? 12.959  12.743  -47.074 1.00 72.84  ? 291 ARG B N   1 
ATOM   4158 C CA  . ARG B 1 279 ? 11.745  12.163  -47.645 1.00 70.81  ? 291 ARG B CA  1 
ATOM   4159 C C   . ARG B 1 279 ? 10.884  13.239  -48.322 1.00 70.54  ? 291 ARG B C   1 
ATOM   4160 O O   . ARG B 1 279 ? 10.398  13.016  -49.436 1.00 70.25  ? 291 ARG B O   1 
ATOM   4161 C CB  . ARG B 1 279 ? 10.939  11.389  -46.583 1.00 70.75  ? 291 ARG B CB  1 
ATOM   4162 C CG  . ARG B 1 279 ? 10.838  12.036  -45.204 1.00 80.49  ? 291 ARG B CG  1 
ATOM   4163 C CD  . ARG B 1 279 ? 10.679  10.962  -44.144 1.00 96.46  ? 291 ARG B CD  1 
ATOM   4164 N NE  . ARG B 1 279 ? 10.271  11.500  -42.845 1.00 107.93 ? 291 ARG B NE  1 
ATOM   4165 C CZ  . ARG B 1 279 ? 11.109  11.920  -41.901 1.00 126.75 ? 291 ARG B CZ  1 
ATOM   4166 N NH1 . ARG B 1 279 ? 12.422  11.890  -42.107 1.00 118.17 ? 291 ARG B NH1 1 
ATOM   4167 N NH2 . ARG B 1 279 ? 10.642  12.381  -40.748 1.00 113.16 ? 291 ARG B NH2 1 
ATOM   4168 N N   . VAL B 1 280 ? 10.747  14.413  -47.663 1.00 62.91  ? 292 VAL B N   1 
ATOM   4169 C CA  . VAL B 1 280 ? 10.026  15.599  -48.134 1.00 58.84  ? 292 VAL B CA  1 
ATOM   4170 C C   . VAL B 1 280 ? 10.698  16.134  -49.414 1.00 62.52  ? 292 VAL B C   1 
ATOM   4171 O O   . VAL B 1 280 ? 9.999   16.532  -50.345 1.00 61.73  ? 292 VAL B O   1 
ATOM   4172 C CB  . VAL B 1 280 ? 9.949   16.671  -47.006 1.00 60.56  ? 292 VAL B CB  1 
ATOM   4173 C CG1 . VAL B 1 280 ? 9.415   18.003  -47.511 1.00 57.96  ? 292 VAL B CG1 1 
ATOM   4174 C CG2 . VAL B 1 280 ? 9.106   16.181  -45.833 1.00 59.61  ? 292 VAL B CG2 1 
ATOM   4175 N N   . ASN B 1 281 ? 12.037  16.099  -49.474 1.00 59.98  ? 293 ASN B N   1 
ATOM   4176 C CA  . ASN B 1 281 ? 12.809  16.644  -50.595 1.00 60.45  ? 293 ASN B CA  1 
ATOM   4177 C C   . ASN B 1 281 ? 12.657  15.789  -51.864 1.00 65.31  ? 293 ASN B C   1 
ATOM   4178 O O   . ASN B 1 281 ? 12.635  16.334  -52.974 1.00 64.07  ? 293 ASN B O   1 
ATOM   4179 C CB  . ASN B 1 281 ? 14.277  16.794  -50.195 1.00 61.08  ? 293 ASN B CB  1 
ATOM   4180 C CG  . ASN B 1 281 ? 14.452  17.736  -49.026 1.00 77.78  ? 293 ASN B CG  1 
ATOM   4181 O OD1 . ASN B 1 281 ? 13.488  18.310  -48.512 1.00 68.86  ? 293 ASN B OD1 1 
ATOM   4182 N ND2 . ASN B 1 281 ? 15.670  17.897  -48.553 1.00 69.43  ? 293 ASN B ND2 1 
ATOM   4183 N N   . LYS B 1 282 ? 12.547  14.455  -51.691 1.00 63.10  ? 294 LYS B N   1 
ATOM   4184 C CA  . LYS B 1 282 ? 12.243  13.525  -52.780 1.00 63.36  ? 294 LYS B CA  1 
ATOM   4185 C C   . LYS B 1 282 ? 10.857  13.822  -53.332 1.00 63.60  ? 294 LYS B C   1 
ATOM   4186 O O   . LYS B 1 282 ? 10.688  13.853  -54.551 1.00 64.25  ? 294 LYS B O   1 
ATOM   4187 C CB  . LYS B 1 282 ? 12.349  12.060  -52.316 1.00 67.81  ? 294 LYS B CB  1 
ATOM   4188 C CG  . LYS B 1 282 ? 13.789  11.590  -52.129 1.00 86.85  ? 294 LYS B CG  1 
ATOM   4189 C CD  . LYS B 1 282 ? 13.878  10.236  -51.453 1.00 95.64  ? 294 LYS B CD  1 
ATOM   4190 C CE  . LYS B 1 282 ? 15.316  9.842   -51.218 1.00 107.76 ? 294 LYS B CE  1 
ATOM   4191 N NZ  . LYS B 1 282 ? 15.425  8.571   -50.461 1.00 120.00 ? 294 LYS B NZ  1 
ATOM   4192 N N   . LEU B 1 283 ? 9.879   14.069  -52.438 1.00 56.05  ? 295 LEU B N   1 
ATOM   4193 C CA  . LEU B 1 283 ? 8.513   14.439  -52.809 1.00 52.87  ? 295 LEU B CA  1 
ATOM   4194 C C   . LEU B 1 283 ? 8.480   15.793  -53.534 1.00 53.28  ? 295 LEU B C   1 
ATOM   4195 O O   . LEU B 1 283 ? 7.823   15.881  -54.572 1.00 51.71  ? 295 LEU B O   1 
ATOM   4196 C CB  . LEU B 1 283 ? 7.591   14.456  -51.578 1.00 51.22  ? 295 LEU B CB  1 
ATOM   4197 C CG  . LEU B 1 283 ? 6.122   14.847  -51.792 1.00 53.58  ? 295 LEU B CG  1 
ATOM   4198 C CD1 . LEU B 1 283 ? 5.460   13.994  -52.858 1.00 54.28  ? 295 LEU B CD1 1 
ATOM   4199 C CD2 . LEU B 1 283 ? 5.346   14.748  -50.498 1.00 54.91  ? 295 LEU B CD2 1 
ATOM   4200 N N   . ILE B 1 284 ? 9.194   16.827  -53.003 1.00 47.76  ? 296 ILE B N   1 
ATOM   4201 C CA  . ILE B 1 284 ? 9.288   18.156  -53.619 1.00 45.95  ? 296 ILE B CA  1 
ATOM   4202 C C   . ILE B 1 284 ? 9.722   18.008  -55.083 1.00 52.80  ? 296 ILE B C   1 
ATOM   4203 O O   . ILE B 1 284 ? 9.032   18.526  -55.965 1.00 52.56  ? 296 ILE B O   1 
ATOM   4204 C CB  . ILE B 1 284 ? 10.216  19.125  -52.822 1.00 48.37  ? 296 ILE B CB  1 
ATOM   4205 C CG1 . ILE B 1 284 ? 9.576   19.525  -51.484 1.00 46.63  ? 296 ILE B CG1 1 
ATOM   4206 C CG2 . ILE B 1 284 ? 10.562  20.380  -53.639 1.00 48.92  ? 296 ILE B CG2 1 
ATOM   4207 C CD1 . ILE B 1 284 ? 10.518  20.091  -50.437 1.00 54.66  ? 296 ILE B CD1 1 
ATOM   4208 N N   . LEU B 1 285 ? 10.811  17.253  -55.339 1.00 51.35  ? 297 LEU B N   1 
ATOM   4209 C CA  . LEU B 1 285 ? 11.382  17.092  -56.677 1.00 52.96  ? 297 LEU B CA  1 
ATOM   4210 C C   . LEU B 1 285 ? 10.422  16.369  -57.620 1.00 56.02  ? 297 LEU B C   1 
ATOM   4211 O O   . LEU B 1 285 ? 10.296  16.783  -58.770 1.00 55.65  ? 297 LEU B O   1 
ATOM   4212 C CB  . LEU B 1 285 ? 12.733  16.361  -56.631 1.00 55.97  ? 297 LEU B CB  1 
ATOM   4213 C CG  . LEU B 1 285 ? 13.884  17.127  -55.996 1.00 62.24  ? 297 LEU B CG  1 
ATOM   4214 C CD1 . LEU B 1 285 ? 15.101  16.229  -55.791 1.00 65.46  ? 297 LEU B CD1 1 
ATOM   4215 C CD2 . LEU B 1 285 ? 14.253  18.342  -56.818 1.00 65.31  ? 297 LEU B CD2 1 
ATOM   4216 N N   . GLN B 1 286 ? 9.733   15.315  -57.130 1.00 51.82  ? 298 GLN B N   1 
ATOM   4217 C CA  . GLN B 1 286 ? 8.691   14.589  -57.861 1.00 51.13  ? 298 GLN B CA  1 
ATOM   4218 C C   . GLN B 1 286 ? 7.601   15.538  -58.348 1.00 54.14  ? 298 GLN B C   1 
ATOM   4219 O O   . GLN B 1 286 ? 7.192   15.459  -59.511 1.00 55.13  ? 298 GLN B O   1 
ATOM   4220 C CB  . GLN B 1 286 ? 8.055   13.508  -56.976 1.00 51.86  ? 298 GLN B CB  1 
ATOM   4221 C CG  . GLN B 1 286 ? 8.864   12.228  -56.832 1.00 61.86  ? 298 GLN B CG  1 
ATOM   4222 C CD  . GLN B 1 286 ? 8.212   11.229  -55.904 1.00 81.53  ? 298 GLN B CD  1 
ATOM   4223 O OE1 . GLN B 1 286 ? 7.076   11.396  -55.434 1.00 66.23  ? 298 GLN B OE1 1 
ATOM   4224 N NE2 . GLN B 1 286 ? 8.923   10.145  -55.632 1.00 89.79  ? 298 GLN B NE2 1 
ATOM   4225 N N   . LEU B 1 287 ? 7.143   16.439  -57.456 1.00 48.38  ? 299 LEU B N   1 
ATOM   4226 C CA  . LEU B 1 287 ? 6.090   17.404  -57.753 1.00 46.62  ? 299 LEU B CA  1 
ATOM   4227 C C   . LEU B 1 287 ? 6.600   18.501  -58.687 1.00 53.05  ? 299 LEU B C   1 
ATOM   4228 O O   . LEU B 1 287 ? 5.834   18.995  -59.513 1.00 53.18  ? 299 LEU B O   1 
ATOM   4229 C CB  . LEU B 1 287 ? 5.519   18.013  -56.467 1.00 44.23  ? 299 LEU B CB  1 
ATOM   4230 C CG  . LEU B 1 287 ? 4.806   17.055  -55.517 1.00 46.93  ? 299 LEU B CG  1 
ATOM   4231 C CD1 . LEU B 1 287 ? 4.573   17.710  -54.188 1.00 45.54  ? 299 LEU B CD1 1 
ATOM   4232 C CD2 . LEU B 1 287 ? 3.494   16.541  -56.097 1.00 47.87  ? 299 LEU B CD2 1 
ATOM   4233 N N   . CYS B 1 288 ? 7.881   18.867  -58.577 1.00 51.24  ? 300 CYS B N   1 
ATOM   4234 C CA  . CYS B 1 288 ? 8.489   19.843  -59.479 1.00 52.86  ? 300 CYS B CA  1 
ATOM   4235 C C   . CYS B 1 288 ? 8.514   19.316  -60.921 1.00 59.52  ? 300 CYS B C   1 
ATOM   4236 O O   . CYS B 1 288 ? 8.131   20.052  -61.831 1.00 60.30  ? 300 CYS B O   1 
ATOM   4237 C CB  . CYS B 1 288 ? 9.885   20.234  -59.009 1.00 54.58  ? 300 CYS B CB  1 
ATOM   4238 S SG  . CYS B 1 288 ? 9.908   21.217  -57.489 1.00 56.73  ? 300 CYS B SG  1 
ATOM   4239 N N   . ILE B 1 289 ? 8.919   18.042  -61.121 1.00 56.36  ? 301 ILE B N   1 
ATOM   4240 C CA  . ILE B 1 289 ? 9.057   17.431  -62.447 1.00 57.81  ? 301 ILE B CA  1 
ATOM   4241 C C   . ILE B 1 289 ? 7.685   17.311  -63.123 1.00 61.30  ? 301 ILE B C   1 
ATOM   4242 O O   . ILE B 1 289 ? 7.539   17.798  -64.242 1.00 62.35  ? 301 ILE B O   1 
ATOM   4243 C CB  . ILE B 1 289 ? 9.816   16.079  -62.374 1.00 62.70  ? 301 ILE B CB  1 
ATOM   4244 C CG1 . ILE B 1 289 ? 11.317  16.325  -62.083 1.00 64.63  ? 301 ILE B CG1 1 
ATOM   4245 C CG2 . ILE B 1 289 ? 9.641   15.238  -63.645 1.00 65.33  ? 301 ILE B CG2 1 
ATOM   4246 C CD1 . ILE B 1 289 ? 11.931  15.325  -61.185 1.00 68.89  ? 301 ILE B CD1 1 
ATOM   4247 N N   . GLY B 1 290 ? 6.711   16.706  -62.437 1.00 56.48  ? 302 GLY B N   1 
ATOM   4248 C CA  . GLY B 1 290 ? 5.359   16.505  -62.946 1.00 55.23  ? 302 GLY B CA  1 
ATOM   4249 C C   . GLY B 1 290 ? 4.656   17.792  -63.314 1.00 58.75  ? 302 GLY B C   1 
ATOM   4250 O O   . GLY B 1 290 ? 4.113   17.903  -64.417 1.00 59.92  ? 302 GLY B O   1 
ATOM   4251 N N   . ASN B 1 291 ? 4.687   18.784  -62.406 1.00 53.55  ? 303 ASN B N   1 
ATOM   4252 C CA  . ASN B 1 291 ? 4.015   20.066  -62.621 1.00 51.93  ? 303 ASN B CA  1 
ATOM   4253 C C   . ASN B 1 291 ? 4.683   20.860  -63.730 1.00 57.66  ? 303 ASN B C   1 
ATOM   4254 O O   . ASN B 1 291 ? 3.981   21.499  -64.503 1.00 57.56  ? 303 ASN B O   1 
ATOM   4255 C CB  . ASN B 1 291 ? 3.946   20.887  -61.345 1.00 47.68  ? 303 ASN B CB  1 
ATOM   4256 C CG  . ASN B 1 291 ? 2.879   20.425  -60.402 1.00 54.03  ? 303 ASN B CG  1 
ATOM   4257 O OD1 . ASN B 1 291 ? 1.680   20.479  -60.700 1.00 47.36  ? 303 ASN B OD1 1 
ATOM   4258 N ND2 . ASN B 1 291 ? 3.292   19.974  -59.231 1.00 45.25  ? 303 ASN B ND2 1 
ATOM   4259 N N   . HIS B 1 292 ? 6.019   20.814  -63.816 1.00 56.67  ? 304 HIS B N   1 
ATOM   4260 C CA  . HIS B 1 292 ? 6.776   21.440  -64.899 1.00 59.35  ? 304 HIS B CA  1 
ATOM   4261 C C   . HIS B 1 292 ? 6.321   20.902  -66.253 1.00 65.95  ? 304 HIS B C   1 
ATOM   4262 O O   . HIS B 1 292 ? 6.070   21.684  -67.167 1.00 67.57  ? 304 HIS B O   1 
ATOM   4263 C CB  . HIS B 1 292 ? 8.285   21.211  -64.723 1.00 62.10  ? 304 HIS B CB  1 
ATOM   4264 C CG  . HIS B 1 292 ? 9.087   21.682  -65.894 1.00 68.57  ? 304 HIS B CG  1 
ATOM   4265 N ND1 . HIS B 1 292 ? 9.359   20.846  -66.970 1.00 72.63  ? 304 HIS B ND1 1 
ATOM   4266 C CD2 . HIS B 1 292 ? 9.613   22.903  -66.143 1.00 71.24  ? 304 HIS B CD2 1 
ATOM   4267 C CE1 . HIS B 1 292 ? 10.048  21.580  -67.825 1.00 74.00  ? 304 HIS B CE1 1 
ATOM   4268 N NE2 . HIS B 1 292 ? 10.230  22.823  -67.370 1.00 73.64  ? 304 HIS B NE2 1 
ATOM   4269 N N   . ASP B 1 293 ? 6.212   19.571  -66.368 1.00 62.38  ? 305 ASP B N   1 
ATOM   4270 C CA  . ASP B 1 293 ? 5.912   18.874  -67.610 1.00 63.55  ? 305 ASP B CA  1 
ATOM   4271 C C   . ASP B 1 293 ? 4.466   19.052  -68.032 1.00 64.89  ? 305 ASP B C   1 
ATOM   4272 O O   . ASP B 1 293 ? 4.208   19.210  -69.222 1.00 66.07  ? 305 ASP B O   1 
ATOM   4273 C CB  . ASP B 1 293 ? 6.252   17.392  -67.470 1.00 66.59  ? 305 ASP B CB  1 
ATOM   4274 C CG  . ASP B 1 293 ? 7.736   17.087  -67.587 1.00 80.32  ? 305 ASP B CG  1 
ATOM   4275 O OD1 . ASP B 1 293 ? 8.558   18.025  -67.419 1.00 82.06  ? 305 ASP B OD1 1 
ATOM   4276 O OD2 . ASP B 1 293 ? 8.077   15.916  -67.830 1.00 89.36  ? 305 ASP B OD2 1 
ATOM   4277 N N   . LEU B 1 294 ? 3.526   19.035  -67.077 1.00 58.87  ? 306 LEU B N   1 
ATOM   4278 C CA  . LEU B 1 294 ? 2.114   19.296  -67.376 1.00 57.06  ? 306 LEU B CA  1 
ATOM   4279 C C   . LEU B 1 294 ? 1.907   20.750  -67.779 1.00 60.81  ? 306 LEU B C   1 
ATOM   4280 O O   . LEU B 1 294 ? 1.087   21.016  -68.654 1.00 61.05  ? 306 LEU B O   1 
ATOM   4281 C CB  . LEU B 1 294 ? 1.200   18.923  -66.206 1.00 54.44  ? 306 LEU B CB  1 
ATOM   4282 C CG  . LEU B 1 294 ? 1.115   17.436  -65.862 1.00 59.23  ? 306 LEU B CG  1 
ATOM   4283 C CD1 . LEU B 1 294 ? 0.368   17.234  -64.576 1.00 56.85  ? 306 LEU B CD1 1 
ATOM   4284 C CD2 . LEU B 1 294 ? 0.463   16.631  -66.982 1.00 63.43  ? 306 LEU B CD2 1 
ATOM   4285 N N   . PHE B 1 295 ? 2.668   21.680  -67.168 1.00 56.74  ? 307 PHE B N   1 
ATOM   4286 C CA  . PHE B 1 295 ? 2.678   23.096  -67.542 1.00 56.50  ? 307 PHE B CA  1 
ATOM   4287 C C   . PHE B 1 295 ? 3.079   23.271  -69.005 1.00 66.72  ? 307 PHE B C   1 
ATOM   4288 O O   . PHE B 1 295 ? 2.436   24.052  -69.710 1.00 67.00  ? 307 PHE B O   1 
ATOM   4289 C CB  . PHE B 1 295 ? 3.627   23.891  -66.635 1.00 56.77  ? 307 PHE B CB  1 
ATOM   4290 C CG  . PHE B 1 295 ? 3.808   25.351  -66.976 1.00 58.06  ? 307 PHE B CG  1 
ATOM   4291 C CD1 . PHE B 1 295 ? 4.748   25.751  -67.923 1.00 62.65  ? 307 PHE B CD1 1 
ATOM   4292 C CD2 . PHE B 1 295 ? 3.086   26.331  -66.308 1.00 58.28  ? 307 PHE B CD2 1 
ATOM   4293 C CE1 . PHE B 1 295 ? 4.927   27.100  -68.228 1.00 64.21  ? 307 PHE B CE1 1 
ATOM   4294 C CE2 . PHE B 1 295 ? 3.285   27.686  -66.596 1.00 61.94  ? 307 PHE B CE2 1 
ATOM   4295 C CZ  . PHE B 1 295 ? 4.201   28.061  -67.558 1.00 62.26  ? 307 PHE B CZ  1 
ATOM   4296 N N   . MET B 1 296 ? 4.142   22.561  -69.452 1.00 67.17  ? 308 MET B N   1 
ATOM   4297 C CA  . MET B 1 296 ? 4.681   22.671  -70.807 1.00 70.80  ? 308 MET B CA  1 
ATOM   4298 C C   . MET B 1 296 ? 3.704   22.109  -71.856 1.00 75.01  ? 308 MET B C   1 
ATOM   4299 O O   . MET B 1 296 ? 3.542   22.722  -72.908 1.00 75.35  ? 308 MET B O   1 
ATOM   4300 C CB  . MET B 1 296 ? 6.053   21.981  -70.919 1.00 75.97  ? 308 MET B CB  1 
ATOM   4301 C CG  . MET B 1 296 ? 7.172   22.657  -70.102 1.00 80.66  ? 308 MET B CG  1 
ATOM   4302 S SD  . MET B 1 296 ? 7.419   24.461  -70.299 1.00 86.12  ? 308 MET B SD  1 
ATOM   4303 C CE  . MET B 1 296 ? 7.818   24.552  -72.041 1.00 86.88  ? 308 MET B CE  1 
ATOM   4304 N N   . ARG B 1 297 ? 3.048   20.968  -71.563 1.00 72.13  ? 309 ARG B N   1 
ATOM   4305 C CA  . ARG B 1 297 ? 2.019   20.349  -72.414 1.00 73.07  ? 309 ARG B CA  1 
ATOM   4306 C C   . ARG B 1 297 ? 0.811   21.271  -72.648 1.00 78.70  ? 309 ARG B C   1 
ATOM   4307 O O   . ARG B 1 297 ? 0.224   21.247  -73.729 1.00 79.74  ? 309 ARG B O   1 
ATOM   4308 C CB  . ARG B 1 297 ? 1.523   19.042  -71.799 1.00 71.00  ? 309 ARG B CB  1 
ATOM   4309 C CG  . ARG B 1 297 ? 2.460   17.873  -71.991 1.00 81.89  ? 309 ARG B CG  1 
ATOM   4310 C CD  . ARG B 1 297 ? 1.765   16.611  -71.552 1.00 89.19  ? 309 ARG B CD  1 
ATOM   4311 N NE  . ARG B 1 297 ? 2.646   15.446  -71.610 1.00 98.03  ? 309 ARG B NE  1 
ATOM   4312 C CZ  . ARG B 1 297 ? 2.414   14.309  -70.963 1.00 113.12 ? 309 ARG B CZ  1 
ATOM   4313 N NH1 . ARG B 1 297 ? 1.331   14.178  -70.206 1.00 98.13  ? 309 ARG B NH1 1 
ATOM   4314 N NH2 . ARG B 1 297 ? 3.265   13.298  -71.062 1.00 102.46 ? 309 ARG B NH2 1 
ATOM   4315 N N   . ARG B 1 298 ? 0.439   22.069  -71.633 1.00 75.30  ? 310 ARG B N   1 
ATOM   4316 C CA  . ARG B 1 298 ? -0.657  23.046  -71.692 1.00 75.27  ? 310 ARG B CA  1 
ATOM   4317 C C   . ARG B 1 298 ? -0.301  24.257  -72.567 1.00 85.48  ? 310 ARG B C   1 
ATOM   4318 O O   . ARG B 1 298 ? -1.195  24.990  -72.990 1.00 85.96  ? 310 ARG B O   1 
ATOM   4319 C CB  . ARG B 1 298 ? -1.035  23.512  -70.282 1.00 70.47  ? 310 ARG B CB  1 
ATOM   4320 C CG  . ARG B 1 298 ? -1.790  22.454  -69.494 1.00 72.90  ? 310 ARG B CG  1 
ATOM   4321 C CD  . ARG B 1 298 ? -1.989  22.875  -68.061 1.00 74.74  ? 310 ARG B CD  1 
ATOM   4322 N NE  . ARG B 1 298 ? -2.366  21.741  -67.225 1.00 74.81  ? 310 ARG B NE  1 
ATOM   4323 C CZ  . ARG B 1 298 ? -1.779  21.434  -66.077 1.00 85.35  ? 310 ARG B CZ  1 
ATOM   4324 N NH1 . ARG B 1 298 ? -0.788  22.184  -65.610 1.00 70.31  ? 310 ARG B NH1 1 
ATOM   4325 N NH2 . ARG B 1 298 ? -2.181  20.379  -65.381 1.00 72.46  ? 310 ARG B NH2 1 
ATOM   4326 N N   . ARG B 1 299 ? 0.997   24.472  -72.823 1.00 86.14  ? 311 ARG B N   1 
ATOM   4327 C CA  . ARG B 1 299 ? 1.484   25.505  -73.726 1.00 89.49  ? 311 ARG B CA  1 
ATOM   4328 C C   . ARG B 1 299 ? 1.863   24.901  -75.094 1.00 99.13  ? 311 ARG B C   1 
ATOM   4329 O O   . ARG B 1 299 ? 2.586   25.525  -75.886 1.00 101.82 ? 311 ARG B O   1 
ATOM   4330 C CB  . ARG B 1 299 ? 2.670   26.205  -73.091 1.00 90.22  ? 311 ARG B CB  1 
ATOM   4331 C CG  . ARG B 1 299 ? 2.289   27.427  -72.303 1.00 100.69 ? 311 ARG B CG  1 
ATOM   4332 C CD  . ARG B 1 299 ? 3.561   28.208  -72.059 1.00 114.82 ? 311 ARG B CD  1 
ATOM   4333 N NE  . ARG B 1 299 ? 4.424   28.192  -73.246 1.00 130.17 ? 311 ARG B NE  1 
ATOM   4334 C CZ  . ARG B 1 299 ? 5.755   28.158  -73.228 1.00 150.67 ? 311 ARG B CZ  1 
ATOM   4335 N NH1 . ARG B 1 299 ? 6.437   28.120  -74.364 1.00 143.67 ? 311 ARG B NH1 1 
ATOM   4336 N NH2 . ARG B 1 299 ? 6.414   28.166  -72.075 1.00 136.54 ? 311 ARG B NH2 1 
ATOM   4337 N N   . LYS B 1 300 ? 1.337   23.675  -75.359 1.00 96.34  ? 312 LYS B N   1 
ATOM   4338 C CA  . LYS B 1 300 ? 1.406   22.901  -76.604 1.00 120.40 ? 312 LYS B CA  1 
ATOM   4339 C C   . LYS B 1 300 ? 2.855   22.552  -76.958 1.00 135.79 ? 312 LYS B C   1 
ATOM   4340 O O   . LYS B 1 300 ? 3.431   21.656  -76.345 1.00 90.05  ? 312 LYS B O   1 
ATOM   4341 C CB  . LYS B 1 300 ? 0.716   23.646  -77.763 1.00 124.41 ? 312 LYS B CB  1 
ATOM   4342 C CG  . LYS B 1 300 ? -0.748  24.073  -77.515 1.00 132.76 ? 312 LYS B CG  1 
ATOM   4343 C CD  . LYS B 1 300 ? -0.983  25.416  -76.745 1.00 137.67 ? 312 LYS B CD  1 
ATOM   4344 C CE  . LYS B 1 300 ? -0.542  26.686  -77.453 1.00 145.49 ? 312 LYS B CE  1 
ATOM   4345 N NZ  . LYS B 1 300 ? -0.801  27.892  -76.630 1.00 148.83 ? 312 LYS B NZ  1 
ATOM   4346 C CA  . LYS C 1 8   ? 26.396  5.443   -40.967 1.00 95.29  ? 20  LYS C CA  1 
ATOM   4347 C C   . LYS C 1 8   ? 25.983  5.074   -39.535 1.00 96.92  ? 20  LYS C C   1 
ATOM   4348 O O   . LYS C 1 8   ? 26.658  5.461   -38.575 1.00 96.33  ? 20  LYS C O   1 
ATOM   4349 C CB  . LYS C 1 8   ? 25.827  6.818   -41.385 1.00 97.37  ? 20  LYS C CB  1 
ATOM   4350 C CG  . LYS C 1 8   ? 24.323  6.922   -41.650 1.00 112.19 ? 20  LYS C CG  1 
ATOM   4351 C CD  . LYS C 1 8   ? 23.805  6.175   -42.882 1.00 124.41 ? 20  LYS C CD  1 
ATOM   4352 C CE  . LYS C 1 8   ? 22.380  6.562   -43.224 1.00 133.83 ? 20  LYS C CE  1 
ATOM   4353 N NZ  . LYS C 1 8   ? 21.396  6.147   -42.179 1.00 139.93 ? 20  LYS C NZ  1 
ATOM   4354 N N   . THR C 1 9   ? 24.870  4.324   -39.396 1.00 91.57  ? 21  THR C N   1 
ATOM   4355 C CA  . THR C 1 9   ? 24.399  3.775   -38.117 1.00 88.38  ? 21  THR C CA  1 
ATOM   4356 C C   . THR C 1 9   ? 24.031  2.290   -38.249 1.00 90.86  ? 21  THR C C   1 
ATOM   4357 O O   . THR C 1 9   ? 23.752  1.810   -39.351 1.00 92.72  ? 21  THR C O   1 
ATOM   4358 C CB  . THR C 1 9   ? 23.196  4.560   -37.537 1.00 93.01  ? 21  THR C CB  1 
ATOM   4359 O OG1 . THR C 1 9   ? 22.116  4.569   -38.470 1.00 90.67  ? 21  THR C OG1 1 
ATOM   4360 C CG2 . THR C 1 9   ? 23.556  5.972   -37.095 1.00 91.08  ? 21  THR C CG2 1 
ATOM   4361 N N   . PHE C 1 10  ? 24.043  1.571   -37.113 1.00 83.32  ? 22  PHE C N   1 
ATOM   4362 C CA  . PHE C 1 10  ? 23.547  0.200   -36.989 1.00 81.65  ? 22  PHE C CA  1 
ATOM   4363 C C   . PHE C 1 10  ? 22.652  0.086   -35.743 1.00 80.48  ? 22  PHE C C   1 
ATOM   4364 O O   . PHE C 1 10  ? 22.828  0.847   -34.787 1.00 78.13  ? 22  PHE C O   1 
ATOM   4365 C CB  . PHE C 1 10  ? 24.708  -0.808  -36.949 1.00 84.58  ? 22  PHE C CB  1 
ATOM   4366 C CG  . PHE C 1 10  ? 25.662  -0.680  -35.783 1.00 84.55  ? 22  PHE C CG  1 
ATOM   4367 C CD1 . PHE C 1 10  ? 26.711  0.232   -35.815 1.00 87.98  ? 22  PHE C CD1 1 
ATOM   4368 C CD2 . PHE C 1 10  ? 25.544  -1.507  -34.677 1.00 84.55  ? 22  PHE C CD2 1 
ATOM   4369 C CE1 . PHE C 1 10  ? 27.601  0.337   -34.742 1.00 87.64  ? 22  PHE C CE1 1 
ATOM   4370 C CE2 . PHE C 1 10  ? 26.439  -1.404  -33.612 1.00 86.07  ? 22  PHE C CE2 1 
ATOM   4371 C CZ  . PHE C 1 10  ? 27.456  -0.480  -33.649 1.00 84.69  ? 22  PHE C CZ  1 
ATOM   4372 N N   . THR C 1 11  ? 21.695  -0.858  -35.759 1.00 75.25  ? 23  THR C N   1 
ATOM   4373 C CA  . THR C 1 11  ? 20.718  -1.026  -34.679 1.00 72.27  ? 23  THR C CA  1 
ATOM   4374 C C   . THR C 1 11  ? 21.349  -1.779  -33.518 1.00 73.73  ? 23  THR C C   1 
ATOM   4375 O O   . THR C 1 11  ? 22.010  -2.789  -33.744 1.00 74.94  ? 23  THR C O   1 
ATOM   4376 C CB  . THR C 1 11  ? 19.453  -1.720  -35.201 1.00 82.18  ? 23  THR C CB  1 
ATOM   4377 O OG1 . THR C 1 11  ? 18.898  -0.911  -36.235 1.00 86.77  ? 23  THR C OG1 1 
ATOM   4378 C CG2 . THR C 1 11  ? 18.394  -1.928  -34.114 1.00 79.02  ? 23  THR C CG2 1 
ATOM   4379 N N   . VAL C 1 12  ? 21.167  -1.262  -32.276 1.00 65.88  ? 24  VAL C N   1 
ATOM   4380 C CA  . VAL C 1 12  ? 21.583  -1.934  -31.039 1.00 63.02  ? 24  VAL C CA  1 
ATOM   4381 C C   . VAL C 1 12  ? 20.354  -2.149  -30.161 1.00 61.45  ? 24  VAL C C   1 
ATOM   4382 O O   . VAL C 1 12  ? 19.629  -1.198  -29.871 1.00 59.03  ? 24  VAL C O   1 
ATOM   4383 C CB  . VAL C 1 12  ? 22.718  -1.201  -30.267 1.00 65.57  ? 24  VAL C CB  1 
ATOM   4384 C CG1 . VAL C 1 12  ? 23.153  -2.000  -29.047 1.00 64.26  ? 24  VAL C CG1 1 
ATOM   4385 C CG2 . VAL C 1 12  ? 23.918  -0.962  -31.159 1.00 67.34  ? 24  VAL C CG2 1 
ATOM   4386 N N   . ARG C 1 13  ? 20.111  -3.412  -29.780 1.00 55.90  ? 25  ARG C N   1 
ATOM   4387 C CA  . ARG C 1 13  ? 19.115  -3.794  -28.787 1.00 53.23  ? 25  ARG C CA  1 
ATOM   4388 C C   . ARG C 1 13  ? 19.723  -3.607  -27.393 1.00 52.30  ? 25  ARG C C   1 
ATOM   4389 O O   . ARG C 1 13  ? 20.785  -4.151  -27.106 1.00 51.47  ? 25  ARG C O   1 
ATOM   4390 C CB  . ARG C 1 13  ? 18.664  -5.252  -29.021 1.00 55.71  ? 25  ARG C CB  1 
ATOM   4391 C CG  . ARG C 1 13  ? 17.360  -5.609  -28.329 1.00 64.69  ? 25  ARG C CG  1 
ATOM   4392 C CD  . ARG C 1 13  ? 16.837  -6.971  -28.729 1.00 85.05  ? 25  ARG C CD  1 
ATOM   4393 N NE  . ARG C 1 13  ? 15.485  -7.162  -28.202 1.00 102.81 ? 25  ARG C NE  1 
ATOM   4394 C CZ  . ARG C 1 13  ? 14.639  -8.111  -28.593 1.00 124.64 ? 25  ARG C CZ  1 
ATOM   4395 N NH1 . ARG C 1 13  ? 13.430  -8.195  -28.050 1.00 113.01 ? 25  ARG C NH1 1 
ATOM   4396 N NH2 . ARG C 1 13  ? 14.993  -8.982  -29.531 1.00 115.46 ? 25  ARG C NH2 1 
ATOM   4397 N N   . ILE C 1 14  ? 19.087  -2.785  -26.556 1.00 46.29  ? 26  ILE C N   1 
ATOM   4398 C CA  . ILE C 1 14  ? 19.464  -2.619  -25.148 1.00 43.87  ? 26  ILE C CA  1 
ATOM   4399 C C   . ILE C 1 14  ? 18.313  -3.175  -24.316 1.00 46.39  ? 26  ILE C C   1 
ATOM   4400 O O   . ILE C 1 14  ? 17.204  -2.647  -24.364 1.00 44.75  ? 26  ILE C O   1 
ATOM   4401 C CB  . ILE C 1 14  ? 19.850  -1.148  -24.773 1.00 44.75  ? 26  ILE C CB  1 
ATOM   4402 C CG1 . ILE C 1 14  ? 21.018  -0.599  -25.652 1.00 45.65  ? 26  ILE C CG1 1 
ATOM   4403 C CG2 . ILE C 1 14  ? 20.121  -0.989  -23.260 1.00 43.16  ? 26  ILE C CG2 1 
ATOM   4404 C CD1 . ILE C 1 14  ? 22.406  -1.223  -25.499 1.00 48.98  ? 26  ILE C CD1 1 
ATOM   4405 N N   . VAL C 1 15  ? 18.563  -4.306  -23.646 1.00 43.50  ? 27  VAL C N   1 
ATOM   4406 C CA  . VAL C 1 15  ? 17.589  -4.989  -22.800 1.00 41.70  ? 27  VAL C CA  1 
ATOM   4407 C C   . VAL C 1 15  ? 17.806  -4.513  -21.393 1.00 43.88  ? 27  VAL C C   1 
ATOM   4408 O O   . VAL C 1 15  ? 18.932  -4.554  -20.897 1.00 43.50  ? 27  VAL C O   1 
ATOM   4409 C CB  . VAL C 1 15  ? 17.681  -6.535  -22.906 1.00 45.72  ? 27  VAL C CB  1 
ATOM   4410 C CG1 . VAL C 1 15  ? 16.497  -7.204  -22.220 1.00 44.71  ? 27  VAL C CG1 1 
ATOM   4411 C CG2 . VAL C 1 15  ? 17.776  -6.987  -24.358 1.00 47.13  ? 27  VAL C CG2 1 
ATOM   4412 N N   . THR C 1 16  ? 16.752  -4.018  -20.758 1.00 40.27  ? 28  THR C N   1 
ATOM   4413 C CA  . THR C 1 16  ? 16.834  -3.742  -19.326 1.00 40.05  ? 28  THR C CA  1 
ATOM   4414 C C   . THR C 1 16  ? 16.264  -4.923  -18.542 1.00 47.37  ? 28  THR C C   1 
ATOM   4415 O O   . THR C 1 16  ? 16.118  -6.037  -19.060 1.00 49.02  ? 28  THR C O   1 
ATOM   4416 C CB  . THR C 1 16  ? 16.147  -2.429  -18.938 1.00 43.31  ? 28  THR C CB  1 
ATOM   4417 O OG1 . THR C 1 16  ? 14.740  -2.542  -19.174 1.00 45.62  ? 28  THR C OG1 1 
ATOM   4418 C CG2 . THR C 1 16  ? 16.757  -1.212  -19.616 1.00 38.54  ? 28  THR C CG2 1 
ATOM   4419 N N   . MET C 1 17  ? 15.946  -4.670  -17.284 1.00 43.58  ? 29  MET C N   1 
ATOM   4420 C CA  . MET C 1 17  ? 15.407  -5.685  -16.406 1.00 43.14  ? 29  MET C CA  1 
ATOM   4421 C C   . MET C 1 17  ? 13.979  -6.140  -16.773 1.00 48.37  ? 29  MET C C   1 
ATOM   4422 O O   . MET C 1 17  ? 13.637  -7.285  -16.469 1.00 49.75  ? 29  MET C O   1 
ATOM   4423 C CB  . MET C 1 17  ? 15.477  -5.200  -14.965 1.00 43.87  ? 29  MET C CB  1 
ATOM   4424 C CG  . MET C 1 17  ? 16.794  -5.543  -14.312 1.00 47.01  ? 29  MET C CG  1 
ATOM   4425 S SD  . MET C 1 17  ? 17.340  -7.298  -14.498 1.00 51.15  ? 29  MET C SD  1 
ATOM   4426 C CE  . MET C 1 17  ? 15.961  -8.157  -13.775 1.00 48.40  ? 29  MET C CE  1 
ATOM   4427 N N   . ASP C 1 18  ? 13.173  -5.290  -17.443 1.00 43.44  ? 30  ASP C N   1 
ATOM   4428 C CA  . ASP C 1 18  ? 11.834  -5.709  -17.869 1.00 43.50  ? 30  ASP C CA  1 
ATOM   4429 C C   . ASP C 1 18  ? 11.380  -5.011  -19.174 1.00 47.43  ? 30  ASP C C   1 
ATOM   4430 O O   . ASP C 1 18  ? 10.234  -5.171  -19.583 1.00 47.42  ? 30  ASP C O   1 
ATOM   4431 C CB  . ASP C 1 18  ? 10.806  -5.490  -16.738 1.00 44.12  ? 30  ASP C CB  1 
ATOM   4432 C CG  . ASP C 1 18  ? 10.592  -4.061  -16.276 1.00 47.74  ? 30  ASP C CG  1 
ATOM   4433 O OD1 . ASP C 1 18  ? 11.424  -3.186  -16.624 1.00 45.88  ? 30  ASP C OD1 1 
ATOM   4434 O OD2 . ASP C 1 18  ? 9.631   -3.828  -15.511 1.00 52.58  ? 30  ASP C OD2 1 
ATOM   4435 N N   . ALA C 1 19  ? 12.273  -4.255  -19.828 1.00 43.79  ? 31  ALA C N   1 
ATOM   4436 C CA  . ALA C 1 19  ? 11.952  -3.596  -21.091 1.00 43.36  ? 31  ALA C CA  1 
ATOM   4437 C C   . ALA C 1 19  ? 13.096  -3.734  -22.100 1.00 48.43  ? 31  ALA C C   1 
ATOM   4438 O O   . ALA C 1 19  ? 14.223  -4.075  -21.754 1.00 47.25  ? 31  ALA C O   1 
ATOM   4439 C CB  . ALA C 1 19  ? 11.611  -2.127  -20.862 1.00 42.36  ? 31  ALA C CB  1 
ATOM   4440 N N   . GLU C 1 20  ? 12.775  -3.492  -23.355 1.00 47.52  ? 32  GLU C N   1 
ATOM   4441 C CA  . GLU C 1 20  ? 13.708  -3.526  -24.464 1.00 49.18  ? 32  GLU C CA  1 
ATOM   4442 C C   . GLU C 1 20  ? 13.713  -2.152  -25.115 1.00 53.98  ? 32  GLU C C   1 
ATOM   4443 O O   . GLU C 1 20  ? 12.661  -1.523  -25.225 1.00 52.62  ? 32  GLU C O   1 
ATOM   4444 C CB  . GLU C 1 20  ? 13.271  -4.632  -25.447 1.00 52.20  ? 32  GLU C CB  1 
ATOM   4445 C CG  . GLU C 1 20  ? 14.124  -4.787  -26.692 1.00 62.83  ? 32  GLU C CG  1 
ATOM   4446 C CD  . GLU C 1 20  ? 13.749  -3.950  -27.902 1.00 82.84  ? 32  GLU C CD  1 
ATOM   4447 O OE1 . GLU C 1 20  ? 12.550  -3.636  -28.084 1.00 77.34  ? 32  GLU C OE1 1 
ATOM   4448 O OE2 . GLU C 1 20  ? 14.667  -3.622  -28.684 1.00 75.01  ? 32  GLU C OE2 1 
ATOM   4449 N N   . MET C 1 21  ? 14.891  -1.671  -25.515 1.00 51.68  ? 33  MET C N   1 
ATOM   4450 C CA  . MET C 1 21  ? 14.960  -0.463  -26.322 1.00 51.87  ? 33  MET C CA  1 
ATOM   4451 C C   . MET C 1 21  ? 15.984  -0.620  -27.403 1.00 55.50  ? 33  MET C C   1 
ATOM   4452 O O   . MET C 1 21  ? 17.047  -1.195  -27.191 1.00 55.38  ? 33  MET C O   1 
ATOM   4453 C CB  . MET C 1 21  ? 15.210  0.811   -25.501 1.00 53.35  ? 33  MET C CB  1 
ATOM   4454 C CG  . MET C 1 21  ? 16.124  0.631   -24.328 1.00 57.18  ? 33  MET C CG  1 
ATOM   4455 S SD  . MET C 1 21  ? 16.020  2.094   -23.294 1.00 61.28  ? 33  MET C SD  1 
ATOM   4456 C CE  . MET C 1 21  ? 17.123  1.645   -21.989 1.00 57.73  ? 33  MET C CE  1 
ATOM   4457 N N   . GLU C 1 22  ? 15.629  -0.136  -28.582 1.00 52.61  ? 34  GLU C N   1 
ATOM   4458 C CA  . GLU C 1 22  ? 16.481  -0.117  -29.753 1.00 54.47  ? 34  GLU C CA  1 
ATOM   4459 C C   . GLU C 1 22  ? 16.983  1.295   -30.008 1.00 59.23  ? 34  GLU C C   1 
ATOM   4460 O O   . GLU C 1 22  ? 16.218  2.258   -29.937 1.00 58.23  ? 34  GLU C O   1 
ATOM   4461 C CB  . GLU C 1 22  ? 15.751  -0.682  -30.976 1.00 57.36  ? 34  GLU C CB  1 
ATOM   4462 C CG  . GLU C 1 22  ? 16.028  -2.162  -31.170 1.00 69.71  ? 34  GLU C CG  1 
ATOM   4463 C CD  . GLU C 1 22  ? 15.171  -2.910  -32.169 1.00 98.33  ? 34  GLU C CD  1 
ATOM   4464 O OE1 . GLU C 1 22  ? 15.193  -4.162  -32.131 1.00 89.17  ? 34  GLU C OE1 1 
ATOM   4465 O OE2 . GLU C 1 22  ? 14.487  -2.257  -32.991 1.00 104.73 ? 34  GLU C OE2 1 
ATOM   4466 N N   . PHE C 1 23  ? 18.288  1.405   -30.273 1.00 57.16  ? 35  PHE C N   1 
ATOM   4467 C CA  . PHE C 1 23  ? 18.985  2.648   -30.564 1.00 57.46  ? 35  PHE C CA  1 
ATOM   4468 C C   . PHE C 1 23  ? 19.716  2.512   -31.908 1.00 65.20  ? 35  PHE C C   1 
ATOM   4469 O O   . PHE C 1 23  ? 20.138  1.411   -32.293 1.00 64.97  ? 35  PHE C O   1 
ATOM   4470 C CB  . PHE C 1 23  ? 19.972  2.994   -29.426 1.00 58.46  ? 35  PHE C CB  1 
ATOM   4471 C CG  . PHE C 1 23  ? 19.368  3.200   -28.044 1.00 58.22  ? 35  PHE C CG  1 
ATOM   4472 C CD1 . PHE C 1 23  ? 18.984  4.469   -27.609 1.00 59.65  ? 35  PHE C CD1 1 
ATOM   4473 C CD2 . PHE C 1 23  ? 19.237  2.139   -27.155 1.00 60.26  ? 35  PHE C CD2 1 
ATOM   4474 C CE1 . PHE C 1 23  ? 18.447  4.660   -26.322 1.00 59.11  ? 35  PHE C CE1 1 
ATOM   4475 C CE2 . PHE C 1 23  ? 18.696  2.335   -25.879 1.00 61.88  ? 35  PHE C CE2 1 
ATOM   4476 C CZ  . PHE C 1 23  ? 18.295  3.589   -25.475 1.00 58.77  ? 35  PHE C CZ  1 
ATOM   4477 N N   . ASN C 1 24  ? 19.835  3.628   -32.636 1.00 65.56  ? 36  ASN C N   1 
ATOM   4478 C CA  . ASN C 1 24  ? 20.700  3.691   -33.821 1.00 69.23  ? 36  ASN C CA  1 
ATOM   4479 C C   . ASN C 1 24  ? 22.068  4.183   -33.383 1.00 77.48  ? 36  ASN C C   1 
ATOM   4480 O O   . ASN C 1 24  ? 22.238  5.355   -33.043 1.00 77.79  ? 36  ASN C O   1 
ATOM   4481 C CB  . ASN C 1 24  ? 20.097  4.567   -34.921 1.00 70.91  ? 36  ASN C CB  1 
ATOM   4482 C CG  . ASN C 1 24  ? 18.887  3.945   -35.560 1.00 89.23  ? 36  ASN C CG  1 
ATOM   4483 O OD1 . ASN C 1 24  ? 18.994  2.992   -36.340 1.00 80.99  ? 36  ASN C OD1 1 
ATOM   4484 N ND2 . ASN C 1 24  ? 17.707  4.453   -35.224 1.00 78.88  ? 36  ASN C ND2 1 
ATOM   4485 N N   . CYS C 1 25  ? 23.020  3.257   -33.324 1.00 76.54  ? 37  CYS C N   1 
ATOM   4486 C CA  . CYS C 1 25  ? 24.381  3.505   -32.873 1.00 77.52  ? 37  CYS C CA  1 
ATOM   4487 C C   . CYS C 1 25  ? 25.233  3.840   -34.089 1.00 84.84  ? 37  CYS C C   1 
ATOM   4488 O O   . CYS C 1 25  ? 25.233  3.082   -35.062 1.00 85.98  ? 37  CYS C O   1 
ATOM   4489 C CB  . CYS C 1 25  ? 24.917  2.291   -32.112 1.00 77.88  ? 37  CYS C CB  1 
ATOM   4490 S SG  . CYS C 1 25  ? 26.598  2.479   -31.467 1.00 82.44  ? 37  CYS C SG  1 
ATOM   4491 N N   . GLU C 1 26  ? 25.940  4.984   -34.044 1.00 82.59  ? 38  GLU C N   1 
ATOM   4492 C CA  . GLU C 1 26  ? 26.853  5.416   -35.109 1.00 84.86  ? 38  GLU C CA  1 
ATOM   4493 C C   . GLU C 1 26  ? 28.010  4.432   -35.256 1.00 90.91  ? 38  GLU C C   1 
ATOM   4494 O O   . GLU C 1 26  ? 28.439  3.843   -34.263 1.00 89.76  ? 38  GLU C O   1 
ATOM   4495 C CB  . GLU C 1 26  ? 27.376  6.829   -34.836 1.00 86.08  ? 38  GLU C CB  1 
ATOM   4496 C CG  . GLU C 1 26  ? 26.379  7.919   -35.187 1.00 96.22  ? 38  GLU C CG  1 
ATOM   4497 C CD  . GLU C 1 26  ? 26.905  9.334   -35.058 1.00 120.04 ? 38  GLU C CD  1 
ATOM   4498 O OE1 . GLU C 1 26  ? 26.359  10.102  -34.232 1.00 119.46 ? 38  GLU C OE1 1 
ATOM   4499 O OE2 . GLU C 1 26  ? 27.847  9.684   -35.803 1.00 117.59 ? 38  GLU C OE2 1 
ATOM   4500 N N   . MET C 1 27  ? 28.506  4.253   -36.492 1.00 90.78  ? 39  MET C N   1 
ATOM   4501 C CA  . MET C 1 27  ? 29.524  3.250   -36.838 1.00 93.38  ? 39  MET C CA  1 
ATOM   4502 C C   . MET C 1 27  ? 30.816  3.407   -36.036 1.00 96.20  ? 39  MET C C   1 
ATOM   4503 O O   . MET C 1 27  ? 31.381  2.398   -35.613 1.00 95.92  ? 39  MET C O   1 
ATOM   4504 C CB  . MET C 1 27  ? 29.865  3.288   -38.341 1.00 99.24  ? 39  MET C CB  1 
ATOM   4505 C CG  . MET C 1 27  ? 28.726  2.872   -39.248 1.00 104.15 ? 39  MET C CG  1 
ATOM   4506 S SD  . MET C 1 27  ? 28.222  1.149   -39.057 1.00 109.30 ? 39  MET C SD  1 
ATOM   4507 C CE  . MET C 1 27  ? 26.905  1.080   -40.251 1.00 106.86 ? 39  MET C CE  1 
ATOM   4508 N N   . LYS C 1 28  ? 31.266  4.657   -35.815 1.00 92.21  ? 40  LYS C N   1 
ATOM   4509 C CA  . LYS C 1 28  ? 32.551  4.942   -35.182 1.00 92.88  ? 40  LYS C CA  1 
ATOM   4510 C C   . LYS C 1 28  ? 32.412  5.266   -33.676 1.00 93.79  ? 40  LYS C C   1 
ATOM   4511 O O   . LYS C 1 28  ? 33.403  5.633   -33.034 1.00 93.72  ? 40  LYS C O   1 
ATOM   4512 C CB  . LYS C 1 28  ? 33.274  6.076   -35.931 1.00 97.83  ? 40  LYS C CB  1 
ATOM   4513 C CG  . LYS C 1 28  ? 34.149  5.567   -37.079 1.00 113.96 ? 40  LYS C CG  1 
ATOM   4514 C CD  . LYS C 1 28  ? 34.835  6.696   -37.832 1.00 123.17 ? 40  LYS C CD  1 
ATOM   4515 C CE  . LYS C 1 28  ? 35.829  6.161   -38.831 1.00 137.02 ? 40  LYS C CE  1 
ATOM   4516 N NZ  . LYS C 1 28  ? 36.448  7.249   -39.633 1.00 146.35 ? 40  LYS C NZ  1 
ATOM   4517 N N   . TRP C 1 29  ? 31.200  5.082   -33.110 1.00 87.48  ? 41  TRP C N   1 
ATOM   4518 C CA  . TRP C 1 29  ? 30.913  5.303   -31.691 1.00 84.44  ? 41  TRP C CA  1 
ATOM   4519 C C   . TRP C 1 29  ? 31.600  4.283   -30.796 1.00 86.79  ? 41  TRP C C   1 
ATOM   4520 O O   . TRP C 1 29  ? 31.671  3.101   -31.137 1.00 87.71  ? 41  TRP C O   1 
ATOM   4521 C CB  . TRP C 1 29  ? 29.407  5.262   -31.429 1.00 81.32  ? 41  TRP C CB  1 
ATOM   4522 C CG  . TRP C 1 29  ? 28.718  6.594   -31.450 1.00 81.47  ? 41  TRP C CG  1 
ATOM   4523 C CD1 . TRP C 1 29  ? 29.225  7.782   -31.892 1.00 85.47  ? 41  TRP C CD1 1 
ATOM   4524 C CD2 . TRP C 1 29  ? 27.379  6.862   -31.024 1.00 79.39  ? 41  TRP C CD2 1 
ATOM   4525 N NE1 . TRP C 1 29  ? 28.285  8.774   -31.762 1.00 83.84  ? 41  TRP C NE1 1 
ATOM   4526 C CE2 . TRP C 1 29  ? 27.141  8.239   -31.230 1.00 83.36  ? 41  TRP C CE2 1 
ATOM   4527 C CE3 . TRP C 1 29  ? 26.356  6.072   -30.469 1.00 79.26  ? 41  TRP C CE3 1 
ATOM   4528 C CZ2 . TRP C 1 29  ? 25.921  8.844   -30.908 1.00 81.15  ? 41  TRP C CZ2 1 
ATOM   4529 C CZ3 . TRP C 1 29  ? 25.151  6.673   -30.132 1.00 79.35  ? 41  TRP C CZ3 1 
ATOM   4530 C CH2 . TRP C 1 29  ? 24.942  8.043   -30.349 1.00 79.97  ? 41  TRP C CH2 1 
ATOM   4531 N N   . LYS C 1 30  ? 32.108  4.757   -29.649 1.00 80.26  ? 42  LYS C N   1 
ATOM   4532 C CA  . LYS C 1 30  ? 32.713  3.931   -28.603 1.00 78.55  ? 42  LYS C CA  1 
ATOM   4533 C C   . LYS C 1 30  ? 31.629  3.514   -27.596 1.00 77.91  ? 42  LYS C C   1 
ATOM   4534 O O   . LYS C 1 30  ? 30.504  4.019   -27.664 1.00 76.02  ? 42  LYS C O   1 
ATOM   4535 C CB  . LYS C 1 30  ? 33.858  4.697   -27.914 1.00 81.44  ? 42  LYS C CB  1 
ATOM   4536 C CG  . LYS C 1 30  ? 35.062  4.942   -28.820 1.00 98.77  ? 42  LYS C CG  1 
ATOM   4537 C CD  . LYS C 1 30  ? 36.058  5.911   -28.198 1.00 107.96 ? 42  LYS C CD  1 
ATOM   4538 C CE  . LYS C 1 30  ? 37.318  6.020   -29.020 1.00 118.45 ? 42  LYS C CE  1 
ATOM   4539 N NZ  . LYS C 1 30  ? 38.425  6.634   -28.244 1.00 125.60 ? 42  LYS C NZ  1 
ATOM   4540 N N   . GLY C 1 31  ? 31.968  2.602   -26.685 1.00 72.52  ? 43  GLY C N   1 
ATOM   4541 C CA  . GLY C 1 31  ? 31.068  2.118   -25.644 1.00 69.48  ? 43  GLY C CA  1 
ATOM   4542 C C   . GLY C 1 31  ? 30.480  3.212   -24.779 1.00 70.20  ? 43  GLY C C   1 
ATOM   4543 O O   . GLY C 1 31  ? 29.306  3.142   -24.401 1.00 68.08  ? 43  GLY C O   1 
ATOM   4544 N N   . LYS C 1 32  ? 31.286  4.245   -24.483 1.00 66.23  ? 44  LYS C N   1 
ATOM   4545 C CA  . LYS C 1 32  ? 30.873  5.389   -23.668 1.00 64.10  ? 44  LYS C CA  1 
ATOM   4546 C C   . LYS C 1 32  ? 29.740  6.178   -24.339 1.00 63.60  ? 44  LYS C C   1 
ATOM   4547 O O   . LYS C 1 32  ? 28.855  6.648   -23.640 1.00 60.44  ? 44  LYS C O   1 
ATOM   4548 C CB  . LYS C 1 32  ? 32.068  6.308   -23.366 1.00 69.05  ? 44  LYS C CB  1 
ATOM   4549 C CG  . LYS C 1 32  ? 31.859  7.118   -22.088 1.00 94.25  ? 44  LYS C CG  1 
ATOM   4550 C CD  . LYS C 1 32  ? 32.944  8.130   -21.784 1.00 106.73 ? 44  LYS C CD  1 
ATOM   4551 C CE  . LYS C 1 32  ? 32.385  9.100   -20.765 1.00 115.38 ? 44  LYS C CE  1 
ATOM   4552 N NZ  . LYS C 1 32  ? 32.420  8.551   -19.378 1.00 122.45 ? 44  LYS C NZ  1 
ATOM   4553 N N   . ASP C 1 33  ? 29.779  6.324   -25.682 1.00 60.63  ? 45  ASP C N   1 
ATOM   4554 C CA  . ASP C 1 33  ? 28.764  7.030   -26.476 1.00 59.01  ? 45  ASP C CA  1 
ATOM   4555 C C   . ASP C 1 33  ? 27.411  6.318   -26.385 1.00 60.14  ? 45  ASP C C   1 
ATOM   4556 O O   . ASP C 1 33  ? 26.381  6.949   -26.091 1.00 58.32  ? 45  ASP C O   1 
ATOM   4557 C CB  . ASP C 1 33  ? 29.198  7.129   -27.948 1.00 62.51  ? 45  ASP C CB  1 
ATOM   4558 C CG  . ASP C 1 33  ? 30.481  7.891   -28.202 1.00 72.84  ? 45  ASP C CG  1 
ATOM   4559 O OD1 . ASP C 1 33  ? 30.546  9.085   -27.833 1.00 73.12  ? 45  ASP C OD1 1 
ATOM   4560 O OD2 . ASP C 1 33  ? 31.387  7.322   -28.847 1.00 78.66  ? 45  ASP C OD2 1 
ATOM   4561 N N   . LEU C 1 34  ? 27.425  4.997   -26.646 1.00 55.18  ? 46  LEU C N   1 
ATOM   4562 C CA  . LEU C 1 34  ? 26.253  4.139   -26.532 1.00 52.85  ? 46  LEU C CA  1 
ATOM   4563 C C   . LEU C 1 34  ? 25.724  4.108   -25.083 1.00 54.19  ? 46  LEU C C   1 
ATOM   4564 O O   . LEU C 1 34  ? 24.518  4.282   -24.895 1.00 52.08  ? 46  LEU C O   1 
ATOM   4565 C CB  . LEU C 1 34  ? 26.563  2.717   -27.039 1.00 53.74  ? 46  LEU C CB  1 
ATOM   4566 C CG  . LEU C 1 34  ? 25.459  1.659   -26.935 1.00 56.86  ? 46  LEU C CG  1 
ATOM   4567 C CD1 . LEU C 1 34  ? 24.201  2.074   -27.699 1.00 56.19  ? 46  LEU C CD1 1 
ATOM   4568 C CD2 . LEU C 1 34  ? 25.954  0.321   -27.432 1.00 59.68  ? 46  LEU C CD2 1 
ATOM   4569 N N   . PHE C 1 35  ? 26.613  3.916   -24.076 1.00 50.39  ? 47  PHE C N   1 
ATOM   4570 C CA  . PHE C 1 35  ? 26.244  3.859   -22.647 1.00 47.90  ? 47  PHE C CA  1 
ATOM   4571 C C   . PHE C 1 35  ? 25.597  5.149   -22.177 1.00 53.25  ? 47  PHE C C   1 
ATOM   4572 O O   . PHE C 1 35  ? 24.556  5.084   -21.530 1.00 52.96  ? 47  PHE C O   1 
ATOM   4573 C CB  . PHE C 1 35  ? 27.460  3.539   -21.760 1.00 49.06  ? 47  PHE C CB  1 
ATOM   4574 C CG  . PHE C 1 35  ? 27.212  3.508   -20.263 1.00 47.75  ? 47  PHE C CG  1 
ATOM   4575 C CD1 . PHE C 1 35  ? 26.522  2.451   -19.675 1.00 49.23  ? 47  PHE C CD1 1 
ATOM   4576 C CD2 . PHE C 1 35  ? 27.711  4.510   -19.435 1.00 47.21  ? 47  PHE C CD2 1 
ATOM   4577 C CE1 . PHE C 1 35  ? 26.322  2.411   -18.288 1.00 48.02  ? 47  PHE C CE1 1 
ATOM   4578 C CE2 . PHE C 1 35  ? 27.488  4.481   -18.054 1.00 47.24  ? 47  PHE C CE2 1 
ATOM   4579 C CZ  . PHE C 1 35  ? 26.806  3.429   -17.488 1.00 44.93  ? 47  PHE C CZ  1 
ATOM   4580 N N   . ASP C 1 36  ? 26.175  6.314   -22.517 1.00 51.89  ? 48  ASP C N   1 
ATOM   4581 C CA  . ASP C 1 36  ? 25.648  7.598   -22.054 1.00 51.81  ? 48  ASP C CA  1 
ATOM   4582 C C   . ASP C 1 36  ? 24.311  7.954   -22.730 1.00 54.26  ? 48  ASP C C   1 
ATOM   4583 O O   . ASP C 1 36  ? 23.493  8.640   -22.114 1.00 53.79  ? 48  ASP C O   1 
ATOM   4584 C CB  . ASP C 1 36  ? 26.676  8.730   -22.193 1.00 55.33  ? 48  ASP C CB  1 
ATOM   4585 C CG  . ASP C 1 36  ? 27.677  8.721   -21.031 1.00 73.85  ? 48  ASP C CG  1 
ATOM   4586 O OD1 . ASP C 1 36  ? 27.274  9.054   -19.880 1.00 74.23  ? 48  ASP C OD1 1 
ATOM   4587 O OD2 . ASP C 1 36  ? 28.843  8.334   -21.254 1.00 81.01  ? 48  ASP C OD2 1 
ATOM   4588 N N   . LEU C 1 37  ? 24.072  7.453   -23.955 1.00 49.42  ? 49  LEU C N   1 
ATOM   4589 C CA  . LEU C 1 37  ? 22.793  7.572   -24.663 1.00 47.66  ? 49  LEU C CA  1 
ATOM   4590 C C   . LEU C 1 37  ? 21.676  6.814   -23.915 1.00 48.21  ? 49  LEU C C   1 
ATOM   4591 O O   . LEU C 1 37  ? 20.566  7.336   -23.772 1.00 45.72  ? 49  LEU C O   1 
ATOM   4592 C CB  . LEU C 1 37  ? 22.949  7.044   -26.108 1.00 49.24  ? 49  LEU C CB  1 
ATOM   4593 C CG  . LEU C 1 37  ? 21.723  7.057   -27.014 1.00 53.89  ? 49  LEU C CG  1 
ATOM   4594 C CD1 . LEU C 1 37  ? 21.232  8.461   -27.261 1.00 53.97  ? 49  LEU C CD1 1 
ATOM   4595 C CD2 . LEU C 1 37  ? 22.016  6.360   -28.349 1.00 57.11  ? 49  LEU C CD2 1 
ATOM   4596 N N   . VAL C 1 38  ? 21.980  5.592   -23.426 1.00 43.85  ? 50  VAL C N   1 
ATOM   4597 C CA  . VAL C 1 38  ? 21.050  4.760   -22.647 1.00 41.23  ? 50  VAL C CA  1 
ATOM   4598 C C   . VAL C 1 38  ? 20.732  5.465   -21.321 1.00 43.75  ? 50  VAL C C   1 
ATOM   4599 O O   . VAL C 1 38  ? 19.560  5.575   -20.959 1.00 43.60  ? 50  VAL C O   1 
ATOM   4600 C CB  . VAL C 1 38  ? 21.590  3.325   -22.423 1.00 44.28  ? 50  VAL C CB  1 
ATOM   4601 C CG1 . VAL C 1 38  ? 20.624  2.494   -21.592 1.00 43.24  ? 50  VAL C CG1 1 
ATOM   4602 C CG2 . VAL C 1 38  ? 21.876  2.633   -23.757 1.00 45.19  ? 50  VAL C CG2 1 
ATOM   4603 N N   . CYS C 1 39  ? 21.768  5.969   -20.622 1.00 38.68  ? 51  CYS C N   1 
ATOM   4604 C CA  . CYS C 1 39  ? 21.643  6.686   -19.342 1.00 36.94  ? 51  CYS C CA  1 
ATOM   4605 C C   . CYS C 1 39  ? 20.799  7.952   -19.488 1.00 42.71  ? 51  CYS C C   1 
ATOM   4606 O O   . CYS C 1 39  ? 19.916  8.183   -18.660 1.00 41.80  ? 51  CYS C O   1 
ATOM   4607 C CB  . CYS C 1 39  ? 23.017  7.003   -18.765 1.00 36.48  ? 51  CYS C CB  1 
ATOM   4608 S SG  . CYS C 1 39  ? 23.962  5.541   -18.299 1.00 39.86  ? 51  CYS C SG  1 
ATOM   4609 N N   . ARG C 1 40  ? 21.051  8.753   -20.546 1.00 41.45  ? 52  ARG C N   1 
ATOM   4610 C CA  . ARG C 1 40  ? 20.283  9.969   -20.854 1.00 41.83  ? 52  ARG C CA  1 
ATOM   4611 C C   . ARG C 1 40  ? 18.800  9.641   -21.145 1.00 43.10  ? 52  ARG C C   1 
ATOM   4612 O O   . ARG C 1 40  ? 17.927  10.394  -20.728 1.00 41.41  ? 52  ARG C O   1 
ATOM   4613 C CB  . ARG C 1 40  ? 20.923  10.727  -22.037 1.00 46.49  ? 52  ARG C CB  1 
ATOM   4614 C CG  . ARG C 1 40  ? 20.587  12.217  -22.068 1.00 69.60  ? 52  ARG C CG  1 
ATOM   4615 C CD  . ARG C 1 40  ? 21.667  13.057  -22.730 1.00 92.72  ? 52  ARG C CD  1 
ATOM   4616 N NE  . ARG C 1 40  ? 21.976  12.606  -24.088 1.00 112.28 ? 52  ARG C NE  1 
ATOM   4617 C CZ  . ARG C 1 40  ? 23.204  12.359  -24.537 1.00 136.12 ? 52  ARG C CZ  1 
ATOM   4618 N NH1 . ARG C 1 40  ? 24.258  12.537  -23.748 1.00 126.10 ? 52  ARG C NH1 1 
ATOM   4619 N NH2 . ARG C 1 40  ? 23.388  11.940  -25.783 1.00 127.87 ? 52  ARG C NH2 1 
ATOM   4620 N N   . THR C 1 41  ? 18.525  8.499   -21.822 1.00 40.04  ? 53  THR C N   1 
ATOM   4621 C CA  . THR C 1 41  ? 17.177  7.995   -22.152 1.00 39.10  ? 53  THR C CA  1 
ATOM   4622 C C   . THR C 1 41  ? 16.390  7.695   -20.859 1.00 41.82  ? 53  THR C C   1 
ATOM   4623 O O   . THR C 1 41  ? 15.171  7.879   -20.818 1.00 41.26  ? 53  THR C O   1 
ATOM   4624 C CB  . THR C 1 41  ? 17.294  6.754   -23.090 1.00 49.35  ? 53  THR C CB  1 
ATOM   4625 O OG1 . THR C 1 41  ? 17.995  7.134   -24.280 1.00 54.39  ? 53  THR C OG1 1 
ATOM   4626 C CG2 . THR C 1 41  ? 15.952  6.138   -23.468 1.00 44.23  ? 53  THR C CG2 1 
ATOM   4627 N N   . LEU C 1 42  ? 17.089  7.248   -19.807 1.00 37.62  ? 54  LEU C N   1 
ATOM   4628 C CA  . LEU C 1 42  ? 16.467  6.876   -18.532 1.00 34.87  ? 54  LEU C CA  1 
ATOM   4629 C C   . LEU C 1 42  ? 16.586  7.997   -17.486 1.00 37.91  ? 54  LEU C C   1 
ATOM   4630 O O   . LEU C 1 42  ? 16.134  7.834   -16.348 1.00 37.43  ? 54  LEU C O   1 
ATOM   4631 C CB  . LEU C 1 42  ? 17.104  5.574   -18.007 1.00 34.00  ? 54  LEU C CB  1 
ATOM   4632 C CG  . LEU C 1 42  ? 17.085  4.371   -18.950 1.00 36.84  ? 54  LEU C CG  1 
ATOM   4633 C CD1 . LEU C 1 42  ? 17.908  3.259   -18.394 1.00 36.84  ? 54  LEU C CD1 1 
ATOM   4634 C CD2 . LEU C 1 42  ? 15.677  3.889   -19.212 1.00 36.55  ? 54  LEU C CD2 1 
ATOM   4635 N N   . GLY C 1 43  ? 17.176  9.121   -17.893 1.00 34.31  ? 55  GLY C N   1 
ATOM   4636 C CA  . GLY C 1 43  ? 17.409  10.285  -17.046 1.00 33.62  ? 55  GLY C CA  1 
ATOM   4637 C C   . GLY C 1 43  ? 18.337  10.009  -15.883 1.00 36.92  ? 55  GLY C C   1 
ATOM   4638 O O   . GLY C 1 43  ? 18.200  10.622  -14.821 1.00 37.26  ? 55  GLY C O   1 
ATOM   4639 N N   . LEU C 1 44  ? 19.297  9.095   -16.085 1.00 33.04  ? 56  LEU C N   1 
ATOM   4640 C CA  . LEU C 1 44  ? 20.138  8.527   -15.035 1.00 32.27  ? 56  LEU C CA  1 
ATOM   4641 C C   . LEU C 1 44  ? 21.491  9.224   -14.975 1.00 36.05  ? 56  LEU C C   1 
ATOM   4642 O O   . LEU C 1 44  ? 22.217  9.272   -15.976 1.00 36.33  ? 56  LEU C O   1 
ATOM   4643 C CB  . LEU C 1 44  ? 20.313  7.015   -15.278 1.00 32.36  ? 56  LEU C CB  1 
ATOM   4644 C CG  . LEU C 1 44  ? 21.294  6.258   -14.397 1.00 36.40  ? 56  LEU C CG  1 
ATOM   4645 C CD1 . LEU C 1 44  ? 20.706  5.999   -13.016 1.00 35.79  ? 56  LEU C CD1 1 
ATOM   4646 C CD2 . LEU C 1 44  ? 21.690  4.963   -15.060 1.00 37.70  ? 56  LEU C CD2 1 
ATOM   4647 N N   . ARG C 1 45  ? 21.812  9.769   -13.789 1.00 31.58  ? 57  ARG C N   1 
ATOM   4648 C CA  . ARG C 1 45  ? 23.065  10.460  -13.506 1.00 32.01  ? 57  ARG C CA  1 
ATOM   4649 C C   . ARG C 1 45  ? 23.998  9.628   -12.622 1.00 35.94  ? 57  ARG C C   1 
ATOM   4650 O O   . ARG C 1 45  ? 25.217  9.746   -12.761 1.00 37.23  ? 57  ARG C O   1 
ATOM   4651 C CB  . ARG C 1 45  ? 22.791  11.816  -12.857 1.00 32.26  ? 57  ARG C CB  1 
ATOM   4652 C CG  . ARG C 1 45  ? 22.237  12.839  -13.864 1.00 33.99  ? 57  ARG C CG  1 
ATOM   4653 C CD  . ARG C 1 45  ? 22.008  14.225  -13.308 1.00 33.04  ? 57  ARG C CD  1 
ATOM   4654 N NE  . ARG C 1 45  ? 21.310  14.212  -12.026 1.00 35.83  ? 57  ARG C NE  1 
ATOM   4655 C CZ  . ARG C 1 45  ? 19.987  14.163  -11.879 1.00 43.26  ? 57  ARG C CZ  1 
ATOM   4656 N NH1 . ARG C 1 45  ? 19.195  14.105  -12.942 1.00 27.88  ? 57  ARG C NH1 1 
ATOM   4657 N NH2 . ARG C 1 45  ? 19.449  14.172  -10.666 1.00 22.48  ? 57  ARG C NH2 1 
ATOM   4658 N N   . GLU C 1 46  ? 23.438  8.773   -11.738 1.00 30.70  ? 58  GLU C N   1 
ATOM   4659 C CA  . GLU C 1 46  ? 24.193  7.852   -10.867 1.00 29.62  ? 58  GLU C CA  1 
ATOM   4660 C C   . GLU C 1 46  ? 24.634  6.616   -11.694 1.00 34.77  ? 58  GLU C C   1 
ATOM   4661 O O   . GLU C 1 46  ? 24.205  5.481   -11.446 1.00 34.84  ? 58  GLU C O   1 
ATOM   4662 C CB  . GLU C 1 46  ? 23.344  7.467   -9.641  1.00 29.67  ? 58  GLU C CB  1 
ATOM   4663 C CG  . GLU C 1 46  ? 22.894  8.670   -8.828  1.00 32.91  ? 58  GLU C CG  1 
ATOM   4664 C CD  . GLU C 1 46  ? 21.983  8.410   -7.640  1.00 48.61  ? 58  GLU C CD  1 
ATOM   4665 O OE1 . GLU C 1 46  ? 20.971  7.688   -7.792  1.00 38.12  ? 58  GLU C OE1 1 
ATOM   4666 O OE2 . GLU C 1 46  ? 22.231  9.018   -6.576  1.00 52.83  ? 58  GLU C OE2 1 
ATOM   4667 N N   . THR C 1 47  ? 25.529  6.857   -12.676 1.00 31.32  ? 59  THR C N   1 
ATOM   4668 C CA  . THR C 1 47  ? 25.784  5.916   -13.770 1.00 30.85  ? 59  THR C CA  1 
ATOM   4669 C C   . THR C 1 47  ? 26.878  4.896   -13.430 1.00 37.17  ? 59  THR C C   1 
ATOM   4670 O O   . THR C 1 47  ? 26.908  3.841   -14.077 1.00 38.00  ? 59  THR C O   1 
ATOM   4671 C CB  . THR C 1 47  ? 26.123  6.659   -15.073 1.00 34.63  ? 59  THR C CB  1 
ATOM   4672 O OG1 . THR C 1 47  ? 27.309  7.408   -14.897 1.00 36.28  ? 59  THR C OG1 1 
ATOM   4673 C CG2 . THR C 1 47  ? 25.019  7.590   -15.538 1.00 32.46  ? 59  THR C CG2 1 
ATOM   4674 N N   . TRP C 1 48  ? 27.746  5.188   -12.409 1.00 34.05  ? 60  TRP C N   1 
ATOM   4675 C CA  . TRP C 1 48  ? 28.933  4.387   -12.032 1.00 35.02  ? 60  TRP C CA  1 
ATOM   4676 C C   . TRP C 1 48  ? 28.601  2.943   -11.610 1.00 38.38  ? 60  TRP C C   1 
ATOM   4677 O O   . TRP C 1 48  ? 29.473  2.074   -11.680 1.00 38.25  ? 60  TRP C O   1 
ATOM   4678 C CB  . TRP C 1 48  ? 29.733  5.065   -10.903 1.00 34.31  ? 60  TRP C CB  1 
ATOM   4679 C CG  . TRP C 1 48  ? 28.899  5.497   -9.735  1.00 34.33  ? 60  TRP C CG  1 
ATOM   4680 C CD1 . TRP C 1 48  ? 28.540  4.740   -8.658  1.00 37.03  ? 60  TRP C CD1 1 
ATOM   4681 C CD2 . TRP C 1 48  ? 28.284  6.776   -9.551  1.00 33.36  ? 60  TRP C CD2 1 
ATOM   4682 N NE1 . TRP C 1 48  ? 27.742  5.475   -7.805  1.00 35.78  ? 60  TRP C NE1 1 
ATOM   4683 C CE2 . TRP C 1 48  ? 27.570  6.728   -8.329  1.00 36.57  ? 60  TRP C CE2 1 
ATOM   4684 C CE3 . TRP C 1 48  ? 28.290  7.974   -10.285 1.00 34.82  ? 60  TRP C CE3 1 
ATOM   4685 C CZ2 . TRP C 1 48  ? 26.857  7.827   -7.835  1.00 34.97  ? 60  TRP C CZ2 1 
ATOM   4686 C CZ3 . TRP C 1 48  ? 27.601  9.068   -9.787  1.00 35.57  ? 60  TRP C CZ3 1 
ATOM   4687 C CH2 . TRP C 1 48  ? 26.880  8.985   -8.585  1.00 35.45  ? 60  TRP C CH2 1 
ATOM   4688 N N   . PHE C 1 49  ? 27.357  2.696   -11.166 1.00 34.97  ? 61  PHE C N   1 
ATOM   4689 C CA  . PHE C 1 49  ? 26.867  1.366   -10.812 1.00 34.96  ? 61  PHE C CA  1 
ATOM   4690 C C   . PHE C 1 49  ? 26.688  0.474   -12.033 1.00 40.11  ? 61  PHE C C   1 
ATOM   4691 O O   . PHE C 1 49  ? 26.776  -0.750  -11.918 1.00 40.92  ? 61  PHE C O   1 
ATOM   4692 C CB  . PHE C 1 49  ? 25.528  1.465   -10.072 1.00 35.81  ? 61  PHE C CB  1 
ATOM   4693 C CG  . PHE C 1 49  ? 25.556  2.171   -8.736  1.00 37.14  ? 61  PHE C CG  1 
ATOM   4694 C CD1 . PHE C 1 49  ? 26.289  1.653   -7.672  1.00 40.71  ? 61  PHE C CD1 1 
ATOM   4695 C CD2 . PHE C 1 49  ? 24.794  3.312   -8.518  1.00 38.42  ? 61  PHE C CD2 1 
ATOM   4696 C CE1 . PHE C 1 49  ? 26.289  2.291   -6.425  1.00 41.03  ? 61  PHE C CE1 1 
ATOM   4697 C CE2 . PHE C 1 49  ? 24.795  3.946   -7.269  1.00 40.62  ? 61  PHE C CE2 1 
ATOM   4698 C CZ  . PHE C 1 49  ? 25.540  3.429   -6.231  1.00 38.94  ? 61  PHE C CZ  1 
ATOM   4699 N N   . PHE C 1 50  ? 26.469  1.081   -13.207 1.00 36.29  ? 62  PHE C N   1 
ATOM   4700 C CA  . PHE C 1 50  ? 25.920  0.366   -14.363 1.00 34.77  ? 62  PHE C CA  1 
ATOM   4701 C C   . PHE C 1 50  ? 26.947  0.134   -15.463 1.00 40.76  ? 62  PHE C C   1 
ATOM   4702 O O   . PHE C 1 50  ? 27.989  0.799   -15.524 1.00 41.60  ? 62  PHE C O   1 
ATOM   4703 C CB  . PHE C 1 50  ? 24.699  1.127   -14.915 1.00 34.20  ? 62  PHE C CB  1 
ATOM   4704 C CG  . PHE C 1 50  ? 23.615  1.273   -13.874 1.00 32.42  ? 62  PHE C CG  1 
ATOM   4705 C CD1 . PHE C 1 50  ? 22.700  0.255   -13.657 1.00 33.64  ? 62  PHE C CD1 1 
ATOM   4706 C CD2 . PHE C 1 50  ? 23.548  2.402   -13.068 1.00 33.11  ? 62  PHE C CD2 1 
ATOM   4707 C CE1 . PHE C 1 50  ? 21.729  0.366   -12.658 1.00 32.88  ? 62  PHE C CE1 1 
ATOM   4708 C CE2 . PHE C 1 50  ? 22.567  2.515   -12.071 1.00 35.36  ? 62  PHE C CE2 1 
ATOM   4709 C CZ  . PHE C 1 50  ? 21.662  1.496   -11.877 1.00 32.23  ? 62  PHE C CZ  1 
ATOM   4710 N N   . GLY C 1 51  ? 26.642  -0.850  -16.296 1.00 37.52  ? 63  GLY C N   1 
ATOM   4711 C CA  . GLY C 1 51  ? 27.369  -1.145  -17.516 1.00 38.45  ? 63  GLY C CA  1 
ATOM   4712 C C   . GLY C 1 51  ? 26.477  -1.834  -18.521 1.00 42.63  ? 63  GLY C C   1 
ATOM   4713 O O   . GLY C 1 51  ? 25.291  -2.061  -18.251 1.00 40.37  ? 63  GLY C O   1 
ATOM   4714 N N   . LEU C 1 52  ? 27.050  -2.166  -19.693 1.00 41.37  ? 64  LEU C N   1 
ATOM   4715 C CA  . LEU C 1 52  ? 26.385  -2.918  -20.761 1.00 41.58  ? 64  LEU C CA  1 
ATOM   4716 C C   . LEU C 1 52  ? 27.012  -4.307  -20.861 1.00 49.04  ? 64  LEU C C   1 
ATOM   4717 O O   . LEU C 1 52  ? 28.178  -4.451  -21.240 1.00 49.93  ? 64  LEU C O   1 
ATOM   4718 C CB  . LEU C 1 52  ? 26.447  -2.167  -22.105 1.00 41.91  ? 64  LEU C CB  1 
ATOM   4719 C CG  . LEU C 1 52  ? 25.697  -0.827  -22.176 1.00 44.83  ? 64  LEU C CG  1 
ATOM   4720 C CD1 . LEU C 1 52  ? 26.128  -0.036  -23.383 1.00 46.01  ? 64  LEU C CD1 1 
ATOM   4721 C CD2 . LEU C 1 52  ? 24.169  -1.022  -22.169 1.00 43.58  ? 64  LEU C CD2 1 
ATOM   4722 N N   . GLN C 1 53  ? 26.234  -5.323  -20.491 1.00 47.33  ? 65  GLN C N   1 
ATOM   4723 C CA  . GLN C 1 53  ? 26.694  -6.701  -20.379 1.00 49.70  ? 65  GLN C CA  1 
ATOM   4724 C C   . GLN C 1 53  ? 26.323  -7.535  -21.614 1.00 60.20  ? 65  GLN C C   1 
ATOM   4725 O O   . GLN C 1 53  ? 25.286  -7.310  -22.239 1.00 60.23  ? 65  GLN C O   1 
ATOM   4726 C CB  . GLN C 1 53  ? 26.102  -7.337  -19.116 1.00 49.42  ? 65  GLN C CB  1 
ATOM   4727 C CG  . GLN C 1 53  ? 26.824  -8.586  -18.639 1.00 42.19  ? 65  GLN C CG  1 
ATOM   4728 C CD  . GLN C 1 53  ? 25.958  -9.374  -17.703 1.00 57.50  ? 65  GLN C CD  1 
ATOM   4729 O OE1 . GLN C 1 53  ? 26.106  -9.313  -16.483 1.00 53.86  ? 65  GLN C OE1 1 
ATOM   4730 N NE2 . GLN C 1 53  ? 25.006  -10.104 -18.249 1.00 51.58  ? 65  GLN C NE2 1 
ATOM   4731 N N   . TYR C 1 54  ? 27.199  -8.484  -21.959 1.00 61.10  ? 66  TYR C N   1 
ATOM   4732 C CA  . TYR C 1 54  ? 27.012  -9.518  -22.972 1.00 64.33  ? 66  TYR C CA  1 
ATOM   4733 C C   . TYR C 1 54  ? 27.730  -10.800 -22.501 1.00 73.99  ? 66  TYR C C   1 
ATOM   4734 O O   . TYR C 1 54  ? 28.375  -10.777 -21.449 1.00 73.25  ? 66  TYR C O   1 
ATOM   4735 C CB  . TYR C 1 54  ? 27.506  -9.037  -24.354 1.00 67.12  ? 66  TYR C CB  1 
ATOM   4736 C CG  . TYR C 1 54  ? 28.975  -8.668  -24.427 1.00 69.76  ? 66  TYR C CG  1 
ATOM   4737 C CD1 . TYR C 1 54  ? 29.440  -7.468  -23.895 1.00 70.50  ? 66  TYR C CD1 1 
ATOM   4738 C CD2 . TYR C 1 54  ? 29.885  -9.478  -25.104 1.00 72.54  ? 66  TYR C CD2 1 
ATOM   4739 C CE1 . TYR C 1 54  ? 30.787  -7.114  -23.973 1.00 72.47  ? 66  TYR C CE1 1 
ATOM   4740 C CE2 . TYR C 1 54  ? 31.234  -9.128  -25.200 1.00 74.56  ? 66  TYR C CE2 1 
ATOM   4741 C CZ  . TYR C 1 54  ? 31.681  -7.944  -24.631 1.00 81.43  ? 66  TYR C CZ  1 
ATOM   4742 O OH  . TYR C 1 54  ? 33.009  -7.587  -24.702 1.00 82.68  ? 66  TYR C OH  1 
ATOM   4743 N N   . THR C 1 55  ? 27.603  -11.918 -23.236 1.00 75.53  ? 67  THR C N   1 
ATOM   4744 C CA  . THR C 1 55  ? 28.232  -13.170 -22.804 1.00 77.84  ? 67  THR C CA  1 
ATOM   4745 C C   . THR C 1 55  ? 29.175  -13.724 -23.874 1.00 86.21  ? 67  THR C C   1 
ATOM   4746 O O   . THR C 1 55  ? 28.784  -13.877 -25.035 1.00 86.59  ? 67  THR C O   1 
ATOM   4747 C CB  . THR C 1 55  ? 27.185  -14.215 -22.374 1.00 88.60  ? 67  THR C CB  1 
ATOM   4748 O OG1 . THR C 1 55  ? 26.180  -14.336 -23.383 1.00 93.44  ? 67  THR C OG1 1 
ATOM   4749 C CG2 . THR C 1 55  ? 26.544  -13.888 -21.022 1.00 83.96  ? 67  THR C CG2 1 
ATOM   4750 N N   . ILE C 1 56  ? 30.434  -13.992 -23.472 1.00 86.19  ? 68  ILE C N   1 
ATOM   4751 C CA  . ILE C 1 56  ? 31.428  -14.693 -24.292 1.00 89.80  ? 68  ILE C CA  1 
ATOM   4752 C C   . ILE C 1 56  ? 31.490  -16.151 -23.807 1.00 96.57  ? 68  ILE C C   1 
ATOM   4753 O O   . ILE C 1 56  ? 31.803  -16.404 -22.639 1.00 95.08  ? 68  ILE C O   1 
ATOM   4754 C CB  . ILE C 1 56  ? 32.822  -13.993 -24.301 1.00 93.65  ? 68  ILE C CB  1 
ATOM   4755 C CG1 . ILE C 1 56  ? 32.703  -12.504 -24.749 1.00 93.21  ? 68  ILE C CG1 1 
ATOM   4756 C CG2 . ILE C 1 56  ? 33.815  -14.770 -25.190 1.00 97.06  ? 68  ILE C CG2 1 
ATOM   4757 C CD1 . ILE C 1 56  ? 33.948  -11.598 -24.456 1.00 101.98 ? 68  ILE C CD1 1 
ATOM   4758 N N   . LYS C 1 57  ? 31.191  -17.097 -24.726 1.00 96.67  ? 69  LYS C N   1 
ATOM   4759 C CA  . LYS C 1 57  ? 30.971  -18.530 -24.483 1.00 98.28  ? 69  LYS C CA  1 
ATOM   4760 C C   . LYS C 1 57  ? 29.860  -18.730 -23.424 1.00 101.76 ? 69  LYS C C   1 
ATOM   4761 O O   . LYS C 1 57  ? 28.693  -18.892 -23.792 1.00 101.95 ? 69  LYS C O   1 
ATOM   4762 C CB  . LYS C 1 57  ? 32.271  -19.273 -24.103 1.00 101.76 ? 69  LYS C CB  1 
ATOM   4763 C CG  . LYS C 1 57  ? 33.104  -19.697 -25.300 1.00 116.31 ? 69  LYS C CG  1 
ATOM   4764 C CD  . LYS C 1 57  ? 34.001  -20.884 -24.955 1.00 126.19 ? 69  LYS C CD  1 
ATOM   4765 C CE  . LYS C 1 57  ? 34.701  -21.442 -26.170 1.00 138.11 ? 69  LYS C CE  1 
ATOM   4766 N NZ  . LYS C 1 57  ? 35.412  -22.709 -25.862 1.00 145.64 ? 69  LYS C NZ  1 
ATOM   4767 N N   . ASP C 1 58  ? 30.220  -18.698 -22.129 1.00 96.64  ? 70  ASP C N   1 
ATOM   4768 C CA  . ASP C 1 58  ? 29.280  -18.851 -21.017 1.00 94.64  ? 70  ASP C CA  1 
ATOM   4769 C C   . ASP C 1 58  ? 29.637  -17.892 -19.871 1.00 94.36  ? 70  ASP C C   1 
ATOM   4770 O O   . ASP C 1 58  ? 29.029  -17.959 -18.797 1.00 92.64  ? 70  ASP C O   1 
ATOM   4771 C CB  . ASP C 1 58  ? 29.271  -20.312 -20.516 1.00 98.57  ? 70  ASP C CB  1 
ATOM   4772 C CG  . ASP C 1 58  ? 28.418  -21.283 -21.319 1.00 114.75 ? 70  ASP C CG  1 
ATOM   4773 O OD1 . ASP C 1 58  ? 27.245  -20.946 -21.614 1.00 115.21 ? 70  ASP C OD1 1 
ATOM   4774 O OD2 . ASP C 1 58  ? 28.888  -22.415 -21.574 1.00 123.61 ? 70  ASP C OD2 1 
ATOM   4775 N N   . THR C 1 59  ? 30.617  -16.993 -20.111 1.00 88.59  ? 71  THR C N   1 
ATOM   4776 C CA  . THR C 1 59  ? 31.124  -16.033 -19.127 1.00 85.23  ? 71  THR C CA  1 
ATOM   4777 C C   . THR C 1 59  ? 30.511  -14.648 -19.361 1.00 82.88  ? 71  THR C C   1 
ATOM   4778 O O   . THR C 1 59  ? 30.306  -14.238 -20.504 1.00 81.94  ? 71  THR C O   1 
ATOM   4779 C CB  . THR C 1 59  ? 32.664  -15.976 -19.180 1.00 96.82  ? 71  THR C CB  1 
ATOM   4780 O OG1 . THR C 1 59  ? 33.188  -17.310 -19.187 1.00 100.70 ? 71  THR C OG1 1 
ATOM   4781 C CG2 . THR C 1 59  ? 33.271  -15.188 -18.017 1.00 93.16  ? 71  THR C CG2 1 
ATOM   4782 N N   . VAL C 1 60  ? 30.216  -13.945 -18.258 1.00 75.19  ? 72  VAL C N   1 
ATOM   4783 C CA  . VAL C 1 60  ? 29.786  -12.549 -18.237 1.00 71.89  ? 72  VAL C CA  1 
ATOM   4784 C C   . VAL C 1 60  ? 30.923  -11.661 -18.785 1.00 73.73  ? 72  VAL C C   1 
ATOM   4785 O O   . VAL C 1 60  ? 32.081  -11.815 -18.393 1.00 75.08  ? 72  VAL C O   1 
ATOM   4786 C CB  . VAL C 1 60  ? 29.341  -12.144 -16.804 1.00 73.67  ? 72  VAL C CB  1 
ATOM   4787 C CG1 . VAL C 1 60  ? 29.306  -10.626 -16.611 1.00 72.16  ? 72  VAL C CG1 1 
ATOM   4788 C CG2 . VAL C 1 60  ? 27.994  -12.766 -16.452 1.00 72.77  ? 72  VAL C CG2 1 
ATOM   4789 N N   . ALA C 1 61  ? 30.585  -10.779 -19.729 1.00 66.53  ? 73  ALA C N   1 
ATOM   4790 C CA  . ALA C 1 61  ? 31.482  -9.762  -20.263 1.00 64.99  ? 73  ALA C CA  1 
ATOM   4791 C C   . ALA C 1 61  ? 30.813  -8.389  -20.209 1.00 64.54  ? 73  ALA C C   1 
ATOM   4792 O O   . ALA C 1 61  ? 29.615  -8.277  -20.458 1.00 63.01  ? 73  ALA C O   1 
ATOM   4793 C CB  . ALA C 1 61  ? 31.861  -10.106 -21.690 1.00 67.62  ? 73  ALA C CB  1 
ATOM   4794 N N   . TRP C 1 62  ? 31.580  -7.353  -19.865 1.00 58.80  ? 74  TRP C N   1 
ATOM   4795 C CA  . TRP C 1 62  ? 31.104  -5.976  -19.862 1.00 56.27  ? 74  TRP C CA  1 
ATOM   4796 C C   . TRP C 1 62  ? 31.750  -5.192  -20.992 1.00 61.59  ? 74  TRP C C   1 
ATOM   4797 O O   . TRP C 1 62  ? 32.956  -5.293  -21.198 1.00 64.07  ? 74  TRP C O   1 
ATOM   4798 C CB  . TRP C 1 62  ? 31.379  -5.316  -18.512 1.00 53.35  ? 74  TRP C CB  1 
ATOM   4799 C CG  . TRP C 1 62  ? 30.662  -5.969  -17.366 1.00 52.82  ? 74  TRP C CG  1 
ATOM   4800 C CD1 . TRP C 1 62  ? 31.116  -6.996  -16.593 1.00 56.05  ? 74  TRP C CD1 1 
ATOM   4801 C CD2 . TRP C 1 62  ? 29.342  -5.668  -16.900 1.00 51.10  ? 74  TRP C CD2 1 
ATOM   4802 N NE1 . TRP C 1 62  ? 30.177  -7.333  -15.651 1.00 54.35  ? 74  TRP C NE1 1 
ATOM   4803 C CE2 . TRP C 1 62  ? 29.069  -6.544  -15.824 1.00 54.68  ? 74  TRP C CE2 1 
ATOM   4804 C CE3 . TRP C 1 62  ? 28.360  -4.733  -17.282 1.00 51.39  ? 74  TRP C CE3 1 
ATOM   4805 C CZ2 . TRP C 1 62  ? 27.862  -6.509  -15.116 1.00 52.48  ? 74  TRP C CZ2 1 
ATOM   4806 C CZ3 . TRP C 1 62  ? 27.166  -4.699  -16.580 1.00 51.46  ? 74  TRP C CZ3 1 
ATOM   4807 C CH2 . TRP C 1 62  ? 26.928  -5.576  -15.510 1.00 51.70  ? 74  TRP C CH2 1 
ATOM   4808 N N   . LEU C 1 63  ? 30.943  -4.431  -21.738 1.00 57.80  ? 75  LEU C N   1 
ATOM   4809 C CA  . LEU C 1 63  ? 31.395  -3.610  -22.864 1.00 59.19  ? 75  LEU C CA  1 
ATOM   4810 C C   . LEU C 1 63  ? 32.393  -2.539  -22.392 1.00 63.77  ? 75  LEU C C   1 
ATOM   4811 O O   . LEU C 1 63  ? 32.171  -1.880  -21.381 1.00 61.96  ? 75  LEU C O   1 
ATOM   4812 C CB  . LEU C 1 63  ? 30.176  -2.968  -23.566 1.00 58.35  ? 75  LEU C CB  1 
ATOM   4813 C CG  . LEU C 1 63  ? 30.432  -2.125  -24.814 1.00 63.62  ? 75  LEU C CG  1 
ATOM   4814 C CD1 . LEU C 1 63  ? 30.762  -2.991  -26.000 1.00 65.76  ? 75  LEU C CD1 1 
ATOM   4815 C CD2 . LEU C 1 63  ? 29.233  -1.251  -25.128 1.00 64.21  ? 75  LEU C CD2 1 
ATOM   4816 N N   . LYS C 1 64  ? 33.507  -2.410  -23.109 1.00 64.11  ? 76  LYS C N   1 
ATOM   4817 C CA  . LYS C 1 64  ? 34.544  -1.413  -22.824 1.00 65.36  ? 76  LYS C CA  1 
ATOM   4818 C C   . LYS C 1 64  ? 34.135  -0.053  -23.388 1.00 69.51  ? 76  LYS C C   1 
ATOM   4819 O O   . LYS C 1 64  ? 33.640  0.034   -24.518 1.00 70.50  ? 76  LYS C O   1 
ATOM   4820 C CB  . LYS C 1 64  ? 35.915  -1.855  -23.384 1.00 70.81  ? 76  LYS C CB  1 
ATOM   4821 C CG  . LYS C 1 64  ? 36.614  -2.916  -22.539 1.00 92.23  ? 76  LYS C CG  1 
ATOM   4822 C CD  . LYS C 1 64  ? 37.767  -2.338  -21.715 1.00 107.83 ? 76  LYS C CD  1 
ATOM   4823 C CE  . LYS C 1 64  ? 38.536  -3.421  -20.997 1.00 125.58 ? 76  LYS C CE  1 
ATOM   4824 N NZ  . LYS C 1 64  ? 39.466  -2.866  -19.977 1.00 137.47 ? 76  LYS C NZ  1 
ATOM   4825 N N   . MET C 1 65  ? 34.364  1.004   -22.602 1.00 64.93  ? 77  MET C N   1 
ATOM   4826 C CA  . MET C 1 65  ? 33.898  2.356   -22.910 1.00 64.47  ? 77  MET C CA  1 
ATOM   4827 C C   . MET C 1 65  ? 34.786  3.072   -23.936 1.00 72.34  ? 77  MET C C   1 
ATOM   4828 O O   . MET C 1 65  ? 34.281  3.943   -24.647 1.00 71.15  ? 77  MET C O   1 
ATOM   4829 C CB  . MET C 1 65  ? 33.780  3.191   -21.624 1.00 65.00  ? 77  MET C CB  1 
ATOM   4830 C CG  . MET C 1 65  ? 32.798  2.612   -20.612 1.00 66.11  ? 77  MET C CG  1 
ATOM   4831 S SD  . MET C 1 65  ? 31.061  2.775   -21.094 1.00 67.97  ? 77  MET C SD  1 
ATOM   4832 C CE  . MET C 1 65  ? 30.680  1.117   -21.588 1.00 64.86  ? 77  MET C CE  1 
ATOM   4833 N N   . ASP C 1 66  ? 36.085  2.707   -24.021 1.00 74.01  ? 78  ASP C N   1 
ATOM   4834 C CA  . ASP C 1 66  ? 37.042  3.302   -24.967 1.00 77.87  ? 78  ASP C CA  1 
ATOM   4835 C C   . ASP C 1 66  ? 37.088  2.558   -26.309 1.00 84.98  ? 78  ASP C C   1 
ATOM   4836 O O   . ASP C 1 66  ? 37.528  3.138   -27.302 1.00 86.82  ? 78  ASP C O   1 
ATOM   4837 C CB  . ASP C 1 66  ? 38.464  3.354   -24.377 1.00 82.07  ? 78  ASP C CB  1 
ATOM   4838 C CG  . ASP C 1 66  ? 38.679  4.377   -23.278 1.00 99.94  ? 78  ASP C CG  1 
ATOM   4839 O OD1 . ASP C 1 66  ? 37.900  4.365   -22.294 1.00 100.06 ? 78  ASP C OD1 1 
ATOM   4840 O OD2 . ASP C 1 66  ? 39.671  5.141   -23.363 1.00 108.73 ? 78  ASP C OD2 1 
ATOM   4841 N N   . LYS C 1 67  ? 36.679  1.277   -26.338 1.00 81.64  ? 79  LYS C N   1 
ATOM   4842 C CA  . LYS C 1 67  ? 36.630  0.505   -27.580 1.00 83.28  ? 79  LYS C CA  1 
ATOM   4843 C C   . LYS C 1 67  ? 35.360  0.820   -28.362 1.00 86.71  ? 79  LYS C C   1 
ATOM   4844 O O   . LYS C 1 67  ? 34.303  1.035   -27.768 1.00 84.21  ? 79  LYS C O   1 
ATOM   4845 C CB  . LYS C 1 67  ? 36.737  -1.010  -27.315 1.00 86.12  ? 79  LYS C CB  1 
ATOM   4846 C CG  . LYS C 1 67  ? 38.134  -1.469  -26.900 1.00 102.17 ? 79  LYS C CG  1 
ATOM   4847 C CD  . LYS C 1 67  ? 38.643  -2.691  -27.675 1.00 116.30 ? 79  LYS C CD  1 
ATOM   4848 C CE  . LYS C 1 67  ? 40.154  -2.743  -27.716 1.00 128.61 ? 79  LYS C CE  1 
ATOM   4849 N NZ  . LYS C 1 67  ? 40.658  -3.295  -29.003 1.00 140.32 ? 79  LYS C NZ  1 
ATOM   4850 N N   . LYS C 1 68  ? 35.477  0.858   -29.701 1.00 85.53  ? 80  LYS C N   1 
ATOM   4851 C CA  . LYS C 1 68  ? 34.356  1.015   -30.629 1.00 85.10  ? 80  LYS C CA  1 
ATOM   4852 C C   . LYS C 1 68  ? 33.369  -0.139  -30.476 1.00 88.08  ? 80  LYS C C   1 
ATOM   4853 O O   . LYS C 1 68  ? 33.788  -1.289  -30.331 1.00 89.01  ? 80  LYS C O   1 
ATOM   4854 C CB  . LYS C 1 68  ? 34.858  1.086   -32.081 1.00 90.20  ? 80  LYS C CB  1 
ATOM   4855 C CG  . LYS C 1 68  ? 35.494  2.422   -32.461 1.00 107.29 ? 80  LYS C CG  1 
ATOM   4856 C CD  . LYS C 1 68  ? 35.927  2.430   -33.923 1.00 121.54 ? 80  LYS C CD  1 
ATOM   4857 C CE  . LYS C 1 68  ? 36.656  3.692   -34.314 1.00 134.61 ? 80  LYS C CE  1 
ATOM   4858 N NZ  . LYS C 1 68  ? 37.120  3.645   -35.729 1.00 145.37 ? 80  LYS C NZ  1 
ATOM   4859 N N   . VAL C 1 69  ? 32.067  0.177   -30.464 1.00 82.48  ? 81  VAL C N   1 
ATOM   4860 C CA  . VAL C 1 69  ? 30.986  -0.812  -30.468 1.00 81.22  ? 81  VAL C CA  1 
ATOM   4861 C C   . VAL C 1 69  ? 30.995  -1.497  -31.850 1.00 88.09  ? 81  VAL C C   1 
ATOM   4862 O O   . VAL C 1 69  ? 30.579  -0.883  -32.838 1.00 88.31  ? 81  VAL C O   1 
ATOM   4863 C CB  . VAL C 1 69  ? 29.608  -0.165  -30.121 1.00 81.98  ? 81  VAL C CB  1 
ATOM   4864 C CG1 . VAL C 1 69  ? 28.498  -1.208  -30.067 1.00 80.78  ? 81  VAL C CG1 1 
ATOM   4865 C CG2 . VAL C 1 69  ? 29.671  0.608   -28.809 1.00 79.55  ? 81  VAL C CG2 1 
ATOM   4866 N N   . LEU C 1 70  ? 31.543  -2.736  -31.899 1.00 86.34  ? 82  LEU C N   1 
ATOM   4867 C CA  . LEU C 1 70  ? 31.708  -3.670  -33.036 1.00 121.06 ? 82  LEU C CA  1 
ATOM   4868 C C   . LEU C 1 70  ? 32.836  -4.665  -32.730 1.00 146.92 ? 82  LEU C C   1 
ATOM   4869 O O   . LEU C 1 70  ? 32.918  -5.736  -33.331 1.00 108.97 ? 82  LEU C O   1 
ATOM   4870 C CB  . LEU C 1 70  ? 31.979  -2.979  -34.394 1.00 123.24 ? 82  LEU C CB  1 
ATOM   4871 C CG  . LEU C 1 70  ? 30.766  -2.730  -35.301 1.00 127.96 ? 82  LEU C CG  1 
ATOM   4872 C CD1 . LEU C 1 70  ? 31.086  -1.687  -36.346 1.00 129.71 ? 82  LEU C CD1 1 
ATOM   4873 C CD2 . LEU C 1 70  ? 30.270  -4.015  -35.952 1.00 132.13 ? 82  LEU C CD2 1 
ATOM   4874 N N   . PRO C 1 79  ? 21.480  -8.974  -34.848 1.00 80.44  ? 91  PRO C N   1 
ATOM   4875 C CA  . PRO C 1 79  ? 21.051  -7.886  -33.940 1.00 76.94  ? 91  PRO C CA  1 
ATOM   4876 C C   . PRO C 1 79  ? 21.924  -7.816  -32.682 1.00 76.83  ? 91  PRO C C   1 
ATOM   4877 O O   . PRO C 1 79  ? 21.841  -8.693  -31.810 1.00 76.06  ? 91  PRO C O   1 
ATOM   4878 C CB  . PRO C 1 79  ? 19.583  -8.220  -33.613 1.00 77.81  ? 91  PRO C CB  1 
ATOM   4879 C CG  . PRO C 1 79  ? 19.288  -9.546  -34.337 1.00 85.04  ? 91  PRO C CG  1 
ATOM   4880 C CD  . PRO C 1 79  ? 20.592  -10.147 -34.768 1.00 82.49  ? 91  PRO C CD  1 
ATOM   4881 N N   . VAL C 1 80  ? 22.777  -6.768  -32.602 1.00 70.25  ? 92  VAL C N   1 
ATOM   4882 C CA  . VAL C 1 80  ? 23.711  -6.532  -31.487 1.00 67.60  ? 92  VAL C CA  1 
ATOM   4883 C C   . VAL C 1 80  ? 22.907  -6.227  -30.216 1.00 65.62  ? 92  VAL C C   1 
ATOM   4884 O O   . VAL C 1 80  ? 22.117  -5.288  -30.202 1.00 63.21  ? 92  VAL C O   1 
ATOM   4885 C CB  . VAL C 1 80  ? 24.743  -5.412  -31.790 1.00 71.36  ? 92  VAL C CB  1 
ATOM   4886 C CG1 . VAL C 1 80  ? 25.826  -5.351  -30.723 1.00 70.17  ? 92  VAL C CG1 1 
ATOM   4887 C CG2 . VAL C 1 80  ? 25.373  -5.595  -33.166 1.00 73.80  ? 92  VAL C CG2 1 
ATOM   4888 N N   . THR C 1 81  ? 23.112  -7.028  -29.159 1.00 60.13  ? 93  THR C N   1 
ATOM   4889 C CA  . THR C 1 81  ? 22.328  -6.934  -27.932 1.00 56.88  ? 93  THR C CA  1 
ATOM   4890 C C   . THR C 1 81  ? 23.244  -6.796  -26.713 1.00 57.31  ? 93  THR C C   1 
ATOM   4891 O O   . THR C 1 81  ? 24.179  -7.582  -26.543 1.00 57.70  ? 93  THR C O   1 
ATOM   4892 C CB  . THR C 1 81  ? 21.368  -8.134  -27.814 1.00 64.84  ? 93  THR C CB  1 
ATOM   4893 O OG1 . THR C 1 81  ? 20.530  -8.174  -28.972 1.00 68.15  ? 93  THR C OG1 1 
ATOM   4894 C CG2 . THR C 1 81  ? 20.493  -8.063  -26.582 1.00 59.78  ? 93  THR C CG2 1 
ATOM   4895 N N   . PHE C 1 82  ? 22.969  -5.774  -25.881 1.00 50.29  ? 94  PHE C N   1 
ATOM   4896 C CA  . PHE C 1 82  ? 23.571  -5.614  -24.563 1.00 48.29  ? 94  PHE C CA  1 
ATOM   4897 C C   . PHE C 1 82  ? 22.495  -5.554  -23.495 1.00 50.10  ? 94  PHE C C   1 
ATOM   4898 O O   . PHE C 1 82  ? 21.368  -5.126  -23.764 1.00 49.27  ? 94  PHE C O   1 
ATOM   4899 C CB  . PHE C 1 82  ? 24.460  -4.369  -24.486 1.00 49.67  ? 94  PHE C CB  1 
ATOM   4900 C CG  . PHE C 1 82  ? 25.564  -4.341  -25.504 1.00 53.56  ? 94  PHE C CG  1 
ATOM   4901 C CD1 . PHE C 1 82  ? 26.731  -5.075  -25.311 1.00 58.08  ? 94  PHE C CD1 1 
ATOM   4902 C CD2 . PHE C 1 82  ? 25.436  -3.597  -26.665 1.00 57.06  ? 94  PHE C CD2 1 
ATOM   4903 C CE1 . PHE C 1 82  ? 27.743  -5.073  -26.271 1.00 60.98  ? 94  PHE C CE1 1 
ATOM   4904 C CE2 . PHE C 1 82  ? 26.457  -3.584  -27.618 1.00 62.01  ? 94  PHE C CE2 1 
ATOM   4905 C CZ  . PHE C 1 82  ? 27.601  -4.323  -27.416 1.00 61.07  ? 94  PHE C CZ  1 
ATOM   4906 N N   . HIS C 1 83  ? 22.842  -6.006  -22.283 1.00 45.19  ? 95  HIS C N   1 
ATOM   4907 C CA  . HIS C 1 83  ? 21.966  -5.921  -21.130 1.00 42.77  ? 95  HIS C CA  1 
ATOM   4908 C C   . HIS C 1 83  ? 22.435  -4.802  -20.224 1.00 44.91  ? 95  HIS C C   1 
ATOM   4909 O O   . HIS C 1 83  ? 23.562  -4.827  -19.736 1.00 44.66  ? 95  HIS C O   1 
ATOM   4910 C CB  . HIS C 1 83  ? 21.910  -7.260  -20.392 1.00 43.93  ? 95  HIS C CB  1 
ATOM   4911 C CG  . HIS C 1 83  ? 21.084  -8.289  -21.091 1.00 48.50  ? 95  HIS C CG  1 
ATOM   4912 N ND1 . HIS C 1 83  ? 21.501  -8.867  -22.273 1.00 52.10  ? 95  HIS C ND1 1 
ATOM   4913 C CD2 . HIS C 1 83  ? 19.887  -8.813  -20.747 1.00 50.18  ? 95  HIS C CD2 1 
ATOM   4914 C CE1 . HIS C 1 83  ? 20.548  -9.716  -22.613 1.00 52.22  ? 95  HIS C CE1 1 
ATOM   4915 N NE2 . HIS C 1 83  ? 19.557  -9.720  -21.723 1.00 51.44  ? 95  HIS C NE2 1 
ATOM   4916 N N   . PHE C 1 84  ? 21.580  -3.790  -20.035 1.00 40.89  ? 96  PHE C N   1 
ATOM   4917 C CA  . PHE C 1 84  ? 21.864  -2.701  -19.120 1.00 38.87  ? 96  PHE C CA  1 
ATOM   4918 C C   . PHE C 1 84  ? 21.608  -3.197  -17.697 1.00 43.59  ? 96  PHE C C   1 
ATOM   4919 O O   . PHE C 1 84  ? 20.465  -3.444  -17.322 1.00 44.10  ? 96  PHE C O   1 
ATOM   4920 C CB  . PHE C 1 84  ? 21.041  -1.451  -19.471 1.00 38.92  ? 96  PHE C CB  1 
ATOM   4921 C CG  . PHE C 1 84  ? 21.417  -0.230  -18.660 1.00 38.48  ? 96  PHE C CG  1 
ATOM   4922 C CD1 . PHE C 1 84  ? 22.495  0.563   -19.026 1.00 41.17  ? 96  PHE C CD1 1 
ATOM   4923 C CD2 . PHE C 1 84  ? 20.684  0.133   -17.535 1.00 37.98  ? 96  PHE C CD2 1 
ATOM   4924 C CE1 . PHE C 1 84  ? 22.835  1.694   -18.276 1.00 40.84  ? 96  PHE C CE1 1 
ATOM   4925 C CE2 . PHE C 1 84  ? 21.028  1.267   -16.790 1.00 39.29  ? 96  PHE C CE2 1 
ATOM   4926 C CZ  . PHE C 1 84  ? 22.094  2.041   -17.169 1.00 37.68  ? 96  PHE C CZ  1 
ATOM   4927 N N   . LEU C 1 85  ? 22.689  -3.389  -16.928 1.00 39.59  ? 97  LEU C N   1 
ATOM   4928 C CA  . LEU C 1 85  ? 22.640  -3.951  -15.584 1.00 38.30  ? 97  LEU C CA  1 
ATOM   4929 C C   . LEU C 1 85  ? 23.586  -3.224  -14.642 1.00 42.15  ? 97  LEU C C   1 
ATOM   4930 O O   . LEU C 1 85  ? 24.556  -2.606  -15.086 1.00 43.19  ? 97  LEU C O   1 
ATOM   4931 C CB  . LEU C 1 85  ? 23.027  -5.449  -15.628 1.00 39.38  ? 97  LEU C CB  1 
ATOM   4932 C CG  . LEU C 1 85  ? 22.063  -6.430  -16.296 1.00 44.25  ? 97  LEU C CG  1 
ATOM   4933 C CD1 . LEU C 1 85  ? 22.727  -7.748  -16.562 1.00 44.74  ? 97  LEU C CD1 1 
ATOM   4934 C CD2 . LEU C 1 85  ? 20.838  -6.649  -15.469 1.00 45.60  ? 97  LEU C CD2 1 
ATOM   4935 N N   . ALA C 1 86  ? 23.312  -3.322  -13.334 1.00 37.33  ? 98  ALA C N   1 
ATOM   4936 C CA  . ALA C 1 86  ? 24.244  -2.931  -12.282 1.00 36.08  ? 98  ALA C CA  1 
ATOM   4937 C C   . ALA C 1 86  ? 25.409  -3.903  -12.228 1.00 39.73  ? 98  ALA C C   1 
ATOM   4938 O O   . ALA C 1 86  ? 25.208  -5.118  -12.115 1.00 39.68  ? 98  ALA C O   1 
ATOM   4939 C CB  . ALA C 1 86  ? 23.535  -2.887  -10.936 1.00 35.69  ? 98  ALA C CB  1 
ATOM   4940 N N   . LYS C 1 87  ? 26.623  -3.360  -12.370 1.00 36.15  ? 99  LYS C N   1 
ATOM   4941 C CA  . LYS C 1 87  ? 27.889  -4.076  -12.208 1.00 36.20  ? 99  LYS C CA  1 
ATOM   4942 C C   . LYS C 1 87  ? 28.320  -4.001  -10.729 1.00 39.69  ? 99  LYS C C   1 
ATOM   4943 O O   . LYS C 1 87  ? 28.923  -4.940  -10.193 1.00 39.07  ? 99  LYS C O   1 
ATOM   4944 C CB  . LYS C 1 87  ? 28.951  -3.453  -13.140 1.00 37.72  ? 99  LYS C CB  1 
ATOM   4945 C CG  . LYS C 1 87  ? 30.222  -4.264  -13.270 1.00 47.38  ? 99  LYS C CG  1 
ATOM   4946 C CD  . LYS C 1 87  ? 31.170  -3.636  -14.260 1.00 59.50  ? 99  LYS C CD  1 
ATOM   4947 C CE  . LYS C 1 87  ? 32.426  -4.451  -14.442 1.00 66.08  ? 99  LYS C CE  1 
ATOM   4948 N NZ  . LYS C 1 87  ? 33.399  -3.774  -15.341 1.00 72.16  ? 99  LYS C NZ  1 
ATOM   4949 N N   . PHE C 1 88  ? 27.982  -2.874  -10.078 1.00 36.08  ? 100 PHE C N   1 
ATOM   4950 C CA  . PHE C 1 88  ? 28.329  -2.578  -8.692  1.00 35.44  ? 100 PHE C CA  1 
ATOM   4951 C C   . PHE C 1 88  ? 27.081  -2.248  -7.884  1.00 39.24  ? 100 PHE C C   1 
ATOM   4952 O O   . PHE C 1 88  ? 26.118  -1.714  -8.431  1.00 39.20  ? 100 PHE C O   1 
ATOM   4953 C CB  . PHE C 1 88  ? 29.342  -1.426  -8.633  1.00 36.65  ? 100 PHE C CB  1 
ATOM   4954 C CG  . PHE C 1 88  ? 30.557  -1.657  -9.498  1.00 38.69  ? 100 PHE C CG  1 
ATOM   4955 C CD1 . PHE C 1 88  ? 31.553  -2.545  -9.106  1.00 41.51  ? 100 PHE C CD1 1 
ATOM   4956 C CD2 . PHE C 1 88  ? 30.703  -0.995  -10.713 1.00 40.90  ? 100 PHE C CD2 1 
ATOM   4957 C CE1 . PHE C 1 88  ? 32.666  -2.778  -9.919  1.00 43.30  ? 100 PHE C CE1 1 
ATOM   4958 C CE2 . PHE C 1 88  ? 31.820  -1.225  -11.526 1.00 44.17  ? 100 PHE C CE2 1 
ATOM   4959 C CZ  . PHE C 1 88  ? 32.792  -2.112  -11.121 1.00 42.77  ? 100 PHE C CZ  1 
ATOM   4960 N N   . TYR C 1 89  ? 27.120  -2.561  -6.575  1.00 35.26  ? 101 TYR C N   1 
ATOM   4961 C CA  . TYR C 1 89  ? 26.016  -2.393  -5.631  1.00 33.44  ? 101 TYR C CA  1 
ATOM   4962 C C   . TYR C 1 89  ? 26.337  -1.312  -4.602  1.00 36.39  ? 101 TYR C C   1 
ATOM   4963 O O   . TYR C 1 89  ? 27.498  -1.148  -4.228  1.00 35.46  ? 101 TYR C O   1 
ATOM   4964 C CB  . TYR C 1 89  ? 25.698  -3.730  -4.928  1.00 34.88  ? 101 TYR C CB  1 
ATOM   4965 C CG  . TYR C 1 89  ? 25.044  -4.723  -5.854  1.00 37.94  ? 101 TYR C CG  1 
ATOM   4966 C CD1 . TYR C 1 89  ? 25.800  -5.450  -6.779  1.00 40.93  ? 101 TYR C CD1 1 
ATOM   4967 C CD2 . TYR C 1 89  ? 23.659  -4.892  -5.861  1.00 37.78  ? 101 TYR C CD2 1 
ATOM   4968 C CE1 . TYR C 1 89  ? 25.197  -6.326  -7.677  1.00 41.05  ? 101 TYR C CE1 1 
ATOM   4969 C CE2 . TYR C 1 89  ? 23.047  -5.774  -6.752  1.00 38.68  ? 101 TYR C CE2 1 
ATOM   4970 C CZ  . TYR C 1 89  ? 23.824  -6.491  -7.652  1.00 47.11  ? 101 TYR C CZ  1 
ATOM   4971 O OH  . TYR C 1 89  ? 23.240  -7.365  -8.523  1.00 50.32  ? 101 TYR C OH  1 
ATOM   4972 N N   . PRO C 1 90  ? 25.332  -0.539  -4.137  1.00 33.50  ? 102 PRO C N   1 
ATOM   4973 C CA  . PRO C 1 90  ? 25.592  0.391   -3.030  1.00 32.84  ? 102 PRO C CA  1 
ATOM   4974 C C   . PRO C 1 90  ? 25.831  -0.352  -1.710  1.00 37.75  ? 102 PRO C C   1 
ATOM   4975 O O   . PRO C 1 90  ? 25.333  -1.473  -1.525  1.00 38.12  ? 102 PRO C O   1 
ATOM   4976 C CB  . PRO C 1 90  ? 24.316  1.227   -2.982  1.00 33.60  ? 102 PRO C CB  1 
ATOM   4977 C CG  . PRO C 1 90  ? 23.276  0.379   -3.567  1.00 37.58  ? 102 PRO C CG  1 
ATOM   4978 C CD  . PRO C 1 90  ? 23.925  -0.466  -4.583  1.00 34.13  ? 102 PRO C CD  1 
ATOM   4979 N N   . GLU C 1 91  ? 26.622  0.248   -0.813  1.00 34.40  ? 103 GLU C N   1 
ATOM   4980 C CA  . GLU C 1 91  ? 26.756  -0.244  0.560   1.00 34.94  ? 103 GLU C CA  1 
ATOM   4981 C C   . GLU C 1 91  ? 25.475  0.055   1.366   1.00 39.44  ? 103 GLU C C   1 
ATOM   4982 O O   . GLU C 1 91  ? 25.033  -0.756  2.186   1.00 40.00  ? 103 GLU C O   1 
ATOM   4983 C CB  . GLU C 1 91  ? 27.973  0.398   1.220   1.00 36.91  ? 103 GLU C CB  1 
ATOM   4984 C CG  . GLU C 1 91  ? 29.052  -0.594  1.601   1.00 45.54  ? 103 GLU C CG  1 
ATOM   4985 C CD  . GLU C 1 91  ? 30.410  0.048   1.796   1.00 64.01  ? 103 GLU C CD  1 
ATOM   4986 O OE1 . GLU C 1 91  ? 30.776  0.295   2.965   1.00 68.69  ? 103 GLU C OE1 1 
ATOM   4987 O OE2 . GLU C 1 91  ? 31.111  0.306   0.792   1.00 53.61  ? 103 GLU C OE2 1 
ATOM   4988 N N   . ASN C 1 92  ? 24.873  1.222   1.089   1.00 35.45  ? 104 ASN C N   1 
ATOM   4989 C CA  . ASN C 1 92  ? 23.663  1.716   1.724   1.00 34.85  ? 104 ASN C CA  1 
ATOM   4990 C C   . ASN C 1 92  ? 22.705  2.225   0.647   1.00 39.18  ? 104 ASN C C   1 
ATOM   4991 O O   . ASN C 1 92  ? 22.891  3.332   0.141   1.00 39.15  ? 104 ASN C O   1 
ATOM   4992 C CB  . ASN C 1 92  ? 24.032  2.825   2.720   1.00 32.54  ? 104 ASN C CB  1 
ATOM   4993 C CG  . ASN C 1 92  ? 22.908  3.332   3.583   1.00 49.24  ? 104 ASN C CG  1 
ATOM   4994 O OD1 . ASN C 1 92  ? 21.751  3.468   3.171   1.00 41.35  ? 104 ASN C OD1 1 
ATOM   4995 N ND2 . ASN C 1 92  ? 23.260  3.718   4.785   1.00 44.17  ? 104 ASN C ND2 1 
ATOM   4996 N N   . ALA C 1 93  ? 21.674  1.423   0.313   1.00 35.24  ? 105 ALA C N   1 
ATOM   4997 C CA  . ALA C 1 93  ? 20.723  1.717   -0.760  1.00 33.75  ? 105 ALA C CA  1 
ATOM   4998 C C   . ALA C 1 93  ? 20.013  3.076   -0.544  1.00 38.45  ? 105 ALA C C   1 
ATOM   4999 O O   . ALA C 1 93  ? 19.955  3.883   -1.480  1.00 39.37  ? 105 ALA C O   1 
ATOM   5000 C CB  . ALA C 1 93  ? 19.697  0.588   -0.869  1.00 34.05  ? 105 ALA C CB  1 
ATOM   5001 N N   . GLU C 1 94  ? 19.526  3.346   0.689   1.00 33.68  ? 106 GLU C N   1 
ATOM   5002 C CA  . GLU C 1 94  ? 18.737  4.546   0.988   1.00 33.40  ? 106 GLU C CA  1 
ATOM   5003 C C   . GLU C 1 94  ? 19.576  5.828   0.813   1.00 38.52  ? 106 GLU C C   1 
ATOM   5004 O O   . GLU C 1 94  ? 19.075  6.805   0.264   1.00 38.69  ? 106 GLU C O   1 
ATOM   5005 C CB  . GLU C 1 94  ? 18.113  4.467   2.398   1.00 35.14  ? 106 GLU C CB  1 
ATOM   5006 C CG  . GLU C 1 94  ? 17.052  5.528   2.656   1.00 46.40  ? 106 GLU C CG  1 
ATOM   5007 C CD  . GLU C 1 94  ? 16.048  5.222   3.751   1.00 70.93  ? 106 GLU C CD  1 
ATOM   5008 O OE1 . GLU C 1 94  ? 16.470  5.050   4.918   1.00 55.04  ? 106 GLU C OE1 1 
ATOM   5009 O OE2 . GLU C 1 94  ? 14.832  5.192   3.447   1.00 70.23  ? 106 GLU C OE2 1 
ATOM   5010 N N   . GLU C 1 95  ? 20.836  5.813   1.261   1.00 36.44  ? 107 GLU C N   1 
ATOM   5011 C CA  . GLU C 1 95  ? 21.742  6.954   1.144   1.00 36.72  ? 107 GLU C CA  1 
ATOM   5012 C C   . GLU C 1 95  ? 22.202  7.176   -0.281  1.00 38.90  ? 107 GLU C C   1 
ATOM   5013 O O   . GLU C 1 95  ? 22.308  8.326   -0.698  1.00 39.14  ? 107 GLU C O   1 
ATOM   5014 C CB  . GLU C 1 95  ? 22.977  6.771   2.033   1.00 39.25  ? 107 GLU C CB  1 
ATOM   5015 C CG  . GLU C 1 95  ? 22.710  6.933   3.519   1.00 56.40  ? 107 GLU C CG  1 
ATOM   5016 C CD  . GLU C 1 95  ? 23.964  6.969   4.374   1.00 84.63  ? 107 GLU C CD  1 
ATOM   5017 O OE1 . GLU C 1 95  ? 24.966  6.308   4.007   1.00 66.30  ? 107 GLU C OE1 1 
ATOM   5018 O OE2 . GLU C 1 95  ? 23.937  7.657   5.420   1.00 87.00  ? 107 GLU C OE2 1 
ATOM   5019 N N   . GLU C 1 96  ? 22.479  6.087   -1.021  1.00 33.46  ? 108 GLU C N   1 
ATOM   5020 C CA  . GLU C 1 96  ? 23.200  6.148   -2.290  1.00 32.63  ? 108 GLU C CA  1 
ATOM   5021 C C   . GLU C 1 96  ? 22.282  6.220   -3.504  1.00 37.91  ? 108 GLU C C   1 
ATOM   5022 O O   . GLU C 1 96  ? 22.683  6.818   -4.514  1.00 39.04  ? 108 GLU C O   1 
ATOM   5023 C CB  . GLU C 1 96  ? 24.136  4.951   -2.444  1.00 33.75  ? 108 GLU C CB  1 
ATOM   5024 C CG  . GLU C 1 96  ? 25.297  4.962   -1.468  1.00 36.51  ? 108 GLU C CG  1 
ATOM   5025 C CD  . GLU C 1 96  ? 26.264  3.810   -1.634  1.00 50.65  ? 108 GLU C CD  1 
ATOM   5026 O OE1 . GLU C 1 96  ? 26.771  3.616   -2.764  1.00 46.39  ? 108 GLU C OE1 1 
ATOM   5027 O OE2 . GLU C 1 96  ? 26.522  3.104   -0.630  1.00 39.13  ? 108 GLU C OE2 1 
ATOM   5028 N N   . LEU C 1 97  ? 21.077  5.594   -3.439  1.00 32.00  ? 109 LEU C N   1 
ATOM   5029 C CA  . LEU C 1 97  ? 20.135  5.600   -4.559  1.00 29.84  ? 109 LEU C CA  1 
ATOM   5030 C C   . LEU C 1 97  ? 19.149  6.763   -4.368  1.00 35.06  ? 109 LEU C C   1 
ATOM   5031 O O   . LEU C 1 97  ? 18.036  6.601   -3.845  1.00 37.00  ? 109 LEU C O   1 
ATOM   5032 C CB  . LEU C 1 97  ? 19.434  4.231   -4.730  1.00 29.33  ? 109 LEU C CB  1 
ATOM   5033 C CG  . LEU C 1 97  ? 20.338  2.952   -4.737  1.00 33.36  ? 109 LEU C CG  1 
ATOM   5034 C CD1 . LEU C 1 97  ? 19.512  1.694   -4.950  1.00 32.64  ? 109 LEU C CD1 1 
ATOM   5035 C CD2 . LEU C 1 97  ? 21.469  3.038   -5.771  1.00 34.72  ? 109 LEU C CD2 1 
ATOM   5036 N N   . VAL C 1 98  ? 19.608  7.961   -4.764  1.00 30.42  ? 110 VAL C N   1 
ATOM   5037 C CA  . VAL C 1 98  ? 18.922  9.240   -4.578  1.00 29.81  ? 110 VAL C CA  1 
ATOM   5038 C C   . VAL C 1 98  ? 17.882  9.420   -5.678  1.00 33.98  ? 110 VAL C C   1 
ATOM   5039 O O   . VAL C 1 98  ? 16.757  9.853   -5.392  1.00 34.98  ? 110 VAL C O   1 
ATOM   5040 C CB  . VAL C 1 98  ? 19.941  10.419  -4.530  1.00 33.67  ? 110 VAL C CB  1 
ATOM   5041 C CG1 . VAL C 1 98  ? 19.247  11.774  -4.466  1.00 33.36  ? 110 VAL C CG1 1 
ATOM   5042 C CG2 . VAL C 1 98  ? 20.905  10.259  -3.361  1.00 33.53  ? 110 VAL C CG2 1 
ATOM   5043 N N   . GLN C 1 99  ? 18.270  9.135   -6.932  1.00 28.68  ? 111 GLN C N   1 
ATOM   5044 C CA  . GLN C 1 99  ? 17.340  9.123   -8.051  1.00 27.68  ? 111 GLN C CA  1 
ATOM   5045 C C   . GLN C 1 99  ? 16.472  7.872   -7.993  1.00 33.66  ? 111 GLN C C   1 
ATOM   5046 O O   . GLN C 1 99  ? 16.982  6.771   -7.739  1.00 35.96  ? 111 GLN C O   1 
ATOM   5047 C CB  . GLN C 1 99  ? 18.087  9.172   -9.387  1.00 28.86  ? 111 GLN C CB  1 
ATOM   5048 C CG  . GLN C 1 99  ? 18.802  10.481  -9.710  1.00 27.23  ? 111 GLN C CG  1 
ATOM   5049 C CD  . GLN C 1 99  ? 19.323  10.402  -11.122 1.00 43.66  ? 111 GLN C CD  1 
ATOM   5050 O OE1 . GLN C 1 99  ? 20.392  9.834   -11.392 1.00 35.25  ? 111 GLN C OE1 1 
ATOM   5051 N NE2 . GLN C 1 99  ? 18.527  10.883  -12.069 1.00 33.09  ? 111 GLN C NE2 1 
ATOM   5052 N N   . GLU C 1 100 ? 15.167  8.036   -8.233  1.00 29.22  ? 112 GLU C N   1 
ATOM   5053 C CA  . GLU C 1 100 ? 14.206  6.939   -8.272  1.00 28.59  ? 112 GLU C CA  1 
ATOM   5054 C C   . GLU C 1 100 ? 14.567  5.937   -9.358  1.00 33.18  ? 112 GLU C C   1 
ATOM   5055 O O   . GLU C 1 100 ? 14.456  4.734   -9.106  1.00 34.08  ? 112 GLU C O   1 
ATOM   5056 C CB  . GLU C 1 100 ? 12.776  7.451   -8.478  1.00 29.54  ? 112 GLU C CB  1 
ATOM   5057 C CG  . GLU C 1 100 ? 11.724  6.443   -8.043  1.00 35.97  ? 112 GLU C CG  1 
ATOM   5058 C CD  . GLU C 1 100 ? 10.304  6.704   -8.505  1.00 45.34  ? 112 GLU C CD  1 
ATOM   5059 O OE1 . GLU C 1 100 ? 10.057  7.750   -9.145  1.00 37.87  ? 112 GLU C OE1 1 
ATOM   5060 O OE2 . GLU C 1 100 ? 9.438   5.841   -8.248  1.00 38.34  ? 112 GLU C OE2 1 
ATOM   5061 N N   . ILE C 1 101 ? 15.008  6.406   -10.554 1.00 28.21  ? 113 ILE C N   1 
ATOM   5062 C CA  . ILE C 1 101 ? 15.383  5.484   -11.644 1.00 27.32  ? 113 ILE C CA  1 
ATOM   5063 C C   . ILE C 1 101 ? 16.422  4.434   -11.134 1.00 31.80  ? 113 ILE C C   1 
ATOM   5064 O O   . ILE C 1 101 ? 16.198  3.247   -11.357 1.00 32.17  ? 113 ILE C O   1 
ATOM   5065 C CB  . ILE C 1 101 ? 15.825  6.189   -12.981 1.00 29.72  ? 113 ILE C CB  1 
ATOM   5066 C CG1 . ILE C 1 101 ? 16.100  5.182   -14.130 1.00 29.89  ? 113 ILE C CG1 1 
ATOM   5067 C CG2 . ILE C 1 101 ? 17.000  7.168   -12.808 1.00 29.64  ? 113 ILE C CG2 1 
ATOM   5068 C CD1 . ILE C 1 101 ? 14.967  4.252   -14.504 1.00 30.94  ? 113 ILE C CD1 1 
ATOM   5069 N N   . THR C 1 102 ? 17.502  4.872   -10.417 1.00 28.57  ? 114 THR C N   1 
ATOM   5070 C CA  . THR C 1 102 ? 18.575  4.027   -9.864  1.00 28.24  ? 114 THR C CA  1 
ATOM   5071 C C   . THR C 1 102 ? 17.969  2.978   -8.924  1.00 33.72  ? 114 THR C C   1 
ATOM   5072 O O   . THR C 1 102 ? 18.280  1.796   -9.051  1.00 33.30  ? 114 THR C O   1 
ATOM   5073 C CB  . THR C 1 102 ? 19.637  4.876   -9.139  1.00 33.31  ? 114 THR C CB  1 
ATOM   5074 O OG1 . THR C 1 102 ? 19.771  6.156   -9.753  1.00 29.63  ? 114 THR C OG1 1 
ATOM   5075 C CG2 . THR C 1 102 ? 20.985  4.213   -9.115  1.00 35.13  ? 114 THR C CG2 1 
ATOM   5076 N N   . GLN C 1 103 ? 17.079  3.426   -7.993  1.00 30.43  ? 115 GLN C N   1 
ATOM   5077 C CA  . GLN C 1 103 ? 16.299  2.599   -7.070  1.00 29.17  ? 115 GLN C CA  1 
ATOM   5078 C C   . GLN C 1 103 ? 15.476  1.565   -7.836  1.00 34.38  ? 115 GLN C C   1 
ATOM   5079 O O   . GLN C 1 103 ? 15.508  0.384   -7.491  1.00 36.69  ? 115 GLN C O   1 
ATOM   5080 C CB  . GLN C 1 103 ? 15.381  3.508   -6.236  1.00 30.02  ? 115 GLN C CB  1 
ATOM   5081 C CG  . GLN C 1 103 ? 14.395  2.791   -5.329  1.00 31.26  ? 115 GLN C CG  1 
ATOM   5082 C CD  . GLN C 1 103 ? 13.273  3.693   -4.901  1.00 49.34  ? 115 GLN C CD  1 
ATOM   5083 O OE1 . GLN C 1 103 ? 12.149  3.572   -5.380  1.00 48.53  ? 115 GLN C OE1 1 
ATOM   5084 N NE2 . GLN C 1 103 ? 13.538  4.604   -3.976  1.00 40.30  ? 115 GLN C NE2 1 
ATOM   5085 N N   . HIS C 1 104 ? 14.735  2.010   -8.868  1.00 29.19  ? 116 HIS C N   1 
ATOM   5086 C CA  . HIS C 1 104 ? 13.888  1.144   -9.683  1.00 27.79  ? 116 HIS C CA  1 
ATOM   5087 C C   . HIS C 1 104 ? 14.719  0.036   -10.351 1.00 34.07  ? 116 HIS C C   1 
ATOM   5088 O O   . HIS C 1 104 ? 14.349  -1.142  -10.267 1.00 35.83  ? 116 HIS C O   1 
ATOM   5089 C CB  . HIS C 1 104 ? 13.125  1.969   -10.730 1.00 26.91  ? 116 HIS C CB  1 
ATOM   5090 C CG  . HIS C 1 104 ? 12.241  1.155   -11.626 1.00 29.49  ? 116 HIS C CG  1 
ATOM   5091 N ND1 . HIS C 1 104 ? 11.255  0.343   -11.118 1.00 30.91  ? 116 HIS C ND1 1 
ATOM   5092 C CD2 . HIS C 1 104 ? 12.214  1.081   -12.976 1.00 30.98  ? 116 HIS C CD2 1 
ATOM   5093 C CE1 . HIS C 1 104 ? 10.672  -0.211  -12.164 1.00 30.89  ? 116 HIS C CE1 1 
ATOM   5094 N NE2 . HIS C 1 104 ? 11.222  0.200   -13.302 1.00 31.29  ? 116 HIS C NE2 1 
ATOM   5095 N N   . LEU C 1 105 ? 15.835  0.408   -10.991 1.00 30.86  ? 117 LEU C N   1 
ATOM   5096 C CA  . LEU C 1 105 ? 16.695  -0.534  -11.713 1.00 31.76  ? 117 LEU C CA  1 
ATOM   5097 C C   . LEU C 1 105 ? 17.337  -1.559  -10.769 1.00 35.34  ? 117 LEU C C   1 
ATOM   5098 O O   . LEU C 1 105 ? 17.389  -2.742  -11.105 1.00 37.21  ? 117 LEU C O   1 
ATOM   5099 C CB  . LEU C 1 105 ? 17.770  0.225   -12.497 1.00 31.80  ? 117 LEU C CB  1 
ATOM   5100 C CG  . LEU C 1 105 ? 17.293  0.985   -13.726 1.00 35.63  ? 117 LEU C CG  1 
ATOM   5101 C CD1 . LEU C 1 105 ? 18.340  1.924   -14.198 1.00 35.96  ? 117 LEU C CD1 1 
ATOM   5102 C CD2 . LEU C 1 105 ? 16.875  0.027   -14.837 1.00 38.46  ? 117 LEU C CD2 1 
ATOM   5103 N N   . PHE C 1 106 ? 17.782  -1.110  -9.587  1.00 29.09  ? 118 PHE C N   1 
ATOM   5104 C CA  . PHE C 1 106 ? 18.300  -2.000  -8.555  1.00 28.35  ? 118 PHE C CA  1 
ATOM   5105 C C   . PHE C 1 106 ? 17.208  -2.920  -8.029  1.00 34.72  ? 118 PHE C C   1 
ATOM   5106 O O   . PHE C 1 106 ? 17.446  -4.121  -7.898  1.00 35.68  ? 118 PHE C O   1 
ATOM   5107 C CB  . PHE C 1 106 ? 18.955  -1.220  -7.405  1.00 28.59  ? 118 PHE C CB  1 
ATOM   5108 C CG  . PHE C 1 106 ? 20.427  -0.992  -7.646  1.00 29.49  ? 118 PHE C CG  1 
ATOM   5109 C CD1 . PHE C 1 106 ? 21.345  -2.013  -7.445  1.00 32.57  ? 118 PHE C CD1 1 
ATOM   5110 C CD2 . PHE C 1 106 ? 20.895  0.241   -8.095  1.00 30.32  ? 118 PHE C CD2 1 
ATOM   5111 C CE1 . PHE C 1 106 ? 22.705  -1.809  -7.692  1.00 33.59  ? 118 PHE C CE1 1 
ATOM   5112 C CE2 . PHE C 1 106 ? 22.256  0.451   -8.330  1.00 33.57  ? 118 PHE C CE2 1 
ATOM   5113 C CZ  . PHE C 1 106 ? 23.151  -0.580  -8.135  1.00 32.35  ? 118 PHE C CZ  1 
ATOM   5114 N N   . PHE C 1 107 ? 16.007  -2.373  -7.762  1.00 30.55  ? 119 PHE C N   1 
ATOM   5115 C CA  . PHE C 1 107 ? 14.873  -3.148  -7.263  1.00 28.83  ? 119 PHE C CA  1 
ATOM   5116 C C   . PHE C 1 107 ? 14.595  -4.340  -8.165  1.00 32.99  ? 119 PHE C C   1 
ATOM   5117 O O   . PHE C 1 107 ? 14.453  -5.452  -7.653  1.00 34.00  ? 119 PHE C O   1 
ATOM   5118 C CB  . PHE C 1 107 ? 13.625  -2.268  -7.119  1.00 29.13  ? 119 PHE C CB  1 
ATOM   5119 C CG  . PHE C 1 107 ? 12.333  -3.026  -6.949  1.00 29.78  ? 119 PHE C CG  1 
ATOM   5120 C CD1 . PHE C 1 107 ? 12.032  -3.654  -5.748  1.00 31.88  ? 119 PHE C CD1 1 
ATOM   5121 C CD2 . PHE C 1 107 ? 11.415  -3.112  -7.995  1.00 30.82  ? 119 PHE C CD2 1 
ATOM   5122 C CE1 . PHE C 1 107 ? 10.835  -4.355  -5.597  1.00 33.05  ? 119 PHE C CE1 1 
ATOM   5123 C CE2 . PHE C 1 107 ? 10.224  -3.818  -7.843  1.00 34.14  ? 119 PHE C CE2 1 
ATOM   5124 C CZ  . PHE C 1 107 ? 9.940   -4.430  -6.646  1.00 32.33  ? 119 PHE C CZ  1 
ATOM   5125 N N   . LEU C 1 108 ? 14.542  -4.126  -9.496  1.00 28.74  ? 120 LEU C N   1 
ATOM   5126 C CA  . LEU C 1 108 ? 14.174  -5.181  -10.447 1.00 28.58  ? 120 LEU C CA  1 
ATOM   5127 C C   . LEU C 1 108 ? 15.268  -6.245  -10.542 1.00 34.99  ? 120 LEU C C   1 
ATOM   5128 O O   . LEU C 1 108 ? 14.963  -7.435  -10.627 1.00 37.33  ? 120 LEU C O   1 
ATOM   5129 C CB  . LEU C 1 108 ? 13.882  -4.588  -11.843 1.00 27.85  ? 120 LEU C CB  1 
ATOM   5130 C CG  . LEU C 1 108 ? 12.629  -3.717  -12.009 1.00 30.32  ? 120 LEU C CG  1 
ATOM   5131 C CD1 . LEU C 1 108 ? 12.578  -3.101  -13.388 1.00 29.28  ? 120 LEU C CD1 1 
ATOM   5132 C CD2 . LEU C 1 108 ? 11.349  -4.503  -11.731 1.00 31.29  ? 120 LEU C CD2 1 
ATOM   5133 N N   . GLN C 1 109 ? 16.537  -5.817  -10.514 1.00 29.97  ? 121 GLN C N   1 
ATOM   5134 C CA  . GLN C 1 109 ? 17.674  -6.712  -10.616 1.00 30.65  ? 121 GLN C CA  1 
ATOM   5135 C C   . GLN C 1 109 ? 17.793  -7.584  -9.370  1.00 37.87  ? 121 GLN C C   1 
ATOM   5136 O O   . GLN C 1 109 ? 18.016  -8.787  -9.498  1.00 39.96  ? 121 GLN C O   1 
ATOM   5137 C CB  . GLN C 1 109 ? 18.959  -5.915  -10.849 1.00 31.54  ? 121 GLN C CB  1 
ATOM   5138 C CG  . GLN C 1 109 ? 20.098  -6.759  -11.382 1.00 36.61  ? 121 GLN C CG  1 
ATOM   5139 C CD  . GLN C 1 109 ? 21.297  -5.935  -11.730 1.00 51.28  ? 121 GLN C CD  1 
ATOM   5140 O OE1 . GLN C 1 109 ? 21.214  -4.933  -12.446 1.00 47.66  ? 121 GLN C OE1 1 
ATOM   5141 N NE2 . GLN C 1 109 ? 22.449  -6.378  -11.287 1.00 47.81  ? 121 GLN C NE2 1 
ATOM   5142 N N   . VAL C 1 110 ? 17.650  -6.981  -8.177  1.00 35.10  ? 122 VAL C N   1 
ATOM   5143 C CA  . VAL C 1 110 ? 17.729  -7.666  -6.884  1.00 34.77  ? 122 VAL C CA  1 
ATOM   5144 C C   . VAL C 1 110 ? 16.524  -8.613  -6.729  1.00 39.00  ? 122 VAL C C   1 
ATOM   5145 O O   . VAL C 1 110 ? 16.719  -9.750  -6.299  1.00 39.96  ? 122 VAL C O   1 
ATOM   5146 C CB  . VAL C 1 110 ? 17.873  -6.665  -5.703  1.00 37.30  ? 122 VAL C CB  1 
ATOM   5147 C CG1 . VAL C 1 110 ? 17.726  -7.357  -4.349  1.00 37.67  ? 122 VAL C CG1 1 
ATOM   5148 C CG2 . VAL C 1 110 ? 19.214  -5.928  -5.780  1.00 36.29  ? 122 VAL C CG2 1 
ATOM   5149 N N   . LYS C 1 111 ? 15.310  -8.172  -7.115  1.00 34.95  ? 123 LYS C N   1 
ATOM   5150 C CA  . LYS C 1 111 ? 14.090  -8.994  -7.050  1.00 34.80  ? 123 LYS C CA  1 
ATOM   5151 C C   . LYS C 1 111 ? 14.245  -10.277 -7.884  1.00 39.60  ? 123 LYS C C   1 
ATOM   5152 O O   . LYS C 1 111 ? 13.885  -11.354 -7.398  1.00 41.42  ? 123 LYS C O   1 
ATOM   5153 C CB  . LYS C 1 111 ? 12.847  -8.190  -7.497  1.00 35.64  ? 123 LYS C CB  1 
ATOM   5154 C CG  . LYS C 1 111 ? 11.522  -8.956  -7.421  1.00 35.02  ? 123 LYS C CG  1 
ATOM   5155 C CD  . LYS C 1 111 ? 10.302  -8.036  -7.517  1.00 36.92  ? 123 LYS C CD  1 
ATOM   5156 C CE  . LYS C 1 111 ? 10.055  -7.462  -8.901  1.00 42.38  ? 123 LYS C CE  1 
ATOM   5157 N NZ  . LYS C 1 111 ? 9.650   -8.503  -9.875  1.00 48.34  ? 123 LYS C NZ  1 
ATOM   5158 N N   . LYS C 1 112 ? 14.805  -10.174 -9.108  1.00 35.11  ? 124 LYS C N   1 
ATOM   5159 C CA  . LYS C 1 112 ? 15.037  -11.351 -9.954  1.00 36.43  ? 124 LYS C CA  1 
ATOM   5160 C C   . LYS C 1 112 ? 15.966  -12.335 -9.270  1.00 40.72  ? 124 LYS C C   1 
ATOM   5161 O O   . LYS C 1 112 ? 15.697  -13.523 -9.322  1.00 41.46  ? 124 LYS C O   1 
ATOM   5162 C CB  . LYS C 1 112 ? 15.602  -10.980 -11.327 1.00 39.21  ? 124 LYS C CB  1 
ATOM   5163 C CG  . LYS C 1 112 ? 15.259  -12.024 -12.382 1.00 53.77  ? 124 LYS C CG  1 
ATOM   5164 C CD  . LYS C 1 112 ? 16.319  -12.113 -13.456 1.00 70.09  ? 124 LYS C CD  1 
ATOM   5165 C CE  . LYS C 1 112 ? 15.954  -13.041 -14.600 1.00 78.40  ? 124 LYS C CE  1 
ATOM   5166 N NZ  . LYS C 1 112 ? 15.718  -14.447 -14.166 1.00 87.18  ? 124 LYS C NZ  1 
ATOM   5167 N N   . GLN C 1 113 ? 17.030  -11.838 -8.597  1.00 36.27  ? 125 GLN C N   1 
ATOM   5168 C CA  . GLN C 1 113 ? 17.993  -12.646 -7.849  1.00 36.74  ? 125 GLN C CA  1 
ATOM   5169 C C   . GLN C 1 113 ? 17.350  -13.323 -6.626  1.00 41.40  ? 125 GLN C C   1 
ATOM   5170 O O   . GLN C 1 113 ? 17.756  -14.425 -6.268  1.00 42.79  ? 125 GLN C O   1 
ATOM   5171 C CB  . GLN C 1 113 ? 19.185  -11.790 -7.415  1.00 37.53  ? 125 GLN C CB  1 
ATOM   5172 C CG  . GLN C 1 113 ? 20.123  -11.429 -8.567  1.00 48.22  ? 125 GLN C CG  1 
ATOM   5173 C CD  . GLN C 1 113 ? 20.996  -10.224 -8.315  1.00 66.78  ? 125 GLN C CD  1 
ATOM   5174 O OE1 . GLN C 1 113 ? 21.147  -9.734  -7.196  1.00 63.65  ? 125 GLN C OE1 1 
ATOM   5175 N NE2 . GLN C 1 113 ? 21.599  -9.715  -9.373  1.00 66.17  ? 125 GLN C NE2 1 
ATOM   5176 N N   . ILE C 1 114 ? 16.360  -12.666 -5.989  1.00 36.51  ? 126 ILE C N   1 
ATOM   5177 C CA  . ILE C 1 114 ? 15.603  -13.209 -4.857  1.00 35.87  ? 126 ILE C CA  1 
ATOM   5178 C C   . ILE C 1 114 ? 14.718  -14.351 -5.361  1.00 43.49  ? 126 ILE C C   1 
ATOM   5179 O O   . ILE C 1 114 ? 14.754  -15.453 -4.795  1.00 43.93  ? 126 ILE C O   1 
ATOM   5180 C CB  . ILE C 1 114 ? 14.781  -12.086 -4.140  1.00 36.27  ? 126 ILE C CB  1 
ATOM   5181 C CG1 . ILE C 1 114 ? 15.689  -11.059 -3.420  1.00 34.76  ? 126 ILE C CG1 1 
ATOM   5182 C CG2 . ILE C 1 114 ? 13.653  -12.628 -3.232  1.00 35.79  ? 126 ILE C CG2 1 
ATOM   5183 C CD1 . ILE C 1 114 ? 16.444  -11.527 -2.219  1.00 39.30  ? 126 ILE C CD1 1 
ATOM   5184 N N   . LEU C 1 115 ? 13.940  -14.090 -6.433  1.00 40.68  ? 127 LEU C N   1 
ATOM   5185 C CA  . LEU C 1 115 ? 12.986  -15.058 -6.963  1.00 41.87  ? 127 LEU C CA  1 
ATOM   5186 C C   . LEU C 1 115 ? 13.696  -16.273 -7.600  1.00 48.81  ? 127 LEU C C   1 
ATOM   5187 O O   . LEU C 1 115 ? 13.191  -17.387 -7.472  1.00 49.97  ? 127 LEU C O   1 
ATOM   5188 C CB  . LEU C 1 115 ? 12.021  -14.381 -7.953  1.00 41.36  ? 127 LEU C CB  1 
ATOM   5189 C CG  . LEU C 1 115 ? 11.124  -13.247 -7.375  1.00 43.85  ? 127 LEU C CG  1 
ATOM   5190 C CD1 . LEU C 1 115 ? 10.212  -12.655 -8.434  1.00 43.23  ? 127 LEU C CD1 1 
ATOM   5191 C CD2 . LEU C 1 115 ? 10.295  -13.729 -6.182  1.00 44.42  ? 127 LEU C CD2 1 
ATOM   5192 N N   . ASP C 1 116 ? 14.876  -16.061 -8.237  1.00 46.64  ? 128 ASP C N   1 
ATOM   5193 C CA  . ASP C 1 116 ? 15.738  -17.102 -8.835  1.00 48.29  ? 128 ASP C CA  1 
ATOM   5194 C C   . ASP C 1 116 ? 16.508  -17.896 -7.793  1.00 51.83  ? 128 ASP C C   1 
ATOM   5195 O O   . ASP C 1 116 ? 17.081  -18.932 -8.123  1.00 52.96  ? 128 ASP C O   1 
ATOM   5196 C CB  . ASP C 1 116 ? 16.763  -16.474 -9.796  1.00 50.70  ? 128 ASP C CB  1 
ATOM   5197 C CG  . ASP C 1 116 ? 16.215  -16.005 -11.126 1.00 68.79  ? 128 ASP C CG  1 
ATOM   5198 O OD1 . ASP C 1 116 ? 14.981  -16.192 -11.373 1.00 71.10  ? 128 ASP C OD1 1 
ATOM   5199 O OD2 . ASP C 1 116 ? 17.002  -15.427 -11.917 1.00 75.52  ? 128 ASP C OD2 1 
ATOM   5200 N N   . GLU C 1 117 ? 16.562  -17.380 -6.549  1.00 46.93  ? 129 GLU C N   1 
ATOM   5201 C CA  . GLU C 1 117 ? 17.273  -17.939 -5.392  1.00 46.21  ? 129 GLU C CA  1 
ATOM   5202 C C   . GLU C 1 117 ? 18.790  -17.866 -5.591  1.00 49.96  ? 129 GLU C C   1 
ATOM   5203 O O   . GLU C 1 117 ? 19.521  -18.673 -5.033  1.00 51.09  ? 129 GLU C O   1 
ATOM   5204 C CB  . GLU C 1 117 ? 16.812  -19.374 -5.076  1.00 48.76  ? 129 GLU C CB  1 
ATOM   5205 C CG  . GLU C 1 117 ? 15.347  -19.448 -4.705  1.00 55.62  ? 129 GLU C CG  1 
ATOM   5206 C CD  . GLU C 1 117 ? 14.802  -20.855 -4.736  1.00 76.27  ? 129 GLU C CD  1 
ATOM   5207 O OE1 . GLU C 1 117 ? 15.009  -21.593 -3.748  1.00 83.70  ? 129 GLU C OE1 1 
ATOM   5208 O OE2 . GLU C 1 117 ? 14.194  -21.233 -5.760  1.00 65.29  ? 129 GLU C OE2 1 
ATOM   5209 N N   . LYS C 1 118 ? 19.260  -16.884 -6.375  1.00 45.46  ? 130 LYS C N   1 
ATOM   5210 C CA  . LYS C 1 118 ? 20.684  -16.574 -6.505  1.00 44.82  ? 130 LYS C CA  1 
ATOM   5211 C C   . LYS C 1 118 ? 21.184  -15.938 -5.211  1.00 47.62  ? 130 LYS C C   1 
ATOM   5212 O O   . LYS C 1 118 ? 22.316  -16.198 -4.820  1.00 48.26  ? 130 LYS C O   1 
ATOM   5213 C CB  . LYS C 1 118 ? 20.946  -15.675 -7.716  1.00 47.43  ? 130 LYS C CB  1 
ATOM   5214 C CG  . LYS C 1 118 ? 20.939  -16.454 -9.030  1.00 79.08  ? 130 LYS C CG  1 
ATOM   5215 C CD  . LYS C 1 118 ? 20.773  -15.545 -10.242 1.00 99.94  ? 130 LYS C CD  1 
ATOM   5216 C CE  . LYS C 1 118 ? 20.728  -16.311 -11.542 1.00 119.15 ? 130 LYS C CE  1 
ATOM   5217 N NZ  . LYS C 1 118 ? 20.448  -15.414 -12.699 1.00 131.18 ? 130 LYS C NZ  1 
ATOM   5218 N N   . ILE C 1 119 ? 20.339  -15.106 -4.554  1.00 42.17  ? 131 ILE C N   1 
ATOM   5219 C CA  . ILE C 1 119 ? 20.506  -14.606 -3.179  1.00 40.75  ? 131 ILE C CA  1 
ATOM   5220 C C   . ILE C 1 119 ? 19.669  -15.484 -2.252  1.00 44.70  ? 131 ILE C C   1 
ATOM   5221 O O   . ILE C 1 119 ? 18.442  -15.513 -2.412  1.00 44.95  ? 131 ILE C O   1 
ATOM   5222 C CB  . ILE C 1 119 ? 20.078  -13.104 -3.042  1.00 42.67  ? 131 ILE C CB  1 
ATOM   5223 C CG1 . ILE C 1 119 ? 20.854  -12.170 -3.986  1.00 42.93  ? 131 ILE C CG1 1 
ATOM   5224 C CG2 . ILE C 1 119 ? 20.172  -12.623 -1.594  1.00 43.24  ? 131 ILE C CG2 1 
ATOM   5225 C CD1 . ILE C 1 119 ? 20.299  -10.683 -4.041  1.00 45.44  ? 131 ILE C CD1 1 
ATOM   5226 N N   . TYR C 1 120 ? 20.297  -16.191 -1.285  1.00 41.10  ? 132 TYR C N   1 
ATOM   5227 C CA  . TYR C 1 120 ? 19.519  -16.924 -0.281  1.00 41.74  ? 132 TYR C CA  1 
ATOM   5228 C C   . TYR C 1 120 ? 18.677  -15.942 0.546   1.00 46.55  ? 132 TYR C C   1 
ATOM   5229 O O   . TYR C 1 120 ? 19.177  -14.890 0.950   1.00 45.53  ? 132 TYR C O   1 
ATOM   5230 C CB  . TYR C 1 120 ? 20.398  -17.805 0.644   1.00 43.10  ? 132 TYR C CB  1 
ATOM   5231 C CG  . TYR C 1 120 ? 19.636  -18.325 1.844   1.00 44.33  ? 132 TYR C CG  1 
ATOM   5232 C CD1 . TYR C 1 120 ? 18.695  -19.342 1.706   1.00 46.75  ? 132 TYR C CD1 1 
ATOM   5233 C CD2 . TYR C 1 120 ? 19.772  -17.726 3.095   1.00 44.64  ? 132 TYR C CD2 1 
ATOM   5234 C CE1 . TYR C 1 120 ? 17.926  -19.768 2.783   1.00 48.46  ? 132 TYR C CE1 1 
ATOM   5235 C CE2 . TYR C 1 120 ? 19.015  -18.148 4.182   1.00 46.62  ? 132 TYR C CE2 1 
ATOM   5236 C CZ  . TYR C 1 120 ? 18.097  -19.178 4.022   1.00 57.37  ? 132 TYR C CZ  1 
ATOM   5237 O OH  . TYR C 1 120 ? 17.333  -19.618 5.076   1.00 61.85  ? 132 TYR C OH  1 
ATOM   5238 N N   . CYS C 1 121 ? 17.420  -16.304 0.806   1.00 43.82  ? 133 CYS C N   1 
ATOM   5239 C CA  . CYS C 1 121 ? 16.465  -15.495 1.555   1.00 43.00  ? 133 CYS C CA  1 
ATOM   5240 C C   . CYS C 1 121 ? 15.697  -16.389 2.520   1.00 47.33  ? 133 CYS C C   1 
ATOM   5241 O O   . CYS C 1 121 ? 15.149  -17.400 2.065   1.00 48.87  ? 133 CYS C O   1 
ATOM   5242 C CB  . CYS C 1 121 ? 15.521  -14.771 0.596   1.00 42.94  ? 133 CYS C CB  1 
ATOM   5243 S SG  . CYS C 1 121 ? 14.452  -13.534 1.386   1.00 46.09  ? 133 CYS C SG  1 
ATOM   5244 N N   . PRO C 1 122 ? 15.649  -16.080 3.843   1.00 42.78  ? 134 PRO C N   1 
ATOM   5245 C CA  . PRO C 1 122 ? 14.851  -16.927 4.763   1.00 43.82  ? 134 PRO C CA  1 
ATOM   5246 C C   . PRO C 1 122 ? 13.337  -16.770 4.530   1.00 48.50  ? 134 PRO C C   1 
ATOM   5247 O O   . PRO C 1 122 ? 12.929  -15.773 3.918   1.00 46.05  ? 134 PRO C O   1 
ATOM   5248 C CB  . PRO C 1 122 ? 15.260  -16.446 6.160   1.00 45.11  ? 134 PRO C CB  1 
ATOM   5249 C CG  . PRO C 1 122 ? 16.397  -15.488 5.955   1.00 47.50  ? 134 PRO C CG  1 
ATOM   5250 C CD  . PRO C 1 122 ? 16.310  -14.975 4.564   1.00 42.28  ? 134 PRO C CD  1 
ATOM   5251 N N   . PRO C 1 123 ? 12.482  -17.729 4.984   1.00 47.71  ? 135 PRO C N   1 
ATOM   5252 C CA  . PRO C 1 123 ? 11.036  -17.641 4.666   1.00 47.73  ? 135 PRO C CA  1 
ATOM   5253 C C   . PRO C 1 123 ? 10.333  -16.348 5.112   1.00 49.56  ? 135 PRO C C   1 
ATOM   5254 O O   . PRO C 1 123 ? 9.561   -15.806 4.324   1.00 50.16  ? 135 PRO C O   1 
ATOM   5255 C CB  . PRO C 1 123 ? 10.444  -18.862 5.374   1.00 50.92  ? 135 PRO C CB  1 
ATOM   5256 C CG  . PRO C 1 123 ? 11.576  -19.806 5.505   1.00 54.77  ? 135 PRO C CG  1 
ATOM   5257 C CD  . PRO C 1 123 ? 12.782  -18.967 5.739   1.00 49.34  ? 135 PRO C CD  1 
ATOM   5258 N N   . GLU C 1 124 ? 10.590  -15.847 6.332   1.00 44.15  ? 136 GLU C N   1 
ATOM   5259 C CA  . GLU C 1 124 ? 9.923   -14.638 6.842   1.00 42.87  ? 136 GLU C CA  1 
ATOM   5260 C C   . GLU C 1 124 ? 10.268  -13.390 6.004   1.00 43.88  ? 136 GLU C C   1 
ATOM   5261 O O   . GLU C 1 124 ? 9.351   -12.654 5.640   1.00 43.91  ? 136 GLU C O   1 
ATOM   5262 C CB  . GLU C 1 124 ? 10.271  -14.404 8.313   1.00 44.72  ? 136 GLU C CB  1 
ATOM   5263 C CG  . GLU C 1 124 ? 9.500   -13.269 8.952   1.00 55.54  ? 136 GLU C CG  1 
ATOM   5264 C CD  . GLU C 1 124 ? 9.817   -13.004 10.411  1.00 72.06  ? 136 GLU C CD  1 
ATOM   5265 O OE1 . GLU C 1 124 ? 10.763  -13.617 10.960  1.00 58.53  ? 136 GLU C OE1 1 
ATOM   5266 O OE2 . GLU C 1 124 ? 9.099   -12.171 11.007  1.00 64.74  ? 136 GLU C OE2 1 
ATOM   5267 N N   . ALA C 1 125 ? 11.576  -13.136 5.736   1.00 37.13  ? 137 ALA C N   1 
ATOM   5268 C CA  . ALA C 1 125 ? 12.022  -12.048 4.868   1.00 34.61  ? 137 ALA C CA  1 
ATOM   5269 C C   . ALA C 1 125 ? 11.364  -12.152 3.484   1.00 39.13  ? 137 ALA C C   1 
ATOM   5270 O O   . ALA C 1 125 ? 10.929  -11.140 2.929   1.00 37.04  ? 137 ALA C O   1 
ATOM   5271 C CB  . ALA C 1 125 ? 13.538  -12.062 4.735   1.00 34.37  ? 137 ALA C CB  1 
ATOM   5272 N N   . SER C 1 126 ? 11.250  -13.389 2.962   1.00 38.38  ? 138 SER C N   1 
ATOM   5273 C CA  . SER C 1 126 ? 10.699  -13.702 1.642   1.00 38.54  ? 138 SER C CA  1 
ATOM   5274 C C   . SER C 1 126 ? 9.246   -13.249 1.496   1.00 41.74  ? 138 SER C C   1 
ATOM   5275 O O   . SER C 1 126 ? 8.896   -12.709 0.443   1.00 40.56  ? 138 SER C O   1 
ATOM   5276 C CB  . SER C 1 126 ? 10.812  -15.196 1.356   1.00 43.90  ? 138 SER C CB  1 
ATOM   5277 O OG  . SER C 1 126 ? 10.219  -15.523 0.110   1.00 57.58  ? 138 SER C OG  1 
ATOM   5278 N N   . VAL C 1 127 ? 8.405   -13.467 2.532   1.00 38.83  ? 139 VAL C N   1 
ATOM   5279 C CA  . VAL C 1 127 ? 7.000   -13.065 2.468   1.00 39.48  ? 139 VAL C CA  1 
ATOM   5280 C C   . VAL C 1 127 ? 6.890   -11.529 2.622   1.00 42.16  ? 139 VAL C C   1 
ATOM   5281 O O   . VAL C 1 127 ? 5.994   -10.938 2.022   1.00 42.88  ? 139 VAL C O   1 
ATOM   5282 C CB  . VAL C 1 127 ? 6.036   -13.846 3.417   1.00 45.55  ? 139 VAL C CB  1 
ATOM   5283 C CG1 . VAL C 1 127 ? 6.084   -15.343 3.148   1.00 46.05  ? 139 VAL C CG1 1 
ATOM   5284 C CG2 . VAL C 1 127 ? 6.309   -13.567 4.881   1.00 46.34  ? 139 VAL C CG2 1 
ATOM   5285 N N   . LEU C 1 128 ? 7.804   -10.887 3.383   1.00 36.91  ? 140 LEU C N   1 
ATOM   5286 C CA  . LEU C 1 128 ? 7.874   -9.425  3.470   1.00 35.76  ? 140 LEU C CA  1 
ATOM   5287 C C   . LEU C 1 128 ? 8.252   -8.814  2.145   1.00 38.62  ? 140 LEU C C   1 
ATOM   5288 O O   . LEU C 1 128 ? 7.556   -7.913  1.682   1.00 38.93  ? 140 LEU C O   1 
ATOM   5289 C CB  . LEU C 1 128 ? 8.864   -8.948  4.545   1.00 35.79  ? 140 LEU C CB  1 
ATOM   5290 C CG  . LEU C 1 128 ? 8.323   -8.818  5.964   1.00 41.20  ? 140 LEU C CG  1 
ATOM   5291 C CD1 . LEU C 1 128 ? 9.391   -8.307  6.874   1.00 41.42  ? 140 LEU C CD1 1 
ATOM   5292 C CD2 . LEU C 1 128 ? 7.121   -7.887  6.024   1.00 41.13  ? 140 LEU C CD2 1 
ATOM   5293 N N   . LEU C 1 129 ? 9.350   -9.298  1.531   1.00 33.64  ? 141 LEU C N   1 
ATOM   5294 C CA  . LEU C 1 129 ? 9.794   -8.890  0.201   1.00 32.03  ? 141 LEU C CA  1 
ATOM   5295 C C   . LEU C 1 129 ? 8.647   -8.995  -0.818  1.00 38.23  ? 141 LEU C C   1 
ATOM   5296 O O   . LEU C 1 129 ? 8.404   -8.032  -1.534  1.00 38.21  ? 141 LEU C O   1 
ATOM   5297 C CB  . LEU C 1 129 ? 11.004  -9.729  -0.243  1.00 31.89  ? 141 LEU C CB  1 
ATOM   5298 C CG  . LEU C 1 129 ? 12.353  -9.382  0.430   1.00 35.34  ? 141 LEU C CG  1 
ATOM   5299 C CD1 . LEU C 1 129 ? 13.439  -10.309 -0.022  1.00 34.06  ? 141 LEU C CD1 1 
ATOM   5300 C CD2 . LEU C 1 129 ? 12.768  -7.948  0.142   1.00 36.94  ? 141 LEU C CD2 1 
ATOM   5301 N N   . ALA C 1 130 ? 7.900   -10.118 -0.825  1.00 37.11  ? 142 ALA C N   1 
ATOM   5302 C CA  . ALA C 1 130 ? 6.791   -10.372 -1.755  1.00 38.00  ? 142 ALA C CA  1 
ATOM   5303 C C   . ALA C 1 130 ? 5.670   -9.323  -1.613  1.00 43.50  ? 142 ALA C C   1 
ATOM   5304 O O   . ALA C 1 130 ? 5.126   -8.874  -2.628  1.00 43.27  ? 142 ALA C O   1 
ATOM   5305 C CB  . ALA C 1 130 ? 6.238   -11.776 -1.532  1.00 40.06  ? 142 ALA C CB  1 
ATOM   5306 N N   . SER C 1 131 ? 5.361   -8.916  -0.354  1.00 40.81  ? 143 SER C N   1 
ATOM   5307 C CA  . SER C 1 131 ? 4.372   -7.883  -0.027  1.00 40.39  ? 143 SER C CA  1 
ATOM   5308 C C   . SER C 1 131 ? 4.768   -6.503  -0.540  1.00 42.57  ? 143 SER C C   1 
ATOM   5309 O O   . SER C 1 131 ? 3.906   -5.788  -1.059  1.00 44.12  ? 143 SER C O   1 
ATOM   5310 C CB  . SER C 1 131 ? 4.149   -7.820  1.474   1.00 43.76  ? 143 SER C CB  1 
ATOM   5311 O OG  . SER C 1 131 ? 3.193   -8.783  1.876   1.00 53.64  ? 143 SER C OG  1 
ATOM   5312 N N   . TYR C 1 132 ? 6.057   -6.130  -0.400  1.00 35.92  ? 144 TYR C N   1 
ATOM   5313 C CA  . TYR C 1 132 ? 6.570   -4.867  -0.920  1.00 34.12  ? 144 TYR C CA  1 
ATOM   5314 C C   . TYR C 1 132 ? 6.588   -4.865  -2.443  1.00 38.60  ? 144 TYR C C   1 
ATOM   5315 O O   . TYR C 1 132 ? 6.300   -3.834  -3.034  1.00 38.56  ? 144 TYR C O   1 
ATOM   5316 C CB  . TYR C 1 132 ? 7.967   -4.532  -0.347  1.00 34.07  ? 144 TYR C CB  1 
ATOM   5317 C CG  . TYR C 1 132 ? 7.876   -4.003  1.061   1.00 34.82  ? 144 TYR C CG  1 
ATOM   5318 C CD1 . TYR C 1 132 ? 7.189   -2.820  1.340   1.00 36.35  ? 144 TYR C CD1 1 
ATOM   5319 C CD2 . TYR C 1 132 ? 8.448   -4.692  2.122   1.00 35.69  ? 144 TYR C CD2 1 
ATOM   5320 C CE1 . TYR C 1 132 ? 7.071   -2.340  2.643   1.00 36.23  ? 144 TYR C CE1 1 
ATOM   5321 C CE2 . TYR C 1 132 ? 8.331   -4.226  3.433   1.00 37.18  ? 144 TYR C CE2 1 
ATOM   5322 C CZ  . TYR C 1 132 ? 7.637   -3.050  3.688   1.00 44.19  ? 144 TYR C CZ  1 
ATOM   5323 O OH  . TYR C 1 132 ? 7.499   -2.571  4.969   1.00 46.87  ? 144 TYR C OH  1 
ATOM   5324 N N   . ALA C 1 133 ? 6.913   -6.007  -3.074  1.00 35.39  ? 145 ALA C N   1 
ATOM   5325 C CA  . ALA C 1 133 ? 6.866   -6.170  -4.528  1.00 34.25  ? 145 ALA C CA  1 
ATOM   5326 C C   . ALA C 1 133 ? 5.437   -5.921  -5.057  1.00 37.78  ? 145 ALA C C   1 
ATOM   5327 O O   . ALA C 1 133 ? 5.288   -5.229  -6.065  1.00 36.35  ? 145 ALA C O   1 
ATOM   5328 C CB  . ALA C 1 133 ? 7.366   -7.557  -4.923  1.00 35.27  ? 145 ALA C CB  1 
ATOM   5329 N N   . VAL C 1 134 ? 4.395   -6.437  -4.362  1.00 35.13  ? 146 VAL C N   1 
ATOM   5330 C CA  . VAL C 1 134 ? 2.991   -6.181  -4.738  1.00 35.95  ? 146 VAL C CA  1 
ATOM   5331 C C   . VAL C 1 134 ? 2.717   -4.646  -4.731  1.00 41.02  ? 146 VAL C C   1 
ATOM   5332 O O   . VAL C 1 134 ? 2.216   -4.083  -5.728  1.00 42.01  ? 146 VAL C O   1 
ATOM   5333 C CB  . VAL C 1 134 ? 1.969   -6.956  -3.844  1.00 40.36  ? 146 VAL C CB  1 
ATOM   5334 C CG1 . VAL C 1 134 ? 0.535   -6.527  -4.151  1.00 40.01  ? 146 VAL C CG1 1 
ATOM   5335 C CG2 . VAL C 1 134 ? 2.114   -8.467  -4.003  1.00 40.92  ? 146 VAL C CG2 1 
ATOM   5336 N N   . GLN C 1 135 ? 3.079   -3.989  -3.612  1.00 36.63  ? 147 GLN C N   1 
ATOM   5337 C CA  . GLN C 1 135 ? 2.901   -2.546  -3.434  1.00 36.04  ? 147 GLN C CA  1 
ATOM   5338 C C   . GLN C 1 135 ? 3.711   -1.723  -4.414  1.00 38.87  ? 147 GLN C C   1 
ATOM   5339 O O   . GLN C 1 135 ? 3.222   -0.683  -4.840  1.00 39.72  ? 147 GLN C O   1 
ATOM   5340 C CB  . GLN C 1 135 ? 3.264   -2.127  -1.996  1.00 37.41  ? 147 GLN C CB  1 
ATOM   5341 C CG  . GLN C 1 135 ? 2.229   -2.575  -0.960  1.00 53.49  ? 147 GLN C CG  1 
ATOM   5342 C CD  . GLN C 1 135 ? 1.164   -1.556  -0.597  1.00 70.01  ? 147 GLN C CD  1 
ATOM   5343 O OE1 . GLN C 1 135 ? 0.476   -1.719  0.416   1.00 66.92  ? 147 GLN C OE1 1 
ATOM   5344 N NE2 . GLN C 1 135 ? 1.004   -0.475  -1.380  1.00 57.69  ? 147 GLN C NE2 1 
ATOM   5345 N N   . ALA C 1 136 ? 4.946   -2.177  -4.762  1.00 33.47  ? 148 ALA C N   1 
ATOM   5346 C CA  . ALA C 1 136 ? 5.833   -1.520  -5.724  1.00 32.01  ? 148 ALA C CA  1 
ATOM   5347 C C   . ALA C 1 136 ? 5.267   -1.610  -7.124  1.00 37.17  ? 148 ALA C C   1 
ATOM   5348 O O   . ALA C 1 136 ? 5.491   -0.714  -7.922  1.00 36.45  ? 148 ALA C O   1 
ATOM   5349 C CB  . ALA C 1 136 ? 7.221   -2.137  -5.683  1.00 32.20  ? 148 ALA C CB  1 
ATOM   5350 N N   . LYS C 1 137 ? 4.508   -2.679  -7.414  1.00 34.91  ? 149 LYS C N   1 
ATOM   5351 C CA  . LYS C 1 137 ? 3.950   -2.921  -8.722  1.00 34.13  ? 149 LYS C CA  1 
ATOM   5352 C C   . LYS C 1 137 ? 2.858   -1.910  -9.006  1.00 39.14  ? 149 LYS C C   1 
ATOM   5353 O O   . LYS C 1 137 ? 2.878   -1.344  -10.108 1.00 39.03  ? 149 LYS C O   1 
ATOM   5354 C CB  . LYS C 1 137 ? 3.429   -4.361  -8.847  1.00 36.45  ? 149 LYS C CB  1 
ATOM   5355 C CG  . LYS C 1 137 ? 3.315   -4.786  -10.293 1.00 39.71  ? 149 LYS C CG  1 
ATOM   5356 C CD  . LYS C 1 137 ? 2.722   -6.176  -10.427 1.00 34.78  ? 149 LYS C CD  1 
ATOM   5357 C CE  . LYS C 1 137 ? 2.541   -6.551  -11.876 1.00 32.25  ? 149 LYS C CE  1 
ATOM   5358 N NZ  . LYS C 1 137 ? 2.068   -7.955  -12.011 1.00 43.91  ? 149 LYS C NZ  1 
ATOM   5359 N N   . TYR C 1 138 ? 1.922   -1.664  -8.039  1.00 36.50  ? 150 TYR C N   1 
ATOM   5360 C CA  . TYR C 1 138 ? 0.781   -0.785  -8.333  1.00 36.28  ? 150 TYR C CA  1 
ATOM   5361 C C   . TYR C 1 138 ? 0.606   0.441   -7.400  1.00 40.72  ? 150 TYR C C   1 
ATOM   5362 O O   . TYR C 1 138 ? -0.020  1.400   -7.844  1.00 40.02  ? 150 TYR C O   1 
ATOM   5363 C CB  . TYR C 1 138 ? -0.554  -1.551  -8.356  1.00 38.17  ? 150 TYR C CB  1 
ATOM   5364 C CG  . TYR C 1 138 ? -0.621  -2.712  -9.331  1.00 39.90  ? 150 TYR C CG  1 
ATOM   5365 C CD1 . TYR C 1 138 ? -0.706  -2.496  -10.708 1.00 40.99  ? 150 TYR C CD1 1 
ATOM   5366 C CD2 . TYR C 1 138 ? -0.643  -4.024  -8.878  1.00 41.59  ? 150 TYR C CD2 1 
ATOM   5367 C CE1 . TYR C 1 138 ? -0.749  -3.561  -11.611 1.00 40.95  ? 150 TYR C CE1 1 
ATOM   5368 C CE2 . TYR C 1 138 ? -0.732  -5.094  -9.767  1.00 43.32  ? 150 TYR C CE2 1 
ATOM   5369 C CZ  . TYR C 1 138 ? -0.776  -4.858  -11.137 1.00 49.28  ? 150 TYR C CZ  1 
ATOM   5370 O OH  . TYR C 1 138 ? -0.849  -5.894  -12.038 1.00 51.18  ? 150 TYR C OH  1 
ATOM   5371 N N   . GLY C 1 139 ? 1.110   0.407   -6.156  1.00 37.29  ? 151 GLY C N   1 
ATOM   5372 C CA  . GLY C 1 139 ? 0.802   1.399   -5.115  1.00 37.80  ? 151 GLY C CA  1 
ATOM   5373 C C   . GLY C 1 139 ? 1.156   2.834   -5.456  1.00 41.70  ? 151 GLY C C   1 
ATOM   5374 O O   . GLY C 1 139 ? 0.529   3.791   -4.994  1.00 41.39  ? 151 GLY C O   1 
ATOM   5375 N N   . ASP C 1 140 ? 2.245   2.949   -6.179  1.00 38.17  ? 152 ASP C N   1 
ATOM   5376 C CA  . ASP C 1 140 ? 2.730   3.973   -7.089  1.00 36.64  ? 152 ASP C CA  1 
ATOM   5377 C C   . ASP C 1 140 ? 1.679   4.980   -7.654  1.00 39.52  ? 152 ASP C C   1 
ATOM   5378 O O   . ASP C 1 140 ? 1.934   6.191   -7.707  1.00 39.48  ? 152 ASP C O   1 
ATOM   5379 C CB  . ASP C 1 140 ? 3.274   3.162   -8.272  1.00 37.67  ? 152 ASP C CB  1 
ATOM   5380 C CG  . ASP C 1 140 ? 4.547   3.670   -8.808  1.00 50.88  ? 152 ASP C CG  1 
ATOM   5381 O OD1 . ASP C 1 140 ? 5.141   4.555   -8.175  1.00 54.10  ? 152 ASP C OD1 1 
ATOM   5382 O OD2 . ASP C 1 140 ? 4.937   3.223   -9.873  1.00 59.60  ? 152 ASP C OD2 1 
ATOM   5383 N N   . TYR C 1 141 ? 0.553   4.463   -8.152  1.00 34.19  ? 153 TYR C N   1 
ATOM   5384 C CA  . TYR C 1 141 ? -0.449  5.247   -8.872  1.00 33.85  ? 153 TYR C CA  1 
ATOM   5385 C C   . TYR C 1 141 ? -1.860  4.778   -8.535  1.00 40.49  ? 153 TYR C C   1 
ATOM   5386 O O   . TYR C 1 141 ? -2.824  5.393   -8.976  1.00 41.73  ? 153 TYR C O   1 
ATOM   5387 C CB  . TYR C 1 141 ? -0.208  5.146   -10.387 1.00 33.34  ? 153 TYR C CB  1 
ATOM   5388 C CG  . TYR C 1 141 ? -0.358  3.749   -10.953 1.00 33.73  ? 153 TYR C CG  1 
ATOM   5389 C CD1 . TYR C 1 141 ? 0.706   2.850   -10.936 1.00 35.71  ? 153 TYR C CD1 1 
ATOM   5390 C CD2 . TYR C 1 141 ? -1.542  3.346   -11.567 1.00 33.87  ? 153 TYR C CD2 1 
ATOM   5391 C CE1 . TYR C 1 141 ? 0.586   1.574   -11.485 1.00 35.85  ? 153 TYR C CE1 1 
ATOM   5392 C CE2 . TYR C 1 141 ? -1.669  2.079   -12.129 1.00 34.50  ? 153 TYR C CE2 1 
ATOM   5393 C CZ  . TYR C 1 141 ? -0.605  1.193   -12.078 1.00 38.45  ? 153 TYR C CZ  1 
ATOM   5394 O OH  . TYR C 1 141 ? -0.714  -0.053  -12.637 1.00 36.62  ? 153 TYR C OH  1 
ATOM   5395 N N   . ASP C 1 142 ? -1.978  3.680   -7.780  1.00 38.33  ? 154 ASP C N   1 
ATOM   5396 C CA  . ASP C 1 142 ? -3.248  3.070   -7.440  1.00 40.13  ? 154 ASP C CA  1 
ATOM   5397 C C   . ASP C 1 142 ? -3.241  2.688   -5.942  1.00 46.49  ? 154 ASP C C   1 
ATOM   5398 O O   . ASP C 1 142 ? -2.596  1.718   -5.551  1.00 46.24  ? 154 ASP C O   1 
ATOM   5399 C CB  . ASP C 1 142 ? -3.511  1.866   -8.367  1.00 42.34  ? 154 ASP C CB  1 
ATOM   5400 C CG  . ASP C 1 142 ? -4.843  1.167   -8.221  1.00 53.32  ? 154 ASP C CG  1 
ATOM   5401 O OD1 . ASP C 1 142 ? -5.721  1.695   -7.500  1.00 54.65  ? 154 ASP C OD1 1 
ATOM   5402 O OD2 . ASP C 1 142 ? -5.020  0.105   -8.847  1.00 61.01  ? 154 ASP C OD2 1 
ATOM   5403 N N   . PRO C 1 143 ? -3.948  3.457   -5.088  1.00 45.72  ? 155 PRO C N   1 
ATOM   5404 C CA  . PRO C 1 143 ? -3.918  3.168   -3.644  1.00 47.37  ? 155 PRO C CA  1 
ATOM   5405 C C   . PRO C 1 143 ? -4.650  1.872   -3.240  1.00 56.39  ? 155 PRO C C   1 
ATOM   5406 O O   . PRO C 1 143 ? -4.381  1.354   -2.158  1.00 57.17  ? 155 PRO C O   1 
ATOM   5407 C CB  . PRO C 1 143 ? -4.595  4.396   -3.033  1.00 49.20  ? 155 PRO C CB  1 
ATOM   5408 C CG  . PRO C 1 143 ? -5.488  4.905   -4.094  1.00 52.79  ? 155 PRO C CG  1 
ATOM   5409 C CD  . PRO C 1 143 ? -4.797  4.629   -5.387  1.00 47.32  ? 155 PRO C CD  1 
ATOM   5410 N N   . SER C 1 144 ? -5.577  1.365   -4.076  1.00 55.37  ? 156 SER C N   1 
ATOM   5411 C CA  . SER C 1 144 ? -6.232  0.071   -3.847  1.00 57.64  ? 156 SER C CA  1 
ATOM   5412 C C   . SER C 1 144 ? -5.296  -1.114  -4.171  1.00 65.82  ? 156 SER C C   1 
ATOM   5413 O O   . SER C 1 144 ? -5.559  -2.225  -3.701  1.00 67.65  ? 156 SER C O   1 
ATOM   5414 C CB  . SER C 1 144 ? -7.514  -0.043  -4.665  1.00 60.45  ? 156 SER C CB  1 
ATOM   5415 O OG  . SER C 1 144 ? -7.265  0.041   -6.057  1.00 65.47  ? 156 SER C OG  1 
ATOM   5416 N N   . VAL C 1 145 ? -4.215  -0.865  -4.973  1.00 62.71  ? 157 VAL C N   1 
ATOM   5417 C CA  . VAL C 1 145 ? -3.155  -1.804  -5.407  1.00 62.79  ? 157 VAL C CA  1 
ATOM   5418 C C   . VAL C 1 145 ? -3.801  -2.996  -6.206  1.00 70.19  ? 157 VAL C C   1 
ATOM   5419 O O   . VAL C 1 145 ? -3.609  -4.183  -5.872  1.00 71.03  ? 157 VAL C O   1 
ATOM   5420 C CB  . VAL C 1 145 ? -2.203  -2.265  -4.245  1.00 66.07  ? 157 VAL C CB  1 
ATOM   5421 C CG1 . VAL C 1 145 ? -0.958  -2.972  -4.786  1.00 64.61  ? 157 VAL C CG1 1 
ATOM   5422 C CG2 . VAL C 1 145 ? -1.782  -1.077  -3.378  1.00 65.30  ? 157 VAL C CG2 1 
ATOM   5423 N N   . HIS C 1 146 ? -4.570  -2.629  -7.278  1.00 66.73  ? 158 HIS C N   1 
ATOM   5424 C CA  . HIS C 1 146 ? -5.284  -3.499  -8.229  1.00 79.21  ? 158 HIS C CA  1 
ATOM   5425 C C   . HIS C 1 146 ? -6.284  -4.416  -7.510  1.00 111.72 ? 158 HIS C C   1 
ATOM   5426 O O   . HIS C 1 146 ? -7.381  -3.983  -7.155  1.00 77.95  ? 158 HIS C O   1 
ATOM   5427 C CB  . HIS C 1 146 ? -4.292  -4.326  -9.074  1.00 79.32  ? 158 HIS C CB  1 
ATOM   5428 C CG  . HIS C 1 146 ? -4.472  -4.203  -10.558 1.00 82.64  ? 158 HIS C CG  1 
ATOM   5429 N ND1 . HIS C 1 146 ? -4.472  -2.965  -11.194 1.00 83.43  ? 158 HIS C ND1 1 
ATOM   5430 C CD2 . HIS C 1 146 ? -4.597  -5.174  -11.495 1.00 85.14  ? 158 HIS C CD2 1 
ATOM   5431 C CE1 . HIS C 1 146 ? -4.628  -3.226  -12.484 1.00 83.16  ? 158 HIS C CE1 1 
ATOM   5432 N NE2 . HIS C 1 146 ? -4.706  -4.541  -12.715 1.00 84.53  ? 158 HIS C NE2 1 
ATOM   5433 N N   . GLN C 1 166 ? -21.496 14.758  -27.110 1.00 63.87  ? 178 GLN C N   1 
ATOM   5434 C CA  . GLN C 1 166 ? -22.213 15.737  -26.293 1.00 63.38  ? 178 GLN C CA  1 
ATOM   5435 C C   . GLN C 1 166 ? -21.387 16.193  -25.070 1.00 63.09  ? 178 GLN C C   1 
ATOM   5436 O O   . GLN C 1 166 ? -20.614 15.405  -24.518 1.00 63.22  ? 178 GLN C O   1 
ATOM   5437 C CB  . GLN C 1 166 ? -23.539 15.138  -25.828 1.00 66.66  ? 178 GLN C CB  1 
ATOM   5438 C CG  . GLN C 1 166 ? -24.566 16.185  -25.408 1.00 86.62  ? 178 GLN C CG  1 
ATOM   5439 C CD  . GLN C 1 166 ? -25.837 15.596  -24.836 1.00 106.88 ? 178 GLN C CD  1 
ATOM   5440 O OE1 . GLN C 1 166 ? -26.182 14.417  -25.029 1.00 101.82 ? 178 GLN C OE1 1 
ATOM   5441 N NE2 . GLN C 1 166 ? -26.587 16.435  -24.145 1.00 100.55 ? 178 GLN C NE2 1 
ATOM   5442 N N   . MET C 1 167 ? -21.536 17.475  -24.680 1.00 55.49  ? 179 MET C N   1 
ATOM   5443 C CA  . MET C 1 167 ? -21.028 18.051  -23.430 1.00 53.03  ? 179 MET C CA  1 
ATOM   5444 C C   . MET C 1 167 ? -21.830 19.297  -23.062 1.00 57.53  ? 179 MET C C   1 
ATOM   5445 O O   . MET C 1 167 ? -21.706 20.342  -23.710 1.00 56.12  ? 179 MET C O   1 
ATOM   5446 C CB  . MET C 1 167 ? -19.519 18.379  -23.472 1.00 52.85  ? 179 MET C CB  1 
ATOM   5447 C CG  . MET C 1 167 ? -18.962 18.751  -22.094 1.00 55.56  ? 179 MET C CG  1 
ATOM   5448 S SD  . MET C 1 167 ? -17.309 19.504  -22.066 1.00 57.78  ? 179 MET C SD  1 
ATOM   5449 C CE  . MET C 1 167 ? -17.658 21.080  -22.802 1.00 55.02  ? 179 MET C CE  1 
ATOM   5450 N N   . THR C 1 168 ? -22.656 19.176  -22.012 1.00 55.79  ? 180 THR C N   1 
ATOM   5451 C CA  . THR C 1 168 ? -23.449 20.285  -21.464 1.00 56.57  ? 180 THR C CA  1 
ATOM   5452 C C   . THR C 1 168 ? -22.556 21.114  -20.503 1.00 59.93  ? 180 THR C C   1 
ATOM   5453 O O   . THR C 1 168 ? -21.493 20.613  -20.115 1.00 58.24  ? 180 THR C O   1 
ATOM   5454 C CB  . THR C 1 168 ? -24.718 19.745  -20.780 1.00 61.71  ? 180 THR C CB  1 
ATOM   5455 O OG1 . THR C 1 168 ? -24.350 18.806  -19.769 1.00 63.93  ? 180 THR C OG1 1 
ATOM   5456 C CG2 . THR C 1 168 ? -25.680 19.105  -21.754 1.00 58.25  ? 180 THR C CG2 1 
ATOM   5457 N N   . PRO C 1 169 ? -22.919 22.377  -20.125 1.00 57.16  ? 181 PRO C N   1 
ATOM   5458 C CA  . PRO C 1 169 ? -22.103 23.114  -19.134 1.00 56.22  ? 181 PRO C CA  1 
ATOM   5459 C C   . PRO C 1 169 ? -21.932 22.376  -17.794 1.00 60.66  ? 181 PRO C C   1 
ATOM   5460 O O   . PRO C 1 169 ? -20.890 22.517  -17.155 1.00 59.68  ? 181 PRO C O   1 
ATOM   5461 C CB  . PRO C 1 169 ? -22.877 24.422  -18.947 1.00 58.90  ? 181 PRO C CB  1 
ATOM   5462 C CG  . PRO C 1 169 ? -23.619 24.598  -20.209 1.00 63.33  ? 181 PRO C CG  1 
ATOM   5463 C CD  . PRO C 1 169 ? -24.035 23.219  -20.607 1.00 59.25  ? 181 PRO C CD  1 
ATOM   5464 N N   . GLU C 1 170 ? -22.943 21.589  -17.382 1.00 57.98  ? 182 GLU C N   1 
ATOM   5465 C CA  . GLU C 1 170 ? -22.906 20.745  -16.186 1.00 57.48  ? 182 GLU C CA  1 
ATOM   5466 C C   . GLU C 1 170 ? -21.926 19.579  -16.381 1.00 58.77  ? 182 GLU C C   1 
ATOM   5467 O O   . GLU C 1 170 ? -21.204 19.239  -15.440 1.00 57.56  ? 182 GLU C O   1 
ATOM   5468 C CB  . GLU C 1 170 ? -24.309 20.231  -15.779 1.00 60.98  ? 182 GLU C CB  1 
ATOM   5469 C CG  . GLU C 1 170 ? -25.398 20.321  -16.846 1.00 75.39  ? 182 GLU C CG  1 
ATOM   5470 C CD  . GLU C 1 170 ? -26.182 21.622  -16.900 1.00 97.98  ? 182 GLU C CD  1 
ATOM   5471 O OE1 . GLU C 1 170 ? -27.153 21.769  -16.123 1.00 105.56 ? 182 GLU C OE1 1 
ATOM   5472 O OE2 . GLU C 1 170 ? -25.849 22.481  -17.748 1.00 80.46  ? 182 GLU C OE2 1 
ATOM   5473 N N   . MET C 1 171 ? -21.886 18.978  -17.592 1.00 54.06  ? 183 MET C N   1 
ATOM   5474 C CA  . MET C 1 171 ? -20.913 17.925  -17.947 1.00 51.46  ? 183 MET C CA  1 
ATOM   5475 C C   . MET C 1 171 ? -19.490 18.468  -17.979 1.00 52.72  ? 183 MET C C   1 
ATOM   5476 O O   . MET C 1 171 ? -18.562 17.742  -17.638 1.00 51.24  ? 183 MET C O   1 
ATOM   5477 C CB  . MET C 1 171 ? -21.242 17.288  -19.299 1.00 53.84  ? 183 MET C CB  1 
ATOM   5478 C CG  . MET C 1 171 ? -22.316 16.240  -19.216 1.00 58.88  ? 183 MET C CG  1 
ATOM   5479 S SD  . MET C 1 171 ? -23.070 15.915  -20.809 1.00 63.87  ? 183 MET C SD  1 
ATOM   5480 C CE  . MET C 1 171 ? -21.995 14.602  -21.401 1.00 59.02  ? 183 MET C CE  1 
ATOM   5481 N N   . TRP C 1 172 ? -19.312 19.732  -18.405 1.00 49.46  ? 184 TRP C N   1 
ATOM   5482 C CA  . TRP C 1 172 ? -18.022 20.424  -18.389 1.00 47.82  ? 184 TRP C CA  1 
ATOM   5483 C C   . TRP C 1 172 ? -17.521 20.566  -16.957 1.00 51.73  ? 184 TRP C C   1 
ATOM   5484 O O   . TRP C 1 172 ? -16.358 20.303  -16.714 1.00 51.11  ? 184 TRP C O   1 
ATOM   5485 C CB  . TRP C 1 172 ? -18.126 21.787  -19.093 1.00 46.98  ? 184 TRP C CB  1 
ATOM   5486 C CG  . TRP C 1 172 ? -17.085 22.818  -18.729 1.00 47.02  ? 184 TRP C CG  1 
ATOM   5487 C CD1 . TRP C 1 172 ? -17.260 23.894  -17.907 1.00 50.50  ? 184 TRP C CD1 1 
ATOM   5488 C CD2 . TRP C 1 172 ? -15.736 22.904  -19.222 1.00 45.15  ? 184 TRP C CD2 1 
ATOM   5489 N NE1 . TRP C 1 172 ? -16.100 24.632  -17.838 1.00 48.92  ? 184 TRP C NE1 1 
ATOM   5490 C CE2 . TRP C 1 172 ? -15.150 24.051  -18.641 1.00 48.93  ? 184 TRP C CE2 1 
ATOM   5491 C CE3 . TRP C 1 172 ? -14.970 22.131  -20.114 1.00 44.80  ? 184 TRP C CE3 1 
ATOM   5492 C CZ2 . TRP C 1 172 ? -13.838 24.446  -18.926 1.00 46.95  ? 184 TRP C CZ2 1 
ATOM   5493 C CZ3 . TRP C 1 172 ? -13.668 22.519  -20.385 1.00 44.92  ? 184 TRP C CZ3 1 
ATOM   5494 C CH2 . TRP C 1 172 ? -13.108 23.650  -19.779 1.00 45.47  ? 184 TRP C CH2 1 
ATOM   5495 N N   . GLU C 1 173 ? -18.403 20.933  -16.011 1.00 49.90  ? 185 GLU C N   1 
ATOM   5496 C CA  . GLU C 1 173 ? -18.084 21.077  -14.586 1.00 49.65  ? 185 GLU C CA  1 
ATOM   5497 C C   . GLU C 1 173 ? -17.689 19.734  -13.959 1.00 53.16  ? 185 GLU C C   1 
ATOM   5498 O O   . GLU C 1 173 ? -16.719 19.687  -13.204 1.00 52.61  ? 185 GLU C O   1 
ATOM   5499 C CB  . GLU C 1 173 ? -19.273 21.694  -13.835 1.00 53.04  ? 185 GLU C CB  1 
ATOM   5500 C CG  . GLU C 1 173 ? -18.897 22.902  -13.000 1.00 65.42  ? 185 GLU C CG  1 
ATOM   5501 C CD  . GLU C 1 173 ? -18.229 24.044  -13.743 1.00 84.79  ? 185 GLU C CD  1 
ATOM   5502 O OE1 . GLU C 1 173 ? -17.056 24.345  -13.427 1.00 83.43  ? 185 GLU C OE1 1 
ATOM   5503 O OE2 . GLU C 1 173 ? -18.867 24.626  -14.649 1.00 77.64  ? 185 GLU C OE2 1 
ATOM   5504 N N   . GLU C 1 174 ? -18.427 18.649  -14.288 1.00 49.36  ? 186 GLU C N   1 
ATOM   5505 C CA  . GLU C 1 174 ? -18.150 17.280  -13.835 1.00 48.35  ? 186 GLU C CA  1 
ATOM   5506 C C   . GLU C 1 174 ? -16.825 16.775  -14.374 1.00 51.00  ? 186 GLU C C   1 
ATOM   5507 O O   . GLU C 1 174 ? -16.110 16.091  -13.646 1.00 49.80  ? 186 GLU C O   1 
ATOM   5508 C CB  . GLU C 1 174 ? -19.269 16.316  -14.252 1.00 50.76  ? 186 GLU C CB  1 
ATOM   5509 C CG  . GLU C 1 174 ? -20.559 16.490  -13.464 1.00 63.05  ? 186 GLU C CG  1 
ATOM   5510 C CD  . GLU C 1 174 ? -21.839 16.067  -14.165 1.00 79.35  ? 186 GLU C CD  1 
ATOM   5511 O OE1 . GLU C 1 174 ? -22.876 16.731  -13.941 1.00 72.02  ? 186 GLU C OE1 1 
ATOM   5512 O OE2 . GLU C 1 174 ? -21.814 15.075  -14.929 1.00 70.52  ? 186 GLU C OE2 1 
ATOM   5513 N N   . ARG C 1 175 ? -16.488 17.106  -15.640 1.00 47.77  ? 187 ARG C N   1 
ATOM   5514 C CA  . ARG C 1 175 ? -15.250 16.655  -16.293 1.00 45.56  ? 187 ARG C CA  1 
ATOM   5515 C C   . ARG C 1 175 ? -14.015 17.400  -15.763 1.00 48.15  ? 187 ARG C C   1 
ATOM   5516 O O   . ARG C 1 175 ? -12.942 16.802  -15.717 1.00 46.35  ? 187 ARG C O   1 
ATOM   5517 C CB  . ARG C 1 175 ? -15.359 16.776  -17.811 1.00 43.63  ? 187 ARG C CB  1 
ATOM   5518 C CG  . ARG C 1 175 ? -16.072 15.572  -18.436 1.00 47.22  ? 187 ARG C CG  1 
ATOM   5519 C CD  . ARG C 1 175 ? -16.640 15.852  -19.818 1.00 55.41  ? 187 ARG C CD  1 
ATOM   5520 N NE  . ARG C 1 175 ? -15.610 15.967  -20.860 1.00 65.94  ? 187 ARG C NE  1 
ATOM   5521 C CZ  . ARG C 1 175 ? -15.273 15.013  -21.727 1.00 87.29  ? 187 ARG C CZ  1 
ATOM   5522 N NH1 . ARG C 1 175 ? -15.871 13.826  -21.690 1.00 89.80  ? 187 ARG C NH1 1 
ATOM   5523 N NH2 . ARG C 1 175 ? -14.323 15.233  -22.626 1.00 64.02  ? 187 ARG C NH2 1 
ATOM   5524 N N   . ILE C 1 176 ? -14.168 18.685  -15.360 1.00 45.93  ? 188 ILE C N   1 
ATOM   5525 C CA  . ILE C 1 176 ? -13.175 19.456  -14.598 1.00 45.80  ? 188 ILE C CA  1 
ATOM   5526 C C   . ILE C 1 176 ? -12.848 18.737  -13.279 1.00 50.80  ? 188 ILE C C   1 
ATOM   5527 O O   . ILE C 1 176 ? -11.684 18.430  -13.048 1.00 50.32  ? 188 ILE C O   1 
ATOM   5528 C CB  . ILE C 1 176 ? -13.652 20.925  -14.322 1.00 50.48  ? 188 ILE C CB  1 
ATOM   5529 C CG1 . ILE C 1 176 ? -13.775 21.815  -15.577 1.00 50.67  ? 188 ILE C CG1 1 
ATOM   5530 C CG2 . ILE C 1 176 ? -12.824 21.629  -13.231 1.00 52.64  ? 188 ILE C CG2 1 
ATOM   5531 C CD1 . ILE C 1 176 ? -12.963 21.504  -16.874 1.00 57.91  ? 188 ILE C CD1 1 
ATOM   5532 N N   . THR C 1 177 ? -13.871 18.462  -12.434 1.00 48.84  ? 189 THR C N   1 
ATOM   5533 C CA  . THR C 1 177 ? -13.689 17.913  -11.084 1.00 48.74  ? 189 THR C CA  1 
ATOM   5534 C C   . THR C 1 177 ? -13.088 16.504  -11.147 1.00 50.62  ? 189 THR C C   1 
ATOM   5535 O O   . THR C 1 177 ? -12.212 16.190  -10.343 1.00 50.30  ? 189 THR C O   1 
ATOM   5536 C CB  . THR C 1 177 ? -14.999 17.918  -10.295 1.00 57.81  ? 189 THR C CB  1 
ATOM   5537 O OG1 . THR C 1 177 ? -15.902 17.052  -10.951 1.00 68.81  ? 189 THR C OG1 1 
ATOM   5538 C CG2 . THR C 1 177 ? -15.604 19.307  -10.155 1.00 50.86  ? 189 THR C CG2 1 
ATOM   5539 N N   . ALA C 1 178 ? -13.543 15.671  -12.105 1.00 45.43  ? 190 ALA C N   1 
ATOM   5540 C CA  . ALA C 1 178 ? -13.069 14.303  -12.312 1.00 43.80  ? 190 ALA C CA  1 
ATOM   5541 C C   . ALA C 1 178 ? -11.604 14.267  -12.733 1.00 46.98  ? 190 ALA C C   1 
ATOM   5542 O O   . ALA C 1 178 ? -10.902 13.340  -12.338 1.00 46.94  ? 190 ALA C O   1 
ATOM   5543 C CB  . ALA C 1 178 ? -13.911 13.606  -13.358 1.00 44.87  ? 190 ALA C CB  1 
ATOM   5544 N N   . TRP C 1 179 ? -11.129 15.265  -13.515 1.00 41.91  ? 191 TRP C N   1 
ATOM   5545 C CA  . TRP C 1 179 ? -9.772  15.282  -14.057 1.00 39.09  ? 191 TRP C CA  1 
ATOM   5546 C C   . TRP C 1 179 ? -8.732  15.423  -12.937 1.00 41.58  ? 191 TRP C C   1 
ATOM   5547 O O   . TRP C 1 179 ? -7.699  14.762  -13.007 1.00 40.61  ? 191 TRP C O   1 
ATOM   5548 C CB  . TRP C 1 179 ? -9.605  16.393  -15.106 1.00 37.15  ? 191 TRP C CB  1 
ATOM   5549 C CG  . TRP C 1 179 ? -8.387  16.239  -15.978 1.00 36.78  ? 191 TRP C CG  1 
ATOM   5550 C CD1 . TRP C 1 179 ? -8.319  15.622  -17.192 1.00 39.19  ? 191 TRP C CD1 1 
ATOM   5551 C CD2 . TRP C 1 179 ? -7.050  16.689  -15.681 1.00 35.74  ? 191 TRP C CD2 1 
ATOM   5552 N NE1 . TRP C 1 179 ? -7.024  15.642  -17.665 1.00 37.61  ? 191 TRP C NE1 1 
ATOM   5553 C CE2 . TRP C 1 179 ? -6.227  16.300  -16.764 1.00 38.84  ? 191 TRP C CE2 1 
ATOM   5554 C CE3 . TRP C 1 179 ? -6.468  17.377  -14.600 1.00 36.37  ? 191 TRP C CE3 1 
ATOM   5555 C CZ2 . TRP C 1 179 ? -4.853  16.575  -16.798 1.00 37.31  ? 191 TRP C CZ2 1 
ATOM   5556 C CZ3 . TRP C 1 179 ? -5.110  17.649  -14.635 1.00 37.13  ? 191 TRP C CZ3 1 
ATOM   5557 C CH2 . TRP C 1 179 ? -4.315  17.243  -15.719 1.00 37.11  ? 191 TRP C CH2 1 
ATOM   5558 N N   . TYR C 1 180 ? -8.999  16.261  -11.904 1.00 37.78  ? 192 TYR C N   1 
ATOM   5559 C CA  . TYR C 1 180 ? -8.077  16.497  -10.784 1.00 35.98  ? 192 TYR C CA  1 
ATOM   5560 C C   . TYR C 1 180 ? -7.702  15.190  -10.068 1.00 42.38  ? 192 TYR C C   1 
ATOM   5561 O O   . TYR C 1 180 ? -6.516  14.929  -9.856  1.00 42.39  ? 192 TYR C O   1 
ATOM   5562 C CB  . TYR C 1 180 ? -8.662  17.487  -9.763  1.00 36.40  ? 192 TYR C CB  1 
ATOM   5563 C CG  . TYR C 1 180 ? -8.772  18.915  -10.247 1.00 37.11  ? 192 TYR C CG  1 
ATOM   5564 C CD1 . TYR C 1 180 ? -7.636  19.670  -10.524 1.00 38.82  ? 192 TYR C CD1 1 
ATOM   5565 C CD2 . TYR C 1 180 ? -10.009 19.544  -10.344 1.00 38.07  ? 192 TYR C CD2 1 
ATOM   5566 C CE1 . TYR C 1 180 ? -7.735  21.002  -10.931 1.00 39.51  ? 192 TYR C CE1 1 
ATOM   5567 C CE2 . TYR C 1 180 ? -10.121 20.865  -10.765 1.00 38.28  ? 192 TYR C CE2 1 
ATOM   5568 C CZ  . TYR C 1 180 ? -8.984  21.591  -11.061 1.00 44.26  ? 192 TYR C CZ  1 
ATOM   5569 O OH  . TYR C 1 180 ? -9.107  22.887  -11.501 1.00 46.24  ? 192 TYR C OH  1 
ATOM   5570 N N   . ALA C 1 181 ? -8.706  14.369  -9.706  1.00 40.38  ? 193 ALA C N   1 
ATOM   5571 C CA  . ALA C 1 181 ? -8.509  13.109  -8.980  1.00 40.14  ? 193 ALA C CA  1 
ATOM   5572 C C   . ALA C 1 181 ? -7.875  12.057  -9.864  1.00 41.20  ? 193 ALA C C   1 
ATOM   5573 O O   . ALA C 1 181 ? -7.134  11.227  -9.360  1.00 40.95  ? 193 ALA C O   1 
ATOM   5574 C CB  . ALA C 1 181 ? -9.836  12.597  -8.435  1.00 42.28  ? 193 ALA C CB  1 
ATOM   5575 N N   . GLU C 1 182 ? -8.171  12.082  -11.169 1.00 36.28  ? 194 GLU C N   1 
ATOM   5576 C CA  . GLU C 1 182 ? -7.672  11.099  -12.134 1.00 35.31  ? 194 GLU C CA  1 
ATOM   5577 C C   . GLU C 1 182 ? -6.224  11.361  -12.556 1.00 37.86  ? 194 GLU C C   1 
ATOM   5578 O O   . GLU C 1 182 ? -5.597  10.443  -13.080 1.00 37.13  ? 194 GLU C O   1 
ATOM   5579 C CB  . GLU C 1 182 ? -8.570  11.060  -13.382 1.00 36.94  ? 194 GLU C CB  1 
ATOM   5580 C CG  . GLU C 1 182 ? -9.747  10.107  -13.252 1.00 44.38  ? 194 GLU C CG  1 
ATOM   5581 C CD  . GLU C 1 182 ? -11.035 10.557  -13.918 1.00 70.68  ? 194 GLU C CD  1 
ATOM   5582 O OE1 . GLU C 1 182 ? -11.003 11.472  -14.773 1.00 80.54  ? 194 GLU C OE1 1 
ATOM   5583 O OE2 . GLU C 1 182 ? -12.088 9.975   -13.584 1.00 63.92  ? 194 GLU C OE2 1 
ATOM   5584 N N   . HIS C 1 183 ? -5.691  12.588  -12.325 1.00 33.39  ? 195 HIS C N   1 
ATOM   5585 C CA  . HIS C 1 183 ? -4.363  12.996  -12.815 1.00 31.80  ? 195 HIS C CA  1 
ATOM   5586 C C   . HIS C 1 183 ? -3.552  13.695  -11.726 1.00 35.16  ? 195 HIS C C   1 
ATOM   5587 O O   . HIS C 1 183 ? -3.478  14.927  -11.649 1.00 33.01  ? 195 HIS C O   1 
ATOM   5588 C CB  . HIS C 1 183 ? -4.483  13.881  -14.060 1.00 32.34  ? 195 HIS C CB  1 
ATOM   5589 C CG  . HIS C 1 183 ? -5.259  13.233  -15.166 1.00 35.89  ? 195 HIS C CG  1 
ATOM   5590 N ND1 . HIS C 1 183 ? -4.642  12.420  -16.101 1.00 36.76  ? 195 HIS C ND1 1 
ATOM   5591 C CD2 . HIS C 1 183 ? -6.586  13.264  -15.422 1.00 38.44  ? 195 HIS C CD2 1 
ATOM   5592 C CE1 . HIS C 1 183 ? -5.607  11.995  -16.900 1.00 36.91  ? 195 HIS C CE1 1 
ATOM   5593 N NE2 . HIS C 1 183 ? -6.794  12.488  -16.536 1.00 38.26  ? 195 HIS C NE2 1 
ATOM   5594 N N   . ARG C 1 184 ? -2.884  12.874  -10.928 1.00 32.79  ? 196 ARG C N   1 
ATOM   5595 C CA  . ARG C 1 184 ? -2.209  13.296  -9.717  1.00 32.60  ? 196 ARG C CA  1 
ATOM   5596 C C   . ARG C 1 184 ? -0.702  13.106  -9.811  1.00 37.88  ? 196 ARG C C   1 
ATOM   5597 O O   . ARG C 1 184 ? 0.021   13.568  -8.927  1.00 39.58  ? 196 ARG C O   1 
ATOM   5598 C CB  . ARG C 1 184 ? -2.768  12.485  -8.556  1.00 33.18  ? 196 ARG C CB  1 
ATOM   5599 C CG  . ARG C 1 184 ? -4.283  12.553  -8.453  1.00 39.79  ? 196 ARG C CG  1 
ATOM   5600 C CD  . ARG C 1 184 ? -4.803  11.644  -7.374  1.00 42.91  ? 196 ARG C CD  1 
ATOM   5601 N NE  . ARG C 1 184 ? -4.790  10.232  -7.755  1.00 40.89  ? 196 ARG C NE  1 
ATOM   5602 C CZ  . ARG C 1 184 ? -3.891  9.364   -7.313  1.00 50.01  ? 196 ARG C CZ  1 
ATOM   5603 N NH1 . ARG C 1 184 ? -3.958  8.090   -7.675  1.00 39.98  ? 196 ARG C NH1 1 
ATOM   5604 N NH2 . ARG C 1 184 ? -2.927  9.758   -6.495  1.00 33.14  ? 196 ARG C NH2 1 
ATOM   5605 N N   . GLY C 1 185 ? -0.236  12.455  -10.880 1.00 33.21  ? 197 GLY C N   1 
ATOM   5606 C CA  . GLY C 1 185 ? 1.165   12.084  -11.018 1.00 32.19  ? 197 GLY C CA  1 
ATOM   5607 C C   . GLY C 1 185 ? 1.493   10.778  -10.319 1.00 35.98  ? 197 GLY C C   1 
ATOM   5608 O O   . GLY C 1 185 ? 0.774   10.362  -9.408  1.00 37.29  ? 197 GLY C O   1 
ATOM   5609 N N   . ARG C 1 186 ? 2.560   10.105  -10.754 1.00 30.65  ? 198 ARG C N   1 
ATOM   5610 C CA  . ARG C 1 186 ? 3.060   8.919   -10.067 1.00 29.61  ? 198 ARG C CA  1 
ATOM   5611 C C   . ARG C 1 186 ? 3.788   9.345   -8.780  1.00 32.84  ? 198 ARG C C   1 
ATOM   5612 O O   . ARG C 1 186 ? 4.602   10.260  -8.814  1.00 32.17  ? 198 ARG C O   1 
ATOM   5613 C CB  . ARG C 1 186 ? 3.980   8.122   -10.995 1.00 26.91  ? 198 ARG C CB  1 
ATOM   5614 C CG  . ARG C 1 186 ? 3.936   6.621   -10.757 1.00 27.75  ? 198 ARG C CG  1 
ATOM   5615 C CD  . ARG C 1 186 ? 4.891   5.844   -11.669 1.00 20.49  ? 198 ARG C CD  1 
ATOM   5616 N NE  . ARG C 1 186 ? 6.174   6.526   -11.894 1.00 30.28  ? 198 ARG C NE  1 
ATOM   5617 C CZ  . ARG C 1 186 ? 7.215   6.471   -11.068 1.00 38.17  ? 198 ARG C CZ  1 
ATOM   5618 N NH1 . ARG C 1 186 ? 7.148   5.760   -9.952  1.00 28.65  ? 198 ARG C NH1 1 
ATOM   5619 N NH2 . ARG C 1 186 ? 8.321   7.148   -11.340 1.00 19.13  ? 198 ARG C NH2 1 
ATOM   5620 N N   . ALA C 1 187 ? 3.469   8.712   -7.648  1.00 29.17  ? 199 ALA C N   1 
ATOM   5621 C CA  . ALA C 1 187 ? 4.243   8.891   -6.426  1.00 28.41  ? 199 ALA C CA  1 
ATOM   5622 C C   . ALA C 1 187 ? 5.618   8.202   -6.585  1.00 33.76  ? 199 ALA C C   1 
ATOM   5623 O O   . ALA C 1 187 ? 5.753   7.291   -7.401  1.00 32.99  ? 199 ALA C O   1 
ATOM   5624 C CB  . ALA C 1 187 ? 3.481   8.305   -5.246  1.00 29.39  ? 199 ALA C CB  1 
ATOM   5625 N N   . ARG C 1 188 ? 6.644   8.657   -5.844  1.00 30.62  ? 200 ARG C N   1 
ATOM   5626 C CA  . ARG C 1 188 ? 7.897   7.917   -5.747  1.00 30.10  ? 200 ARG C CA  1 
ATOM   5627 C C   . ARG C 1 188 ? 7.589   6.522   -5.169  1.00 35.08  ? 200 ARG C C   1 
ATOM   5628 O O   . ARG C 1 188 ? 6.932   6.408   -4.137  1.00 35.92  ? 200 ARG C O   1 
ATOM   5629 C CB  . ARG C 1 188 ? 8.899   8.706   -4.889  1.00 29.11  ? 200 ARG C CB  1 
ATOM   5630 C CG  . ARG C 1 188 ? 10.102  7.924   -4.412  1.00 30.17  ? 200 ARG C CG  1 
ATOM   5631 C CD  . ARG C 1 188 ? 11.349  8.773   -4.472  1.00 40.37  ? 200 ARG C CD  1 
ATOM   5632 N NE  . ARG C 1 188 ? 12.563  7.954   -4.434  1.00 43.23  ? 200 ARG C NE  1 
ATOM   5633 C CZ  . ARG C 1 188 ? 13.778  8.406   -4.717  1.00 52.28  ? 200 ARG C CZ  1 
ATOM   5634 N NH1 . ARG C 1 188 ? 13.953  9.670   -5.081  1.00 42.26  ? 200 ARG C NH1 1 
ATOM   5635 N NH2 . ARG C 1 188 ? 14.828  7.596   -4.644  1.00 36.94  ? 200 ARG C NH2 1 
ATOM   5636 N N   . ASP C 1 189 ? 8.043   5.471   -5.847  1.00 30.29  ? 201 ASP C N   1 
ATOM   5637 C CA  . ASP C 1 189 ? 7.728   4.099   -5.473  1.00 29.16  ? 201 ASP C CA  1 
ATOM   5638 C C   . ASP C 1 189 ? 8.594   3.655   -4.267  1.00 35.02  ? 201 ASP C C   1 
ATOM   5639 O O   . ASP C 1 189 ? 9.553   2.899   -4.405  1.00 36.00  ? 201 ASP C O   1 
ATOM   5640 C CB  . ASP C 1 189 ? 7.917   3.204   -6.700  1.00 29.49  ? 201 ASP C CB  1 
ATOM   5641 C CG  . ASP C 1 189 ? 7.030   1.987   -6.732  1.00 34.25  ? 201 ASP C CG  1 
ATOM   5642 O OD1 . ASP C 1 189 ? 6.179   1.840   -5.818  1.00 32.91  ? 201 ASP C OD1 1 
ATOM   5643 O OD2 . ASP C 1 189 ? 7.176   1.183   -7.667  1.00 41.22  ? 201 ASP C OD2 1 
ATOM   5644 N N   . GLU C 1 190 ? 8.235   4.148   -3.075  1.00 31.39  ? 202 GLU C N   1 
ATOM   5645 C CA  . GLU C 1 190 ? 8.935   3.937   -1.814  1.00 30.93  ? 202 GLU C CA  1 
ATOM   5646 C C   . GLU C 1 190 ? 9.039   2.433   -1.443  1.00 34.79  ? 202 GLU C C   1 
ATOM   5647 O O   . GLU C 1 190 ? 10.058  2.009   -0.879  1.00 33.27  ? 202 GLU C O   1 
ATOM   5648 C CB  . GLU C 1 190 ? 8.196   4.723   -0.734  1.00 33.05  ? 202 GLU C CB  1 
ATOM   5649 C CG  . GLU C 1 190 ? 8.673   4.539   0.700   1.00 46.83  ? 202 GLU C CG  1 
ATOM   5650 C CD  . GLU C 1 190 ? 7.869   5.335   1.714   1.00 70.44  ? 202 GLU C CD  1 
ATOM   5651 O OE1 . GLU C 1 190 ? 8.498   6.009   2.560   1.00 62.14  ? 202 GLU C OE1 1 
ATOM   5652 O OE2 . GLU C 1 190 ? 6.618   5.317   1.643   1.00 67.99  ? 202 GLU C OE2 1 
ATOM   5653 N N   . ALA C 1 191 ? 7.988   1.640   -1.761  1.00 31.94  ? 203 ALA C N   1 
ATOM   5654 C CA  . ALA C 1 191 ? 7.933   0.190   -1.546  1.00 31.81  ? 203 ALA C CA  1 
ATOM   5655 C C   . ALA C 1 191 ? 9.187   -0.547  -2.077  1.00 35.44  ? 203 ALA C C   1 
ATOM   5656 O O   . ALA C 1 191 ? 9.583   -1.553  -1.492  1.00 36.30  ? 203 ALA C O   1 
ATOM   5657 C CB  . ALA C 1 191 ? 6.692   -0.379  -2.198  1.00 32.68  ? 203 ALA C CB  1 
ATOM   5658 N N   . GLU C 1 192 ? 9.794   -0.046  -3.175  1.00 30.06  ? 204 GLU C N   1 
ATOM   5659 C CA  . GLU C 1 192 ? 11.040  -0.561  -3.769  1.00 28.76  ? 204 GLU C CA  1 
ATOM   5660 C C   . GLU C 1 192 ? 12.232  -0.335  -2.853  1.00 33.81  ? 204 GLU C C   1 
ATOM   5661 O O   . GLU C 1 192 ? 13.080  -1.211  -2.748  1.00 34.70  ? 204 GLU C O   1 
ATOM   5662 C CB  . GLU C 1 192 ? 11.327  0.124   -5.118  1.00 29.00  ? 204 GLU C CB  1 
ATOM   5663 C CG  . GLU C 1 192 ? 10.295  -0.114  -6.202  1.00 32.56  ? 204 GLU C CG  1 
ATOM   5664 C CD  . GLU C 1 192 ? 10.599  0.591   -7.507  1.00 47.06  ? 204 GLU C CD  1 
ATOM   5665 O OE1 . GLU C 1 192 ? 11.203  1.687   -7.467  1.00 37.17  ? 204 GLU C OE1 1 
ATOM   5666 O OE2 . GLU C 1 192 ? 10.182  0.077   -8.569  1.00 43.66  ? 204 GLU C OE2 1 
ATOM   5667 N N   . MET C 1 193 ? 12.326  0.859   -2.228  1.00 30.34  ? 205 MET C N   1 
ATOM   5668 C CA  . MET C 1 193 ? 13.369  1.159   -1.254  1.00 29.96  ? 205 MET C CA  1 
ATOM   5669 C C   . MET C 1 193 ? 13.238  0.254   -0.025  1.00 34.68  ? 205 MET C C   1 
ATOM   5670 O O   . MET C 1 193 ? 14.245  -0.251  0.466   1.00 35.53  ? 205 MET C O   1 
ATOM   5671 C CB  . MET C 1 193 ? 13.356  2.639   -0.842  1.00 32.14  ? 205 MET C CB  1 
ATOM   5672 C CG  . MET C 1 193 ? 14.618  3.071   -0.083  1.00 35.77  ? 205 MET C CG  1 
ATOM   5673 S SD  . MET C 1 193 ? 16.173  2.482   -0.803  1.00 39.68  ? 205 MET C SD  1 
ATOM   5674 C CE  . MET C 1 193 ? 16.329  3.623   -2.208  1.00 35.77  ? 205 MET C CE  1 
ATOM   5675 N N   . GLU C 1 194 ? 12.008  0.034   0.454   1.00 30.32  ? 206 GLU C N   1 
ATOM   5676 C CA  . GLU C 1 194 ? 11.707  -0.864  1.568   1.00 30.22  ? 206 GLU C CA  1 
ATOM   5677 C C   . GLU C 1 194 ? 12.125  -2.278  1.232   1.00 33.79  ? 206 GLU C C   1 
ATOM   5678 O O   . GLU C 1 194 ? 12.661  -2.955  2.101   1.00 34.68  ? 206 GLU C O   1 
ATOM   5679 C CB  . GLU C 1 194 ? 10.210  -0.808  1.926   1.00 32.11  ? 206 GLU C CB  1 
ATOM   5680 C CG  . GLU C 1 194 ? 9.764   0.511   2.545   1.00 39.49  ? 206 GLU C CG  1 
ATOM   5681 C CD  . GLU C 1 194 ? 10.574  0.999   3.736   1.00 60.68  ? 206 GLU C CD  1 
ATOM   5682 O OE1 . GLU C 1 194 ? 10.627  0.283   4.764   1.00 57.95  ? 206 GLU C OE1 1 
ATOM   5683 O OE2 . GLU C 1 194 ? 11.176  2.093   3.629   1.00 49.09  ? 206 GLU C OE2 1 
ATOM   5684 N N   . TYR C 1 195 ? 11.906  -2.716  -0.029  1.00 29.46  ? 207 TYR C N   1 
ATOM   5685 C CA  . TYR C 1 195 ? 12.358  -3.994  -0.583  1.00 28.47  ? 207 TYR C CA  1 
ATOM   5686 C C   . TYR C 1 195 ? 13.896  -4.094  -0.517  1.00 35.05  ? 207 TYR C C   1 
ATOM   5687 O O   . TYR C 1 195 ? 14.425  -5.066  0.032   1.00 36.99  ? 207 TYR C O   1 
ATOM   5688 C CB  . TYR C 1 195 ? 11.860  -4.153  -2.026  1.00 28.92  ? 207 TYR C CB  1 
ATOM   5689 C CG  . TYR C 1 195 ? 12.031  -5.548  -2.588  1.00 32.19  ? 207 TYR C CG  1 
ATOM   5690 C CD1 . TYR C 1 195 ? 13.264  -5.978  -3.085  1.00 33.41  ? 207 TYR C CD1 1 
ATOM   5691 C CD2 . TYR C 1 195 ? 10.948  -6.422  -2.678  1.00 33.65  ? 207 TYR C CD2 1 
ATOM   5692 C CE1 . TYR C 1 195 ? 13.429  -7.265  -3.591  1.00 33.39  ? 207 TYR C CE1 1 
ATOM   5693 C CE2 . TYR C 1 195 ? 11.100  -7.709  -3.192  1.00 34.69  ? 207 TYR C CE2 1 
ATOM   5694 C CZ  . TYR C 1 195 ? 12.344  -8.129  -3.639  1.00 38.72  ? 207 TYR C CZ  1 
ATOM   5695 O OH  . TYR C 1 195 ? 12.486  -9.395  -4.153  1.00 36.61  ? 207 TYR C OH  1 
ATOM   5696 N N   . LEU C 1 196 ? 14.610  -3.076  -1.037  1.00 30.40  ? 208 LEU C N   1 
ATOM   5697 C CA  . LEU C 1 196 ? 16.080  -3.089  -1.100  1.00 29.05  ? 208 LEU C CA  1 
ATOM   5698 C C   . LEU C 1 196 ? 16.726  -3.064  0.299   1.00 33.17  ? 208 LEU C C   1 
ATOM   5699 O O   . LEU C 1 196 ? 17.772  -3.674  0.488   1.00 32.78  ? 208 LEU C O   1 
ATOM   5700 C CB  . LEU C 1 196 ? 16.622  -1.931  -1.959  1.00 27.50  ? 208 LEU C CB  1 
ATOM   5701 C CG  . LEU C 1 196 ? 16.318  -2.012  -3.471  1.00 30.11  ? 208 LEU C CG  1 
ATOM   5702 C CD1 . LEU C 1 196 ? 16.546  -0.670  -4.154  1.00 28.42  ? 208 LEU C CD1 1 
ATOM   5703 C CD2 . LEU C 1 196 ? 17.135  -3.092  -4.144  1.00 31.75  ? 208 LEU C CD2 1 
ATOM   5704 N N   . LYS C 1 197 ? 16.092  -2.397  1.273   1.00 29.63  ? 209 LYS C N   1 
ATOM   5705 C CA  . LYS C 1 197 ? 16.574  -2.296  2.653   1.00 29.40  ? 209 LYS C CA  1 
ATOM   5706 C C   . LYS C 1 197 ? 16.527  -3.646  3.366   1.00 35.63  ? 209 LYS C C   1 
ATOM   5707 O O   . LYS C 1 197 ? 17.420  -3.931  4.167   1.00 34.88  ? 209 LYS C O   1 
ATOM   5708 C CB  . LYS C 1 197 ? 15.761  -1.270  3.429   1.00 31.31  ? 209 LYS C CB  1 
ATOM   5709 C CG  . LYS C 1 197 ? 16.242  0.154   3.188   1.00 32.33  ? 209 LYS C CG  1 
ATOM   5710 C CD  . LYS C 1 197 ? 15.123  1.163   3.378   1.00 38.42  ? 209 LYS C CD  1 
ATOM   5711 C CE  . LYS C 1 197 ? 14.835  1.532   4.798   1.00 37.66  ? 209 LYS C CE  1 
ATOM   5712 N NZ  . LYS C 1 197 ? 13.720  2.513   4.859   1.00 49.06  ? 209 LYS C NZ  1 
ATOM   5713 N N   . ILE C 1 198 ? 15.501  -4.483  3.074   1.00 34.87  ? 210 ILE C N   1 
ATOM   5714 C CA  . ILE C 1 198 ? 15.422  -5.872  3.558   1.00 35.61  ? 210 ILE C CA  1 
ATOM   5715 C C   . ILE C 1 198 ? 16.490  -6.693  2.833   1.00 41.81  ? 210 ILE C C   1 
ATOM   5716 O O   . ILE C 1 198 ? 17.278  -7.371  3.493   1.00 43.04  ? 210 ILE C O   1 
ATOM   5717 C CB  . ILE C 1 198 ? 13.993  -6.492  3.393   1.00 38.14  ? 210 ILE C CB  1 
ATOM   5718 C CG1 . ILE C 1 198 ? 12.953  -5.741  4.251   1.00 37.38  ? 210 ILE C CG1 1 
ATOM   5719 C CG2 . ILE C 1 198 ? 13.983  -8.008  3.707   1.00 39.72  ? 210 ILE C CG2 1 
ATOM   5720 C CD1 . ILE C 1 198 ? 11.479  -6.001  3.888   1.00 33.05  ? 210 ILE C CD1 1 
ATOM   5721 N N   . ALA C 1 199 ? 16.528  -6.609  1.483   1.00 38.05  ? 211 ALA C N   1 
ATOM   5722 C CA  . ALA C 1 199 ? 17.429  -7.398  0.638   1.00 36.82  ? 211 ALA C CA  1 
ATOM   5723 C C   . ALA C 1 199 ? 18.902  -7.153  0.976   1.00 39.88  ? 211 ALA C C   1 
ATOM   5724 O O   . ALA C 1 199 ? 19.647  -8.117  1.054   1.00 39.91  ? 211 ALA C O   1 
ATOM   5725 C CB  . ALA C 1 199 ? 17.170  -7.101  -0.828  1.00 36.77  ? 211 ALA C CB  1 
ATOM   5726 N N   . GLN C 1 200 ? 19.315  -5.895  1.247   1.00 36.35  ? 212 GLN C N   1 
ATOM   5727 C CA  . GLN C 1 200 ? 20.729  -5.557  1.479   1.00 36.71  ? 212 GLN C CA  1 
ATOM   5728 C C   . GLN C 1 200 ? 21.275  -6.159  2.797   1.00 42.02  ? 212 GLN C C   1 
ATOM   5729 O O   . GLN C 1 200 ? 22.491  -6.250  2.955   1.00 44.29  ? 212 GLN C O   1 
ATOM   5730 C CB  . GLN C 1 200 ? 20.978  -4.034  1.427   1.00 37.10  ? 212 GLN C CB  1 
ATOM   5731 C CG  . GLN C 1 200 ? 20.490  -3.261  2.629   1.00 33.83  ? 212 GLN C CG  1 
ATOM   5732 C CD  . GLN C 1 200 ? 20.701  -1.769  2.473   1.00 45.20  ? 212 GLN C CD  1 
ATOM   5733 O OE1 . GLN C 1 200 ? 21.326  -1.258  1.522   1.00 40.92  ? 212 GLN C OE1 1 
ATOM   5734 N NE2 . GLN C 1 200 ? 20.166  -1.038  3.426   1.00 32.06  ? 212 GLN C NE2 1 
ATOM   5735 N N   . ASP C 1 201 ? 20.387  -6.581  3.721   1.00 36.44  ? 213 ASP C N   1 
ATOM   5736 C CA  . ASP C 1 201 ? 20.746  -7.250  4.980   1.00 36.82  ? 213 ASP C CA  1 
ATOM   5737 C C   . ASP C 1 201 ? 20.914  -8.780  4.811   1.00 44.09  ? 213 ASP C C   1 
ATOM   5738 O O   . ASP C 1 201 ? 21.176  -9.495  5.796   1.00 45.56  ? 213 ASP C O   1 
ATOM   5739 C CB  . ASP C 1 201 ? 19.684  -6.981  6.054   1.00 39.00  ? 213 ASP C CB  1 
ATOM   5740 C CG  . ASP C 1 201 ? 19.668  -5.568  6.633   1.00 53.18  ? 213 ASP C CG  1 
ATOM   5741 O OD1 . ASP C 1 201 ? 20.631  -4.782  6.355   1.00 53.70  ? 213 ASP C OD1 1 
ATOM   5742 O OD2 . ASP C 1 201 ? 18.717  -5.251  7.381   1.00 57.56  ? 213 ASP C OD2 1 
ATOM   5743 N N   . LEU C 1 202 ? 20.735  -9.296  3.570   1.00 38.32  ? 214 LEU C N   1 
ATOM   5744 C CA  . LEU C 1 202 ? 20.954  -10.702 3.284   1.00 36.97  ? 214 LEU C CA  1 
ATOM   5745 C C   . LEU C 1 202 ? 22.415  -10.912 2.991   1.00 40.86  ? 214 LEU C C   1 
ATOM   5746 O O   . LEU C 1 202 ? 23.018  -10.133 2.257   1.00 41.05  ? 214 LEU C O   1 
ATOM   5747 C CB  . LEU C 1 202 ? 20.071  -11.185 2.129   1.00 36.57  ? 214 LEU C CB  1 
ATOM   5748 C CG  . LEU C 1 202 ? 18.557  -11.051 2.348   1.00 40.64  ? 214 LEU C CG  1 
ATOM   5749 C CD1 . LEU C 1 202 ? 17.812  -11.192 1.064   1.00 40.14  ? 214 LEU C CD1 1 
ATOM   5750 C CD2 . LEU C 1 202 ? 18.038  -12.024 3.398   1.00 43.32  ? 214 LEU C CD2 1 
ATOM   5751 N N   . GLU C 1 203 ? 22.998  -11.953 3.570   1.00 37.83  ? 215 GLU C N   1 
ATOM   5752 C CA  . GLU C 1 203 ? 24.444  -12.205 3.510   1.00 37.82  ? 215 GLU C CA  1 
ATOM   5753 C C   . GLU C 1 203 ? 24.981  -12.333 2.071   1.00 41.94  ? 215 GLU C C   1 
ATOM   5754 O O   . GLU C 1 203 ? 26.115  -11.930 1.812   1.00 42.70  ? 215 GLU C O   1 
ATOM   5755 C CB  . GLU C 1 203 ? 24.788  -13.464 4.302   1.00 40.31  ? 215 GLU C CB  1 
ATOM   5756 C CG  . GLU C 1 203 ? 24.615  -13.319 5.804   1.00 50.76  ? 215 GLU C CG  1 
ATOM   5757 C CD  . GLU C 1 203 ? 24.459  -14.627 6.549   1.00 80.59  ? 215 GLU C CD  1 
ATOM   5758 O OE1 . GLU C 1 203 ? 23.421  -15.307 6.360   1.00 64.28  ? 215 GLU C OE1 1 
ATOM   5759 O OE2 . GLU C 1 203 ? 25.370  -14.963 7.340   1.00 88.46  ? 215 GLU C OE2 1 
ATOM   5760 N N   . MET C 1 204 ? 24.157  -12.856 1.141   1.00 38.49  ? 216 MET C N   1 
ATOM   5761 C CA  . MET C 1 204 ? 24.557  -13.107 -0.249  1.00 38.62  ? 216 MET C CA  1 
ATOM   5762 C C   . MET C 1 204 ? 24.323  -11.911 -1.179  1.00 43.39  ? 216 MET C C   1 
ATOM   5763 O O   . MET C 1 204 ? 24.706  -11.974 -2.346  1.00 44.99  ? 216 MET C O   1 
ATOM   5764 C CB  . MET C 1 204 ? 23.812  -14.324 -0.799  1.00 41.08  ? 216 MET C CB  1 
ATOM   5765 C CG  . MET C 1 204 ? 24.319  -15.617 -0.249  1.00 45.51  ? 216 MET C CG  1 
ATOM   5766 S SD  . MET C 1 204 ? 23.592  -17.045 -1.069  1.00 50.11  ? 216 MET C SD  1 
ATOM   5767 C CE  . MET C 1 204 ? 24.522  -17.079 -2.550  1.00 46.92  ? 216 MET C CE  1 
ATOM   5768 N N   . TYR C 1 205 ? 23.699  -10.837 -0.677  1.00 39.06  ? 217 TYR C N   1 
ATOM   5769 C CA  . TYR C 1 205 ? 23.370  -9.638  -1.450  1.00 37.64  ? 217 TYR C CA  1 
ATOM   5770 C C   . TYR C 1 205 ? 24.643  -8.928  -1.964  1.00 41.38  ? 217 TYR C C   1 
ATOM   5771 O O   . TYR C 1 205 ? 25.543  -8.617  -1.180  1.00 41.75  ? 217 TYR C O   1 
ATOM   5772 C CB  . TYR C 1 205 ? 22.512  -8.696  -0.596  1.00 37.38  ? 217 TYR C CB  1 
ATOM   5773 C CG  . TYR C 1 205 ? 22.248  -7.338  -1.209  1.00 37.93  ? 217 TYR C CG  1 
ATOM   5774 C CD1 . TYR C 1 205 ? 23.120  -6.269  -0.992  1.00 39.39  ? 217 TYR C CD1 1 
ATOM   5775 C CD2 . TYR C 1 205 ? 21.096  -7.101  -1.952  1.00 37.87  ? 217 TYR C CD2 1 
ATOM   5776 C CE1 . TYR C 1 205 ? 22.879  -5.017  -1.547  1.00 38.87  ? 217 TYR C CE1 1 
ATOM   5777 C CE2 . TYR C 1 205 ? 20.830  -5.844  -2.486  1.00 38.39  ? 217 TYR C CE2 1 
ATOM   5778 C CZ  . TYR C 1 205 ? 21.721  -4.801  -2.273  1.00 45.63  ? 217 TYR C CZ  1 
ATOM   5779 O OH  . TYR C 1 205 ? 21.482  -3.558  -2.804  1.00 44.23  ? 217 TYR C OH  1 
ATOM   5780 N N   . GLY C 1 206 ? 24.683  -8.694  -3.278  1.00 37.51  ? 218 GLY C N   1 
ATOM   5781 C CA  . GLY C 1 206 ? 25.738  -7.937  -3.944  1.00 37.33  ? 218 GLY C CA  1 
ATOM   5782 C C   . GLY C 1 206 ? 27.096  -8.606  -3.977  1.00 41.62  ? 218 GLY C C   1 
ATOM   5783 O O   . GLY C 1 206 ? 28.088  -7.946  -4.284  1.00 42.27  ? 218 GLY C O   1 
ATOM   5784 N N   . VAL C 1 207 ? 27.157  -9.915  -3.671  1.00 37.33  ? 219 VAL C N   1 
ATOM   5785 C CA  . VAL C 1 207 ? 28.397  -10.688 -3.693  1.00 37.48  ? 219 VAL C CA  1 
ATOM   5786 C C   . VAL C 1 207 ? 28.505  -11.399 -5.041  1.00 42.38  ? 219 VAL C C   1 
ATOM   5787 O O   . VAL C 1 207 ? 27.559  -12.065 -5.468  1.00 42.07  ? 219 VAL C O   1 
ATOM   5788 C CB  . VAL C 1 207 ? 28.523  -11.681 -2.495  1.00 40.94  ? 219 VAL C CB  1 
ATOM   5789 C CG1 . VAL C 1 207 ? 29.863  -12.401 -2.524  1.00 41.58  ? 219 VAL C CG1 1 
ATOM   5790 C CG2 . VAL C 1 207 ? 28.331  -10.976 -1.148  1.00 39.94  ? 219 VAL C CG2 1 
ATOM   5791 N N   . ASN C 1 208 ? 29.655  -11.226 -5.715  1.00 39.90  ? 220 ASN C N   1 
ATOM   5792 C CA  . ASN C 1 208 ? 30.032  -11.954 -6.928  1.00 40.25  ? 220 ASN C CA  1 
ATOM   5793 C C   . ASN C 1 208 ? 30.859  -13.159 -6.528  1.00 45.03  ? 220 ASN C C   1 
ATOM   5794 O O   . ASN C 1 208 ? 31.918  -12.988 -5.915  1.00 45.89  ? 220 ASN C O   1 
ATOM   5795 C CB  . ASN C 1 208 ? 30.824  -11.044 -7.880  1.00 41.17  ? 220 ASN C CB  1 
ATOM   5796 C CG  . ASN C 1 208 ? 30.103  -9.795  -8.298  1.00 55.30  ? 220 ASN C CG  1 
ATOM   5797 O OD1 . ASN C 1 208 ? 29.292  -9.804  -9.228  1.00 50.50  ? 220 ASN C OD1 1 
ATOM   5798 N ND2 . ASN C 1 208 ? 30.416  -8.690  -7.641  1.00 40.37  ? 220 ASN C ND2 1 
ATOM   5799 N N   . TYR C 1 209 ? 30.377  -14.376 -6.846  1.00 41.78  ? 221 TYR C N   1 
ATOM   5800 C CA  . TYR C 1 209 ? 31.057  -15.619 -6.459  1.00 42.64  ? 221 TYR C CA  1 
ATOM   5801 C C   . TYR C 1 209 ? 31.810  -16.230 -7.622  1.00 49.44  ? 221 TYR C C   1 
ATOM   5802 O O   . TYR C 1 209 ? 31.301  -16.277 -8.748  1.00 50.45  ? 221 TYR C O   1 
ATOM   5803 C CB  . TYR C 1 209 ? 30.089  -16.658 -5.874  1.00 42.99  ? 221 TYR C CB  1 
ATOM   5804 C CG  . TYR C 1 209 ? 29.427  -16.236 -4.586  1.00 43.18  ? 221 TYR C CG  1 
ATOM   5805 C CD1 . TYR C 1 209 ? 30.007  -16.521 -3.354  1.00 45.01  ? 221 TYR C CD1 1 
ATOM   5806 C CD2 . TYR C 1 209 ? 28.187  -15.608 -4.592  1.00 42.84  ? 221 TYR C CD2 1 
ATOM   5807 C CE1 . TYR C 1 209 ? 29.383  -16.160 -2.159  1.00 43.63  ? 221 TYR C CE1 1 
ATOM   5808 C CE2 . TYR C 1 209 ? 27.563  -15.228 -3.406  1.00 42.46  ? 221 TYR C CE2 1 
ATOM   5809 C CZ  . TYR C 1 209 ? 28.153  -15.524 -2.192  1.00 45.01  ? 221 TYR C CZ  1 
ATOM   5810 O OH  . TYR C 1 209 ? 27.521  -15.149 -1.035  1.00 40.31  ? 221 TYR C OH  1 
ATOM   5811 N N   . PHE C 1 210 ? 33.021  -16.720 -7.334  1.00 46.60  ? 222 PHE C N   1 
ATOM   5812 C CA  . PHE C 1 210 ? 33.898  -17.347 -8.318  1.00 47.45  ? 222 PHE C CA  1 
ATOM   5813 C C   . PHE C 1 210 ? 34.525  -18.587 -7.711  1.00 51.34  ? 222 PHE C C   1 
ATOM   5814 O O   . PHE C 1 210 ? 34.987  -18.542 -6.575  1.00 50.80  ? 222 PHE C O   1 
ATOM   5815 C CB  . PHE C 1 210 ? 34.977  -16.357 -8.798  1.00 49.08  ? 222 PHE C CB  1 
ATOM   5816 C CG  . PHE C 1 210 ? 34.419  -15.071 -9.358  1.00 49.10  ? 222 PHE C CG  1 
ATOM   5817 C CD1 . PHE C 1 210 ? 33.968  -15.002 -10.670 1.00 52.58  ? 222 PHE C CD1 1 
ATOM   5818 C CD2 . PHE C 1 210 ? 34.312  -13.937 -8.564  1.00 49.72  ? 222 PHE C CD2 1 
ATOM   5819 C CE1 . PHE C 1 210 ? 33.460  -13.807 -11.193 1.00 52.23  ? 222 PHE C CE1 1 
ATOM   5820 C CE2 . PHE C 1 210 ? 33.787  -12.750 -9.080  1.00 51.87  ? 222 PHE C CE2 1 
ATOM   5821 C CZ  . PHE C 1 210 ? 33.362  -12.693 -10.390 1.00 50.36  ? 222 PHE C CZ  1 
ATOM   5822 N N   . ALA C 1 211 ? 34.513  -19.698 -8.449  1.00 49.18  ? 223 ALA C N   1 
ATOM   5823 C CA  . ALA C 1 211 ? 35.183  -20.923 -8.033  1.00 50.89  ? 223 ALA C CA  1 
ATOM   5824 C C   . ALA C 1 211 ? 36.687  -20.730 -8.134  1.00 56.76  ? 223 ALA C C   1 
ATOM   5825 O O   . ALA C 1 211 ? 37.186  -20.259 -9.162  1.00 56.92  ? 223 ALA C O   1 
ATOM   5826 C CB  . ALA C 1 211 ? 34.728  -22.094 -8.890  1.00 52.90  ? 223 ALA C CB  1 
ATOM   5827 N N   . ILE C 1 212 ? 37.398  -21.038 -7.040  1.00 54.33  ? 224 ILE C N   1 
ATOM   5828 C CA  . ILE C 1 212 ? 38.845  -20.831 -6.915  1.00 55.40  ? 224 ILE C CA  1 
ATOM   5829 C C   . ILE C 1 212 ? 39.476  -21.982 -6.097  1.00 61.48  ? 224 ILE C C   1 
ATOM   5830 O O   . ILE C 1 212 ? 38.771  -22.697 -5.390  1.00 61.22  ? 224 ILE C O   1 
ATOM   5831 C CB  . ILE C 1 212 ? 39.211  -19.415 -6.332  1.00 56.37  ? 224 ILE C CB  1 
ATOM   5832 C CG1 . ILE C 1 212 ? 38.602  -19.155 -4.940  1.00 55.25  ? 224 ILE C CG1 1 
ATOM   5833 C CG2 . ILE C 1 212 ? 38.896  -18.274 -7.309  1.00 53.87  ? 224 ILE C CG2 1 
ATOM   5834 C CD1 . ILE C 1 212 ? 39.590  -19.165 -3.835  1.00 59.80  ? 224 ILE C CD1 1 
ATOM   5835 N N   . ARG C 1 213 ? 40.796  -22.167 -6.228  1.00 60.06  ? 225 ARG C N   1 
ATOM   5836 C CA  . ARG C 1 213 ? 41.602  -23.120 -5.452  1.00 61.45  ? 225 ARG C CA  1 
ATOM   5837 C C   . ARG C 1 213 ? 42.759  -22.374 -4.775  1.00 65.82  ? 225 ARG C C   1 
ATOM   5838 O O   . ARG C 1 213 ? 43.386  -21.534 -5.415  1.00 65.54  ? 225 ARG C O   1 
ATOM   5839 C CB  . ARG C 1 213 ? 42.148  -24.238 -6.367  1.00 64.08  ? 225 ARG C CB  1 
ATOM   5840 C CG  . ARG C 1 213 ? 41.352  -25.535 -6.325  1.00 77.41  ? 225 ARG C CG  1 
ATOM   5841 C CD  . ARG C 1 213 ? 41.870  -26.544 -7.327  1.00 95.45  ? 225 ARG C CD  1 
ATOM   5842 N NE  . ARG C 1 213 ? 41.278  -26.338 -8.645  1.00 111.66 ? 225 ARG C NE  1 
ATOM   5843 C CZ  . ARG C 1 213 ? 40.531  -27.228 -9.288  1.00 128.95 ? 225 ARG C CZ  1 
ATOM   5844 N NH1 . ARG C 1 213 ? 40.276  -28.413 -8.741  1.00 114.35 ? 225 ARG C NH1 1 
ATOM   5845 N NH2 . ARG C 1 213 ? 40.044  -26.947 -10.489 1.00 118.10 ? 225 ARG C NH2 1 
ATOM   5846 N N   . ASN C 1 214 ? 43.039  -22.658 -3.492  1.00 62.83  ? 226 ASN C N   1 
ATOM   5847 C CA  . ASN C 1 214 ? 44.201  -22.080 -2.804  1.00 62.75  ? 226 ASN C CA  1 
ATOM   5848 C C   . ASN C 1 214 ? 45.471  -22.891 -3.150  1.00 69.57  ? 226 ASN C C   1 
ATOM   5849 O O   . ASN C 1 214 ? 45.369  -23.890 -3.863  1.00 70.40  ? 226 ASN C O   1 
ATOM   5850 C CB  . ASN C 1 214 ? 43.963  -21.995 -1.282  1.00 59.09  ? 226 ASN C CB  1 
ATOM   5851 C CG  . ASN C 1 214 ? 43.746  -23.316 -0.579  1.00 71.18  ? 226 ASN C CG  1 
ATOM   5852 O OD1 . ASN C 1 214 ? 43.996  -24.397 -1.119  1.00 65.06  ? 226 ASN C OD1 1 
ATOM   5853 N ND2 . ASN C 1 214 ? 43.308  -23.252 0.671   1.00 60.04  ? 226 ASN C ND2 1 
ATOM   5854 N N   . LYS C 1 215 ? 46.652  -22.478 -2.635  1.00 67.57  ? 227 LYS C N   1 
ATOM   5855 C CA  . LYS C 1 215 ? 47.942  -23.099 -2.965  1.00 69.98  ? 227 LYS C CA  1 
ATOM   5856 C C   . LYS C 1 215 ? 48.021  -24.580 -2.547  1.00 75.78  ? 227 LYS C C   1 
ATOM   5857 O O   . LYS C 1 215 ? 48.768  -25.338 -3.176  1.00 77.77  ? 227 LYS C O   1 
ATOM   5858 C CB  . LYS C 1 215 ? 49.115  -22.308 -2.360  1.00 73.05  ? 227 LYS C CB  1 
ATOM   5859 C CG  . LYS C 1 215 ? 49.482  -21.060 -3.168  1.00 90.41  ? 227 LYS C CG  1 
ATOM   5860 C CD  . LYS C 1 215 ? 50.624  -21.338 -4.170  1.00 104.84 ? 227 LYS C CD  1 
ATOM   5861 C CE  . LYS C 1 215 ? 50.852  -20.214 -5.157  1.00 115.50 ? 227 LYS C CE  1 
ATOM   5862 N NZ  . LYS C 1 215 ? 51.878  -20.554 -6.176  1.00 124.04 ? 227 LYS C NZ  1 
ATOM   5863 N N   . LYS C 1 216 ? 47.243  -24.995 -1.517  1.00 71.37  ? 228 LYS C N   1 
ATOM   5864 C CA  . LYS C 1 216 ? 47.127  -26.405 -1.097  1.00 72.36  ? 228 LYS C CA  1 
ATOM   5865 C C   . LYS C 1 216 ? 46.206  -27.223 -2.045  1.00 76.13  ? 228 LYS C C   1 
ATOM   5866 O O   . LYS C 1 216 ? 46.174  -28.456 -1.958  1.00 77.07  ? 228 LYS C O   1 
ATOM   5867 C CB  . LYS C 1 216 ? 46.613  -26.509 0.351   1.00 73.30  ? 228 LYS C CB  1 
ATOM   5868 C CG  . LYS C 1 216 ? 47.664  -26.218 1.405   1.00 79.84  ? 228 LYS C CG  1 
ATOM   5869 C CD  . LYS C 1 216 ? 47.082  -26.303 2.808   1.00 85.16  ? 228 LYS C CD  1 
ATOM   5870 C CE  . LYS C 1 216 ? 48.106  -25.955 3.865   1.00 99.47  ? 228 LYS C CE  1 
ATOM   5871 N NZ  . LYS C 1 216 ? 49.138  -27.023 4.060   1.00 111.63 ? 228 LYS C NZ  1 
ATOM   5872 N N   . GLY C 1 217 ? 45.479  -26.529 -2.922  1.00 70.64  ? 229 GLY C N   1 
ATOM   5873 C CA  . GLY C 1 217 ? 44.576  -27.138 -3.887  1.00 70.53  ? 229 GLY C CA  1 
ATOM   5874 C C   . GLY C 1 217 ? 43.161  -27.316 -3.382  1.00 72.80  ? 229 GLY C C   1 
ATOM   5875 O O   . GLY C 1 217 ? 42.374  -28.016 -4.018  1.00 73.12  ? 229 GLY C O   1 
ATOM   5876 N N   . THR C 1 218 ? 42.825  -26.685 -2.246  1.00 67.48  ? 230 THR C N   1 
ATOM   5877 C CA  . THR C 1 218 ? 41.488  -26.722 -1.653  1.00 65.59  ? 230 THR C CA  1 
ATOM   5878 C C   . THR C 1 218 ? 40.524  -25.936 -2.533  1.00 68.64  ? 230 THR C C   1 
ATOM   5879 O O   . THR C 1 218 ? 40.799  -24.795 -2.895  1.00 67.34  ? 230 THR C O   1 
ATOM   5880 C CB  . THR C 1 218 ? 41.538  -26.171 -0.222  1.00 72.74  ? 230 THR C CB  1 
ATOM   5881 O OG1 . THR C 1 218 ? 42.456  -26.933 0.562   1.00 74.10  ? 230 THR C OG1 1 
ATOM   5882 C CG2 . THR C 1 218 ? 40.180  -26.115 0.443   1.00 70.27  ? 230 THR C CG2 1 
ATOM   5883 N N   . GLU C 1 219 ? 39.396  -26.551 -2.872  1.00 65.86  ? 231 GLU C N   1 
ATOM   5884 C CA  . GLU C 1 219 ? 38.333  -25.913 -3.656  1.00 64.36  ? 231 GLU C CA  1 
ATOM   5885 C C   . GLU C 1 219 ? 37.552  -24.995 -2.753  1.00 65.62  ? 231 GLU C C   1 
ATOM   5886 O O   . GLU C 1 219 ? 37.084  -25.414 -1.689  1.00 65.47  ? 231 GLU C O   1 
ATOM   5887 C CB  . GLU C 1 219 ? 37.417  -26.955 -4.321  1.00 67.00  ? 231 GLU C CB  1 
ATOM   5888 C CG  . GLU C 1 219 ? 38.133  -27.746 -5.406  1.00 83.03  ? 231 GLU C CG  1 
ATOM   5889 C CD  . GLU C 1 219 ? 37.503  -29.041 -5.881  1.00 108.04 ? 231 GLU C CD  1 
ATOM   5890 O OE1 . GLU C 1 219 ? 36.395  -29.386 -5.406  1.00 93.38  ? 231 GLU C OE1 1 
ATOM   5891 O OE2 . GLU C 1 219 ? 38.141  -29.736 -6.706  1.00 110.89 ? 231 GLU C OE2 1 
ATOM   5892 N N   . LEU C 1 220 ? 37.472  -23.718 -3.146  1.00 59.73  ? 232 LEU C N   1 
ATOM   5893 C CA  . LEU C 1 220 ? 36.901  -22.628 -2.358  1.00 56.39  ? 232 LEU C CA  1 
ATOM   5894 C C   . LEU C 1 220 ? 36.146  -21.664 -3.266  1.00 59.23  ? 232 LEU C C   1 
ATOM   5895 O O   . LEU C 1 220 ? 36.150  -21.834 -4.488  1.00 59.70  ? 232 LEU C O   1 
ATOM   5896 C CB  . LEU C 1 220 ? 38.006  -21.873 -1.584  1.00 55.70  ? 232 LEU C CB  1 
ATOM   5897 C CG  . LEU C 1 220 ? 38.828  -22.666 -0.565  1.00 60.79  ? 232 LEU C CG  1 
ATOM   5898 C CD1 . LEU C 1 220 ? 40.158  -22.001 -0.314  1.00 61.08  ? 232 LEU C CD1 1 
ATOM   5899 C CD2 . LEU C 1 220 ? 38.055  -22.904 0.727   1.00 61.53  ? 232 LEU C CD2 1 
ATOM   5900 N N   . LEU C 1 221 ? 35.478  -20.667 -2.664  1.00 53.43  ? 233 LEU C N   1 
ATOM   5901 C CA  . LEU C 1 221 ? 34.843  -19.587 -3.407  1.00 52.07  ? 233 LEU C CA  1 
ATOM   5902 C C   . LEU C 1 221 ? 35.471  -18.247 -3.065  1.00 55.98  ? 233 LEU C C   1 
ATOM   5903 O O   . LEU C 1 221 ? 35.860  -18.019 -1.914  1.00 56.43  ? 233 LEU C O   1 
ATOM   5904 C CB  . LEU C 1 221 ? 33.330  -19.530 -3.120  1.00 50.86  ? 233 LEU C CB  1 
ATOM   5905 C CG  . LEU C 1 221 ? 32.491  -20.714 -3.583  1.00 56.13  ? 233 LEU C CG  1 
ATOM   5906 C CD1 . LEU C 1 221 ? 31.143  -20.687 -2.903  1.00 55.19  ? 233 LEU C CD1 1 
ATOM   5907 C CD2 . LEU C 1 221 ? 32.341  -20.735 -5.109  1.00 58.55  ? 233 LEU C CD2 1 
ATOM   5908 N N   . LEU C 1 222 ? 35.573  -17.367 -4.073  1.00 50.59  ? 234 LEU C N   1 
ATOM   5909 C CA  . LEU C 1 222 ? 35.915  -15.966 -3.881  1.00 48.25  ? 234 LEU C CA  1 
ATOM   5910 C C   . LEU C 1 222 ? 34.650  -15.120 -3.989  1.00 51.72  ? 234 LEU C C   1 
ATOM   5911 O O   . LEU C 1 222 ? 33.912  -15.233 -4.968  1.00 50.84  ? 234 LEU C O   1 
ATOM   5912 C CB  . LEU C 1 222 ? 36.980  -15.514 -4.907  1.00 48.39  ? 234 LEU C CB  1 
ATOM   5913 C CG  . LEU C 1 222 ? 37.312  -14.022 -4.955  1.00 50.94  ? 234 LEU C CG  1 
ATOM   5914 C CD1 . LEU C 1 222 ? 38.258  -13.629 -3.854  1.00 51.48  ? 234 LEU C CD1 1 
ATOM   5915 C CD2 . LEU C 1 222 ? 37.901  -13.655 -6.270  1.00 52.98  ? 234 LEU C CD2 1 
ATOM   5916 N N   . GLY C 1 223 ? 34.406  -14.305 -2.969  1.00 47.83  ? 235 GLY C N   1 
ATOM   5917 C CA  . GLY C 1 223 ? 33.374  -13.283 -3.002  1.00 45.96  ? 235 GLY C CA  1 
ATOM   5918 C C   . GLY C 1 223 ? 33.972  -11.914 -3.235  1.00 49.91  ? 235 GLY C C   1 
ATOM   5919 O O   . GLY C 1 223 ? 34.833  -11.478 -2.466  1.00 49.87  ? 235 GLY C O   1 
ATOM   5920 N N   . VAL C 1 224 ? 33.550  -11.241 -4.324  1.00 45.96  ? 236 VAL C N   1 
ATOM   5921 C CA  . VAL C 1 224 ? 33.900  -9.832  -4.586  1.00 44.14  ? 236 VAL C CA  1 
ATOM   5922 C C   . VAL C 1 224 ? 32.633  -8.996  -4.362  1.00 45.07  ? 236 VAL C C   1 
ATOM   5923 O O   . VAL C 1 224 ? 31.632  -9.218  -5.035  1.00 44.07  ? 236 VAL C O   1 
ATOM   5924 C CB  . VAL C 1 224 ? 34.535  -9.581  -5.991  1.00 47.67  ? 236 VAL C CB  1 
ATOM   5925 C CG1 . VAL C 1 224 ? 35.105  -8.161  -6.099  1.00 46.83  ? 236 VAL C CG1 1 
ATOM   5926 C CG2 . VAL C 1 224 ? 35.606  -10.614 -6.324  1.00 48.70  ? 236 VAL C CG2 1 
ATOM   5927 N N   . ASP C 1 225 ? 32.677  -8.053  -3.411  1.00 41.20  ? 237 ASP C N   1 
ATOM   5928 C CA  . ASP C 1 225 ? 31.541  -7.186  -3.095  1.00 40.30  ? 237 ASP C CA  1 
ATOM   5929 C C   . ASP C 1 225 ? 32.004  -5.760  -2.679  1.00 44.77  ? 237 ASP C C   1 
ATOM   5930 O O   . ASP C 1 225 ? 33.191  -5.439  -2.798  1.00 44.45  ? 237 ASP C O   1 
ATOM   5931 C CB  . ASP C 1 225 ? 30.636  -7.832  -2.016  1.00 42.00  ? 237 ASP C CB  1 
ATOM   5932 C CG  . ASP C 1 225 ? 31.226  -8.091  -0.638  1.00 55.50  ? 237 ASP C CG  1 
ATOM   5933 O OD1 . ASP C 1 225 ? 32.232  -7.435  -0.279  1.00 56.56  ? 237 ASP C OD1 1 
ATOM   5934 O OD2 . ASP C 1 225 ? 30.650  -8.910  0.105   1.00 64.72  ? 237 ASP C OD2 1 
ATOM   5935 N N   . ALA C 1 226 ? 31.067  -4.919  -2.179  1.00 41.90  ? 238 ALA C N   1 
ATOM   5936 C CA  . ALA C 1 226 ? 31.331  -3.505  -1.863  1.00 42.18  ? 238 ALA C CA  1 
ATOM   5937 C C   . ALA C 1 226 ? 32.319  -3.325  -0.694  1.00 48.05  ? 238 ALA C C   1 
ATOM   5938 O O   . ALA C 1 226 ? 32.945  -2.266  -0.590  1.00 49.63  ? 238 ALA C O   1 
ATOM   5939 C CB  . ALA C 1 226 ? 30.029  -2.781  -1.563  1.00 41.55  ? 238 ALA C CB  1 
ATOM   5940 N N   . LEU C 1 227 ? 32.486  -4.366  0.143   1.00 43.93  ? 239 LEU C N   1 
ATOM   5941 C CA  . LEU C 1 227 ? 33.260  -4.333  1.386   1.00 43.81  ? 239 LEU C CA  1 
ATOM   5942 C C   . LEU C 1 227 ? 34.694  -4.803  1.206   1.00 48.11  ? 239 LEU C C   1 
ATOM   5943 O O   . LEU C 1 227 ? 35.598  -4.286  1.865   1.00 49.23  ? 239 LEU C O   1 
ATOM   5944 C CB  . LEU C 1 227 ? 32.583  -5.209  2.446   1.00 43.74  ? 239 LEU C CB  1 
ATOM   5945 C CG  . LEU C 1 227 ? 31.262  -4.719  3.018   1.00 47.91  ? 239 LEU C CG  1 
ATOM   5946 C CD1 . LEU C 1 227 ? 30.614  -5.802  3.850   1.00 48.20  ? 239 LEU C CD1 1 
ATOM   5947 C CD2 . LEU C 1 227 ? 31.454  -3.455  3.851   1.00 50.90  ? 239 LEU C CD2 1 
ATOM   5948 N N   . GLY C 1 228 ? 34.886  -5.802  0.357   1.00 44.05  ? 240 GLY C N   1 
ATOM   5949 C CA  . GLY C 1 228 ? 36.205  -6.324  0.044   1.00 44.83  ? 240 GLY C CA  1 
ATOM   5950 C C   . GLY C 1 228 ? 36.176  -7.661  -0.646  1.00 49.40  ? 240 GLY C C   1 
ATOM   5951 O O   . GLY C 1 228 ? 35.242  -7.970  -1.395  1.00 48.57  ? 240 GLY C O   1 
ATOM   5952 N N   . LEU C 1 229 ? 37.219  -8.454  -0.385  1.00 47.24  ? 241 LEU C N   1 
ATOM   5953 C CA  . LEU C 1 229 ? 37.359  -9.822  -0.882  1.00 47.64  ? 241 LEU C CA  1 
ATOM   5954 C C   . LEU C 1 229 ? 37.100  -10.813 0.236   1.00 49.51  ? 241 LEU C C   1 
ATOM   5955 O O   . LEU C 1 229 ? 37.504  -10.580 1.373   1.00 49.12  ? 241 LEU C O   1 
ATOM   5956 C CB  . LEU C 1 229 ? 38.757  -10.053 -1.485  1.00 49.53  ? 241 LEU C CB  1 
ATOM   5957 C CG  . LEU C 1 229 ? 39.137  -9.174  -2.691  1.00 54.61  ? 241 LEU C CG  1 
ATOM   5958 C CD1 . LEU C 1 229 ? 40.568  -9.412  -3.101  1.00 55.59  ? 241 LEU C CD1 1 
ATOM   5959 C CD2 . LEU C 1 229 ? 38.193  -9.403  -3.875  1.00 55.66  ? 241 LEU C CD2 1 
ATOM   5960 N N   . HIS C 1 230 ? 36.411  -11.908 -0.085  1.00 44.97  ? 242 HIS C N   1 
ATOM   5961 C CA  . HIS C 1 230 ? 35.984  -12.902 0.889   1.00 44.74  ? 242 HIS C CA  1 
ATOM   5962 C C   . HIS C 1 230 ? 36.269  -14.301 0.362   1.00 49.26  ? 242 HIS C C   1 
ATOM   5963 O O   . HIS C 1 230 ? 36.069  -14.559 -0.824  1.00 49.21  ? 242 HIS C O   1 
ATOM   5964 C CB  . HIS C 1 230 ? 34.492  -12.732 1.226   1.00 44.39  ? 242 HIS C CB  1 
ATOM   5965 C CG  . HIS C 1 230 ? 34.108  -11.319 1.506   1.00 47.26  ? 242 HIS C CG  1 
ATOM   5966 N ND1 . HIS C 1 230 ? 34.415  -10.712 2.712   1.00 49.45  ? 242 HIS C ND1 1 
ATOM   5967 C CD2 . HIS C 1 230 ? 33.501  -10.414 0.704   1.00 49.38  ? 242 HIS C CD2 1 
ATOM   5968 C CE1 . HIS C 1 230 ? 33.974  -9.466  2.615   1.00 48.63  ? 242 HIS C CE1 1 
ATOM   5969 N NE2 . HIS C 1 230 ? 33.412  -9.238  1.428   1.00 48.61  ? 242 HIS C NE2 1 
ATOM   5970 N N   . ILE C 1 231 ? 36.771  -15.188 1.233   1.00 46.06  ? 243 ILE C N   1 
ATOM   5971 C CA  . ILE C 1 231 ? 37.058  -16.580 0.896   1.00 46.93  ? 243 ILE C CA  1 
ATOM   5972 C C   . ILE C 1 231 ? 36.038  -17.458 1.621   1.00 53.09  ? 243 ILE C C   1 
ATOM   5973 O O   . ILE C 1 231 ? 35.924  -17.400 2.845   1.00 53.03  ? 243 ILE C O   1 
ATOM   5974 C CB  . ILE C 1 231 ? 38.532  -16.978 1.215   1.00 50.87  ? 243 ILE C CB  1 
ATOM   5975 C CG1 . ILE C 1 231 ? 39.562  -15.888 0.800   1.00 50.73  ? 243 ILE C CG1 1 
ATOM   5976 C CG2 . ILE C 1 231 ? 38.887  -18.360 0.633   1.00 53.40  ? 243 ILE C CG2 1 
ATOM   5977 C CD1 . ILE C 1 231 ? 39.614  -15.460 -0.747  1.00 54.80  ? 243 ILE C CD1 1 
ATOM   5978 N N   . TYR C 1 232 ? 35.279  -18.250 0.855   1.00 50.75  ? 244 TYR C N   1 
ATOM   5979 C CA  . TYR C 1 232 ? 34.233  -19.119 1.385   1.00 50.94  ? 244 TYR C CA  1 
ATOM   5980 C C   . TYR C 1 232 ? 34.601  -20.580 1.231   1.00 58.58  ? 244 TYR C C   1 
ATOM   5981 O O   . TYR C 1 232 ? 35.243  -20.965 0.251   1.00 58.24  ? 244 TYR C O   1 
ATOM   5982 C CB  . TYR C 1 232 ? 32.902  -18.882 0.655   1.00 50.56  ? 244 TYR C CB  1 
ATOM   5983 C CG  . TYR C 1 232 ? 32.347  -17.483 0.753   1.00 49.89  ? 244 TYR C CG  1 
ATOM   5984 C CD1 . TYR C 1 232 ? 32.714  -16.501 -0.166  1.00 50.88  ? 244 TYR C CD1 1 
ATOM   5985 C CD2 . TYR C 1 232 ? 31.382  -17.160 1.703   1.00 49.67  ? 244 TYR C CD2 1 
ATOM   5986 C CE1 . TYR C 1 232 ? 32.183  -15.215 -0.100  1.00 48.69  ? 244 TYR C CE1 1 
ATOM   5987 C CE2 . TYR C 1 232 ? 30.840  -15.880 1.777   1.00 49.04  ? 244 TYR C CE2 1 
ATOM   5988 C CZ  . TYR C 1 232 ? 31.247  -14.910 0.875   1.00 54.92  ? 244 TYR C CZ  1 
ATOM   5989 O OH  . TYR C 1 232 ? 30.712  -13.647 0.947   1.00 53.90  ? 244 TYR C OH  1 
ATOM   5990 N N   . ASP C 1 233 ? 34.180  -21.395 2.191   1.00 58.30  ? 245 ASP C N   1 
ATOM   5991 C CA  . ASP C 1 233 ? 34.021  -22.830 1.994   1.00 60.86  ? 245 ASP C CA  1 
ATOM   5992 C C   . ASP C 1 233 ? 32.912  -22.996 0.908   1.00 65.76  ? 245 ASP C C   1 
ATOM   5993 O O   . ASP C 1 233 ? 31.911  -22.285 1.003   1.00 62.97  ? 245 ASP C O   1 
ATOM   5994 C CB  . ASP C 1 233 ? 33.638  -23.474 3.346   1.00 63.65  ? 245 ASP C CB  1 
ATOM   5995 C CG  . ASP C 1 233 ? 33.801  -24.972 3.440   1.00 83.33  ? 245 ASP C CG  1 
ATOM   5996 O OD1 . ASP C 1 233 ? 33.433  -25.672 2.473   1.00 85.65  ? 245 ASP C OD1 1 
ATOM   5997 O OD2 . ASP C 1 233 ? 34.233  -25.458 4.513   1.00 95.13  ? 245 ASP C OD2 1 
ATOM   5998 N N   . PRO C 1 234 ? 33.029  -23.838 -0.147  1.00 64.24  ? 246 PRO C N   1 
ATOM   5999 C CA  . PRO C 1 234 ? 31.919  -23.942 -1.116  1.00 64.26  ? 246 PRO C CA  1 
ATOM   6000 C C   . PRO C 1 234 ? 30.569  -24.371 -0.508  1.00 69.05  ? 246 PRO C C   1 
ATOM   6001 O O   . PRO C 1 234 ? 29.514  -24.057 -1.069  1.00 67.46  ? 246 PRO C O   1 
ATOM   6002 C CB  . PRO C 1 234 ? 32.433  -24.973 -2.113  1.00 67.37  ? 246 PRO C CB  1 
ATOM   6003 C CG  . PRO C 1 234 ? 33.896  -24.825 -2.046  1.00 71.62  ? 246 PRO C CG  1 
ATOM   6004 C CD  . PRO C 1 234 ? 34.175  -24.649 -0.589  1.00 66.72  ? 246 PRO C CD  1 
ATOM   6005 N N   . GLU C 1 235 ? 30.599  -25.046 0.651   1.00 66.86  ? 247 GLU C N   1 
ATOM   6006 C CA  . GLU C 1 235 ? 29.378  -25.492 1.323   1.00 66.85  ? 247 GLU C CA  1 
ATOM   6007 C C   . GLU C 1 235 ? 28.778  -24.415 2.246   1.00 68.28  ? 247 GLU C C   1 
ATOM   6008 O O   . GLU C 1 235 ? 27.880  -24.739 3.028   1.00 68.41  ? 247 GLU C O   1 
ATOM   6009 C CB  . GLU C 1 235 ? 29.616  -26.807 2.099   1.00 70.16  ? 247 GLU C CB  1 
ATOM   6010 C CG  . GLU C 1 235 ? 30.556  -26.710 3.287   1.00 84.87  ? 247 GLU C CG  1 
ATOM   6011 C CD  . GLU C 1 235 ? 31.170  -28.028 3.731   1.00 120.03 ? 247 GLU C CD  1 
ATOM   6012 O OE1 . GLU C 1 235 ? 30.455  -29.058 3.744   1.00 115.34 ? 247 GLU C OE1 1 
ATOM   6013 O OE2 . GLU C 1 235 ? 32.369  -28.024 4.094   1.00 120.98 ? 247 GLU C OE2 1 
ATOM   6014 N N   . ASN C 1 236 ? 29.252  -23.145 2.153   1.00 61.81  ? 248 ASN C N   1 
ATOM   6015 C CA  . ASN C 1 236 ? 28.683  -22.026 2.902   1.00 58.92  ? 248 ASN C CA  1 
ATOM   6016 C C   . ASN C 1 236 ? 28.966  -20.714 2.176   1.00 59.64  ? 248 ASN C C   1 
ATOM   6017 O O   . ASN C 1 236 ? 30.037  -20.128 2.349   1.00 58.71  ? 248 ASN C O   1 
ATOM   6018 C CB  . ASN C 1 236 ? 29.213  -21.994 4.351   1.00 58.81  ? 248 ASN C CB  1 
ATOM   6019 C CG  . ASN C 1 236 ? 28.487  -21.042 5.286   1.00 78.49  ? 248 ASN C CG  1 
ATOM   6020 O OD1 . ASN C 1 236 ? 27.440  -20.459 4.972   1.00 76.83  ? 248 ASN C OD1 1 
ATOM   6021 N ND2 . ASN C 1 236 ? 29.023  -20.873 6.483   1.00 68.18  ? 248 ASN C ND2 1 
ATOM   6022 N N   . ARG C 1 237 ? 28.004  -20.264 1.346   1.00 54.87  ? 249 ARG C N   1 
ATOM   6023 C CA  . ARG C 1 237 ? 28.080  -18.975 0.631   1.00 53.17  ? 249 ARG C CA  1 
ATOM   6024 C C   . ARG C 1 237 ? 27.591  -17.813 1.512   1.00 54.18  ? 249 ARG C C   1 
ATOM   6025 O O   . ARG C 1 237 ? 27.617  -16.669 1.075   1.00 53.54  ? 249 ARG C O   1 
ATOM   6026 C CB  . ARG C 1 237 ? 27.279  -19.022 -0.682  1.00 54.33  ? 249 ARG C CB  1 
ATOM   6027 C CG  . ARG C 1 237 ? 27.753  -20.089 -1.663  1.00 61.49  ? 249 ARG C CG  1 
ATOM   6028 C CD  . ARG C 1 237 ? 27.307  -19.802 -3.090  1.00 68.94  ? 249 ARG C CD  1 
ATOM   6029 N NE  . ARG C 1 237 ? 27.900  -20.764 -4.019  1.00 71.45  ? 249 ARG C NE  1 
ATOM   6030 C CZ  . ARG C 1 237 ? 28.162  -20.525 -5.302  1.00 83.23  ? 249 ARG C CZ  1 
ATOM   6031 N NH1 . ARG C 1 237 ? 27.873  -19.345 -5.841  1.00 72.18  ? 249 ARG C NH1 1 
ATOM   6032 N NH2 . ARG C 1 237 ? 28.716  -21.462 -6.056  1.00 70.53  ? 249 ARG C NH2 1 
ATOM   6033 N N   . LEU C 1 238 ? 27.179  -18.107 2.760   1.00 50.13  ? 250 LEU C N   1 
ATOM   6034 C CA  . LEU C 1 238 ? 26.578  -17.121 3.657   1.00 48.87  ? 250 LEU C CA  1 
ATOM   6035 C C   . LEU C 1 238 ? 27.627  -16.454 4.545   1.00 53.35  ? 250 LEU C C   1 
ATOM   6036 O O   . LEU C 1 238 ? 27.622  -15.232 4.659   1.00 51.15  ? 250 LEU C O   1 
ATOM   6037 C CB  . LEU C 1 238 ? 25.448  -17.751 4.511   1.00 48.82  ? 250 LEU C CB  1 
ATOM   6038 C CG  . LEU C 1 238 ? 24.244  -18.367 3.745   1.00 52.47  ? 250 LEU C CG  1 
ATOM   6039 C CD1 . LEU C 1 238 ? 23.241  -18.968 4.680   1.00 52.67  ? 250 LEU C CD1 1 
ATOM   6040 C CD2 . LEU C 1 238 ? 23.514  -17.355 2.910   1.00 52.51  ? 250 LEU C CD2 1 
ATOM   6041 N N   . THR C 1 239 ? 28.532  -17.244 5.166   1.00 51.73  ? 251 THR C N   1 
ATOM   6042 C CA  . THR C 1 239 ? 29.539  -16.713 6.099   1.00 51.99  ? 251 THR C CA  1 
ATOM   6043 C C   . THR C 1 239 ? 30.967  -16.980 5.569   1.00 57.52  ? 251 THR C C   1 
ATOM   6044 O O   . THR C 1 239 ? 31.370  -18.145 5.466   1.00 59.14  ? 251 THR C O   1 
ATOM   6045 C CB  . THR C 1 239 ? 29.333  -17.292 7.511   1.00 59.66  ? 251 THR C CB  1 
ATOM   6046 O OG1 . THR C 1 239 ? 27.988  -17.047 7.924   1.00 61.19  ? 251 THR C OG1 1 
ATOM   6047 C CG2 . THR C 1 239 ? 30.286  -16.693 8.540   1.00 55.73  ? 251 THR C CG2 1 
ATOM   6048 N N   . PRO C 1 240 ? 31.758  -15.925 5.238   1.00 53.04  ? 252 PRO C N   1 
ATOM   6049 C CA  . PRO C 1 240 ? 33.125  -16.169 4.740   1.00 53.24  ? 252 PRO C CA  1 
ATOM   6050 C C   . PRO C 1 240 ? 34.094  -16.642 5.833   1.00 56.36  ? 252 PRO C C   1 
ATOM   6051 O O   . PRO C 1 240 ? 33.993  -16.235 6.986   1.00 55.93  ? 252 PRO C O   1 
ATOM   6052 C CB  . PRO C 1 240 ? 33.539  -14.808 4.167   1.00 53.95  ? 252 PRO C CB  1 
ATOM   6053 C CG  . PRO C 1 240 ? 32.775  -13.829 4.930   1.00 57.11  ? 252 PRO C CG  1 
ATOM   6054 C CD  . PRO C 1 240 ? 31.455  -14.479 5.274   1.00 52.94  ? 252 PRO C CD  1 
ATOM   6055 N N   . LYS C 1 241 ? 35.015  -17.518 5.454   1.00 53.22  ? 253 LYS C N   1 
ATOM   6056 C CA  . LYS C 1 241 ? 36.093  -18.020 6.303   1.00 54.03  ? 253 LYS C CA  1 
ATOM   6057 C C   . LYS C 1 241 ? 37.143  -16.934 6.561   1.00 58.15  ? 253 LYS C C   1 
ATOM   6058 O O   . LYS C 1 241 ? 37.631  -16.789 7.686   1.00 58.82  ? 253 LYS C O   1 
ATOM   6059 C CB  . LYS C 1 241 ? 36.740  -19.244 5.633   1.00 57.20  ? 253 LYS C CB  1 
ATOM   6060 C CG  . LYS C 1 241 ? 36.234  -20.608 6.143   1.00 70.82  ? 253 LYS C CG  1 
ATOM   6061 C CD  . LYS C 1 241 ? 34.697  -20.801 6.177   1.00 78.80  ? 253 LYS C CD  1 
ATOM   6062 C CE  . LYS C 1 241 ? 34.220  -22.011 6.928   1.00 89.73  ? 253 LYS C CE  1 
ATOM   6063 N NZ  . LYS C 1 241 ? 32.760  -21.910 7.191   1.00 97.94  ? 253 LYS C NZ  1 
ATOM   6064 N N   . ILE C 1 242 ? 37.504  -16.194 5.502   1.00 53.40  ? 254 ILE C N   1 
ATOM   6065 C CA  . ILE C 1 242 ? 38.445  -15.076 5.544   1.00 52.27  ? 254 ILE C CA  1 
ATOM   6066 C C   . ILE C 1 242 ? 37.812  -13.892 4.833   1.00 53.68  ? 254 ILE C C   1 
ATOM   6067 O O   . ILE C 1 242 ? 37.152  -14.071 3.812   1.00 51.25  ? 254 ILE C O   1 
ATOM   6068 C CB  . ILE C 1 242 ? 39.840  -15.412 4.932   1.00 56.30  ? 254 ILE C CB  1 
ATOM   6069 C CG1 . ILE C 1 242 ? 40.314  -16.847 5.264   1.00 57.76  ? 254 ILE C CG1 1 
ATOM   6070 C CG2 . ILE C 1 242 ? 40.881  -14.365 5.355   1.00 56.73  ? 254 ILE C CG2 1 
ATOM   6071 C CD1 . ILE C 1 242 ? 41.298  -17.448 4.255   1.00 64.12  ? 254 ILE C CD1 1 
ATOM   6072 N N   . SER C 1 243 ? 38.004  -12.687 5.382   1.00 50.58  ? 255 SER C N   1 
ATOM   6073 C CA  . SER C 1 243 ? 37.621  -11.442 4.728   1.00 48.74  ? 255 SER C CA  1 
ATOM   6074 C C   . SER C 1 243 ? 38.816  -10.503 4.660   1.00 53.85  ? 255 SER C C   1 
ATOM   6075 O O   . SER C 1 243 ? 39.578  -10.390 5.622   1.00 54.60  ? 255 SER C O   1 
ATOM   6076 C CB  . SER C 1 243 ? 36.457  -10.781 5.454   1.00 48.28  ? 255 SER C CB  1 
ATOM   6077 O OG  . SER C 1 243 ? 35.263  -11.521 5.275   1.00 49.74  ? 255 SER C OG  1 
ATOM   6078 N N   . PHE C 1 244 ? 38.996  -9.868  3.499   1.00 50.01  ? 256 PHE C N   1 
ATOM   6079 C CA  . PHE C 1 244 ? 39.982  -8.816  3.277   1.00 50.04  ? 256 PHE C CA  1 
ATOM   6080 C C   . PHE C 1 244 ? 39.232  -7.535  2.916   1.00 53.00  ? 256 PHE C C   1 
ATOM   6081 O O   . PHE C 1 244 ? 38.826  -7.376  1.760   1.00 52.81  ? 256 PHE C O   1 
ATOM   6082 C CB  . PHE C 1 244 ? 40.991  -9.217  2.182   1.00 52.78  ? 256 PHE C CB  1 
ATOM   6083 C CG  . PHE C 1 244 ? 41.704  -10.530 2.414   1.00 55.24  ? 256 PHE C CG  1 
ATOM   6084 C CD1 . PHE C 1 244 ? 42.868  -10.583 3.178   1.00 58.98  ? 256 PHE C CD1 1 
ATOM   6085 C CD2 . PHE C 1 244 ? 41.228  -11.708 1.847   1.00 56.80  ? 256 PHE C CD2 1 
ATOM   6086 C CE1 . PHE C 1 244 ? 43.524  -11.797 3.394   1.00 60.96  ? 256 PHE C CE1 1 
ATOM   6087 C CE2 . PHE C 1 244 ? 41.884  -12.921 2.064   1.00 60.61  ? 256 PHE C CE2 1 
ATOM   6088 C CZ  . PHE C 1 244 ? 43.028  -12.957 2.834   1.00 59.91  ? 256 PHE C CZ  1 
ATOM   6089 N N   . PRO C 1 245 ? 38.959  -6.641  3.903   1.00 48.15  ? 257 PRO C N   1 
ATOM   6090 C CA  . PRO C 1 245 ? 38.307  -5.364  3.573   1.00 46.55  ? 257 PRO C CA  1 
ATOM   6091 C C   . PRO C 1 245 ? 39.185  -4.506  2.666   1.00 50.64  ? 257 PRO C C   1 
ATOM   6092 O O   . PRO C 1 245 ? 40.410  -4.567  2.790   1.00 51.12  ? 257 PRO C O   1 
ATOM   6093 C CB  . PRO C 1 245 ? 38.098  -4.716  4.946   1.00 48.05  ? 257 PRO C CB  1 
ATOM   6094 C CG  . PRO C 1 245 ? 38.148  -5.831  5.922   1.00 52.75  ? 257 PRO C CG  1 
ATOM   6095 C CD  . PRO C 1 245 ? 39.172  -6.762  5.359   1.00 49.78  ? 257 PRO C CD  1 
ATOM   6096 N N   . TRP C 1 246 ? 38.569  -3.711  1.751   1.00 46.29  ? 258 TRP C N   1 
ATOM   6097 C CA  . TRP C 1 246 ? 39.312  -2.939  0.734   1.00 45.96  ? 258 TRP C CA  1 
ATOM   6098 C C   . TRP C 1 246 ? 40.365  -2.000  1.342   1.00 51.60  ? 258 TRP C C   1 
ATOM   6099 O O   . TRP C 1 246 ? 41.433  -1.839  0.750   1.00 52.55  ? 258 TRP C O   1 
ATOM   6100 C CB  . TRP C 1 246 ? 38.377  -2.141  -0.180  1.00 42.67  ? 258 TRP C CB  1 
ATOM   6101 C CG  . TRP C 1 246 ? 37.531  -2.973  -1.100  1.00 42.07  ? 258 TRP C CG  1 
ATOM   6102 C CD1 . TRP C 1 246 ? 36.169  -2.984  -1.168  1.00 43.44  ? 258 TRP C CD1 1 
ATOM   6103 C CD2 . TRP C 1 246 ? 37.991  -3.874  -2.118  1.00 42.40  ? 258 TRP C CD2 1 
ATOM   6104 N NE1 . TRP C 1 246 ? 35.750  -3.841  -2.156  1.00 42.11  ? 258 TRP C NE1 1 
ATOM   6105 C CE2 . TRP C 1 246 ? 36.845  -4.411  -2.748  1.00 44.66  ? 258 TRP C CE2 1 
ATOM   6106 C CE3 . TRP C 1 246 ? 39.264  -4.280  -2.566  1.00 44.89  ? 258 TRP C CE3 1 
ATOM   6107 C CZ2 . TRP C 1 246 ? 36.931  -5.355  -3.777  1.00 44.19  ? 258 TRP C CZ2 1 
ATOM   6108 C CZ3 . TRP C 1 246 ? 39.346  -5.208  -3.590  1.00 46.52  ? 258 TRP C CZ3 1 
ATOM   6109 C CH2 . TRP C 1 246 ? 38.190  -5.738  -4.180  1.00 46.06  ? 258 TRP C CH2 1 
ATOM   6110 N N   . ASN C 1 247 ? 40.074  -1.418  2.529   1.00 49.21  ? 259 ASN C N   1 
ATOM   6111 C CA  . ASN C 1 247 ? 40.969  -0.521  3.271   1.00 51.14  ? 259 ASN C CA  1 
ATOM   6112 C C   . ASN C 1 247 ? 42.164  -1.288  3.883   1.00 59.68  ? 259 ASN C C   1 
ATOM   6113 O O   . ASN C 1 247 ? 43.184  -0.669  4.199   1.00 61.31  ? 259 ASN C O   1 
ATOM   6114 C CB  . ASN C 1 247 ? 40.192  0.249   4.367   1.00 49.58  ? 259 ASN C CB  1 
ATOM   6115 C CG  . ASN C 1 247 ? 39.512  -0.609  5.413   1.00 79.31  ? 259 ASN C CG  1 
ATOM   6116 O OD1 . ASN C 1 247 ? 38.794  -1.565  5.114   1.00 66.70  ? 259 ASN C OD1 1 
ATOM   6117 N ND2 . ASN C 1 247 ? 39.673  -0.244  6.674   1.00 79.86  ? 259 ASN C ND2 1 
ATOM   6118 N N   . GLU C 1 248 ? 42.036  -2.624  4.031   1.00 57.42  ? 260 GLU C N   1 
ATOM   6119 C CA  . GLU C 1 248 ? 43.043  -3.502  4.627   1.00 59.13  ? 260 GLU C CA  1 
ATOM   6120 C C   . GLU C 1 248 ? 43.844  -4.279  3.557   1.00 65.61  ? 260 GLU C C   1 
ATOM   6121 O O   . GLU C 1 248 ? 44.604  -5.182  3.914   1.00 67.04  ? 260 GLU C O   1 
ATOM   6122 C CB  . GLU C 1 248 ? 42.367  -4.480  5.610   1.00 59.86  ? 260 GLU C CB  1 
ATOM   6123 C CG  . GLU C 1 248 ? 42.124  -3.884  6.989   1.00 71.70  ? 260 GLU C CG  1 
ATOM   6124 C CD  . GLU C 1 248 ? 41.125  -4.621  7.865   1.00 97.15  ? 260 GLU C CD  1 
ATOM   6125 O OE1 . GLU C 1 248 ? 41.293  -5.844  8.088   1.00 82.71  ? 260 GLU C OE1 1 
ATOM   6126 O OE2 . GLU C 1 248 ? 40.183  -3.959  8.358   1.00 97.43  ? 260 GLU C OE2 1 
ATOM   6127 N N   . ILE C 1 249 ? 43.684  -3.934  2.261   1.00 62.51  ? 261 ILE C N   1 
ATOM   6128 C CA  . ILE C 1 249 ? 44.435  -4.571  1.166   1.00 63.81  ? 261 ILE C CA  1 
ATOM   6129 C C   . ILE C 1 249 ? 45.510  -3.588  0.680   1.00 71.43  ? 261 ILE C C   1 
ATOM   6130 O O   . ILE C 1 249 ? 45.172  -2.493  0.226   1.00 71.52  ? 261 ILE C O   1 
ATOM   6131 C CB  . ILE C 1 249 ? 43.496  -5.060  0.011   1.00 65.47  ? 261 ILE C CB  1 
ATOM   6132 C CG1 . ILE C 1 249 ? 42.566  -6.211  0.484   1.00 64.21  ? 261 ILE C CG1 1 
ATOM   6133 C CG2 . ILE C 1 249 ? 44.301  -5.475  -1.238  1.00 68.01  ? 261 ILE C CG2 1 
ATOM   6134 C CD1 . ILE C 1 249 ? 41.314  -6.455  -0.372  1.00 65.55  ? 261 ILE C CD1 1 
ATOM   6135 N N   . ARG C 1 250 ? 46.802  -3.976  0.791   1.00 70.39  ? 262 ARG C N   1 
ATOM   6136 C CA  . ARG C 1 250 ? 47.928  -3.178  0.293   1.00 72.10  ? 262 ARG C CA  1 
ATOM   6137 C C   . ARG C 1 250 ? 47.902  -3.158  -1.243  1.00 76.09  ? 262 ARG C C   1 
ATOM   6138 O O   . ARG C 1 250 ? 47.963  -2.082  -1.840  1.00 76.63  ? 262 ARG C O   1 
ATOM   6139 C CB  . ARG C 1 250 ? 49.271  -3.711  0.831   1.00 75.26  ? 262 ARG C CB  1 
ATOM   6140 C CG  . ARG C 1 250 ? 50.472  -2.800  0.563   1.00 89.63  ? 262 ARG C CG  1 
ATOM   6141 C CD  . ARG C 1 250 ? 51.746  -3.352  1.182   1.00 106.11 ? 262 ARG C CD  1 
ATOM   6142 N NE  . ARG C 1 250 ? 52.798  -3.581  0.186   1.00 120.06 ? 262 ARG C NE  1 
ATOM   6143 C CZ  . ARG C 1 250 ? 53.747  -2.702  -0.132  1.00 135.48 ? 262 ARG C CZ  1 
ATOM   6144 N NH1 . ARG C 1 250 ? 53.788  -1.514  0.459   1.00 125.73 ? 262 ARG C NH1 1 
ATOM   6145 N NH2 . ARG C 1 250 ? 54.659  -3.003  -1.049  1.00 118.73 ? 262 ARG C NH2 1 
ATOM   6146 N N   . ASN C 1 251 ? 47.793  -4.346  -1.872  1.00 71.48  ? 263 ASN C N   1 
ATOM   6147 C CA  . ASN C 1 251 ? 47.641  -4.500  -3.318  1.00 70.79  ? 263 ASN C CA  1 
ATOM   6148 C C   . ASN C 1 251 ? 47.079  -5.871  -3.674  1.00 72.44  ? 263 ASN C C   1 
ATOM   6149 O O   . ASN C 1 251 ? 47.122  -6.806  -2.868  1.00 72.03  ? 263 ASN C O   1 
ATOM   6150 C CB  . ASN C 1 251 ? 48.971  -4.267  -4.069  1.00 73.96  ? 263 ASN C CB  1 
ATOM   6151 C CG  . ASN C 1 251 ? 50.097  -5.214  -3.722  1.00 93.69  ? 263 ASN C CG  1 
ATOM   6152 O OD1 . ASN C 1 251 ? 50.095  -6.400  -4.080  1.00 88.10  ? 263 ASN C OD1 1 
ATOM   6153 N ND2 . ASN C 1 251 ? 51.121  -4.683  -3.081  1.00 85.04  ? 263 ASN C ND2 1 
ATOM   6154 N N   . ILE C 1 252 ? 46.535  -5.966  -4.888  1.00 66.98  ? 264 ILE C N   1 
ATOM   6155 C CA  . ILE C 1 252 ? 46.210  -7.215  -5.562  1.00 65.71  ? 264 ILE C CA  1 
ATOM   6156 C C   . ILE C 1 252 ? 47.114  -7.298  -6.798  1.00 70.21  ? 264 ILE C C   1 
ATOM   6157 O O   . ILE C 1 252 ? 47.378  -6.281  -7.436  1.00 70.24  ? 264 ILE C O   1 
ATOM   6158 C CB  . ILE C 1 252 ? 44.682  -7.299  -5.881  1.00 66.14  ? 264 ILE C CB  1 
ATOM   6159 C CG1 . ILE C 1 252 ? 43.875  -7.479  -4.583  1.00 64.42  ? 264 ILE C CG1 1 
ATOM   6160 C CG2 . ILE C 1 252 ? 44.358  -8.436  -6.859  1.00 67.06  ? 264 ILE C CG2 1 
ATOM   6161 C CD1 . ILE C 1 252 ? 42.658  -6.694  -4.512  1.00 68.60  ? 264 ILE C CD1 1 
ATOM   6162 N N   . SER C 1 253 ? 47.638  -8.493  -7.088  1.00 67.36  ? 265 SER C N   1 
ATOM   6163 C CA  . SER C 1 253 ? 48.390  -8.770  -8.312  1.00 68.44  ? 265 SER C CA  1 
ATOM   6164 C C   . SER C 1 253 ? 47.849  -10.039 -8.989  1.00 71.42  ? 265 SER C C   1 
ATOM   6165 O O   . SER C 1 253 ? 47.324  -10.928 -8.314  1.00 69.45  ? 265 SER C O   1 
ATOM   6166 C CB  . SER C 1 253 ? 49.885  -8.886  -8.020  1.00 73.96  ? 265 SER C CB  1 
ATOM   6167 O OG  . SER C 1 253 ? 50.165  -9.627  -6.842  1.00 82.24  ? 265 SER C OG  1 
ATOM   6168 N N   . TYR C 1 254 ? 47.907  -10.082 -10.324 1.00 69.28  ? 266 TYR C N   1 
ATOM   6169 C CA  . TYR C 1 254 ? 47.521  -11.261 -11.095 1.00 70.07  ? 266 TYR C CA  1 
ATOM   6170 C C   . TYR C 1 254 ? 48.530  -11.527 -12.215 1.00 79.31  ? 266 TYR C C   1 
ATOM   6171 O O   . TYR C 1 254 ? 48.922  -10.602 -12.930 1.00 80.20  ? 266 TYR C O   1 
ATOM   6172 C CB  . TYR C 1 254 ? 46.091  -11.130 -11.664 1.00 68.65  ? 266 TYR C CB  1 
ATOM   6173 C CG  . TYR C 1 254 ? 45.727  -12.235 -12.638 1.00 70.68  ? 266 TYR C CG  1 
ATOM   6174 C CD1 . TYR C 1 254 ? 45.341  -13.494 -12.184 1.00 72.29  ? 266 TYR C CD1 1 
ATOM   6175 C CD2 . TYR C 1 254 ? 45.810  -12.035 -14.014 1.00 72.46  ? 266 TYR C CD2 1 
ATOM   6176 C CE1 . TYR C 1 254 ? 45.027  -14.520 -13.075 1.00 73.44  ? 266 TYR C CE1 1 
ATOM   6177 C CE2 . TYR C 1 254 ? 45.504  -13.054 -14.914 1.00 74.33  ? 266 TYR C CE2 1 
ATOM   6178 C CZ  . TYR C 1 254 ? 45.116  -14.297 -14.440 1.00 81.97  ? 266 TYR C CZ  1 
ATOM   6179 O OH  . TYR C 1 254 ? 44.816  -15.301 -15.331 1.00 85.78  ? 266 TYR C OH  1 
ATOM   6180 N N   . SER C 1 255 ? 48.928  -12.805 -12.370 1.00 78.59  ? 267 SER C N   1 
ATOM   6181 C CA  . SER C 1 255 ? 49.817  -13.282 -13.427 1.00 81.83  ? 267 SER C CA  1 
ATOM   6182 C C   . SER C 1 255 ? 49.561  -14.758 -13.693 1.00 87.90  ? 267 SER C C   1 
ATOM   6183 O O   . SER C 1 255 ? 49.846  -15.588 -12.826 1.00 88.61  ? 267 SER C O   1 
ATOM   6184 C CB  . SER C 1 255 ? 51.283  -13.054 -13.050 1.00 87.50  ? 267 SER C CB  1 
ATOM   6185 O OG  . SER C 1 255 ? 52.177  -13.620 -13.996 1.00 98.06  ? 267 SER C OG  1 
ATOM   6186 N N   . ASP C 1 256 ? 49.006  -15.077 -14.882 1.00 84.73  ? 268 ASP C N   1 
ATOM   6187 C CA  . ASP C 1 256 ? 48.853  -16.438 -15.423 1.00 85.96  ? 268 ASP C CA  1 
ATOM   6188 C C   . ASP C 1 256 ? 48.160  -17.387 -14.415 1.00 87.32  ? 268 ASP C C   1 
ATOM   6189 O O   . ASP C 1 256 ? 48.818  -18.205 -13.757 1.00 87.89  ? 268 ASP C O   1 
ATOM   6190 C CB  . ASP C 1 256 ? 50.219  -17.009 -15.886 1.00 91.14  ? 268 ASP C CB  1 
ATOM   6191 C CG  . ASP C 1 256 ? 50.162  -18.351 -16.602 1.00 104.18 ? 268 ASP C CG  1 
ATOM   6192 O OD1 . ASP C 1 256 ? 49.227  -18.557 -17.409 1.00 104.90 ? 268 ASP C OD1 1 
ATOM   6193 O OD2 . ASP C 1 256 ? 51.072  -19.181 -16.381 1.00 111.08 ? 268 ASP C OD2 1 
ATOM   6194 N N   . LYS C 1 257 ? 46.823  -17.219 -14.280 1.00 80.33  ? 269 LYS C N   1 
ATOM   6195 C CA  . LYS C 1 257 ? 45.876  -18.050 -13.513 1.00 78.04  ? 269 LYS C CA  1 
ATOM   6196 C C   . LYS C 1 257 ? 45.976  -17.853 -11.972 1.00 78.09  ? 269 LYS C C   1 
ATOM   6197 O O   . LYS C 1 257 ? 45.019  -18.194 -11.270 1.00 75.63  ? 269 LYS C O   1 
ATOM   6198 C CB  . LYS C 1 257 ? 45.991  -19.547 -13.882 1.00 82.49  ? 269 LYS C CB  1 
ATOM   6199 C CG  . LYS C 1 257 ? 45.361  -19.877 -15.237 1.00 97.45  ? 269 LYS C CG  1 
ATOM   6200 C CD  . LYS C 1 257 ? 45.633  -21.311 -15.686 1.00 110.75 ? 269 LYS C CD  1 
ATOM   6201 C CE  . LYS C 1 257 ? 46.916  -21.474 -16.478 1.00 124.66 ? 269 LYS C CE  1 
ATOM   6202 N NZ  . LYS C 1 257 ? 46.792  -20.949 -17.866 1.00 133.93 ? 269 LYS C NZ  1 
ATOM   6203 N N   . GLU C 1 258 ? 47.085  -17.274 -11.458 1.00 73.51  ? 270 GLU C N   1 
ATOM   6204 C CA  . GLU C 1 258 ? 47.285  -17.097 -10.019 1.00 71.61  ? 270 GLU C CA  1 
ATOM   6205 C C   . GLU C 1 258 ? 47.128  -15.629 -9.595  1.00 72.37  ? 270 GLU C C   1 
ATOM   6206 O O   . GLU C 1 258 ? 47.766  -14.747 -10.172 1.00 72.78  ? 270 GLU C O   1 
ATOM   6207 C CB  . GLU C 1 258 ? 48.662  -17.632 -9.586  1.00 75.15  ? 270 GLU C CB  1 
ATOM   6208 C CG  . GLU C 1 258 ? 48.745  -18.041 -8.116  1.00 85.27  ? 270 GLU C CG  1 
ATOM   6209 C CD  . GLU C 1 258 ? 48.130  -19.374 -7.719  1.00 106.75 ? 270 GLU C CD  1 
ATOM   6210 O OE1 . GLU C 1 258 ? 47.892  -20.224 -8.610  1.00 106.62 ? 270 GLU C OE1 1 
ATOM   6211 O OE2 . GLU C 1 258 ? 47.916  -19.581 -6.503  1.00 96.37  ? 270 GLU C OE2 1 
ATOM   6212 N N   . PHE C 1 259 ? 46.262  -15.388 -8.583  1.00 65.63  ? 271 PHE C N   1 
ATOM   6213 C CA  . PHE C 1 259 ? 46.052  -14.101 -7.902  1.00 62.97  ? 271 PHE C CA  1 
ATOM   6214 C C   . PHE C 1 259 ? 46.817  -14.041 -6.579  1.00 67.29  ? 271 PHE C C   1 
ATOM   6215 O O   . PHE C 1 259 ? 47.031  -15.084 -5.959  1.00 67.44  ? 271 PHE C O   1 
ATOM   6216 C CB  . PHE C 1 259 ? 44.567  -13.885 -7.603  1.00 61.61  ? 271 PHE C CB  1 
ATOM   6217 C CG  . PHE C 1 259 ? 43.650  -13.660 -8.776  1.00 61.79  ? 271 PHE C CG  1 
ATOM   6218 C CD1 . PHE C 1 259 ? 43.136  -14.735 -9.493  1.00 64.71  ? 271 PHE C CD1 1 
ATOM   6219 C CD2 . PHE C 1 259 ? 43.212  -12.383 -9.099  1.00 62.08  ? 271 PHE C CD2 1 
ATOM   6220 C CE1 . PHE C 1 259 ? 42.253  -14.531 -10.550 1.00 64.59  ? 271 PHE C CE1 1 
ATOM   6221 C CE2 . PHE C 1 259 ? 42.325  -12.179 -10.156 1.00 64.05  ? 271 PHE C CE2 1 
ATOM   6222 C CZ  . PHE C 1 259 ? 41.854  -13.254 -10.876 1.00 62.58  ? 271 PHE C CZ  1 
ATOM   6223 N N   . THR C 1 260 ? 47.204  -12.821 -6.136  1.00 63.17  ? 272 THR C N   1 
ATOM   6224 C CA  . THR C 1 260 ? 47.880  -12.600 -4.849  1.00 62.75  ? 272 THR C CA  1 
ATOM   6225 C C   . THR C 1 260 ? 47.230  -11.396 -4.163  1.00 65.44  ? 272 THR C C   1 
ATOM   6226 O O   . THR C 1 260 ? 47.229  -10.295 -4.721  1.00 64.51  ? 272 THR C O   1 
ATOM   6227 C CB  . THR C 1 260 ? 49.408  -12.426 -5.038  1.00 66.20  ? 272 THR C CB  1 
ATOM   6228 O OG1 . THR C 1 260 ? 49.911  -13.465 -5.878  1.00 65.87  ? 272 THR C OG1 1 
ATOM   6229 C CG2 . THR C 1 260 ? 50.175  -12.412 -3.714  1.00 62.83  ? 272 THR C CG2 1 
ATOM   6230 N N   . ILE C 1 261 ? 46.635  -11.624 -2.978  1.00 61.19  ? 273 ILE C N   1 
ATOM   6231 C CA  . ILE C 1 261 ? 46.128  -10.560 -2.112  1.00 59.40  ? 273 ILE C CA  1 
ATOM   6232 C C   . ILE C 1 261 ? 47.213  -10.262 -1.081  1.00 66.51  ? 273 ILE C C   1 
ATOM   6233 O O   . ILE C 1 261 ? 47.535  -11.125 -0.258  1.00 67.23  ? 273 ILE C O   1 
ATOM   6234 C CB  . ILE C 1 261 ? 44.755  -10.897 -1.450  1.00 59.92  ? 273 ILE C CB  1 
ATOM   6235 C CG1 . ILE C 1 261 ? 43.731  -11.460 -2.466  1.00 58.94  ? 273 ILE C CG1 1 
ATOM   6236 C CG2 . ILE C 1 261 ? 44.190  -9.676  -0.697  1.00 58.80  ? 273 ILE C CG2 1 
ATOM   6237 C CD1 . ILE C 1 261 ? 42.590  -12.287 -1.833  1.00 63.94  ? 273 ILE C CD1 1 
ATOM   6238 N N   . LYS C 1 262 ? 47.806  -9.059  -1.153  1.00 64.91  ? 274 LYS C N   1 
ATOM   6239 C CA  . LYS C 1 262 ? 48.794  -8.612  -0.165  1.00 66.23  ? 274 LYS C CA  1 
ATOM   6240 C C   . LYS C 1 262 ? 48.085  -7.727  0.875   1.00 69.14  ? 274 LYS C C   1 
ATOM   6241 O O   . LYS C 1 262 ? 47.636  -6.631  0.534   1.00 67.51  ? 274 LYS C O   1 
ATOM   6242 C CB  . LYS C 1 262 ? 49.986  -7.891  -0.831  1.00 70.78  ? 274 LYS C CB  1 
ATOM   6243 C CG  . LYS C 1 262 ? 50.808  -8.799  -1.749  1.00 95.34  ? 274 LYS C CG  1 
ATOM   6244 C CD  . LYS C 1 262 ? 52.143  -8.180  -2.145  1.00 110.99 ? 274 LYS C CD  1 
ATOM   6245 C CE  . LYS C 1 262 ? 52.732  -8.834  -3.373  1.00 121.22 ? 274 LYS C CE  1 
ATOM   6246 N NZ  . LYS C 1 262 ? 53.895  -8.071  -3.890  1.00 128.35 ? 274 LYS C NZ  1 
ATOM   6247 N N   . PRO C 1 263 ? 47.904  -8.216  2.125   1.00 67.01  ? 275 PRO C N   1 
ATOM   6248 C CA  . PRO C 1 263 ? 47.257  -7.381  3.158   1.00 66.48  ? 275 PRO C CA  1 
ATOM   6249 C C   . PRO C 1 263 ? 48.130  -6.207  3.607   1.00 74.91  ? 275 PRO C C   1 
ATOM   6250 O O   . PRO C 1 263 ? 49.352  -6.248  3.452   1.00 76.63  ? 275 PRO C O   1 
ATOM   6251 C CB  . PRO C 1 263 ? 47.016  -8.361  4.318   1.00 67.76  ? 275 PRO C CB  1 
ATOM   6252 C CG  . PRO C 1 263 ? 47.231  -9.732  3.739   1.00 72.83  ? 275 PRO C CG  1 
ATOM   6253 C CD  . PRO C 1 263 ? 48.241  -9.549  2.659   1.00 69.66  ? 275 PRO C CD  1 
ATOM   6254 N N   . LEU C 1 264 ? 47.495  -5.160  4.159   1.00 72.75  ? 276 LEU C N   1 
ATOM   6255 C CA  . LEU C 1 264 ? 48.164  -3.965  4.680   1.00 74.80  ? 276 LEU C CA  1 
ATOM   6256 C C   . LEU C 1 264 ? 48.990  -4.304  5.931   1.00 82.91  ? 276 LEU C C   1 
ATOM   6257 O O   . LEU C 1 264 ? 50.145  -3.882  6.035   1.00 84.83  ? 276 LEU C O   1 
ATOM   6258 C CB  . LEU C 1 264 ? 47.114  -2.889  4.996   1.00 73.56  ? 276 LEU C CB  1 
ATOM   6259 C CG  . LEU C 1 264 ? 47.553  -1.430  4.895   1.00 78.87  ? 276 LEU C CG  1 
ATOM   6260 C CD1 . LEU C 1 264 ? 47.680  -0.982  3.440   1.00 78.78  ? 276 LEU C CD1 1 
ATOM   6261 C CD2 . LEU C 1 264 ? 46.557  -0.531  5.602   1.00 80.06  ? 276 LEU C CD2 1 
ATOM   6262 N N   . ASP C 1 265 ? 48.396  -5.079  6.865   1.00 79.96  ? 277 ASP C N   1 
ATOM   6263 C CA  . ASP C 1 265 ? 49.055  -5.615  8.056   1.00 81.50  ? 277 ASP C CA  1 
ATOM   6264 C C   . ASP C 1 265 ? 49.991  -6.766  7.655   1.00 88.39  ? 277 ASP C C   1 
ATOM   6265 O O   . ASP C 1 265 ? 49.559  -7.715  6.994   1.00 87.36  ? 277 ASP C O   1 
ATOM   6266 C CB  . ASP C 1 265 ? 47.998  -6.079  9.086   1.00 82.22  ? 277 ASP C CB  1 
ATOM   6267 C CG  . ASP C 1 265 ? 48.509  -6.695  10.386  1.00 95.93  ? 277 ASP C CG  1 
ATOM   6268 O OD1 . ASP C 1 265 ? 49.682  -6.436  10.755  1.00 97.58  ? 277 ASP C OD1 1 
ATOM   6269 O OD2 . ASP C 1 265 ? 47.721  -7.393  11.060  1.00 102.95 ? 277 ASP C OD2 1 
ATOM   6270 N N   . LYS C 1 266 ? 51.271  -6.675  8.060   1.00 88.11  ? 278 LYS C N   1 
ATOM   6271 C CA  . LYS C 1 266 ? 52.293  -7.677  7.745   1.00 90.02  ? 278 LYS C CA  1 
ATOM   6272 C C   . LYS C 1 266 ? 52.150  -8.950  8.607   1.00 95.15  ? 278 LYS C C   1 
ATOM   6273 O O   . LYS C 1 266 ? 52.745  -9.977  8.269   1.00 95.28  ? 278 LYS C O   1 
ATOM   6274 C CB  . LYS C 1 266 ? 53.697  -7.082  7.900   1.00 94.69  ? 278 LYS C CB  1 
ATOM   6275 C CG  . LYS C 1 266 ? 54.471  -7.004  6.587   1.00 111.60 ? 278 LYS C CG  1 
ATOM   6276 C CD  . LYS C 1 266 ? 54.248  -5.683  5.855   1.00 121.95 ? 278 LYS C CD  1 
ATOM   6277 C CE  . LYS C 1 266 ? 55.130  -5.576  4.637   1.00 134.08 ? 278 LYS C CE  1 
ATOM   6278 N NZ  . LYS C 1 266 ? 54.986  -4.260  3.960   1.00 142.87 ? 278 LYS C NZ  1 
ATOM   6279 N N   . LYS C 1 267 ? 51.367  -8.881  9.711   1.00 91.97  ? 279 LYS C N   1 
ATOM   6280 C CA  . LYS C 1 267 ? 51.066  -10.026 10.582  1.00 92.03  ? 279 LYS C CA  1 
ATOM   6281 C C   . LYS C 1 267 ? 50.136  -11.021 9.882   1.00 93.80  ? 279 LYS C C   1 
ATOM   6282 O O   . LYS C 1 267 ? 50.249  -12.229 10.112  1.00 94.24  ? 279 LYS C O   1 
ATOM   6283 C CB  . LYS C 1 267 ? 50.448  -9.563  11.913  1.00 94.66  ? 279 LYS C CB  1 
ATOM   6284 C CG  . LYS C 1 267 ? 51.455  -9.553  13.063  1.00 119.15 ? 279 LYS C CG  1 
ATOM   6285 C CD  . LYS C 1 267 ? 50.837  -9.126  14.392  1.00 132.92 ? 279 LYS C CD  1 
ATOM   6286 C CE  . LYS C 1 267 ? 51.091  -7.668  14.708  1.00 146.63 ? 279 LYS C CE  1 
ATOM   6287 N NZ  . LYS C 1 267 ? 50.637  -7.309  16.077  1.00 155.60 ? 279 LYS C NZ  1 
ATOM   6288 N N   . ILE C 1 268 ? 49.216  -10.509 9.035   1.00 87.44  ? 280 ILE C N   1 
ATOM   6289 C CA  . ILE C 1 268 ? 48.329  -11.318 8.193   1.00 85.22  ? 280 ILE C CA  1 
ATOM   6290 C C   . ILE C 1 268 ? 49.124  -11.791 6.964   1.00 88.83  ? 280 ILE C C   1 
ATOM   6291 O O   . ILE C 1 268 ? 49.780  -10.980 6.304   1.00 89.03  ? 280 ILE C O   1 
ATOM   6292 C CB  . ILE C 1 268 ? 47.034  -10.541 7.813   1.00 86.20  ? 280 ILE C CB  1 
ATOM   6293 C CG1 . ILE C 1 268 ? 46.327  -9.985  9.080   1.00 85.77  ? 280 ILE C CG1 1 
ATOM   6294 C CG2 . ILE C 1 268 ? 46.078  -11.426 6.983   1.00 85.75  ? 280 ILE C CG2 1 
ATOM   6295 C CD1 . ILE C 1 268 ? 45.375  -8.801  8.865   1.00 92.60  ? 280 ILE C CD1 1 
ATOM   6296 N N   . ASP C 1 269 ? 49.085  -13.110 6.689   1.00 84.92  ? 281 ASP C N   1 
ATOM   6297 C CA  . ASP C 1 269 ? 49.792  -13.759 5.575   1.00 85.27  ? 281 ASP C CA  1 
ATOM   6298 C C   . ASP C 1 269 ? 49.195  -13.358 4.227   1.00 84.00  ? 281 ASP C C   1 
ATOM   6299 O O   . ASP C 1 269 ? 47.995  -13.067 4.164   1.00 81.72  ? 281 ASP C O   1 
ATOM   6300 C CB  . ASP C 1 269 ? 49.737  -15.292 5.734   1.00 88.36  ? 281 ASP C CB  1 
ATOM   6301 C CG  . ASP C 1 269 ? 50.481  -15.861 6.934   1.00 105.32 ? 281 ASP C CG  1 
ATOM   6302 O OD1 . ASP C 1 269 ? 50.681  -15.116 7.926   1.00 106.94 ? 281 ASP C OD1 1 
ATOM   6303 O OD2 . ASP C 1 269 ? 50.828  -17.059 6.899   1.00 113.15 ? 281 ASP C OD2 1 
ATOM   6304 N N   . VAL C 1 270 ? 50.025  -13.340 3.150   1.00 78.28  ? 282 VAL C N   1 
ATOM   6305 C CA  . VAL C 1 270 ? 49.525  -13.094 1.789   1.00 76.04  ? 282 VAL C CA  1 
ATOM   6306 C C   . VAL C 1 270 ? 48.640  -14.270 1.367   1.00 76.28  ? 282 VAL C C   1 
ATOM   6307 O O   . VAL C 1 270 ? 48.904  -15.414 1.759   1.00 76.65  ? 282 VAL C O   1 
ATOM   6308 C CB  . VAL C 1 270 ? 50.603  -12.768 0.714   1.00 81.36  ? 282 VAL C CB  1 
ATOM   6309 C CG1 . VAL C 1 270 ? 51.445  -11.561 1.114   1.00 81.81  ? 282 VAL C CG1 1 
ATOM   6310 C CG2 . VAL C 1 270 ? 51.482  -13.970 0.380   1.00 83.24  ? 282 VAL C CG2 1 
ATOM   6311 N N   . PHE C 1 271 ? 47.568  -13.980 0.616   1.00 68.65  ? 283 PHE C N   1 
ATOM   6312 C CA  . PHE C 1 271 ? 46.670  -15.019 0.140   1.00 66.87  ? 283 PHE C CA  1 
ATOM   6313 C C   . PHE C 1 271 ? 46.815  -15.164 -1.362  1.00 69.97  ? 283 PHE C C   1 
ATOM   6314 O O   . PHE C 1 271 ? 46.506  -14.242 -2.119  1.00 68.94  ? 283 PHE C O   1 
ATOM   6315 C CB  . PHE C 1 271 ? 45.209  -14.745 0.548   1.00 66.49  ? 283 PHE C CB  1 
ATOM   6316 C CG  . PHE C 1 271 ? 44.303  -15.946 0.399   1.00 67.50  ? 283 PHE C CG  1 
ATOM   6317 C CD1 . PHE C 1 271 ? 44.244  -16.922 1.389   1.00 70.50  ? 283 PHE C CD1 1 
ATOM   6318 C CD2 . PHE C 1 271 ? 43.511  -16.106 -0.737  1.00 68.58  ? 283 PHE C CD2 1 
ATOM   6319 C CE1 . PHE C 1 271 ? 43.427  -18.049 1.236   1.00 71.42  ? 283 PHE C CE1 1 
ATOM   6320 C CE2 . PHE C 1 271 ? 42.701  -17.236 -0.892  1.00 71.02  ? 283 PHE C CE2 1 
ATOM   6321 C CZ  . PHE C 1 271 ? 42.654  -18.193 0.101   1.00 69.78  ? 283 PHE C CZ  1 
ATOM   6322 N N   . LYS C 1 272 ? 47.323  -16.322 -1.785  1.00 67.29  ? 284 LYS C N   1 
ATOM   6323 C CA  . LYS C 1 272 ? 47.449  -16.689 -3.192  1.00 67.71  ? 284 LYS C CA  1 
ATOM   6324 C C   . LYS C 1 272 ? 46.356  -17.689 -3.564  1.00 70.64  ? 284 LYS C C   1 
ATOM   6325 O O   . LYS C 1 272 ? 46.117  -18.639 -2.817  1.00 70.95  ? 284 LYS C O   1 
ATOM   6326 C CB  . LYS C 1 272 ? 48.852  -17.257 -3.492  1.00 72.52  ? 284 LYS C CB  1 
ATOM   6327 C CG  . LYS C 1 272 ? 49.957  -16.207 -3.402  1.00 85.80  ? 284 LYS C CG  1 
ATOM   6328 C CD  . LYS C 1 272 ? 51.333  -16.813 -3.648  1.00 96.42  ? 284 LYS C CD  1 
ATOM   6329 C CE  . LYS C 1 272 ? 52.308  -15.841 -4.261  1.00 111.26 ? 284 LYS C CE  1 
ATOM   6330 N NZ  . LYS C 1 272 ? 52.758  -14.805 -3.291  1.00 122.10 ? 284 LYS C NZ  1 
ATOM   6331 N N   . PHE C 1 273 ? 45.669  -17.463 -4.695  1.00 65.72  ? 285 PHE C N   1 
ATOM   6332 C CA  . PHE C 1 273 ? 44.680  -18.422 -5.190  1.00 65.02  ? 285 PHE C CA  1 
ATOM   6333 C C   . PHE C 1 273 ? 44.686  -18.527 -6.715  1.00 70.62  ? 285 PHE C C   1 
ATOM   6334 O O   . PHE C 1 273 ? 45.162  -17.628 -7.409  1.00 70.47  ? 285 PHE C O   1 
ATOM   6335 C CB  . PHE C 1 273 ? 43.269  -18.101 -4.677  1.00 64.42  ? 285 PHE C CB  1 
ATOM   6336 C CG  . PHE C 1 273 ? 42.686  -16.771 -5.092  1.00 63.43  ? 285 PHE C CG  1 
ATOM   6337 C CD1 . PHE C 1 273 ? 41.911  -16.664 -6.235  1.00 65.81  ? 285 PHE C CD1 1 
ATOM   6338 C CD2 . PHE C 1 273 ? 42.870  -15.641 -4.309  1.00 64.09  ? 285 PHE C CD2 1 
ATOM   6339 C CE1 . PHE C 1 273 ? 41.340  -15.445 -6.599  1.00 65.88  ? 285 PHE C CE1 1 
ATOM   6340 C CE2 . PHE C 1 273 ? 42.313  -14.419 -4.679  1.00 65.93  ? 285 PHE C CE2 1 
ATOM   6341 C CZ  . PHE C 1 273 ? 41.543  -14.329 -5.816  1.00 63.99  ? 285 PHE C CZ  1 
ATOM   6342 N N   . ASN C 1 274 ? 44.138  -19.640 -7.216  1.00 69.04  ? 286 ASN C N   1 
ATOM   6343 C CA  . ASN C 1 274 ? 44.099  -20.015 -8.623  1.00 70.65  ? 286 ASN C CA  1 
ATOM   6344 C C   . ASN C 1 274 ? 42.667  -19.986 -9.139  1.00 74.16  ? 286 ASN C C   1 
ATOM   6345 O O   . ASN C 1 274 ? 41.746  -20.427 -8.448  1.00 71.59  ? 286 ASN C O   1 
ATOM   6346 C CB  . ASN C 1 274 ? 44.707  -21.415 -8.803  1.00 74.00  ? 286 ASN C CB  1 
ATOM   6347 C CG  . ASN C 1 274 ? 44.654  -21.947 -10.214 1.00 105.02 ? 286 ASN C CG  1 
ATOM   6348 O OD1 . ASN C 1 274 ? 45.483  -21.607 -11.060 1.00 106.75 ? 286 ASN C OD1 1 
ATOM   6349 N ND2 . ASN C 1 274 ? 43.684  -22.804 -10.497 1.00 95.41  ? 286 ASN C ND2 1 
ATOM   6350 N N   . SER C 1 275 ? 42.489  -19.449 -10.348 1.00 73.31  ? 287 SER C N   1 
ATOM   6351 C CA  . SER C 1 275 ? 41.246  -19.555 -11.102 1.00 73.48  ? 287 SER C CA  1 
ATOM   6352 C C   . SER C 1 275 ? 41.577  -20.032 -12.533 1.00 82.90  ? 287 SER C C   1 
ATOM   6353 O O   . SER C 1 275 ? 42.464  -19.475 -13.191 1.00 83.14  ? 287 SER C O   1 
ATOM   6354 C CB  . SER C 1 275 ? 40.490  -18.233 -11.082 1.00 73.70  ? 287 SER C CB  1 
ATOM   6355 O OG  . SER C 1 275 ? 39.315  -18.279 -11.870 1.00 81.60  ? 287 SER C OG  1 
ATOM   6356 N N   . SER C 1 276 ? 40.868  -21.083 -12.988 1.00 82.61  ? 288 SER C N   1 
ATOM   6357 C CA  . SER C 1 276 ? 41.164  -21.833 -14.216 1.00 85.55  ? 288 SER C CA  1 
ATOM   6358 C C   . SER C 1 276 ? 40.814  -21.070 -15.508 1.00 89.92  ? 288 SER C C   1 
ATOM   6359 O O   . SER C 1 276 ? 41.535  -21.215 -16.494 1.00 91.22  ? 288 SER C O   1 
ATOM   6360 C CB  . SER C 1 276 ? 40.438  -23.179 -14.210 1.00 90.45  ? 288 SER C CB  1 
ATOM   6361 O OG  . SER C 1 276 ? 39.044  -23.049 -13.965 1.00 98.75  ? 288 SER C OG  1 
ATOM   6362 N N   . LYS C 1 277 ? 39.723  -20.273 -15.506 1.00 85.16  ? 289 LYS C N   1 
ATOM   6363 C CA  . LYS C 1 277 ? 39.214  -19.588 -16.703 1.00 85.16  ? 289 LYS C CA  1 
ATOM   6364 C C   . LYS C 1 277 ? 39.746  -18.151 -16.801 1.00 88.59  ? 289 LYS C C   1 
ATOM   6365 O O   . LYS C 1 277 ? 39.577  -17.370 -15.867 1.00 86.83  ? 289 LYS C O   1 
ATOM   6366 C CB  . LYS C 1 277 ? 37.678  -19.573 -16.708 1.00 86.01  ? 289 LYS C CB  1 
ATOM   6367 C CG  . LYS C 1 277 ? 37.006  -20.934 -16.795 1.00 103.64 ? 289 LYS C CG  1 
ATOM   6368 C CD  . LYS C 1 277 ? 35.499  -20.771 -16.661 1.00 114.18 ? 289 LYS C CD  1 
ATOM   6369 C CE  . LYS C 1 277 ? 34.726  -22.010 -17.028 1.00 128.93 ? 289 LYS C CE  1 
ATOM   6370 N NZ  . LYS C 1 277 ? 33.259  -21.753 -17.041 1.00 137.40 ? 289 LYS C NZ  1 
ATOM   6371 N N   . LEU C 1 278 ? 40.344  -17.794 -17.948 1.00 86.22  ? 290 LEU C N   1 
ATOM   6372 C CA  . LEU C 1 278 ? 41.019  -16.506 -18.137 1.00 85.03  ? 290 LEU C CA  1 
ATOM   6373 C C   . LEU C 1 278 ? 40.031  -15.338 -18.243 1.00 83.81  ? 290 LEU C C   1 
ATOM   6374 O O   . LEU C 1 278 ? 40.328  -14.259 -17.725 1.00 81.53  ? 290 LEU C O   1 
ATOM   6375 C CB  . LEU C 1 278 ? 41.932  -16.544 -19.373 1.00 87.97  ? 290 LEU C CB  1 
ATOM   6376 C CG  . LEU C 1 278 ? 43.075  -17.560 -19.328 1.00 95.75  ? 290 LEU C CG  1 
ATOM   6377 C CD1 . LEU C 1 278 ? 43.651  -17.792 -20.712 1.00 98.93  ? 290 LEU C CD1 1 
ATOM   6378 C CD2 . LEU C 1 278 ? 44.170  -17.133 -18.342 1.00 99.09  ? 290 LEU C CD2 1 
ATOM   6379 N N   . ARG C 1 279 ? 38.868  -15.552 -18.902 1.00 78.55  ? 291 ARG C N   1 
ATOM   6380 C CA  . ARG C 1 279 ? 37.813  -14.532 -19.053 1.00 75.37  ? 291 ARG C CA  1 
ATOM   6381 C C   . ARG C 1 279 ? 37.209  -14.166 -17.701 1.00 74.34  ? 291 ARG C C   1 
ATOM   6382 O O   . ARG C 1 279 ? 36.922  -12.994 -17.459 1.00 72.92  ? 291 ARG C O   1 
ATOM   6383 C CB  . ARG C 1 279 ? 36.695  -15.003 -20.002 1.00 76.19  ? 291 ARG C CB  1 
ATOM   6384 C CG  . ARG C 1 279 ? 37.146  -15.351 -21.415 1.00 92.32  ? 291 ARG C CG  1 
ATOM   6385 C CD  . ARG C 1 279 ? 36.331  -16.485 -22.037 1.00 106.61 ? 291 ARG C CD  1 
ATOM   6386 N NE  . ARG C 1 279 ? 36.079  -17.601 -21.115 1.00 115.65 ? 291 ARG C NE  1 
ATOM   6387 C CZ  . ARG C 1 279 ? 36.950  -18.566 -20.825 1.00 132.48 ? 291 ARG C CZ  1 
ATOM   6388 N NH1 . ARG C 1 279 ? 36.619  -19.531 -19.979 1.00 119.04 ? 291 ARG C NH1 1 
ATOM   6389 N NH2 . ARG C 1 279 ? 38.158  -18.571 -21.378 1.00 122.22 ? 291 ARG C NH2 1 
ATOM   6390 N N   . VAL C 1 280 ? 37.015  -15.172 -16.824 1.00 68.51  ? 292 VAL C N   1 
ATOM   6391 C CA  . VAL C 1 280 ? 36.517  -14.998 -15.455 1.00 65.36  ? 292 VAL C CA  1 
ATOM   6392 C C   . VAL C 1 280 ? 37.520  -14.124 -14.659 1.00 66.99  ? 292 VAL C C   1 
ATOM   6393 O O   . VAL C 1 280 ? 37.087  -13.223 -13.944 1.00 64.78  ? 292 VAL C O   1 
ATOM   6394 C CB  . VAL C 1 280 ? 36.230  -16.372 -14.773 1.00 69.31  ? 292 VAL C CB  1 
ATOM   6395 C CG1 . VAL C 1 280 ? 35.870  -16.217 -13.300 1.00 67.07  ? 292 VAL C CG1 1 
ATOM   6396 C CG2 . VAL C 1 280 ? 35.128  -17.132 -15.503 1.00 69.32  ? 292 VAL C CG2 1 
ATOM   6397 N N   . ASN C 1 281 ? 38.839  -14.354 -14.834 1.00 63.95  ? 293 ASN C N   1 
ATOM   6398 C CA  . ASN C 1 281 ? 39.906  -13.627 -14.137 1.00 63.75  ? 293 ASN C CA  1 
ATOM   6399 C C   . ASN C 1 281 ? 39.949  -12.131 -14.498 1.00 68.21  ? 293 ASN C C   1 
ATOM   6400 O O   . ASN C 1 281 ? 40.200  -11.305 -13.616 1.00 67.69  ? 293 ASN C O   1 
ATOM   6401 C CB  . ASN C 1 281 ? 41.259  -14.266 -14.417 1.00 66.13  ? 293 ASN C CB  1 
ATOM   6402 C CG  . ASN C 1 281 ? 41.371  -15.704 -13.954 1.00 85.42  ? 293 ASN C CG  1 
ATOM   6403 O OD1 . ASN C 1 281 ? 40.477  -16.249 -13.299 1.00 76.32  ? 293 ASN C OD1 1 
ATOM   6404 N ND2 . ASN C 1 281 ? 42.455  -16.370 -14.324 1.00 76.18  ? 293 ASN C ND2 1 
ATOM   6405 N N   . LYS C 1 282 ? 39.715  -11.786 -15.779 1.00 65.18  ? 294 LYS C N   1 
ATOM   6406 C CA  . LYS C 1 282 ? 39.602  -10.403 -16.256 1.00 64.38  ? 294 LYS C CA  1 
ATOM   6407 C C   . LYS C 1 282 ? 38.415  -9.710  -15.575 1.00 65.85  ? 294 LYS C C   1 
ATOM   6408 O O   . LYS C 1 282 ? 38.534  -8.557  -15.149 1.00 65.29  ? 294 LYS C O   1 
ATOM   6409 C CB  . LYS C 1 282 ? 39.447  -10.376 -17.791 1.00 68.21  ? 294 LYS C CB  1 
ATOM   6410 C CG  . LYS C 1 282 ? 39.444  -8.971  -18.393 1.00 83.89  ? 294 LYS C CG  1 
ATOM   6411 C CD  . LYS C 1 282 ? 38.936  -8.952  -19.826 1.00 94.02  ? 294 LYS C CD  1 
ATOM   6412 C CE  . LYS C 1 282 ? 38.934  -7.552  -20.390 1.00 105.51 ? 294 LYS C CE  1 
ATOM   6413 N NZ  . LYS C 1 282 ? 38.837  -7.556  -21.874 1.00 120.51 ? 294 LYS C NZ  1 
ATOM   6414 N N   . LEU C 1 283 ? 37.282  -10.429 -15.462 1.00 60.08  ? 295 LEU C N   1 
ATOM   6415 C CA  . LEU C 1 283 ? 36.081  -9.953  -14.776 1.00 56.65  ? 295 LEU C CA  1 
ATOM   6416 C C   . LEU C 1 283 ? 36.346  -9.728  -13.279 1.00 58.13  ? 295 LEU C C   1 
ATOM   6417 O O   . LEU C 1 283 ? 35.966  -8.676  -12.771 1.00 57.04  ? 295 LEU C O   1 
ATOM   6418 C CB  . LEU C 1 283 ? 34.909  -10.929 -14.983 1.00 55.88  ? 295 LEU C CB  1 
ATOM   6419 C CG  . LEU C 1 283 ? 33.580  -10.598 -14.309 1.00 57.84  ? 295 LEU C CG  1 
ATOM   6420 C CD1 . LEU C 1 283 ? 33.102  -9.176  -14.661 1.00 56.69  ? 295 LEU C CD1 1 
ATOM   6421 C CD2 . LEU C 1 283 ? 32.533  -11.624 -14.677 1.00 59.38  ? 295 LEU C CD2 1 
ATOM   6422 N N   . ILE C 1 284 ? 36.997  -10.693 -12.588 1.00 54.01  ? 296 ILE C N   1 
ATOM   6423 C CA  . ILE C 1 284 ? 37.347  -10.585 -11.170 1.00 52.76  ? 296 ILE C CA  1 
ATOM   6424 C C   . ILE C 1 284 ? 38.098  -9.257  -10.933 1.00 56.41  ? 296 ILE C C   1 
ATOM   6425 O O   . ILE C 1 284 ? 37.690  -8.488  -10.064 1.00 55.34  ? 296 ILE C O   1 
ATOM   6426 C CB  . ILE C 1 284 ? 38.147  -11.830 -10.665 1.00 56.86  ? 296 ILE C CB  1 
ATOM   6427 C CG1 . ILE C 1 284 ? 37.247  -13.091 -10.618 1.00 56.53  ? 296 ILE C CG1 1 
ATOM   6428 C CG2 . ILE C 1 284 ? 38.800  -11.561 -9.292  1.00 56.67  ? 296 ILE C CG2 1 
ATOM   6429 C CD1 . ILE C 1 284 ? 37.998  -14.441 -10.597 1.00 57.69  ? 296 ILE C CD1 1 
ATOM   6430 N N   . LEU C 1 285 ? 39.133  -8.967  -11.742 1.00 53.88  ? 297 LEU C N   1 
ATOM   6431 C CA  . LEU C 1 285 ? 39.983  -7.786  -11.566 1.00 53.46  ? 297 LEU C CA  1 
ATOM   6432 C C   . LEU C 1 285 ? 39.207  -6.498  -11.796 1.00 56.18  ? 297 LEU C C   1 
ATOM   6433 O O   . LEU C 1 285 ? 39.389  -5.544  -11.037 1.00 55.82  ? 297 LEU C O   1 
ATOM   6434 C CB  . LEU C 1 285 ? 41.214  -7.843  -12.482 1.00 55.63  ? 297 LEU C CB  1 
ATOM   6435 C CG  . LEU C 1 285 ? 42.243  -8.924  -12.163 1.00 62.18  ? 297 LEU C CG  1 
ATOM   6436 C CD1 . LEU C 1 285 ? 43.298  -9.009  -13.259 1.00 65.29  ? 297 LEU C CD1 1 
ATOM   6437 C CD2 . LEU C 1 285 ? 42.896  -8.691  -10.816 1.00 63.22  ? 297 LEU C CD2 1 
ATOM   6438 N N   . GLN C 1 286 ? 38.326  -6.481  -12.818 1.00 52.31  ? 298 GLN C N   1 
ATOM   6439 C CA  . GLN C 1 286 ? 37.417  -5.367  -13.109 1.00 50.99  ? 298 GLN C CA  1 
ATOM   6440 C C   . GLN C 1 286 ? 36.547  -5.027  -11.891 1.00 54.17  ? 298 GLN C C   1 
ATOM   6441 O O   . GLN C 1 286 ? 36.415  -3.850  -11.533 1.00 54.36  ? 298 GLN C O   1 
ATOM   6442 C CB  . GLN C 1 286 ? 36.514  -5.713  -14.300 1.00 52.19  ? 298 GLN C CB  1 
ATOM   6443 C CG  . GLN C 1 286 ? 37.163  -5.564  -15.676 1.00 60.98  ? 298 GLN C CG  1 
ATOM   6444 C CD  . GLN C 1 286 ? 36.230  -5.958  -16.800 1.00 80.79  ? 298 GLN C CD  1 
ATOM   6445 O OE1 . GLN C 1 286 ? 35.039  -6.226  -16.610 1.00 70.16  ? 298 GLN C OE1 1 
ATOM   6446 N NE2 . GLN C 1 286 ? 36.755  -5.996  -18.008 1.00 79.95  ? 298 GLN C NE2 1 
ATOM   6447 N N   . LEU C 1 287 ? 35.975  -6.068  -11.250 1.00 48.90  ? 299 LEU C N   1 
ATOM   6448 C CA  . LEU C 1 287 ? 35.121  -5.934  -10.073 1.00 46.06  ? 299 LEU C CA  1 
ATOM   6449 C C   . LEU C 1 287 ? 35.935  -5.520  -8.849  1.00 49.02  ? 299 LEU C C   1 
ATOM   6450 O O   . LEU C 1 287 ? 35.422  -4.783  -8.010  1.00 48.52  ? 299 LEU C O   1 
ATOM   6451 C CB  . LEU C 1 287 ? 34.350  -7.237  -9.795  1.00 45.14  ? 299 LEU C CB  1 
ATOM   6452 C CG  . LEU C 1 287 ? 33.349  -7.681  -10.862 1.00 48.36  ? 299 LEU C CG  1 
ATOM   6453 C CD1 . LEU C 1 287 ? 32.890  -9.101  -10.614 1.00 48.02  ? 299 LEU C CD1 1 
ATOM   6454 C CD2 . LEU C 1 287 ? 32.159  -6.723  -10.960 1.00 48.05  ? 299 LEU C CD2 1 
ATOM   6455 N N   . CYS C 1 288 ? 37.192  -5.971  -8.749  1.00 44.85  ? 300 CYS C N   1 
ATOM   6456 C CA  . CYS C 1 288 ? 38.086  -5.564  -7.664  1.00 44.50  ? 300 CYS C CA  1 
ATOM   6457 C C   . CYS C 1 288 ? 38.368  -4.057  -7.713  1.00 49.96  ? 300 CYS C C   1 
ATOM   6458 O O   . CYS C 1 288 ? 38.277  -3.396  -6.675  1.00 48.94  ? 300 CYS C O   1 
ATOM   6459 C CB  . CYS C 1 288 ? 39.381  -6.369  -7.680  1.00 45.77  ? 300 CYS C CB  1 
ATOM   6460 S SG  . CYS C 1 288 ? 39.168  -8.115  -7.258  1.00 49.66  ? 300 CYS C SG  1 
ATOM   6461 N N   . ILE C 1 289 ? 38.663  -3.511  -8.915  1.00 47.30  ? 301 ILE C N   1 
ATOM   6462 C CA  . ILE C 1 289 ? 39.042  -2.106  -9.090  1.00 47.50  ? 301 ILE C CA  1 
ATOM   6463 C C   . ILE C 1 289 ? 37.857  -1.189  -8.756  1.00 50.18  ? 301 ILE C C   1 
ATOM   6464 O O   . ILE C 1 289 ? 38.008  -0.276  -7.935  1.00 49.28  ? 301 ILE C O   1 
ATOM   6465 C CB  . ILE C 1 289 ? 39.626  -1.842  -10.511 1.00 51.95  ? 301 ILE C CB  1 
ATOM   6466 C CG1 . ILE C 1 289 ? 41.035  -2.469  -10.633 1.00 54.65  ? 301 ILE C CG1 1 
ATOM   6467 C CG2 . ILE C 1 289 ? 39.697  -0.336  -10.825 1.00 51.77  ? 301 ILE C CG2 1 
ATOM   6468 C CD1 . ILE C 1 289 ? 41.309  -3.083  -11.944 1.00 62.87  ? 301 ILE C CD1 1 
ATOM   6469 N N   . GLY C 1 290 ? 36.705  -1.453  -9.374  1.00 45.62  ? 302 GLY C N   1 
ATOM   6470 C CA  . GLY C 1 290 ? 35.493  -0.668  -9.169  1.00 43.07  ? 302 GLY C CA  1 
ATOM   6471 C C   . GLY C 1 290 ? 35.009  -0.654  -7.732  1.00 44.85  ? 302 GLY C C   1 
ATOM   6472 O O   . GLY C 1 290 ? 34.725  0.419   -7.191  1.00 44.56  ? 302 GLY C O   1 
ATOM   6473 N N   . ASN C 1 291 ? 34.937  -1.840  -7.094  1.00 39.54  ? 303 ASN C N   1 
ATOM   6474 C CA  . ASN C 1 291 ? 34.450  -1.965  -5.726  1.00 37.93  ? 303 ASN C CA  1 
ATOM   6475 C C   . ASN C 1 291 ? 35.409  -1.325  -4.752  1.00 43.94  ? 303 ASN C C   1 
ATOM   6476 O O   . ASN C 1 291 ? 34.959  -0.699  -3.798  1.00 44.36  ? 303 ASN C O   1 
ATOM   6477 C CB  . ASN C 1 291 ? 34.201  -3.421  -5.354  1.00 35.65  ? 303 ASN C CB  1 
ATOM   6478 C CG  . ASN C 1 291 ? 32.899  -3.965  -5.880  1.00 53.55  ? 303 ASN C CG  1 
ATOM   6479 O OD1 . ASN C 1 291 ? 31.800  -3.490  -5.526  1.00 47.11  ? 303 ASN C OD1 1 
ATOM   6480 N ND2 . ASN C 1 291 ? 32.989  -4.978  -6.732  1.00 37.88  ? 303 ASN C ND2 1 
ATOM   6481 N N   . HIS C 1 292 ? 36.723  -1.458  -4.989  1.00 42.07  ? 304 HIS C N   1 
ATOM   6482 C CA  . HIS C 1 292 ? 37.758  -0.794  -4.189  1.00 42.01  ? 304 HIS C CA  1 
ATOM   6483 C C   . HIS C 1 292 ? 37.546  0.721   -4.183  1.00 44.32  ? 304 HIS C C   1 
ATOM   6484 O O   . HIS C 1 292 ? 37.572  1.336   -3.121  1.00 44.21  ? 304 HIS C O   1 
ATOM   6485 C CB  . HIS C 1 292 ? 39.168  -1.131  -4.720  1.00 43.59  ? 304 HIS C CB  1 
ATOM   6486 C CG  . HIS C 1 292 ? 40.248  -0.347  -4.052  1.00 47.37  ? 304 HIS C CG  1 
ATOM   6487 N ND1 . HIS C 1 292 ? 40.639  0.895   -4.527  1.00 49.51  ? 304 HIS C ND1 1 
ATOM   6488 C CD2 . HIS C 1 292 ? 40.954  -0.632  -2.938  1.00 49.51  ? 304 HIS C CD2 1 
ATOM   6489 C CE1 . HIS C 1 292 ? 41.571  1.321   -3.693  1.00 49.94  ? 304 HIS C CE1 1 
ATOM   6490 N NE2 . HIS C 1 292 ? 41.798  0.435   -2.724  1.00 50.45  ? 304 HIS C NE2 1 
ATOM   6491 N N   . ASP C 1 293 ? 37.330  1.299   -5.367  1.00 40.09  ? 305 ASP C N   1 
ATOM   6492 C CA  . ASP C 1 293 ? 37.250  2.738   -5.575  1.00 39.74  ? 305 ASP C CA  1 
ATOM   6493 C C   . ASP C 1 293 ? 35.955  3.324   -5.041  1.00 42.27  ? 305 ASP C C   1 
ATOM   6494 O O   . ASP C 1 293 ? 35.976  4.421   -4.478  1.00 43.05  ? 305 ASP C O   1 
ATOM   6495 C CB  . ASP C 1 293 ? 37.405  3.052   -7.065  1.00 41.50  ? 305 ASP C CB  1 
ATOM   6496 C CG  . ASP C 1 293 ? 38.839  3.028   -7.551  1.00 45.66  ? 305 ASP C CG  1 
ATOM   6497 O OD1 . ASP C 1 293 ? 39.693  2.406   -6.871  1.00 45.88  ? 305 ASP C OD1 1 
ATOM   6498 O OD2 . ASP C 1 293 ? 39.110  3.626   -8.601  1.00 48.80  ? 305 ASP C OD2 1 
ATOM   6499 N N   . LEU C 1 294 ? 34.838  2.602   -5.201  1.00 36.35  ? 306 LEU C N   1 
ATOM   6500 C CA  . LEU C 1 294 ? 33.563  3.035   -4.640  1.00 34.68  ? 306 LEU C CA  1 
ATOM   6501 C C   . LEU C 1 294 ? 33.587  2.945   -3.123  1.00 41.06  ? 306 LEU C C   1 
ATOM   6502 O O   . LEU C 1 294 ? 33.009  3.807   -2.462  1.00 42.20  ? 306 LEU C O   1 
ATOM   6503 C CB  . LEU C 1 294 ? 32.380  2.248   -5.218  1.00 33.21  ? 306 LEU C CB  1 
ATOM   6504 C CG  . LEU C 1 294 ? 32.097  2.444   -6.709  1.00 36.57  ? 306 LEU C CG  1 
ATOM   6505 C CD1 . LEU C 1 294 ? 31.091  1.466   -7.179  1.00 34.40  ? 306 LEU C CD1 1 
ATOM   6506 C CD2 . LEU C 1 294 ? 31.642  3.864   -7.015  1.00 40.44  ? 306 LEU C CD2 1 
ATOM   6507 N N   . PHE C 1 295 ? 34.273  1.932   -2.574  1.00 39.18  ? 307 PHE C N   1 
ATOM   6508 C CA  . PHE C 1 295 ? 34.489  1.787   -1.133  1.00 40.26  ? 307 PHE C CA  1 
ATOM   6509 C C   . PHE C 1 295 ? 35.210  3.013   -0.563  1.00 49.60  ? 307 PHE C C   1 
ATOM   6510 O O   . PHE C 1 295 ? 34.811  3.512   0.488   1.00 50.21  ? 307 PHE C O   1 
ATOM   6511 C CB  . PHE C 1 295 ? 35.292  0.504   -0.838  1.00 42.01  ? 307 PHE C CB  1 
ATOM   6512 C CG  . PHE C 1 295 ? 35.679  0.278   0.603   1.00 43.25  ? 307 PHE C CG  1 
ATOM   6513 C CD1 . PHE C 1 295 ? 36.819  0.869   1.133   1.00 47.14  ? 307 PHE C CD1 1 
ATOM   6514 C CD2 . PHE C 1 295 ? 34.937  -0.570  1.415   1.00 43.63  ? 307 PHE C CD2 1 
ATOM   6515 C CE1 . PHE C 1 295 ? 37.184  0.648   2.460   1.00 47.94  ? 307 PHE C CE1 1 
ATOM   6516 C CE2 . PHE C 1 295 ? 35.315  -0.804  2.738   1.00 46.29  ? 307 PHE C CE2 1 
ATOM   6517 C CZ  . PHE C 1 295 ? 36.435  -0.188  3.252   1.00 45.56  ? 307 PHE C CZ  1 
ATOM   6518 N N   . MET C 1 296 ? 36.270  3.483   -1.251  1.00 49.26  ? 308 MET C N   1 
ATOM   6519 C CA  . MET C 1 296 ? 37.105  4.596   -0.802  1.00 50.54  ? 308 MET C CA  1 
ATOM   6520 C C   . MET C 1 296 ? 36.337  5.918   -0.844  1.00 53.76  ? 308 MET C C   1 
ATOM   6521 O O   . MET C 1 296 ? 36.468  6.704   0.090   1.00 54.35  ? 308 MET C O   1 
ATOM   6522 C CB  . MET C 1 296 ? 38.404  4.695   -1.628  1.00 54.35  ? 308 MET C CB  1 
ATOM   6523 C CG  . MET C 1 296 ? 39.368  3.511   -1.459  1.00 58.92  ? 308 MET C CG  1 
ATOM   6524 S SD  . MET C 1 296 ? 39.829  3.034   0.236   1.00 63.90  ? 308 MET C SD  1 
ATOM   6525 C CE  . MET C 1 296 ? 40.621  4.498   0.792   1.00 62.33  ? 308 MET C CE  1 
ATOM   6526 N N   . ARG C 1 297 ? 35.537  6.157   -1.903  1.00 49.86  ? 309 ARG C N   1 
ATOM   6527 C CA  . ARG C 1 297 ? 34.689  7.353   -2.055  1.00 49.67  ? 309 ARG C CA  1 
ATOM   6528 C C   . ARG C 1 297 ? 33.650  7.485   -0.940  1.00 54.27  ? 309 ARG C C   1 
ATOM   6529 O O   . ARG C 1 297 ? 33.333  8.603   -0.533  1.00 54.56  ? 309 ARG C O   1 
ATOM   6530 C CB  . ARG C 1 297 ? 33.951  7.325   -3.385  1.00 48.38  ? 309 ARG C CB  1 
ATOM   6531 C CG  . ARG C 1 297 ? 34.765  7.740   -4.567  1.00 57.92  ? 309 ARG C CG  1 
ATOM   6532 C CD  . ARG C 1 297 ? 33.834  7.907   -5.747  1.00 60.97  ? 309 ARG C CD  1 
ATOM   6533 N NE  . ARG C 1 297 ? 34.574  8.247   -6.958  1.00 64.75  ? 309 ARG C NE  1 
ATOM   6534 C CZ  . ARG C 1 297 ? 34.122  8.044   -8.187  1.00 67.55  ? 309 ARG C CZ  1 
ATOM   6535 N NH1 . ARG C 1 297 ? 32.924  7.511   -8.381  1.00 42.92  ? 309 ARG C NH1 1 
ATOM   6536 N NH2 . ARG C 1 297 ? 34.863  8.372   -9.231  1.00 58.57  ? 309 ARG C NH2 1 
ATOM   6537 N N   . ARG C 1 298 ? 33.109  6.343   -0.467  1.00 50.67  ? 310 ARG C N   1 
ATOM   6538 C CA  . ARG C 1 298 ? 32.127  6.274   0.617   1.00 49.89  ? 310 ARG C CA  1 
ATOM   6539 C C   . ARG C 1 298 ? 32.750  6.641   1.969   1.00 57.63  ? 310 ARG C C   1 
ATOM   6540 O O   . ARG C 1 298 ? 32.026  6.994   2.902   1.00 58.13  ? 310 ARG C O   1 
ATOM   6541 C CB  . ARG C 1 298 ? 31.505  4.873   0.689   1.00 44.97  ? 310 ARG C CB  1 
ATOM   6542 C CG  . ARG C 1 298 ? 30.522  4.618   -0.418  1.00 45.07  ? 310 ARG C CG  1 
ATOM   6543 C CD  . ARG C 1 298 ? 30.077  3.177   -0.420  1.00 48.82  ? 310 ARG C CD  1 
ATOM   6544 N NE  . ARG C 1 298 ? 29.414  2.844   -1.677  1.00 47.64  ? 310 ARG C NE  1 
ATOM   6545 C CZ  . ARG C 1 298 ? 29.721  1.796   -2.428  1.00 58.04  ? 310 ARG C CZ  1 
ATOM   6546 N NH1 . ARG C 1 298 ? 30.664  0.946   -2.040  1.00 45.90  ? 310 ARG C NH1 1 
ATOM   6547 N NH2 . ARG C 1 298 ? 29.072  1.574   -3.560  1.00 40.67  ? 310 ARG C NH2 1 
ATOM   6548 N N   . ARG C 1 299 ? 34.083  6.534   2.076   1.00 55.95  ? 311 ARG C N   1 
ATOM   6549 C CA  . ARG C 1 299 ? 34.825  6.886   3.276   1.00 57.33  ? 311 ARG C CA  1 
ATOM   6550 C C   . ARG C 1 299 ? 35.494  8.259   3.098   1.00 65.12  ? 311 ARG C C   1 
ATOM   6551 O O   . ARG C 1 299 ? 36.422  8.605   3.832   1.00 66.70  ? 311 ARG C O   1 
ATOM   6552 C CB  . ARG C 1 299 ? 35.833  5.783   3.599   1.00 56.90  ? 311 ARG C CB  1 
ATOM   6553 C CG  . ARG C 1 299 ? 35.222  4.723   4.508   1.00 63.18  ? 311 ARG C CG  1 
ATOM   6554 C CD  . ARG C 1 299 ? 35.617  3.323   4.113   1.00 65.45  ? 311 ARG C CD  1 
ATOM   6555 N NE  . ARG C 1 299 ? 34.664  2.317   4.583   1.00 62.72  ? 311 ARG C NE  1 
ATOM   6556 C CZ  . ARG C 1 299 ? 33.605  1.905   3.888   1.00 66.28  ? 311 ARG C CZ  1 
ATOM   6557 N NH1 . ARG C 1 299 ? 33.342  2.421   2.696   1.00 44.47  ? 311 ARG C NH1 1 
ATOM   6558 N NH2 . ARG C 1 299 ? 32.814  0.958   4.373   1.00 44.83  ? 311 ARG C NH2 1 
ATOM   6559 N N   . LYS C 1 300 ? 34.986  9.042   2.115   1.00 62.47  ? 312 LYS C N   1 
ATOM   6560 C CA  . LYS C 1 300 ? 35.334  10.429  1.775   1.00 94.02  ? 312 LYS C CA  1 
ATOM   6561 C C   . LYS C 1 300 ? 36.795  10.549  1.355   1.00 123.32 ? 312 LYS C C   1 
ATOM   6562 O O   . LYS C 1 300 ? 37.119  10.213  0.218   1.00 87.78  ? 312 LYS C O   1 
ATOM   6563 C CB  . LYS C 1 300 ? 35.018  11.405  2.929   1.00 97.13  ? 312 LYS C CB  1 
ATOM   6564 C CG  . LYS C 1 300 ? 33.566  11.347  3.449   1.00 111.60 ? 312 LYS C CG  1 
ATOM   6565 C CD  . LYS C 1 300 ? 32.560  12.221  2.673   1.00 121.73 ? 312 LYS C CD  1 
ATOM   6566 C CE  . LYS C 1 300 ? 32.603  13.684  3.060   1.00 133.85 ? 312 LYS C CE  1 
ATOM   6567 N NZ  . LYS C 1 300 ? 31.634  14.494  2.273   1.00 141.52 ? 312 LYS C NZ  1 
ATOM   6568 C CA  . LYS D 1 8   ? -26.598 4.388   -39.326 1.00 131.85 ? 20  LYS D CA  1 
ATOM   6569 C C   . LYS D 1 8   ? -26.221 3.863   -40.719 1.00 130.45 ? 20  LYS D C   1 
ATOM   6570 O O   . LYS D 1 8   ? -26.939 4.135   -41.684 1.00 127.13 ? 20  LYS D O   1 
ATOM   6571 C CB  . LYS D 1 8   ? -26.009 5.785   -39.103 1.00 134.75 ? 20  LYS D CB  1 
ATOM   6572 C CG  . LYS D 1 8   ? -24.567 5.743   -38.635 1.00 150.11 ? 20  LYS D CG  1 
ATOM   6573 C CD  . LYS D 1 8   ? -23.722 6.841   -39.264 1.00 158.09 ? 20  LYS D CD  1 
ATOM   6574 C CE  . LYS D 1 8   ? -22.383 6.351   -39.792 1.00 166.13 ? 20  LYS D CE  1 
ATOM   6575 N NZ  . LYS D 1 8   ? -21.527 5.763   -38.724 1.00 180.12 ? 20  LYS D NZ  1 
ATOM   6576 N N   . THR D 1 9   ? -25.090 3.127   -40.826 1.00 125.61 ? 21  THR D N   1 
ATOM   6577 C CA  . THR D 1 9   ? -24.665 2.456   -42.064 1.00 120.09 ? 21  THR D CA  1 
ATOM   6578 C C   . THR D 1 9   ? -24.254 1.004   -41.799 1.00 124.18 ? 21  THR D C   1 
ATOM   6579 O O   . THR D 1 9   ? -23.919 0.642   -40.669 1.00 127.64 ? 21  THR D O   1 
ATOM   6580 C CB  . THR D 1 9   ? -23.512 3.200   -42.775 1.00 125.40 ? 21  THR D CB  1 
ATOM   6581 O OG1 . THR D 1 9   ? -22.396 3.332   -41.898 1.00 128.12 ? 21  THR D OG1 1 
ATOM   6582 C CG2 . THR D 1 9   ? -23.922 4.551   -43.334 1.00 122.68 ? 21  THR D CG2 1 
ATOM   6583 N N   . PHE D 1 10  ? -24.294 0.174   -42.856 1.00 116.92 ? 22  PHE D N   1 
ATOM   6584 C CA  . PHE D 1 10  ? -23.776 -1.194  -42.858 1.00 116.68 ? 22  PHE D CA  1 
ATOM   6585 C C   . PHE D 1 10  ? -22.930 -1.420  -44.114 1.00 114.38 ? 22  PHE D C   1 
ATOM   6586 O O   . PHE D 1 10  ? -23.160 -0.763  -45.134 1.00 110.74 ? 22  PHE D O   1 
ATOM   6587 C CB  . PHE D 1 10  ? -24.915 -2.226  -42.746 1.00 120.13 ? 22  PHE D CB  1 
ATOM   6588 C CG  . PHE D 1 10  ? -25.916 -2.240  -43.877 1.00 118.37 ? 22  PHE D CG  1 
ATOM   6589 C CD1 . PHE D 1 10  ? -26.987 -1.353  -43.893 1.00 122.01 ? 22  PHE D CD1 1 
ATOM   6590 C CD2 . PHE D 1 10  ? -25.824 -3.177  -44.895 1.00 117.52 ? 22  PHE D CD2 1 
ATOM   6591 C CE1 . PHE D 1 10  ? -27.921 -1.376  -44.932 1.00 120.11 ? 22  PHE D CE1 1 
ATOM   6592 C CE2 . PHE D 1 10  ? -26.764 -3.204  -45.928 1.00 117.51 ? 22  PHE D CE2 1 
ATOM   6593 C CZ  . PHE D 1 10  ? -27.799 -2.298  -45.945 1.00 116.02 ? 22  PHE D CZ  1 
ATOM   6594 N N   . THR D 1 11  ? -21.952 -2.340  -44.037 1.00 109.55 ? 23  THR D N   1 
ATOM   6595 C CA  . THR D 1 11  ? -21.014 -2.605  -45.131 1.00 104.46 ? 23  THR D CA  1 
ATOM   6596 C C   . THR D 1 11  ? -21.680 -3.499  -46.175 1.00 103.26 ? 23  THR D C   1 
ATOM   6597 O O   . THR D 1 11  ? -22.313 -4.496  -45.820 1.00 104.78 ? 23  THR D O   1 
ATOM   6598 C CB  . THR D 1 11  ? -19.704 -3.202  -44.584 1.00 114.21 ? 23  THR D CB  1 
ATOM   6599 O OG1 . THR D 1 11  ? -19.125 -2.257  -43.683 1.00 118.22 ? 23  THR D OG1 1 
ATOM   6600 C CG2 . THR D 1 11  ? -18.690 -3.533  -45.682 1.00 108.26 ? 23  THR D CG2 1 
ATOM   6601 N N   . VAL D 1 12  ? -21.556 -3.111  -47.464 1.00 93.67  ? 24  VAL D N   1 
ATOM   6602 C CA  . VAL D 1 12  ? -22.004 -3.909  -48.612 1.00 89.34  ? 24  VAL D CA  1 
ATOM   6603 C C   . VAL D 1 12  ? -20.803 -4.182  -49.510 1.00 87.27  ? 24  VAL D C   1 
ATOM   6604 O O   . VAL D 1 12  ? -20.104 -3.251  -49.910 1.00 84.74  ? 24  VAL D O   1 
ATOM   6605 C CB  . VAL D 1 12  ? -23.180 -3.266  -49.405 1.00 90.94  ? 24  VAL D CB  1 
ATOM   6606 C CG1 . VAL D 1 12  ? -23.640 -4.171  -50.535 1.00 88.15  ? 24  VAL D CG1 1 
ATOM   6607 C CG2 . VAL D 1 12  ? -24.354 -2.968  -48.497 1.00 93.99  ? 24  VAL D CG2 1 
ATOM   6608 N N   . ARG D 1 13  ? -20.554 -5.467  -49.792 1.00 81.91  ? 25  ARG D N   1 
ATOM   6609 C CA  . ARG D 1 13  ? -19.588 -5.917  -50.785 1.00 78.15  ? 25  ARG D CA  1 
ATOM   6610 C C   . ARG D 1 13  ? -20.240 -5.860  -52.165 1.00 76.17  ? 25  ARG D C   1 
ATOM   6611 O O   . ARG D 1 13  ? -21.302 -6.444  -52.369 1.00 75.27  ? 25  ARG D O   1 
ATOM   6612 C CB  . ARG D 1 13  ? -19.103 -7.334  -50.445 1.00 80.56  ? 25  ARG D CB  1 
ATOM   6613 C CG  . ARG D 1 13  ? -17.803 -7.746  -51.127 1.00 91.38  ? 25  ARG D CG  1 
ATOM   6614 C CD  . ARG D 1 13  ? -17.258 -9.066  -50.583 1.00 107.96 ? 25  ARG D CD  1 
ATOM   6615 N NE  . ARG D 1 13  ? -16.878 -8.966  -49.167 1.00 125.01 ? 25  ARG D NE  1 
ATOM   6616 C CZ  . ARG D 1 13  ? -15.640 -9.061  -48.682 1.00 141.46 ? 25  ARG D CZ  1 
ATOM   6617 N NH1 . ARG D 1 13  ? -14.615 -9.280  -49.493 1.00 124.47 ? 25  ARG D NH1 1 
ATOM   6618 N NH2 . ARG D 1 13  ? -15.422 -8.936  -47.385 1.00 133.83 ? 25  ARG D NH2 1 
ATOM   6619 N N   . ILE D 1 14  ? -19.639 -5.104  -53.089 1.00 69.68  ? 26  ILE D N   1 
ATOM   6620 C CA  . ILE D 1 14  ? -20.076 -5.064  -54.488 1.00 65.97  ? 26  ILE D CA  1 
ATOM   6621 C C   . ILE D 1 14  ? -18.964 -5.655  -55.341 1.00 68.01  ? 26  ILE D C   1 
ATOM   6622 O O   . ILE D 1 14  ? -17.848 -5.134  -55.349 1.00 67.31  ? 26  ILE D O   1 
ATOM   6623 C CB  . ILE D 1 14  ? -20.502 -3.640  -54.968 1.00 67.05  ? 26  ILE D CB  1 
ATOM   6624 C CG1 . ILE D 1 14  ? -21.639 -3.024  -54.096 1.00 69.16  ? 26  ILE D CG1 1 
ATOM   6625 C CG2 . ILE D 1 14  ? -20.821 -3.608  -56.485 1.00 64.44  ? 26  ILE D CG2 1 
ATOM   6626 C CD1 . ILE D 1 14  ? -23.026 -3.684  -54.142 1.00 78.31  ? 26  ILE D CD1 1 
ATOM   6627 N N   . VAL D 1 15  ? -19.276 -6.745  -56.055 1.00 63.84  ? 27  VAL D N   1 
ATOM   6628 C CA  . VAL D 1 15  ? -18.307 -7.441  -56.892 1.00 62.36  ? 27  VAL D CA  1 
ATOM   6629 C C   . VAL D 1 15  ? -18.592 -7.083  -58.350 1.00 65.46  ? 27  VAL D C   1 
ATOM   6630 O O   . VAL D 1 15  ? -19.673 -7.385  -58.867 1.00 64.77  ? 27  VAL D O   1 
ATOM   6631 C CB  . VAL D 1 15  ? -18.296 -8.974  -56.633 1.00 66.95  ? 27  VAL D CB  1 
ATOM   6632 C CG1 . VAL D 1 15  ? -17.304 -9.681  -57.543 1.00 65.40  ? 27  VAL D CG1 1 
ATOM   6633 C CG2 . VAL D 1 15  ? -17.962 -9.276  -55.176 1.00 70.28  ? 27  VAL D CG2 1 
ATOM   6634 N N   . THR D 1 16  ? -17.641 -6.381  -58.986 1.00 61.91  ? 28  THR D N   1 
ATOM   6635 C CA  . THR D 1 16  ? -17.656 -6.157  -60.435 1.00 60.38  ? 28  THR D CA  1 
ATOM   6636 C C   . THR D 1 16  ? -16.779 -7.247  -61.071 1.00 67.69  ? 28  THR D C   1 
ATOM   6637 O O   . THR D 1 16  ? -16.153 -8.019  -60.338 1.00 69.65  ? 28  THR D O   1 
ATOM   6638 C CB  . THR D 1 16  ? -17.205 -4.723  -60.789 1.00 63.86  ? 28  THR D CB  1 
ATOM   6639 O OG1 . THR D 1 16  ? -15.808 -4.587  -60.536 1.00 64.56  ? 28  THR D OG1 1 
ATOM   6640 C CG2 . THR D 1 16  ? -17.982 -3.652  -60.030 1.00 62.65  ? 28  THR D CG2 1 
ATOM   6641 N N   . MET D 1 17  ? -16.729 -7.325  -62.416 1.00 64.00  ? 29  MET D N   1 
ATOM   6642 C CA  . MET D 1 17  ? -15.824 -8.259  -63.107 1.00 64.44  ? 29  MET D CA  1 
ATOM   6643 C C   . MET D 1 17  ? -14.342 -7.957  -62.764 1.00 72.59  ? 29  MET D C   1 
ATOM   6644 O O   . MET D 1 17  ? -13.511 -8.862  -62.778 1.00 73.53  ? 29  MET D O   1 
ATOM   6645 C CB  . MET D 1 17  ? -16.027 -8.198  -64.628 1.00 64.47  ? 29  MET D CB  1 
ATOM   6646 C CG  . MET D 1 17  ? -17.396 -8.680  -65.118 1.00 66.80  ? 29  MET D CG  1 
ATOM   6647 S SD  . MET D 1 17  ? -17.868 -10.385 -64.718 1.00 71.75  ? 29  MET D SD  1 
ATOM   6648 C CE  . MET D 1 17  ? -16.517 -11.286 -65.447 1.00 68.52  ? 29  MET D CE  1 
ATOM   6649 N N   . ASP D 1 18  ? -14.035 -6.677  -62.462 1.00 71.09  ? 30  ASP D N   1 
ATOM   6650 C CA  . ASP D 1 18  ? -12.717 -6.142  -62.118 1.00 72.77  ? 30  ASP D CA  1 
ATOM   6651 C C   . ASP D 1 18  ? -12.319 -6.434  -60.677 1.00 79.73  ? 30  ASP D C   1 
ATOM   6652 O O   . ASP D 1 18  ? -11.238 -6.970  -60.422 1.00 81.39  ? 30  ASP D O   1 
ATOM   6653 C CB  . ASP D 1 18  ? -12.718 -4.611  -62.288 1.00 74.19  ? 30  ASP D CB  1 
ATOM   6654 C CG  . ASP D 1 18  ? -12.777 -4.098  -63.699 1.00 86.41  ? 30  ASP D CG  1 
ATOM   6655 O OD1 . ASP D 1 18  ? -11.748 -4.202  -64.406 1.00 86.78  ? 30  ASP D OD1 1 
ATOM   6656 O OD2 . ASP D 1 18  ? -13.819 -3.491  -64.068 1.00 93.05  ? 30  ASP D OD2 1 
ATOM   6657 N N   . ALA D 1 19  ? -13.179 -6.030  -59.725 1.00 76.48  ? 31  ALA D N   1 
ATOM   6658 C CA  . ALA D 1 19  ? -12.769 -5.902  -58.337 1.00 78.36  ? 31  ALA D CA  1 
ATOM   6659 C C   . ALA D 1 19  ? -13.893 -6.193  -57.364 1.00 82.35  ? 31  ALA D C   1 
ATOM   6660 O O   . ALA D 1 19  ? -15.075 -6.163  -57.710 1.00 79.52  ? 31  ALA D O   1 
ATOM   6661 C CB  . ALA D 1 19  ? -12.228 -4.501  -58.084 1.00 79.14  ? 31  ALA D CB  1 
ATOM   6662 N N   . GLU D 1 20  ? -13.474 -6.516  -56.145 1.00 82.39  ? 32  GLU D N   1 
ATOM   6663 C CA  . GLU D 1 20  ? -14.260 -6.608  -54.932 1.00 84.85  ? 32  GLU D CA  1 
ATOM   6664 C C   . GLU D 1 20  ? -14.254 -5.218  -54.294 1.00 89.66  ? 32  GLU D C   1 
ATOM   6665 O O   . GLU D 1 20  ? -13.190 -4.700  -53.946 1.00 90.53  ? 32  GLU D O   1 
ATOM   6666 C CB  . GLU D 1 20  ? -13.606 -7.671  -54.032 1.00 89.79  ? 32  GLU D CB  1 
ATOM   6667 C CG  . GLU D 1 20  ? -14.380 -8.089  -52.799 1.00 105.58 ? 32  GLU D CG  1 
ATOM   6668 C CD  . GLU D 1 20  ? -13.873 -9.406  -52.242 1.00 134.84 ? 32  GLU D CD  1 
ATOM   6669 O OE1 . GLU D 1 20  ? -12.741 -9.430  -51.702 1.00 131.94 ? 32  GLU D OE1 1 
ATOM   6670 O OE2 . GLU D 1 20  ? -14.623 -10.408 -52.311 1.00 131.59 ? 32  GLU D OE2 1 
ATOM   6671 N N   . MET D 1 21  ? -15.425 -4.587  -54.198 1.00 85.35  ? 33  MET D N   1 
ATOM   6672 C CA  . MET D 1 21  ? -15.548 -3.244  -53.623 1.00 85.58  ? 33  MET D CA  1 
ATOM   6673 C C   . MET D 1 21  ? -16.369 -3.277  -52.345 1.00 92.55  ? 33  MET D C   1 
ATOM   6674 O O   . MET D 1 21  ? -17.151 -4.206  -52.141 1.00 92.99  ? 33  MET D O   1 
ATOM   6675 C CB  . MET D 1 21  ? -16.182 -2.268  -54.623 1.00 84.87  ? 33  MET D CB  1 
ATOM   6676 C CG  . MET D 1 21  ? -15.438 -2.183  -55.928 1.00 85.97  ? 33  MET D CG  1 
ATOM   6677 S SD  . MET D 1 21  ? -16.233 -1.072  -57.091 1.00 87.00  ? 33  MET D SD  1 
ATOM   6678 C CE  . MET D 1 21  ? -15.247 -1.428  -58.533 1.00 81.86  ? 33  MET D CE  1 
ATOM   6679 N N   . GLU D 1 22  ? -16.178 -2.276  -51.476 1.00 90.97  ? 34  GLU D N   1 
ATOM   6680 C CA  . GLU D 1 22  ? -16.975 -2.143  -50.266 1.00 93.87  ? 34  GLU D CA  1 
ATOM   6681 C C   . GLU D 1 22  ? -17.495 -0.726  -50.118 1.00 98.02  ? 34  GLU D C   1 
ATOM   6682 O O   . GLU D 1 22  ? -16.751 0.241   -50.298 1.00 97.08  ? 34  GLU D O   1 
ATOM   6683 C CB  . GLU D 1 22  ? -16.196 -2.584  -49.026 1.00 99.29  ? 34  GLU D CB  1 
ATOM   6684 C CG  . GLU D 1 22  ? -16.416 -4.052  -48.706 1.00 111.66 ? 34  GLU D CG  1 
ATOM   6685 C CD  . GLU D 1 22  ? -15.515 -4.680  -47.660 1.00 138.11 ? 34  GLU D CD  1 
ATOM   6686 O OE1 . GLU D 1 22  ? -15.491 -5.930  -47.592 1.00 129.46 ? 34  GLU D OE1 1 
ATOM   6687 O OE2 . GLU D 1 22  ? -14.827 -3.940  -46.918 1.00 137.52 ? 34  GLU D OE2 1 
ATOM   6688 N N   . PHE D 1 23  ? -18.793 -0.619  -49.819 1.00 95.52  ? 35  PHE D N   1 
ATOM   6689 C CA  . PHE D 1 23  ? -19.513 0.636   -49.629 1.00 95.63  ? 35  PHE D CA  1 
ATOM   6690 C C   . PHE D 1 23  ? -20.208 0.640   -48.270 1.00 103.58 ? 35  PHE D C   1 
ATOM   6691 O O   . PHE D 1 23  ? -20.603 -0.418  -47.767 1.00 104.40 ? 35  PHE D O   1 
ATOM   6692 C CB  . PHE D 1 23  ? -20.547 0.838   -50.755 1.00 94.44  ? 35  PHE D CB  1 
ATOM   6693 C CG  . PHE D 1 23  ? -19.982 0.954   -52.154 1.00 92.55  ? 35  PHE D CG  1 
ATOM   6694 C CD1 . PHE D 1 23  ? -19.643 2.192   -52.685 1.00 94.60  ? 35  PHE D CD1 1 
ATOM   6695 C CD2 . PHE D 1 23  ? -19.822 -0.172  -52.955 1.00 93.03  ? 35  PHE D CD2 1 
ATOM   6696 C CE1 . PHE D 1 23  ? -19.138 2.300   -53.987 1.00 92.89  ? 35  PHE D CE1 1 
ATOM   6697 C CE2 . PHE D 1 23  ? -19.313 -0.063  -54.256 1.00 93.24  ? 35  PHE D CE2 1 
ATOM   6698 C CZ  . PHE D 1 23  ? -18.971 1.170   -54.761 1.00 90.42  ? 35  PHE D CZ  1 
ATOM   6699 N N   . ASN D 1 24  ? -20.332 1.829   -47.665 1.00 102.44 ? 36  ASN D N   1 
ATOM   6700 C CA  . ASN D 1 24  ? -21.152 2.011   -46.472 1.00 106.16 ? 36  ASN D CA  1 
ATOM   6701 C C   . ASN D 1 24  ? -22.541 2.426   -46.915 1.00 108.73 ? 36  ASN D C   1 
ATOM   6702 O O   . ASN D 1 24  ? -22.750 3.554   -47.370 1.00 107.42 ? 36  ASN D O   1 
ATOM   6703 C CB  . ASN D 1 24  ? -20.529 3.017   -45.500 1.00 109.87 ? 36  ASN D CB  1 
ATOM   6704 C CG  . ASN D 1 24  ? -19.282 2.495   -44.844 1.00 131.64 ? 36  ASN D CG  1 
ATOM   6705 O OD1 . ASN D 1 24  ? -19.329 1.622   -43.969 1.00 127.30 ? 36  ASN D OD1 1 
ATOM   6706 N ND2 . ASN D 1 24  ? -18.137 3.002   -45.271 1.00 121.67 ? 36  ASN D ND2 1 
ATOM   6707 N N   . CYS D 1 25  ? -23.474 1.476   -46.842 1.00 104.95 ? 37  CYS D N   1 
ATOM   6708 C CA  . CYS D 1 25  ? -24.861 1.654   -47.247 1.00 103.52 ? 37  CYS D CA  1 
ATOM   6709 C C   . CYS D 1 25  ? -25.668 2.097   -46.038 1.00 111.48 ? 37  CYS D C   1 
ATOM   6710 O O   . CYS D 1 25  ? -25.608 1.439   -44.997 1.00 114.71 ? 37  CYS D O   1 
ATOM   6711 C CB  . CYS D 1 25  ? -25.403 0.359   -47.845 1.00 102.04 ? 37  CYS D CB  1 
ATOM   6712 S SG  . CYS D 1 25  ? -27.112 0.458   -48.430 1.00 105.17 ? 37  CYS D SG  1 
ATOM   6713 N N   . GLU D 1 26  ? -26.402 3.220   -46.165 1.00 107.82 ? 38  GLU D N   1 
ATOM   6714 C CA  . GLU D 1 26  ? -27.277 3.737   -45.106 1.00 111.75 ? 38  GLU D CA  1 
ATOM   6715 C C   . GLU D 1 26  ? -28.407 2.747   -44.812 1.00 117.54 ? 38  GLU D C   1 
ATOM   6716 O O   . GLU D 1 26  ? -28.862 2.051   -45.724 1.00 114.73 ? 38  GLU D O   1 
ATOM   6717 C CB  . GLU D 1 26  ? -27.842 5.114   -45.483 1.00 112.51 ? 38  GLU D CB  1 
ATOM   6718 C CG  . GLU D 1 26  ? -26.849 6.247   -45.285 1.00 121.83 ? 38  GLU D CG  1 
ATOM   6719 C CD  . GLU D 1 26  ? -27.395 7.640   -45.518 1.00 138.57 ? 38  GLU D CD  1 
ATOM   6720 O OE1 . GLU D 1 26  ? -26.890 8.333   -46.431 1.00 119.11 ? 38  GLU D OE1 1 
ATOM   6721 O OE2 . GLU D 1 26  ? -28.307 8.051   -44.766 1.00 139.18 ? 38  GLU D OE2 1 
ATOM   6722 N N   . MET D 1 27  ? -28.846 2.677   -43.543 1.00 118.69 ? 39  MET D N   1 
ATOM   6723 C CA  . MET D 1 27  ? -29.815 1.687   -43.055 1.00 121.57 ? 39  MET D CA  1 
ATOM   6724 C C   . MET D 1 27  ? -31.144 1.731   -43.812 1.00 123.51 ? 39  MET D C   1 
ATOM   6725 O O   . MET D 1 27  ? -31.702 0.676   -44.115 1.00 122.36 ? 39  MET D O   1 
ATOM   6726 C CB  . MET D 1 27  ? -30.092 1.872   -41.550 1.00 130.19 ? 39  MET D CB  1 
ATOM   6727 C CG  . MET D 1 27  ? -28.909 1.574   -40.657 1.00 136.48 ? 39  MET D CG  1 
ATOM   6728 S SD  . MET D 1 27  ? -28.361 -0.147  -40.704 1.00 140.95 ? 39  MET D SD  1 
ATOM   6729 C CE  . MET D 1 27  ? -27.011 -0.064  -39.565 1.00 140.93 ? 39  MET D CE  1 
ATOM   6730 N N   . LYS D 1 28  ? -31.639 2.945   -44.124 1.00 119.78 ? 40  LYS D N   1 
ATOM   6731 C CA  . LYS D 1 28  ? -32.962 3.142   -44.715 1.00 119.61 ? 40  LYS D CA  1 
ATOM   6732 C C   . LYS D 1 28  ? -32.894 3.352   -46.242 1.00 117.91 ? 40  LYS D C   1 
ATOM   6733 O O   . LYS D 1 28  ? -33.918 3.648   -46.864 1.00 117.69 ? 40  LYS D O   1 
ATOM   6734 C CB  . LYS D 1 28  ? -33.698 4.302   -44.018 1.00 126.22 ? 40  LYS D CB  1 
ATOM   6735 C CG  . LYS D 1 28  ? -34.513 3.822   -42.818 1.00 148.08 ? 40  LYS D CG  1 
ATOM   6736 C CD  . LYS D 1 28  ? -35.155 4.937   -42.007 1.00 161.73 ? 40  LYS D CD  1 
ATOM   6737 C CE  . LYS D 1 28  ? -36.057 4.347   -40.944 1.00 175.65 ? 40  LYS D CE  1 
ATOM   6738 N NZ  . LYS D 1 28  ? -36.139 5.193   -39.728 1.00 189.95 ? 40  LYS D NZ  1 
ATOM   6739 N N   . TRP D 1 29  ? -31.701 3.145   -46.844 1.00 109.48 ? 41  TRP D N   1 
ATOM   6740 C CA  . TRP D 1 29  ? -31.476 3.237   -48.287 1.00 103.63 ? 41  TRP D CA  1 
ATOM   6741 C C   . TRP D 1 29  ? -32.170 2.124   -49.050 1.00 102.96 ? 41  TRP D C   1 
ATOM   6742 O O   . TRP D 1 29  ? -32.193 0.973   -48.608 1.00 102.96 ? 41  TRP D O   1 
ATOM   6743 C CB  . TRP D 1 29  ? -29.978 3.201   -48.613 1.00 99.74  ? 41  TRP D CB  1 
ATOM   6744 C CG  . TRP D 1 29  ? -29.323 4.542   -48.756 1.00 99.99  ? 41  TRP D CG  1 
ATOM   6745 C CD1 . TRP D 1 29  ? -29.838 5.757   -48.407 1.00 104.84 ? 41  TRP D CD1 1 
ATOM   6746 C CD2 . TRP D 1 29  ? -28.008 4.793   -49.264 1.00 97.28  ? 41  TRP D CD2 1 
ATOM   6747 N NE1 . TRP D 1 29  ? -28.926 6.751   -48.674 1.00 102.93 ? 41  TRP D NE1 1 
ATOM   6748 C CE2 . TRP D 1 29  ? -27.795 6.188   -49.205 1.00 101.49 ? 41  TRP D CE2 1 
ATOM   6749 C CE3 . TRP D 1 29  ? -26.989 3.973   -49.785 1.00 96.08  ? 41  TRP D CE3 1 
ATOM   6750 C CZ2 . TRP D 1 29  ? -26.607 6.781   -49.644 1.00 98.79  ? 41  TRP D CZ2 1 
ATOM   6751 C CZ3 . TRP D 1 29  ? -25.814 4.562   -50.220 1.00 95.57  ? 41  TRP D CZ3 1 
ATOM   6752 C CH2 . TRP D 1 29  ? -25.633 5.950   -50.154 1.00 96.63  ? 41  TRP D CH2 1 
ATOM   6753 N N   . LYS D 1 30  ? -32.733 2.487   -50.203 1.00 96.00  ? 42  LYS D N   1 
ATOM   6754 C CA  . LYS D 1 30  ? -33.357 1.565   -51.145 1.00 93.59  ? 42  LYS D CA  1 
ATOM   6755 C C   . LYS D 1 30  ? -32.311 1.073   -52.149 1.00 91.94  ? 42  LYS D C   1 
ATOM   6756 O O   . LYS D 1 30  ? -31.190 1.589   -52.175 1.00 90.23  ? 42  LYS D O   1 
ATOM   6757 C CB  . LYS D 1 30  ? -34.541 2.251   -51.850 1.00 96.14  ? 42  LYS D CB  1 
ATOM   6758 C CG  . LYS D 1 30  ? -35.720 2.540   -50.918 1.00 113.48 ? 42  LYS D CG  1 
ATOM   6759 C CD  . LYS D 1 30  ? -36.760 3.437   -51.571 1.00 124.59 ? 42  LYS D CD  1 
ATOM   6760 C CE  . LYS D 1 30  ? -38.005 3.581   -50.726 1.00 140.03 ? 42  LYS D CE  1 
ATOM   6761 N NZ  . LYS D 1 30  ? -39.157 4.084   -51.523 1.00 148.80 ? 42  LYS D NZ  1 
ATOM   6762 N N   . GLY D 1 31  ? -32.679 0.069   -52.941 1.00 85.87  ? 43  GLY D N   1 
ATOM   6763 C CA  . GLY D 1 31  ? -31.827 -0.489  -53.988 1.00 81.54  ? 43  GLY D CA  1 
ATOM   6764 C C   . GLY D 1 31  ? -31.236 0.542   -54.931 1.00 80.97  ? 43  GLY D C   1 
ATOM   6765 O O   . GLY D 1 31  ? -30.057 0.449   -55.277 1.00 78.23  ? 43  GLY D O   1 
ATOM   6766 N N   . LYS D 1 32  ? -32.046 1.549   -55.321 1.00 77.15  ? 44  LYS D N   1 
ATOM   6767 C CA  . LYS D 1 32  ? -31.677 2.630   -56.236 1.00 74.78  ? 44  LYS D CA  1 
ATOM   6768 C C   . LYS D 1 32  ? -30.543 3.491   -55.683 1.00 77.77  ? 44  LYS D C   1 
ATOM   6769 O O   . LYS D 1 32  ? -29.685 3.920   -56.452 1.00 75.81  ? 44  LYS D O   1 
ATOM   6770 C CB  . LYS D 1 32  ? -32.893 3.516   -56.547 1.00 79.17  ? 44  LYS D CB  1 
ATOM   6771 C CG  . LYS D 1 32  ? -32.769 4.256   -57.882 1.00 100.03 ? 44  LYS D CG  1 
ATOM   6772 C CD  . LYS D 1 32  ? -33.956 5.172   -58.175 1.00 114.47 ? 44  LYS D CD  1 
ATOM   6773 C CE  . LYS D 1 32  ? -35.089 4.465   -58.891 1.00 127.15 ? 44  LYS D CE  1 
ATOM   6774 N NZ  . LYS D 1 32  ? -36.335 5.277   -58.870 1.00 137.40 ? 44  LYS D NZ  1 
ATOM   6775 N N   . ASP D 1 33  ? -30.536 3.741   -54.366 1.00 75.76  ? 45  ASP D N   1 
ATOM   6776 C CA  . ASP D 1 33  ? -29.522 4.561   -53.695 1.00 75.51  ? 45  ASP D CA  1 
ATOM   6777 C C   . ASP D 1 33  ? -28.160 3.846   -53.689 1.00 77.44  ? 45  ASP D C   1 
ATOM   6778 O O   . ASP D 1 33  ? -27.140 4.479   -53.973 1.00 75.56  ? 45  ASP D O   1 
ATOM   6779 C CB  . ASP D 1 33  ? -29.971 4.918   -52.263 1.00 80.68  ? 45  ASP D CB  1 
ATOM   6780 C CG  . ASP D 1 33  ? -31.389 5.458   -52.177 1.00 87.05  ? 45  ASP D CG  1 
ATOM   6781 O OD1 . ASP D 1 33  ? -31.691 6.452   -52.876 1.00 85.24  ? 45  ASP D OD1 1 
ATOM   6782 O OD2 . ASP D 1 33  ? -32.200 4.875   -51.428 1.00 94.41  ? 45  ASP D OD2 1 
ATOM   6783 N N   . LEU D 1 34  ? -28.154 2.529   -53.394 1.00 74.04  ? 46  LEU D N   1 
ATOM   6784 C CA  . LEU D 1 34  ? -26.959 1.688   -53.460 1.00 72.03  ? 46  LEU D CA  1 
ATOM   6785 C C   . LEU D 1 34  ? -26.465 1.549   -54.911 1.00 72.24  ? 46  LEU D C   1 
ATOM   6786 O O   . LEU D 1 34  ? -25.268 1.727   -55.146 1.00 70.15  ? 46  LEU D O   1 
ATOM   6787 C CB  . LEU D 1 34  ? -27.219 0.306   -52.829 1.00 73.34  ? 46  LEU D CB  1 
ATOM   6788 C CG  . LEU D 1 34  ? -26.089 -0.734  -52.873 1.00 76.64  ? 46  LEU D CG  1 
ATOM   6789 C CD1 . LEU D 1 34  ? -24.822 -0.242  -52.188 1.00 77.38  ? 46  LEU D CD1 1 
ATOM   6790 C CD2 . LEU D 1 34  ? -26.533 -2.031  -52.247 1.00 80.72  ? 46  LEU D CD2 1 
ATOM   6791 N N   . PHE D 1 35  ? -27.380 1.265   -55.870 1.00 67.55  ? 47  PHE D N   1 
ATOM   6792 C CA  . PHE D 1 35  ? -27.049 1.094   -57.291 1.00 64.32  ? 47  PHE D CA  1 
ATOM   6793 C C   . PHE D 1 35  ? -26.432 2.356   -57.889 1.00 69.56  ? 47  PHE D C   1 
ATOM   6794 O O   . PHE D 1 35  ? -25.401 2.256   -58.553 1.00 67.64  ? 47  PHE D O   1 
ATOM   6795 C CB  . PHE D 1 35  ? -28.278 0.672   -58.112 1.00 65.03  ? 47  PHE D CB  1 
ATOM   6796 C CG  . PHE D 1 35  ? -28.056 0.520   -59.606 1.00 62.93  ? 47  PHE D CG  1 
ATOM   6797 C CD1 . PHE D 1 35  ? -27.348 -0.564  -60.117 1.00 63.26  ? 47  PHE D CD1 1 
ATOM   6798 C CD2 . PHE D 1 35  ? -28.585 1.443   -60.502 1.00 64.00  ? 47  PHE D CD2 1 
ATOM   6799 C CE1 . PHE D 1 35  ? -27.160 -0.711  -61.495 1.00 62.04  ? 47  PHE D CE1 1 
ATOM   6800 C CE2 . PHE D 1 35  ? -28.391 1.298   -61.880 1.00 64.58  ? 47  PHE D CE2 1 
ATOM   6801 C CZ  . PHE D 1 35  ? -27.685 0.219   -62.368 1.00 61.07  ? 47  PHE D CZ  1 
ATOM   6802 N N   . ASP D 1 36  ? -27.035 3.532   -57.645 1.00 69.61  ? 48  ASP D N   1 
ATOM   6803 C CA  . ASP D 1 36  ? -26.538 4.787   -58.216 1.00 69.85  ? 48  ASP D CA  1 
ATOM   6804 C C   . ASP D 1 36  ? -25.193 5.220   -57.603 1.00 72.23  ? 48  ASP D C   1 
ATOM   6805 O O   . ASP D 1 36  ? -24.413 5.882   -58.291 1.00 70.67  ? 48  ASP D O   1 
ATOM   6806 C CB  . ASP D 1 36  ? -27.584 5.909   -58.115 1.00 74.69  ? 48  ASP D CB  1 
ATOM   6807 C CG  . ASP D 1 36  ? -28.627 5.794   -59.218 1.00 96.81  ? 48  ASP D CG  1 
ATOM   6808 O OD1 . ASP D 1 36  ? -28.267 6.007   -60.410 1.00 98.19  ? 48  ASP D OD1 1 
ATOM   6809 O OD2 . ASP D 1 36  ? -29.784 5.429   -58.906 1.00 105.85 ? 48  ASP D OD2 1 
ATOM   6810 N N   . LEU D 1 37  ? -24.913 4.818   -56.345 1.00 69.10  ? 49  LEU D N   1 
ATOM   6811 C CA  . LEU D 1 37  ? -23.620 5.016   -55.686 1.00 69.06  ? 49  LEU D CA  1 
ATOM   6812 C C   . LEU D 1 37  ? -22.513 4.229   -56.401 1.00 69.18  ? 49  LEU D C   1 
ATOM   6813 O O   . LEU D 1 37  ? -21.425 4.769   -56.609 1.00 68.59  ? 49  LEU D O   1 
ATOM   6814 C CB  . LEU D 1 37  ? -23.715 4.610   -54.197 1.00 72.09  ? 49  LEU D CB  1 
ATOM   6815 C CG  . LEU D 1 37  ? -22.444 4.706   -53.345 1.00 78.08  ? 49  LEU D CG  1 
ATOM   6816 C CD1 . LEU D 1 37  ? -21.965 6.137   -53.214 1.00 79.15  ? 49  LEU D CD1 1 
ATOM   6817 C CD2 . LEU D 1 37  ? -22.668 4.108   -51.972 1.00 83.36  ? 49  LEU D CD2 1 
ATOM   6818 N N   . VAL D 1 38  ? -22.795 2.965   -56.773 1.00 63.12  ? 50  VAL D N   1 
ATOM   6819 C CA  . VAL D 1 38  ? -21.866 2.088   -57.508 1.00 60.20  ? 50  VAL D CA  1 
ATOM   6820 C C   . VAL D 1 38  ? -21.584 2.696   -58.893 1.00 57.62  ? 50  VAL D C   1 
ATOM   6821 O O   . VAL D 1 38  ? -20.423 2.802   -59.281 1.00 55.92  ? 50  VAL D O   1 
ATOM   6822 C CB  . VAL D 1 38  ? -22.388 0.620   -57.606 1.00 63.89  ? 50  VAL D CB  1 
ATOM   6823 C CG1 . VAL D 1 38  ? -21.425 -0.264  -58.392 1.00 61.90  ? 50  VAL D CG1 1 
ATOM   6824 C CG2 . VAL D 1 38  ? -22.620 0.032   -56.216 1.00 66.33  ? 50  VAL D CG2 1 
ATOM   6825 N N   . CYS D 1 39  ? -22.638 3.122   -59.603 1.00 51.31  ? 51  CYS D N   1 
ATOM   6826 C CA  . CYS D 1 39  ? -22.554 3.729   -60.930 1.00 49.14  ? 51  CYS D CA  1 
ATOM   6827 C C   . CYS D 1 39  ? -21.727 5.033   -60.904 1.00 54.16  ? 51  CYS D C   1 
ATOM   6828 O O   . CYS D 1 39  ? -20.857 5.217   -61.753 1.00 52.75  ? 51  CYS D O   1 
ATOM   6829 C CB  . CYS D 1 39  ? -23.951 3.957   -61.499 1.00 49.21  ? 51  CYS D CB  1 
ATOM   6830 S SG  . CYS D 1 39  ? -24.879 2.427   -61.810 1.00 52.65  ? 51  CYS D SG  1 
ATOM   6831 N N   . ARG D 1 40  ? -21.977 5.911   -59.918 1.00 53.12  ? 52  ARG D N   1 
ATOM   6832 C CA  . ARG D 1 40  ? -21.235 7.161   -59.726 1.00 54.56  ? 52  ARG D CA  1 
ATOM   6833 C C   . ARG D 1 40  ? -19.733 6.894   -59.432 1.00 58.61  ? 52  ARG D C   1 
ATOM   6834 O O   . ARG D 1 40  ? -18.869 7.638   -59.918 1.00 57.06  ? 52  ARG D O   1 
ATOM   6835 C CB  . ARG D 1 40  ? -21.869 7.998   -58.598 1.00 57.58  ? 52  ARG D CB  1 
ATOM   6836 C CG  . ARG D 1 40  ? -21.559 9.489   -58.677 1.00 79.38  ? 52  ARG D CG  1 
ATOM   6837 C CD  . ARG D 1 40  ? -22.656 10.349  -58.061 1.00 104.85 ? 52  ARG D CD  1 
ATOM   6838 N NE  . ARG D 1 40  ? -22.921 9.999   -56.665 1.00 123.26 ? 52  ARG D NE  1 
ATOM   6839 C CZ  . ARG D 1 40  ? -24.129 9.761   -56.163 1.00 141.59 ? 52  ARG D CZ  1 
ATOM   6840 N NH1 . ARG D 1 40  ? -25.206 9.855   -56.934 1.00 128.64 ? 52  ARG D NH1 1 
ATOM   6841 N NH2 . ARG D 1 40  ? -24.270 9.436   -54.886 1.00 132.00 ? 52  ARG D NH2 1 
ATOM   6842 N N   . THR D 1 41  ? -19.433 5.815   -58.669 1.00 55.86  ? 53  THR D N   1 
ATOM   6843 C CA  . THR D 1 41  ? -18.072 5.364   -58.331 1.00 55.79  ? 53  THR D CA  1 
ATOM   6844 C C   . THR D 1 41  ? -17.302 4.965   -59.607 1.00 56.25  ? 53  THR D C   1 
ATOM   6845 O O   . THR D 1 41  ? -16.089 5.158   -59.678 1.00 55.59  ? 53  THR D O   1 
ATOM   6846 C CB  . THR D 1 41  ? -18.139 4.206   -57.303 1.00 63.73  ? 53  THR D CB  1 
ATOM   6847 O OG1 . THR D 1 41  ? -18.813 4.674   -56.131 1.00 65.63  ? 53  THR D OG1 1 
ATOM   6848 C CG2 . THR D 1 41  ? -16.764 3.675   -56.900 1.00 64.31  ? 53  THR D CG2 1 
ATOM   6849 N N   . LEU D 1 42  ? -18.008 4.423   -60.604 1.00 50.83  ? 54  LEU D N   1 
ATOM   6850 C CA  . LEU D 1 42  ? -17.396 3.942   -61.843 1.00 49.01  ? 54  LEU D CA  1 
ATOM   6851 C C   . LEU D 1 42  ? -17.524 4.967   -62.972 1.00 52.59  ? 54  LEU D C   1 
ATOM   6852 O O   . LEU D 1 42  ? -17.033 4.721   -64.078 1.00 50.97  ? 54  LEU D O   1 
ATOM   6853 C CB  . LEU D 1 42  ? -18.017 2.591   -62.257 1.00 47.68  ? 54  LEU D CB  1 
ATOM   6854 C CG  . LEU D 1 42  ? -17.952 1.471   -61.214 1.00 52.97  ? 54  LEU D CG  1 
ATOM   6855 C CD1 . LEU D 1 42  ? -18.765 0.286   -61.649 1.00 52.45  ? 54  LEU D CD1 1 
ATOM   6856 C CD2 . LEU D 1 42  ? -16.511 1.054   -60.924 1.00 55.12  ? 54  LEU D CD2 1 
ATOM   6857 N N   . GLY D 1 43  ? -18.146 6.110   -62.662 1.00 49.99  ? 55  GLY D N   1 
ATOM   6858 C CA  . GLY D 1 43  ? -18.424 7.189   -63.602 1.00 49.43  ? 55  GLY D CA  1 
ATOM   6859 C C   . GLY D 1 43  ? -19.362 6.774   -64.717 1.00 51.41  ? 55  GLY D C   1 
ATOM   6860 O O   . GLY D 1 43  ? -19.252 7.274   -65.836 1.00 50.51  ? 55  GLY D O   1 
ATOM   6861 N N   . LEU D 1 44  ? -20.288 5.855   -64.415 1.00 47.72  ? 56  LEU D N   1 
ATOM   6862 C CA  . LEU D 1 44  ? -21.144 5.179   -65.390 1.00 46.75  ? 56  LEU D CA  1 
ATOM   6863 C C   . LEU D 1 44  ? -22.510 5.850   -65.487 1.00 53.10  ? 56  LEU D C   1 
ATOM   6864 O O   . LEU D 1 44  ? -23.216 5.986   -64.482 1.00 53.57  ? 56  LEU D O   1 
ATOM   6865 C CB  . LEU D 1 44  ? -21.294 3.700   -64.998 1.00 46.03  ? 56  LEU D CB  1 
ATOM   6866 C CG  . LEU D 1 44  ? -22.290 2.853   -65.788 1.00 49.34  ? 56  LEU D CG  1 
ATOM   6867 C CD1 . LEU D 1 44  ? -21.728 2.455   -67.140 1.00 48.65  ? 56  LEU D CD1 1 
ATOM   6868 C CD2 . LEU D 1 44  ? -22.660 1.623   -65.019 1.00 49.85  ? 56  LEU D CD2 1 
ATOM   6869 N N   . ARG D 1 45  ? -22.868 6.269   -66.712 1.00 50.32  ? 57  ARG D N   1 
ATOM   6870 C CA  . ARG D 1 45  ? -24.125 6.948   -67.031 1.00 50.78  ? 57  ARG D CA  1 
ATOM   6871 C C   . ARG D 1 45  ? -25.078 6.024   -67.782 1.00 56.20  ? 57  ARG D C   1 
ATOM   6872 O O   . ARG D 1 45  ? -26.292 6.151   -67.620 1.00 56.77  ? 57  ARG D O   1 
ATOM   6873 C CB  . ARG D 1 45  ? -23.854 8.207   -67.862 1.00 49.37  ? 57  ARG D CB  1 
ATOM   6874 C CG  . ARG D 1 45  ? -23.226 9.337   -67.084 1.00 51.99  ? 57  ARG D CG  1 
ATOM   6875 C CD  . ARG D 1 45  ? -23.054 10.585  -67.934 1.00 60.64  ? 57  ARG D CD  1 
ATOM   6876 N NE  . ARG D 1 45  ? -22.304 10.337  -69.169 1.00 63.06  ? 57  ARG D NE  1 
ATOM   6877 C CZ  . ARG D 1 45  ? -20.976 10.296  -69.258 1.00 72.74  ? 57  ARG D CZ  1 
ATOM   6878 N NH1 . ARG D 1 45  ? -20.225 10.486  -68.180 1.00 60.68  ? 57  ARG D NH1 1 
ATOM   6879 N NH2 . ARG D 1 45  ? -20.391 10.054  -70.423 1.00 52.34  ? 57  ARG D NH2 1 
ATOM   6880 N N   . GLU D 1 46  ? -24.529 5.092   -68.601 1.00 52.43  ? 58  GLU D N   1 
ATOM   6881 C CA  . GLU D 1 46  ? -25.287 4.101   -69.378 1.00 51.24  ? 58  GLU D CA  1 
ATOM   6882 C C   . GLU D 1 46  ? -25.692 2.948   -68.445 1.00 54.19  ? 58  GLU D C   1 
ATOM   6883 O O   . GLU D 1 46  ? -25.249 1.805   -68.605 1.00 54.10  ? 58  GLU D O   1 
ATOM   6884 C CB  . GLU D 1 46  ? -24.447 3.623   -70.588 1.00 51.71  ? 58  GLU D CB  1 
ATOM   6885 C CG  . GLU D 1 46  ? -24.046 4.764   -71.510 1.00 61.66  ? 58  GLU D CG  1 
ATOM   6886 C CD  . GLU D 1 46  ? -23.147 4.456   -72.692 1.00 76.87  ? 58  GLU D CD  1 
ATOM   6887 O OE1 . GLU D 1 46  ? -22.125 3.756   -72.513 1.00 51.64  ? 58  GLU D OE1 1 
ATOM   6888 O OE2 . GLU D 1 46  ? -23.415 5.006   -73.782 1.00 81.62  ? 58  GLU D OE2 1 
ATOM   6889 N N   . THR D 1 47  ? -26.566 3.259   -67.475 1.00 50.73  ? 59  THR D N   1 
ATOM   6890 C CA  . THR D 1 47  ? -26.796 2.412   -66.296 1.00 50.47  ? 59  THR D CA  1 
ATOM   6891 C C   . THR D 1 47  ? -27.889 1.360   -66.525 1.00 54.48  ? 59  THR D C   1 
ATOM   6892 O O   . THR D 1 47  ? -27.895 0.359   -65.805 1.00 54.12  ? 59  THR D O   1 
ATOM   6893 C CB  . THR D 1 47  ? -27.120 3.260   -65.049 1.00 55.52  ? 59  THR D CB  1 
ATOM   6894 O OG1 . THR D 1 47  ? -28.324 3.977   -65.274 1.00 59.31  ? 59  THR D OG1 1 
ATOM   6895 C CG2 . THR D 1 47  ? -26.017 4.242   -64.689 1.00 50.61  ? 59  THR D CG2 1 
ATOM   6896 N N   . TRP D 1 48  ? -28.783 1.567   -67.531 1.00 52.39  ? 60  TRP D N   1 
ATOM   6897 C CA  . TRP D 1 48  ? -29.961 0.719   -67.836 1.00 53.48  ? 60  TRP D CA  1 
ATOM   6898 C C   . TRP D 1 48  ? -29.604 -0.743  -68.148 1.00 57.95  ? 60  TRP D C   1 
ATOM   6899 O O   . TRP D 1 48  ? -30.460 -1.610  -67.992 1.00 59.04  ? 60  TRP D O   1 
ATOM   6900 C CB  . TRP D 1 48  ? -30.790 1.293   -69.006 1.00 52.84  ? 60  TRP D CB  1 
ATOM   6901 C CG  . TRP D 1 48  ? -29.983 1.635   -70.222 1.00 52.69  ? 60  TRP D CG  1 
ATOM   6902 C CD1 . TRP D 1 48  ? -29.617 0.795   -71.235 1.00 54.78  ? 60  TRP D CD1 1 
ATOM   6903 C CD2 . TRP D 1 48  ? -29.393 2.902   -70.518 1.00 52.27  ? 60  TRP D CD2 1 
ATOM   6904 N NE1 . TRP D 1 48  ? -28.848 1.469   -72.154 1.00 53.71  ? 60  TRP D NE1 1 
ATOM   6905 C CE2 . TRP D 1 48  ? -28.690 2.763   -71.734 1.00 55.67  ? 60  TRP D CE2 1 
ATOM   6906 C CE3 . TRP D 1 48  ? -29.405 4.152   -69.880 1.00 54.37  ? 60  TRP D CE3 1 
ATOM   6907 C CZ2 . TRP D 1 48  ? -28.013 3.831   -72.327 1.00 55.54  ? 60  TRP D CZ2 1 
ATOM   6908 C CZ3 . TRP D 1 48  ? -28.740 5.210   -70.470 1.00 56.05  ? 60  TRP D CZ3 1 
ATOM   6909 C CH2 . TRP D 1 48  ? -28.050 5.046   -71.676 1.00 56.28  ? 60  TRP D CH2 1 
ATOM   6910 N N   . PHE D 1 49  ? -28.360 -1.012  -68.593 1.00 53.97  ? 61  PHE D N   1 
ATOM   6911 C CA  . PHE D 1 49  ? -27.857 -2.362  -68.847 1.00 52.80  ? 61  PHE D CA  1 
ATOM   6912 C C   . PHE D 1 49  ? -27.632 -3.143  -67.565 1.00 56.92  ? 61  PHE D C   1 
ATOM   6913 O O   . PHE D 1 49  ? -27.710 -4.368  -67.579 1.00 57.38  ? 61  PHE D O   1 
ATOM   6914 C CB  . PHE D 1 49  ? -26.534 -2.311  -69.622 1.00 53.15  ? 61  PHE D CB  1 
ATOM   6915 C CG  . PHE D 1 49  ? -26.602 -1.722  -71.009 1.00 54.76  ? 61  PHE D CG  1 
ATOM   6916 C CD1 . PHE D 1 49  ? -27.357 -2.335  -72.009 1.00 58.25  ? 61  PHE D CD1 1 
ATOM   6917 C CD2 . PHE D 1 49  ? -25.856 -0.596  -71.339 1.00 56.98  ? 61  PHE D CD2 1 
ATOM   6918 C CE1 . PHE D 1 49  ? -27.394 -1.807  -73.303 1.00 59.61  ? 61  PHE D CE1 1 
ATOM   6919 C CE2 . PHE D 1 49  ? -25.889 -0.074  -72.634 1.00 60.04  ? 61  PHE D CE2 1 
ATOM   6920 C CZ  . PHE D 1 49  ? -26.657 -0.684  -73.608 1.00 58.60  ? 61  PHE D CZ  1 
ATOM   6921 N N   . PHE D 1 50  ? -27.389 -2.440  -66.453 1.00 53.24  ? 62  PHE D N   1 
ATOM   6922 C CA  . PHE D 1 50  ? -26.809 -3.048  -65.261 1.00 52.95  ? 62  PHE D CA  1 
ATOM   6923 C C   . PHE D 1 50  ? -27.808 -3.205  -64.118 1.00 60.49  ? 62  PHE D C   1 
ATOM   6924 O O   . PHE D 1 50  ? -28.856 -2.555  -64.089 1.00 62.74  ? 62  PHE D O   1 
ATOM   6925 C CB  . PHE D 1 50  ? -25.587 -2.239  -64.797 1.00 52.86  ? 62  PHE D CB  1 
ATOM   6926 C CG  . PHE D 1 50  ? -24.523 -2.173  -65.867 1.00 51.75  ? 62  PHE D CG  1 
ATOM   6927 C CD1 . PHE D 1 50  ? -23.591 -3.199  -66.010 1.00 53.44  ? 62  PHE D CD1 1 
ATOM   6928 C CD2 . PHE D 1 50  ? -24.484 -1.114  -66.768 1.00 52.43  ? 62  PHE D CD2 1 
ATOM   6929 C CE1 . PHE D 1 50  ? -22.625 -3.154  -67.021 1.00 53.17  ? 62  PHE D CE1 1 
ATOM   6930 C CE2 . PHE D 1 50  ? -23.526 -1.074  -67.784 1.00 53.67  ? 62  PHE D CE2 1 
ATOM   6931 C CZ  . PHE D 1 50  ? -22.599 -2.091  -67.901 1.00 51.37  ? 62  PHE D CZ  1 
ATOM   6932 N N   . GLY D 1 51  ? -27.467 -4.108  -63.209 1.00 56.18  ? 63  GLY D N   1 
ATOM   6933 C CA  . GLY D 1 51  ? -28.166 -4.307  -61.955 1.00 57.51  ? 63  GLY D CA  1 
ATOM   6934 C C   . GLY D 1 51  ? -27.248 -4.911  -60.923 1.00 61.11  ? 63  GLY D C   1 
ATOM   6935 O O   . GLY D 1 51  ? -26.069 -5.146  -61.205 1.00 58.99  ? 63  GLY D O   1 
ATOM   6936 N N   . LEU D 1 52  ? -27.791 -5.160  -59.720 1.00 60.10  ? 64  LEU D N   1 
ATOM   6937 C CA  . LEU D 1 52  ? -27.086 -5.813  -58.617 1.00 61.37  ? 64  LEU D CA  1 
ATOM   6938 C C   . LEU D 1 52  ? -27.696 -7.193  -58.383 1.00 68.53  ? 64  LEU D C   1 
ATOM   6939 O O   . LEU D 1 52  ? -28.848 -7.314  -57.951 1.00 69.28  ? 64  LEU D O   1 
ATOM   6940 C CB  . LEU D 1 52  ? -27.107 -4.954  -57.332 1.00 62.96  ? 64  LEU D CB  1 
ATOM   6941 C CG  . LEU D 1 52  ? -26.379 -3.611  -57.397 1.00 65.53  ? 64  LEU D CG  1 
ATOM   6942 C CD1 . LEU D 1 52  ? -26.781 -2.725  -56.251 1.00 67.77  ? 64  LEU D CD1 1 
ATOM   6943 C CD2 . LEU D 1 52  ? -24.870 -3.794  -57.437 1.00 65.79  ? 64  LEU D CD2 1 
ATOM   6944 N N   . GLN D 1 53  ? -26.916 -8.230  -58.704 1.00 66.08  ? 65  GLN D N   1 
ATOM   6945 C CA  . GLN D 1 53  ? -27.364 -9.609  -58.691 1.00 67.93  ? 65  GLN D CA  1 
ATOM   6946 C C   . GLN D 1 53  ? -26.941 -10.338 -57.405 1.00 77.42  ? 65  GLN D C   1 
ATOM   6947 O O   . GLN D 1 53  ? -25.885 -10.063 -56.830 1.00 76.56  ? 65  GLN D O   1 
ATOM   6948 C CB  . GLN D 1 53  ? -26.814 -10.338 -59.921 1.00 66.99  ? 65  GLN D CB  1 
ATOM   6949 C CG  . GLN D 1 53  ? -27.554 -11.622 -60.279 1.00 76.37  ? 65  GLN D CG  1 
ATOM   6950 C CD  . GLN D 1 53  ? -26.714 -12.484 -61.173 1.00 90.72  ? 65  GLN D CD  1 
ATOM   6951 O OE1 . GLN D 1 53  ? -26.904 -12.522 -62.390 1.00 84.41  ? 65  GLN D OE1 1 
ATOM   6952 N NE2 . GLN D 1 53  ? -25.735 -13.166 -60.593 1.00 80.39  ? 65  GLN D NE2 1 
ATOM   6953 N N   . TYR D 1 54  ? -27.806 -11.256 -56.959 1.00 78.93  ? 66  TYR D N   1 
ATOM   6954 C CA  . TYR D 1 54  ? -27.575 -12.206 -55.877 1.00 83.14  ? 66  TYR D CA  1 
ATOM   6955 C C   . TYR D 1 54  ? -28.303 -13.520 -56.228 1.00 92.19  ? 66  TYR D C   1 
ATOM   6956 O O   . TYR D 1 54  ? -28.994 -13.581 -57.253 1.00 90.55  ? 66  TYR D O   1 
ATOM   6957 C CB  . TYR D 1 54  ? -28.018 -11.618 -54.519 1.00 87.14  ? 66  TYR D CB  1 
ATOM   6958 C CG  . TYR D 1 54  ? -29.485 -11.252 -54.415 1.00 89.82  ? 66  TYR D CG  1 
ATOM   6959 C CD1 . TYR D 1 54  ? -29.984 -10.101 -55.023 1.00 89.37  ? 66  TYR D CD1 1 
ATOM   6960 C CD2 . TYR D 1 54  ? -30.361 -12.012 -53.642 1.00 94.16  ? 66  TYR D CD2 1 
ATOM   6961 C CE1 . TYR D 1 54  ? -31.330 -9.753  -54.924 1.00 91.20  ? 66  TYR D CE1 1 
ATOM   6962 C CE2 . TYR D 1 54  ? -31.707 -11.664 -53.520 1.00 96.37  ? 66  TYR D CE2 1 
ATOM   6963 C CZ  . TYR D 1 54  ? -32.187 -10.533 -54.165 1.00 100.34 ? 66  TYR D CZ  1 
ATOM   6964 O OH  . TYR D 1 54  ? -33.511 -10.178 -54.064 1.00 101.53 ? 66  TYR D OH  1 
ATOM   6965 N N   . THR D 1 55  ? -28.117 -14.579 -55.428 1.00 94.33  ? 67  THR D N   1 
ATOM   6966 C CA  . THR D 1 55  ? -28.746 -15.862 -55.750 1.00 96.73  ? 67  THR D CA  1 
ATOM   6967 C C   . THR D 1 55  ? -29.620 -16.341 -54.591 1.00 107.09 ? 67  THR D C   1 
ATOM   6968 O O   . THR D 1 55  ? -29.160 -16.402 -53.445 1.00 109.16 ? 67  THR D O   1 
ATOM   6969 C CB  . THR D 1 55  ? -27.712 -16.928 -56.170 1.00 103.24 ? 67  THR D CB  1 
ATOM   6970 O OG1 . THR D 1 55  ? -26.639 -16.969 -55.228 1.00 106.04 ? 67  THR D OG1 1 
ATOM   6971 C CG2 . THR D 1 55  ? -27.169 -16.702 -57.569 1.00 96.29  ? 67  THR D CG2 1 
ATOM   6972 N N   . ILE D 1 56  ? -30.899 -16.645 -54.898 1.00 106.58 ? 68  ILE D N   1 
ATOM   6973 C CA  . ILE D 1 56  ? -31.823 -17.295 -53.963 1.00 111.95 ? 68  ILE D CA  1 
ATOM   6974 C C   . ILE D 1 56  ? -31.878 -18.792 -54.323 1.00 118.89 ? 68  ILE D C   1 
ATOM   6975 O O   . ILE D 1 56  ? -32.279 -19.152 -55.437 1.00 116.39 ? 68  ILE D O   1 
ATOM   6976 C CB  . ILE D 1 56  ? -33.230 -16.623 -53.917 1.00 116.07 ? 68  ILE D CB  1 
ATOM   6977 C CG1 . ILE D 1 56  ? -33.123 -15.094 -53.630 1.00 114.93 ? 68  ILE D CG1 1 
ATOM   6978 C CG2 . ILE D 1 56  ? -34.127 -17.330 -52.881 1.00 121.80 ? 68  ILE D CG2 1 
ATOM   6979 C CD1 . ILE D 1 56  ? -34.394 -14.237 -53.931 1.00 122.17 ? 68  ILE D CD1 1 
ATOM   6980 N N   . LYS D 1 57  ? -31.460 -19.645 -53.360 1.00 120.44 ? 69  LYS D N   1 
ATOM   6981 C CA  . LYS D 1 57  ? -31.212 -21.085 -53.501 1.00 122.95 ? 69  LYS D CA  1 
ATOM   6982 C C   . LYS D 1 57  ? -30.212 -21.366 -54.642 1.00 124.80 ? 69  LYS D C   1 
ATOM   6983 O O   . LYS D 1 57  ? -29.018 -21.502 -54.371 1.00 124.37 ? 69  LYS D O   1 
ATOM   6984 C CB  . LYS D 1 57  ? -32.518 -21.893 -53.670 1.00 128.01 ? 69  LYS D CB  1 
ATOM   6985 C CG  . LYS D 1 57  ? -33.209 -22.191 -52.338 1.00 146.53 ? 69  LYS D CG  1 
ATOM   6986 C CD  . LYS D 1 57  ? -33.798 -23.595 -52.288 1.00 158.33 ? 69  LYS D CD  1 
ATOM   6987 C CE  . LYS D 1 57  ? -34.208 -23.995 -50.885 1.00 171.60 ? 69  LYS D CE  1 
ATOM   6988 N NZ  . LYS D 1 57  ? -34.331 -25.470 -50.733 1.00 183.35 ? 69  LYS D NZ  1 
ATOM   6989 N N   . ASP D 1 58  ? -30.692 -21.439 -55.896 1.00 119.67 ? 70  ASP D N   1 
ATOM   6990 C CA  . ASP D 1 58  ? -29.852 -21.678 -57.072 1.00 116.67 ? 70  ASP D CA  1 
ATOM   6991 C C   . ASP D 1 58  ? -30.295 -20.796 -58.250 1.00 116.41 ? 70  ASP D C   1 
ATOM   6992 O O   . ASP D 1 58  ? -29.749 -20.923 -59.354 1.00 113.49 ? 70  ASP D O   1 
ATOM   6993 C CB  . ASP D 1 58  ? -29.881 -23.171 -57.470 1.00 120.99 ? 70  ASP D CB  1 
ATOM   6994 C CG  . ASP D 1 58  ? -28.958 -24.083 -56.674 1.00 136.35 ? 70  ASP D CG  1 
ATOM   6995 O OD1 . ASP D 1 58  ? -27.768 -23.726 -56.500 1.00 135.84 ? 70  ASP D OD1 1 
ATOM   6996 O OD2 . ASP D 1 58  ? -29.401 -25.192 -56.299 1.00 145.89 ? 70  ASP D OD2 1 
ATOM   6997 N N   . THR D 1 59  ? -31.267 -19.890 -58.005 1.00 112.24 ? 71  THR D N   1 
ATOM   6998 C CA  . THR D 1 59  ? -31.838 -19.004 -59.023 1.00 108.59 ? 71  THR D CA  1 
ATOM   6999 C C   . THR D 1 59  ? -31.214 -17.604 -58.939 1.00 108.18 ? 71  THR D C   1 
ATOM   7000 O O   . THR D 1 59  ? -30.942 -17.103 -57.845 1.00 108.66 ? 71  THR D O   1 
ATOM   7001 C CB  . THR D 1 59  ? -33.373 -18.941 -58.878 1.00 118.65 ? 71  THR D CB  1 
ATOM   7002 O OG1 . THR D 1 59  ? -33.895 -20.266 -58.701 1.00 122.70 ? 71  THR D OG1 1 
ATOM   7003 C CG2 . THR D 1 59  ? -34.061 -18.247 -60.069 1.00 113.60 ? 71  THR D CG2 1 
ATOM   7004 N N   . VAL D 1 60  ? -30.988 -16.988 -60.113 1.00 100.12 ? 72  VAL D N   1 
ATOM   7005 C CA  . VAL D 1 60  ? -30.557 -15.596 -60.265 1.00 96.46  ? 72  VAL D CA  1 
ATOM   7006 C C   . VAL D 1 60  ? -31.665 -14.673 -59.730 1.00 98.86  ? 72  VAL D C   1 
ATOM   7007 O O   . VAL D 1 60  ? -32.842 -14.848 -60.059 1.00 99.92  ? 72  VAL D O   1 
ATOM   7008 C CB  . VAL D 1 60  ? -30.186 -15.295 -61.750 1.00 97.00  ? 72  VAL D CB  1 
ATOM   7009 C CG1 . VAL D 1 60  ? -30.157 -13.799 -62.051 1.00 94.54  ? 72  VAL D CG1 1 
ATOM   7010 C CG2 . VAL D 1 60  ? -28.852 -15.936 -62.115 1.00 95.74  ? 72  VAL D CG2 1 
ATOM   7011 N N   . ALA D 1 61  ? -31.274 -13.728 -58.871 1.00 92.82  ? 73  ALA D N   1 
ATOM   7012 C CA  . ALA D 1 61  ? -32.148 -12.677 -58.376 1.00 92.23  ? 73  ALA D CA  1 
ATOM   7013 C C   . ALA D 1 61  ? -31.487 -11.312 -58.577 1.00 90.95  ? 73  ALA D C   1 
ATOM   7014 O O   . ALA D 1 61  ? -30.277 -11.175 -58.388 1.00 88.62  ? 73  ALA D O   1 
ATOM   7015 C CB  . ALA D 1 61  ? -32.462 -12.912 -56.907 1.00 96.53  ? 73  ALA D CB  1 
ATOM   7016 N N   . TRP D 1 62  ? -32.280 -10.315 -58.984 1.00 84.96  ? 74  TRP D N   1 
ATOM   7017 C CA  . TRP D 1 62  ? -31.815 -8.941  -59.117 1.00 81.64  ? 74  TRP D CA  1 
ATOM   7018 C C   . TRP D 1 62  ? -32.432 -8.092  -58.019 1.00 85.54  ? 74  TRP D C   1 
ATOM   7019 O O   . TRP D 1 62  ? -33.637 -8.194  -57.770 1.00 87.07  ? 74  TRP D O   1 
ATOM   7020 C CB  . TRP D 1 62  ? -32.153 -8.377  -60.508 1.00 77.79  ? 74  TRP D CB  1 
ATOM   7021 C CG  . TRP D 1 62  ? -31.473 -9.108  -61.620 1.00 76.26  ? 74  TRP D CG  1 
ATOM   7022 C CD1 . TRP D 1 62  ? -31.953 -10.187 -62.296 1.00 79.36  ? 74  TRP D CD1 1 
ATOM   7023 C CD2 . TRP D 1 62  ? -30.163 -8.848  -62.150 1.00 73.59  ? 74  TRP D CD2 1 
ATOM   7024 N NE1 . TRP D 1 62  ? -31.038 -10.606 -63.231 1.00 76.73  ? 74  TRP D NE1 1 
ATOM   7025 C CE2 . TRP D 1 62  ? -29.923 -9.808  -63.157 1.00 76.44  ? 74  TRP D CE2 1 
ATOM   7026 C CE3 . TRP D 1 62  ? -29.168 -7.890  -61.876 1.00 73.47  ? 74  TRP D CE3 1 
ATOM   7027 C CZ2 . TRP D 1 62  ? -28.731 -9.834  -63.898 1.00 73.52  ? 74  TRP D CZ2 1 
ATOM   7028 C CZ3 . TRP D 1 62  ? -27.986 -7.919  -62.609 1.00 72.77  ? 74  TRP D CZ3 1 
ATOM   7029 C CH2 . TRP D 1 62  ? -27.778 -8.878  -63.610 1.00 72.45  ? 74  TRP D CH2 1 
ATOM   7030 N N   . LEU D 1 63  ? -31.603 -7.266  -57.362 1.00 80.59  ? 75  LEU D N   1 
ATOM   7031 C CA  . LEU D 1 63  ? -32.024 -6.363  -56.298 1.00 82.28  ? 75  LEU D CA  1 
ATOM   7032 C C   . LEU D 1 63  ? -33.063 -5.357  -56.821 1.00 86.90  ? 75  LEU D C   1 
ATOM   7033 O O   . LEU D 1 63  ? -32.892 -4.788  -57.897 1.00 83.86  ? 75  LEU D O   1 
ATOM   7034 C CB  . LEU D 1 63  ? -30.794 -5.646  -55.703 1.00 81.46  ? 75  LEU D CB  1 
ATOM   7035 C CG  . LEU D 1 63  ? -31.021 -4.707  -54.518 1.00 88.61  ? 75  LEU D CG  1 
ATOM   7036 C CD1 . LEU D 1 63  ? -31.302 -5.472  -53.240 1.00 92.71  ? 75  LEU D CD1 1 
ATOM   7037 C CD2 . LEU D 1 63  ? -29.834 -3.814  -54.311 1.00 89.63  ? 75  LEU D CD2 1 
ATOM   7038 N N   . LYS D 1 64  ? -34.167 -5.197  -56.081 1.00 87.81  ? 76  LYS D N   1 
ATOM   7039 C CA  . LYS D 1 64  ? -35.227 -4.247  -56.410 1.00 88.48  ? 76  LYS D CA  1 
ATOM   7040 C C   . LYS D 1 64  ? -34.828 -2.837  -55.970 1.00 92.12  ? 76  LYS D C   1 
ATOM   7041 O O   . LYS D 1 64  ? -34.297 -2.649  -54.870 1.00 93.31  ? 76  LYS D O   1 
ATOM   7042 C CB  . LYS D 1 64  ? -36.560 -4.672  -55.767 1.00 95.06  ? 76  LYS D CB  1 
ATOM   7043 C CG  . LYS D 1 64  ? -37.283 -5.778  -56.523 1.00 109.66 ? 76  LYS D CG  1 
ATOM   7044 C CD  . LYS D 1 64  ? -38.515 -5.259  -57.261 1.00 120.09 ? 76  LYS D CD  1 
ATOM   7045 C CE  . LYS D 1 64  ? -39.384 -6.386  -57.759 1.00 130.64 ? 76  LYS D CE  1 
ATOM   7046 N NZ  . LYS D 1 64  ? -40.412 -5.911  -58.724 1.00 137.94 ? 76  LYS D NZ  1 
ATOM   7047 N N   . MET D 1 65  ? -35.108 -1.851  -56.829 1.00 86.93  ? 77  MET D N   1 
ATOM   7048 C CA  . MET D 1 65  ? -34.670 -0.467  -56.655 1.00 86.14  ? 77  MET D CA  1 
ATOM   7049 C C   . MET D 1 65  ? -35.551 0.305   -55.656 1.00 95.83  ? 77  MET D C   1 
ATOM   7050 O O   . MET D 1 65  ? -35.062 1.251   -55.034 1.00 95.81  ? 77  MET D O   1 
ATOM   7051 C CB  . MET D 1 65  ? -34.617 0.260   -58.010 1.00 85.45  ? 77  MET D CB  1 
ATOM   7052 C CG  . MET D 1 65  ? -33.659 -0.379  -59.014 1.00 85.39  ? 77  MET D CG  1 
ATOM   7053 S SD  . MET D 1 65  ? -31.898 -0.149  -58.636 1.00 87.29  ? 77  MET D SD  1 
ATOM   7054 C CE  . MET D 1 65  ? -31.460 -1.767  -58.026 1.00 84.10  ? 77  MET D CE  1 
ATOM   7055 N N   . ASP D 1 66  ? -36.829 -0.098  -55.489 1.00 96.90  ? 78  ASP D N   1 
ATOM   7056 C CA  . ASP D 1 66  ? -37.743 0.558   -54.555 1.00 101.39 ? 78  ASP D CA  1 
ATOM   7057 C C   . ASP D 1 66  ? -37.752 -0.089  -53.162 1.00 108.82 ? 78  ASP D C   1 
ATOM   7058 O O   . ASP D 1 66  ? -38.180 0.558   -52.206 1.00 111.31 ? 78  ASP D O   1 
ATOM   7059 C CB  . ASP D 1 66  ? -39.166 0.613   -55.116 1.00 105.65 ? 78  ASP D CB  1 
ATOM   7060 C CG  . ASP D 1 66  ? -39.601 2.017   -55.534 1.00 121.68 ? 78  ASP D CG  1 
ATOM   7061 O OD1 . ASP D 1 66  ? -39.198 3.006   -54.856 1.00 123.24 ? 78  ASP D OD1 1 
ATOM   7062 O OD2 . ASP D 1 66  ? -40.448 2.123   -56.430 1.00 129.40 ? 78  ASP D OD2 1 
ATOM   7063 N N   . LYS D 1 67  ? -37.304 -1.349  -53.045 1.00 105.62 ? 79  LYS D N   1 
ATOM   7064 C CA  . LYS D 1 67  ? -37.197 -2.020  -51.750 1.00 108.99 ? 79  LYS D CA  1 
ATOM   7065 C C   . LYS D 1 67  ? -35.918 -1.608  -51.033 1.00 112.85 ? 79  LYS D C   1 
ATOM   7066 O O   . LYS D 1 67  ? -34.886 -1.415  -51.678 1.00 109.01 ? 79  LYS D O   1 
ATOM   7067 C CB  . LYS D 1 67  ? -37.239 -3.542  -51.898 1.00 111.87 ? 79  LYS D CB  1 
ATOM   7068 C CG  . LYS D 1 67  ? -38.618 -4.110  -52.187 1.00 130.18 ? 79  LYS D CG  1 
ATOM   7069 C CD  . LYS D 1 67  ? -38.587 -5.617  -51.992 1.00 141.97 ? 79  LYS D CD  1 
ATOM   7070 C CE  . LYS D 1 67  ? -39.231 -6.382  -53.129 1.00 153.21 ? 79  LYS D CE  1 
ATOM   7071 N NZ  . LYS D 1 67  ? -38.906 -7.834  -53.076 1.00 162.80 ? 79  LYS D NZ  1 
ATOM   7072 N N   . LYS D 1 68  ? -35.993 -1.475  -49.697 1.00 113.61 ? 80  LYS D N   1 
ATOM   7073 C CA  . LYS D 1 68  ? -34.845 -1.211  -48.827 1.00 114.09 ? 80  LYS D CA  1 
ATOM   7074 C C   . LYS D 1 68  ? -33.831 -2.352  -48.914 1.00 117.20 ? 80  LYS D C   1 
ATOM   7075 O O   . LYS D 1 68  ? -34.217 -3.525  -48.945 1.00 117.92 ? 80  LYS D O   1 
ATOM   7076 C CB  . LYS D 1 68  ? -35.295 -1.020  -47.367 1.00 121.86 ? 80  LYS D CB  1 
ATOM   7077 C CG  . LYS D 1 68  ? -35.947 0.329   -47.081 1.00 138.79 ? 80  LYS D CG  1 
ATOM   7078 C CD  . LYS D 1 68  ? -36.323 0.458   -45.614 1.00 154.36 ? 80  LYS D CD  1 
ATOM   7079 C CE  . LYS D 1 68  ? -37.076 1.733   -45.317 1.00 166.28 ? 80  LYS D CE  1 
ATOM   7080 N NZ  . LYS D 1 68  ? -37.490 1.816   -43.888 1.00 181.10 ? 80  LYS D NZ  1 
ATOM   7081 N N   . VAL D 1 69  ? -32.539 -2.001  -48.992 1.00 111.91 ? 81  VAL D N   1 
ATOM   7082 C CA  . VAL D 1 69  ? -31.434 -2.961  -48.950 1.00 110.72 ? 81  VAL D CA  1 
ATOM   7083 C C   . VAL D 1 69  ? -31.371 -3.525  -47.520 1.00 119.59 ? 81  VAL D C   1 
ATOM   7084 O O   . VAL D 1 69  ? -30.933 -2.821  -46.606 1.00 121.45 ? 81  VAL D O   1 
ATOM   7085 C CB  . VAL D 1 69  ? -30.088 -2.324  -49.406 1.00 111.19 ? 81  VAL D CB  1 
ATOM   7086 C CG1 . VAL D 1 69  ? -28.957 -3.351  -49.408 1.00 110.25 ? 81  VAL D CG1 1 
ATOM   7087 C CG2 . VAL D 1 69  ? -30.219 -1.667  -50.777 1.00 106.96 ? 81  VAL D CG2 1 
ATOM   7088 N N   . LEU D 1 70  ? -31.890 -4.765  -47.343 1.00 117.87 ? 82  LEU D N   1 
ATOM   7089 C CA  . LEU D 1 70  ? -31.954 -5.608  -46.132 1.00 144.59 ? 82  LEU D CA  1 
ATOM   7090 C C   . LEU D 1 70  ? -33.016 -6.689  -46.319 1.00 167.12 ? 82  LEU D C   1 
ATOM   7091 O O   . LEU D 1 70  ? -32.961 -7.734  -45.673 1.00 128.40 ? 82  LEU D O   1 
ATOM   7092 C CB  . LEU D 1 70  ? -32.224 -4.823  -44.826 1.00 149.08 ? 82  LEU D CB  1 
ATOM   7093 C CG  . LEU D 1 70  ? -30.994 -4.450  -43.980 1.00 155.09 ? 82  LEU D CG  1 
ATOM   7094 C CD1 . LEU D 1 70  ? -31.312 -3.314  -43.030 1.00 158.55 ? 82  LEU D CD1 1 
ATOM   7095 C CD2 . LEU D 1 70  ? -30.439 -5.649  -43.223 1.00 160.65 ? 82  LEU D CD2 1 
ATOM   7096 N N   . PRO D 1 79  ? -21.610 -10.651 -44.280 1.00 118.14 ? 91  PRO D N   1 
ATOM   7097 C CA  . PRO D 1 79  ? -21.268 -9.575  -45.228 1.00 112.80 ? 91  PRO D CA  1 
ATOM   7098 C C   . PRO D 1 79  ? -22.163 -9.612  -46.470 1.00 110.67 ? 91  PRO D C   1 
ATOM   7099 O O   . PRO D 1 79  ? -22.073 -10.546 -47.273 1.00 108.36 ? 91  PRO D O   1 
ATOM   7100 C CB  . PRO D 1 79  ? -19.788 -9.835  -45.568 1.00 113.69 ? 91  PRO D CB  1 
ATOM   7101 C CG  . PRO D 1 79  ? -19.383 -11.074 -44.780 1.00 122.66 ? 91  PRO D CG  1 
ATOM   7102 C CD  . PRO D 1 79  ? -20.639 -11.756 -44.332 1.00 120.86 ? 91  PRO D CD  1 
ATOM   7103 N N   . VAL D 1 80  ? -23.041 -8.594  -46.611 1.00 104.52 ? 92  VAL D N   1 
ATOM   7104 C CA  . VAL D 1 80  ? -24.023 -8.482  -47.702 1.00 100.20 ? 92  VAL D CA  1 
ATOM   7105 C C   . VAL D 1 80  ? -23.281 -8.276  -49.026 1.00 97.39  ? 92  VAL D C   1 
ATOM   7106 O O   . VAL D 1 80  ? -22.516 -7.319  -49.153 1.00 95.54  ? 92  VAL D O   1 
ATOM   7107 C CB  . VAL D 1 80  ? -25.067 -7.358  -47.456 1.00 104.21 ? 92  VAL D CB  1 
ATOM   7108 C CG1 . VAL D 1 80  ? -26.190 -7.415  -48.486 1.00 101.48 ? 92  VAL D CG1 1 
ATOM   7109 C CG2 . VAL D 1 80  ? -25.640 -7.429  -46.044 1.00 109.09 ? 92  VAL D CG2 1 
ATOM   7110 N N   . THR D 1 81  ? -23.507 -9.173  -50.001 1.00 90.16  ? 93  THR D N   1 
ATOM   7111 C CA  . THR D 1 81  ? -22.761 -9.170  -51.259 1.00 85.15  ? 93  THR D CA  1 
ATOM   7112 C C   . THR D 1 81  ? -23.720 -9.153  -52.458 1.00 84.68  ? 93  THR D C   1 
ATOM   7113 O O   . THR D 1 81  ? -24.647 -9.962  -52.533 1.00 84.95  ? 93  THR D O   1 
ATOM   7114 C CB  . THR D 1 81  ? -21.775 -10.359 -51.307 1.00 91.89  ? 93  THR D CB  1 
ATOM   7115 O OG1 . THR D 1 81  ? -20.907 -10.291 -50.175 1.00 95.30  ? 93  THR D OG1 1 
ATOM   7116 C CG2 . THR D 1 81  ? -20.925 -10.373 -52.562 1.00 85.65  ? 93  THR D CG2 1 
ATOM   7117 N N   . PHE D 1 82  ? -23.487 -8.204  -53.381 1.00 77.18  ? 94  PHE D N   1 
ATOM   7118 C CA  . PHE D 1 82  ? -24.131 -8.160  -54.692 1.00 73.53  ? 94  PHE D CA  1 
ATOM   7119 C C   . PHE D 1 82  ? -23.090 -8.174  -55.790 1.00 73.97  ? 94  PHE D C   1 
ATOM   7120 O O   . PHE D 1 82  ? -21.968 -7.708  -55.588 1.00 73.01  ? 94  PHE D O   1 
ATOM   7121 C CB  . PHE D 1 82  ? -25.041 -6.933  -54.845 1.00 74.32  ? 94  PHE D CB  1 
ATOM   7122 C CG  . PHE D 1 82  ? -26.115 -6.835  -53.791 1.00 78.72  ? 94  PHE D CG  1 
ATOM   7123 C CD1 . PHE D 1 82  ? -27.277 -7.586  -53.888 1.00 82.39  ? 94  PHE D CD1 1 
ATOM   7124 C CD2 . PHE D 1 82  ? -25.960 -5.996  -52.696 1.00 82.83  ? 94  PHE D CD2 1 
ATOM   7125 C CE1 . PHE D 1 82  ? -28.259 -7.507  -52.904 1.00 86.44  ? 94  PHE D CE1 1 
ATOM   7126 C CE2 . PHE D 1 82  ? -26.949 -5.913  -51.715 1.00 88.81  ? 94  PHE D CE2 1 
ATOM   7127 C CZ  . PHE D 1 82  ? -28.089 -6.670  -51.824 1.00 88.01  ? 94  PHE D CZ  1 
ATOM   7128 N N   . HIS D 1 83  ? -23.458 -8.733  -56.946 1.00 68.97  ? 95  HIS D N   1 
ATOM   7129 C CA  . HIS D 1 83  ? -22.617 -8.736  -58.131 1.00 66.00  ? 95  HIS D CA  1 
ATOM   7130 C C   . HIS D 1 83  ? -23.128 -7.705  -59.116 1.00 66.79  ? 95  HIS D C   1 
ATOM   7131 O O   . HIS D 1 83  ? -24.274 -7.796  -59.579 1.00 65.98  ? 95  HIS D O   1 
ATOM   7132 C CB  . HIS D 1 83  ? -22.559 -10.132 -58.758 1.00 66.57  ? 95  HIS D CB  1 
ATOM   7133 C CG  . HIS D 1 83  ? -21.677 -11.070 -58.003 1.00 72.20  ? 95  HIS D CG  1 
ATOM   7134 N ND1 . HIS D 1 83  ? -22.037 -11.552 -56.759 1.00 77.19  ? 95  HIS D ND1 1 
ATOM   7135 C CD2 . HIS D 1 83  ? -20.468 -11.579 -58.336 1.00 74.00  ? 95  HIS D CD2 1 
ATOM   7136 C CE1 . HIS D 1 83  ? -21.042 -12.335 -56.374 1.00 78.33  ? 95  HIS D CE1 1 
ATOM   7137 N NE2 . HIS D 1 83  ? -20.075 -12.384 -57.291 1.00 76.80  ? 95  HIS D NE2 1 
ATOM   7138 N N   . PHE D 1 84  ? -22.291 -6.695  -59.403 1.00 60.91  ? 96  PHE D N   1 
ATOM   7139 C CA  . PHE D 1 84  ? -22.614 -5.685  -60.396 1.00 58.08  ? 96  PHE D CA  1 
ATOM   7140 C C   . PHE D 1 84  ? -22.387 -6.287  -61.774 1.00 59.73  ? 96  PHE D C   1 
ATOM   7141 O O   . PHE D 1 84  ? -21.247 -6.555  -62.163 1.00 58.83  ? 96  PHE D O   1 
ATOM   7142 C CB  . PHE D 1 84  ? -21.795 -4.406  -60.170 1.00 59.29  ? 96  PHE D CB  1 
ATOM   7143 C CG  . PHE D 1 84  ? -22.202 -3.255  -61.062 1.00 58.52  ? 96  PHE D CG  1 
ATOM   7144 C CD1 . PHE D 1 84  ? -23.286 -2.444  -60.729 1.00 61.07  ? 96  PHE D CD1 1 
ATOM   7145 C CD2 . PHE D 1 84  ? -21.494 -2.973  -62.227 1.00 57.65  ? 96  PHE D CD2 1 
ATOM   7146 C CE1 . PHE D 1 84  ? -23.656 -1.377  -61.549 1.00 60.29  ? 96  PHE D CE1 1 
ATOM   7147 C CE2 . PHE D 1 84  ? -21.863 -1.902  -63.045 1.00 58.67  ? 96  PHE D CE2 1 
ATOM   7148 C CZ  . PHE D 1 84  ? -22.936 -1.108  -62.694 1.00 57.35  ? 96  PHE D CZ  1 
ATOM   7149 N N   . LEU D 1 85  ? -23.487 -6.549  -62.486 1.00 55.50  ? 97  LEU D N   1 
ATOM   7150 C CA  . LEU D 1 85  ? -23.472 -7.230  -63.776 1.00 54.17  ? 97  LEU D CA  1 
ATOM   7151 C C   . LEU D 1 85  ? -24.455 -6.601  -64.747 1.00 57.63  ? 97  LEU D C   1 
ATOM   7152 O O   . LEU D 1 85  ? -25.425 -5.965  -64.333 1.00 58.68  ? 97  LEU D O   1 
ATOM   7153 C CB  . LEU D 1 85  ? -23.823 -8.730  -63.613 1.00 55.34  ? 97  LEU D CB  1 
ATOM   7154 C CG  . LEU D 1 85  ? -22.820 -9.642  -62.896 1.00 60.74  ? 97  LEU D CG  1 
ATOM   7155 C CD1 . LEU D 1 85  ? -23.479 -10.945 -62.505 1.00 61.87  ? 97  LEU D CD1 1 
ATOM   7156 C CD2 . LEU D 1 85  ? -21.520 -9.857  -63.723 1.00 61.23  ? 97  LEU D CD2 1 
ATOM   7157 N N   . ALA D 1 86  ? -24.211 -6.801  -66.044 1.00 52.40  ? 98  ALA D N   1 
ATOM   7158 C CA  . ALA D 1 86  ? -25.169 -6.498  -67.091 1.00 51.32  ? 98  ALA D CA  1 
ATOM   7159 C C   . ALA D 1 86  ? -26.332 -7.482  -67.041 1.00 56.37  ? 98  ALA D C   1 
ATOM   7160 O O   . ALA D 1 86  ? -26.118 -8.696  -67.050 1.00 56.18  ? 98  ALA D O   1 
ATOM   7161 C CB  . ALA D 1 86  ? -24.488 -6.555  -68.444 1.00 50.86  ? 98  ALA D CB  1 
ATOM   7162 N N   . LYS D 1 87  ? -27.557 -6.942  -66.925 1.00 54.16  ? 99  LYS D N   1 
ATOM   7163 C CA  . LYS D 1 87  ? -28.834 -7.657  -66.996 1.00 55.06  ? 99  LYS D CA  1 
ATOM   7164 C C   . LYS D 1 87  ? -29.300 -7.705  -68.444 1.00 60.12  ? 99  LYS D C   1 
ATOM   7165 O O   . LYS D 1 87  ? -29.924 -8.689  -68.868 1.00 60.84  ? 99  LYS D O   1 
ATOM   7166 C CB  . LYS D 1 87  ? -29.876 -6.951  -66.107 1.00 58.02  ? 99  LYS D CB  1 
ATOM   7167 C CG  . LYS D 1 87  ? -31.142 -7.751  -65.868 1.00 65.66  ? 99  LYS D CG  1 
ATOM   7168 C CD  . LYS D 1 87  ? -32.064 -7.032  -64.910 1.00 69.76  ? 99  LYS D CD  1 
ATOM   7169 C CE  . LYS D 1 87  ? -33.331 -7.810  -64.644 1.00 71.31  ? 99  LYS D CE  1 
ATOM   7170 N NZ  . LYS D 1 87  ? -34.264 -7.029  -63.795 1.00 77.33  ? 99  LYS D NZ  1 
ATOM   7171 N N   . PHE D 1 88  ? -28.980 -6.633  -69.198 1.00 55.93  ? 100 PHE D N   1 
ATOM   7172 C CA  . PHE D 1 88  ? -29.356 -6.456  -70.597 1.00 55.71  ? 100 PHE D CA  1 
ATOM   7173 C C   . PHE D 1 88  ? -28.129 -6.189  -71.454 1.00 58.69  ? 100 PHE D C   1 
ATOM   7174 O O   . PHE D 1 88  ? -27.145 -5.603  -70.977 1.00 57.80  ? 100 PHE D O   1 
ATOM   7175 C CB  . PHE D 1 88  ? -30.373 -5.317  -70.746 1.00 58.30  ? 100 PHE D CB  1 
ATOM   7176 C CG  . PHE D 1 88  ? -31.578 -5.466  -69.849 1.00 62.02  ? 100 PHE D CG  1 
ATOM   7177 C CD1 . PHE D 1 88  ? -32.588 -6.370  -70.156 1.00 66.51  ? 100 PHE D CD1 1 
ATOM   7178 C CD2 . PHE D 1 88  ? -31.696 -4.713  -68.687 1.00 64.93  ? 100 PHE D CD2 1 
ATOM   7179 C CE1 . PHE D 1 88  ? -33.691 -6.522  -69.314 1.00 69.52  ? 100 PHE D CE1 1 
ATOM   7180 C CE2 . PHE D 1 88  ? -32.807 -4.859  -67.852 1.00 69.58  ? 100 PHE D CE2 1 
ATOM   7181 C CZ  . PHE D 1 88  ? -33.795 -5.760  -68.173 1.00 69.24  ? 100 PHE D CZ  1 
ATOM   7182 N N   . TYR D 1 89  ? -28.201 -6.613  -72.722 1.00 54.54  ? 101 TYR D N   1 
ATOM   7183 C CA  . TYR D 1 89  ? -27.106 -6.530  -73.678 1.00 53.68  ? 101 TYR D CA  1 
ATOM   7184 C C   . TYR D 1 89  ? -27.437 -5.555  -74.814 1.00 57.25  ? 101 TYR D C   1 
ATOM   7185 O O   . TYR D 1 89  ? -28.610 -5.449  -75.192 1.00 58.15  ? 101 TYR D O   1 
ATOM   7186 C CB  . TYR D 1 89  ? -26.799 -7.929  -74.230 1.00 55.42  ? 101 TYR D CB  1 
ATOM   7187 C CG  . TYR D 1 89  ? -26.109 -8.820  -73.219 1.00 57.46  ? 101 TYR D CG  1 
ATOM   7188 C CD1 . TYR D 1 89  ? -26.836 -9.488  -72.238 1.00 60.65  ? 101 TYR D CD1 1 
ATOM   7189 C CD2 . TYR D 1 89  ? -24.726 -8.971  -73.224 1.00 57.35  ? 101 TYR D CD2 1 
ATOM   7190 C CE1 . TYR D 1 89  ? -26.201 -10.282 -71.283 1.00 61.80  ? 101 TYR D CE1 1 
ATOM   7191 C CE2 . TYR D 1 89  ? -24.082 -9.776  -72.288 1.00 58.18  ? 101 TYR D CE2 1 
ATOM   7192 C CZ  . TYR D 1 89  ? -24.822 -10.429 -71.319 1.00 66.86  ? 101 TYR D CZ  1 
ATOM   7193 O OH  . TYR D 1 89  ? -24.186 -11.226 -70.398 1.00 69.26  ? 101 TYR D OH  1 
ATOM   7194 N N   . PRO D 1 90  ? -26.444 -4.814  -75.362 1.00 52.14  ? 102 PRO D N   1 
ATOM   7195 C CA  . PRO D 1 90  ? -26.735 -3.979  -76.536 1.00 52.68  ? 102 PRO D CA  1 
ATOM   7196 C C   . PRO D 1 90  ? -26.991 -4.834  -77.779 1.00 58.93  ? 102 PRO D C   1 
ATOM   7197 O O   . PRO D 1 90  ? -26.490 -5.950  -77.863 1.00 58.24  ? 102 PRO D O   1 
ATOM   7198 C CB  . PRO D 1 90  ? -25.474 -3.125  -76.686 1.00 53.49  ? 102 PRO D CB  1 
ATOM   7199 C CG  . PRO D 1 90  ? -24.402 -3.912  -76.054 1.00 56.93  ? 102 PRO D CG  1 
ATOM   7200 C CD  . PRO D 1 90  ? -25.032 -4.682  -74.943 1.00 52.37  ? 102 PRO D CD  1 
ATOM   7201 N N   . GLU D 1 91  ? -27.800 -4.334  -78.723 1.00 58.19  ? 103 GLU D N   1 
ATOM   7202 C CA  . GLU D 1 91  ? -27.940 -4.937  -80.046 1.00 59.78  ? 103 GLU D CA  1 
ATOM   7203 C C   . GLU D 1 91  ? -26.699 -4.657  -80.877 1.00 63.02  ? 103 GLU D C   1 
ATOM   7204 O O   . GLU D 1 91  ? -26.269 -5.510  -81.649 1.00 63.36  ? 103 GLU D O   1 
ATOM   7205 C CB  . GLU D 1 91  ? -29.170 -4.367  -80.752 1.00 63.70  ? 103 GLU D CB  1 
ATOM   7206 C CG  . GLU D 1 91  ? -30.212 -5.394  -81.135 1.00 79.79  ? 103 GLU D CG  1 
ATOM   7207 C CD  . GLU D 1 91  ? -31.568 -4.760  -81.373 1.00 106.53 ? 103 GLU D CD  1 
ATOM   7208 O OE1 . GLU D 1 91  ? -31.939 -4.584  -82.556 1.00 104.31 ? 103 GLU D OE1 1 
ATOM   7209 O OE2 . GLU D 1 91  ? -32.259 -4.438  -80.379 1.00 98.20  ? 103 GLU D OE2 1 
ATOM   7210 N N   . ASN D 1 92  ? -26.138 -3.450  -80.719 1.00 58.98  ? 104 ASN D N   1 
ATOM   7211 C CA  . ASN D 1 92  ? -24.960 -2.967  -81.424 1.00 59.40  ? 104 ASN D CA  1 
ATOM   7212 C C   . ASN D 1 92  ? -23.994 -2.341  -80.417 1.00 62.09  ? 104 ASN D C   1 
ATOM   7213 O O   . ASN D 1 92  ? -24.198 -1.200  -79.999 1.00 61.90  ? 104 ASN D O   1 
ATOM   7214 C CB  . ASN D 1 92  ? -25.385 -1.959  -82.495 1.00 63.18  ? 104 ASN D CB  1 
ATOM   7215 C CG  . ASN D 1 92  ? -24.300 -1.492  -83.429 1.00 87.17  ? 104 ASN D CG  1 
ATOM   7216 O OD1 . ASN D 1 92  ? -23.129 -1.300  -83.067 1.00 80.89  ? 104 ASN D OD1 1 
ATOM   7217 N ND2 . ASN D 1 92  ? -24.713 -1.197  -84.641 1.00 79.35  ? 104 ASN D ND2 1 
ATOM   7218 N N   . ALA D 1 93  ? -22.932 -3.084  -80.047 1.00 57.50  ? 105 ALA D N   1 
ATOM   7219 C CA  . ALA D 1 93  ? -21.963 -2.675  -79.033 1.00 56.07  ? 105 ALA D CA  1 
ATOM   7220 C C   . ALA D 1 93  ? -21.290 -1.341  -79.381 1.00 62.53  ? 105 ALA D C   1 
ATOM   7221 O O   . ALA D 1 93  ? -21.228 -0.473  -78.513 1.00 62.50  ? 105 ALA D O   1 
ATOM   7222 C CB  . ALA D 1 93  ? -20.919 -3.758  -78.842 1.00 56.09  ? 105 ALA D CB  1 
ATOM   7223 N N   . GLU D 1 94  ? -20.851 -1.148  -80.647 1.00 61.40  ? 106 GLU D N   1 
ATOM   7224 C CA  . GLU D 1 94  ? -20.104 0.048   -81.063 1.00 62.82  ? 106 GLU D CA  1 
ATOM   7225 C C   . GLU D 1 94  ? -20.969 1.313   -80.978 1.00 66.89  ? 106 GLU D C   1 
ATOM   7226 O O   . GLU D 1 94  ? -20.474 2.351   -80.524 1.00 66.98  ? 106 GLU D O   1 
ATOM   7227 C CB  . GLU D 1 94  ? -19.525 -0.119  -82.476 1.00 66.62  ? 106 GLU D CB  1 
ATOM   7228 C CG  . GLU D 1 94  ? -18.488 0.929   -82.859 1.00 84.14  ? 106 GLU D CG  1 
ATOM   7229 C CD  . GLU D 1 94  ? -17.534 0.531   -83.973 1.00 120.27 ? 106 GLU D CD  1 
ATOM   7230 O OE1 . GLU D 1 94  ? -18.006 0.259   -85.102 1.00 119.39 ? 106 GLU D OE1 1 
ATOM   7231 O OE2 . GLU D 1 94  ? -16.307 0.522   -83.723 1.00 120.41 ? 106 GLU D OE2 1 
ATOM   7232 N N   . GLU D 1 95  ? -22.247 1.225   -81.390 1.00 62.59  ? 107 GLU D N   1 
ATOM   7233 C CA  . GLU D 1 95  ? -23.182 2.348   -81.325 1.00 62.85  ? 107 GLU D CA  1 
ATOM   7234 C C   . GLU D 1 95  ? -23.599 2.672   -79.896 1.00 63.95  ? 107 GLU D C   1 
ATOM   7235 O O   . GLU D 1 95  ? -23.710 3.847   -79.553 1.00 64.66  ? 107 GLU D O   1 
ATOM   7236 C CB  . GLU D 1 95  ? -24.439 2.060   -82.149 1.00 65.72  ? 107 GLU D CB  1 
ATOM   7237 C CG  . GLU D 1 95  ? -24.233 2.095   -83.648 1.00 81.20  ? 107 GLU D CG  1 
ATOM   7238 C CD  . GLU D 1 95  ? -25.522 2.040   -84.446 1.00 115.73 ? 107 GLU D CD  1 
ATOM   7239 O OE1 . GLU D 1 95  ? -26.459 1.305   -84.054 1.00 102.65 ? 107 GLU D OE1 1 
ATOM   7240 O OE2 . GLU D 1 95  ? -25.599 2.761   -85.465 1.00 124.00 ? 107 GLU D OE2 1 
ATOM   7241 N N   . GLU D 1 96  ? -23.815 1.638   -79.067 1.00 57.64  ? 108 GLU D N   1 
ATOM   7242 C CA  . GLU D 1 96  ? -24.488 1.773   -77.777 1.00 56.12  ? 108 GLU D CA  1 
ATOM   7243 C C   . GLU D 1 96  ? -23.531 1.956   -76.611 1.00 60.21  ? 108 GLU D C   1 
ATOM   7244 O O   . GLU D 1 96  ? -23.906 2.634   -75.650 1.00 61.62  ? 108 GLU D O   1 
ATOM   7245 C CB  . GLU D 1 96  ? -25.388 0.571   -77.500 1.00 56.48  ? 108 GLU D CB  1 
ATOM   7246 C CG  . GLU D 1 96  ? -26.571 0.481   -78.445 1.00 62.98  ? 108 GLU D CG  1 
ATOM   7247 C CD  . GLU D 1 96  ? -27.492 -0.687  -78.177 1.00 73.81  ? 108 GLU D CD  1 
ATOM   7248 O OE1 . GLU D 1 96  ? -27.974 -0.813  -77.029 1.00 68.50  ? 108 GLU D OE1 1 
ATOM   7249 O OE2 . GLU D 1 96  ? -27.747 -1.469  -79.120 1.00 68.36  ? 108 GLU D OE2 1 
ATOM   7250 N N   . LEU D 1 97  ? -22.321 1.348   -76.665 1.00 53.88  ? 109 LEU D N   1 
ATOM   7251 C CA  . LEU D 1 97  ? -21.347 1.456   -75.578 1.00 51.29  ? 109 LEU D CA  1 
ATOM   7252 C C   . LEU D 1 97  ? -20.380 2.613   -75.903 1.00 57.52  ? 109 LEU D C   1 
ATOM   7253 O O   . LEU D 1 97  ? -19.288 2.423   -76.459 1.00 58.23  ? 109 LEU D O   1 
ATOM   7254 C CB  . LEU D 1 97  ? -20.624 0.115   -75.300 1.00 49.63  ? 109 LEU D CB  1 
ATOM   7255 C CG  . LEU D 1 97  ? -21.501 -1.173  -75.172 1.00 52.20  ? 109 LEU D CG  1 
ATOM   7256 C CD1 . LEU D 1 97  ? -20.652 -2.389  -74.865 1.00 50.99  ? 109 LEU D CD1 1 
ATOM   7257 C CD2 . LEU D 1 97  ? -22.592 -1.038  -74.117 1.00 52.32  ? 109 LEU D CD2 1 
ATOM   7258 N N   . VAL D 1 98  ? -20.840 3.831   -75.578 1.00 54.20  ? 110 VAL D N   1 
ATOM   7259 C CA  . VAL D 1 98  ? -20.162 5.091   -75.874 1.00 55.17  ? 110 VAL D CA  1 
ATOM   7260 C C   . VAL D 1 98  ? -19.072 5.349   -74.806 1.00 57.67  ? 110 VAL D C   1 
ATOM   7261 O O   . VAL D 1 98  ? -17.971 5.791   -75.155 1.00 58.61  ? 110 VAL D O   1 
ATOM   7262 C CB  . VAL D 1 98  ? -21.195 6.251   -75.980 1.00 60.49  ? 110 VAL D CB  1 
ATOM   7263 C CG1 . VAL D 1 98  ? -20.517 7.612   -76.143 1.00 61.61  ? 110 VAL D CG1 1 
ATOM   7264 C CG2 . VAL D 1 98  ? -22.179 5.996   -77.128 1.00 61.22  ? 110 VAL D CG2 1 
ATOM   7265 N N   . GLN D 1 99  ? -19.384 5.070   -73.522 1.00 50.74  ? 111 GLN D N   1 
ATOM   7266 C CA  . GLN D 1 99  ? -18.440 5.171   -72.411 1.00 49.32  ? 111 GLN D CA  1 
ATOM   7267 C C   . GLN D 1 99  ? -17.452 4.003   -72.426 1.00 51.87  ? 111 GLN D C   1 
ATOM   7268 O O   . GLN D 1 99  ? -17.827 2.906   -72.833 1.00 51.62  ? 111 GLN D O   1 
ATOM   7269 C CB  . GLN D 1 99  ? -19.197 5.195   -71.080 1.00 50.32  ? 111 GLN D CB  1 
ATOM   7270 C CG  . GLN D 1 99  ? -20.013 6.457   -70.852 1.00 56.87  ? 111 GLN D CG  1 
ATOM   7271 C CD  . GLN D 1 99  ? -20.488 6.549   -69.433 1.00 61.86  ? 111 GLN D CD  1 
ATOM   7272 O OE1 . GLN D 1 99  ? -21.506 5.969   -69.063 1.00 55.66  ? 111 GLN D OE1 1 
ATOM   7273 N NE2 . GLN D 1 99  ? -19.744 7.265   -68.601 1.00 50.39  ? 111 GLN D NE2 1 
ATOM   7274 N N   . GLU D 1 100 ? -16.196 4.230   -72.001 1.00 48.50  ? 112 GLU D N   1 
ATOM   7275 C CA  . GLU D 1 100 ? -15.205 3.150   -71.912 1.00 48.56  ? 112 GLU D CA  1 
ATOM   7276 C C   . GLU D 1 100 ? -15.570 2.168   -70.819 1.00 51.66  ? 112 GLU D C   1 
ATOM   7277 O O   . GLU D 1 100 ? -15.333 0.971   -70.989 1.00 50.87  ? 112 GLU D O   1 
ATOM   7278 C CB  . GLU D 1 100 ? -13.777 3.670   -71.660 1.00 51.19  ? 112 GLU D CB  1 
ATOM   7279 C CG  . GLU D 1 100 ? -12.671 2.727   -72.132 1.00 61.99  ? 112 GLU D CG  1 
ATOM   7280 C CD  . GLU D 1 100 ? -12.244 1.546   -71.264 1.00 87.86  ? 112 GLU D CD  1 
ATOM   7281 O OE1 . GLU D 1 100 ? -12.241 1.670   -70.016 1.00 89.63  ? 112 GLU D OE1 1 
ATOM   7282 O OE2 . GLU D 1 100 ? -11.852 0.509   -71.848 1.00 75.62  ? 112 GLU D OE2 1 
ATOM   7283 N N   . ILE D 1 101 ? -16.136 2.674   -69.704 1.00 48.15  ? 113 ILE D N   1 
ATOM   7284 C CA  . ILE D 1 101 ? -16.501 1.884   -68.531 1.00 47.75  ? 113 ILE D CA  1 
ATOM   7285 C C   . ILE D 1 101 ? -17.573 0.852   -68.893 1.00 50.90  ? 113 ILE D C   1 
ATOM   7286 O O   . ILE D 1 101 ? -17.427 -0.296  -68.487 1.00 50.06  ? 113 ILE D O   1 
ATOM   7287 C CB  . ILE D 1 101 ? -16.896 2.752   -67.297 1.00 51.67  ? 113 ILE D CB  1 
ATOM   7288 C CG1 . ILE D 1 101 ? -17.052 1.902   -66.016 1.00 52.40  ? 113 ILE D CG1 1 
ATOM   7289 C CG2 . ILE D 1 101 ? -18.115 3.669   -67.539 1.00 52.20  ? 113 ILE D CG2 1 
ATOM   7290 C CD1 . ILE D 1 101 ? -15.772 1.263   -65.517 1.00 56.13  ? 113 ILE D CD1 1 
ATOM   7291 N N   . THR D 1 102 ? -18.599 1.234   -69.685 1.00 48.47  ? 114 THR D N   1 
ATOM   7292 C CA  . THR D 1 102 ? -19.642 0.310   -70.169 1.00 48.39  ? 114 THR D CA  1 
ATOM   7293 C C   . THR D 1 102 ? -19.014 -0.752  -71.077 1.00 53.45  ? 114 THR D C   1 
ATOM   7294 O O   . THR D 1 102 ? -19.326 -1.935  -70.935 1.00 54.16  ? 114 THR D O   1 
ATOM   7295 C CB  . THR D 1 102 ? -20.780 1.047   -70.894 1.00 57.52  ? 114 THR D CB  1 
ATOM   7296 O OG1 . THR D 1 102 ? -20.848 2.404   -70.476 1.00 62.86  ? 114 THR D OG1 1 
ATOM   7297 C CG2 . THR D 1 102 ? -22.109 0.415   -70.648 1.00 56.24  ? 114 THR D CG2 1 
ATOM   7298 N N   . GLN D 1 103 ? -18.117 -0.320  -71.983 1.00 49.77  ? 115 GLN D N   1 
ATOM   7299 C CA  . GLN D 1 103 ? -17.370 -1.146  -72.929 1.00 49.81  ? 115 GLN D CA  1 
ATOM   7300 C C   . GLN D 1 103 ? -16.488 -2.159  -72.196 1.00 53.33  ? 115 GLN D C   1 
ATOM   7301 O O   . GLN D 1 103 ? -16.466 -3.333  -72.567 1.00 53.98  ? 115 GLN D O   1 
ATOM   7302 C CB  . GLN D 1 103 ? -16.516 -0.240  -73.839 1.00 52.33  ? 115 GLN D CB  1 
ATOM   7303 C CG  . GLN D 1 103 ? -15.584 -0.984  -74.791 1.00 67.12  ? 115 GLN D CG  1 
ATOM   7304 C CD  . GLN D 1 103 ? -14.484 -0.084  -75.271 1.00 83.62  ? 115 GLN D CD  1 
ATOM   7305 O OE1 . GLN D 1 103 ? -13.420 0.015   -74.655 1.00 81.10  ? 115 GLN D OE1 1 
ATOM   7306 N NE2 . GLN D 1 103 ? -14.728 0.617   -76.358 1.00 74.17  ? 115 GLN D NE2 1 
ATOM   7307 N N   . HIS D 1 104 ? -15.753 -1.693  -71.175 1.00 48.57  ? 116 HIS D N   1 
ATOM   7308 C CA  . HIS D 1 104 ? -14.840 -2.501  -70.367 1.00 47.69  ? 116 HIS D CA  1 
ATOM   7309 C C   . HIS D 1 104 ? -15.607 -3.570  -69.593 1.00 51.62  ? 116 HIS D C   1 
ATOM   7310 O O   . HIS D 1 104 ? -15.215 -4.740  -69.618 1.00 52.85  ? 116 HIS D O   1 
ATOM   7311 C CB  . HIS D 1 104 ? -14.040 -1.599  -69.407 1.00 48.19  ? 116 HIS D CB  1 
ATOM   7312 C CG  . HIS D 1 104 ? -13.064 -2.329  -68.540 1.00 51.93  ? 116 HIS D CG  1 
ATOM   7313 N ND1 . HIS D 1 104 ? -12.078 -3.143  -69.080 1.00 53.93  ? 116 HIS D ND1 1 
ATOM   7314 C CD2 . HIS D 1 104 ? -12.940 -2.327  -67.192 1.00 53.83  ? 116 HIS D CD2 1 
ATOM   7315 C CE1 . HIS D 1 104 ? -11.394 -3.607  -68.048 1.00 54.04  ? 116 HIS D CE1 1 
ATOM   7316 N NE2 . HIS D 1 104 ? -11.865 -3.136  -66.894 1.00 54.44  ? 116 HIS D NE2 1 
ATOM   7317 N N   . LEU D 1 105 ? -16.704 -3.166  -68.919 1.00 46.34  ? 117 LEU D N   1 
ATOM   7318 C CA  . LEU D 1 105 ? -17.528 -4.054  -68.096 1.00 45.63  ? 117 LEU D CA  1 
ATOM   7319 C C   . LEU D 1 105 ? -18.177 -5.142  -68.939 1.00 48.37  ? 117 LEU D C   1 
ATOM   7320 O O   . LEU D 1 105 ? -18.184 -6.294  -68.513 1.00 48.82  ? 117 LEU D O   1 
ATOM   7321 C CB  . LEU D 1 105 ? -18.602 -3.273  -67.315 1.00 45.42  ? 117 LEU D CB  1 
ATOM   7322 C CG  . LEU D 1 105 ? -18.113 -2.398  -66.167 1.00 49.44  ? 117 LEU D CG  1 
ATOM   7323 C CD1 . LEU D 1 105 ? -19.228 -1.497  -65.682 1.00 49.61  ? 117 LEU D CD1 1 
ATOM   7324 C CD2 . LEU D 1 105 ? -17.554 -3.220  -65.022 1.00 50.93  ? 117 LEU D CD2 1 
ATOM   7325 N N   . PHE D 1 106 ? -18.696 -4.792  -70.129 1.00 44.09  ? 118 PHE D N   1 
ATOM   7326 C CA  . PHE D 1 106 ? -19.245 -5.776  -71.059 1.00 43.65  ? 118 PHE D CA  1 
ATOM   7327 C C   . PHE D 1 106 ? -18.158 -6.708  -71.582 1.00 46.87  ? 118 PHE D C   1 
ATOM   7328 O O   . PHE D 1 106 ? -18.377 -7.915  -71.607 1.00 47.69  ? 118 PHE D O   1 
ATOM   7329 C CB  . PHE D 1 106 ? -19.980 -5.104  -72.219 1.00 45.39  ? 118 PHE D CB  1 
ATOM   7330 C CG  . PHE D 1 106 ? -21.448 -4.891  -71.929 1.00 47.13  ? 118 PHE D CG  1 
ATOM   7331 C CD1 . PHE D 1 106 ? -22.355 -5.944  -72.020 1.00 50.43  ? 118 PHE D CD1 1 
ATOM   7332 C CD2 . PHE D 1 106 ? -21.927 -3.637  -71.567 1.00 49.02  ? 118 PHE D CD2 1 
ATOM   7333 C CE1 . PHE D 1 106 ? -23.717 -5.738  -71.769 1.00 51.79  ? 118 PHE D CE1 1 
ATOM   7334 C CE2 . PHE D 1 106 ? -23.287 -3.435  -71.312 1.00 51.96  ? 118 PHE D CE2 1 
ATOM   7335 C CZ  . PHE D 1 106 ? -24.171 -4.484  -71.414 1.00 50.58  ? 118 PHE D CZ  1 
ATOM   7336 N N   . PHE D 1 107 ? -16.984 -6.170  -71.952 1.00 42.52  ? 119 PHE D N   1 
ATOM   7337 C CA  . PHE D 1 107 ? -15.867 -6.970  -72.447 1.00 42.94  ? 119 PHE D CA  1 
ATOM   7338 C C   . PHE D 1 107 ? -15.518 -8.094  -71.479 1.00 48.09  ? 119 PHE D C   1 
ATOM   7339 O O   . PHE D 1 107 ? -15.400 -9.246  -71.908 1.00 48.90  ? 119 PHE D O   1 
ATOM   7340 C CB  . PHE D 1 107 ? -14.629 -6.094  -72.732 1.00 45.22  ? 119 PHE D CB  1 
ATOM   7341 C CG  . PHE D 1 107 ? -13.336 -6.867  -72.935 1.00 47.96  ? 119 PHE D CG  1 
ATOM   7342 C CD1 . PHE D 1 107 ? -13.124 -7.625  -74.089 1.00 50.79  ? 119 PHE D CD1 1 
ATOM   7343 C CD2 . PHE D 1 107 ? -12.341 -6.856  -71.963 1.00 50.78  ? 119 PHE D CD2 1 
ATOM   7344 C CE1 . PHE D 1 107 ? -11.925 -8.337  -74.273 1.00 52.69  ? 119 PHE D CE1 1 
ATOM   7345 C CE2 . PHE D 1 107 ? -11.153 -7.580  -72.147 1.00 54.33  ? 119 PHE D CE2 1 
ATOM   7346 C CZ  . PHE D 1 107 ? -10.949 -8.306  -73.306 1.00 52.43  ? 119 PHE D CZ  1 
ATOM   7347 N N   . LEU D 1 108 ? -15.377 -7.768  -70.183 1.00 44.84  ? 120 LEU D N   1 
ATOM   7348 C CA  . LEU D 1 108 ? -14.959 -8.735  -69.170 1.00 45.61  ? 120 LEU D CA  1 
ATOM   7349 C C   . LEU D 1 108 ? -16.036 -9.782  -68.903 1.00 51.11  ? 120 LEU D C   1 
ATOM   7350 O O   . LEU D 1 108 ? -15.703 -10.959 -68.736 1.00 52.21  ? 120 LEU D O   1 
ATOM   7351 C CB  . LEU D 1 108 ? -14.571 -8.036  -67.866 1.00 45.99  ? 120 LEU D CB  1 
ATOM   7352 C CG  . LEU D 1 108 ? -13.315 -7.152  -67.874 1.00 50.35  ? 120 LEU D CG  1 
ATOM   7353 C CD1 . LEU D 1 108 ? -13.189 -6.408  -66.560 1.00 50.83  ? 120 LEU D CD1 1 
ATOM   7354 C CD2 . LEU D 1 108 ? -12.045 -7.962  -68.155 1.00 51.61  ? 120 LEU D CD2 1 
ATOM   7355 N N   . GLN D 1 109 ? -17.318 -9.363  -68.885 1.00 47.92  ? 121 GLN D N   1 
ATOM   7356 C CA  . GLN D 1 109 ? -18.451 -10.255 -68.641 1.00 48.97  ? 121 GLN D CA  1 
ATOM   7357 C C   . GLN D 1 109 ? -18.625 -11.239 -69.799 1.00 54.57  ? 121 GLN D C   1 
ATOM   7358 O O   . GLN D 1 109 ? -18.822 -12.427 -69.548 1.00 55.53  ? 121 GLN D O   1 
ATOM   7359 C CB  . GLN D 1 109 ? -19.739 -9.456  -68.415 1.00 49.69  ? 121 GLN D CB  1 
ATOM   7360 C CG  . GLN D 1 109 ? -20.854 -10.265 -67.760 1.00 62.24  ? 121 GLN D CG  1 
ATOM   7361 C CD  . GLN D 1 109 ? -22.079 -9.440  -67.457 1.00 79.68  ? 121 GLN D CD  1 
ATOM   7362 O OE1 . GLN D 1 109 ? -22.011 -8.372  -66.849 1.00 76.24  ? 121 GLN D OE1 1 
ATOM   7363 N NE2 . GLN D 1 109 ? -23.241 -9.948  -67.828 1.00 69.35  ? 121 GLN D NE2 1 
ATOM   7364 N N   . VAL D 1 110 ? -18.541 -10.746 -71.053 1.00 50.78  ? 122 VAL D N   1 
ATOM   7365 C CA  . VAL D 1 110 ? -18.688 -11.555 -72.266 1.00 50.82  ? 122 VAL D CA  1 
ATOM   7366 C C   . VAL D 1 110 ? -17.477 -12.510 -72.410 1.00 55.45  ? 122 VAL D C   1 
ATOM   7367 O O   . VAL D 1 110 ? -17.674 -13.688 -72.717 1.00 55.40  ? 122 VAL D O   1 
ATOM   7368 C CB  . VAL D 1 110 ? -18.914 -10.675 -73.520 1.00 53.89  ? 122 VAL D CB  1 
ATOM   7369 C CG1 . VAL D 1 110 ? -18.860 -11.507 -74.794 1.00 54.11  ? 122 VAL D CG1 1 
ATOM   7370 C CG2 . VAL D 1 110 ? -20.249 -9.933  -73.430 1.00 53.19  ? 122 VAL D CG2 1 
ATOM   7371 N N   . LYS D 1 111 ? -16.248 -12.018 -72.152 1.00 51.76  ? 123 LYS D N   1 
ATOM   7372 C CA  . LYS D 1 111 ? -15.034 -12.842 -72.206 1.00 52.22  ? 123 LYS D CA  1 
ATOM   7373 C C   . LYS D 1 111 ? -15.125 -14.038 -71.233 1.00 57.11  ? 123 LYS D C   1 
ATOM   7374 O O   . LYS D 1 111 ? -14.777 -15.152 -71.631 1.00 57.98  ? 123 LYS D O   1 
ATOM   7375 C CB  . LYS D 1 111 ? -13.779 -11.992 -71.920 1.00 54.03  ? 123 LYS D CB  1 
ATOM   7376 C CG  . LYS D 1 111 ? -12.451 -12.761 -72.046 1.00 60.74  ? 123 LYS D CG  1 
ATOM   7377 C CD  . LYS D 1 111 ? -11.229 -11.838 -72.114 1.00 63.34  ? 123 LYS D CD  1 
ATOM   7378 C CE  . LYS D 1 111 ? -10.907 -11.138 -70.809 1.00 66.76  ? 123 LYS D CE  1 
ATOM   7379 N NZ  . LYS D 1 111 ? -10.438 -12.091 -69.768 1.00 74.01  ? 123 LYS D NZ  1 
ATOM   7380 N N   . LYS D 1 112 ? -15.609 -13.818 -69.983 1.00 53.27  ? 124 LYS D N   1 
ATOM   7381 C CA  . LYS D 1 112 ? -15.802 -14.902 -69.010 1.00 54.55  ? 124 LYS D CA  1 
ATOM   7382 C C   . LYS D 1 112 ? -16.757 -15.956 -69.557 1.00 58.29  ? 124 LYS D C   1 
ATOM   7383 O O   . LYS D 1 112 ? -16.480 -17.136 -69.398 1.00 59.47  ? 124 LYS D O   1 
ATOM   7384 C CB  . LYS D 1 112 ? -16.311 -14.388 -67.659 1.00 57.38  ? 124 LYS D CB  1 
ATOM   7385 C CG  . LYS D 1 112 ? -16.006 -15.329 -66.497 1.00 72.29  ? 124 LYS D CG  1 
ATOM   7386 C CD  . LYS D 1 112 ? -17.102 -15.296 -65.433 1.00 82.86  ? 124 LYS D CD  1 
ATOM   7387 C CE  . LYS D 1 112 ? -16.728 -16.080 -64.198 1.00 97.77  ? 124 LYS D CE  1 
ATOM   7388 N NZ  . LYS D 1 112 ? -17.751 -15.944 -63.129 1.00 107.16 ? 124 LYS D NZ  1 
ATOM   7389 N N   . GLN D 1 113 ? -17.845 -15.532 -70.228 1.00 53.19  ? 125 GLN D N   1 
ATOM   7390 C CA  . GLN D 1 113 ? -18.840 -16.426 -70.833 1.00 53.46  ? 125 GLN D CA  1 
ATOM   7391 C C   . GLN D 1 113 ? -18.256 -17.222 -72.007 1.00 57.86  ? 125 GLN D C   1 
ATOM   7392 O O   . GLN D 1 113 ? -18.667 -18.358 -72.225 1.00 59.09  ? 125 GLN D O   1 
ATOM   7393 C CB  . GLN D 1 113 ? -20.066 -15.630 -71.292 1.00 53.35  ? 125 GLN D CB  1 
ATOM   7394 C CG  . GLN D 1 113 ? -20.943 -15.165 -70.130 1.00 66.26  ? 125 GLN D CG  1 
ATOM   7395 C CD  . GLN D 1 113 ? -21.840 -14.000 -70.453 1.00 84.27  ? 125 GLN D CD  1 
ATOM   7396 O OE1 . GLN D 1 113 ? -22.069 -13.634 -71.611 1.00 75.66  ? 125 GLN D OE1 1 
ATOM   7397 N NE2 . GLN D 1 113 ? -22.386 -13.392 -69.412 1.00 81.77  ? 125 GLN D NE2 1 
ATOM   7398 N N   . ILE D 1 114 ? -17.308 -16.627 -72.759 1.00 53.48  ? 126 ILE D N   1 
ATOM   7399 C CA  . ILE D 1 114 ? -16.602 -17.283 -73.866 1.00 53.79  ? 126 ILE D CA  1 
ATOM   7400 C C   . ILE D 1 114 ? -15.676 -18.364 -73.291 1.00 62.35  ? 126 ILE D C   1 
ATOM   7401 O O   . ILE D 1 114 ? -15.730 -19.521 -73.726 1.00 63.38  ? 126 ILE D O   1 
ATOM   7402 C CB  . ILE D 1 114 ? -15.841 -16.240 -74.740 1.00 55.38  ? 126 ILE D CB  1 
ATOM   7403 C CG1 . ILE D 1 114 ? -16.799 -15.279 -75.509 1.00 53.84  ? 126 ILE D CG1 1 
ATOM   7404 C CG2 . ILE D 1 114 ? -14.771 -16.871 -75.644 1.00 57.66  ? 126 ILE D CG2 1 
ATOM   7405 C CD1 . ILE D 1 114 ? -17.630 -15.857 -76.606 1.00 55.18  ? 126 ILE D CD1 1 
ATOM   7406 N N   . LEU D 1 115 ? -14.855 -17.987 -72.294 1.00 61.08  ? 127 LEU D N   1 
ATOM   7407 C CA  . LEU D 1 115 ? -13.872 -18.889 -71.698 1.00 63.50  ? 127 LEU D CA  1 
ATOM   7408 C C   . LEU D 1 115 ? -14.545 -20.038 -70.900 1.00 69.55  ? 127 LEU D C   1 
ATOM   7409 O O   . LEU D 1 115 ? -14.042 -21.160 -70.932 1.00 71.95  ? 127 LEU D O   1 
ATOM   7410 C CB  . LEU D 1 115 ? -12.867 -18.108 -70.830 1.00 63.55  ? 127 LEU D CB  1 
ATOM   7411 C CG  . LEU D 1 115 ? -12.011 -17.027 -71.562 1.00 67.04  ? 127 LEU D CG  1 
ATOM   7412 C CD1 . LEU D 1 115 ? -11.046 -16.342 -70.610 1.00 67.02  ? 127 LEU D CD1 1 
ATOM   7413 C CD2 . LEU D 1 115 ? -11.245 -17.600 -72.751 1.00 70.33  ? 127 LEU D CD2 1 
ATOM   7414 N N   . ASP D 1 116 ? -15.692 -19.764 -70.238 1.00 65.34  ? 128 ASP D N   1 
ATOM   7415 C CA  . ASP D 1 116 ? -16.513 -20.742 -69.495 1.00 66.68  ? 128 ASP D CA  1 
ATOM   7416 C C   . ASP D 1 116 ? -17.322 -21.647 -70.411 1.00 71.57  ? 128 ASP D C   1 
ATOM   7417 O O   . ASP D 1 116 ? -17.869 -22.652 -69.945 1.00 73.38  ? 128 ASP D O   1 
ATOM   7418 C CB  . ASP D 1 116 ? -17.499 -20.032 -68.551 1.00 67.54  ? 128 ASP D CB  1 
ATOM   7419 C CG  . ASP D 1 116 ? -16.900 -19.426 -67.298 1.00 80.88  ? 128 ASP D CG  1 
ATOM   7420 O OD1 . ASP D 1 116 ? -15.663 -19.558 -67.096 1.00 82.83  ? 128 ASP D OD1 1 
ATOM   7421 O OD2 . ASP D 1 116 ? -17.658 -18.796 -66.529 1.00 87.68  ? 128 ASP D OD2 1 
ATOM   7422 N N   . GLU D 1 117 ? -17.430 -21.270 -71.703 1.00 66.79  ? 129 GLU D N   1 
ATOM   7423 C CA  . GLU D 1 117 ? -18.186 -21.954 -72.759 1.00 67.02  ? 129 GLU D CA  1 
ATOM   7424 C C   . GLU D 1 117 ? -19.696 -21.878 -72.505 1.00 71.10  ? 129 GLU D C   1 
ATOM   7425 O O   . GLU D 1 117 ? -20.448 -22.752 -72.951 1.00 71.84  ? 129 GLU D O   1 
ATOM   7426 C CB  . GLU D 1 117 ? -17.735 -23.413 -72.941 1.00 70.76  ? 129 GLU D CB  1 
ATOM   7427 C CG  . GLU D 1 117 ? -16.271 -23.550 -73.295 1.00 82.04  ? 129 GLU D CG  1 
ATOM   7428 C CD  . GLU D 1 117 ? -15.750 -24.963 -73.156 1.00 106.45 ? 129 GLU D CD  1 
ATOM   7429 O OE1 . GLU D 1 117 ? -16.003 -25.785 -74.068 1.00 86.89  ? 129 GLU D OE1 1 
ATOM   7430 O OE2 . GLU D 1 117 ? -15.153 -25.268 -72.099 1.00 110.86 ? 129 GLU D OE2 1 
ATOM   7431 N N   . LYS D 1 118 ? -20.135 -20.817 -71.798 1.00 66.62  ? 130 LYS D N   1 
ATOM   7432 C CA  . LYS D 1 118 ? -21.547 -20.491 -71.633 1.00 66.15  ? 130 LYS D CA  1 
ATOM   7433 C C   . LYS D 1 118 ? -22.114 -19.996 -72.958 1.00 68.26  ? 130 LYS D C   1 
ATOM   7434 O O   . LYS D 1 118 ? -23.257 -20.305 -73.262 1.00 69.20  ? 130 LYS D O   1 
ATOM   7435 C CB  . LYS D 1 118 ? -21.750 -19.470 -70.507 1.00 68.35  ? 130 LYS D CB  1 
ATOM   7436 C CG  . LYS D 1 118 ? -21.698 -20.120 -69.130 1.00 95.11  ? 130 LYS D CG  1 
ATOM   7437 C CD  . LYS D 1 118 ? -21.493 -19.115 -68.010 1.00 113.00 ? 130 LYS D CD  1 
ATOM   7438 C CE  . LYS D 1 118 ? -21.395 -19.820 -66.672 1.00 132.52 ? 130 LYS D CE  1 
ATOM   7439 N NZ  . LYS D 1 118 ? -21.070 -18.885 -65.561 1.00 143.59 ? 130 LYS D NZ  1 
ATOM   7440 N N   . ILE D 1 119 ? -21.318 -19.234 -73.734 1.00 62.67  ? 131 ILE D N   1 
ATOM   7441 C CA  . ILE D 1 119 ? -21.556 -18.878 -75.141 1.00 61.65  ? 131 ILE D CA  1 
ATOM   7442 C C   . ILE D 1 119 ? -20.735 -19.838 -76.020 1.00 64.25  ? 131 ILE D C   1 
ATOM   7443 O O   . ILE D 1 119 ? -19.500 -19.844 -75.912 1.00 64.47  ? 131 ILE D O   1 
ATOM   7444 C CB  . ILE D 1 119 ? -21.166 -17.383 -75.447 1.00 63.42  ? 131 ILE D CB  1 
ATOM   7445 C CG1 . ILE D 1 119 ? -21.909 -16.371 -74.555 1.00 63.23  ? 131 ILE D CG1 1 
ATOM   7446 C CG2 . ILE D 1 119 ? -21.351 -17.038 -76.934 1.00 63.82  ? 131 ILE D CG2 1 
ATOM   7447 C CD1 . ILE D 1 119 ? -21.374 -14.885 -74.672 1.00 65.03  ? 131 ILE D CD1 1 
ATOM   7448 N N   . TYR D 1 120 ? -21.386 -20.629 -76.885 1.00 58.73  ? 132 TYR D N   1 
ATOM   7449 C CA  . TYR D 1 120 ? -20.628 -21.416 -77.860 1.00 58.74  ? 132 TYR D CA  1 
ATOM   7450 C C   . TYR D 1 120 ? -19.894 -20.477 -78.844 1.00 61.96  ? 132 TYR D C   1 
ATOM   7451 O O   . TYR D 1 120 ? -20.455 -19.468 -79.278 1.00 59.89  ? 132 TYR D O   1 
ATOM   7452 C CB  . TYR D 1 120 ? -21.516 -22.427 -78.612 1.00 60.74  ? 132 TYR D CB  1 
ATOM   7453 C CG  . TYR D 1 120 ? -20.840 -23.002 -79.844 1.00 62.60  ? 132 TYR D CG  1 
ATOM   7454 C CD1 . TYR D 1 120 ? -19.832 -23.959 -79.731 1.00 65.61  ? 132 TYR D CD1 1 
ATOM   7455 C CD2 . TYR D 1 120 ? -21.135 -22.517 -81.114 1.00 63.09  ? 132 TYR D CD2 1 
ATOM   7456 C CE1 . TYR D 1 120 ? -19.152 -24.431 -80.856 1.00 66.30  ? 132 TYR D CE1 1 
ATOM   7457 C CE2 . TYR D 1 120 ? -20.479 -23.001 -82.246 1.00 65.08  ? 132 TYR D CE2 1 
ATOM   7458 C CZ  . TYR D 1 120 ? -19.491 -23.961 -82.113 1.00 70.08  ? 132 TYR D CZ  1 
ATOM   7459 O OH  . TYR D 1 120 ? -18.845 -24.443 -83.226 1.00 69.14  ? 132 TYR D OH  1 
ATOM   7460 N N   . CYS D 1 121 ? -18.650 -20.841 -79.202 1.00 59.32  ? 133 CYS D N   1 
ATOM   7461 C CA  . CYS D 1 121 ? -17.792 -20.069 -80.086 1.00 58.86  ? 133 CYS D CA  1 
ATOM   7462 C C   . CYS D 1 121 ? -17.107 -20.993 -81.129 1.00 63.76  ? 133 CYS D C   1 
ATOM   7463 O O   . CYS D 1 121 ? -16.457 -21.966 -80.733 1.00 64.71  ? 133 CYS D O   1 
ATOM   7464 C CB  . CYS D 1 121 ? -16.766 -19.306 -79.253 1.00 58.53  ? 133 CYS D CB  1 
ATOM   7465 S SG  . CYS D 1 121 ? -15.791 -18.090 -80.179 1.00 62.16  ? 133 CYS D SG  1 
ATOM   7466 N N   . PRO D 1 122 ? -17.259 -20.724 -82.457 1.00 59.76  ? 134 PRO D N   1 
ATOM   7467 C CA  . PRO D 1 122 ? -16.591 -21.562 -83.470 1.00 61.74  ? 134 PRO D CA  1 
ATOM   7468 C C   . PRO D 1 122 ? -15.073 -21.336 -83.518 1.00 66.07  ? 134 PRO D C   1 
ATOM   7469 O O   . PRO D 1 122 ? -14.604 -20.344 -82.951 1.00 63.54  ? 134 PRO D O   1 
ATOM   7470 C CB  . PRO D 1 122 ? -17.268 -21.138 -84.788 1.00 64.06  ? 134 PRO D CB  1 
ATOM   7471 C CG  . PRO D 1 122 ? -18.381 -20.248 -84.422 1.00 66.31  ? 134 PRO D CG  1 
ATOM   7472 C CD  . PRO D 1 122 ? -18.058 -19.673 -83.105 1.00 59.72  ? 134 PRO D CD  1 
ATOM   7473 N N   . PRO D 1 123 ? -14.289 -22.234 -84.183 1.00 65.51  ? 135 PRO D N   1 
ATOM   7474 C CA  . PRO D 1 123 ? -12.817 -22.126 -84.120 1.00 66.45  ? 135 PRO D CA  1 
ATOM   7475 C C   . PRO D 1 123 ? -12.222 -20.795 -84.594 1.00 71.75  ? 135 PRO D C   1 
ATOM   7476 O O   . PRO D 1 123 ? -11.327 -20.292 -83.914 1.00 71.77  ? 135 PRO D O   1 
ATOM   7477 C CB  . PRO D 1 123 ? -12.332 -23.270 -85.016 1.00 70.82  ? 135 PRO D CB  1 
ATOM   7478 C CG  . PRO D 1 123 ? -13.454 -24.203 -85.096 1.00 75.30  ? 135 PRO D CG  1 
ATOM   7479 C CD  . PRO D 1 123 ? -14.696 -23.410 -84.983 1.00 68.69  ? 135 PRO D CD  1 
ATOM   7480 N N   . GLU D 1 124 ? -12.688 -20.227 -85.732 1.00 69.51  ? 136 GLU D N   1 
ATOM   7481 C CA  . GLU D 1 124 ? -12.113 -18.982 -86.282 1.00 69.98  ? 136 GLU D CA  1 
ATOM   7482 C C   . GLU D 1 124 ? -12.345 -17.814 -85.337 1.00 71.11  ? 136 GLU D C   1 
ATOM   7483 O O   . GLU D 1 124 ? -11.412 -17.062 -85.062 1.00 71.48  ? 136 GLU D O   1 
ATOM   7484 C CB  . GLU D 1 124 ? -12.692 -18.644 -87.667 1.00 73.13  ? 136 GLU D CB  1 
ATOM   7485 C CG  . GLU D 1 124 ? -12.100 -19.411 -88.847 1.00 93.41  ? 136 GLU D CG  1 
ATOM   7486 C CD  . GLU D 1 124 ? -13.023 -19.581 -90.046 1.00 123.79 ? 136 GLU D CD  1 
ATOM   7487 O OE1 . GLU D 1 124 ? -13.804 -18.645 -90.332 1.00 127.35 ? 136 GLU D OE1 1 
ATOM   7488 O OE2 . GLU D 1 124 ? -12.964 -20.650 -90.700 1.00 117.54 ? 136 GLU D OE2 1 
ATOM   7489 N N   . ALA D 1 125 ? -13.590 -17.681 -84.825 1.00 64.74  ? 137 ALA D N   1 
ATOM   7490 C CA  . ALA D 1 125 ? -13.973 -16.675 -83.842 1.00 61.56  ? 137 ALA D CA  1 
ATOM   7491 C C   . ALA D 1 125 ? -13.141 -16.827 -82.556 1.00 65.65  ? 137 ALA D C   1 
ATOM   7492 O O   . ALA D 1 125 ? -12.658 -15.826 -82.033 1.00 64.01  ? 137 ALA D O   1 
ATOM   7493 C CB  . ALA D 1 125 ? -15.462 -16.775 -83.543 1.00 60.56  ? 137 ALA D CB  1 
ATOM   7494 N N   . SER D 1 126 ? -12.915 -18.079 -82.107 1.00 64.36  ? 138 SER D N   1 
ATOM   7495 C CA  . SER D 1 126 ? -12.113 -18.432 -80.929 1.00 64.73  ? 138 SER D CA  1 
ATOM   7496 C C   . SER D 1 126 ? -10.688 -17.860 -81.004 1.00 69.53  ? 138 SER D C   1 
ATOM   7497 O O   . SER D 1 126 ? -10.255 -17.234 -80.035 1.00 69.37  ? 138 SER D O   1 
ATOM   7498 C CB  . SER D 1 126 ? -12.061 -19.949 -80.751 1.00 71.48  ? 138 SER D CB  1 
ATOM   7499 O OG  . SER D 1 126 ? -11.254 -20.347 -79.655 1.00 83.46  ? 138 SER D OG  1 
ATOM   7500 N N   . VAL D 1 127 ? -9.981  -18.034 -82.146 1.00 66.62  ? 139 VAL D N   1 
ATOM   7501 C CA  . VAL D 1 127 ? -8.583  -17.588 -82.282 1.00 67.28  ? 139 VAL D CA  1 
ATOM   7502 C C   . VAL D 1 127 ? -8.518  -16.064 -82.465 1.00 68.42  ? 139 VAL D C   1 
ATOM   7503 O O   . VAL D 1 127 ? -7.570  -15.435 -81.984 1.00 68.19  ? 139 VAL D O   1 
ATOM   7504 C CB  . VAL D 1 127 ? -7.759  -18.342 -83.377 1.00 74.16  ? 139 VAL D CB  1 
ATOM   7505 C CG1 . VAL D 1 127 ? -7.755  -19.845 -83.125 1.00 74.93  ? 139 VAL D CG1 1 
ATOM   7506 C CG2 . VAL D 1 127 ? -8.236  -18.033 -84.800 1.00 74.97  ? 139 VAL D CG2 1 
ATOM   7507 N N   . LEU D 1 128 ? -9.530  -15.487 -83.146 1.00 63.29  ? 140 LEU D N   1 
ATOM   7508 C CA  . LEU D 1 128 ? -9.679  -14.047 -83.392 1.00 61.73  ? 140 LEU D CA  1 
ATOM   7509 C C   . LEU D 1 128 ? -9.901  -13.310 -82.072 1.00 60.78  ? 140 LEU D C   1 
ATOM   7510 O O   . LEU D 1 128 ? -9.145  -12.397 -81.757 1.00 58.60  ? 140 LEU D O   1 
ATOM   7511 C CB  . LEU D 1 128 ? -10.859 -13.816 -84.363 1.00 61.58  ? 140 LEU D CB  1 
ATOM   7512 C CG  . LEU D 1 128 ? -10.691 -12.793 -85.490 1.00 67.11  ? 140 LEU D CG  1 
ATOM   7513 C CD1 . LEU D 1 128 ? -9.281  -12.811 -86.084 1.00 70.16  ? 140 LEU D CD1 1 
ATOM   7514 C CD2 . LEU D 1 128 ? -11.717 -13.030 -86.583 1.00 68.34  ? 140 LEU D CD2 1 
ATOM   7515 N N   . LEU D 1 129 ? -10.923 -13.742 -81.293 1.00 55.82  ? 141 LEU D N   1 
ATOM   7516 C CA  . LEU D 1 129 ? -11.251 -13.240 -79.959 1.00 53.42  ? 141 LEU D CA  1 
ATOM   7517 C C   . LEU D 1 129 ? -10.051 -13.322 -79.005 1.00 58.14  ? 141 LEU D C   1 
ATOM   7518 O O   . LEU D 1 129 ? -9.781  -12.357 -78.287 1.00 56.99  ? 141 LEU D O   1 
ATOM   7519 C CB  . LEU D 1 129 ? -12.437 -14.024 -79.358 1.00 52.03  ? 141 LEU D CB  1 
ATOM   7520 C CG  . LEU D 1 129 ? -13.854 -13.713 -79.862 1.00 54.45  ? 141 LEU D CG  1 
ATOM   7521 C CD1 . LEU D 1 129 ? -14.859 -14.651 -79.227 1.00 52.91  ? 141 LEU D CD1 1 
ATOM   7522 C CD2 . LEU D 1 129 ? -14.255 -12.287 -79.559 1.00 54.18  ? 141 LEU D CD2 1 
ATOM   7523 N N   . ALA D 1 130 ? -9.339  -14.466 -78.998 1.00 56.61  ? 142 ALA D N   1 
ATOM   7524 C CA  . ALA D 1 130 ? -8.175  -14.693 -78.138 1.00 57.85  ? 142 ALA D CA  1 
ATOM   7525 C C   . ALA D 1 130 ? -7.073  -13.666 -78.401 1.00 63.31  ? 142 ALA D C   1 
ATOM   7526 O O   . ALA D 1 130 ? -6.467  -13.171 -77.449 1.00 63.14  ? 142 ALA D O   1 
ATOM   7527 C CB  . ALA D 1 130 ? -7.641  -16.101 -78.347 1.00 60.89  ? 142 ALA D CB  1 
ATOM   7528 N N   . SER D 1 131 ? -6.848  -13.325 -79.694 1.00 61.36  ? 143 SER D N   1 
ATOM   7529 C CA  . SER D 1 131 ? -5.895  -12.312 -80.153 1.00 62.15  ? 143 SER D CA  1 
ATOM   7530 C C   . SER D 1 131 ? -6.258  -10.918 -79.682 1.00 65.68  ? 143 SER D C   1 
ATOM   7531 O O   . SER D 1 131 ? -5.361  -10.171 -79.299 1.00 66.57  ? 143 SER D O   1 
ATOM   7532 C CB  . SER D 1 131 ? -5.789  -12.313 -81.672 1.00 66.60  ? 143 SER D CB  1 
ATOM   7533 O OG  . SER D 1 131 ? -4.772  -13.210 -82.068 1.00 82.04  ? 143 SER D OG  1 
ATOM   7534 N N   . TYR D 1 132 ? -7.552  -10.556 -79.720 1.00 61.05  ? 144 TYR D N   1 
ATOM   7535 C CA  . TYR D 1 132 ? -8.014  -9.253  -79.248 1.00 59.46  ? 144 TYR D CA  1 
ATOM   7536 C C   . TYR D 1 132 ? -7.919  -9.149  -77.731 1.00 63.11  ? 144 TYR D C   1 
ATOM   7537 O O   . TYR D 1 132 ? -7.570  -8.079  -77.233 1.00 62.39  ? 144 TYR D O   1 
ATOM   7538 C CB  . TYR D 1 132 ? -9.433  -8.941  -79.734 1.00 58.67  ? 144 TYR D CB  1 
ATOM   7539 C CG  . TYR D 1 132 ? -9.440  -8.546  -81.192 1.00 60.89  ? 144 TYR D CG  1 
ATOM   7540 C CD1 . TYR D 1 132 ? -8.751  -7.420  -81.633 1.00 63.90  ? 144 TYR D CD1 1 
ATOM   7541 C CD2 . TYR D 1 132 ? -10.098 -9.321  -82.141 1.00 61.72  ? 144 TYR D CD2 1 
ATOM   7542 C CE1 . TYR D 1 132 ? -8.709  -7.079  -82.982 1.00 66.87  ? 144 TYR D CE1 1 
ATOM   7543 C CE2 . TYR D 1 132 ? -10.064 -8.988  -83.495 1.00 64.26  ? 144 TYR D CE2 1 
ATOM   7544 C CZ  . TYR D 1 132 ? -9.371  -7.862  -83.910 1.00 73.05  ? 144 TYR D CZ  1 
ATOM   7545 O OH  . TYR D 1 132 ? -9.321  -7.506  -85.233 1.00 75.42  ? 144 TYR D OH  1 
ATOM   7546 N N   . ALA D 1 133 ? -8.202  -10.251 -77.003 1.00 59.76  ? 145 ALA D N   1 
ATOM   7547 C CA  . ALA D 1 133 ? -8.030  -10.310 -75.551 1.00 59.36  ? 145 ALA D CA  1 
ATOM   7548 C C   . ALA D 1 133 ? -6.555  -10.045 -75.157 1.00 66.19  ? 145 ALA D C   1 
ATOM   7549 O O   . ALA D 1 133 ? -6.314  -9.272  -74.215 1.00 66.20  ? 145 ALA D O   1 
ATOM   7550 C CB  . ALA D 1 133 ? -8.501  -11.653 -75.022 1.00 59.86  ? 145 ALA D CB  1 
ATOM   7551 N N   . VAL D 1 134 ? -5.580  -10.636 -75.908 1.00 64.09  ? 146 VAL D N   1 
ATOM   7552 C CA  . VAL D 1 134 ? -4.141  -10.390 -75.703 1.00 66.48  ? 146 VAL D CA  1 
ATOM   7553 C C   . VAL D 1 134 ? -3.849  -8.887  -75.859 1.00 71.20  ? 146 VAL D C   1 
ATOM   7554 O O   . VAL D 1 134 ? -3.217  -8.307  -74.981 1.00 71.27  ? 146 VAL D O   1 
ATOM   7555 C CB  . VAL D 1 134 ? -3.225  -11.251 -76.626 1.00 72.94  ? 146 VAL D CB  1 
ATOM   7556 C CG1 . VAL D 1 134 ? -1.755  -10.834 -76.514 1.00 75.56  ? 146 VAL D CG1 1 
ATOM   7557 C CG2 . VAL D 1 134 ? -3.372  -12.736 -76.321 1.00 73.16  ? 146 VAL D CG2 1 
ATOM   7558 N N   . GLN D 1 135 ? -4.336  -8.266  -76.951 1.00 67.96  ? 147 GLN D N   1 
ATOM   7559 C CA  . GLN D 1 135 ? -4.141  -6.846  -77.250 1.00 67.91  ? 147 GLN D CA  1 
ATOM   7560 C C   . GLN D 1 135 ? -4.828  -5.949  -76.228 1.00 70.38  ? 147 GLN D C   1 
ATOM   7561 O O   . GLN D 1 135 ? -4.280  -4.896  -75.899 1.00 71.10  ? 147 GLN D O   1 
ATOM   7562 C CB  . GLN D 1 135 ? -4.623  -6.504  -78.654 1.00 69.44  ? 147 GLN D CB  1 
ATOM   7563 C CG  . GLN D 1 135 ? -3.661  -7.002  -79.728 1.00 92.22  ? 147 GLN D CG  1 
ATOM   7564 C CD  . GLN D 1 135 ? -4.312  -7.323  -81.052 1.00 116.64 ? 147 GLN D CD  1 
ATOM   7565 O OE1 . GLN D 1 135 ? -3.746  -8.037  -81.890 1.00 116.38 ? 147 GLN D OE1 1 
ATOM   7566 N NE2 . GLN D 1 135 ? -5.503  -6.800  -81.291 1.00 107.03 ? 147 GLN D NE2 1 
ATOM   7567 N N   . ALA D 1 136 ? -6.006  -6.363  -75.711 1.00 65.28  ? 148 ALA D N   1 
ATOM   7568 C CA  . ALA D 1 136 ? -6.725  -5.614  -74.668 1.00 63.63  ? 148 ALA D CA  1 
ATOM   7569 C C   . ALA D 1 136 ? -5.951  -5.621  -73.341 1.00 68.70  ? 148 ALA D C   1 
ATOM   7570 O O   . ALA D 1 136 ? -5.997  -4.635  -72.604 1.00 67.73  ? 148 ALA D O   1 
ATOM   7571 C CB  . ALA D 1 136 ? -8.122  -6.180  -74.468 1.00 62.16  ? 148 ALA D CB  1 
ATOM   7572 N N   . LYS D 1 137 ? -5.223  -6.722  -73.064 1.00 66.91  ? 149 LYS D N   1 
ATOM   7573 C CA  . LYS D 1 137 ? -4.439  -6.928  -71.843 1.00 67.91  ? 149 LYS D CA  1 
ATOM   7574 C C   . LYS D 1 137 ? -3.142  -6.074  -71.821 1.00 74.49  ? 149 LYS D C   1 
ATOM   7575 O O   . LYS D 1 137 ? -2.764  -5.587  -70.759 1.00 75.32  ? 149 LYS D O   1 
ATOM   7576 C CB  . LYS D 1 137 ? -4.103  -8.423  -71.702 1.00 71.10  ? 149 LYS D CB  1 
ATOM   7577 C CG  . LYS D 1 137 ? -3.565  -8.836  -70.340 1.00 84.97  ? 149 LYS D CG  1 
ATOM   7578 C CD  . LYS D 1 137 ? -3.211  -10.309 -70.304 1.00 98.13  ? 149 LYS D CD  1 
ATOM   7579 C CE  . LYS D 1 137 ? -2.543  -10.698 -69.009 1.00 115.22 ? 149 LYS D CE  1 
ATOM   7580 N NZ  . LYS D 1 137 ? -2.306  -12.164 -68.926 1.00 126.22 ? 149 LYS D NZ  1 
ATOM   7581 N N   . TYR D 1 138 ? -2.482  -5.873  -72.977 1.00 72.30  ? 150 TYR D N   1 
ATOM   7582 C CA  . TYR D 1 138 ? -1.155  -5.246  -73.050 1.00 105.55 ? 150 TYR D CA  1 
ATOM   7583 C C   . TYR D 1 138 ? -1.145  -3.944  -73.885 1.00 130.52 ? 150 TYR D C   1 
ATOM   7584 O O   . TYR D 1 138 ? -1.356  -3.945  -75.100 1.00 86.56  ? 150 TYR D O   1 
ATOM   7585 C CB  . TYR D 1 138 ? -0.124  -6.246  -73.612 1.00 109.31 ? 150 TYR D CB  1 
ATOM   7586 C CG  . TYR D 1 138 ? 0.056   -7.491  -72.768 1.00 111.89 ? 150 TYR D CG  1 
ATOM   7587 C CD1 . TYR D 1 138 ? 0.685   -7.432  -71.527 1.00 115.51 ? 150 TYR D CD1 1 
ATOM   7588 C CD2 . TYR D 1 138 ? -0.366  -8.737  -73.226 1.00 112.16 ? 150 TYR D CD2 1 
ATOM   7589 C CE1 . TYR D 1 138 ? 0.870   -8.576  -70.753 1.00 117.37 ? 150 TYR D CE1 1 
ATOM   7590 C CE2 . TYR D 1 138 ? -0.192  -9.889  -72.458 1.00 114.04 ? 150 TYR D CE2 1 
ATOM   7591 C CZ  . TYR D 1 138 ? 0.430   -9.803  -71.222 1.00 122.98 ? 150 TYR D CZ  1 
ATOM   7592 O OH  . TYR D 1 138 ? 0.616   -10.930 -70.457 1.00 125.54 ? 150 TYR D OH  1 
ATOM   7593 N N   . ALA D 1 187 ? -5.955  1.535   -77.832 1.00 72.76  ? 199 ALA D N   1 
ATOM   7594 C CA  . ALA D 1 187 ? -5.521  0.259   -78.413 1.00 73.57  ? 199 ALA D CA  1 
ATOM   7595 C C   . ALA D 1 187 ? -5.977  -0.916  -77.552 1.00 75.73  ? 199 ALA D C   1 
ATOM   7596 O O   . ALA D 1 187 ? -6.496  -1.898  -78.082 1.00 73.40  ? 199 ALA D O   1 
ATOM   7597 C CB  . ALA D 1 187 ? -4.004  0.231   -78.580 1.00 76.96  ? 199 ALA D CB  1 
ATOM   7598 N N   . ARG D 1 188 ? -5.771  -0.811  -76.222 1.00 72.83  ? 200 ARG D N   1 
ATOM   7599 C CA  . ARG D 1 188 ? -6.308  -1.744  -75.230 1.00 71.02  ? 200 ARG D CA  1 
ATOM   7600 C C   . ARG D 1 188 ? -7.829  -1.570  -75.128 1.00 72.43  ? 200 ARG D C   1 
ATOM   7601 O O   . ARG D 1 188 ? -8.540  -2.534  -74.864 1.00 71.32  ? 200 ARG D O   1 
ATOM   7602 C CB  . ARG D 1 188 ? -5.645  -1.522  -73.858 1.00 72.33  ? 200 ARG D CB  1 
ATOM   7603 C CG  . ARG D 1 188 ? -4.152  -1.859  -73.802 1.00 87.26  ? 200 ARG D CG  1 
ATOM   7604 C CD  . ARG D 1 188 ? -3.664  -2.150  -72.388 1.00 104.51 ? 200 ARG D CD  1 
ATOM   7605 N NE  . ARG D 1 188 ? -3.762  -0.996  -71.487 1.00 120.92 ? 200 ARG D NE  1 
ATOM   7606 C CZ  . ARG D 1 188 ? -3.148  -0.906  -70.310 1.00 140.86 ? 200 ARG D CZ  1 
ATOM   7607 N NH1 . ARG D 1 188 ? -2.366  -1.891  -69.882 1.00 133.03 ? 200 ARG D NH1 1 
ATOM   7608 N NH2 . ARG D 1 188 ? -3.307  0.172   -69.553 1.00 127.13 ? 200 ARG D NH2 1 
ATOM   7609 N N   . ASP D 1 189 ? -8.317  -0.329  -75.316 1.00 68.21  ? 201 ASP D N   1 
ATOM   7610 C CA  . ASP D 1 189 ? -9.736  0.017   -75.348 1.00 65.40  ? 201 ASP D CA  1 
ATOM   7611 C C   . ASP D 1 189 ? -10.350 -0.333  -76.683 1.00 65.33  ? 201 ASP D C   1 
ATOM   7612 O O   . ASP D 1 189 ? -11.499 -0.759  -76.712 1.00 63.99  ? 201 ASP D O   1 
ATOM   7613 C CB  . ASP D 1 189 ? -9.945  1.509   -75.069 1.00 68.16  ? 201 ASP D CB  1 
ATOM   7614 C CG  . ASP D 1 189 ? -9.535  1.967   -73.686 1.00 88.03  ? 201 ASP D CG  1 
ATOM   7615 O OD1 . ASP D 1 189 ? -9.136  1.104   -72.860 1.00 89.78  ? 201 ASP D OD1 1 
ATOM   7616 O OD2 . ASP D 1 189 ? -9.624  3.185   -73.417 1.00 98.88  ? 201 ASP D OD2 1 
ATOM   7617 N N   . GLU D 1 190 ? -9.611  -0.135  -77.790 1.00 60.98  ? 202 GLU D N   1 
ATOM   7618 C CA  . GLU D 1 190 ? -10.069 -0.501  -79.138 1.00 60.30  ? 202 GLU D CA  1 
ATOM   7619 C C   . GLU D 1 190 ? -10.266 -2.013  -79.266 1.00 62.46  ? 202 GLU D C   1 
ATOM   7620 O O   . GLU D 1 190 ? -11.280 -2.430  -79.828 1.00 61.66  ? 202 GLU D O   1 
ATOM   7621 C CB  . GLU D 1 190 ? -9.087  -0.018  -80.207 1.00 64.03  ? 202 GLU D CB  1 
ATOM   7622 C CG  . GLU D 1 190 ? -9.509  1.273   -80.882 1.00 75.50  ? 202 GLU D CG  1 
ATOM   7623 C CD  . GLU D 1 190 ? -8.381  2.243   -81.191 1.00 98.64  ? 202 GLU D CD  1 
ATOM   7624 O OE1 . GLU D 1 190 ? -8.438  3.392   -80.695 1.00 90.39  ? 202 GLU D OE1 1 
ATOM   7625 O OE2 . GLU D 1 190 ? -7.447  1.865   -81.936 1.00 94.21  ? 202 GLU D OE2 1 
ATOM   7626 N N   . ALA D 1 191 ? -9.314  -2.834  -78.735 1.00 57.50  ? 203 ALA D N   1 
ATOM   7627 C CA  . ALA D 1 191 ? -9.345  -4.307  -78.763 1.00 55.87  ? 203 ALA D CA  1 
ATOM   7628 C C   . ALA D 1 191 ? -10.557 -4.863  -78.033 1.00 58.19  ? 203 ALA D C   1 
ATOM   7629 O O   . ALA D 1 191 ? -11.083 -5.906  -78.430 1.00 58.31  ? 203 ALA D O   1 
ATOM   7630 C CB  . ALA D 1 191 ? -8.075  -4.881  -78.157 1.00 57.19  ? 203 ALA D CB  1 
ATOM   7631 N N   . GLU D 1 192 ? -11.001 -4.169  -76.972 1.00 53.18  ? 204 GLU D N   1 
ATOM   7632 C CA  . GLU D 1 192 ? -12.195 -4.516  -76.204 1.00 51.41  ? 204 GLU D CA  1 
ATOM   7633 C C   . GLU D 1 192 ? -13.467 -4.409  -77.049 1.00 56.59  ? 204 GLU D C   1 
ATOM   7634 O O   . GLU D 1 192 ? -14.360 -5.244  -76.923 1.00 56.29  ? 204 GLU D O   1 
ATOM   7635 C CB  . GLU D 1 192 ? -12.305 -3.615  -74.979 1.00 51.80  ? 204 GLU D CB  1 
ATOM   7636 C CG  . GLU D 1 192 ? -11.277 -3.934  -73.913 1.00 60.11  ? 204 GLU D CG  1 
ATOM   7637 C CD  . GLU D 1 192 ? -11.520 -3.277  -72.572 1.00 76.91  ? 204 GLU D CD  1 
ATOM   7638 O OE1 . GLU D 1 192 ? -12.375 -2.366  -72.499 1.00 71.69  ? 204 GLU D OE1 1 
ATOM   7639 O OE2 . GLU D 1 192 ? -10.846 -3.667  -71.593 1.00 72.18  ? 204 GLU D OE2 1 
ATOM   7640 N N   . MET D 1 193 ? -13.538 -3.391  -77.912 1.00 54.75  ? 205 MET D N   1 
ATOM   7641 C CA  . MET D 1 193 ? -14.651 -3.163  -78.826 1.00 54.84  ? 205 MET D CA  1 
ATOM   7642 C C   . MET D 1 193 ? -14.609 -4.160  -79.985 1.00 60.09  ? 205 MET D C   1 
ATOM   7643 O O   . MET D 1 193 ? -15.652 -4.694  -80.352 1.00 59.88  ? 205 MET D O   1 
ATOM   7644 C CB  . MET D 1 193 ? -14.647 -1.711  -79.338 1.00 58.05  ? 205 MET D CB  1 
ATOM   7645 C CG  . MET D 1 193 ? -15.932 -1.303  -80.043 1.00 61.97  ? 205 MET D CG  1 
ATOM   7646 S SD  . MET D 1 193 ? -17.449 -1.807  -79.181 1.00 64.70  ? 205 MET D SD  1 
ATOM   7647 C CE  . MET D 1 193 ? -17.553 -0.583  -77.902 1.00 60.35  ? 205 MET D CE  1 
ATOM   7648 N N   . GLU D 1 194 ? -13.410 -4.418  -80.544 1.00 57.99  ? 206 GLU D N   1 
ATOM   7649 C CA  . GLU D 1 194 ? -13.198 -5.404  -81.600 1.00 59.01  ? 206 GLU D CA  1 
ATOM   7650 C C   . GLU D 1 194 ? -13.599 -6.794  -81.123 1.00 61.25  ? 206 GLU D C   1 
ATOM   7651 O O   . GLU D 1 194 ? -14.198 -7.544  -81.897 1.00 62.76  ? 206 GLU D O   1 
ATOM   7652 C CB  . GLU D 1 194 ? -11.739 -5.399  -82.074 1.00 62.70  ? 206 GLU D CB  1 
ATOM   7653 C CG  . GLU D 1 194 ? -11.305 -4.137  -82.810 1.00 79.26  ? 206 GLU D CG  1 
ATOM   7654 C CD  . GLU D 1 194 ? -12.182 -3.721  -83.976 1.00 111.80 ? 206 GLU D CD  1 
ATOM   7655 O OE1 . GLU D 1 194 ? -12.311 -4.508  -84.942 1.00 119.92 ? 206 GLU D OE1 1 
ATOM   7656 O OE2 . GLU D 1 194 ? -12.760 -2.612  -83.910 1.00 106.25 ? 206 GLU D OE2 1 
ATOM   7657 N N   . TYR D 1 195 ? -13.289 -7.127  -79.844 1.00 54.63  ? 207 TYR D N   1 
ATOM   7658 C CA  . TYR D 1 195 ? -13.712 -8.363  -79.177 1.00 52.80  ? 207 TYR D CA  1 
ATOM   7659 C C   . TYR D 1 195 ? -15.240 -8.466  -79.140 1.00 54.58  ? 207 TYR D C   1 
ATOM   7660 O O   . TYR D 1 195 ? -15.790 -9.480  -79.576 1.00 55.10  ? 207 TYR D O   1 
ATOM   7661 C CB  . TYR D 1 195 ? -13.147 -8.430  -77.746 1.00 52.97  ? 207 TYR D CB  1 
ATOM   7662 C CG  . TYR D 1 195 ? -13.288 -9.787  -77.074 1.00 54.36  ? 207 TYR D CG  1 
ATOM   7663 C CD1 . TYR D 1 195 ? -14.485 -10.168 -76.458 1.00 54.65  ? 207 TYR D CD1 1 
ATOM   7664 C CD2 . TYR D 1 195 ? -12.214 -10.668 -77.008 1.00 56.14  ? 207 TYR D CD2 1 
ATOM   7665 C CE1 . TYR D 1 195 ? -14.620 -11.417 -75.847 1.00 53.89  ? 207 TYR D CE1 1 
ATOM   7666 C CE2 . TYR D 1 195 ? -12.335 -11.914 -76.389 1.00 57.15  ? 207 TYR D CE2 1 
ATOM   7667 C CZ  . TYR D 1 195 ? -13.538 -12.285 -75.807 1.00 62.07  ? 207 TYR D CZ  1 
ATOM   7668 O OH  . TYR D 1 195 ? -13.640 -13.516 -75.190 1.00 62.40  ? 207 TYR D OH  1 
ATOM   7669 N N   . LEU D 1 196 ? -15.924 -7.412  -78.644 1.00 48.58  ? 208 LEU D N   1 
ATOM   7670 C CA  . LEU D 1 196 ? -17.379 -7.420  -78.483 1.00 46.52  ? 208 LEU D CA  1 
ATOM   7671 C C   . LEU D 1 196 ? -18.101 -7.511  -79.823 1.00 50.12  ? 208 LEU D C   1 
ATOM   7672 O O   . LEU D 1 196 ? -19.150 -8.145  -79.884 1.00 50.24  ? 208 LEU D O   1 
ATOM   7673 C CB  . LEU D 1 196 ? -17.868 -6.190  -77.695 1.00 45.47  ? 208 LEU D CB  1 
ATOM   7674 C CG  . LEU D 1 196 ? -17.508 -6.154  -76.210 1.00 48.64  ? 208 LEU D CG  1 
ATOM   7675 C CD1 . LEU D 1 196 ? -17.698 -4.761  -75.635 1.00 47.69  ? 208 LEU D CD1 1 
ATOM   7676 C CD2 . LEU D 1 196 ? -18.299 -7.206  -75.409 1.00 50.54  ? 208 LEU D CD2 1 
ATOM   7677 N N   . LYS D 1 197 ? -17.533 -6.913  -80.891 1.00 47.20  ? 209 LYS D N   1 
ATOM   7678 C CA  . LYS D 1 197 ? -18.100 -6.923  -82.242 1.00 48.44  ? 209 LYS D CA  1 
ATOM   7679 C C   . LYS D 1 197 ? -18.128 -8.332  -82.836 1.00 54.63  ? 209 LYS D C   1 
ATOM   7680 O O   . LYS D 1 197 ? -19.079 -8.672  -83.544 1.00 54.65  ? 209 LYS D O   1 
ATOM   7681 C CB  . LYS D 1 197 ? -17.331 -5.965  -83.155 1.00 52.11  ? 209 LYS D CB  1 
ATOM   7682 C CG  . LYS D 1 197 ? -17.781 -4.508  -82.997 1.00 58.57  ? 209 LYS D CG  1 
ATOM   7683 C CD  . LYS D 1 197 ? -16.684 -3.508  -83.326 1.00 66.60  ? 209 LYS D CD  1 
ATOM   7684 C CE  . LYS D 1 197 ? -16.502 -3.258  -84.801 1.00 75.93  ? 209 LYS D CE  1 
ATOM   7685 N NZ  . LYS D 1 197 ? -15.383 -2.324  -85.051 1.00 86.99  ? 209 LYS D NZ  1 
ATOM   7686 N N   . ILE D 1 198 ? -17.092 -9.149  -82.555 1.00 52.94  ? 210 ILE D N   1 
ATOM   7687 C CA  . ILE D 1 198 ? -17.055 -10.568 -82.941 1.00 53.48  ? 210 ILE D CA  1 
ATOM   7688 C C   . ILE D 1 198 ? -18.040 -11.342 -82.063 1.00 56.35  ? 210 ILE D C   1 
ATOM   7689 O O   . ILE D 1 198 ? -18.870 -12.074 -82.602 1.00 57.99  ? 210 ILE D O   1 
ATOM   7690 C CB  . ILE D 1 198 ? -15.617 -11.167 -82.882 1.00 57.41  ? 210 ILE D CB  1 
ATOM   7691 C CG1 . ILE D 1 198 ? -14.683 -10.471 -83.894 1.00 59.70  ? 210 ILE D CG1 1 
ATOM   7692 C CG2 . ILE D 1 198 ? -15.625 -12.692 -83.093 1.00 58.63  ? 210 ILE D CG2 1 
ATOM   7693 C CD1 . ILE D 1 198 ? -13.223 -10.658 -83.649 1.00 71.49  ? 210 ILE D CD1 1 
ATOM   7694 N N   . ALA D 1 199 ? -17.968 -11.154 -80.726 1.00 50.57  ? 211 ALA D N   1 
ATOM   7695 C CA  . ALA D 1 199 ? -18.790 -11.883 -79.751 1.00 49.24  ? 211 ALA D CA  1 
ATOM   7696 C C   . ALA D 1 199 ? -20.290 -11.693 -79.983 1.00 53.00  ? 211 ALA D C   1 
ATOM   7697 O O   . ALA D 1 199 ? -21.027 -12.679 -79.927 1.00 54.04  ? 211 ALA D O   1 
ATOM   7698 C CB  . ALA D 1 199 ? -18.431 -11.467 -78.341 1.00 48.52  ? 211 ALA D CB  1 
ATOM   7699 N N   . GLN D 1 200 ? -20.736 -10.459 -80.302 1.00 48.28  ? 212 GLN D N   1 
ATOM   7700 C CA  . GLN D 1 200 ? -22.164 -10.143 -80.461 1.00 47.78  ? 212 GLN D CA  1 
ATOM   7701 C C   . GLN D 1 200 ? -22.815 -10.855 -81.680 1.00 53.80  ? 212 GLN D C   1 
ATOM   7702 O O   . GLN D 1 200 ? -24.038 -10.945 -81.742 1.00 54.28  ? 212 GLN D O   1 
ATOM   7703 C CB  . GLN D 1 200 ? -22.401 -8.621  -80.519 1.00 48.20  ? 212 GLN D CB  1 
ATOM   7704 C CG  . GLN D 1 200 ? -21.961 -7.948  -81.812 1.00 52.70  ? 212 GLN D CG  1 
ATOM   7705 C CD  . GLN D 1 200 ? -22.108 -6.456  -81.817 1.00 62.05  ? 212 GLN D CD  1 
ATOM   7706 O OE1 . GLN D 1 200 ? -22.618 -5.844  -80.878 1.00 57.14  ? 212 GLN D OE1 1 
ATOM   7707 N NE2 . GLN D 1 200 ? -21.663 -5.835  -82.897 1.00 54.51  ? 212 GLN D NE2 1 
ATOM   7708 N N   . ASP D 1 201 ? -21.997 -11.355 -82.624 1.00 51.74  ? 213 ASP D N   1 
ATOM   7709 C CA  . ASP D 1 201 ? -22.455 -12.094 -83.798 1.00 53.54  ? 213 ASP D CA  1 
ATOM   7710 C C   . ASP D 1 201 ? -22.625 -13.601 -83.498 1.00 57.71  ? 213 ASP D C   1 
ATOM   7711 O O   . ASP D 1 201 ? -23.041 -14.352 -84.385 1.00 59.47  ? 213 ASP D O   1 
ATOM   7712 C CB  . ASP D 1 201 ? -21.485 -11.878 -84.979 1.00 56.56  ? 213 ASP D CB  1 
ATOM   7713 C CG  . ASP D 1 201 ? -21.549 -10.502 -85.628 1.00 68.37  ? 213 ASP D CG  1 
ATOM   7714 O OD1 . ASP D 1 201 ? -22.502 -9.746  -85.337 1.00 67.30  ? 213 ASP D OD1 1 
ATOM   7715 O OD2 . ASP D 1 201 ? -20.660 -10.190 -86.447 1.00 79.21  ? 213 ASP D OD2 1 
ATOM   7716 N N   . LEU D 1 202 ? -22.313 -14.037 -82.266 1.00 52.18  ? 214 LEU D N   1 
ATOM   7717 C CA  . LEU D 1 202 ? -22.466 -15.437 -81.878 1.00 52.28  ? 214 LEU D CA  1 
ATOM   7718 C C   . LEU D 1 202 ? -23.904 -15.705 -81.489 1.00 57.96  ? 214 LEU D C   1 
ATOM   7719 O O   . LEU D 1 202 ? -24.506 -14.890 -80.794 1.00 57.79  ? 214 LEU D O   1 
ATOM   7720 C CB  . LEU D 1 202 ? -21.502 -15.820 -80.740 1.00 50.83  ? 214 LEU D CB  1 
ATOM   7721 C CG  . LEU D 1 202 ? -20.014 -15.678 -81.053 1.00 54.34  ? 214 LEU D CG  1 
ATOM   7722 C CD1 . LEU D 1 202 ? -19.197 -15.720 -79.813 1.00 53.11  ? 214 LEU D CD1 1 
ATOM   7723 C CD2 . LEU D 1 202 ? -19.550 -16.699 -82.027 1.00 55.88  ? 214 LEU D CD2 1 
ATOM   7724 N N   . GLU D 1 203 ? -24.449 -16.855 -81.931 1.00 56.46  ? 215 GLU D N   1 
ATOM   7725 C CA  . GLU D 1 203 ? -25.860 -17.222 -81.781 1.00 57.74  ? 215 GLU D CA  1 
ATOM   7726 C C   . GLU D 1 203 ? -26.326 -17.180 -80.314 1.00 61.98  ? 215 GLU D C   1 
ATOM   7727 O O   . GLU D 1 203 ? -27.455 -16.752 -80.054 1.00 62.94  ? 215 GLU D O   1 
ATOM   7728 C CB  . GLU D 1 203 ? -26.141 -18.614 -82.382 1.00 61.26  ? 215 GLU D CB  1 
ATOM   7729 C CG  . GLU D 1 203 ? -26.048 -18.640 -83.897 1.00 74.23  ? 215 GLU D CG  1 
ATOM   7730 C CD  . GLU D 1 203 ? -25.883 -20.021 -84.497 1.00 100.06 ? 215 GLU D CD  1 
ATOM   7731 O OE1 . GLU D 1 203 ? -24.825 -20.648 -84.262 1.00 83.26  ? 215 GLU D OE1 1 
ATOM   7732 O OE2 . GLU D 1 203 ? -26.796 -20.464 -85.233 1.00 104.47 ? 215 GLU D OE2 1 
ATOM   7733 N N   . MET D 1 204 ? -25.452 -17.578 -79.367 1.00 56.86  ? 216 MET D N   1 
ATOM   7734 C CA  . MET D 1 204 ? -25.797 -17.705 -77.945 1.00 55.79  ? 216 MET D CA  1 
ATOM   7735 C C   . MET D 1 204 ? -25.545 -16.422 -77.140 1.00 59.96  ? 216 MET D C   1 
ATOM   7736 O O   . MET D 1 204 ? -25.896 -16.379 -75.956 1.00 60.15  ? 216 MET D O   1 
ATOM   7737 C CB  . MET D 1 204 ? -25.008 -18.855 -77.315 1.00 58.10  ? 216 MET D CB  1 
ATOM   7738 C CG  . MET D 1 204 ? -25.520 -20.212 -77.699 1.00 62.85  ? 216 MET D CG  1 
ATOM   7739 S SD  . MET D 1 204 ? -24.740 -21.534 -76.753 1.00 66.90  ? 216 MET D SD  1 
ATOM   7740 C CE  . MET D 1 204 ? -25.646 -21.424 -75.236 1.00 63.37  ? 216 MET D CE  1 
ATOM   7741 N N   . TYR D 1 205 ? -24.943 -15.386 -77.767 1.00 55.78  ? 217 TYR D N   1 
ATOM   7742 C CA  . TYR D 1 205 ? -24.617 -14.110 -77.127 1.00 54.67  ? 217 TYR D CA  1 
ATOM   7743 C C   . TYR D 1 205 ? -25.881 -13.377 -76.639 1.00 58.92  ? 217 TYR D C   1 
ATOM   7744 O O   . TYR D 1 205 ? -26.817 -13.147 -77.412 1.00 59.52  ? 217 TYR D O   1 
ATOM   7745 C CB  . TYR D 1 205 ? -23.824 -13.220 -78.099 1.00 55.94  ? 217 TYR D CB  1 
ATOM   7746 C CG  . TYR D 1 205 ? -23.541 -11.816 -77.610 1.00 57.52  ? 217 TYR D CG  1 
ATOM   7747 C CD1 . TYR D 1 205 ? -24.428 -10.775 -77.870 1.00 59.65  ? 217 TYR D CD1 1 
ATOM   7748 C CD2 . TYR D 1 205 ? -22.347 -11.509 -76.966 1.00 57.56  ? 217 TYR D CD2 1 
ATOM   7749 C CE1 . TYR D 1 205 ? -24.161 -9.473  -77.446 1.00 59.19  ? 217 TYR D CE1 1 
ATOM   7750 C CE2 . TYR D 1 205 ? -22.060 -10.209 -76.555 1.00 57.84  ? 217 TYR D CE2 1 
ATOM   7751 C CZ  . TYR D 1 205 ? -22.965 -9.190  -76.803 1.00 66.75  ? 217 TYR D CZ  1 
ATOM   7752 O OH  . TYR D 1 205 ? -22.663 -7.900  -76.417 1.00 70.09  ? 217 TYR D OH  1 
ATOM   7753 N N   . GLY D 1 206 ? -25.878 -13.034 -75.357 1.00 54.49  ? 218 GLY D N   1 
ATOM   7754 C CA  . GLY D 1 206 ? -26.921 -12.228 -74.734 1.00 54.39  ? 218 GLY D CA  1 
ATOM   7755 C C   . GLY D 1 206 ? -28.288 -12.881 -74.627 1.00 58.46  ? 218 GLY D C   1 
ATOM   7756 O O   . GLY D 1 206 ? -29.279 -12.184 -74.389 1.00 58.94  ? 218 GLY D O   1 
ATOM   7757 N N   . VAL D 1 207 ? -28.362 -14.213 -74.820 1.00 53.92  ? 219 VAL D N   1 
ATOM   7758 C CA  . VAL D 1 207 ? -29.611 -14.975 -74.724 1.00 55.04  ? 219 VAL D CA  1 
ATOM   7759 C C   . VAL D 1 207 ? -29.721 -15.555 -73.316 1.00 59.67  ? 219 VAL D C   1 
ATOM   7760 O O   . VAL D 1 207 ? -28.775 -16.181 -72.834 1.00 59.88  ? 219 VAL D O   1 
ATOM   7761 C CB  . VAL D 1 207 ? -29.744 -16.082 -75.815 1.00 59.71  ? 219 VAL D CB  1 
ATOM   7762 C CG1 . VAL D 1 207 ? -31.076 -16.808 -75.706 1.00 61.08  ? 219 VAL D CG1 1 
ATOM   7763 C CG2 . VAL D 1 207 ? -29.576 -15.512 -77.218 1.00 59.25  ? 219 VAL D CG2 1 
ATOM   7764 N N   . ASN D 1 208 ? -30.866 -15.312 -72.655 1.00 56.58  ? 220 ASN D N   1 
ATOM   7765 C CA  . ASN D 1 208 ? -31.237 -15.908 -71.370 1.00 57.49  ? 220 ASN D CA  1 
ATOM   7766 C C   . ASN D 1 208 ? -32.077 -17.137 -71.628 1.00 62.69  ? 220 ASN D C   1 
ATOM   7767 O O   . ASN D 1 208 ? -33.135 -17.026 -72.254 1.00 63.19  ? 220 ASN D O   1 
ATOM   7768 C CB  . ASN D 1 208 ? -32.010 -14.908 -70.507 1.00 59.20  ? 220 ASN D CB  1 
ATOM   7769 C CG  . ASN D 1 208 ? -31.263 -13.642 -70.218 1.00 78.44  ? 220 ASN D CG  1 
ATOM   7770 O OD1 . ASN D 1 208 ? -30.428 -13.581 -69.307 1.00 71.86  ? 220 ASN D OD1 1 
ATOM   7771 N ND2 . ASN D 1 208 ? -31.569 -12.602 -70.984 1.00 68.40  ? 220 ASN D ND2 1 
ATOM   7772 N N   . TYR D 1 209 ? -31.606 -18.309 -71.175 1.00 59.56  ? 221 TYR D N   1 
ATOM   7773 C CA  . TYR D 1 209 ? -32.291 -19.580 -71.429 1.00 61.07  ? 221 TYR D CA  1 
ATOM   7774 C C   . TYR D 1 209 ? -33.058 -20.064 -70.205 1.00 68.00  ? 221 TYR D C   1 
ATOM   7775 O O   . TYR D 1 209 ? -32.561 -20.001 -69.079 1.00 67.80  ? 221 TYR D O   1 
ATOM   7776 C CB  . TYR D 1 209 ? -31.306 -20.664 -71.885 1.00 61.42  ? 221 TYR D CB  1 
ATOM   7777 C CG  . TYR D 1 209 ? -30.638 -20.384 -73.216 1.00 60.73  ? 221 TYR D CG  1 
ATOM   7778 C CD1 . TYR D 1 209 ? -31.217 -20.803 -74.411 1.00 63.86  ? 221 TYR D CD1 1 
ATOM   7779 C CD2 . TYR D 1 209 ? -29.390 -19.760 -73.279 1.00 58.71  ? 221 TYR D CD2 1 
ATOM   7780 C CE1 . TYR D 1 209 ? -30.588 -20.573 -75.641 1.00 63.34  ? 221 TYR D CE1 1 
ATOM   7781 C CE2 . TYR D 1 209 ? -28.756 -19.519 -74.503 1.00 58.09  ? 221 TYR D CE2 1 
ATOM   7782 C CZ  . TYR D 1 209 ? -29.354 -19.937 -75.680 1.00 65.21  ? 221 TYR D CZ  1 
ATOM   7783 O OH  . TYR D 1 209 ? -28.733 -19.691 -76.881 1.00 65.44  ? 221 TYR D OH  1 
ATOM   7784 N N   . PHE D 1 210 ? -34.275 -20.560 -70.439 1.00 67.33  ? 222 PHE D N   1 
ATOM   7785 C CA  . PHE D 1 210 ? -35.167 -21.069 -69.394 1.00 69.97  ? 222 PHE D CA  1 
ATOM   7786 C C   . PHE D 1 210 ? -35.819 -22.350 -69.845 1.00 75.30  ? 222 PHE D C   1 
ATOM   7787 O O   . PHE D 1 210 ? -36.290 -22.416 -70.978 1.00 75.70  ? 222 PHE D O   1 
ATOM   7788 C CB  . PHE D 1 210 ? -36.238 -20.023 -69.040 1.00 72.30  ? 222 PHE D CB  1 
ATOM   7789 C CG  . PHE D 1 210 ? -35.664 -18.697 -68.615 1.00 71.73  ? 222 PHE D CG  1 
ATOM   7790 C CD1 . PHE D 1 210 ? -35.219 -18.499 -67.315 1.00 75.09  ? 222 PHE D CD1 1 
ATOM   7791 C CD2 . PHE D 1 210 ? -35.538 -17.654 -69.523 1.00 71.62  ? 222 PHE D CD2 1 
ATOM   7792 C CE1 . PHE D 1 210 ? -34.682 -17.278 -66.927 1.00 74.02  ? 222 PHE D CE1 1 
ATOM   7793 C CE2 . PHE D 1 210 ? -35.002 -16.433 -69.132 1.00 72.23  ? 222 PHE D CE2 1 
ATOM   7794 C CZ  . PHE D 1 210 ? -34.569 -16.257 -67.841 1.00 70.67  ? 222 PHE D CZ  1 
ATOM   7795 N N   . ALA D 1 211 ? -35.831 -23.376 -68.983 1.00 73.19  ? 223 ALA D N   1 
ATOM   7796 C CA  . ALA D 1 211 ? -36.550 -24.617 -69.281 1.00 75.72  ? 223 ALA D CA  1 
ATOM   7797 C C   . ALA D 1 211 ? -38.056 -24.364 -69.218 1.00 81.66  ? 223 ALA D C   1 
ATOM   7798 O O   . ALA D 1 211 ? -38.556 -23.790 -68.245 1.00 81.15  ? 223 ALA D O   1 
ATOM   7799 C CB  . ALA D 1 211 ? -36.146 -25.719 -68.313 1.00 78.56  ? 223 ALA D CB  1 
ATOM   7800 N N   . ILE D 1 212 ? -38.764 -24.737 -70.294 1.00 80.67  ? 224 ILE D N   1 
ATOM   7801 C CA  . ILE D 1 212 ? -40.215 -24.570 -70.434 1.00 83.11  ? 224 ILE D CA  1 
ATOM   7802 C C   . ILE D 1 212 ? -40.847 -25.875 -70.978 1.00 92.74  ? 224 ILE D C   1 
ATOM   7803 O O   . ILE D 1 212 ? -40.126 -26.745 -71.476 1.00 92.12  ? 224 ILE D O   1 
ATOM   7804 C CB  . ILE D 1 212 ? -40.579 -23.322 -71.311 1.00 83.60  ? 224 ILE D CB  1 
ATOM   7805 C CG1 . ILE D 1 212 ? -40.086 -23.457 -72.776 1.00 81.92  ? 224 ILE D CG1 1 
ATOM   7806 C CG2 . ILE D 1 212 ? -40.079 -22.019 -70.662 1.00 80.79  ? 224 ILE D CG2 1 
ATOM   7807 C CD1 . ILE D 1 212 ? -40.926 -22.743 -73.818 1.00 84.94  ? 224 ILE D CD1 1 
ATOM   7808 N N   . ARG D 1 213 ? -42.180 -26.024 -70.824 1.00 94.33  ? 225 ARG D N   1 
ATOM   7809 C CA  . ARG D 1 213 ? -42.991 -27.060 -71.472 1.00 98.26  ? 225 ARG D CA  1 
ATOM   7810 C C   . ARG D 1 213 ? -44.119 -26.405 -72.271 1.00 104.14 ? 225 ARG D C   1 
ATOM   7811 O O   . ARG D 1 213 ? -44.758 -25.481 -71.762 1.00 104.45 ? 225 ARG D O   1 
ATOM   7812 C CB  . ARG D 1 213 ? -43.569 -28.041 -70.434 1.00 103.61 ? 225 ARG D CB  1 
ATOM   7813 C CG  . ARG D 1 213 ? -42.788 -29.339 -70.315 1.00 116.41 ? 225 ARG D CG  1 
ATOM   7814 C CD  . ARG D 1 213 ? -43.308 -30.225 -69.195 1.00 130.46 ? 225 ARG D CD  1 
ATOM   7815 N NE  . ARG D 1 213 ? -42.729 -29.860 -67.901 1.00 139.46 ? 225 ARG D NE  1 
ATOM   7816 C CZ  . ARG D 1 213 ? -41.953 -30.655 -67.169 1.00 151.42 ? 225 ARG D CZ  1 
ATOM   7817 N NH1 . ARG D 1 213 ? -41.665 -31.884 -67.585 1.00 135.50 ? 225 ARG D NH1 1 
ATOM   7818 N NH2 . ARG D 1 213 ? -41.466 -30.231 -66.009 1.00 137.37 ? 225 ARG D NH2 1 
ATOM   7819 N N   . ASN D 1 214 ? -44.365 -26.877 -73.515 1.00 101.64 ? 226 ASN D N   1 
ATOM   7820 C CA  . ASN D 1 214 ? -45.494 -26.394 -74.322 1.00 103.22 ? 226 ASN D CA  1 
ATOM   7821 C C   . ASN D 1 214 ? -46.805 -27.079 -73.890 1.00 111.70 ? 226 ASN D C   1 
ATOM   7822 O O   . ASN D 1 214 ? -46.783 -27.943 -73.009 1.00 112.94 ? 226 ASN D O   1 
ATOM   7823 C CB  . ASN D 1 214 ? -45.238 -26.566 -75.838 1.00 102.56 ? 226 ASN D CB  1 
ATOM   7824 C CG  . ASN D 1 214 ? -45.105 -27.976 -76.382 1.00 118.32 ? 226 ASN D CG  1 
ATOM   7825 O OD1 . ASN D 1 214 ? -45.571 -28.969 -75.811 1.00 112.09 ? 226 ASN D OD1 1 
ATOM   7826 N ND2 . ASN D 1 214 ? -44.524 -28.074 -77.564 1.00 108.02 ? 226 ASN D ND2 1 
ATOM   7827 N N   . LYS D 1 215 ? -47.938 -26.699 -74.524 1.00 110.80 ? 227 LYS D N   1 
ATOM   7828 C CA  . LYS D 1 215 ? -49.283 -27.238 -74.234 1.00 115.77 ? 227 LYS D CA  1 
ATOM   7829 C C   . LYS D 1 215 ? -49.352 -28.767 -74.442 1.00 122.66 ? 227 LYS D C   1 
ATOM   7830 O O   . LYS D 1 215 ? -50.161 -29.415 -73.779 1.00 126.63 ? 227 LYS D O   1 
ATOM   7831 C CB  . LYS D 1 215 ? -50.426 -26.566 -75.062 1.00 120.20 ? 227 LYS D CB  1 
ATOM   7832 C CG  . LYS D 1 215 ? -50.316 -25.081 -75.418 1.00 126.85 ? 227 LYS D CG  1 
ATOM   7833 C CD  . LYS D 1 215 ? -49.467 -24.897 -76.697 1.00 127.60 ? 227 LYS D CD  1 
ATOM   7834 C CE  . LYS D 1 215 ? -49.549 -23.534 -77.316 1.00 123.64 ? 227 LYS D CE  1 
ATOM   7835 N NZ  . LYS D 1 215 ? -48.724 -23.444 -78.552 1.00 115.68 ? 227 LYS D NZ  1 
ATOM   7836 N N   . LYS D 1 216 ? -48.520 -29.339 -75.350 1.00 117.16 ? 228 LYS D N   1 
ATOM   7837 C CA  . LYS D 1 216 ? -48.429 -30.792 -75.576 1.00 119.49 ? 228 LYS D CA  1 
ATOM   7838 C C   . LYS D 1 216 ? -47.553 -31.483 -74.506 1.00 121.34 ? 228 LYS D C   1 
ATOM   7839 O O   . LYS D 1 216 ? -47.522 -32.713 -74.446 1.00 122.80 ? 228 LYS D O   1 
ATOM   7840 C CB  . LYS D 1 216 ? -47.878 -31.103 -76.983 1.00 121.00 ? 228 LYS D CB  1 
ATOM   7841 C CG  . LYS D 1 216 ? -48.890 -30.961 -78.109 1.00 136.41 ? 228 LYS D CG  1 
ATOM   7842 C CD  . LYS D 1 216 ? -48.199 -31.001 -79.465 1.00 142.52 ? 228 LYS D CD  1 
ATOM   7843 C CE  . LYS D 1 216 ? -49.152 -30.747 -80.603 1.00 152.20 ? 228 LYS D CE  1 
ATOM   7844 N NZ  . LYS D 1 216 ? -49.973 -31.947 -80.918 1.00 167.42 ? 228 LYS D NZ  1 
ATOM   7845 N N   . GLY D 1 217 ? -46.853 -30.689 -73.690 1.00 114.24 ? 229 GLY D N   1 
ATOM   7846 C CA  . GLY D 1 217 ? -45.979 -31.187 -72.632 1.00 113.05 ? 229 GLY D CA  1 
ATOM   7847 C C   . GLY D 1 217 ? -44.552 -31.450 -73.075 1.00 112.48 ? 229 GLY D C   1 
ATOM   7848 O O   . GLY D 1 217 ? -43.767 -32.040 -72.326 1.00 111.91 ? 229 GLY D O   1 
ATOM   7849 N N   . THR D 1 218 ? -44.210 -31.013 -74.304 1.00 105.79 ? 230 THR D N   1 
ATOM   7850 C CA  . THR D 1 218 ? -42.880 -31.167 -74.893 1.00 102.10 ? 230 THR D CA  1 
ATOM   7851 C C   . THR D 1 218 ? -41.924 -30.190 -74.197 1.00 103.47 ? 230 THR D C   1 
ATOM   7852 O O   . THR D 1 218 ? -42.202 -28.984 -74.137 1.00 101.36 ? 230 THR D O   1 
ATOM   7853 C CB  . THR D 1 218 ? -42.942 -30.954 -76.422 1.00 102.77 ? 230 THR D CB  1 
ATOM   7854 O OG1 . THR D 1 218 ? -44.100 -31.594 -76.969 1.00 103.95 ? 230 THR D OG1 1 
ATOM   7855 C CG2 . THR D 1 218 ? -41.697 -31.435 -77.133 1.00 96.46  ? 230 THR D CG2 1 
ATOM   7856 N N   . GLU D 1 219 ? -40.809 -30.725 -73.653 1.00 99.27  ? 231 GLU D N   1 
ATOM   7857 C CA  . GLU D 1 219 ? -39.768 -29.946 -72.968 1.00 94.86  ? 231 GLU D CA  1 
ATOM   7858 C C   . GLU D 1 219 ? -39.005 -29.116 -73.974 1.00 93.25  ? 231 GLU D C   1 
ATOM   7859 O O   . GLU D 1 219 ? -38.564 -29.633 -74.992 1.00 91.84  ? 231 GLU D O   1 
ATOM   7860 C CB  . GLU D 1 219 ? -38.821 -30.851 -72.169 1.00 97.05  ? 231 GLU D CB  1 
ATOM   7861 C CG  . GLU D 1 219 ? -39.499 -31.485 -70.965 1.00 114.68 ? 231 GLU D CG  1 
ATOM   7862 C CD  . GLU D 1 219 ? -38.737 -32.574 -70.234 1.00 140.30 ? 231 GLU D CD  1 
ATOM   7863 O OE1 . GLU D 1 219 ? -37.519 -32.732 -70.486 1.00 124.84 ? 231 GLU D OE1 1 
ATOM   7864 O OE2 . GLU D 1 219 ? -39.361 -33.263 -69.392 1.00 141.36 ? 231 GLU D OE2 1 
ATOM   7865 N N   . LEU D 1 220 ? -38.904 -27.808 -73.711 1.00 87.30  ? 232 LEU D N   1 
ATOM   7866 C CA  . LEU D 1 220 ? -38.327 -26.826 -74.626 1.00 83.37  ? 232 LEU D CA  1 
ATOM   7867 C C   . LEU D 1 220 ? -37.526 -25.795 -73.859 1.00 83.68  ? 232 LEU D C   1 
ATOM   7868 O O   . LEU D 1 220 ? -37.581 -25.766 -72.628 1.00 83.61  ? 232 LEU D O   1 
ATOM   7869 C CB  . LEU D 1 220 ? -39.440 -26.124 -75.442 1.00 84.10  ? 232 LEU D CB  1 
ATOM   7870 C CG  . LEU D 1 220 ? -40.256 -26.976 -76.429 1.00 91.78  ? 232 LEU D CG  1 
ATOM   7871 C CD1 . LEU D 1 220 ? -41.569 -26.311 -76.747 1.00 93.42  ? 232 LEU D CD1 1 
ATOM   7872 C CD2 . LEU D 1 220 ? -39.482 -27.249 -77.710 1.00 93.45  ? 232 LEU D CD2 1 
ATOM   7873 N N   . LEU D 1 221 ? -36.753 -24.967 -74.584 1.00 77.25  ? 233 LEU D N   1 
ATOM   7874 C CA  . LEU D 1 221 ? -36.087 -23.819 -73.992 1.00 73.96  ? 233 LEU D CA  1 
ATOM   7875 C C   . LEU D 1 221 ? -36.697 -22.527 -74.500 1.00 76.54  ? 233 LEU D C   1 
ATOM   7876 O O   . LEU D 1 221 ? -37.092 -22.439 -75.662 1.00 76.99  ? 233 LEU D O   1 
ATOM   7877 C CB  . LEU D 1 221 ? -34.573 -23.814 -74.268 1.00 71.57  ? 233 LEU D CB  1 
ATOM   7878 C CG  . LEU D 1 221 ? -33.721 -24.930 -73.659 1.00 76.71  ? 233 LEU D CG  1 
ATOM   7879 C CD1 . LEU D 1 221 ? -32.359 -24.974 -74.322 1.00 74.99  ? 233 LEU D CD1 1 
ATOM   7880 C CD2 . LEU D 1 221 ? -33.584 -24.783 -72.142 1.00 78.33  ? 233 LEU D CD2 1 
ATOM   7881 N N   . LEU D 1 222 ? -36.785 -21.532 -73.619 1.00 71.63  ? 234 LEU D N   1 
ATOM   7882 C CA  . LEU D 1 222 ? -37.133 -20.166 -73.976 1.00 70.23  ? 234 LEU D CA  1 
ATOM   7883 C C   . LEU D 1 222 ? -35.865 -19.319 -73.951 1.00 73.96  ? 234 LEU D C   1 
ATOM   7884 O O   . LEU D 1 222 ? -35.136 -19.322 -72.959 1.00 73.48  ? 234 LEU D O   1 
ATOM   7885 C CB  . LEU D 1 222 ? -38.205 -19.603 -73.023 1.00 71.24  ? 234 LEU D CB  1 
ATOM   7886 C CG  . LEU D 1 222 ? -38.525 -18.110 -73.138 1.00 73.96  ? 234 LEU D CG  1 
ATOM   7887 C CD1 . LEU D 1 222 ? -39.456 -17.832 -74.294 1.00 74.92  ? 234 LEU D CD1 1 
ATOM   7888 C CD2 . LEU D 1 222 ? -39.117 -17.590 -71.854 1.00 76.82  ? 234 LEU D CD2 1 
ATOM   7889 N N   . GLY D 1 223 ? -35.605 -18.634 -75.055 1.00 69.72  ? 235 GLY D N   1 
ATOM   7890 C CA  . GLY D 1 223 ? -34.571 -17.618 -75.129 1.00 67.09  ? 235 GLY D CA  1 
ATOM   7891 C C   . GLY D 1 223 ? -35.156 -16.223 -75.054 1.00 70.55  ? 235 GLY D C   1 
ATOM   7892 O O   . GLY D 1 223 ? -35.998 -15.863 -75.879 1.00 71.36  ? 235 GLY D O   1 
ATOM   7893 N N   . VAL D 1 224 ? -34.742 -15.443 -74.038 1.00 65.56  ? 236 VAL D N   1 
ATOM   7894 C CA  . VAL D 1 224 ? -35.082 -14.019 -73.919 1.00 64.78  ? 236 VAL D CA  1 
ATOM   7895 C C   . VAL D 1 224 ? -33.811 -13.210 -74.227 1.00 67.87  ? 236 VAL D C   1 
ATOM   7896 O O   . VAL D 1 224 ? -32.815 -13.346 -73.513 1.00 66.52  ? 236 VAL D O   1 
ATOM   7897 C CB  . VAL D 1 224 ? -35.702 -13.631 -72.542 1.00 68.74  ? 236 VAL D CB  1 
ATOM   7898 C CG1 . VAL D 1 224 ? -36.236 -12.201 -72.563 1.00 68.16  ? 236 VAL D CG1 1 
ATOM   7899 C CG2 . VAL D 1 224 ? -36.799 -14.603 -72.115 1.00 71.05  ? 236 VAL D CG2 1 
ATOM   7900 N N   . ASP D 1 225 ? -33.834 -12.403 -75.306 1.00 64.41  ? 237 ASP D N   1 
ATOM   7901 C CA  . ASP D 1 225 ? -32.695 -11.577 -75.695 1.00 62.36  ? 237 ASP D CA  1 
ATOM   7902 C C   . ASP D 1 225 ? -33.160 -10.209 -76.252 1.00 67.64  ? 237 ASP D C   1 
ATOM   7903 O O   . ASP D 1 225 ? -34.339 -9.864  -76.141 1.00 68.49  ? 237 ASP D O   1 
ATOM   7904 C CB  . ASP D 1 225 ? -31.780 -12.328 -76.693 1.00 63.49  ? 237 ASP D CB  1 
ATOM   7905 C CG  . ASP D 1 225 ? -32.326 -12.612 -78.083 1.00 75.15  ? 237 ASP D CG  1 
ATOM   7906 O OD1 . ASP D 1 225 ? -33.434 -12.130 -78.403 1.00 78.19  ? 237 ASP D OD1 1 
ATOM   7907 O OD2 . ASP D 1 225 ? -31.636 -13.301 -78.858 1.00 80.33  ? 237 ASP D OD2 1 
ATOM   7908 N N   . ALA D 1 226 ? -32.222 -9.440  -76.840 1.00 64.36  ? 238 ALA D N   1 
ATOM   7909 C CA  . ALA D 1 226 ? -32.449 -8.099  -77.379 1.00 65.02  ? 238 ALA D CA  1 
ATOM   7910 C C   . ALA D 1 226 ? -33.404 -8.101  -78.580 1.00 72.39  ? 238 ALA D C   1 
ATOM   7911 O O   . ALA D 1 226 ? -34.090 -7.101  -78.807 1.00 73.60  ? 238 ALA D O   1 
ATOM   7912 C CB  . ALA D 1 226 ? -31.123 -7.477  -77.783 1.00 64.14  ? 238 ALA D CB  1 
ATOM   7913 N N   . LEU D 1 227 ? -33.461 -9.219  -79.329 1.00 70.34  ? 239 LEU D N   1 
ATOM   7914 C CA  . LEU D 1 227 ? -34.183 -9.304  -80.605 1.00 72.43  ? 239 LEU D CA  1 
ATOM   7915 C C   . LEU D 1 227 ? -35.630 -9.736  -80.427 1.00 77.64  ? 239 LEU D C   1 
ATOM   7916 O O   . LEU D 1 227 ? -36.488 -9.275  -81.181 1.00 79.29  ? 239 LEU D O   1 
ATOM   7917 C CB  . LEU D 1 227 ? -33.472 -10.253 -81.581 1.00 72.83  ? 239 LEU D CB  1 
ATOM   7918 C CG  . LEU D 1 227 ? -32.037 -9.876  -81.986 1.00 76.64  ? 239 LEU D CG  1 
ATOM   7919 C CD1 . LEU D 1 227 ? -31.400 -10.989 -82.795 1.00 77.56  ? 239 LEU D CD1 1 
ATOM   7920 C CD2 . LEU D 1 227 ? -31.986 -8.554  -82.760 1.00 80.02  ? 239 LEU D CD2 1 
ATOM   7921 N N   . GLY D 1 228 ? -35.877 -10.631 -79.468 1.00 73.53  ? 240 GLY D N   1 
ATOM   7922 C CA  . GLY D 1 228 ? -37.218 -11.070 -79.098 1.00 75.31  ? 240 GLY D CA  1 
ATOM   7923 C C   . GLY D 1 228 ? -37.262 -12.268 -78.169 1.00 78.18  ? 240 GLY D C   1 
ATOM   7924 O O   . GLY D 1 228 ? -36.390 -12.431 -77.310 1.00 75.74  ? 240 GLY D O   1 
ATOM   7925 N N   . LEU D 1 229 ? -38.318 -13.086 -78.316 1.00 76.24  ? 241 LEU D N   1 
ATOM   7926 C CA  . LEU D 1 229 ? -38.478 -14.383 -77.663 1.00 76.40  ? 241 LEU D CA  1 
ATOM   7927 C C   . LEU D 1 229 ? -38.224 -15.501 -78.662 1.00 80.50  ? 241 LEU D C   1 
ATOM   7928 O O   . LEU D 1 229 ? -38.624 -15.399 -79.821 1.00 81.76  ? 241 LEU D O   1 
ATOM   7929 C CB  . LEU D 1 229 ? -39.879 -14.532 -77.041 1.00 78.86  ? 241 LEU D CB  1 
ATOM   7930 C CG  . LEU D 1 229 ? -40.258 -13.540 -75.935 1.00 82.72  ? 241 LEU D CG  1 
ATOM   7931 C CD1 . LEU D 1 229 ? -41.686 -13.728 -75.515 1.00 85.84  ? 241 LEU D CD1 1 
ATOM   7932 C CD2 . LEU D 1 229 ? -39.346 -13.662 -74.725 1.00 82.63  ? 241 LEU D CD2 1 
ATOM   7933 N N   . HIS D 1 230 ? -37.552 -16.567 -78.214 1.00 75.31  ? 242 HIS D N   1 
ATOM   7934 C CA  . HIS D 1 230 ? -37.145 -17.676 -79.070 1.00 75.01  ? 242 HIS D CA  1 
ATOM   7935 C C   . HIS D 1 230 ? -37.448 -18.996 -78.388 1.00 78.48  ? 242 HIS D C   1 
ATOM   7936 O O   . HIS D 1 230 ? -37.267 -19.114 -77.176 1.00 77.16  ? 242 HIS D O   1 
ATOM   7937 C CB  . HIS D 1 230 ? -35.653 -17.569 -79.420 1.00 73.46  ? 242 HIS D CB  1 
ATOM   7938 C CG  . HIS D 1 230 ? -35.244 -16.194 -79.852 1.00 75.63  ? 242 HIS D CG  1 
ATOM   7939 N ND1 . HIS D 1 230 ? -35.525 -15.725 -81.123 1.00 78.62  ? 242 HIS D ND1 1 
ATOM   7940 C CD2 . HIS D 1 230 ? -34.649 -15.202 -79.143 1.00 75.10  ? 242 HIS D CD2 1 
ATOM   7941 C CE1 . HIS D 1 230 ? -35.070 -14.482 -81.158 1.00 76.37  ? 242 HIS D CE1 1 
ATOM   7942 N NE2 . HIS D 1 230 ? -34.531 -14.124 -79.991 1.00 74.52  ? 242 HIS D NE2 1 
ATOM   7943 N N   . ILE D 1 231 ? -37.941 -19.977 -79.162 1.00 76.12  ? 243 ILE D N   1 
ATOM   7944 C CA  . ILE D 1 231 ? -38.246 -21.316 -78.661 1.00 77.02  ? 243 ILE D CA  1 
ATOM   7945 C C   . ILE D 1 231 ? -37.234 -22.280 -79.260 1.00 78.48  ? 243 ILE D C   1 
ATOM   7946 O O   . ILE D 1 231 ? -37.077 -22.340 -80.478 1.00 77.92  ? 243 ILE D O   1 
ATOM   7947 C CB  . ILE D 1 231 ? -39.733 -21.732 -78.925 1.00 83.61  ? 243 ILE D CB  1 
ATOM   7948 C CG1 . ILE D 1 231 ? -40.757 -20.673 -78.410 1.00 84.36  ? 243 ILE D CG1 1 
ATOM   7949 C CG2 . ILE D 1 231 ? -40.050 -23.135 -78.381 1.00 87.02  ? 243 ILE D CG2 1 
ATOM   7950 C CD1 . ILE D 1 231 ? -40.645 -20.223 -76.909 1.00 89.74  ? 243 ILE D CD1 1 
ATOM   7951 N N   . TYR D 1 232 ? -36.528 -23.007 -78.392 1.00 74.29  ? 244 TYR D N   1 
ATOM   7952 C CA  . TYR D 1 232 ? -35.486 -23.945 -78.794 1.00 74.06  ? 244 TYR D CA  1 
ATOM   7953 C C   . TYR D 1 232 ? -35.861 -25.371 -78.453 1.00 81.70  ? 244 TYR D C   1 
ATOM   7954 O O   . TYR D 1 232 ? -36.531 -25.615 -77.450 1.00 82.54  ? 244 TYR D O   1 
ATOM   7955 C CB  . TYR D 1 232 ? -34.153 -23.622 -78.094 1.00 72.37  ? 244 TYR D CB  1 
ATOM   7956 C CG  . TYR D 1 232 ? -33.591 -22.249 -78.364 1.00 70.89  ? 244 TYR D CG  1 
ATOM   7957 C CD1 . TYR D 1 232 ? -33.939 -21.163 -77.567 1.00 71.82  ? 244 TYR D CD1 1 
ATOM   7958 C CD2 . TYR D 1 232 ? -32.630 -22.052 -79.352 1.00 69.96  ? 244 TYR D CD2 1 
ATOM   7959 C CE1 . TYR D 1 232 ? -33.393 -19.900 -77.785 1.00 70.17  ? 244 TYR D CE1 1 
ATOM   7960 C CE2 . TYR D 1 232 ? -32.085 -20.793 -79.587 1.00 68.39  ? 244 TYR D CE2 1 
ATOM   7961 C CZ  . TYR D 1 232 ? -32.462 -19.720 -78.794 1.00 72.75  ? 244 TYR D CZ  1 
ATOM   7962 O OH  . TYR D 1 232 ? -31.920 -18.476 -79.007 1.00 66.79  ? 244 TYR D OH  1 
ATOM   7963 N N   . ASP D 1 233 ? -35.435 -26.315 -79.301 1.00 80.29  ? 245 ASP D N   1 
ATOM   7964 C CA  . ASP D 1 233 ? -35.266 -27.712 -78.914 1.00 82.29  ? 245 ASP D CA  1 
ATOM   7965 C C   . ASP D 1 233 ? -34.218 -27.738 -77.781 1.00 84.81  ? 245 ASP D C   1 
ATOM   7966 O O   . ASP D 1 233 ? -33.200 -27.043 -77.914 1.00 82.13  ? 245 ASP D O   1 
ATOM   7967 C CB  . ASP D 1 233 ? -34.812 -28.512 -80.155 1.00 85.35  ? 245 ASP D CB  1 
ATOM   7968 C CG  . ASP D 1 233 ? -34.965 -30.013 -80.096 1.00 99.75  ? 245 ASP D CG  1 
ATOM   7969 O OD1 . ASP D 1 233 ? -34.648 -30.596 -79.043 1.00 100.46 ? 245 ASP D OD1 1 
ATOM   7970 O OD2 . ASP D 1 233 ? -35.276 -30.621 -81.149 1.00 109.31 ? 245 ASP D OD2 1 
ATOM   7971 N N   . PRO D 1 234 ? -34.432 -28.477 -76.660 1.00 82.85  ? 246 PRO D N   1 
ATOM   7972 C CA  . PRO D 1 234 ? -33.452 -28.451 -75.558 1.00 81.41  ? 246 PRO D CA  1 
ATOM   7973 C C   . PRO D 1 234 ? -32.040 -28.879 -75.954 1.00 85.19  ? 246 PRO D C   1 
ATOM   7974 O O   . PRO D 1 234 ? -31.089 -28.506 -75.250 1.00 82.13  ? 246 PRO D O   1 
ATOM   7975 C CB  . PRO D 1 234 ? -34.028 -29.447 -74.546 1.00 86.05  ? 246 PRO D CB  1 
ATOM   7976 C CG  . PRO D 1 234 ? -35.421 -29.488 -74.827 1.00 92.54  ? 246 PRO D CG  1 
ATOM   7977 C CD  . PRO D 1 234 ? -35.570 -29.341 -76.309 1.00 87.87  ? 246 PRO D CD  1 
ATOM   7978 N N   . GLU D 1 235 ? -31.907 -29.644 -77.085 1.00 83.78  ? 247 GLU D N   1 
ATOM   7979 C CA  . GLU D 1 235 ? -30.643 -30.180 -77.600 1.00 83.21  ? 247 GLU D CA  1 
ATOM   7980 C C   . GLU D 1 235 ? -29.976 -29.237 -78.654 1.00 84.65  ? 247 GLU D C   1 
ATOM   7981 O O   . GLU D 1 235 ? -28.966 -29.624 -79.249 1.00 84.29  ? 247 GLU D O   1 
ATOM   7982 C CB  . GLU D 1 235 ? -30.854 -31.611 -78.175 1.00 87.61  ? 247 GLU D CB  1 
ATOM   7983 C CG  . GLU D 1 235 ? -31.690 -31.650 -79.450 1.00 97.25  ? 247 GLU D CG  1 
ATOM   7984 C CD  . GLU D 1 235 ? -32.246 -32.996 -79.875 1.00 116.29 ? 247 GLU D CD  1 
ATOM   7985 O OE1 . GLU D 1 235 ? -31.457 -33.966 -79.903 1.00 135.25 ? 247 GLU D OE1 1 
ATOM   7986 O OE2 . GLU D 1 235 ? -33.466 -33.090 -80.154 1.00 84.58  ? 247 GLU D OE2 1 
ATOM   7987 N N   . ASN D 1 236 ? -30.506 -28.008 -78.858 1.00 79.63  ? 248 ASN D N   1 
ATOM   7988 C CA  . ASN D 1 236 ? -29.915 -27.037 -79.781 1.00 77.48  ? 248 ASN D CA  1 
ATOM   7989 C C   . ASN D 1 236 ? -30.201 -25.620 -79.293 1.00 78.35  ? 248 ASN D C   1 
ATOM   7990 O O   . ASN D 1 236 ? -31.277 -25.077 -79.546 1.00 78.56  ? 248 ASN D O   1 
ATOM   7991 C CB  . ASN D 1 236 ? -30.412 -27.259 -81.221 1.00 79.09  ? 248 ASN D CB  1 
ATOM   7992 C CG  . ASN D 1 236 ? -29.699 -26.445 -82.286 1.00 105.59 ? 248 ASN D CG  1 
ATOM   7993 O OD1 . ASN D 1 236 ? -28.666 -25.799 -82.063 1.00 97.08  ? 248 ASN D OD1 1 
ATOM   7994 N ND2 . ASN D 1 236 ? -30.238 -26.473 -83.488 1.00 101.18 ? 248 ASN D ND2 1 
ATOM   7995 N N   . ARG D 1 237 ? -29.227 -25.038 -78.573 1.00 72.08  ? 249 ARG D N   1 
ATOM   7996 C CA  . ARG D 1 237 ? -29.299 -23.675 -78.038 1.00 69.22  ? 249 ARG D CA  1 
ATOM   7997 C C   . ARG D 1 237 ? -28.826 -22.645 -79.077 1.00 71.89  ? 249 ARG D C   1 
ATOM   7998 O O   . ARG D 1 237 ? -28.837 -21.444 -78.801 1.00 69.99  ? 249 ARG D O   1 
ATOM   7999 C CB  . ARG D 1 237 ? -28.466 -23.553 -76.747 1.00 67.64  ? 249 ARG D CB  1 
ATOM   8000 C CG  . ARG D 1 237 ? -28.920 -24.493 -75.638 1.00 77.64  ? 249 ARG D CG  1 
ATOM   8001 C CD  . ARG D 1 237 ? -28.481 -24.052 -74.259 1.00 85.99  ? 249 ARG D CD  1 
ATOM   8002 N NE  . ARG D 1 237 ? -29.084 -24.909 -73.232 1.00 93.53  ? 249 ARG D NE  1 
ATOM   8003 C CZ  . ARG D 1 237 ? -29.351 -24.528 -71.986 1.00 103.88 ? 249 ARG D CZ  1 
ATOM   8004 N NH1 . ARG D 1 237 ? -29.068 -23.295 -71.585 1.00 93.42  ? 249 ARG D NH1 1 
ATOM   8005 N NH2 . ARG D 1 237 ? -29.906 -25.376 -71.133 1.00 88.14  ? 249 ARG D NH2 1 
ATOM   8006 N N   . LEU D 1 238 ? -28.429 -23.108 -80.275 1.00 70.01  ? 250 LEU D N   1 
ATOM   8007 C CA  . LEU D 1 238 ? -27.861 -22.244 -81.314 1.00 68.81  ? 250 LEU D CA  1 
ATOM   8008 C C   . LEU D 1 238 ? -28.930 -21.736 -82.282 1.00 76.21  ? 250 LEU D C   1 
ATOM   8009 O O   . LEU D 1 238 ? -28.952 -20.536 -82.569 1.00 75.46  ? 250 LEU D O   1 
ATOM   8010 C CB  . LEU D 1 238 ? -26.743 -22.968 -82.095 1.00 69.01  ? 250 LEU D CB  1 
ATOM   8011 C CG  . LEU D 1 238 ? -25.537 -23.450 -81.286 1.00 71.70  ? 250 LEU D CG  1 
ATOM   8012 C CD1 . LEU D 1 238 ? -24.589 -24.185 -82.148 1.00 72.72  ? 250 LEU D CD1 1 
ATOM   8013 C CD2 . LEU D 1 238 ? -24.802 -22.296 -80.626 1.00 70.78  ? 250 LEU D CD2 1 
ATOM   8014 N N   . THR D 1 239 ? -29.812 -22.636 -82.775 1.00 75.78  ? 251 THR D N   1 
ATOM   8015 C CA  . THR D 1 239 ? -30.815 -22.304 -83.785 1.00 77.06  ? 251 THR D CA  1 
ATOM   8016 C C   . THR D 1 239 ? -32.226 -22.489 -83.200 1.00 81.85  ? 251 THR D C   1 
ATOM   8017 O O   . THR D 1 239 ? -32.633 -23.626 -82.928 1.00 81.59  ? 251 THR D O   1 
ATOM   8018 C CB  . THR D 1 239 ? -30.585 -23.126 -85.072 1.00 84.51  ? 251 THR D CB  1 
ATOM   8019 O OG1 . THR D 1 239 ? -29.244 -22.913 -85.522 1.00 84.77  ? 251 THR D OG1 1 
ATOM   8020 C CG2 . THR D 1 239 ? -31.554 -22.756 -86.188 1.00 83.00  ? 251 THR D CG2 1 
ATOM   8021 N N   . PRO D 1 240 ? -32.975 -21.374 -82.983 1.00 78.49  ? 252 PRO D N   1 
ATOM   8022 C CA  . PRO D 1 240 ? -34.362 -21.512 -82.504 1.00 79.69  ? 252 PRO D CA  1 
ATOM   8023 C C   . PRO D 1 240 ? -35.271 -22.177 -83.528 1.00 85.93  ? 252 PRO D C   1 
ATOM   8024 O O   . PRO D 1 240 ? -35.052 -22.058 -84.733 1.00 85.98  ? 252 PRO D O   1 
ATOM   8025 C CB  . PRO D 1 240 ? -34.799 -20.070 -82.219 1.00 79.93  ? 252 PRO D CB  1 
ATOM   8026 C CG  . PRO D 1 240 ? -33.893 -19.224 -83.014 1.00 82.85  ? 252 PRO D CG  1 
ATOM   8027 C CD  . PRO D 1 240 ? -32.591 -19.954 -83.130 1.00 77.56  ? 252 PRO D CD  1 
ATOM   8028 N N   . LYS D 1 241 ? -36.264 -22.914 -83.023 1.00 84.82  ? 253 LYS D N   1 
ATOM   8029 C CA  . LYS D 1 241 ? -37.363 -23.493 -83.793 1.00 88.20  ? 253 LYS D CA  1 
ATOM   8030 C C   . LYS D 1 241 ? -38.345 -22.395 -84.222 1.00 93.64  ? 253 LYS D C   1 
ATOM   8031 O O   . LYS D 1 241 ? -38.790 -22.374 -85.368 1.00 95.48  ? 253 LYS D O   1 
ATOM   8032 C CB  . LYS D 1 241 ? -38.088 -24.548 -82.945 1.00 92.45  ? 253 LYS D CB  1 
ATOM   8033 C CG  . LYS D 1 241 ? -37.637 -25.976 -83.166 1.00 106.74 ? 253 LYS D CG  1 
ATOM   8034 C CD  . LYS D 1 241 ? -38.440 -26.862 -82.233 1.00 118.06 ? 253 LYS D CD  1 
ATOM   8035 C CE  . LYS D 1 241 ? -38.452 -28.313 -82.615 1.00 124.95 ? 253 LYS D CE  1 
ATOM   8036 N NZ  . LYS D 1 241 ? -39.551 -29.024 -81.914 1.00 132.69 ? 253 LYS D NZ  1 
ATOM   8037 N N   . ILE D 1 242 ? -38.700 -21.502 -83.279 1.00 89.78  ? 254 ILE D N   1 
ATOM   8038 C CA  . ILE D 1 242 ? -39.605 -20.365 -83.481 1.00 90.34  ? 254 ILE D CA  1 
ATOM   8039 C C   . ILE D 1 242 ? -38.955 -19.111 -82.900 1.00 89.76  ? 254 ILE D C   1 
ATOM   8040 O O   . ILE D 1 242 ? -38.307 -19.182 -81.856 1.00 86.36  ? 254 ILE D O   1 
ATOM   8041 C CB  . ILE D 1 242 ? -41.025 -20.594 -82.859 1.00 96.10  ? 254 ILE D CB  1 
ATOM   8042 C CG1 . ILE D 1 242 ? -41.538 -22.039 -83.029 1.00 99.48  ? 254 ILE D CG1 1 
ATOM   8043 C CG2 . ILE D 1 242 ? -42.036 -19.587 -83.420 1.00 98.74  ? 254 ILE D CG2 1 
ATOM   8044 C CD1 . ILE D 1 242 ? -42.539 -22.501 -81.952 1.00 111.15 ? 254 ILE D CD1 1 
ATOM   8045 N N   . SER D 1 243 ? -39.125 -17.971 -83.580 1.00 86.80  ? 255 SER D N   1 
ATOM   8046 C CA  . SER D 1 243 ? -38.737 -16.659 -83.062 1.00 84.17  ? 255 SER D CA  1 
ATOM   8047 C C   . SER D 1 243 ? -39.917 -15.704 -83.105 1.00 90.74  ? 255 SER D C   1 
ATOM   8048 O O   . SER D 1 243 ? -40.677 -15.695 -84.079 1.00 93.15  ? 255 SER D O   1 
ATOM   8049 C CB  . SER D 1 243 ? -37.562 -16.087 -83.849 1.00 84.94  ? 255 SER D CB  1 
ATOM   8050 O OG  . SER D 1 243 ? -36.378 -16.823 -83.592 1.00 89.13  ? 255 SER D OG  1 
ATOM   8051 N N   . PHE D 1 244 ? -40.092 -14.935 -82.022 1.00 86.72  ? 256 PHE D N   1 
ATOM   8052 C CA  . PHE D 1 244 ? -41.071 -13.858 -81.921 1.00 88.05  ? 256 PHE D CA  1 
ATOM   8053 C C   . PHE D 1 244 ? -40.313 -12.550 -81.693 1.00 91.42  ? 256 PHE D C   1 
ATOM   8054 O O   . PHE D 1 244 ? -39.926 -12.270 -80.554 1.00 89.56  ? 256 PHE D O   1 
ATOM   8055 C CB  . PHE D 1 244 ? -42.094 -14.133 -80.799 1.00 90.94  ? 256 PHE D CB  1 
ATOM   8056 C CG  . PHE D 1 244 ? -42.818 -15.454 -80.888 1.00 94.79  ? 256 PHE D CG  1 
ATOM   8057 C CD1 . PHE D 1 244 ? -43.979 -15.581 -81.644 1.00 101.14 ? 256 PHE D CD1 1 
ATOM   8058 C CD2 . PHE D 1 244 ? -42.358 -16.565 -80.192 1.00 95.98  ? 256 PHE D CD2 1 
ATOM   8059 C CE1 . PHE D 1 244 ? -44.655 -16.804 -81.719 1.00 104.45 ? 256 PHE D CE1 1 
ATOM   8060 C CE2 . PHE D 1 244 ? -43.032 -17.788 -80.270 1.00 101.35 ? 256 PHE D CE2 1 
ATOM   8061 C CZ  . PHE D 1 244 ? -44.179 -17.896 -81.029 1.00 102.61 ? 256 PHE D CZ  1 
ATOM   8062 N N   . PRO D 1 245 ? -40.012 -11.769 -82.760 1.00 89.44  ? 257 PRO D N   1 
ATOM   8063 C CA  . PRO D 1 245 ? -39.353 -10.459 -82.551 1.00 88.03  ? 257 PRO D CA  1 
ATOM   8064 C C   . PRO D 1 245 ? -40.233 -9.502  -81.739 1.00 94.12  ? 257 PRO D C   1 
ATOM   8065 O O   . PRO D 1 245 ? -41.462 -9.579  -81.864 1.00 96.77  ? 257 PRO D O   1 
ATOM   8066 C CB  . PRO D 1 245 ? -39.119 -9.950  -83.978 1.00 90.94  ? 257 PRO D CB  1 
ATOM   8067 C CG  . PRO D 1 245 ? -39.180 -11.180 -84.844 1.00 96.34  ? 257 PRO D CG  1 
ATOM   8068 C CD  . PRO D 1 245 ? -40.207 -12.044 -84.197 1.00 93.03  ? 257 PRO D CD  1 
ATOM   8069 N N   . TRP D 1 246 ? -39.623 -8.612  -80.908 1.00 88.71  ? 258 TRP D N   1 
ATOM   8070 C CA  . TRP D 1 246 ? -40.373 -7.746  -79.977 1.00 89.49  ? 258 TRP D CA  1 
ATOM   8071 C C   . TRP D 1 246 ? -41.430 -6.869  -80.690 1.00 98.45  ? 258 TRP D C   1 
ATOM   8072 O O   . TRP D 1 246 ? -42.500 -6.634  -80.122 1.00 100.03 ? 258 TRP D O   1 
ATOM   8073 C CB  . TRP D 1 246 ? -39.444 -6.852  -79.134 1.00 85.05  ? 258 TRP D CB  1 
ATOM   8074 C CG  . TRP D 1 246 ? -38.602 -7.581  -78.125 1.00 83.16  ? 258 TRP D CG  1 
ATOM   8075 C CD1 . TRP D 1 246 ? -37.241 -7.587  -78.052 1.00 83.37  ? 258 TRP D CD1 1 
ATOM   8076 C CD2 . TRP D 1 246 ? -39.067 -8.365  -77.013 1.00 83.21  ? 258 TRP D CD2 1 
ATOM   8077 N NE1 . TRP D 1 246 ? -36.826 -8.341  -76.976 1.00 81.32  ? 258 TRP D NE1 1 
ATOM   8078 C CE2 . TRP D 1 246 ? -37.927 -8.832  -76.321 1.00 84.44  ? 258 TRP D CE2 1 
ATOM   8079 C CE3 . TRP D 1 246 ? -40.339 -8.721  -76.534 1.00 86.87  ? 258 TRP D CE3 1 
ATOM   8080 C CZ2 . TRP D 1 246 ? -38.021 -9.652  -75.186 1.00 83.64  ? 258 TRP D CZ2 1 
ATOM   8081 C CZ3 . TRP D 1 246 ? -40.428 -9.525  -75.405 1.00 88.10  ? 258 TRP D CZ3 1 
ATOM   8082 C CH2 . TRP D 1 246 ? -39.281 -9.987  -74.749 1.00 86.17  ? 258 TRP D CH2 1 
ATOM   8083 N N   . ASN D 1 247 ? -41.135 -6.420  -81.934 1.00 96.98  ? 259 ASN D N   1 
ATOM   8084 C CA  . ASN D 1 247 ? -42.027 -5.611  -82.776 1.00 100.50 ? 259 ASN D CA  1 
ATOM   8085 C C   . ASN D 1 247 ? -43.202 -6.433  -83.317 1.00 108.34 ? 259 ASN D C   1 
ATOM   8086 O O   . ASN D 1 247 ? -44.214 -5.849  -83.714 1.00 111.24 ? 259 ASN D O   1 
ATOM   8087 C CB  . ASN D 1 247 ? -41.253 -4.963  -83.942 1.00 102.31 ? 259 ASN D CB  1 
ATOM   8088 C CG  . ASN D 1 247 ? -40.548 -5.922  -84.883 1.00 128.34 ? 259 ASN D CG  1 
ATOM   8089 O OD1 . ASN D 1 247 ? -39.825 -6.833  -84.474 1.00 120.77 ? 259 ASN D OD1 1 
ATOM   8090 N ND2 . ASN D 1 247 ? -40.691 -5.693  -86.178 1.00 123.82 ? 259 ASN D ND2 1 
ATOM   8091 N N   . GLU D 1 248 ? -43.071 -7.777  -83.323 1.00 105.02 ? 260 GLU D N   1 
ATOM   8092 C CA  . GLU D 1 248 ? -44.076 -8.716  -83.827 1.00 108.17 ? 260 GLU D CA  1 
ATOM   8093 C C   . GLU D 1 248 ? -44.888 -9.372  -82.687 1.00 112.63 ? 260 GLU D C   1 
ATOM   8094 O O   . GLU D 1 248 ? -45.659 -10.295 -82.950 1.00 115.51 ? 260 GLU D O   1 
ATOM   8095 C CB  . GLU D 1 248 ? -43.399 -9.790  -84.695 1.00 109.25 ? 260 GLU D CB  1 
ATOM   8096 C CG  . GLU D 1 248 ? -43.150 -9.344  -86.127 1.00 123.65 ? 260 GLU D CG  1 
ATOM   8097 C CD  . GLU D 1 248 ? -42.153 -10.173 -86.913 1.00 146.60 ? 260 GLU D CD  1 
ATOM   8098 O OE1 . GLU D 1 248 ? -42.344 -11.407 -87.016 1.00 130.77 ? 260 GLU D OE1 1 
ATOM   8099 O OE2 . GLU D 1 248 ? -41.197 -9.578  -87.462 1.00 146.17 ? 260 GLU D OE2 1 
ATOM   8100 N N   . ILE D 1 249 ? -44.730 -8.895  -81.437 1.00 106.62 ? 261 ILE D N   1 
ATOM   8101 C CA  . ILE D 1 249 ? -45.492 -9.386  -80.284 1.00 107.34 ? 261 ILE D CA  1 
ATOM   8102 C C   . ILE D 1 249 ? -46.557 -8.333  -79.916 1.00 113.80 ? 261 ILE D C   1 
ATOM   8103 O O   . ILE D 1 249 ? -46.214 -7.197  -79.589 1.00 112.04 ? 261 ILE D O   1 
ATOM   8104 C CB  . ILE D 1 249 ? -44.559 -9.750  -79.080 1.00 107.00 ? 261 ILE D CB  1 
ATOM   8105 C CG1 . ILE D 1 249 ? -43.636 -10.950 -79.418 1.00 105.32 ? 261 ILE D CG1 1 
ATOM   8106 C CG2 . ILE D 1 249 ? -45.367 -10.017 -77.793 1.00 109.42 ? 261 ILE D CG2 1 
ATOM   8107 C CD1 . ILE D 1 249 ? -42.388 -11.100 -78.529 1.00 107.33 ? 261 ILE D CD1 1 
ATOM   8108 N N   . ARG D 1 250 ? -47.844 -8.713  -79.988 1.00 114.38 ? 262 ARG D N   1 
ATOM   8109 C CA  . ARG D 1 250 ? -48.961 -7.851  -79.587 1.00 117.09 ? 262 ARG D CA  1 
ATOM   8110 C C   . ARG D 1 250 ? -48.931 -7.655  -78.065 1.00 118.29 ? 262 ARG D C   1 
ATOM   8111 O O   . ARG D 1 250 ? -48.993 -6.516  -77.604 1.00 117.85 ? 262 ARG D O   1 
ATOM   8112 C CB  . ARG D 1 250 ? -50.311 -8.432  -80.062 1.00 122.84 ? 262 ARG D CB  1 
ATOM   8113 C CG  . ARG D 1 250 ? -51.499 -7.484  -79.905 1.00 139.92 ? 262 ARG D CG  1 
ATOM   8114 C CD  . ARG D 1 250 ? -52.777 -8.082  -80.464 1.00 159.37 ? 262 ARG D CD  1 
ATOM   8115 N NE  . ARG D 1 250 ? -53.835 -8.177  -79.453 1.00 173.82 ? 262 ARG D NE  1 
ATOM   8116 C CZ  . ARG D 1 250 ? -54.766 -7.249  -79.238 1.00 187.47 ? 262 ARG D CZ  1 
ATOM   8117 N NH1 . ARG D 1 250 ? -54.780 -6.132  -79.957 1.00 175.67 ? 262 ARG D NH1 1 
ATOM   8118 N NH2 . ARG D 1 250 ? -55.686 -7.429  -78.300 1.00 173.90 ? 262 ARG D NH2 1 
ATOM   8119 N N   . ASN D 1 251 ? -48.830 -8.763  -77.300 1.00 112.87 ? 263 ASN D N   1 
ATOM   8120 C CA  . ASN D 1 251 ? -48.679 -8.760  -75.845 1.00 110.93 ? 263 ASN D CA  1 
ATOM   8121 C C   . ASN D 1 251 ? -48.131 -10.084 -75.331 1.00 111.73 ? 263 ASN D C   1 
ATOM   8122 O O   . ASN D 1 251 ? -48.176 -11.102 -76.027 1.00 111.81 ? 263 ASN D O   1 
ATOM   8123 C CB  . ASN D 1 251 ? -50.002 -8.422  -75.127 1.00 116.06 ? 263 ASN D CB  1 
ATOM   8124 C CG  . ASN D 1 251 ? -51.140 -9.383  -75.369 1.00 142.96 ? 263 ASN D CG  1 
ATOM   8125 O OD1 . ASN D 1 251 ? -51.153 -10.520 -74.879 1.00 136.98 ? 263 ASN D OD1 1 
ATOM   8126 N ND2 . ASN D 1 251 ? -52.159 -8.914  -76.072 1.00 138.50 ? 263 ASN D ND2 1 
ATOM   8127 N N   . ILE D 1 252 ? -47.589 -10.043 -74.110 1.00 105.72 ? 264 ILE D N   1 
ATOM   8128 C CA  . ILE D 1 252 ? -47.286 -11.215 -73.298 1.00 104.88 ? 264 ILE D CA  1 
ATOM   8129 C C   . ILE D 1 252 ? -48.184 -11.143 -72.061 1.00 112.10 ? 264 ILE D C   1 
ATOM   8130 O O   . ILE D 1 252 ? -48.404 -10.054 -71.527 1.00 112.51 ? 264 ILE D O   1 
ATOM   8131 C CB  . ILE D 1 252 ? -45.764 -11.302 -72.966 1.00 103.42 ? 264 ILE D CB  1 
ATOM   8132 C CG1 . ILE D 1 252 ? -44.959 -11.633 -74.237 1.00 101.64 ? 264 ILE D CG1 1 
ATOM   8133 C CG2 . ILE D 1 252 ? -45.456 -12.328 -71.859 1.00 103.86 ? 264 ILE D CG2 1 
ATOM   8134 C CD1 . ILE D 1 252 ? -43.739 -10.849 -74.388 1.00 105.43 ? 264 ILE D CD1 1 
ATOM   8135 N N   . SER D 1 253 ? -48.745 -12.292 -71.649 1.00 110.54 ? 265 SER D N   1 
ATOM   8136 C CA  . SER D 1 253 ? -49.513 -12.419 -70.412 1.00 112.74 ? 265 SER D CA  1 
ATOM   8137 C C   . SER D 1 253 ? -49.018 -13.613 -69.592 1.00 115.30 ? 265 SER D C   1 
ATOM   8138 O O   . SER D 1 253 ? -48.482 -14.571 -70.151 1.00 113.05 ? 265 SER D O   1 
ATOM   8139 C CB  . SER D 1 253 ? -51.008 -12.541 -70.707 1.00 120.84 ? 265 SER D CB  1 
ATOM   8140 O OG  . SER D 1 253 ? -51.293 -13.419 -71.784 1.00 128.30 ? 265 SER D OG  1 
ATOM   8141 N N   . TYR D 1 254 ? -49.174 -13.533 -68.263 1.00 113.39 ? 266 TYR D N   1 
ATOM   8142 C CA  . TYR D 1 254 ? -48.830 -14.614 -67.348 1.00 114.07 ? 266 TYR D CA  1 
ATOM   8143 C C   . TYR D 1 254 ? -49.983 -14.870 -66.359 1.00 124.74 ? 266 TYR D C   1 
ATOM   8144 O O   . TYR D 1 254 ? -50.485 -13.938 -65.725 1.00 126.69 ? 266 TYR D O   1 
ATOM   8145 C CB  . TYR D 1 254 ? -47.513 -14.313 -66.612 1.00 111.33 ? 266 TYR D CB  1 
ATOM   8146 C CG  . TYR D 1 254 ? -47.164 -15.337 -65.556 1.00 113.45 ? 266 TYR D CG  1 
ATOM   8147 C CD1 . TYR D 1 254 ? -46.602 -16.561 -65.903 1.00 114.47 ? 266 TYR D CD1 1 
ATOM   8148 C CD2 . TYR D 1 254 ? -47.403 -15.086 -64.210 1.00 116.32 ? 266 TYR D CD2 1 
ATOM   8149 C CE1 . TYR D 1 254 ? -46.287 -17.512 -64.934 1.00 117.00 ? 266 TYR D CE1 1 
ATOM   8150 C CE2 . TYR D 1 254 ? -47.106 -16.033 -63.234 1.00 118.86 ? 266 TYR D CE2 1 
ATOM   8151 C CZ  . TYR D 1 254 ? -46.546 -17.246 -63.599 1.00 125.88 ? 266 TYR D CZ  1 
ATOM   8152 O OH  . TYR D 1 254 ? -46.245 -18.177 -62.631 1.00 129.12 ? 266 TYR D OH  1 
ATOM   8153 N N   . SER D 1 255 ? -50.394 -16.146 -66.245 1.00 125.61 ? 267 SER D N   1 
ATOM   8154 C CA  . SER D 1 255 ? -51.440 -16.605 -65.333 1.00 131.13 ? 267 SER D CA  1 
ATOM   8155 C C   . SER D 1 255 ? -51.106 -17.993 -64.790 1.00 137.56 ? 267 SER D C   1 
ATOM   8156 O O   . SER D 1 255 ? -50.703 -18.866 -65.561 1.00 135.36 ? 267 SER D O   1 
ATOM   8157 C CB  . SER D 1 255 ? -52.793 -16.625 -66.042 1.00 139.07 ? 267 SER D CB  1 
ATOM   8158 O OG  . SER D 1 255 ? -53.837 -17.089 -65.201 1.00 155.21 ? 267 SER D OG  1 
ATOM   8159 N N   . ASP D 1 256 ? -51.314 -18.196 -63.465 1.00 138.22 ? 268 ASP D N   1 
ATOM   8160 C CA  . ASP D 1 256 ? -51.009 -19.412 -62.694 1.00 139.42 ? 268 ASP D CA  1 
ATOM   8161 C C   . ASP D 1 256 ? -49.508 -19.733 -62.824 1.00 138.55 ? 268 ASP D C   1 
ATOM   8162 O O   . ASP D 1 256 ? -48.710 -19.204 -62.047 1.00 136.49 ? 268 ASP D O   1 
ATOM   8163 C CB  . ASP D 1 256 ? -51.905 -20.603 -63.120 1.00 144.63 ? 268 ASP D CB  1 
ATOM   8164 C CG  . ASP D 1 256 ? -52.365 -21.505 -61.989 1.00 157.89 ? 268 ASP D CG  1 
ATOM   8165 O OD1 . ASP D 1 256 ? -51.504 -21.976 -61.214 1.00 159.78 ? 268 ASP D OD1 1 
ATOM   8166 O OD2 . ASP D 1 256 ? -53.577 -21.803 -61.925 1.00 161.97 ? 268 ASP D OD2 1 
ATOM   8167 N N   . LYS D 1 257 ? -49.130 -20.564 -63.818 1.00 133.58 ? 269 LYS D N   1 
ATOM   8168 C CA  . LYS D 1 257 ? -47.740 -20.855 -64.191 1.00 128.68 ? 269 LYS D CA  1 
ATOM   8169 C C   . LYS D 1 257 ? -47.563 -20.802 -65.722 1.00 127.36 ? 269 LYS D C   1 
ATOM   8170 O O   . LYS D 1 257 ? -46.494 -21.151 -66.235 1.00 123.53 ? 269 LYS D O   1 
ATOM   8171 C CB  . LYS D 1 257 ? -47.317 -22.234 -63.656 1.00 133.67 ? 269 LYS D CB  1 
ATOM   8172 C CG  . LYS D 1 257 ? -46.882 -22.256 -62.198 1.00 152.39 ? 269 LYS D CG  1 
ATOM   8173 C CD  . LYS D 1 257 ? -46.319 -23.633 -61.842 1.00 166.11 ? 269 LYS D CD  1 
ATOM   8174 C CE  . LYS D 1 257 ? -46.424 -23.945 -60.367 1.00 183.30 ? 269 LYS D CE  1 
ATOM   8175 N NZ  . LYS D 1 257 ? -46.858 -25.353 -60.116 1.00 192.69 ? 269 LYS D NZ  1 
ATOM   8176 N N   . GLU D 1 258 ? -48.605 -20.332 -66.437 1.00 123.54 ? 270 GLU D N   1 
ATOM   8177 C CA  . GLU D 1 258 ? -48.737 -20.429 -67.888 1.00 121.69 ? 270 GLU D CA  1 
ATOM   8178 C C   . GLU D 1 258 ? -48.603 -19.060 -68.555 1.00 120.47 ? 270 GLU D C   1 
ATOM   8179 O O   . GLU D 1 258 ? -49.421 -18.162 -68.328 1.00 121.19 ? 270 GLU D O   1 
ATOM   8180 C CB  . GLU D 1 258 ? -50.086 -21.083 -68.260 1.00 128.05 ? 270 GLU D CB  1 
ATOM   8181 C CG  . GLU D 1 258 ? -50.167 -21.618 -69.684 1.00 138.40 ? 270 GLU D CG  1 
ATOM   8182 C CD  . GLU D 1 258 ? -49.394 -22.890 -69.984 1.00 157.73 ? 270 GLU D CD  1 
ATOM   8183 O OE1 . GLU D 1 258 ? -49.130 -23.672 -69.042 1.00 153.63 ? 270 GLU D OE1 1 
ATOM   8184 O OE2 . GLU D 1 258 ? -49.084 -23.124 -71.175 1.00 150.40 ? 270 GLU D OE2 1 
ATOM   8185 N N   . PHE D 1 259 ? -47.551 -18.924 -69.379 1.00 111.82 ? 271 PHE D N   1 
ATOM   8186 C CA  . PHE D 1 259 ? -47.262 -17.769 -70.230 1.00 107.98 ? 271 PHE D CA  1 
ATOM   8187 C C   . PHE D 1 259 ? -48.044 -17.855 -71.535 1.00 113.24 ? 271 PHE D C   1 
ATOM   8188 O O   . PHE D 1 259 ? -48.327 -18.959 -72.006 1.00 114.42 ? 271 PHE D O   1 
ATOM   8189 C CB  . PHE D 1 259 ? -45.758 -17.703 -70.547 1.00 104.70 ? 271 PHE D CB  1 
ATOM   8190 C CG  . PHE D 1 259 ? -44.834 -17.394 -69.394 1.00 103.59 ? 271 PHE D CG  1 
ATOM   8191 C CD1 . PHE D 1 259 ? -44.415 -18.398 -68.527 1.00 107.13 ? 271 PHE D CD1 1 
ATOM   8192 C CD2 . PHE D 1 259 ? -44.334 -16.111 -69.208 1.00 102.47 ? 271 PHE D CD2 1 
ATOM   8193 C CE1 . PHE D 1 259 ? -43.544 -18.115 -67.471 1.00 106.25 ? 271 PHE D CE1 1 
ATOM   8194 C CE2 . PHE D 1 259 ? -43.468 -15.827 -68.150 1.00 103.45 ? 271 PHE D CE2 1 
ATOM   8195 C CZ  . PHE D 1 259 ? -43.073 -16.831 -67.292 1.00 102.48 ? 271 PHE D CZ  1 
ATOM   8196 N N   . THR D 1 260 ? -48.382 -16.696 -72.122 1.00 109.47 ? 272 THR D N   1 
ATOM   8197 C CA  . THR D 1 260 ? -49.044 -16.617 -73.424 1.00 111.03 ? 272 THR D CA  1 
ATOM   8198 C C   . THR D 1 260 ? -48.365 -15.511 -74.236 1.00 112.66 ? 272 THR D C   1 
ATOM   8199 O O   . THR D 1 260 ? -48.342 -14.357 -73.802 1.00 110.58 ? 272 THR D O   1 
ATOM   8200 C CB  . THR D 1 260 ? -50.572 -16.402 -73.262 1.00 122.23 ? 272 THR D CB  1 
ATOM   8201 O OG1 . THR D 1 260 ? -51.102 -17.327 -72.309 1.00 122.89 ? 272 THR D OG1 1 
ATOM   8202 C CG2 . THR D 1 260 ? -51.334 -16.533 -74.581 1.00 123.29 ? 272 THR D CG2 1 
ATOM   8203 N N   . ILE D 1 261 ? -47.767 -15.882 -75.382 1.00 109.15 ? 273 ILE D N   1 
ATOM   8204 C CA  . ILE D 1 261 ? -47.244 -14.930 -76.364 1.00 107.26 ? 273 ILE D CA  1 
ATOM   8205 C C   . ILE D 1 261 ? -48.324 -14.733 -77.425 1.00 116.56 ? 273 ILE D C   1 
ATOM   8206 O O   . ILE D 1 261 ? -48.659 -15.680 -78.146 1.00 118.46 ? 273 ILE D O   1 
ATOM   8207 C CB  . ILE D 1 261 ? -45.880 -15.364 -76.990 1.00 106.80 ? 273 ILE D CB  1 
ATOM   8208 C CG1 . ILE D 1 261 ? -44.862 -15.821 -75.921 1.00 104.45 ? 273 ILE D CG1 1 
ATOM   8209 C CG2 . ILE D 1 261 ? -45.303 -14.248 -77.879 1.00 105.59 ? 273 ILE D CG2 1 
ATOM   8210 C CD1 . ILE D 1 261 ? -43.734 -16.723 -76.465 1.00 109.08 ? 273 ILE D CD1 1 
ATOM   8211 N N   . LYS D 1 262 ? -48.897 -13.522 -77.491 1.00 115.37 ? 274 LYS D N   1 
ATOM   8212 C CA  . LYS D 1 262 ? -49.880 -13.179 -78.517 1.00 119.19 ? 274 LYS D CA  1 
ATOM   8213 C C   . LYS D 1 262 ? -49.163 -12.433 -79.653 1.00 122.72 ? 274 LYS D C   1 
ATOM   8214 O O   . LYS D 1 262 ? -48.702 -11.310 -79.438 1.00 120.17 ? 274 LYS D O   1 
ATOM   8215 C CB  . LYS D 1 262 ? -51.058 -12.368 -77.933 1.00 124.77 ? 274 LYS D CB  1 
ATOM   8216 C CG  . LYS D 1 262 ? -51.904 -13.154 -76.929 1.00 140.75 ? 274 LYS D CG  1 
ATOM   8217 C CD  . LYS D 1 262 ? -53.225 -12.468 -76.617 1.00 151.04 ? 274 LYS D CD  1 
ATOM   8218 C CE  . LYS D 1 262 ? -53.833 -12.964 -75.330 1.00 157.79 ? 274 LYS D CE  1 
ATOM   8219 N NZ  . LYS D 1 262 ? -54.992 -12.131 -74.926 1.00 168.67 ? 274 LYS D NZ  1 
ATOM   8220 N N   . PRO D 1 263 ? -48.994 -13.063 -80.845 1.00 121.24 ? 275 PRO D N   1 
ATOM   8221 C CA  . PRO D 1 263 ? -48.337 -12.361 -81.963 1.00 120.32 ? 275 PRO D CA  1 
ATOM   8222 C C   . PRO D 1 263 ? -49.198 -11.236 -82.541 1.00 128.76 ? 275 PRO D C   1 
ATOM   8223 O O   . PRO D 1 263 ? -50.422 -11.243 -82.384 1.00 132.50 ? 275 PRO D O   1 
ATOM   8224 C CB  . PRO D 1 263 ? -48.111 -13.469 -83.003 1.00 122.86 ? 275 PRO D CB  1 
ATOM   8225 C CG  . PRO D 1 263 ? -48.352 -14.759 -82.281 1.00 127.60 ? 275 PRO D CG  1 
ATOM   8226 C CD  . PRO D 1 263 ? -49.356 -14.439 -81.229 1.00 124.97 ? 275 PRO D CD  1 
ATOM   8227 N N   . LEU D 1 264 ? -48.546 -10.266 -83.207 1.00 124.63 ? 276 LEU D N   1 
ATOM   8228 C CA  . LEU D 1 264 ? -49.198 -9.127  -83.856 1.00 127.76 ? 276 LEU D CA  1 
ATOM   8229 C C   . LEU D 1 264 ? -50.024 -9.592  -85.064 1.00 137.32 ? 276 LEU D C   1 
ATOM   8230 O O   . LEU D 1 264 ? -51.170 -9.163  -85.224 1.00 140.80 ? 276 LEU D O   1 
ATOM   8231 C CB  . LEU D 1 264 ? -48.136 -8.103  -84.285 1.00 125.25 ? 276 LEU D CB  1 
ATOM   8232 C CG  . LEU D 1 264 ? -48.564 -6.642  -84.352 1.00 131.76 ? 276 LEU D CG  1 
ATOM   8233 C CD1 . LEU D 1 264 ? -48.688 -6.035  -82.961 1.00 130.27 ? 276 LEU D CD1 1 
ATOM   8234 C CD2 . LEU D 1 264 ? -47.566 -5.837  -85.154 1.00 133.12 ? 276 LEU D CD2 1 
ATOM   8235 N N   . ASP D 1 265 ? -49.435 -10.478 -85.901 1.00 134.82 ? 277 ASP D N   1 
ATOM   8236 C CA  . ASP D 1 265 ? -50.095 -11.130 -87.034 1.00 138.84 ? 277 ASP D CA  1 
ATOM   8237 C C   . ASP D 1 265 ? -51.058 -12.205 -86.517 1.00 144.38 ? 277 ASP D C   1 
ATOM   8238 O O   . ASP D 1 265 ? -50.656 -13.079 -85.744 1.00 142.17 ? 277 ASP D O   1 
ATOM   8239 C CB  . ASP D 1 265 ? -49.035 -11.728 -87.991 1.00 139.36 ? 277 ASP D CB  1 
ATOM   8240 C CG  . ASP D 1 265 ? -49.540 -12.481 -89.217 1.00 154.63 ? 277 ASP D CG  1 
ATOM   8241 O OD1 . ASP D 1 265 ? -50.699 -12.242 -89.635 1.00 159.99 ? 277 ASP D OD1 1 
ATOM   8242 O OD2 . ASP D 1 265 ? -48.756 -13.268 -89.791 1.00 159.25 ? 277 ASP D OD2 1 
ATOM   8243 N N   . LYS D 1 266 ? -52.329 -12.131 -86.947 1.00 145.51 ? 278 LYS D N   1 
ATOM   8244 C CA  . LYS D 1 266 ? -53.380 -13.069 -86.542 1.00 148.61 ? 278 LYS D CA  1 
ATOM   8245 C C   . LYS D 1 266 ? -53.251 -14.437 -87.248 1.00 154.39 ? 278 LYS D C   1 
ATOM   8246 O O   . LYS D 1 266 ? -53.864 -15.406 -86.793 1.00 156.49 ? 278 LYS D O   1 
ATOM   8247 C CB  . LYS D 1 266 ? -54.770 -12.461 -86.798 1.00 156.76 ? 278 LYS D CB  1 
ATOM   8248 C CG  . LYS D 1 266 ? -55.576 -12.217 -85.527 1.00 164.83 ? 278 LYS D CG  1 
ATOM   8249 C CD  . LYS D 1 266 ? -55.309 -10.847 -84.903 1.00 169.66 ? 278 LYS D CD  1 
ATOM   8250 C CE  . LYS D 1 266 ? -56.176 -10.619 -83.692 1.00 179.41 ? 278 LYS D CE  1 
ATOM   8251 N NZ  . LYS D 1 266 ? -56.006 -9.250  -83.140 1.00 189.54 ? 278 LYS D NZ  1 
ATOM   8252 N N   . LYS D 1 267 ? -52.464 -14.512 -88.348 1.00 151.00 ? 279 LYS D N   1 
ATOM   8253 C CA  . LYS D 1 267 ? -52.176 -15.758 -89.068 1.00 152.36 ? 279 LYS D CA  1 
ATOM   8254 C C   . LYS D 1 267 ? -51.276 -16.682 -88.239 1.00 153.43 ? 279 LYS D C   1 
ATOM   8255 O O   . LYS D 1 267 ? -51.415 -17.906 -88.326 1.00 155.43 ? 279 LYS D O   1 
ATOM   8256 C CB  . LYS D 1 267 ? -51.527 -15.469 -90.431 1.00 155.05 ? 279 LYS D CB  1 
ATOM   8257 C CG  . LYS D 1 267 ? -52.499 -15.567 -91.603 1.00 172.31 ? 279 LYS D CG  1 
ATOM   8258 C CD  . LYS D 1 267 ? -51.799 -15.391 -92.950 1.00 181.78 ? 279 LYS D CD  1 
ATOM   8259 C CE  . LYS D 1 267 ? -51.911 -13.989 -93.494 1.00 192.59 ? 279 LYS D CE  1 
ATOM   8260 N NZ  . LYS D 1 267 ? -51.285 -13.871 -94.839 1.00 203.44 ? 279 LYS D NZ  1 
ATOM   8261 N N   . ILE D 1 268 ? -50.350 -16.093 -87.453 1.00 144.80 ? 280 ILE D N   1 
ATOM   8262 C CA  . ILE D 1 268 ? -49.483 -16.819 -86.522 1.00 140.49 ? 280 ILE D CA  1 
ATOM   8263 C C   . ILE D 1 268 ? -50.296 -17.135 -85.251 1.00 143.88 ? 280 ILE D C   1 
ATOM   8264 O O   . ILE D 1 268 ? -50.945 -16.245 -84.692 1.00 144.18 ? 280 ILE D O   1 
ATOM   8265 C CB  . ILE D 1 268 ? -48.169 -16.033 -86.223 1.00 138.82 ? 280 ILE D CB  1 
ATOM   8266 C CG1 . ILE D 1 268 ? -47.442 -15.634 -87.535 1.00 139.27 ? 280 ILE D CG1 1 
ATOM   8267 C CG2 . ILE D 1 268 ? -47.233 -16.841 -85.301 1.00 135.69 ? 280 ILE D CG2 1 
ATOM   8268 C CD1 . ILE D 1 268 ? -46.459 -14.442 -87.424 1.00 146.22 ? 280 ILE D CD1 1 
ATOM   8269 N N   . ASP D 1 269 ? -50.277 -18.416 -84.829 1.00 139.56 ? 281 ASP D N   1 
ATOM   8270 C CA  . ASP D 1 269 ? -50.988 -18.922 -83.649 1.00 140.08 ? 281 ASP D CA  1 
ATOM   8271 C C   . ASP D 1 269 ? -50.367 -18.384 -82.357 1.00 138.03 ? 281 ASP D C   1 
ATOM   8272 O O   . ASP D 1 269 ? -49.162 -18.109 -82.331 1.00 133.54 ? 281 ASP D O   1 
ATOM   8273 C CB  . ASP D 1 269 ? -50.969 -20.465 -83.631 1.00 143.34 ? 281 ASP D CB  1 
ATOM   8274 C CG  . ASP D 1 269 ? -51.717 -21.151 -84.767 1.00 158.54 ? 281 ASP D CG  1 
ATOM   8275 O OD1 . ASP D 1 269 ? -51.845 -20.541 -85.851 1.00 159.89 ? 281 ASP D OD1 1 
ATOM   8276 O OD2 . ASP D 1 269 ? -52.132 -22.316 -84.585 1.00 166.17 ? 281 ASP D OD2 1 
ATOM   8277 N N   . VAL D 1 270 ? -51.187 -18.229 -81.287 1.00 134.10 ? 282 VAL D N   1 
ATOM   8278 C CA  . VAL D 1 270 ? -50.677 -17.836 -79.965 1.00 129.77 ? 282 VAL D CA  1 
ATOM   8279 C C   . VAL D 1 270 ? -49.806 -18.971 -79.415 1.00 129.53 ? 282 VAL D C   1 
ATOM   8280 O O   . VAL D 1 270 ? -50.090 -20.150 -79.669 1.00 131.87 ? 282 VAL D O   1 
ATOM   8281 C CB  . VAL D 1 270 ? -51.754 -17.378 -78.933 1.00 135.89 ? 282 VAL D CB  1 
ATOM   8282 C CG1 . VAL D 1 270 ? -52.577 -16.208 -79.462 1.00 137.73 ? 282 VAL D CG1 1 
ATOM   8283 C CG2 . VAL D 1 270 ? -52.655 -18.524 -78.476 1.00 139.66 ? 282 VAL D CG2 1 
ATOM   8284 N N   . PHE D 1 271 ? -48.726 -18.612 -78.709 1.00 119.48 ? 283 PHE D N   1 
ATOM   8285 C CA  . PHE D 1 271 ? -47.847 -19.602 -78.111 1.00 116.39 ? 283 PHE D CA  1 
ATOM   8286 C C   . PHE D 1 271 ? -47.996 -19.576 -76.599 1.00 118.04 ? 283 PHE D C   1 
ATOM   8287 O O   . PHE D 1 271 ? -47.679 -18.580 -75.947 1.00 115.17 ? 283 PHE D O   1 
ATOM   8288 C CB  . PHE D 1 271 ? -46.386 -19.395 -78.541 1.00 114.01 ? 283 PHE D CB  1 
ATOM   8289 C CG  . PHE D 1 271 ? -45.497 -20.585 -78.256 1.00 114.43 ? 283 PHE D CG  1 
ATOM   8290 C CD1 . PHE D 1 271 ? -45.448 -21.663 -79.132 1.00 118.90 ? 283 PHE D CD1 1 
ATOM   8291 C CD2 . PHE D 1 271 ? -44.712 -20.629 -77.109 1.00 114.31 ? 283 PHE D CD2 1 
ATOM   8292 C CE1 . PHE D 1 271 ? -44.640 -22.770 -78.859 1.00 119.09 ? 283 PHE D CE1 1 
ATOM   8293 C CE2 . PHE D 1 271 ? -43.914 -21.741 -76.832 1.00 116.55 ? 283 PHE D CE2 1 
ATOM   8294 C CZ  . PHE D 1 271 ? -43.873 -22.798 -77.715 1.00 116.09 ? 283 PHE D CZ  1 
ATOM   8295 N N   . LYS D 1 272 ? -48.526 -20.667 -76.051 1.00 116.40 ? 284 LYS D N   1 
ATOM   8296 C CA  . LYS D 1 272 ? -48.657 -20.862 -74.609 1.00 116.27 ? 284 LYS D CA  1 
ATOM   8297 C C   . LYS D 1 272 ? -47.583 -21.830 -74.122 1.00 116.02 ? 284 LYS D C   1 
ATOM   8298 O O   . LYS D 1 272 ? -47.365 -22.871 -74.751 1.00 116.74 ? 284 LYS D O   1 
ATOM   8299 C CB  . LYS D 1 272 ? -50.070 -21.368 -74.229 1.00 123.74 ? 284 LYS D CB  1 
ATOM   8300 C CG  . LYS D 1 272 ? -51.165 -20.352 -74.484 1.00 139.94 ? 284 LYS D CG  1 
ATOM   8301 C CD  . LYS D 1 272 ? -52.546 -20.911 -74.161 1.00 158.65 ? 284 LYS D CD  1 
ATOM   8302 C CE  . LYS D 1 272 ? -53.507 -19.852 -73.659 1.00 173.91 ? 284 LYS D CE  1 
ATOM   8303 N NZ  . LYS D 1 272 ? -53.943 -18.917 -74.730 1.00 181.19 ? 284 LYS D NZ  1 
ATOM   8304 N N   . PHE D 1 273 ? -46.898 -21.481 -73.023 1.00 107.63 ? 285 PHE D N   1 
ATOM   8305 C CA  . PHE D 1 273 ? -45.933 -22.386 -72.405 1.00 105.12 ? 285 PHE D CA  1 
ATOM   8306 C C   . PHE D 1 273 ? -45.960 -22.286 -70.876 1.00 109.43 ? 285 PHE D C   1 
ATOM   8307 O O   . PHE D 1 273 ? -46.424 -21.295 -70.312 1.00 108.53 ? 285 PHE D O   1 
ATOM   8308 C CB  . PHE D 1 273 ? -44.509 -22.171 -72.951 1.00 101.91 ? 285 PHE D CB  1 
ATOM   8309 C CG  . PHE D 1 273 ? -43.897 -20.817 -72.706 1.00 99.32  ? 285 PHE D CG  1 
ATOM   8310 C CD1 . PHE D 1 273 ? -43.134 -20.578 -71.571 1.00 100.09 ? 285 PHE D CD1 1 
ATOM   8311 C CD2 . PHE D 1 273 ? -44.059 -19.786 -73.623 1.00 99.67  ? 285 PHE D CD2 1 
ATOM   8312 C CE1 . PHE D 1 273 ? -42.553 -19.329 -71.352 1.00 97.96  ? 285 PHE D CE1 1 
ATOM   8313 C CE2 . PHE D 1 273 ? -43.498 -18.532 -73.393 1.00 99.46  ? 285 PHE D CE2 1 
ATOM   8314 C CZ  . PHE D 1 273 ? -42.734 -18.315 -72.268 1.00 95.82  ? 285 PHE D CZ  1 
ATOM   8315 N N   . ASN D 1 274 ? -45.451 -23.332 -70.223 1.00 107.66 ? 286 ASN D N   1 
ATOM   8316 C CA  . ASN D 1 274 ? -45.442 -23.514 -68.780 1.00 109.43 ? 286 ASN D CA  1 
ATOM   8317 C C   . ASN D 1 274 ? -44.018 -23.460 -68.251 1.00 111.27 ? 286 ASN D C   1 
ATOM   8318 O O   . ASN D 1 274 ? -43.109 -24.014 -68.868 1.00 108.49 ? 286 ASN D O   1 
ATOM   8319 C CB  . ASN D 1 274 ? -46.094 -24.864 -68.431 1.00 114.47 ? 286 ASN D CB  1 
ATOM   8320 C CG  . ASN D 1 274 ? -46.079 -25.212 -66.965 1.00 139.99 ? 286 ASN D CG  1 
ATOM   8321 O OD1 . ASN D 1 274 ? -46.902 -24.733 -66.180 1.00 136.12 ? 286 ASN D OD1 1 
ATOM   8322 N ND2 . ASN D 1 274 ? -45.144 -26.064 -66.567 1.00 132.13 ? 286 ASN D ND2 1 
ATOM   8323 N N   . SER D 1 275 ? -43.828 -22.784 -67.114 1.00 109.38 ? 287 SER D N   1 
ATOM   8324 C CA  . SER D 1 275 ? -42.593 -22.848 -66.335 1.00 108.21 ? 287 SER D CA  1 
ATOM   8325 C C   . SER D 1 275 ? -42.952 -23.127 -64.862 1.00 117.72 ? 287 SER D C   1 
ATOM   8326 O O   . SER D 1 275 ? -43.823 -22.458 -64.292 1.00 118.50 ? 287 SER D O   1 
ATOM   8327 C CB  . SER D 1 275 ? -41.776 -21.570 -66.504 1.00 107.31 ? 287 SER D CB  1 
ATOM   8328 O OG  . SER D 1 275 ? -40.614 -21.572 -65.692 1.00 114.01 ? 287 SER D OG  1 
ATOM   8329 N N   . SER D 1 276 ? -42.284 -24.135 -64.266 1.00 117.30 ? 288 SER D N   1 
ATOM   8330 C CA  . SER D 1 276 ? -42.643 -24.716 -62.963 1.00 121.61 ? 288 SER D CA  1 
ATOM   8331 C C   . SER D 1 276 ? -42.293 -23.809 -61.764 1.00 125.18 ? 288 SER D C   1 
ATOM   8332 O O   . SER D 1 276 ? -43.049 -23.789 -60.789 1.00 128.19 ? 288 SER D O   1 
ATOM   8333 C CB  . SER D 1 276 ? -41.979 -26.081 -62.783 1.00 127.10 ? 288 SER D CB  1 
ATOM   8334 O OG  . SER D 1 276 ? -40.574 -26.031 -62.983 1.00 134.09 ? 288 SER D OG  1 
ATOM   8335 N N   . LYS D 1 277 ? -41.162 -23.072 -61.834 1.00 117.69 ? 289 LYS D N   1 
ATOM   8336 C CA  . LYS D 1 277 ? -40.648 -22.275 -60.717 1.00 117.03 ? 289 LYS D CA  1 
ATOM   8337 C C   . LYS D 1 277 ? -41.101 -20.816 -60.804 1.00 118.77 ? 289 LYS D C   1 
ATOM   8338 O O   . LYS D 1 277 ? -40.889 -20.161 -61.824 1.00 115.02 ? 289 LYS D O   1 
ATOM   8339 C CB  . LYS D 1 277 ? -39.113 -22.350 -60.648 1.00 116.66 ? 289 LYS D CB  1 
ATOM   8340 C CG  . LYS D 1 277 ? -38.566 -23.729 -60.302 1.00 131.58 ? 289 LYS D CG  1 
ATOM   8341 C CD  . LYS D 1 277 ? -37.057 -23.714 -60.263 1.00 138.51 ? 289 LYS D CD  1 
ATOM   8342 C CE  . LYS D 1 277 ? -36.504 -24.958 -59.611 1.00 151.24 ? 289 LYS D CE  1 
ATOM   8343 N NZ  . LYS D 1 277 ? -35.018 -24.952 -59.555 1.00 158.02 ? 289 LYS D NZ  1 
ATOM   8344 N N   . LEU D 1 278 ? -41.702 -20.318 -59.708 1.00 117.34 ? 290 LEU D N   1 
ATOM   8345 C CA  . LEU D 1 278 ? -42.239 -18.966 -59.523 1.00 116.52 ? 290 LEU D CA  1 
ATOM   8346 C C   . LEU D 1 278 ? -41.170 -17.854 -59.656 1.00 115.29 ? 290 LEU D C   1 
ATOM   8347 O O   . LEU D 1 278 ? -41.448 -16.826 -60.282 1.00 112.37 ? 290 LEU D O   1 
ATOM   8348 C CB  . LEU D 1 278 ? -42.936 -18.863 -58.147 1.00 121.20 ? 290 LEU D CB  1 
ATOM   8349 C CG  . LEU D 1 278 ? -42.153 -19.353 -56.909 1.00 127.73 ? 290 LEU D CG  1 
ATOM   8350 C CD1 . LEU D 1 278 ? -41.738 -18.190 -56.029 1.00 127.28 ? 290 LEU D CD1 1 
ATOM   8351 C CD2 . LEU D 1 278 ? -42.948 -20.382 -56.116 1.00 135.96 ? 290 LEU D CD2 1 
ATOM   8352 N N   . ARG D 1 279 ? -39.970 -18.051 -59.060 1.00 110.58 ? 291 ARG D N   1 
ATOM   8353 C CA  . ARG D 1 279 ? -38.857 -17.089 -59.085 1.00 106.46 ? 291 ARG D CA  1 
ATOM   8354 C C   . ARG D 1 279 ? -38.340 -16.880 -60.505 1.00 104.37 ? 291 ARG D C   1 
ATOM   8355 O O   . ARG D 1 279 ? -37.980 -15.760 -60.871 1.00 101.77 ? 291 ARG D O   1 
ATOM   8356 C CB  . ARG D 1 279 ? -37.695 -17.558 -58.189 1.00 108.50 ? 291 ARG D CB  1 
ATOM   8357 C CG  . ARG D 1 279 ? -38.022 -17.673 -56.709 1.00 128.31 ? 291 ARG D CG  1 
ATOM   8358 C CD  . ARG D 1 279 ? -36.878 -18.343 -55.979 1.00 145.75 ? 291 ARG D CD  1 
ATOM   8359 N NE  . ARG D 1 279 ? -37.296 -18.913 -54.698 1.00 163.39 ? 291 ARG D NE  1 
ATOM   8360 C CZ  . ARG D 1 279 ? -36.591 -19.810 -54.016 1.00 182.27 ? 291 ARG D CZ  1 
ATOM   8361 N NH1 . ARG D 1 279 ? -37.041 -20.274 -52.859 1.00 174.48 ? 291 ARG D NH1 1 
ATOM   8362 N NH2 . ARG D 1 279 ? -35.432 -20.255 -54.490 1.00 168.78 ? 291 ARG D NH2 1 
ATOM   8363 N N   . VAL D 1 280 ? -38.291 -17.971 -61.290 1.00 98.55  ? 292 VAL D N   1 
ATOM   8364 C CA  . VAL D 1 280 ? -37.868 -17.988 -62.688 1.00 94.27  ? 292 VAL D CA  1 
ATOM   8365 C C   . VAL D 1 280 ? -38.866 -17.162 -63.517 1.00 95.26  ? 292 VAL D C   1 
ATOM   8366 O O   . VAL D 1 280 ? -38.435 -16.321 -64.307 1.00 91.45  ? 292 VAL D O   1 
ATOM   8367 C CB  . VAL D 1 280 ? -37.711 -19.450 -63.196 1.00 99.39  ? 292 VAL D CB  1 
ATOM   8368 C CG1 . VAL D 1 280 ? -37.497 -19.514 -64.705 1.00 96.68  ? 292 VAL D CG1 1 
ATOM   8369 C CG2 . VAL D 1 280 ? -36.572 -20.161 -62.469 1.00 99.52  ? 292 VAL D CG2 1 
ATOM   8370 N N   . ASN D 1 281 ? -40.185 -17.369 -63.296 1.00 93.92  ? 293 ASN D N   1 
ATOM   8371 C CA  . ASN D 1 281 ? -41.270 -16.653 -63.974 1.00 93.71  ? 293 ASN D CA  1 
ATOM   8372 C C   . ASN D 1 281 ? -41.159 -15.141 -63.780 1.00 95.41  ? 293 ASN D C   1 
ATOM   8373 O O   . ASN D 1 281 ? -41.304 -14.401 -64.755 1.00 93.11  ? 293 ASN D O   1 
ATOM   8374 C CB  . ASN D 1 281 ? -42.630 -17.138 -63.483 1.00 98.17  ? 293 ASN D CB  1 
ATOM   8375 C CG  . ASN D 1 281 ? -42.871 -18.612 -63.663 1.00 120.47 ? 293 ASN D CG  1 
ATOM   8376 O OD1 . ASN D 1 281 ? -42.345 -19.254 -64.576 1.00 108.12 ? 293 ASN D OD1 1 
ATOM   8377 N ND2 . ASN D 1 281 ? -43.660 -19.187 -62.771 1.00 118.93 ? 293 ASN D ND2 1 
ATOM   8378 N N   . LYS D 1 282 ? -40.878 -14.690 -62.531 1.00 92.42  ? 294 LYS D N   1 
ATOM   8379 C CA  . LYS D 1 282 ? -40.694 -13.269 -62.199 1.00 90.77  ? 294 LYS D CA  1 
ATOM   8380 C C   . LYS D 1 282 ? -39.489 -12.695 -62.944 1.00 89.63  ? 294 LYS D C   1 
ATOM   8381 O O   . LYS D 1 282 ? -39.582 -11.591 -63.487 1.00 88.05  ? 294 LYS D O   1 
ATOM   8382 C CB  . LYS D 1 282 ? -40.536 -13.059 -60.686 1.00 95.40  ? 294 LYS D CB  1 
ATOM   8383 C CG  . LYS D 1 282 ? -41.834 -13.241 -59.900 1.00 116.99 ? 294 LYS D CG  1 
ATOM   8384 C CD  . LYS D 1 282 ? -41.576 -13.250 -58.397 1.00 126.99 ? 294 LYS D CD  1 
ATOM   8385 C CE  . LYS D 1 282 ? -42.805 -13.543 -57.578 1.00 130.64 ? 294 LYS D CE  1 
ATOM   8386 N NZ  . LYS D 1 282 ? -42.468 -13.661 -56.137 1.00 135.31 ? 294 LYS D NZ  1 
ATOM   8387 N N   . LEU D 1 283 ? -38.375 -13.461 -62.994 1.00 83.11  ? 295 LEU D N   1 
ATOM   8388 C CA  . LEU D 1 283 ? -37.165 -13.102 -63.727 1.00 78.24  ? 295 LEU D CA  1 
ATOM   8389 C C   . LEU D 1 283 ? -37.442 -13.020 -65.235 1.00 79.55  ? 295 LEU D C   1 
ATOM   8390 O O   . LEU D 1 283 ? -37.038 -12.032 -65.852 1.00 77.00  ? 295 LEU D O   1 
ATOM   8391 C CB  . LEU D 1 283 ? -36.017 -14.092 -63.417 1.00 77.40  ? 295 LEU D CB  1 
ATOM   8392 C CG  . LEU D 1 283 ? -34.656 -13.854 -64.118 1.00 78.32  ? 295 LEU D CG  1 
ATOM   8393 C CD1 . LEU D 1 283 ? -34.135 -12.432 -63.913 1.00 76.09  ? 295 LEU D CD1 1 
ATOM   8394 C CD2 . LEU D 1 283 ? -33.621 -14.859 -63.654 1.00 80.87  ? 295 LEU D CD2 1 
ATOM   8395 N N   . ILE D 1 284 ? -38.135 -14.041 -65.817 1.00 76.45  ? 296 ILE D N   1 
ATOM   8396 C CA  . ILE D 1 284 ? -38.504 -14.073 -67.242 1.00 74.88  ? 296 ILE D CA  1 
ATOM   8397 C C   . ILE D 1 284 ? -39.224 -12.765 -67.614 1.00 78.96  ? 296 ILE D C   1 
ATOM   8398 O O   . ILE D 1 284 ? -38.813 -12.101 -68.563 1.00 75.90  ? 296 ILE D O   1 
ATOM   8399 C CB  . ILE D 1 284 ? -39.338 -15.334 -67.627 1.00 79.86  ? 296 ILE D CB  1 
ATOM   8400 C CG1 . ILE D 1 284 ? -38.472 -16.602 -67.560 1.00 79.79  ? 296 ILE D CG1 1 
ATOM   8401 C CG2 . ILE D 1 284 ? -39.978 -15.197 -69.025 1.00 79.41  ? 296 ILE D CG2 1 
ATOM   8402 C CD1 . ILE D 1 284 ? -39.262 -17.939 -67.485 1.00 83.08  ? 296 ILE D CD1 1 
ATOM   8403 N N   . LEU D 1 285 ? -40.246 -12.378 -66.836 1.00 79.45  ? 297 LEU D N   1 
ATOM   8404 C CA  . LEU D 1 285 ? -41.071 -11.209 -67.129 1.00 80.97  ? 297 LEU D CA  1 
ATOM   8405 C C   . LEU D 1 285 ? -40.269 -9.918  -67.041 1.00 83.97  ? 297 LEU D C   1 
ATOM   8406 O O   . LEU D 1 285 ? -40.441 -9.060  -67.906 1.00 83.52  ? 297 LEU D O   1 
ATOM   8407 C CB  . LEU D 1 285 ? -42.301 -11.145 -66.211 1.00 84.84  ? 297 LEU D CB  1 
ATOM   8408 C CG  . LEU D 1 285 ? -43.360 -12.247 -66.434 1.00 93.02  ? 297 LEU D CG  1 
ATOM   8409 C CD1 . LEU D 1 285 ? -44.395 -12.245 -65.337 1.00 96.78  ? 297 LEU D CD1 1 
ATOM   8410 C CD2 . LEU D 1 285 ? -44.026 -12.145 -67.823 1.00 96.15  ? 297 LEU D CD2 1 
ATOM   8411 N N   . GLN D 1 286 ? -39.377 -9.793  -66.023 1.00 79.54  ? 298 GLN D N   1 
ATOM   8412 C CA  . GLN D 1 286 ? -38.434 -8.674  -65.860 1.00 76.76  ? 298 GLN D CA  1 
ATOM   8413 C C   . GLN D 1 286 ? -37.595 -8.483  -67.123 1.00 77.63  ? 298 GLN D C   1 
ATOM   8414 O O   . GLN D 1 286 ? -37.459 -7.358  -67.610 1.00 76.78  ? 298 GLN D O   1 
ATOM   8415 C CB  . GLN D 1 286 ? -37.494 -8.918  -64.659 1.00 77.53  ? 298 GLN D CB  1 
ATOM   8416 C CG  . GLN D 1 286 ? -38.081 -8.620  -63.286 1.00 88.90  ? 298 GLN D CG  1 
ATOM   8417 C CD  . GLN D 1 286 ? -37.119 -8.932  -62.141 1.00 104.73 ? 298 GLN D CD  1 
ATOM   8418 O OE1 . GLN D 1 286 ? -35.935 -9.265  -62.317 1.00 94.10  ? 298 GLN D OE1 1 
ATOM   8419 N NE2 . GLN D 1 286 ? -37.615 -8.832  -60.925 1.00 103.26 ? 298 GLN D NE2 1 
ATOM   8420 N N   . LEU D 1 287 ? -37.045 -9.593  -67.651 1.00 72.61  ? 299 LEU D N   1 
ATOM   8421 C CA  . LEU D 1 287 ? -36.202 -9.596  -68.842 1.00 69.99  ? 299 LEU D CA  1 
ATOM   8422 C C   . LEU D 1 287 ? -37.015 -9.309  -70.102 1.00 74.06  ? 299 LEU D C   1 
ATOM   8423 O O   . LEU D 1 287 ? -36.499 -8.668  -71.014 1.00 72.60  ? 299 LEU D O   1 
ATOM   8424 C CB  . LEU D 1 287 ? -35.449 -10.929 -68.978 1.00 69.45  ? 299 LEU D CB  1 
ATOM   8425 C CG  . LEU D 1 287 ? -34.443 -11.264 -67.865 1.00 73.52  ? 299 LEU D CG  1 
ATOM   8426 C CD1 . LEU D 1 287 ? -34.004 -12.699 -67.957 1.00 74.20  ? 299 LEU D CD1 1 
ATOM   8427 C CD2 . LEU D 1 287 ? -33.236 -10.331 -67.883 1.00 72.37  ? 299 LEU D CD2 1 
ATOM   8428 N N   . CYS D 1 288 ? -38.277 -9.759  -70.152 1.00 72.66  ? 300 CYS D N   1 
ATOM   8429 C CA  . CYS D 1 288 ? -39.169 -9.472  -71.277 1.00 73.52  ? 300 CYS D CA  1 
ATOM   8430 C C   . CYS D 1 288 ? -39.448 -7.972  -71.389 1.00 76.85  ? 300 CYS D C   1 
ATOM   8431 O O   . CYS D 1 288 ? -39.353 -7.431  -72.489 1.00 76.10  ? 300 CYS D O   1 
ATOM   8432 C CB  . CYS D 1 288 ? -40.466 -10.266 -71.170 1.00 76.89  ? 300 CYS D CB  1 
ATOM   8433 S SG  . CYS D 1 288 ? -40.270 -12.045 -71.443 1.00 81.22  ? 300 CYS D SG  1 
ATOM   8434 N N   . ILE D 1 289 ? -39.747 -7.303  -70.256 1.00 73.63  ? 301 ILE D N   1 
ATOM   8435 C CA  . ILE D 1 289 ? -40.113 -5.885  -70.225 1.00 74.09  ? 301 ILE D CA  1 
ATOM   8436 C C   . ILE D 1 289 ? -38.918 -5.015  -70.651 1.00 75.46  ? 301 ILE D C   1 
ATOM   8437 O O   . ILE D 1 289 ? -39.069 -4.200  -71.567 1.00 75.44  ? 301 ILE D O   1 
ATOM   8438 C CB  . ILE D 1 289 ? -40.695 -5.463  -68.842 1.00 78.85  ? 301 ILE D CB  1 
ATOM   8439 C CG1 . ILE D 1 289 ? -42.101 -6.063  -68.641 1.00 82.19  ? 301 ILE D CG1 1 
ATOM   8440 C CG2 . ILE D 1 289 ? -40.743 -3.932  -68.679 1.00 79.33  ? 301 ILE D CG2 1 
ATOM   8441 C CD1 . ILE D 1 289 ? -42.360 -6.495  -67.260 1.00 88.26  ? 301 ILE D CD1 1 
ATOM   8442 N N   . GLY D 1 290 ? -37.763 -5.216  -70.007 1.00 69.43  ? 302 GLY D N   1 
ATOM   8443 C CA  . GLY D 1 290 ? -36.540 -4.471  -70.281 1.00 66.34  ? 302 GLY D CA  1 
ATOM   8444 C C   . GLY D 1 290 ? -36.070 -4.594  -71.712 1.00 68.39  ? 302 GLY D C   1 
ATOM   8445 O O   . GLY D 1 290 ? -35.800 -3.580  -72.358 1.00 67.64  ? 302 GLY D O   1 
ATOM   8446 N N   . ASN D 1 291 ? -36.004 -5.835  -72.229 1.00 64.39  ? 303 ASN D N   1 
ATOM   8447 C CA  . ASN D 1 291 ? -35.529 -6.101  -73.586 1.00 63.26  ? 303 ASN D CA  1 
ATOM   8448 C C   . ASN D 1 291 ? -36.494 -5.563  -74.626 1.00 69.00  ? 303 ASN D C   1 
ATOM   8449 O O   . ASN D 1 291 ? -36.043 -5.051  -75.644 1.00 68.24  ? 303 ASN D O   1 
ATOM   8450 C CB  . ASN D 1 291 ? -35.280 -7.587  -73.810 1.00 63.60  ? 303 ASN D CB  1 
ATOM   8451 C CG  . ASN D 1 291 ? -33.986 -8.065  -73.211 1.00 79.41  ? 303 ASN D CG  1 
ATOM   8452 O OD1 . ASN D 1 291 ? -32.891 -7.645  -73.603 1.00 68.95  ? 303 ASN D OD1 1 
ATOM   8453 N ND2 . ASN D 1 291 ? -34.083 -8.967  -72.257 1.00 72.49  ? 303 ASN D ND2 1 
ATOM   8454 N N   . HIS D 1 292 ? -37.807 -5.669  -74.374 1.00 68.71  ? 304 HIS D N   1 
ATOM   8455 C CA  . HIS D 1 292 ? -38.837 -5.097  -75.238 1.00 71.25  ? 304 HIS D CA  1 
ATOM   8456 C C   . HIS D 1 292 ? -38.639 -3.596  -75.387 1.00 74.03  ? 304 HIS D C   1 
ATOM   8457 O O   . HIS D 1 292 ? -38.665 -3.086  -76.503 1.00 74.11  ? 304 HIS D O   1 
ATOM   8458 C CB  . HIS D 1 292 ? -40.245 -5.387  -74.691 1.00 75.18  ? 304 HIS D CB  1 
ATOM   8459 C CG  . HIS D 1 292 ? -41.330 -4.681  -75.441 1.00 81.54  ? 304 HIS D CG  1 
ATOM   8460 N ND1 . HIS D 1 292 ? -41.750 -3.415  -75.078 1.00 84.48  ? 304 HIS D ND1 1 
ATOM   8461 C CD2 . HIS D 1 292 ? -42.013 -5.069  -76.542 1.00 85.58  ? 304 HIS D CD2 1 
ATOM   8462 C CE1 . HIS D 1 292 ? -42.676 -3.079  -75.959 1.00 86.65  ? 304 HIS D CE1 1 
ATOM   8463 N NE2 . HIS D 1 292 ? -42.871 -4.042  -76.856 1.00 87.77  ? 304 HIS D NE2 1 
ATOM   8464 N N   . ASP D 1 293 ? -38.437 -2.904  -74.263 1.00 70.33  ? 305 ASP D N   1 
ATOM   8465 C CA  . ASP D 1 293 ? -38.356 -1.446  -74.202 1.00 70.76  ? 305 ASP D CA  1 
ATOM   8466 C C   . ASP D 1 293 ? -37.059 -0.910  -74.786 1.00 73.16  ? 305 ASP D C   1 
ATOM   8467 O O   . ASP D 1 293 ? -37.082 0.130   -75.446 1.00 73.28  ? 305 ASP D O   1 
ATOM   8468 C CB  . ASP D 1 293 ? -38.517 -0.975  -72.762 1.00 72.43  ? 305 ASP D CB  1 
ATOM   8469 C CG  . ASP D 1 293 ? -39.949 -0.959  -72.282 1.00 84.08  ? 305 ASP D CG  1 
ATOM   8470 O OD1 . ASP D 1 293 ? -40.796 -1.653  -72.894 1.00 86.81  ? 305 ASP D OD1 1 
ATOM   8471 O OD2 . ASP D 1 293 ? -40.230 -0.245  -71.314 1.00 89.88  ? 305 ASP D OD2 1 
ATOM   8472 N N   . LEU D 1 294 ? -35.937 -1.606  -74.554 1.00 68.47  ? 306 LEU D N   1 
ATOM   8473 C CA  . LEU D 1 294 ? -34.670 -1.228  -75.159 1.00 67.43  ? 306 LEU D CA  1 
ATOM   8474 C C   . LEU D 1 294 ? -34.704 -1.467  -76.670 1.00 74.80  ? 306 LEU D C   1 
ATOM   8475 O O   . LEU D 1 294 ? -34.136 -0.675  -77.416 1.00 74.40  ? 306 LEU D O   1 
ATOM   8476 C CB  . LEU D 1 294 ? -33.487 -1.964  -74.510 1.00 65.07  ? 306 LEU D CB  1 
ATOM   8477 C CG  . LEU D 1 294 ? -33.173 -1.620  -73.049 1.00 68.65  ? 306 LEU D CG  1 
ATOM   8478 C CD1 . LEU D 1 294 ? -32.154 -2.572  -72.473 1.00 66.46  ? 306 LEU D CD1 1 
ATOM   8479 C CD2 . LEU D 1 294 ? -32.703 -0.179  -72.892 1.00 70.79  ? 306 LEU D CD2 1 
ATOM   8480 N N   . PHE D 1 295 ? -35.391 -2.531  -77.118 1.00 75.47  ? 307 PHE D N   1 
ATOM   8481 C CA  . PHE D 1 295 ? -35.618 -2.813  -78.539 1.00 78.43  ? 307 PHE D CA  1 
ATOM   8482 C C   . PHE D 1 295 ? -36.352 -1.651  -79.219 1.00 88.25  ? 307 PHE D C   1 
ATOM   8483 O O   . PHE D 1 295 ? -35.967 -1.256  -80.321 1.00 89.65  ? 307 PHE D O   1 
ATOM   8484 C CB  . PHE D 1 295 ? -36.404 -4.123  -78.713 1.00 81.35  ? 307 PHE D CB  1 
ATOM   8485 C CG  . PHE D 1 295 ? -36.788 -4.483  -80.125 1.00 85.08  ? 307 PHE D CG  1 
ATOM   8486 C CD1 . PHE D 1 295 ? -37.937 -3.960  -80.704 1.00 91.25  ? 307 PHE D CD1 1 
ATOM   8487 C CD2 . PHE D 1 295 ? -36.035 -5.392  -80.858 1.00 86.91  ? 307 PHE D CD2 1 
ATOM   8488 C CE1 . PHE D 1 295 ? -38.310 -4.320  -81.994 1.00 94.44  ? 307 PHE D CE1 1 
ATOM   8489 C CE2 . PHE D 1 295 ? -36.409 -5.752  -82.158 1.00 91.81  ? 307 PHE D CE2 1 
ATOM   8490 C CZ  . PHE D 1 295 ? -37.538 -5.205  -82.722 1.00 92.78  ? 307 PHE D CZ  1 
ATOM   8491 N N   . MET D 1 296 ? -37.403 -1.119  -78.565 1.00 87.55  ? 308 MET D N   1 
ATOM   8492 C CA  . MET D 1 296 ? -38.245 -0.056  -79.114 1.00 90.67  ? 308 MET D CA  1 
ATOM   8493 C C   . MET D 1 296 ? -37.488 1.275   -79.205 1.00 95.15  ? 308 MET D C   1 
ATOM   8494 O O   . MET D 1 296 ? -37.634 1.976   -80.206 1.00 96.94  ? 308 MET D O   1 
ATOM   8495 C CB  . MET D 1 296 ? -39.536 0.114   -78.300 1.00 95.04  ? 308 MET D CB  1 
ATOM   8496 C CG  . MET D 1 296 ? -40.493 -1.082  -78.372 1.00 100.25 ? 308 MET D CG  1 
ATOM   8497 S SD  . MET D 1 296 ? -40.937 -1.712  -80.024 1.00 107.06 ? 308 MET D SD  1 
ATOM   8498 C CE  . MET D 1 296 ? -41.745 -0.277  -80.719 1.00 107.36 ? 308 MET D CE  1 
ATOM   8499 N N   . ARG D 1 297 ? -36.676 1.615   -78.180 1.00 90.29  ? 309 ARG D N   1 
ATOM   8500 C CA  . ARG D 1 297 ? -35.825 2.815   -78.152 1.00 89.81  ? 309 ARG D CA  1 
ATOM   8501 C C   . ARG D 1 297 ? -34.805 2.836   -79.291 1.00 94.67  ? 309 ARG D C   1 
ATOM   8502 O O   . ARG D 1 297 ? -34.494 3.906   -79.809 1.00 95.56  ? 309 ARG D O   1 
ATOM   8503 C CB  . ARG D 1 297 ? -35.073 2.910   -76.828 1.00 87.09  ? 309 ARG D CB  1 
ATOM   8504 C CG  . ARG D 1 297 ? -35.888 3.432   -75.676 1.00 97.35  ? 309 ARG D CG  1 
ATOM   8505 C CD  . ARG D 1 297 ? -34.951 3.687   -74.518 1.00 104.52 ? 309 ARG D CD  1 
ATOM   8506 N NE  . ARG D 1 297 ? -35.654 4.188   -73.342 1.00 110.34 ? 309 ARG D NE  1 
ATOM   8507 C CZ  . ARG D 1 297 ? -35.166 4.145   -72.110 1.00 118.01 ? 309 ARG D CZ  1 
ATOM   8508 N NH1 . ARG D 1 297 ? -33.974 3.607   -71.877 1.00 95.88  ? 309 ARG D NH1 1 
ATOM   8509 N NH2 . ARG D 1 297 ? -35.868 4.632   -71.098 1.00 107.54 ? 309 ARG D NH2 1 
ATOM   8510 N N   . ARG D 1 298 ? -34.276 1.657   -79.663 1.00 91.01  ? 310 ARG D N   1 
ATOM   8511 C CA  . ARG D 1 298 ? -33.313 1.477   -80.754 1.00 91.27  ? 310 ARG D CA  1 
ATOM   8512 C C   . ARG D 1 298 ? -33.959 1.690   -82.128 1.00 100.12 ? 310 ARG D C   1 
ATOM   8513 O O   . ARG D 1 298 ? -33.249 1.934   -83.108 1.00 101.29 ? 310 ARG D O   1 
ATOM   8514 C CB  . ARG D 1 298 ? -32.687 0.080   -80.685 1.00 88.64  ? 310 ARG D CB  1 
ATOM   8515 C CG  . ARG D 1 298 ? -31.692 -0.059  -79.551 1.00 91.95  ? 310 ARG D CG  1 
ATOM   8516 C CD  . ARG D 1 298 ? -31.249 -1.489  -79.386 1.00 91.17  ? 310 ARG D CD  1 
ATOM   8517 N NE  . ARG D 1 298 ? -30.596 -1.708  -78.093 1.00 82.95  ? 310 ARG D NE  1 
ATOM   8518 C CZ  . ARG D 1 298 ? -30.880 -2.707  -77.260 1.00 87.48  ? 310 ARG D CZ  1 
ATOM   8519 N NH1 . ARG D 1 298 ? -31.811 -3.600  -77.573 1.00 75.30  ? 310 ARG D NH1 1 
ATOM   8520 N NH2 . ARG D 1 298 ? -30.227 -2.825  -76.112 1.00 67.15  ? 310 ARG D NH2 1 
ATOM   8521 N N   . ARG D 1 299 ? -35.293 1.583   -82.201 1.00 98.90  ? 311 ARG D N   1 
ATOM   8522 C CA  . ARG D 1 299 ? -36.049 1.835   -83.419 1.00 102.50 ? 311 ARG D CA  1 
ATOM   8523 C C   . ARG D 1 299 ? -36.690 3.239   -83.370 1.00 109.55 ? 311 ARG D C   1 
ATOM   8524 O O   . ARG D 1 299 ? -37.612 3.534   -84.141 1.00 112.84 ? 311 ARG D O   1 
ATOM   8525 C CB  . ARG D 1 299 ? -37.081 0.729   -83.627 1.00 104.28 ? 311 ARG D CB  1 
ATOM   8526 C CG  . ARG D 1 299 ? -36.512 -0.408  -84.454 1.00 117.11 ? 311 ARG D CG  1 
ATOM   8527 C CD  . ARG D 1 299 ? -36.888 -1.763  -83.904 1.00 130.90 ? 311 ARG D CD  1 
ATOM   8528 N NE  . ARG D 1 299 ? -36.860 -2.803  -84.936 1.00 143.46 ? 311 ARG D NE  1 
ATOM   8529 C CZ  . ARG D 1 299 ? -37.901 -3.151  -85.693 1.00 159.92 ? 311 ARG D CZ  1 
ATOM   8530 N NH1 . ARG D 1 299 ? -39.074 -2.546  -85.543 1.00 146.38 ? 311 ARG D NH1 1 
ATOM   8531 N NH2 . ARG D 1 299 ? -37.777 -4.109  -86.603 1.00 148.96 ? 311 ARG D NH2 1 
ATOM   8532 N N   . LYS D 1 300 ? -36.154 4.107   -82.468 1.00 104.22 ? 312 LYS D N   1 
ATOM   8533 C CA  . LYS D 1 300 ? -36.489 5.523   -82.248 1.00 125.69 ? 312 LYS D CA  1 
ATOM   8534 C C   . LYS D 1 300 ? -37.948 5.696   -81.836 1.00 147.38 ? 312 LYS D C   1 
ATOM   8535 O O   . LYS D 1 300 ? -38.299 5.440   -80.683 1.00 102.34 ? 312 LYS D O   1 
ATOM   8536 C CB  . LYS D 1 300 ? -36.183 6.382   -83.481 1.00 130.46 ? 312 LYS D CB  1 
ATOM   8537 C CG  . LYS D 1 300 ? -34.738 6.282   -83.953 1.00 137.94 ? 312 LYS D CG  1 
ATOM   8538 C CD  . LYS D 1 300 ? -34.649 6.413   -85.456 1.00 147.05 ? 312 LYS D CD  1 
ATOM   8539 C CE  . LYS D 1 300 ? -34.550 7.847   -85.929 1.00 153.79 ? 312 LYS D CE  1 
ATOM   8540 N NZ  . LYS D 1 300 ? -33.371 8.073   -86.816 1.00 157.99 ? 312 LYS D NZ  1 
HETATM 8541 O O   . HOH E 2 .   ? 26.295  13.676  -11.415 1.00 43.33  ? 1   HOH A O   1 
HETATM 8542 O O   . HOH E 2 .   ? 0.173   25.061  -23.675 1.00 36.15  ? 2   HOH A O   1 
HETATM 8543 O O   . HOH E 2 .   ? 15.616  38.056  -34.664 1.00 49.06  ? 3   HOH A O   1 
HETATM 8544 O O   . HOH E 2 .   ? 8.831   11.188  -25.737 1.00 30.89  ? 4   HOH A O   1 
HETATM 8545 O O   . HOH E 2 .   ? 11.189  29.104  -16.981 1.00 38.96  ? 5   HOH A O   1 
HETATM 8546 O O   . HOH E 2 .   ? -0.506  22.656  -22.763 1.00 32.71  ? 6   HOH A O   1 
HETATM 8547 O O   . HOH E 2 .   ? 25.283  26.358  -21.868 1.00 46.26  ? 7   HOH A O   1 
HETATM 8548 O O   . HOH E 2 .   ? -1.267  18.239  -27.574 1.00 30.69  ? 8   HOH A O   1 
HETATM 8549 O O   . HOH E 2 .   ? 20.599  18.401  -29.190 1.00 27.71  ? 9   HOH A O   1 
HETATM 8550 O O   . HOH E 2 .   ? -8.186  36.455  -43.996 1.00 60.74  ? 10  HOH A O   1 
HETATM 8551 O O   . HOH E 2 .   ? 8.323   13.909  -25.144 1.00 36.13  ? 11  HOH A O   1 
HETATM 8552 O O   . HOH E 2 .   ? -1.682  22.042  -33.682 1.00 42.52  ? 12  HOH A O   1 
HETATM 8553 O O   . HOH E 2 .   ? 7.332   16.891  -31.789 1.00 43.37  ? 313 HOH A O   1 
HETATM 8554 O O   . HOH E 2 .   ? 23.595  28.677  -34.008 1.00 47.24  ? 314 HOH A O   1 
HETATM 8555 O O   . HOH E 2 .   ? 24.727  21.435  -20.422 1.00 52.35  ? 315 HOH A O   1 
HETATM 8556 O O   . HOH E 2 .   ? 17.025  26.368  -34.269 1.00 42.10  ? 316 HOH A O   1 
HETATM 8557 O O   . HOH E 2 .   ? 1.910   -1.132  -14.040 1.00 43.95  ? 317 HOH A O   1 
HETATM 8558 O O   . HOH E 2 .   ? 5.330   4.928   -36.291 1.00 71.87  ? 318 HOH A O   1 
HETATM 8559 O O   . HOH E 2 .   ? 6.704   18.382  -9.317  1.00 42.58  ? 319 HOH A O   1 
HETATM 8560 O O   . HOH E 2 .   ? 6.464   -3.533  -13.103 1.00 50.51  ? 320 HOH A O   1 
HETATM 8561 O O   . HOH E 2 .   ? 46.813  -2.467  -16.841 1.00 52.14  ? 321 HOH A O   1 
HETATM 8562 O O   . HOH E 2 .   ? 20.365  15.894  -28.025 1.00 40.68  ? 322 HOH A O   1 
HETATM 8563 O O   . HOH E 2 .   ? 5.782   20.213  -11.632 1.00 40.41  ? 323 HOH A O   1 
HETATM 8564 O O   . HOH E 2 .   ? 0.749   31.568  -12.246 1.00 58.18  ? 324 HOH A O   1 
HETATM 8565 O O   . HOH E 2 .   ? 19.671  23.573  -36.213 1.00 48.37  ? 325 HOH A O   1 
HETATM 8566 O O   . HOH E 2 .   ? 0.929   17.096  -28.249 1.00 26.05  ? 326 HOH A O   1 
HETATM 8567 O O   . HOH E 2 .   ? -3.082  16.436  -28.647 1.00 36.47  ? 327 HOH A O   1 
HETATM 8568 O O   . HOH E 2 .   ? -8.867  27.817  -40.733 1.00 51.27  ? 328 HOH A O   1 
HETATM 8569 O O   . HOH E 2 .   ? -2.561  13.618  -18.867 1.00 37.35  ? 329 HOH A O   1 
HETATM 8570 O O   . HOH E 2 .   ? -9.114  8.360   -20.168 1.00 58.82  ? 330 HOH A O   1 
HETATM 8571 O O   . HOH E 2 .   ? 19.148  14.967  -20.204 1.00 39.66  ? 331 HOH A O   1 
HETATM 8572 O O   . HOH E 2 .   ? -14.003 38.112  -34.124 1.00 114.63 ? 332 HOH A O   1 
HETATM 8573 O O   . HOH E 2 .   ? -5.097  38.327  -27.401 1.00 66.32  ? 333 HOH A O   1 
HETATM 8574 O O   . HOH E 2 .   ? 19.231  22.429  -33.444 1.00 29.62  ? 334 HOH A O   1 
HETATM 8575 O O   . HOH E 2 .   ? -2.417  16.950  -31.159 1.00 56.43  ? 335 HOH A O   1 
HETATM 8576 O O   . HOH E 2 .   ? 36.748  10.952  -6.497  1.00 31.51  ? 336 HOH A O   1 
HETATM 8577 O O   . HOH E 2 .   ? 48.481  6.342   -12.147 1.00 75.64  ? 337 HOH A O   1 
HETATM 8578 O O   . HOH E 2 .   ? 10.861  -8.864  -22.599 1.00 68.92  ? 338 HOH A O   1 
HETATM 8579 O O   . HOH E 2 .   ? -19.780 33.690  -33.362 1.00 52.13  ? 339 HOH A O   1 
HETATM 8580 O O   . HOH E 2 .   ? 12.929  7.676   -23.508 1.00 58.93  ? 340 HOH A O   1 
HETATM 8581 O O   . HOH E 2 .   ? 7.127   25.721  -21.046 1.00 30.68  ? 341 HOH A O   1 
HETATM 8582 O O   . HOH E 2 .   ? 6.029   31.381  -32.398 1.00 29.26  ? 342 HOH A O   1 
HETATM 8583 O O   . HOH E 2 .   ? -17.137 28.853  -44.733 1.00 53.34  ? 343 HOH A O   1 
HETATM 8584 O O   . HOH E 2 .   ? 11.641  31.875  -20.332 1.00 46.22  ? 344 HOH A O   1 
HETATM 8585 O O   . HOH E 2 .   ? 47.655  -11.904 -20.101 1.00 82.79  ? 345 HOH A O   1 
HETATM 8586 O O   . HOH E 2 .   ? 5.038   28.223  -38.533 1.00 48.11  ? 346 HOH A O   1 
HETATM 8587 O O   . HOH E 2 .   ? 0.451   40.131  -35.714 1.00 76.12  ? 347 HOH A O   1 
HETATM 8588 O O   . HOH E 2 .   ? 7.782   10.072  -31.665 1.00 60.06  ? 348 HOH A O   1 
HETATM 8589 O O   . HOH E 2 .   ? -4.676  35.844  -36.039 1.00 51.74  ? 349 HOH A O   1 
HETATM 8590 O O   . HOH E 2 .   ? 5.329   37.731  -38.701 1.00 85.14  ? 350 HOH A O   1 
HETATM 8591 O O   . HOH E 2 .   ? -14.784 37.106  -19.109 1.00 61.63  ? 351 HOH A O   1 
HETATM 8592 O O   . HOH E 2 .   ? -5.279  5.257   -39.488 1.00 65.88  ? 352 HOH A O   1 
HETATM 8593 O O   . HOH E 2 .   ? -16.042 24.193  -39.758 1.00 39.32  ? 353 HOH A O   1 
HETATM 8594 O O   . HOH E 2 .   ? -3.598  39.845  -29.266 1.00 64.57  ? 354 HOH A O   1 
HETATM 8595 O O   . HOH E 2 .   ? -9.422  7.115   -27.886 1.00 63.63  ? 355 HOH A O   1 
HETATM 8596 O O   . HOH E 2 .   ? 20.109  15.479  -24.881 1.00 55.14  ? 356 HOH A O   1 
HETATM 8597 O O   . HOH E 2 .   ? 2.672   26.298  -22.365 1.00 39.09  ? 357 HOH A O   1 
HETATM 8598 O O   . HOH E 2 .   ? 17.782  30.451  -21.861 1.00 45.70  ? 358 HOH A O   1 
HETATM 8599 O O   . HOH E 2 .   ? -8.701  20.768  -37.731 1.00 57.82  ? 359 HOH A O   1 
HETATM 8600 O O   . HOH E 2 .   ? 18.895  21.602  -15.467 1.00 44.71  ? 360 HOH A O   1 
HETATM 8601 O O   . HOH E 2 .   ? 8.520   -7.787  -24.871 1.00 74.46  ? 361 HOH A O   1 
HETATM 8602 O O   . HOH E 2 .   ? -6.070  35.839  -41.947 1.00 52.70  ? 362 HOH A O   1 
HETATM 8603 O O   . HOH E 2 .   ? -1.483  32.102  -26.537 1.00 52.49  ? 363 HOH A O   1 
HETATM 8604 O O   . HOH E 2 .   ? -0.409  -3.966  -36.300 1.00 75.50  ? 364 HOH A O   1 
HETATM 8605 O O   . HOH E 2 .   ? 6.984   33.925  -31.780 1.00 44.58  ? 365 HOH A O   1 
HETATM 8606 O O   . HOH E 2 .   ? 29.512  12.415  -24.239 1.00 68.78  ? 366 HOH A O   1 
HETATM 8607 O O   . HOH E 2 .   ? 2.615   38.731  -36.120 1.00 66.94  ? 367 HOH A O   1 
HETATM 8608 O O   . HOH E 2 .   ? 3.921   27.448  -13.627 1.00 43.14  ? 368 HOH A O   1 
HETATM 8609 O O   . HOH E 2 .   ? -3.040  8.644   -23.171 1.00 41.63  ? 369 HOH A O   1 
HETATM 8610 O O   . HOH E 2 .   ? -8.580  4.540   -26.574 1.00 50.92  ? 370 HOH A O   1 
HETATM 8611 O O   . HOH E 2 .   ? 18.155  26.745  -16.181 1.00 58.36  ? 371 HOH A O   1 
HETATM 8612 O O   . HOH E 2 .   ? -16.319 37.945  -38.877 1.00 45.10  ? 372 HOH A O   1 
HETATM 8613 O O   . HOH E 2 .   ? 14.968  12.130  -14.422 1.00 36.44  ? 373 HOH A O   1 
HETATM 8614 O O   . HOH E 2 .   ? 33.575  10.463  -15.680 1.00 60.70  ? 374 HOH A O   1 
HETATM 8615 O O   . HOH E 2 .   ? 7.047   36.327  -28.515 1.00 49.86  ? 375 HOH A O   1 
HETATM 8616 O O   . HOH E 2 .   ? 4.853   29.712  -21.848 1.00 62.63  ? 376 HOH A O   1 
HETATM 8617 O O   . HOH E 2 .   ? -10.826 34.571  -42.058 1.00 42.77  ? 377 HOH A O   1 
HETATM 8618 O O   . HOH E 2 .   ? 33.715  -0.164  -14.428 1.00 48.98  ? 378 HOH A O   1 
HETATM 8619 O O   . HOH E 2 .   ? 4.463   23.389  -29.141 1.00 54.53  ? 379 HOH A O   1 
HETATM 8620 O O   . HOH E 2 .   ? 12.853  30.795  -15.696 1.00 51.57  ? 380 HOH A O   1 
HETATM 8621 O O   . HOH E 2 .   ? 38.146  2.294   -16.039 1.00 50.13  ? 381 HOH A O   1 
HETATM 8622 O O   . HOH E 2 .   ? 14.748  36.768  -32.090 1.00 65.99  ? 382 HOH A O   1 
HETATM 8623 O O   . HOH E 2 .   ? -2.054  4.716   -35.193 1.00 55.79  ? 383 HOH A O   1 
HETATM 8624 O O   . HOH E 2 .   ? -4.406  11.367  -22.799 1.00 57.63  ? 384 HOH A O   1 
HETATM 8625 O O   . HOH E 2 .   ? -15.316 35.925  -34.993 1.00 65.74  ? 385 HOH A O   1 
HETATM 8626 O O   . HOH E 2 .   ? 8.884   15.368  -8.217  1.00 40.92  ? 386 HOH A O   1 
HETATM 8627 O O   . HOH E 2 .   ? -15.581 14.395  -40.665 1.00 62.61  ? 387 HOH A O   1 
HETATM 8628 O O   . HOH E 2 .   ? 2.375   28.849  -22.296 1.00 50.13  ? 388 HOH A O   1 
HETATM 8629 O O   . HOH E 2 .   ? -15.740 11.242  -36.619 1.00 59.35  ? 389 HOH A O   1 
HETATM 8630 O O   . HOH E 2 .   ? 17.351  24.780  -13.780 1.00 62.34  ? 390 HOH A O   1 
HETATM 8631 O O   . HOH E 2 .   ? 22.199  22.535  -33.027 1.00 32.69  ? 391 HOH A O   1 
HETATM 8632 O O   . HOH E 2 .   ? 5.433   26.270  -41.250 1.00 55.10  ? 392 HOH A O   1 
HETATM 8633 O O   . HOH E 2 .   ? 0.143   17.427  -8.482  1.00 47.24  ? 393 HOH A O   1 
HETATM 8634 O O   . HOH E 2 .   ? 20.929  15.247  -32.790 1.00 44.42  ? 394 HOH A O   1 
HETATM 8635 O O   . HOH E 2 .   ? 22.136  27.838  -36.456 1.00 51.70  ? 395 HOH A O   1 
HETATM 8636 O O   . HOH E 2 .   ? -8.009  39.853  -25.579 1.00 62.94  ? 396 HOH A O   1 
HETATM 8637 O O   . HOH E 2 .   ? 23.366  20.043  -32.781 1.00 43.49  ? 397 HOH A O   1 
HETATM 8638 O O   . HOH E 2 .   ? 18.705  15.292  -30.567 1.00 39.98  ? 398 HOH A O   1 
HETATM 8639 O O   . HOH E 2 .   ? 19.420  19.516  -33.510 1.00 51.88  ? 399 HOH A O   1 
HETATM 8640 O O   . HOH E 2 .   ? 15.775  20.112  -10.075 1.00 43.99  ? 400 HOH A O   1 
HETATM 8641 O O   . HOH E 2 .   ? 20.937  18.121  -31.830 1.00 47.49  ? 401 HOH A O   1 
HETATM 8642 O O   . HOH E 2 .   ? 20.318  40.539  -28.485 1.00 54.79  ? 402 HOH A O   1 
HETATM 8643 O O   . HOH E 2 .   ? -0.725  23.073  -19.168 1.00 34.14  ? 403 HOH A O   1 
HETATM 8644 O O   . HOH E 2 .   ? 25.485  16.122  -19.288 1.00 46.60  ? 404 HOH A O   1 
HETATM 8645 O O   . HOH E 2 .   ? 2.595   -10.510 -28.559 1.00 52.19  ? 405 HOH A O   1 
HETATM 8646 O O   . HOH E 2 .   ? -5.107  -5.375  -21.792 1.00 48.12  ? 406 HOH A O   1 
HETATM 8647 O O   . HOH E 2 .   ? 5.187   -11.625 -24.986 1.00 63.52  ? 407 HOH A O   1 
HETATM 8648 O O   . HOH E 2 .   ? 7.143   9.491   -29.148 1.00 50.59  ? 408 HOH A O   1 
HETATM 8649 O O   . HOH E 2 .   ? -8.181  11.300  -28.050 1.00 48.90  ? 409 HOH A O   1 
HETATM 8650 O O   . HOH E 2 .   ? 6.058   -6.047  -17.579 1.00 46.01  ? 410 HOH A O   1 
HETATM 8651 O O   . HOH E 2 .   ? 14.014  1.110   -16.014 1.00 30.27  ? 411 HOH A O   1 
HETATM 8652 O O   . HOH E 2 .   ? 0.931   -7.286  -29.851 1.00 62.71  ? 412 HOH A O   1 
HETATM 8653 O O   . HOH E 2 .   ? 12.147  7.727   -31.487 1.00 53.67  ? 413 HOH A O   1 
HETATM 8654 O O   . HOH E 2 .   ? -0.426  -16.960 -22.325 1.00 78.52  ? 414 HOH A O   1 
HETATM 8655 O O   . HOH E 2 .   ? 4.615   16.965  -31.184 1.00 44.93  ? 415 HOH A O   1 
HETATM 8656 O O   . HOH E 2 .   ? -9.020  9.274   -25.291 1.00 53.97  ? 416 HOH A O   1 
HETATM 8657 O O   . HOH E 2 .   ? -23.086 35.556  -29.146 1.00 46.87  ? 417 HOH A O   1 
HETATM 8658 O O   . HOH E 2 .   ? -11.043 20.206  -39.510 1.00 59.74  ? 418 HOH A O   1 
HETATM 8659 O O   . HOH E 2 .   ? -7.057  1.507   -23.403 1.00 54.72  ? 419 HOH A O   1 
HETATM 8660 O O   . HOH E 2 .   ? -23.488 16.337  -29.408 1.00 62.07  ? 420 HOH A O   1 
HETATM 8661 O O   . HOH E 2 .   ? -25.573 27.512  -18.394 1.00 58.40  ? 421 HOH A O   1 
HETATM 8662 O O   . HOH E 2 .   ? 42.306  4.312   -3.670  1.00 65.11  ? 422 HOH A O   1 
HETATM 8663 O O   . HOH E 2 .   ? -13.667 30.042  -14.206 1.00 60.53  ? 423 HOH A O   1 
HETATM 8664 O O   . HOH E 2 .   ? -16.292 37.328  -27.564 1.00 41.63  ? 424 HOH A O   1 
HETATM 8665 O O   . HOH E 2 .   ? -15.295 10.271  -41.551 1.00 67.14  ? 425 HOH A O   1 
HETATM 8666 O O   . HOH E 2 .   ? -11.246 21.367  -36.394 1.00 51.06  ? 426 HOH A O   1 
HETATM 8667 O O   . HOH E 2 .   ? -13.920 13.311  -42.394 1.00 50.58  ? 427 HOH A O   1 
HETATM 8668 O O   . HOH E 2 .   ? -6.453  14.313  -21.087 1.00 52.06  ? 428 HOH A O   1 
HETATM 8669 O O   . HOH E 2 .   ? 1.503   33.832  -18.397 1.00 73.59  ? 429 HOH A O   1 
HETATM 8670 O O   . HOH E 2 .   ? 2.571   37.699  -38.708 1.00 52.12  ? 430 HOH A O   1 
HETATM 8671 O O   . HOH E 2 .   ? 9.973   12.328  -3.845  1.00 55.36  ? 431 HOH A O   1 
HETATM 8672 O O   . HOH E 2 .   ? 4.227   26.309  -11.266 1.00 67.45  ? 432 HOH A O   1 
HETATM 8673 O O   . HOH E 2 .   ? 2.660   4.963   -36.820 1.00 67.19  ? 433 HOH A O   1 
HETATM 8674 O O   . HOH E 2 .   ? -6.069  40.806  -27.855 1.00 60.75  ? 434 HOH A O   1 
HETATM 8675 O O   . HOH E 2 .   ? 2.541   29.978  -13.636 1.00 50.11  ? 435 HOH A O   1 
HETATM 8676 O O   . HOH E 2 .   ? -4.703  27.925  -41.396 1.00 63.46  ? 436 HOH A O   1 
HETATM 8677 O O   . HOH E 2 .   ? -26.497 28.972  -25.568 1.00 56.26  ? 437 HOH A O   1 
HETATM 8678 O O   . HOH E 2 .   ? -15.135 10.969  -24.378 1.00 71.15  ? 438 HOH A O   1 
HETATM 8679 O O   . HOH E 2 .   ? 25.947  18.779  -19.516 1.00 62.81  ? 439 HOH A O   1 
HETATM 8680 O O   . HOH E 2 .   ? -6.804  27.938  -8.189  1.00 53.46  ? 440 HOH A O   1 
HETATM 8681 O O   . HOH E 2 .   ? 5.976   12.059  -33.300 1.00 56.04  ? 441 HOH A O   1 
HETATM 8682 O O   . HOH E 2 .   ? 27.063  13.775  -35.713 1.00 76.92  ? 442 HOH A O   1 
HETATM 8683 O O   . HOH E 2 .   ? -6.846  32.653  -11.229 1.00 72.80  ? 443 HOH A O   1 
HETATM 8684 O O   . HOH E 2 .   ? -19.617 35.610  -35.158 1.00 77.57  ? 444 HOH A O   1 
HETATM 8685 O O   . HOH E 2 .   ? 11.305  35.049  -39.618 1.00 45.95  ? 445 HOH A O   1 
HETATM 8686 O O   . HOH E 2 .   ? -12.180 26.088  -46.737 1.00 31.42  ? 446 HOH A O   1 
HETATM 8687 O O   . HOH E 2 .   ? -13.414 10.977  -43.198 1.00 59.06  ? 447 HOH A O   1 
HETATM 8688 O O   . HOH E 2 .   ? 12.567  32.774  -39.129 1.00 31.99  ? 448 HOH A O   1 
HETATM 8689 O O   . HOH E 2 .   ? -13.419 22.217  -39.732 1.00 48.64  ? 449 HOH A O   1 
HETATM 8690 O O   . HOH E 2 .   ? 8.215   -1.264  -13.482 1.00 41.27  ? 450 HOH A O   1 
HETATM 8691 O O   . HOH E 2 .   ? -1.302  11.087  -14.259 1.00 7.92   ? 451 HOH A O   1 
HETATM 8692 O O   . HOH E 2 .   ? 0.558   8.352   -12.435 1.00 48.73  ? 452 HOH A O   1 
HETATM 8693 O O   . HOH E 2 .   ? 10.556  -6.529  -23.586 1.00 48.28  ? 453 HOH A O   1 
HETATM 8694 O O   . HOH E 2 .   ? -13.069 27.556  -13.292 1.00 49.41  ? 454 HOH A O   1 
HETATM 8695 O O   . HOH E 2 .   ? -0.125  18.587  -11.244 1.00 38.36  ? 455 HOH A O   1 
HETATM 8696 O O   . HOH E 2 .   ? 30.957  11.077  -8.087  1.00 58.49  ? 456 HOH A O   1 
HETATM 8697 O O   . HOH E 2 .   ? -15.197 26.873  -15.950 1.00 56.86  ? 457 HOH A O   1 
HETATM 8698 O O   . HOH E 2 .   ? 12.819  -7.257  -22.517 1.00 48.97  ? 458 HOH A O   1 
HETATM 8699 O O   . HOH E 2 .   ? 38.679  16.532  -25.159 1.00 50.07  ? 459 HOH A O   1 
HETATM 8700 O O   . HOH E 2 .   ? -3.892  23.363  -37.989 1.00 63.16  ? 460 HOH A O   1 
HETATM 8701 O O   . HOH E 2 .   ? 2.008   24.912  -31.926 1.00 32.24  ? 461 HOH A O   1 
HETATM 8702 O O   . HOH E 2 .   ? 14.243  16.302  -31.447 1.00 42.30  ? 462 HOH A O   1 
HETATM 8703 O O   . HOH E 2 .   ? -9.073  28.548  -43.222 1.00 35.49  ? 463 HOH A O   1 
HETATM 8704 O O   . HOH E 2 .   ? 17.165  24.166  -32.557 1.00 29.92  ? 464 HOH A O   1 
HETATM 8705 O O   . HOH F 2 .   ? -1.703  24.197  -46.180 1.00 55.00  ? 1   HOH B O   1 
HETATM 8706 O O   . HOH F 2 .   ? -1.389  22.836  -58.935 1.00 37.69  ? 2   HOH B O   1 
HETATM 8707 O O   . HOH F 2 .   ? -17.009 36.973  -49.181 1.00 38.07  ? 3   HOH B O   1 
HETATM 8708 O O   . HOH F 2 .   ? -9.972  9.207   -55.199 1.00 33.53  ? 4   HOH B O   1 
HETATM 8709 O O   . HOH F 2 .   ? -12.566 25.977  -65.984 1.00 47.74  ? 5   HOH B O   1 
HETATM 8710 O O   . HOH F 2 .   ? -0.713  20.351  -59.547 1.00 28.38  ? 6   HOH B O   1 
HETATM 8711 O O   . HOH F 2 .   ? -26.602 23.756  -60.609 1.00 45.95  ? 7   HOH B O   1 
HETATM 8712 O O   . HOH F 2 .   ? 0.073   16.620  -54.302 1.00 33.70  ? 8   HOH B O   1 
HETATM 8713 O O   . HOH F 2 .   ? -21.790 16.781  -52.488 1.00 28.64  ? 9   HOH B O   1 
HETATM 8714 O O   . HOH F 2 .   ? 6.916   36.580  -40.191 1.00 58.14  ? 10  HOH B O   1 
HETATM 8715 O O   . HOH F 2 .   ? -9.485  11.889  -56.116 1.00 38.34  ? 11  HOH B O   1 
HETATM 8716 O O   . HOH F 2 .   ? 0.529   21.085  -48.588 1.00 36.25  ? 12  HOH B O   1 
HETATM 8717 O O   . HOH F 2 .   ? 15.853  16.087  -68.794 1.00 51.59  ? 313 HOH B O   1 
HETATM 8718 O O   . HOH F 2 .   ? -19.382 24.211  -43.286 1.00 56.31  ? 314 HOH B O   1 
HETATM 8719 O O   . HOH F 2 .   ? -12.491 34.853  -44.154 1.00 43.53  ? 315 HOH B O   1 
HETATM 8720 O O   . HOH F 2 .   ? 11.065  26.871  -36.063 1.00 27.22  ? 316 HOH B O   1 
HETATM 8721 O O   . HOH F 2 .   ? 12.657  13.115  -38.938 1.00 63.00  ? 317 HOH B O   1 
HETATM 8722 O O   . HOH F 2 .   ? -13.650 32.450  -44.424 1.00 50.08  ? 318 HOH B O   1 
HETATM 8723 O O   . HOH F 2 .   ? -14.137 37.115  -44.140 1.00 46.69  ? 319 HOH B O   1 
HETATM 8724 O O   . HOH F 2 .   ? 7.630   12.854  -37.593 1.00 56.17  ? 320 HOH B O   1 
HETATM 8725 O O   . HOH F 2 .   ? -19.319 24.903  -45.986 1.00 37.25  ? 321 HOH B O   1 
HETATM 8726 O O   . HOH F 2 .   ? -8.478  15.677  -49.859 1.00 51.65  ? 322 HOH B O   1 
HETATM 8727 O O   . HOH F 2 .   ? -24.686 27.442  -48.887 1.00 55.56  ? 323 HOH B O   1 
HETATM 8728 O O   . HOH F 2 .   ? -26.004 18.629  -61.458 1.00 55.65  ? 324 HOH B O   1 
HETATM 8729 O O   . HOH F 2 .   ? -18.209 25.320  -48.382 1.00 30.71  ? 325 HOH B O   1 
HETATM 8730 O O   . HOH F 2 .   ? -8.137  13.979  -72.574 1.00 41.93  ? 326 HOH B O   1 
HETATM 8731 O O   . HOH F 2 .   ? -21.592 14.092  -53.410 1.00 44.74  ? 327 HOH B O   1 
HETATM 8732 O O   . HOH F 2 .   ? -7.100  16.526  -70.318 1.00 58.80  ? 328 HOH B O   1 
HETATM 8733 O O   . HOH F 2 .   ? 21.795  14.481  -61.278 1.00 67.50  ? 329 HOH B O   1 
HETATM 8734 O O   . HOH F 2 .   ? 7.841   18.807  -71.263 1.00 56.37  ? 330 HOH B O   1 
HETATM 8735 O O   . HOH F 2 .   ? -20.997 22.475  -46.312 1.00 50.96  ? 331 HOH B O   1 
HETATM 8736 O O   . HOH F 2 .   ? -2.147  15.543  -53.461 1.00 44.96  ? 332 HOH B O   1 
HETATM 8737 O O   . HOH F 2 .   ? 7.829   27.706  -42.290 1.00 46.36  ? 333 HOH B O   1 
HETATM 8738 O O   . HOH F 2 .   ? -33.859 18.406  -59.213 1.00 58.64  ? 334 HOH B O   1 
HETATM 8739 O O   . HOH F 2 .   ? 1.385   11.047  -62.423 1.00 64.14  ? 335 HOH B O   1 
HETATM 8740 O O   . HOH F 2 .   ? 8.082   6.339   -60.584 1.00 67.36  ? 336 HOH B O   1 
HETATM 8741 O O   . HOH F 2 .   ? -20.361 12.323  -60.965 1.00 56.49  ? 337 HOH B O   1 
HETATM 8742 O O   . HOH F 2 .   ? 13.058  36.601  -47.276 1.00 69.00  ? 338 HOH B O   1 
HETATM 8743 O O   . HOH F 2 .   ? -20.378 21.232  -48.686 1.00 38.97  ? 339 HOH B O   1 
HETATM 8744 O O   . HOH F 2 .   ? -49.342 3.102   -67.853 1.00 69.02  ? 340 HOH B O   1 
HETATM 8745 O O   . HOH F 2 .   ? -20.163 10.085  -53.887 1.00 64.67  ? 341 HOH B O   1 
HETATM 8746 O O   . HOH F 2 .   ? 18.468  32.591  -50.218 1.00 58.06  ? 342 HOH B O   1 
HETATM 8747 O O   . HOH F 2 .   ? -15.566 6.049   -66.171 1.00 39.25  ? 343 HOH B O   1 
HETATM 8748 O O   . HOH F 2 .   ? -7.204  30.127  -50.972 1.00 38.73  ? 344 HOH B O   1 
HETATM 8749 O O   . HOH F 2 .   ? -24.299 27.531  -62.442 1.00 63.40  ? 345 HOH B O   1 
HETATM 8750 O O   . HOH F 2 .   ? -23.374 20.967  -49.284 1.00 39.24  ? 346 HOH B O   1 
HETATM 8751 O O   . HOH F 2 .   ? -16.496 16.302  -66.930 1.00 31.54  ? 347 HOH B O   1 
HETATM 8752 O O   . HOH F 2 .   ? -48.754 -13.723 -58.132 1.00 63.55  ? 348 HOH B O   1 
HETATM 8753 O O   . HOH F 2 .   ? -25.381 11.515  -60.249 1.00 62.83  ? 349 HOH B O   1 
HETATM 8754 O O   . HOH F 2 .   ? -8.859  8.875   -49.255 1.00 56.01  ? 350 HOH B O   1 
HETATM 8755 O O   . HOH F 2 .   ? 3.511   35.046  -47.858 1.00 48.16  ? 351 HOH B O   1 
HETATM 8756 O O   . HOH F 2 .   ? 13.543  34.225  -64.942 1.00 66.35  ? 352 HOH B O   1 
HETATM 8757 O O   . HOH F 2 .   ? -12.523 29.538  -63.128 1.00 55.44  ? 353 HOH B O   1 
HETATM 8758 O O   . HOH F 2 .   ? 14.996  24.012  -42.828 1.00 38.50  ? 354 HOH B O   1 
HETATM 8759 O O   . HOH F 2 .   ? -21.330 13.407  -56.433 1.00 48.49  ? 355 HOH B O   1 
HETATM 8760 O O   . HOH F 2 .   ? 12.759  -0.855  -65.417 1.00 72.68  ? 356 HOH B O   1 
HETATM 8761 O O   . HOH F 2 .   ? 4.922   35.812  -42.048 1.00 63.35  ? 357 HOH B O   1 
HETATM 8762 O O   . HOH F 2 .   ? 0.244   30.358  -56.867 1.00 60.01  ? 358 HOH B O   1 
HETATM 8763 O O   . HOH F 2 .   ? 3.800   37.927  -47.519 1.00 61.27  ? 359 HOH B O   1 
HETATM 8764 O O   . HOH F 2 .   ? -8.173  32.615  -51.852 1.00 43.79  ? 360 HOH B O   1 
HETATM 8765 O O   . HOH F 2 .   ? -5.260  24.035  -69.147 1.00 54.49  ? 361 HOH B O   1 
HETATM 8766 O O   . HOH F 2 .   ? 1.882   38.839  -45.933 1.00 64.95  ? 362 HOH B O   1 
HETATM 8767 O O   . HOH F 2 .   ? 22.641  28.049  -64.624 1.00 57.93  ? 363 HOH B O   1 
HETATM 8768 O O   . HOH F 2 .   ? -3.202  23.645  -50.727 1.00 37.82  ? 364 HOH B O   1 
HETATM 8769 O O   . HOH F 2 .   ? -16.222 8.548   -66.298 1.00 46.28  ? 365 HOH B O   1 
HETATM 8770 O O   . HOH F 2 .   ? -8.167  34.593  -55.455 1.00 52.09  ? 366 HOH B O   1 
HETATM 8771 O O   . HOH F 2 .   ? -6.154  27.200  -61.270 1.00 48.60  ? 367 HOH B O   1 
HETATM 8772 O O   . HOH F 2 .   ? 19.537  32.283  -52.433 1.00 62.61  ? 368 HOH B O   1 
HETATM 8773 O O   . HOH F 2 .   ? 9.708   34.564  -41.806 1.00 38.47  ? 369 HOH B O   1 
HETATM 8774 O O   . HOH F 2 .   ? -35.036 -3.616  -65.215 1.00 70.88  ? 370 HOH B O   1 
HETATM 8775 O O   . HOH F 2 .   ? -5.671  21.852  -53.258 1.00 38.57  ? 371 HOH B O   1 
HETATM 8776 O O   . HOH F 2 .   ? 0.091   21.809  -45.561 1.00 58.05  ? 372 HOH B O   1 
HETATM 8777 O O   . HOH F 2 .   ? 5.802   7.455   -59.829 1.00 62.66  ? 373 HOH B O   1 
HETATM 8778 O O   . HOH F 2 .   ? 6.572   10.049  -35.997 1.00 70.69  ? 374 HOH B O   1 
HETATM 8779 O O   . HOH F 2 .   ? -14.232 27.469  -67.514 1.00 56.59  ? 375 HOH B O   1 
HETATM 8780 O O   . HOH F 2 .   ? -22.475 13.424  -72.408 1.00 60.43  ? 376 HOH B O   1 
HETATM 8781 O O   . HOH F 2 .   ? -3.711  23.740  -59.955 1.00 46.76  ? 377 HOH B O   1 
HETATM 8782 O O   . HOH F 2 .   ? -3.218  23.466  -48.149 1.00 47.28  ? 378 HOH B O   1 
HETATM 8783 O O   . HOH F 2 .   ? 1.694   14.963  -52.574 1.00 40.04  ? 379 HOH B O   1 
HETATM 8784 O O   . HOH F 2 .   ? 14.045  35.051  -49.195 1.00 46.34  ? 380 HOH B O   1 
HETATM 8785 O O   . HOH F 2 .   ? -8.169  11.377  -72.781 1.00 70.58  ? 381 HOH B O   1 
HETATM 8786 O O   . HOH F 2 .   ? 14.322  14.211  -40.807 1.00 58.18  ? 382 HOH B O   1 
HETATM 8787 O O   . HOH F 2 .   ? -3.642  26.343  -60.690 1.00 60.74  ? 383 HOH B O   1 
HETATM 8788 O O   . HOH F 2 .   ? -0.307  24.901  -66.111 1.00 42.20  ? 384 HOH B O   1 
HETATM 8789 O O   . HOH F 2 .   ? 13.827  9.975   -43.687 1.00 90.31  ? 385 HOH B O   1 
HETATM 8790 O O   . HOH F 2 .   ? -10.833 11.880  -72.968 1.00 57.83  ? 386 HOH B O   1 
HETATM 8791 O O   . HOH F 2 .   ? -6.717  26.130  -41.409 1.00 56.68  ? 387 HOH B O   1 
HETATM 8792 O O   . HOH F 2 .   ? -22.061 13.728  -48.743 1.00 50.53  ? 388 HOH B O   1 
HETATM 8793 O O   . HOH F 2 .   ? -23.507 29.791  -63.761 1.00 59.38  ? 389 HOH B O   1 
HETATM 8794 O O   . HOH F 2 .   ? -23.234 26.872  -46.429 1.00 72.98  ? 390 HOH B O   1 
HETATM 8795 O O   . HOH F 2 .   ? -15.463 7.653   -71.063 1.00 52.72  ? 391 HOH B O   1 
HETATM 8796 O O   . HOH F 2 .   ? -19.868 13.797  -50.764 1.00 51.99  ? 392 HOH B O   1 
HETATM 8797 O O   . HOH F 2 .   ? -17.725 30.345  -62.102 1.00 47.43  ? 393 HOH B O   1 
HETATM 8798 O O   . HOH F 2 .   ? -9.738  33.971  -53.398 1.00 56.99  ? 394 HOH B O   1 
HETATM 8799 O O   . HOH F 2 .   ? -22.030 16.738  -49.827 1.00 47.91  ? 395 HOH B O   1 
HETATM 8800 O O   . HOH F 2 .   ? -21.932 38.224  -55.868 1.00 56.03  ? 396 HOH B O   1 
HETATM 8801 O O   . HOH F 2 .   ? -26.595 13.265  -62.121 1.00 66.17  ? 397 HOH B O   1 
HETATM 8802 O O   . HOH F 2 .   ? 4.035   15.861  -75.272 1.00 56.07  ? 398 HOH B O   1 
HETATM 8803 O O   . HOH F 2 .   ? -8.387  23.051  -61.658 1.00 41.17  ? 399 HOH B O   1 
HETATM 8804 O O   . HOH F 2 .   ? -19.634 28.025  -61.252 1.00 43.76  ? 400 HOH B O   1 
HETATM 8805 O O   . HOH F 2 .   ? 3.052   22.359  -44.394 1.00 59.66  ? 401 HOH B O   1 
HETATM 8806 O O   . HOH F 2 .   ? -5.557  29.193  -58.181 1.00 39.69  ? 402 HOH B O   1 
HETATM 8807 O O   . HOH F 2 .   ? -24.652 22.579  -62.532 1.00 60.95  ? 403 HOH B O   1 
HETATM 8808 O O   . HOH F 2 .   ? 4.623   5.089   -39.991 1.00 76.16  ? 404 HOH B O   1 
HETATM 8809 O O   . HOH F 2 .   ? 0.867   19.140  -57.882 1.00 35.26  ? 405 HOH B O   1 
HETATM 8810 O O   . HOH F 2 .   ? 5.760   4.184   -42.284 1.00 75.20  ? 406 HOH B O   1 
HETATM 8811 O O   . HOH F 2 .   ? 4.347   23.836  -42.619 1.00 67.41  ? 407 HOH B O   1 
HETATM 8812 O O   . HOH F 2 .   ? -16.575 28.645  -68.879 1.00 55.16  ? 408 HOH B O   1 
HETATM 8813 O O   . HOH F 2 .   ? -47.728 0.506   -73.200 1.00 74.27  ? 409 HOH B O   1 
HETATM 8814 O O   . HOH F 2 .   ? -1.235  31.058  -53.044 1.00 58.40  ? 410 HOH B O   1 
HETATM 8815 O O   . HOH F 2 .   ? -9.545  29.710  -64.463 1.00 58.81  ? 411 HOH B O   1 
HETATM 8816 O O   . HOH F 2 .   ? -2.224  14.248  -51.162 1.00 53.86  ? 412 HOH B O   1 
HETATM 8817 O O   . HOH F 2 .   ? 25.505  25.183  -51.194 1.00 40.53  ? 413 HOH B O   1 
HETATM 8818 O O   . HOH F 2 .   ? 2.014   11.212  -68.855 1.00 52.61  ? 414 HOH B O   1 
HETATM 8819 O O   . HOH F 2 .   ? -3.671  18.123  -69.048 1.00 59.75  ? 415 HOH B O   1 
HETATM 8820 O O   . HOH F 2 .   ? -3.323  25.195  -43.787 1.00 60.89  ? 416 HOH B O   1 
HETATM 8821 O O   . HOH F 2 .   ? 19.697  27.359  -43.507 1.00 52.78  ? 417 HOH B O   1 
HETATM 8822 O O   . HOH F 2 .   ? -2.086  3.631   -47.194 1.00 62.13  ? 418 HOH B O   1 
HETATM 8823 O O   . HOH F 2 .   ? 21.395  19.011  -61.800 1.00 59.72  ? 419 HOH B O   1 
HETATM 8824 O O   . HOH F 2 .   ? 20.555  17.469  -59.718 1.00 63.11  ? 420 HOH B O   1 
HETATM 8825 O O   . HOH F 2 .   ? 12.646  15.145  -66.490 1.00 47.60  ? 421 HOH B O   1 
HETATM 8826 O O   . HOH F 2 .   ? 16.177  20.370  -64.092 1.00 69.49  ? 422 HOH B O   1 
HETATM 8827 O O   . HOH F 2 .   ? 7.041   12.838  -71.515 1.00 60.02  ? 423 HOH B O   1 
HETATM 8828 O O   . HOH F 2 .   ? -15.916 26.705  -47.146 1.00 43.36  ? 424 HOH B O   1 
HETATM 8829 O O   . HOH F 2 .   ? 20.619  15.051  -64.018 1.00 57.00  ? 425 HOH B O   1 
HETATM 8830 O O   . HOH F 2 .   ? -20.324 27.704  -45.379 1.00 55.95  ? 426 HOH B O   1 
HETATM 8831 O O   . HOH F 2 .   ? 20.006  13.687  -55.280 1.00 74.59  ? 427 HOH B O   1 
HETATM 8832 O O   . HOH F 2 .   ? 7.853   15.957  -71.157 1.00 63.33  ? 428 HOH B O   1 
HETATM 8833 O O   . HOH F 2 .   ? 20.683  18.280  -64.806 1.00 66.20  ? 429 HOH B O   1 
HETATM 8834 O O   . HOH F 2 .   ? -24.395 22.533  -47.233 1.00 46.26  ? 430 HOH B O   1 
HETATM 8835 O O   . HOH F 2 .   ? 6.169   -6.478  -64.157 1.00 70.39  ? 431 HOH B O   1 
HETATM 8836 O O   . HOH F 2 .   ? 12.286  17.665  -67.245 1.00 83.38  ? 432 HOH B O   1 
HETATM 8837 O O   . HOH F 2 .   ? 7.158   15.905  -74.598 1.00 61.84  ? 433 HOH B O   1 
HETATM 8838 O O   . HOH F 2 .   ? 21.106  12.778  -52.915 1.00 73.99  ? 434 HOH B O   1 
HETATM 8839 O O   . HOH F 2 .   ? 24.744  24.811  -58.958 1.00 67.30  ? 435 HOH B O   1 
HETATM 8840 O O   . HOH F 2 .   ? 20.037  15.877  -57.699 1.00 51.89  ? 436 HOH B O   1 
HETATM 8841 O O   . HOH F 2 .   ? 13.557  19.755  -62.656 1.00 65.03  ? 437 HOH B O   1 
HETATM 8842 O O   . HOH F 2 .   ? 24.594  15.664  -57.556 1.00 76.87  ? 438 HOH B O   1 
HETATM 8843 O O   . HOH F 2 .   ? -15.393 14.989  -50.064 1.00 36.13  ? 439 HOH B O   1 
HETATM 8844 O O   . HOH F 2 .   ? 7.896   28.799  -39.854 1.00 42.34  ? 440 HOH B O   1 
HETATM 8845 O O   . HOH F 2 .   ? -18.318 22.939  -49.870 1.00 23.91  ? 441 HOH B O   1 
HETATM 8846 O O   . HOH G 2 .   ? 4.317   12.922  -8.054  1.00 40.53  ? 1   HOH C O   1 
HETATM 8847 O O   . HOH G 2 .   ? 28.463  -5.538  -3.222  1.00 32.22  ? 2   HOH C O   1 
HETATM 8848 O O   . HOH G 2 .   ? 4.929   0.683   0.630   1.00 34.27  ? 7   HOH C O   1 
HETATM 8849 O O   . HOH G 2 .   ? 28.514  -7.596  -11.032 1.00 37.23  ? 8   HOH C O   1 
HETATM 8850 O O   . HOH G 2 .   ? 6.899   -5.551  -8.241  1.00 38.55  ? 9   HOH C O   1 
HETATM 8851 O O   . HOH G 2 .   ? 20.357  -22.181 4.865   1.00 60.65  ? 10  HOH C O   1 
HETATM 8852 O O   . HOH G 2 .   ? 28.090  -14.873 -8.134  1.00 48.57  ? 12  HOH C O   1 
HETATM 8853 O O   . HOH G 2 .   ? 19.675  11.338  -25.983 1.00 68.68  ? 313 HOH C O   1 
HETATM 8854 O O   . HOH G 2 .   ? 30.411  6.642   -15.002 1.00 51.18  ? 314 HOH C O   1 
HETATM 8855 O O   . HOH G 2 .   ? 14.750  9.462   -14.509 1.00 27.47  ? 315 HOH C O   1 
HETATM 8856 O O   . HOH G 2 .   ? -13.633 13.758  -24.897 1.00 56.73  ? 316 HOH C O   1 
HETATM 8857 O O   . HOH G 2 .   ? 28.672  9.042   -17.376 1.00 64.96  ? 317 HOH C O   1 
HETATM 8858 O O   . HOH G 2 .   ? -1.382  8.536   -10.271 1.00 36.62  ? 318 HOH C O   1 
HETATM 8859 O O   . HOH G 2 .   ? 15.136  3.363   -32.684 1.00 71.21  ? 319 HOH C O   1 
HETATM 8860 O O   . HOH G 2 .   ? 43.937  1.897   -1.200  1.00 66.75  ? 320 HOH C O   1 
HETATM 8861 O O   . HOH G 2 .   ? 30.612  8.161   -7.152  1.00 59.88  ? 321 HOH C O   1 
HETATM 8862 O O   . HOH G 2 .   ? 4.285   -14.669 -3.373  1.00 45.17  ? 322 HOH C O   1 
HETATM 8863 O O   . HOH G 2 .   ? 18.016  12.676  -19.320 1.00 42.75  ? 323 HOH C O   1 
HETATM 8864 O O   . HOH G 2 .   ? 56.033  -7.562  -8.451  1.00 73.13  ? 324 HOH C O   1 
HETATM 8865 O O   . HOH G 2 .   ? -6.964  4.040   -7.955  1.00 60.59  ? 325 HOH C O   1 
HETATM 8866 O O   . HOH G 2 .   ? 19.251  -10.947 -12.100 1.00 51.00  ? 326 HOH C O   1 
HETATM 8867 O O   . HOH G 2 .   ? 3.574   -12.131 0.712   1.00 51.11  ? 327 HOH C O   1 
HETATM 8868 O O   . HOH G 2 .   ? 4.778   -14.875 -0.498  1.00 42.53  ? 328 HOH C O   1 
HETATM 8869 O O   . HOH G 2 .   ? 4.736   2.247   -3.239  1.00 47.21  ? 329 HOH C O   1 
HETATM 8870 O O   . HOH G 2 .   ? 9.939   -12.922 -2.051  1.00 34.28  ? 330 HOH C O   1 
HETATM 8871 O O   . HOH G 2 .   ? 24.608  10.503  -5.959  1.00 40.91  ? 331 HOH C O   1 
HETATM 8872 O O   . HOH G 2 .   ? 56.080  -5.978  -6.028  1.00 66.80  ? 332 HOH C O   1 
HETATM 8873 O O   . HOH G 2 .   ? 7.189   -3.848  -10.388 1.00 36.03  ? 333 HOH C O   1 
HETATM 8874 O O   . HOH G 2 .   ? 24.945  8.090   -4.559  1.00 34.96  ? 334 HOH C O   1 
HETATM 8875 O O   . HOH G 2 .   ? 6.773   -13.839 -4.868  1.00 44.84  ? 335 HOH C O   1 
HETATM 8876 O O   . HOH G 2 .   ? 25.983  -7.779  -11.968 1.00 38.29  ? 336 HOH C O   1 
HETATM 8877 O O   . HOH G 2 .   ? 8.139   -1.553  -9.304  1.00 48.35  ? 337 HOH C O   1 
HETATM 8878 O O   . HOH G 2 .   ? 38.760  -29.312 -1.660  1.00 44.82  ? 338 HOH C O   1 
HETATM 8879 O O   . HOH G 2 .   ? 29.200  -4.559  -5.483  1.00 35.84  ? 339 HOH C O   1 
HETATM 8880 O O   . HOH G 2 .   ? 29.791  -9.025  -13.163 1.00 34.13  ? 340 HOH C O   1 
HETATM 8881 O O   . HOH G 2 .   ? 30.830  -21.735 -8.397  1.00 58.07  ? 341 HOH C O   1 
HETATM 8882 O O   . HOH G 2 .   ? 28.269  -13.303 2.719   1.00 50.19  ? 342 HOH C O   1 
HETATM 8883 O O   . HOH G 2 .   ? 36.197  -24.253 -6.702  1.00 64.12  ? 343 HOH C O   1 
HETATM 8884 O O   . HOH G 2 .   ? 21.298  -14.147 4.709   1.00 53.76  ? 344 HOH C O   1 
HETATM 8885 O O   . HOH G 2 .   ? 30.804  1.115   -13.847 1.00 53.98  ? 345 HOH C O   1 
HETATM 8886 O O   . HOH G 2 .   ? 10.273  3.431   -9.174  1.00 45.11  ? 346 HOH C O   1 
HETATM 8887 O O   . HOH G 2 .   ? 42.360  -21.227 2.375   1.00 56.80  ? 347 HOH C O   1 
HETATM 8888 O O   . HOH G 2 .   ? 7.752   -11.039 -5.638  1.00 28.59  ? 348 HOH C O   1 
HETATM 8889 O O   . HOH G 2 .   ? -18.761 15.982  -10.388 1.00 52.15  ? 349 HOH C O   1 
HETATM 8890 O O   . HOH G 2 .   ? 22.612  -1.828  -0.722  1.00 38.29  ? 350 HOH C O   1 
HETATM 8891 O O   . HOH G 2 .   ? -7.737  -3.870  -1.902  1.00 71.95  ? 351 HOH C O   1 
HETATM 8892 O O   . HOH G 2 .   ? -15.002 26.139  -12.242 1.00 50.67  ? 352 HOH C O   1 
HETATM 8893 O O   . HOH G 2 .   ? 6.216   11.275  -4.468  1.00 30.83  ? 353 HOH C O   1 
HETATM 8894 O O   . HOH G 2 .   ? 19.085  -2.465  5.489   1.00 40.30  ? 354 HOH C O   1 
HETATM 8895 O O   . HOH G 2 .   ? 28.413  -16.684 -26.001 1.00 72.62  ? 355 HOH C O   1 
HETATM 8896 O O   . HOH G 2 .   ? 26.472  -4.384  -1.266  1.00 40.04  ? 356 HOH C O   1 
HETATM 8897 O O   . HOH G 2 .   ? -5.897  0.744   0.361   1.00 50.01  ? 357 HOH C O   1 
HETATM 8898 O O   . HOH G 2 .   ? 22.503  -11.284 -29.612 1.00 57.08  ? 358 HOH C O   1 
HETATM 8899 O O   . HOH G 2 .   ? 12.675  -2.175  4.808   1.00 32.44  ? 359 HOH C O   1 
HETATM 8900 O O   . HOH G 2 .   ? 33.923  -19.173 -11.580 1.00 55.03  ? 360 HOH C O   1 
HETATM 8901 O O   . HOH G 2 .   ? 11.760  5.971   -2.443  1.00 38.31  ? 361 HOH C O   1 
HETATM 8902 O O   . HOH G 2 .   ? 26.364  -19.057 8.825   1.00 63.26  ? 362 HOH C O   1 
HETATM 8903 O O   . HOH G 2 .   ? 22.619  -2.059  6.197   1.00 63.80  ? 363 HOH C O   1 
HETATM 8904 O O   . HOH G 2 .   ? 30.188  -1.525  -19.560 1.00 53.78  ? 364 HOH C O   1 
HETATM 8905 O O   . HOH G 2 .   ? 14.649  -20.166 0.549   1.00 65.87  ? 365 HOH C O   1 
HETATM 8906 O O   . HOH G 2 .   ? 40.497  -4.663  -18.048 1.00 63.15  ? 366 HOH C O   1 
HETATM 8907 O O   . HOH G 2 .   ? 13.621  -1.417  -16.901 1.00 42.33  ? 367 HOH C O   1 
HETATM 8908 O O   . HOH G 2 .   ? 34.253  -4.543  -25.155 1.00 55.58  ? 368 HOH C O   1 
HETATM 8909 O O   . HOH G 2 .   ? 11.560  4.469   2.384   1.00 57.11  ? 369 HOH C O   1 
HETATM 8910 O O   . HOH G 2 .   ? -3.518  10.093  -11.127 1.00 38.12  ? 370 HOH C O   1 
HETATM 8911 O O   . HOH G 2 .   ? 21.658  -10.069 -12.316 1.00 51.49  ? 371 HOH C O   1 
HETATM 8912 O O   . HOH G 2 .   ? 27.902  -12.449 6.280   1.00 46.38  ? 372 HOH C O   1 
HETATM 8913 O O   . HOH G 2 .   ? 29.194  11.509  -18.700 1.00 38.01  ? 373 HOH C O   1 
HETATM 8914 O O   . HOH G 2 .   ? -9.196  12.466  -17.592 1.00 40.87  ? 374 HOH C O   1 
HETATM 8915 O O   . HOH G 2 .   ? 10.968  -17.744 -5.084  1.00 54.11  ? 375 HOH C O   1 
HETATM 8916 O O   . HOH G 2 .   ? 14.123  -13.641 7.640   1.00 37.94  ? 376 HOH C O   1 
HETATM 8917 O O   . HOH G 2 .   ? 26.071  -11.875 -26.071 1.00 55.92  ? 377 HOH C O   1 
HETATM 8918 O O   . HOH G 2 .   ? 31.414  -1.336  -16.807 1.00 70.82  ? 378 HOH C O   1 
HETATM 8919 O O   . HOH G 2 .   ? 24.564  -9.433  -29.725 1.00 59.62  ? 379 HOH C O   1 
HETATM 8920 O O   . HOH G 2 .   ? 30.256  -5.814  -7.861  1.00 45.97  ? 380 HOH C O   1 
HETATM 8921 O O   . HOH G 2 .   ? 28.624  -23.625 -3.583  1.00 72.84  ? 381 HOH C O   1 
HETATM 8922 O O   . HOH G 2 .   ? 13.249  6.189   0.334   1.00 61.27  ? 382 HOH C O   1 
HETATM 8923 O O   . HOH G 2 .   ? 4.989   -10.035 -5.314  1.00 35.27  ? 383 HOH C O   1 
HETATM 8924 O O   . HOH G 2 .   ? 5.952   -7.972  -8.605  1.00 41.89  ? 384 HOH C O   1 
HETATM 8925 O O   . HOH G 2 .   ? 38.677  -9.440  8.756   1.00 66.27  ? 385 HOH C O   1 
HETATM 8926 O O   . HOH G 2 .   ? 3.681   -8.945  -7.479  1.00 38.30  ? 386 HOH C O   1 
HETATM 8927 O O   . HOH G 2 .   ? 19.508  -12.722 7.205   1.00 57.83  ? 387 HOH C O   1 
HETATM 8928 O O   . HOH G 2 .   ? 7.442   -10.376 -8.438  1.00 45.18  ? 388 HOH C O   1 
HETATM 8929 O O   . HOH G 2 .   ? 16.297  11.143  -2.768  1.00 56.26  ? 389 HOH C O   1 
HETATM 8930 O O   . HOH G 2 .   ? 24.758  -15.457 -5.684  1.00 52.22  ? 390 HOH C O   1 
HETATM 8931 O O   . HOH G 2 .   ? 30.002  -0.862  -4.638  1.00 40.89  ? 391 HOH C O   1 
HETATM 8932 O O   . HOH G 2 .   ? 21.863  -14.223 1.981   1.00 36.36  ? 392 HOH C O   1 
HETATM 8933 O O   . HOH G 2 .   ? 15.874  -16.483 -2.555  1.00 29.36  ? 393 HOH C O   1 
HETATM 8934 O O   . HOH G 2 .   ? 11.972  -16.764 -2.245  1.00 57.94  ? 394 HOH C O   1 
HETATM 8935 O O   . HOH G 2 .   ? 19.994  1.731   3.330   1.00 36.76  ? 395 HOH C O   1 
HETATM 8936 O O   . HOH G 2 .   ? 12.440  -1.569  -29.668 1.00 52.11  ? 396 HOH C O   1 
HETATM 8937 O O   . HOH G 2 .   ? 23.165  -19.639 -6.991  1.00 51.52  ? 397 HOH C O   1 
HETATM 8938 O O   . HOH G 2 .   ? 39.339  -22.811 -10.987 1.00 55.21  ? 398 HOH C O   1 
HETATM 8939 O O   . HOH G 2 .   ? -26.675 25.150  -17.882 1.00 63.43  ? 399 HOH C O   1 
HETATM 8940 O O   . HOH G 2 .   ? -6.770  15.351  -6.957  1.00 41.78  ? 400 HOH C O   1 
HETATM 8941 O O   . HOH G 2 .   ? 18.300  -3.040  -15.891 1.00 31.88  ? 401 HOH C O   1 
HETATM 8942 O O   . HOH G 2 .   ? 36.223  -1.629  -13.105 1.00 48.00  ? 402 HOH C O   1 
HETATM 8943 O O   . HOH G 2 .   ? 0.240   6.484   -4.997  1.00 37.04  ? 403 HOH C O   1 
HETATM 8944 O O   . HOH G 2 .   ? -0.194  8.510   -7.343  1.00 37.16  ? 404 HOH C O   1 
HETATM 8945 O O   . HOH G 2 .   ? 39.011  7.297   1.786   1.00 51.32  ? 405 HOH C O   1 
HETATM 8946 O O   . HOH G 2 .   ? 44.280  -23.366 -13.358 1.00 61.08  ? 406 HOH C O   1 
HETATM 8947 O O   . HOH G 2 .   ? 19.149  -3.063  -13.126 1.00 35.82  ? 407 HOH C O   1 
HETATM 8948 O O   . HOH G 2 .   ? -17.267 14.339  -11.812 1.00 42.26  ? 408 HOH C O   1 
HETATM 8949 O O   . HOH G 2 .   ? -11.737 16.562  -7.545  1.00 40.88  ? 409 HOH C O   1 
HETATM 8950 O O   . HOH G 2 .   ? 16.154  -9.358  5.897   1.00 36.13  ? 410 HOH C O   1 
HETATM 8951 O O   . HOH G 2 .   ? 25.037  -18.429 -5.555  1.00 66.87  ? 411 HOH C O   1 
HETATM 8952 O O   . HOH G 2 .   ? 25.006  -8.981  -9.749  1.00 44.35  ? 412 HOH C O   1 
HETATM 8953 O O   . HOH G 2 .   ? 50.015  -13.068 -8.717  1.00 68.39  ? 413 HOH C O   1 
HETATM 8954 O O   . HOH G 2 .   ? 42.861  -25.953 3.150   1.00 57.13  ? 414 HOH C O   1 
HETATM 8955 O O   . HOH G 2 .   ? -0.293  3.287   -2.430  1.00 33.75  ? 415 HOH C O   1 
HETATM 8956 O O   . HOH G 2 .   ? 8.875   -7.759  -18.663 1.00 42.31  ? 416 HOH C O   1 
HETATM 8957 O O   . HOH G 2 .   ? 23.528  -10.026 -5.359  1.00 53.77  ? 417 HOH C O   1 
HETATM 8958 O O   . HOH G 2 .   ? 32.183  -20.229 3.958   1.00 46.40  ? 418 HOH C O   1 
HETATM 8959 O O   . HOH G 2 .   ? 42.094  -9.104  7.106   1.00 55.66  ? 419 HOH C O   1 
HETATM 8960 O O   . HOH G 2 .   ? 14.635  -21.201 3.637   1.00 63.20  ? 420 HOH C O   1 
HETATM 8961 O O   . HOH G 2 .   ? 11.346  -16.574 -11.382 1.00 62.17  ? 421 HOH C O   1 
HETATM 8962 O O   . HOH G 2 .   ? -0.913  -8.970  -11.067 1.00 23.89  ? 422 HOH C O   1 
HETATM 8963 O O   . HOH G 2 .   ? -6.159  8.689   -9.883  1.00 42.28  ? 423 HOH C O   1 
HETATM 8964 O O   . HOH G 2 .   ? 48.008  -18.879 0.402   1.00 44.48  ? 424 HOH C O   1 
HETATM 8965 O O   . HOH G 2 .   ? 26.015  -11.075 -8.589  1.00 49.37  ? 425 HOH C O   1 
HETATM 8966 O O   . HOH G 2 .   ? 13.307  -15.342 9.868   1.00 41.40  ? 426 HOH C O   1 
HETATM 8967 O O   . HOH G 2 .   ? 29.662  -11.023 4.270   1.00 67.95  ? 427 HOH C O   1 
HETATM 8968 O O   . HOH G 2 .   ? 16.208  -18.597 -0.926  1.00 52.09  ? 428 HOH C O   1 
HETATM 8969 O O   . HOH G 2 .   ? -6.455  -5.415  -4.419  1.00 53.88  ? 429 HOH C O   1 
HETATM 8970 O O   . HOH G 2 .   ? 10.218  -0.881  -15.429 1.00 42.00  ? 430 HOH C O   1 
HETATM 8971 O O   . HOH G 2 .   ? 18.458  -16.573 -14.854 1.00 66.54  ? 431 HOH C O   1 
HETATM 8972 O O   . HOH G 2 .   ? 18.121  -8.635  -18.121 1.00 48.29  ? 432 HOH C O   1 
HETATM 8973 O O   . HOH G 2 .   ? 28.924  -11.409 -12.251 1.00 63.00  ? 433 HOH C O   1 
HETATM 8974 O O   . HOH G 2 .   ? 14.909  -3.385  6.343   1.00 56.07  ? 434 HOH C O   1 
HETATM 8975 O O   . HOH G 2 .   ? 9.096   -6.698  -14.048 1.00 57.98  ? 435 HOH C O   1 
HETATM 8976 O O   . HOH G 2 .   ? 26.587  6.267   6.599   1.00 59.13  ? 436 HOH C O   1 
HETATM 8977 O O   . HOH G 2 .   ? 22.965  -10.811 -19.771 1.00 57.00  ? 437 HOH C O   1 
HETATM 8978 O O   . HOH G 2 .   ? 7.711   -4.725  -19.546 1.00 37.38  ? 438 HOH C O   1 
HETATM 8979 O O   . HOH G 2 .   ? 18.909  6.266   -32.034 1.00 72.66  ? 439 HOH C O   1 
HETATM 8980 O O   . HOH G 2 .   ? -11.785 14.293  -20.134 1.00 32.88  ? 440 HOH C O   1 
HETATM 8981 O O   . HOH G 2 .   ? 12.232  -17.146 8.262   1.00 40.24  ? 441 HOH C O   1 
HETATM 8982 O O   . HOH G 2 .   ? 40.411  -21.643 4.148   1.00 43.82  ? 442 HOH C O   1 
HETATM 8983 O O   . HOH G 2 .   ? 14.790  12.297  -6.421  1.00 50.18  ? 443 HOH C O   1 
HETATM 8984 O O   . HOH G 2 .   ? 17.113  13.126  -7.188  1.00 32.79  ? 444 HOH C O   1 
HETATM 8985 O O   . HOH G 2 .   ? 7.353   -16.050 -0.127  1.00 38.92  ? 445 HOH C O   1 
HETATM 8986 O O   . HOH G 2 .   ? 0.546   -9.162  0.013   1.00 56.39  ? 446 HOH C O   1 
HETATM 8987 O O   . HOH G 2 .   ? 1.972   -10.999 -1.357  1.00 43.06  ? 447 HOH C O   1 
HETATM 8988 O O   . HOH G 2 .   ? 21.270  -13.422 9.202   1.00 39.57  ? 448 HOH C O   1 
HETATM 8989 O O   . HOH G 2 .   ? 6.474   -12.313 7.734   1.00 49.53  ? 449 HOH C O   1 
HETATM 8990 O O   . HOH G 2 .   ? 6.683   1.767   2.399   1.00 42.79  ? 450 HOH C O   1 
HETATM 8991 O O   . HOH G 2 .   ? 25.374  -21.915 -24.024 1.00 73.74  ? 451 HOH C O   1 
HETATM 8992 O O   . HOH G 2 .   ? -14.613 11.909  -16.559 1.00 55.37  ? 452 HOH C O   1 
HETATM 8993 O O   . HOH G 2 .   ? 31.186  -17.529 -11.626 1.00 63.87  ? 453 HOH C O   1 
HETATM 8994 O O   . HOH G 2 .   ? 47.289  -14.854 8.167   1.00 69.82  ? 454 HOH C O   1 
HETATM 8995 O O   . HOH G 2 .   ? 35.001  -28.429 4.623   1.00 71.65  ? 455 HOH C O   1 
HETATM 8996 O O   . HOH G 2 .   ? 39.169  -12.477 7.941   1.00 57.41  ? 456 HOH C O   1 
HETATM 8997 O O   . HOH G 2 .   ? -12.560 14.015  -17.158 1.00 50.34  ? 457 HOH C O   1 
HETATM 8998 O O   . HOH G 2 .   ? 2.852   1.717   -1.468  1.00 49.90  ? 458 HOH C O   1 
HETATM 8999 O O   . HOH G 2 .   ? 3.074   -12.035 -4.303  1.00 59.36  ? 459 HOH C O   1 
HETATM 9000 O O   . HOH G 2 .   ? 28.855  -8.503  2.890   1.00 61.31  ? 460 HOH C O   1 
HETATM 9001 O O   . HOH G 2 .   ? 6.304   -12.617 -9.608  1.00 50.30  ? 461 HOH C O   1 
HETATM 9002 O O   . HOH G 2 .   ? 50.897  -17.509 1.662   1.00 65.22  ? 462 HOH C O   1 
HETATM 9003 O O   . HOH G 2 .   ? 54.716  -5.379  -3.441  1.00 74.93  ? 463 HOH C O   1 
HETATM 9004 O O   . HOH G 2 .   ? 29.246  -19.699 -8.229  1.00 55.11  ? 464 HOH C O   1 
HETATM 9005 O O   . HOH G 2 .   ? 25.099  -12.893 -4.848  1.00 44.50  ? 465 HOH C O   1 
HETATM 9006 O O   . HOH G 2 .   ? 12.558  -8.387  -11.368 1.00 49.64  ? 466 HOH C O   1 
HETATM 9007 O O   . HOH G 2 .   ? 10.111  -10.872 -4.071  1.00 34.46  ? 467 HOH C O   1 
HETATM 9008 O O   . HOH H 2 .   ? -24.460 10.347  -71.480 1.00 59.86  ? 1   HOH D O   1 
HETATM 9009 O O   . HOH H 2 .   ? -14.747 -21.245 -87.941 1.00 65.19  ? 3   HOH D O   1 
HETATM 9010 O O   . HOH H 2 .   ? -19.080 -6.014  -63.728 1.00 53.81  ? 4   HOH D O   1 
HETATM 9011 O O   . HOH H 2 .   ? -21.079 -2.965  -83.494 1.00 61.65  ? 5   HOH D O   1 
HETATM 9012 O O   . HOH H 2 .   ? -30.317 -8.305  -73.496 1.00 53.64  ? 6   HOH D O   1 
HETATM 9013 O O   . HOH H 2 .   ? -20.117 -6.323  -66.355 1.00 53.13  ? 11  HOH D O   1 
HETATM 9014 O O   . HOH H 2 .   ? -18.709 -17.115 -96.995 1.00 61.58  ? 313 HOH D O   1 
HETATM 9015 O O   . HOH H 2 .   ? -28.013 -11.405 -67.021 1.00 59.98  ? 314 HOH D O   1 
HETATM 9016 O O   . HOH H 2 .   ? -43.818 -25.369 -80.759 1.00 63.67  ? 315 HOH D O   1 
HETATM 9017 O O   . HOH H 2 .   ? -29.848 -31.455 -82.233 1.00 52.48  ? 316 HOH D O   1 
HETATM 9018 O O   . HOH H 2 .   ? -37.350 -2.682  -59.246 1.00 63.14  ? 317 HOH D O   1 
HETATM 9019 O O   . HOH H 2 .   ? -16.316 2.904   -76.049 1.00 47.76  ? 318 HOH D O   1 
HETATM 9020 O O   . HOH H 2 .   ? -22.919 12.058  -52.319 1.00 62.20  ? 319 HOH D O   1 
HETATM 9021 O O   . HOH H 2 .   ? -20.826 -6.743  -85.666 1.00 67.73  ? 320 HOH D O   1 
HETATM 9022 O O   . HOH H 2 .   ? -20.079 -13.628 -66.125 1.00 59.98  ? 321 HOH D O   1 
HETATM 9023 O O   . HOH H 2 .   ? -28.205 -21.436 -69.097 1.00 76.61  ? 322 HOH D O   1 
HETATM 9024 O O   . HOH H 2 .   ? -30.227 -28.194 -72.670 1.00 72.31  ? 323 HOH D O   1 
HETATM 9025 O O   . HOH H 2 .   ? -35.107 -3.452  -60.487 1.00 70.76  ? 324 HOH D O   1 
HETATM 9026 O O   . HOH H 2 .   ? -24.052 -16.841 -86.121 1.00 58.68  ? 325 HOH D O   1 
HETATM 9027 O O   . HOH H 2 .   ? -36.668 -34.921 -68.421 1.00 71.04  ? 326 HOH D O   1 
HETATM 9028 O O   . HOH H 2 .   ? -25.579 11.257  -53.365 1.00 60.13  ? 327 HOH D O   1 
HETATM 9029 O O   . HOH H 2 .   ? -14.090 -24.739 -69.530 1.00 64.21  ? 328 HOH D O   1 
HETATM 9030 O O   . HOH H 2 .   ? -29.392 -9.630  -75.701 1.00 63.55  ? 329 HOH D O   1 
HETATM 9031 O O   . HOH H 2 .   ? -25.697 -19.351 -72.274 1.00 56.60  ? 330 HOH D O   1 
HETATM 9032 O O   . HOH H 2 .   ? -25.792 -13.076 -65.160 1.00 66.68  ? 331 HOH D O   1 
HETATM 9033 O O   . HOH H 2 .   ? -30.538 -12.569 -65.399 1.00 68.40  ? 332 HOH D O   1 
HETATM 9034 O O   . HOH H 2 .   ? -24.764 -11.600 -49.150 1.00 73.20  ? 333 HOH D O   1 
HETATM 9035 O O   . HOH H 2 .   ? -27.720 -27.988 -75.359 1.00 78.98  ? 334 HOH D O   1 
HETATM 9036 O O   . HOH H 2 .   ? -22.644 8.802   -72.911 1.00 61.51  ? 335 HOH D O   1 
HETATM 9037 O O   . HOH H 2 .   ? -16.940 9.633   -69.891 1.00 18.14  ? 336 HOH D O   1 
HETATM 9038 O O   . HOH H 2 .   ? -15.966 -18.799 -86.879 1.00 75.45  ? 337 HOH D O   1 
HETATM 9039 O O   . HOH H 2 .   ? -18.083 -8.093  -87.371 1.00 53.43  ? 338 HOH D O   1 
HETATM 9040 O O   . HOH H 2 .   ? -21.872 -18.048 -85.068 1.00 59.86  ? 339 HOH D O   1 
HETATM 9041 O O   . HOH H 2 .   ? -19.232 9.760   -61.556 1.00 39.98  ? 340 HOH D O   1 
HETATM 9042 O O   . HOH H 2 .   ? -25.625 -11.690 -45.417 1.00 75.17  ? 341 HOH D O   1 
HETATM 9043 O O   . HOH H 2 .   ? -14.609 -28.333 -73.326 1.00 59.93  ? 342 HOH D O   1 
HETATM 9044 O O   . HOH H 2 .   ? -13.153 -11.892 -67.934 1.00 53.10  ? 343 HOH D O   1 
HETATM 9045 O O   . HOH H 2 .   ? -26.465 -26.443 -78.403 1.00 48.40  ? 344 HOH D O   1 
HETATM 9046 O O   . HOH H 2 .   ? -28.771 -18.774 -69.270 1.00 59.54  ? 345 HOH D O   1 
HETATM 9047 O O   . HOH H 2 .   ? -23.027 -19.179 -79.901 1.00 47.60  ? 346 HOH D O   1 
HETATM 9048 O O   . HOH H 2 .   ? -15.866 2.452   -81.269 1.00 75.43  ? 347 HOH D O   1 
HETATM 9049 O O   . HOH H 2 .   ? -41.536 -26.768 -80.673 1.00 69.35  ? 348 HOH D O   1 
HETATM 9050 O O   . HOH H 2 .   ? -33.382 -25.405 -81.080 1.00 48.58  ? 349 HOH D O   1 
HETATM 9051 O O   . HOH H 2 .   ? -42.045 -26.147 -83.247 1.00 80.59  ? 350 HOH D O   1 
HETATM 9052 O O   . HOH H 2 .   ? -22.562 6.162   -80.560 1.00 55.78  ? 351 HOH D O   1 
HETATM 9053 O O   . HOH H 2 .   ? -30.925 -17.460 -68.051 1.00 63.37  ? 352 HOH D O   1 
HETATM 9054 O O   . HOH H 2 .   ? -17.562 -3.124  -88.032 1.00 66.96  ? 353 HOH D O   1 
HETATM 9055 O O   . HOH H 2 .   ? -11.103 -17.219 -77.406 1.00 51.42  ? 354 HOH D O   1 
HETATM 9056 O O   . HOH H 2 .   ? -25.879 -8.723  -81.370 1.00 47.09  ? 355 HOH D O   1 
HETATM 9057 O O   . HOH H 2 .   ? -27.557 -30.673 -75.887 1.00 57.38  ? 356 HOH D O   1 
HETATM 9058 O O   . HOH H 2 .   ? -30.996 -4.698  -60.287 1.00 64.33  ? 357 HOH D O   1 
HETATM 9059 O O   . HOH H 2 .   ? -11.345 -14.887 -75.435 1.00 53.05  ? 358 HOH D O   1 
HETATM 9060 O O   . HOH H 2 .   ? -26.336 -22.497 -71.760 1.00 68.34  ? 359 HOH D O   1 
HETATM 9061 O O   . HOH H 2 .   ? -8.801  4.839   -75.563 1.00 60.16  ? 360 HOH D O   1 
HETATM 9062 O O   . HOH H 2 .   ? -26.747 9.492   -59.154 1.00 88.85  ? 361 HOH D O   1 
HETATM 9063 O O   . HOH H 2 .   ? -31.282 -30.415 -84.523 1.00 53.54  ? 362 HOH D O   1 
HETATM 9064 O O   . HOH H 2 .   ? -22.764 -13.413 -66.399 1.00 59.70  ? 363 HOH D O   1 
HETATM 9065 O O   . HOH H 2 .   ? -15.429 -13.780 -39.262 1.00 71.25  ? 364 HOH D O   1 
HETATM 9066 O O   . HOH H 2 .   ? -28.194 -10.361 -45.303 1.00 70.46  ? 365 HOH D O   1 
HETATM 9067 O O   . HOH H 2 .   ? -34.893 2.554   -86.769 1.00 66.17  ? 366 HOH D O   1 
HETATM 9068 O O   . HOH H 2 .   ? -44.506 -30.603 -79.466 1.00 78.49  ? 367 HOH D O   1 
HETATM 9069 O O   . HOH H 2 .   ? -28.096 -15.169 -65.410 1.00 56.19  ? 368 HOH D O   1 
HETATM 9070 O O   . HOH H 2 .   ? -40.226 -24.344 -57.398 1.00 94.32  ? 369 HOH D O   1 
HETATM 9071 O O   . HOH H 2 .   ? -9.792  -16.600 -87.826 1.00 69.90  ? 370 HOH D O   1 
HETATM 9072 O O   . HOH H 2 .   ? -53.156 -28.784 -75.039 1.00 78.08  ? 371 HOH D O   1 
HETATM 9073 O O   . HOH H 2 .   ? -13.626 -13.020 -37.245 1.00 71.34  ? 372 HOH D O   1 
HETATM 9074 O O   . HOH H 2 .   ? -39.200 -20.911 -56.570 1.00 81.87  ? 373 HOH D O   1 
HETATM 9075 O O   . HOH H 2 .   ? -8.740  -15.004 -74.176 1.00 55.67  ? 374 HOH D O   1 
HETATM 9076 O O   . HOH H 2 .   ? -19.302 -24.826 -76.056 1.00 78.50  ? 375 HOH D O   1 
HETATM 9077 O O   . HOH H 2 .   ? -22.436 -18.907 -82.534 1.00 72.50  ? 390 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A 8   ? 0.9684 0.6352 0.9927 -0.0850 -0.1529 -0.0339 20  LYS A N   
2    C CA  . LYS A 8   ? 0.9275 0.6332 0.9719 -0.0808 -0.1373 -0.0236 20  LYS A CA  
3    C C   . LYS A 8   ? 0.9039 0.6432 0.9519 -0.0683 -0.1241 -0.0311 20  LYS A C   
4    O O   . LYS A 8   ? 0.8617 0.6384 0.9298 -0.0728 -0.1160 -0.0223 20  LYS A O   
5    C CB  . LYS A 8   ? 0.9831 0.6731 1.0213 -0.0701 -0.1325 -0.0206 20  LYS A CB  
6    C CG  . LYS A 8   ? 1.1823 0.9078 1.2360 -0.0622 -0.1166 -0.0123 20  LYS A CG  
7    C CD  . LYS A 8   ? 1.3464 1.0848 1.4191 -0.0766 -0.1168 0.0065  20  LYS A CD  
8    C CE  . LYS A 8   ? 1.4840 1.2413 1.5633 -0.0662 -0.1040 0.0134  20  LYS A CE  
9    N NZ  . LYS A 8   ? 1.6019 1.3270 1.6656 -0.0556 -0.1060 0.0108  20  LYS A NZ  
10   N N   . THR A 9   ? 0.8334 0.5594 0.8617 -0.0523 -0.1217 -0.0465 21  THR A N   
11   C CA  . THR A 9   ? 0.7824 0.5363 0.8122 -0.0415 -0.1110 -0.0539 21  THR A CA  
12   C C   . THR A 9   ? 0.8142 0.5499 0.8241 -0.0371 -0.1175 -0.0685 21  THR A C   
13   O O   . THR A 9   ? 0.8480 0.5454 0.8379 -0.0363 -0.1283 -0.0757 21  THR A O   
14   C CB  . THR A 9   ? 0.8300 0.5956 0.8585 -0.0233 -0.0972 -0.0561 21  THR A CB  
15   O OG1 . THR A 9   ? 0.9068 0.6384 0.9148 -0.0110 -0.0999 -0.0640 21  THR A OG1 
16   C CG2 . THR A 9   ? 0.7639 0.5544 0.8119 -0.0262 -0.0891 -0.0424 21  THR A CG2 
17   N N   . PHE A 10  ? 0.7122 0.4746 0.7264 -0.0338 -0.1111 -0.0728 22  PHE A N   
18   C CA  . PHE A 10  ? 0.7004 0.4520 0.6959 -0.0266 -0.1140 -0.0864 22  PHE A CA  
19   C C   . PHE A 10  ? 0.7118 0.4901 0.7085 -0.0112 -0.0993 -0.0913 22  PHE A C   
20   O O   . PHE A 10  ? 0.6600 0.4700 0.6757 -0.0114 -0.0893 -0.0833 22  PHE A O   
21   C CB  . PHE A 10  ? 0.7146 0.4696 0.7141 -0.0425 -0.1250 -0.0857 22  PHE A CB  
22   C CG  . PHE A 10  ? 0.6840 0.4811 0.7085 -0.0511 -0.1188 -0.0762 22  PHE A CG  
23   C CD1 . PHE A 10  ? 0.7061 0.5198 0.7531 -0.0646 -0.1195 -0.0615 22  PHE A CD1 
24   C CD2 . PHE A 10  ? 0.6732 0.4926 0.6980 -0.0454 -0.1128 -0.0816 22  PHE A CD2 
25   C CE1 . PHE A 10  ? 0.6816 0.5337 0.7502 -0.0707 -0.1135 -0.0529 22  PHE A CE1 
26   C CE2 . PHE A 10  ? 0.6742 0.5302 0.7205 -0.0523 -0.1076 -0.0731 22  PHE A CE2 
27   C CZ  . PHE A 10  ? 0.6441 0.5162 0.7119 -0.0642 -0.1077 -0.0591 22  PHE A CZ  
28   N N   . THR A 11  ? 0.6959 0.4609 0.6718 0.0019  -0.0982 -0.1038 23  THR A N   
29   C CA  . THR A 11  ? 0.6677 0.4552 0.6431 0.0170  -0.0848 -0.1083 23  THR A CA  
30   C C   . THR A 11  ? 0.6938 0.5103 0.6795 0.0109  -0.0823 -0.1074 23  THR A C   
31   O O   . THR A 11  ? 0.7043 0.5126 0.6833 0.0026  -0.0918 -0.1110 23  THR A O   
32   C CB  . THR A 11  ? 0.7266 0.4888 0.6755 0.0343  -0.0840 -0.1207 23  THR A CB  
33   O OG1 . THR A 11  ? 0.7791 0.5172 0.7207 0.0410  -0.0852 -0.1203 23  THR A OG1 
34   C CG2 . THR A 11  ? 0.6512 0.4377 0.6002 0.0495  -0.0702 -0.1242 23  THR A CG2 
35   N N   . VAL A 12  ? 0.6192 0.4687 0.6208 0.0150  -0.0703 -0.1023 24  VAL A N   
36   C CA  . VAL A 12  ? 0.5934 0.4709 0.6037 0.0128  -0.0658 -0.1017 24  VAL A CA  
37   C C   . VAL A 12  ? 0.6270 0.5181 0.6327 0.0284  -0.0541 -0.1063 24  VAL A C   
38   O O   . VAL A 12  ? 0.6109 0.5104 0.6231 0.0360  -0.0461 -0.1029 24  VAL A O   
39   C CB  . VAL A 12  ? 0.6084 0.5137 0.6429 0.0012  -0.0636 -0.0901 24  VAL A CB  
40   C CG1 . VAL A 12  ? 0.5822 0.5136 0.6237 0.0000  -0.0596 -0.0901 24  VAL A CG1 
41   C CG2 . VAL A 12  ? 0.6167 0.5117 0.6580 -0.0146 -0.0746 -0.0836 24  VAL A CG2 
42   N N   . ARG A 13  ? 0.5784 0.4716 0.5731 0.0327  -0.0536 -0.1133 25  ARG A N   
43   C CA  . ARG A 13  ? 0.5479 0.4588 0.5409 0.0450  -0.0427 -0.1158 25  ARG A CA  
44   C C   . ARG A 13  ? 0.5456 0.4889 0.5584 0.0391  -0.0371 -0.1084 25  ARG A C   
45   O O   . ARG A 13  ? 0.5134 0.4644 0.5314 0.0290  -0.0420 -0.1066 25  ARG A O   
46   C CB  . ARG A 13  ? 0.5576 0.4563 0.5291 0.0519  -0.0448 -0.1256 25  ARG A CB  
47   C CG  . ARG A 13  ? 0.7015 0.6125 0.6669 0.0675  -0.0333 -0.1286 25  ARG A CG  
48   C CD  . ARG A 13  ? 0.8966 0.7915 0.8372 0.0758  -0.0354 -0.1384 25  ARG A CD  
49   N NE  . ARG A 13  ? 1.2035 1.0636 1.1232 0.0818  -0.0420 -0.1458 25  ARG A NE  
50   C CZ  . ARG A 13  ? 1.4756 1.3127 1.3688 0.0895  -0.0463 -0.1557 25  ARG A CZ  
51   N NH1 . ARG A 13  ? 1.3420 1.1450 1.2156 0.0953  -0.0528 -0.1624 25  ARG A NH1 
52   N NH2 . ARG A 13  ? 1.3527 1.1989 1.2370 0.0917  -0.0447 -0.1591 25  ARG A NH2 
53   N N   . ILE A 14  ? 0.4862 0.4475 0.5099 0.0452  -0.0276 -0.1037 26  ILE A N   
54   C CA  . ILE A 14  ? 0.4530 0.4424 0.4923 0.0418  -0.0220 -0.0977 26  ILE A CA  
55   C C   . ILE A 14  ? 0.4981 0.4998 0.5338 0.0525  -0.0137 -0.1002 26  ILE A C   
56   O O   . ILE A 14  ? 0.4893 0.4903 0.5234 0.0622  -0.0083 -0.1005 26  ILE A O   
57   C CB  . ILE A 14  ? 0.4721 0.4728 0.5280 0.0376  -0.0196 -0.0890 26  ILE A CB  
58   C CG1 . ILE A 14  ? 0.4796 0.4702 0.5404 0.0263  -0.0273 -0.0847 26  ILE A CG1 
59   C CG2 . ILE A 14  ? 0.4402 0.4670 0.5087 0.0362  -0.0138 -0.0839 26  ILE A CG2 
60   C CD1 . ILE A 14  ? 0.5612 0.5588 0.6276 0.0148  -0.0330 -0.0824 26  ILE A CD1 
61   N N   . VAL A 15  ? 0.4559 0.4698 0.4910 0.0505  -0.0128 -0.1011 27  VAL A N   
62   C CA  . VAL A 15  ? 0.4468 0.4738 0.4793 0.0592  -0.0052 -0.1020 27  VAL A CA  
63   C C   . VAL A 15  ? 0.4798 0.5304 0.5286 0.0555  -0.0007 -0.0949 27  VAL A C   
64   O O   . VAL A 15  ? 0.4502 0.5089 0.5051 0.0475  -0.0035 -0.0924 27  VAL A O   
65   C CB  . VAL A 15  ? 0.5005 0.5223 0.5178 0.0612  -0.0071 -0.1082 27  VAL A CB  
66   C CG1 . VAL A 15  ? 0.4877 0.5251 0.5035 0.0696  0.0015  -0.1074 27  VAL A CG1 
67   C CG2 . VAL A 15  ? 0.5289 0.5238 0.5270 0.0656  -0.0126 -0.1161 27  VAL A CG2 
68   N N   . THR A 16  ? 0.4379 0.4985 0.4938 0.0616  0.0056  -0.0913 28  THR A N   
69   C CA  . THR A 16  ? 0.4142 0.4950 0.4826 0.0595  0.0095  -0.0853 28  THR A CA  
70   C C   . THR A 16  ? 0.4660 0.5574 0.5307 0.0651  0.0147  -0.0857 28  THR A C   
71   O O   . THR A 16  ? 0.4815 0.5653 0.5340 0.0718  0.0161  -0.0905 28  THR A O   
72   C CB  . THR A 16  ? 0.4910 0.5765 0.5697 0.0611  0.0116  -0.0803 28  THR A CB  
73   O OG1 . THR A 16  ? 0.5810 0.6664 0.6572 0.0709  0.0161  -0.0810 28  THR A OG1 
74   C CG2 . THR A 16  ? 0.4358 0.5102 0.5169 0.0563  0.0071  -0.0792 28  THR A CG2 
75   N N   . MET A 17  ? 0.4161 0.5241 0.4902 0.0628  0.0173  -0.0806 29  MET A N   
76   C CA  . MET A 17  ? 0.4230 0.5430 0.4959 0.0672  0.0224  -0.0789 29  MET A CA  
77   C C   . MET A 17  ? 0.5009 0.6240 0.5738 0.0771  0.0281  -0.0780 29  MET A C   
78   O O   . MET A 17  ? 0.5133 0.6422 0.5806 0.0834  0.0329  -0.0782 29  MET A O   
79   C CB  . MET A 17  ? 0.4318 0.5666 0.5154 0.0618  0.0228  -0.0727 29  MET A CB  
80   C CG  . MET A 17  ? 0.4616 0.5959 0.5445 0.0543  0.0186  -0.0730 29  MET A CG  
81   S SD  . MET A 17  ? 0.5176 0.6480 0.5875 0.0544  0.0174  -0.0774 29  MET A SD  
82   C CE  . MET A 17  ? 0.4720 0.6149 0.5406 0.0597  0.0239  -0.0739 29  MET A CE  
83   N N   . ASP A 18  ? 0.4633 0.5834 0.5424 0.0789  0.0277  -0.0765 30  ASP A N   
84   C CA  . ASP A 18  ? 0.4626 0.5859 0.5439 0.0886  0.0324  -0.0749 30  ASP A CA  
85   C C   . ASP A 18  ? 0.5449 0.6513 0.6112 0.0978  0.0332  -0.0816 30  ASP A C   
86   O O   . ASP A 18  ? 0.5809 0.6919 0.6421 0.1082  0.0391  -0.0820 30  ASP A O   
87   C CB  . ASP A 18  ? 0.4753 0.5990 0.5673 0.0867  0.0302  -0.0710 30  ASP A CB  
88   C CG  . ASP A 18  ? 0.5968 0.7364 0.7026 0.0804  0.0294  -0.0641 30  ASP A CG  
89   O OD1 . ASP A 18  ? 0.6090 0.7642 0.7225 0.0837  0.0331  -0.0590 30  ASP A OD1 
90   O OD2 . ASP A 18  ? 0.6493 0.7853 0.7580 0.0728  0.0249  -0.0633 30  ASP A OD2 
91   N N   . ALA A 19  ? 0.4880 0.5744 0.5469 0.0943  0.0272  -0.0866 31  ALA A N   
92   C CA  . ALA A 19  ? 0.4965 0.5627 0.5415 0.1027  0.0264  -0.0926 31  ALA A CA  
93   C C   . ALA A 19  ? 0.5523 0.5966 0.5857 0.0961  0.0184  -0.0988 31  ALA A C   
94   O O   . ALA A 19  ? 0.5318 0.5779 0.5714 0.0846  0.0135  -0.0971 31  ALA A O   
95   C CB  . ALA A 19  ? 0.5056 0.5694 0.5578 0.1073  0.0271  -0.0894 31  ALA A CB  
96   N N   . GLU A 20  ? 0.5441 0.5676 0.5600 0.1041  0.0169  -0.1058 32  GLU A N   
97   C CA  . GLU A 20  ? 0.5689 0.5660 0.5720 0.0995  0.0080  -0.1119 32  GLU A CA  
98   C C   . GLU A 20  ? 0.6125 0.5971 0.6201 0.0994  0.0052  -0.1099 32  GLU A C   
99   O O   . GLU A 20  ? 0.6275 0.6075 0.6314 0.1111  0.0093  -0.1104 32  GLU A O   
100  C CB  . GLU A 20  ? 0.6269 0.6064 0.6063 0.1103  0.0081  -0.1207 32  GLU A CB  
101  C CG  . GLU A 20  ? 0.8912 0.8406 0.8534 0.1055  -0.0028 -0.1282 32  GLU A CG  
102  C CD  . GLU A 20  ? 1.3105 1.2356 1.2469 0.1197  -0.0029 -0.1372 32  GLU A CD  
103  O OE1 . GLU A 20  ? 1.3263 1.2574 1.2510 0.1290  0.0027  -0.1404 32  GLU A OE1 
104  O OE2 . GLU A 20  ? 1.2603 1.1600 1.1875 0.1224  -0.0082 -0.1407 32  GLU A OE2 
105  N N   . MET A 21  ? 0.5467 0.5276 0.5631 0.0867  -0.0013 -0.1066 33  MET A N   
106  C CA  . MET A 21  ? 0.5379 0.5085 0.5598 0.0850  -0.0041 -0.1031 33  MET A CA  
107  C C   . MET A 21  ? 0.5995 0.5430 0.6112 0.0779  -0.0141 -0.1066 33  MET A C   
108  O O   . MET A 21  ? 0.5953 0.5335 0.6012 0.0704  -0.0198 -0.1100 33  MET A O   
109  C CB  . MET A 21  ? 0.5422 0.5330 0.5840 0.0765  -0.0026 -0.0943 33  MET A CB  
110  C CG  . MET A 21  ? 0.5716 0.5871 0.6239 0.0818  0.0054  -0.0901 33  MET A CG  
111  S SD  . MET A 21  ? 0.6050 0.6389 0.6761 0.0727  0.0057  -0.0810 33  MET A SD  
112  C CE  . MET A 21  ? 0.5568 0.6155 0.6359 0.0782  0.0128  -0.0781 33  MET A CE  
113  N N   . GLU A 22  ? 0.5727 0.4990 0.5826 0.0798  -0.0169 -0.1054 34  GLU A N   
114  C CA  . GLU A 22  ? 0.5890 0.4889 0.5914 0.0713  -0.0273 -0.1069 34  GLU A CA  
115  C C   . GLU A 22  ? 0.5989 0.4995 0.6147 0.0643  -0.0290 -0.0983 34  GLU A C   
116  O O   . GLU A 22  ? 0.5851 0.4898 0.6058 0.0723  -0.0238 -0.0948 34  GLU A O   
117  C CB  . GLU A 22  ? 0.6495 0.5176 0.6286 0.0816  -0.0313 -0.1159 34  GLU A CB  
118  C CG  . GLU A 22  ? 0.8285 0.6859 0.7911 0.0807  -0.0362 -0.1244 34  GLU A CG  
119  C CD  . GLU A 22  ? 1.2850 1.1124 1.2205 0.0940  -0.0387 -0.1349 34  GLU A CD  
120  O OE1 . GLU A 22  ? 1.3185 1.1402 1.2390 0.0958  -0.0409 -0.1421 34  GLU A OE1 
121  O OE2 . GLU A 22  ? 1.2849 1.0937 1.2129 0.1033  -0.0385 -0.1360 34  GLU A OE2 
122  N N   . PHE A 23  ? 0.5316 0.4298 0.5541 0.0494  -0.0362 -0.0940 35  PHE A N   
123  C CA  . PHE A 23  ? 0.5112 0.4105 0.5462 0.0406  -0.0384 -0.0847 35  PHE A CA  
124  C C   . PHE A 23  ? 0.6131 0.4851 0.6413 0.0310  -0.0496 -0.0845 35  PHE A C   
125  O O   . PHE A 23  ? 0.6257 0.4852 0.6446 0.0256  -0.0570 -0.0900 35  PHE A O   
126  C CB  . PHE A 23  ? 0.4898 0.4178 0.5427 0.0309  -0.0354 -0.0771 35  PHE A CB  
127  C CG  . PHE A 23  ? 0.4703 0.4238 0.5313 0.0384  -0.0257 -0.0755 35  PHE A CG  
128  C CD1 . PHE A 23  ? 0.4843 0.4474 0.5541 0.0417  -0.0209 -0.0691 35  PHE A CD1 
129  C CD2 . PHE A 23  ? 0.4661 0.4334 0.5255 0.0416  -0.0220 -0.0802 35  PHE A CD2 
130  C CE1 . PHE A 23  ? 0.4609 0.4462 0.5378 0.0476  -0.0135 -0.0676 35  PHE A CE1 
131  C CE2 . PHE A 23  ? 0.4664 0.4562 0.5336 0.0472  -0.0141 -0.0780 35  PHE A CE2 
132  C CZ  . PHE A 23  ? 0.4235 0.4220 0.4995 0.0498  -0.0103 -0.0719 35  PHE A CZ  
133  N N   . ASN A 24  ? 0.5849 0.4470 0.6174 0.0283  -0.0516 -0.0777 36  ASN A N   
134  C CA  . ASN A 24  ? 0.6053 0.4442 0.6354 0.0164  -0.0624 -0.0743 36  ASN A CA  
135  C C   . ASN A 24  ? 0.6397 0.5006 0.6896 0.0012  -0.0631 -0.0630 36  ASN A C   
136  O O   . ASN A 24  ? 0.6276 0.5043 0.6900 0.0006  -0.0574 -0.0540 36  ASN A O   
137  C CB  . ASN A 24  ? 0.6269 0.4413 0.6497 0.0225  -0.0643 -0.0726 36  ASN A CB  
138  C CG  . ASN A 24  ? 0.9010 0.6902 0.9023 0.0377  -0.0650 -0.0840 36  ASN A CG  
139  O OD1 . ASN A 24  ? 0.9614 0.7241 0.9458 0.0366  -0.0737 -0.0920 36  ASN A OD1 
140  N ND2 . ASN A 24  ? 0.7535 0.5510 0.7546 0.0527  -0.0559 -0.0847 36  ASN A ND2 
141  N N   . CYS A 25  ? 0.5881 0.4516 0.6401 -0.0100 -0.0696 -0.0636 37  CYS A N   
142  C CA  . CYS A 25  ? 0.5630 0.4485 0.6336 -0.0241 -0.0707 -0.0530 37  CYS A CA  
143  C C   . CYS A 25  ? 0.6334 0.4999 0.7068 -0.0378 -0.0814 -0.0454 37  CYS A C   
144  O O   . CYS A 25  ? 0.6498 0.4875 0.7099 -0.0419 -0.0924 -0.0513 37  CYS A O   
145  C CB  . CYS A 25  ? 0.5516 0.4516 0.6240 -0.0283 -0.0724 -0.0571 37  CYS A CB  
146  S SG  . CYS A 25  ? 0.5784 0.5089 0.6742 -0.0436 -0.0730 -0.0441 37  CYS A SG  
147  N N   . GLU A 26  ? 0.5788 0.4600 0.6683 -0.0448 -0.0783 -0.0320 38  GLU A N   
148  C CA  . GLU A 26  ? 0.5984 0.4662 0.6941 -0.0595 -0.0877 -0.0218 38  GLU A CA  
149  C C   . GLU A 26  ? 0.6963 0.5676 0.7987 -0.0748 -0.0976 -0.0196 38  GLU A C   
150  O O   . GLU A 26  ? 0.6779 0.5747 0.7882 -0.0752 -0.0937 -0.0205 38  GLU A O   
151  C CB  . GLU A 26  ? 0.5927 0.4807 0.7046 -0.0627 -0.0805 -0.0071 38  GLU A CB  
152  C CG  . GLU A 26  ? 0.6699 0.5451 0.7744 -0.0518 -0.0756 -0.0068 38  GLU A CG  
153  C CD  . GLU A 26  ? 0.7984 0.6885 0.9160 -0.0559 -0.0704 0.0083  38  GLU A CD  
154  O OE1 . GLU A 26  ? 0.5286 0.4372 0.6487 -0.0457 -0.0599 0.0094  38  GLU A OE1 
155  O OE2 . GLU A 26  ? 0.8012 0.6839 0.9260 -0.0693 -0.0771 0.0192  38  GLU A OE2 
156  N N   . MET A 27  ? 0.7021 0.5475 0.8015 -0.0875 -0.1110 -0.0163 39  MET A N   
157  C CA  . MET A 27  ? 0.7242 0.5667 0.8277 -0.1030 -0.1237 -0.0149 39  MET A CA  
158  C C   . MET A 27  ? 0.7327 0.6155 0.8618 -0.1136 -0.1199 -0.0018 39  MET A C   
159  O O   . MET A 27  ? 0.7241 0.6187 0.8570 -0.1188 -0.1243 -0.0044 39  MET A O   
160  C CB  . MET A 27  ? 0.8020 0.6093 0.8999 -0.1162 -0.1391 -0.0107 39  MET A CB  
161  C CG  . MET A 27  ? 0.8984 0.6611 0.9679 -0.1064 -0.1459 -0.0251 39  MET A CG  
162  S SD  . MET A 27  ? 0.9888 0.7362 1.0365 -0.1003 -0.1529 -0.0437 39  MET A SD  
163  C CE  . MET A 27  ? 0.9932 0.6895 1.0088 -0.0867 -0.1582 -0.0570 39  MET A CE  
164  N N   . LYS A 28  ? 0.6635 0.5674 0.8090 -0.1156 -0.1116 0.0121  40  LYS A N   
165  C CA  . LYS A 28  ? 0.6356 0.5769 0.8052 -0.1251 -0.1077 0.0264  40  LYS A CA  
166  C C   . LYS A 28  ? 0.6076 0.5825 0.7830 -0.1119 -0.0919 0.0254  40  LYS A C   
167  O O   . LYS A 28  ? 0.5870 0.5943 0.7808 -0.1161 -0.0862 0.0369  40  LYS A O   
168  C CB  . LYS A 28  ? 0.6852 0.6291 0.8692 -0.1369 -0.1091 0.0441  40  LYS A CB  
169  C CG  . LYS A 28  ? 0.9017 0.8300 1.0920 -0.1571 -0.1260 0.0513  40  LYS A CG  
170  C CD  . LYS A 28  ? 1.0546 0.9843 1.2591 -0.1694 -0.1277 0.0698  40  LYS A CD  
171  C CE  . LYS A 28  ? 1.2166 1.1375 1.4318 -0.1915 -0.1445 0.0793  40  LYS A CE  
172  N NZ  . LYS A 28  ? 1.3298 1.2538 1.5602 -0.2043 -0.1458 0.0992  40  LYS A NZ  
173  N N   . TRP A 29  ? 0.5171 0.4843 0.6767 -0.0959 -0.0854 0.0118  41  TRP A N   
174  C CA  . TRP A 29  ? 0.4631 0.4567 0.6251 -0.0833 -0.0721 0.0091  41  TRP A CA  
175  C C   . TRP A 29  ? 0.5100 0.5255 0.6788 -0.0852 -0.0721 0.0070  41  TRP A C   
176  O O   . TRP A 29  ? 0.5155 0.5190 0.6781 -0.0900 -0.0815 -0.0001 41  TRP A O   
177  C CB  . TRP A 29  ? 0.4290 0.4071 0.5731 -0.0675 -0.0671 -0.0042 41  TRP A CB  
178  C CG  . TRP A 29  ? 0.4240 0.3998 0.5662 -0.0593 -0.0596 -0.0005 41  TRP A CG  
179  C CD1 . TRP A 29  ? 0.4606 0.4401 0.6119 -0.0647 -0.0581 0.0124  41  TRP A CD1 
180  C CD2 . TRP A 29  ? 0.4113 0.3811 0.5419 -0.0444 -0.0530 -0.0093 41  TRP A CD2 
181  N NE1 . TRP A 29  ? 0.4441 0.4193 0.5890 -0.0537 -0.0513 0.0116  41  TRP A NE1 
182  C CE2 . TRP A 29  ? 0.4555 0.4257 0.5886 -0.0413 -0.0481 -0.0015 41  TRP A CE2 
183  C CE3 . TRP A 29  ? 0.4222 0.3880 0.5412 -0.0334 -0.0505 -0.0222 41  TRP A CE3 
184  C CZ2 . TRP A 29  ? 0.4423 0.4090 0.5673 -0.0278 -0.0418 -0.0063 41  TRP A CZ2 
185  C CZ3 . TRP A 29  ? 0.4353 0.3986 0.5474 -0.0203 -0.0438 -0.0263 41  TRP A CZ3 
186  C CH2 . TRP A 29  ? 0.4407 0.4045 0.5561 -0.0178 -0.0399 -0.0186 41  TRP A CH2 
187  N N   . LYS A 30  ? 0.4512 0.4978 0.6314 -0.0806 -0.0618 0.0132  42  LYS A N   
188  C CA  . LYS A 30  ? 0.4294 0.4994 0.6158 -0.0792 -0.0594 0.0116  42  LYS A CA  
189  C C   . LYS A 30  ? 0.4774 0.5455 0.6501 -0.0648 -0.0529 -0.0015 42  LYS A C   
190  O O   . LYS A 30  ? 0.4822 0.5353 0.6435 -0.0562 -0.0494 -0.0074 42  LYS A O   
191  C CB  . LYS A 30  ? 0.4346 0.5377 0.6391 -0.0806 -0.0515 0.0256  42  LYS A CB  
192  C CG  . LYS A 30  ? 0.6445 0.7549 0.8659 -0.0963 -0.0581 0.0404  42  LYS A CG  
193  C CD  . LYS A 30  ? 0.7781 0.9212 1.0163 -0.0957 -0.0484 0.0555  42  LYS A CD  
194  C CE  . LYS A 30  ? 0.9253 1.0804 1.1830 -0.1120 -0.0551 0.0713  42  LYS A CE  
195  N NZ  . LYS A 30  ? 1.0445 1.2377 1.3199 -0.1102 -0.0455 0.0854  42  LYS A NZ  
196  N N   . GLY A 31  ? 0.4234 0.5068 0.5978 -0.0626 -0.0519 -0.0052 43  GLY A N   
197  C CA  . GLY A 31  ? 0.4047 0.4895 0.5682 -0.0503 -0.0458 -0.0158 43  GLY A CA  
198  C C   . GLY A 31  ? 0.4334 0.5253 0.5950 -0.0395 -0.0351 -0.0150 43  GLY A C   
199  O O   . GLY A 31  ? 0.4314 0.5127 0.5814 -0.0305 -0.0321 -0.0237 43  GLY A O   
200  N N   . LYS A 32  ? 0.3722 0.4822 0.5451 -0.0403 -0.0294 -0.0040 44  LYS A N   
201  C CA  . LYS A 32  ? 0.3449 0.4622 0.5158 -0.0308 -0.0201 -0.0020 44  LYS A CA  
202  C C   . LYS A 32  ? 0.4027 0.4995 0.5650 -0.0276 -0.0203 -0.0044 44  LYS A C   
203  O O   . LYS A 32  ? 0.3917 0.4874 0.5470 -0.0180 -0.0149 -0.0086 44  LYS A O   
204  C CB  . LYS A 32  ? 0.3576 0.4971 0.5409 -0.0326 -0.0148 0.0109  44  LYS A CB  
205  C CG  . LYS A 32  ? 0.5011 0.6517 0.6802 -0.0213 -0.0053 0.0117  44  LYS A CG  
206  C CD  . LYS A 32  ? 0.5814 0.7395 0.7551 -0.0134 -0.0024 0.0038  44  LYS A CD  
207  C CE  . LYS A 32  ? 0.6433 0.8117 0.8125 -0.0032 0.0055  0.0052  44  LYS A CE  
208  N NZ  . LYS A 32  ? 0.7625 0.9345 0.9256 0.0034  0.0068  -0.0026 44  LYS A NZ  
209  N N   . ASP A 33  ? 0.3614 0.4415 0.5242 -0.0357 -0.0272 -0.0018 45  ASP A N   
210  C CA  . ASP A 33  ? 0.3646 0.4241 0.5192 -0.0323 -0.0278 -0.0035 45  ASP A CA  
211  C C   . ASP A 33  ? 0.4291 0.4714 0.5697 -0.0242 -0.0292 -0.0167 45  ASP A C   
212  O O   . ASP A 33  ? 0.4309 0.4672 0.5651 -0.0152 -0.0251 -0.0196 45  ASP A O   
213  C CB  . ASP A 33  ? 0.4025 0.4474 0.5609 -0.0435 -0.0354 0.0038  45  ASP A CB  
214  C CG  . ASP A 33  ? 0.4921 0.5566 0.6659 -0.0518 -0.0335 0.0187  45  ASP A CG  
215  O OD1 . ASP A 33  ? 0.4797 0.5572 0.6561 -0.0463 -0.0253 0.0252  45  ASP A OD1 
216  O OD2 . ASP A 33  ? 0.5665 0.6342 0.7496 -0.0637 -0.0401 0.0242  45  ASP A OD2 
217  N N   . LEU A 34  ? 0.3784 0.4147 0.5145 -0.0267 -0.0346 -0.0242 46  LEU A N   
218  C CA  . LEU A 34  ? 0.3714 0.3941 0.4937 -0.0183 -0.0350 -0.0363 46  LEU A CA  
219  C C   . LEU A 34  ? 0.4008 0.4405 0.5227 -0.0085 -0.0265 -0.0396 46  LEU A C   
220  O O   . LEU A 34  ? 0.3999 0.4330 0.5144 0.0008  -0.0231 -0.0447 46  LEU A O   
221  C CB  . LEU A 34  ? 0.3788 0.3919 0.4955 -0.0239 -0.0432 -0.0426 46  LEU A CB  
222  C CG  . LEU A 34  ? 0.4301 0.4319 0.5316 -0.0150 -0.0431 -0.0548 46  LEU A CG  
223  C CD1 . LEU A 34  ? 0.4355 0.4152 0.5249 -0.0063 -0.0426 -0.0600 46  LEU A CD1 
224  C CD2 . LEU A 34  ? 0.4622 0.4554 0.5578 -0.0215 -0.0520 -0.0598 46  LEU A CD2 
225  N N   . PHE A 35  ? 0.3295 0.3908 0.4598 -0.0104 -0.0234 -0.0359 47  PHE A N   
226  C CA  . PHE A 35  ? 0.3039 0.3803 0.4337 -0.0025 -0.0166 -0.0383 47  PHE A CA  
227  C C   . PHE A 35  ? 0.3729 0.4517 0.5025 0.0043  -0.0109 -0.0355 47  PHE A C   
228  O O   . PHE A 35  ? 0.3666 0.4452 0.4910 0.0120  -0.0078 -0.0405 47  PHE A O   
229  C CB  . PHE A 35  ? 0.3041 0.4009 0.4425 -0.0060 -0.0151 -0.0337 47  PHE A CB  
230  C CG  . PHE A 35  ? 0.3006 0.4109 0.4377 0.0016  -0.0090 -0.0354 47  PHE A CG  
231  C CD1 . PHE A 35  ? 0.3298 0.4387 0.4602 0.0059  -0.0088 -0.0432 47  PHE A CD1 
232  C CD2 . PHE A 35  ? 0.2933 0.4167 0.4350 0.0043  -0.0039 -0.0291 47  PHE A CD2 
233  C CE1 . PHE A 35  ? 0.3170 0.4365 0.4462 0.0117  -0.0042 -0.0441 47  PHE A CE1 
234  C CE2 . PHE A 35  ? 0.3120 0.4442 0.4505 0.0111  0.0003  -0.0312 47  PHE A CE2 
235  C CZ  . PHE A 35  ? 0.2873 0.4172 0.4202 0.0141  -0.0002 -0.0385 47  PHE A CZ  
236  N N   . ASP A 36  ? 0.3576 0.4389 0.4929 0.0012  -0.0100 -0.0269 48  ASP A N   
237  C CA  . ASP A 36  ? 0.3552 0.4395 0.4896 0.0074  -0.0052 -0.0236 48  ASP A CA  
238  C C   . ASP A 36  ? 0.4429 0.5103 0.5707 0.0124  -0.0064 -0.0273 48  ASP A C   
239  O O   . ASP A 36  ? 0.4631 0.5333 0.5885 0.0195  -0.0029 -0.0277 48  ASP A O   
240  C CB  . ASP A 36  ? 0.3762 0.4692 0.5175 0.0034  -0.0033 -0.0127 48  ASP A CB  
241  C CG  . ASP A 36  ? 0.5118 0.6253 0.6574 0.0046  0.0012  -0.0092 48  ASP A CG  
242  O OD1 . ASP A 36  ? 0.5038 0.6233 0.6448 0.0121  0.0053  -0.0109 48  ASP A OD1 
243  O OD2 . ASP A 36  ? 0.6203 0.7432 0.7734 -0.0017 0.0001  -0.0045 48  ASP A OD2 
244  N N   . LEU A 37  ? 0.3959 0.4452 0.5198 0.0092  -0.0117 -0.0302 49  LEU A N   
245  C CA  . LEU A 37  ? 0.3906 0.4223 0.5065 0.0157  -0.0129 -0.0351 49  LEU A CA  
246  C C   . LEU A 37  ? 0.4364 0.4719 0.5472 0.0245  -0.0098 -0.0433 49  LEU A C   
247  O O   . LEU A 37  ? 0.4383 0.4721 0.5467 0.0325  -0.0072 -0.0443 49  LEU A O   
248  C CB  . LEU A 37  ? 0.4040 0.4135 0.5146 0.0106  -0.0200 -0.0374 49  LEU A CB  
249  C CG  . LEU A 37  ? 0.4629 0.4508 0.5627 0.0187  -0.0217 -0.0433 49  LEU A CG  
250  C CD1 . LEU A 37  ? 0.4549 0.4389 0.5560 0.0230  -0.0197 -0.0373 49  LEU A CD1 
251  C CD2 . LEU A 37  ? 0.4928 0.4570 0.5844 0.0135  -0.0300 -0.0473 49  LEU A CD2 
252  N N   . VAL A 38  ? 0.3848 0.4261 0.4943 0.0229  -0.0102 -0.0483 50  VAL A N   
253  C CA  . VAL A 38  ? 0.3693 0.4163 0.4746 0.0301  -0.0070 -0.0548 50  VAL A CA  
254  C C   . VAL A 38  ? 0.4026 0.4662 0.5132 0.0341  -0.0020 -0.0515 50  VAL A C   
255  O O   . VAL A 38  ? 0.4111 0.4764 0.5202 0.0414  0.0006  -0.0535 50  VAL A O   
256  C CB  . VAL A 38  ? 0.4185 0.4686 0.5213 0.0264  -0.0091 -0.0594 50  VAL A CB  
257  C CG1 . VAL A 38  ? 0.4059 0.4630 0.5045 0.0335  -0.0052 -0.0647 50  VAL A CG1 
258  C CG2 . VAL A 38  ? 0.4357 0.4669 0.5313 0.0220  -0.0157 -0.0631 50  VAL A CG2 
259  N N   . CYS A 39  ? 0.3444 0.4200 0.4608 0.0297  -0.0010 -0.0462 51  CYS A N   
260  C CA  . CYS A 39  ? 0.3164 0.4052 0.4356 0.0329  0.0025  -0.0434 51  CYS A CA  
261  C C   . CYS A 39  ? 0.3763 0.4617 0.4952 0.0378  0.0034  -0.0404 51  CYS A C   
262  O O   . CYS A 39  ? 0.3768 0.4680 0.4957 0.0428  0.0049  -0.0414 51  CYS A O   
263  C CB  . CYS A 39  ? 0.3087 0.4080 0.4318 0.0284  0.0032  -0.0383 51  CYS A CB  
264  S SG  . CYS A 39  ? 0.3495 0.4564 0.4740 0.0239  0.0022  -0.0410 51  CYS A SG  
265  N N   . ARG A 40  ? 0.3254 0.4014 0.4446 0.0358  0.0018  -0.0361 52  ARG A N   
266  C CA  . ARG A 40  ? 0.3291 0.4005 0.4477 0.0403  0.0021  -0.0326 52  ARG A CA  
267  C C   . ARG A 40  ? 0.4125 0.4773 0.5284 0.0476  0.0021  -0.0374 52  ARG A C   
268  O O   . ARG A 40  ? 0.4260 0.4948 0.5430 0.0531  0.0030  -0.0355 52  ARG A O   
269  C CB  . ARG A 40  ? 0.3452 0.4065 0.4643 0.0359  0.0002  -0.0266 52  ARG A CB  
270  C CG  . ARG A 40  ? 0.3251 0.3863 0.4438 0.0393  0.0010  -0.0202 52  ARG A CG  
271  C CD  . ARG A 40  ? 0.3810 0.4389 0.5014 0.0333  0.0005  -0.0117 52  ARG A CD  
272  N NE  . ARG A 40  ? 0.4740 0.5166 0.5947 0.0276  -0.0034 -0.0115 52  ARG A NE  
273  C CZ  . ARG A 40  ? 0.5544 0.5980 0.6795 0.0185  -0.0050 -0.0071 52  ARG A CZ  
274  N NH1 . ARG A 40  ? 0.3683 0.4291 0.4982 0.0154  -0.0018 -0.0021 52  ARG A NH1 
275  N NH2 . ARG A 40  ? 0.5363 0.5634 0.6606 0.0128  -0.0102 -0.0074 52  ARG A NH2 
276  N N   . THR A 41  ? 0.3800 0.4355 0.4921 0.0482  0.0009  -0.0433 53  THR A N   
277  C CA  . THR A 41  ? 0.3758 0.4256 0.4842 0.0566  0.0019  -0.0481 53  THR A CA  
278  C C   . THR A 41  ? 0.4066 0.4731 0.5186 0.0611  0.0053  -0.0493 53  THR A C   
279  O O   . THR A 41  ? 0.4261 0.4949 0.5393 0.0687  0.0069  -0.0493 53  THR A O   
280  C CB  . THR A 41  ? 0.3820 0.4174 0.4827 0.0561  -0.0003 -0.0545 53  THR A CB  
281  O OG1 . THR A 41  ? 0.3123 0.3309 0.4102 0.0507  -0.0048 -0.0525 53  THR A OG1 
282  C CG2 . THR A 41  ? 0.2925 0.3216 0.3870 0.0668  0.0017  -0.0598 53  THR A CG2 
283  N N   . LEU A 42  ? 0.3355 0.4137 0.4499 0.0563  0.0059  -0.0495 54  LEU A N   
284  C CA  . LEU A 42  ? 0.3197 0.4123 0.4373 0.0587  0.0081  -0.0501 54  LEU A CA  
285  C C   . LEU A 42  ? 0.3579 0.4603 0.4798 0.0575  0.0075  -0.0451 54  LEU A C   
286  O O   . LEU A 42  ? 0.3495 0.4626 0.4743 0.0582  0.0079  -0.0447 54  LEU A O   
287  C CB  . LEU A 42  ? 0.3114 0.4084 0.4271 0.0548  0.0086  -0.0538 54  LEU A CB  
288  C CG  . LEU A 42  ? 0.3669 0.4535 0.4760 0.0554  0.0082  -0.0594 54  LEU A CG  
289  C CD1 . LEU A 42  ? 0.3569 0.4485 0.4643 0.0504  0.0077  -0.0618 54  LEU A CD1 
290  C CD2 . LEU A 42  ? 0.4225 0.5077 0.5287 0.0642  0.0109  -0.0623 54  LEU A CD2 
291  N N   . GLY A 43  ? 0.3043 0.4017 0.4256 0.0557  0.0061  -0.0411 55  GLY A N   
292  C CA  . GLY A 43  ? 0.2850 0.3885 0.4071 0.0552  0.0051  -0.0365 55  GLY A CA  
293  C C   . GLY A 43  ? 0.3196 0.4306 0.4402 0.0514  0.0052  -0.0367 55  GLY A C   
294  O O   . GLY A 43  ? 0.3058 0.4222 0.4254 0.0521  0.0038  -0.0348 55  GLY A O   
295  N N   . LEU A 44  ? 0.2955 0.4058 0.4154 0.0474  0.0061  -0.0389 56  LEU A N   
296  C CA  . LEU A 44  ? 0.2843 0.4014 0.4029 0.0447  0.0065  -0.0397 56  LEU A CA  
297  C C   . LEU A 44  ? 0.3073 0.4257 0.4244 0.0426  0.0072  -0.0355 56  LEU A C   
298  O O   . LEU A 44  ? 0.3005 0.4154 0.4194 0.0395  0.0075  -0.0333 56  LEU A O   
299  C CB  . LEU A 44  ? 0.2895 0.4065 0.4086 0.0424  0.0070  -0.0442 56  LEU A CB  
300  C CG  . LEU A 44  ? 0.3608 0.4841 0.4789 0.0397  0.0072  -0.0449 56  LEU A CG  
301  C CD1 . LEU A 44  ? 0.3632 0.4920 0.4800 0.0414  0.0069  -0.0462 56  LEU A CD1 
302  C CD2 . LEU A 44  ? 0.3935 0.5147 0.5118 0.0366  0.0068  -0.0481 56  LEU A CD2 
303  N N   . ARG A 45  ? 0.2678 0.3910 0.3810 0.0444  0.0071  -0.0339 57  ARG A N   
304  C CA  . ARG A 45  ? 0.2594 0.3856 0.3693 0.0445  0.0088  -0.0296 57  ARG A CA  
305  C C   . ARG A 45  ? 0.3116 0.4440 0.4201 0.0440  0.0099  -0.0310 57  ARG A C   
306  O O   . ARG A 45  ? 0.3324 0.4697 0.4417 0.0434  0.0122  -0.0274 57  ARG A O   
307  C CB  . ARG A 45  ? 0.2394 0.3644 0.3425 0.0488  0.0078  -0.0269 57  ARG A CB  
308  C CG  . ARG A 45  ? 0.2584 0.3783 0.3625 0.0496  0.0073  -0.0233 57  ARG A CG  
309  C CD  . ARG A 45  ? 0.2687 0.3874 0.3646 0.0539  0.0057  -0.0205 57  ARG A CD  
310  N NE  . ARG A 45  ? 0.3121 0.4309 0.4040 0.0558  0.0018  -0.0242 57  ARG A NE  
311  C CZ  . ARG A 45  ? 0.4274 0.5455 0.5232 0.0559  -0.0017 -0.0257 57  ARG A CZ  
312  N NH1 . ARG A 45  ? 0.3124 0.4289 0.4151 0.0559  -0.0012 -0.0247 57  ARG A NH1 
313  N NH2 . ARG A 45  ? 0.2802 0.3991 0.3733 0.0562  -0.0060 -0.0279 57  ARG A NH2 
314  N N   . GLU A 46  ? 0.2634 0.3962 0.3704 0.0445  0.0082  -0.0355 58  GLU A N   
315  C CA  . GLU A 46  ? 0.2555 0.3926 0.3605 0.0446  0.0086  -0.0373 58  GLU A CA  
316  C C   . GLU A 46  ? 0.3340 0.4739 0.4452 0.0404  0.0093  -0.0386 58  GLU A C   
317  O O   . GLU A 46  ? 0.3341 0.4741 0.4460 0.0392  0.0083  -0.0424 58  GLU A O   
318  C CB  . GLU A 46  ? 0.2637 0.3987 0.3645 0.0459  0.0057  -0.0406 58  GLU A CB  
319  C CG  . GLU A 46  ? 0.3736 0.5043 0.4674 0.0491  0.0032  -0.0394 58  GLU A CG  
320  C CD  . GLU A 46  ? 0.5127 0.6402 0.6032 0.0489  -0.0014 -0.0414 58  GLU A CD  
321  O OE1 . GLU A 46  ? 0.3477 0.4775 0.4448 0.0462  -0.0023 -0.0426 58  GLU A OE1 
322  O OE2 . GLU A 46  ? 0.5458 0.6683 0.6268 0.0516  -0.0043 -0.0413 58  GLU A OE2 
323  N N   . THR A 47  ? 0.3104 0.4527 0.4260 0.0379  0.0107  -0.0349 59  THR A N   
324  C CA  . THR A 47  ? 0.3075 0.4491 0.4289 0.0327  0.0096  -0.0359 59  THR A CA  
325  C C   . THR A 47  ? 0.3219 0.4717 0.4457 0.0309  0.0096  -0.0356 59  THR A C   
326  O O   . THR A 47  ? 0.3191 0.4676 0.4456 0.0269  0.0073  -0.0381 59  THR A O   
327  C CB  . THR A 47  ? 0.3761 0.5146 0.5019 0.0293  0.0095  -0.0313 59  THR A CB  
328  O OG1 . THR A 47  ? 0.3644 0.5114 0.4921 0.0297  0.0121  -0.0245 59  THR A OG1 
329  C CG2 . THR A 47  ? 0.3300 0.4595 0.4536 0.0314  0.0090  -0.0315 59  THR A CG2 
330  N N   . TRP A 48  ? 0.2574 0.4148 0.3790 0.0347  0.0118  -0.0328 60  TRP A N   
331  C CA  . TRP A 48  ? 0.2485 0.4158 0.3730 0.0347  0.0123  -0.0311 60  TRP A CA  
332  C C   . TRP A 48  ? 0.2993 0.4652 0.4222 0.0337  0.0098  -0.0365 60  TRP A C   
333  O O   . TRP A 48  ? 0.3126 0.4857 0.4396 0.0318  0.0090  -0.0354 60  TRP A O   
334  C CB  . TRP A 48  ? 0.2297 0.4031 0.3490 0.0418  0.0157  -0.0278 60  TRP A CB  
335  C CG  . TRP A 48  ? 0.2420 0.4068 0.3504 0.0472  0.0150  -0.0317 60  TRP A CG  
336  C CD1 . TRP A 48  ? 0.2734 0.4342 0.3760 0.0493  0.0129  -0.0361 60  TRP A CD1 
337  C CD2 . TRP A 48  ? 0.2436 0.4018 0.3458 0.0500  0.0152  -0.0311 60  TRP A CD2 
338  N NE1 . TRP A 48  ? 0.2684 0.4204 0.3621 0.0526  0.0114  -0.0381 60  TRP A NE1 
339  C CE2 . TRP A 48  ? 0.2875 0.4380 0.3806 0.0533  0.0126  -0.0354 60  TRP A CE2 
340  C CE3 . TRP A 48  ? 0.2607 0.4186 0.3640 0.0499  0.0169  -0.0268 60  TRP A CE3 
341  C CZ2 . TRP A 48  ? 0.2772 0.4200 0.3625 0.0561  0.0108  -0.0359 60  TRP A CZ2 
342  C CZ3 . TRP A 48  ? 0.2867 0.4373 0.3815 0.0537  0.0159  -0.0274 60  TRP A CZ3 
343  C CH2 . TRP A 48  ? 0.2940 0.4372 0.3801 0.0566  0.0125  -0.0321 60  TRP A CH2 
344  N N   . PHE A 49  ? 0.2510 0.4089 0.3685 0.0350  0.0087  -0.0414 61  PHE A N   
345  C CA  . PHE A 49  ? 0.2474 0.4038 0.3627 0.0341  0.0068  -0.0458 61  PHE A CA  
346  C C   . PHE A 49  ? 0.3243 0.4785 0.4428 0.0292  0.0047  -0.0482 61  PHE A C   
347  O O   . PHE A 49  ? 0.3508 0.5063 0.4680 0.0281  0.0031  -0.0506 61  PHE A O   
348  C CB  . PHE A 49  ? 0.2634 0.4138 0.3738 0.0362  0.0065  -0.0487 61  PHE A CB  
349  C CG  . PHE A 49  ? 0.2820 0.4311 0.3867 0.0404  0.0065  -0.0475 61  PHE A CG  
350  C CD1 . PHE A 49  ? 0.3154 0.4661 0.4157 0.0430  0.0060  -0.0474 61  PHE A CD1 
351  C CD2 . PHE A 49  ? 0.2986 0.4431 0.4011 0.0419  0.0060  -0.0469 61  PHE A CD2 
352  C CE1 . PHE A 49  ? 0.3258 0.4715 0.4181 0.0472  0.0049  -0.0471 61  PHE A CE1 
353  C CE2 . PHE A 49  ? 0.3320 0.4726 0.4271 0.0454  0.0045  -0.0465 61  PHE A CE2 
354  C CZ  . PHE A 49  ? 0.3119 0.4521 0.4012 0.0480  0.0038  -0.0468 61  PHE A CZ  
355  N N   . PHE A 50  ? 0.2596 0.4091 0.3811 0.0266  0.0043  -0.0475 62  PHE A N   
356  C CA  . PHE A 50  ? 0.2460 0.3878 0.3666 0.0234  0.0017  -0.0512 62  PHE A CA  
357  C C   . PHE A 50  ? 0.3251 0.4673 0.4507 0.0173  -0.0016 -0.0489 62  PHE A C   
358  O O   . PHE A 50  ? 0.3335 0.4831 0.4655 0.0154  -0.0010 -0.0430 62  PHE A O   
359  C CB  . PHE A 50  ? 0.2517 0.3844 0.3703 0.0255  0.0026  -0.0528 62  PHE A CB  
360  C CG  . PHE A 50  ? 0.2481 0.3820 0.3636 0.0303  0.0049  -0.0543 62  PHE A CG  
361  C CD1 . PHE A 50  ? 0.2646 0.3972 0.3764 0.0320  0.0051  -0.0583 62  PHE A CD1 
362  C CD2 . PHE A 50  ? 0.2643 0.4009 0.3803 0.0328  0.0063  -0.0511 62  PHE A CD2 
363  C CE1 . PHE A 50  ? 0.2685 0.4041 0.3795 0.0352  0.0068  -0.0581 62  PHE A CE1 
364  C CE2 . PHE A 50  ? 0.2902 0.4277 0.4041 0.0358  0.0068  -0.0519 62  PHE A CE2 
365  C CZ  . PHE A 50  ? 0.2555 0.3932 0.3680 0.0365  0.0070  -0.0549 62  PHE A CZ  
366  N N   . GLY A 51  ? 0.2895 0.4239 0.4116 0.0145  -0.0054 -0.0533 63  GLY A N   
367  C CA  . GLY A 51  ? 0.2903 0.4209 0.4157 0.0075  -0.0107 -0.0521 63  GLY A CA  
368  C C   . GLY A 51  ? 0.3493 0.4638 0.4659 0.0070  -0.0144 -0.0588 63  GLY A C   
369  O O   . GLY A 51  ? 0.3210 0.4300 0.4301 0.0129  -0.0117 -0.0637 63  GLY A O   
370  N N   . LEU A 52  ? 0.3502 0.4571 0.4674 0.0000  -0.0210 -0.0586 64  LEU A N   
371  C CA  . LEU A 52  ? 0.3664 0.4549 0.4725 -0.0006 -0.0262 -0.0656 64  LEU A CA  
372  C C   . LEU A 52  ? 0.4331 0.5227 0.5358 -0.0048 -0.0322 -0.0683 64  LEU A C   
373  O O   . LEU A 52  ? 0.4202 0.5151 0.5308 -0.0130 -0.0379 -0.0638 64  LEU A O   
374  C CB  . LEU A 52  ? 0.3752 0.4485 0.4817 -0.0055 -0.0308 -0.0640 64  LEU A CB  
375  C CG  . LEU A 52  ? 0.4344 0.5038 0.5423 -0.0007 -0.0256 -0.0619 64  LEU A CG  
376  C CD1 . LEU A 52  ? 0.4474 0.5053 0.5588 -0.0074 -0.0303 -0.0574 64  LEU A CD1 
377  C CD2 . LEU A 52  ? 0.4790 0.5381 0.5754 0.0090  -0.0220 -0.0690 64  LEU A CD2 
378  N N   . GLN A 53  ? 0.4187 0.5048 0.5100 0.0009  -0.0310 -0.0749 65  GLN A N   
379  C CA  . GLN A 53  ? 0.4286 0.5169 0.5146 -0.0012 -0.0358 -0.0778 65  GLN A CA  
380  C C   . GLN A 53  ? 0.5304 0.5978 0.6015 -0.0026 -0.0434 -0.0852 65  GLN A C   
381  O O   . GLN A 53  ? 0.5359 0.5874 0.5966 0.0027  -0.0421 -0.0902 65  GLN A O   
382  C CB  . GLN A 53  ? 0.4276 0.5257 0.5095 0.0062  -0.0294 -0.0794 65  GLN A CB  
383  C CG  . GLN A 53  ? 0.5674 0.6736 0.6477 0.0041  -0.0331 -0.0795 65  GLN A CG  
384  C CD  . GLN A 53  ? 0.6910 0.8001 0.7624 0.0114  -0.0280 -0.0825 65  GLN A CD  
385  O OE1 . GLN A 53  ? 0.6324 0.7544 0.7094 0.0137  -0.0235 -0.0788 65  GLN A OE1 
386  N NE2 . GLN A 53  ? 0.5094 0.6060 0.5659 0.0154  -0.0286 -0.0891 65  GLN A NE2 
387  N N   . TYR A 54  ? 0.5180 0.5853 0.5877 -0.0092 -0.0519 -0.0856 66  TYR A N   
388  C CA  . TYR A 54  ? 0.5541 0.6021 0.6073 -0.0109 -0.0609 -0.0931 66  TYR A CA  
389  C C   . TYR A 54  ? 0.6347 0.6928 0.6864 -0.0137 -0.0658 -0.0931 66  TYR A C   
390  O O   . TYR A 54  ? 0.5796 0.6590 0.6442 -0.0142 -0.0618 -0.0870 66  TYR A O   
391  C CB  . TYR A 54  ? 0.5835 0.6146 0.6376 -0.0200 -0.0706 -0.0924 66  TYR A CB  
392  C CG  . TYR A 54  ? 0.5989 0.6445 0.6725 -0.0321 -0.0764 -0.0829 66  TYR A CG  
393  C CD1 . TYR A 54  ? 0.6050 0.6676 0.6968 -0.0334 -0.0696 -0.0738 66  TYR A CD1 
394  C CD2 . TYR A 54  ? 0.6250 0.6667 0.6983 -0.0422 -0.0889 -0.0825 66  TYR A CD2 
395  C CE1 . TYR A 54  ? 0.6146 0.6928 0.7247 -0.0434 -0.0736 -0.0640 66  TYR A CE1 
396  C CE2 . TYR A 54  ? 0.6328 0.6905 0.7262 -0.0535 -0.0940 -0.0722 66  TYR A CE2 
397  C CZ  . TYR A 54  ? 0.7135 0.7904 0.8256 -0.0536 -0.0857 -0.0627 66  TYR A CZ  
398  O OH  . TYR A 54  ? 0.7032 0.7985 0.8355 -0.0636 -0.0894 -0.0515 66  TYR A OH  
399  N N   . THR A 55  ? 0.6750 0.7174 0.7098 -0.0146 -0.0742 -0.1002 67  THR A N   
400  C CA  . THR A 55  ? 0.7028 0.7540 0.7346 -0.0167 -0.0794 -0.1003 67  THR A CA  
401  C C   . THR A 55  ? 0.8384 0.8797 0.8683 -0.0279 -0.0947 -0.1009 67  THR A C   
402  O O   . THR A 55  ? 0.8676 0.8839 0.8820 -0.0294 -0.1022 -0.1076 67  THR A O   
403  C CB  . THR A 55  ? 0.8036 0.8494 0.8154 -0.0062 -0.0749 -0.1074 67  THR A CB  
404  O OG1 . THR A 55  ? 0.8710 0.8922 0.8628 -0.0009 -0.0763 -0.1160 67  THR A OG1 
405  C CG2 . THR A 55  ? 0.7423 0.8048 0.7604 0.0022  -0.0615 -0.1041 67  THR A CG2 
406  N N   . ILE A 56  ? 0.8259 0.8867 0.8718 -0.0358 -0.0996 -0.0934 68  ILE A N   
407  C CA  . ILE A 56  ? 0.8650 0.9216 0.9115 -0.0473 -0.1149 -0.0924 68  ILE A CA  
408  C C   . ILE A 56  ? 0.9684 1.0285 1.0027 -0.0440 -0.1187 -0.0962 68  ILE A C   
409  O O   . ILE A 56  ? 0.9470 1.0290 0.9905 -0.0400 -0.1122 -0.0914 68  ILE A O   
410  C CB  . ILE A 56  ? 0.8937 0.9711 0.9678 -0.0587 -0.1187 -0.0802 68  ILE A CB  
411  C CG1 . ILE A 56  ? 0.8942 0.9680 0.9791 -0.0611 -0.1139 -0.0759 68  ILE A CG1 
412  C CG2 . ILE A 56  ? 0.9239 0.9977 0.9999 -0.0718 -0.1361 -0.0785 68  ILE A CG2 
413  C CD1 . ILE A 56  ? 0.9655 1.0651 1.0788 -0.0689 -0.1123 -0.0622 68  ILE A CD1 
414  N N   . LYS A 57  ? 0.9874 1.0243 0.9995 -0.0454 -0.1298 -0.1049 69  LYS A N   
415  C CA  . LYS A 57  ? 1.0103 1.0432 1.0030 -0.0407 -0.1339 -0.1108 69  LYS A CA  
416  C C   . LYS A 57  ? 1.0485 1.0866 1.0313 -0.0262 -0.1187 -0.1137 69  LYS A C   
417  O O   . LYS A 57  ? 1.0717 1.0908 1.0333 -0.0175 -0.1148 -0.1221 69  LYS A O   
418  C CB  . LYS A 57  ? 1.0426 1.0956 1.0486 -0.0489 -0.1430 -0.1038 69  LYS A CB  
419  C CG  . LYS A 57  ? 1.2707 1.3119 1.2755 -0.0626 -0.1622 -0.1041 69  LYS A CG  
420  C CD  . LYS A 57  ? 1.3993 1.4555 1.4074 -0.0672 -0.1720 -0.1005 69  LYS A CD  
421  C CE  . LYS A 57  ? 1.5292 1.5712 1.5324 -0.0807 -0.1928 -0.1019 69  LYS A CE  
422  N NZ  . LYS A 57  ? 1.6062 1.6627 1.6109 -0.0842 -0.2027 -0.0987 69  LYS A NZ  
423  N N   . ASP A 58  ? 0.9576 1.0213 0.9561 -0.0235 -0.1104 -0.1064 70  ASP A N   
424  C CA  . ASP A 58  ? 0.9353 1.0062 0.9278 -0.0118 -0.0970 -0.1070 70  ASP A CA  
425  C C   . ASP A 58  ? 0.9064 0.9999 0.9222 -0.0109 -0.0868 -0.0981 70  ASP A C   
426  O O   . ASP A 58  ? 0.8893 0.9908 0.9039 -0.0029 -0.0766 -0.0969 70  ASP A O   
427  C CB  . ASP A 58  ? 0.9794 1.0530 0.9577 -0.0084 -0.1004 -0.1089 70  ASP A CB  
428  C CG  . ASP A 58  ? 1.2054 1.2741 1.1652 0.0037  -0.0902 -0.1133 70  ASP A CG  
429  O OD1 . ASP A 58  ? 1.2155 1.2945 1.1713 0.0073  -0.0883 -0.1109 70  ASP A OD1 
430  O OD2 . ASP A 58  ? 1.3258 1.3814 1.2758 0.0097  -0.0840 -0.1183 70  ASP A OD2 
431  N N   . THR A 59  ? 0.8157 0.9185 0.8519 -0.0189 -0.0897 -0.0916 71  THR A N   
432  C CA  . THR A 59  ? 0.7655 0.8887 0.8226 -0.0180 -0.0812 -0.0832 71  THR A CA  
433  C C   . THR A 59  ? 0.7438 0.8612 0.8060 -0.0162 -0.0736 -0.0831 71  THR A C   
434  O O   . THR A 59  ? 0.7382 0.8402 0.7967 -0.0205 -0.0783 -0.0862 71  THR A O   
435  C CB  . THR A 59  ? 0.8482 0.9889 0.9249 -0.0267 -0.0885 -0.0746 71  THR A CB  
436  O OG1 . THR A 59  ? 0.8443 0.9879 0.9150 -0.0291 -0.0977 -0.0753 71  THR A OG1 
437  C CG2 . THR A 59  ? 0.8120 0.9750 0.9073 -0.0232 -0.0794 -0.0659 71  THR A CG2 
438  N N   . VAL A 60  ? 0.6495 0.7781 0.7192 -0.0101 -0.0627 -0.0795 72  VAL A N   
439  C CA  . VAL A 60  ? 0.6244 0.7521 0.7018 -0.0084 -0.0554 -0.0776 72  VAL A CA  
440  C C   . VAL A 60  ? 0.6440 0.7796 0.7388 -0.0167 -0.0593 -0.0706 72  VAL A C   
441  O O   . VAL A 60  ? 0.6403 0.7928 0.7477 -0.0199 -0.0616 -0.0640 72  VAL A O   
442  C CB  . VAL A 60  ? 0.6517 0.7903 0.7326 -0.0005 -0.0447 -0.0749 72  VAL A CB  
443  C CG1 . VAL A 60  ? 0.6382 0.7806 0.7304 0.0001  -0.0386 -0.0708 72  VAL A CG1 
444  C CG2 . VAL A 60  ? 0.6542 0.7842 0.7196 0.0068  -0.0399 -0.0806 72  VAL A CG2 
445  N N   . ALA A 61  ? 0.5721 0.6953 0.6671 -0.0197 -0.0602 -0.0717 73  ALA A N   
446  C CA  . ALA A 61  ? 0.5404 0.6696 0.6514 -0.0274 -0.0625 -0.0643 73  ALA A CA  
447  C C   . ALA A 61  ? 0.5403 0.6657 0.6539 -0.0234 -0.0543 -0.0631 73  ALA A C   
448  O O   . ALA A 61  ? 0.5316 0.6414 0.6329 -0.0182 -0.0515 -0.0697 73  ALA A O   
449  C CB  . ALA A 61  ? 0.5677 0.6828 0.6759 -0.0374 -0.0748 -0.0658 73  ALA A CB  
450  N N   . TRP A 62  ? 0.4654 0.6060 0.5947 -0.0251 -0.0503 -0.0545 74  TRP A N   
451  C CA  . TRP A 62  ? 0.4465 0.5845 0.5791 -0.0222 -0.0435 -0.0522 74  TRP A CA  
452  C C   . TRP A 62  ? 0.5020 0.6370 0.6441 -0.0315 -0.0487 -0.0462 74  TRP A C   
453  O O   . TRP A 62  ? 0.5258 0.6741 0.6807 -0.0390 -0.0533 -0.0388 74  TRP A O   
454  C CB  . TRP A 62  ? 0.4138 0.5694 0.5538 -0.0155 -0.0343 -0.0471 74  TRP A CB  
455  C CG  . TRP A 62  ? 0.4190 0.5754 0.5496 -0.0071 -0.0297 -0.0522 74  TRP A CG  
456  C CD1 . TRP A 62  ? 0.4523 0.6180 0.5820 -0.0053 -0.0308 -0.0523 74  TRP A CD1 
457  C CD2 . TRP A 62  ? 0.4154 0.5628 0.5366 -0.0001 -0.0241 -0.0573 74  TRP A CD2 
458  N NE1 . TRP A 62  ? 0.4434 0.6056 0.5634 0.0020  -0.0260 -0.0568 74  TRP A NE1 
459  C CE2 . TRP A 62  ? 0.4630 0.6149 0.5784 0.0050  -0.0219 -0.0597 74  TRP A CE2 
460  C CE3 . TRP A 62  ? 0.4363 0.5733 0.5543 0.0023  -0.0208 -0.0592 74  TRP A CE3 
461  C CZ2 . TRP A 62  ? 0.4498 0.5970 0.5575 0.0114  -0.0167 -0.0633 74  TRP A CZ2 
462  C CZ3 . TRP A 62  ? 0.4518 0.5852 0.5624 0.0094  -0.0157 -0.0630 74  TRP A CZ3 
463  C CH2 . TRP A 62  ? 0.4540 0.5929 0.5601 0.0133  -0.0137 -0.0647 74  TRP A CH2 
464  N N   . LEU A 63  ? 0.4387 0.5566 0.5752 -0.0313 -0.0482 -0.0487 75  LEU A N   
465  C CA  . LEU A 63  ? 0.4277 0.5387 0.5714 -0.0400 -0.0531 -0.0430 75  LEU A CA  
466  C C   . LEU A 63  ? 0.4539 0.5867 0.6153 -0.0423 -0.0480 -0.0310 75  LEU A C   
467  O O   . LEU A 63  ? 0.4269 0.5706 0.5897 -0.0340 -0.0386 -0.0293 75  LEU A O   
468  C CB  . LEU A 63  ? 0.4336 0.5223 0.5662 -0.0361 -0.0516 -0.0483 75  LEU A CB  
469  C CG  . LEU A 63  ? 0.5031 0.5789 0.6399 -0.0445 -0.0571 -0.0433 75  LEU A CG  
470  C CD1 . LEU A 63  ? 0.5227 0.5809 0.6540 -0.0544 -0.0704 -0.0462 75  LEU A CD1 
471  C CD2 . LEU A 63  ? 0.5382 0.5977 0.6662 -0.0373 -0.0524 -0.0468 75  LEU A CD2 
472  N N   . LYS A 64  ? 0.4321 0.5714 0.6064 -0.0534 -0.0545 -0.0223 76  LYS A N   
473  C CA  . LYS A 64  ? 0.4322 0.5936 0.6241 -0.0561 -0.0498 -0.0093 76  LYS A CA  
474  C C   . LYS A 64  ? 0.4912 0.6434 0.6834 -0.0561 -0.0460 -0.0054 76  LYS A C   
475  O O   . LYS A 64  ? 0.4955 0.6256 0.6815 -0.0616 -0.0524 -0.0081 76  LYS A O   
476  C CB  . LYS A 64  ? 0.4793 0.6541 0.6871 -0.0687 -0.0584 0.0001  76  LYS A CB  
477  C CG  . LYS A 64  ? 0.8693 1.0634 1.0820 -0.0667 -0.0593 0.0003  76  LYS A CG  
478  C CD  . LYS A 64  ? 1.0816 1.3072 1.3111 -0.0630 -0.0511 0.0122  76  LYS A CD  
479  C CE  . LYS A 64  ? 1.2500 1.4938 1.4846 -0.0608 -0.0529 0.0129  76  LYS A CE  
480  N NZ  . LYS A 64  ? 1.3487 1.6207 1.5954 -0.0530 -0.0431 0.0225  76  LYS A NZ  
481  N N   . MET A 65  ? 0.4383 0.6061 0.6358 -0.0493 -0.0358 0.0008  77  MET A N   
482  C CA  . MET A 65  ? 0.4368 0.5981 0.6330 -0.0468 -0.0307 0.0044  77  MET A CA  
483  C C   . MET A 65  ? 0.5283 0.6941 0.7380 -0.0578 -0.0340 0.0170  77  MET A C   
484  O O   . MET A 65  ? 0.5379 0.6900 0.7444 -0.0589 -0.0337 0.0189  77  MET A O   
485  C CB  . MET A 65  ? 0.4426 0.6180 0.6372 -0.0349 -0.0194 0.0058  77  MET A CB  
486  C CG  . MET A 65  ? 0.4743 0.6431 0.6556 -0.0249 -0.0165 -0.0057 77  MET A CG  
487  S SD  . MET A 65  ? 0.5358 0.6776 0.7017 -0.0207 -0.0175 -0.0163 77  MET A SD  
488  C CE  . MET A 65  ? 0.4961 0.6242 0.6542 -0.0244 -0.0258 -0.0261 77  MET A CE  
489  N N   . ASP A 66  ? 0.5103 0.6959 0.7358 -0.0660 -0.0374 0.0265  78  ASP A N   
490  C CA  . ASP A 66  ? 0.5316 0.7264 0.7734 -0.0781 -0.0409 0.0409  78  ASP A CA  
491  C C   . ASP A 66  ? 0.6048 0.7799 0.8473 -0.0927 -0.0554 0.0398  78  ASP A C   
492  O O   . ASP A 66  ? 0.6213 0.7940 0.8733 -0.1036 -0.0597 0.0502  78  ASP A O   
493  C CB  . ASP A 66  ? 0.5577 0.7872 0.8181 -0.0792 -0.0369 0.0532  78  ASP A CB  
494  C CG  . ASP A 66  ? 0.8521 1.1013 1.1137 -0.0666 -0.0230 0.0588  78  ASP A CG  
495  O OD1 . ASP A 66  ? 0.8780 1.1204 1.1249 -0.0538 -0.0168 0.0486  78  ASP A OD1 
496  O OD2 . ASP A 66  ? 0.9898 1.2622 1.2669 -0.0693 -0.0185 0.0737  78  ASP A OD2 
497  N N   . LYS A 67  ? 0.5576 0.7184 0.7895 -0.0933 -0.0632 0.0280  79  LYS A N   
498  C CA  . LYS A 67  ? 0.5669 0.7045 0.7948 -0.1059 -0.0780 0.0248  79  LYS A CA  
499  C C   . LYS A 67  ? 0.6198 0.7232 0.8297 -0.1031 -0.0801 0.0160  79  LYS A C   
500  O O   . LYS A 67  ? 0.6067 0.7027 0.8033 -0.0899 -0.0720 0.0069  79  LYS A O   
501  C CB  . LYS A 67  ? 0.5984 0.7335 0.8194 -0.1063 -0.0855 0.0153  79  LYS A CB  
502  C CG  . LYS A 67  ? 0.8190 0.9837 1.0591 -0.1133 -0.0888 0.0250  79  LYS A CG  
503  C CD  . LYS A 67  ? 0.9846 1.1375 1.2212 -0.1240 -0.1048 0.0202  79  LYS A CD  
504  C CE  . LYS A 67  ? 1.0997 1.2473 1.3202 -0.1146 -0.1050 0.0066  79  LYS A CE  
505  N NZ  . LYS A 67  ? 1.2308 1.3653 1.4458 -0.1250 -0.1212 0.0020  79  LYS A NZ  
506  N N   . LYS A 68  ? 0.6017 0.6843 0.8117 -0.1156 -0.0915 0.0192  80  LYS A N   
507  C CA  . LYS A 68  ? 0.6224 0.6683 0.8139 -0.1137 -0.0961 0.0103  80  LYS A CA  
508  C C   . LYS A 68  ? 0.7051 0.7305 0.8750 -0.1054 -0.0995 -0.0069 80  LYS A C   
509  O O   . LYS A 68  ? 0.7048 0.7331 0.8738 -0.1098 -0.1069 -0.0107 80  LYS A O   
510  C CB  . LYS A 68  ? 0.6665 0.6929 0.8619 -0.1303 -0.1099 0.0174  80  LYS A CB  
511  C CG  . LYS A 68  ? 0.8165 0.8546 1.0287 -0.1372 -0.1061 0.0340  80  LYS A CG  
512  C CD  . LYS A 68  ? 0.9864 1.0006 1.2007 -0.1543 -0.1212 0.0405  80  LYS A CD  
513  C CE  . LYS A 68  ? 1.1998 1.2284 1.4328 -0.1632 -0.1179 0.0593  80  LYS A CE  
514  N NZ  . LYS A 68  ? 1.3732 1.3794 1.6101 -0.1820 -0.1341 0.0671  80  LYS A NZ  
515  N N   . VAL A 69  ? 0.6771 0.6838 0.8300 -0.0929 -0.0938 -0.0167 81  VAL A N   
516  C CA  . VAL A 69  ? 0.6841 0.6695 0.8151 -0.0839 -0.0962 -0.0324 81  VAL A CA  
517  C C   . VAL A 69  ? 0.8074 0.7596 0.9262 -0.0934 -0.1120 -0.0369 81  VAL A C   
518  O O   . VAL A 69  ? 0.8447 0.7728 0.9568 -0.0947 -0.1156 -0.0366 81  VAL A O   
519  C CB  . VAL A 69  ? 0.7073 0.6851 0.8262 -0.0678 -0.0852 -0.0396 81  VAL A CB  
520  C CG1 . VAL A 69  ? 0.7117 0.6725 0.8095 -0.0576 -0.0862 -0.0544 81  VAL A CG1 
521  C CG2 . VAL A 69  ? 0.6699 0.6779 0.8008 -0.0604 -0.0717 -0.0341 81  VAL A CG2 
522  N N   . LEU A 70  ? 0.7733 0.7245 0.8897 -0.1008 -0.1223 -0.0403 82  LEU A N   
523  C CA  . LEU A 70  ? 1.1103 1.0314 1.2139 -0.1110 -0.1398 -0.0455 82  LEU A CA  
524  C C   . LEU A 70  ? 1.5860 1.5245 1.6999 -0.1220 -0.1486 -0.0421 82  LEU A C   
525  O O   . LEU A 70  ? 1.1827 1.1002 1.2821 -0.1270 -0.1620 -0.0498 82  LEU A O   
526  C CB  . LEU A 70  ? 1.1345 1.0323 1.2404 -0.1231 -0.1498 -0.0385 82  LEU A CB  
527  C CG  . LEU A 70  ? 1.2206 1.0789 1.3028 -0.1144 -0.1515 -0.0482 82  LEU A CG  
528  C CD1 . LEU A 70  ? 1.2351 1.0783 1.3247 -0.1250 -0.1572 -0.0378 82  LEU A CD1 
529  C CD2 . LEU A 70  ? 1.2963 1.1200 1.3510 -0.1119 -0.1637 -0.0633 82  LEU A CD2 
530  N N   . PRO A 79  ? 1.1181 0.8596 0.9984 0.0166  -0.1210 -0.1582 91  PRO A N   
531  C CA  . PRO A 79  ? 1.0736 0.8437 0.9763 0.0219  -0.1057 -0.1497 91  PRO A CA  
532  C C   . PRO A 79  ? 1.0441 0.8542 0.9738 0.0122  -0.1003 -0.1401 91  PRO A C   
533  O O   . PRO A 79  ? 1.0293 0.8568 0.9571 0.0160  -0.0957 -0.1424 91  PRO A O   
534  C CB  . PRO A 79  ? 1.1007 0.8706 0.9870 0.0435  -0.0931 -0.1571 91  PRO A CB  
535  C CG  . PRO A 79  ? 1.1994 0.9405 1.0530 0.0503  -0.1012 -0.1698 91  PRO A CG  
536  C CD  . PRO A 79  ? 1.1539 0.8874 1.0081 0.0322  -0.1171 -0.1694 91  PRO A CD  
537  N N   . VAL A 80  ? 0.9335 0.7572 0.8874 0.0000  -0.1011 -0.1290 92  VAL A N   
538  C CA  . VAL A 80  ? 0.8650 0.7246 0.8445 -0.0092 -0.0967 -0.1191 92  VAL A CA  
539  C C   . VAL A 80  ? 0.8090 0.6950 0.7959 0.0030  -0.0807 -0.1178 92  VAL A C   
540  O O   . VAL A 80  ? 0.7991 0.6848 0.7882 0.0113  -0.0728 -0.1163 92  VAL A O   
541  C CB  . VAL A 80  ? 0.9026 0.7692 0.9042 -0.0233 -0.1004 -0.1072 92  VAL A CB  
542  C CG1 . VAL A 80  ? 0.8669 0.7686 0.8917 -0.0321 -0.0973 -0.0977 92  VAL A CG1 
543  C CG2 . VAL A 80  ? 0.9347 0.7713 0.9286 -0.0354 -0.1167 -0.1076 92  VAL A CG2 
544  N N   . THR A 81  ? 0.6841 0.5919 0.6745 0.0038  -0.0767 -0.1179 93  THR A N   
545  C CA  . THR A 81  ? 0.6318 0.5621 0.6270 0.0147  -0.0631 -0.1171 93  THR A CA  
546  C C   . THR A 81  ? 0.6325 0.5941 0.6486 0.0079  -0.0590 -0.1088 93  THR A C   
547  O O   . THR A 81  ? 0.6288 0.5970 0.6473 0.0002  -0.0651 -0.1079 93  THR A O   
548  C CB  . THR A 81  ? 0.6251 0.5482 0.5991 0.0265  -0.0603 -0.1264 93  THR A CB  
549  O OG1 . THR A 81  ? 0.6665 0.5594 0.6198 0.0345  -0.0637 -0.1343 93  THR A OG1 
550  C CG2 . THR A 81  ? 0.5224 0.4689 0.5021 0.0372  -0.0465 -0.1245 93  THR A CG2 
551  N N   . PHE A 82  ? 0.5494 0.5292 0.5796 0.0116  -0.0491 -0.1027 94  PHE A N   
552  C CA  . PHE A 82  ? 0.5034 0.5112 0.5499 0.0089  -0.0435 -0.0960 94  PHE A CA  
553  C C   . PHE A 82  ? 0.5263 0.5468 0.5724 0.0198  -0.0326 -0.0967 94  PHE A C   
554  O O   . PHE A 82  ? 0.5328 0.5455 0.5731 0.0283  -0.0281 -0.0992 94  PHE A O   
555  C CB  . PHE A 82  ? 0.5007 0.5189 0.5654 0.0012  -0.0433 -0.0865 94  PHE A CB  
556  C CG  . PHE A 82  ? 0.5216 0.5305 0.5901 -0.0110 -0.0538 -0.0834 94  PHE A CG  
557  C CD1 . PHE A 82  ? 0.5461 0.5655 0.6209 -0.0197 -0.0598 -0.0807 94  PHE A CD1 
558  C CD2 . PHE A 82  ? 0.5565 0.5461 0.6229 -0.0140 -0.0583 -0.0825 94  PHE A CD2 
559  C CE1 . PHE A 82  ? 0.5698 0.5820 0.6498 -0.0320 -0.0705 -0.0768 94  PHE A CE1 
560  C CE2 . PHE A 82  ? 0.6005 0.5814 0.6715 -0.0268 -0.0690 -0.0784 94  PHE A CE2 
561  C CZ  . PHE A 82  ? 0.5742 0.5670 0.6525 -0.0361 -0.0752 -0.0754 94  PHE A CZ  
562  N N   . HIS A 83  ? 0.4494 0.4896 0.5021 0.0194  -0.0290 -0.0940 95  HIS A N   
563  C CA  . HIS A 83  ? 0.4259 0.4799 0.4809 0.0272  -0.0198 -0.0929 95  HIS A CA  
564  C C   . HIS A 83  ? 0.4420 0.5121 0.5131 0.0245  -0.0159 -0.0853 95  HIS A C   
565  O O   . HIS A 83  ? 0.4287 0.5096 0.5082 0.0184  -0.0178 -0.0810 95  HIS A O   
566  C CB  . HIS A 83  ? 0.4366 0.4983 0.4850 0.0294  -0.0188 -0.0953 95  HIS A CB  
567  C CG  . HIS A 83  ? 0.5034 0.5506 0.5332 0.0359  -0.0197 -0.1030 95  HIS A CG  
568  N ND1 . HIS A 83  ? 0.5480 0.5761 0.5658 0.0327  -0.0285 -0.1084 95  HIS A ND1 
569  C CD2 . HIS A 83  ? 0.5274 0.5767 0.5483 0.0456  -0.0131 -0.1055 95  HIS A CD2 
570  C CE1 . HIS A 83  ? 0.5575 0.5753 0.5575 0.0416  -0.0267 -0.1150 95  HIS A CE1 
571  N NE2 . HIS A 83  ? 0.5512 0.5826 0.5531 0.0499  -0.0169 -0.1130 95  HIS A NE2 
572  N N   . PHE A 84  ? 0.3760 0.4473 0.4505 0.0297  -0.0106 -0.0835 96  PHE A N   
573  C CA  . PHE A 84  ? 0.3476 0.4321 0.4342 0.0286  -0.0069 -0.0770 96  PHE A CA  
574  C C   . PHE A 84  ? 0.3870 0.4858 0.4754 0.0314  -0.0027 -0.0759 96  PHE A C   
575  O O   . PHE A 84  ? 0.3913 0.4920 0.4762 0.0375  0.0014  -0.0775 96  PHE A O   
576  C CB  . PHE A 84  ? 0.3622 0.4417 0.4510 0.0328  -0.0042 -0.0754 96  PHE A CB  
577  C CG  . PHE A 84  ? 0.3573 0.4478 0.4564 0.0315  -0.0016 -0.0689 96  PHE A CG  
578  C CD1 . PHE A 84  ? 0.3827 0.4733 0.4881 0.0256  -0.0040 -0.0642 96  PHE A CD1 
579  C CD2 . PHE A 84  ? 0.3610 0.4616 0.4631 0.0360  0.0028  -0.0672 96  PHE A CD2 
580  C CE1 . PHE A 84  ? 0.3834 0.4833 0.4956 0.0257  -0.0013 -0.0585 96  PHE A CE1 
581  C CE2 . PHE A 84  ? 0.3849 0.4931 0.4936 0.0352  0.0042  -0.0620 96  PHE A CE2 
582  C CZ  . PHE A 84  ? 0.3679 0.4753 0.4806 0.0307  0.0024  -0.0580 96  PHE A CZ  
583  N N   . LEU A 85  ? 0.3279 0.4368 0.4217 0.0270  -0.0038 -0.0727 97  LEU A N   
584  C CA  . LEU A 85  ? 0.3197 0.4398 0.4140 0.0288  -0.0012 -0.0716 97  LEU A CA  
585  C C   . LEU A 85  ? 0.3569 0.4868 0.4592 0.0267  -0.0006 -0.0663 97  LEU A C   
586  O O   . LEU A 85  ? 0.3559 0.4867 0.4634 0.0231  -0.0025 -0.0634 97  LEU A O   
587  C CB  . LEU A 85  ? 0.3291 0.4490 0.4167 0.0275  -0.0040 -0.0747 97  LEU A CB  
588  C CG  . LEU A 85  ? 0.3940 0.5050 0.4699 0.0315  -0.0038 -0.0804 97  LEU A CG  
589  C CD1 . LEU A 85  ? 0.3896 0.4983 0.4582 0.0287  -0.0087 -0.0833 97  LEU A CD1 
590  C CD2 . LEU A 85  ? 0.4133 0.5300 0.4873 0.0379  0.0024  -0.0799 97  LEU A CD2 
591  N N   . ALA A 86  ? 0.3041 0.4409 0.4065 0.0292  0.0019  -0.0648 98  ALA A N   
592  C CA  . ALA A 86  ? 0.2870 0.4312 0.3932 0.0289  0.0021  -0.0609 98  ALA A CA  
593  C C   . ALA A 86  ? 0.3101 0.4590 0.4164 0.0264  -0.0006 -0.0605 98  ALA A C   
594  O O   . ALA A 86  ? 0.2906 0.4392 0.3919 0.0265  -0.0018 -0.0630 98  ALA A O   
595  C CB  . ALA A 86  ? 0.2900 0.4367 0.3943 0.0319  0.0040  -0.0599 98  ALA A CB  
596  N N   . LYS A 87  ? 0.2477 0.4019 0.3599 0.0245  -0.0015 -0.0568 99  LYS A N   
597  C CA  . LYS A 87  ? 0.2467 0.4091 0.3620 0.0228  -0.0038 -0.0545 99  LYS A CA  
598  C C   . LYS A 87  ? 0.3270 0.4954 0.4410 0.0276  -0.0016 -0.0520 99  LYS A C   
599  O O   . LYS A 87  ? 0.3135 0.4869 0.4266 0.0285  -0.0031 -0.0515 99  LYS A O   
600  C CB  . LYS A 87  ? 0.2693 0.4364 0.3931 0.0186  -0.0054 -0.0502 99  LYS A CB  
601  C CG  . LYS A 87  ? 0.3271 0.5042 0.4564 0.0155  -0.0089 -0.0472 99  LYS A CG  
602  C CD  . LYS A 87  ? 0.3984 0.5813 0.5379 0.0101  -0.0107 -0.0417 99  LYS A CD  
603  C CE  . LYS A 87  ? 0.3920 0.5876 0.5394 0.0064  -0.0147 -0.0375 99  LYS A CE  
604  N NZ  . LYS A 87  ? 0.4464 0.6501 0.6061 0.0002  -0.0163 -0.0301 99  LYS A NZ  
605  N N   . PHE A 88  ? 0.2923 0.4587 0.4051 0.0311  0.0013  -0.0507 100 PHE A N   
606  C CA  . PHE A 88  ? 0.2856 0.4534 0.3946 0.0362  0.0027  -0.0490 100 PHE A CA  
607  C C   . PHE A 88  ? 0.3300 0.4898 0.4332 0.0380  0.0031  -0.0510 100 PHE A C   
608  O O   . PHE A 88  ? 0.3292 0.4849 0.4334 0.0364  0.0037  -0.0523 100 PHE A O   
609  C CB  . PHE A 88  ? 0.3053 0.4786 0.4174 0.0392  0.0050  -0.0445 100 PHE A CB  
610  C CG  . PHE A 88  ? 0.3220 0.5062 0.4428 0.0365  0.0047  -0.0406 100 PHE A CG  
611  C CD1 . PHE A 88  ? 0.3466 0.5396 0.4694 0.0383  0.0038  -0.0385 100 PHE A CD1 
612  C CD2 . PHE A 88  ? 0.3409 0.5266 0.4687 0.0318  0.0046  -0.0382 100 PHE A CD2 
613  C CE1 . PHE A 88  ? 0.3470 0.5523 0.4801 0.0350  0.0027  -0.0338 100 PHE A CE1 
614  C CE2 . PHE A 88  ? 0.3597 0.5561 0.4972 0.0278  0.0034  -0.0334 100 PHE A CE2 
615  C CZ  . PHE A 88  ? 0.3318 0.5390 0.4726 0.0292  0.0023  -0.0310 100 PHE A CZ  
616  N N   . TYR A 89  ? 0.2691 0.4266 0.3664 0.0412  0.0023  -0.0508 101 TYR A N   
617  C CA  . TYR A 89  ? 0.2647 0.4148 0.3570 0.0415  0.0012  -0.0517 101 TYR A CA  
618  C C   . TYR A 89  ? 0.3267 0.4714 0.4130 0.0458  0.0005  -0.0505 101 TYR A C   
619  O O   . TYR A 89  ? 0.2986 0.4450 0.3820 0.0503  0.0012  -0.0491 101 TYR A O   
620  C CB  . TYR A 89  ? 0.2704 0.4193 0.3592 0.0405  -0.0004 -0.0523 101 TYR A CB  
621  C CG  . TYR A 89  ? 0.3056 0.4576 0.3971 0.0370  0.0003  -0.0540 101 TYR A CG  
622  C CD1 . TYR A 89  ? 0.3284 0.4852 0.4220 0.0359  0.0000  -0.0550 101 TYR A CD1 
623  C CD2 . TYR A 89  ? 0.3246 0.4752 0.4163 0.0353  0.0011  -0.0544 101 TYR A CD2 
624  C CE1 . TYR A 89  ? 0.3345 0.4914 0.4274 0.0335  0.0000  -0.0575 101 TYR A CE1 
625  C CE2 . TYR A 89  ? 0.3369 0.4897 0.4288 0.0339  0.0025  -0.0563 101 TYR A CE2 
626  C CZ  . TYR A 89  ? 0.4129 0.5674 0.5040 0.0333  0.0017  -0.0584 101 TYR A CZ  
627  O OH  . TYR A 89  ? 0.4450 0.5990 0.5331 0.0328  0.0024  -0.0610 101 TYR A OH  
628  N N   . PRO A 90  ? 0.3010 0.4392 0.3848 0.0450  -0.0011 -0.0507 102 PRO A N   
629  C CA  . PRO A 90  ? 0.3081 0.4380 0.3830 0.0492  -0.0034 -0.0502 102 PRO A CA  
630  C C   . PRO A 90  ? 0.4066 0.5292 0.4732 0.0511  -0.0066 -0.0505 102 PRO A C   
631  O O   . PRO A 90  ? 0.4131 0.5365 0.4818 0.0475  -0.0077 -0.0503 102 PRO A O   
632  C CB  . PRO A 90  ? 0.3175 0.4433 0.3934 0.0462  -0.0056 -0.0502 102 PRO A CB  
633  C CG  . PRO A 90  ? 0.3552 0.4862 0.4391 0.0413  -0.0048 -0.0502 102 PRO A CG  
634  C CD  . PRO A 90  ? 0.2978 0.4361 0.3863 0.0410  -0.0013 -0.0511 102 PRO A CD  
635  N N   . GLU A 91  ? 0.3898 0.5045 0.4459 0.0574  -0.0080 -0.0507 103 GLU A N   
636  C CA  . GLU A 91  ? 0.4147 0.5175 0.4600 0.0598  -0.0124 -0.0512 103 GLU A CA  
637  C C   . GLU A 91  ? 0.4839 0.5753 0.5254 0.0548  -0.0185 -0.0513 103 GLU A C   
638  O O   . GLU A 91  ? 0.5054 0.5895 0.5436 0.0518  -0.0227 -0.0505 103 GLU A O   
639  C CB  . GLU A 91  ? 0.4508 0.5471 0.4840 0.0698  -0.0120 -0.0518 103 GLU A CB  
640  C CG  . GLU A 91  ? 0.6535 0.7516 0.6838 0.0753  -0.0108 -0.0511 103 GLU A CG  
641  C CD  . GLU A 91  ? 1.0803 1.1796 1.1029 0.0866  -0.0074 -0.0506 103 GLU A CD  
642  O OE1 . GLU A 91  ? 1.1495 1.2333 1.1562 0.0941  -0.0105 -0.0522 103 GLU A OE1 
643  O OE2 . GLU A 91  ? 0.9011 1.0164 0.9331 0.0882  -0.0017 -0.0482 103 GLU A OE2 
644  N N   . ASN A 92  ? 0.4021 0.4925 0.4445 0.0535  -0.0194 -0.0514 104 ASN A N   
645  C CA  . ASN A 92  ? 0.3907 0.4727 0.4313 0.0483  -0.0258 -0.0507 104 ASN A CA  
646  C C   . ASN A 92  ? 0.4301 0.5230 0.4831 0.0439  -0.0234 -0.0495 104 ASN A C   
647  O O   . ASN A 92  ? 0.4107 0.5046 0.4627 0.0468  -0.0220 -0.0500 104 ASN A O   
648  C CB  . ASN A 92  ? 0.3528 0.4182 0.3771 0.0535  -0.0312 -0.0526 104 ASN A CB  
649  C CG  . ASN A 92  ? 0.5549 0.6086 0.5752 0.0476  -0.0403 -0.0518 104 ASN A CG  
650  O OD1 . ASN A 92  ? 0.5494 0.6109 0.5811 0.0407  -0.0415 -0.0494 104 ASN A OD1 
651  N ND2 . ASN A 92  ? 0.4394 0.4736 0.4426 0.0509  -0.0473 -0.0538 104 ASN A ND2 
652  N N   . ALA A 93  ? 0.3814 0.4825 0.4454 0.0376  -0.0228 -0.0474 105 ALA A N   
653  C CA  . ALA A 93  ? 0.3550 0.4670 0.4308 0.0346  -0.0199 -0.0461 105 ALA A CA  
654  C C   . ALA A 93  ? 0.4134 0.5214 0.4884 0.0337  -0.0245 -0.0450 105 ALA A C   
655  O O   . ALA A 93  ? 0.4059 0.5189 0.4849 0.0357  -0.0215 -0.0453 105 ALA A O   
656  C CB  . ALA A 93  ? 0.3493 0.4696 0.4344 0.0295  -0.0189 -0.0435 105 ALA A CB  
657  N N   . GLU A 94  ? 0.3763 0.4742 0.4453 0.0307  -0.0324 -0.0437 106 GLU A N   
658  C CA  . GLU A 94  ? 0.3786 0.4727 0.4469 0.0287  -0.0386 -0.0423 106 GLU A CA  
659  C C   . GLU A 94  ? 0.4641 0.5505 0.5210 0.0354  -0.0384 -0.0452 106 GLU A C   
660  O O   . GLU A 94  ? 0.4794 0.5693 0.5397 0.0357  -0.0389 -0.0442 106 GLU A O   
661  C CB  . GLU A 94  ? 0.4009 0.4841 0.4644 0.0228  -0.0487 -0.0400 106 GLU A CB  
662  C CG  . GLU A 94  ? 0.5005 0.5831 0.5672 0.0185  -0.0562 -0.0372 106 GLU A CG  
663  C CD  . GLU A 94  ? 0.9735 1.0525 1.0439 0.0093  -0.0658 -0.0323 106 GLU A CD  
664  O OE1 . GLU A 94  ? 1.0122 1.0738 1.0696 0.0078  -0.0731 -0.0335 106 GLU A OE1 
665  O OE2 . GLU A 94  ? 1.0160 1.1098 1.1026 0.0037  -0.0663 -0.0268 106 GLU A OE2 
666  N N   . GLU A 95  ? 0.4290 0.5060 0.4727 0.0415  -0.0374 -0.0483 107 GLU A N   
667  C CA  . GLU A 95  ? 0.4279 0.4991 0.4597 0.0492  -0.0359 -0.0503 107 GLU A CA  
668  C C   . GLU A 95  ? 0.4269 0.5117 0.4678 0.0519  -0.0270 -0.0495 107 GLU A C   
669  O O   . GLU A 95  ? 0.4183 0.5030 0.4561 0.0549  -0.0262 -0.0489 107 GLU A O   
670  C CB  . GLU A 95  ? 0.4615 0.5206 0.4770 0.0563  -0.0363 -0.0531 107 GLU A CB  
671  C CG  . GLU A 95  ? 0.6755 0.7145 0.6757 0.0556  -0.0467 -0.0548 107 GLU A CG  
672  C CD  . GLU A 95  ? 1.0850 1.1090 1.0655 0.0652  -0.0473 -0.0581 107 GLU A CD  
673  O OE1 . GLU A 95  ? 0.9823 1.0140 0.9650 0.0704  -0.0399 -0.0582 107 GLU A OE1 
674  O OE2 . GLU A 95  ? 1.1729 1.1770 1.1351 0.0678  -0.0557 -0.0606 107 GLU A OE2 
675  N N   . GLU A 96  ? 0.3555 0.4511 0.4070 0.0503  -0.0211 -0.0491 108 GLU A N   
676  C CA  . GLU A 96  ? 0.3252 0.4313 0.3837 0.0525  -0.0136 -0.0484 108 GLU A CA  
677  C C   . GLU A 96  ? 0.3666 0.4814 0.4382 0.0483  -0.0115 -0.0470 108 GLU A C   
678  O O   . GLU A 96  ? 0.3766 0.4956 0.4513 0.0499  -0.0076 -0.0459 108 GLU A O   
679  C CB  . GLU A 96  ? 0.3251 0.4366 0.3862 0.0535  -0.0095 -0.0490 108 GLU A CB  
680  C CG  . GLU A 96  ? 0.3117 0.4164 0.3601 0.0601  -0.0099 -0.0499 108 GLU A CG  
681  C CD  . GLU A 96  ? 0.4858 0.5973 0.5377 0.0615  -0.0064 -0.0498 108 GLU A CD  
682  O OE1 . GLU A 96  ? 0.4887 0.6119 0.5501 0.0606  -0.0015 -0.0483 108 GLU A OE1 
683  O OE2 . GLU A 96  ? 0.5313 0.6359 0.5761 0.0633  -0.0091 -0.0509 108 GLU A OE2 
684  N N   . LEU A 97  ? 0.3105 0.4281 0.3896 0.0433  -0.0136 -0.0465 109 LEU A N   
685  C CA  . LEU A 97  ? 0.2939 0.4196 0.3844 0.0411  -0.0111 -0.0453 109 LEU A CA  
686  C C   . LEU A 97  ? 0.3795 0.5037 0.4710 0.0404  -0.0156 -0.0432 109 LEU A C   
687  O O   . LEU A 97  ? 0.3877 0.5143 0.4843 0.0369  -0.0194 -0.0413 109 LEU A O   
688  C CB  . LEU A 97  ? 0.2767 0.4090 0.3751 0.0377  -0.0094 -0.0454 109 LEU A CB  
689  C CG  . LEU A 97  ? 0.3096 0.4430 0.4061 0.0378  -0.0065 -0.0473 109 LEU A CG  
690  C CD1 . LEU A 97  ? 0.2993 0.4390 0.4018 0.0352  -0.0048 -0.0470 109 LEU A CD1 
691  C CD2 . LEU A 97  ? 0.2794 0.4147 0.3761 0.0401  -0.0023 -0.0486 109 LEU A CD2 
692  N N   . VAL A 98  ? 0.3401 0.4610 0.4269 0.0438  -0.0153 -0.0427 110 VAL A N   
693  C CA  . VAL A 98  ? 0.3310 0.4490 0.4159 0.0442  -0.0201 -0.0408 110 VAL A CA  
694  C C   . VAL A 98  ? 0.3646 0.4910 0.4620 0.0434  -0.0181 -0.0386 110 VAL A C   
695  O O   . VAL A 98  ? 0.3809 0.5098 0.4828 0.0416  -0.0228 -0.0361 110 VAL A O   
696  C CB  . VAL A 98  ? 0.3729 0.4838 0.4456 0.0492  -0.0200 -0.0408 110 VAL A CB  
697  C CG1 . VAL A 98  ? 0.3698 0.4774 0.4393 0.0500  -0.0252 -0.0387 110 VAL A CG1 
698  C CG2 . VAL A 98  ? 0.3788 0.4808 0.4378 0.0519  -0.0220 -0.0432 110 VAL A CG2 
699  N N   . GLN A 99  ? 0.2684 0.3985 0.3709 0.0448  -0.0118 -0.0391 111 GLN A N   
700  C CA  . GLN A 99  ? 0.2373 0.3729 0.3497 0.0455  -0.0094 -0.0379 111 GLN A CA  
701  C C   . GLN A 99  ? 0.3046 0.4475 0.4250 0.0437  -0.0079 -0.0383 111 GLN A C   
702  O O   . GLN A 99  ? 0.3264 0.4696 0.4452 0.0420  -0.0061 -0.0404 111 GLN A O   
703  C CB  . GLN A 99  ? 0.2494 0.3829 0.3620 0.0473  -0.0043 -0.0386 111 GLN A CB  
704  C CG  . GLN A 99  ? 0.2736 0.4020 0.3793 0.0492  -0.0041 -0.0369 111 GLN A CG  
705  C CD  . GLN A 99  ? 0.4109 0.5380 0.5200 0.0494  0.0000  -0.0363 111 GLN A CD  
706  O OE1 . GLN A 99  ? 0.3107 0.4380 0.4193 0.0478  0.0027  -0.0373 111 GLN A OE1 
707  N NE2 . GLN A 99  ? 0.1770 0.3025 0.2900 0.0511  -0.0001 -0.0346 111 GLN A NE2 
708  N N   . GLU A 100 ? 0.2753 0.4248 0.4042 0.0447  -0.0081 -0.0358 112 GLU A N   
709  C CA  . GLU A 100 ? 0.2783 0.4370 0.4153 0.0444  -0.0056 -0.0350 112 GLU A CA  
710  C C   . GLU A 100 ? 0.3279 0.4853 0.4638 0.0466  0.0006  -0.0388 112 GLU A C   
711  O O   . GLU A 100 ? 0.3236 0.4855 0.4606 0.0455  0.0027  -0.0396 112 GLU A O   
712  C CB  . GLU A 100 ? 0.3013 0.4690 0.4481 0.0467  -0.0065 -0.0307 112 GLU A CB  
713  C CG  . GLU A 100 ? 0.4734 0.6540 0.6295 0.0462  -0.0044 -0.0279 112 GLU A CG  
714  C CD  . GLU A 100 ? 0.7330 0.9263 0.9010 0.0490  -0.0047 -0.0223 112 GLU A CD  
715  O OE1 . GLU A 100 ? 0.5877 0.7793 0.7569 0.0541  -0.0041 -0.0220 112 GLU A OE1 
716  O OE2 . GLU A 100 ? 0.7167 0.9229 0.8937 0.0466  -0.0050 -0.0176 112 GLU A OE2 
717  N N   . ILE A 101 ? 0.2701 0.4205 0.4031 0.0493  0.0028  -0.0408 113 ILE A N   
718  C CA  . ILE A 101 ? 0.2559 0.4025 0.3866 0.0507  0.0069  -0.0447 113 ILE A CA  
719  C C   . ILE A 101 ? 0.3233 0.4688 0.4492 0.0470  0.0071  -0.0473 113 ILE A C   
720  O O   . ILE A 101 ? 0.3212 0.4684 0.4463 0.0473  0.0094  -0.0496 113 ILE A O   
721  C CB  . ILE A 101 ? 0.2797 0.4170 0.4081 0.0529  0.0078  -0.0458 113 ILE A CB  
722  C CG1 . ILE A 101 ? 0.2752 0.4066 0.4004 0.0544  0.0105  -0.0501 113 ILE A CG1 
723  C CG2 . ILE A 101 ? 0.2511 0.3830 0.3756 0.0501  0.0060  -0.0445 113 ILE A CG2 
724  C CD1 . ILE A 101 ? 0.2246 0.3605 0.3512 0.0592  0.0135  -0.0515 113 ILE A CD1 
725  N N   . THR A 102 ? 0.2846 0.4276 0.4067 0.0444  0.0046  -0.0466 114 THR A N   
726  C CA  . THR A 102 ? 0.2818 0.4240 0.3995 0.0419  0.0046  -0.0484 114 THR A CA  
727  C C   . THR A 102 ? 0.3271 0.4743 0.4455 0.0404  0.0039  -0.0480 114 THR A C   
728  O O   . THR A 102 ? 0.3291 0.4776 0.4460 0.0396  0.0055  -0.0500 114 THR A O   
729  C CB  . THR A 102 ? 0.3562 0.4950 0.4690 0.0417  0.0028  -0.0471 114 THR A CB  
730  O OG1 . THR A 102 ? 0.5289 0.6672 0.6389 0.0414  -0.0008 -0.0456 114 THR A OG1 
731  C CG2 . THR A 102 ? 0.2936 0.4291 0.4065 0.0432  0.0033  -0.0453 114 THR A CG2 
732  N N   . GLN A 103 ? 0.2789 0.4289 0.3998 0.0395  0.0009  -0.0450 115 GLN A N   
733  C CA  . GLN A 103 ? 0.2769 0.4325 0.4007 0.0371  -0.0004 -0.0428 115 GLN A CA  
734  C C   . GLN A 103 ? 0.3228 0.4858 0.4512 0.0388  0.0045  -0.0430 115 GLN A C   
735  O O   . GLN A 103 ? 0.3263 0.4923 0.4535 0.0373  0.0056  -0.0428 115 GLN A O   
736  C CB  . GLN A 103 ? 0.2900 0.4480 0.4178 0.0353  -0.0053 -0.0386 115 GLN A CB  
737  C CG  . GLN A 103 ? 0.4202 0.5853 0.5533 0.0313  -0.0074 -0.0345 115 GLN A CG  
738  C CD  . GLN A 103 ? 0.5873 0.7583 0.7283 0.0296  -0.0118 -0.0294 115 GLN A CD  
739  O OE1 . GLN A 103 ? 0.4683 0.6509 0.6194 0.0314  -0.0089 -0.0261 115 GLN A OE1 
740  N NE2 . GLN A 103 ? 0.4380 0.6008 0.5738 0.0268  -0.0192 -0.0288 115 GLN A NE2 
741  N N   . HIS A 104 ? 0.2714 0.4364 0.4036 0.0429  0.0073  -0.0433 116 HIS A N   
742  C CA  . HIS A 104 ? 0.2606 0.4313 0.3950 0.0469  0.0123  -0.0439 116 HIS A CA  
743  C C   . HIS A 104 ? 0.3432 0.5079 0.4697 0.0476  0.0147  -0.0489 116 HIS A C   
744  O O   . HIS A 104 ? 0.3588 0.5282 0.4836 0.0484  0.0175  -0.0491 116 HIS A O   
745  C CB  . HIS A 104 ? 0.2603 0.4311 0.3985 0.0524  0.0141  -0.0435 116 HIS A CB  
746  C CG  . HIS A 104 ? 0.3018 0.4771 0.4403 0.0587  0.0196  -0.0444 116 HIS A CG  
747  N ND1 . HIS A 104 ? 0.3190 0.5076 0.4627 0.0599  0.0226  -0.0404 116 HIS A ND1 
748  C CD2 . HIS A 104 ? 0.3189 0.4862 0.4520 0.0647  0.0224  -0.0486 116 HIS A CD2 
749  C CE1 . HIS A 104 ? 0.3091 0.4983 0.4497 0.0676  0.0279  -0.0426 116 HIS A CE1 
750  N NE2 . HIS A 104 ? 0.3185 0.4936 0.4520 0.0708  0.0275  -0.0480 116 HIS A NE2 
751  N N   . LEU A 105 ? 0.3013 0.4564 0.4230 0.0468  0.0134  -0.0524 117 LEU A N   
752  C CA  . LEU A 105 ? 0.2887 0.4377 0.4037 0.0464  0.0141  -0.0569 117 LEU A CA  
753  C C   . LEU A 105 ? 0.3342 0.4860 0.4462 0.0430  0.0131  -0.0569 117 LEU A C   
754  O O   . LEU A 105 ? 0.3468 0.4981 0.4539 0.0437  0.0144  -0.0594 117 LEU A O   
755  C CB  . LEU A 105 ? 0.2861 0.4264 0.3994 0.0449  0.0121  -0.0586 117 LEU A CB  
756  C CG  . LEU A 105 ? 0.3204 0.4541 0.4343 0.0483  0.0127  -0.0593 117 LEU A CG  
757  C CD1 . LEU A 105 ? 0.3199 0.4471 0.4340 0.0453  0.0104  -0.0585 117 LEU A CD1 
758  C CD2 . LEU A 105 ? 0.2894 0.4171 0.3976 0.0520  0.0145  -0.0637 117 LEU A CD2 
759  N N   . PHE A 106 ? 0.2861 0.4393 0.3995 0.0400  0.0104  -0.0542 118 PHE A N   
760  C CA  . PHE A 106 ? 0.2863 0.4409 0.3964 0.0375  0.0090  -0.0535 118 PHE A CA  
761  C C   . PHE A 106 ? 0.3461 0.5075 0.4577 0.0374  0.0107  -0.0510 118 PHE A C   
762  O O   . PHE A 106 ? 0.3690 0.5314 0.4762 0.0370  0.0116  -0.0518 118 PHE A O   
763  C CB  . PHE A 106 ? 0.2990 0.4509 0.4082 0.0356  0.0053  -0.0515 118 PHE A CB  
764  C CG  . PHE A 106 ? 0.3039 0.4519 0.4097 0.0359  0.0046  -0.0532 118 PHE A CG  
765  C CD1 . PHE A 106 ? 0.3384 0.4867 0.4407 0.0353  0.0043  -0.0543 118 PHE A CD1 
766  C CD2 . PHE A 106 ? 0.3167 0.4621 0.4235 0.0369  0.0044  -0.0529 118 PHE A CD2 
767  C CE1 . PHE A 106 ? 0.3451 0.4930 0.4464 0.0357  0.0038  -0.0547 118 PHE A CE1 
768  C CE2 . PHE A 106 ? 0.3449 0.4896 0.4501 0.0371  0.0044  -0.0530 118 PHE A CE2 
769  C CZ  . PHE A 106 ? 0.3211 0.4678 0.4243 0.0366  0.0042  -0.0537 118 PHE A CZ  
770  N N   . PHE A 107 ? 0.2707 0.4379 0.3887 0.0378  0.0111  -0.0472 119 PHE A N   
771  C CA  . PHE A 107 ? 0.2625 0.4392 0.3843 0.0375  0.0133  -0.0429 119 PHE A CA  
772  C C   . PHE A 107 ? 0.3362 0.5156 0.4534 0.0416  0.0185  -0.0454 119 PHE A C   
773  O O   . PHE A 107 ? 0.3440 0.5274 0.4585 0.0406  0.0198  -0.0434 119 PHE A O   
774  C CB  . PHE A 107 ? 0.2677 0.4527 0.3994 0.0379  0.0132  -0.0379 119 PHE A CB  
775  C CG  . PHE A 107 ? 0.2631 0.4616 0.4009 0.0389  0.0171  -0.0324 119 PHE A CG  
776  C CD1 . PHE A 107 ? 0.2828 0.4866 0.4230 0.0336  0.0153  -0.0268 119 PHE A CD1 
777  C CD2 . PHE A 107 ? 0.2641 0.4701 0.4051 0.0456  0.0228  -0.0322 119 PHE A CD2 
778  C CE1 . PHE A 107 ? 0.2813 0.5000 0.4286 0.0342  0.0195  -0.0202 119 PHE A CE1 
779  C CE2 . PHE A 107 ? 0.2854 0.5064 0.4324 0.0477  0.0276  -0.0262 119 PHE A CE2 
780  C CZ  . PHE A 107 ? 0.2581 0.4865 0.4090 0.0416  0.0261  -0.0197 119 PHE A CZ  
781  N N   . LEU A 108 ? 0.2859 0.4614 0.4007 0.0466  0.0210  -0.0496 120 LEU A N   
782  C CA  . LEU A 108 ? 0.2971 0.4725 0.4050 0.0518  0.0254  -0.0528 120 LEU A CA  
783  C C   . LEU A 108 ? 0.3687 0.5371 0.4667 0.0499  0.0237  -0.0571 120 LEU A C   
784  O O   . LEU A 108 ? 0.3822 0.5532 0.4737 0.0524  0.0265  -0.0576 120 LEU A O   
785  C CB  . LEU A 108 ? 0.3018 0.4711 0.4079 0.0577  0.0272  -0.0567 120 LEU A CB  
786  C CG  . LEU A 108 ? 0.3447 0.5222 0.4598 0.0622  0.0300  -0.0525 120 LEU A CG  
787  C CD1 . LEU A 108 ? 0.3443 0.5118 0.4559 0.0680  0.0306  -0.0569 120 LEU A CD1 
788  C CD2 . LEU A 108 ? 0.3340 0.5256 0.4517 0.0667  0.0357  -0.0479 120 LEU A CD2 
789  N N   . GLN A 109 ? 0.3030 0.4639 0.4001 0.0459  0.0192  -0.0595 121 GLN A N   
790  C CA  . GLN A 109 ? 0.2928 0.4487 0.3826 0.0438  0.0167  -0.0628 121 GLN A CA  
791  C C   . GLN A 109 ? 0.3402 0.5015 0.4289 0.0413  0.0162  -0.0593 121 GLN A C   
792  O O   . GLN A 109 ? 0.3371 0.4979 0.4182 0.0420  0.0164  -0.0609 121 GLN A O   
793  C CB  . GLN A 109 ? 0.3050 0.4549 0.3968 0.0405  0.0126  -0.0643 121 GLN A CB  
794  C CG  . GLN A 109 ? 0.4327 0.5781 0.5186 0.0386  0.0096  -0.0678 121 GLN A CG  
795  C CD  . GLN A 109 ? 0.4224 0.5650 0.5123 0.0354  0.0063  -0.0678 121 GLN A CD  
796  O OE1 . GLN A 109 ? 0.4178 0.5566 0.5112 0.0354  0.0063  -0.0680 121 GLN A OE1 
797  N NE2 . GLN A 109 ? 0.2535 0.3987 0.3434 0.0328  0.0037  -0.0669 121 GLN A NE2 
798  N N   . VAL A 110 ? 0.2936 0.4583 0.3884 0.0384  0.0148  -0.0545 122 VAL A N   
799  C CA  . VAL A 110 ? 0.2882 0.4555 0.3819 0.0356  0.0133  -0.0505 122 VAL A CA  
800  C C   . VAL A 110 ? 0.3466 0.5222 0.4398 0.0369  0.0175  -0.0467 122 VAL A C   
801  O O   . VAL A 110 ? 0.3711 0.5476 0.4587 0.0362  0.0176  -0.0454 122 VAL A O   
802  C CB  . VAL A 110 ? 0.3309 0.4964 0.4294 0.0323  0.0095  -0.0470 122 VAL A CB  
803  C CG1 . VAL A 110 ? 0.3333 0.4993 0.4300 0.0291  0.0074  -0.0423 122 VAL A CG1 
804  C CG2 . VAL A 110 ? 0.3231 0.4816 0.4198 0.0323  0.0065  -0.0501 122 VAL A CG2 
805  N N   . LYS A 111 ? 0.2653 0.4477 0.3644 0.0393  0.0211  -0.0445 123 LYS A N   
806  C CA  . LYS A 111 ? 0.2569 0.4501 0.3570 0.0417  0.0263  -0.0397 123 LYS A CA  
807  C C   . LYS A 111 ? 0.3306 0.5221 0.4187 0.0466  0.0298  -0.0438 123 LYS A C   
808  O O   . LYS A 111 ? 0.3438 0.5415 0.4284 0.0467  0.0324  -0.0397 123 LYS A O   
809  C CB  . LYS A 111 ? 0.2679 0.4700 0.3773 0.0450  0.0299  -0.0367 123 LYS A CB  
810  C CG  . LYS A 111 ? 0.1773 0.3945 0.2900 0.0482  0.0363  -0.0300 123 LYS A CG  
811  C CD  . LYS A 111 ? 0.2061 0.4352 0.3317 0.0504  0.0388  -0.0246 123 LYS A CD  
812  C CE  . LYS A 111 ? 0.1763 0.4018 0.2995 0.0588  0.0420  -0.0304 123 LYS A CE  
813  N NZ  . LYS A 111 ? 0.3589 0.5858 0.4714 0.0681  0.0491  -0.0334 123 LYS A NZ  
814  N N   . LYS A 112 ? 0.2895 0.4717 0.3706 0.0502  0.0293  -0.0516 124 LYS A N   
815  C CA  . LYS A 112 ? 0.2893 0.4664 0.3566 0.0546  0.0307  -0.0567 124 LYS A CA  
816  C C   . LYS A 112 ? 0.3290 0.5043 0.3904 0.0506  0.0272  -0.0562 124 LYS A C   
817  O O   . LYS A 112 ? 0.3277 0.5052 0.3797 0.0534  0.0298  -0.0557 124 LYS A O   
818  C CB  . LYS A 112 ? 0.3272 0.4918 0.3886 0.0570  0.0282  -0.0648 124 LYS A CB  
819  C CG  . LYS A 112 ? 0.5669 0.7255 0.6132 0.0638  0.0305  -0.0702 124 LYS A CG  
820  C CD  . LYS A 112 ? 0.7375 0.8812 0.7750 0.0619  0.0240  -0.0778 124 LYS A CD  
821  C CE  . LYS A 112 ? 0.8655 0.9990 0.8854 0.0689  0.0248  -0.0844 124 LYS A CE  
822  N NZ  . LYS A 112 ? 1.0362 1.1755 1.0453 0.0728  0.0284  -0.0828 124 LYS A NZ  
823  N N   . GLN A 113 ? 0.2899 0.4614 0.3560 0.0449  0.0218  -0.0558 125 GLN A N   
824  C CA  . GLN A 113 ? 0.2950 0.4648 0.3567 0.0418  0.0181  -0.0548 125 GLN A CA  
825  C C   . GLN A 113 ? 0.3678 0.5448 0.4304 0.0401  0.0200  -0.0473 125 GLN A C   
826  O O   . GLN A 113 ? 0.3745 0.5511 0.4295 0.0399  0.0191  -0.0461 125 GLN A O   
827  C CB  . GLN A 113 ? 0.3005 0.4657 0.3678 0.0379  0.0129  -0.0556 125 GLN A CB  
828  C CG  . GLN A 113 ? 0.4346 0.5937 0.5006 0.0381  0.0100  -0.0616 125 GLN A CG  
829  C CD  . GLN A 113 ? 0.5512 0.7084 0.6250 0.0357  0.0072  -0.0613 125 GLN A CD  
830  O OE1 . GLN A 113 ? 0.4822 0.6406 0.5600 0.0343  0.0062  -0.0576 125 GLN A OE1 
831  N NE2 . GLN A 113 ? 0.4357 0.5891 0.5108 0.0353  0.0055  -0.0649 125 GLN A NE2 
832  N N   . ILE A 114 ? 0.3236 0.5069 0.3957 0.0385  0.0221  -0.0415 126 ILE A N   
833  C CA  . ILE A 114 ? 0.3199 0.5107 0.3950 0.0356  0.0236  -0.0329 126 ILE A CA  
834  C C   . ILE A 114 ? 0.3801 0.5795 0.4489 0.0403  0.0303  -0.0306 126 ILE A C   
835  O O   . ILE A 114 ? 0.3881 0.5896 0.4509 0.0395  0.0308  -0.0265 126 ILE A O   
836  C CB  . ILE A 114 ? 0.3432 0.5389 0.4315 0.0316  0.0227  -0.0271 126 ILE A CB  
837  C CG1 . ILE A 114 ? 0.3176 0.5030 0.4087 0.0274  0.0156  -0.0288 126 ILE A CG1 
838  C CG2 . ILE A 114 ? 0.3484 0.5553 0.4423 0.0283  0.0251  -0.0166 126 ILE A CG2 
839  C CD1 . ILE A 114 ? 0.3018 0.4798 0.3882 0.0236  0.0106  -0.0263 126 ILE A CD1 
840  N N   . LEU A 115 ? 0.3378 0.5414 0.4067 0.0463  0.0354  -0.0333 127 LEU A N   
841  C CA  . LEU A 115 ? 0.3467 0.5588 0.4084 0.0531  0.0429  -0.0314 127 LEU A CA  
842  C C   . LEU A 115 ? 0.4019 0.6058 0.4458 0.0570  0.0423  -0.0376 127 LEU A C   
843  O O   . LEU A 115 ? 0.3910 0.6012 0.4267 0.0603  0.0468  -0.0337 127 LEU A O   
844  C CB  . LEU A 115 ? 0.3501 0.5673 0.4155 0.0600  0.0482  -0.0332 127 LEU A CB  
845  C CG  . LEU A 115 ? 0.4107 0.6390 0.4942 0.0569  0.0491  -0.0259 127 LEU A CG  
846  C CD1 . LEU A 115 ? 0.4191 0.6524 0.5050 0.0654  0.0546  -0.0278 127 LEU A CD1 
847  C CD2 . LEU A 115 ? 0.4132 0.6568 0.5059 0.0521  0.0514  -0.0135 127 LEU A CD2 
848  N N   . ASP A 116 ? 0.3877 0.5783 0.4258 0.0562  0.0363  -0.0463 128 ASP A N   
849  C CA  . ASP A 116 ? 0.4007 0.5825 0.4230 0.0582  0.0332  -0.0524 128 ASP A CA  
850  C C   . ASP A 116 ? 0.4541 0.6364 0.4743 0.0533  0.0293  -0.0482 128 ASP A C   
851  O O   . ASP A 116 ? 0.4727 0.6504 0.4796 0.0551  0.0270  -0.0512 128 ASP A O   
852  C CB  . ASP A 116 ? 0.4290 0.5984 0.4497 0.0571  0.0270  -0.0613 128 ASP A CB  
853  C CG  . ASP A 116 ? 0.6590 0.8225 0.6754 0.0630  0.0293  -0.0675 128 ASP A CG  
854  O OD1 . ASP A 116 ? 0.6691 0.8388 0.6829 0.0698  0.0366  -0.0654 128 ASP A OD1 
855  O OD2 . ASP A 116 ? 0.7651 0.9181 0.7812 0.0612  0.0240  -0.0737 128 ASP A OD2 
856  N N   . GLU A 117 ? 0.3900 0.5760 0.4221 0.0474  0.0276  -0.0415 129 GLU A N   
857  C CA  . GLU A 117 ? 0.3807 0.5651 0.4120 0.0429  0.0234  -0.0370 129 GLU A CA  
858  C C   . GLU A 117 ? 0.4628 0.6381 0.4911 0.0415  0.0162  -0.0431 129 GLU A C   
859  O O   . GLU A 117 ? 0.4782 0.6514 0.5008 0.0405  0.0127  -0.0414 129 GLU A O   
860  C CB  . GLU A 117 ? 0.4010 0.5906 0.4222 0.0448  0.0268  -0.0315 129 GLU A CB  
861  C CG  . GLU A 117 ? 0.4177 0.6195 0.4449 0.0453  0.0340  -0.0229 129 GLU A CG  
862  C CD  . GLU A 117 ? 0.4667 0.6757 0.4826 0.0492  0.0396  -0.0177 129 GLU A CD  
863  O OE1 . GLU A 117 ? 0.4157 0.6244 0.4281 0.0459  0.0375  -0.0117 129 GLU A OE1 
864  O OE2 . GLU A 117 ? 0.5497 0.7645 0.5596 0.0564  0.0464  -0.0194 129 GLU A OE2 
865  N N   . LYS A 118 ? 0.4181 0.5891 0.4512 0.0415  0.0141  -0.0492 130 LYS A N   
866  C CA  . LYS A 118 ? 0.4110 0.5766 0.4459 0.0394  0.0078  -0.0530 130 LYS A CA  
867  C C   . LYS A 118 ? 0.4868 0.6517 0.5298 0.0362  0.0052  -0.0485 130 LYS A C   
868  O O   . LYS A 118 ? 0.5133 0.6760 0.5552 0.0357  0.0008  -0.0487 130 LYS A O   
869  C CB  . LYS A 118 ? 0.4305 0.5922 0.4686 0.0398  0.0069  -0.0594 130 LYS A CB  
870  C CG  . LYS A 118 ? 0.7149 0.8721 0.7413 0.0427  0.0060  -0.0654 130 LYS A CG  
871  C CD  . LYS A 118 ? 0.9665 1.1180 0.9950 0.0435  0.0060  -0.0708 130 LYS A CD  
872  C CE  . LYS A 118 ? 1.2202 1.3635 1.2345 0.0465  0.0040  -0.0774 130 LYS A CE  
873  N NZ  . LYS A 118 ? 1.4118 1.5473 1.4271 0.0477  0.0038  -0.0824 130 LYS A NZ  
874  N N   . ILE A 119 ? 0.4307 0.5973 0.4813 0.0346  0.0076  -0.0445 131 ILE A N   
875  C CA  . ILE A 119 ? 0.4223 0.5860 0.4776 0.0317  0.0048  -0.0397 131 ILE A CA  
876  C C   . ILE A 119 ? 0.4398 0.6061 0.4924 0.0298  0.0063  -0.0324 131 ILE A C   
877  O O   . ILE A 119 ? 0.4266 0.5999 0.4821 0.0294  0.0109  -0.0290 131 ILE A O   
878  C CB  . ILE A 119 ? 0.4664 0.6291 0.5311 0.0301  0.0049  -0.0397 131 ILE A CB  
879  C CG1 . ILE A 119 ? 0.4728 0.6334 0.5404 0.0317  0.0040  -0.0458 131 ILE A CG1 
880  C CG2 . ILE A 119 ? 0.4844 0.6410 0.5510 0.0271  0.0009  -0.0350 131 ILE A CG2 
881  C CD1 . ILE A 119 ? 0.4767 0.6369 0.5523 0.0309  0.0047  -0.0458 131 ILE A CD1 
882  N N   . TYR A 120 ? 0.3816 0.5431 0.4291 0.0289  0.0027  -0.0290 132 TYR A N   
883  C CA  . TYR A 120 ? 0.3747 0.5371 0.4205 0.0259  0.0032  -0.0206 132 TYR A CA  
884  C C   . TYR A 120 ? 0.4328 0.5940 0.4876 0.0210  0.0021  -0.0157 132 TYR A C   
885  O O   . TYR A 120 ? 0.4285 0.5821 0.4867 0.0203  -0.0019 -0.0182 132 TYR A O   
886  C CB  . TYR A 120 ? 0.3812 0.5363 0.4191 0.0261  -0.0014 -0.0179 132 TYR A CB  
887  C CG  . TYR A 120 ? 0.3905 0.5433 0.4277 0.0216  -0.0023 -0.0083 132 TYR A CG  
888  C CD1 . TYR A 120 ? 0.4143 0.5757 0.4486 0.0206  0.0023  -0.0021 132 TYR A CD1 
889  C CD2 . TYR A 120 ? 0.3956 0.5371 0.4348 0.0181  -0.0079 -0.0050 132 TYR A CD2 
890  C CE1 . TYR A 120 ? 0.4291 0.5896 0.4645 0.0153  0.0015  0.0083  132 TYR A CE1 
891  C CE2 . TYR A 120 ? 0.4109 0.5488 0.4500 0.0125  -0.0099 0.0045  132 TYR A CE2 
892  C CZ  . TYR A 120 ? 0.5092 0.6574 0.5474 0.0105  -0.0052 0.0117  132 TYR A CZ  
893  O OH  . TYR A 120 ? 0.5105 0.6559 0.5498 0.0039  -0.0074 0.0225  132 TYR A OH  
894  N N   . CYS A 121 ? 0.3976 0.5667 0.4560 0.0178  0.0055  -0.0081 133 CYS A N   
895  C CA  . CYS A 121 ? 0.3998 0.5703 0.4682 0.0120  0.0039  -0.0018 133 CYS A CA  
896  C C   . CYS A 121 ? 0.4436 0.6166 0.5122 0.0064  0.0035  0.0095  133 CYS A C   
897  O O   . CYS A 121 ? 0.4407 0.6244 0.5067 0.0081  0.0093  0.0136  133 CYS A O   
898  C CB  . CYS A 121 ? 0.4062 0.5889 0.4836 0.0135  0.0094  -0.0030 133 CYS A CB  
899  S SG  . CYS A 121 ? 0.4615 0.6468 0.5530 0.0066  0.0060  0.0033  133 CYS A SG  
900  N N   . PRO A 122 ? 0.4091 0.5713 0.4796 -0.0001 -0.0038 0.0149  134 PRO A N   
901  C CA  . PRO A 122 ? 0.4143 0.5785 0.4862 -0.0069 -0.0049 0.0269  134 PRO A CA  
902  C C   . PRO A 122 ? 0.4845 0.6670 0.5702 -0.0116 -0.0001 0.0358  134 PRO A C   
903  O O   . PRO A 122 ? 0.4720 0.6619 0.5662 -0.0101 0.0020  0.0321  134 PRO A O   
904  C CB  . PRO A 122 ? 0.4398 0.5836 0.5087 -0.0123 -0.0155 0.0285  134 PRO A CB  
905  C CG  . PRO A 122 ? 0.4895 0.6219 0.5535 -0.0064 -0.0186 0.0170  134 PRO A CG  
906  C CD  . PRO A 122 ? 0.4234 0.5699 0.4934 -0.0015 -0.0116 0.0105  134 PRO A CD  
907  N N   . PRO A 123 ? 0.4552 0.6465 0.5441 -0.0170 0.0018  0.0484  135 PRO A N   
908  C CA  . PRO A 123 ? 0.4461 0.6596 0.5495 -0.0202 0.0080  0.0580  135 PRO A CA  
909  C C   . PRO A 123 ? 0.4883 0.7040 0.6066 -0.0269 0.0028  0.0607  135 PRO A C   
910  O O   . PRO A 123 ? 0.4785 0.7117 0.6073 -0.0240 0.0089  0.0613  135 PRO A O   
911  C CB  . PRO A 123 ? 0.4800 0.6986 0.5837 -0.0266 0.0086  0.0723  135 PRO A CB  
912  C CG  . PRO A 123 ? 0.5454 0.7493 0.6319 -0.0225 0.0069  0.0678  135 PRO A CG  
913  C CD  . PRO A 123 ? 0.4859 0.6690 0.5657 -0.0200 -0.0009 0.0552  135 PRO A CD  
914  N N   . GLU A 124 ? 0.4454 0.6430 0.5638 -0.0351 -0.0087 0.0622  136 GLU A N   
915  C CA  . GLU A 124 ? 0.4367 0.6350 0.5680 -0.0423 -0.0153 0.0651  136 GLU A CA  
916  C C   . GLU A 124 ? 0.4733 0.6711 0.6050 -0.0349 -0.0138 0.0529  136 GLU A C   
917  O O   . GLU A 124 ? 0.4736 0.6862 0.6188 -0.0360 -0.0119 0.0556  136 GLU A O   
918  C CB  . GLU A 124 ? 0.4670 0.6414 0.5938 -0.0518 -0.0291 0.0679  136 GLU A CB  
919  C CG  . GLU A 124 ? 0.5844 0.7581 0.7232 -0.0605 -0.0378 0.0717  136 GLU A CG  
920  C CD  . GLU A 124 ? 0.8637 1.0128 0.9974 -0.0711 -0.0526 0.0758  136 GLU A CD  
921  O OE1 . GLU A 124 ? 0.8410 0.9796 0.9676 -0.0752 -0.0556 0.0819  136 GLU A OE1 
922  O OE2 . GLU A 124 ? 0.6543 0.7941 0.7907 -0.0754 -0.0617 0.0734  136 GLU A OE2 
923  N N   . ALA A 125 ? 0.4020 0.5840 0.5198 -0.0274 -0.0146 0.0403  137 ALA A N   
924  C CA  . ALA A 125 ? 0.3746 0.5556 0.4916 -0.0201 -0.0127 0.0290  137 ALA A CA  
925  C C   . ALA A 125 ? 0.3821 0.5839 0.5054 -0.0134 -0.0017 0.0279  137 ALA A C   
926  O O   . ALA A 125 ? 0.3728 0.5809 0.5038 -0.0114 -0.0005 0.0251  137 ALA A O   
927  C CB  . ALA A 125 ? 0.3840 0.5476 0.4859 -0.0136 -0.0146 0.0182  137 ALA A CB  
928  N N   . SER A 126 ? 0.3201 0.5316 0.4390 -0.0095 0.0060  0.0304  138 SER A N   
929  C CA  . SER A 126 ? 0.3048 0.5345 0.4265 -0.0020 0.0167  0.0298  138 SER A CA  
930  C C   . SER A 126 ? 0.3316 0.5806 0.4704 -0.0045 0.0198  0.0385  138 SER A C   
931  O O   . SER A 126 ? 0.3072 0.5632 0.4503 0.0017  0.0239  0.0336  138 SER A O   
932  C CB  . SER A 126 ? 0.3464 0.5825 0.4593 0.0014  0.0232  0.0334  138 SER A CB  
933  O OG  . SER A 126 ? 0.5309 0.7558 0.6287 0.0083  0.0239  0.0227  138 SER A OG  
934  N N   . VAL A 127 ? 0.2898 0.5471 0.4392 -0.0139 0.0169  0.0519  139 VAL A N   
935  C CA  . VAL A 127 ? 0.2878 0.5673 0.4559 -0.0169 0.0198  0.0625  139 VAL A CA  
936  C C   . VAL A 127 ? 0.3411 0.6152 0.5182 -0.0206 0.0119  0.0592  139 VAL A C   
937  O O   . VAL A 127 ? 0.3314 0.6224 0.5215 -0.0181 0.0155  0.0622  139 VAL A O   
938  C CB  . VAL A 127 ? 0.3405 0.6337 0.5194 -0.0266 0.0194  0.0796  139 VAL A CB  
939  C CG1 . VAL A 127 ? 0.3466 0.6466 0.5157 -0.0217 0.0283  0.0832  139 VAL A CG1 
940  C CG2 . VAL A 127 ? 0.3430 0.6184 0.5230 -0.0400 0.0056  0.0842  139 VAL A CG2 
941  N N   . LEU A 128 ? 0.2979 0.5485 0.4669 -0.0254 0.0013  0.0531  140 LEU A N   
942  C CA  . LEU A 128 ? 0.2937 0.5356 0.4671 -0.0285 -0.0071 0.0492  140 LEU A CA  
943  C C   . LEU A 128 ? 0.3207 0.5620 0.4902 -0.0178 -0.0020 0.0374  140 LEU A C   
944  O O   . LEU A 128 ? 0.3177 0.5674 0.4975 -0.0172 -0.0026 0.0380  140 LEU A O   
945  C CB  . LEU A 128 ? 0.3082 0.5234 0.4701 -0.0346 -0.0189 0.0457  140 LEU A CB  
946  C CG  . LEU A 128 ? 0.3808 0.5866 0.5483 -0.0438 -0.0314 0.0487  140 LEU A CG  
947  C CD1 . LEU A 128 ? 0.3757 0.6035 0.5641 -0.0523 -0.0326 0.0627  140 LEU A CD1 
948  C CD2 . LEU A 128 ? 0.4492 0.6297 0.6042 -0.0503 -0.0422 0.0486  140 LEU A CD2 
949  N N   . LEU A 129 ? 0.2534 0.4853 0.4086 -0.0098 0.0027  0.0274  141 LEU A N   
950  C CA  . LEU A 129 ? 0.2384 0.4696 0.3893 -0.0002 0.0079  0.0170  141 LEU A CA  
951  C C   . LEU A 129 ? 0.2838 0.5359 0.4440 0.0060  0.0173  0.0204  141 LEU A C   
952  O O   . LEU A 129 ? 0.2803 0.5351 0.4449 0.0105  0.0185  0.0166  141 LEU A O   
953  C CB  . LEU A 129 ? 0.2398 0.4592 0.3750 0.0057  0.0105  0.0078  141 LEU A CB  
954  C CG  . LEU A 129 ? 0.2921 0.4910 0.4169 0.0038  0.0029  0.0016  141 LEU A CG  
955  C CD1 . LEU A 129 ? 0.2802 0.4729 0.3927 0.0090  0.0060  -0.0047 141 LEU A CD1 
956  C CD2 . LEU A 129 ? 0.3285 0.5194 0.4541 0.0053  -0.0009 -0.0047 141 LEU A CD2 
957  N N   . ALA A 130 ? 0.2486 0.5153 0.4109 0.0071  0.0241  0.0279  142 ALA A N   
958  C CA  . ALA A 130 ? 0.2463 0.5335 0.4153 0.0149  0.0342  0.0318  142 ALA A CA  
959  C C   . ALA A 130 ? 0.3128 0.6158 0.5009 0.0120  0.0327  0.0398  142 ALA A C   
960  O O   . ALA A 130 ? 0.3233 0.6363 0.5155 0.0207  0.0388  0.0378  142 ALA A O   
961  C CB  . ALA A 130 ? 0.2618 0.5619 0.4291 0.0157  0.0412  0.0402  142 ALA A CB  
962  N N   . SER A 131 ? 0.2633 0.5671 0.4622 -0.0001 0.0238  0.0486  143 SER A N   
963  C CA  . SER A 131 ? 0.2502 0.5688 0.4683 -0.0051 0.0198  0.0573  143 SER A CA  
964  C C   . SER A 131 ? 0.2751 0.5838 0.4925 -0.0015 0.0156  0.0482  143 SER A C   
965  O O   . SER A 131 ? 0.2638 0.5882 0.4940 0.0021  0.0179  0.0519  143 SER A O   
966  C CB  . SER A 131 ? 0.2838 0.6004 0.5104 -0.0200 0.0089  0.0677  143 SER A CB  
967  O OG  . SER A 131 ? 0.3380 0.6275 0.5532 -0.0259 -0.0025 0.0601  143 SER A OG  
968  N N   . TYR A 132 ? 0.2362 0.5202 0.4388 -0.0018 0.0098  0.0369  144 TYR A N   
969  C CA  . TYR A 132 ? 0.2286 0.5019 0.4283 0.0019  0.0062  0.0282  144 TYR A CA  
970  C C   . TYR A 132 ? 0.2944 0.5715 0.4898 0.0145  0.0159  0.0210  144 TYR A C   
971  O O   . TYR A 132 ? 0.3030 0.5831 0.5039 0.0186  0.0158  0.0193  144 TYR A O   
972  C CB  . TYR A 132 ? 0.2288 0.4764 0.4139 -0.0014 -0.0019 0.0196  144 TYR A CB  
973  C CG  . TYR A 132 ? 0.2421 0.4820 0.4304 -0.0127 -0.0138 0.0253  144 TYR A CG  
974  C CD1 . TYR A 132 ? 0.2595 0.5047 0.4590 -0.0172 -0.0207 0.0299  144 TYR A CD1 
975  C CD2 . TYR A 132 ? 0.2593 0.4859 0.4389 -0.0189 -0.0190 0.0264  144 TYR A CD2 
976  C CE1 . TYR A 132 ? 0.2839 0.5201 0.4850 -0.0282 -0.0331 0.0351  144 TYR A CE1 
977  C CE2 . TYR A 132 ? 0.2730 0.4896 0.4539 -0.0293 -0.0309 0.0316  144 TYR A CE2 
978  C CZ  . TYR A 132 ? 0.3546 0.5753 0.5457 -0.0342 -0.0383 0.0356  144 TYR A CZ  
979  O OH  . TYR A 132 ? 0.4085 0.6169 0.5991 -0.0450 -0.0516 0.0403  144 TYR A OH  
980  N N   . ALA A 133 ? 0.2447 0.5206 0.4296 0.0206  0.0236  0.0170  145 ALA A N   
981  C CA  . ALA A 133 ? 0.2413 0.5194 0.4204 0.0325  0.0324  0.0105  145 ALA A CA  
982  C C   . ALA A 133 ? 0.3075 0.6083 0.5002 0.0386  0.0392  0.0182  145 ALA A C   
983  O O   . ALA A 133 ? 0.3259 0.6262 0.5183 0.0470  0.0422  0.0135  145 ALA A O   
984  C CB  . ALA A 133 ? 0.2555 0.5286 0.4203 0.0366  0.0379  0.0062  145 ALA A CB  
985  N N   . VAL A 134 ? 0.2504 0.5716 0.4558 0.0344  0.0414  0.0310  146 VAL A N   
986  C CA  . VAL A 134 ? 0.2391 0.5862 0.4608 0.0396  0.0477  0.0408  146 VAL A CA  
987  C C   . VAL A 134 ? 0.2920 0.6409 0.5259 0.0379  0.0413  0.0417  146 VAL A C   
988  O O   . VAL A 134 ? 0.2922 0.6496 0.5301 0.0482  0.0467  0.0407  146 VAL A O   
989  C CB  . VAL A 134 ? 0.2835 0.6533 0.5190 0.0329  0.0498  0.0563  146 VAL A CB  
990  C CG1 . VAL A 134 ? 0.2750 0.6748 0.5313 0.0372  0.0552  0.0683  146 VAL A CG1 
991  C CG2 . VAL A 134 ? 0.2862 0.6566 0.5088 0.0372  0.0580  0.0560  146 VAL A CG2 
992  N N   . GLN A 135 ? 0.2429 0.5821 0.4806 0.0258  0.0294  0.0430  147 GLN A N   
993  C CA  . GLN A 135 ? 0.2336 0.5728 0.4810 0.0229  0.0215  0.0440  147 GLN A CA  
994  C C   . GLN A 135 ? 0.3036 0.6258 0.5393 0.0314  0.0222  0.0316  147 GLN A C   
995  O O   . GLN A 135 ? 0.3145 0.6434 0.5586 0.0357  0.0215  0.0328  147 GLN A O   
996  C CB  . GLN A 135 ? 0.2414 0.5697 0.4906 0.0084  0.0081  0.0470  147 GLN A CB  
997  C CG  . GLN A 135 ? 0.1607 0.5086 0.4270 -0.0018 0.0050  0.0622  147 GLN A CG  
998  C CD  . GLN A 135 ? 0.2701 0.6024 0.5315 -0.0154 -0.0061 0.0641  147 GLN A CD  
999  O OE1 . GLN A 135 ? 0.2170 0.5612 0.4891 -0.0245 -0.0085 0.0760  147 GLN A OE1 
1000 N NE2 . GLN A 135 ? 0.2715 0.5768 0.5169 -0.0172 -0.0136 0.0535  147 GLN A NE2 
1001 N N   . ALA A 136 ? 0.2613 0.5626 0.4786 0.0338  0.0234  0.0205  148 ALA A N   
1002 C CA  . ALA A 136 ? 0.2604 0.5456 0.4665 0.0411  0.0243  0.0094  148 ALA A CA  
1003 C C   . ALA A 136 ? 0.3558 0.6492 0.5617 0.0544  0.0342  0.0076  148 ALA A C   
1004 O O   . ALA A 136 ? 0.3661 0.6524 0.5699 0.0603  0.0340  0.0027  148 ALA A O   
1005 C CB  . ALA A 136 ? 0.2604 0.5248 0.4492 0.0396  0.0231  -0.0001 148 ALA A CB  
1006 N N   . LYS A 137 ? 0.3230 0.6305 0.5299 0.0594  0.0426  0.0119  149 LYS A N   
1007 C CA  . LYS A 137 ? 0.3381 0.6531 0.5422 0.0736  0.0527  0.0104  149 LYS A CA  
1008 C C   . LYS A 137 ? 0.4424 0.7778 0.6639 0.0791  0.0549  0.0188  149 LYS A C   
1009 O O   . LYS A 137 ? 0.4510 0.7841 0.6687 0.0910  0.0597  0.0146  149 LYS A O   
1010 C CB  . LYS A 137 ? 0.3602 0.6847 0.5588 0.0773  0.0611  0.0132  149 LYS A CB  
1011 C CG  . LYS A 137 ? 0.4244 0.7500 0.6125 0.0934  0.0714  0.0087  149 LYS A CG  
1012 C CD  . LYS A 137 ? 0.5944 0.9302 0.7759 0.0972  0.0796  0.0124  149 LYS A CD  
1013 C CE  . LYS A 137 ? 0.7265 1.0644 0.8966 0.1145  0.0901  0.0086  149 LYS A CE  
1014 N NZ  . LYS A 137 ? 0.9561 1.3017 1.1162 0.1186  0.0978  0.0113  149 LYS A NZ  
1015 N N   . TYR A 138 ? 0.4333 0.7878 0.6738 0.0704  0.0505  0.0308  150 TYR A N   
1016 C CA  . TYR A 138 ? 0.4522 0.8316 0.7122 0.0751  0.0528  0.0412  150 TYR A CA  
1017 C C   . TYR A 138 ? 0.5951 0.9746 0.8675 0.0664  0.0413  0.0448  150 TYR A C   
1018 O O   . TYR A 138 ? 0.6033 0.9831 0.8824 0.0525  0.0321  0.0499  150 TYR A O   
1019 C CB  . TYR A 138 ? 0.4557 0.8639 0.7303 0.0736  0.0587  0.0551  150 TYR A CB  
1020 C CG  . TYR A 138 ? 0.4777 0.8892 0.7400 0.0847  0.0712  0.0528  150 TYR A CG  
1021 C CD1 . TYR A 138 ? 0.5071 0.9227 0.7635 0.1025  0.0815  0.0493  150 TYR A CD1 
1022 C CD2 . TYR A 138 ? 0.4867 0.8967 0.7421 0.0782  0.0726  0.0544  150 TYR A CD2 
1023 C CE1 . TYR A 138 ? 0.5116 0.9293 0.7544 0.1136  0.0926  0.0471  150 TYR A CE1 
1024 C CE2 . TYR A 138 ? 0.5058 0.9187 0.7483 0.0888  0.0838  0.0525  150 TYR A CE2 
1025 C CZ  . TYR A 138 ? 0.6020 1.0184 0.8376 0.1066  0.0937  0.0486  150 TYR A CZ  
1026 O OH  . TYR A 138 ? 0.6426 1.0599 0.8626 0.1179  0.1043  0.0460  150 TYR A OH  
1027 N N   . GLY A 139 ? 0.6014 0.9797 0.8755 0.0754  0.0419  0.0421  151 GLY A N   
1028 C CA  . GLY A 139 ? 0.6108 0.9935 0.8976 0.0710  0.0327  0.0467  151 GLY A CA  
1029 C C   . GLY A 139 ? 0.6910 1.1030 0.9981 0.0793  0.0371  0.0579  151 GLY A C   
1030 O O   . GLY A 139 ? 0.7036 1.1139 1.0089 0.0917  0.0408  0.0546  151 GLY A O   
1031 N N   . ASP A 140 ? 0.6359 1.0756 0.9629 0.0728  0.0369  0.0720  152 ASP A N   
1032 C CA  . ASP A 140 ? 0.8954 1.3679 1.2473 0.0765  0.0381  0.0860  152 ASP A CA  
1033 C C   . ASP A 140 ? 1.0271 1.5187 1.3988 0.0595  0.0293  0.0999  152 ASP A C   
1034 O O   . ASP A 140 ? 0.5040 0.9991 0.8748 0.0525  0.0316  0.1036  152 ASP A O   
1035 C CB  . ASP A 140 ? 0.9269 1.4206 1.2824 0.0940  0.0540  0.0902  152 ASP A CB  
1036 C CG  . ASP A 140 ? 1.0268 1.5535 1.4065 0.1023  0.0567  0.1033  152 ASP A CG  
1037 O OD1 . ASP A 140 ? 1.0077 1.5637 1.4115 0.0930  0.0534  0.1190  152 ASP A OD1 
1038 O OD2 . ASP A 140 ? 1.1120 1.6357 1.4871 0.1183  0.0622  0.0986  152 ASP A OD2 
1039 N N   . GLN A 166 ? 0.8770 1.3876 1.2463 0.5299  0.1221  0.1254  178 GLN A N   
1040 C CA  . GLN A 166 ? 0.8495 1.4054 1.2562 0.5268  0.1153  0.1439  178 GLN A CA  
1041 C C   . GLN A 166 ? 0.8428 1.4135 1.2687 0.4913  0.1017  0.1485  178 GLN A C   
1042 O O   . GLN A 166 ? 0.8238 1.3925 1.2454 0.4732  0.1030  0.1430  178 GLN A O   
1043 C CB  . GLN A 166 ? 0.8662 1.4791 1.3009 0.5474  0.1289  0.1600  178 GLN A CB  
1044 C CG  . GLN A 166 ? 1.0779 1.7393 1.5522 0.5486  0.1222  0.1804  178 GLN A CG  
1045 C CD  . GLN A 166 ? 1.3473 2.0692 1.8525 0.5674  0.1355  0.1981  178 GLN A CD  
1046 O OE1 . GLN A 166 ? 1.3369 2.0641 1.8316 0.5866  0.1521  0.1954  178 GLN A OE1 
1047 N NE2 . GLN A 166 ? 1.2028 1.9726 1.7469 0.5625  0.1284  0.2173  178 GLN A NE2 
1048 N N   . MET A 167 ? 0.7674 1.3508 1.2124 0.4823  0.0883  0.1583  179 MET A N   
1049 C CA  . MET A 167 ? 0.7233 1.3274 1.1901 0.4519  0.0746  0.1656  179 MET A CA  
1050 C C   . MET A 167 ? 0.7558 1.3924 1.2516 0.4534  0.0642  0.1820  179 MET A C   
1051 O O   . MET A 167 ? 0.7630 1.3747 1.2481 0.4589  0.0563  0.1798  179 MET A O   
1052 C CB  . MET A 167 ? 0.7420 1.2984 1.1830 0.4284  0.0637  0.1507  179 MET A CB  
1053 C CG  . MET A 167 ? 0.7557 1.3300 1.2144 0.3977  0.0511  0.1561  179 MET A CG  
1054 S SD  . MET A 167 ? 0.7983 1.3207 1.2293 0.3732  0.0371  0.1416  179 MET A SD  
1055 C CE  . MET A 167 ? 0.7708 1.2793 1.1995 0.3844  0.0274  0.1460  179 MET A CE  
1056 N N   . THR A 168 ? 0.6889 1.3813 1.2217 0.4479  0.0639  0.1992  180 THR A N   
1057 C CA  . THR A 168 ? 0.6776 1.4074 1.2425 0.4454  0.0524  0.2166  180 THR A CA  
1058 C C   . THR A 168 ? 0.6983 1.4186 1.2658 0.4128  0.0330  0.2157  180 THR A C   
1059 O O   . THR A 168 ? 0.6799 1.3756 1.2305 0.3935  0.0315  0.2042  180 THR A O   
1060 C CB  . THR A 168 ? 0.7735 1.5681 1.3777 0.4532  0.0603  0.2362  180 THR A CB  
1061 O OG1 . THR A 168 ? 0.7785 1.5896 1.3915 0.4322  0.0620  0.2371  180 THR A OG1 
1062 C CG2 . THR A 168 ? 0.7628 1.5690 1.3645 0.4888  0.0793  0.2385  180 THR A CG2 
1063 N N   . PRO A 169 ? 0.6456 1.3822 1.2314 0.4069  0.0179  0.2268  181 PRO A N   
1064 C CA  . PRO A 169 ? 0.6295 1.3572 1.2159 0.3765  -0.0006 0.2258  181 PRO A CA  
1065 C C   . PRO A 169 ? 0.6780 1.4316 1.2819 0.3527  -0.0033 0.2304  181 PRO A C   
1066 O O   . PRO A 169 ? 0.6642 1.3939 1.2546 0.3290  -0.0133 0.2220  181 PRO A O   
1067 C CB  . PRO A 169 ? 0.6515 1.4036 1.2599 0.3790  -0.0142 0.2404  181 PRO A CB  
1068 C CG  . PRO A 169 ? 0.7292 1.4783 1.3332 0.4108  -0.0041 0.2420  181 PRO A CG  
1069 C CD  . PRO A 169 ? 0.6769 1.4372 1.2805 0.4280  0.0163  0.2399  181 PRO A CD  
1070 N N   . GLU A 170 ? 0.6355 1.4375 1.2689 0.3596  0.0059  0.2442  182 GLU A N   
1071 C CA  . GLU A 170 ? 0.6133 1.4427 1.2648 0.3395  0.0057  0.2503  182 GLU A CA  
1072 C C   . GLU A 170 ? 0.6410 1.4371 1.2640 0.3352  0.0169  0.2336  182 GLU A C   
1073 O O   . GLU A 170 ? 0.6273 1.4179 1.2488 0.3108  0.0102  0.2304  182 GLU A O   
1074 C CB  . GLU A 170 ? 0.6316 1.5238 1.3231 0.3501  0.0140  0.2713  182 GLU A CB  
1075 C CG  . GLU A 170 ? 0.8349 1.7458 1.5341 0.3840  0.0267  0.2783  182 GLU A CG  
1076 C CD  . GLU A 170 ? 1.1988 2.1323 1.9199 0.3897  0.0141  0.2919  182 GLU A CD  
1077 O OE1 . GLU A 170 ? 1.1736 2.1608 1.9344 0.3840  0.0085  0.3122  182 GLU A OE1 
1078 O OE2 . GLU A 170 ? 1.1727 2.0708 1.8718 0.3998  0.0096  0.2829  182 GLU A OE2 
1079 N N   . MET A 171 ? 0.5930 1.3658 1.1928 0.3587  0.0331  0.2229  183 MET A N   
1080 C CA  . MET A 171 ? 0.5805 1.3170 1.1497 0.3566  0.0431  0.2057  183 MET A CA  
1081 C C   . MET A 171 ? 0.6066 1.2926 1.1468 0.3380  0.0315  0.1897  183 MET A C   
1082 O O   . MET A 171 ? 0.5982 1.2647 1.1233 0.3233  0.0329  0.1796  183 MET A O   
1083 C CB  . MET A 171 ? 0.6314 1.3515 1.1806 0.3871  0.0606  0.1980  183 MET A CB  
1084 C CG  . MET A 171 ? 0.6786 1.4421 1.2474 0.4044  0.0770  0.2093  183 MET A CG  
1085 S SD  . MET A 171 ? 0.7603 1.5111 1.3103 0.4461  0.0946  0.2043  183 MET A SD  
1086 C CE  . MET A 171 ? 0.7283 1.4319 1.2369 0.4474  0.1059  0.1828  183 MET A CE  
1087 N N   . TRP A 172 ? 0.5512 1.2169 1.0836 0.3394  0.0206  0.1880  184 TRP A N   
1088 C CA  . TRP A 172 ? 0.5355 1.1571 1.0426 0.3226  0.0090  0.1753  184 TRP A CA  
1089 C C   . TRP A 172 ? 0.5602 1.1929 1.0785 0.2935  -0.0043 0.1787  184 TRP A C   
1090 O O   . TRP A 172 ? 0.5517 1.1536 1.0490 0.2780  -0.0070 0.1665  184 TRP A O   
1091 C CB  . TRP A 172 ? 0.5279 1.1321 1.0278 0.3323  0.0007  0.1760  184 TRP A CB  
1092 C CG  . TRP A 172 ? 0.5303 1.1052 1.0151 0.3128  -0.0149 0.1700  184 TRP A CG  
1093 C CD1 . TRP A 172 ? 0.5610 1.1518 1.0608 0.2999  -0.0310 0.1795  184 TRP A CD1 
1094 C CD2 . TRP A 172 ? 0.5262 1.0517 0.9776 0.3049  -0.0158 0.1539  184 TRP A CD2 
1095 N NE1 . TRP A 172 ? 0.5520 1.1058 1.0282 0.2857  -0.0411 0.1699  184 TRP A NE1 
1096 C CE2 . TRP A 172 ? 0.5691 1.0838 1.0166 0.2885  -0.0317 0.1547  184 TRP A CE2 
1097 C CE3 . TRP A 172 ? 0.5458 1.0352 0.9700 0.3106  -0.0051 0.1393  184 TRP A CE3 
1098 C CZ2 . TRP A 172 ? 0.5568 1.0287 0.9755 0.2776  -0.0359 0.1422  184 TRP A CZ2 
1099 C CZ3 . TRP A 172 ? 0.5612 1.0086 0.9587 0.2987  -0.0103 0.1272  184 TRP A CZ3 
1100 C CH2 . TRP A 172 ? 0.5616 1.0016 0.9569 0.2828  -0.0249 0.1291  184 TRP A CH2 
1101 N N   . GLU A 173 ? 0.4989 1.1753 1.0502 0.2866  -0.0127 0.1955  185 GLU A N   
1102 C CA  . GLU A 173 ? 0.4836 1.1724 1.0474 0.2595  -0.0269 0.2004  185 GLU A CA  
1103 C C   . GLU A 173 ? 0.5356 1.2285 1.0990 0.2477  -0.0194 0.1969  185 GLU A C   
1104 O O   . GLU A 173 ? 0.5316 1.2046 1.0832 0.2265  -0.0281 0.1898  185 GLU A O   
1105 C CB  . GLU A 173 ? 0.4988 1.2353 1.0997 0.2565  -0.0374 0.2204  185 GLU A CB  
1106 C CG  . GLU A 173 ? 0.6608 1.3895 1.2620 0.2362  -0.0594 0.2225  185 GLU A CG  
1107 C CD  . GLU A 173 ? 0.9776 1.6662 1.5517 0.2409  -0.0661 0.2123  185 GLU A CD  
1108 O OE1 . GLU A 173 ? 0.9126 1.5659 1.4624 0.2253  -0.0739 0.2005  185 GLU A OE1 
1109 O OE2 . GLU A 173 ? 0.8956 1.5878 1.4722 0.2607  -0.0632 0.2163  185 GLU A OE2 
1110 N N   . GLU A 174 ? 0.4955 1.2129 1.0699 0.2626  -0.0031 0.2018  186 GLU A N   
1111 C CA  . GLU A 174 ? 0.4907 1.2137 1.0642 0.2552  0.0065  0.1994  186 GLU A CA  
1112 C C   . GLU A 174 ? 0.5406 1.2138 1.0767 0.2522  0.0115  0.1789  186 GLU A C   
1113 O O   . GLU A 174 ? 0.5362 1.2011 1.0663 0.2345  0.0096  0.1742  186 GLU A O   
1114 C CB  . GLU A 174 ? 0.5178 1.2769 1.1084 0.2763  0.0243  0.2092  186 GLU A CB  
1115 C CG  . GLU A 174 ? 0.6822 1.4992 1.3151 0.2753  0.0209  0.2320  186 GLU A CG  
1116 C CD  . GLU A 174 ? 1.0448 1.8978 1.6950 0.3031  0.0373  0.2432  186 GLU A CD  
1117 O OE1 . GLU A 174 ? 0.8800 1.7722 1.5607 0.3084  0.0324  0.2602  186 GLU A OE1 
1118 O OE2 . GLU A 174 ? 1.0773 1.9199 1.7104 0.3201  0.0547  0.2353  186 GLU A OE2 
1119 N N   . ARG A 175 ? 0.5044 1.1444 1.0159 0.2690  0.0170  0.1674  187 ARG A N   
1120 C CA  . ARG A 175 ? 0.5085 1.1013 0.9851 0.2677  0.0216  0.1487  187 ARG A CA  
1121 C C   . ARG A 175 ? 0.5684 1.1307 1.0297 0.2459  0.0070  0.1405  187 ARG A C   
1122 O O   . ARG A 175 ? 0.5610 1.0955 1.0015 0.2363  0.0088  0.1283  187 ARG A O   
1123 C CB  . ARG A 175 ? 0.5229 1.0903 0.9794 0.2918  0.0306  0.1406  187 ARG A CB  
1124 C CG  . ARG A 175 ? 0.6280 1.2091 1.0847 0.3128  0.0484  0.1411  187 ARG A CG  
1125 C CD  . ARG A 175 ? 0.7534 1.3212 1.1989 0.3401  0.0558  0.1385  187 ARG A CD  
1126 N NE  . ARG A 175 ? 0.8686 1.3831 1.2783 0.3433  0.0564  0.1211  187 ARG A NE  
1127 C CZ  . ARG A 175 ? 1.1022 1.5932 1.4887 0.3552  0.0679  0.1097  187 ARG A CZ  
1128 N NH1 . ARG A 175 ? 1.0627 1.5781 1.4560 0.3658  0.0807  0.1132  187 ARG A NH1 
1129 N NH2 . ARG A 175 ? 0.8521 1.2949 1.2081 0.3559  0.0661  0.0951  187 ARG A NH2 
1130 N N   . ILE A 176 ? 0.5356 1.1036 1.0067 0.2390  -0.0074 0.1473  188 ILE A N   
1131 C CA  . ILE A 176 ? 0.5274 1.0734 0.9872 0.2181  -0.0224 0.1423  188 ILE A CA  
1132 C C   . ILE A 176 ? 0.5392 1.0964 1.0067 0.1973  -0.0266 0.1438  188 ILE A C   
1133 O O   . ILE A 176 ? 0.5299 1.0583 0.9765 0.1856  -0.0279 0.1323  188 ILE A O   
1134 C CB  . ILE A 176 ? 0.5767 1.1338 1.0488 0.2160  -0.0373 0.1520  188 ILE A CB  
1135 C CG1 . ILE A 176 ? 0.5871 1.1239 1.0459 0.2339  -0.0354 0.1487  188 ILE A CG1 
1136 C CG2 . ILE A 176 ? 0.6014 1.1450 1.0665 0.1927  -0.0540 0.1496  188 ILE A CG2 
1137 C CD1 . ILE A 176 ? 0.6314 1.1851 1.1053 0.2344  -0.0486 0.1601  188 ILE A CD1 
1138 N N   . THR A 177 ? 0.4755 1.0750 0.9735 0.1928  -0.0289 0.1588  189 THR A N   
1139 C CA  . THR A 177 ? 0.4587 1.0719 0.9678 0.1717  -0.0357 0.1633  189 THR A CA  
1140 C C   . THR A 177 ? 0.5022 1.1023 0.9972 0.1700  -0.0232 0.1539  189 THR A C   
1141 O O   . THR A 177 ? 0.5006 1.0837 0.9847 0.1525  -0.0291 0.1477  189 THR A O   
1142 C CB  . THR A 177 ? 0.5266 1.1907 1.0738 0.1697  -0.0393 0.1832  189 THR A CB  
1143 O OG1 . THR A 177 ? 0.4830 1.1614 1.0434 0.1775  -0.0474 0.1920  189 THR A OG1 
1144 C CG2 . THR A 177 ? 0.5102 1.1861 1.0699 0.1447  -0.0520 0.1896  189 THR A CG2 
1145 N N   . ALA A 178 ? 0.4475 1.0543 0.9413 0.1892  -0.0062 0.1527  190 ALA A N   
1146 C CA  . ALA A 178 ? 0.4342 1.0311 0.9147 0.1910  0.0068  0.1446  190 ALA A CA  
1147 C C   . ALA A 178 ? 0.4781 1.0273 0.9249 0.1853  0.0060  0.1263  190 ALA A C   
1148 O O   . ALA A 178 ? 0.4831 1.0218 0.9201 0.1751  0.0086  0.1201  190 ALA A O   
1149 C CB  . ALA A 178 ? 0.4507 1.0615 0.9335 0.2157  0.0240  0.1465  190 ALA A CB  
1150 N N   . TRP A 179 ? 0.4112 0.9327 0.8412 0.1918  0.0021  0.1186  191 TRP A N   
1151 C CA  . TRP A 179 ? 0.3993 0.8772 0.7986 0.1890  0.0025  0.1025  191 TRP A CA  
1152 C C   . TRP A 179 ? 0.4481 0.9114 0.8397 0.1666  -0.0086 0.0982  191 TRP A C   
1153 O O   . TRP A 179 ? 0.4436 0.8829 0.8161 0.1612  -0.0050 0.0872  191 TRP A O   
1154 C CB  . TRP A 179 ? 0.3870 0.8423 0.7734 0.2003  0.0002  0.0982  191 TRP A CB  
1155 C CG  . TRP A 179 ? 0.4006 0.8140 0.7571 0.2019  0.0041  0.0831  191 TRP A CG  
1156 C CD1 . TRP A 179 ? 0.4493 0.8454 0.7909 0.2174  0.0153  0.0754  191 TRP A CD1 
1157 C CD2 . TRP A 179 ? 0.3885 0.7725 0.7266 0.1874  -0.0038 0.0744  191 TRP A CD2 
1158 N NE1 . TRP A 179 ? 0.4438 0.8025 0.7605 0.2118  0.0142  0.0630  191 TRP A NE1 
1159 C CE2 . TRP A 179 ? 0.4477 0.7997 0.7626 0.1940  0.0033  0.0626  191 TRP A CE2 
1160 C CE3 . TRP A 179 ? 0.3904 0.7717 0.7286 0.1700  -0.0162 0.0755  191 TRP A CE3 
1161 C CZ2 . TRP A 179 ? 0.4371 0.7583 0.7318 0.1834  -0.0010 0.0533  191 TRP A CZ2 
1162 C CZ3 . TRP A 179 ? 0.4066 0.7562 0.7227 0.1611  -0.0197 0.0655  191 TRP A CZ3 
1163 C CH2 . TRP A 179 ? 0.4220 0.7437 0.7180 0.1676  -0.0118 0.0551  191 TRP A CH2 
1164 N N   . TYR A 180 ? 0.4000 0.8774 0.8057 0.1541  -0.0225 0.1067  192 TYR A N   
1165 C CA  . TYR A 180 ? 0.3876 0.8498 0.7844 0.1341  -0.0345 0.1028  192 TYR A CA  
1166 C C   . TYR A 180 ? 0.4620 0.9256 0.8575 0.1236  -0.0303 0.1002  192 TYR A C   
1167 O O   . TYR A 180 ? 0.4517 0.8877 0.8265 0.1159  -0.0310 0.0893  192 TYR A O   
1168 C CB  . TYR A 180 ? 0.3873 0.8682 0.8015 0.1234  -0.0504 0.1140  192 TYR A CB  
1169 C CG  . TYR A 180 ? 0.3998 0.8727 0.8101 0.1298  -0.0582 0.1151  192 TYR A CG  
1170 C CD1 . TYR A 180 ? 0.4305 0.8683 0.8150 0.1274  -0.0627 0.1045  192 TYR A CD1 
1171 C CD2 . TYR A 180 ? 0.4013 0.9034 0.8345 0.1374  -0.0618 0.1279  192 TYR A CD2 
1172 C CE1 . TYR A 180 ? 0.4412 0.8716 0.8213 0.1328  -0.0701 0.1064  192 TYR A CE1 
1173 C CE2 . TYR A 180 ? 0.4133 0.9080 0.8426 0.1431  -0.0697 0.1295  192 TYR A CE2 
1174 C CZ  . TYR A 180 ? 0.4934 0.9516 0.8955 0.1408  -0.0737 0.1187  192 TYR A CZ  
1175 O OH  . TYR A 180 ? 0.5026 0.9534 0.9000 0.1465  -0.0813 0.1209  192 TYR A OH  
1176 N N   . ALA A 181 ? 0.4444 0.9408 0.8622 0.1239  -0.0255 0.1108  193 ALA A N   
1177 C CA  . ALA A 181 ? 0.4376 0.9392 0.8568 0.1139  -0.0217 0.1107  193 ALA A CA  
1178 C C   . ALA A 181 ? 0.4914 0.9741 0.8911 0.1235  -0.0071 0.0992  193 ALA A C   
1179 O O   . ALA A 181 ? 0.4814 0.9506 0.8698 0.1138  -0.0063 0.0929  193 ALA A O   
1180 C CB  . ALA A 181 ? 0.4460 0.9903 0.8956 0.1130  -0.0196 0.1270  193 ALA A CB  
1181 N N   . GLU A 182 ? 0.4604 0.9408 0.8552 0.1426  0.0034  0.0962  194 GLU A N   
1182 C CA  . GLU A 182 ? 0.4676 0.9298 0.8434 0.1535  0.0165  0.0855  194 GLU A CA  
1183 C C   . GLU A 182 ? 0.5286 0.9494 0.8765 0.1492  0.0136  0.0705  194 GLU A C   
1184 O O   . GLU A 182 ? 0.5355 0.9390 0.8668 0.1526  0.0217  0.0611  194 GLU A O   
1185 C CB  . GLU A 182 ? 0.4982 0.9698 0.8767 0.1761  0.0275  0.0876  194 GLU A CB  
1186 C CG  . GLU A 182 ? 0.6468 1.1539 1.0437 0.1847  0.0382  0.0981  194 GLU A CG  
1187 C CD  . GLU A 182 ? 1.0346 1.5699 1.4503 0.2021  0.0429  0.1091  194 GLU A CD  
1188 O OE1 . GLU A 182 ? 1.0034 1.5769 1.4468 0.1979  0.0409  0.1243  194 GLU A OE1 
1189 O OE2 . GLU A 182 ? 0.9735 1.4935 1.3770 0.2197  0.0482  0.1034  194 GLU A OE2 
1190 N N   . HIS A 183 ? 0.4807 0.8866 0.8235 0.1419  0.0022  0.0687  195 HIS A N   
1191 C CA  . HIS A 183 ? 0.4837 0.8533 0.8020 0.1392  0.0000  0.0565  195 HIS A CA  
1192 C C   . HIS A 183 ? 0.5680 0.9272 0.8818 0.1222  -0.0130 0.0555  195 HIS A C   
1193 O O   . HIS A 183 ? 0.5921 0.9428 0.9026 0.1213  -0.0210 0.0562  195 HIS A O   
1194 C CB  . HIS A 183 ? 0.4984 0.8545 0.8093 0.1533  0.0017  0.0542  195 HIS A CB  
1195 C CG  . HIS A 183 ? 0.5468 0.9093 0.8591 0.1716  0.0137  0.0542  195 HIS A CG  
1196 N ND1 . HIS A 183 ? 0.5753 0.9147 0.8683 0.1784  0.0221  0.0436  195 HIS A ND1 
1197 C CD2 . HIS A 183 ? 0.5694 0.9589 0.8993 0.1843  0.0181  0.0638  195 HIS A CD2 
1198 C CE1 . HIS A 183 ? 0.5785 0.9290 0.8757 0.1956  0.0313  0.0462  195 HIS A CE1 
1199 N NE2 . HIS A 183 ? 0.5796 0.9612 0.8993 0.2003  0.0300  0.0585  195 HIS A NE2 
1200 N N   . ARG A 184 ? 0.5086 0.8675 0.8207 0.1095  -0.0149 0.0539  196 ARG A N   
1201 C CA  . ARG A 184 ? 0.4990 0.8462 0.8043 0.0943  -0.0269 0.0522  196 ARG A CA  
1202 C C   . ARG A 184 ? 0.5322 0.8519 0.8155 0.0889  -0.0246 0.0406  196 ARG A C   
1203 O O   . ARG A 184 ? 0.5168 0.8224 0.7901 0.0788  -0.0333 0.0376  196 ARG A O   
1204 C CB  . ARG A 184 ? 0.4946 0.8641 0.8174 0.0823  -0.0343 0.0617  196 ARG A CB  
1205 C CG  . ARG A 184 ? 0.5449 0.9408 0.8899 0.0834  -0.0412 0.0742  196 ARG A CG  
1206 C CD  . ARG A 184 ? 0.6274 1.0321 0.9819 0.0671  -0.0554 0.0812  196 ARG A CD  
1207 N NE  . ARG A 184 ? 0.7966 1.2371 1.1797 0.0662  -0.0582 0.0960  196 ARG A NE  
1208 C CZ  . ARG A 184 ? 0.9674 1.4234 1.3643 0.0692  -0.0656 0.1044  196 ARG A CZ  
1209 N NH1 . ARG A 184 ? 0.7422 1.1795 1.1256 0.0737  -0.0709 0.0992  196 ARG A NH1 
1210 N NH2 . ARG A 184 ? 0.7932 1.2845 1.2181 0.0679  -0.0676 0.1189  196 ARG A NH2 
1211 N N   . GLY A 185 ? 0.4870 0.7995 0.7625 0.0960  -0.0135 0.0343  197 GLY A N   
1212 C CA  . GLY A 185 ? 0.4783 0.7672 0.7349 0.0919  -0.0108 0.0240  197 GLY A CA  
1213 C C   . GLY A 185 ? 0.5066 0.8001 0.7637 0.0837  -0.0090 0.0232  197 GLY A C   
1214 O O   . GLY A 185 ? 0.5190 0.8320 0.7905 0.0777  -0.0125 0.0311  197 GLY A O   
1215 N N   . ARG A 186 ? 0.4237 0.6997 0.6656 0.0832  -0.0040 0.0144  198 ARG A N   
1216 C CA  . ARG A 186 ? 0.4027 0.6792 0.6418 0.0759  -0.0022 0.0124  198 ARG A CA  
1217 C C   . ARG A 186 ? 0.4581 0.7280 0.6938 0.0633  -0.0122 0.0128  198 ARG A C   
1218 O O   . ARG A 186 ? 0.4557 0.7086 0.6800 0.0611  -0.0174 0.0084  198 ARG A O   
1219 C CB  . ARG A 186 ? 0.3862 0.6440 0.6090 0.0793  0.0045  0.0026  198 ARG A CB  
1220 C CG  . ARG A 186 ? 0.4354 0.6990 0.6580 0.0881  0.0147  0.0010  198 ARG A CG  
1221 C CD  . ARG A 186 ? 0.4039 0.6465 0.6090 0.0883  0.0183  -0.0089 198 ARG A CD  
1222 N NE  . ARG A 186 ? 0.4731 0.7122 0.6740 0.0777  0.0152  -0.0106 198 ARG A NE  
1223 C CZ  . ARG A 186 ? 0.6361 0.8591 0.8270 0.0711  0.0103  -0.0153 198 ARG A CZ  
1224 N NH1 . ARG A 186 ? 0.5095 0.7187 0.6937 0.0732  0.0084  -0.0185 198 ARG A NH1 
1225 N NH2 . ARG A 186 ? 0.4591 0.6801 0.6466 0.0629  0.0077  -0.0161 198 ARG A NH2 
1226 N N   . ALA A 187 ? 0.4081 0.6904 0.6525 0.0552  -0.0150 0.0182  199 ALA A N   
1227 C CA  . ALA A 187 ? 0.3943 0.6659 0.6317 0.0435  -0.0241 0.0170  199 ALA A CA  
1228 C C   . ALA A 187 ? 0.4192 0.6731 0.6403 0.0426  -0.0196 0.0081  199 ALA A C   
1229 O O   . ALA A 187 ? 0.3996 0.6547 0.6186 0.0485  -0.0102 0.0049  199 ALA A O   
1230 C CB  . ALA A 187 ? 0.4007 0.6900 0.6529 0.0347  -0.0290 0.0263  199 ALA A CB  
1231 N N   . ARG A 188 ? 0.3769 0.6140 0.5856 0.0360  -0.0266 0.0040  200 ARG A N   
1232 C CA  . ARG A 188 ? 0.3757 0.5981 0.5704 0.0347  -0.0234 -0.0032 200 ARG A CA  
1233 C C   . ARG A 188 ? 0.4433 0.6741 0.6428 0.0299  -0.0212 -0.0004 200 ARG A C   
1234 O O   . ARG A 188 ? 0.4391 0.6796 0.6482 0.0229  -0.0272 0.0067  200 ARG A O   
1235 C CB  . ARG A 188 ? 0.3686 0.5725 0.5489 0.0305  -0.0311 -0.0074 200 ARG A CB  
1236 C CG  . ARG A 188 ? 0.4544 0.6439 0.6205 0.0320  -0.0265 -0.0150 200 ARG A CG  
1237 C CD  . ARG A 188 ? 0.5521 0.7254 0.7040 0.0291  -0.0334 -0.0182 200 ARG A CD  
1238 N NE  . ARG A 188 ? 0.6959 0.8590 0.8367 0.0300  -0.0291 -0.0239 200 ARG A NE  
1239 C CZ  . ARG A 188 ? 0.8834 1.0361 1.0136 0.0339  -0.0267 -0.0284 200 ARG A CZ  
1240 N NH1 . ARG A 188 ? 0.6670 0.8165 0.7945 0.0372  -0.0281 -0.0279 200 ARG A NH1 
1241 N NH2 . ARG A 188 ? 0.6440 0.7906 0.7666 0.0346  -0.0230 -0.0324 200 ARG A NH2 
1242 N N   . ASP A 189 ? 0.4006 0.6276 0.5937 0.0334  -0.0131 -0.0054 201 ASP A N   
1243 C CA  . ASP A 189 ? 0.3847 0.6198 0.5808 0.0310  -0.0090 -0.0031 201 ASP A CA  
1244 C C   . ASP A 189 ? 0.4154 0.6380 0.6021 0.0230  -0.0149 -0.0048 201 ASP A C   
1245 O O   . ASP A 189 ? 0.4194 0.6310 0.5949 0.0242  -0.0118 -0.0109 201 ASP A O   
1246 C CB  . ASP A 189 ? 0.4040 0.6385 0.5949 0.0392  0.0013  -0.0082 201 ASP A CB  
1247 C CG  . ASP A 189 ? 0.5665 0.8148 0.7627 0.0403  0.0078  -0.0043 201 ASP A CG  
1248 O OD1 . ASP A 189 ? 0.5724 0.8277 0.7741 0.0328  0.0044  0.0017  201 ASP A OD1 
1249 O OD2 . ASP A 189 ? 0.6698 0.9204 0.8631 0.0486  0.0160  -0.0073 201 ASP A OD2 
1250 N N   . GLU A 190 ? 0.3575 0.5815 0.5491 0.0150  -0.0240 0.0009  202 GLU A N   
1251 C CA  . GLU A 190 ? 0.3527 0.5632 0.5351 0.0074  -0.0314 0.0000  202 GLU A CA  
1252 C C   . GLU A 190 ? 0.3730 0.5863 0.5546 0.0052  -0.0268 0.0013  202 GLU A C   
1253 O O   . GLU A 190 ? 0.3765 0.5748 0.5459 0.0028  -0.0295 -0.0028 202 GLU A O   
1254 C CB  . GLU A 190 ? 0.3785 0.5903 0.5674 -0.0013 -0.0433 0.0069  202 GLU A CB  
1255 C CG  . GLU A 190 ? 0.5764 0.7669 0.7501 -0.0028 -0.0527 0.0015  202 GLU A CG  
1256 C CD  . GLU A 190 ? 0.9958 1.1668 1.1526 -0.0042 -0.0547 -0.0041 202 GLU A CD  
1257 O OE1 . GLU A 190 ? 0.9370 1.0957 1.0804 0.0022  -0.0512 -0.0119 202 GLU A OE1 
1258 O OE2 . GLU A 190 ? 0.9565 1.1253 1.1141 -0.0114 -0.0593 -0.0002 202 GLU A OE2 
1259 N N   . ALA A 191 ? 0.3078 0.5401 0.5013 0.0070  -0.0194 0.0068  203 ALA A N   
1260 C CA  . ALA A 191 ? 0.2914 0.5282 0.4838 0.0059  -0.0140 0.0087  203 ALA A CA  
1261 C C   . ALA A 191 ? 0.3247 0.5471 0.5014 0.0111  -0.0092 -0.0009 203 ALA A C   
1262 O O   . ALA A 191 ? 0.3225 0.5381 0.4922 0.0077  -0.0100 -0.0013 203 ALA A O   
1263 C CB  . ALA A 191 ? 0.2934 0.5534 0.4991 0.0102  -0.0052 0.0155  203 ALA A CB  
1264 N N   . GLU A 192 ? 0.2666 0.4842 0.4382 0.0187  -0.0049 -0.0081 204 GLU A N   
1265 C CA  . GLU A 192 ? 0.2572 0.4621 0.4156 0.0230  -0.0013 -0.0168 204 GLU A CA  
1266 C C   . GLU A 192 ? 0.3362 0.5248 0.4839 0.0190  -0.0078 -0.0202 204 GLU A C   
1267 O O   . GLU A 192 ? 0.3533 0.5353 0.4925 0.0197  -0.0059 -0.0239 204 GLU A O   
1268 C CB  . GLU A 192 ? 0.2645 0.4663 0.4211 0.0301  0.0023  -0.0221 204 GLU A CB  
1269 C CG  . GLU A 192 ? 0.3013 0.5154 0.4645 0.0367  0.0096  -0.0207 204 GLU A CG  
1270 C CD  . GLU A 192 ? 0.4669 0.6746 0.6264 0.0438  0.0127  -0.0263 204 GLU A CD  
1271 O OE1 . GLU A 192 ? 0.3147 0.5141 0.4724 0.0431  0.0085  -0.0281 204 GLU A OE1 
1272 O OE2 . GLU A 192 ? 0.3877 0.5980 0.5451 0.0503  0.0192  -0.0285 204 GLU A OE2 
1273 N N   . MET A 193 ? 0.2941 0.4758 0.4410 0.0156  -0.0156 -0.0191 205 MET A N   
1274 C CA  . MET A 193 ? 0.3066 0.4717 0.4415 0.0133  -0.0222 -0.0222 205 MET A CA  
1275 C C   . MET A 193 ? 0.3661 0.5279 0.4992 0.0070  -0.0265 -0.0183 205 MET A C   
1276 O O   . MET A 193 ? 0.3807 0.5310 0.5029 0.0077  -0.0274 -0.0218 205 MET A O   
1277 C CB  . MET A 193 ? 0.3475 0.5050 0.4798 0.0124  -0.0296 -0.0223 205 MET A CB  
1278 C CG  . MET A 193 ? 0.4039 0.5425 0.5202 0.0133  -0.0348 -0.0271 205 MET A CG  
1279 S SD  . MET A 193 ? 0.4460 0.5792 0.5525 0.0201  -0.0272 -0.0339 205 MET A SD  
1280 C CE  . MET A 193 ? 0.3875 0.5243 0.4963 0.0255  -0.0229 -0.0364 205 MET A CE  
1281 N N   . GLU A 194 ? 0.3200 0.4928 0.4646 0.0011  -0.0289 -0.0103 206 GLU A N   
1282 C CA  . GLU A 194 ? 0.3191 0.4908 0.4644 -0.0061 -0.0330 -0.0045 206 GLU A CA  
1283 C C   . GLU A 194 ? 0.3410 0.5154 0.4826 -0.0034 -0.0255 -0.0057 206 GLU A C   
1284 O O   . GLU A 194 ? 0.3481 0.5122 0.4818 -0.0065 -0.0290 -0.0053 206 GLU A O   
1285 C CB  . GLU A 194 ? 0.3413 0.5295 0.5033 -0.0130 -0.0357 0.0060  206 GLU A CB  
1286 C CG  . GLU A 194 ? 0.5128 0.6973 0.6786 -0.0180 -0.0462 0.0087  206 GLU A CG  
1287 C CD  . GLU A 194 ? 0.9634 1.1232 1.1139 -0.0222 -0.0576 0.0052  206 GLU A CD  
1288 O OE1 . GLU A 194 ? 0.9033 1.0548 1.0502 -0.0288 -0.0629 0.0087  206 GLU A OE1 
1289 O OE2 . GLU A 194 ? 0.9890 1.1368 1.1299 -0.0183 -0.0611 -0.0011 206 GLU A OE2 
1290 N N   . TYR A 195 ? 0.2873 0.4742 0.4331 0.0029  -0.0159 -0.0076 207 TYR A N   
1291 C CA  . TYR A 195 ? 0.2685 0.4574 0.4088 0.0069  -0.0086 -0.0102 207 TYR A CA  
1292 C C   . TYR A 195 ? 0.3185 0.4913 0.4450 0.0096  -0.0103 -0.0178 207 TYR A C   
1293 O O   . TYR A 195 ? 0.3111 0.4786 0.4310 0.0083  -0.0109 -0.0175 207 TYR A O   
1294 C CB  . TYR A 195 ? 0.2665 0.4676 0.4111 0.0141  0.0004  -0.0123 207 TYR A CB  
1295 C CG  . TYR A 195 ? 0.2766 0.4814 0.4156 0.0178  0.0073  -0.0139 207 TYR A CG  
1296 C CD1 . TYR A 195 ? 0.2921 0.4863 0.4196 0.0214  0.0084  -0.0216 207 TYR A CD1 
1297 C CD2 . TYR A 195 ? 0.2784 0.4984 0.4235 0.0183  0.0128  -0.0072 207 TYR A CD2 
1298 C CE1 . TYR A 195 ? 0.2732 0.4699 0.3944 0.0246  0.0135  -0.0233 207 TYR A CE1 
1299 C CE2 . TYR A 195 ? 0.2958 0.5183 0.4333 0.0225  0.0190  -0.0089 207 TYR A CE2 
1300 C CZ  . TYR A 195 ? 0.3650 0.5749 0.4900 0.0254  0.0188  -0.0173 207 TYR A CZ  
1301 O OH  . TYR A 195 ? 0.3590 0.5705 0.4754 0.0294  0.0236  -0.0192 207 TYR A OH  
1302 N N   . LEU A 196 ? 0.2830 0.4485 0.4055 0.0135  -0.0110 -0.0239 208 LEU A N   
1303 C CA  . LEU A 196 ? 0.2733 0.4272 0.3848 0.0171  -0.0113 -0.0303 208 LEU A CA  
1304 C C   . LEU A 196 ? 0.3446 0.4847 0.4472 0.0144  -0.0184 -0.0297 208 LEU A C   
1305 O O   . LEU A 196 ? 0.3589 0.4926 0.4534 0.0170  -0.0178 -0.0326 208 LEU A O   
1306 C CB  . LEU A 196 ? 0.2631 0.4144 0.3737 0.0214  -0.0102 -0.0350 208 LEU A CB  
1307 C CG  . LEU A 196 ? 0.2980 0.4578 0.4135 0.0254  -0.0034 -0.0373 208 LEU A CG  
1308 C CD1 . LEU A 196 ? 0.2876 0.4448 0.4042 0.0281  -0.0037 -0.0397 208 LEU A CD1 
1309 C CD2 . LEU A 196 ? 0.3100 0.4695 0.4203 0.0278  0.0006  -0.0411 208 LEU A CD2 
1310 N N   . LYS A 197 ? 0.3065 0.4417 0.4105 0.0095  -0.0255 -0.0259 209 LYS A N   
1311 C CA  . LYS A 197 ? 0.3183 0.4368 0.4118 0.0069  -0.0337 -0.0254 209 LYS A CA  
1312 C C   . LYS A 197 ? 0.3982 0.5149 0.4897 0.0034  -0.0344 -0.0216 209 LYS A C   
1313 O O   . LYS A 197 ? 0.4287 0.5308 0.5084 0.0051  -0.0381 -0.0236 209 LYS A O   
1314 C CB  . LYS A 197 ? 0.3574 0.4709 0.4532 0.0011  -0.0424 -0.0219 209 LYS A CB  
1315 C CG  . LYS A 197 ? 0.5112 0.6176 0.6012 0.0055  -0.0447 -0.0267 209 LYS A CG  
1316 C CD  . LYS A 197 ? 0.5448 0.6548 0.6427 0.0004  -0.0508 -0.0226 209 LYS A CD  
1317 C CE  . LYS A 197 ? 0.6364 0.7308 0.7273 -0.0063 -0.0632 -0.0199 209 LYS A CE  
1318 N NZ  . LYS A 197 ? 0.7830 0.8836 0.8836 -0.0120 -0.0697 -0.0152 209 LYS A NZ  
1319 N N   . ILE A 198 ? 0.3305 0.4622 0.4328 -0.0005 -0.0304 -0.0156 210 ILE A N   
1320 C CA  . ILE A 198 ? 0.3262 0.4587 0.4268 -0.0032 -0.0294 -0.0112 210 ILE A CA  
1321 C C   . ILE A 198 ? 0.3732 0.5067 0.4670 0.0038  -0.0229 -0.0169 210 ILE A C   
1322 O O   . ILE A 198 ? 0.3877 0.5112 0.4723 0.0048  -0.0251 -0.0174 210 ILE A O   
1323 C CB  . ILE A 198 ? 0.3583 0.5087 0.4723 -0.0088 -0.0263 -0.0021 210 ILE A CB  
1324 C CG1 . ILE A 198 ? 0.3652 0.5157 0.4878 -0.0174 -0.0343 0.0052  210 ILE A CG1 
1325 C CG2 . ILE A 198 ? 0.3655 0.5181 0.4767 -0.0105 -0.0237 0.0026  210 ILE A CG2 
1326 C CD1 . ILE A 198 ? 0.4322 0.6054 0.5717 -0.0213 -0.0300 0.0142  210 ILE A CD1 
1327 N N   . ALA A 199 ? 0.3128 0.4572 0.4108 0.0087  -0.0158 -0.0209 211 ALA A N   
1328 C CA  . ALA A 199 ? 0.3062 0.4530 0.3993 0.0142  -0.0104 -0.0257 211 ALA A CA  
1329 C C   . ALA A 199 ? 0.3656 0.5002 0.4490 0.0181  -0.0133 -0.0308 211 ALA A C   
1330 O O   . ALA A 199 ? 0.3673 0.5005 0.4451 0.0202  -0.0124 -0.0317 211 ALA A O   
1331 C CB  . ALA A 199 ? 0.3024 0.4592 0.4009 0.0180  -0.0043 -0.0294 211 ALA A CB  
1332 N N   . GLN A 200 ? 0.3294 0.4559 0.4105 0.0196  -0.0168 -0.0335 212 GLN A N   
1333 C CA  . GLN A 200 ? 0.3301 0.4475 0.4025 0.0250  -0.0182 -0.0379 212 GLN A CA  
1334 C C   . GLN A 200 ? 0.4355 0.5402 0.4979 0.0256  -0.0231 -0.0364 212 GLN A C   
1335 O O   . GLN A 200 ? 0.4444 0.5444 0.4998 0.0314  -0.0230 -0.0393 212 GLN A O   
1336 C CB  . GLN A 200 ? 0.3365 0.4486 0.4074 0.0274  -0.0201 -0.0406 212 GLN A CB  
1337 C CG  . GLN A 200 ? 0.3687 0.4684 0.4347 0.0243  -0.0276 -0.0385 212 GLN A CG  
1338 C CD  . GLN A 200 ? 0.4914 0.5860 0.5543 0.0271  -0.0295 -0.0412 212 GLN A CD  
1339 O OE1 . GLN A 200 ? 0.4297 0.5300 0.4942 0.0317  -0.0247 -0.0441 212 GLN A OE1 
1340 N NE2 . GLN A 200 ? 0.2727 0.3559 0.3307 0.0239  -0.0372 -0.0397 212 GLN A NE2 
1341 N N   . ASP A 201 ? 0.4077 0.5076 0.4699 0.0196  -0.0275 -0.0312 213 ASP A N   
1342 C CA  . ASP A 201 ? 0.4224 0.5081 0.4747 0.0192  -0.0330 -0.0289 213 ASP A CA  
1343 C C   . ASP A 201 ? 0.4623 0.5545 0.5146 0.0193  -0.0296 -0.0265 213 ASP A C   
1344 O O   . ASP A 201 ? 0.4835 0.5646 0.5276 0.0195  -0.0336 -0.0241 213 ASP A O   
1345 C CB  . ASP A 201 ? 0.4627 0.5389 0.5151 0.0112  -0.0406 -0.0235 213 ASP A CB  
1346 C CG  . ASP A 201 ? 0.6546 0.7175 0.7014 0.0116  -0.0471 -0.0262 213 ASP A CG  
1347 O OD1 . ASP A 201 ? 0.6527 0.7113 0.6927 0.0194  -0.0456 -0.0323 213 ASP A OD1 
1348 O OD2 . ASP A 201 ? 0.7716 0.8285 0.8204 0.0039  -0.0541 -0.0218 213 ASP A OD2 
1349 N N   . LEU A 202 ? 0.3844 0.4929 0.4442 0.0197  -0.0227 -0.0272 214 LEU A N   
1350 C CA  . LEU A 202 ? 0.3687 0.4833 0.4267 0.0206  -0.0196 -0.0256 214 LEU A CA  
1351 C C   . LEU A 202 ? 0.4107 0.5235 0.4629 0.0275  -0.0190 -0.0303 214 LEU A C   
1352 O O   . LEU A 202 ? 0.3951 0.5114 0.4497 0.0311  -0.0170 -0.0350 214 LEU A O   
1353 C CB  . LEU A 202 ? 0.3549 0.4856 0.4205 0.0190  -0.0131 -0.0248 214 LEU A CB  
1354 C CG  . LEU A 202 ? 0.4030 0.5401 0.4765 0.0130  -0.0124 -0.0185 214 LEU A CG  
1355 C CD1 . LEU A 202 ? 0.3935 0.5456 0.4736 0.0145  -0.0054 -0.0195 214 LEU A CD1 
1356 C CD2 . LEU A 202 ? 0.4266 0.5613 0.4980 0.0080  -0.0148 -0.0106 214 LEU A CD2 
1357 N N   . GLU A 203 ? 0.3877 0.4960 0.4330 0.0292  -0.0209 -0.0281 215 GLU A N   
1358 C CA  . GLU A 203 ? 0.3938 0.5005 0.4338 0.0361  -0.0214 -0.0311 215 GLU A CA  
1359 C C   . GLU A 203 ? 0.4297 0.5503 0.4755 0.0385  -0.0170 -0.0353 215 GLU A C   
1360 O O   . GLU A 203 ? 0.4223 0.5442 0.4683 0.0435  -0.0170 -0.0381 215 GLU A O   
1361 C CB  . GLU A 203 ? 0.4210 0.5227 0.4537 0.0368  -0.0239 -0.0270 215 GLU A CB  
1362 C CG  . GLU A 203 ? 0.5759 0.6597 0.6008 0.0355  -0.0300 -0.0231 215 GLU A CG  
1363 C CD  . GLU A 203 ? 0.8110 0.8895 0.8298 0.0336  -0.0324 -0.0172 215 GLU A CD  
1364 O OE1 . GLU A 203 ? 0.6599 0.7461 0.6826 0.0273  -0.0301 -0.0125 215 GLU A OE1 
1365 O OE2 . GLU A 203 ? 0.7384 0.8049 0.7480 0.0389  -0.0364 -0.0166 215 GLU A OE2 
1366 N N   . MET A 204 ? 0.3730 0.5034 0.4231 0.0350  -0.0133 -0.0354 216 MET A N   
1367 C CA  . MET A 204 ? 0.3537 0.4942 0.4072 0.0362  -0.0105 -0.0394 216 MET A CA  
1368 C C   . MET A 204 ? 0.4113 0.5553 0.4718 0.0356  -0.0081 -0.0430 216 MET A C   
1369 O O   . MET A 204 ? 0.4242 0.5743 0.4875 0.0362  -0.0067 -0.0463 216 MET A O   
1370 C CB  . MET A 204 ? 0.3778 0.5244 0.4288 0.0342  -0.0082 -0.0383 216 MET A CB  
1371 C CG  . MET A 204 ? 0.4216 0.5667 0.4652 0.0356  -0.0105 -0.0354 216 MET A CG  
1372 S SD  . MET A 204 ? 0.4685 0.6208 0.5065 0.0348  -0.0076 -0.0352 216 MET A SD  
1373 C CE  . MET A 204 ? 0.4150 0.5724 0.4542 0.0367  -0.0087 -0.0420 216 MET A CE  
1374 N N   . TYR A 205 ? 0.3575 0.4970 0.4206 0.0341  -0.0083 -0.0420 217 TYR A N   
1375 C CA  . TYR A 205 ? 0.3347 0.4768 0.4040 0.0337  -0.0063 -0.0446 217 TYR A CA  
1376 C C   . TYR A 205 ? 0.3794 0.5224 0.4502 0.0372  -0.0065 -0.0476 217 TYR A C   
1377 O O   . TYR A 205 ? 0.3816 0.5197 0.4486 0.0407  -0.0086 -0.0469 217 TYR A O   
1378 C CB  . TYR A 205 ? 0.3370 0.4733 0.4076 0.0313  -0.0081 -0.0422 217 TYR A CB  
1379 C CG  . TYR A 205 ? 0.3223 0.4599 0.3982 0.0315  -0.0069 -0.0444 217 TYR A CG  
1380 C CD1 . TYR A 205 ? 0.3414 0.4738 0.4153 0.0348  -0.0084 -0.0462 217 TYR A CD1 
1381 C CD2 . TYR A 205 ? 0.3068 0.4506 0.3890 0.0293  -0.0041 -0.0440 217 TYR A CD2 
1382 C CE1 . TYR A 205 ? 0.3325 0.4658 0.4104 0.0350  -0.0074 -0.0475 217 TYR A CE1 
1383 C CE2 . TYR A 205 ? 0.3137 0.4580 0.4005 0.0298  -0.0034 -0.0454 217 TYR A CE2 
1384 C CZ  . TYR A 205 ? 0.4057 0.5445 0.4902 0.0322  -0.0053 -0.0471 217 TYR A CZ  
1385 O OH  . TYR A 205 ? 0.4470 0.5860 0.5351 0.0327  -0.0048 -0.0480 217 TYR A OH  
1386 N N   . GLY A 206 ? 0.3195 0.4686 0.3952 0.0366  -0.0042 -0.0503 218 GLY A N   
1387 C CA  . GLY A 206 ? 0.3056 0.4575 0.3851 0.0385  -0.0039 -0.0517 218 GLY A CA  
1388 C C   . GLY A 206 ? 0.3455 0.5019 0.4246 0.0411  -0.0054 -0.0510 218 GLY A C   
1389 O O   . GLY A 206 ? 0.3452 0.5056 0.4280 0.0434  -0.0050 -0.0504 218 GLY A O   
1390 N N   . VAL A 207 ? 0.2890 0.4460 0.3639 0.0409  -0.0071 -0.0503 219 VAL A N   
1391 C CA  . VAL A 207 ? 0.2767 0.4392 0.3516 0.0434  -0.0092 -0.0491 219 VAL A CA  
1392 C C   . VAL A 207 ? 0.3271 0.4960 0.4050 0.0398  -0.0103 -0.0511 219 VAL A C   
1393 O O   . VAL A 207 ? 0.3329 0.4995 0.4069 0.0371  -0.0100 -0.0531 219 VAL A O   
1394 C CB  . VAL A 207 ? 0.3140 0.4721 0.3813 0.0459  -0.0113 -0.0467 219 VAL A CB  
1395 C CG1 . VAL A 207 ? 0.3127 0.4778 0.3810 0.0495  -0.0137 -0.0450 219 VAL A CG1 
1396 C CG2 . VAL A 207 ? 0.3027 0.4504 0.3651 0.0488  -0.0117 -0.0451 219 VAL A CG2 
1397 N N   . ASN A 208 ? 0.2861 0.4631 0.3706 0.0398  -0.0117 -0.0503 220 ASN A N   
1398 C CA  . ASN A 208 ? 0.2772 0.4594 0.3644 0.0358  -0.0150 -0.0517 220 ASN A CA  
1399 C C   . ASN A 208 ? 0.3395 0.5271 0.4245 0.0375  -0.0187 -0.0495 220 ASN A C   
1400 O O   . ASN A 208 ? 0.3435 0.5378 0.4327 0.0417  -0.0190 -0.0458 220 ASN A O   
1401 C CB  . ASN A 208 ? 0.2576 0.4465 0.3551 0.0334  -0.0153 -0.0505 220 ASN A CB  
1402 C CG  . ASN A 208 ? 0.3896 0.5732 0.4891 0.0321  -0.0120 -0.0521 220 ASN A CG  
1403 O OD1 . ASN A 208 ? 0.2436 0.4215 0.3413 0.0284  -0.0124 -0.0556 220 ASN A OD1 
1404 N ND2 . ASN A 208 ? 0.2851 0.4699 0.3873 0.0358  -0.0088 -0.0495 220 ASN A ND2 
1405 N N   . TYR A 209 ? 0.2787 0.4636 0.3564 0.0354  -0.0214 -0.0517 221 TYR A N   
1406 C CA  . TYR A 209 ? 0.2604 0.4497 0.3345 0.0371  -0.0254 -0.0495 221 TYR A CA  
1407 C C   . TYR A 209 ? 0.3328 0.5290 0.4106 0.0330  -0.0314 -0.0502 221 TYR A C   
1408 O O   . TYR A 209 ? 0.3620 0.5537 0.4377 0.0282  -0.0331 -0.0543 221 TYR A O   
1409 C CB  . TYR A 209 ? 0.2691 0.4509 0.3309 0.0380  -0.0248 -0.0503 221 TYR A CB  
1410 C CG  . TYR A 209 ? 0.2637 0.4387 0.3223 0.0410  -0.0208 -0.0482 221 TYR A CG  
1411 C CD1 . TYR A 209 ? 0.2825 0.4565 0.3387 0.0454  -0.0218 -0.0442 221 TYR A CD1 
1412 C CD2 . TYR A 209 ? 0.2561 0.4252 0.3135 0.0392  -0.0166 -0.0498 221 TYR A CD2 
1413 C CE1 . TYR A 209 ? 0.2762 0.4412 0.3282 0.0471  -0.0196 -0.0422 221 TYR A CE1 
1414 C CE2 . TYR A 209 ? 0.2614 0.4243 0.3165 0.0405  -0.0143 -0.0472 221 TYR A CE2 
1415 C CZ  . TYR A 209 ? 0.3344 0.4943 0.3863 0.0440  -0.0163 -0.0436 221 TYR A CZ  
1416 O OH  . TYR A 209 ? 0.3175 0.4687 0.3662 0.0443  -0.0155 -0.0410 221 TYR A OH  
1417 N N   . PHE A 210 ? 0.2685 0.4749 0.3513 0.0349  -0.0352 -0.0461 222 PHE A N   
1418 C CA  . PHE A 210 ? 0.2550 0.4702 0.3431 0.0304  -0.0425 -0.0452 222 PHE A CA  
1419 C C   . PHE A 210 ? 0.3097 0.5304 0.3940 0.0336  -0.0469 -0.0422 222 PHE A C   
1420 O O   . PHE A 210 ? 0.3186 0.5428 0.4040 0.0402  -0.0444 -0.0382 222 PHE A O   
1421 C CB  . PHE A 210 ? 0.2641 0.4920 0.3687 0.0286  -0.0427 -0.0410 222 PHE A CB  
1422 C CG  . PHE A 210 ? 0.2732 0.4956 0.3815 0.0257  -0.0383 -0.0432 222 PHE A CG  
1423 C CD1 . PHE A 210 ? 0.3077 0.5236 0.4152 0.0184  -0.0418 -0.0471 222 PHE A CD1 
1424 C CD2 . PHE A 210 ? 0.2858 0.5076 0.3966 0.0309  -0.0313 -0.0415 222 PHE A CD2 
1425 C CE1 . PHE A 210 ? 0.3089 0.5192 0.4196 0.0163  -0.0379 -0.0487 222 PHE A CE1 
1426 C CE2 . PHE A 210 ? 0.3082 0.5250 0.4220 0.0285  -0.0276 -0.0432 222 PHE A CE2 
1427 C CZ  . PHE A 210 ? 0.2850 0.4966 0.3992 0.0212  -0.0308 -0.0464 222 PHE A CZ  
1428 N N   . ALA A 211 ? 0.2664 0.4861 0.3443 0.0294  -0.0539 -0.0444 223 ALA A N   
1429 C CA  . ALA A 211 ? 0.2645 0.4905 0.3391 0.0319  -0.0596 -0.0412 223 ALA A CA  
1430 C C   . ALA A 211 ? 0.3297 0.5742 0.4212 0.0321  -0.0636 -0.0347 223 ALA A C   
1431 O O   . ALA A 211 ? 0.3061 0.5577 0.4087 0.0257  -0.0672 -0.0342 223 ALA A O   
1432 C CB  . ALA A 211 ? 0.2786 0.4979 0.3403 0.0275  -0.0666 -0.0456 223 ALA A CB  
1433 N N   . ILE A 212 ? 0.3112 0.5634 0.4050 0.0399  -0.0625 -0.0293 224 ILE A N   
1434 C CA  . ILE A 212 ? 0.3084 0.5805 0.4183 0.0432  -0.0648 -0.0218 224 ILE A CA  
1435 C C   . ILE A 212 ? 0.4034 0.6815 0.5095 0.0488  -0.0697 -0.0176 224 ILE A C   
1436 O O   . ILE A 212 ? 0.4078 0.6731 0.4983 0.0519  -0.0693 -0.0199 224 ILE A O   
1437 C CB  . ILE A 212 ? 0.3337 0.6105 0.4523 0.0504  -0.0562 -0.0184 224 ILE A CB  
1438 C CG1 . ILE A 212 ? 0.3382 0.6019 0.4440 0.0600  -0.0505 -0.0190 224 ILE A CG1 
1439 C CG2 . ILE A 212 ? 0.3502 0.6232 0.4739 0.0448  -0.0520 -0.0214 224 ILE A CG2 
1440 C CD1 . ILE A 212 ? 0.4285 0.6988 0.5399 0.0708  -0.0453 -0.0141 224 ILE A CD1 
1441 N N   . ARG A 213 ? 0.3670 0.6658 0.4884 0.0504  -0.0741 -0.0106 225 ARG A N   
1442 C CA  . ARG A 213 ? 0.3609 0.6692 0.4824 0.0576  -0.0783 -0.0050 225 ARG A CA  
1443 C C   . ARG A 213 ? 0.4124 0.7377 0.5485 0.0675  -0.0735 0.0027  225 ARG A C   
1444 O O   . ARG A 213 ? 0.4031 0.7433 0.5557 0.0647  -0.0719 0.0061  225 ARG A O   
1445 C CB  . ARG A 213 ? 0.3278 0.6469 0.4533 0.0499  -0.0904 -0.0033 225 ARG A CB  
1446 C CG  . ARG A 213 ? 0.4200 0.7233 0.5248 0.0479  -0.0956 -0.0083 225 ARG A CG  
1447 C CD  . ARG A 213 ? 0.4266 0.7374 0.5327 0.0393  -0.1085 -0.0081 225 ARG A CD  
1448 N NE  . ARG A 213 ? 0.5359 0.8368 0.6388 0.0282  -0.1116 -0.0150 225 ARG A NE  
1449 C CZ  . ARG A 213 ? 0.6629 0.9473 0.7470 0.0232  -0.1168 -0.0222 225 ARG A CZ  
1450 N NH1 . ARG A 213 ? 0.5375 0.8152 0.6048 0.0273  -0.1198 -0.0229 225 ARG A NH1 
1451 N NH2 . ARG A 213 ? 0.4198 0.6938 0.5006 0.0146  -0.1190 -0.0285 225 ARG A NH2 
1452 N N   . ASN A 214 ? 0.3699 0.6922 0.4991 0.0795  -0.0708 0.0056  226 ASN A N   
1453 C CA  . ASN A 214 ? 0.3664 0.7047 0.5073 0.0914  -0.0664 0.0130  226 ASN A CA  
1454 C C   . ASN A 214 ? 0.4576 0.8230 0.6151 0.0918  -0.0743 0.0214  226 ASN A C   
1455 O O   . ASN A 214 ? 0.4751 0.8438 0.6332 0.0818  -0.0836 0.0206  226 ASN A O   
1456 C CB  . ASN A 214 ? 0.3393 0.6611 0.4648 0.1047  -0.0614 0.0125  226 ASN A CB  
1457 C CG  . ASN A 214 ? 0.4658 0.7818 0.5802 0.1089  -0.0674 0.0142  226 ASN A CG  
1458 O OD1 . ASN A 214 ? 0.3063 0.6360 0.4265 0.1052  -0.0756 0.0176  226 ASN A OD1 
1459 N ND2 . ASN A 214 ? 0.3144 0.6097 0.4124 0.1170  -0.0639 0.0126  226 ASN A ND2 
1460 N N   . LYS A 215 ? 0.4217 0.8062 0.5915 0.1039  -0.0708 0.0297  227 LYS A N   
1461 C CA  . LYS A 215 ? 0.4199 0.8341 0.6086 0.1053  -0.0774 0.0394  227 LYS A CA  
1462 C C   . LYS A 215 ? 0.4903 0.9022 0.6702 0.1072  -0.0865 0.0406  227 LYS A C   
1463 O O   . LYS A 215 ? 0.4964 0.9288 0.6895 0.1017  -0.0959 0.0462  227 LYS A O   
1464 C CB  . LYS A 215 ? 0.4442 0.8792 0.6467 0.1203  -0.0696 0.0482  227 LYS A CB  
1465 C CG  . LYS A 215 ? 0.5764 1.0272 0.7963 0.1159  -0.0637 0.0514  227 LYS A CG  
1466 C CD  . LYS A 215 ? 0.7218 1.2092 0.9696 0.1097  -0.0700 0.0626  227 LYS A CD  
1467 C CE  . LYS A 215 ? 0.9018 1.4030 1.1669 0.1002  -0.0666 0.0659  227 LYS A CE  
1468 N NZ  . LYS A 215 ? 0.9814 1.5178 1.2745 0.0918  -0.0745 0.0776  227 LYS A NZ  
1469 N N   . LYS A 216 ? 0.4637 0.8508 0.6215 0.1141  -0.0844 0.0358  228 LYS A N   
1470 C CA  . LYS A 216 ? 0.4708 0.8514 0.6165 0.1153  -0.0925 0.0364  228 LYS A CA  
1471 C C   . LYS A 216 ? 0.5124 0.8808 0.6474 0.1000  -0.1001 0.0295  228 LYS A C   
1472 O O   . LYS A 216 ? 0.5256 0.8905 0.6507 0.0993  -0.1078 0.0301  228 LYS A O   
1473 C CB  . LYS A 216 ? 0.5167 0.8737 0.6421 0.1276  -0.0874 0.0345  228 LYS A CB  
1474 C CG  . LYS A 216 ? 0.7796 1.1462 0.9104 0.1456  -0.0830 0.0417  228 LYS A CG  
1475 C CD  . LYS A 216 ? 0.9847 1.3221 1.0932 0.1560  -0.0784 0.0387  228 LYS A CD  
1476 C CE  . LYS A 216 ? 1.2105 1.5530 1.3209 0.1754  -0.0739 0.0446  228 LYS A CE  
1477 N NZ  . LYS A 216 ? 1.3523 1.6987 1.4696 0.1811  -0.0644 0.0437  228 LYS A NZ  
1478 N N   . GLY A 217 ? 0.4405 0.8016 0.5761 0.0890  -0.0977 0.0232  229 GLY A N   
1479 C CA  . GLY A 217 ? 0.4361 0.7847 0.5608 0.0758  -0.1039 0.0161  229 GLY A CA  
1480 C C   . GLY A 217 ? 0.4939 0.8142 0.5948 0.0759  -0.0991 0.0085  229 GLY A C   
1481 O O   . GLY A 217 ? 0.5004 0.8091 0.5887 0.0674  -0.1035 0.0028  229 GLY A O   
1482 N N   . THR A 218 ? 0.4273 0.7361 0.5213 0.0860  -0.0905 0.0091  230 THR A N   
1483 C CA  . THR A 218 ? 0.4058 0.6893 0.4806 0.0860  -0.0848 0.0035  230 THR A CA  
1484 C C   . THR A 218 ? 0.4111 0.6870 0.4866 0.0768  -0.0802 -0.0034 230 THR A C   
1485 O O   . THR A 218 ? 0.3855 0.6693 0.4742 0.0766  -0.0760 -0.0031 230 THR A O   
1486 C CB  . THR A 218 ? 0.4649 0.7388 0.5348 0.0982  -0.0781 0.0064  230 THR A CB  
1487 O OG1 . THR A 218 ? 0.5363 0.8165 0.6048 0.1072  -0.0829 0.0129  230 THR A OG1 
1488 C CG2 . THR A 218 ? 0.3910 0.6396 0.4433 0.0970  -0.0729 0.0020  230 THR A CG2 
1489 N N   . GLU A 219 ? 0.3560 0.6171 0.4167 0.0700  -0.0810 -0.0091 231 GLU A N   
1490 C CA  . GLU A 219 ? 0.3291 0.5802 0.3870 0.0626  -0.0765 -0.0159 231 GLU A CA  
1491 C C   . GLU A 219 ? 0.4024 0.6405 0.4565 0.0669  -0.0671 -0.0170 231 GLU A C   
1492 O O   . GLU A 219 ? 0.4086 0.6357 0.4517 0.0720  -0.0650 -0.0150 231 GLU A O   
1493 C CB  . GLU A 219 ? 0.3445 0.5847 0.3861 0.0565  -0.0800 -0.0208 231 GLU A CB  
1494 C CG  . GLU A 219 ? 0.3804 0.6303 0.4245 0.0503  -0.0904 -0.0217 231 GLU A CG  
1495 C CD  . GLU A 219 ? 0.4843 0.7225 0.5096 0.0456  -0.0945 -0.0272 231 GLU A CD  
1496 O OE1 . GLU A 219 ? 0.5391 0.7629 0.5507 0.0463  -0.0879 -0.0308 231 GLU A OE1 
1497 O OE2 . GLU A 219 ? 0.3493 0.5931 0.3735 0.0412  -0.1047 -0.0279 231 GLU A OE2 
1498 N N   . LEU A 220 ? 0.3575 0.5966 0.4207 0.0642  -0.0622 -0.0196 232 LEU A N   
1499 C CA  . LEU A 220 ? 0.3446 0.5721 0.4054 0.0672  -0.0543 -0.0211 232 LEU A CA  
1500 C C   . LEU A 220 ? 0.3796 0.6035 0.4434 0.0598  -0.0509 -0.0265 232 LEU A C   
1501 O O   . LEU A 220 ? 0.3848 0.6138 0.4518 0.0529  -0.0548 -0.0291 232 LEU A O   
1502 C CB  . LEU A 220 ? 0.3421 0.5769 0.4124 0.0762  -0.0513 -0.0166 232 LEU A CB  
1503 C CG  . LEU A 220 ? 0.4070 0.6451 0.4749 0.0862  -0.0540 -0.0108 232 LEU A CG  
1504 C CD1 . LEU A 220 ? 0.4014 0.6554 0.4831 0.0942  -0.0523 -0.0062 232 LEU A CD1 
1505 C CD2 . LEU A 220 ? 0.4331 0.6508 0.4854 0.0912  -0.0517 -0.0107 232 LEU A CD2 
1506 N N   . LEU A 221 ? 0.3211 0.5352 0.3833 0.0613  -0.0444 -0.0281 233 LEU A N   
1507 C CA  . LEU A 221 ? 0.3054 0.5169 0.3720 0.0561  -0.0406 -0.0322 233 LEU A CA  
1508 C C   . LEU A 221 ? 0.3637 0.5792 0.4397 0.0606  -0.0363 -0.0304 233 LEU A C   
1509 O O   . LEU A 221 ? 0.3526 0.5647 0.4258 0.0684  -0.0345 -0.0276 233 LEU A O   
1510 C CB  . LEU A 221 ? 0.3042 0.5007 0.3600 0.0535  -0.0367 -0.0356 233 LEU A CB  
1511 C CG  . LEU A 221 ? 0.3680 0.5602 0.4131 0.0494  -0.0389 -0.0379 233 LEU A CG  
1512 C CD1 . LEU A 221 ? 0.3678 0.5483 0.4040 0.0488  -0.0340 -0.0384 233 LEU A CD1 
1513 C CD2 . LEU A 221 ? 0.3829 0.5785 0.4304 0.0433  -0.0413 -0.0426 233 LEU A CD2 
1514 N N   . LEU A 222 ? 0.3292 0.5509 0.4150 0.0560  -0.0350 -0.0320 234 LEU A N   
1515 C CA  . LEU A 222 ? 0.3110 0.5353 0.4040 0.0594  -0.0301 -0.0307 234 LEU A CA  
1516 C C   . LEU A 222 ? 0.3670 0.5785 0.4552 0.0557  -0.0260 -0.0353 234 LEU A C   
1517 O O   . LEU A 222 ? 0.3754 0.5845 0.4635 0.0486  -0.0270 -0.0389 234 LEU A O   
1518 C CB  . LEU A 222 ? 0.2979 0.5400 0.4065 0.0569  -0.0314 -0.0274 234 LEU A CB  
1519 C CG  . LEU A 222 ? 0.3283 0.5747 0.4447 0.0594  -0.0258 -0.0257 234 LEU A CG  
1520 C CD1 . LEU A 222 ? 0.3217 0.5732 0.4383 0.0713  -0.0222 -0.0211 234 LEU A CD1 
1521 C CD2 . LEU A 222 ? 0.3285 0.5891 0.4596 0.0522  -0.0277 -0.0231 234 LEU A CD2 
1522 N N   . GLY A 223 ? 0.3303 0.5330 0.4138 0.0610  -0.0221 -0.0352 235 GLY A N   
1523 C CA  . GLY A 223 ? 0.3183 0.5112 0.3996 0.0583  -0.0184 -0.0384 235 GLY A CA  
1524 C C   . GLY A 223 ? 0.3463 0.5448 0.4351 0.0609  -0.0150 -0.0372 235 GLY A C   
1525 O O   . GLY A 223 ? 0.3336 0.5341 0.4218 0.0689  -0.0134 -0.0344 235 GLY A O   
1526 N N   . VAL A 224 ? 0.2922 0.4929 0.3872 0.0548  -0.0138 -0.0391 236 VAL A N   
1527 C CA  . VAL A 224 ? 0.2851 0.4896 0.3861 0.0563  -0.0101 -0.0377 236 VAL A CA  
1528 C C   . VAL A 224 ? 0.3424 0.5334 0.4372 0.0546  -0.0077 -0.0414 236 VAL A C   
1529 O O   . VAL A 224 ? 0.3409 0.5275 0.4354 0.0483  -0.0084 -0.0445 236 VAL A O   
1530 C CB  . VAL A 224 ? 0.3321 0.5498 0.4460 0.0506  -0.0109 -0.0356 236 VAL A CB  
1531 C CG1 . VAL A 224 ? 0.3263 0.5499 0.4464 0.0535  -0.0065 -0.0323 236 VAL A CG1 
1532 C CG2 . VAL A 224 ? 0.3258 0.5576 0.4470 0.0501  -0.0151 -0.0317 236 VAL A CG2 
1533 N N   . ASP A 225 ? 0.3097 0.4940 0.3988 0.0609  -0.0054 -0.0409 237 ASP A N   
1534 C CA  . ASP A 225 ? 0.3066 0.4790 0.3904 0.0594  -0.0042 -0.0436 237 ASP A CA  
1535 C C   . ASP A 225 ? 0.3742 0.5447 0.4554 0.0658  -0.0014 -0.0423 237 ASP A C   
1536 O O   . ASP A 225 ? 0.3666 0.5468 0.4511 0.0716  0.0007  -0.0390 237 ASP A O   
1537 C CB  . ASP A 225 ? 0.3276 0.4869 0.4016 0.0588  -0.0066 -0.0452 237 ASP A CB  
1538 C CG  . ASP A 225 ? 0.4229 0.5731 0.4869 0.0660  -0.0083 -0.0439 237 ASP A CG  
1539 O OD1 . ASP A 225 ? 0.4271 0.5803 0.4900 0.0737  -0.0069 -0.0424 237 ASP A OD1 
1540 O OD2 . ASP A 225 ? 0.5205 0.6600 0.5774 0.0643  -0.0110 -0.0442 237 ASP A OD2 
1541 N N   . ALA A 226 ? 0.3325 0.4909 0.4073 0.0650  -0.0015 -0.0446 238 ALA A N   
1542 C CA  . ALA A 226 ? 0.3282 0.4816 0.3977 0.0704  0.0003  -0.0444 238 ALA A CA  
1543 C C   . ALA A 226 ? 0.4202 0.5691 0.4797 0.0809  0.0004  -0.0433 238 ALA A C   
1544 O O   . ALA A 226 ? 0.4369 0.5880 0.4935 0.0879  0.0035  -0.0418 238 ALA A O   
1545 C CB  . ALA A 226 ? 0.3323 0.4725 0.3961 0.0667  -0.0019 -0.0471 238 ALA A CB  
1546 N N   . LEU A 227 ? 0.3906 0.5333 0.4443 0.0829  -0.0026 -0.0436 239 LEU A N   
1547 C CA  . LEU A 227 ? 0.3955 0.5283 0.4364 0.0934  -0.0037 -0.0434 239 LEU A CA  
1548 C C   . LEU A 227 ? 0.4690 0.6162 0.5144 0.1014  -0.0008 -0.0397 239 LEU A C   
1549 O O   . LEU A 227 ? 0.4975 0.6406 0.5334 0.1131  0.0006  -0.0389 239 LEU A O   
1550 C CB  . LEU A 227 ? 0.3959 0.5117 0.4270 0.0911  -0.0093 -0.0451 239 LEU A CB  
1551 C CG  . LEU A 227 ? 0.4409 0.5410 0.4659 0.0849  -0.0131 -0.0475 239 LEU A CG  
1552 C CD1 . LEU A 227 ? 0.4523 0.5367 0.4685 0.0825  -0.0189 -0.0475 239 LEU A CD1 
1553 C CD2 . LEU A 227 ? 0.4456 0.5355 0.4602 0.0911  -0.0132 -0.0494 239 LEU A CD2 
1554 N N   . GLY A 228 ? 0.4047 0.5682 0.4638 0.0957  -0.0005 -0.0374 240 GLY A N   
1555 C CA  . GLY A 228 ? 0.3927 0.5733 0.4595 0.1015  0.0014  -0.0329 240 GLY A CA  
1556 C C   . GLY A 228 ? 0.4363 0.6276 0.5133 0.0938  -0.0016 -0.0317 240 GLY A C   
1557 O O   . GLY A 228 ? 0.4263 0.6171 0.5081 0.0833  -0.0033 -0.0339 240 GLY A O   
1558 N N   . LEU A 229 ? 0.4053 0.6068 0.4853 0.0998  -0.0023 -0.0280 241 LEU A N   
1559 C CA  . LEU A 229 ? 0.3952 0.6059 0.4823 0.0942  -0.0063 -0.0265 241 LEU A CA  
1560 C C   . LEU A 229 ? 0.4493 0.6464 0.5244 0.0978  -0.0099 -0.0277 241 LEU A C   
1561 O O   . LEU A 229 ? 0.4605 0.6479 0.5251 0.1082  -0.0093 -0.0273 241 LEU A O   
1562 C CB  . LEU A 229 ? 0.3916 0.6264 0.4930 0.0975  -0.0053 -0.0202 241 LEU A CB  
1563 C CG  . LEU A 229 ? 0.4363 0.6873 0.5523 0.0925  -0.0024 -0.0170 241 LEU A CG  
1564 C CD1 . LEU A 229 ? 0.4313 0.7070 0.5617 0.0965  -0.0017 -0.0090 241 LEU A CD1 
1565 C CD2 . LEU A 229 ? 0.4624 0.7112 0.5837 0.0784  -0.0058 -0.0203 241 LEU A CD2 
1566 N N   . HIS A 230 ? 0.4057 0.6007 0.4808 0.0897  -0.0138 -0.0291 242 HIS A N   
1567 C CA  . HIS A 230 ? 0.4128 0.5944 0.4765 0.0912  -0.0174 -0.0295 242 HIS A CA  
1568 C C   . HIS A 230 ? 0.4470 0.6393 0.5154 0.0877  -0.0212 -0.0275 242 HIS A C   
1569 O O   . HIS A 230 ? 0.4466 0.6489 0.5234 0.0795  -0.0222 -0.0284 242 HIS A O   
1570 C CB  . HIS A 230 ? 0.4269 0.5911 0.4821 0.0844  -0.0180 -0.0332 242 HIS A CB  
1571 C CG  . HIS A 230 ? 0.4739 0.6291 0.5260 0.0855  -0.0153 -0.0356 242 HIS A CG  
1572 N ND1 . HIS A 230 ? 0.5102 0.6516 0.5512 0.0942  -0.0156 -0.0356 242 HIS A ND1 
1573 C CD2 . HIS A 230 ? 0.4852 0.6430 0.5431 0.0796  -0.0129 -0.0378 242 HIS A CD2 
1574 C CE1 . HIS A 230 ? 0.4983 0.6347 0.5384 0.0929  -0.0135 -0.0380 242 HIS A CE1 
1575 N NE2 . HIS A 230 ? 0.4881 0.6345 0.5387 0.0842  -0.0117 -0.0391 242 HIS A NE2 
1576 N N   . ILE A 231 ? 0.3821 0.5711 0.4439 0.0943  -0.0240 -0.0248 243 ILE A N   
1577 C CA  . ILE A 231 ? 0.3744 0.5721 0.4384 0.0920  -0.0284 -0.0225 243 ILE A CA  
1578 C C   . ILE A 231 ? 0.4421 0.6230 0.4930 0.0889  -0.0310 -0.0234 243 ILE A C   
1579 O O   . ILE A 231 ? 0.4553 0.6206 0.4955 0.0943  -0.0312 -0.0227 243 ILE A O   
1580 C CB  . ILE A 231 ? 0.4106 0.6219 0.4797 0.1021  -0.0298 -0.0170 243 ILE A CB  
1581 C CG1 . ILE A 231 ? 0.4007 0.6312 0.4843 0.1055  -0.0262 -0.0144 243 ILE A CG1 
1582 C CG2 . ILE A 231 ? 0.4127 0.6331 0.4837 0.0995  -0.0356 -0.0144 243 ILE A CG2 
1583 C CD1 . ILE A 231 ? 0.4016 0.6464 0.4992 0.0941  -0.0267 -0.0151 243 ILE A CD1 
1584 N N   . TYR A 232 ? 0.3935 0.5772 0.4445 0.0803  -0.0330 -0.0248 244 TYR A N   
1585 C CA  . TYR A 232 ? 0.3986 0.5695 0.4381 0.0765  -0.0344 -0.0248 244 TYR A CA  
1586 C C   . TYR A 232 ? 0.4799 0.6570 0.5164 0.0765  -0.0389 -0.0222 244 TYR A C   
1587 O O   . TYR A 232 ? 0.4685 0.6602 0.5128 0.0749  -0.0414 -0.0223 244 TYR A O   
1588 C CB  . TYR A 232 ? 0.3983 0.5662 0.4378 0.0674  -0.0318 -0.0287 244 TYR A CB  
1589 C CG  . TYR A 232 ? 0.3902 0.5518 0.4324 0.0661  -0.0278 -0.0313 244 TYR A CG  
1590 C CD1 . TYR A 232 ? 0.3977 0.5684 0.4499 0.0649  -0.0256 -0.0337 244 TYR A CD1 
1591 C CD2 . TYR A 232 ? 0.3990 0.5460 0.4339 0.0649  -0.0268 -0.0307 244 TYR A CD2 
1592 C CE1 . TYR A 232 ? 0.3977 0.5625 0.4515 0.0639  -0.0223 -0.0359 244 TYR A CE1 
1593 C CE2 . TYR A 232 ? 0.4037 0.5450 0.4408 0.0634  -0.0242 -0.0330 244 TYR A CE2 
1594 C CZ  . TYR A 232 ? 0.4654 0.6157 0.5115 0.0632  -0.0217 -0.0358 244 TYR A CZ  
1595 O OH  . TYR A 232 ? 0.5076 0.6524 0.5551 0.0619  -0.0194 -0.0378 244 TYR A OH  
1596 N N   . ASP A 233 ? 0.4800 0.6456 0.5051 0.0779  -0.0406 -0.0193 245 ASP A N   
1597 C CA  . ASP A 233 ? 0.4984 0.6666 0.5170 0.0756  -0.0442 -0.0173 245 ASP A CA  
1598 C C   . ASP A 233 ? 0.5513 0.7222 0.5694 0.0669  -0.0426 -0.0214 245 ASP A C   
1599 O O   . ASP A 233 ? 0.5443 0.7083 0.5620 0.0630  -0.0383 -0.0236 245 ASP A O   
1600 C CB  . ASP A 233 ? 0.5445 0.6978 0.5503 0.0778  -0.0454 -0.0127 245 ASP A CB  
1601 C CG  . ASP A 233 ? 0.7840 0.9344 0.7869 0.0875  -0.0490 -0.0082 245 ASP A CG  
1602 O OD1 . ASP A 233 ? 0.8066 0.9698 0.8132 0.0912  -0.0527 -0.0064 245 ASP A OD1 
1603 O OD2 . ASP A 233 ? 0.9133 1.0480 0.9099 0.0917  -0.0486 -0.0064 245 ASP A OD2 
1604 N N   . PRO A 234 ? 0.5126 0.6929 0.5300 0.0643  -0.0463 -0.0226 246 PRO A N   
1605 C CA  . PRO A 234 ? 0.5121 0.6932 0.5273 0.0574  -0.0449 -0.0276 246 PRO A CA  
1606 C C   . PRO A 234 ? 0.5970 0.7681 0.6013 0.0549  -0.0406 -0.0271 246 PRO A C   
1607 O O   . PRO A 234 ? 0.5879 0.7585 0.5912 0.0508  -0.0374 -0.0312 246 PRO A O   
1608 C CB  . PRO A 234 ? 0.5360 0.7257 0.5486 0.0564  -0.0516 -0.0282 246 PRO A CB  
1609 C CG  . PRO A 234 ? 0.5912 0.7833 0.6016 0.0623  -0.0558 -0.0224 246 PRO A CG  
1610 C CD  . PRO A 234 ? 0.5311 0.7207 0.5488 0.0677  -0.0527 -0.0196 246 PRO A CD  
1611 N N   . GLU A 235 ? 0.5928 0.7563 0.5893 0.0574  -0.0405 -0.0216 247 GLU A N   
1612 C CA  . GLU A 235 ? 0.6072 0.7633 0.5949 0.0545  -0.0364 -0.0188 247 GLU A CA  
1613 C C   . GLU A 235 ? 0.6806 0.8270 0.6716 0.0537  -0.0332 -0.0159 247 GLU A C   
1614 O O   . GLU A 235 ? 0.7004 0.8397 0.6851 0.0519  -0.0318 -0.0105 247 GLU A O   
1615 C CB  . GLU A 235 ? 0.6343 0.7887 0.6094 0.0563  -0.0391 -0.0136 247 GLU A CB  
1616 C CG  . GLU A 235 ? 0.7370 0.8993 0.7062 0.0567  -0.0433 -0.0167 247 GLU A CG  
1617 C CD  . GLU A 235 ? 0.9126 1.0788 0.8807 0.0532  -0.0413 -0.0236 247 GLU A CD  
1618 O OE1 . GLU A 235 ? 0.8510 1.0143 0.8141 0.0512  -0.0353 -0.0238 247 GLU A OE1 
1619 O OE2 . GLU A 235 ? 0.7089 0.8810 0.6806 0.0525  -0.0462 -0.0283 247 GLU A OE2 
1620 N N   . ASN A 236 ? 0.6081 0.7540 0.6087 0.0550  -0.0328 -0.0189 248 ASN A N   
1621 C CA  . ASN A 236 ? 0.5951 0.7313 0.5984 0.0536  -0.0306 -0.0179 248 ASN A CA  
1622 C C   . ASN A 236 ? 0.6166 0.7570 0.6301 0.0537  -0.0287 -0.0233 248 ASN A C   
1623 O O   . ASN A 236 ? 0.6210 0.7619 0.6384 0.0586  -0.0304 -0.0242 248 ASN A O   
1624 C CB  . ASN A 236 ? 0.6325 0.7559 0.6303 0.0578  -0.0341 -0.0130 248 ASN A CB  
1625 C CG  . ASN A 236 ? 0.9660 1.0759 0.9636 0.0552  -0.0336 -0.0114 248 ASN A CG  
1626 O OD1 . ASN A 236 ? 0.8784 0.9896 0.8803 0.0494  -0.0303 -0.0124 248 ASN A OD1 
1627 N ND2 . ASN A 236 ? 0.9032 0.9991 0.8949 0.0598  -0.0375 -0.0087 248 ASN A ND2 
1628 N N   . ARG A 237 ? 0.5483 0.6921 0.5656 0.0488  -0.0248 -0.0264 249 ARG A N   
1629 C CA  . ARG A 237 ? 0.5181 0.6653 0.5446 0.0480  -0.0227 -0.0311 249 ARG A CA  
1630 C C   . ARG A 237 ? 0.5652 0.7029 0.5934 0.0474  -0.0216 -0.0300 249 ARG A C   
1631 O O   . ARG A 237 ? 0.5560 0.6950 0.5907 0.0471  -0.0199 -0.0333 249 ARG A O   
1632 C CB  . ARG A 237 ? 0.4827 0.6364 0.5112 0.0440  -0.0196 -0.0350 249 ARG A CB  
1633 C CG  . ARG A 237 ? 0.5078 0.6684 0.5326 0.0442  -0.0219 -0.0372 249 ARG A CG  
1634 C CD  . ARG A 237 ? 0.4780 0.6424 0.5053 0.0415  -0.0202 -0.0428 249 ARG A CD  
1635 N NE  . ARG A 237 ? 0.5584 0.7271 0.5811 0.0414  -0.0246 -0.0453 249 ARG A NE  
1636 C CZ  . ARG A 237 ? 0.6910 0.8623 0.7167 0.0392  -0.0266 -0.0502 249 ARG A CZ  
1637 N NH1 . ARG A 237 ? 0.5334 0.7040 0.5669 0.0374  -0.0239 -0.0529 249 ARG A NH1 
1638 N NH2 . ARG A 237 ? 0.5776 0.7513 0.5981 0.0384  -0.0322 -0.0521 249 ARG A NH2 
1639 N N   . LEU A 238 ? 0.5258 0.6529 0.5476 0.0468  -0.0234 -0.0251 250 LEU A N   
1640 C CA  . LEU A 238 ? 0.5169 0.6328 0.5388 0.0447  -0.0241 -0.0236 250 LEU A CA  
1641 C C   . LEU A 238 ? 0.5664 0.6713 0.5843 0.0511  -0.0277 -0.0241 250 LEU A C   
1642 O O   . LEU A 238 ? 0.5652 0.6653 0.5852 0.0519  -0.0276 -0.0267 250 LEU A O   
1643 C CB  . LEU A 238 ? 0.5236 0.6330 0.5411 0.0393  -0.0248 -0.0172 250 LEU A CB  
1644 C CG  . LEU A 238 ? 0.5745 0.6950 0.5947 0.0342  -0.0201 -0.0154 250 LEU A CG  
1645 C CD1 . LEU A 238 ? 0.5795 0.6952 0.5961 0.0292  -0.0208 -0.0071 250 LEU A CD1 
1646 C CD2 . LEU A 238 ? 0.5894 0.7167 0.6184 0.0316  -0.0163 -0.0192 250 LEU A CD2 
1647 N N   . THR A 239 ? 0.5310 0.6317 0.5423 0.0565  -0.0308 -0.0217 251 THR A N   
1648 C CA  . THR A 239 ? 0.5392 0.6278 0.5442 0.0646  -0.0341 -0.0218 251 THR A CA  
1649 C C   . THR A 239 ? 0.5704 0.6709 0.5786 0.0728  -0.0335 -0.0232 251 THR A C   
1650 O O   . THR A 239 ? 0.5514 0.6580 0.5582 0.0743  -0.0350 -0.0207 251 THR A O   
1651 C CB  . THR A 239 ? 0.6943 0.7646 0.6879 0.0646  -0.0391 -0.0165 251 THR A CB  
1652 O OG1 . THR A 239 ? 0.7239 0.7866 0.7175 0.0553  -0.0398 -0.0139 251 THR A OG1 
1653 C CG2 . THR A 239 ? 0.6803 0.7339 0.6644 0.0740  -0.0430 -0.0173 251 THR A CG2 
1654 N N   . PRO A 240 ? 0.5229 0.6282 0.5359 0.0781  -0.0315 -0.0265 252 PRO A N   
1655 C CA  . PRO A 240 ? 0.5183 0.6371 0.5362 0.0860  -0.0310 -0.0262 252 PRO A CA  
1656 C C   . PRO A 240 ? 0.5894 0.6995 0.5983 0.0960  -0.0342 -0.0230 252 PRO A C   
1657 O O   . PRO A 240 ? 0.6069 0.6969 0.6043 0.0992  -0.0367 -0.0224 252 PRO A O   
1658 C CB  . PRO A 240 ? 0.5247 0.6493 0.5490 0.0891  -0.0274 -0.0292 252 PRO A CB  
1659 C CG  . PRO A 240 ? 0.5800 0.6875 0.5973 0.0866  -0.0277 -0.0312 252 PRO A CG  
1660 C CD  . PRO A 240 ? 0.5278 0.6281 0.5424 0.0771  -0.0296 -0.0298 252 PRO A CD  
1661 N N   . LYS A 241 ? 0.5434 0.6680 0.5571 0.1006  -0.0350 -0.0206 253 LYS A N   
1662 C CA  . LYS A 241 ? 0.5568 0.6783 0.5646 0.1123  -0.0375 -0.0172 253 LYS A CA  
1663 C C   . LYS A 241 ? 0.5927 0.7151 0.6010 0.1237  -0.0346 -0.0182 253 LYS A C   
1664 O O   . LYS A 241 ? 0.6079 0.7147 0.6044 0.1341  -0.0362 -0.0173 253 LYS A O   
1665 C CB  . LYS A 241 ? 0.5941 0.7352 0.6099 0.1128  -0.0393 -0.0140 253 LYS A CB  
1666 C CG  . LYS A 241 ? 0.8567 0.9915 0.8645 0.1096  -0.0436 -0.0107 253 LYS A CG  
1667 C CD  . LYS A 241 ? 1.0204 1.1760 1.0364 0.1104  -0.0461 -0.0081 253 LYS A CD  
1668 C CE  . LYS A 241 ? 1.1884 1.3471 1.2028 0.1232  -0.0488 -0.0034 253 LYS A CE  
1669 N NZ  . LYS A 241 ? 1.2812 1.4635 1.3066 0.1233  -0.0518 -0.0005 253 LYS A NZ  
1670 N N   . ILE A 242 ? 0.5182 0.6589 0.5395 0.1223  -0.0304 -0.0197 254 ILE A N   
1671 C CA  . ILE A 242 ? 0.5047 0.6510 0.5283 0.1326  -0.0263 -0.0199 254 ILE A CA  
1672 C C   . ILE A 242 ? 0.5183 0.6667 0.5475 0.1252  -0.0226 -0.0236 254 ILE A C   
1673 O O   . ILE A 242 ? 0.4922 0.6496 0.5305 0.1136  -0.0224 -0.0248 254 ILE A O   
1674 C CB  . ILE A 242 ? 0.5302 0.7028 0.5672 0.1401  -0.0246 -0.0150 254 ILE A CB  
1675 C CG1 . ILE A 242 ? 0.5356 0.7116 0.5712 0.1438  -0.0293 -0.0108 254 ILE A CG1 
1676 C CG2 . ILE A 242 ? 0.5463 0.7222 0.5818 0.1545  -0.0198 -0.0138 254 ILE A CG2 
1677 C CD1 . ILE A 242 ? 0.5895 0.7956 0.6430 0.1434  -0.0300 -0.0059 254 ILE A CD1 
1678 N N   . SER A 243 ? 0.4823 0.6211 0.5042 0.1326  -0.0199 -0.0255 255 SER A N   
1679 C CA  . SER A 243 ? 0.4655 0.6082 0.4926 0.1282  -0.0160 -0.0282 255 SER A CA  
1680 C C   . SER A 243 ? 0.5375 0.6919 0.5674 0.1403  -0.0107 -0.0262 255 SER A C   
1681 O O   . SER A 243 ? 0.5589 0.7054 0.5778 0.1542  -0.0102 -0.0253 255 SER A O   
1682 C CB  . SER A 243 ? 0.4968 0.6149 0.5109 0.1240  -0.0182 -0.0325 255 SER A CB  
1683 O OG  . SER A 243 ? 0.5925 0.7056 0.6081 0.1114  -0.0215 -0.0332 255 SER A OG  
1684 N N   . PHE A 244 ? 0.4737 0.6474 0.5180 0.1354  -0.0065 -0.0250 256 PHE A N   
1685 C CA  . PHE A 244 ? 0.4633 0.6503 0.5118 0.1451  -0.0004 -0.0221 256 PHE A CA  
1686 C C   . PHE A 244 ? 0.4988 0.6790 0.5453 0.1397  0.0021  -0.0256 256 PHE A C   
1687 O O   . PHE A 244 ? 0.4778 0.6700 0.5377 0.1285  0.0030  -0.0251 256 PHE A O   
1688 C CB  . PHE A 244 ? 0.4691 0.6875 0.5385 0.1438  0.0019  -0.0155 256 PHE A CB  
1689 C CG  . PHE A 244 ? 0.4864 0.7139 0.5598 0.1478  -0.0015 -0.0116 256 PHE A CG  
1690 C CD1 . PHE A 244 ? 0.5291 0.7627 0.5992 0.1642  0.0010  -0.0073 256 PHE A CD1 
1691 C CD2 . PHE A 244 ? 0.4997 0.7305 0.5797 0.1361  -0.0071 -0.0119 256 PHE A CD2 
1692 C CE1 . PHE A 244 ? 0.5375 0.7804 0.6118 0.1683  -0.0025 -0.0032 256 PHE A CE1 
1693 C CE2 . PHE A 244 ? 0.5363 0.7758 0.6194 0.1399  -0.0108 -0.0081 256 PHE A CE2 
1694 C CZ  . PHE A 244 ? 0.5187 0.7646 0.5996 0.1557  -0.0087 -0.0035 256 PHE A CZ  
1695 N N   . PRO A 245 ? 0.4520 0.6108 0.4807 0.1469  0.0022  -0.0294 257 PRO A N   
1696 C CA  . PRO A 245 ? 0.4389 0.5922 0.4652 0.1428  0.0043  -0.0322 257 PRO A CA  
1697 C C   . PRO A 245 ? 0.4882 0.6647 0.5266 0.1465  0.0115  -0.0274 257 PRO A C   
1698 O O   . PRO A 245 ? 0.4939 0.6850 0.5355 0.1579  0.0155  -0.0225 257 PRO A O   
1699 C CB  . PRO A 245 ? 0.4751 0.6009 0.4780 0.1523  0.0018  -0.0366 257 PRO A CB  
1700 C CG  . PRO A 245 ? 0.5346 0.6465 0.5283 0.1556  -0.0035 -0.0371 257 PRO A CG  
1701 C CD  . PRO A 245 ? 0.4804 0.6165 0.4887 0.1587  -0.0007 -0.0316 257 PRO A CD  
1702 N N   . TRP A 246 ? 0.4324 0.6131 0.4780 0.1372  0.0131  -0.0280 258 TRP A N   
1703 C CA  . TRP A 246 ? 0.4242 0.6276 0.4835 0.1377  0.0194  -0.0224 258 TRP A CA  
1704 C C   . TRP A 246 ? 0.5140 0.7212 0.5641 0.1547  0.0259  -0.0192 258 TRP A C   
1705 O O   . TRP A 246 ? 0.5128 0.7448 0.5760 0.1591  0.0316  -0.0116 258 TRP A O   
1706 C CB  . TRP A 246 ? 0.3894 0.5912 0.4541 0.1261  0.0195  -0.0241 258 TRP A CB  
1707 C CG  . TRP A 246 ? 0.3891 0.5933 0.4658 0.1108  0.0152  -0.0257 258 TRP A CG  
1708 C CD1 . TRP A 246 ? 0.4263 0.6153 0.4989 0.1016  0.0113  -0.0311 258 TRP A CD1 
1709 C CD2 . TRP A 246 ? 0.3769 0.6001 0.4710 0.1036  0.0142  -0.0217 258 TRP A CD2 
1710 N NE1 . TRP A 246 ? 0.4116 0.6080 0.4963 0.0904  0.0087  -0.0312 258 TRP A NE1 
1711 C CE2 . TRP A 246 ? 0.4209 0.6368 0.5180 0.0910  0.0098  -0.0259 258 TRP A CE2 
1712 C CE3 . TRP A 246 ? 0.3892 0.6353 0.4967 0.1066  0.0162  -0.0147 258 TRP A CE3 
1713 C CZ2 . TRP A 246 ? 0.4039 0.6315 0.5140 0.0819  0.0068  -0.0244 258 TRP A CZ2 
1714 C CZ3 . TRP A 246 ? 0.3985 0.6572 0.5208 0.0960  0.0124  -0.0125 258 TRP A CZ3 
1715 C CH2 . TRP A 246 ? 0.4020 0.6499 0.5241 0.0840  0.0076  -0.0179 258 TRP A CH2 
1716 N N   . ASN A 247 ? 0.4925 0.6753 0.5196 0.1642  0.0246  -0.0245 259 ASN A N   
1717 C CA  . ASN A 247 ? 0.5121 0.6923 0.5242 0.1824  0.0300  -0.0232 259 ASN A CA  
1718 C C   . ASN A 247 ? 0.6174 0.8062 0.6284 0.1965  0.0322  -0.0195 259 ASN A C   
1719 O O   . ASN A 247 ? 0.6446 0.8416 0.6491 0.2129  0.0390  -0.0157 259 ASN A O   
1720 C CB  . ASN A 247 ? 0.4819 0.6290 0.4675 0.1870  0.0256  -0.0312 259 ASN A CB  
1721 C CG  . ASN A 247 ? 0.7490 0.8700 0.7216 0.1847  0.0167  -0.0371 259 ASN A CG  
1722 O OD1 . ASN A 247 ? 0.6420 0.7632 0.6251 0.1715  0.0119  -0.0378 259 ASN A OD1 
1723 N ND2 . ASN A 247 ? 0.7942 0.8904 0.7420 0.1974  0.0140  -0.0414 259 ASN A ND2 
1724 N N   . GLU A 248 ? 0.5710 0.7585 0.5877 0.1911  0.0266  -0.0200 260 GLU A N   
1725 C CA  . GLU A 248 ? 0.5785 0.7727 0.5945 0.2034  0.0272  -0.0166 260 GLU A CA  
1726 C C   . GLU A 248 ? 0.5899 0.8192 0.6333 0.1983  0.0296  -0.0079 260 GLU A C   
1727 O O   . GLU A 248 ? 0.5984 0.8364 0.6451 0.2059  0.0289  -0.0044 260 GLU A O   
1728 C CB  . GLU A 248 ? 0.6115 0.7788 0.6137 0.2013  0.0185  -0.0224 260 GLU A CB  
1729 C CG  . GLU A 248 ? 0.8157 0.9493 0.7886 0.2128  0.0157  -0.0289 260 GLU A CG  
1730 C CD  . GLU A 248 ? 1.1718 1.2758 1.1317 0.2057  0.0060  -0.0345 260 GLU A CD  
1731 O OE1 . GLU A 248 ? 1.1139 1.2195 1.0779 0.2051  0.0027  -0.0325 260 GLU A OE1 
1732 O OE2 . GLU A 248 ? 1.1514 1.2305 1.0967 0.2009  0.0013  -0.0403 260 GLU A OE2 
1733 N N   . ILE A 249 ? 0.5041 0.7527 0.5664 0.1855  0.0316  -0.0043 261 ILE A N   
1734 C CA  . ILE A 249 ? 0.4732 0.7543 0.5616 0.1790  0.0327  0.0042  261 ILE A CA  
1735 C C   . ILE A 249 ? 0.5289 0.8359 0.6276 0.1875  0.0420  0.0132  261 ILE A C   
1736 O O   . ILE A 249 ? 0.5153 0.8210 0.6128 0.1842  0.0457  0.0131  261 ILE A O   
1737 C CB  . ILE A 249 ? 0.4832 0.7660 0.5855 0.1575  0.0270  0.0022  261 ILE A CB  
1738 C CG1 . ILE A 249 ? 0.4828 0.7447 0.5763 0.1504  0.0188  -0.0049 261 ILE A CG1 
1739 C CG2 . ILE A 249 ? 0.4679 0.7829 0.5964 0.1496  0.0273  0.0113  261 ILE A CG2 
1740 C CD1 . ILE A 249 ? 0.5149 0.7689 0.6132 0.1323  0.0140  -0.0096 261 ILE A CD1 
1741 N N   . ARG A 250 ? 0.5074 0.8388 0.6165 0.1989  0.0459  0.0218  262 ARG A N   
1742 C CA  . ARG A 250 ? 0.5080 0.8700 0.6308 0.2070  0.0553  0.0329  262 ARG A CA  
1743 C C   . ARG A 250 ? 0.5340 0.9196 0.6835 0.1880  0.0540  0.0398  262 ARG A C   
1744 O O   . ARG A 250 ? 0.5360 0.9310 0.6904 0.1862  0.0598  0.0442  262 ARG A O   
1745 C CB  . ARG A 250 ? 0.5234 0.9070 0.6518 0.2242  0.0593  0.0410  262 ARG A CB  
1746 C CG  . ARG A 250 ? 0.6976 1.1126 0.8367 0.2368  0.0708  0.0530  262 ARG A CG  
1747 C CD  . ARG A 250 ? 0.8924 1.3284 1.0362 0.2558  0.0751  0.0609  262 ARG A CD  
1748 N NE  . ARG A 250 ? 1.1383 1.6195 1.3153 0.2512  0.0782  0.0762  262 ARG A NE  
1749 C CZ  . ARG A 250 ? 1.4319 1.9432 1.6206 0.2604  0.0891  0.0882  262 ARG A CZ  
1750 N NH1 . ARG A 250 ? 1.3590 1.8590 1.5265 0.2761  0.0984  0.0860  262 ARG A NH1 
1751 N NH2 . ARG A 250 ? 1.2534 1.8064 1.4746 0.2539  0.0904  0.1030  262 ARG A NH2 
1752 N N   . ASN A 251 ? 0.4533 0.8467 0.6184 0.1742  0.0459  0.0406  263 ASN A N   
1753 C CA  . ASN A 251 ? 0.4188 0.8278 0.6062 0.1545  0.0418  0.0451  263 ASN A CA  
1754 C C   . ASN A 251 ? 0.4243 0.8258 0.6162 0.1409  0.0309  0.0402  263 ASN A C   
1755 O O   . ASN A 251 ? 0.4167 0.8101 0.6001 0.1473  0.0274  0.0367  263 ASN A O   
1756 C CB  . ASN A 251 ? 0.4096 0.8585 0.6227 0.1556  0.0467  0.0604  263 ASN A CB  
1757 C CG  . ASN A 251 ? 0.6458 1.1183 0.8709 0.1645  0.0460  0.0681  263 ASN A CG  
1758 O OD1 . ASN A 251 ? 0.6606 1.1380 0.8962 0.1546  0.0371  0.0682  263 ASN A OD1 
1759 N ND2 . ASN A 251 ? 0.4971 0.9866 0.7215 0.1837  0.0556  0.0756  263 ASN A ND2 
1760 N N   . ILE A 252 ? 0.3580 0.7607 0.5614 0.1225  0.0256  0.0398  264 ILE A N   
1761 C CA  . ILE A 252 ? 0.3509 0.7532 0.5625 0.1084  0.0154  0.0376  264 ILE A CA  
1762 C C   . ILE A 252 ? 0.4020 0.8350 0.6405 0.0982  0.0131  0.0492  264 ILE A C   
1763 O O   . ILE A 252 ? 0.3999 0.8438 0.6479 0.0949  0.0178  0.0553  264 ILE A O   
1764 C CB  . ILE A 252 ? 0.3816 0.7547 0.5803 0.0963  0.0103  0.0261  264 ILE A CB  
1765 C CG1 . ILE A 252 ? 0.3975 0.7434 0.5725 0.1052  0.0108  0.0164  264 ILE A CG1 
1766 C CG2 . ILE A 252 ? 0.3736 0.7475 0.5811 0.0807  0.0002  0.0244  264 ILE A CG2 
1767 C CD1 . ILE A 252 ? 0.5413 0.8638 0.7028 0.1015  0.0122  0.0085  264 ILE A CD1 
1768 N N   . SER A 253 ? 0.3505 0.7979 0.6012 0.0935  0.0055  0.0530  265 SER A N   
1769 C CA  . SER A 253 ? 0.3396 0.8135 0.6159 0.0806  -0.0001 0.0634  265 SER A CA  
1770 C C   . SER A 253 ? 0.3880 0.8523 0.6649 0.0659  -0.0132 0.0579  265 SER A C   
1771 O O   . SER A 253 ? 0.3925 0.8386 0.6535 0.0694  -0.0168 0.0492  265 SER A O   
1772 C CB  . SER A 253 ? 0.3698 0.8793 0.6645 0.0910  0.0037  0.0773  265 SER A CB  
1773 O OG  . SER A 253 ? 0.4386 0.9462 0.7236 0.1055  0.0041  0.0750  265 SER A OG  
1774 N N   . TYR A 254 ? 0.3247 0.8001 0.6188 0.0494  -0.0206 0.0632  266 TYR A N   
1775 C CA  . TYR A 254 ? 0.3180 0.7832 0.6116 0.0348  -0.0338 0.0580  266 TYR A CA  
1776 C C   . TYR A 254 ? 0.3962 0.8893 0.7157 0.0227  -0.0426 0.0700  266 TYR A C   
1777 O O   . TYR A 254 ? 0.4016 0.9085 0.7373 0.0148  -0.0413 0.0787  266 TYR A O   
1778 C CB  . TYR A 254 ? 0.3139 0.7485 0.5929 0.0241  -0.0366 0.0468  266 TYR A CB  
1779 C CG  . TYR A 254 ? 0.3195 0.7437 0.5970 0.0095  -0.0502 0.0418  266 TYR A CG  
1780 C CD1 . TYR A 254 ? 0.3396 0.7478 0.6007 0.0119  -0.0553 0.0328  266 TYR A CD1 
1781 C CD2 . TYR A 254 ? 0.3287 0.7596 0.6209 -0.0064 -0.0587 0.0470  266 TYR A CD2 
1782 C CE1 . TYR A 254 ? 0.3506 0.7490 0.6079 -0.0001 -0.0679 0.0281  266 TYR A CE1 
1783 C CE2 . TYR A 254 ? 0.3504 0.7700 0.6391 -0.0191 -0.0724 0.0421  266 TYR A CE2 
1784 C CZ  . TYR A 254 ? 0.4390 0.8424 0.7094 -0.0153 -0.0767 0.0323  266 TYR A CZ  
1785 O OH  . TYR A 254 ? 0.4501 0.8409 0.7140 -0.0267 -0.0901 0.0268  266 TYR A OH  
1786 N N   . SER A 255 ? 0.3702 0.8706 0.6934 0.0202  -0.0523 0.0709  267 SER A N   
1787 C CA  . SER A 255 ? 0.3801 0.9054 0.7271 0.0072  -0.0635 0.0817  267 SER A CA  
1788 C C   . SER A 255 ? 0.4557 0.9698 0.7944 0.0002  -0.0774 0.0750  267 SER A C   
1789 O O   . SER A 255 ? 0.4500 0.9585 0.7759 0.0114  -0.0764 0.0702  267 SER A O   
1790 C CB  . SER A 255 ? 0.4155 0.9809 0.7860 0.0169  -0.0581 0.0977  267 SER A CB  
1791 O OG  . SER A 255 ? 0.5188 1.1107 0.9148 0.0033  -0.0697 0.1095  267 SER A OG  
1792 N N   . ASP A 256 ? 0.4365 0.9447 0.7803 -0.0183 -0.0906 0.0743  268 ASP A N   
1793 C CA  . ASP A 256 ? 0.4471 0.9497 0.7867 -0.0273 -0.1062 0.0706  268 ASP A CA  
1794 C C   . ASP A 256 ? 0.4684 0.9439 0.7791 -0.0176 -0.1050 0.0566  268 ASP A C   
1795 O O   . ASP A 256 ? 0.4737 0.9572 0.7822 -0.0104 -0.1082 0.0577  268 ASP A O   
1796 C CB  . ASP A 256 ? 0.4731 1.0138 0.8384 -0.0278 -0.1129 0.0854  268 ASP A CB  
1797 C CG  . ASP A 256 ? 0.6900 1.2296 1.0564 -0.0408 -0.1317 0.0845  268 ASP A CG  
1798 O OD1 . ASP A 256 ? 0.7160 1.2264 1.0658 -0.0527 -0.1412 0.0737  268 ASP A OD1 
1799 O OD2 . ASP A 256 ? 0.8059 1.3739 1.1891 -0.0386 -0.1374 0.0947  268 ASP A OD2 
1800 N N   . LYS A 257 ? 0.3926 0.8374 0.6821 -0.0169 -0.0994 0.0446  269 LYS A N   
1801 C CA  . LYS A 257 ? 0.3810 0.7971 0.6427 -0.0102 -0.0973 0.0312  269 LYS A CA  
1802 C C   . LYS A 257 ? 0.3903 0.8088 0.6444 0.0080  -0.0858 0.0311  269 LYS A C   
1803 O O   . LYS A 257 ? 0.3847 0.7806 0.6170 0.0137  -0.0834 0.0214  269 LYS A O   
1804 C CB  . LYS A 257 ? 0.4259 0.8311 0.6765 -0.0177 -0.1115 0.0255  269 LYS A CB  
1805 C CG  . LYS A 257 ? 0.6873 1.0728 0.9313 -0.0330 -0.1212 0.0190  269 LYS A CG  
1806 C CD  . LYS A 257 ? 0.8900 1.2626 1.1196 -0.0395 -0.1355 0.0127  269 LYS A CD  
1807 C CE  . LYS A 257 ? 1.0961 1.4561 1.3255 -0.0561 -0.1484 0.0099  269 LYS A CE  
1808 N NZ  . LYS A 257 ? 1.2720 1.6136 1.4812 -0.0609 -0.1618 0.0014  269 LYS A NZ  
1809 N N   . GLU A 258 ? 0.3171 0.7616 0.5882 0.0174  -0.0785 0.0420  270 GLU A N   
1810 C CA  . GLU A 258 ? 0.3042 0.7493 0.5670 0.0355  -0.0683 0.0420  270 GLU A CA  
1811 C C   . GLU A 258 ? 0.3438 0.7850 0.6046 0.0435  -0.0549 0.0419  270 GLU A C   
1812 O O   . GLU A 258 ? 0.3424 0.8020 0.6206 0.0409  -0.0513 0.0503  270 GLU A O   
1813 C CB  . GLU A 258 ? 0.3180 0.7933 0.5971 0.0440  -0.0697 0.0535  270 GLU A CB  
1814 C CG  . GLU A 258 ? 0.4397 0.9085 0.7045 0.0614  -0.0644 0.0513  270 GLU A CG  
1815 C CD  . GLU A 258 ? 0.7805 1.2290 1.0261 0.0605  -0.0719 0.0430  270 GLU A CD  
1816 O OE1 . GLU A 258 ? 0.5569 0.9995 0.8007 0.0470  -0.0828 0.0396  270 GLU A OE1 
1817 O OE2 . GLU A 258 ? 0.8150 1.2528 1.0462 0.0737  -0.0672 0.0404  270 GLU A OE2 
1818 N N   . PHE A 259 ? 0.2757 0.6926 0.5149 0.0526  -0.0481 0.0329  271 PHE A N   
1819 C CA  . PHE A 259 ? 0.2623 0.6725 0.4954 0.0623  -0.0362 0.0318  271 PHE A CA  
1820 C C   . PHE A 259 ? 0.3437 0.7623 0.5739 0.0805  -0.0296 0.0360  271 PHE A C   
1821 O O   . PHE A 259 ? 0.3380 0.7528 0.5605 0.0864  -0.0333 0.0346  271 PHE A O   
1822 C CB  . PHE A 259 ? 0.2706 0.6483 0.4820 0.0605  -0.0339 0.0196  271 PHE A CB  
1823 C CG  . PHE A 259 ? 0.2817 0.6465 0.4918 0.0455  -0.0385 0.0140  271 PHE A CG  
1824 C CD1 . PHE A 259 ? 0.3174 0.6746 0.5235 0.0354  -0.0486 0.0096  271 PHE A CD1 
1825 C CD2 . PHE A 259 ? 0.2903 0.6477 0.5001 0.0428  -0.0328 0.0124  271 PHE A CD2 
1826 C CE1 . PHE A 259 ? 0.3211 0.6640 0.5236 0.0232  -0.0529 0.0038  271 PHE A CE1 
1827 C CE2 . PHE A 259 ? 0.3201 0.6638 0.5274 0.0302  -0.0372 0.0070  271 PHE A CE2 
1828 C CZ  . PHE A 259 ? 0.3039 0.6399 0.5072 0.0209  -0.0470 0.0026  271 PHE A CZ  
1829 N N   . THR A 260 ? 0.3181 0.7463 0.5526 0.0902  -0.0198 0.0409  272 THR A N   
1830 C CA  . THR A 260 ? 0.3308 0.7635 0.5593 0.1096  -0.0124 0.0441  272 THR A CA  
1831 C C   . THR A 260 ? 0.4242 0.8359 0.6354 0.1175  -0.0036 0.0379  272 THR A C   
1832 O O   . THR A 260 ? 0.4243 0.8410 0.6415 0.1142  0.0015  0.0401  272 THR A O   
1833 C CB  . THR A 260 ? 0.3694 0.8400 0.6212 0.1164  -0.0094 0.0584  272 THR A CB  
1834 O OG1 . THR A 260 ? 0.3158 0.8061 0.5857 0.1050  -0.0196 0.0643  272 THR A OG1 
1835 C CG2 . THR A 260 ? 0.3388 0.8149 0.5837 0.1384  -0.0026 0.0618  272 THR A CG2 
1836 N N   . ILE A 261 ? 0.4184 0.8053 0.6078 0.1267  -0.0027 0.0302  273 ILE A N   
1837 C CA  . ILE A 261 ? 0.4387 0.8048 0.6099 0.1364  0.0046  0.0247  273 ILE A CA  
1838 C C   . ILE A 261 ? 0.5205 0.8961 0.6882 0.1569  0.0111  0.0302  273 ILE A C   
1839 O O   . ILE A 261 ? 0.5234 0.8953 0.6843 0.1660  0.0085  0.0302  273 ILE A O   
1840 C CB  . ILE A 261 ? 0.4891 0.8207 0.6382 0.1332  0.0010  0.0134  273 ILE A CB  
1841 C CG1 . ILE A 261 ? 0.4872 0.8115 0.6394 0.1148  -0.0058 0.0085  273 ILE A CG1 
1842 C CG2 . ILE A 261 ? 0.5037 0.8146 0.6359 0.1404  0.0070  0.0081  273 ILE A CG2 
1843 C CD1 . ILE A 261 ? 0.6203 0.9185 0.7548 0.1121  -0.0104 0.0004  273 ILE A CD1 
1844 N N   . LYS A 262 ? 0.4987 0.8868 0.6706 0.1647  0.0197  0.0352  274 LYS A N   
1845 C CA  . LYS A 262 ? 0.5138 0.9094 0.6794 0.1864  0.0274  0.0400  274 LYS A CA  
1846 C C   . LYS A 262 ? 0.5764 0.9393 0.7142 0.1962  0.0313  0.0307  274 LYS A C   
1847 O O   . LYS A 262 ? 0.5570 0.9140 0.6914 0.1924  0.0352  0.0286  274 LYS A O   
1848 C CB  . LYS A 262 ? 0.5431 0.9755 0.7302 0.1910  0.0351  0.0527  274 LYS A CB  
1849 C CG  . LYS A 262 ? 0.7645 1.2308 0.9801 0.1822  0.0302  0.0633  274 LYS A CG  
1850 C CD  . LYS A 262 ? 0.8494 1.3548 1.0864 0.1903  0.0384  0.0780  274 LYS A CD  
1851 C CE  . LYS A 262 ? 0.8724 1.4105 1.1404 0.1749  0.0320  0.0887  274 LYS A CE  
1852 N NZ  . LYS A 262 ? 0.9197 1.4965 1.2106 0.1797  0.0404  0.1042  274 LYS A NZ  
1853 N N   . PRO A 263 ? 0.5659 0.9053 0.6831 0.2076  0.0289  0.0251  275 PRO A N   
1854 C CA  . PRO A 263 ? 0.5854 0.8918 0.6753 0.2163  0.0308  0.0164  275 PRO A CA  
1855 C C   . PRO A 263 ? 0.6675 0.9807 0.7497 0.2354  0.0407  0.0201  275 PRO A C   
1856 O O   . PRO A 263 ? 0.6623 1.0044 0.7577 0.2466  0.0464  0.0297  275 PRO A O   
1857 C CB  . PRO A 263 ? 0.6217 0.9043 0.6944 0.2231  0.0246  0.0115  275 PRO A CB  
1858 C CG  . PRO A 263 ? 0.6645 0.9651 0.7553 0.2138  0.0188  0.0160  275 PRO A CG  
1859 C CD  . PRO A 263 ? 0.5927 0.9327 0.7098 0.2122  0.0233  0.0264  275 PRO A CD  
1860 N N   . LEU A 264 ? 0.6507 0.9378 0.7113 0.2393  0.0425  0.0128  276 LEU A N   
1861 C CA  . LEU A 264 ? 0.6700 0.9570 0.7169 0.2583  0.0515  0.0143  276 LEU A CA  
1862 C C   . LEU A 264 ? 0.7646 1.0427 0.7943 0.2814  0.0531  0.0144  276 LEU A C   
1863 O O   . LEU A 264 ? 0.7750 1.0741 0.8072 0.2992  0.0620  0.0218  276 LEU A O   
1864 C CB  . LEU A 264 ? 0.6770 0.9337 0.7028 0.2548  0.0503  0.0052  276 LEU A CB  
1865 C CG  . LEU A 264 ? 0.7476 1.0110 0.7663 0.2658  0.0597  0.0078  276 LEU A CG  
1866 C CD1 . LEU A 264 ? 0.7263 1.0209 0.7716 0.2523  0.0643  0.0160  276 LEU A CD1 
1867 C CD2 . LEU A 264 ? 0.8023 1.0281 0.7927 0.2667  0.0563  -0.0028 276 LEU A CD2 
1868 N N   . ASP A 265 ? 0.7384 0.9857 0.7510 0.2814  0.0445  0.0068  277 ASP A N   
1869 C CA  . ASP A 265 ? 0.7709 1.0051 0.7667 0.3012  0.0437  0.0062  277 ASP A CA  
1870 C C   . ASP A 265 ? 0.8373 1.1045 0.8567 0.3036  0.0443  0.0160  277 ASP A C   
1871 O O   . ASP A 265 ? 0.8154 1.0925 0.8527 0.2859  0.0381  0.0175  277 ASP A O   
1872 C CB  . ASP A 265 ? 0.8095 1.0001 0.7817 0.2964  0.0331  -0.0041 277 ASP A CB  
1873 C CG  . ASP A 265 ? 1.0098 1.1781 0.9604 0.3154  0.0302  -0.0060 277 ASP A CG  
1874 O OD1 . ASP A 265 ? 1.0390 1.2205 0.9863 0.3373  0.0375  -0.0010 277 ASP A OD1 
1875 O OD2 . ASP A 265 ? 1.1088 1.2460 1.0452 0.3088  0.0208  -0.0121 277 ASP A OD2 
1876 N N   . LYS A 266 ? 0.8290 1.1131 0.8476 0.3264  0.0517  0.0228  278 LYS A N   
1877 C CA  . LYS A 266 ? 0.8289 1.1469 0.8701 0.3316  0.0528  0.0334  278 LYS A CA  
1878 C C   . LYS A 266 ? 0.9061 1.2038 0.9370 0.3347  0.0438  0.0302  278 LYS A C   
1879 O O   . LYS A 266 ? 0.8839 1.2070 0.9347 0.3335  0.0415  0.0379  278 LYS A O   
1880 C CB  . LYS A 266 ? 0.8714 1.2165 0.9158 0.3562  0.0647  0.0428  278 LYS A CB  
1881 C CG  . LYS A 266 ? 1.0021 1.3990 1.0832 0.3490  0.0709  0.0566  278 LYS A CG  
1882 C CD  . LYS A 266 ? 1.0620 1.4676 1.1474 0.3416  0.0779  0.0577  278 LYS A CD  
1883 C CE  . LYS A 266 ? 1.1110 1.5678 1.2327 0.3353  0.0839  0.0729  278 LYS A CE  
1884 N NZ  . LYS A 266 ? 1.1789 1.6440 1.3041 0.3294  0.0912  0.0751  278 LYS A NZ  
1885 N N   . LYS A 267 ? 0.8996 1.1517 0.8996 0.3382  0.0381  0.0194  279 LYS A N   
1886 C CA  . LYS A 267 ? 0.9169 1.1441 0.9043 0.3393  0.0289  0.0160  279 LYS A CA  
1887 C C   . LYS A 267 ? 0.9395 1.1695 0.9428 0.3135  0.0201  0.0153  279 LYS A C   
1888 O O   . LYS A 267 ? 0.9318 1.1630 0.9390 0.3128  0.0142  0.0180  279 LYS A O   
1889 C CB  . LYS A 267 ? 0.9884 1.1652 0.9388 0.3481  0.0246  0.0053  279 LYS A CB  
1890 C CG  . LYS A 267 ? 1.2233 1.3871 1.1523 0.3773  0.0275  0.0061  279 LYS A CG  
1891 C CD  . LYS A 267 ? 1.4039 1.5136 1.2949 0.3842  0.0209  -0.0049 279 LYS A CD  
1892 C CE  . LYS A 267 ? 1.5728 1.6686 1.4422 0.3989  0.0274  -0.0098 279 LYS A CE  
1893 N NZ  . LYS A 267 ? 1.7203 1.7610 1.5515 0.4046  0.0189  -0.0207 279 LYS A NZ  
1894 N N   . ILE A 268 ? 0.8710 1.1011 0.8819 0.2935  0.0194  0.0116  280 ILE A N   
1895 C CA  . ILE A 268 ? 0.8395 1.0747 0.8657 0.2696  0.0125  0.0108  280 ILE A CA  
1896 C C   . ILE A 268 ? 0.8349 1.1146 0.8928 0.2635  0.0147  0.0207  280 ILE A C   
1897 O O   . ILE A 268 ? 0.8195 1.1250 0.8914 0.2666  0.0222  0.0261  280 ILE A O   
1898 C CB  . ILE A 268 ? 0.8748 1.0918 0.8955 0.2526  0.0110  0.0032  280 ILE A CB  
1899 C CG1 . ILE A 268 ? 0.9053 1.0792 0.8951 0.2589  0.0080  -0.0057 280 ILE A CG1 
1900 C CG2 . ILE A 268 ? 0.8681 1.0884 0.9020 0.2296  0.0043  0.0020  280 ILE A CG2 
1901 C CD1 . ILE A 268 ? 1.0122 1.1713 0.9949 0.2489  0.0088  -0.0121 280 ILE A CD1 
1902 N N   . ASP A 269 ? 0.7604 1.0483 0.8288 0.2549  0.0076  0.0234  281 ASP A N   
1903 C CA  . ASP A 269 ? 0.7269 1.0534 0.8240 0.2471  0.0065  0.0323  281 ASP A CA  
1904 C C   . ASP A 269 ? 0.6688 1.0073 0.7821 0.2260  0.0061  0.0314  281 ASP A C   
1905 O O   . ASP A 269 ? 0.6422 0.9563 0.7441 0.2143  0.0039  0.0230  281 ASP A O   
1906 C CB  . ASP A 269 ? 0.7649 1.0899 0.8635 0.2428  -0.0026 0.0337  281 ASP A CB  
1907 C CG  . ASP A 269 ? 1.0141 1.3306 1.0998 0.2634  -0.0032 0.0363  281 ASP A CG  
1908 O OD1 . ASP A 269 ? 1.0621 1.3616 1.1298 0.2809  0.0022  0.0339  281 ASP A OD1 
1909 O OD2 . ASP A 269 ? 1.0982 1.4231 1.1901 0.2624  -0.0095 0.0404  281 ASP A OD2 
1910 N N   . VAL A 270 ? 0.5535 0.9295 0.6934 0.2213  0.0078  0.0406  282 VAL A N   
1911 C CA  . VAL A 270 ? 0.5058 0.8929 0.6617 0.2007  0.0058  0.0404  282 VAL A CA  
1912 C C   . VAL A 270 ? 0.5104 0.8855 0.6651 0.1839  -0.0044 0.0354  282 VAL A C   
1913 O O   . VAL A 270 ? 0.5191 0.8951 0.6725 0.1872  -0.0101 0.0372  282 VAL A O   
1914 C CB  . VAL A 270 ? 0.5298 0.9583 0.7147 0.1979  0.0090  0.0522  282 VAL A CB  
1915 C CG1 . VAL A 270 ? 0.5317 0.9730 0.7168 0.2150  0.0206  0.0578  282 VAL A CG1 
1916 C CG2 . VAL A 270 ? 0.5219 0.9775 0.7255 0.1971  0.0028  0.0610  282 VAL A CG2 
1917 N N   . PHE A 271 ? 0.4167 0.7795 0.5700 0.1674  -0.0064 0.0290  283 PHE A N   
1918 C CA  . PHE A 271 ? 0.3943 0.7461 0.5453 0.1521  -0.0151 0.0241  283 PHE A CA  
1919 C C   . PHE A 271 ? 0.4132 0.7867 0.5851 0.1363  -0.0192 0.0277  283 PHE A C   
1920 O O   . PHE A 271 ? 0.4000 0.7757 0.5780 0.1283  -0.0162 0.0268  283 PHE A O   
1921 C CB  . PHE A 271 ? 0.4152 0.7334 0.5460 0.1463  -0.0153 0.0137  283 PHE A CB  
1922 C CG  . PHE A 271 ? 0.4349 0.7398 0.5589 0.1353  -0.0230 0.0092  283 PHE A CG  
1923 C CD1 . PHE A 271 ? 0.4805 0.7723 0.5915 0.1421  -0.0267 0.0087  283 PHE A CD1 
1924 C CD2 . PHE A 271 ? 0.4529 0.7575 0.5820 0.1190  -0.0266 0.0057  283 PHE A CD2 
1925 C CE1 . PHE A 271 ? 0.4893 0.7702 0.5934 0.1324  -0.0332 0.0055  283 PHE A CE1 
1926 C CE2 . PHE A 271 ? 0.4877 0.7809 0.6090 0.1105  -0.0330 0.0017  283 PHE A CE2 
1927 C CZ  . PHE A 271 ? 0.4713 0.7534 0.5802 0.1171  -0.0360 0.0020  283 PHE A CZ  
1928 N N   . LYS A 272 ? 0.3567 0.7460 0.5392 0.1321  -0.0269 0.0323  284 LYS A N   
1929 C CA  . LYS A 272 ? 0.3375 0.7440 0.5376 0.1160  -0.0337 0.0353  284 LYS A CA  
1930 C C   . LYS A 272 ? 0.3698 0.7562 0.5580 0.1033  -0.0422 0.0271  284 LYS A C   
1931 O O   . LYS A 272 ? 0.3772 0.7515 0.5523 0.1080  -0.0455 0.0246  284 LYS A O   
1932 C CB  . LYS A 272 ? 0.3591 0.7997 0.5808 0.1192  -0.0375 0.0470  284 LYS A CB  
1933 C CG  . LYS A 272 ? 0.3847 0.8509 0.6223 0.1297  -0.0285 0.0568  284 LYS A CG  
1934 C CD  . LYS A 272 ? 0.4479 0.9508 0.7088 0.1334  -0.0322 0.0697  284 LYS A CD  
1935 C CE  . LYS A 272 ? 0.6116 1.1467 0.8966 0.1336  -0.0263 0.0813  284 LYS A CE  
1936 N NZ  . LYS A 272 ? 0.8363 1.3743 1.1154 0.1536  -0.0130 0.0841  284 LYS A NZ  
1937 N N   . PHE A 273 ? 0.2945 0.6764 0.4859 0.0883  -0.0451 0.0231  285 PHE A N   
1938 C CA  . PHE A 273 ? 0.2899 0.6548 0.4701 0.0769  -0.0528 0.0157  285 PHE A CA  
1939 C C   . PHE A 273 ? 0.3692 0.7427 0.5616 0.0611  -0.0599 0.0161  285 PHE A C   
1940 O O   . PHE A 273 ? 0.3562 0.7437 0.5641 0.0572  -0.0576 0.0208  285 PHE A O   
1941 C CB  . PHE A 273 ? 0.3007 0.6358 0.4602 0.0770  -0.0482 0.0060  285 PHE A CB  
1942 C CG  . PHE A 273 ? 0.2892 0.6169 0.4495 0.0732  -0.0418 0.0026  285 PHE A CG  
1943 C CD1 . PHE A 273 ? 0.2974 0.6181 0.4582 0.0602  -0.0448 -0.0021 285 PHE A CD1 
1944 C CD2 . PHE A 273 ? 0.2992 0.6250 0.4577 0.0834  -0.0331 0.0039  285 PHE A CD2 
1945 C CE1 . PHE A 273 ? 0.2989 0.6123 0.4600 0.0572  -0.0392 -0.0049 285 PHE A CE1 
1946 C CE2 . PHE A 273 ? 0.3211 0.6400 0.4796 0.0799  -0.0277 0.0010  285 PHE A CE2 
1947 C CZ  . PHE A 273 ? 0.2858 0.5989 0.4461 0.0668  -0.0307 -0.0031 285 PHE A CZ  
1948 N N   . ASN A 274 ? 0.3613 0.7249 0.5451 0.0525  -0.0689 0.0112  286 ASN A N   
1949 C CA  . ASN A 274 ? 0.3761 0.7428 0.5666 0.0376  -0.0784 0.0103  286 ASN A CA  
1950 C C   . ASN A 274 ? 0.4529 0.7928 0.6260 0.0302  -0.0785 -0.0005 286 ASN A C   
1951 O O   . ASN A 274 ? 0.4507 0.7723 0.6052 0.0347  -0.0761 -0.0067 286 ASN A O   
1952 C CB  . ASN A 274 ? 0.3872 0.7646 0.5801 0.0349  -0.0901 0.0137  286 ASN A CB  
1953 C CG  . ASN A 274 ? 0.6667 1.0438 0.8631 0.0195  -0.1022 0.0120  286 ASN A CG  
1954 O OD1 . ASN A 274 ? 0.6936 1.0892 0.9100 0.0117  -0.1068 0.0189  286 ASN A OD1 
1955 N ND2 . ASN A 274 ? 0.5113 0.8670 0.6876 0.0150  -0.1079 0.0031  286 ASN A ND2 
1956 N N   . SER A 275 ? 0.4252 0.7632 0.6047 0.0193  -0.0812 -0.0021 287 SER A N   
1957 C CA  . SER A 275 ? 0.4401 0.7544 0.6040 0.0116  -0.0836 -0.0119 287 SER A CA  
1958 C C   . SER A 275 ? 0.5177 0.8349 0.6879 -0.0018 -0.0961 -0.0116 287 SER A C   
1959 O O   . SER A 275 ? 0.5053 0.8390 0.6951 -0.0079 -0.0988 -0.0043 287 SER A O   
1960 C CB  . SER A 275 ? 0.4838 0.7865 0.6452 0.0128  -0.0738 -0.0156 287 SER A CB  
1961 O OG  . SER A 275 ? 0.5803 0.8625 0.7292 0.0057  -0.0759 -0.0241 287 SER A OG  
1962 N N   . SER A 276 ? 0.5043 0.8047 0.6570 -0.0061 -0.1039 -0.0192 288 SER A N   
1963 C CA  . SER A 276 ? 0.5266 0.8261 0.6798 -0.0177 -0.1184 -0.0200 288 SER A CA  
1964 C C   . SER A 276 ? 0.6054 0.8949 0.7622 -0.0288 -0.1220 -0.0226 288 SER A C   
1965 O O   . SER A 276 ? 0.6332 0.9311 0.8019 -0.0396 -0.1334 -0.0182 288 SER A O   
1966 C CB  . SER A 276 ? 0.5956 0.8774 0.7246 -0.0168 -0.1245 -0.0281 288 SER A CB  
1967 O OG  . SER A 276 ? 0.7263 0.9852 0.8354 -0.0126 -0.1166 -0.0373 288 SER A OG  
1968 N N   . LYS A 277 ? 0.5443 0.8160 0.6912 -0.0266 -0.1131 -0.0292 289 LYS A N   
1969 C CA  . LYS A 277 ? 0.5420 0.7997 0.6884 -0.0359 -0.1166 -0.0329 289 LYS A CA  
1970 C C   . LYS A 277 ? 0.5898 0.8607 0.7567 -0.0375 -0.1095 -0.0253 289 LYS A C   
1971 O O   . LYS A 277 ? 0.5843 0.8590 0.7529 -0.0283 -0.0970 -0.0240 289 LYS A O   
1972 C CB  . LYS A 277 ? 0.5711 0.8011 0.6934 -0.0321 -0.1118 -0.0445 289 LYS A CB  
1973 C CG  . LYS A 277 ? 0.6320 0.8459 0.7312 -0.0312 -0.1189 -0.0527 289 LYS A CG  
1974 C CD  . LYS A 277 ? 0.7572 0.9490 0.8354 -0.0247 -0.1107 -0.0622 289 LYS A CD  
1975 C CE  . LYS A 277 ? 0.9834 1.1572 1.0365 -0.0237 -0.1174 -0.0707 289 LYS A CE  
1976 N NZ  . LYS A 277 ? 1.1545 1.3109 1.1891 -0.0160 -0.1078 -0.0783 289 LYS A NZ  
1977 N N   . LEU A 278 ? 0.5623 0.8389 0.7436 -0.0494 -0.1179 -0.0200 290 LEU A N   
1978 C CA  . LEU A 278 ? 0.5583 0.8496 0.7605 -0.0525 -0.1125 -0.0109 290 LEU A CA  
1979 C C   . LEU A 278 ? 0.5805 0.8534 0.7740 -0.0499 -0.1031 -0.0165 290 LEU A C   
1980 O O   . LEU A 278 ? 0.5549 0.8389 0.7587 -0.0446 -0.0924 -0.0111 290 LEU A O   
1981 C CB  . LEU A 278 ? 0.5825 0.8825 0.8014 -0.0680 -0.1257 -0.0034 290 LEU A CB  
1982 C CG  . LEU A 278 ? 0.6497 0.9707 0.8938 -0.0725 -0.1212 0.0092  290 LEU A CG  
1983 C CD1 . LEU A 278 ? 0.6449 0.9990 0.9074 -0.0635 -0.1132 0.0204  290 LEU A CD1 
1984 C CD2 . LEU A 278 ? 0.6956 1.0183 0.9529 -0.0901 -0.1358 0.0153  290 LEU A CD2 
1985 N N   . ARG A 279 ? 0.5345 0.7796 0.7087 -0.0531 -0.1073 -0.0272 291 ARG A N   
1986 C CA  . ARG A 279 ? 0.5110 0.7372 0.6757 -0.0503 -0.0996 -0.0332 291 ARG A CA  
1987 C C   . ARG A 279 ? 0.4870 0.7132 0.6437 -0.0367 -0.0857 -0.0363 291 ARG A C   
1988 O O   . ARG A 279 ? 0.4724 0.6958 0.6311 -0.0332 -0.0768 -0.0359 291 ARG A O   
1989 C CB  . ARG A 279 ? 0.5389 0.7356 0.6834 -0.0551 -0.1077 -0.0439 291 ARG A CB  
1990 C CG  . ARG A 279 ? 0.7491 0.9342 0.8728 -0.0508 -0.1122 -0.0525 291 ARG A CG  
1991 C CD  . ARG A 279 ? 0.9740 1.1392 1.0850 -0.0600 -0.1270 -0.0586 291 ARG A CD  
1992 N NE  . ARG A 279 ? 1.1681 1.3201 1.2556 -0.0542 -0.1300 -0.0676 291 ARG A NE  
1993 C CZ  . ARG A 279 ? 1.4097 1.5710 1.4955 -0.0552 -0.1376 -0.0660 291 ARG A CZ  
1994 N NH1 . ARG A 279 ? 1.2912 1.4763 1.3989 -0.0616 -0.1433 -0.0557 291 ARG A NH1 
1995 N NH2 . ARG A 279 ? 1.2417 1.3897 1.3042 -0.0493 -0.1395 -0.0742 291 ARG A NH2 
1996 N N   . VAL A 280 ? 0.4062 0.6356 0.5544 -0.0296 -0.0847 -0.0386 292 VAL A N   
1997 C CA  . VAL A 280 ? 0.3773 0.6082 0.5195 -0.0178 -0.0733 -0.0399 292 VAL A CA  
1998 C C   . VAL A 280 ? 0.3947 0.6474 0.5545 -0.0131 -0.0663 -0.0304 292 VAL A C   
1999 O O   . VAL A 280 ? 0.3794 0.6299 0.5374 -0.0062 -0.0566 -0.0307 292 VAL A O   
2000 C CB  . VAL A 280 ? 0.4214 0.6489 0.5494 -0.0125 -0.0752 -0.0441 292 VAL A CB  
2001 C CG1 . VAL A 280 ? 0.4011 0.6291 0.5238 -0.0016 -0.0646 -0.0443 292 VAL A CG1 
2002 C CG2 . VAL A 280 ? 0.4329 0.6389 0.5412 -0.0153 -0.0809 -0.0535 292 VAL A CG2 
2003 N N   . ASN A 281 ? 0.3417 0.6152 0.5177 -0.0166 -0.0715 -0.0217 293 ASN A N   
2004 C CA  . ASN A 281 ? 0.3222 0.6186 0.5146 -0.0106 -0.0647 -0.0118 293 ASN A CA  
2005 C C   . ASN A 281 ? 0.3474 0.6462 0.5488 -0.0116 -0.0578 -0.0079 293 ASN A C   
2006 O O   . ASN A 281 ? 0.3128 0.6205 0.5176 -0.0024 -0.0483 -0.0040 293 ASN A O   
2007 C CB  . ASN A 281 ? 0.3107 0.6309 0.5204 -0.0151 -0.0724 -0.0024 293 ASN A CB  
2008 C CG  . ASN A 281 ? 0.5709 0.8921 0.7728 -0.0119 -0.0783 -0.0047 293 ASN A CG  
2009 O OD1 . ASN A 281 ? 0.4695 0.7759 0.6537 -0.0048 -0.0750 -0.0120 293 ASN A OD1 
2010 N ND2 . ASN A 281 ? 0.5061 0.8449 0.7212 -0.0178 -0.0878 0.0022  293 ASN A ND2 
2011 N N   . LYS A 282 ? 0.3255 0.6155 0.5297 -0.0226 -0.0631 -0.0087 294 LYS A N   
2012 C CA  . LYS A 282 ? 0.3191 0.6070 0.5294 -0.0250 -0.0578 -0.0056 294 LYS A CA  
2013 C C   . LYS A 282 ? 0.3579 0.6290 0.5531 -0.0163 -0.0485 -0.0132 294 LYS A C   
2014 O O   . LYS A 282 ? 0.3610 0.6378 0.5606 -0.0111 -0.0399 -0.0092 294 LYS A O   
2015 C CB  . LYS A 282 ? 0.3559 0.6325 0.5687 -0.0388 -0.0674 -0.0063 294 LYS A CB  
2016 C CG  . LYS A 282 ? 0.4719 0.7683 0.7047 -0.0496 -0.0765 0.0043  294 LYS A CG  
2017 C CD  . LYS A 282 ? 0.5598 0.8395 0.7910 -0.0640 -0.0889 0.0020  294 LYS A CD  
2018 C CE  . LYS A 282 ? 0.6285 0.9281 0.8810 -0.0764 -0.0993 0.0135  294 LYS A CE  
2019 N NZ  . LYS A 282 ? 0.7639 1.0426 1.0116 -0.0910 -0.1136 0.0100  294 LYS A NZ  
2020 N N   . LEU A 283 ? 0.3018 0.5533 0.4793 -0.0146 -0.0501 -0.0234 295 LEU A N   
2021 C CA  . LEU A 283 ? 0.2972 0.5339 0.4611 -0.0070 -0.0423 -0.0302 295 LEU A CA  
2022 C C   . LEU A 283 ? 0.3542 0.6002 0.5174 0.0041  -0.0343 -0.0277 295 LEU A C   
2023 O O   . LEU A 283 ? 0.3632 0.6059 0.5245 0.0092  -0.0270 -0.0277 295 LEU A O   
2024 C CB  . LEU A 283 ? 0.3035 0.5210 0.4500 -0.0073 -0.0459 -0.0400 295 LEU A CB  
2025 C CG  . LEU A 283 ? 0.3608 0.5644 0.4940 -0.0004 -0.0387 -0.0464 295 LEU A CG  
2026 C CD1 . LEU A 283 ? 0.3542 0.5521 0.4904 -0.0006 -0.0337 -0.0459 295 LEU A CD1 
2027 C CD2 . LEU A 283 ? 0.3857 0.5735 0.5033 -0.0010 -0.0424 -0.0546 295 LEU A CD2 
2028 N N   . ILE A 284 ? 0.2855 0.5413 0.4491 0.0079  -0.0364 -0.0258 296 ILE A N   
2029 C CA  . ILE A 284 ? 0.2666 0.5295 0.4285 0.0188  -0.0301 -0.0233 296 ILE A CA  
2030 C C   . ILE A 284 ? 0.3111 0.5865 0.4835 0.0232  -0.0235 -0.0162 296 ILE A C   
2031 O O   . ILE A 284 ? 0.3114 0.5805 0.4765 0.0309  -0.0167 -0.0177 296 ILE A O   
2032 C CB  . ILE A 284 ? 0.3104 0.5844 0.4740 0.0216  -0.0346 -0.0205 296 ILE A CB  
2033 C CG1 . ILE A 284 ? 0.3131 0.5726 0.4621 0.0197  -0.0396 -0.0279 296 ILE A CG1 
2034 C CG2 . ILE A 284 ? 0.3263 0.6092 0.4901 0.0338  -0.0284 -0.0162 296 ILE A CG2 
2035 C CD1 . ILE A 284 ? 0.3773 0.6466 0.5279 0.0197  -0.0465 -0.0253 296 ILE A CD1 
2036 N N   . LEU A 285 ? 0.2585 0.5512 0.4473 0.0178  -0.0257 -0.0081 297 LEU A N   
2037 C CA  . LEU A 285 ? 0.2406 0.5489 0.4403 0.0224  -0.0188 0.0004  297 LEU A CA  
2038 C C   . LEU A 285 ? 0.2821 0.5781 0.4768 0.0220  -0.0135 -0.0020 297 LEU A C   
2039 O O   . LEU A 285 ? 0.2660 0.5647 0.4580 0.0311  -0.0058 0.0003  297 LEU A O   
2040 C CB  . LEU A 285 ? 0.2353 0.5665 0.4555 0.0150  -0.0229 0.0109  297 LEU A CB  
2041 C CG  . LEU A 285 ? 0.2840 0.6339 0.5130 0.0172  -0.0273 0.0161  297 LEU A CG  
2042 C CD1 . LEU A 285 ? 0.2743 0.6459 0.5250 0.0067  -0.0334 0.0266  297 LEU A CD1 
2043 C CD2 . LEU A 285 ? 0.3216 0.6825 0.5486 0.0329  -0.0191 0.0197  297 LEU A CD2 
2044 N N   . GLN A 286 ? 0.2469 0.5280 0.4386 0.0124  -0.0179 -0.0069 298 GLN A N   
2045 C CA  . GLN A 286 ? 0.2421 0.5091 0.4279 0.0117  -0.0141 -0.0101 298 GLN A CA  
2046 C C   . GLN A 286 ? 0.3187 0.5737 0.4898 0.0216  -0.0082 -0.0161 298 GLN A C   
2047 O O   . GLN A 286 ? 0.3210 0.5745 0.4899 0.0265  -0.0022 -0.0145 298 GLN A O   
2048 C CB  . GLN A 286 ? 0.2571 0.5072 0.4386 0.0019  -0.0207 -0.0162 298 GLN A CB  
2049 C CG  . GLN A 286 ? 0.3078 0.5635 0.5023 -0.0096 -0.0267 -0.0102 298 GLN A CG  
2050 C CD  . GLN A 286 ? 0.5078 0.7426 0.6944 -0.0178 -0.0339 -0.0174 298 GLN A CD  
2051 O OE1 . GLN A 286 ? 0.5449 0.7623 0.7168 -0.0144 -0.0331 -0.0266 298 GLN A OE1 
2052 N NE2 . GLN A 286 ? 0.3298 0.5654 0.5257 -0.0287 -0.0410 -0.0130 298 GLN A NE2 
2053 N N   . LEU A 287 ? 0.2835 0.5299 0.4444 0.0241  -0.0105 -0.0224 299 LEU A N   
2054 C CA  . LEU A 287 ? 0.2732 0.5076 0.4208 0.0318  -0.0066 -0.0276 299 LEU A CA  
2055 C C   . LEU A 287 ? 0.3180 0.5606 0.4644 0.0422  -0.0019 -0.0236 299 LEU A C   
2056 O O   . LEU A 287 ? 0.3315 0.5646 0.4684 0.0483  0.0019  -0.0259 299 LEU A O   
2057 C CB  . LEU A 287 ? 0.2725 0.4970 0.4107 0.0306  -0.0106 -0.0338 299 LEU A CB  
2058 C CG  . LEU A 287 ? 0.3149 0.5282 0.4495 0.0230  -0.0146 -0.0393 299 LEU A CG  
2059 C CD1 . LEU A 287 ? 0.3156 0.5237 0.4417 0.0227  -0.0184 -0.0436 299 LEU A CD1 
2060 C CD2 . LEU A 287 ? 0.3129 0.5136 0.4420 0.0233  -0.0111 -0.0430 299 LEU A CD2 
2061 N N   . CYS A 288 ? 0.2765 0.5360 0.4317 0.0447  -0.0024 -0.0174 300 CYS A N   
2062 C CA  . CYS A 288 ? 0.2727 0.5409 0.4264 0.0565  0.0026  -0.0131 300 CYS A CA  
2063 C C   . CYS A 288 ? 0.3027 0.5748 0.4580 0.0606  0.0090  -0.0090 300 CYS A C   
2064 O O   . CYS A 288 ? 0.2944 0.5590 0.4383 0.0704  0.0133  -0.0106 300 CYS A O   
2065 C CB  . CYS A 288 ? 0.2778 0.5662 0.4428 0.0584  0.0007  -0.0064 300 CYS A CB  
2066 S SG  . CYS A 288 ? 0.3282 0.6114 0.4870 0.0579  -0.0061 -0.0107 300 CYS A SG  
2067 N N   . ILE A 289 ? 0.2525 0.5345 0.4205 0.0529  0.0091  -0.0038 301 ILE A N   
2068 C CA  . ILE A 289 ? 0.2506 0.5390 0.4216 0.0561  0.0154  0.0018  301 ILE A CA  
2069 C C   . ILE A 289 ? 0.3210 0.5888 0.4778 0.0578  0.0174  -0.0048 301 ILE A C   
2070 O O   . ILE A 289 ? 0.3288 0.5943 0.4766 0.0676  0.0227  -0.0041 301 ILE A O   
2071 C CB  . ILE A 289 ? 0.2804 0.5836 0.4694 0.0455  0.0138  0.0098  301 ILE A CB  
2072 C CG1 . ILE A 289 ? 0.2906 0.6195 0.4953 0.0463  0.0131  0.0192  301 ILE A CG1 
2073 C CG2 . ILE A 289 ? 0.2608 0.5659 0.4509 0.0467  0.0197  0.0148  301 ILE A CG2 
2074 C CD1 . ILE A 289 ? 0.3917 0.7287 0.6117 0.0322  0.0056  0.0231  301 ILE A CD1 
2075 N N   . GLY A 290 ? 0.2699 0.5234 0.4242 0.0491  0.0130  -0.0110 302 GLY A N   
2076 C CA  . GLY A 290 ? 0.2657 0.5016 0.4091 0.0494  0.0139  -0.0167 302 GLY A CA  
2077 C C   . GLY A 290 ? 0.3395 0.5636 0.4680 0.0581  0.0149  -0.0218 302 GLY A C   
2078 O O   . GLY A 290 ? 0.3396 0.5566 0.4595 0.0636  0.0179  -0.0224 302 GLY A O   
2079 N N   . ASN A 291 ? 0.3041 0.5254 0.4288 0.0593  0.0118  -0.0251 303 ASN A N   
2080 C CA  . ASN A 291 ? 0.3019 0.5102 0.4125 0.0662  0.0115  -0.0295 303 ASN A CA  
2081 C C   . ASN A 291 ? 0.3565 0.5680 0.4605 0.0781  0.0154  -0.0264 303 ASN A C   
2082 O O   . ASN A 291 ? 0.3827 0.5803 0.4732 0.0837  0.0156  -0.0296 303 ASN A O   
2083 C CB  . ASN A 291 ? 0.2936 0.4986 0.4021 0.0643  0.0073  -0.0325 303 ASN A CB  
2084 C CG  . ASN A 291 ? 0.3844 0.5802 0.4922 0.0558  0.0040  -0.0374 303 ASN A CG  
2085 O OD1 . ASN A 291 ? 0.3209 0.5046 0.4219 0.0550  0.0039  -0.0408 303 ASN A OD1 
2086 N ND2 . ASN A 291 ? 0.1936 0.3952 0.3081 0.0496  0.0011  -0.0375 303 ASN A ND2 
2087 N N   . HIS A 292 ? 0.3010 0.5306 0.4140 0.0821  0.0182  -0.0199 304 HIS A N   
2088 C CA  . HIS A 292 ? 0.2981 0.5337 0.4054 0.0951  0.0234  -0.0158 304 HIS A CA  
2089 C C   . HIS A 292 ? 0.3354 0.5659 0.4358 0.0986  0.0276  -0.0152 304 HIS A C   
2090 O O   . HIS A 292 ? 0.3475 0.5665 0.4319 0.1090  0.0292  -0.0176 304 HIS A O   
2091 C CB  . HIS A 292 ? 0.3108 0.5718 0.4335 0.0972  0.0263  -0.0071 304 HIS A CB  
2092 C CG  . HIS A 292 ? 0.3717 0.6420 0.4895 0.1119  0.0333  -0.0018 304 HIS A CG  
2093 N ND1 . HIS A 292 ? 0.3993 0.6792 0.5204 0.1142  0.0393  0.0040  304 HIS A ND1 
2094 C CD2 . HIS A 292 ? 0.4070 0.6767 0.5152 0.1255  0.0352  -0.0016 304 HIS A CD2 
2095 C CE1 . HIS A 292 ? 0.4057 0.6914 0.5186 0.1296  0.0451  0.0073  304 HIS A CE1 
2096 N NE2 . HIS A 292 ? 0.4165 0.6959 0.5214 0.1372  0.0428  0.0040  304 HIS A NE2 
2097 N N   . ASP A 293 ? 0.2745 0.5116 0.3855 0.0901  0.0286  -0.0122 305 ASP A N   
2098 C CA  . ASP A 293 ? 0.2737 0.5092 0.3805 0.0927  0.0327  -0.0099 305 ASP A CA  
2099 C C   . ASP A 293 ? 0.3448 0.5578 0.4368 0.0921  0.0297  -0.0174 305 ASP A C   
2100 O O   . ASP A 293 ? 0.3537 0.5598 0.4332 0.0999  0.0323  -0.0175 305 ASP A O   
2101 C CB  . ASP A 293 ? 0.2879 0.5365 0.4114 0.0826  0.0337  -0.0037 305 ASP A CB  
2102 C CG  . ASP A 293 ? 0.3402 0.6141 0.4782 0.0847  0.0383  0.0069  305 ASP A CG  
2103 O OD1 . ASP A 293 ? 0.3451 0.6285 0.4834 0.0925  0.0396  0.0088  305 ASP A OD1 
2104 O OD2 . ASP A 293 ? 0.3196 0.6042 0.4690 0.0787  0.0403  0.0139  305 ASP A OD2 
2105 N N   . LEU A 294 ? 0.3182 0.5206 0.4114 0.0834  0.0241  -0.0231 306 LEU A N   
2106 C CA  . LEU A 294 ? 0.3290 0.5124 0.4106 0.0822  0.0207  -0.0293 306 LEU A CA  
2107 C C   . LEU A 294 ? 0.3899 0.5600 0.4550 0.0910  0.0187  -0.0331 306 LEU A C   
2108 O O   . LEU A 294 ? 0.4232 0.5793 0.4755 0.0941  0.0170  -0.0360 306 LEU A O   
2109 C CB  . LEU A 294 ? 0.3203 0.4983 0.4082 0.0715  0.0162  -0.0334 306 LEU A CB  
2110 C CG  . LEU A 294 ? 0.3564 0.5408 0.4568 0.0628  0.0166  -0.0312 306 LEU A CG  
2111 C CD1 . LEU A 294 ? 0.3548 0.5340 0.4591 0.0549  0.0126  -0.0357 306 LEU A CD1 
2112 C CD2 . LEU A 294 ? 0.3690 0.5488 0.4664 0.0633  0.0183  -0.0300 306 LEU A CD2 
2113 N N   . PHE A 295 ? 0.3086 0.4822 0.3732 0.0952  0.0183  -0.0329 307 PHE A N   
2114 C CA  . PHE A 295 ? 0.3065 0.4667 0.3546 0.1049  0.0164  -0.0358 307 PHE A CA  
2115 C C   . PHE A 295 ? 0.4000 0.5573 0.4349 0.1172  0.0204  -0.0343 307 PHE A C   
2116 O O   . PHE A 295 ? 0.4408 0.5787 0.4577 0.1226  0.0171  -0.0387 307 PHE A O   
2117 C CB  . PHE A 295 ? 0.3128 0.4808 0.3649 0.1082  0.0163  -0.0342 307 PHE A CB  
2118 C CG  . PHE A 295 ? 0.3236 0.4779 0.3588 0.1195  0.0145  -0.0365 307 PHE A CG  
2119 C CD1 . PHE A 295 ? 0.3462 0.5041 0.3728 0.1338  0.0193  -0.0338 307 PHE A CD1 
2120 C CD2 . PHE A 295 ? 0.3416 0.4796 0.3692 0.1163  0.0082  -0.0407 307 PHE A CD2 
2121 C CE1 . PHE A 295 ? 0.3652 0.5077 0.3740 0.1455  0.0173  -0.0365 307 PHE A CE1 
2122 C CE2 . PHE A 295 ? 0.3880 0.5107 0.3991 0.1265  0.0057  -0.0427 307 PHE A CE2 
2123 C CZ  . PHE A 295 ? 0.3655 0.4893 0.3664 0.1414  0.0100  -0.0410 307 PHE A CZ  
2124 N N   . MET A 296 ? 0.3512 0.5276 0.3946 0.1216  0.0273  -0.0278 308 MET A N   
2125 C CA  . MET A 296 ? 0.3516 0.5292 0.3828 0.1350  0.0329  -0.0250 308 MET A CA  
2126 C C   . MET A 296 ? 0.4032 0.5681 0.4236 0.1340  0.0320  -0.0273 308 MET A C   
2127 O O   . MET A 296 ? 0.4049 0.5556 0.4049 0.1447  0.0319  -0.0300 308 MET A O   
2128 C CB  . MET A 296 ? 0.3650 0.5703 0.4114 0.1384  0.0410  -0.0154 308 MET A CB  
2129 C CG  . MET A 296 ? 0.3991 0.6187 0.4545 0.1426  0.0421  -0.0121 308 MET A CG  
2130 S SD  . MET A 296 ? 0.4703 0.6735 0.5037 0.1591  0.0407  -0.0169 308 MET A SD  
2131 C CE  . MET A 296 ? 0.4586 0.6601 0.4732 0.1771  0.0484  -0.0145 308 MET A CE  
2132 N N   . ARG A 297 ? 0.3642 0.5332 0.3973 0.1217  0.0309  -0.0264 309 ARG A N   
2133 C CA  . ARG A 297 ? 0.3707 0.5289 0.3964 0.1192  0.0292  -0.0281 309 ARG A CA  
2134 C C   . ARG A 297 ? 0.4723 0.6059 0.4809 0.1194  0.0213  -0.0359 309 ARG A C   
2135 O O   . ARG A 297 ? 0.4780 0.5996 0.4720 0.1237  0.0197  -0.0376 309 ARG A O   
2136 C CB  . ARG A 297 ? 0.3045 0.4703 0.3479 0.1058  0.0284  -0.0262 309 ARG A CB  
2137 C CG  . ARG A 297 ? 0.2587 0.4444 0.3162 0.1040  0.0349  -0.0178 309 ARG A CG  
2138 C CD  . ARG A 297 ? 0.2839 0.4696 0.3535 0.0917  0.0325  -0.0174 309 ARG A CD  
2139 N NE  . ARG A 297 ? 0.3588 0.5614 0.4424 0.0881  0.0373  -0.0089 309 ARG A NE  
2140 C CZ  . ARG A 297 ? 0.4937 0.6990 0.5909 0.0771  0.0355  -0.0072 309 ARG A CZ  
2141 N NH1 . ARG A 297 ? 0.2936 0.4874 0.3921 0.0698  0.0299  -0.0137 309 ARG A NH1 
2142 N NH2 . ARG A 297 ? 0.3291 0.5484 0.4383 0.0735  0.0392  0.0014  309 ARG A NH2 
2143 N N   . ARG A 298 ? 0.4542 0.5807 0.4651 0.1143  0.0159  -0.0399 310 ARG A N   
2144 C CA  . ARG A 298 ? 0.4715 0.5760 0.4691 0.1125  0.0076  -0.0459 310 ARG A CA  
2145 C C   . ARG A 298 ? 0.6058 0.6937 0.5802 0.1254  0.0057  -0.0488 310 ARG A C   
2146 O O   . ARG A 298 ? 0.6387 0.7054 0.5981 0.1251  -0.0020 -0.0535 310 ARG A O   
2147 C CB  . ARG A 298 ? 0.4050 0.5094 0.4126 0.1036  0.0036  -0.0476 310 ARG A CB  
2148 C CG  . ARG A 298 ? 0.3716 0.4843 0.3960 0.0913  0.0031  -0.0469 310 ARG A CG  
2149 C CD  . ARG A 298 ? 0.4010 0.5160 0.4343 0.0843  0.0008  -0.0479 310 ARG A CD  
2150 N NE  . ARG A 298 ? 0.3246 0.4505 0.3738 0.0750  0.0022  -0.0468 310 ARG A NE  
2151 C CZ  . ARG A 298 ? 0.3762 0.5135 0.4369 0.0711  0.0041  -0.0456 310 ARG A CZ  
2152 N NH1 . ARG A 298 ? 0.3771 0.5184 0.4370 0.0751  0.0049  -0.0448 310 ARG A NH1 
2153 N NH2 . ARG A 298 ? 0.2976 0.4410 0.3695 0.0635  0.0048  -0.0455 310 ARG A NH2 
2154 N N   . ARG A 299 ? 0.5779 0.6752 0.5492 0.1370  0.0123  -0.0458 311 ARG A N   
2155 C CA  . ARG A 299 ? 0.6043 0.6867 0.5522 0.1521  0.0119  -0.0484 311 ARG A CA  
2156 C C   . ARG A 299 ? 0.6811 0.7664 0.6176 0.1628  0.0178  -0.0460 311 ARG A C   
2157 O O   . ARG A 299 ? 0.7092 0.7876 0.6269 0.1783  0.0207  -0.0467 311 ARG A O   
2158 C CB  . ARG A 299 ? 0.6336 0.7246 0.5846 0.1598  0.0155  -0.0464 311 ARG A CB  
2159 C CG  . ARG A 299 ? 0.8633 0.9363 0.8088 0.1559  0.0071  -0.0511 311 ARG A CG  
2160 C CD  . ARG A 299 ? 0.9511 1.0403 0.9142 0.1518  0.0090  -0.0479 311 ARG A CD  
2161 N NE  . ARG A 299 ? 1.0357 1.1117 0.9999 0.1420  0.0010  -0.0512 311 ARG A NE  
2162 C CZ  . ARG A 299 ? 1.1801 1.2608 1.1589 0.1271  -0.0018 -0.0512 311 ARG A CZ  
2163 N NH1 . ARG A 299 ? 0.9292 1.0252 0.9221 0.1202  0.0021  -0.0489 311 ARG A NH1 
2164 N NH2 . ARG A 299 ? 1.0412 1.1113 1.0200 0.1195  -0.0082 -0.0531 311 ARG A NH2 
2165 N N   . LYS A 300 ? 0.6354 0.7297 0.5819 0.1549  0.0196  -0.0432 312 LYS A N   
2166 C CA  . LYS A 300 ? 0.7595 0.8568 0.6970 0.1616  0.0245  -0.0402 312 LYS A CA  
2167 C C   . LYS A 300 ? 1.3713 1.4908 1.3132 0.1730  0.0360  -0.0326 312 LYS A C   
2168 O O   . LYS A 300 ? 0.9029 1.0464 0.8682 0.1662  0.0416  -0.0257 312 LYS A O   
2169 C CB  . LYS A 300 ? 0.8093 0.8789 0.7166 0.1703  0.0180  -0.0466 312 LYS A CB  
2170 C CG  . LYS A 300 ? 1.0528 1.1005 0.9554 0.1592  0.0055  -0.0532 312 LYS A CG  
2171 C CD  . LYS A 300 ? 1.2570 1.3067 1.1672 0.1488  0.0027  -0.0521 312 LYS A CD  
2172 C CE  . LYS A 300 ? 1.3950 1.4208 1.2928 0.1429  -0.0099 -0.0581 312 LYS A CE  
2173 N NZ  . LYS A 300 ? 1.4564 1.4859 1.3622 0.1341  -0.0123 -0.0563 312 LYS A NZ  
2174 C CA  . LYS B 8   ? 1.6897 1.1300 2.4864 0.4238  -0.2597 -0.3513 20  LYS B CA  
2175 C C   . LYS B 8   ? 1.6738 1.1671 2.4233 0.3935  -0.2331 -0.3283 20  LYS B C   
2176 O O   . LYS B 8   ? 1.6250 1.1932 2.3773 0.3956  -0.2128 -0.3516 20  LYS B O   
2177 C CB  . LYS B 8   ? 1.7441 1.1651 2.5553 0.4192  -0.2534 -0.3883 20  LYS B CB  
2178 C CG  . LYS B 8   ? 1.9603 1.3056 2.7448 0.3929  -0.2610 -0.3593 20  LYS B CG  
2179 C CD  . LYS B 8   ? 2.0841 1.4443 2.8568 0.3699  -0.2398 -0.3840 20  LYS B CD  
2180 C CE  . LYS B 8   ? 2.2796 1.5612 3.0377 0.3474  -0.2501 -0.3638 20  LYS B CE  
2181 N NZ  . LYS B 8   ? 2.3547 1.6154 3.0660 0.3171  -0.2474 -0.3090 20  LYS B NZ  
2182 N N   . THR B 9   ? 1.6197 1.0741 2.3263 0.3648  -0.2333 -0.2835 21  THR B N   
2183 C CA  . THR B 9   ? 1.5505 1.0469 2.2126 0.3370  -0.2119 -0.2571 21  THR B CA  
2184 C C   . THR B 9   ? 1.5887 1.0506 2.2198 0.3263  -0.2243 -0.2045 21  THR B C   
2185 O O   . THR B 9   ? 1.6405 1.0344 2.2750 0.3311  -0.2478 -0.1835 21  THR B O   
2186 C CB  . THR B 9   ? 1.6399 1.1382 2.2762 0.3062  -0.1919 -0.2616 21  THR B CB  
2187 O OG1 . THR B 9   ? 1.6968 1.1195 2.3271 0.2933  -0.2050 -0.2451 21  THR B OG1 
2188 C CG2 . THR B 9   ? 1.6051 1.1522 2.2609 0.3117  -0.1751 -0.3112 21  THR B CG2 
2189 N N   . PHE B 10  ? 1.4751 0.9839 2.0748 0.3112  -0.2088 -0.1837 22  PHE B N   
2190 C CA  . PHE B 10  ? 1.4620 0.9487 2.0248 0.2951  -0.2147 -0.1354 22  PHE B CA  
2191 C C   . PHE B 10  ? 1.4291 0.9481 1.9512 0.2627  -0.1895 -0.1208 22  PHE B C   
2192 O O   . PHE B 10  ? 1.3799 0.9538 1.9037 0.2587  -0.1692 -0.1461 22  PHE B O   
2193 C CB  . PHE B 10  ? 1.4776 0.9891 2.0493 0.3164  -0.2271 -0.1244 22  PHE B CB  
2194 C CG  . PHE B 10  ? 1.4376 1.0318 2.0162 0.3228  -0.2089 -0.1453 22  PHE B CG  
2195 C CD1 . PHE B 10  ? 1.4686 1.1033 2.0889 0.3467  -0.2059 -0.1888 22  PHE B CD1 
2196 C CD2 . PHE B 10  ? 1.4234 1.0544 1.9674 0.3046  -0.1953 -0.1216 22  PHE B CD2 
2197 C CE1 . PHE B 10  ? 1.4281 1.1392 2.0528 0.3497  -0.1883 -0.2067 22  PHE B CE1 
2198 C CE2 . PHE B 10  ? 1.4089 1.1126 1.9586 0.3089  -0.1795 -0.1393 22  PHE B CE2 
2199 C CZ  . PHE B 10  ? 1.3770 1.1204 1.9660 0.3302  -0.1757 -0.1808 22  PHE B CZ  
2200 N N   . THR B 11  ? 1.3706 0.8559 1.8564 0.2396  -0.1914 -0.0806 23  THR B N   
2201 C CA  . THR B 11  ? 1.3128 0.8225 1.7618 0.2089  -0.1696 -0.0657 23  THR B CA  
2202 C C   . THR B 11  ? 1.2737 0.8419 1.7068 0.2093  -0.1592 -0.0567 23  THR B C   
2203 O O   . THR B 11  ? 1.2820 0.8478 1.7131 0.2212  -0.1724 -0.0382 23  THR B O   
2204 C CB  . THR B 11  ? 1.4416 0.8940 1.8609 0.1836  -0.1747 -0.0293 23  THR B CB  
2205 O OG1 . THR B 11  ? 1.4816 0.8820 1.9178 0.1818  -0.1832 -0.0408 23  THR B OG1 
2206 C CG2 . THR B 11  ? 1.3801 0.8590 1.7648 0.1528  -0.1528 -0.0150 23  THR B CG2 
2207 N N   . VAL B 12  ? 1.1416 0.7616 1.5638 0.1965  -0.1367 -0.0707 24  VAL B N   
2208 C CA  . VAL B 12  ? 1.0686 0.7418 1.4717 0.1914  -0.1246 -0.0615 24  VAL B CA  
2209 C C   . VAL B 12  ? 1.0476 0.7266 1.4162 0.1616  -0.1084 -0.0446 24  VAL B C   
2210 O O   . VAL B 12  ? 1.0324 0.7148 1.4011 0.1494  -0.0973 -0.0602 24  VAL B O   
2211 C CB  . VAL B 12  ? 1.0778 0.8130 1.5014 0.2060  -0.1140 -0.0947 24  VAL B CB  
2212 C CG1 . VAL B 12  ? 1.0273 0.8112 1.4301 0.1991  -0.1034 -0.0823 24  VAL B CG1 
2213 C CG2 . VAL B 12  ? 1.1030 0.8369 1.5654 0.2363  -0.1293 -0.1150 24  VAL B CG2 
2214 N N   . ARG B 13  ? 0.9616 0.6418 1.3023 0.1506  -0.1082 -0.0138 25  ARG B N   
2215 C CA  . ARG B 13  ? 0.9159 0.6118 1.2259 0.1253  -0.0924 0.0011  25  ARG B CA  
2216 C C   . ARG B 13  ? 0.8852 0.6427 1.1924 0.1264  -0.0781 -0.0133 25  ARG B C   
2217 O O   . ARG B 13  ? 0.8617 0.6458 1.1724 0.1393  -0.0815 -0.0124 25  ARG B O   
2218 C CB  . ARG B 13  ? 0.9316 0.6035 1.2134 0.1141  -0.0986 0.0379  25  ARG B CB  
2219 C CG  . ARG B 13  ? 1.0593 0.7339 1.3120 0.0862  -0.0841 0.0537  25  ARG B CG  
2220 C CD  . ARG B 13  ? 1.2707 0.9170 1.4953 0.0744  -0.0906 0.0885  25  ARG B CD  
2221 N NE  . ARG B 13  ? 1.5312 1.1180 1.7578 0.0727  -0.1052 0.1019  25  ARG B NE  
2222 C CZ  . ARG B 13  ? 1.7755 1.3267 1.9783 0.0634  -0.1151 0.1330  25  ARG B CZ  
2223 N NH1 . ARG B 13  ? 1.6792 1.1731 1.8840 0.0612  -0.1293 0.1448  25  ARG B NH1 
2224 N NH2 . ARG B 13  ? 1.6045 1.1756 1.7798 0.0558  -0.1114 0.1527  25  ARG B NH2 
2225 N N   . ILE B 14  ? 0.8010 0.5801 1.1030 0.1130  -0.0633 -0.0274 26  ILE B N   
2226 C CA  . ILE B 14  ? 0.7382 0.5702 1.0316 0.1096  -0.0500 -0.0370 26  ILE B CA  
2227 C C   . ILE B 14  ? 0.7514 0.5877 1.0174 0.0871  -0.0400 -0.0191 26  ILE B C   
2228 O O   . ILE B 14  ? 0.7424 0.5621 1.0051 0.0729  -0.0355 -0.0206 26  ILE B O   
2229 C CB  . ILE B 14  ? 0.7602 0.6200 1.0706 0.1153  -0.0426 -0.0709 26  ILE B CB  
2230 C CG1 . ILE B 14  ? 0.7807 0.6404 1.1224 0.1392  -0.0515 -0.0932 26  ILE B CG1 
2231 C CG2 . ILE B 14  ? 0.7173 0.6275 1.0129 0.1076  -0.0294 -0.0768 26  ILE B CG2 
2232 C CD1 . ILE B 14  ? 0.8266 0.7159 1.1775 0.1557  -0.0555 -0.0932 26  ILE B CD1 
2233 N N   . VAL B 15  ? 0.6811 0.5409 0.9295 0.0840  -0.0369 -0.0039 27  VAL B N   
2234 C CA  . VAL B 15  ? 0.6494 0.5161 0.8736 0.0649  -0.0280 0.0118  27  VAL B CA  
2235 C C   . VAL B 15  ? 0.6642 0.5746 0.8835 0.0616  -0.0175 -0.0013 27  VAL B C   
2236 O O   . VAL B 15  ? 0.6485 0.5873 0.8680 0.0703  -0.0174 -0.0045 27  VAL B O   
2237 C CB  . VAL B 15  ? 0.6949 0.5517 0.9002 0.0617  -0.0327 0.0391  27  VAL B CB  
2238 C CG1 . VAL B 15  ? 0.6724 0.5401 0.8548 0.0428  -0.0223 0.0513  27  VAL B CG1 
2239 C CG2 . VAL B 15  ? 0.7367 0.5462 0.9429 0.0632  -0.0446 0.0545  27  VAL B CG2 
2240 N N   . THR B 16  ? 0.6091 0.5242 0.8248 0.0488  -0.0097 -0.0093 28  THR B N   
2241 C CA  . THR B 16  ? 0.5766 0.5276 0.7826 0.0426  -0.0015 -0.0168 28  THR B CA  
2242 C C   . THR B 16  ? 0.6435 0.5963 0.8304 0.0290  0.0028  0.0021  28  THR B C   
2243 O O   . THR B 16  ? 0.6658 0.5938 0.8469 0.0232  0.0010  0.0185  28  THR B O   
2244 C CB  . THR B 16  ? 0.5883 0.5461 0.8027 0.0386  0.0021  -0.0384 28  THR B CB  
2245 O OG1 . THR B 16  ? 0.5979 0.5341 0.8121 0.0251  0.0037  -0.0340 28  THR B OG1 
2246 C CG2 . THR B 16  ? 0.5201 0.4747 0.7543 0.0519  -0.0016 -0.0596 28  THR B CG2 
2247 N N   . MET B 17  ? 0.5814 0.5625 0.7580 0.0237  0.0081  -0.0003 29  MET B N   
2248 C CA  . MET B 17  ? 0.5733 0.5582 0.7354 0.0118  0.0123  0.0130  29  MET B CA  
2249 C C   . MET B 17  ? 0.6824 0.6496 0.8484 -0.0009 0.0156  0.0131  29  MET B C   
2250 O O   . MET B 17  ? 0.6967 0.6580 0.8538 -0.0108 0.0191  0.0261  29  MET B O   
2251 C CB  . MET B 17  ? 0.5681 0.5833 0.7214 0.0095  0.0151  0.0079  29  MET B CB  
2252 C CG  . MET B 17  ? 0.5923 0.6267 0.7391 0.0176  0.0131  0.0102  29  MET B CG  
2253 S SD  . MET B 17  ? 0.6389 0.6678 0.7753 0.0199  0.0104  0.0303  29  MET B SD  
2254 C CE  . MET B 17  ? 0.5880 0.6162 0.7104 0.0065  0.0151  0.0405  29  MET B CE  
2255 N N   . ASP B 18  ? 0.6543 0.6152 0.8342 -0.0014 0.0150  -0.0027 30  ASP B N   
2256 C CA  . ASP B 18  ? 0.6661 0.6123 0.8540 -0.0138 0.0176  -0.0066 30  ASP B CA  
2257 C C   . ASP B 18  ? 0.7564 0.6657 0.9481 -0.0178 0.0154  0.0042  30  ASP B C   
2258 O O   . ASP B 18  ? 0.7766 0.6744 0.9639 -0.0321 0.0198  0.0151  30  ASP B O   
2259 C CB  . ASP B 18  ? 0.6884 0.6415 0.8895 -0.0118 0.0161  -0.0292 30  ASP B CB  
2260 C CG  . ASP B 18  ? 0.7885 0.7735 0.9846 -0.0125 0.0172  -0.0398 30  ASP B CG  
2261 O OD1 . ASP B 18  ? 0.7893 0.7837 0.9844 -0.0226 0.0197  -0.0388 30  ASP B OD1 
2262 O OD2 . ASP B 18  ? 0.9073 0.9077 1.1019 -0.0033 0.0151  -0.0509 30  ASP B OD2 
2263 N N   . ALA B 19  ? 0.7061 0.5969 0.9068 -0.0056 0.0084  0.0003  31  ALA B N   
2264 C CA  . ALA B 19  ? 0.7363 0.5871 0.9443 -0.0089 0.0036  0.0061  31  ALA B CA  
2265 C C   . ALA B 19  ? 0.7971 0.6281 1.0087 0.0073  -0.0064 0.0119  31  ALA B C   
2266 O O   . ALA B 19  ? 0.7603 0.6121 0.9752 0.0226  -0.0091 0.0043  31  ALA B O   
2267 C CB  . ALA B 19  ? 0.7588 0.6007 0.9844 -0.0127 0.0034  -0.0142 31  ALA B CB  
2268 N N   . GLU B 20  ? 0.8082 0.5987 1.0193 0.0026  -0.0123 0.0262  32  GLU B N   
2269 C CA  . GLU B 20  ? 0.8460 0.6054 1.0646 0.0169  -0.0253 0.0318  32  GLU B CA  
2270 C C   . GLU B 20  ? 0.9213 0.6606 1.1637 0.0227  -0.0302 0.0104  32  GLU B C   
2271 O O   . GLU B 20  ? 0.9434 0.6606 1.1891 0.0077  -0.0279 0.0090  32  GLU B O   
2272 C CB  . GLU B 20  ? 0.9018 0.6253 1.1028 0.0049  -0.0295 0.0607  32  GLU B CB  
2273 C CG  . GLU B 20  ? 1.1337 0.8233 1.3369 0.0193  -0.0458 0.0734  32  GLU B CG  
2274 C CD  . GLU B 20  ? 1.5699 1.2345 1.7466 0.0068  -0.0493 0.1052  32  GLU B CD  
2275 O OE1 . GLU B 20  ? 1.6177 1.2555 1.7840 -0.0141 -0.0455 0.1173  32  GLU B OE1 
2276 O OE2 . GLU B 20  ? 1.5476 1.2210 1.7131 0.0168  -0.0559 0.1177  32  GLU B OE2 
2277 N N   . MET B 21  ? 0.8739 0.6240 1.1338 0.0434  -0.0359 -0.0085 33  MET B N   
2278 C CA  . MET B 21  ? 0.8883 0.6236 1.1722 0.0513  -0.0403 -0.0336 33  MET B CA  
2279 C C   . MET B 21  ? 0.9603 0.6627 1.2610 0.0704  -0.0557 -0.0335 33  MET B C   
2280 O O   . MET B 21  ? 0.9398 0.6449 1.2361 0.0819  -0.0624 -0.0196 33  MET B O   
2281 C CB  . MET B 21  ? 0.8867 0.6671 1.1793 0.0591  -0.0328 -0.0621 33  MET B CB  
2282 C CG  . MET B 21  ? 0.9023 0.7146 1.1796 0.0426  -0.0207 -0.0630 33  MET B CG  
2283 S SD  . MET B 21  ? 0.9263 0.7884 1.2076 0.0504  -0.0139 -0.0925 33  MET B SD  
2284 C CE  . MET B 21  ? 0.8550 0.7433 1.1153 0.0307  -0.0043 -0.0832 33  MET B CE  
2285 N N   . GLU B 22  ? 0.9619 0.6322 1.2830 0.0741  -0.0625 -0.0497 34  GLU B N   
2286 C CA  . GLU B 22  ? 1.0041 0.6420 1.3465 0.0951  -0.0789 -0.0544 34  GLU B CA  
2287 C C   . GLU B 22  ? 1.0551 0.7007 1.4262 0.1094  -0.0798 -0.0922 34  GLU B C   
2288 O O   . GLU B 22  ? 1.0545 0.6965 1.4297 0.0976  -0.0738 -0.1085 34  GLU B O   
2289 C CB  . GLU B 22  ? 1.0771 0.6516 1.4146 0.0860  -0.0913 -0.0303 34  GLU B CB  
2290 C CG  . GLU B 22  ? 1.2683 0.8311 1.5853 0.0866  -0.0991 0.0036  34  GLU B CG  
2291 C CD  . GLU B 22  ? 1.6757 1.1798 1.9769 0.0714  -0.1091 0.0343  34  GLU B CD  
2292 O OE1 . GLU B 22  ? 1.6727 1.1725 1.9497 0.0663  -0.1124 0.0633  34  GLU B OE1 
2293 O OE2 . GLU B 22  ? 1.6774 1.1395 1.9887 0.0632  -0.1139 0.0296  34  GLU B OE2 
2294 N N   . PHE B 23  ? 1.0108 0.6709 1.4022 0.1347  -0.0870 -0.1075 35  PHE B N   
2295 C CA  . PHE B 23  ? 1.0169 0.6902 1.4376 0.1521  -0.0878 -0.1462 35  PHE B CA  
2296 C C   . PHE B 23  ? 1.1348 0.7709 1.5839 0.1761  -0.1071 -0.1517 35  PHE B C   
2297 O O   . PHE B 23  ? 1.1343 0.7554 1.5805 0.1851  -0.1186 -0.1283 35  PHE B O   
2298 C CB  . PHE B 23  ? 0.9887 0.7287 1.4095 0.1603  -0.0753 -0.1652 35  PHE B CB  
2299 C CG  . PHE B 23  ? 0.9582 0.7364 1.3533 0.1395  -0.0582 -0.1636 35  PHE B CG  
2300 C CD1 . PHE B 23  ? 0.9853 0.7809 1.3829 0.1323  -0.0494 -0.1903 35  PHE B CD1 
2301 C CD2 . PHE B 23  ? 0.9481 0.7451 1.3170 0.1282  -0.0523 -0.1364 35  PHE B CD2 
2302 C CE1 . PHE B 23  ? 0.9596 0.7893 1.3339 0.1146  -0.0364 -0.1881 35  PHE B CE1 
2303 C CE2 . PHE B 23  ? 0.9466 0.7766 1.2941 0.1109  -0.0387 -0.1356 35  PHE B CE2 
2304 C CZ  . PHE B 23  ? 0.9169 0.7624 1.2673 0.1045  -0.0316 -0.1606 35  PHE B CZ  
2305 N N   . ASN B 24  ? 1.1484 0.7681 1.6251 0.1869  -0.1119 -0.1832 36  ASN B N   
2306 C CA  . ASN B 24  ? 1.1999 0.7912 1.7105 0.2143  -0.1303 -0.1971 36  ASN B CA  
2307 C C   . ASN B 24  ? 1.2324 0.8822 1.7656 0.2369  -0.1243 -0.2293 36  ASN B C   
2308 O O   . ASN B 24  ? 1.2187 0.9003 1.7626 0.2381  -0.1128 -0.2643 36  ASN B O   
2309 C CB  . ASN B 24  ? 1.2776 0.8159 1.8082 0.2144  -0.1400 -0.2145 36  ASN B CB  
2310 C CG  . ASN B 24  ? 1.5991 1.0740 2.1107 0.1933  -0.1488 -0.1803 36  ASN B CG  
2311 O OD1 . ASN B 24  ? 1.5353 0.9664 2.0448 0.1990  -0.1660 -0.1528 36  ASN B OD1 
2312 N ND2 . ASN B 24  ? 1.4974 0.9679 1.9937 0.1674  -0.1373 -0.1809 36  ASN B ND2 
2313 N N   . CYS B 25  ? 1.1789 0.8464 1.7167 0.2523  -0.1311 -0.2167 37  CYS B N   
2314 C CA  . CYS B 25  ? 1.1528 0.8788 1.7126 0.2726  -0.1256 -0.2433 37  CYS B CA  
2315 C C   . CYS B 25  ? 1.2599 0.9647 1.8649 0.3037  -0.1436 -0.2684 37  CYS B C   
2316 O O   . CYS B 25  ? 1.2982 0.9528 1.9117 0.3145  -0.1652 -0.2476 37  CYS B O   
2317 C CB  . CYS B 25  ? 1.1185 0.8769 1.6605 0.2712  -0.1235 -0.2166 37  CYS B CB  
2318 S SG  . CYS B 25  ? 1.1338 0.9693 1.7012 0.2918  -0.1151 -0.2461 37  CYS B SG  
2319 N N   . GLU B 26  ? 1.2191 0.9613 1.8525 0.3178  -0.1354 -0.3134 38  GLU B N   
2320 C CA  . GLU B 26  ? 1.2611 0.9927 1.9429 0.3500  -0.1507 -0.3449 38  GLU B CA  
2321 C C   . GLU B 26  ? 1.3130 1.0654 2.0143 0.3724  -0.1627 -0.3357 38  GLU B C   
2322 O O   . GLU B 26  ? 1.2639 1.0659 1.9470 0.3645  -0.1509 -0.3227 38  GLU B O   
2323 C CB  . GLU B 26  ? 1.2716 1.0503 1.9761 0.3577  -0.1353 -0.3970 38  GLU B CB  
2324 C CG  . GLU B 26  ? 1.4195 1.1645 2.1197 0.3449  -0.1321 -0.4145 38  GLU B CG  
2325 C CD  . GLU B 26  ? 1.6544 1.4394 2.3799 0.3555  -0.1204 -0.4689 38  GLU B CD  
2326 O OE1 . GLU B 26  ? 1.5291 1.3490 2.2300 0.3350  -0.1005 -0.4811 38  GLU B OE1 
2327 O OE2 . GLU B 26  ? 1.6281 1.4094 2.3979 0.3844  -0.1317 -0.5002 38  GLU B OE2 
2328 N N   . MET B 27  ? 1.3208 1.0340 2.0596 0.4003  -0.1874 -0.3427 39  MET B N   
2329 C CA  . MET B 27  ? 1.3281 1.0493 2.0884 0.4237  -0.2052 -0.3311 39  MET B CA  
2330 C C   . MET B 27  ? 1.3124 1.1201 2.0934 0.4357  -0.1902 -0.3586 39  MET B C   
2331 O O   . MET B 27  ? 1.2775 1.1118 2.0519 0.4374  -0.1931 -0.3373 39  MET B O   
2332 C CB  . MET B 27  ? 1.4300 1.0947 2.2335 0.4545  -0.2354 -0.3423 39  MET B CB  
2333 C CG  . MET B 27  ? 1.5350 1.1086 2.3179 0.4437  -0.2555 -0.3069 39  MET B CG  
2334 S SD  . MET B 27  ? 1.5931 1.1377 2.3295 0.4261  -0.2669 -0.2421 39  MET B SD  
2335 C CE  . MET B 27  ? 1.6219 1.0621 2.3403 0.4123  -0.2866 -0.2135 39  MET B CE  
2336 N N   . LYS B 28  ? 1.2522 1.1044 2.0565 0.4420  -0.1738 -0.4058 40  LYS B N   
2337 C CA  . LYS B 28  ? 1.2118 1.1469 2.0405 0.4537  -0.1590 -0.4372 40  LYS B CA  
2338 C C   . LYS B 28  ? 1.1876 1.1823 1.9767 0.4238  -0.1279 -0.4363 40  LYS B C   
2339 O O   . LYS B 28  ? 1.1551 1.2212 1.9582 0.4273  -0.1114 -0.4632 40  LYS B O   
2340 C CB  . LYS B 28  ? 1.2728 1.2241 2.1546 0.4813  -0.1608 -0.4923 40  LYS B CB  
2341 C CG  . LYS B 28  ? 1.4850 1.4172 2.4193 0.5189  -0.1890 -0.5012 40  LYS B CG  
2342 C CD  . LYS B 28  ? 1.6324 1.5834 2.6220 0.5470  -0.1897 -0.5599 40  LYS B CD  
2343 C CE  . LYS B 28  ? 1.7563 1.7126 2.8043 0.5865  -0.2138 -0.5761 40  LYS B CE  
2344 N NZ  . LYS B 28  ? 1.8808 1.8772 2.9844 0.6127  -0.2081 -0.6393 40  LYS B NZ  
2345 N N   . TRP B 29  ? 1.1114 1.0770 1.8519 0.3941  -0.1207 -0.4046 41  TRP B N   
2346 C CA  . TRP B 29  ? 1.0513 1.0623 1.7509 0.3652  -0.0953 -0.3981 41  TRP B CA  
2347 C C   . TRP B 29  ? 1.0376 1.0937 1.7233 0.3592  -0.0895 -0.3760 41  TRP B C   
2348 O O   . TRP B 29  ? 1.0322 1.0634 1.7169 0.3653  -0.1059 -0.3454 41  TRP B O   
2349 C CB  . TRP B 29  ? 1.0291 0.9934 1.6858 0.3380  -0.0929 -0.3691 41  TRP B CB  
2350 C CG  . TRP B 29  ? 1.0497 1.0069 1.7025 0.3283  -0.0828 -0.3962 41  TRP B CG  
2351 C CD1 . TRP B 29  ? 1.1068 1.0827 1.7911 0.3434  -0.0789 -0.4428 41  TRP B CD1 
2352 C CD2 . TRP B 29  ? 1.0409 0.9714 1.6570 0.3015  -0.0760 -0.3794 41  TRP B CD2 
2353 N NE1 . TRP B 29  ? 1.1064 1.0680 1.7735 0.3267  -0.0704 -0.4555 41  TRP B NE1 
2354 C CE