data_3UDB
# 
_entry.id   3UDB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3UDB         
RCSB  RCSB068610   
WWPDB D_1000068610 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3UDB 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xie, T.'  1 
'Ren, R.'  2 
'Pang, Y.' 3 
'Yan, C.'  4 
# 
_citation.id                        primary 
_citation.title                     
;Molecular mechanism for the inhibition of a critical component in the Arabidopsis thaliana abscisic acid signal transduction pathways, SnRK2.6, by the protein phosphatase ABI1
;
_citation.journal_abbrev            'to be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xie, T.'  1 
primary 'Ren, R.'  2 
primary 'Pang, Y.' 3 
primary 'Yan, C.'  4 
# 
_cell.entry_id           3UDB 
_cell.length_a           228.094 
_cell.length_b           98.793 
_cell.length_c           113.103 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.48 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3UDB 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase SRK2E' 35980.152 6   2.7.11.1 S7A/S29A/S43A/C131A/C137A/C159A/S166A/T176A 
'residues 1-317' ? 
2 non-polymer syn 'CHLORIDE ION'                          35.453    6   ?        ?                                           ? ? 
3 water       nat water                                   18.015    129 ?        ?                                           ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein OPEN STOMATA 1, SNF1-related kinase 2.6, SnRK2.6, Serine/threonine-protein kinase OST1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRPAVAGPMDLPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIAD
FGYSKASVLHSQPKSAVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRPAVAGPMDLPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIAD
FGYSKASVLHSQPKSAVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATV
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ARG n 
1 4   PRO n 
1 5   ALA n 
1 6   VAL n 
1 7   ALA n 
1 8   GLY n 
1 9   PRO n 
1 10  MET n 
1 11  ASP n 
1 12  LEU n 
1 13  PRO n 
1 14  ILE n 
1 15  MET n 
1 16  HIS n 
1 17  ASP n 
1 18  SER n 
1 19  ASP n 
1 20  ARG n 
1 21  TYR n 
1 22  GLU n 
1 23  LEU n 
1 24  VAL n 
1 25  LYS n 
1 26  ASP n 
1 27  ILE n 
1 28  GLY n 
1 29  ALA n 
1 30  GLY n 
1 31  ASN n 
1 32  PHE n 
1 33  GLY n 
1 34  VAL n 
1 35  ALA n 
1 36  ARG n 
1 37  LEU n 
1 38  MET n 
1 39  ARG n 
1 40  ASP n 
1 41  LYS n 
1 42  GLN n 
1 43  ALA n 
1 44  ASN n 
1 45  GLU n 
1 46  LEU n 
1 47  VAL n 
1 48  ALA n 
1 49  VAL n 
1 50  LYS n 
1 51  TYR n 
1 52  ILE n 
1 53  GLU n 
1 54  ARG n 
1 55  GLY n 
1 56  GLU n 
1 57  LYS n 
1 58  ILE n 
1 59  ASP n 
1 60  GLU n 
1 61  ASN n 
1 62  VAL n 
1 63  LYS n 
1 64  ARG n 
1 65  GLU n 
1 66  ILE n 
1 67  ILE n 
1 68  ASN n 
1 69  HIS n 
1 70  ARG n 
1 71  SER n 
1 72  LEU n 
1 73  ARG n 
1 74  HIS n 
1 75  PRO n 
1 76  ASN n 
1 77  ILE n 
1 78  VAL n 
1 79  ARG n 
1 80  PHE n 
1 81  LYS n 
1 82  GLU n 
1 83  VAL n 
1 84  ILE n 
1 85  LEU n 
1 86  THR n 
1 87  PRO n 
1 88  THR n 
1 89  HIS n 
1 90  LEU n 
1 91  ALA n 
1 92  ILE n 
1 93  VAL n 
1 94  MET n 
1 95  GLU n 
1 96  TYR n 
1 97  ALA n 
1 98  SER n 
1 99  GLY n 
1 100 GLY n 
1 101 GLU n 
1 102 LEU n 
1 103 PHE n 
1 104 GLU n 
1 105 ARG n 
1 106 ILE n 
1 107 CYS n 
1 108 ASN n 
1 109 ALA n 
1 110 GLY n 
1 111 ARG n 
1 112 PHE n 
1 113 SER n 
1 114 GLU n 
1 115 ASP n 
1 116 GLU n 
1 117 ALA n 
1 118 ARG n 
1 119 PHE n 
1 120 PHE n 
1 121 PHE n 
1 122 GLN n 
1 123 GLN n 
1 124 LEU n 
1 125 ILE n 
1 126 SER n 
1 127 GLY n 
1 128 VAL n 
1 129 SER n 
1 130 TYR n 
1 131 ALA n 
1 132 HIS n 
1 133 ALA n 
1 134 MET n 
1 135 GLN n 
1 136 VAL n 
1 137 ALA n 
1 138 HIS n 
1 139 ARG n 
1 140 ASP n 
1 141 LEU n 
1 142 LYS n 
1 143 LEU n 
1 144 GLU n 
1 145 ASN n 
1 146 THR n 
1 147 LEU n 
1 148 LEU n 
1 149 ASP n 
1 150 GLY n 
1 151 SER n 
1 152 PRO n 
1 153 ALA n 
1 154 PRO n 
1 155 ARG n 
1 156 LEU n 
1 157 LYS n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 PHE n 
1 162 GLY n 
1 163 TYR n 
1 164 SER n 
1 165 LYS n 
1 166 ALA n 
1 167 SER n 
1 168 VAL n 
1 169 LEU n 
1 170 HIS n 
1 171 SER n 
1 172 GLN n 
1 173 PRO n 
1 174 LYS n 
1 175 SER n 
1 176 ALA n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 ALA n 
1 182 TYR n 
1 183 ILE n 
1 184 ALA n 
1 185 PRO n 
1 186 GLU n 
1 187 VAL n 
1 188 LEU n 
1 189 LEU n 
1 190 LYS n 
1 191 LYS n 
1 192 GLU n 
1 193 TYR n 
1 194 ASP n 
1 195 GLY n 
1 196 LYS n 
1 197 VAL n 
1 198 ALA n 
1 199 ASP n 
1 200 VAL n 
1 201 TRP n 
1 202 SER n 
1 203 CYS n 
1 204 GLY n 
1 205 VAL n 
1 206 THR n 
1 207 LEU n 
1 208 TYR n 
1 209 VAL n 
1 210 MET n 
1 211 LEU n 
1 212 VAL n 
1 213 GLY n 
1 214 ALA n 
1 215 TYR n 
1 216 PRO n 
1 217 PHE n 
1 218 GLU n 
1 219 ASP n 
1 220 PRO n 
1 221 GLU n 
1 222 GLU n 
1 223 PRO n 
1 224 LYS n 
1 225 ASN n 
1 226 PHE n 
1 227 ARG n 
1 228 LYS n 
1 229 THR n 
1 230 ILE n 
1 231 HIS n 
1 232 ARG n 
1 233 ILE n 
1 234 LEU n 
1 235 ASN n 
1 236 VAL n 
1 237 GLN n 
1 238 TYR n 
1 239 ALA n 
1 240 ILE n 
1 241 PRO n 
1 242 ASP n 
1 243 TYR n 
1 244 VAL n 
1 245 HIS n 
1 246 ILE n 
1 247 SER n 
1 248 PRO n 
1 249 GLU n 
1 250 CYS n 
1 251 ARG n 
1 252 HIS n 
1 253 LEU n 
1 254 ILE n 
1 255 SER n 
1 256 ARG n 
1 257 ILE n 
1 258 PHE n 
1 259 VAL n 
1 260 ALA n 
1 261 ASP n 
1 262 PRO n 
1 263 ALA n 
1 264 LYS n 
1 265 ARG n 
1 266 ILE n 
1 267 SER n 
1 268 ILE n 
1 269 PRO n 
1 270 GLU n 
1 271 ILE n 
1 272 ARG n 
1 273 ASN n 
1 274 HIS n 
1 275 GLU n 
1 276 TRP n 
1 277 PHE n 
1 278 LEU n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 PRO n 
1 283 ALA n 
1 284 ASP n 
1 285 LEU n 
1 286 MET n 
1 287 ASN n 
1 288 ASP n 
1 289 ASN n 
1 290 THR n 
1 291 MET n 
1 292 THR n 
1 293 THR n 
1 294 GLN n 
1 295 PHE n 
1 296 ASP n 
1 297 GLU n 
1 298 SER n 
1 299 ASP n 
1 300 GLN n 
1 301 PRO n 
1 302 GLY n 
1 303 GLN n 
1 304 SER n 
1 305 ILE n 
1 306 GLU n 
1 307 GLU n 
1 308 ILE n 
1 309 MET n 
1 310 GLN n 
1 311 ILE n 
1 312 ILE n 
1 313 ALA n 
1 314 GLU n 
1 315 ALA n 
1 316 THR n 
1 317 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               thale-cress 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SNRK2.6 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SRK2E_ARATH 
_struct_ref.pdbx_db_accession          Q940H6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDRPAVSGPMDLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICD
FGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3UDB A 1 ? 317 ? Q940H6 1 ? 317 ? 1 317 
2 1 3UDB B 1 ? 317 ? Q940H6 1 ? 317 ? 1 317 
3 1 3UDB C 1 ? 317 ? Q940H6 1 ? 317 ? 1 317 
4 1 3UDB D 1 ? 317 ? Q940H6 1 ? 317 ? 1 317 
5 1 3UDB E 1 ? 317 ? Q940H6 1 ? 317 ? 1 317 
6 1 3UDB F 1 ? 317 ? Q940H6 1 ? 317 ? 1 317 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3UDB ALA A 7   ? UNP Q940H6 SER 7   'ENGINEERED MUTATION' 7   1  
1 3UDB ALA A 29  ? UNP Q940H6 SER 29  'ENGINEERED MUTATION' 29  2  
1 3UDB ALA A 43  ? UNP Q940H6 SER 43  'ENGINEERED MUTATION' 43  3  
1 3UDB ALA A 131 ? UNP Q940H6 CYS 131 'ENGINEERED MUTATION' 131 4  
1 3UDB ALA A 137 ? UNP Q940H6 CYS 137 'ENGINEERED MUTATION' 137 5  
1 3UDB ALA A 159 ? UNP Q940H6 CYS 159 'ENGINEERED MUTATION' 159 6  
1 3UDB ALA A 166 ? UNP Q940H6 SER 166 'ENGINEERED MUTATION' 166 7  
1 3UDB ALA A 176 ? UNP Q940H6 THR 176 'ENGINEERED MUTATION' 176 8  
2 3UDB ALA B 7   ? UNP Q940H6 SER 7   'ENGINEERED MUTATION' 7   9  
2 3UDB ALA B 29  ? UNP Q940H6 SER 29  'ENGINEERED MUTATION' 29  10 
2 3UDB ALA B 43  ? UNP Q940H6 SER 43  'ENGINEERED MUTATION' 43  11 
2 3UDB ALA B 131 ? UNP Q940H6 CYS 131 'ENGINEERED MUTATION' 131 12 
2 3UDB ALA B 137 ? UNP Q940H6 CYS 137 'ENGINEERED MUTATION' 137 13 
2 3UDB ALA B 159 ? UNP Q940H6 CYS 159 'ENGINEERED MUTATION' 159 14 
2 3UDB ALA B 166 ? UNP Q940H6 SER 166 'ENGINEERED MUTATION' 166 15 
2 3UDB ALA B 176 ? UNP Q940H6 THR 176 'ENGINEERED MUTATION' 176 16 
3 3UDB ALA C 7   ? UNP Q940H6 SER 7   'ENGINEERED MUTATION' 7   17 
3 3UDB ALA C 29  ? UNP Q940H6 SER 29  'ENGINEERED MUTATION' 29  18 
3 3UDB ALA C 43  ? UNP Q940H6 SER 43  'ENGINEERED MUTATION' 43  19 
3 3UDB ALA C 131 ? UNP Q940H6 CYS 131 'ENGINEERED MUTATION' 131 20 
3 3UDB ALA C 137 ? UNP Q940H6 CYS 137 'ENGINEERED MUTATION' 137 21 
3 3UDB ALA C 159 ? UNP Q940H6 CYS 159 'ENGINEERED MUTATION' 159 22 
3 3UDB ALA C 166 ? UNP Q940H6 SER 166 'ENGINEERED MUTATION' 166 23 
3 3UDB ALA C 176 ? UNP Q940H6 THR 176 'ENGINEERED MUTATION' 176 24 
4 3UDB ALA D 7   ? UNP Q940H6 SER 7   'ENGINEERED MUTATION' 7   25 
4 3UDB ALA D 29  ? UNP Q940H6 SER 29  'ENGINEERED MUTATION' 29  26 
4 3UDB ALA D 43  ? UNP Q940H6 SER 43  'ENGINEERED MUTATION' 43  27 
4 3UDB ALA D 131 ? UNP Q940H6 CYS 131 'ENGINEERED MUTATION' 131 28 
4 3UDB ALA D 137 ? UNP Q940H6 CYS 137 'ENGINEERED MUTATION' 137 29 
4 3UDB ALA D 159 ? UNP Q940H6 CYS 159 'ENGINEERED MUTATION' 159 30 
4 3UDB ALA D 166 ? UNP Q940H6 SER 166 'ENGINEERED MUTATION' 166 31 
4 3UDB ALA D 176 ? UNP Q940H6 THR 176 'ENGINEERED MUTATION' 176 32 
5 3UDB ALA E 7   ? UNP Q940H6 SER 7   'ENGINEERED MUTATION' 7   33 
5 3UDB ALA E 29  ? UNP Q940H6 SER 29  'ENGINEERED MUTATION' 29  34 
5 3UDB ALA E 43  ? UNP Q940H6 SER 43  'ENGINEERED MUTATION' 43  35 
5 3UDB ALA E 131 ? UNP Q940H6 CYS 131 'ENGINEERED MUTATION' 131 36 
5 3UDB ALA E 137 ? UNP Q940H6 CYS 137 'ENGINEERED MUTATION' 137 37 
5 3UDB ALA E 159 ? UNP Q940H6 CYS 159 'ENGINEERED MUTATION' 159 38 
5 3UDB ALA E 166 ? UNP Q940H6 SER 166 'ENGINEERED MUTATION' 166 39 
5 3UDB ALA E 176 ? UNP Q940H6 THR 176 'ENGINEERED MUTATION' 176 40 
6 3UDB ALA F 7   ? UNP Q940H6 SER 7   'ENGINEERED MUTATION' 7   41 
6 3UDB ALA F 29  ? UNP Q940H6 SER 29  'ENGINEERED MUTATION' 29  42 
6 3UDB ALA F 43  ? UNP Q940H6 SER 43  'ENGINEERED MUTATION' 43  43 
6 3UDB ALA F 131 ? UNP Q940H6 CYS 131 'ENGINEERED MUTATION' 131 44 
6 3UDB ALA F 137 ? UNP Q940H6 CYS 137 'ENGINEERED MUTATION' 137 45 
6 3UDB ALA F 159 ? UNP Q940H6 CYS 159 'ENGINEERED MUTATION' 159 46 
6 3UDB ALA F 166 ? UNP Q940H6 SER 166 'ENGINEERED MUTATION' 166 47 
6 3UDB ALA F 176 ? UNP Q940H6 THR 176 'ENGINEERED MUTATION' 176 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3UDB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.density_percent_sol   57.87 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '0.1M Tris, 19% PEG4000, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2010-12-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03887 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.03887 
# 
_reflns.entry_id                     3UDB 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.567 
_reflns.number_obs                   78271 
_reflns.number_all                   78743 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        49.750 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.58 
_reflns_shell.d_res_low                   2.67 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3UDB 
_refine.ls_number_reflns_obs                     78250 
_refine.ls_number_reflns_all                     78743 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.076 
_refine.ls_d_res_high                            2.567 
_refine.ls_percent_reflns_obs                    98.36 
_refine.ls_R_factor_obs                          0.2376 
_refine.ls_R_factor_all                          0.2378 
_refine.ls_R_factor_R_work                       0.2364 
_refine.ls_R_factor_R_free                       0.2594 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  3929 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               61.3777 
_refine.aniso_B[1][1]                            3.2037 
_refine.aniso_B[2][2]                            -9.3960 
_refine.aniso_B[3][3]                            6.7274 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -4.9171 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.291 
_refine.solvent_model_param_bsol                 36.958 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.72 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2FH9 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.82 
_refine.overall_FOM_work_R_set                   0.7649 
_refine.B_iso_max                                200.750 
_refine.B_iso_min                                16.210 
_refine.pdbx_overall_phase_error                 30.1600 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.450 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13030 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             129 
_refine_hist.number_atoms_total               13165 
_refine_hist.d_res_high                       2.567 
_refine_hist.d_res_low                        37.076 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           13338 0.010  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          18033 1.596  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     1992  0.104  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      2334  0.014  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 5035  20.491 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.5667 2.5980  28 71.0000  1934 . 0.3317 0.4232 . 88  . 2022 . 'X-RAY DIFFRACTION' . 
2.5980 2.6309  28 100.0000 2664 . 0.3505 0.3985 . 129 . 2793 . 'X-RAY DIFFRACTION' . 
2.6309 2.6655  28 100.0000 2687 . 0.3505 0.3877 . 143 . 2830 . 'X-RAY DIFFRACTION' . 
2.6655 2.7020  28 100.0000 2669 . 0.3350 0.3975 . 131 . 2800 . 'X-RAY DIFFRACTION' . 
2.7020 2.7406  28 100.0000 2684 . 0.3073 0.3689 . 138 . 2822 . 'X-RAY DIFFRACTION' . 
2.7406 2.7815  28 100.0000 2671 . 0.2927 0.3276 . 159 . 2830 . 'X-RAY DIFFRACTION' . 
2.7815 2.8249  28 100.0000 2693 . 0.2827 0.3382 . 156 . 2849 . 'X-RAY DIFFRACTION' . 
2.8249 2.8712  28 100.0000 2660 . 0.2770 0.3015 . 124 . 2784 . 'X-RAY DIFFRACTION' . 
2.8712 2.9207  28 100.0000 2682 . 0.2766 0.3108 . 136 . 2818 . 'X-RAY DIFFRACTION' . 
2.9207 2.9738  28 100.0000 2677 . 0.2757 0.3486 . 144 . 2821 . 'X-RAY DIFFRACTION' . 
2.9738 3.0309  28 100.0000 2697 . 0.2859 0.3107 . 136 . 2833 . 'X-RAY DIFFRACTION' . 
3.0309 3.0928  28 100.0000 2693 . 0.2717 0.3037 . 108 . 2801 . 'X-RAY DIFFRACTION' . 
3.0928 3.1600  28 100.0000 2689 . 0.2780 0.3167 . 135 . 2824 . 'X-RAY DIFFRACTION' . 
3.1600 3.2335  28 100.0000 2682 . 0.2761 0.2976 . 151 . 2833 . 'X-RAY DIFFRACTION' . 
3.2335 3.3143  28 100.0000 2695 . 0.2835 0.2774 . 128 . 2823 . 'X-RAY DIFFRACTION' . 
3.3143 3.4038  28 100.0000 2707 . 0.2725 0.3180 . 136 . 2843 . 'X-RAY DIFFRACTION' . 
3.4038 3.5039  28 100.0000 2657 . 0.2686 0.3044 . 155 . 2812 . 'X-RAY DIFFRACTION' . 
3.5039 3.6169  28 100.0000 2667 . 0.2574 0.2882 . 140 . 2807 . 'X-RAY DIFFRACTION' . 
3.6169 3.7461  28 99.0000  2707 . 0.2325 0.2599 . 133 . 2840 . 'X-RAY DIFFRACTION' . 
3.7461 3.8959  28 99.0000  2694 . 0.2154 0.2424 . 132 . 2826 . 'X-RAY DIFFRACTION' . 
3.8959 4.0730  28 99.0000  2657 . 0.2039 0.2378 . 149 . 2806 . 'X-RAY DIFFRACTION' . 
4.0730 4.2875  28 99.0000  2692 . 0.1876 0.2006 . 139 . 2831 . 'X-RAY DIFFRACTION' . 
4.2875 4.5556  28 99.0000  2683 . 0.1765 0.2168 . 152 . 2835 . 'X-RAY DIFFRACTION' . 
4.5556 4.9066  28 99.0000  2624 . 0.1713 0.1890 . 167 . 2791 . 'X-RAY DIFFRACTION' . 
4.9066 5.3991  28 99.0000  2702 . 0.2131 0.2519 . 160 . 2862 . 'X-RAY DIFFRACTION' . 
5.3991 6.1772  28 99.0000  2684 . 0.2472 0.2509 . 147 . 2831 . 'X-RAY DIFFRACTION' . 
6.1772 7.7708  28 99.0000  2680 . 0.2093 0.2097 . 158 . 2838 . 'X-RAY DIFFRACTION' . 
7.7708 37.0794 28 97.0000  2690 . 0.2122 0.2106 . 155 . 2845 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3UDB 
_struct.title                     'Crystal structure of SnRK2.6' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase SRK2E (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3UDB 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'SnRK2.6, kinase, ABA signaling pathway, ABI1, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 59  ? SER A 71  ? ASP A 59  SER A 71  1 ? 13 
HELX_P HELX_P2  2  GLU A 101 ? ALA A 109 ? GLU A 101 ALA A 109 1 ? 9  
HELX_P HELX_P3  3  SER A 113 ? MET A 134 ? SER A 113 MET A 134 1 ? 22 
HELX_P HELX_P4  4  LYS A 142 ? THR A 146 ? LYS A 142 THR A 146 5 ? 5  
HELX_P HELX_P5  5  THR A 179 ? ILE A 183 ? THR A 179 ILE A 183 5 ? 5  
HELX_P HELX_P6  6  ALA A 184 ? LYS A 190 ? ALA A 184 LYS A 190 1 ? 7  
HELX_P HELX_P7  7  ASP A 194 ? GLY A 213 ? ASP A 194 GLY A 213 1 ? 20 
HELX_P HELX_P8  8  PHE A 226 ? VAL A 236 ? PHE A 226 VAL A 236 1 ? 11 
HELX_P HELX_P9  9  SER A 247 ? PHE A 258 ? SER A 247 PHE A 258 1 ? 12 
HELX_P HELX_P10 10 SER A 267 ? ARG A 272 ? SER A 267 ARG A 272 1 ? 6  
HELX_P HELX_P11 11 HIS A 274 ? LYS A 279 ? HIS A 274 LYS A 279 1 ? 6  
HELX_P HELX_P12 12 SER A 304 ? THR A 316 ? SER A 304 THR A 316 1 ? 13 
HELX_P HELX_P13 13 ASP B 59  ? SER B 71  ? ASP B 59  SER B 71  1 ? 13 
HELX_P HELX_P14 14 GLU B 101 ? GLY B 110 ? GLU B 101 GLY B 110 1 ? 10 
HELX_P HELX_P15 15 SER B 113 ? MET B 134 ? SER B 113 MET B 134 1 ? 22 
HELX_P HELX_P16 16 LYS B 142 ? THR B 146 ? LYS B 142 THR B 146 5 ? 5  
HELX_P HELX_P17 17 ALA B 184 ? LYS B 190 ? ALA B 184 LYS B 190 1 ? 7  
HELX_P HELX_P18 18 ASP B 194 ? GLY B 213 ? ASP B 194 GLY B 213 1 ? 20 
HELX_P HELX_P19 19 ASN B 225 ? ASN B 235 ? ASN B 225 ASN B 235 1 ? 11 
HELX_P HELX_P20 20 SER B 247 ? PHE B 258 ? SER B 247 PHE B 258 1 ? 12 
HELX_P HELX_P21 21 SER B 267 ? ASN B 273 ? SER B 267 ASN B 273 1 ? 7  
HELX_P HELX_P22 22 HIS B 274 ? LYS B 279 ? HIS B 274 LYS B 279 1 ? 6  
HELX_P HELX_P23 23 SER B 304 ? THR B 316 ? SER B 304 THR B 316 1 ? 13 
HELX_P HELX_P24 24 GLY C 55  ? ILE C 58  ? GLY C 55  ILE C 58  5 ? 4  
HELX_P HELX_P25 25 ASP C 59  ? SER C 71  ? ASP C 59  SER C 71  1 ? 13 
HELX_P HELX_P26 26 GLU C 101 ? GLY C 110 ? GLU C 101 GLY C 110 1 ? 10 
HELX_P HELX_P27 27 SER C 113 ? MET C 134 ? SER C 113 MET C 134 1 ? 22 
HELX_P HELX_P28 28 LYS C 142 ? THR C 146 ? LYS C 142 THR C 146 5 ? 5  
HELX_P HELX_P29 29 ALA C 184 ? LYS C 190 ? ALA C 184 LYS C 190 1 ? 7  
HELX_P HELX_P30 30 ASP C 194 ? GLY C 213 ? ASP C 194 GLY C 213 1 ? 20 
HELX_P HELX_P31 31 ASN C 225 ? ASN C 235 ? ASN C 225 ASN C 235 1 ? 11 
HELX_P HELX_P32 32 SER C 247 ? PHE C 258 ? SER C 247 PHE C 258 1 ? 12 
HELX_P HELX_P33 33 ASP C 261 ? ARG C 265 ? ASP C 261 ARG C 265 5 ? 5  
HELX_P HELX_P34 34 SER C 267 ? ARG C 272 ? SER C 267 ARG C 272 1 ? 6  
HELX_P HELX_P35 35 HIS C 274 ? LYS C 279 ? HIS C 274 LYS C 279 1 ? 6  
HELX_P HELX_P36 36 SER C 304 ? VAL C 317 ? SER C 304 VAL C 317 1 ? 14 
HELX_P HELX_P37 37 ASP D 59  ? SER D 71  ? ASP D 59  SER D 71  1 ? 13 
HELX_P HELX_P38 38 GLU D 101 ? ALA D 109 ? GLU D 101 ALA D 109 1 ? 9  
HELX_P HELX_P39 39 SER D 113 ? GLN D 135 ? SER D 113 GLN D 135 1 ? 23 
HELX_P HELX_P40 40 THR D 179 ? ILE D 183 ? THR D 179 ILE D 183 5 ? 5  
HELX_P HELX_P41 41 ALA D 184 ? LYS D 190 ? ALA D 184 LYS D 190 1 ? 7  
HELX_P HELX_P42 42 ASP D 194 ? GLY D 213 ? ASP D 194 GLY D 213 1 ? 20 
HELX_P HELX_P43 43 ASN D 225 ? ASN D 235 ? ASN D 225 ASN D 235 1 ? 11 
HELX_P HELX_P44 44 SER D 247 ? PHE D 258 ? SER D 247 PHE D 258 1 ? 12 
HELX_P HELX_P45 45 SER D 267 ? ARG D 272 ? SER D 267 ARG D 272 1 ? 6  
HELX_P HELX_P46 46 HIS D 274 ? LYS D 279 ? HIS D 274 LYS D 279 1 ? 6  
HELX_P HELX_P47 47 ASP D 296 ? GLN D 300 ? ASP D 296 GLN D 300 5 ? 5  
HELX_P HELX_P48 48 SER D 304 ? VAL D 317 ? SER D 304 VAL D 317 1 ? 14 
HELX_P HELX_P49 49 ASN E 61  ? SER E 71  ? ASN E 61  SER E 71  1 ? 11 
HELX_P HELX_P50 50 GLU E 101 ? GLY E 110 ? GLU E 101 GLY E 110 1 ? 10 
HELX_P HELX_P51 51 SER E 113 ? MET E 134 ? SER E 113 MET E 134 1 ? 22 
HELX_P HELX_P52 52 GLY E 195 ? GLY E 213 ? GLY E 195 GLY E 213 1 ? 19 
HELX_P HELX_P53 53 ASN E 225 ? ASN E 235 ? ASN E 225 ASN E 235 1 ? 11 
HELX_P HELX_P54 54 SER E 247 ? PHE E 258 ? SER E 247 PHE E 258 1 ? 12 
HELX_P HELX_P55 55 SER E 267 ? ARG E 272 ? SER E 267 ARG E 272 1 ? 6  
HELX_P HELX_P56 56 HIS E 274 ? LYS E 279 ? HIS E 274 LYS E 279 1 ? 6  
HELX_P HELX_P57 57 PRO E 282 ? ASN E 287 ? PRO E 282 ASN E 287 1 ? 6  
HELX_P HELX_P58 58 GLU E 306 ? ALA E 315 ? GLU E 306 ALA E 315 1 ? 10 
HELX_P HELX_P59 59 ASP F 59  ? SER F 71  ? ASP F 59  SER F 71  1 ? 13 
HELX_P HELX_P60 60 GLU F 101 ? ALA F 109 ? GLU F 101 ALA F 109 1 ? 9  
HELX_P HELX_P61 61 SER F 113 ? MET F 134 ? SER F 113 MET F 134 1 ? 22 
HELX_P HELX_P62 62 LYS F 142 ? THR F 146 ? LYS F 142 THR F 146 5 ? 5  
HELX_P HELX_P63 63 THR F 179 ? ILE F 183 ? THR F 179 ILE F 183 5 ? 5  
HELX_P HELX_P64 64 ALA F 184 ? LYS F 190 ? ALA F 184 LYS F 190 1 ? 7  
HELX_P HELX_P65 65 ASP F 194 ? GLY F 213 ? ASP F 194 GLY F 213 1 ? 20 
HELX_P HELX_P66 66 ASN F 225 ? ASN F 235 ? ASN F 225 ASN F 235 1 ? 11 
HELX_P HELX_P67 67 SER F 247 ? PHE F 258 ? SER F 247 PHE F 258 1 ? 12 
HELX_P HELX_P68 68 ASP F 261 ? ARG F 265 ? ASP F 261 ARG F 265 5 ? 5  
HELX_P HELX_P69 69 SER F 267 ? ARG F 272 ? SER F 267 ARG F 272 1 ? 6  
HELX_P HELX_P70 70 HIS F 274 ? LYS F 279 ? HIS F 274 LYS F 279 1 ? 6  
HELX_P HELX_P71 71 SER F 304 ? ALA F 315 ? SER F 304 ALA F 315 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 219 B . ? ASP 219 B PRO 220 B ? PRO 220 B 1 -1.65  
2 ILE 27  C . ? ILE 27  C GLY 28  C ? GLY 28  C 1 0.25   
3 PRO 282 D . ? PRO 282 D ALA 283 D ? ALA 283 D 1 26.53  
4 GLN 300 D . ? GLN 300 D PRO 301 D ? PRO 301 D 1 -16.54 
5 GLY 302 E . ? GLY 302 E GLN 303 E ? GLN 303 E 1 0.08   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 5 ? 
D ? 2 ? 
E ? 5 ? 
F ? 2 ? 
G ? 5 ? 
H ? 2 ? 
I ? 5 ? 
J ? 2 ? 
K ? 5 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 21  ? ASP A 26  ? TYR A 21  ASP A 26  
A 2 ARG A 36  ? ASP A 40  ? ARG A 36  ASP A 40  
A 3 GLU A 45  ? GLU A 53  ? GLU A 45  GLU A 53  
A 4 HIS A 89  ? GLU A 95  ? HIS A 89  GLU A 95  
A 5 PHE A 80  ? THR A 86  ? PHE A 80  THR A 86  
B 1 LEU A 147 ? LEU A 148 ? LEU A 147 LEU A 148 
B 2 LEU A 156 ? LYS A 157 ? LEU A 156 LYS A 157 
C 1 TYR B 21  ? ILE B 27  ? TYR B 21  ILE B 27  
C 2 ALA B 35  ? ASP B 40  ? ALA B 35  ASP B 40  
C 3 GLU B 45  ? GLU B 53  ? GLU B 45  GLU B 53  
C 4 HIS B 89  ? GLU B 95  ? HIS B 89  GLU B 95  
C 5 PHE B 80  ? LEU B 85  ? PHE B 80  LEU B 85  
D 1 LEU B 147 ? LEU B 148 ? LEU B 147 LEU B 148 
D 2 LEU B 156 ? LYS B 157 ? LEU B 156 LYS B 157 
E 1 TYR C 21  ? ILE C 27  ? TYR C 21  ILE C 27  
E 2 ALA C 35  ? ASP C 40  ? ALA C 35  ASP C 40  
E 3 GLU C 45  ? GLU C 53  ? GLU C 45  GLU C 53  
E 4 HIS C 89  ? GLU C 95  ? HIS C 89  GLU C 95  
E 5 PHE C 80  ? LEU C 85  ? PHE C 80  LEU C 85  
F 1 LEU C 147 ? LEU C 148 ? LEU C 147 LEU C 148 
F 2 LEU C 156 ? LYS C 157 ? LEU C 156 LYS C 157 
G 1 TYR D 21  ? ASP D 26  ? TYR D 21  ASP D 26  
G 2 ARG D 36  ? ASP D 40  ? ARG D 36  ASP D 40  
G 3 GLU D 45  ? GLU D 53  ? GLU D 45  GLU D 53  
G 4 HIS D 89  ? GLU D 95  ? HIS D 89  GLU D 95  
G 5 PHE D 80  ? THR D 86  ? PHE D 80  THR D 86  
H 1 LEU D 147 ? LEU D 148 ? LEU D 147 LEU D 148 
H 2 LEU D 156 ? LYS D 157 ? LEU D 156 LYS D 157 
I 1 TYR E 21  ? ASP E 26  ? TYR E 21  ASP E 26  
I 2 ARG E 36  ? ASP E 40  ? ARG E 36  ASP E 40  
I 3 GLU E 45  ? GLU E 53  ? GLU E 45  GLU E 53  
I 4 HIS E 89  ? GLU E 95  ? HIS E 89  GLU E 95  
I 5 PHE E 80  ? LEU E 85  ? PHE E 80  LEU E 85  
J 1 LEU E 147 ? LEU E 148 ? LEU E 147 LEU E 148 
J 2 LEU E 156 ? LYS E 157 ? LEU E 156 LYS E 157 
K 1 TYR F 21  ? LYS F 25  ? TYR F 21  LYS F 25  
K 2 ARG F 36  ? ASP F 40  ? ARG F 36  ASP F 40  
K 3 GLU F 45  ? GLU F 53  ? GLU F 45  GLU F 53  
K 4 HIS F 89  ? GLU F 95  ? HIS F 89  GLU F 95  
K 5 PHE F 80  ? LEU F 85  ? PHE F 80  LEU F 85  
L 1 LEU F 147 ? LEU F 148 ? LEU F 147 LEU F 148 
L 2 LEU F 156 ? LYS F 157 ? LEU F 156 LYS F 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 22  ? N GLU A 22  O ARG A 39  ? O ARG A 39  
A 2 3 N MET A 38  ? N MET A 38  O VAL A 47  ? O VAL A 47  
A 3 4 N ALA A 48  ? N ALA A 48  O MET A 94  ? O MET A 94  
A 4 5 O ALA A 91  ? O ALA A 91  N ILE A 84  ? N ILE A 84  
B 1 2 N LEU A 147 ? N LEU A 147 O LYS A 157 ? O LYS A 157 
C 1 2 N LYS B 25  ? N LYS B 25  O LEU B 37  ? O LEU B 37  
C 2 3 N MET B 38  ? N MET B 38  O VAL B 47  ? O VAL B 47  
C 3 4 N LYS B 50  ? N LYS B 50  O ILE B 92  ? O ILE B 92  
C 4 5 O VAL B 93  ? O VAL B 93  N GLU B 82  ? N GLU B 82  
D 1 2 N LEU B 147 ? N LEU B 147 O LYS B 157 ? O LYS B 157 
E 1 2 N GLU C 22  ? N GLU C 22  O ARG C 39  ? O ARG C 39  
E 2 3 N MET C 38  ? N MET C 38  O VAL C 47  ? O VAL C 47  
E 3 4 N LYS C 50  ? N LYS C 50  O ILE C 92  ? O ILE C 92  
E 4 5 O ALA C 91  ? O ALA C 91  N ILE C 84  ? N ILE C 84  
F 1 2 N LEU C 147 ? N LEU C 147 O LYS C 157 ? O LYS C 157 
G 1 2 N GLU D 22  ? N GLU D 22  O ARG D 39  ? O ARG D 39  
G 2 3 N MET D 38  ? N MET D 38  O VAL D 47  ? O VAL D 47  
G 3 4 N LYS D 50  ? N LYS D 50  O ILE D 92  ? O ILE D 92  
G 4 5 O ALA D 91  ? O ALA D 91  N ILE D 84  ? N ILE D 84  
H 1 2 N LEU D 147 ? N LEU D 147 O LYS D 157 ? O LYS D 157 
I 1 2 N GLU E 22  ? N GLU E 22  O ARG E 39  ? O ARG E 39  
I 2 3 N MET E 38  ? N MET E 38  O VAL E 47  ? O VAL E 47  
I 3 4 N LYS E 50  ? N LYS E 50  O ILE E 92  ? O ILE E 92  
I 4 5 O ALA E 91  ? O ALA E 91  N ILE E 84  ? N ILE E 84  
J 1 2 N LEU E 147 ? N LEU E 147 O LYS E 157 ? O LYS E 157 
K 1 2 N GLU F 22  ? N GLU F 22  O ARG F 39  ? O ARG F 39  
K 2 3 N MET F 38  ? N MET F 38  O VAL F 47  ? O VAL F 47  
K 3 4 N ILE F 52  ? N ILE F 52  O LEU F 90  ? O LEU F 90  
K 4 5 O ALA F 91  ? O ALA F 91  N ILE F 84  ? N ILE F 84  
L 1 2 N LEU F 147 ? N LEU F 147 O LYS F 157 ? O LYS F 157 
# 
_database_PDB_matrix.entry_id          3UDB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3UDB 
_atom_sites.fract_transf_matrix[1][1]   0.004384 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000654 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010122 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008939 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A 1 12  ? -38.592 -5.052  12.095  1.00 97.48  ? 12  LEU A N   1 
ATOM   2     C  CA  . LEU A 1 12  ? -37.162 -4.949  12.360  1.00 90.50  ? 12  LEU A CA  1 
ATOM   3     C  C   . LEU A 1 12  ? -36.531 -3.819  11.556  1.00 84.49  ? 12  LEU A C   1 
ATOM   4     O  O   . LEU A 1 12  ? -37.216 -3.112  10.820  1.00 79.80  ? 12  LEU A O   1 
ATOM   5     C  CB  . LEU A 1 12  ? -36.461 -6.273  12.045  1.00 92.15  ? 12  LEU A CB  1 
ATOM   6     C  CG  . LEU A 1 12  ? -35.925 -7.052  13.247  1.00 85.95  ? 12  LEU A CG  1 
ATOM   7     C  CD1 . LEU A 1 12  ? -35.062 -8.217  12.791  1.00 80.53  ? 12  LEU A CD1 1 
ATOM   8     C  CD2 . LEU A 1 12  ? -35.145 -6.135  14.176  1.00 90.58  ? 12  LEU A CD2 1 
ATOM   9     N  N   . PRO A 1 13  ? -35.221 -3.654  11.702  1.00 83.68  ? 13  PRO A N   1 
ATOM   10    C  CA  . PRO A 1 13  ? -34.494 -2.591  11.001  1.00 71.21  ? 13  PRO A CA  1 
ATOM   11    C  C   . PRO A 1 13  ? -33.964 -3.048  9.646   1.00 64.99  ? 13  PRO A C   1 
ATOM   12    O  O   . PRO A 1 13  ? -33.446 -4.157  9.520   1.00 82.75  ? 13  PRO A O   1 
ATOM   13    C  CB  . PRO A 1 13  ? -33.329 -2.280  11.947  1.00 72.11  ? 13  PRO A CB  1 
ATOM   14    C  CG  . PRO A 1 13  ? -33.142 -3.526  12.735  1.00 81.66  ? 13  PRO A CG  1 
ATOM   15    C  CD  . PRO A 1 13  ? -34.512 -4.103  12.912  1.00 86.02  ? 13  PRO A CD  1 
ATOM   16    N  N   . ILE A 1 14  ? -34.099 -2.188  8.643   1.00 57.18  ? 14  ILE A N   1 
ATOM   17    C  CA  . ILE A 1 14  ? -33.641 -2.499  7.296   1.00 59.73  ? 14  ILE A CA  1 
ATOM   18    C  C   . ILE A 1 14  ? -32.202 -2.998  7.303   1.00 56.40  ? 14  ILE A C   1 
ATOM   19    O  O   . ILE A 1 14  ? -31.356 -2.478  8.029   1.00 74.58  ? 14  ILE A O   1 
ATOM   20    C  CB  . ILE A 1 14  ? -33.746 -1.275  6.367   1.00 81.05  ? 14  ILE A CB  1 
ATOM   21    C  CG1 . ILE A 1 14  ? -34.744 -1.547  5.240   1.00 83.70  ? 14  ILE A CG1 1 
ATOM   22    C  CG2 . ILE A 1 14  ? -32.381 -0.919  5.799   1.00 86.67  ? 14  ILE A CG2 1 
ATOM   23    C  CD1 . ILE A 1 14  ? -36.174 -1.689  5.711   1.00 82.31  ? 14  ILE A CD1 1 
ATOM   24    N  N   . MET A 1 15  ? -31.934 -4.012  6.487   1.00 60.16  ? 15  MET A N   1 
ATOM   25    C  CA  . MET A 1 15  ? -30.598 -4.587  6.381   1.00 54.94  ? 15  MET A CA  1 
ATOM   26    C  C   . MET A 1 15  ? -29.528 -3.504  6.297   1.00 55.28  ? 15  MET A C   1 
ATOM   27    O  O   . MET A 1 15  ? -29.761 -2.429  5.747   1.00 53.90  ? 15  MET A O   1 
ATOM   28    C  CB  . MET A 1 15  ? -30.508 -5.511  5.166   1.00 57.24  ? 15  MET A CB  1 
ATOM   29    C  CG  . MET A 1 15  ? -29.164 -6.206  5.011   1.00 66.77  ? 15  MET A CG  1 
ATOM   30    S  SD  . MET A 1 15  ? -28.755 -7.261  6.414   1.00 53.99  ? 15  MET A SD  1 
ATOM   31    C  CE  . MET A 1 15  ? -27.088 -7.759  5.988   1.00 20.86  ? 15  MET A CE  1 
ATOM   32    N  N   . HIS A 1 16  ? -28.355 -3.797  6.848   1.00 65.30  ? 16  HIS A N   1 
ATOM   33    C  CA  . HIS A 1 16  ? -27.242 -2.858  6.828   1.00 70.50  ? 16  HIS A CA  1 
ATOM   34    C  C   . HIS A 1 16  ? -25.845 -3.461  6.900   1.00 71.28  ? 16  HIS A C   1 
ATOM   35    O  O   . HIS A 1 16  ? -25.647 -4.518  7.496   1.00 74.04  ? 16  HIS A O   1 
ATOM   36    C  CB  . HIS A 1 16  ? -27.091 -2.177  8.189   1.00 50.83  ? 16  HIS A CB  1 
ATOM   37    C  CG  . HIS A 1 16  ? -27.432 -3.064  9.347   1.00 52.88  ? 16  HIS A CG  1 
ATOM   38    N  ND1 . HIS A 1 16  ? -26.471 -3.685  10.115  1.00 49.51  ? 16  HIS A ND1 1 
ATOM   39    C  CD2 . HIS A 1 16  ? -28.626 -3.431  9.867   1.00 54.22  ? 16  HIS A CD2 1 
ATOM   40    C  CE1 . HIS A 1 16  ? -27.059 -4.399  11.059  1.00 58.26  ? 16  HIS A CE1 1 
ATOM   41    N  NE2 . HIS A 1 16  ? -28.366 -4.262  10.931  1.00 53.37  ? 16  HIS A NE2 1 
ATOM   42    N  N   . ASP A 1 17  ? -24.881 -2.784  6.284   1.00 65.79  ? 17  ASP A N   1 
ATOM   43    C  CA  . ASP A 1 17  ? -23.581 -3.330  5.919   1.00 64.13  ? 17  ASP A CA  1 
ATOM   44    C  C   . ASP A 1 17  ? -23.914 -4.654  5.238   1.00 63.68  ? 17  ASP A C   1 
ATOM   45    O  O   . ASP A 1 17  ? -23.350 -5.695  5.575   1.00 52.66  ? 17  ASP A O   1 
ATOM   46    C  CB  . ASP A 1 17  ? -22.787 -3.704  7.171   1.00 67.79  ? 17  ASP A CB  1 
ATOM   47    C  CG  . ASP A 1 17  ? -22.663 -2.548  8.147   1.00 68.89  ? 17  ASP A CG  1 
ATOM   48    O  OD1 . ASP A 1 17  ? -23.642 -2.273  8.871   1.00 64.05  ? 17  ASP A OD1 1 
ATOM   49    O  OD2 . ASP A 1 17  ? -21.586 -1.917  8.189   1.00 67.80  ? 17  ASP A OD2 1 
ATOM   50    N  N   . SER A 1 18  ? -24.836 -4.608  4.283   1.00 80.82  ? 18  SER A N   1 
ATOM   51    C  CA  . SER A 1 18  ? -25.081 -5.708  3.360   1.00 92.02  ? 18  SER A CA  1 
ATOM   52    C  C   . SER A 1 18  ? -23.728 -6.265  2.937   1.00 94.81  ? 18  SER A C   1 
ATOM   53    O  O   . SER A 1 18  ? -23.598 -7.452  2.640   1.00 110.90 ? 18  SER A O   1 
ATOM   54    C  CB  . SER A 1 18  ? -26.290 -5.407  2.474   1.00 91.59  ? 18  SER A CB  1 
ATOM   55    O  OG  . SER A 1 18  ? -25.885 -5.025  1.171   1.00 88.25  ? 18  SER A OG  1 
ATOM   56    N  N   . ASP A 1 19  ? -22.722 -5.397  2.912   1.00 72.89  ? 19  ASP A N   1 
ATOM   57    C  CA  . ASP A 1 19  ? -21.469 -5.558  2.186   1.00 73.93  ? 19  ASP A CA  1 
ATOM   58    C  C   . ASP A 1 19  ? -20.490 -6.412  2.984   1.00 78.95  ? 19  ASP A C   1 
ATOM   59    O  O   . ASP A 1 19  ? -19.533 -6.957  2.434   1.00 67.31  ? 19  ASP A O   1 
ATOM   60    C  CB  . ASP A 1 19  ? -20.848 -4.195  1.880   1.00 82.53  ? 19  ASP A CB  1 
ATOM   61    C  CG  . ASP A 1 19  ? -20.157 -3.588  3.085   1.00 93.39  ? 19  ASP A CG  1 
ATOM   62    O  OD1 . ASP A 1 19  ? -19.190 -4.198  3.588   1.00 91.06  ? 19  ASP A OD1 1 
ATOM   63    O  OD2 . ASP A 1 19  ? -20.580 -2.500  3.529   1.00 94.43  ? 19  ASP A OD2 1 
ATOM   64    N  N   . ARG A 1 20  ? -20.738 -6.522  4.285   1.00 78.64  ? 20  ARG A N   1 
ATOM   65    C  CA  . ARG A 1 20  ? -19.892 -7.318  5.164   1.00 60.04  ? 20  ARG A CA  1 
ATOM   66    C  C   . ARG A 1 20  ? -20.680 -8.473  5.768   1.00 55.05  ? 20  ARG A C   1 
ATOM   67    O  O   . ARG A 1 20  ? -20.102 -9.448  6.247   1.00 39.38  ? 20  ARG A O   1 
ATOM   68    C  CB  . ARG A 1 20  ? -19.309 -6.446  6.278   1.00 58.53  ? 20  ARG A CB  1 
ATOM   69    C  CG  . ARG A 1 20  ? -18.071 -5.665  5.874   1.00 78.17  ? 20  ARG A CG  1 
ATOM   70    C  CD  . ARG A 1 20  ? -17.390 -5.048  7.085   1.00 88.72  ? 20  ARG A CD  1 
ATOM   71    N  NE  . ARG A 1 20  ? -18.354 -4.508  8.039   1.00 90.10  ? 20  ARG A NE  1 
ATOM   72    C  CZ  . ARG A 1 20  ? -18.315 -4.731  9.348   1.00 82.31  ? 20  ARG A CZ  1 
ATOM   73    N  NH1 . ARG A 1 20  ? -19.234 -4.198  10.142  1.00 73.60  ? 20  ARG A NH1 1 
ATOM   74    N  NH2 . ARG A 1 20  ? -17.357 -5.488  9.865   1.00 70.62  ? 20  ARG A NH2 1 
ATOM   75    N  N   . TYR A 1 21  ? -22.003 -8.355  5.741   1.00 60.30  ? 21  TYR A N   1 
ATOM   76    C  CA  . TYR A 1 21  ? -22.875 -9.374  6.310   1.00 57.24  ? 21  TYR A CA  1 
ATOM   77    C  C   . TYR A 1 21  ? -23.995 -9.757  5.350   1.00 61.11  ? 21  TYR A C   1 
ATOM   78    O  O   . TYR A 1 21  ? -24.685 -8.891  4.811   1.00 49.26  ? 21  TYR A O   1 
ATOM   79    C  CB  . TYR A 1 21  ? -23.487 -8.880  7.622   1.00 55.62  ? 21  TYR A CB  1 
ATOM   80    C  CG  . TYR A 1 21  ? -22.502 -8.722  8.757   1.00 53.60  ? 21  TYR A CG  1 
ATOM   81    C  CD1 . TYR A 1 21  ? -22.086 -9.819  9.498   1.00 51.08  ? 21  TYR A CD1 1 
ATOM   82    C  CD2 . TYR A 1 21  ? -21.997 -7.474  9.095   1.00 58.70  ? 21  TYR A CD2 1 
ATOM   83    C  CE1 . TYR A 1 21  ? -21.189 -9.678  10.540  1.00 64.05  ? 21  TYR A CE1 1 
ATOM   84    C  CE2 . TYR A 1 21  ? -21.101 -7.323  10.134  1.00 57.61  ? 21  TYR A CE2 1 
ATOM   85    C  CZ  . TYR A 1 21  ? -20.701 -8.428  10.854  1.00 62.99  ? 21  TYR A CZ  1 
ATOM   86    O  OH  . TYR A 1 21  ? -19.808 -8.282  11.890  1.00 52.83  ? 21  TYR A OH  1 
ATOM   87    N  N   . GLU A 1 22  ? -24.185 -11.058 5.158   1.00 59.51  ? 22  GLU A N   1 
ATOM   88    C  CA  . GLU A 1 22  ? -25.262 -11.556 4.313   1.00 47.38  ? 22  GLU A CA  1 
ATOM   89    C  C   . GLU A 1 22  ? -26.457 -11.979 5.160   1.00 52.95  ? 22  GLU A C   1 
ATOM   90    O  O   . GLU A 1 22  ? -26.365 -12.917 5.952   1.00 62.03  ? 22  GLU A O   1 
ATOM   91    C  CB  . GLU A 1 22  ? -24.778 -12.731 3.462   1.00 52.23  ? 22  GLU A CB  1 
ATOM   92    C  CG  . GLU A 1 22  ? -25.876 -13.704 3.066   1.00 77.06  ? 22  GLU A CG  1 
ATOM   93    C  CD  . GLU A 1 22  ? -25.344 -14.909 2.318   1.00 89.25  ? 22  GLU A CD  1 
ATOM   94    O  OE1 . GLU A 1 22  ? -26.114 -15.519 1.547   1.00 79.37  ? 22  GLU A OE1 1 
ATOM   95    O  OE2 . GLU A 1 22  ? -24.156 -15.247 2.501   1.00 91.70  ? 22  GLU A OE2 1 
ATOM   96    N  N   . LEU A 1 23  ? -27.574 -11.280 4.986   1.00 39.84  ? 23  LEU A N   1 
ATOM   97    C  CA  . LEU A 1 23  ? -28.791 -11.578 5.730   1.00 44.96  ? 23  LEU A CA  1 
ATOM   98    C  C   . LEU A 1 23  ? -29.208 -13.032 5.543   1.00 64.58  ? 23  LEU A C   1 
ATOM   99    O  O   . LEU A 1 23  ? -29.459 -13.477 4.424   1.00 66.58  ? 23  LEU A O   1 
ATOM   100   C  CB  . LEU A 1 23  ? -29.924 -10.647 5.295   1.00 34.80  ? 23  LEU A CB  1 
ATOM   101   C  CG  . LEU A 1 23  ? -31.304 -10.933 5.888   1.00 44.99  ? 23  LEU A CG  1 
ATOM   102   C  CD1 . LEU A 1 23  ? -31.226 -11.042 7.402   1.00 27.35  ? 23  LEU A CD1 1 
ATOM   103   C  CD2 . LEU A 1 23  ? -32.298 -9.860  5.474   1.00 50.35  ? 23  LEU A CD2 1 
ATOM   104   N  N   . VAL A 1 24  ? -29.279 -13.768 6.647   1.00 62.84  ? 24  VAL A N   1 
ATOM   105   C  CA  . VAL A 1 24  ? -29.664 -15.173 6.607   1.00 34.36  ? 24  VAL A CA  1 
ATOM   106   C  C   . VAL A 1 24  ? -31.164 -15.342 6.821   1.00 33.28  ? 24  VAL A C   1 
ATOM   107   O  O   . VAL A 1 24  ? -31.825 -16.074 6.086   1.00 43.03  ? 24  VAL A O   1 
ATOM   108   C  CB  . VAL A 1 24  ? -28.904 -15.996 7.662   1.00 45.74  ? 24  VAL A CB  1 
ATOM   109   C  CG1 . VAL A 1 24  ? -29.507 -17.386 7.786   1.00 58.39  ? 24  VAL A CG1 1 
ATOM   110   C  CG2 . VAL A 1 24  ? -27.429 -16.079 7.307   1.00 40.04  ? 24  VAL A CG2 1 
ATOM   111   N  N   . LYS A 1 25  ? -31.691 -14.669 7.838   1.00 43.81  ? 25  LYS A N   1 
ATOM   112   C  CA  . LYS A 1 25  ? -33.107 -14.762 8.166   1.00 50.93  ? 25  LYS A CA  1 
ATOM   113   C  C   . LYS A 1 25  ? -33.452 -13.889 9.368   1.00 55.79  ? 25  LYS A C   1 
ATOM   114   O  O   . LYS A 1 25  ? -32.584 -13.548 10.169  1.00 62.87  ? 25  LYS A O   1 
ATOM   115   C  CB  . LYS A 1 25  ? -33.496 -16.214 8.445   1.00 58.21  ? 25  LYS A CB  1 
ATOM   116   C  CG  . LYS A 1 25  ? -34.950 -16.537 8.144   1.00 73.90  ? 25  LYS A CG  1 
ATOM   117   C  CD  . LYS A 1 25  ? -35.715 -16.874 9.412   1.00 70.04  ? 25  LYS A CD  1 
ATOM   118   C  CE  . LYS A 1 25  ? -37.180 -17.145 9.116   1.00 73.23  ? 25  LYS A CE  1 
ATOM   119   N  NZ  . LYS A 1 25  ? -37.553 -16.726 7.737   1.00 78.83  ? 25  LYS A NZ  1 
ATOM   120   N  N   . ASP A 1 26  ? -34.727 -13.533 9.487   1.00 58.70  ? 26  ASP A N   1 
ATOM   121   C  CA  . ASP A 1 26  ? -35.192 -12.704 10.592  1.00 66.31  ? 26  ASP A CA  1 
ATOM   122   C  C   . ASP A 1 26  ? -36.063 -13.508 11.550  1.00 78.19  ? 26  ASP A C   1 
ATOM   123   O  O   . ASP A 1 26  ? -37.228 -13.779 11.264  1.00 91.55  ? 26  ASP A O   1 
ATOM   124   C  CB  . ASP A 1 26  ? -35.973 -11.500 10.065  1.00 71.46  ? 26  ASP A CB  1 
ATOM   125   C  CG  . ASP A 1 26  ? -35.072 -10.344 9.681   1.00 83.36  ? 26  ASP A CG  1 
ATOM   126   O  OD1 . ASP A 1 26  ? -35.565 -9.392  9.041   1.00 81.08  ? 26  ASP A OD1 1 
ATOM   127   O  OD2 . ASP A 1 26  ? -33.871 -10.388 10.019  1.00 93.93  ? 26  ASP A OD2 1 
ATOM   128   N  N   . ILE A 1 27  ? -35.491 -13.886 12.688  1.00 75.32  ? 27  ILE A N   1 
ATOM   129   C  CA  . ILE A 1 27  ? -36.220 -14.652 13.691  1.00 75.67  ? 27  ILE A CA  1 
ATOM   130   C  C   . ILE A 1 27  ? -37.003 -13.730 14.620  1.00 73.49  ? 27  ILE A C   1 
ATOM   131   O  O   . ILE A 1 27  ? -36.836 -12.512 14.586  1.00 80.99  ? 27  ILE A O   1 
ATOM   132   C  CB  . ILE A 1 27  ? -35.275 -15.530 14.530  1.00 79.54  ? 27  ILE A CB  1 
ATOM   133   C  CG1 . ILE A 1 27  ? -35.799 -15.663 15.960  1.00 87.43  ? 27  ILE A CG1 1 
ATOM   134   C  CG2 . ILE A 1 27  ? -33.868 -14.954 14.525  1.00 82.62  ? 27  ILE A CG2 1 
ATOM   135   C  CD1 . ILE A 1 27  ? -35.261 -16.869 16.697  1.00 92.50  ? 27  ILE A CD1 1 
ATOM   136   N  N   . GLY A 1 28  ? -37.859 -14.318 15.448  1.00 84.44  ? 28  GLY A N   1 
ATOM   137   C  CA  . GLY A 1 28  ? -38.668 -13.551 16.377  1.00 91.54  ? 28  GLY A CA  1 
ATOM   138   C  C   . GLY A 1 28  ? -39.086 -14.356 17.591  1.00 101.15 ? 28  GLY A C   1 
ATOM   139   O  O   . GLY A 1 28  ? -40.176 -14.165 18.129  1.00 104.21 ? 28  GLY A O   1 
ATOM   140   N  N   . ALA A 1 29  ? -38.214 -15.261 18.024  1.00 97.97  ? 29  ALA A N   1 
ATOM   141   C  CA  . ALA A 1 29  ? -38.492 -16.102 19.181  1.00 87.97  ? 29  ALA A CA  1 
ATOM   142   C  C   . ALA A 1 29  ? -37.382 -17.126 19.388  1.00 88.99  ? 29  ALA A C   1 
ATOM   143   O  O   . ALA A 1 29  ? -36.756 -17.578 18.430  1.00 85.53  ? 29  ALA A O   1 
ATOM   144   C  CB  . ALA A 1 29  ? -39.834 -16.798 19.020  1.00 80.65  ? 29  ALA A CB  1 
ATOM   145   N  N   . GLY A 1 30  ? -37.144 -17.490 20.644  1.00 95.89  ? 30  GLY A N   1 
ATOM   146   C  CA  . GLY A 1 30  ? -36.109 -18.456 20.969  1.00 96.98  ? 30  GLY A CA  1 
ATOM   147   C  C   . GLY A 1 30  ? -35.248 -18.037 22.137  1.00 94.78  ? 30  GLY A C   1 
ATOM   148   O  O   . GLY A 1 30  ? -35.631 -17.168 22.921  1.00 84.39  ? 30  GLY A O   1 
ATOM   149   N  N   . ASN A 1 31  ? -34.075 -18.650 22.250  1.00 106.66 ? 31  ASN A N   1 
ATOM   150   C  CA  . ASN A 1 31  ? -33.114 -18.278 23.279  1.00 123.01 ? 31  ASN A CA  1 
ATOM   151   C  C   . ASN A 1 31  ? -32.391 -16.997 22.887  1.00 121.71 ? 31  ASN A C   1 
ATOM   152   O  O   . ASN A 1 31  ? -31.585 -16.462 23.648  1.00 120.08 ? 31  ASN A O   1 
ATOM   153   C  CB  . ASN A 1 31  ? -32.106 -19.404 23.505  1.00 131.84 ? 31  ASN A CB  1 
ATOM   154   C  CG  . ASN A 1 31  ? -32.215 -20.017 24.886  1.00 140.41 ? 31  ASN A CG  1 
ATOM   155   O  OD1 . ASN A 1 31  ? -31.591 -19.546 25.838  1.00 143.30 ? 31  ASN A OD1 1 
ATOM   156   N  ND2 . ASN A 1 31  ? -33.011 -21.073 25.004  1.00 142.86 ? 31  ASN A ND2 1 
ATOM   157   N  N   . PHE A 1 32  ? -32.691 -16.513 21.686  1.00 115.84 ? 32  PHE A N   1 
ATOM   158   C  CA  . PHE A 1 32  ? -32.076 -15.295 21.159  1.00 109.28 ? 32  PHE A CA  1 
ATOM   159   C  C   . PHE A 1 32  ? -33.092 -14.150 21.007  1.00 110.33 ? 32  PHE A C   1 
ATOM   160   O  O   . PHE A 1 32  ? -32.890 -13.220 20.217  1.00 108.08 ? 32  PHE A O   1 
ATOM   161   C  CB  . PHE A 1 32  ? -31.335 -15.570 19.837  1.00 97.00  ? 32  PHE A CB  1 
ATOM   162   C  CG  . PHE A 1 32  ? -29.956 -16.176 20.023  1.00 91.45  ? 32  PHE A CG  1 
ATOM   163   C  CD1 . PHE A 1 32  ? -28.822 -15.382 20.004  1.00 90.41  ? 32  PHE A CD1 1 
ATOM   164   C  CD2 . PHE A 1 32  ? -29.797 -17.539 20.238  1.00 92.94  ? 32  PHE A CD2 1 
ATOM   165   C  CE1 . PHE A 1 32  ? -27.552 -15.943 20.185  1.00 87.69  ? 32  PHE A CE1 1 
ATOM   166   C  CE2 . PHE A 1 32  ? -28.542 -18.098 20.412  1.00 90.88  ? 32  PHE A CE2 1 
ATOM   167   C  CZ  . PHE A 1 32  ? -27.414 -17.305 20.384  1.00 81.73  ? 32  PHE A CZ  1 
ATOM   168   N  N   . GLY A 1 33  ? -34.172 -14.219 21.785  1.00 109.99 ? 33  GLY A N   1 
ATOM   169   C  CA  . GLY A 1 33  ? -35.228 -13.219 21.740  1.00 107.27 ? 33  GLY A CA  1 
ATOM   170   C  C   . GLY A 1 33  ? -35.697 -12.974 20.322  1.00 99.76  ? 33  GLY A C   1 
ATOM   171   O  O   . GLY A 1 33  ? -35.789 -13.912 19.530  1.00 89.55  ? 33  GLY A O   1 
ATOM   172   N  N   . VAL A 1 34  ? -36.001 -11.719 19.997  1.00 98.01  ? 34  VAL A N   1 
ATOM   173   C  CA  . VAL A 1 34  ? -36.252 -11.336 18.602  1.00 95.89  ? 34  VAL A CA  1 
ATOM   174   C  C   . VAL A 1 34  ? -34.956 -10.827 17.936  1.00 90.06  ? 34  VAL A C   1 
ATOM   175   O  O   . VAL A 1 34  ? -34.322 -9.896  18.439  1.00 95.49  ? 34  VAL A O   1 
ATOM   176   C  CB  . VAL A 1 34  ? -37.394 -10.283 18.489  1.00 74.62  ? 34  VAL A CB  1 
ATOM   177   C  CG1 . VAL A 1 34  ? -37.334 -9.305  19.654  1.00 85.79  ? 34  VAL A CG1 1 
ATOM   178   C  CG2 . VAL A 1 34  ? -37.335 -9.550  17.153  1.00 59.39  ? 34  VAL A CG2 1 
ATOM   179   N  N   . ALA A 1 35  ? -34.557 -11.427 16.814  1.00 74.25  ? 35  ALA A N   1 
ATOM   180   C  CA  . ALA A 1 35  ? -33.222 -11.150 16.290  1.00 55.78  ? 35  ALA A CA  1 
ATOM   181   C  C   . ALA A 1 35  ? -33.088 -11.301 14.780  1.00 61.03  ? 35  ALA A C   1 
ATOM   182   O  O   . ALA A 1 35  ? -34.050 -11.597 14.079  1.00 73.37  ? 35  ALA A O   1 
ATOM   183   C  CB  . ALA A 1 35  ? -32.209 -12.045 16.991  1.00 40.94  ? 35  ALA A CB  1 
ATOM   184   N  N   . ARG A 1 36  ? -31.868 -11.132 14.282  1.00 51.95  ? 36  ARG A N   1 
ATOM   185   C  CA  . ARG A 1 36  ? -31.592 -11.332 12.864  1.00 43.01  ? 36  ARG A CA  1 
ATOM   186   C  C   . ARG A 1 36  ? -30.323 -12.157 12.674  1.00 49.41  ? 36  ARG A C   1 
ATOM   187   O  O   . ARG A 1 36  ? -29.255 -11.777 13.152  1.00 52.15  ? 36  ARG A O   1 
ATOM   188   C  CB  . ARG A 1 36  ? -31.456 -9.987  12.149  1.00 47.05  ? 36  ARG A CB  1 
ATOM   189   C  CG  . ARG A 1 36  ? -30.324 -9.934  11.137  1.00 45.69  ? 36  ARG A CG  1 
ATOM   190   C  CD  . ARG A 1 36  ? -30.645 -8.983  9.998   1.00 46.83  ? 36  ARG A CD  1 
ATOM   191   N  NE  . ARG A 1 36  ? -31.922 -8.302  10.195  1.00 59.70  ? 36  ARG A NE  1 
ATOM   192   C  CZ  . ARG A 1 36  ? -32.337 -7.270  9.470   1.00 65.10  ? 36  ARG A CZ  1 
ATOM   193   N  NH1 . ARG A 1 36  ? -31.577 -6.793  8.494   1.00 67.49  ? 36  ARG A NH1 1 
ATOM   194   N  NH2 . ARG A 1 36  ? -33.514 -6.712  9.720   1.00 59.21  ? 36  ARG A NH2 1 
ATOM   195   N  N   . LEU A 1 37  ? -30.438 -13.287 11.980  1.00 50.99  ? 37  LEU A N   1 
ATOM   196   C  CA  . LEU A 1 37  ? -29.269 -14.146 11.752  1.00 39.11  ? 37  LEU A CA  1 
ATOM   197   C  C   . LEU A 1 37  ? -28.552 -13.630 10.524  1.00 40.52  ? 37  LEU A C   1 
ATOM   198   O  O   . LEU A 1 37  ? -29.186 -13.309 9.521   1.00 44.46  ? 37  LEU A O   1 
ATOM   199   C  CB  . LEU A 1 37  ? -29.708 -15.572 11.482  1.00 41.29  ? 37  LEU A CB  1 
ATOM   200   C  CG  . LEU A 1 37  ? -29.678 -16.573 12.622  1.00 53.27  ? 37  LEU A CG  1 
ATOM   201   C  CD1 . LEU A 1 37  ? -29.843 -15.821 13.940  1.00 45.04  ? 37  LEU A CD1 1 
ATOM   202   C  CD2 . LEU A 1 37  ? -30.785 -17.632 12.424  1.00 40.90  ? 37  LEU A CD2 1 
ATOM   203   N  N   . MET A 1 38  ? -27.239 -13.546 10.585  1.00 31.37  ? 38  MET A N   1 
ATOM   204   C  CA  . MET A 1 38  ? -26.492 -13.043 9.448   1.00 34.74  ? 38  MET A CA  1 
ATOM   205   C  C   . MET A 1 38  ? -25.252 -13.865 9.313   1.00 30.39  ? 38  MET A C   1 
ATOM   206   O  O   . MET A 1 38  ? -24.778 -14.453 10.283  1.00 45.36  ? 38  MET A O   1 
ATOM   207   C  CB  . MET A 1 38  ? -26.037 -11.597 9.667   1.00 41.97  ? 38  MET A CB  1 
ATOM   208   C  CG  . MET A 1 38  ? -27.100 -10.514 9.544   1.00 44.37  ? 38  MET A CG  1 
ATOM   209   S  SD  . MET A 1 38  ? -26.306 -8.918  9.818   1.00 75.90  ? 38  MET A SD  1 
ATOM   210   C  CE  . MET A 1 38  ? -27.757 -7.862  9.879   1.00 52.44  ? 38  MET A CE  1 
ATOM   211   N  N   . ARG A 1 39  ? -24.717 -13.905 8.108   1.00 39.90  ? 39  ARG A N   1 
ATOM   212   C  CA  . ARG A 1 39  ? -23.476 -14.597 7.878   1.00 52.68  ? 39  ARG A CA  1 
ATOM   213   C  C   . ARG A 1 39  ? -22.494 -13.495 7.618   1.00 62.26  ? 39  ARG A C   1 
ATOM   214   O  O   . ARG A 1 39  ? -22.702 -12.671 6.720   1.00 66.41  ? 39  ARG A O   1 
ATOM   215   C  CB  . ARG A 1 39  ? -23.576 -15.532 6.663   1.00 57.84  ? 39  ARG A CB  1 
ATOM   216   C  CG  . ARG A 1 39  ? -22.428 -16.547 6.572   1.00 60.45  ? 39  ARG A CG  1 
ATOM   217   C  CD  . ARG A 1 39  ? -22.441 -17.357 5.279   1.00 67.04  ? 39  ARG A CD  1 
ATOM   218   N  NE  . ARG A 1 39  ? -22.440 -16.482 4.111   1.00 83.98  ? 39  ARG A NE  1 
ATOM   219   C  CZ  . ARG A 1 39  ? -21.411 -16.171 3.316   1.00 88.93  ? 39  ARG A CZ  1 
ATOM   220   N  NH1 . ARG A 1 39  ? -20.190 -16.675 3.489   1.00 88.04  ? 39  ARG A NH1 1 
ATOM   221   N  NH2 . ARG A 1 39  ? -21.636 -15.334 2.308   1.00 85.62  ? 39  ARG A NH2 1 
ATOM   222   N  N   . ASP A 1 40  ? -21.427 -13.454 8.411   1.00 62.70  ? 40  ASP A N   1 
ATOM   223   C  CA  . ASP A 1 40  ? -20.351 -12.496 8.205   1.00 68.25  ? 40  ASP A CA  1 
ATOM   224   C  C   . ASP A 1 40  ? -19.494 -13.003 7.057   1.00 72.63  ? 40  ASP A C   1 
ATOM   225   O  O   . ASP A 1 40  ? -18.872 -14.058 7.159   1.00 76.47  ? 40  ASP A O   1 
ATOM   226   C  CB  . ASP A 1 40  ? -19.511 -12.350 9.473   1.00 67.87  ? 40  ASP A CB  1 
ATOM   227   C  CG  . ASP A 1 40  ? -18.070 -11.990 9.179   1.00 80.50  ? 40  ASP A CG  1 
ATOM   228   O  OD1 . ASP A 1 40  ? -17.463 -11.256 9.986   1.00 82.03  ? 40  ASP A OD1 1 
ATOM   229   O  OD2 . ASP A 1 40  ? -17.543 -12.441 8.139   1.00 97.17  ? 40  ASP A OD2 1 
ATOM   230   N  N   . LYS A 1 41  ? -19.473 -12.259 5.957   1.00 72.59  ? 41  LYS A N   1 
ATOM   231   C  CA  . LYS A 1 41  ? -18.861 -12.763 4.730   1.00 70.18  ? 41  LYS A CA  1 
ATOM   232   C  C   . LYS A 1 41  ? -17.407 -13.215 4.876   1.00 81.49  ? 41  LYS A C   1 
ATOM   233   O  O   . LYS A 1 41  ? -17.049 -14.287 4.384   1.00 91.13  ? 41  LYS A O   1 
ATOM   234   C  CB  . LYS A 1 41  ? -19.003 -11.757 3.586   1.00 71.11  ? 41  LYS A CB  1 
ATOM   235   C  CG  . LYS A 1 41  ? -20.441 -11.562 3.083   1.00 71.23  ? 41  LYS A CG  1 
ATOM   236   C  CD  . LYS A 1 41  ? -20.461 -11.241 1.584   1.00 76.72  ? 41  LYS A CD  1 
ATOM   237   C  CE  . LYS A 1 41  ? -21.389 -10.075 1.244   1.00 73.35  ? 41  LYS A CE  1 
ATOM   238   N  NZ  . LYS A 1 41  ? -22.781 -10.348 1.701   1.00 76.21  ? 41  LYS A NZ  1 
ATOM   239   N  N   . GLN A 1 42  ? -16.570 -12.408 5.523   1.00 83.55  ? 42  GLN A N   1 
ATOM   240   C  CA  . GLN A 1 42  ? -15.212 -12.839 5.854   1.00 90.07  ? 42  GLN A CA  1 
ATOM   241   C  C   . GLN A 1 42  ? -15.301 -13.726 7.073   1.00 89.25  ? 42  GLN A C   1 
ATOM   242   O  O   . GLN A 1 42  ? -16.110 -13.471 7.946   1.00 100.35 ? 42  GLN A O   1 
ATOM   243   C  CB  . GLN A 1 42  ? -14.321 -11.647 6.193   1.00 105.01 ? 42  GLN A CB  1 
ATOM   244   C  CG  . GLN A 1 42  ? -13.939 -10.774 5.021   1.00 121.02 ? 42  GLN A CG  1 
ATOM   245   C  CD  . GLN A 1 42  ? -12.940 -9.698  5.414   1.00 126.09 ? 42  GLN A CD  1 
ATOM   246   O  OE1 . GLN A 1 42  ? -12.661 -9.492  6.597   1.00 125.03 ? 42  GLN A OE1 1 
ATOM   247   N  NE2 . GLN A 1 42  ? -12.392 -9.011  4.419   1.00 126.09 ? 42  GLN A NE2 1 
ATOM   248   N  N   . ALA A 1 43  ? -14.470 -14.754 7.155   1.00 91.19  ? 43  ALA A N   1 
ATOM   249   C  CA  . ALA A 1 43  ? -14.548 -15.703 8.265   1.00 90.47  ? 43  ALA A CA  1 
ATOM   250   C  C   . ALA A 1 43  ? -15.766 -16.620 8.162   1.00 78.75  ? 43  ALA A C   1 
ATOM   251   O  O   . ALA A 1 43  ? -15.913 -17.558 8.937   1.00 69.53  ? 43  ALA A O   1 
ATOM   252   C  CB  . ALA A 1 43  ? -14.541 -14.970 9.603   1.00 86.33  ? 43  ALA A CB  1 
ATOM   253   N  N   . ASN A 1 44  ? -16.639 -16.330 7.206   1.00 82.57  ? 44  ASN A N   1 
ATOM   254   C  CA  . ASN A 1 44  ? -17.789 -17.177 6.916   1.00 85.17  ? 44  ASN A CA  1 
ATOM   255   C  C   . ASN A 1 44  ? -18.345 -17.864 8.157   1.00 76.46  ? 44  ASN A C   1 
ATOM   256   O  O   . ASN A 1 44  ? -18.083 -19.045 8.391   1.00 81.53  ? 44  ASN A O   1 
ATOM   257   C  CB  . ASN A 1 44  ? -17.422 -18.218 5.848   1.00 88.09  ? 44  ASN A CB  1 
ATOM   258   C  CG  . ASN A 1 44  ? -18.593 -19.123 5.464   1.00 86.61  ? 44  ASN A CG  1 
ATOM   259   O  OD1 . ASN A 1 44  ? -19.734 -18.915 5.881   1.00 80.64  ? 44  ASN A OD1 1 
ATOM   260   N  ND2 . ASN A 1 44  ? -18.307 -20.127 4.651   1.00 90.55  ? 44  ASN A ND2 1 
ATOM   261   N  N   . GLU A 1 45  ? -19.105 -17.123 8.958   1.00 61.66  ? 45  GLU A N   1 
ATOM   262   C  CA  . GLU A 1 45  ? -19.749 -17.738 10.105  1.00 64.94  ? 45  GLU A CA  1 
ATOM   263   C  C   . GLU A 1 45  ? -20.992 -17.021 10.580  1.00 52.98  ? 45  GLU A C   1 
ATOM   264   O  O   . GLU A 1 45  ? -21.097 -15.806 10.476  1.00 70.92  ? 45  GLU A O   1 
ATOM   265   C  CB  . GLU A 1 45  ? -18.769 -17.921 11.249  1.00 81.87  ? 45  GLU A CB  1 
ATOM   266   C  CG  . GLU A 1 45  ? -18.195 -16.637 11.762  1.00 100.77 ? 45  GLU A CG  1 
ATOM   267   C  CD  . GLU A 1 45  ? -17.368 -16.853 13.016  1.00 116.42 ? 45  GLU A CD  1 
ATOM   268   O  OE1 . GLU A 1 45  ? -17.968 -16.920 14.110  1.00 118.83 ? 45  GLU A OE1 1 
ATOM   269   O  OE2 . GLU A 1 45  ? -16.124 -16.968 12.911  1.00 121.49 ? 45  GLU A OE2 1 
ATOM   270   N  N   . LEU A 1 46  ? -21.949 -17.798 11.076  1.00 50.88  ? 46  LEU A N   1 
ATOM   271   C  CA  . LEU A 1 46  ? -23.222 -17.277 11.515  1.00 56.02  ? 46  LEU A CA  1 
ATOM   272   C  C   . LEU A 1 46  ? -23.046 -16.387 12.711  1.00 59.98  ? 46  LEU A C   1 
ATOM   273   O  O   . LEU A 1 46  ? -22.178 -16.617 13.547  1.00 58.97  ? 46  LEU A O   1 
ATOM   274   C  CB  . LEU A 1 46  ? -24.173 -18.397 11.884  1.00 50.39  ? 46  LEU A CB  1 
ATOM   275   C  CG  . LEU A 1 46  ? -24.908 -19.024 10.717  1.00 48.91  ? 46  LEU A CG  1 
ATOM   276   C  CD1 . LEU A 1 46  ? -25.779 -20.142 11.251  1.00 46.85  ? 46  LEU A CD1 1 
ATOM   277   C  CD2 . LEU A 1 46  ? -25.738 -17.976 9.991   1.00 39.91  ? 46  LEU A CD2 1 
ATOM   278   N  N   . VAL A 1 47  ? -23.919 -15.394 12.800  1.00 54.95  ? 47  VAL A N   1 
ATOM   279   C  CA  . VAL A 1 47  ? -23.831 -14.376 13.808  1.00 37.23  ? 47  VAL A CA  1 
ATOM   280   C  C   . VAL A 1 47  ? -25.242 -13.937 14.088  1.00 33.61  ? 47  VAL A C   1 
ATOM   281   O  O   . VAL A 1 47  ? -26.058 -13.972 13.175  1.00 54.51  ? 47  VAL A O   1 
ATOM   282   C  CB  . VAL A 1 47  ? -23.031 -13.227 13.205  1.00 45.28  ? 47  VAL A CB  1 
ATOM   283   C  CG1 . VAL A 1 47  ? -23.819 -11.979 13.262  1.00 44.96  ? 47  VAL A CG1 1 
ATOM   284   C  CG2 . VAL A 1 47  ? -21.660 -13.133 13.864  1.00 52.38  ? 47  VAL A CG2 1 
ATOM   285   N  N   . ALA A 1 48  ? -25.567 -13.566 15.324  1.00 31.32  ? 48  ALA A N   1 
ATOM   286   C  CA  . ALA A 1 48  ? -26.930 -13.094 15.613  1.00 32.51  ? 48  ALA A CA  1 
ATOM   287   C  C   . ALA A 1 48  ? -26.857 -11.646 15.945  1.00 43.40  ? 48  ALA A C   1 
ATOM   288   O  O   . ALA A 1 48  ? -25.912 -11.213 16.603  1.00 48.31  ? 48  ALA A O   1 
ATOM   289   C  CB  . ALA A 1 48  ? -27.513 -13.813 16.783  1.00 32.90  ? 48  ALA A CB  1 
ATOM   290   N  N   . VAL A 1 49  ? -27.873 -10.893 15.541  1.00 42.18  ? 49  VAL A N   1 
ATOM   291   C  CA  . VAL A 1 49  ? -27.874 -9.473  15.771  1.00 26.08  ? 49  VAL A CA  1 
ATOM   292   C  C   . VAL A 1 49  ? -29.095 -9.095  16.565  1.00 44.64  ? 49  VAL A C   1 
ATOM   293   O  O   . VAL A 1 49  ? -30.202 -9.492  16.224  1.00 54.63  ? 49  VAL A O   1 
ATOM   294   C  CB  . VAL A 1 49  ? -27.865 -8.714  14.440  1.00 37.27  ? 49  VAL A CB  1 
ATOM   295   C  CG1 . VAL A 1 49  ? -27.809 -7.198  14.680  1.00 34.99  ? 49  VAL A CG1 1 
ATOM   296   C  CG2 . VAL A 1 49  ? -26.703 -9.189  13.587  1.00 26.14  ? 49  VAL A CG2 1 
ATOM   297   N  N   . LYS A 1 50  ? -28.884 -8.321  17.624  1.00 57.68  ? 50  LYS A N   1 
ATOM   298   C  CA  . LYS A 1 50  ? -29.972 -7.759  18.409  1.00 52.30  ? 50  LYS A CA  1 
ATOM   299   C  C   . LYS A 1 50  ? -30.056 -6.271  18.098  1.00 47.40  ? 50  LYS A C   1 
ATOM   300   O  O   . LYS A 1 50  ? -29.054 -5.653  17.742  1.00 48.03  ? 50  LYS A O   1 
ATOM   301   C  CB  . LYS A 1 50  ? -29.731 -7.979  19.903  1.00 45.04  ? 50  LYS A CB  1 
ATOM   302   C  CG  . LYS A 1 50  ? -30.550 -9.109  20.503  1.00 62.37  ? 50  LYS A CG  1 
ATOM   303   C  CD  . LYS A 1 50  ? -31.484 -8.600  21.588  1.00 82.08  ? 50  LYS A CD  1 
ATOM   304   C  CE  . LYS A 1 50  ? -32.409 -7.517  21.059  1.00 91.53  ? 50  LYS A CE  1 
ATOM   305   N  NZ  . LYS A 1 50  ? -32.877 -6.607  22.140  1.00 88.00  ? 50  LYS A NZ  1 
ATOM   306   N  N   . TYR A 1 51  ? -31.247 -5.697  18.220  1.00 47.76  ? 51  TYR A N   1 
ATOM   307   C  CA  . TYR A 1 51  ? -31.441 -4.298  17.850  1.00 40.08  ? 51  TYR A CA  1 
ATOM   308   C  C   . TYR A 1 51  ? -32.126 -3.497  18.970  1.00 51.91  ? 51  TYR A C   1 
ATOM   309   O  O   . TYR A 1 51  ? -33.201 -3.862  19.457  1.00 50.51  ? 51  TYR A O   1 
ATOM   310   C  CB  . TYR A 1 51  ? -32.271 -4.199  16.562  1.00 33.10  ? 51  TYR A CB  1 
ATOM   311   C  CG  . TYR A 1 51  ? -31.551 -4.586  15.290  1.00 42.51  ? 51  TYR A CG  1 
ATOM   312   C  CD1 . TYR A 1 51  ? -30.667 -3.710  14.668  1.00 36.96  ? 51  TYR A CD1 1 
ATOM   313   C  CD2 . TYR A 1 51  ? -31.758 -5.827  14.699  1.00 44.14  ? 51  TYR A CD2 1 
ATOM   314   C  CE1 . TYR A 1 51  ? -30.012 -4.057  13.492  1.00 38.47  ? 51  TYR A CE1 1 
ATOM   315   C  CE2 . TYR A 1 51  ? -31.101 -6.181  13.523  1.00 31.23  ? 51  TYR A CE2 1 
ATOM   316   C  CZ  . TYR A 1 51  ? -30.234 -5.298  12.933  1.00 37.38  ? 51  TYR A CZ  1 
ATOM   317   O  OH  . TYR A 1 51  ? -29.590 -5.644  11.785  1.00 39.49  ? 51  TYR A OH  1 
ATOM   318   N  N   . ILE A 1 52  ? -31.501 -2.401  19.388  1.00 52.55  ? 52  ILE A N   1 
ATOM   319   C  CA  . ILE A 1 52  ? -32.161 -1.505  20.331  1.00 44.96  ? 52  ILE A CA  1 
ATOM   320   C  C   . ILE A 1 52  ? -32.428 -0.160  19.664  1.00 55.56  ? 52  ILE A C   1 
ATOM   321   O  O   . ILE A 1 52  ? -31.555 0.411   18.987  1.00 41.57  ? 52  ILE A O   1 
ATOM   322   C  CB  . ILE A 1 52  ? -31.366 -1.305  21.617  1.00 38.71  ? 52  ILE A CB  1 
ATOM   323   C  CG1 . ILE A 1 52  ? -31.065 -2.632  22.285  1.00 42.25  ? 52  ILE A CG1 1 
ATOM   324   C  CG2 . ILE A 1 52  ? -32.154 -0.463  22.561  1.00 49.36  ? 52  ILE A CG2 1 
ATOM   325   C  CD1 . ILE A 1 52  ? -30.136 -2.496  23.443  1.00 54.84  ? 52  ILE A CD1 1 
ATOM   326   N  N   . GLU A 1 53  ? -33.663 0.301   19.846  1.00 51.81  ? 53  GLU A N   1 
ATOM   327   C  CA  . GLU A 1 53  ? -34.137 1.546   19.274  1.00 64.85  ? 53  GLU A CA  1 
ATOM   328   C  C   . GLU A 1 53  ? -33.258 2.690   19.730  1.00 61.07  ? 53  GLU A C   1 
ATOM   329   O  O   . GLU A 1 53  ? -32.843 2.754   20.887  1.00 53.63  ? 53  GLU A O   1 
ATOM   330   C  CB  . GLU A 1 53  ? -35.589 1.804   19.679  1.00 77.64  ? 53  GLU A CB  1 
ATOM   331   C  CG  . GLU A 1 53  ? -36.513 2.115   18.513  1.00 86.66  ? 53  GLU A CG  1 
ATOM   332   C  CD  . GLU A 1 53  ? -37.945 2.350   18.951  1.00 97.28  ? 53  GLU A CD  1 
ATOM   333   O  OE1 . GLU A 1 53  ? -38.462 1.546   19.755  1.00 97.81  ? 53  GLU A OE1 1 
ATOM   334   O  OE2 . GLU A 1 53  ? -38.553 3.339   18.492  1.00 98.39  ? 53  GLU A OE2 1 
ATOM   335   N  N   . ARG A 1 54  ? -32.976 3.593   18.805  1.00 55.87  ? 54  ARG A N   1 
ATOM   336   C  CA  . ARG A 1 54  ? -32.087 4.700   19.070  1.00 49.40  ? 54  ARG A CA  1 
ATOM   337   C  C   . ARG A 1 54  ? -32.494 5.674   20.203  1.00 67.35  ? 54  ARG A C   1 
ATOM   338   O  O   . ARG A 1 54  ? -31.637 6.344   20.768  1.00 69.56  ? 54  ARG A O   1 
ATOM   339   C  CB  . ARG A 1 54  ? -31.850 5.457   17.782  1.00 41.58  ? 54  ARG A CB  1 
ATOM   340   C  CG  . ARG A 1 54  ? -30.452 5.948   17.618  1.00 39.63  ? 54  ARG A CG  1 
ATOM   341   C  CD  . ARG A 1 54  ? -29.634 4.997   16.793  1.00 41.92  ? 54  ARG A CD  1 
ATOM   342   N  NE  . ARG A 1 54  ? -28.862 5.618   15.710  1.00 49.99  ? 54  ARG A NE  1 
ATOM   343   C  CZ  . ARG A 1 54  ? -28.391 6.872   15.672  1.00 62.03  ? 54  ARG A CZ  1 
ATOM   344   N  NH1 . ARG A 1 54  ? -28.565 7.738   16.678  1.00 65.23  ? 54  ARG A NH1 1 
ATOM   345   N  NH2 . ARG A 1 54  ? -27.712 7.263   14.597  1.00 47.01  ? 54  ARG A NH2 1 
ATOM   346   N  N   . GLY A 1 55  ? -33.789 5.748   20.490  1.00 73.61  ? 55  GLY A N   1 
ATOM   347   C  CA  . GLY A 1 55  ? -34.308 6.682   21.471  1.00 81.56  ? 55  GLY A CA  1 
ATOM   348   C  C   . GLY A 1 55  ? -33.599 6.633   22.810  1.00 74.64  ? 55  GLY A C   1 
ATOM   349   O  O   . GLY A 1 55  ? -32.472 6.151   22.914  1.00 60.52  ? 55  GLY A O   1 
ATOM   350   N  N   . GLU A 1 56  ? -34.270 7.141   23.839  1.00 77.26  ? 56  GLU A N   1 
ATOM   351   C  CA  . GLU A 1 56  ? -33.721 7.145   25.189  1.00 75.68  ? 56  GLU A CA  1 
ATOM   352   C  C   . GLU A 1 56  ? -33.562 5.722   25.707  1.00 76.03  ? 56  GLU A C   1 
ATOM   353   O  O   . GLU A 1 56  ? -33.129 5.505   26.838  1.00 78.26  ? 56  GLU A O   1 
ATOM   354   C  CB  . GLU A 1 56  ? -34.622 7.946   26.129  1.00 96.14  ? 56  GLU A CB  1 
ATOM   355   C  CG  . GLU A 1 56  ? -36.101 7.865   25.788  1.00 109.28 ? 56  GLU A CG  1 
ATOM   356   C  CD  . GLU A 1 56  ? -36.909 7.159   26.860  1.00 117.61 ? 56  GLU A CD  1 
ATOM   357   O  OE1 . GLU A 1 56  ? -37.393 7.841   27.788  1.00 119.55 ? 56  GLU A OE1 1 
ATOM   358   O  OE2 . GLU A 1 56  ? -37.061 5.922   26.773  1.00 120.02 ? 56  GLU A OE2 1 
ATOM   359   N  N   . LYS A 1 57  ? -33.918 4.753   24.870  1.00 81.26  ? 57  LYS A N   1 
ATOM   360   C  CA  . LYS A 1 57  ? -33.797 3.348   25.233  1.00 75.54  ? 57  LYS A CA  1 
ATOM   361   C  C   . LYS A 1 57  ? -32.336 2.978   25.452  1.00 61.23  ? 57  LYS A C   1 
ATOM   362   O  O   . LYS A 1 57  ? -32.027 1.905   25.968  1.00 45.30  ? 57  LYS A O   1 
ATOM   363   C  CB  . LYS A 1 57  ? -34.410 2.460   24.149  1.00 68.88  ? 57  LYS A CB  1 
ATOM   364   C  CG  . LYS A 1 57  ? -35.781 1.909   24.499  1.00 63.29  ? 57  LYS A CG  1 
ATOM   365   C  CD  . LYS A 1 57  ? -36.414 1.208   23.308  1.00 71.44  ? 57  LYS A CD  1 
ATOM   366   C  CE  . LYS A 1 57  ? -37.900 0.977   23.529  1.00 75.40  ? 57  LYS A CE  1 
ATOM   367   N  NZ  . LYS A 1 57  ? -38.562 0.429   22.314  1.00 80.95  ? 57  LYS A NZ  1 
ATOM   368   N  N   . ILE A 1 58  ? -31.439 3.868   25.040  1.00 45.58  ? 58  ILE A N   1 
ATOM   369   C  CA  . ILE A 1 58  ? -30.009 3.635   25.188  1.00 44.10  ? 58  ILE A CA  1 
ATOM   370   C  C   . ILE A 1 58  ? -29.496 4.254   26.481  1.00 56.61  ? 58  ILE A C   1 
ATOM   371   O  O   . ILE A 1 58  ? -28.836 5.292   26.464  1.00 52.70  ? 58  ILE A O   1 
ATOM   372   C  CB  . ILE A 1 58  ? -29.219 4.214   24.002  1.00 48.22  ? 58  ILE A CB  1 
ATOM   373   C  CG1 . ILE A 1 58  ? -29.666 3.562   22.693  1.00 48.02  ? 58  ILE A CG1 1 
ATOM   374   C  CG2 . ILE A 1 58  ? -27.726 4.021   24.214  1.00 46.33  ? 58  ILE A CG2 1 
ATOM   375   C  CD1 . ILE A 1 58  ? -29.629 2.051   22.722  1.00 47.23  ? 58  ILE A CD1 1 
ATOM   376   N  N   . ASP A 1 59  ? -29.808 3.612   27.602  1.00 51.66  ? 59  ASP A N   1 
ATOM   377   C  CA  . ASP A 1 59  ? -29.390 4.105   28.896  1.00 58.51  ? 59  ASP A CA  1 
ATOM   378   C  C   . ASP A 1 59  ? -28.169 3.296   29.273  1.00 65.94  ? 59  ASP A C   1 
ATOM   379   O  O   . ASP A 1 59  ? -27.751 2.418   28.522  1.00 63.82  ? 59  ASP A O   1 
ATOM   380   C  CB  . ASP A 1 59  ? -30.494 3.935   29.938  1.00 64.98  ? 59  ASP A CB  1 
ATOM   381   C  CG  . ASP A 1 59  ? -30.861 2.477   30.165  1.00 73.78  ? 59  ASP A CG  1 
ATOM   382   O  OD1 . ASP A 1 59  ? -32.036 2.203   30.483  1.00 82.65  ? 59  ASP A OD1 1 
ATOM   383   O  OD2 . ASP A 1 59  ? -29.977 1.602   30.022  1.00 62.30  ? 59  ASP A OD2 1 
ATOM   384   N  N   . GLU A 1 60  ? -27.594 3.617   30.428  1.00 63.98  ? 60  GLU A N   1 
ATOM   385   C  CA  . GLU A 1 60  ? -26.381 2.967   30.905  1.00 76.84  ? 60  GLU A CA  1 
ATOM   386   C  C   . GLU A 1 60  ? -26.581 1.469   31.069  1.00 69.42  ? 60  GLU A C   1 
ATOM   387   O  O   . GLU A 1 60  ? -25.702 0.677   30.730  1.00 66.97  ? 60  GLU A O   1 
ATOM   388   C  CB  . GLU A 1 60  ? -25.934 3.583   32.232  1.00 83.02  ? 60  GLU A CB  1 
ATOM   389   C  CG  . GLU A 1 60  ? -25.390 4.997   32.108  1.00 97.15  ? 60  GLU A CG  1 
ATOM   390   C  CD  . GLU A 1 60  ? -23.876 5.044   32.149  1.00 112.09 ? 60  GLU A CD  1 
ATOM   391   O  OE1 . GLU A 1 60  ? -23.292 5.968   31.545  1.00 107.71 ? 60  GLU A OE1 1 
ATOM   392   O  OE2 . GLU A 1 60  ? -23.270 4.156   32.785  1.00 121.44 ? 60  GLU A OE2 1 
ATOM   393   N  N   . ASN A 1 61  ? -27.735 1.077   31.600  1.00 66.81  ? 61  ASN A N   1 
ATOM   394   C  CA  . ASN A 1 61  ? -28.044 -0.337  31.769  1.00 69.36  ? 61  ASN A CA  1 
ATOM   395   C  C   . ASN A 1 61  ? -27.609 -1.120  30.539  1.00 59.96  ? 61  ASN A C   1 
ATOM   396   O  O   . ASN A 1 61  ? -26.881 -2.107  30.637  1.00 55.98  ? 61  ASN A O   1 
ATOM   397   C  CB  . ASN A 1 61  ? -29.540 -0.534  32.015  1.00 82.40  ? 61  ASN A CB  1 
ATOM   398   C  CG  . ASN A 1 61  ? -29.903 -0.464  33.484  1.00 95.93  ? 61  ASN A CG  1 
ATOM   399   O  OD1 . ASN A 1 61  ? -29.423 -1.258  34.293  1.00 100.86 ? 61  ASN A OD1 1 
ATOM   400   N  ND2 . ASN A 1 61  ? -30.758 0.489   33.837  1.00 96.72  ? 61  ASN A ND2 1 
ATOM   401   N  N   . VAL A 1 62  ? -28.063 -0.661  29.379  1.00 52.36  ? 62  VAL A N   1 
ATOM   402   C  CA  . VAL A 1 62  ? -27.677 -1.238  28.102  1.00 58.71  ? 62  VAL A CA  1 
ATOM   403   C  C   . VAL A 1 62  ? -26.167 -1.162  27.924  1.00 54.32  ? 62  VAL A C   1 
ATOM   404   O  O   . VAL A 1 62  ? -25.525 -2.125  27.505  1.00 50.89  ? 62  VAL A O   1 
ATOM   405   C  CB  . VAL A 1 62  ? -28.416 -0.545  26.935  1.00 54.58  ? 62  VAL A CB  1 
ATOM   406   C  CG1 . VAL A 1 62  ? -27.662 -0.689  25.606  1.00 45.63  ? 62  VAL A CG1 1 
ATOM   407   C  CG2 . VAL A 1 62  ? -29.829 -1.082  26.843  1.00 50.68  ? 62  VAL A CG2 1 
ATOM   408   N  N   . LYS A 1 63  ? -25.591 -0.012  28.255  1.00 41.37  ? 63  LYS A N   1 
ATOM   409   C  CA  . LYS A 1 63  ? -24.147 0.166   28.158  1.00 51.99  ? 63  LYS A CA  1 
ATOM   410   C  C   . LYS A 1 63  ? -23.418 -0.846  29.038  1.00 52.58  ? 63  LYS A C   1 
ATOM   411   O  O   . LYS A 1 63  ? -22.464 -1.491  28.604  1.00 34.63  ? 63  LYS A O   1 
ATOM   412   C  CB  . LYS A 1 63  ? -23.753 1.589   28.556  1.00 66.42  ? 63  LYS A CB  1 
ATOM   413   C  CG  . LYS A 1 63  ? -22.414 2.042   27.999  1.00 75.09  ? 63  LYS A CG  1 
ATOM   414   C  CD  . LYS A 1 63  ? -21.665 2.910   28.997  1.00 80.51  ? 63  LYS A CD  1 
ATOM   415   C  CE  . LYS A 1 63  ? -22.180 2.697   30.410  1.00 86.48  ? 63  LYS A CE  1 
ATOM   416   N  NZ  . LYS A 1 63  ? -22.084 3.936   31.229  1.00 98.95  ? 63  LYS A NZ  1 
ATOM   417   N  N   . ARG A 1 64  ? -23.880 -0.978  30.277  1.00 41.22  ? 64  ARG A N   1 
ATOM   418   C  CA  . ARG A 1 64  ? -23.303 -1.915  31.231  1.00 43.87  ? 64  ARG A CA  1 
ATOM   419   C  C   . ARG A 1 64  ? -23.271 -3.326  30.659  1.00 51.45  ? 64  ARG A C   1 
ATOM   420   O  O   . ARG A 1 64  ? -22.215 -3.954  30.592  1.00 56.23  ? 64  ARG A O   1 
ATOM   421   C  CB  . ARG A 1 64  ? -24.091 -1.897  32.541  1.00 35.99  ? 64  ARG A CB  1 
ATOM   422   C  CG  . ARG A 1 64  ? -23.409 -2.628  33.683  1.00 58.41  ? 64  ARG A CG  1 
ATOM   423   C  CD  . ARG A 1 64  ? -24.376 -3.560  34.395  1.00 69.29  ? 64  ARG A CD  1 
ATOM   424   N  NE  . ARG A 1 64  ? -25.471 -2.834  35.027  1.00 71.92  ? 64  ARG A NE  1 
ATOM   425   C  CZ  . ARG A 1 64  ? -26.757 -3.106  34.834  1.00 84.63  ? 64  ARG A CZ  1 
ATOM   426   N  NH1 . ARG A 1 64  ? -27.114 -4.094  34.024  1.00 86.93  ? 64  ARG A NH1 1 
ATOM   427   N  NH2 . ARG A 1 64  ? -27.690 -2.392  35.450  1.00 85.81  ? 64  ARG A NH2 1 
ATOM   428   N  N   . GLU A 1 65  ? -24.433 -3.820  30.246  1.00 50.04  ? 65  GLU A N   1 
ATOM   429   C  CA  . GLU A 1 65  ? -24.522 -5.146  29.677  1.00 48.61  ? 65  GLU A CA  1 
ATOM   430   C  C   . GLU A 1 65  ? -23.619 -5.376  28.460  1.00 36.06  ? 65  GLU A C   1 
ATOM   431   O  O   . GLU A 1 65  ? -22.957 -6.403  28.356  1.00 36.38  ? 65  GLU A O   1 
ATOM   432   C  CB  . GLU A 1 65  ? -25.974 -5.474  29.362  1.00 62.60  ? 65  GLU A CB  1 
ATOM   433   C  CG  . GLU A 1 65  ? -26.759 -5.821  30.610  1.00 83.99  ? 65  GLU A CG  1 
ATOM   434   C  CD  . GLU A 1 65  ? -28.253 -5.878  30.359  1.00 114.64 ? 65  GLU A CD  1 
ATOM   435   O  OE1 . GLU A 1 65  ? -28.716 -5.272  29.363  1.00 119.41 ? 65  GLU A OE1 1 
ATOM   436   O  OE2 . GLU A 1 65  ? -28.965 -6.526  31.161  1.00 126.99 ? 65  GLU A OE2 1 
ATOM   437   N  N   . ILE A 1 66  ? -23.592 -4.406  27.554  1.00 33.51  ? 66  ILE A N   1 
ATOM   438   C  CA  . ILE A 1 66  ? -22.746 -4.495  26.370  1.00 26.38  ? 66  ILE A CA  1 
ATOM   439   C  C   . ILE A 1 66  ? -21.283 -4.688  26.756  1.00 42.79  ? 66  ILE A C   1 
ATOM   440   O  O   . ILE A 1 66  ? -20.600 -5.558  26.217  1.00 48.69  ? 66  ILE A O   1 
ATOM   441   C  CB  . ILE A 1 66  ? -22.875 -3.241  25.488  1.00 37.00  ? 66  ILE A CB  1 
ATOM   442   C  CG1 . ILE A 1 66  ? -24.274 -3.163  24.874  1.00 35.32  ? 66  ILE A CG1 1 
ATOM   443   C  CG2 . ILE A 1 66  ? -21.812 -3.243  24.402  1.00 23.93  ? 66  ILE A CG2 1 
ATOM   444   C  CD1 . ILE A 1 66  ? -24.412 -2.102  23.805  1.00 31.75  ? 66  ILE A CD1 1 
ATOM   445   N  N   . ILE A 1 67  ? -20.807 -3.873  27.692  1.00 38.31  ? 67  ILE A N   1 
ATOM   446   C  CA  . ILE A 1 67  ? -19.425 -3.958  28.153  1.00 34.19  ? 67  ILE A CA  1 
ATOM   447   C  C   . ILE A 1 67  ? -19.161 -5.288  28.851  1.00 40.14  ? 67  ILE A C   1 
ATOM   448   O  O   . ILE A 1 67  ? -18.227 -6.007  28.503  1.00 48.23  ? 67  ILE A O   1 
ATOM   449   C  CB  . ILE A 1 67  ? -19.078 -2.806  29.114  1.00 49.32  ? 67  ILE A CB  1 
ATOM   450   C  CG1 . ILE A 1 67  ? -19.424 -1.459  28.478  1.00 57.87  ? 67  ILE A CG1 1 
ATOM   451   C  CG2 . ILE A 1 67  ? -17.607 -2.857  29.497  1.00 42.07  ? 67  ILE A CG2 1 
ATOM   452   C  CD1 . ILE A 1 67  ? -18.223 -0.705  27.952  1.00 56.33  ? 67  ILE A CD1 1 
ATOM   453   N  N   . ASN A 1 68  ? -19.995 -5.613  29.832  1.00 31.33  ? 68  ASN A N   1 
ATOM   454   C  CA  . ASN A 1 68  ? -19.854 -6.865  30.565  1.00 46.58  ? 68  ASN A CA  1 
ATOM   455   C  C   . ASN A 1 68  ? -19.742 -8.065  29.631  1.00 43.69  ? 68  ASN A C   1 
ATOM   456   O  O   . ASN A 1 68  ? -18.906 -8.945  29.832  1.00 57.26  ? 68  ASN A O   1 
ATOM   457   C  CB  . ASN A 1 68  ? -21.026 -7.057  31.529  1.00 52.67  ? 68  ASN A CB  1 
ATOM   458   C  CG  . ASN A 1 68  ? -20.871 -6.247  32.801  1.00 71.68  ? 68  ASN A CG  1 
ATOM   459   O  OD1 . ASN A 1 68  ? -19.961 -5.428  32.923  1.00 80.43  ? 68  ASN A OD1 1 
ATOM   460   N  ND2 . ASN A 1 68  ? -21.764 -6.473  33.757  1.00 78.39  ? 68  ASN A ND2 1 
ATOM   461   N  N   . HIS A 1 69  ? -20.598 -8.097  28.614  1.00 38.84  ? 69  HIS A N   1 
ATOM   462   C  CA  . HIS A 1 69  ? -20.599 -9.187  27.647  1.00 42.77  ? 69  HIS A CA  1 
ATOM   463   C  C   . HIS A 1 69  ? -19.372 -9.107  26.749  1.00 46.32  ? 69  HIS A C   1 
ATOM   464   O  O   . HIS A 1 69  ? -18.901 -10.117 26.225  1.00 56.57  ? 69  HIS A O   1 
ATOM   465   C  CB  . HIS A 1 69  ? -21.873 -9.146  26.801  1.00 29.19  ? 69  HIS A CB  1 
ATOM   466   C  CG  . HIS A 1 69  ? -21.965 -10.249 25.794  1.00 55.86  ? 69  HIS A CG  1 
ATOM   467   N  ND1 . HIS A 1 69  ? -22.901 -10.257 24.783  1.00 56.36  ? 69  HIS A ND1 1 
ATOM   468   C  CD2 . HIS A 1 69  ? -21.239 -11.382 25.642  1.00 51.09  ? 69  HIS A CD2 1 
ATOM   469   C  CE1 . HIS A 1 69  ? -22.748 -11.346 24.051  1.00 52.11  ? 69  HIS A CE1 1 
ATOM   470   N  NE2 . HIS A 1 69  ? -21.746 -12.046 24.551  1.00 46.93  ? 69  HIS A NE2 1 
ATOM   471   N  N   . ARG A 1 70  ? -18.858 -7.895  26.578  1.00 42.71  ? 70  ARG A N   1 
ATOM   472   C  CA  . ARG A 1 70  ? -17.696 -7.662  25.737  1.00 36.58  ? 70  ARG A CA  1 
ATOM   473   C  C   . ARG A 1 70  ? -16.419 -8.150  26.406  1.00 44.33  ? 70  ARG A C   1 
ATOM   474   O  O   . ARG A 1 70  ? -15.402 -8.342  25.741  1.00 45.37  ? 70  ARG A O   1 
ATOM   475   C  CB  . ARG A 1 70  ? -17.574 -6.176  25.396  1.00 45.48  ? 70  ARG A CB  1 
ATOM   476   C  CG  . ARG A 1 70  ? -16.776 -5.892  24.135  1.00 47.57  ? 70  ARG A CG  1 
ATOM   477   C  CD  . ARG A 1 70  ? -15.352 -6.405  24.256  1.00 39.36  ? 70  ARG A CD  1 
ATOM   478   N  NE  . ARG A 1 70  ? -14.456 -5.759  23.302  1.00 37.95  ? 70  ARG A NE  1 
ATOM   479   C  CZ  . ARG A 1 70  ? -13.139 -5.933  23.281  1.00 55.49  ? 70  ARG A CZ  1 
ATOM   480   N  NH1 . ARG A 1 70  ? -12.561 -6.736  24.163  1.00 44.75  ? 70  ARG A NH1 1 
ATOM   481   N  NH2 . ARG A 1 70  ? -12.401 -5.305  22.376  1.00 60.87  ? 70  ARG A NH2 1 
ATOM   482   N  N   . SER A 1 71  ? -16.464 -8.350  27.720  1.00 42.18  ? 71  SER A N   1 
ATOM   483   C  CA  . SER A 1 71  ? -15.277 -8.809  28.422  1.00 37.47  ? 71  SER A CA  1 
ATOM   484   C  C   . SER A 1 71  ? -15.169 -10.332 28.445  1.00 39.85  ? 71  SER A C   1 
ATOM   485   O  O   . SER A 1 71  ? -14.119 -10.857 28.770  1.00 55.84  ? 71  SER A O   1 
ATOM   486   C  CB  . SER A 1 71  ? -15.241 -8.257  29.843  1.00 40.95  ? 71  SER A CB  1 
ATOM   487   O  OG  . SER A 1 71  ? -16.252 -8.859  30.626  1.00 41.59  ? 71  SER A OG  1 
ATOM   488   N  N   . LEU A 1 72  ? -16.242 -11.043 28.122  1.00 42.04  ? 72  LEU A N   1 
ATOM   489   C  CA  . LEU A 1 72  ? -16.227 -12.492 28.242  1.00 36.02  ? 72  LEU A CA  1 
ATOM   490   C  C   . LEU A 1 72  ? -15.570 -13.137 27.021  1.00 37.69  ? 72  LEU A C   1 
ATOM   491   O  O   . LEU A 1 72  ? -16.068 -13.033 25.904  1.00 52.32  ? 72  LEU A O   1 
ATOM   492   C  CB  . LEU A 1 72  ? -17.643 -12.994 28.447  1.00 41.08  ? 72  LEU A CB  1 
ATOM   493   C  CG  . LEU A 1 72  ? -18.292 -12.442 29.717  1.00 39.31  ? 72  LEU A CG  1 
ATOM   494   C  CD1 . LEU A 1 72  ? -19.719 -12.940 29.827  1.00 35.08  ? 72  LEU A CD1 1 
ATOM   495   C  CD2 . LEU A 1 72  ? -17.507 -12.849 30.918  1.00 42.10  ? 72  LEU A CD2 1 
ATOM   496   N  N   . ARG A 1 73  ? -14.417 -13.756 27.252  1.00 33.89  ? 73  ARG A N   1 
ATOM   497   C  CA  . ARG A 1 73  ? -13.632 -14.360 26.184  1.00 50.35  ? 73  ARG A CA  1 
ATOM   498   C  C   . ARG A 1 73  ? -13.304 -15.802 26.536  1.00 61.59  ? 73  ARG A C   1 
ATOM   499   O  O   . ARG A 1 73  ? -12.238 -16.097 27.074  1.00 69.32  ? 73  ARG A O   1 
ATOM   500   C  CB  . ARG A 1 73  ? -12.342 -13.569 25.956  1.00 51.36  ? 73  ARG A CB  1 
ATOM   501   C  CG  . ARG A 1 73  ? -12.250 -12.911 24.590  1.00 81.18  ? 73  ARG A CG  1 
ATOM   502   C  CD  . ARG A 1 73  ? -13.392 -11.934 24.369  1.00 86.40  ? 73  ARG A CD  1 
ATOM   503   N  NE  . ARG A 1 73  ? -13.295 -11.264 23.075  1.00 96.25  ? 73  ARG A NE  1 
ATOM   504   C  CZ  . ARG A 1 73  ? -14.208 -10.424 22.599  1.00 98.95  ? 73  ARG A CZ  1 
ATOM   505   N  NH1 . ARG A 1 73  ? -15.293 -10.147 23.308  1.00 103.20 ? 73  ARG A NH1 1 
ATOM   506   N  NH2 . ARG A 1 73  ? -14.038 -9.860  21.411  1.00 80.57  ? 73  ARG A NH2 1 
ATOM   507   N  N   . HIS A 1 74  ? -14.236 -16.697 26.231  1.00 53.45  ? 74  HIS A N   1 
ATOM   508   C  CA  . HIS A 1 74  ? -14.089 -18.107 26.564  1.00 51.30  ? 74  HIS A CA  1 
ATOM   509   C  C   . HIS A 1 74  ? -14.773 -18.926 25.479  1.00 51.79  ? 74  HIS A C   1 
ATOM   510   O  O   . HIS A 1 74  ? -15.767 -18.487 24.904  1.00 50.74  ? 74  HIS A O   1 
ATOM   511   C  CB  . HIS A 1 74  ? -14.721 -18.397 27.924  1.00 44.65  ? 74  HIS A CB  1 
ATOM   512   C  CG  . HIS A 1 74  ? -14.429 -19.766 28.450  1.00 50.85  ? 74  HIS A CG  1 
ATOM   513   N  ND1 . HIS A 1 74  ? -14.957 -20.909 27.889  1.00 49.58  ? 74  HIS A ND1 1 
ATOM   514   C  CD2 . HIS A 1 74  ? -13.666 -20.177 29.492  1.00 50.43  ? 74  HIS A CD2 1 
ATOM   515   C  CE1 . HIS A 1 74  ? -14.531 -21.965 28.560  1.00 55.62  ? 74  HIS A CE1 1 
ATOM   516   N  NE2 . HIS A 1 74  ? -13.745 -21.548 29.537  1.00 56.49  ? 74  HIS A NE2 1 
ATOM   517   N  N   . PRO A 1 75  ? -14.242 -20.108 25.190  1.00 53.35  ? 75  PRO A N   1 
ATOM   518   C  CA  . PRO A 1 75  ? -14.773 -20.908 24.063  1.00 44.69  ? 75  PRO A CA  1 
ATOM   519   C  C   . PRO A 1 75  ? -16.158 -21.478 24.341  1.00 40.27  ? 75  PRO A C   1 
ATOM   520   O  O   . PRO A 1 75  ? -16.905 -21.765 23.406  1.00 52.07  ? 75  PRO A O   1 
ATOM   521   C  CB  . PRO A 1 75  ? -13.759 -22.035 23.908  1.00 41.47  ? 75  PRO A CB  1 
ATOM   522   C  CG  . PRO A 1 75  ? -12.569 -21.632 24.733  1.00 51.70  ? 75  PRO A CG  1 
ATOM   523   C  CD  . PRO A 1 75  ? -13.085 -20.758 25.834  1.00 40.97  ? 75  PRO A CD  1 
ATOM   524   N  N   . ASN A 1 76  ? -16.502 -21.599 25.618  1.00 36.02  ? 76  ASN A N   1 
ATOM   525   C  CA  . ASN A 1 76  ? -17.810 -22.103 26.016  1.00 39.07  ? 76  ASN A CA  1 
ATOM   526   C  C   . ASN A 1 76  ? -18.800 -20.995 26.371  1.00 38.01  ? 76  ASN A C   1 
ATOM   527   O  O   . ASN A 1 76  ? -19.874 -21.265 26.906  1.00 46.32  ? 76  ASN A O   1 
ATOM   528   C  CB  . ASN A 1 76  ? -17.671 -23.081 27.184  1.00 33.66  ? 76  ASN A CB  1 
ATOM   529   C  CG  . ASN A 1 76  ? -16.855 -24.306 26.823  1.00 40.81  ? 76  ASN A CG  1 
ATOM   530   O  OD1 . ASN A 1 76  ? -15.905 -24.661 27.520  1.00 49.59  ? 76  ASN A OD1 1 
ATOM   531   N  ND2 . ASN A 1 76  ? -17.222 -24.959 25.728  1.00 37.83  ? 76  ASN A ND2 1 
ATOM   532   N  N   . ILE A 1 77  ? -18.439 -19.750 26.071  1.00 46.33  ? 77  ILE A N   1 
ATOM   533   C  CA  . ILE A 1 77  ? -19.332 -18.627 26.326  1.00 32.65  ? 77  ILE A CA  1 
ATOM   534   C  C   . ILE A 1 77  ? -19.706 -17.910 25.035  1.00 38.34  ? 77  ILE A C   1 
ATOM   535   O  O   . ILE A 1 77  ? -18.876 -17.750 24.141  1.00 44.66  ? 77  ILE A O   1 
ATOM   536   C  CB  . ILE A 1 77  ? -18.703 -17.612 27.299  1.00 48.09  ? 77  ILE A CB  1 
ATOM   537   C  CG1 . ILE A 1 77  ? -18.184 -18.324 28.550  1.00 47.26  ? 77  ILE A CG1 1 
ATOM   538   C  CG2 . ILE A 1 77  ? -19.712 -16.539 27.674  1.00 40.08  ? 77  ILE A CG2 1 
ATOM   539   C  CD1 . ILE A 1 77  ? -18.763 -17.788 29.839  1.00 33.03  ? 77  ILE A CD1 1 
ATOM   540   N  N   . VAL A 1 78  ? -20.960 -17.481 24.943  1.00 38.58  ? 78  VAL A N   1 
ATOM   541   C  CA  . VAL A 1 78  ? -21.422 -16.727 23.786  1.00 45.05  ? 78  VAL A CA  1 
ATOM   542   C  C   . VAL A 1 78  ? -20.660 -15.412 23.701  1.00 36.48  ? 78  VAL A C   1 
ATOM   543   O  O   . VAL A 1 78  ? -21.029 -14.425 24.335  1.00 45.21  ? 78  VAL A O   1 
ATOM   544   C  CB  . VAL A 1 78  ? -22.930 -16.437 23.863  1.00 46.68  ? 78  VAL A CB  1 
ATOM   545   C  CG1 . VAL A 1 78  ? -23.443 -15.939 22.521  1.00 47.91  ? 78  VAL A CG1 1 
ATOM   546   C  CG2 . VAL A 1 78  ? -23.686 -17.680 24.301  1.00 33.12  ? 78  VAL A CG2 1 
ATOM   547   N  N   . ARG A 1 79  ? -19.587 -15.410 22.919  1.00 41.01  ? 79  ARG A N   1 
ATOM   548   C  CA  . ARG A 1 79  ? -18.709 -14.251 22.811  1.00 43.04  ? 79  ARG A CA  1 
ATOM   549   C  C   . ARG A 1 79  ? -19.369 -13.063 22.116  1.00 50.23  ? 79  ARG A C   1 
ATOM   550   O  O   . ARG A 1 79  ? -20.198 -13.230 21.224  1.00 51.21  ? 79  ARG A O   1 
ATOM   551   C  CB  . ARG A 1 79  ? -17.418 -14.627 22.082  1.00 44.84  ? 79  ARG A CB  1 
ATOM   552   C  CG  . ARG A 1 79  ? -16.170 -14.540 22.945  1.00 66.47  ? 79  ARG A CG  1 
ATOM   553   C  CD  . ARG A 1 79  ? -15.839 -15.885 23.573  1.00 71.20  ? 79  ARG A CD  1 
ATOM   554   N  NE  . ARG A 1 79  ? -14.559 -16.406 23.103  1.00 87.86  ? 79  ARG A NE  1 
ATOM   555   C  CZ  . ARG A 1 79  ? -14.431 -17.303 22.130  1.00 89.90  ? 79  ARG A CZ  1 
ATOM   556   N  NH1 . ARG A 1 79  ? -15.507 -17.783 21.522  1.00 82.16  ? 79  ARG A NH1 1 
ATOM   557   N  NH2 . ARG A 1 79  ? -13.227 -17.721 21.765  1.00 88.49  ? 79  ARG A NH2 1 
ATOM   558   N  N   . PHE A 1 80  ? -18.984 -11.863 22.537  1.00 63.66  ? 80  PHE A N   1 
ATOM   559   C  CA  . PHE A 1 80  ? -19.448 -10.633 21.911  1.00 40.37  ? 80  PHE A CA  1 
ATOM   560   C  C   . PHE A 1 80  ? -18.548 -10.365 20.713  1.00 24.33  ? 80  PHE A C   1 
ATOM   561   O  O   . PHE A 1 80  ? -17.411 -10.833 20.676  1.00 43.02  ? 80  PHE A O   1 
ATOM   562   C  CB  . PHE A 1 80  ? -19.382 -9.473  22.903  1.00 53.44  ? 80  PHE A CB  1 
ATOM   563   C  CG  . PHE A 1 80  ? -19.572 -8.123  22.273  1.00 46.76  ? 80  PHE A CG  1 
ATOM   564   C  CD1 . PHE A 1 80  ? -18.570 -7.553  21.506  1.00 34.57  ? 80  PHE A CD1 1 
ATOM   565   C  CD2 . PHE A 1 80  ? -20.751 -7.421  22.451  1.00 35.78  ? 80  PHE A CD2 1 
ATOM   566   C  CE1 . PHE A 1 80  ? -18.743 -6.312  20.927  1.00 30.18  ? 80  PHE A CE1 1 
ATOM   567   C  CE2 . PHE A 1 80  ? -20.929 -6.180  21.874  1.00 30.14  ? 80  PHE A CE2 1 
ATOM   568   C  CZ  . PHE A 1 80  ? -19.924 -5.624  21.111  1.00 36.74  ? 80  PHE A CZ  1 
ATOM   569   N  N   . LYS A 1 81  ? -19.105 -9.653  19.759  1.00 32.20  ? 81  LYS A N   1 
ATOM   570   C  CA  . LYS A 1 81  ? -18.566 -9.472  18.427  1.00 47.60  ? 81  LYS A CA  1 
ATOM   571   C  C   . LYS A 1 81  ? -18.206 -8.047  18.072  1.00 51.08  ? 81  LYS A C   1 
ATOM   572   O  O   . LYS A 1 81  ? -17.109 -7.751  17.704  1.00 50.87  ? 81  LYS A O   1 
ATOM   573   C  CB  . LYS A 1 81  ? -19.629 -9.880  17.436  1.00 57.90  ? 81  LYS A CB  1 
ATOM   574   C  CG  . LYS A 1 81  ? -19.491 -11.242 16.873  1.00 59.41  ? 81  LYS A CG  1 
ATOM   575   C  CD  . LYS A 1 81  ? -18.233 -11.852 17.287  1.00 72.53  ? 81  LYS A CD  1 
ATOM   576   C  CE  . LYS A 1 81  ? -17.416 -12.198 16.109  1.00 76.25  ? 81  LYS A CE  1 
ATOM   577   N  NZ  . LYS A 1 81  ? -17.603 -13.627 15.834  1.00 72.61  ? 81  LYS A NZ  1 
ATOM   578   N  N   . GLU A 1 82  ? -19.181 -7.178  18.183  1.00 51.91  ? 82  GLU A N   1 
ATOM   579   C  CA  . GLU A 1 82  ? -19.168 -5.801  17.649  1.00 43.65  ? 82  GLU A CA  1 
ATOM   580   C  C   . GLU A 1 82  ? -20.493 -5.033  17.786  1.00 45.17  ? 82  GLU A C   1 
ATOM   581   O  O   . GLU A 1 82  ? -21.559 -5.610  17.635  1.00 41.43  ? 82  GLU A O   1 
ATOM   582   C  CB  . GLU A 1 82  ? -18.673 -5.815  16.202  1.00 33.98  ? 82  GLU A CB  1 
ATOM   583   C  CG  . GLU A 1 82  ? -19.583 -5.192  15.176  1.00 50.05  ? 82  GLU A CG  1 
ATOM   584   C  CD  . GLU A 1 82  ? -18.923 -5.115  13.793  1.00 67.30  ? 82  GLU A CD  1 
ATOM   585   O  OE1 . GLU A 1 82  ? -18.750 -6.169  13.159  1.00 71.42  ? 82  GLU A OE1 1 
ATOM   586   O  OE2 . GLU A 1 82  ? -18.569 -4.005  13.343  1.00 75.57  ? 82  GLU A OE2 1 
ATOM   587   N  N   . VAL A 1 83  ? -20.429 -3.735  18.109  1.00 43.80  ? 83  VAL A N   1 
ATOM   588   C  CA  . VAL A 1 83  ? -21.610 -2.878  17.939  1.00 24.14  ? 83  VAL A CA  1 
ATOM   589   C  C   . VAL A 1 83  ? -21.537 -2.101  16.654  1.00 37.74  ? 83  VAL A C   1 
ATOM   590   O  O   . VAL A 1 83  ? -20.457 -1.717  16.223  1.00 43.26  ? 83  VAL A O   1 
ATOM   591   C  CB  . VAL A 1 83  ? -21.857 -1.910  19.063  1.00 35.78  ? 83  VAL A CB  1 
ATOM   592   C  CG1 . VAL A 1 83  ? -22.676 -2.564  20.141  1.00 29.64  ? 83  VAL A CG1 1 
ATOM   593   C  CG2 . VAL A 1 83  ? -20.540 -1.343  19.591  1.00 51.53  ? 83  VAL A CG2 1 
ATOM   594   N  N   . ILE A 1 84  ? -22.694 -1.911  16.029  1.00 37.41  ? 84  ILE A N   1 
ATOM   595   C  CA  . ILE A 1 84  ? -22.796 -1.155  14.793  1.00 37.69  ? 84  ILE A CA  1 
ATOM   596   C  C   . ILE A 1 84  ? -23.943 -0.188  14.942  1.00 42.82  ? 84  ILE A C   1 
ATOM   597   O  O   . ILE A 1 84  ? -24.987 -0.540  15.474  1.00 31.01  ? 84  ILE A O   1 
ATOM   598   C  CB  . ILE A 1 84  ? -23.148 -2.032  13.608  1.00 45.29  ? 84  ILE A CB  1 
ATOM   599   C  CG1 . ILE A 1 84  ? -22.246 -3.251  13.530  1.00 46.05  ? 84  ILE A CG1 1 
ATOM   600   C  CG2 . ILE A 1 84  ? -23.058 -1.224  12.328  1.00 30.52  ? 84  ILE A CG2 1 
ATOM   601   C  CD1 . ILE A 1 84  ? -22.446 -4.021  12.248  1.00 46.38  ? 84  ILE A CD1 1 
ATOM   602   N  N   . LEU A 1 85  ? -23.764 1.040   14.472  1.00 41.09  ? 85  LEU A N   1 
ATOM   603   C  CA  . LEU A 1 85  ? -24.819 2.040   14.578  1.00 48.93  ? 85  LEU A CA  1 
ATOM   604   C  C   . LEU A 1 85  ? -25.530 2.240   13.243  1.00 52.25  ? 85  LEU A C   1 
ATOM   605   O  O   . LEU A 1 85  ? -24.895 2.578   12.245  1.00 64.21  ? 85  LEU A O   1 
ATOM   606   C  CB  . LEU A 1 85  ? -24.244 3.369   15.072  1.00 54.48  ? 85  LEU A CB  1 
ATOM   607   C  CG  . LEU A 1 85  ? -25.232 4.524   15.238  1.00 51.36  ? 85  LEU A CG  1 
ATOM   608   C  CD1 . LEU A 1 85  ? -26.041 4.358   16.514  1.00 45.40  ? 85  LEU A CD1 1 
ATOM   609   C  CD2 . LEU A 1 85  ? -24.501 5.856   15.232  1.00 50.82  ? 85  LEU A CD2 1 
ATOM   610   N  N   . THR A 1 86  ? -26.847 2.096   13.271  1.00 48.34  ? 86  THR A N   1 
ATOM   611   C  CA  . THR A 1 86  ? -27.699 2.416   12.143  1.00 66.32  ? 86  THR A CA  1 
ATOM   612   C  C   . THR A 1 86  ? -28.578 3.554   12.628  1.00 69.84  ? 86  THR A C   1 
ATOM   613   O  O   . THR A 1 86  ? -28.789 3.705   13.831  1.00 68.31  ? 86  THR A O   1 
ATOM   614   C  CB  . THR A 1 86  ? -28.578 1.224   11.730  1.00 65.20  ? 86  THR A CB  1 
ATOM   615   O  OG1 . THR A 1 86  ? -29.701 1.127   12.615  1.00 56.42  ? 86  THR A OG1 1 
ATOM   616   C  CG2 . THR A 1 86  ? -27.782 -0.069  11.785  1.00 52.27  ? 86  THR A CG2 1 
ATOM   617   N  N   . PRO A 1 87  ? -29.130 4.335   11.711  1.00 79.79  ? 87  PRO A N   1 
ATOM   618   C  CA  . PRO A 1 87  ? -29.931 5.486   12.132  1.00 75.20  ? 87  PRO A CA  1 
ATOM   619   C  C   . PRO A 1 87  ? -31.125 5.019   12.953  1.00 77.17  ? 87  PRO A C   1 
ATOM   620   O  O   . PRO A 1 87  ? -31.454 5.635   13.966  1.00 91.20  ? 87  PRO A O   1 
ATOM   621   C  CB  . PRO A 1 87  ? -30.408 6.082   10.806  1.00 75.42  ? 87  PRO A CB  1 
ATOM   622   C  CG  . PRO A 1 87  ? -29.380 5.661   9.812   1.00 80.02  ? 87  PRO A CG  1 
ATOM   623   C  CD  . PRO A 1 87  ? -28.936 4.297   10.251  1.00 85.19  ? 87  PRO A CD  1 
ATOM   624   N  N   . THR A 1 88  ? -31.765 3.940   12.518  1.00 63.84  ? 88  THR A N   1 
ATOM   625   C  CA  . THR A 1 88  ? -32.893 3.373   13.248  1.00 58.93  ? 88  THR A CA  1 
ATOM   626   C  C   . THR A 1 88  ? -32.551 2.810   14.634  1.00 57.38  ? 88  THR A C   1 
ATOM   627   O  O   . THR A 1 88  ? -33.296 3.023   15.590  1.00 60.10  ? 88  THR A O   1 
ATOM   628   C  CB  . THR A 1 88  ? -33.598 2.280   12.420  1.00 73.70  ? 88  THR A CB  1 
ATOM   629   O  OG1 . THR A 1 88  ? -34.951 2.137   12.867  1.00 64.71  ? 88  THR A OG1 1 
ATOM   630   C  CG2 . THR A 1 88  ? -32.874 0.951   12.563  1.00 71.18  ? 88  THR A CG2 1 
ATOM   631   N  N   . HIS A 1 89  ? -31.435 2.092   14.742  1.00 46.47  ? 89  HIS A N   1 
ATOM   632   C  CA  . HIS A 1 89  ? -31.100 1.409   15.986  1.00 44.11  ? 89  HIS A CA  1 
ATOM   633   C  C   . HIS A 1 89  ? -29.640 1.104   16.190  1.00 42.29  ? 89  HIS A C   1 
ATOM   634   O  O   . HIS A 1 89  ? -28.839 1.102   15.231  1.00 48.31  ? 89  HIS A O   1 
ATOM   635   C  CB  . HIS A 1 89  ? -31.890 0.108   16.108  1.00 55.66  ? 89  HIS A CB  1 
ATOM   636   C  CG  . HIS A 1 89  ? -33.324 0.212   15.646  1.00 57.76  ? 89  HIS A CG  1 
ATOM   637   N  ND1 . HIS A 1 89  ? -34.321 -0.477  16.228  1.00 49.19  ? 89  HIS A ND1 1 
ATOM   638   C  CD2 . HIS A 1 89  ? -33.905 0.951   14.618  1.00 51.58  ? 89  HIS A CD2 1 
ATOM   639   C  CE1 . HIS A 1 89  ? -35.482 -0.193  15.611  1.00 45.81  ? 89  HIS A CE1 1 
ATOM   640   N  NE2 . HIS A 1 89  ? -35.226 0.681   14.626  1.00 52.12  ? 89  HIS A NE2 1 
ATOM   641   N  N   . LEU A 1 90  ? -29.282 0.830   17.443  1.00 26.22  ? 90  LEU A N   1 
ATOM   642   C  CA  . LEU A 1 90  ? -28.008 0.245   17.794  1.00 37.71  ? 90  LEU A CA  1 
ATOM   643   C  C   . LEU A 1 90  ? -28.099 -1.254  17.493  1.00 39.60  ? 90  LEU A C   1 
ATOM   644   O  O   . LEU A 1 90  ? -29.025 -1.925  17.922  1.00 39.62  ? 90  LEU A O   1 
ATOM   645   C  CB  . LEU A 1 90  ? -27.732 0.467   19.282  1.00 26.13  ? 90  LEU A CB  1 
ATOM   646   C  CG  . LEU A 1 90  ? -26.456 -0.154  19.820  1.00 35.60  ? 90  LEU A CG  1 
ATOM   647   C  CD1 . LEU A 1 90  ? -25.216 0.439   19.162  1.00 39.24  ? 90  LEU A CD1 1 
ATOM   648   C  CD2 . LEU A 1 90  ? -26.417 -0.026  21.320  1.00 26.88  ? 90  LEU A CD2 1 
ATOM   649   N  N   . ALA A 1 91  ? -27.140 -1.766  16.737  1.00 38.04  ? 91  ALA A N   1 
ATOM   650   C  CA  . ALA A 1 91  ? -27.043 -3.181  16.460  1.00 32.55  ? 91  ALA A CA  1 
ATOM   651   C  C   . ALA A 1 91  ? -25.996 -3.847  17.345  1.00 39.85  ? 91  ALA A C   1 
ATOM   652   O  O   . ALA A 1 91  ? -24.840 -3.454  17.323  1.00 59.64  ? 91  ALA A O   1 
ATOM   653   C  CB  . ALA A 1 91  ? -26.657 -3.370  15.011  1.00 40.36  ? 91  ALA A CB  1 
ATOM   654   N  N   . ILE A 1 92  ? -26.387 -4.860  18.111  1.00 49.15  ? 92  ILE A N   1 
ATOM   655   C  CA  . ILE A 1 92  ? -25.440 -5.651  18.894  1.00 42.56  ? 92  ILE A CA  1 
ATOM   656   C  C   . ILE A 1 92  ? -25.207 -7.017  18.228  1.00 44.28  ? 92  ILE A C   1 
ATOM   657   O  O   . ILE A 1 92  ? -26.110 -7.831  18.139  1.00 39.55  ? 92  ILE A O   1 
ATOM   658   C  CB  . ILE A 1 92  ? -25.975 -5.843  20.319  1.00 36.23  ? 92  ILE A CB  1 
ATOM   659   C  CG1 . ILE A 1 92  ? -26.357 -4.482  20.915  1.00 30.04  ? 92  ILE A CG1 1 
ATOM   660   C  CG2 . ILE A 1 92  ? -24.972 -6.612  21.182  1.00 27.01  ? 92  ILE A CG2 1 
ATOM   661   C  CD1 . ILE A 1 92  ? -27.149 -4.589  22.174  1.00 28.51  ? 92  ILE A CD1 1 
ATOM   662   N  N   . VAL A 1 93  ? -23.994 -7.257  17.750  1.00 45.38  ? 93  VAL A N   1 
ATOM   663   C  CA  . VAL A 1 93  ? -23.659 -8.479  17.036  1.00 38.66  ? 93  VAL A CA  1 
ATOM   664   C  C   . VAL A 1 93  ? -22.869 -9.467  17.905  1.00 43.91  ? 93  VAL A C   1 
ATOM   665   O  O   . VAL A 1 93  ? -21.846 -9.111  18.493  1.00 57.20  ? 93  VAL A O   1 
ATOM   666   C  CB  . VAL A 1 93  ? -22.812 -8.132  15.822  1.00 34.31  ? 93  VAL A CB  1 
ATOM   667   C  CG1 . VAL A 1 93  ? -22.448 -9.387  15.033  1.00 35.93  ? 93  VAL A CG1 1 
ATOM   668   C  CG2 . VAL A 1 93  ? -23.562 -7.145  14.951  1.00 30.15  ? 93  VAL A CG2 1 
ATOM   669   N  N   . MET A 1 94  ? -23.351 -10.703 17.980  1.00 52.84  ? 94  MET A N   1 
ATOM   670   C  CA  . MET A 1 94  ? -22.689 -11.730 18.774  1.00 47.86  ? 94  MET A CA  1 
ATOM   671   C  C   . MET A 1 94  ? -22.689 -13.070 18.050  1.00 45.07  ? 94  MET A C   1 
ATOM   672   O  O   . MET A 1 94  ? -23.444 -13.272 17.101  1.00 48.75  ? 94  MET A O   1 
ATOM   673   C  CB  . MET A 1 94  ? -23.369 -11.872 20.137  1.00 25.95  ? 94  MET A CB  1 
ATOM   674   C  CG  . MET A 1 94  ? -24.800 -12.375 20.067  1.00 24.88  ? 94  MET A CG  1 
ATOM   675   S  SD  . MET A 1 94  ? -25.753 -11.961 21.539  1.00 61.50  ? 94  MET A SD  1 
ATOM   676   C  CE  . MET A 1 94  ? -26.331 -10.320 21.118  1.00 40.72  ? 94  MET A CE  1 
ATOM   677   N  N   . GLU A 1 95  ? -21.835 -13.982 18.502  1.00 50.77  ? 95  GLU A N   1 
ATOM   678   C  CA  . GLU A 1 95  ? -21.758 -15.309 17.904  1.00 56.29  ? 95  GLU A CA  1 
ATOM   679   C  C   . GLU A 1 95  ? -23.049 -16.081 18.153  1.00 47.26  ? 95  GLU A C   1 
ATOM   680   O  O   . GLU A 1 95  ? -23.625 -16.012 19.239  1.00 39.50  ? 95  GLU A O   1 
ATOM   681   C  CB  . GLU A 1 95  ? -20.555 -16.080 18.450  1.00 57.26  ? 95  GLU A CB  1 
ATOM   682   C  CG  . GLU A 1 95  ? -20.739 -16.614 19.858  1.00 69.18  ? 95  GLU A CG  1 
ATOM   683   C  CD  . GLU A 1 95  ? -19.583 -17.487 20.301  1.00 74.71  ? 95  GLU A CD  1 
ATOM   684   O  OE1 . GLU A 1 95  ? -19.705 -18.149 21.353  1.00 76.18  ? 95  GLU A OE1 1 
ATOM   685   O  OE2 . GLU A 1 95  ? -18.552 -17.513 19.597  1.00 70.85  ? 95  GLU A OE2 1 
ATOM   686   N  N   . TYR A 1 96  ? -23.500 -16.811 17.139  1.00 48.56  ? 96  TYR A N   1 
ATOM   687   C  CA  . TYR A 1 96  ? -24.753 -17.549 17.222  1.00 50.92  ? 96  TYR A CA  1 
ATOM   688   C  C   . TYR A 1 96  ? -24.513 -19.051 17.335  1.00 44.52  ? 96  TYR A C   1 
ATOM   689   O  O   . TYR A 1 96  ? -23.811 -19.639 16.514  1.00 46.76  ? 96  TYR A O   1 
ATOM   690   C  CB  . TYR A 1 96  ? -25.620 -17.245 15.998  1.00 41.20  ? 96  TYR A CB  1 
ATOM   691   C  CG  . TYR A 1 96  ? -26.876 -18.078 15.900  1.00 45.15  ? 96  TYR A CG  1 
ATOM   692   C  CD1 . TYR A 1 96  ? -27.924 -17.897 16.791  1.00 34.14  ? 96  TYR A CD1 1 
ATOM   693   C  CD2 . TYR A 1 96  ? -27.017 -19.042 14.910  1.00 52.70  ? 96  TYR A CD2 1 
ATOM   694   C  CE1 . TYR A 1 96  ? -29.076 -18.655 16.702  1.00 39.20  ? 96  TYR A CE1 1 
ATOM   695   C  CE2 . TYR A 1 96  ? -28.164 -19.804 14.814  1.00 54.65  ? 96  TYR A CE2 1 
ATOM   696   C  CZ  . TYR A 1 96  ? -29.190 -19.607 15.712  1.00 54.25  ? 96  TYR A CZ  1 
ATOM   697   O  OH  . TYR A 1 96  ? -30.334 -20.364 15.620  1.00 59.64  ? 96  TYR A OH  1 
ATOM   698   N  N   . ALA A 1 97  ? -25.100 -19.666 18.357  1.00 35.85  ? 97  ALA A N   1 
ATOM   699   C  CA  . ALA A 1 97  ? -24.976 -21.121 18.552  1.00 49.95  ? 97  ALA A CA  1 
ATOM   700   C  C   . ALA A 1 97  ? -26.003 -21.804 17.653  1.00 44.98  ? 97  ALA A C   1 
ATOM   701   O  O   . ALA A 1 97  ? -27.208 -21.751 17.923  1.00 31.80  ? 97  ALA A O   1 
ATOM   702   C  CB  . ALA A 1 97  ? -25.198 -21.510 20.014  1.00 39.78  ? 97  ALA A CB  1 
ATOM   703   N  N   . SER A 1 98  ? -25.543 -22.410 16.563  1.00 32.56  ? 98  SER A N   1 
ATOM   704   C  CA  . SER A 1 98  ? -26.504 -23.006 15.615  1.00 53.39  ? 98  SER A CA  1 
ATOM   705   C  C   . SER A 1 98  ? -27.145 -24.246 16.248  1.00 58.15  ? 98  SER A C   1 
ATOM   706   O  O   . SER A 1 98  ? -28.364 -24.298 16.462  1.00 71.20  ? 98  SER A O   1 
ATOM   707   C  CB  . SER A 1 98  ? -25.856 -23.329 14.249  1.00 44.21  ? 98  SER A CB  1 
ATOM   708   O  OG  . SER A 1 98  ? -24.433 -23.376 14.331  1.00 42.65  ? 98  SER A OG  1 
ATOM   709   N  N   . GLY A 1 99  ? -26.281 -25.200 16.582  1.00 40.36  ? 99  GLY A N   1 
ATOM   710   C  CA  . GLY A 1 99  ? -26.590 -26.409 17.331  1.00 37.96  ? 99  GLY A CA  1 
ATOM   711   C  C   . GLY A 1 99  ? -27.873 -26.715 18.074  1.00 37.03  ? 99  GLY A C   1 
ATOM   712   O  O   . GLY A 1 99  ? -28.168 -27.911 18.345  1.00 38.12  ? 99  GLY A O   1 
ATOM   713   N  N   . GLY A 1 100 ? -28.621 -25.682 18.426  1.00 29.28  ? 100 GLY A N   1 
ATOM   714   C  CA  . GLY A 1 100 ? -29.889 -25.874 19.089  1.00 23.45  ? 100 GLY A CA  1 
ATOM   715   C  C   . GLY A 1 100 ? -29.553 -25.954 20.544  1.00 35.06  ? 100 GLY A C   1 
ATOM   716   O  O   . GLY A 1 100 ? -28.427 -25.633 20.941  1.00 37.34  ? 100 GLY A O   1 
ATOM   717   N  N   . GLU A 1 101 ? -30.504 -26.391 21.352  1.00 39.37  ? 101 GLU A N   1 
ATOM   718   C  CA  . GLU A 1 101 ? -30.275 -26.444 22.784  1.00 41.11  ? 101 GLU A CA  1 
ATOM   719   C  C   . GLU A 1 101 ? -29.687 -27.780 23.228  1.00 36.80  ? 101 GLU A C   1 
ATOM   720   O  O   . GLU A 1 101 ? -29.912 -28.800 22.585  1.00 49.88  ? 101 GLU A O   1 
ATOM   721   C  CB  . GLU A 1 101 ? -31.590 -26.230 23.515  1.00 43.25  ? 101 GLU A CB  1 
ATOM   722   C  CG  . GLU A 1 101 ? -32.052 -24.804 23.568  1.00 28.34  ? 101 GLU A CG  1 
ATOM   723   C  CD  . GLU A 1 101 ? -33.355 -24.689 24.378  1.00 60.64  ? 101 GLU A CD  1 
ATOM   724   O  OE1 . GLU A 1 101 ? -34.417 -24.348 23.807  1.00 64.01  ? 101 GLU A OE1 1 
ATOM   725   O  OE2 . GLU A 1 101 ? -33.308 -24.963 25.597  1.00 70.37  ? 101 GLU A OE2 1 
ATOM   726   N  N   . LEU A 1 102 ? -28.963 -27.764 24.350  1.00 38.61  ? 102 LEU A N   1 
ATOM   727   C  CA  . LEU A 1 102 ? -28.412 -28.978 24.950  1.00 44.88  ? 102 LEU A CA  1 
ATOM   728   C  C   . LEU A 1 102 ? -29.549 -29.903 25.332  1.00 42.74  ? 102 LEU A C   1 
ATOM   729   O  O   . LEU A 1 102 ? -29.508 -31.099 25.064  1.00 50.26  ? 102 LEU A O   1 
ATOM   730   C  CB  . LEU A 1 102 ? -27.591 -28.677 26.205  1.00 30.55  ? 102 LEU A CB  1 
ATOM   731   C  CG  . LEU A 1 102 ? -27.094 -29.927 26.967  1.00 30.33  ? 102 LEU A CG  1 
ATOM   732   C  CD1 . LEU A 1 102 ? -26.112 -30.741 26.122  1.00 29.71  ? 102 LEU A CD1 1 
ATOM   733   C  CD2 . LEU A 1 102 ? -26.425 -29.563 28.272  1.00 29.20  ? 102 LEU A CD2 1 
ATOM   734   N  N   . PHE A 1 103 ? -30.577 -29.338 25.948  1.00 36.35  ? 103 PHE A N   1 
ATOM   735   C  CA  . PHE A 1 103 ? -31.681 -30.144 26.408  1.00 33.49  ? 103 PHE A CA  1 
ATOM   736   C  C   . PHE A 1 103 ? -32.353 -30.843 25.227  1.00 45.20  ? 103 PHE A C   1 
ATOM   737   O  O   . PHE A 1 103 ? -32.802 -31.979 25.331  1.00 41.24  ? 103 PHE A O   1 
ATOM   738   C  CB  . PHE A 1 103 ? -32.650 -29.273 27.156  1.00 22.38  ? 103 PHE A CB  1 
ATOM   739   C  CG  . PHE A 1 103 ? -33.867 -29.975 27.621  1.00 49.82  ? 103 PHE A CG  1 
ATOM   740   C  CD1 . PHE A 1 103 ? -35.094 -29.753 27.000  1.00 63.76  ? 103 PHE A CD1 1 
ATOM   741   C  CD2 . PHE A 1 103 ? -33.810 -30.840 28.708  1.00 50.91  ? 103 PHE A CD2 1 
ATOM   742   C  CE1 . PHE A 1 103 ? -36.256 -30.391 27.456  1.00 57.68  ? 103 PHE A CE1 1 
ATOM   743   C  CE2 . PHE A 1 103 ? -34.954 -31.483 29.166  1.00 51.82  ? 103 PHE A CE2 1 
ATOM   744   C  CZ  . PHE A 1 103 ? -36.184 -31.256 28.537  1.00 57.92  ? 103 PHE A CZ  1 
ATOM   745   N  N   . GLU A 1 104 ? -32.371 -30.158 24.089  1.00 43.75  ? 104 GLU A N   1 
ATOM   746   C  CA  . GLU A 1 104 ? -32.921 -30.719 22.865  1.00 42.90  ? 104 GLU A CA  1 
ATOM   747   C  C   . GLU A 1 104 ? -32.148 -31.954 22.407  1.00 51.42  ? 104 GLU A C   1 
ATOM   748   O  O   . GLU A 1 104 ? -32.741 -32.906 21.900  1.00 67.25  ? 104 GLU A O   1 
ATOM   749   C  CB  . GLU A 1 104 ? -32.931 -29.666 21.755  1.00 42.15  ? 104 GLU A CB  1 
ATOM   750   C  CG  . GLU A 1 104 ? -34.028 -29.863 20.722  1.00 67.41  ? 104 GLU A CG  1 
ATOM   751   C  CD  . GLU A 1 104 ? -35.373 -30.167 21.353  1.00 82.30  ? 104 GLU A CD  1 
ATOM   752   O  OE1 . GLU A 1 104 ? -36.129 -30.981 20.781  1.00 85.02  ? 104 GLU A OE1 1 
ATOM   753   O  OE2 . GLU A 1 104 ? -35.675 -29.593 22.419  1.00 86.52  ? 104 GLU A OE2 1 
ATOM   754   N  N   . ARG A 1 105 ? -30.829 -31.943 22.583  1.00 39.83  ? 105 ARG A N   1 
ATOM   755   C  CA  . ARG A 1 105 ? -30.017 -33.066 22.147  1.00 41.72  ? 105 ARG A CA  1 
ATOM   756   C  C   . ARG A 1 105 ? -30.183 -34.217 23.140  1.00 48.08  ? 105 ARG A C   1 
ATOM   757   O  O   . ARG A 1 105 ? -30.165 -35.403 22.771  1.00 46.85  ? 105 ARG A O   1 
ATOM   758   C  CB  . ARG A 1 105 ? -28.558 -32.648 22.016  1.00 30.89  ? 105 ARG A CB  1 
ATOM   759   C  CG  . ARG A 1 105 ? -27.624 -33.767 21.686  1.00 48.06  ? 105 ARG A CG  1 
ATOM   760   C  CD  . ARG A 1 105 ? -26.185 -33.279 21.612  1.00 56.77  ? 105 ARG A CD  1 
ATOM   761   N  NE  . ARG A 1 105 ? -25.519 -33.760 20.393  1.00 65.37  ? 105 ARG A NE  1 
ATOM   762   C  CZ  . ARG A 1 105 ? -24.610 -34.731 20.371  1.00 71.10  ? 105 ARG A CZ  1 
ATOM   763   N  NH1 . ARG A 1 105 ? -24.243 -35.330 21.493  1.00 76.28  ? 105 ARG A NH1 1 
ATOM   764   N  NH2 . ARG A 1 105 ? -24.056 -35.104 19.230  1.00 79.33  ? 105 ARG A NH2 1 
ATOM   765   N  N   . ILE A 1 106 ? -30.371 -33.865 24.403  1.00 45.69  ? 106 ILE A N   1 
ATOM   766   C  CA  . ILE A 1 106 ? -30.509 -34.891 25.409  1.00 44.91  ? 106 ILE A CA  1 
ATOM   767   C  C   . ILE A 1 106 ? -31.760 -35.709 25.161  1.00 46.56  ? 106 ILE A C   1 
ATOM   768   O  O   . ILE A 1 106 ? -31.708 -36.945 25.192  1.00 50.64  ? 106 ILE A O   1 
ATOM   769   C  CB  . ILE A 1 106 ? -30.584 -34.332 26.827  1.00 38.19  ? 106 ILE A CB  1 
ATOM   770   C  CG1 . ILE A 1 106 ? -29.248 -33.728 27.240  1.00 39.27  ? 106 ILE A CG1 1 
ATOM   771   C  CG2 . ILE A 1 106 ? -30.967 -35.455 27.804  1.00 36.86  ? 106 ILE A CG2 1 
ATOM   772   C  CD1 . ILE A 1 106 ? -29.367 -32.984 28.595  1.00 31.56  ? 106 ILE A CD1 1 
ATOM   773   N  N   . CYS A 1 107 ? -32.887 -35.052 24.922  1.00 31.45  ? 107 CYS A N   1 
ATOM   774   C  CA  . CYS A 1 107 ? -34.079 -35.856 24.760  1.00 52.68  ? 107 CYS A CA  1 
ATOM   775   C  C   . CYS A 1 107 ? -34.263 -36.517 23.387  1.00 54.57  ? 107 CYS A C   1 
ATOM   776   O  O   . CYS A 1 107 ? -35.008 -37.487 23.278  1.00 53.60  ? 107 CYS A O   1 
ATOM   777   C  CB  . CYS A 1 107 ? -35.361 -35.234 25.334  1.00 55.91  ? 107 CYS A CB  1 
ATOM   778   S  SG  . CYS A 1 107 ? -35.680 -33.562 25.008  1.00 74.58  ? 107 CYS A SG  1 
ATOM   779   N  N   . ASN A 1 108 ? -33.542 -36.052 22.370  1.00 41.69  ? 108 ASN A N   1 
ATOM   780   C  CA  . ASN A 1 108 ? -33.442 -36.826 21.128  1.00 37.92  ? 108 ASN A CA  1 
ATOM   781   C  C   . ASN A 1 108 ? -32.664 -38.129 21.316  1.00 50.71  ? 108 ASN A C   1 
ATOM   782   O  O   . ASN A 1 108 ? -32.921 -39.123 20.628  1.00 64.94  ? 108 ASN A O   1 
ATOM   783   C  CB  . ASN A 1 108 ? -32.783 -36.032 20.009  1.00 41.78  ? 108 ASN A CB  1 
ATOM   784   C  CG  . ASN A 1 108 ? -33.696 -34.973 19.434  1.00 46.85  ? 108 ASN A CG  1 
ATOM   785   O  OD1 . ASN A 1 108 ? -34.892 -34.910 19.752  1.00 52.89  ? 108 ASN A OD1 1 
ATOM   786   N  ND2 . ASN A 1 108 ? -33.146 -34.153 18.561  1.00 43.07  ? 108 ASN A ND2 1 
ATOM   787   N  N   . ALA A 1 109 ? -31.706 -38.127 22.232  1.00 49.77  ? 109 ALA A N   1 
ATOM   788   C  CA  . ALA A 1 109 ? -30.882 -39.309 22.464  1.00 39.91  ? 109 ALA A CA  1 
ATOM   789   C  C   . ALA A 1 109 ? -31.494 -40.178 23.555  1.00 39.18  ? 109 ALA A C   1 
ATOM   790   O  O   . ALA A 1 109 ? -30.990 -41.266 23.851  1.00 37.61  ? 109 ALA A O   1 
ATOM   791   C  CB  . ALA A 1 109 ? -29.453 -38.878 22.850  1.00 35.10  ? 109 ALA A CB  1 
ATOM   792   N  N   . GLY A 1 110 ? -32.587 -39.699 24.148  1.00 41.18  ? 110 GLY A N   1 
ATOM   793   C  CA  . GLY A 1 110 ? -33.108 -40.308 25.366  1.00 26.93  ? 110 GLY A CA  1 
ATOM   794   C  C   . GLY A 1 110 ? -32.285 -39.894 26.589  1.00 37.84  ? 110 GLY A C   1 
ATOM   795   O  O   . GLY A 1 110 ? -32.804 -39.264 27.517  1.00 37.03  ? 110 GLY A O   1 
ATOM   796   N  N   . ARG A 1 111 ? -30.995 -40.233 26.564  1.00 21.97  ? 111 ARG A N   1 
ATOM   797   C  CA  . ARG A 1 111 ? -30.062 -39.896 27.624  1.00 33.42  ? 111 ARG A CA  1 
ATOM   798   C  C   . ARG A 1 111 ? -28.643 -40.132 27.103  1.00 45.43  ? 111 ARG A C   1 
ATOM   799   O  O   . ARG A 1 111 ? -28.460 -40.910 26.165  1.00 42.01  ? 111 ARG A O   1 
ATOM   800   C  CB  . ARG A 1 111 ? -30.335 -40.741 28.865  1.00 39.80  ? 111 ARG A CB  1 
ATOM   801   C  CG  . ARG A 1 111 ? -30.034 -42.232 28.741  1.00 31.56  ? 111 ARG A CG  1 
ATOM   802   C  CD  . ARG A 1 111 ? -30.142 -42.839 30.138  1.00 39.78  ? 111 ARG A CD  1 
ATOM   803   N  NE  . ARG A 1 111 ? -30.374 -44.276 30.098  1.00 59.98  ? 111 ARG A NE  1 
ATOM   804   C  CZ  . ARG A 1 111 ? -29.430 -45.198 30.250  1.00 53.19  ? 111 ARG A CZ  1 
ATOM   805   N  NH1 . ARG A 1 111 ? -28.166 -44.849 30.479  1.00 45.78  ? 111 ARG A NH1 1 
ATOM   806   N  NH2 . ARG A 1 111 ? -29.764 -46.475 30.175  1.00 45.15  ? 111 ARG A NH2 1 
ATOM   807   N  N   . PHE A 1 112 ? -27.639 -39.452 27.656  1.00 38.99  ? 112 PHE A N   1 
ATOM   808   C  CA  . PHE A 1 112 ? -26.292 -39.610 27.126  1.00 26.67  ? 112 PHE A CA  1 
ATOM   809   C  C   . PHE A 1 112 ? -25.609 -40.781 27.797  1.00 39.38  ? 112 PHE A C   1 
ATOM   810   O  O   . PHE A 1 112 ? -26.011 -41.231 28.878  1.00 28.23  ? 112 PHE A O   1 
ATOM   811   C  CB  . PHE A 1 112 ? -25.420 -38.379 27.347  1.00 33.58  ? 112 PHE A CB  1 
ATOM   812   C  CG  . PHE A 1 112 ? -25.887 -37.132 26.628  1.00 33.37  ? 112 PHE A CG  1 
ATOM   813   C  CD1 . PHE A 1 112 ? -26.709 -37.202 25.527  1.00 23.62  ? 112 PHE A CD1 1 
ATOM   814   C  CD2 . PHE A 1 112 ? -25.484 -35.872 27.081  1.00 26.65  ? 112 PHE A CD2 1 
ATOM   815   C  CE1 . PHE A 1 112 ? -27.123 -36.032 24.878  1.00 31.74  ? 112 PHE A CE1 1 
ATOM   816   C  CE2 . PHE A 1 112 ? -25.880 -34.720 26.446  1.00 35.94  ? 112 PHE A CE2 1 
ATOM   817   C  CZ  . PHE A 1 112 ? -26.704 -34.790 25.350  1.00 42.64  ? 112 PHE A CZ  1 
ATOM   818   N  N   . SER A 1 113 ? -24.554 -41.264 27.155  1.00 38.59  ? 113 SER A N   1 
ATOM   819   C  CA  . SER A 1 113 ? -23.633 -42.156 27.824  1.00 32.78  ? 113 SER A CA  1 
ATOM   820   C  C   . SER A 1 113 ? -22.882 -41.365 28.920  1.00 49.25  ? 113 SER A C   1 
ATOM   821   O  O   . SER A 1 113 ? -22.801 -40.153 28.865  1.00 41.68  ? 113 SER A O   1 
ATOM   822   C  CB  . SER A 1 113 ? -22.643 -42.732 26.819  1.00 36.51  ? 113 SER A CB  1 
ATOM   823   O  OG  . SER A 1 113 ? -21.596 -41.822 26.533  1.00 39.76  ? 113 SER A OG  1 
ATOM   824   N  N   . GLU A 1 114 ? -22.325 -42.060 29.902  1.00 50.92  ? 114 GLU A N   1 
ATOM   825   C  CA  . GLU A 1 114 ? -21.565 -41.401 30.932  1.00 34.11  ? 114 GLU A CA  1 
ATOM   826   C  C   . GLU A 1 114 ? -20.441 -40.543 30.337  1.00 39.98  ? 114 GLU A C   1 
ATOM   827   O  O   . GLU A 1 114 ? -20.246 -39.415 30.741  1.00 40.67  ? 114 GLU A O   1 
ATOM   828   C  CB  . GLU A 1 114 ? -21.028 -42.421 31.943  1.00 26.65  ? 114 GLU A CB  1 
ATOM   829   C  CG  . GLU A 1 114 ? -20.148 -41.798 33.029  1.00 51.14  ? 114 GLU A CG  1 
ATOM   830   C  CD  . GLU A 1 114 ? -19.867 -42.725 34.209  1.00 56.38  ? 114 GLU A CD  1 
ATOM   831   O  OE1 . GLU A 1 114 ? -18.823 -42.522 34.868  1.00 61.15  ? 114 GLU A OE1 1 
ATOM   832   O  OE2 . GLU A 1 114 ? -20.690 -43.623 34.488  1.00 59.05  ? 114 GLU A OE2 1 
ATOM   833   N  N   . ASP A 1 115 ? -19.711 -41.116 29.388  1.00 52.35  ? 115 ASP A N   1 
ATOM   834   C  CA  . ASP A 1 115 ? -18.575 -40.443 28.775  1.00 50.16  ? 115 ASP A CA  1 
ATOM   835   C  C   . ASP A 1 115 ? -18.991 -39.188 28.021  1.00 48.39  ? 115 ASP A C   1 
ATOM   836   O  O   . ASP A 1 115 ? -18.218 -38.236 27.919  1.00 40.83  ? 115 ASP A O   1 
ATOM   837   C  CB  . ASP A 1 115 ? -17.840 -41.396 27.831  1.00 37.55  ? 115 ASP A CB  1 
ATOM   838   C  CG  . ASP A 1 115 ? -16.654 -42.069 28.490  1.00 78.19  ? 115 ASP A CG  1 
ATOM   839   O  OD1 . ASP A 1 115 ? -16.866 -43.031 29.257  1.00 86.36  ? 115 ASP A OD1 1 
ATOM   840   O  OD2 . ASP A 1 115 ? -15.510 -41.635 28.242  1.00 96.85  ? 115 ASP A OD2 1 
ATOM   841   N  N   . GLU A 1 116 ? -20.196 -39.216 27.462  1.00 32.72  ? 116 GLU A N   1 
ATOM   842   C  CA  . GLU A 1 116 ? -20.712 -38.097 26.688  1.00 36.14  ? 116 GLU A CA  1 
ATOM   843   C  C   . GLU A 1 116 ? -21.133 -36.977 27.625  1.00 44.78  ? 116 GLU A C   1 
ATOM   844   O  O   . GLU A 1 116 ? -20.912 -35.800 27.344  1.00 39.18  ? 116 GLU A O   1 
ATOM   845   C  CB  . GLU A 1 116 ? -21.896 -38.541 25.829  1.00 23.52  ? 116 GLU A CB  1 
ATOM   846   C  CG  . GLU A 1 116 ? -22.426 -37.464 24.900  1.00 56.32  ? 116 GLU A CG  1 
ATOM   847   C  CD  . GLU A 1 116 ? -23.410 -38.006 23.883  1.00 77.13  ? 116 GLU A CD  1 
ATOM   848   O  OE1 . GLU A 1 116 ? -23.591 -39.241 23.829  1.00 71.37  ? 116 GLU A OE1 1 
ATOM   849   O  OE2 . GLU A 1 116 ? -24.002 -37.198 23.136  1.00 68.21  ? 116 GLU A OE2 1 
ATOM   850   N  N   . ALA A 1 117 ? -21.740 -37.356 28.743  1.00 34.38  ? 117 ALA A N   1 
ATOM   851   C  CA  . ALA A 1 117 ? -22.131 -36.397 29.753  1.00 29.59  ? 117 ALA A CA  1 
ATOM   852   C  C   . ALA A 1 117 ? -20.899 -35.714 30.333  1.00 44.88  ? 117 ALA A C   1 
ATOM   853   O  O   . ALA A 1 117 ? -20.929 -34.514 30.574  1.00 48.60  ? 117 ALA A O   1 
ATOM   854   C  CB  . ALA A 1 117 ? -22.951 -37.047 30.845  1.00 19.38  ? 117 ALA A CB  1 
ATOM   855   N  N   . ARG A 1 118 ? -19.823 -36.462 30.557  1.00 46.08  ? 118 ARG A N   1 
ATOM   856   C  CA  . ARG A 1 118 ? -18.601 -35.886 31.107  1.00 45.46  ? 118 ARG A CA  1 
ATOM   857   C  C   . ARG A 1 118 ? -18.068 -34.851 30.127  1.00 41.18  ? 118 ARG A C   1 
ATOM   858   O  O   . ARG A 1 118 ? -17.567 -33.791 30.501  1.00 42.34  ? 118 ARG A O   1 
ATOM   859   C  CB  . ARG A 1 118 ? -17.539 -36.961 31.352  1.00 34.63  ? 118 ARG A CB  1 
ATOM   860   C  CG  . ARG A 1 118 ? -16.519 -36.583 32.402  1.00 35.87  ? 118 ARG A CG  1 
ATOM   861   C  CD  . ARG A 1 118 ? -15.236 -37.386 32.265  1.00 46.24  ? 118 ARG A CD  1 
ATOM   862   N  NE  . ARG A 1 118 ? -15.454 -38.757 31.779  1.00 55.84  ? 118 ARG A NE  1 
ATOM   863   C  CZ  . ARG A 1 118 ? -15.766 -39.791 32.547  1.00 40.94  ? 118 ARG A CZ  1 
ATOM   864   N  NH1 . ARG A 1 118 ? -15.921 -39.636 33.850  1.00 44.78  ? 118 ARG A NH1 1 
ATOM   865   N  NH2 . ARG A 1 118 ? -15.932 -40.979 32.009  1.00 59.10  ? 118 ARG A NH2 1 
ATOM   866   N  N   . PHE A 1 119 ? -18.196 -35.170 28.857  1.00 34.14  ? 119 PHE A N   1 
ATOM   867   C  CA  . PHE A 1 119 ? -17.660 -34.325 27.812  1.00 45.75  ? 119 PHE A CA  1 
ATOM   868   C  C   . PHE A 1 119 ? -18.281 -32.927 27.846  1.00 58.63  ? 119 PHE A C   1 
ATOM   869   O  O   . PHE A 1 119 ? -17.604 -31.930 27.576  1.00 60.54  ? 119 PHE A O   1 
ATOM   870   C  CB  . PHE A 1 119 ? -17.959 -34.956 26.472  1.00 40.03  ? 119 PHE A CB  1 
ATOM   871   C  CG  . PHE A 1 119 ? -17.732 -34.044 25.300  1.00 48.20  ? 119 PHE A CG  1 
ATOM   872   C  CD1 . PHE A 1 119 ? -16.441 -33.775 24.842  1.00 41.52  ? 119 PHE A CD1 1 
ATOM   873   C  CD2 . PHE A 1 119 ? -18.817 -33.489 24.622  1.00 51.75  ? 119 PHE A CD2 1 
ATOM   874   C  CE1 . PHE A 1 119 ? -16.238 -32.966 23.736  1.00 46.08  ? 119 PHE A CE1 1 
ATOM   875   C  CE2 . PHE A 1 119 ? -18.623 -32.672 23.506  1.00 44.78  ? 119 PHE A CE2 1 
ATOM   876   C  CZ  . PHE A 1 119 ? -17.332 -32.411 23.072  1.00 47.19  ? 119 PHE A CZ  1 
ATOM   877   N  N   . PHE A 1 120 ? -19.576 -32.873 28.151  1.00 42.45  ? 120 PHE A N   1 
ATOM   878   C  CA  . PHE A 1 120 ? -20.312 -31.627 28.222  1.00 38.64  ? 120 PHE A CA  1 
ATOM   879   C  C   . PHE A 1 120 ? -20.170 -30.928 29.576  1.00 36.51  ? 120 PHE A C   1 
ATOM   880   O  O   . PHE A 1 120 ? -20.045 -29.710 29.654  1.00 43.00  ? 120 PHE A O   1 
ATOM   881   C  CB  . PHE A 1 120 ? -21.770 -31.905 27.919  1.00 30.82  ? 120 PHE A CB  1 
ATOM   882   C  CG  . PHE A 1 120 ? -22.059 -32.064 26.461  1.00 40.58  ? 120 PHE A CG  1 
ATOM   883   C  CD1 . PHE A 1 120 ? -21.828 -31.016 25.580  1.00 38.13  ? 120 PHE A CD1 1 
ATOM   884   C  CD2 . PHE A 1 120 ? -22.587 -33.249 25.967  1.00 26.19  ? 120 PHE A CD2 1 
ATOM   885   C  CE1 . PHE A 1 120 ? -22.099 -31.149 24.218  1.00 52.85  ? 120 PHE A CE1 1 
ATOM   886   C  CE2 . PHE A 1 120 ? -22.866 -33.387 24.616  1.00 36.22  ? 120 PHE A CE2 1 
ATOM   887   C  CZ  . PHE A 1 120 ? -22.631 -32.332 23.736  1.00 55.98  ? 120 PHE A CZ  1 
ATOM   888   N  N   . PHE A 1 121 ? -20.160 -31.741 30.627  1.00 29.50  ? 121 PHE A N   1 
ATOM   889   C  CA  . PHE A 1 121 ? -20.027 -31.265 31.986  1.00 38.80  ? 121 PHE A CA  1 
ATOM   890   C  C   . PHE A 1 121 ? -18.680 -30.582 32.184  1.00 46.39  ? 121 PHE A C   1 
ATOM   891   O  O   . PHE A 1 121 ? -18.569 -29.609 32.914  1.00 42.86  ? 121 PHE A O   1 
ATOM   892   C  CB  . PHE A 1 121 ? -20.176 -32.425 32.968  1.00 39.97  ? 121 PHE A CB  1 
ATOM   893   C  CG  . PHE A 1 121 ? -20.289 -31.987 34.400  1.00 38.43  ? 121 PHE A CG  1 
ATOM   894   C  CD1 . PHE A 1 121 ? -21.461 -31.409 34.868  1.00 34.22  ? 121 PHE A CD1 1 
ATOM   895   C  CD2 . PHE A 1 121 ? -19.218 -32.148 35.275  1.00 35.81  ? 121 PHE A CD2 1 
ATOM   896   C  CE1 . PHE A 1 121 ? -21.581 -31.013 36.190  1.00 27.07  ? 121 PHE A CE1 1 
ATOM   897   C  CE2 . PHE A 1 121 ? -19.330 -31.753 36.585  1.00 30.35  ? 121 PHE A CE2 1 
ATOM   898   C  CZ  . PHE A 1 121 ? -20.512 -31.188 37.050  1.00 32.32  ? 121 PHE A CZ  1 
ATOM   899   N  N   . GLN A 1 122 ? -17.652 -31.110 31.530  1.00 40.88  ? 122 GLN A N   1 
ATOM   900   C  CA  . GLN A 1 122 ? -16.319 -30.529 31.619  1.00 46.94  ? 122 GLN A CA  1 
ATOM   901   C  C   . GLN A 1 122 ? -16.339 -29.111 31.067  1.00 43.07  ? 122 GLN A C   1 
ATOM   902   O  O   . GLN A 1 122 ? -15.786 -28.189 31.664  1.00 38.17  ? 122 GLN A O   1 
ATOM   903   C  CB  . GLN A 1 122 ? -15.304 -31.386 30.863  1.00 41.23  ? 122 GLN A CB  1 
ATOM   904   C  CG  . GLN A 1 122 ? -14.776 -32.567 31.662  1.00 38.48  ? 122 GLN A CG  1 
ATOM   905   C  CD  . GLN A 1 122 ? -14.146 -33.628 30.786  1.00 45.25  ? 122 GLN A CD  1 
ATOM   906   O  OE1 . GLN A 1 122 ? -14.274 -33.597 29.563  1.00 43.74  ? 122 GLN A OE1 1 
ATOM   907   N  NE2 . GLN A 1 122 ? -13.460 -34.579 31.410  1.00 48.41  ? 122 GLN A NE2 1 
ATOM   908   N  N   . GLN A 1 123 ? -16.989 -28.948 29.920  1.00 27.17  ? 123 GLN A N   1 
ATOM   909   C  CA  . GLN A 1 123 ? -17.168 -27.626 29.309  1.00 38.63  ? 123 GLN A CA  1 
ATOM   910   C  C   . GLN A 1 123 ? -18.042 -26.720 30.180  1.00 38.72  ? 123 GLN A C   1 
ATOM   911   O  O   . GLN A 1 123 ? -17.706 -25.554 30.406  1.00 38.86  ? 123 GLN A O   1 
ATOM   912   C  CB  . GLN A 1 123 ? -17.775 -27.740 27.921  1.00 35.96  ? 123 GLN A CB  1 
ATOM   913   C  CG  . GLN A 1 123 ? -16.917 -28.469 26.926  1.00 42.32  ? 123 GLN A CG  1 
ATOM   914   C  CD  . GLN A 1 123 ? -17.662 -28.713 25.624  1.00 49.48  ? 123 GLN A CD  1 
ATOM   915   O  OE1 . GLN A 1 123 ? -18.049 -27.780 24.934  1.00 56.38  ? 123 GLN A OE1 1 
ATOM   916   N  NE2 . GLN A 1 123 ? -17.870 -29.975 25.288  1.00 48.85  ? 123 GLN A NE2 1 
ATOM   917   N  N   . LEU A 1 124 ? -19.149 -27.277 30.673  1.00 28.44  ? 124 LEU A N   1 
ATOM   918   C  CA  . LEU A 1 124 ? -20.061 -26.521 31.501  1.00 29.49  ? 124 LEU A CA  1 
ATOM   919   C  C   . LEU A 1 124 ? -19.314 -25.907 32.671  1.00 31.93  ? 124 LEU A C   1 
ATOM   920   O  O   . LEU A 1 124 ? -19.461 -24.720 32.940  1.00 53.11  ? 124 LEU A O   1 
ATOM   921   C  CB  . LEU A 1 124 ? -21.180 -27.402 32.035  1.00 29.99  ? 124 LEU A CB  1 
ATOM   922   C  CG  . LEU A 1 124 ? -22.172 -26.649 32.922  1.00 31.56  ? 124 LEU A CG  1 
ATOM   923   C  CD1 . LEU A 1 124 ? -22.824 -25.517 32.150  1.00 21.65  ? 124 LEU A CD1 1 
ATOM   924   C  CD2 . LEU A 1 124 ? -23.226 -27.579 33.507  1.00 26.87  ? 124 LEU A CD2 1 
ATOM   925   N  N   . ILE A 1 125 ? -18.520 -26.722 33.362  1.00 32.23  ? 125 ILE A N   1 
ATOM   926   C  CA  . ILE A 1 125 ? -17.844 -26.307 34.580  1.00 33.52  ? 125 ILE A CA  1 
ATOM   927   C  C   . ILE A 1 125 ? -16.685 -25.362 34.271  1.00 39.65  ? 125 ILE A C   1 
ATOM   928   O  O   . ILE A 1 125 ? -16.379 -24.451 35.022  1.00 40.75  ? 125 ILE A O   1 
ATOM   929   C  CB  . ILE A 1 125 ? -17.313 -27.484 35.354  1.00 28.71  ? 125 ILE A CB  1 
ATOM   930   C  CG1 . ILE A 1 125 ? -18.475 -28.244 35.959  1.00 32.75  ? 125 ILE A CG1 1 
ATOM   931   C  CG2 . ILE A 1 125 ? -16.396 -27.026 36.456  1.00 18.83  ? 125 ILE A CG2 1 
ATOM   932   C  CD1 . ILE A 1 125 ? -19.197 -27.530 37.046  1.00 33.15  ? 125 ILE A CD1 1 
ATOM   933   N  N   . SER A 1 126 ? -16.030 -25.573 33.157  1.00 29.87  ? 126 SER A N   1 
ATOM   934   C  CA  . SER A 1 126 ? -14.986 -24.653 32.788  1.00 31.86  ? 126 SER A CA  1 
ATOM   935   C  C   . SER A 1 126 ? -15.544 -23.264 32.477  1.00 39.65  ? 126 SER A C   1 
ATOM   936   O  O   . SER A 1 126 ? -14.964 -22.264 32.852  1.00 49.92  ? 126 SER A O   1 
ATOM   937   C  CB  . SER A 1 126 ? -14.264 -25.170 31.557  1.00 32.69  ? 126 SER A CB  1 
ATOM   938   O  OG  . SER A 1 126 ? -13.557 -24.098 30.971  1.00 46.98  ? 126 SER A OG  1 
ATOM   939   N  N   . GLY A 1 127 ? -16.665 -23.210 31.772  1.00 32.04  ? 127 GLY A N   1 
ATOM   940   C  CA  . GLY A 1 127 ? -17.260 -21.962 31.392  1.00 26.01  ? 127 GLY A CA  1 
ATOM   941   C  C   . GLY A 1 127 ? -17.880 -21.262 32.587  1.00 38.70  ? 127 GLY A C   1 
ATOM   942   O  O   . GLY A 1 127 ? -17.824 -20.038 32.675  1.00 48.53  ? 127 GLY A O   1 
ATOM   943   N  N   . VAL A 1 128 ? -18.453 -22.026 33.515  1.00 37.78  ? 128 VAL A N   1 
ATOM   944   C  CA  . VAL A 1 128 ? -19.064 -21.451 34.703  1.00 38.47  ? 128 VAL A CA  1 
ATOM   945   C  C   . VAL A 1 128 ? -17.990 -20.905 35.630  1.00 52.27  ? 128 VAL A C   1 
ATOM   946   O  O   . VAL A 1 128 ? -18.176 -19.872 36.296  1.00 51.07  ? 128 VAL A O   1 
ATOM   947   C  CB  . VAL A 1 128 ? -19.974 -22.466 35.440  1.00 31.97  ? 128 VAL A CB  1 
ATOM   948   C  CG1 . VAL A 1 128 ? -20.186 -22.075 36.870  1.00 23.44  ? 128 VAL A CG1 1 
ATOM   949   C  CG2 . VAL A 1 128 ? -21.320 -22.569 34.751  1.00 28.47  ? 128 VAL A CG2 1 
ATOM   950   N  N   . SER A 1 129 ? -16.854 -21.592 35.654  1.00 42.98  ? 129 SER A N   1 
ATOM   951   C  CA  . SER A 1 129 ? -15.756 -21.216 36.529  1.00 32.24  ? 129 SER A CA  1 
ATOM   952   C  C   . SER A 1 129 ? -15.181 -19.894 36.055  1.00 41.36  ? 129 SER A C   1 
ATOM   953   O  O   . SER A 1 129 ? -14.806 -19.037 36.849  1.00 38.74  ? 129 SER A O   1 
ATOM   954   C  CB  . SER A 1 129 ? -14.672 -22.300 36.529  1.00 35.36  ? 129 SER A CB  1 
ATOM   955   O  OG  . SER A 1 129 ? -13.515 -21.884 37.224  1.00 42.19  ? 129 SER A OG  1 
ATOM   956   N  N   . TYR A 1 130 ? -15.111 -19.739 34.744  1.00 40.61  ? 130 TYR A N   1 
ATOM   957   C  CA  . TYR A 1 130 ? -14.591 -18.532 34.151  1.00 37.08  ? 130 TYR A CA  1 
ATOM   958   C  C   . TYR A 1 130 ? -15.531 -17.380 34.457  1.00 47.33  ? 130 TYR A C   1 
ATOM   959   O  O   . TYR A 1 130 ? -15.102 -16.288 34.825  1.00 52.07  ? 130 TYR A O   1 
ATOM   960   C  CB  . TYR A 1 130 ? -14.500 -18.708 32.647  1.00 41.09  ? 130 TYR A CB  1 
ATOM   961   C  CG  . TYR A 1 130 ? -14.047 -17.472 31.919  1.00 38.60  ? 130 TYR A CG  1 
ATOM   962   C  CD1 . TYR A 1 130 ? -12.694 -17.214 31.716  1.00 43.68  ? 130 TYR A CD1 1 
ATOM   963   C  CD2 . TYR A 1 130 ? -14.963 -16.568 31.424  1.00 42.12  ? 130 TYR A CD2 1 
ATOM   964   C  CE1 . TYR A 1 130 ? -12.268 -16.078 31.033  1.00 43.11  ? 130 TYR A CE1 1 
ATOM   965   C  CE2 . TYR A 1 130 ? -14.545 -15.413 30.742  1.00 37.50  ? 130 TYR A CE2 1 
ATOM   966   C  CZ  . TYR A 1 130 ? -13.197 -15.181 30.553  1.00 47.29  ? 130 TYR A CZ  1 
ATOM   967   O  OH  . TYR A 1 130 ? -12.770 -14.045 29.898  1.00 53.18  ? 130 TYR A OH  1 
ATOM   968   N  N   . ALA A 1 131 ? -16.827 -17.623 34.331  1.00 46.36  ? 131 ALA A N   1 
ATOM   969   C  CA  . ALA A 1 131 ? -17.775 -16.552 34.594  1.00 48.47  ? 131 ALA A CA  1 
ATOM   970   C  C   . ALA A 1 131 ? -17.720 -16.118 36.043  1.00 48.70  ? 131 ALA A C   1 
ATOM   971   O  O   . ALA A 1 131 ? -18.049 -14.984 36.376  1.00 54.09  ? 131 ALA A O   1 
ATOM   972   C  CB  . ALA A 1 131 ? -19.184 -16.987 34.221  1.00 24.50  ? 131 ALA A CB  1 
ATOM   973   N  N   . HIS A 1 132 ? -17.336 -17.048 36.898  1.00 49.15  ? 132 HIS A N   1 
ATOM   974   C  CA  . HIS A 1 132 ? -17.296 -16.802 38.314  1.00 48.19  ? 132 HIS A CA  1 
ATOM   975   C  C   . HIS A 1 132 ? -16.086 -15.916 38.639  1.00 65.78  ? 132 HIS A C   1 
ATOM   976   O  O   . HIS A 1 132 ? -16.125 -15.071 39.547  1.00 76.19  ? 132 HIS A O   1 
ATOM   977   C  CB  . HIS A 1 132 ? -17.271 -18.137 39.077  1.00 38.88  ? 132 HIS A CB  1 
ATOM   978   C  CG  . HIS A 1 132 ? -18.625 -18.736 39.273  1.00 46.97  ? 132 HIS A CG  1 
ATOM   979   N  ND1 . HIS A 1 132 ? -18.858 -19.841 40.075  1.00 50.02  ? 132 HIS A ND1 1 
ATOM   980   C  CD2 . HIS A 1 132 ? -19.834 -18.374 38.770  1.00 36.27  ? 132 HIS A CD2 1 
ATOM   981   C  CE1 . HIS A 1 132 ? -20.148 -20.122 40.067  1.00 45.41  ? 132 HIS A CE1 1 
ATOM   982   N  NE2 . HIS A 1 132 ? -20.761 -19.245 39.277  1.00 37.25  ? 132 HIS A NE2 1 
ATOM   983   N  N   . ALA A 1 133 ? -15.023 -16.086 37.863  1.00 52.88  ? 133 ALA A N   1 
ATOM   984   C  CA  . ALA A 1 133 ? -13.794 -15.353 38.115  1.00 49.56  ? 133 ALA A CA  1 
ATOM   985   C  C   . ALA A 1 133 ? -13.900 -13.995 37.491  1.00 56.56  ? 133 ALA A C   1 
ATOM   986   O  O   . ALA A 1 133 ? -13.035 -13.153 37.676  1.00 68.02  ? 133 ALA A O   1 
ATOM   987   C  CB  . ALA A 1 133 ? -12.600 -16.107 37.531  1.00 56.07  ? 133 ALA A CB  1 
ATOM   988   N  N   . MET A 1 134 ? -14.979 -13.773 36.749  1.00 54.27  ? 134 MET A N   1 
ATOM   989   C  CA  . MET A 1 134 ? -15.189 -12.501 36.068  1.00 44.89  ? 134 MET A CA  1 
ATOM   990   C  C   . MET A 1 134 ? -16.476 -11.820 36.523  1.00 56.01  ? 134 MET A C   1 
ATOM   991   O  O   . MET A 1 134 ? -16.867 -10.787 35.981  1.00 52.44  ? 134 MET A O   1 
ATOM   992   C  CB  . MET A 1 134 ? -15.220 -12.709 34.554  1.00 46.91  ? 134 MET A CB  1 
ATOM   993   C  CG  . MET A 1 134 ? -14.590 -11.581 33.759  1.00 56.05  ? 134 MET A CG  1 
ATOM   994   S  SD  . MET A 1 134 ? -12.882 -11.924 33.308  1.00 54.31  ? 134 MET A SD  1 
ATOM   995   C  CE  . MET A 1 134 ? -12.765 -11.063 31.743  1.00 78.17  ? 134 MET A CE  1 
ATOM   996   N  N   . GLN A 1 135 ? -17.133 -12.406 37.518  1.00 73.45  ? 135 GLN A N   1 
ATOM   997   C  CA  . GLN A 1 135 ? -18.401 -11.879 38.010  1.00 81.24  ? 135 GLN A CA  1 
ATOM   998   C  C   . GLN A 1 135 ? -18.209 -10.915 39.175  1.00 80.82  ? 135 GLN A C   1 
ATOM   999   O  O   . GLN A 1 135 ? -17.514 -11.224 40.143  1.00 81.98  ? 135 GLN A O   1 
ATOM   1000  C  CB  . GLN A 1 135 ? -19.330 -13.021 38.424  1.00 90.03  ? 135 GLN A CB  1 
ATOM   1001  C  CG  . GLN A 1 135 ? -20.772 -12.838 37.980  1.00 91.68  ? 135 GLN A CG  1 
ATOM   1002  C  CD  . GLN A 1 135 ? -21.315 -14.052 37.253  1.00 86.26  ? 135 GLN A CD  1 
ATOM   1003  O  OE1 . GLN A 1 135 ? -21.442 -14.051 36.029  1.00 78.86  ? 135 GLN A OE1 1 
ATOM   1004  N  NE2 . GLN A 1 135 ? -21.638 -15.097 38.007  1.00 80.96  ? 135 GLN A NE2 1 
ATOM   1005  N  N   . VAL A 1 136 ? -18.835 -9.747  39.076  1.00 79.95  ? 136 VAL A N   1 
ATOM   1006  C  CA  . VAL A 1 136 ? -18.765 -8.747  40.135  1.00 65.15  ? 136 VAL A CA  1 
ATOM   1007  C  C   . VAL A 1 136 ? -20.096 -8.648  40.870  1.00 68.25  ? 136 VAL A C   1 
ATOM   1008  O  O   . VAL A 1 136 ? -20.151 -8.218  42.022  1.00 78.75  ? 136 VAL A O   1 
ATOM   1009  C  CB  . VAL A 1 136 ? -18.394 -7.360  39.578  1.00 55.42  ? 136 VAL A CB  1 
ATOM   1010  C  CG1 . VAL A 1 136 ? -18.065 -6.404  40.713  1.00 43.95  ? 136 VAL A CG1 1 
ATOM   1011  C  CG2 . VAL A 1 136 ? -17.226 -7.473  38.611  1.00 61.39  ? 136 VAL A CG2 1 
ATOM   1012  N  N   . ALA A 1 137 ? -21.168 -9.052  40.196  1.00 75.75  ? 137 ALA A N   1 
ATOM   1013  C  CA  . ALA A 1 137 ? -22.502 -9.012  40.777  1.00 76.46  ? 137 ALA A CA  1 
ATOM   1014  C  C   . ALA A 1 137 ? -23.172 -10.379 40.708  1.00 81.26  ? 137 ALA A C   1 
ATOM   1015  O  O   . ALA A 1 137 ? -24.277 -10.568 41.212  1.00 96.02  ? 137 ALA A O   1 
ATOM   1016  C  CB  . ALA A 1 137 ? -23.355 -7.963  40.077  1.00 74.31  ? 137 ALA A CB  1 
ATOM   1017  N  N   . HIS A 1 138 ? -22.493 -11.331 40.076  1.00 84.63  ? 138 HIS A N   1 
ATOM   1018  C  CA  . HIS A 1 138 ? -23.024 -12.679 39.927  1.00 86.85  ? 138 HIS A CA  1 
ATOM   1019  C  C   . HIS A 1 138 ? -24.274 -12.683 39.056  1.00 83.70  ? 138 HIS A C   1 
ATOM   1020  O  O   . HIS A 1 138 ? -25.385 -12.867 39.552  1.00 80.22  ? 138 HIS A O   1 
ATOM   1021  C  CB  . HIS A 1 138 ? -23.344 -13.289 41.293  1.00 82.66  ? 138 HIS A CB  1 
ATOM   1022  C  CG  . HIS A 1 138 ? -24.330 -14.413 41.236  1.00 91.34  ? 138 HIS A CG  1 
ATOM   1023  N  ND1 . HIS A 1 138 ? -25.469 -14.445 42.012  1.00 94.93  ? 138 HIS A ND1 1 
ATOM   1024  C  CD2 . HIS A 1 138 ? -24.353 -15.545 40.492  1.00 73.10  ? 138 HIS A CD2 1 
ATOM   1025  C  CE1 . HIS A 1 138 ? -26.147 -15.547 41.750  1.00 81.07  ? 138 HIS A CE1 1 
ATOM   1026  N  NE2 . HIS A 1 138 ? -25.493 -16.232 40.831  1.00 68.90  ? 138 HIS A NE2 1 
ATOM   1027  N  N   . ARG A 1 139 ? -24.088 -12.479 37.757  1.00 90.45  ? 139 ARG A N   1 
ATOM   1028  C  CA  . ARG A 1 139 ? -25.204 -12.477 36.821  1.00 81.67  ? 139 ARG A CA  1 
ATOM   1029  C  C   . ARG A 1 139 ? -25.973 -13.790 36.899  1.00 74.11  ? 139 ARG A C   1 
ATOM   1030  O  O   . ARG A 1 139 ? -25.640 -14.669 37.695  1.00 68.81  ? 139 ARG A O   1 
ATOM   1031  C  CB  . ARG A 1 139 ? -24.707 -12.241 35.394  1.00 75.19  ? 139 ARG A CB  1 
ATOM   1032  C  CG  . ARG A 1 139 ? -24.048 -10.888 35.183  1.00 69.26  ? 139 ARG A CG  1 
ATOM   1033  C  CD  . ARG A 1 139 ? -23.360 -10.815 33.830  1.00 81.57  ? 139 ARG A CD  1 
ATOM   1034  N  NE  . ARG A 1 139 ? -22.066 -10.144 33.910  1.00 96.87  ? 139 ARG A NE  1 
ATOM   1035  C  CZ  . ARG A 1 139 ? -20.960 -10.580 33.316  1.00 98.03  ? 139 ARG A CZ  1 
ATOM   1036  N  NH1 . ARG A 1 139 ? -20.987 -11.693 32.593  1.00 82.03  ? 139 ARG A NH1 1 
ATOM   1037  N  NH2 . ARG A 1 139 ? -19.826 -9.906  33.443  1.00 100.05 ? 139 ARG A NH2 1 
ATOM   1038  N  N   . ASP A 1 140 ? -26.997 -13.919 36.062  1.00 82.94  ? 140 ASP A N   1 
ATOM   1039  C  CA  . ASP A 1 140 ? -27.779 -15.146 35.981  1.00 80.44  ? 140 ASP A CA  1 
ATOM   1040  C  C   . ASP A 1 140 ? -27.467 -15.876 34.680  1.00 63.15  ? 140 ASP A C   1 
ATOM   1041  O  O   . ASP A 1 140 ? -27.950 -15.496 33.614  1.00 54.99  ? 140 ASP A O   1 
ATOM   1042  C  CB  . ASP A 1 140 ? -29.274 -14.839 36.068  1.00 92.43  ? 140 ASP A CB  1 
ATOM   1043  C  CG  . ASP A 1 140 ? -30.135 -16.054 35.789  1.00 101.98 ? 140 ASP A CG  1 
ATOM   1044  O  OD1 . ASP A 1 140 ? -30.617 -16.194 34.645  1.00 99.98  ? 140 ASP A OD1 1 
ATOM   1045  O  OD2 . ASP A 1 140 ? -30.331 -16.870 36.713  1.00 107.18 ? 140 ASP A OD2 1 
ATOM   1046  N  N   . LEU A 1 141 ? -26.652 -16.920 34.773  1.00 52.93  ? 141 LEU A N   1 
ATOM   1047  C  CA  . LEU A 1 141 ? -26.215 -17.659 33.595  1.00 63.24  ? 141 LEU A CA  1 
ATOM   1048  C  C   . LEU A 1 141 ? -27.394 -18.293 32.862  1.00 62.38  ? 141 LEU A C   1 
ATOM   1049  O  O   . LEU A 1 141 ? -27.285 -18.640 31.687  1.00 43.41  ? 141 LEU A O   1 
ATOM   1050  C  CB  . LEU A 1 141 ? -24.967 -18.485 33.918  1.00 72.53  ? 141 LEU A CB  1 
ATOM   1051  C  CG  . LEU A 1 141 ? -23.693 -17.700 34.234  1.00 63.99  ? 141 LEU A CG  1 
ATOM   1052  C  CD1 . LEU A 1 141 ? -23.499 -16.562 33.244  1.00 34.54  ? 141 LEU A CD1 1 
ATOM   1053  C  CD2 . LEU A 1 141 ? -23.722 -17.175 35.661  1.00 66.94  ? 141 LEU A CD2 1 
ATOM   1054  N  N   . LYS A 1 142 ? -28.519 -18.442 33.553  1.00 72.28  ? 142 LYS A N   1 
ATOM   1055  C  CA  . LYS A 1 142 ? -29.625 -19.271 33.089  1.00 81.07  ? 142 LYS A CA  1 
ATOM   1056  C  C   . LYS A 1 142 ? -29.081 -20.602 32.585  1.00 71.25  ? 142 LYS A C   1 
ATOM   1057  O  O   . LYS A 1 142 ? -29.059 -20.863 31.383  1.00 48.43  ? 142 LYS A O   1 
ATOM   1058  C  CB  . LYS A 1 142 ? -30.400 -18.563 31.977  1.00 77.30  ? 142 LYS A CB  1 
ATOM   1059  C  CG  . LYS A 1 142 ? -29.520 -17.839 30.972  1.00 71.41  ? 142 LYS A CG  1 
ATOM   1060  C  CD  . LYS A 1 142 ? -30.355 -17.077 29.956  1.00 85.89  ? 142 LYS A CD  1 
ATOM   1061  C  CE  . LYS A 1 142 ? -30.446 -15.602 30.310  1.00 82.46  ? 142 LYS A CE  1 
ATOM   1062  N  NZ  . LYS A 1 142 ? -29.703 -14.750 29.341  1.00 73.68  ? 142 LYS A NZ  1 
ATOM   1063  N  N   . LEU A 1 143 ? -28.628 -21.439 33.513  1.00 75.97  ? 143 LEU A N   1 
ATOM   1064  C  CA  . LEU A 1 143 ? -27.980 -22.701 33.167  1.00 70.76  ? 143 LEU A CA  1 
ATOM   1065  C  C   . LEU A 1 143 ? -28.962 -23.783 32.726  1.00 69.49  ? 143 LEU A C   1 
ATOM   1066  O  O   . LEU A 1 143 ? -28.555 -24.883 32.352  1.00 76.44  ? 143 LEU A O   1 
ATOM   1067  C  CB  . LEU A 1 143 ? -27.138 -23.207 34.340  1.00 61.28  ? 143 LEU A CB  1 
ATOM   1068  C  CG  . LEU A 1 143 ? -25.722 -22.637 34.449  1.00 54.25  ? 143 LEU A CG  1 
ATOM   1069  C  CD1 . LEU A 1 143 ? -25.169 -22.307 33.072  1.00 39.03  ? 143 LEU A CD1 1 
ATOM   1070  C  CD2 . LEU A 1 143 ? -25.703 -21.410 35.346  1.00 48.63  ? 143 LEU A CD2 1 
ATOM   1071  N  N   . GLU A 1 144 ? -30.251 -23.470 32.771  1.00 69.64  ? 144 GLU A N   1 
ATOM   1072  C  CA  . GLU A 1 144 ? -31.278 -24.421 32.371  1.00 62.93  ? 144 GLU A CA  1 
ATOM   1073  C  C   . GLU A 1 144 ? -31.462 -24.475 30.862  1.00 51.33  ? 144 GLU A C   1 
ATOM   1074  O  O   . GLU A 1 144 ? -32.284 -25.236 30.355  1.00 72.74  ? 144 GLU A O   1 
ATOM   1075  C  CB  . GLU A 1 144 ? -32.542 -24.227 33.211  1.00 75.59  ? 144 GLU A CB  1 
ATOM   1076  C  CG  . GLU A 1 144 ? -32.361 -23.299 34.400  1.00 92.15  ? 144 GLU A CG  1 
ATOM   1077  C  CD  . GLU A 1 144 ? -32.700 -21.858 34.072  1.00 100.99 ? 144 GLU A CD  1 
ATOM   1078  O  OE1 . GLU A 1 144 ? -33.654 -21.321 34.671  1.00 111.32 ? 144 GLU A OE1 1 
ATOM   1079  O  OE2 . GLU A 1 144 ? -32.012 -21.263 33.216  1.00 89.65  ? 144 GLU A OE2 1 
ATOM   1080  N  N   . ASN A 1 145 ? -30.694 -23.660 30.146  1.00 40.38  ? 145 ASN A N   1 
ATOM   1081  C  CA  . ASN A 1 145 ? -30.909 -23.436 28.722  1.00 44.50  ? 145 ASN A CA  1 
ATOM   1082  C  C   . ASN A 1 145 ? -29.620 -23.167 27.953  1.00 40.80  ? 145 ASN A C   1 
ATOM   1083  O  O   . ASN A 1 145 ? -29.563 -22.265 27.119  1.00 45.66  ? 145 ASN A O   1 
ATOM   1084  C  CB  . ASN A 1 145 ? -31.892 -22.284 28.507  1.00 61.13  ? 145 ASN A CB  1 
ATOM   1085  C  CG  . ASN A 1 145 ? -33.146 -22.717 27.776  1.00 83.23  ? 145 ASN A CG  1 
ATOM   1086  O  OD1 . ASN A 1 145 ? -34.255 -22.329 28.140  1.00 98.33  ? 145 ASN A OD1 1 
ATOM   1087  N  ND2 . ASN A 1 145 ? -32.975 -23.529 26.740  1.00 84.21  ? 145 ASN A ND2 1 
ATOM   1088  N  N   . THR A 1 146 ? -28.588 -23.956 28.233  1.00 25.49  ? 146 THR A N   1 
ATOM   1089  C  CA  . THR A 1 146 ? -27.319 -23.827 27.521  1.00 34.97  ? 146 THR A CA  1 
ATOM   1090  C  C   . THR A 1 146 ? -27.455 -24.358 26.074  1.00 32.79  ? 146 THR A C   1 
ATOM   1091  O  O   . THR A 1 146 ? -28.303 -25.203 25.795  1.00 35.33  ? 146 THR A O   1 
ATOM   1092  C  CB  . THR A 1 146 ? -26.182 -24.486 28.318  1.00 34.72  ? 146 THR A CB  1 
ATOM   1093  O  OG1 . THR A 1 146 ? -26.163 -25.889 28.075  1.00 37.84  ? 146 THR A OG1 1 
ATOM   1094  C  CG2 . THR A 1 146 ? -26.418 -24.278 29.823  1.00 29.00  ? 146 THR A CG2 1 
ATOM   1095  N  N   . LEU A 1 147 ? -26.663 -23.838 25.153  1.00 33.10  ? 147 LEU A N   1 
ATOM   1096  C  CA  . LEU A 1 147 ? -26.807 -24.165 23.748  1.00 36.97  ? 147 LEU A CA  1 
ATOM   1097  C  C   . LEU A 1 147 ? -25.596 -24.923 23.255  1.00 45.03  ? 147 LEU A C   1 
ATOM   1098  O  O   . LEU A 1 147 ? -24.679 -25.257 24.009  1.00 37.17  ? 147 LEU A O   1 
ATOM   1099  C  CB  . LEU A 1 147 ? -26.952 -22.890 22.909  1.00 39.07  ? 147 LEU A CB  1 
ATOM   1100  C  CG  . LEU A 1 147 ? -27.830 -21.786 23.510  1.00 51.83  ? 147 LEU A CG  1 
ATOM   1101  C  CD1 . LEU A 1 147 ? -28.006 -20.631 22.532  1.00 49.65  ? 147 LEU A CD1 1 
ATOM   1102  C  CD2 . LEU A 1 147 ? -29.171 -22.355 23.888  1.00 46.64  ? 147 LEU A CD2 1 
ATOM   1103  N  N   . LEU A 1 148 ? -25.583 -25.187 21.961  1.00 40.26  ? 148 LEU A N   1 
ATOM   1104  C  CA  . LEU A 1 148 ? -24.473 -25.907 21.384  1.00 42.25  ? 148 LEU A CA  1 
ATOM   1105  C  C   . LEU A 1 148 ? -24.151 -25.137 20.131  1.00 41.28  ? 148 LEU A C   1 
ATOM   1106  O  O   . LEU A 1 148 ? -25.067 -24.603 19.514  1.00 36.75  ? 148 LEU A O   1 
ATOM   1107  C  CB  . LEU A 1 148 ? -24.924 -27.333 20.985  1.00 37.26  ? 148 LEU A CB  1 
ATOM   1108  C  CG  . LEU A 1 148 ? -25.581 -28.173 22.074  1.00 33.03  ? 148 LEU A CG  1 
ATOM   1109  C  CD1 . LEU A 1 148 ? -26.049 -29.491 21.527  1.00 47.72  ? 148 LEU A CD1 1 
ATOM   1110  C  CD2 . LEU A 1 148 ? -24.589 -28.417 23.170  1.00 40.57  ? 148 LEU A CD2 1 
ATOM   1111  N  N   . ASP A 1 149 ? -22.889 -25.139 19.722  1.00 42.89  ? 149 ASP A N   1 
ATOM   1112  C  CA  . ASP A 1 149 ? -22.535 -24.693 18.389  1.00 59.46  ? 149 ASP A CA  1 
ATOM   1113  C  C   . ASP A 1 149 ? -22.879 -25.841 17.446  1.00 64.73  ? 149 ASP A C   1 
ATOM   1114  O  O   . ASP A 1 149 ? -23.718 -26.682 17.765  1.00 71.67  ? 149 ASP A O   1 
ATOM   1115  C  CB  . ASP A 1 149 ? -21.047 -24.360 18.307  1.00 62.65  ? 149 ASP A CB  1 
ATOM   1116  C  CG  . ASP A 1 149 ? -20.176 -25.597 18.231  1.00 80.15  ? 149 ASP A CG  1 
ATOM   1117  O  OD1 . ASP A 1 149 ? -20.628 -26.672 18.677  1.00 94.58  ? 149 ASP A OD1 1 
ATOM   1118  O  OD2 . ASP A 1 149 ? -19.039 -25.496 17.725  1.00 79.58  ? 149 ASP A OD2 1 
ATOM   1119  N  N   . GLY A 1 150 ? -22.216 -25.877 16.295  1.00 62.46  ? 150 GLY A N   1 
ATOM   1120  C  CA  . GLY A 1 150 ? -22.427 -26.936 15.326  1.00 75.26  ? 150 GLY A CA  1 
ATOM   1121  C  C   . GLY A 1 150 ? -21.354 -27.647 14.523  1.00 85.91  ? 150 GLY A C   1 
ATOM   1122  O  O   . GLY A 1 150 ? -20.758 -27.065 13.617  1.00 87.60  ? 150 GLY A O   1 
ATOM   1123  N  N   . SER A 1 151 ? -21.106 -28.909 14.857  1.00 98.57  ? 151 SER A N   1 
ATOM   1124  C  CA  . SER A 1 151 ? -19.913 -29.646 14.457  1.00 105.89 ? 151 SER A CA  1 
ATOM   1125  C  C   . SER A 1 151 ? -19.862 -31.024 15.107  1.00 106.60 ? 151 SER A C   1 
ATOM   1126  O  O   . SER A 1 151 ? -20.516 -31.265 16.122  1.00 112.80 ? 151 SER A O   1 
ATOM   1127  C  CB  . SER A 1 151 ? -18.652 -28.864 14.831  1.00 99.60  ? 151 SER A CB  1 
ATOM   1128  O  OG  . SER A 1 151 ? -18.804 -28.221 16.084  1.00 82.87  ? 151 SER A OG  1 
ATOM   1129  N  N   . PRO A 1 152 ? -19.083 -31.926 14.519  1.00 103.52 ? 152 PRO A N   1 
ATOM   1130  C  CA  . PRO A 1 152 ? -18.962 -33.290 15.042  1.00 112.98 ? 152 PRO A CA  1 
ATOM   1131  C  C   . PRO A 1 152 ? -19.217 -33.339 16.544  1.00 112.19 ? 152 PRO A C   1 
ATOM   1132  O  O   . PRO A 1 152 ? -20.260 -33.827 16.976  1.00 113.81 ? 152 PRO A O   1 
ATOM   1133  C  CB  . PRO A 1 152 ? -17.504 -33.649 14.743  1.00 113.71 ? 152 PRO A CB  1 
ATOM   1134  C  CG  . PRO A 1 152 ? -16.800 -32.341 14.677  1.00 107.60 ? 152 PRO A CG  1 
ATOM   1135  C  CD  . PRO A 1 152 ? -17.785 -31.386 14.077  1.00 101.47 ? 152 PRO A CD  1 
ATOM   1136  N  N   . ALA A 1 153 ? -18.269 -32.835 17.326  1.00 101.63 ? 153 ALA A N   1 
ATOM   1137  C  CA  . ALA A 1 153 ? -18.403 -32.815 18.777  1.00 96.70  ? 153 ALA A CA  1 
ATOM   1138  C  C   . ALA A 1 153 ? -18.918 -31.463 19.257  1.00 84.61  ? 153 ALA A C   1 
ATOM   1139  O  O   . ALA A 1 153 ? -18.165 -30.660 19.807  1.00 87.70  ? 153 ALA A O   1 
ATOM   1140  C  CB  . ALA A 1 153 ? -17.075 -33.145 19.438  1.00 102.57 ? 153 ALA A CB  1 
ATOM   1141  N  N   . PRO A 1 154 ? -20.206 -31.218 19.043  1.00 61.96  ? 154 PRO A N   1 
ATOM   1142  C  CA  . PRO A 1 154 ? -20.831 -29.954 19.445  1.00 55.43  ? 154 PRO A CA  1 
ATOM   1143  C  C   . PRO A 1 154 ? -20.166 -29.350 20.679  1.00 62.98  ? 154 PRO A C   1 
ATOM   1144  O  O   . PRO A 1 154 ? -19.805 -30.075 21.605  1.00 66.78  ? 154 PRO A O   1 
ATOM   1145  C  CB  . PRO A 1 154 ? -22.265 -30.369 19.773  1.00 54.96  ? 154 PRO A CB  1 
ATOM   1146  C  CG  . PRO A 1 154 ? -22.148 -31.785 20.205  1.00 68.33  ? 154 PRO A CG  1 
ATOM   1147  C  CD  . PRO A 1 154 ? -21.042 -32.382 19.382  1.00 57.42  ? 154 PRO A CD  1 
ATOM   1148  N  N   . ARG A 1 155 ? -20.012 -28.030 20.683  1.00 58.27  ? 155 ARG A N   1 
ATOM   1149  C  CA  . ARG A 1 155 ? -19.405 -27.331 21.807  1.00 46.94  ? 155 ARG A CA  1 
ATOM   1150  C  C   . ARG A 1 155 ? -20.467 -26.639 22.653  1.00 46.39  ? 155 ARG A C   1 
ATOM   1151  O  O   . ARG A 1 155 ? -21.384 -26.013 22.124  1.00 39.77  ? 155 ARG A O   1 
ATOM   1152  C  CB  . ARG A 1 155 ? -18.379 -26.311 21.313  1.00 46.41  ? 155 ARG A CB  1 
ATOM   1153  C  CG  . ARG A 1 155 ? -17.336 -26.890 20.374  1.00 55.94  ? 155 ARG A CG  1 
ATOM   1154  C  CD  . ARG A 1 155 ? -15.949 -26.840 20.991  1.00 71.95  ? 155 ARG A CD  1 
ATOM   1155  N  NE  . ARG A 1 155 ? -15.597 -28.093 21.651  1.00 70.30  ? 155 ARG A NE  1 
ATOM   1156  C  CZ  . ARG A 1 155 ? -15.021 -28.171 22.847  1.00 77.24  ? 155 ARG A CZ  1 
ATOM   1157  N  NH1 . ARG A 1 155 ? -14.729 -27.067 23.519  1.00 88.74  ? 155 ARG A NH1 1 
ATOM   1158  N  NH2 . ARG A 1 155 ? -14.736 -29.355 23.371  1.00 68.85  ? 155 ARG A NH2 1 
ATOM   1159  N  N   . LEU A 1 156 ? -20.339 -26.759 23.970  1.00 43.08  ? 156 LEU A N   1 
ATOM   1160  C  CA  . LEU A 1 156 ? -21.287 -26.140 24.888  1.00 45.73  ? 156 LEU A CA  1 
ATOM   1161  C  C   . LEU A 1 156 ? -21.144 -24.623 24.878  1.00 39.45  ? 156 LEU A C   1 
ATOM   1162  O  O   . LEU A 1 156 ? -20.033 -24.096 24.919  1.00 36.01  ? 156 LEU A O   1 
ATOM   1163  C  CB  . LEU A 1 156 ? -21.090 -26.679 26.306  1.00 40.93  ? 156 LEU A CB  1 
ATOM   1164  C  CG  . LEU A 1 156 ? -22.214 -26.383 27.301  1.00 50.39  ? 156 LEU A CG  1 
ATOM   1165  C  CD1 . LEU A 1 156 ? -23.479 -27.132 26.918  1.00 53.17  ? 156 LEU A CD1 1 
ATOM   1166  C  CD2 . LEU A 1 156 ? -21.785 -26.736 28.715  1.00 56.43  ? 156 LEU A CD2 1 
ATOM   1167  N  N   . LYS A 1 157 ? -22.274 -23.926 24.820  1.00 45.79  ? 157 LYS A N   1 
ATOM   1168  C  CA  . LYS A 1 157 ? -22.272 -22.452 24.796  1.00 47.39  ? 157 LYS A CA  1 
ATOM   1169  C  C   . LYS A 1 157 ? -23.232 -21.923 25.841  1.00 44.82  ? 157 LYS A C   1 
ATOM   1170  O  O   . LYS A 1 157 ? -24.420 -22.167 25.769  1.00 38.50  ? 157 LYS A O   1 
ATOM   1171  C  CB  . LYS A 1 157 ? -22.672 -21.948 23.419  1.00 45.35  ? 157 LYS A CB  1 
ATOM   1172  C  CG  . LYS A 1 157 ? -21.651 -22.268 22.357  1.00 41.29  ? 157 LYS A CG  1 
ATOM   1173  C  CD  . LYS A 1 157 ? -20.514 -21.299 22.460  1.00 39.64  ? 157 LYS A CD  1 
ATOM   1174  C  CE  . LYS A 1 157 ? -19.343 -21.728 21.624  1.00 50.71  ? 157 LYS A CE  1 
ATOM   1175  N  NZ  . LYS A 1 157 ? -18.429 -20.578 21.354  1.00 67.61  ? 157 LYS A NZ  1 
ATOM   1176  N  N   . ILE A 1 158 ? -22.707 -21.130 26.744  1.00 50.96  ? 158 ILE A N   1 
ATOM   1177  C  CA  . ILE A 1 158 ? -23.506 -20.484 27.751  1.00 50.73  ? 158 ILE A CA  1 
ATOM   1178  C  C   . ILE A 1 158 ? -23.848 -19.074 27.338  1.00 46.05  ? 158 ILE A C   1 
ATOM   1179  O  O   . ILE A 1 158 ? -23.014 -18.340 26.911  1.00 40.00  ? 158 ILE A O   1 
ATOM   1180  C  CB  . ILE A 1 158 ? -22.777 -20.439 29.065  1.00 47.04  ? 158 ILE A CB  1 
ATOM   1181  C  CG1 . ILE A 1 158 ? -22.585 -21.836 29.593  1.00 43.95  ? 158 ILE A CG1 1 
ATOM   1182  C  CG2 . ILE A 1 158 ? -23.529 -19.632 30.054  1.00 42.25  ? 158 ILE A CG2 1 
ATOM   1183  C  CD1 . ILE A 1 158 ? -21.510 -21.928 30.620  1.00 40.40  ? 158 ILE A CD1 1 
ATOM   1184  N  N   . ALA A 1 159 ? -25.104 -18.720 27.503  1.00 43.05  ? 159 ALA A N   1 
ATOM   1185  C  CA  . ALA A 1 159 ? -25.611 -17.435 27.132  1.00 59.58  ? 159 ALA A CA  1 
ATOM   1186  C  C   . ALA A 1 159 ? -25.683 -16.421 28.282  1.00 67.77  ? 159 ALA A C   1 
ATOM   1187  O  O   . ALA A 1 159 ? -26.605 -16.420 29.046  1.00 66.67  ? 159 ALA A O   1 
ATOM   1188  C  CB  . ALA A 1 159 ? -26.944 -17.620 26.501  1.00 56.05  ? 159 ALA A CB  1 
ATOM   1189  N  N   . ASP A 1 160 ? -24.676 -15.558 28.358  1.00 69.54  ? 160 ASP A N   1 
ATOM   1190  C  CA  . ASP A 1 160 ? -24.624 -14.520 29.379  1.00 74.42  ? 160 ASP A CA  1 
ATOM   1191  C  C   . ASP A 1 160 ? -25.087 -13.181 28.814  1.00 77.71  ? 160 ASP A C   1 
ATOM   1192  O  O   . ASP A 1 160 ? -24.309 -12.231 28.730  1.00 66.56  ? 160 ASP A O   1 
ATOM   1193  C  CB  . ASP A 1 160 ? -23.204 -14.391 29.933  1.00 78.10  ? 160 ASP A CB  1 
ATOM   1194  C  CG  . ASP A 1 160 ? -23.177 -14.269 31.443  1.00 89.41  ? 160 ASP A CG  1 
ATOM   1195  O  OD1 . ASP A 1 160 ? -24.060 -13.587 32.003  1.00 99.28  ? 160 ASP A OD1 1 
ATOM   1196  O  OD2 . ASP A 1 160 ? -22.269 -14.855 32.071  1.00 86.38  ? 160 ASP A OD2 1 
ATOM   1197  N  N   . PHE A 1 161 ? -26.356 -13.114 28.426  1.00 88.87  ? 161 PHE A N   1 
ATOM   1198  C  CA  . PHE A 1 161 ? -26.921 -11.892 27.866  1.00 92.09  ? 161 PHE A CA  1 
ATOM   1199  C  C   . PHE A 1 161 ? -27.698 -11.109 28.918  1.00 100.28 ? 161 PHE A C   1 
ATOM   1200  O  O   . PHE A 1 161 ? -27.827 -11.545 30.062  1.00 106.96 ? 161 PHE A O   1 
ATOM   1201  C  CB  . PHE A 1 161 ? -27.834 -12.215 26.682  1.00 103.47 ? 161 PHE A CB  1 
ATOM   1202  C  CG  . PHE A 1 161 ? -27.264 -13.231 25.735  1.00 107.56 ? 161 PHE A CG  1 
ATOM   1203  C  CD1 . PHE A 1 161 ? -25.901 -13.465 25.687  1.00 113.37 ? 161 PHE A CD1 1 
ATOM   1204  C  CD2 . PHE A 1 161 ? -28.093 -13.951 24.892  1.00 101.95 ? 161 PHE A CD2 1 
ATOM   1205  C  CE1 . PHE A 1 161 ? -25.375 -14.399 24.818  1.00 115.39 ? 161 PHE A CE1 1 
ATOM   1206  C  CE2 . PHE A 1 161 ? -27.573 -14.886 24.019  1.00 104.24 ? 161 PHE A CE2 1 
ATOM   1207  C  CZ  . PHE A 1 161 ? -26.213 -15.111 23.983  1.00 111.30 ? 161 PHE A CZ  1 
ATOM   1208  N  N   . GLY A 1 162 ? -28.215 -9.951  28.521  1.00 104.56 ? 162 GLY A N   1 
ATOM   1209  C  CA  . GLY A 1 162 ? -28.986 -9.111  29.417  1.00 118.78 ? 162 GLY A CA  1 
ATOM   1210  C  C   . GLY A 1 162 ? -30.081 -8.356  28.692  1.00 129.48 ? 162 GLY A C   1 
ATOM   1211  O  O   . GLY A 1 162 ? -31.265 -8.529  28.981  1.00 136.97 ? 162 GLY A O   1 
ATOM   1212  N  N   . TYR A 1 163 ? -29.684 -7.515  27.742  1.00 122.43 ? 163 TYR A N   1 
ATOM   1213  C  CA  . TYR A 1 163 ? -30.637 -6.732  26.965  1.00 108.97 ? 163 TYR A CA  1 
ATOM   1214  C  C   . TYR A 1 163 ? -32.058 -7.253  27.148  1.00 110.29 ? 163 TYR A C   1 
ATOM   1215  O  O   . TYR A 1 163 ? -32.453 -8.238  26.524  1.00 106.28 ? 163 TYR A O   1 
ATOM   1216  C  CB  . TYR A 1 163 ? -30.258 -6.745  25.483  1.00 86.59  ? 163 TYR A CB  1 
ATOM   1217  C  CG  . TYR A 1 163 ? -28.794 -7.023  25.230  1.00 67.66  ? 163 TYR A CG  1 
ATOM   1218  C  CD1 . TYR A 1 163 ? -28.379 -8.236  24.697  1.00 62.28  ? 163 TYR A CD1 1 
ATOM   1219  C  CD2 . TYR A 1 163 ? -27.826 -6.073  25.524  1.00 60.60  ? 163 TYR A CD2 1 
ATOM   1220  C  CE1 . TYR A 1 163 ? -27.042 -8.495  24.464  1.00 65.59  ? 163 TYR A CE1 1 
ATOM   1221  C  CE2 . TYR A 1 163 ? -26.487 -6.322  25.294  1.00 66.17  ? 163 TYR A CE2 1 
ATOM   1222  C  CZ  . TYR A 1 163 ? -26.100 -7.534  24.764  1.00 65.58  ? 163 TYR A CZ  1 
ATOM   1223  O  OH  . TYR A 1 163 ? -24.768 -7.787  24.534  1.00 56.43  ? 163 TYR A OH  1 
ATOM   1224  N  N   . THR A 1 179 ? -38.177 -24.834 34.899  1.00 107.30 ? 179 THR A N   1 
ATOM   1225  C  CA  . THR A 1 179 ? -39.024 -25.277 36.007  1.00 105.43 ? 179 THR A CA  1 
ATOM   1226  C  C   . THR A 1 179 ? -38.239 -25.214 37.325  1.00 90.94  ? 179 THR A C   1 
ATOM   1227  O  O   . THR A 1 179 ? -37.047 -24.883 37.313  1.00 92.11  ? 179 THR A O   1 
ATOM   1228  C  CB  . THR A 1 179 ? -39.621 -26.708 35.761  1.00 101.20 ? 179 THR A CB  1 
ATOM   1229  O  OG1 . THR A 1 179 ? -38.640 -27.715 36.042  1.00 91.66  ? 179 THR A OG1 1 
ATOM   1230  C  CG2 . THR A 1 179 ? -40.134 -26.857 34.331  1.00 101.30 ? 179 THR A CG2 1 
ATOM   1231  N  N   . PRO A 1 180 ? -38.904 -25.518 38.460  1.00 74.34  ? 180 PRO A N   1 
ATOM   1232  C  CA  . PRO A 1 180 ? -38.308 -25.450 39.807  1.00 60.91  ? 180 PRO A CA  1 
ATOM   1233  C  C   . PRO A 1 180 ? -37.037 -26.278 39.936  1.00 54.67  ? 180 PRO A C   1 
ATOM   1234  O  O   . PRO A 1 180 ? -36.240 -26.081 40.846  1.00 53.48  ? 180 PRO A O   1 
ATOM   1235  C  CB  . PRO A 1 180 ? -39.376 -26.079 40.705  1.00 56.45  ? 180 PRO A CB  1 
ATOM   1236  C  CG  . PRO A 1 180 ? -40.625 -25.960 39.965  1.00 70.65  ? 180 PRO A CG  1 
ATOM   1237  C  CD  . PRO A 1 180 ? -40.303 -25.972 38.503  1.00 72.69  ? 180 PRO A CD  1 
ATOM   1238  N  N   . ALA A 1 181 ? -36.854 -27.214 39.022  1.00 69.51  ? 181 ALA A N   1 
ATOM   1239  C  CA  . ALA A 1 181 ? -35.791 -28.192 39.176  1.00 74.77  ? 181 ALA A CA  1 
ATOM   1240  C  C   . ALA A 1 181 ? -34.391 -27.581 39.357  1.00 60.02  ? 181 ALA A C   1 
ATOM   1241  O  O   . ALA A 1 181 ? -33.591 -28.107 40.121  1.00 65.65  ? 181 ALA A O   1 
ATOM   1242  C  CB  . ALA A 1 181 ? -35.823 -29.219 38.028  1.00 85.62  ? 181 ALA A CB  1 
ATOM   1243  N  N   . TYR A 1 182 ? -34.119 -26.459 38.698  1.00 49.16  ? 182 TYR A N   1 
ATOM   1244  C  CA  . TYR A 1 182 ? -32.789 -25.849 38.747  1.00 46.08  ? 182 TYR A CA  1 
ATOM   1245  C  C   . TYR A 1 182 ? -32.527 -24.921 39.943  1.00 55.33  ? 182 TYR A C   1 
ATOM   1246  O  O   . TYR A 1 182 ? -31.465 -24.305 40.024  1.00 68.48  ? 182 TYR A O   1 
ATOM   1247  C  CB  . TYR A 1 182 ? -32.499 -25.103 37.442  1.00 40.82  ? 182 TYR A CB  1 
ATOM   1248  C  CG  . TYR A 1 182 ? -32.341 -26.009 36.242  1.00 45.69  ? 182 TYR A CG  1 
ATOM   1249  C  CD1 . TYR A 1 182 ? -33.451 -26.476 35.550  1.00 47.61  ? 182 TYR A CD1 1 
ATOM   1250  C  CD2 . TYR A 1 182 ? -31.085 -26.398 35.802  1.00 38.72  ? 182 TYR A CD2 1 
ATOM   1251  C  CE1 . TYR A 1 182 ? -33.313 -27.303 34.454  1.00 54.42  ? 182 TYR A CE1 1 
ATOM   1252  C  CE2 . TYR A 1 182 ? -30.936 -27.226 34.706  1.00 35.34  ? 182 TYR A CE2 1 
ATOM   1253  C  CZ  . TYR A 1 182 ? -32.053 -27.676 34.036  1.00 51.74  ? 182 TYR A CZ  1 
ATOM   1254  O  OH  . TYR A 1 182 ? -31.912 -28.500 32.944  1.00 54.00  ? 182 TYR A OH  1 
ATOM   1255  N  N   . ILE A 1 183 ? -33.474 -24.832 40.869  1.00 40.35  ? 183 ILE A N   1 
ATOM   1256  C  CA  . ILE A 1 183 ? -33.309 -23.944 42.015  1.00 48.38  ? 183 ILE A CA  1 
ATOM   1257  C  C   . ILE A 1 183 ? -32.834 -24.669 43.273  1.00 49.24  ? 183 ILE A C   1 
ATOM   1258  O  O   . ILE A 1 183 ? -33.534 -25.532 43.801  1.00 47.31  ? 183 ILE A O   1 
ATOM   1259  C  CB  . ILE A 1 183 ? -34.615 -23.191 42.333  1.00 50.61  ? 183 ILE A CB  1 
ATOM   1260  C  CG1 . ILE A 1 183 ? -35.039 -22.332 41.141  1.00 45.49  ? 183 ILE A CG1 1 
ATOM   1261  C  CG2 . ILE A 1 183 ? -34.442 -22.332 43.577  1.00 43.07  ? 183 ILE A CG2 1 
ATOM   1262  C  CD1 . ILE A 1 183 ? -36.384 -22.709 40.566  1.00 48.77  ? 183 ILE A CD1 1 
ATOM   1263  N  N   . ALA A 1 184 ? -31.646 -24.309 43.752  1.00 42.53  ? 184 ALA A N   1 
ATOM   1264  C  CA  . ALA A 1 184 ? -31.142 -24.841 45.011  1.00 39.28  ? 184 ALA A CA  1 
ATOM   1265  C  C   . ALA A 1 184 ? -32.065 -24.584 46.240  1.00 34.17  ? 184 ALA A C   1 
ATOM   1266  O  O   . ALA A 1 184 ? -32.844 -23.656 46.243  1.00 41.63  ? 184 ALA A O   1 
ATOM   1267  C  CB  . ALA A 1 184 ? -29.759 -24.327 45.255  1.00 31.02  ? 184 ALA A CB  1 
ATOM   1268  N  N   . PRO A 1 185 ? -31.996 -25.459 47.265  1.00 34.95  ? 185 PRO A N   1 
ATOM   1269  C  CA  . PRO A 1 185 ? -32.802 -25.365 48.497  1.00 28.36  ? 185 PRO A CA  1 
ATOM   1270  C  C   . PRO A 1 185 ? -32.620 -24.049 49.254  1.00 46.53  ? 185 PRO A C   1 
ATOM   1271  O  O   . PRO A 1 185 ? -33.604 -23.450 49.713  1.00 52.22  ? 185 PRO A O   1 
ATOM   1272  C  CB  . PRO A 1 185 ? -32.277 -26.532 49.344  1.00 31.07  ? 185 PRO A CB  1 
ATOM   1273  C  CG  . PRO A 1 185 ? -31.791 -27.516 48.346  1.00 28.47  ? 185 PRO A CG  1 
ATOM   1274  C  CD  . PRO A 1 185 ? -31.214 -26.718 47.214  1.00 33.82  ? 185 PRO A CD  1 
ATOM   1275  N  N   . GLU A 1 186 ? -31.379 -23.598 49.393  1.00 48.66  ? 186 GLU A N   1 
ATOM   1276  C  CA  . GLU A 1 186 ? -31.131 -22.272 49.968  1.00 49.72  ? 186 GLU A CA  1 
ATOM   1277  C  C   . GLU A 1 186 ? -31.780 -21.144 49.168  1.00 43.88  ? 186 GLU A C   1 
ATOM   1278  O  O   . GLU A 1 186 ? -32.252 -20.169 49.756  1.00 39.74  ? 186 GLU A O   1 
ATOM   1279  C  CB  . GLU A 1 186 ? -29.647 -22.019 50.059  1.00 47.93  ? 186 GLU A CB  1 
ATOM   1280  C  CG  . GLU A 1 186 ? -28.886 -23.148 49.417  1.00 61.98  ? 186 GLU A CG  1 
ATOM   1281  C  CD  . GLU A 1 186 ? -28.145 -22.728 48.193  1.00 60.10  ? 186 GLU A CD  1 
ATOM   1282  O  OE1 . GLU A 1 186 ? -28.080 -21.517 47.912  1.00 65.75  ? 186 GLU A OE1 1 
ATOM   1283  O  OE2 . GLU A 1 186 ? -27.613 -23.620 47.523  1.00 59.33  ? 186 GLU A OE2 1 
ATOM   1284  N  N   . VAL A 1 187 ? -31.861 -21.254 47.851  1.00 38.56  ? 187 VAL A N   1 
ATOM   1285  C  CA  . VAL A 1 187 ? -32.266 -20.076 47.104  1.00 38.93  ? 187 VAL A CA  1 
ATOM   1286  C  C   . VAL A 1 187 ? -33.647 -19.609 47.554  1.00 46.05  ? 187 VAL A C   1 
ATOM   1287  O  O   . VAL A 1 187 ? -33.851 -18.419 47.792  1.00 44.53  ? 187 VAL A O   1 
ATOM   1288  C  CB  . VAL A 1 187 ? -32.288 -20.345 45.589  1.00 32.36  ? 187 VAL A CB  1 
ATOM   1289  C  CG1 . VAL A 1 187 ? -32.886 -19.158 44.850  1.00 31.60  ? 187 VAL A CG1 1 
ATOM   1290  C  CG2 . VAL A 1 187 ? -30.886 -20.643 45.084  1.00 38.78  ? 187 VAL A CG2 1 
ATOM   1291  N  N   . LEU A 1 188 ? -34.603 -20.529 47.607  1.00 49.31  ? 188 LEU A N   1 
ATOM   1292  C  CA  . LEU A 1 188 ? -35.878 -20.283 48.270  1.00 40.52  ? 188 LEU A CA  1 
ATOM   1293  C  C   . LEU A 1 188 ? -35.743 -20.135 49.791  1.00 40.98  ? 188 LEU A C   1 
ATOM   1294  O  O   . LEU A 1 188 ? -36.376 -19.278 50.406  1.00 43.97  ? 188 LEU A O   1 
ATOM   1295  C  CB  . LEU A 1 188 ? -36.871 -21.400 47.940  1.00 51.89  ? 188 LEU A CB  1 
ATOM   1296  C  CG  . LEU A 1 188 ? -36.564 -22.231 46.693  1.00 47.85  ? 188 LEU A CG  1 
ATOM   1297  C  CD1 . LEU A 1 188 ? -35.078 -22.545 46.608  1.00 50.97  ? 188 LEU A CD1 1 
ATOM   1298  C  CD2 . LEU A 1 188 ? -37.385 -23.511 46.680  1.00 44.81  ? 188 LEU A CD2 1 
ATOM   1299  N  N   . LEU A 1 189 ? -34.920 -20.999 50.381  1.00 61.13  ? 189 LEU A N   1 
ATOM   1300  C  CA  . LEU A 1 189 ? -34.831 -21.179 51.835  1.00 70.26  ? 189 LEU A CA  1 
ATOM   1301  C  C   . LEU A 1 189 ? -34.326 -20.025 52.714  1.00 77.81  ? 189 LEU A C   1 
ATOM   1302  O  O   . LEU A 1 189 ? -34.870 -19.787 53.792  1.00 74.62  ? 189 LEU A O   1 
ATOM   1303  C  CB  . LEU A 1 189 ? -34.033 -22.449 52.155  1.00 59.27  ? 189 LEU A CB  1 
ATOM   1304  C  CG  . LEU A 1 189 ? -34.795 -23.542 52.906  1.00 51.01  ? 189 LEU A CG  1 
ATOM   1305  C  CD1 . LEU A 1 189 ? -36.289 -23.432 52.641  1.00 53.31  ? 189 LEU A CD1 1 
ATOM   1306  C  CD2 . LEU A 1 189 ? -34.278 -24.920 52.523  1.00 44.40  ? 189 LEU A CD2 1 
ATOM   1307  N  N   . LYS A 1 190 ? -33.289 -19.322 52.269  1.00 80.93  ? 190 LYS A N   1 
ATOM   1308  C  CA  . LYS A 1 190 ? -32.596 -18.360 53.127  1.00 83.35  ? 190 LYS A CA  1 
ATOM   1309  C  C   . LYS A 1 190 ? -32.512 -16.986 52.481  1.00 86.88  ? 190 LYS A C   1 
ATOM   1310  O  O   . LYS A 1 190 ? -32.582 -16.869 51.258  1.00 71.79  ? 190 LYS A O   1 
ATOM   1311  C  CB  . LYS A 1 190 ? -31.193 -18.864 53.469  1.00 81.96  ? 190 LYS A CB  1 
ATOM   1312  C  CG  . LYS A 1 190 ? -31.160 -20.272 54.040  1.00 93.55  ? 190 LYS A CG  1 
ATOM   1313  C  CD  . LYS A 1 190 ? -29.760 -20.651 54.494  1.00 108.30 ? 190 LYS A CD  1 
ATOM   1314  C  CE  . LYS A 1 190 ? -29.371 -22.033 53.993  1.00 111.68 ? 190 LYS A CE  1 
ATOM   1315  N  NZ  . LYS A 1 190 ? -28.903 -22.915 55.098  1.00 104.94 ? 190 LYS A NZ  1 
ATOM   1316  N  N   . LYS A 1 191 ? -32.385 -15.939 53.295  1.00 104.30 ? 191 LYS A N   1 
ATOM   1317  C  CA  . LYS A 1 191 ? -32.473 -14.596 52.736  1.00 109.48 ? 191 LYS A CA  1 
ATOM   1318  C  C   . LYS A 1 191 ? -31.210 -14.266 51.953  1.00 104.67 ? 191 LYS A C   1 
ATOM   1319  O  O   . LYS A 1 191 ? -31.270 -13.922 50.772  1.00 93.02  ? 191 LYS A O   1 
ATOM   1320  C  CB  . LYS A 1 191 ? -32.691 -13.565 53.845  1.00 113.35 ? 191 LYS A CB  1 
ATOM   1321  C  CG  . LYS A 1 191 ? -33.699 -12.482 53.497  1.00 110.83 ? 191 LYS A CG  1 
ATOM   1322  C  CD  . LYS A 1 191 ? -34.790 -12.381 54.550  1.00 109.51 ? 191 LYS A CD  1 
ATOM   1323  C  CE  . LYS A 1 191 ? -35.911 -11.461 54.096  1.00 106.75 ? 191 LYS A CE  1 
ATOM   1324  N  NZ  . LYS A 1 191 ? -36.875 -11.175 55.195  1.00 103.03 ? 191 LYS A NZ  1 
ATOM   1325  N  N   . GLU A 1 192 ? -30.067 -14.378 52.619  1.00 112.32 ? 192 GLU A N   1 
ATOM   1326  C  CA  . GLU A 1 192 ? -28.780 -14.163 51.972  1.00 118.17 ? 192 GLU A CA  1 
ATOM   1327  C  C   . GLU A 1 192 ? -28.201 -15.503 51.538  1.00 93.58  ? 192 GLU A C   1 
ATOM   1328  O  O   . GLU A 1 192 ? -28.025 -16.405 52.357  1.00 89.38  ? 192 GLU A O   1 
ATOM   1329  C  CB  . GLU A 1 192 ? -27.814 -13.451 52.919  1.00 133.32 ? 192 GLU A CB  1 
ATOM   1330  C  CG  . GLU A 1 192 ? -26.777 -12.590 52.215  1.00 145.90 ? 192 GLU A CG  1 
ATOM   1331  C  CD  . GLU A 1 192 ? -25.408 -13.240 52.178  1.00 150.51 ? 192 GLU A CD  1 
ATOM   1332  O  OE1 . GLU A 1 192 ? -24.939 -13.580 51.072  1.00 146.18 ? 192 GLU A OE1 1 
ATOM   1333  O  OE2 . GLU A 1 192 ? -24.801 -13.411 53.256  1.00 152.76 ? 192 GLU A OE2 1 
ATOM   1334  N  N   . TYR A 1 193 ? -27.914 -15.632 50.249  1.00 66.50  ? 193 TYR A N   1 
ATOM   1335  C  CA  . TYR A 1 193 ? -27.389 -16.882 49.716  1.00 66.29  ? 193 TYR A CA  1 
ATOM   1336  C  C   . TYR A 1 193 ? -26.347 -16.651 48.629  1.00 54.65  ? 193 TYR A C   1 
ATOM   1337  O  O   . TYR A 1 193 ? -26.559 -15.867 47.705  1.00 42.18  ? 193 TYR A O   1 
ATOM   1338  C  CB  . TYR A 1 193 ? -28.527 -17.748 49.170  1.00 64.89  ? 193 TYR A CB  1 
ATOM   1339  C  CG  . TYR A 1 193 ? -28.950 -17.385 47.765  1.00 44.98  ? 193 TYR A CG  1 
ATOM   1340  C  CD1 . TYR A 1 193 ? -28.130 -17.661 46.680  1.00 39.69  ? 193 TYR A CD1 1 
ATOM   1341  C  CD2 . TYR A 1 193 ? -30.168 -16.766 47.524  1.00 40.58  ? 193 TYR A CD2 1 
ATOM   1342  C  CE1 . TYR A 1 193 ? -28.512 -17.332 45.394  1.00 39.23  ? 193 TYR A CE1 1 
ATOM   1343  C  CE2 . TYR A 1 193 ? -30.559 -16.434 46.241  1.00 37.96  ? 193 TYR A CE2 1 
ATOM   1344  C  CZ  . TYR A 1 193 ? -29.727 -16.718 45.181  1.00 44.39  ? 193 TYR A CZ  1 
ATOM   1345  O  OH  . TYR A 1 193 ? -30.111 -16.388 43.902  1.00 51.31  ? 193 TYR A OH  1 
ATOM   1346  N  N   . ASP A 1 194 ? -25.221 -17.345 48.748  1.00 38.23  ? 194 ASP A N   1 
ATOM   1347  C  CA  . ASP A 1 194 ? -24.164 -17.299 47.720  1.00 38.54  ? 194 ASP A CA  1 
ATOM   1348  C  C   . ASP A 1 194 ? -24.576 -17.882 46.373  1.00 45.59  ? 194 ASP A C   1 
ATOM   1349  O  O   . ASP A 1 194 ? -24.804 -19.099 46.238  1.00 44.52  ? 194 ASP A O   1 
ATOM   1350  C  CB  . ASP A 1 194 ? -22.922 -18.060 48.194  1.00 40.62  ? 194 ASP A CB  1 
ATOM   1351  C  CG  . ASP A 1 194 ? -21.669 -17.746 47.349  1.00 62.44  ? 194 ASP A CG  1 
ATOM   1352  O  OD1 . ASP A 1 194 ? -20.578 -17.575 47.941  1.00 65.47  ? 194 ASP A OD1 1 
ATOM   1353  O  OD2 . ASP A 1 194 ? -21.780 -17.669 46.100  1.00 66.66  ? 194 ASP A OD2 1 
ATOM   1354  N  N   . GLY A 1 195 ? -24.615 -17.009 45.371  1.00 41.40  ? 195 GLY A N   1 
ATOM   1355  C  CA  . GLY A 1 195 ? -25.025 -17.368 44.020  1.00 37.57  ? 195 GLY A CA  1 
ATOM   1356  C  C   . GLY A 1 195 ? -24.113 -18.350 43.292  1.00 54.56  ? 195 GLY A C   1 
ATOM   1357  O  O   . GLY A 1 195 ? -24.518 -19.012 42.322  1.00 56.80  ? 195 GLY A O   1 
ATOM   1358  N  N   . LYS A 1 196 ? -22.875 -18.441 43.752  1.00 43.85  ? 196 LYS A N   1 
ATOM   1359  C  CA  . LYS A 1 196 ? -21.916 -19.322 43.124  1.00 43.45  ? 196 LYS A CA  1 
ATOM   1360  C  C   . LYS A 1 196 ? -22.143 -20.760 43.566  1.00 49.72  ? 196 LYS A C   1 
ATOM   1361  O  O   . LYS A 1 196 ? -21.971 -21.674 42.784  1.00 48.33  ? 196 LYS A O   1 
ATOM   1362  C  CB  . LYS A 1 196 ? -20.492 -18.871 43.417  1.00 35.49  ? 196 LYS A CB  1 
ATOM   1363  C  CG  . LYS A 1 196 ? -20.116 -17.556 42.770  1.00 44.17  ? 196 LYS A CG  1 
ATOM   1364  C  CD  . LYS A 1 196 ? -18.716 -17.140 43.168  1.00 54.14  ? 196 LYS A CD  1 
ATOM   1365  C  CE  . LYS A 1 196 ? -18.263 -15.901 42.419  1.00 63.02  ? 196 LYS A CE  1 
ATOM   1366  N  NZ  . LYS A 1 196 ? -16.817 -15.640 42.627  1.00 63.53  ? 196 LYS A NZ  1 
ATOM   1367  N  N   . VAL A 1 197 ? -22.575 -20.937 44.809  1.00 39.69  ? 197 VAL A N   1 
ATOM   1368  C  CA  . VAL A 1 197 ? -22.933 -22.256 45.312  1.00 40.43  ? 197 VAL A CA  1 
ATOM   1369  C  C   . VAL A 1 197 ? -24.251 -22.722 44.697  1.00 41.36  ? 197 VAL A C   1 
ATOM   1370  O  O   . VAL A 1 197 ? -24.453 -23.914 44.473  1.00 56.87  ? 197 VAL A O   1 
ATOM   1371  C  CB  . VAL A 1 197 ? -23.060 -22.259 46.845  1.00 44.55  ? 197 VAL A CB  1 
ATOM   1372  C  CG1 . VAL A 1 197 ? -23.370 -23.659 47.347  1.00 40.25  ? 197 VAL A CG1 1 
ATOM   1373  C  CG2 . VAL A 1 197 ? -21.787 -21.726 47.482  1.00 43.52  ? 197 VAL A CG2 1 
ATOM   1374  N  N   . ALA A 1 198 ? -25.143 -21.773 44.426  1.00 45.65  ? 198 ALA A N   1 
ATOM   1375  C  CA  . ALA A 1 198 ? -26.432 -22.076 43.827  1.00 39.84  ? 198 ALA A CA  1 
ATOM   1376  C  C   . ALA A 1 198 ? -26.207 -22.572 42.409  1.00 32.41  ? 198 ALA A C   1 
ATOM   1377  O  O   . ALA A 1 198 ? -26.936 -23.422 41.922  1.00 43.60  ? 198 ALA A O   1 
ATOM   1378  C  CB  . ALA A 1 198 ? -27.316 -20.843 43.829  1.00 31.35  ? 198 ALA A CB  1 
ATOM   1379  N  N   . ASP A 1 199 ? -25.167 -22.042 41.771  1.00 27.69  ? 199 ASP A N   1 
ATOM   1380  C  CA  . ASP A 1 199 ? -24.818 -22.419 40.413  1.00 29.14  ? 199 ASP A CA  1 
ATOM   1381  C  C   . ASP A 1 199 ? -24.326 -23.868 40.320  1.00 43.05  ? 199 ASP A C   1 
ATOM   1382  O  O   . ASP A 1 199 ? -24.654 -24.585 39.380  1.00 28.53  ? 199 ASP A O   1 
ATOM   1383  C  CB  . ASP A 1 199 ? -23.757 -21.478 39.850  1.00 39.03  ? 199 ASP A CB  1 
ATOM   1384  C  CG  . ASP A 1 199 ? -24.328 -20.130 39.404  1.00 44.75  ? 199 ASP A CG  1 
ATOM   1385  O  OD1 . ASP A 1 199 ? -23.518 -19.233 39.149  1.00 46.47  ? 199 ASP A OD1 1 
ATOM   1386  O  OD2 . ASP A 1 199 ? -25.558 -19.964 39.298  1.00 40.78  ? 199 ASP A OD2 1 
ATOM   1387  N  N   . VAL A 1 200 ? -23.542 -24.295 41.298  1.00 36.01  ? 200 VAL A N   1 
ATOM   1388  C  CA  . VAL A 1 200 ? -23.076 -25.665 41.337  1.00 35.08  ? 200 VAL A CA  1 
ATOM   1389  C  C   . VAL A 1 200 ? -24.265 -26.631 41.392  1.00 41.56  ? 200 VAL A C   1 
ATOM   1390  O  O   . VAL A 1 200 ? -24.321 -27.618 40.645  1.00 36.19  ? 200 VAL A O   1 
ATOM   1391  C  CB  . VAL A 1 200 ? -22.131 -25.884 42.525  1.00 40.01  ? 200 VAL A CB  1 
ATOM   1392  C  CG1 . VAL A 1 200 ? -21.963 -27.346 42.771  1.00 29.74  ? 200 VAL A CG1 1 
ATOM   1393  C  CG2 . VAL A 1 200 ? -20.792 -25.209 42.251  1.00 34.11  ? 200 VAL A CG2 1 
ATOM   1394  N  N   . TRP A 1 201 ? -25.245 -26.333 42.240  1.00 36.42  ? 201 TRP A N   1 
ATOM   1395  C  CA  . TRP A 1 201 ? -26.466 -27.139 42.253  1.00 27.70  ? 201 TRP A CA  1 
ATOM   1396  C  C   . TRP A 1 201 ? -27.066 -27.234 40.856  1.00 35.84  ? 201 TRP A C   1 
ATOM   1397  O  O   . TRP A 1 201 ? -27.332 -28.319 40.377  1.00 31.84  ? 201 TRP A O   1 
ATOM   1398  C  CB  . TRP A 1 201 ? -27.463 -26.538 43.206  1.00 33.13  ? 201 TRP A CB  1 
ATOM   1399  C  CG  . TRP A 1 201 ? -28.774 -27.228 43.258  1.00 32.22  ? 201 TRP A CG  1 
ATOM   1400  C  CD1 . TRP A 1 201 ? -29.805 -27.039 42.424  1.00 32.94  ? 201 TRP A CD1 1 
ATOM   1401  C  CD2 . TRP A 1 201 ? -29.218 -28.152 44.233  1.00 33.61  ? 201 TRP A CD2 1 
ATOM   1402  N  NE1 . TRP A 1 201 ? -30.874 -27.813 42.794  1.00 36.59  ? 201 TRP A NE1 1 
ATOM   1403  C  CE2 . TRP A 1 201 ? -30.525 -28.529 43.958  1.00 30.54  ? 201 TRP A CE2 1 
ATOM   1404  C  CE3 . TRP A 1 201 ? -28.623 -28.759 45.372  1.00 38.77  ? 201 TRP A CE3 1 
ATOM   1405  C  CZ2 . TRP A 1 201 ? -31.270 -29.434 44.682  1.00 32.37  ? 201 TRP A CZ2 1 
ATOM   1406  C  CZ3 . TRP A 1 201 ? -29.352 -29.669 46.123  1.00 37.01  ? 201 TRP A CZ3 1 
ATOM   1407  C  CH2 . TRP A 1 201 ? -30.652 -29.993 45.777  1.00 34.72  ? 201 TRP A CH2 1 
ATOM   1408  N  N   . SER A 1 202 ? -27.275 -26.087 40.207  1.00 39.93  ? 202 SER A N   1 
ATOM   1409  C  CA  . SER A 1 202 ? -27.768 -26.058 38.826  1.00 42.48  ? 202 SER A CA  1 
ATOM   1410  C  C   . SER A 1 202 ? -26.919 -26.892 37.898  1.00 34.40  ? 202 SER A C   1 
ATOM   1411  O  O   . SER A 1 202 ? -27.427 -27.497 36.974  1.00 48.78  ? 202 SER A O   1 
ATOM   1412  C  CB  . SER A 1 202 ? -27.840 -24.632 38.265  1.00 43.92  ? 202 SER A CB  1 
ATOM   1413  O  OG  . SER A 1 202 ? -28.994 -23.977 38.740  1.00 49.81  ? 202 SER A OG  1 
ATOM   1414  N  N   . CYS A 1 203 ? -25.621 -26.916 38.124  1.00 24.43  ? 203 CYS A N   1 
ATOM   1415  C  CA  . CYS A 1 203 ? -24.786 -27.715 37.266  1.00 36.78  ? 203 CYS A CA  1 
ATOM   1416  C  C   . CYS A 1 203 ? -25.053 -29.202 37.563  1.00 44.25  ? 203 CYS A C   1 
ATOM   1417  O  O   . CYS A 1 203 ? -24.908 -30.045 36.699  1.00 45.30  ? 203 CYS A O   1 
ATOM   1418  C  CB  . CYS A 1 203 ? -23.321 -27.331 37.458  1.00 38.30  ? 203 CYS A CB  1 
ATOM   1419  S  SG  . CYS A 1 203 ? -22.880 -25.759 36.773  1.00 47.75  ? 203 CYS A SG  1 
ATOM   1420  N  N   . GLY A 1 204 ? -25.455 -29.500 38.793  1.00 35.70  ? 204 GLY A N   1 
ATOM   1421  C  CA  . GLY A 1 204 ? -25.690 -30.860 39.198  1.00 34.71  ? 204 GLY A CA  1 
ATOM   1422  C  C   . GLY A 1 204 ? -26.901 -31.344 38.460  1.00 42.69  ? 204 GLY A C   1 
ATOM   1423  O  O   . GLY A 1 204 ? -26.893 -32.460 37.906  1.00 31.79  ? 204 GLY A O   1 
ATOM   1424  N  N   . VAL A 1 205 ? -27.930 -30.491 38.432  1.00 34.96  ? 205 VAL A N   1 
ATOM   1425  C  CA  . VAL A 1 205 ? -29.187 -30.844 37.804  1.00 34.13  ? 205 VAL A CA  1 
ATOM   1426  C  C   . VAL A 1 205 ? -28.966 -31.138 36.322  1.00 35.34  ? 205 VAL A C   1 
ATOM   1427  O  O   . VAL A 1 205 ? -29.522 -32.066 35.785  1.00 28.29  ? 205 VAL A O   1 
ATOM   1428  C  CB  . VAL A 1 205 ? -30.229 -29.741 37.949  1.00 33.13  ? 205 VAL A CB  1 
ATOM   1429  C  CG1 . VAL A 1 205 ? -31.462 -30.142 37.214  1.00 40.96  ? 205 VAL A CG1 1 
ATOM   1430  C  CG2 . VAL A 1 205 ? -30.547 -29.489 39.405  1.00 32.47  ? 205 VAL A CG2 1 
ATOM   1431  N  N   . THR A 1 206 ? -28.132 -30.333 35.673  1.00 39.36  ? 206 THR A N   1 
ATOM   1432  C  CA  . THR A 1 206 ? -27.841 -30.524 34.256  1.00 37.07  ? 206 THR A CA  1 
ATOM   1433  C  C   . THR A 1 206 ? -27.136 -31.854 33.999  1.00 41.03  ? 206 THR A C   1 
ATOM   1434  O  O   . THR A 1 206 ? -27.352 -32.497 32.973  1.00 38.72  ? 206 THR A O   1 
ATOM   1435  C  CB  . THR A 1 206 ? -26.970 -29.381 33.706  1.00 46.31  ? 206 THR A CB  1 
ATOM   1436  O  OG1 . THR A 1 206 ? -27.712 -28.156 33.736  1.00 50.03  ? 206 THR A OG1 1 
ATOM   1437  C  CG2 . THR A 1 206 ? -26.546 -29.676 32.276  1.00 50.79  ? 206 THR A CG2 1 
ATOM   1438  N  N   . LEU A 1 207 ? -26.292 -32.254 34.943  1.00 41.44  ? 207 LEU A N   1 
ATOM   1439  C  CA  . LEU A 1 207 ? -25.528 -33.497 34.843  1.00 32.94  ? 207 LEU A CA  1 
ATOM   1440  C  C   . LEU A 1 207 ? -26.474 -34.679 35.038  1.00 46.75  ? 207 LEU A C   1 
ATOM   1441  O  O   . LEU A 1 207 ? -26.411 -35.670 34.315  1.00 51.29  ? 207 LEU A O   1 
ATOM   1442  C  CB  . LEU A 1 207 ? -24.449 -33.541 35.920  1.00 30.85  ? 207 LEU A CB  1 
ATOM   1443  C  CG  . LEU A 1 207 ? -23.693 -34.857 36.124  1.00 30.01  ? 207 LEU A CG  1 
ATOM   1444  C  CD1 . LEU A 1 207 ? -23.072 -35.385 34.830  1.00 21.07  ? 207 LEU A CD1 1 
ATOM   1445  C  CD2 . LEU A 1 207 ? -22.623 -34.700 37.170  1.00 28.57  ? 207 LEU A CD2 1 
ATOM   1446  N  N   . TYR A 1 208 ? -27.359 -34.569 36.022  1.00 38.38  ? 208 TYR A N   1 
ATOM   1447  C  CA  . TYR A 1 208 ? -28.345 -35.613 36.270  1.00 25.22  ? 208 TYR A CA  1 
ATOM   1448  C  C   . TYR A 1 208 ? -29.192 -35.825 35.021  1.00 43.22  ? 208 TYR A C   1 
ATOM   1449  O  O   . TYR A 1 208 ? -29.331 -36.946 34.531  1.00 37.31  ? 208 TYR A O   1 
ATOM   1450  C  CB  . TYR A 1 208 ? -29.234 -35.240 37.455  1.00 31.53  ? 208 TYR A CB  1 
ATOM   1451  C  CG  . TYR A 1 208 ? -30.306 -36.261 37.762  1.00 46.57  ? 208 TYR A CG  1 
ATOM   1452  C  CD1 . TYR A 1 208 ? -30.177 -37.131 38.836  1.00 43.57  ? 208 TYR A CD1 1 
ATOM   1453  C  CD2 . TYR A 1 208 ? -31.448 -36.352 36.979  1.00 45.01  ? 208 TYR A CD2 1 
ATOM   1454  C  CE1 . TYR A 1 208 ? -31.155 -38.065 39.120  1.00 45.34  ? 208 TYR A CE1 1 
ATOM   1455  C  CE2 . TYR A 1 208 ? -32.430 -37.281 37.254  1.00 48.79  ? 208 TYR A CE2 1 
ATOM   1456  C  CZ  . TYR A 1 208 ? -32.279 -38.136 38.326  1.00 60.40  ? 208 TYR A CZ  1 
ATOM   1457  O  OH  . TYR A 1 208 ? -33.256 -39.063 38.604  1.00 83.21  ? 208 TYR A OH  1 
ATOM   1458  N  N   . VAL A 1 209 ? -29.752 -34.734 34.512  1.00 32.91  ? 209 VAL A N   1 
ATOM   1459  C  CA  . VAL A 1 209 ? -30.531 -34.755 33.285  1.00 26.19  ? 209 VAL A CA  1 
ATOM   1460  C  C   . VAL A 1 209 ? -29.797 -35.420 32.110  1.00 37.05  ? 209 VAL A C   1 
ATOM   1461  O  O   . VAL A 1 209 ? -30.374 -36.193 31.367  1.00 44.78  ? 209 VAL A O   1 
ATOM   1462  C  CB  . VAL A 1 209 ? -30.995 -33.331 32.898  1.00 34.45  ? 209 VAL A CB  1 
ATOM   1463  C  CG1 . VAL A 1 209 ? -31.579 -33.316 31.514  1.00 30.52  ? 209 VAL A CG1 1 
ATOM   1464  C  CG2 . VAL A 1 209 ? -32.039 -32.851 33.888  1.00 40.00  ? 209 VAL A CG2 1 
ATOM   1465  N  N   . MET A 1 210 ? -28.525 -35.125 31.939  1.00 36.03  ? 210 MET A N   1 
ATOM   1466  C  CA  . MET A 1 210 ? -27.800 -35.725 30.847  1.00 28.73  ? 210 MET A CA  1 
ATOM   1467  C  C   . MET A 1 210 ? -27.674 -37.234 31.035  1.00 35.02  ? 210 MET A C   1 
ATOM   1468  O  O   . MET A 1 210 ? -27.687 -37.986 30.069  1.00 34.05  ? 210 MET A O   1 
ATOM   1469  C  CB  . MET A 1 210 ? -26.406 -35.111 30.720  1.00 31.83  ? 210 MET A CB  1 
ATOM   1470  C  CG  . MET A 1 210 ? -26.399 -33.720 30.079  1.00 45.31  ? 210 MET A CG  1 
ATOM   1471  S  SD  . MET A 1 210 ? -24.753 -33.173 29.535  1.00 35.91  ? 210 MET A SD  1 
ATOM   1472  C  CE  . MET A 1 210 ? -24.003 -32.996 31.111  1.00 18.71  ? 210 MET A CE  1 
ATOM   1473  N  N   . LEU A 1 211 ? -27.522 -37.674 32.278  1.00 34.88  ? 211 LEU A N   1 
ATOM   1474  C  CA  . LEU A 1 211 ? -27.268 -39.089 32.549  1.00 31.34  ? 211 LEU A CA  1 
ATOM   1475  C  C   . LEU A 1 211 ? -28.562 -39.894 32.568  1.00 35.81  ? 211 LEU A C   1 
ATOM   1476  O  O   . LEU A 1 211 ? -28.576 -41.075 32.219  1.00 28.22  ? 211 LEU A O   1 
ATOM   1477  C  CB  . LEU A 1 211 ? -26.537 -39.267 33.887  1.00 25.27  ? 211 LEU A CB  1 
ATOM   1478  C  CG  . LEU A 1 211 ? -25.074 -38.811 33.930  1.00 32.10  ? 211 LEU A CG  1 
ATOM   1479  C  CD1 . LEU A 1 211 ? -24.558 -38.769 35.338  1.00 26.01  ? 211 LEU A CD1 1 
ATOM   1480  C  CD2 . LEU A 1 211 ? -24.184 -39.680 33.058  1.00 29.80  ? 211 LEU A CD2 1 
ATOM   1481  N  N   . VAL A 1 212 ? -29.649 -39.237 32.968  1.00 37.04  ? 212 VAL A N   1 
ATOM   1482  C  CA  . VAL A 1 212 ? -30.911 -39.926 33.285  1.00 38.91  ? 212 VAL A CA  1 
ATOM   1483  C  C   . VAL A 1 212 ? -32.030 -39.662 32.290  1.00 48.17  ? 212 VAL A C   1 
ATOM   1484  O  O   . VAL A 1 212 ? -32.929 -40.489 32.128  1.00 58.27  ? 212 VAL A O   1 
ATOM   1485  C  CB  . VAL A 1 212 ? -31.408 -39.507 34.666  1.00 30.28  ? 212 VAL A CB  1 
ATOM   1486  C  CG1 . VAL A 1 212 ? -32.826 -39.905 34.871  1.00 25.50  ? 212 VAL A CG1 1 
ATOM   1487  C  CG2 . VAL A 1 212 ? -30.499 -40.100 35.738  1.00 36.40  ? 212 VAL A CG2 1 
ATOM   1488  N  N   . GLY A 1 213 ? -31.974 -38.510 31.621  1.00 39.07  ? 213 GLY A N   1 
ATOM   1489  C  CA  . GLY A 1 213 ? -32.996 -38.139 30.665  1.00 28.97  ? 213 GLY A CA  1 
ATOM   1490  C  C   . GLY A 1 213 ? -34.234 -37.449 31.244  1.00 36.50  ? 213 GLY A C   1 
ATOM   1491  O  O   . GLY A 1 213 ? -35.152 -37.103 30.501  1.00 54.62  ? 213 GLY A O   1 
ATOM   1492  N  N   . ALA A 1 214 ? -34.257 -37.231 32.558  1.00 40.18  ? 214 ALA A N   1 
ATOM   1493  C  CA  . ALA A 1 214 ? -35.387 -36.591 33.238  1.00 32.70  ? 214 ALA A CA  1 
ATOM   1494  C  C   . ALA A 1 214 ? -34.855 -35.716 34.353  1.00 42.52  ? 214 ALA A C   1 
ATOM   1495  O  O   . ALA A 1 214 ? -33.753 -35.952 34.838  1.00 39.94  ? 214 ALA A O   1 
ATOM   1496  C  CB  . ALA A 1 214 ? -36.277 -37.630 33.839  1.00 43.33  ? 214 ALA A CB  1 
ATOM   1497  N  N   . TYR A 1 215 ? -35.642 -34.732 34.779  1.00 47.27  ? 215 TYR A N   1 
ATOM   1498  C  CA  . TYR A 1 215 ? -35.231 -33.848 35.867  1.00 51.14  ? 215 TYR A CA  1 
ATOM   1499  C  C   . TYR A 1 215 ? -35.091 -34.663 37.134  1.00 55.66  ? 215 TYR A C   1 
ATOM   1500  O  O   . TYR A 1 215 ? -35.817 -35.647 37.307  1.00 53.14  ? 215 TYR A O   1 
ATOM   1501  C  CB  . TYR A 1 215 ? -36.234 -32.699 36.073  1.00 51.95  ? 215 TYR A CB  1 
ATOM   1502  C  CG  . TYR A 1 215 ? -36.172 -31.701 34.968  1.00 47.65  ? 215 TYR A CG  1 
ATOM   1503  C  CD1 . TYR A 1 215 ? -34.956 -31.221 34.535  1.00 50.49  ? 215 TYR A CD1 1 
ATOM   1504  C  CD2 . TYR A 1 215 ? -37.315 -31.276 34.320  1.00 49.81  ? 215 TYR A CD2 1 
ATOM   1505  C  CE1 . TYR A 1 215 ? -34.872 -30.326 33.504  1.00 54.59  ? 215 TYR A CE1 1 
ATOM   1506  C  CE2 . TYR A 1 215 ? -37.245 -30.366 33.286  1.00 59.05  ? 215 TYR A CE2 1 
ATOM   1507  C  CZ  . TYR A 1 215 ? -36.016 -29.899 32.873  1.00 66.23  ? 215 TYR A CZ  1 
ATOM   1508  O  OH  . TYR A 1 215 ? -35.922 -28.985 31.831  1.00 77.66  ? 215 TYR A OH  1 
ATOM   1509  N  N   . PRO A 1 216 ? -34.159 -34.240 38.020  1.00 54.13  ? 216 PRO A N   1 
ATOM   1510  C  CA  . PRO A 1 216 ? -33.722 -34.826 39.293  1.00 51.95  ? 216 PRO A CA  1 
ATOM   1511  C  C   . PRO A 1 216 ? -34.819 -35.002 40.358  1.00 59.96  ? 216 PRO A C   1 
ATOM   1512  O  O   . PRO A 1 216 ? -34.778 -36.009 41.090  1.00 71.05  ? 216 PRO A O   1 
ATOM   1513  C  CB  . PRO A 1 216 ? -32.691 -33.818 39.799  1.00 54.50  ? 216 PRO A CB  1 
ATOM   1514  C  CG  . PRO A 1 216 ? -32.193 -33.139 38.596  1.00 52.45  ? 216 PRO A CG  1 
ATOM   1515  C  CD  . PRO A 1 216 ? -33.364 -33.052 37.675  1.00 50.82  ? 216 PRO A CD  1 
ATOM   1516  N  N   . PHE A 1 217 ? -35.748 -34.057 40.451  1.00 39.21  ? 217 PHE A N   1 
ATOM   1517  C  CA  . PHE A 1 217 ? -36.815 -34.130 41.442  1.00 58.03  ? 217 PHE A CA  1 
ATOM   1518  C  C   . PHE A 1 217 ? -38.173 -33.857 40.808  1.00 81.55  ? 217 PHE A C   1 
ATOM   1519  O  O   . PHE A 1 217 ? -38.757 -32.792 41.004  1.00 95.73  ? 217 PHE A O   1 
ATOM   1520  C  CB  . PHE A 1 217 ? -36.559 -33.139 42.580  1.00 62.00  ? 217 PHE A CB  1 
ATOM   1521  C  CG  . PHE A 1 217 ? -35.114 -33.030 42.978  1.00 45.31  ? 217 PHE A CG  1 
ATOM   1522  C  CD1 . PHE A 1 217 ? -34.242 -32.232 42.258  1.00 41.73  ? 217 PHE A CD1 1 
ATOM   1523  C  CD2 . PHE A 1 217 ? -34.629 -33.724 44.073  1.00 44.36  ? 217 PHE A CD2 1 
ATOM   1524  C  CE1 . PHE A 1 217 ? -32.913 -32.129 42.621  1.00 33.78  ? 217 PHE A CE1 1 
ATOM   1525  C  CE2 . PHE A 1 217 ? -33.302 -33.625 44.442  1.00 31.10  ? 217 PHE A CE2 1 
ATOM   1526  C  CZ  . PHE A 1 217 ? -32.443 -32.827 43.714  1.00 31.24  ? 217 PHE A CZ  1 
ATOM   1527  N  N   . GLU A 1 218 ? -38.671 -34.825 40.046  1.00 93.64  ? 218 GLU A N   1 
ATOM   1528  C  CA  . GLU A 1 218 ? -39.954 -34.683 39.370  1.00 94.12  ? 218 GLU A CA  1 
ATOM   1529  C  C   . GLU A 1 218 ? -40.418 -36.130 39.483  1.00 108.70 ? 218 GLU A C   1 
ATOM   1530  O  O   . GLU A 1 218 ? -40.237 -36.923 38.559  1.00 121.24 ? 218 GLU A O   1 
ATOM   1531  C  CB  . GLU A 1 218 ? -39.744 -34.244 37.919  1.00 89.47  ? 218 GLU A CB  1 
ATOM   1532  C  CG  . GLU A 1 218 ? -40.911 -33.471 37.329  1.00 99.58  ? 218 GLU A CG  1 
ATOM   1533  C  CD  . GLU A 1 218 ? -40.541 -32.746 36.051  1.00 107.42 ? 218 GLU A CD  1 
ATOM   1534  O  OE1 . GLU A 1 218 ? -40.531 -33.391 34.981  1.00 109.40 ? 218 GLU A OE1 1 
ATOM   1535  O  OE2 . GLU A 1 218 ? -40.259 -31.531 36.115  1.00 108.39 ? 218 GLU A OE2 1 
ATOM   1536  N  N   . ASP A 1 219 ? -41.015 -36.468 40.621  1.00 106.67 ? 219 ASP A N   1 
ATOM   1537  C  CA  . ASP A 1 219 ? -41.763 -37.707 40.797  1.00 120.28 ? 219 ASP A CA  1 
ATOM   1538  C  C   . ASP A 1 219 ? -42.557 -38.052 39.542  1.00 132.32 ? 219 ASP A C   1 
ATOM   1539  O  O   . ASP A 1 219 ? -43.228 -37.196 38.966  1.00 132.29 ? 219 ASP A O   1 
ATOM   1540  C  CB  . ASP A 1 219 ? -42.701 -37.603 42.000  1.00 118.77 ? 219 ASP A CB  1 
ATOM   1541  C  CG  . ASP A 1 219 ? -43.709 -38.733 42.052  1.00 116.61 ? 219 ASP A CG  1 
ATOM   1542  O  OD1 . ASP A 1 219 ? -43.581 -39.682 41.250  1.00 122.11 ? 219 ASP A OD1 1 
ATOM   1543  O  OD2 . ASP A 1 219 ? -44.629 -38.674 42.894  1.00 108.99 ? 219 ASP A OD2 1 
ATOM   1544  N  N   . PRO A 1 220 ? -42.477 -39.311 39.124  1.00 135.83 ? 220 PRO A N   1 
ATOM   1545  C  CA  . PRO A 1 220 ? -43.193 -39.774 37.932  1.00 137.63 ? 220 PRO A CA  1 
ATOM   1546  C  C   . PRO A 1 220 ? -44.705 -39.687 38.112  1.00 151.20 ? 220 PRO A C   1 
ATOM   1547  O  O   . PRO A 1 220 ? -45.347 -38.816 37.526  1.00 154.11 ? 220 PRO A O   1 
ATOM   1548  C  CB  . PRO A 1 220 ? -42.761 -41.236 37.818  1.00 129.06 ? 220 PRO A CB  1 
ATOM   1549  C  CG  . PRO A 1 220 ? -42.474 -41.644 39.218  1.00 128.77 ? 220 PRO A CG  1 
ATOM   1550  C  CD  . PRO A 1 220 ? -41.906 -40.428 39.896  1.00 132.72 ? 220 PRO A CD  1 
ATOM   1551  N  N   . GLU A 1 221 ? -45.260 -40.586 38.918  1.00 158.64 ? 221 GLU A N   1 
ATOM   1552  C  CA  . GLU A 1 221 ? -46.696 -40.604 39.172  1.00 163.18 ? 221 GLU A CA  1 
ATOM   1553  C  C   . GLU A 1 221 ? -47.361 -39.328 38.670  1.00 156.05 ? 221 GLU A C   1 
ATOM   1554  O  O   . GLU A 1 221 ? -48.303 -39.377 37.880  1.00 160.06 ? 221 GLU A O   1 
ATOM   1555  C  CB  . GLU A 1 221 ? -46.972 -40.790 40.666  1.00 175.95 ? 221 GLU A CB  1 
ATOM   1556  C  CG  . GLU A 1 221 ? -46.563 -42.150 41.209  1.00 187.97 ? 221 GLU A CG  1 
ATOM   1557  C  CD  . GLU A 1 221 ? -46.787 -42.268 42.705  1.00 197.15 ? 221 GLU A CD  1 
ATOM   1558  O  OE1 . GLU A 1 221 ? -47.078 -41.239 43.348  1.00 200.75 ? 221 GLU A OE1 1 
ATOM   1559  O  OE2 . GLU A 1 221 ? -46.668 -43.392 43.238  1.00 198.62 ? 221 GLU A OE2 1 
ATOM   1560  N  N   . GLU A 1 222 ? -46.864 -38.186 39.135  1.00 144.92 ? 222 GLU A N   1 
ATOM   1561  C  CA  . GLU A 1 222 ? -47.407 -36.895 38.732  1.00 135.03 ? 222 GLU A CA  1 
ATOM   1562  C  C   . GLU A 1 222 ? -46.351 -35.801 38.834  1.00 128.48 ? 222 GLU A C   1 
ATOM   1563  O  O   . GLU A 1 222 ? -46.328 -35.036 39.797  1.00 131.48 ? 222 GLU A O   1 
ATOM   1564  C  CB  . GLU A 1 222 ? -48.621 -36.534 39.589  1.00 132.87 ? 222 GLU A CB  1 
ATOM   1565  C  CG  . GLU A 1 222 ? -48.608 -37.155 40.976  1.00 132.33 ? 222 GLU A CG  1 
ATOM   1566  C  CD  . GLU A 1 222 ? -49.189 -36.236 42.031  1.00 131.06 ? 222 GLU A CD  1 
ATOM   1567  O  OE1 . GLU A 1 222 ? -48.601 -36.141 43.129  1.00 127.71 ? 222 GLU A OE1 1 
ATOM   1568  O  OE2 . GLU A 1 222 ? -50.235 -35.608 41.764  1.00 131.86 ? 222 GLU A OE2 1 
ATOM   1569  N  N   . PRO A 1 223 ? -45.479 -35.733 37.833  1.00 119.74 ? 223 PRO A N   1 
ATOM   1570  C  CA  . PRO A 1 223 ? -44.408 -34.731 37.813  1.00 122.00 ? 223 PRO A CA  1 
ATOM   1571  C  C   . PRO A 1 223 ? -44.951 -33.316 37.648  1.00 129.68 ? 223 PRO A C   1 
ATOM   1572  O  O   . PRO A 1 223 ? -44.571 -32.420 38.400  1.00 142.56 ? 223 PRO A O   1 
ATOM   1573  C  CB  . PRO A 1 223 ? -43.584 -35.129 36.586  1.00 115.07 ? 223 PRO A CB  1 
ATOM   1574  C  CG  . PRO A 1 223 ? -44.548 -35.835 35.701  1.00 109.94 ? 223 PRO A CG  1 
ATOM   1575  C  CD  . PRO A 1 223 ? -45.484 -36.564 36.618  1.00 111.16 ? 223 PRO A CD  1 
ATOM   1576  N  N   . LYS A 1 224 ? -45.831 -33.122 36.671  1.00 117.87 ? 224 LYS A N   1 
ATOM   1577  C  CA  . LYS A 1 224 ? -46.410 -31.810 36.413  1.00 108.52 ? 224 LYS A CA  1 
ATOM   1578  C  C   . LYS A 1 224 ? -46.695 -31.062 37.712  1.00 101.37 ? 224 LYS A C   1 
ATOM   1579  O  O   . LYS A 1 224 ? -46.771 -29.834 37.728  1.00 90.54  ? 224 LYS A O   1 
ATOM   1580  C  CB  . LYS A 1 224 ? -47.680 -31.944 35.587  1.00 106.74 ? 224 LYS A CB  1 
ATOM   1581  N  N   . ASN A 1 225 ? -46.852 -31.811 38.799  1.00 93.97  ? 225 ASN A N   1 
ATOM   1582  C  CA  . ASN A 1 225 ? -47.137 -31.220 40.102  1.00 90.46  ? 225 ASN A CA  1 
ATOM   1583  C  C   . ASN A 1 225 ? -46.083 -30.199 40.518  1.00 105.57 ? 225 ASN A C   1 
ATOM   1584  O  O   . ASN A 1 225 ? -45.033 -30.085 39.887  1.00 122.29 ? 225 ASN A O   1 
ATOM   1585  C  CB  . ASN A 1 225 ? -47.262 -32.310 41.167  1.00 86.13  ? 225 ASN A CB  1 
ATOM   1586  C  CG  . ASN A 1 225 ? -47.516 -31.745 42.549  1.00 81.26  ? 225 ASN A CG  1 
ATOM   1587  O  OD1 . ASN A 1 225 ? -47.061 -30.650 42.878  1.00 87.31  ? 225 ASN A OD1 1 
ATOM   1588  N  ND2 . ASN A 1 225 ? -48.247 -32.491 43.367  1.00 75.20  ? 225 ASN A ND2 1 
ATOM   1589  N  N   . PHE A 1 226 ? -46.371 -29.458 41.583  1.00 100.73 ? 226 PHE A N   1 
ATOM   1590  C  CA  . PHE A 1 226 ? -45.455 -28.438 42.080  1.00 89.39  ? 226 PHE A CA  1 
ATOM   1591  C  C   . PHE A 1 226 ? -45.077 -28.677 43.538  1.00 73.91  ? 226 PHE A C   1 
ATOM   1592  O  O   . PHE A 1 226 ? -43.896 -28.719 43.883  1.00 72.08  ? 226 PHE A O   1 
ATOM   1593  C  CB  . PHE A 1 226 ? -46.061 -27.043 41.914  1.00 89.97  ? 226 PHE A CB  1 
ATOM   1594  C  CG  . PHE A 1 226 ? -45.226 -26.118 41.079  1.00 89.05  ? 226 PHE A CG  1 
ATOM   1595  C  CD1 . PHE A 1 226 ? -45.445 -26.007 39.716  1.00 96.29  ? 226 PHE A CD1 1 
ATOM   1596  C  CD2 . PHE A 1 226 ? -44.221 -25.360 41.655  1.00 87.15  ? 226 PHE A CD2 1 
ATOM   1597  C  CE1 . PHE A 1 226 ? -44.678 -25.157 38.944  1.00 101.19 ? 226 PHE A CE1 1 
ATOM   1598  C  CE2 . PHE A 1 226 ? -43.451 -24.508 40.888  1.00 103.47 ? 226 PHE A CE2 1 
ATOM   1599  C  CZ  . PHE A 1 226 ? -43.680 -24.405 39.531  1.00 108.50 ? 226 PHE A CZ  1 
ATOM   1600  N  N   . ARG A 1 227 ? -46.063 -28.854 44.393  1.00 68.79  ? 227 ARG A N   1 
ATOM   1601  C  CA  . ARG A 1 227 ? -45.787 -29.108 45.785  1.00 64.34  ? 227 ARG A CA  1 
ATOM   1602  C  C   . ARG A 1 227 ? -44.890 -30.284 45.935  1.00 68.88  ? 227 ARG A C   1 
ATOM   1603  O  O   . ARG A 1 227 ? -44.035 -30.313 46.774  1.00 76.66  ? 227 ARG A O   1 
ATOM   1604  C  CB  . ARG A 1 227 ? -47.058 -29.397 46.569  1.00 60.42  ? 227 ARG A CB  1 
ATOM   1605  C  CG  . ARG A 1 227 ? -46.759 -29.843 47.990  1.00 66.93  ? 227 ARG A CG  1 
ATOM   1606  C  CD  . ARG A 1 227 ? -47.966 -30.311 48.736  1.00 66.34  ? 227 ARG A CD  1 
ATOM   1607  N  NE  . ARG A 1 227 ? -49.167 -29.796 48.123  1.00 82.05  ? 227 ARG A NE  1 
ATOM   1608  C  CZ  . ARG A 1 227 ? -50.033 -29.017 48.745  1.00 95.80  ? 227 ARG A CZ  1 
ATOM   1609  N  NH1 . ARG A 1 227 ? -51.098 -28.573 48.118  1.00 106.56 ? 227 ARG A NH1 1 
ATOM   1610  N  NH2 . ARG A 1 227 ? -49.832 -28.686 49.992  1.00 91.39  ? 227 ARG A NH2 1 
ATOM   1611  N  N   . LYS A 1 228 ? -45.113 -31.286 45.133  1.00 71.03  ? 228 LYS A N   1 
ATOM   1612  C  CA  . LYS A 1 228 ? -44.352 -32.497 45.275  1.00 67.52  ? 228 LYS A CA  1 
ATOM   1613  C  C   . LYS A 1 228 ? -42.934 -32.270 44.857  1.00 62.48  ? 228 LYS A C   1 
ATOM   1614  O  O   . LYS A 1 228 ? -42.027 -32.733 45.493  1.00 48.23  ? 228 LYS A O   1 
ATOM   1615  C  CB  . LYS A 1 228 ? -44.945 -33.577 44.407  1.00 75.00  ? 228 LYS A CB  1 
ATOM   1616  C  CG  . LYS A 1 228 ? -45.018 -34.916 45.078  1.00 91.07  ? 228 LYS A CG  1 
ATOM   1617  C  CD  . LYS A 1 228 ? -43.792 -35.759 44.808  1.00 104.74 ? 228 LYS A CD  1 
ATOM   1618  C  CE  . LYS A 1 228 ? -44.035 -37.228 45.124  1.00 111.19 ? 228 LYS A CE  1 
ATOM   1619  N  NZ  . LYS A 1 228 ? -43.607 -37.571 46.509  1.00 110.36 ? 228 LYS A NZ  1 
ATOM   1620  N  N   . THR A 1 229 ? -42.747 -31.551 43.767  1.00 57.08  ? 229 THR A N   1 
ATOM   1621  C  CA  . THR A 1 229 ? -41.399 -31.281 43.285  1.00 60.08  ? 229 THR A CA  1 
ATOM   1622  C  C   . THR A 1 229 ? -40.606 -30.355 44.234  1.00 58.59  ? 229 THR A C   1 
ATOM   1623  O  O   . THR A 1 229 ? -39.512 -30.706 44.674  1.00 51.36  ? 229 THR A O   1 
ATOM   1624  C  CB  . THR A 1 229 ? -41.377 -30.794 41.824  1.00 60.94  ? 229 THR A CB  1 
ATOM   1625  O  OG1 . THR A 1 229 ? -40.056 -30.365 41.492  1.00 69.22  ? 229 THR A OG1 1 
ATOM   1626  C  CG2 . THR A 1 229 ? -42.319 -29.642 41.630  1.00 68.69  ? 229 THR A CG2 1 
ATOM   1627  N  N   . ILE A 1 230 ? -41.154 -29.191 44.571  1.00 59.34  ? 230 ILE A N   1 
ATOM   1628  C  CA  . ILE A 1 230 ? -40.475 -28.324 45.540  1.00 56.05  ? 230 ILE A CA  1 
ATOM   1629  C  C   . ILE A 1 230 ? -40.134 -29.136 46.783  1.00 54.85  ? 230 ILE A C   1 
ATOM   1630  O  O   . ILE A 1 230 ? -39.047 -29.029 47.369  1.00 53.85  ? 230 ILE A O   1 
ATOM   1631  C  CB  . ILE A 1 230 ? -41.309 -27.082 45.922  1.00 35.43  ? 230 ILE A CB  1 
ATOM   1632  C  CG1 . ILE A 1 230 ? -41.098 -25.979 44.893  1.00 49.66  ? 230 ILE A CG1 1 
ATOM   1633  C  CG2 . ILE A 1 230 ? -40.886 -26.559 47.246  1.00 27.86  ? 230 ILE A CG2 1 
ATOM   1634  C  CD1 . ILE A 1 230 ? -42.382 -25.336 44.407  1.00 64.44  ? 230 ILE A CD1 1 
ATOM   1635  N  N   . HIS A 1 231 ? -41.087 -29.964 47.196  1.00 53.07  ? 231 HIS A N   1 
ATOM   1636  C  CA  . HIS A 1 231 ? -40.921 -30.782 48.390  1.00 64.03  ? 231 HIS A CA  1 
ATOM   1637  C  C   . HIS A 1 231 ? -39.680 -31.662 48.305  1.00 61.24  ? 231 HIS A C   1 
ATOM   1638  O  O   . HIS A 1 231 ? -38.889 -31.721 49.245  1.00 66.65  ? 231 HIS A O   1 
ATOM   1639  C  CB  . HIS A 1 231 ? -42.161 -31.645 48.634  1.00 74.01  ? 231 HIS A CB  1 
ATOM   1640  C  CG  . HIS A 1 231 ? -42.098 -32.444 49.898  1.00 74.96  ? 231 HIS A CG  1 
ATOM   1641  N  ND1 . HIS A 1 231 ? -42.222 -31.873 51.146  1.00 76.75  ? 231 HIS A ND1 1 
ATOM   1642  C  CD2 . HIS A 1 231 ? -41.921 -33.770 50.105  1.00 81.51  ? 231 HIS A CD2 1 
ATOM   1643  C  CE1 . HIS A 1 231 ? -42.125 -32.813 52.069  1.00 81.69  ? 231 HIS A CE1 1 
ATOM   1644  N  NE2 . HIS A 1 231 ? -41.942 -33.973 51.464  1.00 84.29  ? 231 HIS A NE2 1 
ATOM   1645  N  N   . ARG A 1 232 ? -39.515 -32.338 47.173  1.00 59.81  ? 232 ARG A N   1 
ATOM   1646  C  CA  . ARG A 1 232 ? -38.364 -33.207 46.957  1.00 59.90  ? 232 ARG A CA  1 
ATOM   1647  C  C   . ARG A 1 232 ? -37.060 -32.417 47.007  1.00 55.03  ? 232 ARG A C   1 
ATOM   1648  O  O   . ARG A 1 232 ? -36.096 -32.836 47.646  1.00 56.33  ? 232 ARG A O   1 
ATOM   1649  C  CB  . ARG A 1 232 ? -38.487 -33.940 45.622  1.00 70.91  ? 232 ARG A CB  1 
ATOM   1650  C  CG  . ARG A 1 232 ? -39.438 -35.124 45.652  1.00 72.43  ? 232 ARG A CG  1 
ATOM   1651  C  CD  . ARG A 1 232 ? -39.702 -35.653 44.253  1.00 90.44  ? 232 ARG A CD  1 
ATOM   1652  N  NE  . ARG A 1 232 ? -38.964 -36.885 43.989  1.00 109.98 ? 232 ARG A NE  1 
ATOM   1653  C  CZ  . ARG A 1 232 ? -39.323 -38.081 44.443  1.00 116.00 ? 232 ARG A CZ  1 
ATOM   1654  N  NH1 . ARG A 1 232 ? -40.412 -38.212 45.186  1.00 115.79 ? 232 ARG A NH1 1 
ATOM   1655  N  NH2 . ARG A 1 232 ? -38.591 -39.150 44.153  1.00 115.90 ? 232 ARG A NH2 1 
ATOM   1656  N  N   . ILE A 1 233 ? -37.037 -31.275 46.329  1.00 45.26  ? 233 ILE A N   1 
ATOM   1657  C  CA  . ILE A 1 233 ? -35.870 -30.420 46.326  1.00 36.52  ? 233 ILE A CA  1 
ATOM   1658  C  C   . ILE A 1 233 ? -35.430 -30.168 47.765  1.00 44.11  ? 233 ILE A C   1 
ATOM   1659  O  O   . ILE A 1 233 ? -34.266 -30.402 48.121  1.00 54.68  ? 233 ILE A O   1 
ATOM   1660  C  CB  . ILE A 1 233 ? -36.169 -29.080 45.596  1.00 42.26  ? 233 ILE A CB  1 
ATOM   1661  C  CG1 . ILE A 1 233 ? -36.327 -29.337 44.104  1.00 32.46  ? 233 ILE A CG1 1 
ATOM   1662  C  CG2 . ILE A 1 233 ? -35.081 -28.034 45.831  1.00 38.42  ? 233 ILE A CG2 1 
ATOM   1663  C  CD1 . ILE A 1 233 ? -36.858 -28.164 43.321  1.00 30.99  ? 233 ILE A CD1 1 
ATOM   1664  N  N   . LEU A 1 234 ? -36.355 -29.699 48.601  1.00 49.24  ? 234 LEU A N   1 
ATOM   1665  C  CA  . LEU A 1 234 ? -35.987 -29.263 49.962  1.00 54.55  ? 234 LEU A CA  1 
ATOM   1666  C  C   . LEU A 1 234 ? -35.469 -30.441 50.778  1.00 47.68  ? 234 LEU A C   1 
ATOM   1667  O  O   . LEU A 1 234 ? -34.648 -30.274 51.668  1.00 55.68  ? 234 LEU A O   1 
ATOM   1668  C  CB  . LEU A 1 234 ? -37.158 -28.577 50.672  1.00 43.16  ? 234 LEU A CB  1 
ATOM   1669  C  CG  . LEU A 1 234 ? -37.658 -27.351 49.914  1.00 55.50  ? 234 LEU A CG  1 
ATOM   1670  C  CD1 . LEU A 1 234 ? -38.928 -26.765 50.531  1.00 52.81  ? 234 LEU A CD1 1 
ATOM   1671  C  CD2 . LEU A 1 234 ? -36.549 -26.334 49.870  1.00 56.28  ? 234 LEU A CD2 1 
ATOM   1672  N  N   . ASN A 1 235 ? -35.921 -31.640 50.445  1.00 54.09  ? 235 ASN A N   1 
ATOM   1673  C  CA  . ASN A 1 235 ? -35.482 -32.823 51.172  1.00 63.19  ? 235 ASN A CA  1 
ATOM   1674  C  C   . ASN A 1 235 ? -34.467 -33.628 50.397  1.00 53.56  ? 235 ASN A C   1 
ATOM   1675  O  O   . ASN A 1 235 ? -34.100 -34.715 50.780  1.00 54.27  ? 235 ASN A O   1 
ATOM   1676  C  CB  . ASN A 1 235 ? -36.684 -33.665 51.574  1.00 72.44  ? 235 ASN A CB  1 
ATOM   1677  C  CG  . ASN A 1 235 ? -37.621 -32.901 52.486  1.00 72.72  ? 235 ASN A CG  1 
ATOM   1678  O  OD1 . ASN A 1 235 ? -38.734 -32.545 52.098  1.00 72.08  ? 235 ASN A OD1 1 
ATOM   1679  N  ND2 . ASN A 1 235 ? -37.152 -32.598 53.696  1.00 65.52  ? 235 ASN A ND2 1 
ATOM   1680  N  N   . VAL A 1 236 ? -33.996 -33.072 49.301  1.00 48.92  ? 236 VAL A N   1 
ATOM   1681  C  CA  . VAL A 1 236 ? -33.023 -33.761 48.487  1.00 44.81  ? 236 VAL A CA  1 
ATOM   1682  C  C   . VAL A 1 236 ? -33.359 -35.217 48.207  1.00 38.56  ? 236 VAL A C   1 
ATOM   1683  O  O   . VAL A 1 236 ? -32.474 -36.049 48.293  1.00 41.09  ? 236 VAL A O   1 
ATOM   1684  C  CB  . VAL A 1 236 ? -31.665 -33.750 49.155  1.00 42.20  ? 236 VAL A CB  1 
ATOM   1685  C  CG1 . VAL A 1 236 ? -30.601 -34.003 48.117  1.00 54.58  ? 236 VAL A CG1 1 
ATOM   1686  C  CG2 . VAL A 1 236 ? -31.423 -32.410 49.816  1.00 41.89  ? 236 VAL A CG2 1 
ATOM   1687  N  N   . GLN A 1 237 ? -34.615 -35.524 47.871  1.00 46.20  ? 237 GLN A N   1 
ATOM   1688  C  CA  . GLN A 1 237 ? -35.021 -36.899 47.497  1.00 51.44  ? 237 GLN A CA  1 
ATOM   1689  C  C   . GLN A 1 237 ? -34.969 -37.100 45.996  1.00 49.89  ? 237 GLN A C   1 
ATOM   1690  O  O   . GLN A 1 237 ? -35.861 -36.665 45.253  1.00 51.91  ? 237 GLN A O   1 
ATOM   1691  C  CB  . GLN A 1 237 ? -36.433 -37.233 47.983  1.00 52.16  ? 237 GLN A CB  1 
ATOM   1692  C  CG  . GLN A 1 237 ? -36.643 -36.992 49.470  1.00 68.73  ? 237 GLN A CG  1 
ATOM   1693  C  CD  . GLN A 1 237 ? -38.088 -37.212 49.901  1.00 75.18  ? 237 GLN A CD  1 
ATOM   1694  O  OE1 . GLN A 1 237 ? -38.465 -36.900 51.039  1.00 69.96  ? 237 GLN A OE1 1 
ATOM   1695  N  NE2 . GLN A 1 237 ? -38.906 -37.755 48.992  1.00 78.78  ? 237 GLN A NE2 1 
ATOM   1696  N  N   . TYR A 1 238 ? -33.896 -37.737 45.556  1.00 47.81  ? 238 TYR A N   1 
ATOM   1697  C  CA  . TYR A 1 238 ? -33.726 -38.053 44.153  1.00 52.33  ? 238 TYR A CA  1 
ATOM   1698  C  C   . TYR A 1 238 ? -33.321 -39.507 44.070  1.00 49.16  ? 238 TYR A C   1 
ATOM   1699  O  O   . TYR A 1 238 ? -32.815 -40.075 45.037  1.00 58.53  ? 238 TYR A O   1 
ATOM   1700  C  CB  . TYR A 1 238 ? -32.685 -37.155 43.486  1.00 35.99  ? 238 TYR A CB  1 
ATOM   1701  C  CG  . TYR A 1 238 ? -31.269 -37.391 43.934  1.00 35.00  ? 238 TYR A CG  1 
ATOM   1702  C  CD1 . TYR A 1 238 ? -30.427 -38.259 43.242  1.00 35.82  ? 238 TYR A CD1 1 
ATOM   1703  C  CD2 . TYR A 1 238 ? -30.760 -36.729 45.046  1.00 45.46  ? 238 TYR A CD2 1 
ATOM   1704  C  CE1 . TYR A 1 238 ? -29.105 -38.471 43.671  1.00 28.77  ? 238 TYR A CE1 1 
ATOM   1705  C  CE2 . TYR A 1 238 ? -29.458 -36.933 45.478  1.00 37.25  ? 238 TYR A CE2 1 
ATOM   1706  C  CZ  . TYR A 1 238 ? -28.647 -37.797 44.787  1.00 34.57  ? 238 TYR A CZ  1 
ATOM   1707  O  OH  . TYR A 1 238 ? -27.369 -37.967 45.223  1.00 50.96  ? 238 TYR A OH  1 
ATOM   1708  N  N   . ALA A 1 239 ? -33.553 -40.114 42.918  1.00 56.54  ? 239 ALA A N   1 
ATOM   1709  C  CA  . ALA A 1 239 ? -33.385 -41.546 42.797  1.00 65.25  ? 239 ALA A CA  1 
ATOM   1710  C  C   . ALA A 1 239 ? -32.948 -41.871 41.394  1.00 56.40  ? 239 ALA A C   1 
ATOM   1711  O  O   . ALA A 1 239 ? -33.781 -41.865 40.495  1.00 68.97  ? 239 ALA A O   1 
ATOM   1712  C  CB  . ALA A 1 239 ? -34.711 -42.236 43.093  1.00 72.93  ? 239 ALA A CB  1 
ATOM   1713  N  N   . ILE A 1 240 ? -31.676 -42.196 41.194  1.00 41.48  ? 240 ILE A N   1 
ATOM   1714  C  CA  . ILE A 1 240 ? -31.227 -42.676 39.892  1.00 49.32  ? 240 ILE A CA  1 
ATOM   1715  C  C   . ILE A 1 240 ? -31.879 -44.030 39.624  1.00 69.59  ? 240 ILE A C   1 
ATOM   1716  O  O   . ILE A 1 240 ? -31.685 -44.975 40.388  1.00 62.63  ? 240 ILE A O   1 
ATOM   1717  C  CB  . ILE A 1 240 ? -29.699 -42.832 39.841  1.00 47.84  ? 240 ILE A CB  1 
ATOM   1718  C  CG1 . ILE A 1 240 ? -29.017 -41.534 40.272  1.00 43.94  ? 240 ILE A CG1 1 
ATOM   1719  C  CG2 . ILE A 1 240 ? -29.252 -43.235 38.445  1.00 39.32  ? 240 ILE A CG2 1 
ATOM   1720  C  CD1 . ILE A 1 240 ? -27.523 -41.528 40.041  1.00 42.04  ? 240 ILE A CD1 1 
ATOM   1721  N  N   . PRO A 1 241 ? -32.660 -44.126 38.550  1.00 71.07  ? 241 PRO A N   1 
ATOM   1722  C  CA  . PRO A 1 241 ? -33.424 -45.349 38.291  1.00 67.94  ? 241 PRO A CA  1 
ATOM   1723  C  C   . PRO A 1 241 ? -32.548 -46.567 38.015  1.00 63.48  ? 241 PRO A C   1 
ATOM   1724  O  O   . PRO A 1 241 ? -31.386 -46.430 37.595  1.00 53.99  ? 241 PRO A O   1 
ATOM   1725  C  CB  . PRO A 1 241 ? -34.261 -44.985 37.051  1.00 71.24  ? 241 PRO A CB  1 
ATOM   1726  C  CG  . PRO A 1 241 ? -33.579 -43.810 36.429  1.00 65.93  ? 241 PRO A CG  1 
ATOM   1727  C  CD  . PRO A 1 241 ? -32.939 -43.072 37.552  1.00 68.00  ? 241 PRO A CD  1 
ATOM   1728  N  N   . ASP A 1 242 ? -33.114 -47.744 38.270  1.00 66.83  ? 242 ASP A N   1 
ATOM   1729  C  CA  . ASP A 1 242 ? -32.450 -49.022 37.998  1.00 65.62  ? 242 ASP A CA  1 
ATOM   1730  C  C   . ASP A 1 242 ? -31.699 -49.131 36.668  1.00 57.69  ? 242 ASP A C   1 
ATOM   1731  O  O   . ASP A 1 242 ? -30.570 -49.625 36.636  1.00 50.90  ? 242 ASP A O   1 
ATOM   1732  C  CB  . ASP A 1 242 ? -33.467 -50.163 38.043  1.00 82.10  ? 242 ASP A CB  1 
ATOM   1733  C  CG  . ASP A 1 242 ? -34.069 -50.339 39.411  1.00 97.05  ? 242 ASP A CG  1 
ATOM   1734  O  OD1 . ASP A 1 242 ? -33.320 -50.738 40.346  1.00 98.64  ? 242 ASP A OD1 1 
ATOM   1735  O  OD2 . ASP A 1 242 ? -35.287 -50.074 39.541  1.00 99.92  ? 242 ASP A OD2 1 
ATOM   1736  N  N   . TYR A 1 243 ? -32.350 -48.744 35.576  1.00 54.32  ? 243 TYR A N   1 
ATOM   1737  C  CA  . TYR A 1 243 ? -31.826 -49.000 34.236  1.00 51.30  ? 243 TYR A CA  1 
ATOM   1738  C  C   . TYR A 1 243 ? -30.632 -48.126 33.870  1.00 57.21  ? 243 TYR A C   1 
ATOM   1739  O  O   . TYR A 1 243 ? -29.988 -48.337 32.843  1.00 55.95  ? 243 TYR A O   1 
ATOM   1740  C  CB  . TYR A 1 243 ? -32.931 -48.842 33.189  1.00 44.41  ? 243 TYR A CB  1 
ATOM   1741  C  CG  . TYR A 1 243 ? -33.673 -47.528 33.270  1.00 49.28  ? 243 TYR A CG  1 
ATOM   1742  C  CD1 . TYR A 1 243 ? -33.275 -46.437 32.512  1.00 46.81  ? 243 TYR A CD1 1 
ATOM   1743  C  CD2 . TYR A 1 243 ? -34.773 -47.381 34.103  1.00 50.56  ? 243 TYR A CD2 1 
ATOM   1744  C  CE1 . TYR A 1 243 ? -33.951 -45.234 32.582  1.00 48.89  ? 243 TYR A CE1 1 
ATOM   1745  C  CE2 . TYR A 1 243 ? -35.455 -46.184 34.180  1.00 55.71  ? 243 TYR A CE2 1 
ATOM   1746  C  CZ  . TYR A 1 243 ? -35.040 -45.114 33.417  1.00 57.86  ? 243 TYR A CZ  1 
ATOM   1747  O  OH  . TYR A 1 243 ? -35.715 -43.918 33.489  1.00 78.64  ? 243 TYR A OH  1 
ATOM   1748  N  N   . VAL A 1 244 ? -30.343 -47.146 34.715  1.00 48.43  ? 244 VAL A N   1 
ATOM   1749  C  CA  . VAL A 1 244 ? -29.244 -46.209 34.467  1.00 55.04  ? 244 VAL A CA  1 
ATOM   1750  C  C   . VAL A 1 244 ? -27.988 -46.614 35.240  1.00 57.60  ? 244 VAL A C   1 
ATOM   1751  O  O   . VAL A 1 244 ? -27.979 -46.639 36.475  1.00 53.31  ? 244 VAL A O   1 
ATOM   1752  C  CB  . VAL A 1 244 ? -29.621 -44.725 34.764  1.00 56.23  ? 244 VAL A CB  1 
ATOM   1753  C  CG1 . VAL A 1 244 ? -28.644 -43.790 34.068  1.00 61.61  ? 244 VAL A CG1 1 
ATOM   1754  C  CG2 . VAL A 1 244 ? -31.025 -44.397 34.281  1.00 37.99  ? 244 VAL A CG2 1 
ATOM   1755  N  N   . HIS A 1 245 ? -26.939 -46.942 34.489  1.00 59.08  ? 245 HIS A N   1 
ATOM   1756  C  CA  . HIS A 1 245 ? -25.709 -47.454 35.059  1.00 60.49  ? 245 HIS A CA  1 
ATOM   1757  C  C   . HIS A 1 245 ? -24.580 -46.467 34.943  1.00 64.08  ? 245 HIS A C   1 
ATOM   1758  O  O   . HIS A 1 245 ? -24.282 -45.951 33.865  1.00 65.52  ? 245 HIS A O   1 
ATOM   1759  C  CB  . HIS A 1 245 ? -25.330 -48.794 34.434  1.00 70.23  ? 245 HIS A CB  1 
ATOM   1760  C  CG  . HIS A 1 245 ? -26.150 -49.933 34.946  1.00 73.19  ? 245 HIS A CG  1 
ATOM   1761  N  ND1 . HIS A 1 245 ? -26.234 -50.240 36.287  1.00 86.11  ? 245 HIS A ND1 1 
ATOM   1762  C  CD2 . HIS A 1 245 ? -26.946 -50.818 34.303  1.00 67.77  ? 245 HIS A CD2 1 
ATOM   1763  C  CE1 . HIS A 1 245 ? -27.048 -51.269 36.449  1.00 87.33  ? 245 HIS A CE1 1 
ATOM   1764  N  NE2 . HIS A 1 245 ? -27.498 -51.634 35.261  1.00 74.79  ? 245 HIS A NE2 1 
ATOM   1765  N  N   . ILE A 1 246 ? -23.940 -46.182 36.071  1.00 73.46  ? 246 ILE A N   1 
ATOM   1766  C  CA  . ILE A 1 246 ? -22.848 -45.218 36.100  1.00 54.77  ? 246 ILE A CA  1 
ATOM   1767  C  C   . ILE A 1 246 ? -21.805 -45.583 37.148  1.00 50.24  ? 246 ILE A C   1 
ATOM   1768  O  O   . ILE A 1 246 ? -22.137 -46.087 38.221  1.00 59.73  ? 246 ILE A O   1 
ATOM   1769  C  CB  . ILE A 1 246 ? -23.363 -43.795 36.383  1.00 57.07  ? 246 ILE A CB  1 
ATOM   1770  C  CG1 . ILE A 1 246 ? -24.587 -43.844 37.299  1.00 50.87  ? 246 ILE A CG1 1 
ATOM   1771  C  CG2 . ILE A 1 246 ? -23.695 -43.079 35.083  1.00 56.96  ? 246 ILE A CG2 1 
ATOM   1772  C  CD1 . ILE A 1 246 ? -24.502 -42.902 38.479  1.00 46.24  ? 246 ILE A CD1 1 
ATOM   1773  N  N   . SER A 1 247 ? -20.541 -45.321 36.831  1.00 36.51  ? 247 SER A N   1 
ATOM   1774  C  CA  . SER A 1 247 ? -19.450 -45.595 37.756  1.00 40.01  ? 247 SER A CA  1 
ATOM   1775  C  C   . SER A 1 247 ? -19.737 -44.966 39.112  1.00 50.09  ? 247 SER A C   1 
ATOM   1776  O  O   . SER A 1 247 ? -20.436 -43.957 39.200  1.00 55.57  ? 247 SER A O   1 
ATOM   1777  C  CB  . SER A 1 247 ? -18.131 -45.062 37.198  1.00 47.39  ? 247 SER A CB  1 
ATOM   1778  O  OG  . SER A 1 247 ? -18.110 -43.645 37.209  1.00 59.58  ? 247 SER A OG  1 
ATOM   1779  N  N   . PRO A 1 248 ? -19.198 -45.564 40.168  1.00 62.53  ? 248 PRO A N   1 
ATOM   1780  C  CA  . PRO A 1 248 ? -19.405 -45.043 41.518  1.00 62.84  ? 248 PRO A CA  1 
ATOM   1781  C  C   . PRO A 1 248 ? -18.725 -43.683 41.738  1.00 58.15  ? 248 PRO A C   1 
ATOM   1782  O  O   . PRO A 1 248 ? -19.215 -42.928 42.580  1.00 56.56  ? 248 PRO A O   1 
ATOM   1783  C  CB  . PRO A 1 248 ? -18.790 -46.129 42.406  1.00 49.42  ? 248 PRO A CB  1 
ATOM   1784  C  CG  . PRO A 1 248 ? -17.823 -46.826 41.514  1.00 53.86  ? 248 PRO A CG  1 
ATOM   1785  C  CD  . PRO A 1 248 ? -18.410 -46.806 40.154  1.00 49.20  ? 248 PRO A CD  1 
ATOM   1786  N  N   . GLU A 1 249 ? -17.665 -43.388 40.992  1.00 52.08  ? 249 GLU A N   1 
ATOM   1787  C  CA  . GLU A 1 249 ? -17.027 -42.083 41.058  1.00 51.00  ? 249 GLU A CA  1 
ATOM   1788  C  C   . GLU A 1 249 ? -18.010 -41.017 40.591  1.00 55.99  ? 249 GLU A C   1 
ATOM   1789  O  O   . GLU A 1 249 ? -18.051 -39.916 41.138  1.00 46.18  ? 249 GLU A O   1 
ATOM   1790  C  CB  . GLU A 1 249 ? -15.766 -42.056 40.196  1.00 49.49  ? 249 GLU A CB  1 
ATOM   1791  C  CG  . GLU A 1 249 ? -14.865 -43.265 40.378  1.00 78.43  ? 249 GLU A CG  1 
ATOM   1792  C  CD  . GLU A 1 249 ? -15.014 -44.274 39.258  1.00 89.13  ? 249 GLU A CD  1 
ATOM   1793  O  OE1 . GLU A 1 249 ? -15.644 -45.327 39.486  1.00 97.82  ? 249 GLU A OE1 1 
ATOM   1794  O  OE2 . GLU A 1 249 ? -14.502 -44.012 38.150  1.00 88.31  ? 249 GLU A OE2 1 
ATOM   1795  N  N   . CYS A 1 250 ? -18.804 -41.352 39.578  1.00 43.83  ? 250 CYS A N   1 
ATOM   1796  C  CA  . CYS A 1 250 ? -19.809 -40.438 39.079  1.00 49.17  ? 250 CYS A CA  1 
ATOM   1797  C  C   . CYS A 1 250 ? -20.901 -40.280 40.132  1.00 54.60  ? 250 CYS A C   1 
ATOM   1798  O  O   . CYS A 1 250 ? -21.432 -39.175 40.336  1.00 55.82  ? 250 CYS A O   1 
ATOM   1799  C  CB  . CYS A 1 250 ? -20.397 -40.948 37.776  1.00 56.74  ? 250 CYS A CB  1 
ATOM   1800  S  SG  . CYS A 1 250 ? -21.774 -39.948 37.160  1.00 59.14  ? 250 CYS A SG  1 
ATOM   1801  N  N   . ARG A 1 251 ? -21.271 -41.390 40.762  1.00 43.72  ? 251 ARG A N   1 
ATOM   1802  C  CA  . ARG A 1 251 ? -22.355 -41.392 41.732  1.00 40.93  ? 251 ARG A CA  1 
ATOM   1803  C  C   . ARG A 1 251 ? -21.959 -40.611 42.973  1.00 46.26  ? 251 ARG A C   1 
ATOM   1804  O  O   . ARG A 1 251 ? -22.810 -40.124 43.713  1.00 53.05  ? 251 ARG A O   1 
ATOM   1805  C  CB  . ARG A 1 251 ? -22.735 -42.825 42.109  1.00 38.69  ? 251 ARG A CB  1 
ATOM   1806  C  CG  . ARG A 1 251 ? -24.053 -42.941 42.856  1.00 41.79  ? 251 ARG A CG  1 
ATOM   1807  C  CD  . ARG A 1 251 ? -24.431 -44.396 43.082  1.00 52.81  ? 251 ARG A CD  1 
ATOM   1808  N  NE  . ARG A 1 251 ? -24.569 -45.125 41.825  1.00 63.65  ? 251 ARG A NE  1 
ATOM   1809  C  CZ  . ARG A 1 251 ? -25.730 -45.530 41.320  1.00 62.48  ? 251 ARG A CZ  1 
ATOM   1810  N  NH1 . ARG A 1 251 ? -26.860 -45.278 41.965  1.00 43.39  ? 251 ARG A NH1 1 
ATOM   1811  N  NH2 . ARG A 1 251 ? -25.760 -46.188 40.169  1.00 65.68  ? 251 ARG A NH2 1 
ATOM   1812  N  N   . HIS A 1 252 ? -20.655 -40.497 43.189  1.00 53.25  ? 252 HIS A N   1 
ATOM   1813  C  CA  . HIS A 1 252 ? -20.134 -39.791 44.350  1.00 43.30  ? 252 HIS A CA  1 
ATOM   1814  C  C   . HIS A 1 252 ? -20.252 -38.297 44.096  1.00 44.44  ? 252 HIS A C   1 
ATOM   1815  O  O   . HIS A 1 252 ? -20.817 -37.568 44.920  1.00 43.71  ? 252 HIS A O   1 
ATOM   1816  C  CB  . HIS A 1 252 ? -18.679 -40.180 44.640  1.00 34.95  ? 252 HIS A CB  1 
ATOM   1817  C  CG  . HIS A 1 252 ? -18.097 -39.451 45.800  1.00 46.48  ? 252 HIS A CG  1 
ATOM   1818  N  ND1 . HIS A 1 252 ? -17.113 -38.493 45.666  1.00 49.22  ? 252 HIS A ND1 1 
ATOM   1819  C  CD2 . HIS A 1 252 ? -18.406 -39.488 47.120  1.00 41.55  ? 252 HIS A CD2 1 
ATOM   1820  C  CE1 . HIS A 1 252 ? -16.817 -38.003 46.857  1.00 47.91  ? 252 HIS A CE1 1 
ATOM   1821  N  NE2 . HIS A 1 252 ? -17.598 -38.587 47.755  1.00 39.76  ? 252 HIS A NE2 1 
ATOM   1822  N  N   . LEU A 1 253 ? -19.729 -37.856 42.952  1.00 36.29  ? 253 LEU A N   1 
ATOM   1823  C  CA  . LEU A 1 253 ? -19.779 -36.451 42.558  1.00 30.48  ? 253 LEU A CA  1 
ATOM   1824  C  C   . LEU A 1 253 ? -21.193 -35.920 42.684  1.00 31.06  ? 253 LEU A C   1 
ATOM   1825  O  O   . LEU A 1 253 ? -21.430 -34.932 43.368  1.00 45.59  ? 253 LEU A O   1 
ATOM   1826  C  CB  . LEU A 1 253 ? -19.275 -36.255 41.136  1.00 31.20  ? 253 LEU A CB  1 
ATOM   1827  C  CG  . LEU A 1 253 ? -19.461 -34.831 40.598  1.00 33.72  ? 253 LEU A CG  1 
ATOM   1828  C  CD1 . LEU A 1 253 ? -18.879 -33.832 41.543  1.00 36.20  ? 253 LEU A CD1 1 
ATOM   1829  C  CD2 . LEU A 1 253 ? -18.798 -34.694 39.245  1.00 36.28  ? 253 LEU A CD2 1 
ATOM   1830  N  N   . ILE A 1 254 ? -22.145 -36.611 42.070  1.00 36.12  ? 254 ILE A N   1 
ATOM   1831  C  CA  . ILE A 1 254 ? -23.526 -36.197 42.177  1.00 34.61  ? 254 ILE A CA  1 
ATOM   1832  C  C   . ILE A 1 254 ? -23.971 -36.018 43.627  1.00 38.90  ? 254 ILE A C   1 
ATOM   1833  O  O   . ILE A 1 254 ? -24.669 -35.066 43.959  1.00 46.46  ? 254 ILE A O   1 
ATOM   1834  C  CB  . ILE A 1 254 ? -24.453 -37.171 41.487  1.00 31.53  ? 254 ILE A CB  1 
ATOM   1835  C  CG1 . ILE A 1 254 ? -24.262 -37.108 39.968  1.00 38.94  ? 254 ILE A CG1 1 
ATOM   1836  C  CG2 . ILE A 1 254 ? -25.887 -36.825 41.833  1.00 20.58  ? 254 ILE A CG2 1 
ATOM   1837  C  CD1 . ILE A 1 254 ? -25.060 -38.176 39.238  1.00 39.65  ? 254 ILE A CD1 1 
ATOM   1838  N  N   . SER A 1 255 ? -23.554 -36.925 44.504  1.00 45.54  ? 255 SER A N   1 
ATOM   1839  C  CA  . SER A 1 255 ? -24.017 -36.860 45.887  1.00 36.66  ? 255 SER A CA  1 
ATOM   1840  C  C   . SER A 1 255 ? -23.392 -35.677 46.629  1.00 47.36  ? 255 SER A C   1 
ATOM   1841  O  O   . SER A 1 255 ? -23.949 -35.185 47.617  1.00 48.49  ? 255 SER A O   1 
ATOM   1842  C  CB  . SER A 1 255 ? -23.697 -38.155 46.624  1.00 43.23  ? 255 SER A CB  1 
ATOM   1843  O  OG  . SER A 1 255 ? -22.297 -38.243 46.876  1.00 50.43  ? 255 SER A OG  1 
ATOM   1844  N  N   . ARG A 1 256 ? -22.228 -35.237 46.150  1.00 45.15  ? 256 ARG A N   1 
ATOM   1845  C  CA  . ARG A 1 256 ? -21.519 -34.122 46.757  1.00 45.73  ? 256 ARG A CA  1 
ATOM   1846  C  C   . ARG A 1 256 ? -22.118 -32.807 46.275  1.00 55.25  ? 256 ARG A C   1 
ATOM   1847  O  O   . ARG A 1 256 ? -21.911 -31.770 46.890  1.00 55.03  ? 256 ARG A O   1 
ATOM   1848  C  CB  . ARG A 1 256 ? -20.041 -34.174 46.388  1.00 38.14  ? 256 ARG A CB  1 
ATOM   1849  C  CG  . ARG A 1 256 ? -19.274 -35.275 47.091  1.00 47.55  ? 256 ARG A CG  1 
ATOM   1850  C  CD  . ARG A 1 256 ? -19.000 -34.961 48.567  1.00 44.00  ? 256 ARG A CD  1 
ATOM   1851  N  NE  . ARG A 1 256 ? -18.023 -33.871 48.709  1.00 72.91  ? 256 ARG A NE  1 
ATOM   1852  C  CZ  . ARG A 1 256 ? -18.281 -32.677 49.268  1.00 74.14  ? 256 ARG A CZ  1 
ATOM   1853  N  NH1 . ARG A 1 256 ? -19.499 -32.408 49.768  1.00 54.78  ? 256 ARG A NH1 1 
ATOM   1854  N  NH2 . ARG A 1 256 ? -17.315 -31.750 49.349  1.00 72.01  ? 256 ARG A NH2 1 
ATOM   1855  N  N   . ILE A 1 257 ? -22.837 -32.849 45.155  1.00 41.10  ? 257 ILE A N   1 
ATOM   1856  C  CA  . ILE A 1 257 ? -23.433 -31.645 44.625  1.00 40.11  ? 257 ILE A CA  1 
ATOM   1857  C  C   . ILE A 1 257 ? -24.798 -31.441 45.247  1.00 47.31  ? 257 ILE A C   1 
ATOM   1858  O  O   . ILE A 1 257 ? -25.144 -30.335 45.653  1.00 45.22  ? 257 ILE A O   1 
ATOM   1859  C  CB  . ILE A 1 257 ? -23.552 -31.681 43.095  1.00 37.59  ? 257 ILE A CB  1 
ATOM   1860  C  CG1 . ILE A 1 257 ? -22.180 -31.536 42.457  1.00 36.98  ? 257 ILE A CG1 1 
ATOM   1861  C  CG2 . ILE A 1 257 ? -24.400 -30.538 42.626  1.00 30.99  ? 257 ILE A CG2 1 
ATOM   1862  C  CD1 . ILE A 1 257 ? -22.179 -31.822 40.998  1.00 30.28  ? 257 ILE A CD1 1 
ATOM   1863  N  N   . PHE A 1 258 ? -25.570 -32.512 45.329  1.00 44.25  ? 258 PHE A N   1 
ATOM   1864  C  CA  . PHE A 1 258 ? -26.914 -32.425 45.881  1.00 45.11  ? 258 PHE A CA  1 
ATOM   1865  C  C   . PHE A 1 258 ? -26.900 -32.489 47.400  1.00 49.96  ? 258 PHE A C   1 
ATOM   1866  O  O   . PHE A 1 258 ? -27.389 -33.437 48.009  1.00 46.59  ? 258 PHE A O   1 
ATOM   1867  C  CB  . PHE A 1 258 ? -27.817 -33.501 45.289  1.00 37.81  ? 258 PHE A CB  1 
ATOM   1868  C  CG  . PHE A 1 258 ? -28.159 -33.271 43.848  1.00 39.60  ? 258 PHE A CG  1 
ATOM   1869  C  CD1 . PHE A 1 258 ? -28.189 -31.985 43.335  1.00 36.17  ? 258 PHE A CD1 1 
ATOM   1870  C  CD2 . PHE A 1 258 ? -28.469 -34.332 43.011  1.00 36.20  ? 258 PHE A CD2 1 
ATOM   1871  C  CE1 . PHE A 1 258 ? -28.526 -31.745 42.003  1.00 39.10  ? 258 PHE A CE1 1 
ATOM   1872  C  CE2 . PHE A 1 258 ? -28.792 -34.121 41.689  1.00 39.29  ? 258 PHE A CE2 1 
ATOM   1873  C  CZ  . PHE A 1 258 ? -28.825 -32.815 41.174  1.00 45.10  ? 258 PHE A CZ  1 
ATOM   1874  N  N   . VAL A 1 259 ? -26.315 -31.461 47.993  1.00 44.01  ? 259 VAL A N   1 
ATOM   1875  C  CA  . VAL A 1 259 ? -26.318 -31.276 49.429  1.00 50.93  ? 259 VAL A CA  1 
ATOM   1876  C  C   . VAL A 1 259 ? -27.089 -29.999 49.730  1.00 49.76  ? 259 VAL A C   1 
ATOM   1877  O  O   . VAL A 1 259 ? -26.796 -28.923 49.180  1.00 45.97  ? 259 VAL A O   1 
ATOM   1878  C  CB  . VAL A 1 259 ? -24.880 -31.175 49.959  1.00 59.49  ? 259 VAL A CB  1 
ATOM   1879  C  CG1 . VAL A 1 259 ? -24.874 -30.867 51.447  1.00 62.27  ? 259 VAL A CG1 1 
ATOM   1880  C  CG2 . VAL A 1 259 ? -24.126 -32.478 49.647  1.00 55.52  ? 259 VAL A CG2 1 
ATOM   1881  N  N   . ALA A 1 260 ? -28.099 -30.154 50.579  1.00 47.83  ? 260 ALA A N   1 
ATOM   1882  C  CA  . ALA A 1 260 ? -29.038 -29.093 50.916  1.00 37.61  ? 260 ALA A CA  1 
ATOM   1883  C  C   . ALA A 1 260 ? -28.353 -27.877 51.531  1.00 46.35  ? 260 ALA A C   1 
ATOM   1884  O  O   . ALA A 1 260 ? -28.666 -26.738 51.167  1.00 57.06  ? 260 ALA A O   1 
ATOM   1885  C  CB  . ALA A 1 260 ? -30.098 -29.654 51.876  1.00 41.88  ? 260 ALA A CB  1 
ATOM   1886  N  N   . ASP A 1 261 ? -27.428 -28.130 52.464  1.00 47.15  ? 261 ASP A N   1 
ATOM   1887  C  CA  . ASP A 1 261 ? -26.654 -27.081 53.136  1.00 48.85  ? 261 ASP A CA  1 
ATOM   1888  C  C   . ASP A 1 261 ? -25.463 -26.619 52.305  1.00 49.92  ? 261 ASP A C   1 
ATOM   1889  O  O   . ASP A 1 261 ? -24.502 -27.370 52.118  1.00 64.79  ? 261 ASP A O   1 
ATOM   1890  C  CB  . ASP A 1 261 ? -26.170 -27.528 54.529  1.00 59.95  ? 261 ASP A CB  1 
ATOM   1891  C  CG  . ASP A 1 261 ? -25.109 -26.574 55.119  1.00 69.12  ? 261 ASP A CG  1 
ATOM   1892  O  OD1 . ASP A 1 261 ? -25.113 -25.377 54.764  1.00 59.74  ? 261 ASP A OD1 1 
ATOM   1893  O  OD2 . ASP A 1 261 ? -24.257 -27.012 55.924  1.00 81.85  ? 261 ASP A OD2 1 
ATOM   1894  N  N   . PRO A 1 262 ? -25.513 -25.364 51.841  1.00 39.68  ? 262 PRO A N   1 
ATOM   1895  C  CA  . PRO A 1 262 ? -24.575 -24.682 50.940  1.00 35.49  ? 262 PRO A CA  1 
ATOM   1896  C  C   . PRO A 1 262 ? -23.147 -24.695 51.439  1.00 38.98  ? 262 PRO A C   1 
ATOM   1897  O  O   . PRO A 1 262 ? -22.221 -24.846 50.630  1.00 51.38  ? 262 PRO A O   1 
ATOM   1898  C  CB  . PRO A 1 262 ? -25.066 -23.233 50.957  1.00 45.82  ? 262 PRO A CB  1 
ATOM   1899  C  CG  . PRO A 1 262 ? -26.505 -23.316 51.300  1.00 37.68  ? 262 PRO A CG  1 
ATOM   1900  C  CD  . PRO A 1 262 ? -26.644 -24.506 52.228  1.00 37.64  ? 262 PRO A CD  1 
ATOM   1901  N  N   . ALA A 1 263 ? -22.955 -24.510 52.745  1.00 52.92  ? 263 ALA A N   1 
ATOM   1902  C  CA  . ALA A 1 263 ? -21.605 -24.513 53.310  1.00 49.47  ? 263 ALA A CA  1 
ATOM   1903  C  C   . ALA A 1 263 ? -20.976 -25.873 53.034  1.00 50.80  ? 263 ALA A C   1 
ATOM   1904  O  O   . ALA A 1 263 ? -19.760 -26.001 52.980  1.00 49.50  ? 263 ALA A O   1 
ATOM   1905  C  CB  . ALA A 1 263 ? -21.623 -24.232 54.803  1.00 31.83  ? 263 ALA A CB  1 
ATOM   1906  N  N   . LYS A 1 264 ? -21.809 -26.883 52.831  1.00 47.84  ? 264 LYS A N   1 
ATOM   1907  C  CA  . LYS A 1 264 ? -21.281 -28.232 52.669  1.00 53.75  ? 264 LYS A CA  1 
ATOM   1908  C  C   . LYS A 1 264 ? -21.250 -28.743 51.247  1.00 44.49  ? 264 LYS A C   1 
ATOM   1909  O  O   . LYS A 1 264 ? -20.603 -29.719 50.965  1.00 48.39  ? 264 LYS A O   1 
ATOM   1910  C  CB  . LYS A 1 264 ? -21.996 -29.199 53.603  1.00 53.17  ? 264 LYS A CB  1 
ATOM   1911  C  CG  . LYS A 1 264 ? -21.818 -28.788 55.050  1.00 65.51  ? 264 LYS A CG  1 
ATOM   1912  C  CD  . LYS A 1 264 ? -22.521 -29.710 56.008  1.00 86.18  ? 264 LYS A CD  1 
ATOM   1913  C  CE  . LYS A 1 264 ? -22.299 -29.276 57.450  1.00 103.27 ? 264 LYS A CE  1 
ATOM   1914  N  NZ  . LYS A 1 264 ? -22.494 -30.407 58.407  1.00 113.82 ? 264 LYS A NZ  1 
ATOM   1915  N  N   . ARG A 1 265 ? -21.917 -28.046 50.350  1.00 37.70  ? 265 ARG A N   1 
ATOM   1916  C  CA  . ARG A 1 265 ? -21.895 -28.412 48.949  1.00 44.69  ? 265 ARG A CA  1 
ATOM   1917  C  C   . ARG A 1 265 ? -20.480 -28.333 48.382  1.00 46.69  ? 265 ARG A C   1 
ATOM   1918  O  O   . ARG A 1 265 ? -19.735 -27.411 48.682  1.00 51.55  ? 265 ARG A O   1 
ATOM   1919  C  CB  . ARG A 1 265 ? -22.828 -27.485 48.150  1.00 37.72  ? 265 ARG A CB  1 
ATOM   1920  C  CG  . ARG A 1 265 ? -23.068 -27.923 46.709  1.00 38.17  ? 265 ARG A CG  1 
ATOM   1921  C  CD  . ARG A 1 265 ? -24.287 -27.244 46.123  1.00 39.11  ? 265 ARG A CD  1 
ATOM   1922  N  NE  . ARG A 1 265 ? -25.376 -27.314 47.087  1.00 44.57  ? 265 ARG A NE  1 
ATOM   1923  C  CZ  . ARG A 1 265 ? -26.248 -26.339 47.264  1.00 43.25  ? 265 ARG A CZ  1 
ATOM   1924  N  NH1 . ARG A 1 265 ? -26.135 -25.259 46.531  1.00 35.99  ? 265 ARG A NH1 1 
ATOM   1925  N  NH2 . ARG A 1 265 ? -27.214 -26.437 48.169  1.00 44.22  ? 265 ARG A NH2 1 
ATOM   1926  N  N   . ILE A 1 266 ? -20.107 -29.295 47.549  1.00 41.96  ? 266 ILE A N   1 
ATOM   1927  C  CA  . ILE A 1 266 ? -18.820 -29.242 46.867  1.00 35.22  ? 266 ILE A CA  1 
ATOM   1928  C  C   . ILE A 1 266 ? -18.726 -27.951 46.048  1.00 40.49  ? 266 ILE A C   1 
ATOM   1929  O  O   . ILE A 1 266 ? -19.734 -27.400 45.636  1.00 43.91  ? 266 ILE A O   1 
ATOM   1930  C  CB  . ILE A 1 266 ? -18.614 -30.504 45.982  1.00 31.86  ? 266 ILE A CB  1 
ATOM   1931  C  CG1 . ILE A 1 266 ? -17.150 -30.684 45.605  1.00 41.76  ? 266 ILE A CG1 1 
ATOM   1932  C  CG2 . ILE A 1 266 ? -19.467 -30.440 44.722  1.00 45.21  ? 266 ILE A CG2 1 
ATOM   1933  C  CD1 . ILE A 1 266 ? -16.879 -31.877 44.750  1.00 38.03  ? 266 ILE A CD1 1 
ATOM   1934  N  N   . SER A 1 267 ? -17.508 -27.477 45.824  1.00 45.51  ? 267 SER A N   1 
ATOM   1935  C  CA  . SER A 1 267 ? -17.272 -26.206 45.154  1.00 49.28  ? 267 SER A CA  1 
ATOM   1936  C  C   . SER A 1 267 ? -16.605 -26.438 43.808  1.00 48.97  ? 267 SER A C   1 
ATOM   1937  O  O   . SER A 1 267 ? -16.000 -27.485 43.591  1.00 54.04  ? 267 SER A O   1 
ATOM   1938  C  CB  . SER A 1 267 ? -16.317 -25.360 45.991  1.00 57.25  ? 267 SER A CB  1 
ATOM   1939  O  OG  . SER A 1 267 ? -14.987 -25.891 45.903  1.00 56.86  ? 267 SER A OG  1 
ATOM   1940  N  N   . ILE A 1 268 ? -16.662 -25.439 42.930  1.00 47.17  ? 268 ILE A N   1 
ATOM   1941  C  CA  . ILE A 1 268 ? -16.094 -25.562 41.585  1.00 43.60  ? 268 ILE A CA  1 
ATOM   1942  C  C   . ILE A 1 268 ? -14.635 -26.024 41.610  1.00 53.12  ? 268 ILE A C   1 
ATOM   1943  O  O   . ILE A 1 268 ? -14.238 -26.909 40.850  1.00 50.45  ? 268 ILE A O   1 
ATOM   1944  C  CB  . ILE A 1 268 ? -16.195 -24.261 40.784  1.00 33.27  ? 268 ILE A CB  1 
ATOM   1945  C  CG1 . ILE A 1 268 ? -17.649 -23.814 40.628  1.00 40.35  ? 268 ILE A CG1 1 
ATOM   1946  C  CG2 . ILE A 1 268 ? -15.569 -24.426 39.434  1.00 30.71  ? 268 ILE A CG2 1 
ATOM   1947  C  CD1 . ILE A 1 268 ? -18.405 -24.539 39.538  1.00 54.12  ? 268 ILE A CD1 1 
ATOM   1948  N  N   . PRO A 1 269 ? -13.820 -25.429 42.482  1.00 58.29  ? 269 PRO A N   1 
ATOM   1949  C  CA  . PRO A 1 269 ? -12.434 -25.904 42.520  1.00 54.29  ? 269 PRO A CA  1 
ATOM   1950  C  C   . PRO A 1 269 ? -12.348 -27.379 42.901  1.00 53.28  ? 269 PRO A C   1 
ATOM   1951  O  O   . PRO A 1 269 ? -11.587 -28.109 42.279  1.00 62.00  ? 269 PRO A O   1 
ATOM   1952  C  CB  . PRO A 1 269 ? -11.800 -25.032 43.592  1.00 52.31  ? 269 PRO A CB  1 
ATOM   1953  C  CG  . PRO A 1 269 ? -12.593 -23.769 43.545  1.00 52.38  ? 269 PRO A CG  1 
ATOM   1954  C  CD  . PRO A 1 269 ? -14.017 -24.212 43.283  1.00 53.93  ? 269 PRO A CD  1 
ATOM   1955  N  N   . GLU A 1 270 ? -13.121 -27.826 43.884  1.00 46.60  ? 270 GLU A N   1 
ATOM   1956  C  CA  . GLU A 1 270 ? -13.111 -29.240 44.262  1.00 49.48  ? 270 GLU A CA  1 
ATOM   1957  C  C   . GLU A 1 270 ? -13.622 -30.154 43.130  1.00 50.46  ? 270 GLU A C   1 
ATOM   1958  O  O   . GLU A 1 270 ? -13.106 -31.253 42.925  1.00 52.61  ? 270 GLU A O   1 
ATOM   1959  C  CB  . GLU A 1 270 ? -13.916 -29.453 45.545  1.00 44.55  ? 270 GLU A CB  1 
ATOM   1960  C  CG  . GLU A 1 270 ? -13.441 -28.573 46.713  1.00 58.98  ? 270 GLU A CG  1 
ATOM   1961  C  CD  . GLU A 1 270 ? -14.380 -28.625 47.928  1.00 75.67  ? 270 GLU A CD  1 
ATOM   1962  O  OE1 . GLU A 1 270 ? -15.562 -28.240 47.812  1.00 81.78  ? 270 GLU A OE1 1 
ATOM   1963  O  OE2 . GLU A 1 270 ? -13.941 -29.057 49.012  1.00 83.30  ? 270 GLU A OE2 1 
ATOM   1964  N  N   . ILE A 1 271 ? -14.626 -29.694 42.398  1.00 44.41  ? 271 ILE A N   1 
ATOM   1965  C  CA  . ILE A 1 271 ? -15.178 -30.465 41.292  1.00 39.51  ? 271 ILE A CA  1 
ATOM   1966  C  C   . ILE A 1 271 ? -14.124 -30.667 40.232  1.00 45.39  ? 271 ILE A C   1 
ATOM   1967  O  O   . ILE A 1 271 ? -14.064 -31.717 39.603  1.00 57.32  ? 271 ILE A O   1 
ATOM   1968  C  CB  . ILE A 1 271 ? -16.400 -29.766 40.637  1.00 35.90  ? 271 ILE A CB  1 
ATOM   1969  C  CG1 . ILE A 1 271 ? -17.595 -29.736 41.593  1.00 39.32  ? 271 ILE A CG1 1 
ATOM   1970  C  CG2 . ILE A 1 271 ? -16.800 -30.492 39.376  1.00 28.91  ? 271 ILE A CG2 1 
ATOM   1971  C  CD1 . ILE A 1 271 ? -18.785 -28.901 41.107  1.00 38.36  ? 271 ILE A CD1 1 
ATOM   1972  N  N   . ARG A 1 272 ? -13.294 -29.655 40.018  1.00 45.37  ? 272 ARG A N   1 
ATOM   1973  C  CA  . ARG A 1 272 ? -12.263 -29.734 38.979  1.00 44.70  ? 272 ARG A CA  1 
ATOM   1974  C  C   . ARG A 1 272 ? -11.185 -30.721 39.407  1.00 52.25  ? 272 ARG A C   1 
ATOM   1975  O  O   . ARG A 1 272 ? -10.292 -31.073 38.625  1.00 54.52  ? 272 ARG A O   1 
ATOM   1976  C  CB  . ARG A 1 272 ? -11.598 -28.377 38.753  1.00 46.90  ? 272 ARG A CB  1 
ATOM   1977  C  CG  . ARG A 1 272 ? -12.551 -27.203 38.541  1.00 61.82  ? 272 ARG A CG  1 
ATOM   1978  C  CD  . ARG A 1 272 ? -11.763 -25.938 38.278  1.00 79.05  ? 272 ARG A CD  1 
ATOM   1979  N  NE  . ARG A 1 272 ? -11.083 -26.030 36.995  1.00 95.38  ? 272 ARG A NE  1 
ATOM   1980  C  CZ  . ARG A 1 272 ? -11.398 -25.291 35.939  1.00 110.82 ? 272 ARG A CZ  1 
ATOM   1981  N  NH1 . ARG A 1 272 ? -12.369 -24.388 36.036  1.00 117.84 ? 272 ARG A NH1 1 
ATOM   1982  N  NH2 . ARG A 1 272 ? -10.739 -25.447 34.796  1.00 113.99 ? 272 ARG A NH2 1 
ATOM   1983  N  N   . ASN A 1 273 ? -11.244 -31.130 40.667  1.00 42.27  ? 273 ASN A N   1 
ATOM   1984  C  CA  . ASN A 1 273 ? -10.241 -32.025 41.218  1.00 60.55  ? 273 ASN A CA  1 
ATOM   1985  C  C   . ASN A 1 273 ? -10.830 -33.392 41.510  1.00 54.75  ? 273 ASN A C   1 
ATOM   1986  O  O   . ASN A 1 273 ? -10.177 -34.236 42.121  1.00 50.50  ? 273 ASN A O   1 
ATOM   1987  C  CB  . ASN A 1 273 ? -9.639  -31.433 42.494  1.00 73.32  ? 273 ASN A CB  1 
ATOM   1988  C  CG  . ASN A 1 273 ? -8.449  -30.539 42.216  1.00 80.72  ? 273 ASN A CG  1 
ATOM   1989  O  OD1 . ASN A 1 273 ? -7.589  -30.867 41.399  1.00 92.44  ? 273 ASN A OD1 1 
ATOM   1990  N  ND2 . ASN A 1 273 ? -8.391  -29.401 42.895  1.00 69.39  ? 273 ASN A ND2 1 
ATOM   1991  N  N   . HIS A 1 274 ? -12.067 -33.611 41.078  1.00 42.82  ? 274 HIS A N   1 
ATOM   1992  C  CA  . HIS A 1 274 ? -12.710 -34.877 41.358  1.00 45.50  ? 274 HIS A CA  1 
ATOM   1993  C  C   . HIS A 1 274 ? -12.322 -35.947 40.320  1.00 50.72  ? 274 HIS A C   1 
ATOM   1994  O  O   . HIS A 1 274 ? -12.219 -35.673 39.112  1.00 50.84  ? 274 HIS A O   1 
ATOM   1995  C  CB  . HIS A 1 274 ? -14.202 -34.685 41.414  1.00 41.73  ? 274 HIS A CB  1 
ATOM   1996  C  CG  . HIS A 1 274 ? -14.942 -35.861 41.953  1.00 51.61  ? 274 HIS A CG  1 
ATOM   1997  N  ND1 . HIS A 1 274 ? -15.072 -37.051 41.261  1.00 43.49  ? 274 HIS A ND1 1 
ATOM   1998  C  CD2 . HIS A 1 274 ? -15.615 -36.023 43.118  1.00 41.32  ? 274 HIS A CD2 1 
ATOM   1999  C  CE1 . HIS A 1 274 ? -15.786 -37.895 41.987  1.00 49.71  ? 274 HIS A CE1 1 
ATOM   2000  N  NE2 . HIS A 1 274 ? -16.132 -37.292 43.115  1.00 50.19  ? 274 HIS A NE2 1 
ATOM   2001  N  N   . GLU A 1 275 ? -12.072 -37.157 40.810  1.00 52.78  ? 275 GLU A N   1 
ATOM   2002  C  CA  . GLU A 1 275 ? -11.685 -38.272 39.946  1.00 66.39  ? 275 GLU A CA  1 
ATOM   2003  C  C   . GLU A 1 275 ? -12.517 -38.344 38.670  1.00 60.85  ? 275 GLU A C   1 
ATOM   2004  O  O   . GLU A 1 275 ? -11.980 -38.568 37.585  1.00 52.98  ? 275 GLU A O   1 
ATOM   2005  C  CB  . GLU A 1 275 ? -11.822 -39.599 40.687  1.00 75.81  ? 275 GLU A CB  1 
ATOM   2006  C  CG  . GLU A 1 275 ? -10.504 -40.165 41.167  1.00 99.86  ? 275 GLU A CG  1 
ATOM   2007  C  CD  . GLU A 1 275 ? -10.663 -41.551 41.761  1.00 117.79 ? 275 GLU A CD  1 
ATOM   2008  O  OE1 . GLU A 1 275 ? -9.644  -42.129 42.204  1.00 128.69 ? 275 GLU A OE1 1 
ATOM   2009  O  OE2 . GLU A 1 275 ? -11.814 -42.050 41.784  1.00 114.97 ? 275 GLU A OE2 1 
ATOM   2010  N  N   . TRP A 1 276 ? -13.827 -38.153 38.809  1.00 52.11  ? 276 TRP A N   1 
ATOM   2011  C  CA  . TRP A 1 276 ? -14.738 -38.319 37.680  1.00 46.73  ? 276 TRP A CA  1 
ATOM   2012  C  C   . TRP A 1 276 ? -14.538 -37.225 36.652  1.00 58.14  ? 276 TRP A C   1 
ATOM   2013  O  O   . TRP A 1 276 ? -14.707 -37.444 35.446  1.00 62.97  ? 276 TRP A O   1 
ATOM   2014  C  CB  . TRP A 1 276 ? -16.202 -38.320 38.129  1.00 35.91  ? 276 TRP A CB  1 
ATOM   2015  C  CG  . TRP A 1 276 ? -17.127 -38.718 37.027  1.00 44.93  ? 276 TRP A CG  1 
ATOM   2016  C  CD1 . TRP A 1 276 ? -17.412 -39.988 36.611  1.00 56.06  ? 276 TRP A CD1 1 
ATOM   2017  C  CD2 . TRP A 1 276 ? -17.875 -37.857 36.187  1.00 45.41  ? 276 TRP A CD2 1 
ATOM   2018  N  NE1 . TRP A 1 276 ? -18.291 -39.967 35.570  1.00 50.60  ? 276 TRP A NE1 1 
ATOM   2019  C  CE2 . TRP A 1 276 ? -18.605 -38.647 35.281  1.00 40.03  ? 276 TRP A CE2 1 
ATOM   2020  C  CE3 . TRP A 1 276 ? -18.025 -36.456 36.104  1.00 43.24  ? 276 TRP A CE3 1 
ATOM   2021  C  CZ2 . TRP A 1 276 ? -19.454 -38.133 34.308  1.00 40.29  ? 276 TRP A CZ2 1 
ATOM   2022  C  CZ3 . TRP A 1 276 ? -18.862 -35.933 35.140  1.00 28.90  ? 276 TRP A CZ3 1 
ATOM   2023  C  CH2 . TRP A 1 276 ? -19.577 -36.772 34.259  1.00 37.25  ? 276 TRP A CH2 1 
ATOM   2024  N  N   . PHE A 1 277 ? -14.188 -36.043 37.146  1.00 50.75  ? 277 PHE A N   1 
ATOM   2025  C  CA  . PHE A 1 277 ? -14.065 -34.889 36.301  1.00 39.13  ? 277 PHE A CA  1 
ATOM   2026  C  C   . PHE A 1 277 ? -12.743 -34.968 35.549  1.00 42.04  ? 277 PHE A C   1 
ATOM   2027  O  O   . PHE A 1 277 ? -12.619 -34.451 34.438  1.00 42.55  ? 277 PHE A O   1 
ATOM   2028  C  CB  . PHE A 1 277 ? -14.149 -33.610 37.149  1.00 42.17  ? 277 PHE A CB  1 
ATOM   2029  C  CG  . PHE A 1 277 ? -14.099 -32.348 36.344  1.00 40.08  ? 277 PHE A CG  1 
ATOM   2030  C  CD1 . PHE A 1 277 ? -15.269 -31.707 35.976  1.00 43.09  ? 277 PHE A CD1 1 
ATOM   2031  C  CD2 . PHE A 1 277 ? -12.899 -31.822 35.933  1.00 36.23  ? 277 PHE A CD2 1 
ATOM   2032  C  CE1 . PHE A 1 277 ? -15.235 -30.572 35.232  1.00 27.43  ? 277 PHE A CE1 1 
ATOM   2033  C  CE2 . PHE A 1 277 ? -12.871 -30.669 35.181  1.00 43.20  ? 277 PHE A CE2 1 
ATOM   2034  C  CZ  . PHE A 1 277 ? -14.038 -30.050 34.837  1.00 29.78  ? 277 PHE A CZ  1 
ATOM   2035  N  N   . LEU A 1 278 ? -11.750 -35.616 36.149  1.00 35.98  ? 278 LEU A N   1 
ATOM   2036  C  CA  . LEU A 1 278 ? -10.396 -35.598 35.586  1.00 44.86  ? 278 LEU A CA  1 
ATOM   2037  C  C   . LEU A 1 278 ? -10.216 -36.567 34.423  1.00 46.44  ? 278 LEU A C   1 
ATOM   2038  O  O   . LEU A 1 278 ? -9.435  -36.320 33.502  1.00 37.81  ? 278 LEU A O   1 
ATOM   2039  C  CB  . LEU A 1 278 ? -9.366  -35.849 36.683  1.00 46.91  ? 278 LEU A CB  1 
ATOM   2040  C  CG  . LEU A 1 278 ? -9.205  -34.717 37.721  1.00 45.70  ? 278 LEU A CG  1 
ATOM   2041  C  CD1 . LEU A 1 278 ? -8.565  -35.166 39.025  1.00 41.92  ? 278 LEU A CD1 1 
ATOM   2042  C  CD2 . LEU A 1 278 ? -8.415  -33.588 37.129  1.00 38.31  ? 278 LEU A CD2 1 
ATOM   2043  N  N   . LYS A 1 279 ? -10.961 -37.666 34.475  1.00 47.61  ? 279 LYS A N   1 
ATOM   2044  C  CA  . LYS A 1 279 ? -10.914 -38.687 33.438  1.00 48.45  ? 279 LYS A CA  1 
ATOM   2045  C  C   . LYS A 1 279 ? -11.221 -38.108 32.063  1.00 48.62  ? 279 LYS A C   1 
ATOM   2046  O  O   . LYS A 1 279 ? -12.329 -37.641 31.804  1.00 51.17  ? 279 LYS A O   1 
ATOM   2047  C  CB  . LYS A 1 279 ? -11.893 -39.818 33.760  1.00 61.02  ? 279 LYS A CB  1 
ATOM   2048  C  CG  . LYS A 1 279 ? -11.572 -41.133 33.070  1.00 64.08  ? 279 LYS A CG  1 
ATOM   2049  C  CD  . LYS A 1 279 ? -12.816 -41.753 32.459  1.00 78.61  ? 279 LYS A CD  1 
ATOM   2050  C  CE  . LYS A 1 279 ? -12.879 -43.247 32.732  1.00 79.48  ? 279 LYS A CE  1 
ATOM   2051  N  NZ  . LYS A 1 279 ? -14.091 -43.619 33.512  1.00 81.28  ? 279 LYS A NZ  1 
ATOM   2052  N  N   . ASN A 1 280 ? -10.226 -38.128 31.181  1.00 53.27  ? 280 ASN A N   1 
ATOM   2053  C  CA  . ASN A 1 280 ? -10.411 -37.674 29.804  1.00 55.26  ? 280 ASN A CA  1 
ATOM   2054  C  C   . ASN A 1 280 ? -10.483 -36.156 29.629  1.00 59.64  ? 280 ASN A C   1 
ATOM   2055  O  O   . ASN A 1 280 ? -10.926 -35.668 28.590  1.00 63.22  ? 280 ASN A O   1 
ATOM   2056  C  CB  . ASN A 1 280 ? -11.656 -38.324 29.193  1.00 62.49  ? 280 ASN A CB  1 
ATOM   2057  C  CG  . ASN A 1 280 ? -11.451 -39.792 28.873  1.00 69.60  ? 280 ASN A CG  1 
ATOM   2058  O  OD1 . ASN A 1 280 ? -10.320 -40.254 28.725  1.00 69.42  ? 280 ASN A OD1 1 
ATOM   2059  N  ND2 . ASN A 1 280 ? -12.547 -40.532 28.765  1.00 77.69  ? 280 ASN A ND2 1 
ATOM   2060  N  N   . LEU A 1 281 ? -10.046 -35.424 30.648  1.00 55.58  ? 281 LEU A N   1 
ATOM   2061  C  CA  . LEU A 1 281 ? -10.062 -33.967 30.609  1.00 51.86  ? 281 LEU A CA  1 
ATOM   2062  C  C   . LEU A 1 281 ? -9.127  -33.433 29.531  1.00 63.82  ? 281 LEU A C   1 
ATOM   2063  O  O   . LEU A 1 281 ? -7.909  -33.578 29.627  1.00 76.59  ? 281 LEU A O   1 
ATOM   2064  C  CB  . LEU A 1 281 ? -9.672  -33.393 31.973  1.00 49.79  ? 281 LEU A CB  1 
ATOM   2065  C  CG  . LEU A 1 281 ? -10.207 -31.998 32.303  1.00 52.54  ? 281 LEU A CG  1 
ATOM   2066  C  CD1 . LEU A 1 281 ? -10.150 -31.746 33.801  1.00 57.78  ? 281 LEU A CD1 1 
ATOM   2067  C  CD2 . LEU A 1 281 ? -9.428  -30.934 31.547  1.00 61.16  ? 281 LEU A CD2 1 
ATOM   2068  N  N   . PRO A 1 282 ? -9.704  -32.817 28.507  1.00 66.66  ? 282 PRO A N   1 
ATOM   2069  C  CA  . PRO A 1 282 ? -8.915  -32.254 27.405  1.00 67.52  ? 282 PRO A CA  1 
ATOM   2070  C  C   . PRO A 1 282 ? -7.987  -31.111 27.796  1.00 81.28  ? 282 PRO A C   1 
ATOM   2071  O  O   . PRO A 1 282 ? -8.232  -30.431 28.791  1.00 91.57  ? 282 PRO A O   1 
ATOM   2072  C  CB  . PRO A 1 282 ? -9.946  -31.437 26.625  1.00 62.78  ? 282 PRO A CB  1 
ATOM   2073  C  CG  . PRO A 1 282 ? -11.239 -32.117 26.898  1.00 67.94  ? 282 PRO A CG  1 
ATOM   2074  C  CD  . PRO A 1 282 ? -11.149 -32.613 28.312  1.00 66.70  ? 282 PRO A CD  1 
ATOM   2075  N  N   . ALA A 1 283 ? -6.931  -30.906 27.014  1.00 85.51  ? 283 ALA A N   1 
ATOM   2076  C  CA  . ALA A 1 283 ? -5.823  -30.035 27.384  1.00 82.87  ? 283 ALA A CA  1 
ATOM   2077  C  C   . ALA A 1 283 ? -6.265  -28.578 27.457  1.00 86.14  ? 283 ALA A C   1 
ATOM   2078  O  O   . ALA A 1 283 ? -5.733  -27.795 28.245  1.00 72.94  ? 283 ALA A O   1 
ATOM   2079  C  CB  . ALA A 1 283 ? -4.674  -30.193 26.400  1.00 76.91  ? 283 ALA A CB  1 
ATOM   2080  N  N   . ASP A 1 284 ? -7.242  -28.219 26.630  1.00 95.20  ? 284 ASP A N   1 
ATOM   2081  C  CA  . ASP A 1 284 ? -7.747  -26.852 26.587  1.00 97.18  ? 284 ASP A CA  1 
ATOM   2082  C  C   . ASP A 1 284 ? -8.382  -26.444 27.912  1.00 87.57  ? 284 ASP A C   1 
ATOM   2083  O  O   . ASP A 1 284 ? -8.133  -25.350 28.417  1.00 77.34  ? 284 ASP A O   1 
ATOM   2084  C  CB  . ASP A 1 284 ? -8.758  -26.690 25.449  1.00 104.52 ? 284 ASP A CB  1 
ATOM   2085  C  CG  . ASP A 1 284 ? -8.849  -27.921 24.571  1.00 104.56 ? 284 ASP A CG  1 
ATOM   2086  O  OD1 . ASP A 1 284 ? -7.838  -28.644 24.450  1.00 108.07 ? 284 ASP A OD1 1 
ATOM   2087  O  OD2 . ASP A 1 284 ? -9.932  -28.166 24.001  1.00 92.17  ? 284 ASP A OD2 1 
ATOM   2088  N  N   . LEU A 1 285 ? -9.204  -27.327 28.470  1.00 90.60  ? 285 LEU A N   1 
ATOM   2089  C  CA  . LEU A 1 285 ? -9.884  -27.042 29.728  1.00 91.14  ? 285 LEU A CA  1 
ATOM   2090  C  C   . LEU A 1 285 ? -8.948  -27.227 30.917  1.00 100.07 ? 285 LEU A C   1 
ATOM   2091  O  O   . LEU A 1 285 ? -9.368  -27.134 32.070  1.00 98.72  ? 285 LEU A O   1 
ATOM   2092  C  CB  . LEU A 1 285 ? -11.115 -27.936 29.885  1.00 79.98  ? 285 LEU A CB  1 
ATOM   2093  C  CG  . LEU A 1 285 ? -11.974 -28.132 28.633  1.00 69.89  ? 285 LEU A CG  1 
ATOM   2094  C  CD1 . LEU A 1 285 ? -13.034 -29.196 28.868  1.00 64.53  ? 285 LEU A CD1 1 
ATOM   2095  C  CD2 . LEU A 1 285 ? -12.611 -26.820 28.208  1.00 65.68  ? 285 LEU A CD2 1 
ATOM   2096  N  N   . GLY A 1 302 ? -10.674 -7.884  18.805  1.00 52.19  ? 302 GLY A N   1 
ATOM   2097  C  CA  . GLY A 1 302 ? -12.002 -7.412  19.150  1.00 57.72  ? 302 GLY A CA  1 
ATOM   2098  C  C   . GLY A 1 302 ? -12.150 -5.914  18.971  1.00 60.91  ? 302 GLY A C   1 
ATOM   2099  O  O   . GLY A 1 302 ? -11.227 -5.239  18.515  1.00 63.79  ? 302 GLY A O   1 
ATOM   2100  N  N   . GLN A 1 303 ? -13.318 -5.394  19.332  1.00 45.36  ? 303 GLN A N   1 
ATOM   2101  C  CA  . GLN A 1 303 ? -13.588 -3.966  19.215  1.00 51.58  ? 303 GLN A CA  1 
ATOM   2102  C  C   . GLN A 1 303 ? -12.990 -3.194  20.385  1.00 52.32  ? 303 GLN A C   1 
ATOM   2103  O  O   . GLN A 1 303 ? -13.027 -3.650  21.527  1.00 44.44  ? 303 GLN A O   1 
ATOM   2104  C  CB  . GLN A 1 303 ? -15.094 -3.712  19.133  1.00 38.21  ? 303 GLN A CB  1 
ATOM   2105  C  CG  . GLN A 1 303 ? -15.524 -2.928  17.905  1.00 36.23  ? 303 GLN A CG  1 
ATOM   2106  C  CD  . GLN A 1 303 ? -16.969 -2.477  17.980  1.00 46.11  ? 303 GLN A CD  1 
ATOM   2107  O  OE1 . GLN A 1 303 ? -17.389 -1.579  17.251  1.00 54.34  ? 303 GLN A OE1 1 
ATOM   2108  N  NE2 . GLN A 1 303 ? -17.738 -3.100  18.864  1.00 48.12  ? 303 GLN A NE2 1 
ATOM   2109  N  N   . SER A 1 304 ? -12.438 -2.020  20.093  1.00 48.93  ? 304 SER A N   1 
ATOM   2110  C  CA  . SER A 1 304 ? -11.830 -1.181  21.120  1.00 62.09  ? 304 SER A CA  1 
ATOM   2111  C  C   . SER A 1 304 ? -12.877 -0.662  22.101  1.00 52.36  ? 304 SER A C   1 
ATOM   2112  O  O   . SER A 1 304 ? -13.992 -0.323  21.710  1.00 59.33  ? 304 SER A O   1 
ATOM   2113  C  CB  . SER A 1 304 ? -11.084 -0.009  20.481  1.00 62.64  ? 304 SER A CB  1 
ATOM   2114  O  OG  . SER A 1 304 ? -11.634 0.315   19.217  1.00 66.63  ? 304 SER A OG  1 
ATOM   2115  N  N   . ILE A 1 305 ? -12.509 -0.605  23.375  1.00 40.42  ? 305 ILE A N   1 
ATOM   2116  C  CA  . ILE A 1 305 ? -13.415 -0.126  24.411  1.00 41.62  ? 305 ILE A CA  1 
ATOM   2117  C  C   . ILE A 1 305 ? -13.976 1.246   24.053  1.00 50.96  ? 305 ILE A C   1 
ATOM   2118  O  O   . ILE A 1 305 ? -15.135 1.547   24.337  1.00 57.92  ? 305 ILE A O   1 
ATOM   2119  C  CB  . ILE A 1 305 ? -12.715 -0.047  25.780  1.00 52.19  ? 305 ILE A CB  1 
ATOM   2120  C  CG1 . ILE A 1 305 ? -13.662 -0.505  26.890  1.00 56.63  ? 305 ILE A CG1 1 
ATOM   2121  C  CG2 . ILE A 1 305 ? -12.218 1.366   26.044  1.00 65.45  ? 305 ILE A CG2 1 
ATOM   2122  C  CD1 . ILE A 1 305 ? -14.636 0.561   27.335  1.00 50.36  ? 305 ILE A CD1 1 
ATOM   2123  N  N   . GLU A 1 306 ? -13.145 2.075   23.430  1.00 40.53  ? 306 GLU A N   1 
ATOM   2124  C  CA  . GLU A 1 306 ? -13.553 3.416   23.030  1.00 51.12  ? 306 GLU A CA  1 
ATOM   2125  C  C   . GLU A 1 306 ? -14.529 3.375   21.858  1.00 57.63  ? 306 GLU A C   1 
ATOM   2126  O  O   . GLU A 1 306 ? -15.638 3.901   21.944  1.00 62.30  ? 306 GLU A O   1 
ATOM   2127  C  CB  . GLU A 1 306 ? -12.330 4.261   22.665  1.00 35.71  ? 306 GLU A CB  1 
ATOM   2128  C  CG  . GLU A 1 306 ? -11.137 3.449   22.188  1.00 64.80  ? 306 GLU A CG  1 
ATOM   2129  C  CD  . GLU A 1 306 ? -10.213 3.050   23.320  1.00 77.31  ? 306 GLU A CD  1 
ATOM   2130  O  OE1 . GLU A 1 306 ? -10.010 3.869   24.241  1.00 89.71  ? 306 GLU A OE1 1 
ATOM   2131  O  OE2 . GLU A 1 306 ? -9.688  1.917   23.290  1.00 64.70  ? 306 GLU A OE2 1 
ATOM   2132  N  N   . GLU A 1 307 ? -14.109 2.750   20.764  1.00 52.91  ? 307 GLU A N   1 
ATOM   2133  C  CA  . GLU A 1 307 ? -14.953 2.619   19.584  1.00 40.03  ? 307 GLU A CA  1 
ATOM   2134  C  C   . GLU A 1 307 ? -16.361 2.203   19.989  1.00 41.08  ? 307 GLU A C   1 
ATOM   2135  O  O   . GLU A 1 307 ? -17.347 2.694   19.442  1.00 48.29  ? 307 GLU A O   1 
ATOM   2136  C  CB  . GLU A 1 307 ? -14.361 1.601   18.609  1.00 51.91  ? 307 GLU A CB  1 
ATOM   2137  C  CG  . GLU A 1 307 ? -15.350 1.083   17.579  1.00 68.28  ? 307 GLU A CG  1 
ATOM   2138  C  CD  . GLU A 1 307 ? -14.683 0.687   16.277  1.00 82.85  ? 307 GLU A CD  1 
ATOM   2139  O  OE1 . GLU A 1 307 ? -13.439 0.581   16.254  1.00 82.31  ? 307 GLU A OE1 1 
ATOM   2140  O  OE2 . GLU A 1 307 ? -15.403 0.481   15.278  1.00 82.18  ? 307 GLU A OE2 1 
ATOM   2141  N  N   . ILE A 1 308 ? -16.447 1.295   20.955  1.00 26.18  ? 308 ILE A N   1 
ATOM   2142  C  CA  . ILE A 1 308 ? -17.732 0.821   21.452  1.00 34.97  ? 308 ILE A CA  1 
ATOM   2143  C  C   . ILE A 1 308 ? -18.469 1.931   22.191  1.00 28.11  ? 308 ILE A C   1 
ATOM   2144  O  O   . ILE A 1 308 ? -19.650 2.175   21.946  1.00 35.04  ? 308 ILE A O   1 
ATOM   2145  C  CB  . ILE A 1 308 ? -17.562 -0.380  22.400  1.00 37.26  ? 308 ILE A CB  1 
ATOM   2146  C  CG1 . ILE A 1 308 ? -17.297 -1.658  21.602  1.00 38.71  ? 308 ILE A CG1 1 
ATOM   2147  C  CG2 . ILE A 1 308 ? -18.791 -0.541  23.280  1.00 32.37  ? 308 ILE A CG2 1 
ATOM   2148  C  CD1 . ILE A 1 308 ? -16.764 -2.799  22.440  1.00 34.44  ? 308 ILE A CD1 1 
ATOM   2149  N  N   . MET A 1 309 ? -17.763 2.600   23.095  1.00 41.09  ? 309 MET A N   1 
ATOM   2150  C  CA  . MET A 1 309 ? -18.348 3.686   23.871  1.00 32.19  ? 309 MET A CA  1 
ATOM   2151  C  C   . MET A 1 309 ? -18.809 4.820   22.964  1.00 24.11  ? 309 MET A C   1 
ATOM   2152  O  O   . MET A 1 309 ? -19.833 5.453   23.217  1.00 32.86  ? 309 MET A O   1 
ATOM   2153  C  CB  . MET A 1 309 ? -17.345 4.210   24.900  1.00 37.01  ? 309 MET A CB  1 
ATOM   2154  C  CG  . MET A 1 309 ? -17.984 4.876   26.107  1.00 40.93  ? 309 MET A CG  1 
ATOM   2155  S  SD  . MET A 1 309 ? -18.326 3.714   27.442  1.00 67.13  ? 309 MET A SD  1 
ATOM   2156  C  CE  . MET A 1 309 ? -19.611 4.588   28.331  1.00 89.70  ? 309 MET A CE  1 
ATOM   2157  N  N   . GLN A 1 310 ? -18.048 5.069   21.904  1.00 35.06  ? 310 GLN A N   1 
ATOM   2158  C  CA  . GLN A 1 310 ? -18.383 6.122   20.954  1.00 41.21  ? 310 GLN A CA  1 
ATOM   2159  C  C   . GLN A 1 310 ? -19.651 5.784   20.178  1.00 49.62  ? 310 GLN A C   1 
ATOM   2160  O  O   . GLN A 1 310 ? -20.394 6.675   19.772  1.00 59.47  ? 310 GLN A O   1 
ATOM   2161  C  CB  . GLN A 1 310 ? -17.222 6.360   19.987  1.00 43.86  ? 310 GLN A CB  1 
ATOM   2162  C  CG  . GLN A 1 310 ? -17.467 7.477   18.988  1.00 61.79  ? 310 GLN A CG  1 
ATOM   2163  C  CD  . GLN A 1 310 ? -18.155 6.993   17.728  1.00 82.69  ? 310 GLN A CD  1 
ATOM   2164  O  OE1 . GLN A 1 310 ? -19.269 7.412   17.415  1.00 84.91  ? 310 GLN A OE1 1 
ATOM   2165  N  NE2 . GLN A 1 310 ? -17.493 6.105   16.996  1.00 93.55  ? 310 GLN A NE2 1 
ATOM   2166  N  N   . ILE A 1 311 ? -19.894 4.493   19.975  1.00 58.20  ? 311 ILE A N   1 
ATOM   2167  C  CA  . ILE A 1 311 ? -21.070 4.051   19.234  1.00 46.48  ? 311 ILE A CA  1 
ATOM   2168  C  C   . ILE A 1 311 ? -22.339 4.097   20.080  1.00 45.04  ? 311 ILE A C   1 
ATOM   2169  O  O   . ILE A 1 311 ? -23.421 4.392   19.574  1.00 56.75  ? 311 ILE A O   1 
ATOM   2170  C  CB  . ILE A 1 311 ? -20.884 2.627   18.677  1.00 50.25  ? 311 ILE A CB  1 
ATOM   2171  C  CG1 . ILE A 1 311 ? -19.844 2.627   17.555  1.00 42.85  ? 311 ILE A CG1 1 
ATOM   2172  C  CG2 . ILE A 1 311 ? -22.208 2.072   18.178  1.00 31.28  ? 311 ILE A CG2 1 
ATOM   2173  C  CD1 . ILE A 1 311 ? -19.399 1.245   17.134  1.00 42.92  ? 311 ILE A CD1 1 
ATOM   2174  N  N   . ILE A 1 312 ? -22.202 3.805   21.369  1.00 34.94  ? 312 ILE A N   1 
ATOM   2175  C  CA  . ILE A 1 312 ? -23.344 3.807   22.274  1.00 35.86  ? 312 ILE A CA  1 
ATOM   2176  C  C   . ILE A 1 312 ? -23.879 5.218   22.497  1.00 48.86  ? 312 ILE A C   1 
ATOM   2177  O  O   . ILE A 1 312 ? -25.090 5.430   22.550  1.00 59.14  ? 312 ILE A O   1 
ATOM   2178  C  CB  . ILE A 1 312 ? -22.990 3.178   23.633  1.00 33.36  ? 312 ILE A CB  1 
ATOM   2179  C  CG1 . ILE A 1 312 ? -22.287 1.835   23.429  1.00 34.07  ? 312 ILE A CG1 1 
ATOM   2180  C  CG2 . ILE A 1 312 ? -24.239 3.002   24.479  1.00 29.28  ? 312 ILE A CG2 1 
ATOM   2181  C  CD1 . ILE A 1 312 ? -22.894 0.703   24.227  1.00 42.16  ? 312 ILE A CD1 1 
ATOM   2182  N  N   . ALA A 1 313 ? -22.970 6.179   22.625  1.00 53.36  ? 313 ALA A N   1 
ATOM   2183  C  CA  . ALA A 1 313 ? -23.352 7.571   22.834  1.00 45.03  ? 313 ALA A CA  1 
ATOM   2184  C  C   . ALA A 1 313 ? -24.281 8.056   21.728  1.00 51.90  ? 313 ALA A C   1 
ATOM   2185  O  O   . ALA A 1 313 ? -25.412 8.467   21.988  1.00 60.46  ? 313 ALA A O   1 
ATOM   2186  C  CB  . ALA A 1 313 ? -22.116 8.452   22.919  1.00 48.94  ? 313 ALA A CB  1 
ATOM   2187  N  N   . GLU A 1 314 ? -23.797 8.000   20.492  1.00 47.06  ? 314 GLU A N   1 
ATOM   2188  C  CA  . GLU A 1 314 ? -24.590 8.409   19.341  1.00 49.75  ? 314 GLU A CA  1 
ATOM   2189  C  C   . GLU A 1 314 ? -25.984 7.797   19.406  1.00 51.11  ? 314 GLU A C   1 
ATOM   2190  O  O   . GLU A 1 314 ? -26.985 8.487   19.219  1.00 61.99  ? 314 GLU A O   1 
ATOM   2191  C  CB  . GLU A 1 314 ? -23.901 7.993   18.041  1.00 47.40  ? 314 GLU A CB  1 
ATOM   2192  C  CG  . GLU A 1 314 ? -22.679 8.824   17.689  1.00 52.96  ? 314 GLU A CG  1 
ATOM   2193  C  CD  . GLU A 1 314 ? -22.416 8.868   16.197  1.00 69.09  ? 314 GLU A CD  1 
ATOM   2194  O  OE1 . GLU A 1 314 ? -21.291 8.523   15.779  1.00 73.84  ? 314 GLU A OE1 1 
ATOM   2195  O  OE2 . GLU A 1 314 ? -23.335 9.248   15.442  1.00 67.26  ? 314 GLU A OE2 1 
ATOM   2196  N  N   . ALA A 1 315 ? -26.038 6.497   19.673  1.00 47.31  ? 315 ALA A N   1 
ATOM   2197  C  CA  . ALA A 1 315 ? -27.305 5.780   19.759  1.00 50.43  ? 315 ALA A CA  1 
ATOM   2198  C  C   . ALA A 1 315 ? -28.285 6.487   20.689  1.00 50.13  ? 315 ALA A C   1 
ATOM   2199  O  O   . ALA A 1 315 ? -29.496 6.444   20.477  1.00 56.51  ? 315 ALA A O   1 
ATOM   2200  C  CB  . ALA A 1 315 ? -27.073 4.348   20.219  1.00 43.40  ? 315 ALA A CB  1 
ATOM   2201  N  N   . THR A 1 316 ? -27.754 7.136   21.720  1.00 39.30  ? 316 THR A N   1 
ATOM   2202  C  CA  . THR A 1 316 ? -28.586 7.851   22.683  1.00 51.81  ? 316 THR A CA  1 
ATOM   2203  C  C   . THR A 1 316 ? -29.418 8.927   21.995  1.00 52.07  ? 316 THR A C   1 
ATOM   2204  O  O   . THR A 1 316 ? -30.344 9.481   22.587  1.00 60.11  ? 316 THR A O   1 
ATOM   2205  C  CB  . THR A 1 316 ? -27.738 8.498   23.793  1.00 52.19  ? 316 THR A CB  1 
ATOM   2206  O  OG1 . THR A 1 316 ? -26.894 9.508   23.226  1.00 68.38  ? 316 THR A OG1 1 
ATOM   2207  C  CG2 . THR A 1 316 ? -26.876 7.453   24.483  1.00 48.05  ? 316 THR A CG2 1 
ATOM   2208  N  N   . VAL A 1 317 ? -29.084 9.218   20.743  1.00 60.19  ? 317 VAL A N   1 
ATOM   2209  C  CA  . VAL A 1 317 ? -29.804 10.222  19.970  1.00 78.27  ? 317 VAL A CA  1 
ATOM   2210  C  C   . VAL A 1 317 ? -30.463 9.604   18.742  1.00 77.65  ? 317 VAL A C   1 
ATOM   2211  O  O   . VAL A 1 317 ? -31.689 9.565   18.637  1.00 72.49  ? 317 VAL A O   1 
ATOM   2212  C  CB  . VAL A 1 317 ? -28.873 11.363  19.520  1.00 77.83  ? 317 VAL A CB  1 
ATOM   2213  C  CG1 . VAL A 1 317 ? -29.401 12.702  20.010  1.00 83.00  ? 317 VAL A CG1 1 
ATOM   2214  C  CG2 . VAL A 1 317 ? -27.459 11.122  20.024  1.00 65.56  ? 317 VAL A CG2 1 
ATOM   2215  N  N   . LEU B 1 12  ? -4.079  4.499   54.308  1.00 73.79  ? 12  LEU B N   1 
ATOM   2216  C  CA  . LEU B 1 12  ? -3.380  4.490   53.029  1.00 79.38  ? 12  LEU B CA  1 
ATOM   2217  C  C   . LEU B 1 12  ? -2.503  3.250   52.889  1.00 80.95  ? 12  LEU B C   1 
ATOM   2218  O  O   . LEU B 1 12  ? -1.526  3.085   53.617  1.00 92.83  ? 12  LEU B O   1 
ATOM   2219  C  CB  . LEU B 1 12  ? -2.531  5.754   52.874  1.00 85.55  ? 12  LEU B CB  1 
ATOM   2220  C  CG  . LEU B 1 12  ? -2.973  6.736   51.789  1.00 86.53  ? 12  LEU B CG  1 
ATOM   2221  C  CD1 . LEU B 1 12  ? -1.853  7.710   51.459  1.00 82.91  ? 12  LEU B CD1 1 
ATOM   2222  C  CD2 . LEU B 1 12  ? -3.425  5.992   50.542  1.00 90.91  ? 12  LEU B CD2 1 
ATOM   2223  N  N   . PRO B 1 13  ? -2.860  2.381   51.948  1.00 84.52  ? 13  PRO B N   1 
ATOM   2224  C  CA  . PRO B 1 13  ? -2.101  1.150   51.705  1.00 81.71  ? 13  PRO B CA  1 
ATOM   2225  C  C   . PRO B 1 13  ? -0.597  1.397   51.728  1.00 82.92  ? 13  PRO B C   1 
ATOM   2226  O  O   . PRO B 1 13  ? -0.162  2.542   51.845  1.00 86.46  ? 13  PRO B O   1 
ATOM   2227  C  CB  . PRO B 1 13  ? -2.547  0.737   50.300  1.00 89.19  ? 13  PRO B CB  1 
ATOM   2228  C  CG  . PRO B 1 13  ? -2.965  2.008   49.653  1.00 100.61 ? 13  PRO B CG  1 
ATOM   2229  C  CD  . PRO B 1 13  ? -3.571  2.840   50.743  1.00 96.68  ? 13  PRO B CD  1 
ATOM   2230  N  N   . ILE B 1 14  ? 0.185   0.329   51.615  1.00 84.15  ? 14  ILE B N   1 
ATOM   2231  C  CA  . ILE B 1 14  ? 1.638   0.438   51.650  1.00 94.76  ? 14  ILE B CA  1 
ATOM   2232  C  C   . ILE B 1 14  ? 2.246   0.357   50.253  1.00 101.14 ? 14  ILE B C   1 
ATOM   2233  O  O   . ILE B 1 14  ? 1.814   -0.439  49.420  1.00 111.23 ? 14  ILE B O   1 
ATOM   2234  C  CB  . ILE B 1 14  ? 2.267   -0.656  52.534  1.00 100.97 ? 14  ILE B CB  1 
ATOM   2235  C  CG1 . ILE B 1 14  ? 3.584   -1.142  51.927  1.00 99.28  ? 14  ILE B CG1 1 
ATOM   2236  C  CG2 . ILE B 1 14  ? 1.300   -1.816  52.716  1.00 107.38 ? 14  ILE B CG2 1 
ATOM   2237  C  CD1 . ILE B 1 14  ? 3.455   -2.428  51.142  1.00 97.80  ? 14  ILE B CD1 1 
ATOM   2238  N  N   . MET B 1 15  ? 3.254   1.188   50.008  1.00 92.21  ? 15  MET B N   1 
ATOM   2239  C  CA  . MET B 1 15  ? 3.950   1.202   48.727  1.00 85.76  ? 15  MET B CA  1 
ATOM   2240  C  C   . MET B 1 15  ? 4.058   -0.199  48.136  1.00 90.31  ? 15  MET B C   1 
ATOM   2241  O  O   . MET B 1 15  ? 4.241   -1.177  48.861  1.00 94.48  ? 15  MET B O   1 
ATOM   2242  C  CB  . MET B 1 15  ? 5.342   1.817   48.880  1.00 75.27  ? 15  MET B CB  1 
ATOM   2243  C  CG  . MET B 1 15  ? 5.917   2.381   47.590  1.00 75.13  ? 15  MET B CG  1 
ATOM   2244  S  SD  . MET B 1 15  ? 4.709   3.323   46.641  1.00 192.41 ? 15  MET B SD  1 
ATOM   2245  C  CE  . MET B 1 15  ? 5.383   3.173   44.989  1.00 120.29 ? 15  MET B CE  1 
ATOM   2246  N  N   . HIS B 1 16  ? 3.944   -0.285  46.815  1.00 93.30  ? 16  HIS B N   1 
ATOM   2247  C  CA  . HIS B 1 16  ? 4.013   -1.563  46.119  1.00 98.20  ? 16  HIS B CA  1 
ATOM   2248  C  C   . HIS B 1 16  ? 4.328   -1.399  44.637  1.00 111.46 ? 16  HIS B C   1 
ATOM   2249  O  O   . HIS B 1 16  ? 4.207   -0.305  44.085  1.00 116.56 ? 16  HIS B O   1 
ATOM   2250  C  CB  . HIS B 1 16  ? 2.612   -2.152  45.956  1.00 91.22  ? 16  HIS B CB  1 
ATOM   2251  C  CG  . HIS B 1 16  ? 1.514   -1.152  46.138  1.00 89.36  ? 16  HIS B CG  1 
ATOM   2252  N  ND1 . HIS B 1 16  ? 0.762   -1.074  47.290  1.00 91.75  ? 16  HIS B ND1 1 
ATOM   2253  C  CD2 . HIS B 1 16  ? 1.043   -0.186  45.315  1.00 80.19  ? 16  HIS B CD2 1 
ATOM   2254  C  CE1 . HIS B 1 16  ? -0.127  -0.104  47.168  1.00 91.52  ? 16  HIS B CE1 1 
ATOM   2255  N  NE2 . HIS B 1 16  ? 0.023   0.451   45.979  1.00 79.77  ? 16  HIS B NE2 1 
ATOM   2256  N  N   . ASP B 1 17  ? 4.728   -2.492  43.996  1.00 113.03 ? 17  ASP B N   1 
ATOM   2257  C  CA  . ASP B 1 17  ? 5.340   -2.470  42.673  1.00 107.74 ? 17  ASP B CA  1 
ATOM   2258  C  C   . ASP B 1 17  ? 6.298   -1.290  42.778  1.00 108.48 ? 17  ASP B C   1 
ATOM   2259  O  O   . ASP B 1 17  ? 6.375   -0.457  41.876  1.00 107.43 ? 17  ASP B O   1 
ATOM   2260  C  CB  . ASP B 1 17  ? 4.392   -1.836  41.654  1.00 95.10  ? 17  ASP B CB  1 
ATOM   2261  C  CG  . ASP B 1 17  ? 3.424   -2.837  41.058  1.00 85.09  ? 17  ASP B CG  1 
ATOM   2262  O  OD1 . ASP B 1 17  ? 2.303   -2.971  41.590  1.00 65.38  ? 17  ASP B OD1 1 
ATOM   2263  O  OD2 . ASP B 1 17  ? 3.785   -3.491  40.057  1.00 79.44  ? 17  ASP B OD2 1 
ATOM   2264  N  N   . SER B 1 18  ? 7.052   -1.263  43.871  1.00 110.85 ? 18  SER B N   1 
ATOM   2265  C  CA  . SER B 1 18  ? 8.220   -0.416  43.972  1.00 105.06 ? 18  SER B CA  1 
ATOM   2266  C  C   . SER B 1 18  ? 9.129   -0.853  42.837  1.00 97.84  ? 18  SER B C   1 
ATOM   2267  O  O   . SER B 1 18  ? 9.966   -0.085  42.362  1.00 95.21  ? 18  SER B O   1 
ATOM   2268  C  CB  . SER B 1 18  ? 8.916   -0.614  45.317  1.00 103.02 ? 18  SER B CB  1 
ATOM   2269  O  OG  . SER B 1 18  ? 9.715   -1.784  45.308  1.00 94.12  ? 18  SER B OG  1 
ATOM   2270  N  N   . ASP B 1 19  ? 8.949   -2.097  42.396  1.00 97.05  ? 19  ASP B N   1 
ATOM   2271  C  CA  . ASP B 1 19  ? 9.682   -2.598  41.248  1.00 102.76 ? 19  ASP B CA  1 
ATOM   2272  C  C   . ASP B 1 19  ? 9.428   -1.694  40.052  1.00 92.94  ? 19  ASP B C   1 
ATOM   2273  O  O   . ASP B 1 19  ? 10.210  -1.676  39.101  1.00 93.84  ? 19  ASP B O   1 
ATOM   2274  C  CB  . ASP B 1 19  ? 9.263   -4.033  40.924  1.00 107.77 ? 19  ASP B CB  1 
ATOM   2275  C  CG  . ASP B 1 19  ? 7.895   -4.378  41.477  1.00 117.03 ? 19  ASP B CG  1 
ATOM   2276  O  OD1 . ASP B 1 19  ? 6.966   -4.597  40.671  1.00 118.80 ? 19  ASP B OD1 1 
ATOM   2277  O  OD2 . ASP B 1 19  ? 7.749   -4.431  42.716  1.00 120.67 ? 19  ASP B OD2 1 
ATOM   2278  N  N   . ARG B 1 20  ? 8.334   -0.940  40.099  1.00 74.13  ? 20  ARG B N   1 
ATOM   2279  C  CA  . ARG B 1 20  ? 8.031   0.001   39.002  1.00 54.74  ? 20  ARG B CA  1 
ATOM   2280  C  C   . ARG B 1 20  ? 7.861   1.494   39.357  1.00 53.93  ? 20  ARG B C   1 
ATOM   2281  O  O   . ARG B 1 20  ? 8.480   2.366   38.749  1.00 68.83  ? 20  ARG B O   1 
ATOM   2282  C  CB  . ARG B 1 20  ? 6.805   -0.482  38.221  1.00 64.09  ? 20  ARG B CB  1 
ATOM   2283  C  CG  . ARG B 1 20  ? 6.848   -1.955  37.849  1.00 76.94  ? 20  ARG B CG  1 
ATOM   2284  C  CD  . ARG B 1 20  ? 5.850   -2.277  36.749  1.00 85.80  ? 20  ARG B CD  1 
ATOM   2285  N  NE  . ARG B 1 20  ? 4.472   -2.067  37.183  1.00 96.27  ? 20  ARG B NE  1 
ATOM   2286  C  CZ  . ARG B 1 20  ? 3.409   -2.559  36.556  1.00 99.36  ? 20  ARG B CZ  1 
ATOM   2287  N  NH1 . ARG B 1 20  ? 2.192   -2.316  37.023  1.00 88.27  ? 20  ARG B NH1 1 
ATOM   2288  N  NH2 . ARG B 1 20  ? 3.562   -3.294  35.463  1.00 102.09 ? 20  ARG B NH2 1 
ATOM   2289  N  N   . TYR B 1 21  ? 7.002   1.758   40.333  1.00 53.84  ? 21  TYR B N   1 
ATOM   2290  C  CA  . TYR B 1 21  ? 6.499   3.074   40.707  1.00 60.58  ? 21  TYR B CA  1 
ATOM   2291  C  C   . TYR B 1 21  ? 7.222   3.621   41.931  1.00 71.48  ? 21  TYR B C   1 
ATOM   2292  O  O   . TYR B 1 21  ? 7.135   3.047   43.017  1.00 79.05  ? 21  TYR B O   1 
ATOM   2293  C  CB  . TYR B 1 21  ? 4.997   3.007   40.994  1.00 52.86  ? 21  TYR B CB  1 
ATOM   2294  C  CG  . TYR B 1 21  ? 4.129   2.860   39.766  1.00 53.94  ? 21  TYR B CG  1 
ATOM   2295  C  CD1 . TYR B 1 21  ? 4.072   3.862   38.806  1.00 40.51  ? 21  TYR B CD1 1 
ATOM   2296  C  CD2 . TYR B 1 21  ? 3.358   1.723   39.569  1.00 59.62  ? 21  TYR B CD2 1 
ATOM   2297  C  CE1 . TYR B 1 21  ? 3.277   3.732   37.684  1.00 38.87  ? 21  TYR B CE1 1 
ATOM   2298  C  CE2 . TYR B 1 21  ? 2.558   1.584   38.451  1.00 47.43  ? 21  TYR B CE2 1 
ATOM   2299  C  CZ  . TYR B 1 21  ? 2.522   2.591   37.512  1.00 46.11  ? 21  TYR B CZ  1 
ATOM   2300  O  OH  . TYR B 1 21  ? 1.729   2.457   36.397  1.00 38.63  ? 21  TYR B OH  1 
ATOM   2301  N  N   . GLU B 1 22  ? 7.918   4.740   41.775  1.00 60.65  ? 22  GLU B N   1 
ATOM   2302  C  CA  . GLU B 1 22  ? 8.592   5.370   42.908  1.00 56.17  ? 22  GLU B CA  1 
ATOM   2303  C  C   . GLU B 1 22  ? 7.638   6.312   43.640  1.00 46.70  ? 22  GLU B C   1 
ATOM   2304  O  O   . GLU B 1 22  ? 7.093   7.235   43.038  1.00 59.13  ? 22  GLU B O   1 
ATOM   2305  C  CB  . GLU B 1 22  ? 9.829   6.136   42.436  1.00 73.55  ? 22  GLU B CB  1 
ATOM   2306  C  CG  . GLU B 1 22  ? 10.661  6.726   43.562  1.00 96.21  ? 22  GLU B CG  1 
ATOM   2307  C  CD  . GLU B 1 22  ? 11.672  7.742   43.067  1.00 110.23 ? 22  GLU B CD  1 
ATOM   2308  O  OE1 . GLU B 1 22  ? 12.642  8.024   43.801  1.00 110.99 ? 22  GLU B OE1 1 
ATOM   2309  O  OE2 . GLU B 1 22  ? 11.498  8.259   41.944  1.00 116.59 ? 22  GLU B OE2 1 
ATOM   2310  N  N   . LEU B 1 23  ? 7.432   6.080   44.935  1.00 33.03  ? 23  LEU B N   1 
ATOM   2311  C  CA  . LEU B 1 23  ? 6.505   6.923   45.701  1.00 43.08  ? 23  LEU B CA  1 
ATOM   2312  C  C   . LEU B 1 23  ? 7.037   8.368   45.775  1.00 53.92  ? 23  LEU B C   1 
ATOM   2313  O  O   . LEU B 1 23  ? 8.174   8.606   46.149  1.00 59.62  ? 23  LEU B O   1 
ATOM   2314  C  CB  . LEU B 1 23  ? 6.265   6.360   47.110  1.00 36.18  ? 23  LEU B CB  1 
ATOM   2315  C  CG  . LEU B 1 23  ? 5.699   7.341   48.137  1.00 46.15  ? 23  LEU B CG  1 
ATOM   2316  C  CD1 . LEU B 1 23  ? 4.393   7.884   47.646  1.00 48.67  ? 23  LEU B CD1 1 
ATOM   2317  C  CD2 . LEU B 1 23  ? 5.518   6.702   49.516  1.00 53.30  ? 23  LEU B CD2 1 
ATOM   2318  N  N   . VAL B 1 24  ? 6.205   9.325   45.398  1.00 52.74  ? 24  VAL B N   1 
ATOM   2319  C  CA  . VAL B 1 24  ? 6.612   10.719  45.327  1.00 37.00  ? 24  VAL B CA  1 
ATOM   2320  C  C   . VAL B 1 24  ? 6.101   11.515  46.541  1.00 44.51  ? 24  VAL B C   1 
ATOM   2321  O  O   . VAL B 1 24  ? 6.886   12.019  47.331  1.00 46.84  ? 24  VAL B O   1 
ATOM   2322  C  CB  . VAL B 1 24  ? 6.097   11.366  44.047  1.00 31.79  ? 24  VAL B CB  1 
ATOM   2323  C  CG1 . VAL B 1 24  ? 6.274   12.865  44.119  1.00 37.50  ? 24  VAL B CG1 1 
ATOM   2324  C  CG2 . VAL B 1 24  ? 6.807   10.783  42.830  1.00 29.84  ? 24  VAL B CG2 1 
ATOM   2325  N  N   . LYS B 1 25  ? 4.787   11.635  46.692  1.00 32.18  ? 25  LYS B N   1 
ATOM   2326  C  CA  . LYS B 1 25  ? 4.239   12.090  47.958  1.00 48.25  ? 25  LYS B CA  1 
ATOM   2327  C  C   . LYS B 1 25  ? 2.798   11.642  48.194  1.00 52.15  ? 25  LYS B C   1 
ATOM   2328  O  O   . LYS B 1 25  ? 2.029   11.539  47.245  1.00 58.80  ? 25  LYS B O   1 
ATOM   2329  C  CB  . LYS B 1 25  ? 4.281   13.613  48.014  1.00 62.47  ? 25  LYS B CB  1 
ATOM   2330  C  CG  . LYS B 1 25  ? 3.925   14.178  49.374  1.00 73.53  ? 25  LYS B CG  1 
ATOM   2331  C  CD  . LYS B 1 25  ? 3.945   15.683  49.363  1.00 87.14  ? 25  LYS B CD  1 
ATOM   2332  C  CE  . LYS B 1 25  ? 2.537   16.258  49.555  1.00 101.67 ? 25  LYS B CE  1 
ATOM   2333  N  NZ  . LYS B 1 25  ? 2.365   17.622  48.930  1.00 103.49 ? 25  LYS B NZ  1 
ATOM   2334  N  N   . ASP B 1 26  ? 2.429   11.417  49.455  1.00 50.31  ? 26  ASP B N   1 
ATOM   2335  C  CA  . ASP B 1 26  ? 1.032   11.206  49.815  1.00 45.31  ? 26  ASP B CA  1 
ATOM   2336  C  C   . ASP B 1 26  ? 0.294   12.536  49.978  1.00 53.73  ? 26  ASP B C   1 
ATOM   2337  O  O   . ASP B 1 26  ? 0.460   13.225  50.984  1.00 69.79  ? 26  ASP B O   1 
ATOM   2338  C  CB  . ASP B 1 26  ? 0.921   10.370  51.096  1.00 63.82  ? 26  ASP B CB  1 
ATOM   2339  C  CG  . ASP B 1 26  ? 1.268   8.906   50.871  1.00 69.88  ? 26  ASP B CG  1 
ATOM   2340  O  OD1 . ASP B 1 26  ? 1.659   8.202   51.837  1.00 70.53  ? 26  ASP B OD1 1 
ATOM   2341  O  OD2 . ASP B 1 26  ? 1.163   8.479   49.708  1.00 70.75  ? 26  ASP B OD2 1 
ATOM   2342  N  N   . ILE B 1 27  ? -0.531  12.886  48.996  1.00 62.45  ? 27  ILE B N   1 
ATOM   2343  C  CA  . ILE B 1 27  ? -1.317  14.116  49.058  1.00 61.76  ? 27  ILE B CA  1 
ATOM   2344  C  C   . ILE B 1 27  ? -2.591  13.915  49.877  1.00 73.21  ? 27  ILE B C   1 
ATOM   2345  O  O   . ILE B 1 27  ? -3.004  12.782  50.122  1.00 86.12  ? 27  ILE B O   1 
ATOM   2346  C  CB  . ILE B 1 27  ? -1.696  14.616  47.653  1.00 58.32  ? 27  ILE B CB  1 
ATOM   2347  C  CG1 . ILE B 1 27  ? -2.253  13.467  46.812  1.00 56.38  ? 27  ILE B CG1 1 
ATOM   2348  C  CG2 . ILE B 1 27  ? -0.492  15.245  46.969  1.00 52.22  ? 27  ILE B CG2 1 
ATOM   2349  C  CD1 . ILE B 1 27  ? -2.019  13.631  45.328  1.00 71.02  ? 27  ILE B CD1 1 
ATOM   2350  N  N   . GLY B 1 28  ? -3.210  15.013  50.302  1.00 77.52  ? 28  GLY B N   1 
ATOM   2351  C  CA  . GLY B 1 28  ? -4.419  14.927  51.113  1.00 77.77  ? 28  GLY B CA  1 
ATOM   2352  C  C   . GLY B 1 28  ? -5.568  15.779  50.582  1.00 80.15  ? 28  GLY B C   1 
ATOM   2353  O  O   . GLY B 1 28  ? -6.753  15.565  50.884  1.00 88.25  ? 28  GLY B O   1 
ATOM   2354  N  N   . ALA B 1 29  ? -5.218  16.762  49.768  1.00 79.16  ? 29  ALA B N   1 
ATOM   2355  C  CA  . ALA B 1 29  ? -6.208  17.678  49.232  1.00 84.27  ? 29  ALA B CA  1 
ATOM   2356  C  C   . ALA B 1 29  ? -5.773  18.174  47.857  1.00 86.22  ? 29  ALA B C   1 
ATOM   2357  O  O   . ALA B 1 29  ? -4.586  18.349  47.586  1.00 90.61  ? 29  ALA B O   1 
ATOM   2358  C  CB  . ALA B 1 29  ? -6.414  18.853  50.199  1.00 88.14  ? 29  ALA B CB  1 
ATOM   2359  N  N   . GLY B 1 30  ? -6.732  18.400  46.977  1.00 85.87  ? 30  GLY B N   1 
ATOM   2360  C  CA  . GLY B 1 30  ? -6.403  18.840  45.641  1.00 86.47  ? 30  GLY B CA  1 
ATOM   2361  C  C   . GLY B 1 30  ? -7.555  18.531  44.728  1.00 90.75  ? 30  GLY B C   1 
ATOM   2362  O  O   . GLY B 1 30  ? -8.642  18.176  45.188  1.00 86.33  ? 30  GLY B O   1 
ATOM   2363  N  N   . ASN B 1 31  ? -7.331  18.662  43.425  1.00 102.00 ? 31  ASN B N   1 
ATOM   2364  C  CA  . ASN B 1 31  ? -8.346  18.315  42.438  1.00 100.71 ? 31  ASN B CA  1 
ATOM   2365  C  C   . ASN B 1 31  ? -8.305  16.822  42.149  1.00 91.51  ? 31  ASN B C   1 
ATOM   2366  O  O   . ASN B 1 31  ? -9.032  16.314  41.295  1.00 89.84  ? 31  ASN B O   1 
ATOM   2367  C  CB  . ASN B 1 31  ? -8.142  19.112  41.150  1.00 103.56 ? 31  ASN B CB  1 
ATOM   2368  C  CG  . ASN B 1 31  ? -8.589  20.554  41.280  1.00 105.65 ? 31  ASN B CG  1 
ATOM   2369  O  OD1 . ASN B 1 31  ? -9.734  20.830  41.639  1.00 106.04 ? 31  ASN B OD1 1 
ATOM   2370  N  ND2 . ASN B 1 31  ? -7.686  21.483  40.991  1.00 102.14 ? 31  ASN B ND2 1 
ATOM   2371  N  N   . PHE B 1 32  ? -7.438  16.128  42.878  1.00 78.40  ? 32  PHE B N   1 
ATOM   2372  C  CA  . PHE B 1 32  ? -7.258  14.684  42.739  1.00 56.66  ? 32  PHE B CA  1 
ATOM   2373  C  C   . PHE B 1 32  ? -7.665  13.949  44.011  1.00 67.17  ? 32  PHE B C   1 
ATOM   2374  O  O   . PHE B 1 32  ? -7.363  12.764  44.168  1.00 54.84  ? 32  PHE B O   1 
ATOM   2375  C  CB  . PHE B 1 32  ? -5.800  14.341  42.417  1.00 40.77  ? 32  PHE B CB  1 
ATOM   2376  C  CG  . PHE B 1 32  ? -5.466  14.421  40.946  1.00 52.45  ? 32  PHE B CG  1 
ATOM   2377  C  CD1 . PHE B 1 32  ? -5.597  13.296  40.134  1.00 55.21  ? 32  PHE B CD1 1 
ATOM   2378  C  CD2 . PHE B 1 32  ? -5.031  15.612  40.367  1.00 53.60  ? 32  PHE B CD2 1 
ATOM   2379  C  CE1 . PHE B 1 32  ? -5.300  13.339  38.758  1.00 43.59  ? 32  PHE B CE1 1 
ATOM   2380  C  CE2 . PHE B 1 32  ? -4.719  15.669  38.990  1.00 54.48  ? 32  PHE B CE2 1 
ATOM   2381  C  CZ  . PHE B 1 32  ? -4.857  14.525  38.185  1.00 51.66  ? 32  PHE B CZ  1 
ATOM   2382  N  N   . GLY B 1 33  ? -8.337  14.656  44.919  1.00 77.73  ? 33  GLY B N   1 
ATOM   2383  C  CA  . GLY B 1 33  ? -8.725  14.099  46.206  1.00 75.85  ? 33  GLY B CA  1 
ATOM   2384  C  C   . GLY B 1 33  ? -7.532  13.520  46.941  1.00 80.78  ? 33  GLY B C   1 
ATOM   2385  O  O   . GLY B 1 33  ? -6.436  13.464  46.387  1.00 87.56  ? 33  GLY B O   1 
ATOM   2386  N  N   . VAL B 1 34  ? -7.716  13.093  48.186  1.00 72.22  ? 34  VAL B N   1 
ATOM   2387  C  CA  . VAL B 1 34  ? -6.647  12.339  48.833  1.00 63.84  ? 34  VAL B CA  1 
ATOM   2388  C  C   . VAL B 1 34  ? -6.184  11.262  47.845  1.00 63.05  ? 34  VAL B C   1 
ATOM   2389  O  O   . VAL B 1 34  ? -6.984  10.670  47.137  1.00 63.16  ? 34  VAL B O   1 
ATOM   2390  C  CB  . VAL B 1 34  ? -7.080  11.713  50.166  1.00 58.58  ? 34  VAL B CB  1 
ATOM   2391  C  CG1 . VAL B 1 34  ? -8.538  12.007  50.442  1.00 54.98  ? 34  VAL B CG1 1 
ATOM   2392  C  CG2 . VAL B 1 34  ? -6.799  10.223  50.164  1.00 47.09  ? 34  VAL B CG2 1 
ATOM   2393  N  N   . ALA B 1 35  ? -4.882  11.043  47.774  1.00 54.13  ? 35  ALA B N   1 
ATOM   2394  C  CA  . ALA B 1 35  ? -4.310  10.202  46.742  1.00 48.95  ? 35  ALA B CA  1 
ATOM   2395  C  C   . ALA B 1 35  ? -2.818  10.000  46.991  1.00 55.51  ? 35  ALA B C   1 
ATOM   2396  O  O   . ALA B 1 35  ? -2.255  10.490  47.976  1.00 64.95  ? 35  ALA B O   1 
ATOM   2397  C  CB  . ALA B 1 35  ? -4.516  10.851  45.394  1.00 38.78  ? 35  ALA B CB  1 
ATOM   2398  N  N   . ARG B 1 36  ? -2.170  9.275   46.092  1.00 35.14  ? 36  ARG B N   1 
ATOM   2399  C  CA  . ARG B 1 36  ? -0.738  9.088   46.193  1.00 35.94  ? 36  ARG B CA  1 
ATOM   2400  C  C   . ARG B 1 36  ? -0.108  9.452   44.858  1.00 37.83  ? 36  ARG B C   1 
ATOM   2401  O  O   . ARG B 1 36  ? -0.534  8.957   43.830  1.00 39.97  ? 36  ARG B O   1 
ATOM   2402  C  CB  . ARG B 1 36  ? -0.406  7.632   46.555  1.00 45.47  ? 36  ARG B CB  1 
ATOM   2403  C  CG  . ARG B 1 36  ? 1.032   7.444   46.980  1.00 52.80  ? 36  ARG B CG  1 
ATOM   2404  C  CD  . ARG B 1 36  ? 1.504   6.027   46.930  1.00 50.17  ? 36  ARG B CD  1 
ATOM   2405  N  NE  . ARG B 1 36  ? 0.813   5.155   47.879  1.00 64.59  ? 36  ARG B NE  1 
ATOM   2406  C  CZ  . ARG B 1 36  ? 1.043   5.112   49.193  1.00 62.24  ? 36  ARG B CZ  1 
ATOM   2407  N  NH1 . ARG B 1 36  ? 1.945   5.901   49.760  1.00 66.97  ? 36  ARG B NH1 1 
ATOM   2408  N  NH2 . ARG B 1 36  ? 0.352   4.277   49.952  1.00 64.38  ? 36  ARG B NH2 1 
ATOM   2409  N  N   . LEU B 1 37  ? 0.872   10.350  44.866  1.00 32.06  ? 37  LEU B N   1 
ATOM   2410  C  CA  . LEU B 1 37  ? 1.619   10.664  43.653  1.00 35.89  ? 37  LEU B CA  1 
ATOM   2411  C  C   . LEU B 1 37  ? 2.751   9.684   43.512  1.00 35.89  ? 37  LEU B C   1 
ATOM   2412  O  O   . LEU B 1 37  ? 3.469   9.423   44.475  1.00 45.25  ? 37  LEU B O   1 
ATOM   2413  C  CB  . LEU B 1 37  ? 2.231   12.062  43.746  1.00 43.39  ? 37  LEU B CB  1 
ATOM   2414  C  CG  . LEU B 1 37  ? 1.469   13.222  43.100  1.00 52.43  ? 37  LEU B CG  1 
ATOM   2415  C  CD1 . LEU B 1 37  ? -0.009  12.902  43.025  1.00 62.47  ? 37  LEU B CD1 1 
ATOM   2416  C  CD2 . LEU B 1 37  ? 1.689   14.509  43.899  1.00 42.74  ? 37  LEU B CD2 1 
ATOM   2417  N  N   . MET B 1 38  ? 2.943   9.155   42.321  1.00 34.24  ? 38  MET B N   1 
ATOM   2418  C  CA  . MET B 1 38  ? 4.054   8.249   42.098  1.00 38.88  ? 38  MET B CA  1 
ATOM   2419  C  C   . MET B 1 38  ? 4.683   8.608   40.786  1.00 45.32  ? 38  MET B C   1 
ATOM   2420  O  O   . MET B 1 38  ? 4.047   9.224   39.910  1.00 38.93  ? 38  MET B O   1 
ATOM   2421  C  CB  . MET B 1 38  ? 3.577   6.800   42.036  1.00 39.38  ? 38  MET B CB  1 
ATOM   2422  C  CG  . MET B 1 38  ? 3.048   6.230   43.358  1.00 45.02  ? 38  MET B CG  1 
ATOM   2423  S  SD  . MET B 1 38  ? 2.507   4.578   43.021  1.00 72.63  ? 38  MET B SD  1 
ATOM   2424  C  CE  . MET B 1 38  ? 1.937   4.060   44.623  1.00 124.63 ? 38  MET B CE  1 
ATOM   2425  N  N   . ARG B 1 39  ? 5.934   8.201   40.612  1.00 50.31  ? 39  ARG B N   1 
ATOM   2426  C  CA  . ARG B 1 39  ? 6.623   8.364   39.338  1.00 46.48  ? 39  ARG B CA  1 
ATOM   2427  C  C   . ARG B 1 39  ? 6.899   6.995   38.735  1.00 58.55  ? 39  ARG B C   1 
ATOM   2428  O  O   . ARG B 1 39  ? 7.738   6.248   39.237  1.00 69.37  ? 39  ARG B O   1 
ATOM   2429  C  CB  . ARG B 1 39  ? 7.930   9.135   39.524  1.00 35.01  ? 39  ARG B CB  1 
ATOM   2430  C  CG  . ARG B 1 39  ? 8.590   9.551   38.220  1.00 47.51  ? 39  ARG B CG  1 
ATOM   2431  C  CD  . ARG B 1 39  ? 9.926   10.230  38.469  1.00 55.99  ? 39  ARG B CD  1 
ATOM   2432  N  NE  . ARG B 1 39  ? 10.833  9.387   39.242  1.00 75.23  ? 39  ARG B NE  1 
ATOM   2433  C  CZ  . ARG B 1 39  ? 11.714  8.549   38.706  1.00 88.70  ? 39  ARG B CZ  1 
ATOM   2434  N  NH1 . ARG B 1 39  ? 11.809  8.438   37.388  1.00 88.04  ? 39  ARG B NH1 1 
ATOM   2435  N  NH2 . ARG B 1 39  ? 12.498  7.820   39.487  1.00 95.52  ? 39  ARG B NH2 1 
ATOM   2436  N  N   . ASP B 1 40  ? 6.187   6.657   37.663  1.00 41.20  ? 40  ASP B N   1 
ATOM   2437  C  CA  . ASP B 1 40  ? 6.336   5.365   37.064  1.00 54.69  ? 40  ASP B CA  1 
ATOM   2438  C  C   . ASP B 1 40  ? 7.711   5.321   36.400  1.00 66.84  ? 40  ASP B C   1 
ATOM   2439  O  O   . ASP B 1 40  ? 8.001   6.122   35.510  1.00 59.65  ? 40  ASP B O   1 
ATOM   2440  C  CB  . ASP B 1 40  ? 5.166   5.087   36.126  1.00 64.89  ? 40  ASP B CB  1 
ATOM   2441  C  CG  . ASP B 1 40  ? 5.600   4.754   34.745  1.00 73.85  ? 40  ASP B CG  1 
ATOM   2442  O  OD1 . ASP B 1 40  ? 5.564   3.560   34.391  1.00 69.09  ? 40  ASP B OD1 1 
ATOM   2443  O  OD2 . ASP B 1 40  ? 5.973   5.697   34.017  1.00 89.19  ? 40  ASP B OD2 1 
ATOM   2444  N  N   . LYS B 1 41  ? 8.557   4.401   36.848  1.00 79.19  ? 41  LYS B N   1 
ATOM   2445  C  CA  . LYS B 1 41  ? 9.921   4.302   36.340  1.00 73.52  ? 41  LYS B CA  1 
ATOM   2446  C  C   . LYS B 1 41  ? 9.956   4.090   34.830  1.00 68.14  ? 41  LYS B C   1 
ATOM   2447  O  O   . LYS B 1 41  ? 10.839  4.601   34.144  1.00 63.13  ? 41  LYS B O   1 
ATOM   2448  C  CB  . LYS B 1 41  ? 10.674  3.174   37.047  1.00 80.37  ? 41  LYS B CB  1 
ATOM   2449  C  CG  . LYS B 1 41  ? 10.502  3.165   38.557  1.00 81.89  ? 41  LYS B CG  1 
ATOM   2450  C  CD  . LYS B 1 41  ? 11.845  3.209   39.266  1.00 81.31  ? 41  LYS B CD  1 
ATOM   2451  C  CE  . LYS B 1 41  ? 12.026  2.008   40.179  1.00 81.53  ? 41  LYS B CE  1 
ATOM   2452  N  NZ  . LYS B 1 41  ? 11.324  2.189   41.479  1.00 88.08  ? 41  LYS B NZ  1 
ATOM   2453  N  N   . GLN B 1 42  ? 8.991   3.332   34.319  1.00 76.49  ? 42  GLN B N   1 
ATOM   2454  C  CA  . GLN B 1 42  ? 8.931   3.026   32.895  1.00 88.30  ? 42  GLN B CA  1 
ATOM   2455  C  C   . GLN B 1 42  ? 8.959   4.286   32.034  1.00 81.79  ? 42  GLN B C   1 
ATOM   2456  O  O   . GLN B 1 42  ? 10.026  4.751   31.633  1.00 67.40  ? 42  GLN B O   1 
ATOM   2457  C  CB  . GLN B 1 42  ? 7.683   2.201   32.577  1.00 106.58 ? 42  GLN B CB  1 
ATOM   2458  C  CG  . GLN B 1 42  ? 7.881   0.700   32.709  1.00 111.74 ? 42  GLN B CG  1 
ATOM   2459  C  CD  . GLN B 1 42  ? 7.931   -0.002  31.366  1.00 113.33 ? 42  GLN B CD  1 
ATOM   2460  O  OE1 . GLN B 1 42  ? 6.902   -0.216  30.725  1.00 108.74 ? 42  GLN B OE1 1 
ATOM   2461  N  NE2 . GLN B 1 42  ? 9.133   -0.366  30.933  1.00 112.55 ? 42  GLN B NE2 1 
ATOM   2462  N  N   . ALA B 1 43  ? 7.780   4.830   31.748  1.00 85.15  ? 43  ALA B N   1 
ATOM   2463  C  CA  . ALA B 1 43  ? 7.662   6.003   30.889  1.00 79.91  ? 43  ALA B CA  1 
ATOM   2464  C  C   . ALA B 1 43  ? 8.097   7.284   31.594  1.00 64.88  ? 43  ALA B C   1 
ATOM   2465  O  O   . ALA B 1 43  ? 7.813   8.385   31.127  1.00 72.83  ? 43  ALA B O   1 
ATOM   2466  C  CB  . ALA B 1 43  ? 6.237   6.140   30.375  1.00 77.85  ? 43  ALA B CB  1 
ATOM   2467  N  N   . ASN B 1 44  ? 8.790   7.134   32.718  1.00 59.24  ? 44  ASN B N   1 
ATOM   2468  C  CA  . ASN B 1 44  ? 9.261   8.284   33.480  1.00 62.21  ? 44  ASN B CA  1 
ATOM   2469  C  C   . ASN B 1 44  ? 8.264   9.438   33.457  1.00 69.68  ? 44  ASN B C   1 
ATOM   2470  O  O   . ASN B 1 44  ? 8.376   10.354  32.644  1.00 66.94  ? 44  ASN B O   1 
ATOM   2471  C  CB  . ASN B 1 44  ? 10.619  8.754   32.956  1.00 68.63  ? 44  ASN B CB  1 
ATOM   2472  C  CG  . ASN B 1 44  ? 11.009  10.117  33.492  1.00 76.45  ? 44  ASN B CG  1 
ATOM   2473  O  OD1 . ASN B 1 44  ? 11.257  10.279  34.687  1.00 71.93  ? 44  ASN B OD1 1 
ATOM   2474  N  ND2 . ASN B 1 44  ? 11.066  11.106  32.609  1.00 84.00  ? 44  ASN B ND2 1 
ATOM   2475  N  N   . GLU B 1 45  ? 7.287   9.389   34.357  1.00 67.55  ? 45  GLU B N   1 
ATOM   2476  C  CA  . GLU B 1 45  ? 6.274   10.434  34.441  1.00 70.43  ? 45  GLU B CA  1 
ATOM   2477  C  C   . GLU B 1 45  ? 5.452   10.320  35.721  1.00 59.42  ? 45  GLU B C   1 
ATOM   2478  O  O   . GLU B 1 45  ? 5.364   9.249   36.320  1.00 52.10  ? 45  GLU B O   1 
ATOM   2479  C  CB  . GLU B 1 45  ? 5.354   10.390  33.219  1.00 79.59  ? 45  GLU B CB  1 
ATOM   2480  C  CG  . GLU B 1 45  ? 4.875   8.995   32.853  1.00 95.17  ? 45  GLU B CG  1 
ATOM   2481  C  CD  . GLU B 1 45  ? 3.748   9.015   31.839  1.00 105.84 ? 45  GLU B CD  1 
ATOM   2482  O  OE1 . GLU B 1 45  ? 2.636   9.462   32.192  1.00 102.60 ? 45  GLU B OE1 1 
ATOM   2483  O  OE2 . GLU B 1 45  ? 3.973   8.583   30.689  1.00 111.10 ? 45  GLU B OE2 1 
ATOM   2484  N  N   . LEU B 1 46  ? 4.852   11.432  36.132  1.00 46.18  ? 46  LEU B N   1 
ATOM   2485  C  CA  . LEU B 1 46  ? 4.039   11.464  37.327  1.00 39.61  ? 46  LEU B CA  1 
ATOM   2486  C  C   . LEU B 1 46  ? 2.675   10.861  37.079  1.00 49.53  ? 46  LEU B C   1 
ATOM   2487  O  O   . LEU B 1 46  ? 2.110   10.972  36.000  1.00 56.85  ? 46  LEU B O   1 
ATOM   2488  C  CB  . LEU B 1 46  ? 3.878   12.875  37.835  1.00 41.61  ? 46  LEU B CB  1 
ATOM   2489  C  CG  . LEU B 1 46  ? 5.020   13.462  38.644  1.00 51.05  ? 46  LEU B CG  1 
ATOM   2490  C  CD1 . LEU B 1 46  ? 4.639   14.879  39.043  1.00 43.84  ? 46  LEU B CD1 1 
ATOM   2491  C  CD2 . LEU B 1 46  ? 5.228   12.610  39.864  1.00 52.84  ? 46  LEU B CD2 1 
ATOM   2492  N  N   . VAL B 1 47  ? 2.136   10.246  38.117  1.00 38.00  ? 47  VAL B N   1 
ATOM   2493  C  CA  . VAL B 1 47  ? 0.934   9.480   38.004  1.00 36.79  ? 47  VAL B CA  1 
ATOM   2494  C  C   . VAL B 1 47  ? 0.251   9.643   39.349  1.00 33.50  ? 47  VAL B C   1 
ATOM   2495  O  O   . VAL B 1 47  ? 0.938   9.839   40.342  1.00 39.95  ? 47  VAL B O   1 
ATOM   2496  C  CB  . VAL B 1 47  ? 1.332   8.010   37.753  1.00 41.44  ? 47  VAL B CB  1 
ATOM   2497  C  CG1 . VAL B 1 47  ? 0.684   7.103   38.732  1.00 41.59  ? 47  VAL B CG1 1 
ATOM   2498  C  CG2 . VAL B 1 47  ? 1.043   7.622   36.354  1.00 38.98  ? 47  VAL B CG2 1 
ATOM   2499  N  N   . ALA B 1 48  ? -1.078  9.583   39.398  1.00 27.13  ? 48  ALA B N   1 
ATOM   2500  C  CA  . ALA B 1 48  ? -1.780  9.711   40.675  1.00 32.68  ? 48  ALA B CA  1 
ATOM   2501  C  C   . ALA B 1 48  ? -2.490  8.425   40.907  1.00 42.40  ? 48  ALA B C   1 
ATOM   2502  O  O   . ALA B 1 48  ? -3.006  7.839   39.977  1.00 57.24  ? 48  ALA B O   1 
ATOM   2503  C  CB  . ALA B 1 48  ? -2.795  10.858  40.662  1.00 20.84  ? 48  ALA B CB  1 
ATOM   2504  N  N   . VAL B 1 49  ? -2.541  7.985   42.153  1.00 39.83  ? 49  VAL B N   1 
ATOM   2505  C  CA  . VAL B 1 49  ? -3.158  6.712   42.454  1.00 35.79  ? 49  VAL B CA  1 
ATOM   2506  C  C   . VAL B 1 49  ? -4.271  6.903   43.445  1.00 36.45  ? 49  VAL B C   1 
ATOM   2507  O  O   . VAL B 1 49  ? -4.046  7.500   44.486  1.00 47.73  ? 49  VAL B O   1 
ATOM   2508  C  CB  . VAL B 1 49  ? -2.124  5.727   43.047  1.00 33.00  ? 49  VAL B CB  1 
ATOM   2509  C  CG1 . VAL B 1 49  ? -2.759  4.397   43.358  1.00 29.48  ? 49  VAL B CG1 1 
ATOM   2510  C  CG2 . VAL B 1 49  ? -0.976  5.544   42.106  1.00 23.74  ? 49  VAL B CG2 1 
ATOM   2511  N  N   . LYS B 1 50  ? -5.458  6.380   43.122  1.00 39.03  ? 50  LYS B N   1 
ATOM   2512  C  CA  . LYS B 1 50  ? -6.627  6.432   44.004  1.00 42.17  ? 50  LYS B CA  1 
ATOM   2513  C  C   . LYS B 1 50  ? -6.881  5.033   44.564  1.00 44.79  ? 50  LYS B C   1 
ATOM   2514  O  O   . LYS B 1 50  ? -6.666  4.039   43.869  1.00 45.46  ? 50  LYS B O   1 
ATOM   2515  C  CB  . LYS B 1 50  ? -7.839  6.939   43.225  1.00 44.30  ? 50  LYS B CB  1 
ATOM   2516  C  CG  . LYS B 1 50  ? -8.830  7.775   44.023  1.00 65.20  ? 50  LYS B CG  1 
ATOM   2517  C  CD  . LYS B 1 50  ? -8.327  9.213   44.241  1.00 70.37  ? 50  LYS B CD  1 
ATOM   2518  C  CE  . LYS B 1 50  ? -9.050  9.907   45.406  1.00 70.37  ? 50  LYS B CE  1 
ATOM   2519  N  NZ  . LYS B 1 50  ? -10.328 10.572  45.015  1.00 79.26  ? 50  LYS B NZ  1 
ATOM   2520  N  N   . TYR B 1 51  ? -7.317  4.939   45.822  1.00 40.67  ? 51  TYR B N   1 
ATOM   2521  C  CA  . TYR B 1 51  ? -7.436  3.637   46.486  1.00 32.80  ? 51  TYR B CA  1 
ATOM   2522  C  C   . TYR B 1 51  ? -8.846  3.366   47.017  1.00 48.11  ? 51  TYR B C   1 
ATOM   2523  O  O   . TYR B 1 51  ? -9.389  4.154   47.790  1.00 40.00  ? 51  TYR B O   1 
ATOM   2524  C  CB  . TYR B 1 51  ? -6.451  3.529   47.646  1.00 36.63  ? 51  TYR B CB  1 
ATOM   2525  C  CG  . TYR B 1 51  ? -4.990  3.377   47.267  1.00 44.03  ? 51  TYR B CG  1 
ATOM   2526  C  CD1 . TYR B 1 51  ? -4.460  2.143   46.956  1.00 34.18  ? 51  TYR B CD1 1 
ATOM   2527  C  CD2 . TYR B 1 51  ? -4.128  4.479   47.266  1.00 47.24  ? 51  TYR B CD2 1 
ATOM   2528  C  CE1 . TYR B 1 51  ? -3.125  1.999   46.619  1.00 43.38  ? 51  TYR B CE1 1 
ATOM   2529  C  CE2 . TYR B 1 51  ? -2.782  4.341   46.931  1.00 36.79  ? 51  TYR B CE2 1 
ATOM   2530  C  CZ  . TYR B 1 51  ? -2.292  3.097   46.608  1.00 49.32  ? 51  TYR B CZ  1 
ATOM   2531  O  OH  . TYR B 1 51  ? -0.965  2.951   46.274  1.00 58.95  ? 51  TYR B OH  1 
ATOM   2532  N  N   . ILE B 1 52  ? -9.438  2.244   46.608  1.00 58.93  ? 52  ILE B N   1 
ATOM   2533  C  CA  . ILE B 1 52  ? -10.726 1.814   47.159  1.00 54.73  ? 52  ILE B CA  1 
ATOM   2534  C  C   . ILE B 1 52  ? -10.584 0.492   47.914  1.00 57.44  ? 52  ILE B C   1 
ATOM   2535  O  O   . ILE B 1 52  ? -9.847  -0.398  47.483  1.00 39.85  ? 52  ILE B O   1 
ATOM   2536  C  CB  . ILE B 1 52  ? -11.795 1.647   46.076  1.00 47.59  ? 52  ILE B CB  1 
ATOM   2537  C  CG1 . ILE B 1 52  ? -11.905 2.919   45.230  1.00 60.73  ? 52  ILE B CG1 1 
ATOM   2538  C  CG2 . ILE B 1 52  ? -13.126 1.333   46.716  1.00 46.14  ? 52  ILE B CG2 1 
ATOM   2539  C  CD1 . ILE B 1 52  ? -12.798 2.785   44.033  1.00 72.21  ? 52  ILE B CD1 1 
ATOM   2540  N  N   . GLU B 1 53  ? -11.300 0.361   49.027  1.00 64.27  ? 53  GLU B N   1 
ATOM   2541  C  CA  . GLU B 1 53  ? -11.225 -0.811  49.909  1.00 69.32  ? 53  GLU B CA  1 
ATOM   2542  C  C   . GLU B 1 53  ? -11.736 -2.116  49.279  1.00 65.05  ? 53  GLU B C   1 
ATOM   2543  O  O   . GLU B 1 53  ? -12.828 -2.162  48.700  1.00 58.44  ? 53  GLU B O   1 
ATOM   2544  C  CB  . GLU B 1 53  ? -12.070 -0.523  51.146  1.00 91.15  ? 53  GLU B CB  1 
ATOM   2545  C  CG  . GLU B 1 53  ? -11.492 -0.956  52.486  1.00 110.39 ? 53  GLU B CG  1 
ATOM   2546  C  CD  . GLU B 1 53  ? -12.405 -0.540  53.648  1.00 126.87 ? 53  GLU B CD  1 
ATOM   2547  O  OE1 . GLU B 1 53  ? -13.556 -1.049  53.695  1.00 130.71 ? 53  GLU B OE1 1 
ATOM   2548  O  OE2 . GLU B 1 53  ? -11.992 0.308   54.489  1.00 126.55 ? 53  GLU B OE2 1 
ATOM   2549  N  N   . ARG B 1 54  ? -10.973 -3.189  49.454  1.00 53.44  ? 54  ARG B N   1 
ATOM   2550  C  CA  . ARG B 1 54  ? -11.352 -4.499  48.929  1.00 32.73  ? 54  ARG B CA  1 
ATOM   2551  C  C   . ARG B 1 54  ? -12.569 -5.119  49.627  1.00 61.25  ? 54  ARG B C   1 
ATOM   2552  O  O   . ARG B 1 54  ? -12.667 -6.340  49.732  1.00 86.03  ? 54  ARG B O   1 
ATOM   2553  C  CB  . ARG B 1 54  ? -10.167 -5.463  49.010  1.00 29.24  ? 54  ARG B CB  1 
ATOM   2554  C  CG  . ARG B 1 54  ? -9.340  -5.540  47.740  1.00 37.58  ? 54  ARG B CG  1 
ATOM   2555  C  CD  . ARG B 1 54  ? -9.247  -6.970  47.232  1.00 51.59  ? 54  ARG B CD  1 
ATOM   2556  N  NE  . ARG B 1 54  ? -7.875  -7.468  47.245  1.00 48.92  ? 54  ARG B NE  1 
ATOM   2557  C  CZ  . ARG B 1 54  ? -7.533  -8.720  46.960  1.00 51.88  ? 54  ARG B CZ  1 
ATOM   2558  N  NH1 . ARG B 1 54  ? -8.466  -9.606  46.637  1.00 44.41  ? 54  ARG B NH1 1 
ATOM   2559  N  NH2 . ARG B 1 54  ? -6.260  -9.088  46.994  1.00 61.26  ? 54  ARG B NH2 1 
ATOM   2560  N  N   . GLY B 1 55  ? -13.492 -4.284  50.099  1.00 74.07  ? 55  GLY B N   1 
ATOM   2561  C  CA  . GLY B 1 55  ? -14.713 -4.774  50.721  1.00 88.28  ? 55  GLY B CA  1 
ATOM   2562  C  C   . GLY B 1 55  ? -15.810 -4.944  49.686  1.00 72.82  ? 55  GLY B C   1 
ATOM   2563  O  O   . GLY B 1 55  ? -15.545 -4.814  48.490  1.00 68.97  ? 55  GLY B O   1 
ATOM   2564  N  N   . GLU B 1 56  ? -17.028 -5.215  50.141  1.00 59.03  ? 56  GLU B N   1 
ATOM   2565  C  CA  . GLU B 1 56  ? -18.172 -5.298  49.246  1.00 83.46  ? 56  GLU B CA  1 
ATOM   2566  C  C   . GLU B 1 56  ? -18.464 -3.913  48.683  1.00 85.78  ? 56  GLU B C   1 
ATOM   2567  O  O   . GLU B 1 56  ? -19.399 -3.728  47.906  1.00 94.89  ? 56  GLU B O   1 
ATOM   2568  C  CB  . GLU B 1 56  ? -19.396 -5.837  49.987  1.00 106.78 ? 56  GLU B CB  1 
ATOM   2569  C  CG  . GLU B 1 56  ? -20.724 -5.472  49.344  1.00 121.79 ? 56  GLU B CG  1 
ATOM   2570  C  CD  . GLU B 1 56  ? -21.819 -6.474  49.659  1.00 124.97 ? 56  GLU B CD  1 
ATOM   2571  O  OE1 . GLU B 1 56  ? -22.948 -6.043  49.975  1.00 126.39 ? 56  GLU B OE1 1 
ATOM   2572  O  OE2 . GLU B 1 56  ? -21.551 -7.692  49.590  1.00 120.47 ? 56  GLU B OE2 1 
ATOM   2573  N  N   . LYS B 1 57  ? -17.650 -2.943  49.087  1.00 77.56  ? 57  LYS B N   1 
ATOM   2574  C  CA  . LYS B 1 57  ? -17.805 -1.566  48.636  1.00 77.58  ? 57  LYS B CA  1 
ATOM   2575  C  C   . LYS B 1 57  ? -17.499 -1.437  47.150  1.00 71.49  ? 57  LYS B C   1 
ATOM   2576  O  O   . LYS B 1 57  ? -17.706 -0.382  46.552  1.00 64.88  ? 57  LYS B O   1 
ATOM   2577  C  CB  . LYS B 1 57  ? -16.897 -0.635  49.442  1.00 88.54  ? 57  LYS B CB  1 
ATOM   2578  C  CG  . LYS B 1 57  ? -16.627 0.701   48.774  1.00 86.94  ? 57  LYS B CG  1 
ATOM   2579  C  CD  . LYS B 1 57  ? -16.036 1.696   49.758  1.00 82.76  ? 57  LYS B CD  1 
ATOM   2580  C  CE  . LYS B 1 57  ? -16.143 1.187   51.186  1.00 76.10  ? 57  LYS B CE  1 
ATOM   2581  N  NZ  . LYS B 1 57  ? -14.829 1.211   51.884  1.00 82.79  ? 57  LYS B NZ  1 
ATOM   2582  N  N   . ILE B 1 58  ? -17.004 -2.519  46.558  1.00 66.03  ? 58  ILE B N   1 
ATOM   2583  C  CA  . ILE B 1 58  ? -16.707 -2.542  45.132  1.00 51.42  ? 58  ILE B CA  1 
ATOM   2584  C  C   . ILE B 1 58  ? -17.931 -2.998  44.348  1.00 56.00  ? 58  ILE B C   1 
ATOM   2585  O  O   . ILE B 1 58  ? -18.026 -4.156  43.945  1.00 69.56  ? 58  ILE B O   1 
ATOM   2586  C  CB  . ILE B 1 58  ? -15.524 -3.474  44.816  1.00 49.99  ? 58  ILE B CB  1 
ATOM   2587  C  CG1 . ILE B 1 58  ? -14.222 -2.674  44.740  1.00 56.32  ? 58  ILE B CG1 1 
ATOM   2588  C  CG2 . ILE B 1 58  ? -15.768 -4.223  43.517  1.00 65.02  ? 58  ILE B CG2 1 
ATOM   2589  C  CD1 . ILE B 1 58  ? -13.257 -2.969  45.866  1.00 65.79  ? 58  ILE B CD1 1 
ATOM   2590  N  N   . ASP B 1 59  ? -18.869 -2.081  44.142  1.00 59.08  ? 59  ASP B N   1 
ATOM   2591  C  CA  . ASP B 1 59  ? -20.104 -2.391  43.433  1.00 52.35  ? 59  ASP B CA  1 
ATOM   2592  C  C   . ASP B 1 59  ? -19.948 -2.193  41.931  1.00 57.84  ? 59  ASP B C   1 
ATOM   2593  O  O   . ASP B 1 59  ? -18.833 -2.173  41.411  1.00 62.29  ? 59  ASP B O   1 
ATOM   2594  C  CB  . ASP B 1 59  ? -21.250 -1.525  43.959  1.00 70.96  ? 59  ASP B CB  1 
ATOM   2595  C  CG  . ASP B 1 59  ? -20.783 -0.159  44.422  1.00 70.72  ? 59  ASP B CG  1 
ATOM   2596  O  OD1 . ASP B 1 59  ? -21.436 0.426   45.311  1.00 76.81  ? 59  ASP B OD1 1 
ATOM   2597  O  OD2 . ASP B 1 59  ? -19.762 0.330   43.896  1.00 55.51  ? 59  ASP B OD2 1 
ATOM   2598  N  N   . GLU B 1 60  ? -21.072 -2.049  41.237  1.00 59.02  ? 60  GLU B N   1 
ATOM   2599  C  CA  . GLU B 1 60  ? -21.057 -1.854  39.803  1.00 66.36  ? 60  GLU B CA  1 
ATOM   2600  C  C   . GLU B 1 60  ? -20.854 -0.392  39.467  1.00 55.78  ? 60  GLU B C   1 
ATOM   2601  O  O   . GLU B 1 60  ? -20.528 -0.046  38.332  1.00 45.13  ? 60  GLU B O   1 
ATOM   2602  C  CB  . GLU B 1 60  ? -22.362 -2.371  39.176  1.00 76.30  ? 60  GLU B CB  1 
ATOM   2603  C  CG  . GLU B 1 60  ? -22.545 -3.895  39.200  1.00 79.28  ? 60  GLU B CG  1 
ATOM   2604  C  CD  . GLU B 1 60  ? -22.022 -4.559  37.929  1.00 101.71 ? 60  GLU B CD  1 
ATOM   2605  O  OE1 . GLU B 1 60  ? -20.823 -4.900  37.907  1.00 115.14 ? 60  GLU B OE1 1 
ATOM   2606  O  OE2 . GLU B 1 60  ? -22.795 -4.739  36.953  1.00 106.64 ? 60  GLU B OE2 1 
ATOM   2607  N  N   . ASN B 1 61  ? -21.036 0.467   40.464  1.00 61.78  ? 61  ASN B N   1 
ATOM   2608  C  CA  . ASN B 1 61  ? -20.790 1.892   40.298  1.00 67.55  ? 61  ASN B CA  1 
ATOM   2609  C  C   . ASN B 1 61  ? -19.305 2.156   40.085  1.00 57.83  ? 61  ASN B C   1 
ATOM   2610  O  O   . ASN B 1 61  ? -18.914 2.822   39.128  1.00 71.93  ? 61  ASN B O   1 
ATOM   2611  C  CB  . ASN B 1 61  ? -21.297 2.668   41.513  1.00 80.50  ? 61  ASN B CB  1 
ATOM   2612  C  CG  . ASN B 1 61  ? -22.778 2.978   41.429  1.00 99.77  ? 61  ASN B CG  1 
ATOM   2613  O  OD1 . ASN B 1 61  ? -23.218 3.730   40.559  1.00 116.66 ? 61  ASN B OD1 1 
ATOM   2614  N  ND2 . ASN B 1 61  ? -23.556 2.397   42.334  1.00 93.42  ? 61  ASN B ND2 1 
ATOM   2615  N  N   . VAL B 1 62  ? -18.482 1.622   40.983  1.00 39.57  ? 62  VAL B N   1 
ATOM   2616  C  CA  . VAL B 1 62  ? -17.040 1.733   40.850  1.00 49.26  ? 62  VAL B CA  1 
ATOM   2617  C  C   . VAL B 1 62  ? -16.575 1.151   39.526  1.00 50.78  ? 62  VAL B C   1 
ATOM   2618  O  O   . VAL B 1 62  ? -15.770 1.762   38.815  1.00 59.70  ? 62  VAL B O   1 
ATOM   2619  C  CB  . VAL B 1 62  ? -16.314 1.073   42.046  1.00 41.00  ? 62  VAL B CB  1 
ATOM   2620  C  CG1 . VAL B 1 62  ? -14.882 0.798   41.730  1.00 30.07  ? 62  VAL B CG1 1 
ATOM   2621  C  CG2 . VAL B 1 62  ? -16.395 1.980   43.254  1.00 45.40  ? 62  VAL B CG2 1 
ATOM   2622  N  N   . LYS B 1 63  ? -17.114 -0.009  39.181  1.00 44.95  ? 63  LYS B N   1 
ATOM   2623  C  CA  . LYS B 1 63  ? -16.787 -0.667  37.921  1.00 44.29  ? 63  LYS B CA  1 
ATOM   2624  C  C   . LYS B 1 63  ? -17.195 0.204   36.739  1.00 44.57  ? 63  LYS B C   1 
ATOM   2625  O  O   . LYS B 1 63  ? -16.447 0.384   35.767  1.00 53.46  ? 63  LYS B O   1 
ATOM   2626  C  CB  . LYS B 1 63  ? -17.492 -2.011  37.824  1.00 46.84  ? 63  LYS B CB  1 
ATOM   2627  C  CG  . LYS B 1 63  ? -17.077 -2.825  36.629  1.00 56.85  ? 63  LYS B CG  1 
ATOM   2628  C  CD  . LYS B 1 63  ? -17.977 -4.025  36.452  1.00 61.81  ? 63  LYS B CD  1 
ATOM   2629  C  CE  . LYS B 1 63  ? -19.226 -3.626  35.697  1.00 75.76  ? 63  LYS B CE  1 
ATOM   2630  N  NZ  . LYS B 1 63  ? -20.218 -4.745  35.593  1.00 93.67  ? 63  LYS B NZ  1 
ATOM   2631  N  N   . ARG B 1 64  ? -18.397 0.765   36.817  1.00 26.20  ? 64  ARG B N   1 
ATOM   2632  C  CA  . ARG B 1 64  ? -18.904 1.625   35.752  1.00 43.40  ? 64  ARG B CA  1 
ATOM   2633  C  C   . ARG B 1 64  ? -17.959 2.794   35.476  1.00 52.34  ? 64  ARG B C   1 
ATOM   2634  O  O   . ARG B 1 64  ? -17.573 3.044   34.334  1.00 59.83  ? 64  ARG B O   1 
ATOM   2635  C  CB  . ARG B 1 64  ? -20.297 2.150   36.104  1.00 46.58  ? 64  ARG B CB  1 
ATOM   2636  C  CG  . ARG B 1 64  ? -20.911 3.046   35.042  1.00 46.83  ? 64  ARG B CG  1 
ATOM   2637  C  CD  . ARG B 1 64  ? -21.576 4.261   35.665  1.00 63.26  ? 64  ARG B CD  1 
ATOM   2638  N  NE  . ARG B 1 64  ? -22.277 3.927   36.901  1.00 79.78  ? 64  ARG B NE  1 
ATOM   2639  C  CZ  . ARG B 1 64  ? -22.191 4.633   38.023  1.00 83.07  ? 64  ARG B CZ  1 
ATOM   2640  N  NH1 . ARG B 1 64  ? -21.431 5.718   38.070  1.00 72.33  ? 64  ARG B NH1 1 
ATOM   2641  N  NH2 . ARG B 1 64  ? -22.863 4.254   39.101  1.00 85.78  ? 64  ARG B NH2 1 
ATOM   2642  N  N   . GLU B 1 65  ? -17.593 3.499   36.543  1.00 42.53  ? 65  GLU B N   1 
ATOM   2643  C  CA  . GLU B 1 65  ? -16.697 4.645   36.452  1.00 35.87  ? 65  GLU B CA  1 
ATOM   2644  C  C   . GLU B 1 65  ? -15.362 4.259   35.827  1.00 37.98  ? 65  GLU B C   1 
ATOM   2645  O  O   . GLU B 1 65  ? -14.932 4.864   34.846  1.00 53.28  ? 65  GLU B O   1 
ATOM   2646  C  CB  . GLU B 1 65  ? -16.471 5.257   37.835  1.00 35.90  ? 65  GLU B CB  1 
ATOM   2647  C  CG  . GLU B 1 65  ? -17.748 5.672   38.544  1.00 54.18  ? 65  GLU B CG  1 
ATOM   2648  C  CD  . GLU B 1 65  ? -17.491 6.208   39.938  1.00 72.21  ? 65  GLU B CD  1 
ATOM   2649  O  OE1 . GLU B 1 65  ? -16.594 5.676   40.624  1.00 76.82  ? 65  GLU B OE1 1 
ATOM   2650  O  OE2 . GLU B 1 65  ? -18.188 7.160   40.349  1.00 84.36  ? 65  GLU B OE2 1 
ATOM   2651  N  N   . ILE B 1 66  ? -14.708 3.253   36.399  1.00 30.60  ? 66  ILE B N   1 
ATOM   2652  C  CA  . ILE B 1 66  ? -13.441 2.781   35.855  1.00 18.66  ? 66  ILE B CA  1 
ATOM   2653  C  C   . ILE B 1 66  ? -13.480 2.548   34.368  1.00 33.04  ? 66  ILE B C   1 
ATOM   2654  O  O   . ILE B 1 66  ? -12.543 2.939   33.676  1.00 39.64  ? 66  ILE B O   1 
ATOM   2655  C  CB  . ILE B 1 66  ? -12.983 1.455   36.527  1.00 41.02  ? 66  ILE B CB  1 
ATOM   2656  C  CG1 . ILE B 1 66  ? -12.655 1.662   38.006  1.00 37.75  ? 66  ILE B CG1 1 
ATOM   2657  C  CG2 . ILE B 1 66  ? -11.781 0.863   35.825  1.00 28.30  ? 66  ILE B CG2 1 
ATOM   2658  C  CD1 . ILE B 1 66  ? -11.986 0.455   38.623  1.00 34.91  ? 66  ILE B CD1 1 
ATOM   2659  N  N   . ILE B 1 67  ? -14.514 1.866   33.884  1.00 34.91  ? 67  ILE B N   1 
ATOM   2660  C  CA  . ILE B 1 67  ? -14.607 1.524   32.470  1.00 48.86  ? 67  ILE B CA  1 
ATOM   2661  C  C   . ILE B 1 67  ? -14.805 2.781   31.643  1.00 29.17  ? 67  ILE B C   1 
ATOM   2662  O  O   . ILE B 1 67  ? -14.119 3.005   30.645  1.00 34.83  ? 67  ILE B O   1 
ATOM   2663  C  CB  . ILE B 1 67  ? -15.769 0.551   32.201  1.00 43.17  ? 67  ILE B CB  1 
ATOM   2664  C  CG1 . ILE B 1 67  ? -15.267 -0.894  32.214  1.00 38.18  ? 67  ILE B CG1 1 
ATOM   2665  C  CG2 . ILE B 1 67  ? -16.437 0.875   30.875  1.00 32.45  ? 67  ILE B CG2 1 
ATOM   2666  C  CD1 . ILE B 1 67  ? -15.447 -1.590  33.545  1.00 42.03  ? 67  ILE B CD1 1 
ATOM   2667  N  N   . ASN B 1 68  ? -15.753 3.604   32.073  1.00 30.77  ? 68  ASN B N   1 
ATOM   2668  C  CA  . ASN B 1 68  ? -16.024 4.897   31.427  1.00 43.74  ? 68  ASN B CA  1 
ATOM   2669  C  C   . ASN B 1 68  ? -14.759 5.695   31.265  1.00 40.61  ? 68  ASN B C   1 
ATOM   2670  O  O   . ASN B 1 68  ? -14.464 6.187   30.190  1.00 48.41  ? 68  ASN B O   1 
ATOM   2671  C  CB  . ASN B 1 68  ? -17.026 5.719   32.244  1.00 40.44  ? 68  ASN B CB  1 
ATOM   2672  C  CG  . ASN B 1 68  ? -18.469 5.455   31.842  1.00 58.85  ? 68  ASN B CG  1 
ATOM   2673  O  OD1 . ASN B 1 68  ? -18.766 5.236   30.676  1.00 82.86  ? 68  ASN B OD1 1 
ATOM   2674  N  ND2 . ASN B 1 68  ? -19.365 5.473   32.806  1.00 47.37  ? 68  ASN B ND2 1 
ATOM   2675  N  N   . HIS B 1 69  ? -14.008 5.830   32.354  1.00 39.97  ? 69  HIS B N   1 
ATOM   2676  C  CA  . HIS B 1 69  ? -12.760 6.582   32.344  1.00 43.64  ? 69  HIS B CA  1 
ATOM   2677  C  C   . HIS B 1 69  ? -11.722 5.899   31.461  1.00 38.85  ? 69  HIS B C   1 
ATOM   2678  O  O   . HIS B 1 69  ? -10.912 6.558   30.810  1.00 40.61  ? 69  HIS B O   1 
ATOM   2679  C  CB  . HIS B 1 69  ? -12.220 6.737   33.767  1.00 45.39  ? 69  HIS B CB  1 
ATOM   2680  C  CG  . HIS B 1 69  ? -11.028 7.637   33.867  1.00 45.09  ? 69  HIS B CG  1 
ATOM   2681  N  ND1 . HIS B 1 69  ? -10.335 7.823   35.044  1.00 46.09  ? 69  HIS B ND1 1 
ATOM   2682  C  CD2 . HIS B 1 69  ? -10.408 8.402   32.939  1.00 25.78  ? 69  HIS B CD2 1 
ATOM   2683  C  CE1 . HIS B 1 69  ? -9.338  8.665   34.835  1.00 30.45  ? 69  HIS B CE1 1 
ATOM   2684  N  NE2 . HIS B 1 69  ? -9.359  9.031   33.566  1.00 38.53  ? 69  HIS B NE2 1 
ATOM   2685  N  N   . ARG B 1 70  ? -11.761 4.571   31.437  1.00 44.67  ? 70  ARG B N   1 
ATOM   2686  C  CA  . ARG B 1 70  ? -10.819 3.788   30.647  1.00 31.46  ? 70  ARG B CA  1 
ATOM   2687  C  C   . ARG B 1 70  ? -10.993 4.017   29.148  1.00 37.82  ? 70  ARG B C   1 
ATOM   2688  O  O   . ARG B 1 70  ? -10.054 3.833   28.374  1.00 32.58  ? 70  ARG B O   1 
ATOM   2689  C  CB  . ARG B 1 70  ? -10.960 2.299   30.969  1.00 36.50  ? 70  ARG B CB  1 
ATOM   2690  C  CG  . ARG B 1 70  ? -9.767  1.456   30.545  1.00 42.39  ? 70  ARG B CG  1 
ATOM   2691  C  CD  . ARG B 1 70  ? -9.554  1.517   29.041  1.00 41.83  ? 70  ARG B CD  1 
ATOM   2692  N  NE  . ARG B 1 70  ? -8.456  0.657   28.609  1.00 34.01  ? 70  ARG B NE  1 
ATOM   2693  C  CZ  . ARG B 1 70  ? -8.111  0.469   27.340  1.00 55.63  ? 70  ARG B CZ  1 
ATOM   2694  N  NH1 . ARG B 1 70  ? -8.778  1.080   26.371  1.00 67.23  ? 70  ARG B NH1 1 
ATOM   2695  N  NH2 . ARG B 1 70  ? -7.098  -0.332  27.038  1.00 56.47  ? 70  ARG B NH2 1 
ATOM   2696  N  N   . SER B 1 71  ? -12.194 4.416   28.740  1.00 47.34  ? 71  SER B N   1 
ATOM   2697  C  CA  . SER B 1 71  ? -12.472 4.635   27.334  1.00 53.47  ? 71  SER B CA  1 
ATOM   2698  C  C   . SER B 1 71  ? -12.024 5.993   26.819  1.00 54.14  ? 71  SER B C   1 
ATOM   2699  O  O   . SER B 1 71  ? -11.954 6.204   25.609  1.00 64.53  ? 71  SER B O   1 
ATOM   2700  C  CB  . SER B 1 71  ? -13.965 4.459   27.068  1.00 61.54  ? 71  SER B CB  1 
ATOM   2701  O  OG  . SER B 1 71  ? -14.689 5.570   27.561  1.00 54.39  ? 71  SER B OG  1 
ATOM   2702  N  N   . LEU B 1 72  ? -11.717 6.913   27.727  1.00 55.61  ? 72  LEU B N   1 
ATOM   2703  C  CA  . LEU B 1 72  ? -11.347 8.277   27.321  1.00 47.97  ? 72  LEU B CA  1 
ATOM   2704  C  C   . LEU B 1 72  ? -9.883  8.351   26.883  1.00 40.08  ? 72  LEU B C   1 
ATOM   2705  O  O   . LEU B 1 72  ? -8.988  8.142   27.676  1.00 44.76  ? 72  LEU B O   1 
ATOM   2706  C  CB  . LEU B 1 72  ? -11.683 9.280   28.428  1.00 41.66  ? 72  LEU B CB  1 
ATOM   2707  C  CG  . LEU B 1 72  ? -13.180 9.308   28.758  1.00 42.12  ? 72  LEU B CG  1 
ATOM   2708  C  CD1 . LEU B 1 72  ? -13.445 10.263  29.917  1.00 58.22  ? 72  LEU B CD1 1 
ATOM   2709  C  CD2 . LEU B 1 72  ? -13.981 9.697   27.538  1.00 40.77  ? 72  LEU B CD2 1 
ATOM   2710  N  N   . ARG B 1 73  ? -9.665  8.600   25.598  1.00 44.84  ? 73  ARG B N   1 
ATOM   2711  C  CA  . ARG B 1 73  ? -8.317  8.621   25.050  1.00 49.51  ? 73  ARG B CA  1 
ATOM   2712  C  C   . ARG B 1 73  ? -8.090  9.899   24.262  1.00 48.69  ? 73  ARG B C   1 
ATOM   2713  O  O   . ARG B 1 73  ? -8.081  9.888   23.032  1.00 52.75  ? 73  ARG B O   1 
ATOM   2714  C  CB  . ARG B 1 73  ? -8.084  7.401   24.159  1.00 67.13  ? 73  ARG B CB  1 
ATOM   2715  C  CG  . ARG B 1 73  ? -7.011  7.598   23.102  1.00 85.33  ? 73  ARG B CG  1 
ATOM   2716  C  CD  . ARG B 1 73  ? -7.228  6.672   21.916  1.00 103.70 ? 73  ARG B CD  1 
ATOM   2717  N  NE  . ARG B 1 73  ? -6.537  5.397   22.082  1.00 116.79 ? 73  ARG B NE  1 
ATOM   2718  C  CZ  . ARG B 1 73  ? -6.960  4.246   21.570  1.00 117.19 ? 73  ARG B CZ  1 
ATOM   2719  N  NH1 . ARG B 1 73  ? -8.077  4.206   20.857  1.00 116.80 ? 73  ARG B NH1 1 
ATOM   2720  N  NH2 . ARG B 1 73  ? -6.267  3.134   21.772  1.00 111.33 ? 73  ARG B NH2 1 
ATOM   2721  N  N   . HIS B 1 74  ? -7.910  11.002  24.978  1.00 44.02  ? 74  HIS B N   1 
ATOM   2722  C  CA  . HIS B 1 74  ? -7.710  12.296  24.330  1.00 36.95  ? 74  HIS B CA  1 
ATOM   2723  C  C   . HIS B 1 74  ? -6.690  13.046  25.153  1.00 42.61  ? 74  HIS B C   1 
ATOM   2724  O  O   . HIS B 1 74  ? -6.711  13.011  26.394  1.00 40.66  ? 74  HIS B O   1 
ATOM   2725  C  CB  . HIS B 1 74  ? -9.023  13.067  24.244  1.00 34.94  ? 74  HIS B CB  1 
ATOM   2726  C  CG  . HIS B 1 74  ? -8.977  14.309  23.394  1.00 46.62  ? 74  HIS B CG  1 
ATOM   2727  N  ND1 . HIS B 1 74  ? -8.555  15.533  23.901  1.00 53.21  ? 74  HIS B ND1 1 
ATOM   2728  C  CD2 . HIS B 1 74  ? -9.355  14.517  22.130  1.00 44.65  ? 74  HIS B CD2 1 
ATOM   2729  C  CE1 . HIS B 1 74  ? -8.669  16.433  22.944  1.00 54.14  ? 74  HIS B CE1 1 
ATOM   2730  N  NE2 . HIS B 1 74  ? -9.143  15.865  21.859  1.00 40.42  ? 74  HIS B NE2 1 
ATOM   2731  N  N   . PRO B 1 75  ? -5.764  13.692  24.450  1.00 37.72  ? 75  PRO B N   1 
ATOM   2732  C  CA  . PRO B 1 75  ? -4.675  14.510  24.979  1.00 39.76  ? 75  PRO B CA  1 
ATOM   2733  C  C   . PRO B 1 75  ? -5.159  15.487  26.067  1.00 47.03  ? 75  PRO B C   1 
ATOM   2734  O  O   . PRO B 1 75  ? -4.537  15.555  27.134  1.00 54.81  ? 75  PRO B O   1 
ATOM   2735  C  CB  . PRO B 1 75  ? -4.194  15.273  23.741  1.00 46.25  ? 75  PRO B CB  1 
ATOM   2736  C  CG  . PRO B 1 75  ? -4.537  14.362  22.595  1.00 56.77  ? 75  PRO B CG  1 
ATOM   2737  C  CD  . PRO B 1 75  ? -5.839  13.733  22.979  1.00 40.77  ? 75  PRO B CD  1 
ATOM   2738  N  N   . ASN B 1 76  ? -6.253  16.197  25.810  1.00 39.40  ? 76  ASN B N   1 
ATOM   2739  C  CA  . ASN B 1 76  ? -6.771  17.167  26.766  1.00 46.03  ? 76  ASN B CA  1 
ATOM   2740  C  C   . ASN B 1 76  ? -7.663  16.563  27.851  1.00 45.70  ? 76  ASN B C   1 
ATOM   2741  O  O   . ASN B 1 76  ? -8.388  17.284  28.534  1.00 50.90  ? 76  ASN B O   1 
ATOM   2742  C  CB  . ASN B 1 76  ? -7.509  18.292  26.038  1.00 34.16  ? 76  ASN B CB  1 
ATOM   2743  C  CG  . ASN B 1 76  ? -6.603  19.075  25.109  1.00 38.35  ? 76  ASN B CG  1 
ATOM   2744  O  OD1 . ASN B 1 76  ? -6.783  19.064  23.892  1.00 49.50  ? 76  ASN B OD1 1 
ATOM   2745  N  ND2 . ASN B 1 76  ? -5.619  19.758  25.680  1.00 49.72  ? 76  ASN B ND2 1 
ATOM   2746  N  N   . ILE B 1 77  ? -7.605  15.244  28.013  1.00 51.19  ? 77  ILE B N   1 
ATOM   2747  C  CA  . ILE B 1 77  ? -8.378  14.582  29.059  1.00 46.89  ? 77  ILE B CA  1 
ATOM   2748  C  C   . ILE B 1 77  ? -7.447  13.852  29.996  1.00 51.13  ? 77  ILE B C   1 
ATOM   2749  O  O   . ILE B 1 77  ? -6.407  13.333  29.579  1.00 50.84  ? 77  ILE B O   1 
ATOM   2750  C  CB  . ILE B 1 77  ? -9.398  13.614  28.487  1.00 46.53  ? 77  ILE B CB  1 
ATOM   2751  C  CG1 . ILE B 1 77  ? -10.264 14.363  27.473  1.00 39.31  ? 77  ILE B CG1 1 
ATOM   2752  C  CG2 . ILE B 1 77  ? -10.228 12.987  29.622  1.00 48.01  ? 77  ILE B CG2 1 
ATOM   2753  C  CD1 . ILE B 1 77  ? -11.685 14.251  27.749  1.00 34.47  ? 77  ILE B CD1 1 
ATOM   2754  N  N   . VAL B 1 78  ? -7.820  13.790  31.270  1.00 49.63  ? 78  VAL B N   1 
ATOM   2755  C  CA  . VAL B 1 78  ? -7.052  13.030  32.248  1.00 38.72  ? 78  VAL B CA  1 
ATOM   2756  C  C   . VAL B 1 78  ? -7.206  11.540  31.968  1.00 47.63  ? 78  VAL B C   1 
ATOM   2757  O  O   . VAL B 1 78  ? -8.128  10.896  32.468  1.00 48.42  ? 78  VAL B O   1 
ATOM   2758  C  CB  . VAL B 1 78  ? -7.506  13.329  33.686  1.00 43.41  ? 78  VAL B CB  1 
ATOM   2759  C  CG1 . VAL B 1 78  ? -6.812  12.396  34.665  1.00 36.90  ? 78  VAL B CG1 1 
ATOM   2760  C  CG2 . VAL B 1 78  ? -7.229  14.781  34.038  1.00 47.80  ? 78  VAL B CG2 1 
ATOM   2761  N  N   . ARG B 1 79  ? -6.301  11.002  31.158  1.00 42.11  ? 79  ARG B N   1 
ATOM   2762  C  CA  . ARG B 1 79  ? -6.375  9.612   30.721  1.00 56.58  ? 79  ARG B CA  1 
ATOM   2763  C  C   . ARG B 1 79  ? -6.258  8.609   31.864  1.00 45.06  ? 79  ARG B C   1 
ATOM   2764  O  O   . ARG B 1 79  ? -5.523  8.829   32.827  1.00 42.54  ? 79  ARG B O   1 
ATOM   2765  C  CB  . ARG B 1 79  ? -5.298  9.327   29.671  1.00 72.47  ? 79  ARG B CB  1 
ATOM   2766  C  CG  . ARG B 1 79  ? -5.837  9.124   28.266  1.00 90.74  ? 79  ARG B CG  1 
ATOM   2767  C  CD  . ARG B 1 79  ? -5.795  10.416  27.470  1.00 89.98  ? 79  ARG B CD  1 
ATOM   2768  N  NE  . ARG B 1 79  ? -4.470  11.028  27.492  1.00 93.73  ? 79  ARG B NE  1 
ATOM   2769  C  CZ  . ARG B 1 79  ? -3.578  10.911  26.515  1.00 101.08 ? 79  ARG B CZ  1 
ATOM   2770  N  NH1 . ARG B 1 79  ? -3.868  10.202  25.432  1.00 105.90 ? 79  ARG B NH1 1 
ATOM   2771  N  NH2 . ARG B 1 79  ? -2.397  11.503  26.618  1.00 98.60  ? 79  ARG B NH2 1 
ATOM   2772  N  N   . PHE B 1 80  ? -6.985  7.503   31.744  1.00 48.15  ? 80  PHE B N   1 
ATOM   2773  C  CA  . PHE B 1 80  ? -6.906  6.413   32.707  1.00 35.96  ? 80  PHE B CA  1 
ATOM   2774  C  C   . PHE B 1 80  ? -5.666  5.581   32.407  1.00 47.11  ? 80  PHE B C   1 
ATOM   2775  O  O   . PHE B 1 80  ? -5.306  5.393   31.245  1.00 46.74  ? 80  PHE B O   1 
ATOM   2776  C  CB  . PHE B 1 80  ? -8.163  5.545   32.633  1.00 29.11  ? 80  PHE B CB  1 
ATOM   2777  C  CG  . PHE B 1 80  ? -8.039  4.230   33.346  1.00 37.47  ? 80  PHE B CG  1 
ATOM   2778  C  CD1 . PHE B 1 80  ? -7.418  3.153   32.738  1.00 34.25  ? 80  PHE B CD1 1 
ATOM   2779  C  CD2 . PHE B 1 80  ? -8.548  4.069   34.623  1.00 31.76  ? 80  PHE B CD2 1 
ATOM   2780  C  CE1 . PHE B 1 80  ? -7.305  1.941   33.390  1.00 41.44  ? 80  PHE B CE1 1 
ATOM   2781  C  CE2 . PHE B 1 80  ? -8.439  2.859   35.281  1.00 33.41  ? 80  PHE B CE2 1 
ATOM   2782  C  CZ  . PHE B 1 80  ? -7.816  1.795   34.663  1.00 38.28  ? 80  PHE B CZ  1 
ATOM   2783  N  N   . LYS B 1 81  ? -5.006  5.090   33.450  1.00 51.95  ? 81  LYS B N   1 
ATOM   2784  C  CA  . LYS B 1 81  ? -3.743  4.383   33.270  1.00 42.23  ? 81  LYS B CA  1 
ATOM   2785  C  C   . LYS B 1 81  ? -3.912  2.871   33.371  1.00 49.08  ? 81  LYS B C   1 
ATOM   2786  O  O   . LYS B 1 81  ? -3.649  2.142   32.415  1.00 43.46  ? 81  LYS B O   1 
ATOM   2787  C  CB  . LYS B 1 81  ? -2.711  4.863   34.294  1.00 43.76  ? 81  LYS B CB  1 
ATOM   2788  C  CG  . LYS B 1 81  ? -1.831  5.999   33.802  1.00 47.14  ? 81  LYS B CG  1 
ATOM   2789  C  CD  . LYS B 1 81  ? -1.024  5.585   32.584  1.00 48.25  ? 81  LYS B CD  1 
ATOM   2790  C  CE  . LYS B 1 81  ? -0.040  6.670   32.182  1.00 65.68  ? 81  LYS B CE  1 
ATOM   2791  N  NZ  . LYS B 1 81  ? 1.372   6.212   32.304  1.00 78.59  ? 81  LYS B NZ  1 
ATOM   2792  N  N   . GLU B 1 82  ? -4.346  2.403   34.537  1.00 38.29  ? 82  GLU B N   1 
ATOM   2793  C  CA  . GLU B 1 82  ? -4.515  0.975   34.770  1.00 37.75  ? 82  GLU B CA  1 
ATOM   2794  C  C   . GLU B 1 82  ? -4.941  0.699   36.206  1.00 43.94  ? 82  GLU B C   1 
ATOM   2795  O  O   . GLU B 1 82  ? -4.825  1.564   37.074  1.00 47.52  ? 82  GLU B O   1 
ATOM   2796  C  CB  . GLU B 1 82  ? -3.210  0.236   34.476  1.00 34.79  ? 82  GLU B CB  1 
ATOM   2797  C  CG  . GLU B 1 82  ? -2.228  0.245   35.637  1.00 29.69  ? 82  GLU B CG  1 
ATOM   2798  C  CD  . GLU B 1 82  ? -1.077  -0.721  35.440  1.00 60.57  ? 82  GLU B CD  1 
ATOM   2799  O  OE1 . GLU B 1 82  ? 0.089   -0.287  35.547  1.00 59.06  ? 82  GLU B OE1 1 
ATOM   2800  O  OE2 . GLU B 1 82  ? -1.337  -1.915  35.182  1.00 68.33  ? 82  GLU B OE2 1 
ATOM   2801  N  N   . VAL B 1 83  ? -5.428  -0.512  36.453  1.00 42.69  ? 83  VAL B N   1 
ATOM   2802  C  CA  . VAL B 1 83  ? -5.795  -0.929  37.819  1.00 31.97  ? 83  VAL B CA  1 
ATOM   2803  C  C   . VAL B 1 83  ? -4.835  -1.969  38.334  1.00 42.45  ? 83  VAL B C   1 
ATOM   2804  O  O   . VAL B 1 83  ? -4.372  -2.823  37.593  1.00 41.72  ? 83  VAL B O   1 
ATOM   2805  C  CB  . VAL B 1 83  ? -7.201  -1.531  37.956  1.00 30.19  ? 83  VAL B CB  1 
ATOM   2806  C  CG1 . VAL B 1 83  ? -8.247  -0.446  38.206  1.00 30.91  ? 83  VAL B CG1 1 
ATOM   2807  C  CG2 . VAL B 1 83  ? -7.553  -2.361  36.747  1.00 38.09  ? 83  VAL B CG2 1 
ATOM   2808  N  N   . ILE B 1 84  ? -4.526  -1.874  39.618  1.00 41.36  ? 84  ILE B N   1 
ATOM   2809  C  CA  . ILE B 1 84  ? -3.621  -2.798  40.280  1.00 44.95  ? 84  ILE B CA  1 
ATOM   2810  C  C   . ILE B 1 84  ? -4.322  -3.284  41.523  1.00 46.71  ? 84  ILE B C   1 
ATOM   2811  O  O   . ILE B 1 84  ? -4.978  -2.509  42.201  1.00 53.59  ? 84  ILE B O   1 
ATOM   2812  C  CB  . ILE B 1 84  ? -2.345  -2.107  40.736  1.00 51.50  ? 84  ILE B CB  1 
ATOM   2813  C  CG1 . ILE B 1 84  ? -1.740  -1.280  39.606  1.00 47.72  ? 84  ILE B CG1 1 
ATOM   2814  C  CG2 . ILE B 1 84  ? -1.353  -3.137  41.232  1.00 49.38  ? 84  ILE B CG2 1 
ATOM   2815  C  CD1 . ILE B 1 84  ? -0.365  -0.816  39.914  1.00 43.89  ? 84  ILE B CD1 1 
ATOM   2816  N  N   . LEU B 1 85  ? -4.191  -4.574  41.811  1.00 53.44  ? 85  LEU B N   1 
ATOM   2817  C  CA  . LEU B 1 85  ? -4.848  -5.167  42.968  1.00 46.31  ? 85  LEU B CA  1 
ATOM   2818  C  C   . LEU B 1 85  ? -3.881  -5.334  44.133  1.00 42.79  ? 85  LEU B C   1 
ATOM   2819  O  O   . LEU B 1 85  ? -2.861  -6.010  44.014  1.00 52.33  ? 85  LEU B O   1 
ATOM   2820  C  CB  . LEU B 1 85  ? -5.463  -6.519  42.597  1.00 51.47  ? 85  LEU B CB  1 
ATOM   2821  C  CG  . LEU B 1 85  ? -5.836  -7.440  43.760  1.00 62.41  ? 85  LEU B CG  1 
ATOM   2822  C  CD1 . LEU B 1 85  ? -5.743  -6.697  45.083  1.00 80.04  ? 85  LEU B CD1 1 
ATOM   2823  C  CD2 . LEU B 1 85  ? -7.227  -8.016  43.561  1.00 59.57  ? 85  LEU B CD2 1 
ATOM   2824  N  N   . THR B 1 86  ? -4.211  -4.711  45.260  1.00 48.68  ? 86  THR B N   1 
ATOM   2825  C  CA  . THR B 1 86  ? -3.395  -4.819  46.461  1.00 60.34  ? 86  THR B CA  1 
ATOM   2826  C  C   . THR B 1 86  ? -4.107  -5.663  47.510  1.00 69.87  ? 86  THR B C   1 
ATOM   2827  O  O   . THR B 1 86  ? -5.306  -5.509  47.735  1.00 81.81  ? 86  THR B O   1 
ATOM   2828  C  CB  . THR B 1 86  ? -3.069  -3.436  47.053  1.00 60.43  ? 86  THR B CB  1 
ATOM   2829  O  OG1 . THR B 1 86  ? -4.033  -3.105  48.060  1.00 69.76  ? 86  THR B OG1 1 
ATOM   2830  C  CG2 . THR B 1 86  ? -3.093  -2.373  45.967  1.00 52.56  ? 86  THR B CG2 1 
ATOM   2831  N  N   . PRO B 1 87  ? -3.361  -6.560  48.146  1.00 60.83  ? 87  PRO B N   1 
ATOM   2832  C  CA  . PRO B 1 87  ? -3.928  -7.458  49.156  1.00 57.36  ? 87  PRO B CA  1 
ATOM   2833  C  C   . PRO B 1 87  ? -4.869  -6.734  50.112  1.00 51.28  ? 87  PRO B C   1 
ATOM   2834  O  O   . PRO B 1 87  ? -5.517  -7.378  50.936  1.00 57.20  ? 87  PRO B O   1 
ATOM   2835  C  CB  . PRO B 1 87  ? -2.692  -7.951  49.912  1.00 61.78  ? 87  PRO B CB  1 
ATOM   2836  C  CG  . PRO B 1 87  ? -1.586  -7.850  48.926  1.00 68.09  ? 87  PRO B CG  1 
ATOM   2837  C  CD  . PRO B 1 87  ? -1.891  -6.638  48.097  1.00 65.36  ? 87  PRO B CD  1 
ATOM   2838  N  N   . THR B 1 88  ? -4.939  -5.411  50.003  1.00 48.04  ? 88  THR B N   1 
ATOM   2839  C  CA  . THR B 1 88  ? -5.770  -4.619  50.902  1.00 37.33  ? 88  THR B CA  1 
ATOM   2840  C  C   . THR B 1 88  ? -6.844  -3.825  50.161  1.00 47.35  ? 88  THR B C   1 
ATOM   2841  O  O   . THR B 1 88  ? -8.017  -3.863  50.531  1.00 53.49  ? 88  THR B O   1 
ATOM   2842  C  CB  . THR B 1 88  ? -4.919  -3.658  51.753  1.00 55.16  ? 88  THR B CB  1 
ATOM   2843  O  OG1 . THR B 1 88  ? -5.768  -2.918  52.637  1.00 81.89  ? 88  THR B OG1 1 
ATOM   2844  C  CG2 . THR B 1 88  ? -4.153  -2.692  50.863  1.00 45.64  ? 88  THR B CG2 1 
ATOM   2845  N  N   . HIS B 1 89  ? -6.442  -3.104  49.119  1.00 54.93  ? 89  HIS B N   1 
ATOM   2846  C  CA  . HIS B 1 89  ? -7.382  -2.298  48.346  1.00 43.21  ? 89  HIS B CA  1 
ATOM   2847  C  C   . HIS B 1 89  ? -7.130  -2.403  46.847  1.00 38.91  ? 89  HIS B C   1 
ATOM   2848  O  O   . HIS B 1 89  ? -6.157  -3.015  46.408  1.00 46.28  ? 89  HIS B O   1 
ATOM   2849  C  CB  . HIS B 1 89  ? -7.315  -0.829  48.772  1.00 53.02  ? 89  HIS B CB  1 
ATOM   2850  C  CG  . HIS B 1 89  ? -6.883  -0.626  50.190  1.00 43.88  ? 89  HIS B CG  1 
ATOM   2851  N  ND1 . HIS B 1 89  ? -7.436  0.339   51.004  1.00 44.49  ? 89  HIS B ND1 1 
ATOM   2852  C  CD2 . HIS B 1 89  ? -5.950  -1.260  50.938  1.00 34.04  ? 89  HIS B CD2 1 
ATOM   2853  C  CE1 . HIS B 1 89  ? -6.864  0.290   52.193  1.00 56.53  ? 89  HIS B CE1 1 
ATOM   2854  N  NE2 . HIS B 1 89  ? -5.959  -0.672  52.180  1.00 63.52  ? 89  HIS B NE2 1 
ATOM   2855  N  N   . LEU B 1 90  ? -8.017  -1.793  46.068  1.00 42.71  ? 90  LEU B N   1 
ATOM   2856  C  CA  . LEU B 1 90  ? -7.866  -1.740  44.620  1.00 45.72  ? 90  LEU B CA  1 
ATOM   2857  C  C   . LEU B 1 90  ? -7.351  -0.366  44.212  1.00 48.90  ? 90  LEU B C   1 
ATOM   2858  O  O   . LEU B 1 90  ? -8.007  0.648   44.449  1.00 37.45  ? 90  LEU B O   1 
ATOM   2859  C  CB  . LEU B 1 90  ? -9.199  -2.030  43.929  1.00 33.83  ? 90  LEU B CB  1 
ATOM   2860  C  CG  . LEU B 1 90  ? -9.288  -1.653  42.449  1.00 39.99  ? 90  LEU B CG  1 
ATOM   2861  C  CD1 . LEU B 1 90  ? -8.709  -2.755  41.577  1.00 33.75  ? 90  LEU B CD1 1 
ATOM   2862  C  CD2 . LEU B 1 90  ? -10.723 -1.350  42.054  1.00 22.90  ? 90  LEU B CD2 1 
ATOM   2863  N  N   . ALA B 1 91  ? -6.170  -0.337  43.603  1.00 39.28  ? 91  ALA B N   1 
ATOM   2864  C  CA  . ALA B 1 91  ? -5.542  0.921   43.218  1.00 37.35  ? 91  ALA B CA  1 
ATOM   2865  C  C   . ALA B 1 91  ? -5.894  1.331   41.792  1.00 36.97  ? 91  ALA B C   1 
ATOM   2866  O  O   . ALA B 1 91  ? -5.735  0.551   40.854  1.00 39.36  ? 91  ALA B O   1 
ATOM   2867  C  CB  . ALA B 1 91  ? -4.033  0.829   43.385  1.00 33.80  ? 91  ALA B CB  1 
ATOM   2868  N  N   . ILE B 1 92  ? -6.370  2.562   41.638  1.00 53.28  ? 92  ILE B N   1 
ATOM   2869  C  CA  . ILE B 1 92  ? -6.682  3.107   40.312  1.00 55.01  ? 92  ILE B CA  1 
ATOM   2870  C  C   . ILE B 1 92  ? -5.632  4.147   39.906  1.00 45.20  ? 92  ILE B C   1 
ATOM   2871  O  O   . ILE B 1 92  ? -5.501  5.172   40.562  1.00 48.27  ? 92  ILE B O   1 
ATOM   2872  C  CB  . ILE B 1 92  ? -8.085  3.725   40.302  1.00 44.94  ? 92  ILE B CB  1 
ATOM   2873  C  CG1 . ILE B 1 92  ? -9.094  2.688   40.814  1.00 39.19  ? 92  ILE B CG1 1 
ATOM   2874  C  CG2 . ILE B 1 92  ? -8.448  4.240   38.906  1.00 46.59  ? 92  ILE B CG2 1 
ATOM   2875  C  CD1 . ILE B 1 92  ? -10.441 3.272   41.198  1.00 53.43  ? 92  ILE B CD1 1 
ATOM   2876  N  N   . VAL B 1 93  ? -4.888  3.878   38.838  1.00 36.62  ? 93  VAL B N   1 
ATOM   2877  C  CA  . VAL B 1 93  ? -3.759  4.712   38.445  1.00 29.74  ? 93  VAL B CA  1 
ATOM   2878  C  C   . VAL B 1 93  ? -4.091  5.526   37.217  1.00 35.36  ? 93  VAL B C   1 
ATOM   2879  O  O   . VAL B 1 93  ? -4.545  4.970   36.213  1.00 45.80  ? 93  VAL B O   1 
ATOM   2880  C  CB  . VAL B 1 93  ? -2.550  3.806   38.121  1.00 40.12  ? 93  VAL B CB  1 
ATOM   2881  C  CG1 . VAL B 1 93  ? -1.353  4.605   37.656  1.00 31.11  ? 93  VAL B CG1 1 
ATOM   2882  C  CG2 . VAL B 1 93  ? -2.180  2.948   39.345  1.00 38.85  ? 93  VAL B CG2 1 
ATOM   2883  N  N   . MET B 1 94  ? -3.868  6.838   37.275  1.00 35.47  ? 94  MET B N   1 
ATOM   2884  C  CA  . MET B 1 94  ? -4.228  7.728   36.166  1.00 42.73  ? 94  MET B CA  1 
ATOM   2885  C  C   . MET B 1 94  ? -3.229  8.864   35.986  1.00 45.21  ? 94  MET B C   1 
ATOM   2886  O  O   . MET B 1 94  ? -2.420  9.107   36.866  1.00 55.19  ? 94  MET B O   1 
ATOM   2887  C  CB  . MET B 1 94  ? -5.601  8.322   36.408  1.00 38.86  ? 94  MET B CB  1 
ATOM   2888  C  CG  . MET B 1 94  ? -5.629  9.293   37.558  1.00 34.84  ? 94  MET B CG  1 
ATOM   2889  S  SD  . MET B 1 94  ? -7.302  9.601   38.163  1.00 46.25  ? 94  MET B SD  1 
ATOM   2890  C  CE  . MET B 1 94  ? -7.561  8.154   39.194  1.00 47.82  ? 94  MET B CE  1 
ATOM   2891  N  N   . GLU B 1 95  ? -3.275  9.556   34.851  1.00 42.31  ? 95  GLU B N   1 
ATOM   2892  C  CA  . GLU B 1 95  ? -2.335  10.640  34.608  1.00 41.08  ? 95  GLU B CA  1 
ATOM   2893  C  C   . GLU B 1 95  ? -2.464  11.657  35.711  1.00 40.21  ? 95  GLU B C   1 
ATOM   2894  O  O   . GLU B 1 95  ? -3.539  11.833  36.303  1.00 44.16  ? 95  GLU B O   1 
ATOM   2895  C  CB  . GLU B 1 95  ? -2.639  11.369  33.314  1.00 59.18  ? 95  GLU B CB  1 
ATOM   2896  C  CG  . GLU B 1 95  ? -2.110  10.746  32.055  1.00 73.42  ? 95  GLU B CG  1 
ATOM   2897  C  CD  . GLU B 1 95  ? -2.441  11.610  30.824  1.00 86.56  ? 95  GLU B CD  1 
ATOM   2898  O  OE1 . GLU B 1 95  ? -3.472  12.341  30.836  1.00 58.35  ? 95  GLU B OE1 1 
ATOM   2899  O  OE2 . GLU B 1 95  ? -1.653  11.559  29.850  1.00 104.23 ? 95  GLU B OE2 1 
ATOM   2900  N  N   . TYR B 1 96  ? -1.366  12.335  35.995  1.00 39.77  ? 96  TYR B N   1 
ATOM   2901  C  CA  . TYR B 1 96  ? -1.406  13.428  36.946  1.00 45.45  ? 96  TYR B CA  1 
ATOM   2902  C  C   . TYR B 1 96  ? -1.064  14.710  36.202  1.00 35.07  ? 96  TYR B C   1 
ATOM   2903  O  O   . TYR B 1 96  ? -0.106  14.741  35.435  1.00 30.90  ? 96  TYR B O   1 
ATOM   2904  C  CB  . TYR B 1 96  ? -0.417  13.185  38.079  1.00 46.00  ? 96  TYR B CB  1 
ATOM   2905  C  CG  . TYR B 1 96  ? -0.352  14.306  39.088  1.00 45.39  ? 96  TYR B CG  1 
ATOM   2906  C  CD1 . TYR B 1 96  ? -1.470  14.673  39.814  1.00 45.82  ? 96  TYR B CD1 1 
ATOM   2907  C  CD2 . TYR B 1 96  ? 0.826   14.991  39.324  1.00 47.64  ? 96  TYR B CD2 1 
ATOM   2908  C  CE1 . TYR B 1 96  ? -1.410  15.684  40.758  1.00 45.61  ? 96  TYR B CE1 1 
ATOM   2909  C  CE2 . TYR B 1 96  ? 0.891   16.010  40.270  1.00 29.37  ? 96  TYR B CE2 1 
ATOM   2910  C  CZ  . TYR B 1 96  ? -0.233  16.352  40.984  1.00 39.18  ? 96  TYR B CZ  1 
ATOM   2911  O  OH  . TYR B 1 96  ? -0.218  17.379  41.932  1.00 47.06  ? 96  TYR B OH  1 
ATOM   2912  N  N   . ALA B 1 97  ? -1.876  15.740  36.393  1.00 35.46  ? 97  ALA B N   1 
ATOM   2913  C  CA  . ALA B 1 97  ? -1.613  17.070  35.849  1.00 33.27  ? 97  ALA B CA  1 
ATOM   2914  C  C   . ALA B 1 97  ? -0.767  17.832  36.866  1.00 35.13  ? 97  ALA B C   1 
ATOM   2915  O  O   . ALA B 1 97  ? -1.278  18.214  37.924  1.00 42.37  ? 97  ALA B O   1 
ATOM   2916  C  CB  . ALA B 1 97  ? -2.904  17.772  35.642  1.00 41.71  ? 97  ALA B CB  1 
ATOM   2917  N  N   . SER B 1 98  ? 0.519   18.034  36.566  1.00 33.56  ? 98  SER B N   1 
ATOM   2918  C  CA  . SER B 1 98  ? 1.472   18.591  37.541  1.00 41.74  ? 98  SER B CA  1 
ATOM   2919  C  C   . SER B 1 98  ? 1.465   20.124  37.617  1.00 47.39  ? 98  SER B C   1 
ATOM   2920  O  O   . SER B 1 98  ? 1.890   20.701  38.628  1.00 55.69  ? 98  SER B O   1 
ATOM   2921  C  CB  . SER B 1 98  ? 2.889   18.098  37.232  1.00 43.27  ? 98  SER B CB  1 
ATOM   2922  O  OG  . SER B 1 98  ? 3.130   18.165  35.835  1.00 61.89  ? 98  SER B OG  1 
ATOM   2923  N  N   . GLY B 1 99  ? 0.976   20.774  36.564  1.00 43.52  ? 99  GLY B N   1 
ATOM   2924  C  CA  . GLY B 1 99  ? 1.029   22.226  36.487  1.00 43.47  ? 99  GLY B CA  1 
ATOM   2925  C  C   . GLY B 1 99  ? -0.189  23.064  36.875  1.00 45.20  ? 99  GLY B C   1 
ATOM   2926  O  O   . GLY B 1 99  ? -0.744  23.772  36.029  1.00 63.33  ? 99  GLY B O   1 
ATOM   2927  N  N   . GLY B 1 100 ? -0.605  22.987  38.138  1.00 38.89  ? 100 GLY B N   1 
ATOM   2928  C  CA  . GLY B 1 100 ? -1.730  23.754  38.668  1.00 41.20  ? 100 GLY B CA  1 
ATOM   2929  C  C   . GLY B 1 100 ? -2.998  23.972  37.838  1.00 48.76  ? 100 GLY B C   1 
ATOM   2930  O  O   . GLY B 1 100 ? -3.166  23.380  36.749  1.00 29.36  ? 100 GLY B O   1 
ATOM   2931  N  N   . GLU B 1 101 ? -3.899  24.793  38.364  1.00 47.84  ? 101 GLU B N   1 
ATOM   2932  C  CA  . GLU B 1 101 ? -5.175  25.052  37.713  1.00 39.34  ? 101 GLU B CA  1 
ATOM   2933  C  C   . GLU B 1 101 ? -5.063  26.200  36.722  1.00 47.43  ? 101 GLU B C   1 
ATOM   2934  O  O   . GLU B 1 101 ? -4.416  27.210  36.996  1.00 55.07  ? 101 GLU B O   1 
ATOM   2935  C  CB  . GLU B 1 101 ? -6.252  25.364  38.754  1.00 57.98  ? 101 GLU B CB  1 
ATOM   2936  C  CG  . GLU B 1 101 ? -6.089  24.606  40.061  1.00 74.41  ? 101 GLU B CG  1 
ATOM   2937  C  CD  . GLU B 1 101 ? -7.314  24.706  40.947  1.00 83.88  ? 101 GLU B CD  1 
ATOM   2938  O  OE1 . GLU B 1 101 ? -7.329  24.068  42.021  1.00 80.99  ? 101 GLU B OE1 1 
ATOM   2939  O  OE2 . GLU B 1 101 ? -8.265  25.420  40.571  1.00 84.53  ? 101 GLU B OE2 1 
ATOM   2940  N  N   . LEU B 1 102 ? -5.698  26.039  35.567  1.00 43.21  ? 102 LEU B N   1 
ATOM   2941  C  CA  . LEU B 1 102 ? -5.685  27.074  34.545  1.00 35.25  ? 102 LEU B CA  1 
ATOM   2942  C  C   . LEU B 1 102 ? -6.076  28.418  35.145  1.00 45.68  ? 102 LEU B C   1 
ATOM   2943  O  O   . LEU B 1 102 ? -5.822  29.467  34.555  1.00 46.11  ? 102 LEU B O   1 
ATOM   2944  C  CB  . LEU B 1 102 ? -6.637  26.713  33.404  1.00 28.24  ? 102 LEU B CB  1 
ATOM   2945  C  CG  . LEU B 1 102 ? -6.935  27.824  32.396  1.00 31.61  ? 102 LEU B CG  1 
ATOM   2946  C  CD1 . LEU B 1 102 ? -5.729  28.080  31.510  1.00 31.28  ? 102 LEU B CD1 1 
ATOM   2947  C  CD2 . LEU B 1 102 ? -8.155  27.474  31.559  1.00 32.59  ? 102 LEU B CD2 1 
ATOM   2948  N  N   . PHE B 1 103 ? -6.696  28.381  36.320  1.00 47.87  ? 103 PHE B N   1 
ATOM   2949  C  CA  . PHE B 1 103 ? -7.140  29.586  36.955  1.00 45.29  ? 103 PHE B CA  1 
ATOM   2950  C  C   . PHE B 1 103 ? -5.958  30.230  37.649  1.00 57.45  ? 103 PHE B C   1 
ATOM   2951  O  O   . PHE B 1 103 ? -5.818  31.451  37.655  1.00 47.21  ? 103 PHE B O   1 
ATOM   2952  C  CB  . PHE B 1 103 ? -8.274  29.266  37.923  1.00 48.21  ? 103 PHE B CB  1 
ATOM   2953  C  CG  . PHE B 1 103 ? -8.774  30.457  38.680  1.00 53.46  ? 103 PHE B CG  1 
ATOM   2954  C  CD1 . PHE B 1 103 ? -8.528  30.570  40.043  1.00 55.53  ? 103 PHE B CD1 1 
ATOM   2955  C  CD2 . PHE B 1 103 ? -9.488  31.469  38.030  1.00 46.82  ? 103 PHE B CD2 1 
ATOM   2956  C  CE1 . PHE B 1 103 ? -8.985  31.676  40.755  1.00 63.22  ? 103 PHE B CE1 1 
ATOM   2957  C  CE2 . PHE B 1 103 ? -9.939  32.574  38.731  1.00 47.50  ? 103 PHE B CE2 1 
ATOM   2958  C  CZ  . PHE B 1 103 ? -9.690  32.679  40.099  1.00 57.16  ? 103 PHE B CZ  1 
ATOM   2959  N  N   . GLU B 1 104 ? -5.084  29.402  38.205  1.00 60.69  ? 104 GLU B N   1 
ATOM   2960  C  CA  . GLU B 1 104 ? -3.901  29.909  38.881  1.00 59.74  ? 104 GLU B CA  1 
ATOM   2961  C  C   . GLU B 1 104 ? -2.999  30.646  37.899  1.00 54.74  ? 104 GLU B C   1 
ATOM   2962  O  O   . GLU B 1 104 ? -2.422  31.691  38.212  1.00 56.05  ? 104 GLU B O   1 
ATOM   2963  C  CB  . GLU B 1 104 ? -3.135  28.772  39.522  1.00 68.72  ? 104 GLU B CB  1 
ATOM   2964  C  CG  . GLU B 1 104 ? -2.588  29.106  40.882  1.00 89.31  ? 104 GLU B CG  1 
ATOM   2965  C  CD  . GLU B 1 104 ? -3.664  29.674  41.789  1.00 103.62 ? 104 GLU B CD  1 
ATOM   2966  O  OE1 . GLU B 1 104 ? -3.481  30.833  42.257  1.00 98.91  ? 104 GLU B OE1 1 
ATOM   2967  O  OE2 . GLU B 1 104 ? -4.688  28.969  42.010  1.00 110.96 ? 104 GLU B OE2 1 
ATOM   2968  N  N   . ARG B 1 105 ? -2.879  30.105  36.698  1.00 47.64  ? 105 ARG B N   1 
ATOM   2969  C  CA  . ARG B 1 105 ? -2.023  30.724  35.699  1.00 47.52  ? 105 ARG B CA  1 
ATOM   2970  C  C   . ARG B 1 105 ? -2.637  32.044  35.252  1.00 58.30  ? 105 ARG B C   1 
ATOM   2971  O  O   . ARG B 1 105 ? -1.938  33.014  34.963  1.00 57.71  ? 105 ARG B O   1 
ATOM   2972  C  CB  . ARG B 1 105 ? -1.849  29.797  34.498  1.00 32.12  ? 105 ARG B CB  1 
ATOM   2973  C  CG  . ARG B 1 105 ? -0.963  30.383  33.414  1.00 38.25  ? 105 ARG B CG  1 
ATOM   2974  C  CD  . ARG B 1 105 ? -0.743  29.383  32.295  1.00 38.37  ? 105 ARG B CD  1 
ATOM   2975  N  NE  . ARG B 1 105 ? 0.658   29.312  31.903  1.00 37.72  ? 105 ARG B NE  1 
ATOM   2976  C  CZ  . ARG B 1 105 ? 1.144   29.866  30.800  1.00 56.70  ? 105 ARG B CZ  1 
ATOM   2977  N  NH1 . ARG B 1 105 ? 0.340   30.522  29.983  1.00 71.56  ? 105 ARG B NH1 1 
ATOM   2978  N  NH2 . ARG B 1 105 ? 2.431   29.757  30.506  1.00 63.96  ? 105 ARG B NH2 1 
ATOM   2979  N  N   . ILE B 1 106 ? -3.959  32.082  35.194  1.00 59.86  ? 106 ILE B N   1 
ATOM   2980  C  CA  . ILE B 1 106 ? -4.619  33.279  34.737  1.00 52.66  ? 106 ILE B CA  1 
ATOM   2981  C  C   . ILE B 1 106 ? -4.383  34.390  35.739  1.00 48.32  ? 106 ILE B C   1 
ATOM   2982  O  O   . ILE B 1 106 ? -3.975  35.487  35.359  1.00 40.96  ? 106 ILE B O   1 
ATOM   2983  C  CB  . ILE B 1 106 ? -6.120  33.099  34.598  1.00 46.07  ? 106 ILE B CB  1 
ATOM   2984  C  CG1 . ILE B 1 106 ? -6.455  32.108  33.468  1.00 39.24  ? 106 ILE B CG1 1 
ATOM   2985  C  CG2 . ILE B 1 106 ? -6.774  34.457  34.356  1.00 24.10  ? 106 ILE B CG2 1 
ATOM   2986  C  CD1 . ILE B 1 106 ? -7.944  31.862  33.351  1.00 25.70  ? 106 ILE B CD1 1 
ATOM   2987  N  N   . CYS B 1 107 ? -4.626  34.131  37.019  1.00 36.51  ? 107 CYS B N   1 
ATOM   2988  C  CA  . CYS B 1 107 ? -4.410  35.220  37.937  1.00 46.99  ? 107 CYS B CA  1 
ATOM   2989  C  C   . CYS B 1 107 ? -2.958  35.617  38.272  1.00 52.28  ? 107 CYS B C   1 
ATOM   2990  O  O   . CYS B 1 107 ? -2.726  36.718  38.753  1.00 52.04  ? 107 CYS B O   1 
ATOM   2991  C  CB  . CYS B 1 107 ? -5.360  35.215  39.144  1.00 52.65  ? 107 CYS B CB  1 
ATOM   2992  S  SG  . CYS B 1 107 ? -5.621  33.731  39.994  1.00 67.71  ? 107 CYS B SG  1 
ATOM   2993  N  N   . ASN B 1 108 ? -1.988  34.761  37.962  1.00 54.88  ? 108 ASN B N   1 
ATOM   2994  C  CA  . ASN B 1 108 ? -0.582  35.163  38.006  1.00 43.99  ? 108 ASN B CA  1 
ATOM   2995  C  C   . ASN B 1 108 ? -0.234  36.081  36.843  1.00 51.24  ? 108 ASN B C   1 
ATOM   2996  O  O   . ASN B 1 108 ? 0.638   36.923  36.926  1.00 63.38  ? 108 ASN B O   1 
ATOM   2997  C  CB  . ASN B 1 108 ? 0.331   33.959  37.951  1.00 36.04  ? 108 ASN B CB  1 
ATOM   2998  C  CG  . ASN B 1 108 ? 0.346   33.207  39.258  1.00 51.86  ? 108 ASN B CG  1 
ATOM   2999  O  OD1 . ASN B 1 108 ? -0.209  33.672  40.262  1.00 59.00  ? 108 ASN B OD1 1 
ATOM   3000  N  ND2 . ASN B 1 108 ? 0.994   32.058  39.271  1.00 49.95  ? 108 ASN B ND2 1 
ATOM   3001  N  N   . ALA B 1 109 ? -0.923  35.913  35.737  1.00 57.26  ? 109 ALA B N   1 
ATOM   3002  C  CA  . ALA B 1 109 ? -0.655  36.728  34.569  1.00 57.52  ? 109 ALA B CA  1 
ATOM   3003  C  C   . ALA B 1 109 ? -1.509  37.991  34.579  1.00 48.69  ? 109 ALA B C   1 
ATOM   3004  O  O   . ALA B 1 109 ? -1.339  38.846  33.708  1.00 39.65  ? 109 ALA B O   1 
ATOM   3005  C  CB  . ALA B 1 109 ? -0.955  35.894  33.277  1.00 43.09  ? 109 ALA B CB  1 
ATOM   3006  N  N   . GLY B 1 110 ? -2.430  38.075  35.544  1.00 34.39  ? 110 GLY B N   1 
ATOM   3007  C  CA  . GLY B 1 110 ? -3.501  39.057  35.530  1.00 43.22  ? 110 GLY B CA  1 
ATOM   3008  C  C   . GLY B 1 110 ? -4.603  38.685  34.535  1.00 48.36  ? 110 GLY B C   1 
ATOM   3009  O  O   . GLY B 1 110 ? -5.762  38.493  34.902  1.00 41.16  ? 110 GLY B O   1 
ATOM   3010  N  N   . ARG B 1 111 ? -4.242  38.595  33.259  1.00 39.42  ? 111 ARG B N   1 
ATOM   3011  C  CA  . ARG B 1 111 ? -5.193  38.185  32.249  1.00 50.67  ? 111 ARG B CA  1 
ATOM   3012  C  C   . ARG B 1 111 ? -4.404  37.876  30.985  1.00 46.15  ? 111 ARG B C   1 
ATOM   3013  O  O   . ARG B 1 111 ? -3.270  38.306  30.858  1.00 40.85  ? 111 ARG B O   1 
ATOM   3014  C  CB  . ARG B 1 111 ? -6.205  39.273  32.024  1.00 52.38  ? 111 ARG B CB  1 
ATOM   3015  C  CG  . ARG B 1 111 ? -5.602  40.502  31.410  1.00 38.27  ? 111 ARG B CG  1 
ATOM   3016  C  CD  . ARG B 1 111 ? -6.590  41.654  31.424  1.00 50.26  ? 111 ARG B CD  1 
ATOM   3017  N  NE  . ARG B 1 111 ? -6.766  42.031  30.040  1.00 60.69  ? 111 ARG B NE  1 
ATOM   3018  C  CZ  . ARG B 1 111 ? -6.130  43.031  29.451  1.00 54.09  ? 111 ARG B CZ  1 
ATOM   3019  N  NH1 . ARG B 1 111 ? -5.319  43.809  30.157  1.00 44.67  ? 111 ARG B NH1 1 
ATOM   3020  N  NH2 . ARG B 1 111 ? -6.324  43.241  28.160  1.00 56.08  ? 111 ARG B NH2 1 
ATOM   3021  N  N   . PHE B 1 112 ? -4.969  37.106  30.066  1.00 32.18  ? 112 PHE B N   1 
ATOM   3022  C  CA  . PHE B 1 112 ? -4.150  36.563  29.011  1.00 37.66  ? 112 PHE B CA  1 
ATOM   3023  C  C   . PHE B 1 112 ? -4.261  37.447  27.819  1.00 42.53  ? 112 PHE B C   1 
ATOM   3024  O  O   . PHE B 1 112 ? -5.206  38.225  27.679  1.00 43.62  ? 112 PHE B O   1 
ATOM   3025  C  CB  . PHE B 1 112 ? -4.630  35.148  28.601  1.00 45.27  ? 112 PHE B CB  1 
ATOM   3026  C  CG  . PHE B 1 112 ? -4.335  34.045  29.614  1.00 37.79  ? 112 PHE B CG  1 
ATOM   3027  C  CD1 . PHE B 1 112 ? -3.432  34.224  30.645  1.00 48.94  ? 112 PHE B CD1 1 
ATOM   3028  C  CD2 . PHE B 1 112 ? -4.980  32.812  29.517  1.00 42.56  ? 112 PHE B CD2 1 
ATOM   3029  C  CE1 . PHE B 1 112 ? -3.175  33.170  31.573  1.00 54.83  ? 112 PHE B CE1 1 
ATOM   3030  C  CE2 . PHE B 1 112 ? -4.734  31.763  30.443  1.00 43.28  ? 112 PHE B CE2 1 
ATOM   3031  C  CZ  . PHE B 1 112 ? -3.843  31.937  31.458  1.00 44.31  ? 112 PHE B CZ  1 
ATOM   3032  N  N   . SER B 1 113 ? -3.316  37.305  26.909  1.00 55.89  ? 113 SER B N   1 
ATOM   3033  C  CA  . SER B 1 113 ? -3.504  37.928  25.615  1.00 51.72  ? 113 SER B CA  1 
ATOM   3034  C  C   . SER B 1 113 ? -4.613  37.155  24.872  1.00 61.57  ? 113 SER B C   1 
ATOM   3035  O  O   . SER B 1 113 ? -4.908  36.004  25.187  1.00 71.12  ? 113 SER B O   1 
ATOM   3036  C  CB  . SER B 1 113 ? -2.196  37.871  24.833  1.00 51.61  ? 113 SER B CB  1 
ATOM   3037  O  OG  . SER B 1 113 ? -2.039  36.601  24.209  1.00 72.45  ? 113 SER B OG  1 
ATOM   3038  N  N   . GLU B 1 114 ? -5.222  37.775  23.877  1.00 61.02  ? 114 GLU B N   1 
ATOM   3039  C  CA  . GLU B 1 114 ? -6.244  37.100  23.106  1.00 49.91  ? 114 GLU B CA  1 
ATOM   3040  C  C   . GLU B 1 114 ? -5.706  35.789  22.499  1.00 53.58  ? 114 GLU B C   1 
ATOM   3041  O  O   . GLU B 1 114 ? -6.377  34.781  22.545  1.00 61.75  ? 114 GLU B O   1 
ATOM   3042  C  CB  . GLU B 1 114 ? -6.800  38.028  22.015  1.00 53.35  ? 114 GLU B CB  1 
ATOM   3043  C  CG  . GLU B 1 114 ? -7.842  37.373  21.096  1.00 63.02  ? 114 GLU B CG  1 
ATOM   3044  C  CD  . GLU B 1 114 ? -8.594  38.361  20.250  1.00 69.94  ? 114 GLU B CD  1 
ATOM   3045  O  OE1 . GLU B 1 114 ? -9.013  37.976  19.145  1.00 74.93  ? 114 GLU B OE1 1 
ATOM   3046  O  OE2 . GLU B 1 114 ? -8.779  39.525  20.691  1.00 68.70  ? 114 GLU B OE2 1 
ATOM   3047  N  N   . ASP B 1 115 ? -4.492  35.812  21.948  1.00 59.86  ? 115 ASP B N   1 
ATOM   3048  C  CA  . ASP B 1 115 ? -3.918  34.650  21.277  1.00 52.77  ? 115 ASP B CA  1 
ATOM   3049  C  C   . ASP B 1 115 ? -3.686  33.488  22.229  1.00 52.55  ? 115 ASP B C   1 
ATOM   3050  O  O   . ASP B 1 115 ? -3.802  32.307  21.853  1.00 53.87  ? 115 ASP B O   1 
ATOM   3051  C  CB  . ASP B 1 115 ? -2.595  35.017  20.624  1.00 52.77  ? 115 ASP B CB  1 
ATOM   3052  C  CG  . ASP B 1 115 ? -2.792  35.715  19.292  1.00 75.03  ? 115 ASP B CG  1 
ATOM   3053  O  OD1 . ASP B 1 115 ? -2.247  36.824  19.115  1.00 82.17  ? 115 ASP B OD1 1 
ATOM   3054  O  OD2 . ASP B 1 115 ? -3.499  35.152  18.419  1.00 89.24  ? 115 ASP B OD2 1 
ATOM   3055  N  N   . GLU B 1 116 ? -3.309  33.832  23.457  1.00 41.54  ? 116 GLU B N   1 
ATOM   3056  C  CA  . GLU B 1 116 ? -3.015  32.845  24.482  1.00 43.38  ? 116 GLU B CA  1 
ATOM   3057  C  C   . GLU B 1 116 ? -4.310  32.224  24.975  1.00 52.41  ? 116 GLU B C   1 
ATOM   3058  O  O   . GLU B 1 116 ? -4.355  31.039  25.306  1.00 56.80  ? 116 GLU B O   1 
ATOM   3059  C  CB  . GLU B 1 116 ? -2.261  33.486  25.647  1.00 40.62  ? 116 GLU B CB  1 
ATOM   3060  C  CG  . GLU B 1 116 ? -2.289  32.671  26.928  1.00 54.27  ? 116 GLU B CG  1 
ATOM   3061  C  CD  . GLU B 1 116 ? -1.143  33.009  27.860  1.00 70.51  ? 116 GLU B CD  1 
ATOM   3062  O  OE1 . GLU B 1 116 ? -0.675  34.166  27.833  1.00 79.34  ? 116 GLU B OE1 1 
ATOM   3063  O  OE2 . GLU B 1 116 ? -0.711  32.117  28.620  1.00 67.50  ? 116 GLU B OE2 1 
ATOM   3064  N  N   . ALA B 1 117 ? -5.365  33.028  25.018  1.00 43.53  ? 117 ALA B N   1 
ATOM   3065  C  CA  . ALA B 1 117 ? -6.665  32.516  25.410  1.00 50.34  ? 117 ALA B CA  1 
ATOM   3066  C  C   . ALA B 1 117 ? -7.202  31.590  24.325  1.00 46.99  ? 117 ALA B C   1 
ATOM   3067  O  O   . ALA B 1 117 ? -7.843  30.597  24.628  1.00 53.09  ? 117 ALA B O   1 
ATOM   3068  C  CB  . ALA B 1 117 ? -7.631  33.656  25.653  1.00 40.35  ? 117 ALA B CB  1 
ATOM   3069  N  N   . ARG B 1 118 ? -6.956  31.930  23.064  1.00 39.05  ? 118 ARG B N   1 
ATOM   3070  C  CA  . ARG B 1 118 ? -7.423  31.104  21.955  1.00 48.80  ? 118 ARG B CA  1 
ATOM   3071  C  C   . ARG B 1 118 ? -6.726  29.751  21.987  1.00 56.23  ? 118 ARG B C   1 
ATOM   3072  O  O   . ARG B 1 118 ? -7.325  28.717  21.696  1.00 63.25  ? 118 ARG B O   1 
ATOM   3073  C  CB  . ARG B 1 118 ? -7.163  31.800  20.619  1.00 45.02  ? 118 ARG B CB  1 
ATOM   3074  C  CG  . ARG B 1 118 ? -8.065  31.327  19.490  1.00 42.93  ? 118 ARG B CG  1 
ATOM   3075  C  CD  . ARG B 1 118 ? -7.561  31.806  18.140  1.00 50.18  ? 118 ARG B CD  1 
ATOM   3076  N  NE  . ARG B 1 118 ? -6.846  33.075  18.240  1.00 69.41  ? 118 ARG B NE  1 
ATOM   3077  C  CZ  . ARG B 1 118 ? -7.248  34.206  17.670  1.00 69.59  ? 118 ARG B CZ  1 
ATOM   3078  N  NH1 . ARG B 1 118 ? -8.363  34.229  16.954  1.00 73.65  ? 118 ARG B NH1 1 
ATOM   3079  N  NH2 . ARG B 1 118 ? -6.534  35.313  17.814  1.00 69.16  ? 118 ARG B NH2 1 
ATOM   3080  N  N   . PHE B 1 119 ? -5.450  29.779  22.350  1.00 63.10  ? 119 PHE B N   1 
ATOM   3081  C  CA  . PHE B 1 119 ? -4.635  28.579  22.477  1.00 56.19  ? 119 PHE B CA  1 
ATOM   3082  C  C   . PHE B 1 119 ? -5.229  27.584  23.470  1.00 55.78  ? 119 PHE B C   1 
ATOM   3083  O  O   . PHE B 1 119 ? -5.224  26.379  23.222  1.00 59.67  ? 119 PHE B O   1 
ATOM   3084  C  CB  . PHE B 1 119 ? -3.212  28.956  22.896  1.00 52.70  ? 119 PHE B CB  1 
ATOM   3085  C  CG  . PHE B 1 119 ? -2.344  27.775  23.227  1.00 60.47  ? 119 PHE B CG  1 
ATOM   3086  C  CD1 . PHE B 1 119 ? -1.804  26.991  22.222  1.00 63.91  ? 119 PHE B CD1 1 
ATOM   3087  C  CD2 . PHE B 1 119 ? -2.061  27.453  24.544  1.00 64.70  ? 119 PHE B CD2 1 
ATOM   3088  C  CE1 . PHE B 1 119 ? -1.004  25.908  22.524  1.00 66.37  ? 119 PHE B CE1 1 
ATOM   3089  C  CE2 . PHE B 1 119 ? -1.261  26.371  24.852  1.00 67.10  ? 119 PHE B CE2 1 
ATOM   3090  C  CZ  . PHE B 1 119 ? -0.732  25.597  23.841  1.00 73.67  ? 119 PHE B CZ  1 
ATOM   3091  N  N   . PHE B 1 120 ? -5.736  28.084  24.593  1.00 48.83  ? 120 PHE B N   1 
ATOM   3092  C  CA  . PHE B 1 120 ? -6.301  27.203  25.602  1.00 47.96  ? 120 PHE B CA  1 
ATOM   3093  C  C   . PHE B 1 120 ? -7.748  26.820  25.292  1.00 56.23  ? 120 PHE B C   1 
ATOM   3094  O  O   . PHE B 1 120 ? -8.171  25.682  25.515  1.00 57.35  ? 120 PHE B O   1 
ATOM   3095  C  CB  . PHE B 1 120 ? -6.211  27.860  26.967  1.00 29.70  ? 120 PHE B CB  1 
ATOM   3096  C  CG  . PHE B 1 120 ? -4.834  27.817  27.574  1.00 40.24  ? 120 PHE B CG  1 
ATOM   3097  C  CD1 . PHE B 1 120 ? -4.264  26.619  27.927  1.00 39.68  ? 120 PHE B CD1 1 
ATOM   3098  C  CD2 . PHE B 1 120 ? -4.132  28.985  27.834  1.00 44.32  ? 120 PHE B CD2 1 
ATOM   3099  C  CE1 . PHE B 1 120 ? -3.016  26.568  28.508  1.00 40.33  ? 120 PHE B CE1 1 
ATOM   3100  C  CE2 . PHE B 1 120 ? -2.875  28.942  28.430  1.00 46.58  ? 120 PHE B CE2 1 
ATOM   3101  C  CZ  . PHE B 1 120 ? -2.322  27.728  28.755  1.00 53.49  ? 120 PHE B CZ  1 
ATOM   3102  N  N   . PHE B 1 121 ? -8.488  27.790  24.764  1.00 50.76  ? 121 PHE B N   1 
ATOM   3103  C  CA  . PHE B 1 121 ? -9.876  27.585  24.396  1.00 46.45  ? 121 PHE B CA  1 
ATOM   3104  C  C   . PHE B 1 121 ? -10.033 26.514  23.323  1.00 39.90  ? 121 PHE B C   1 
ATOM   3105  O  O   . PHE B 1 121 ? -10.968 25.732  23.361  1.00 51.05  ? 121 PHE B O   1 
ATOM   3106  C  CB  . PHE B 1 121 ? -10.501 28.887  23.917  1.00 28.31  ? 121 PHE B CB  1 
ATOM   3107  C  CG  . PHE B 1 121 ? -11.997 28.813  23.751  1.00 32.21  ? 121 PHE B CG  1 
ATOM   3108  C  CD1 . PHE B 1 121 ? -12.828 28.762  24.866  1.00 29.06  ? 121 PHE B CD1 1 
ATOM   3109  C  CD2 . PHE B 1 121 ? -12.564 28.780  22.493  1.00 35.67  ? 121 PHE B CD2 1 
ATOM   3110  C  CE1 . PHE B 1 121 ? -14.197 28.685  24.737  1.00 38.92  ? 121 PHE B CE1 1 
ATOM   3111  C  CE2 . PHE B 1 121 ? -13.955 28.702  22.337  1.00 29.45  ? 121 PHE B CE2 1 
ATOM   3112  C  CZ  . PHE B 1 121 ? -14.770 28.645  23.479  1.00 31.66  ? 121 PHE B CZ  1 
ATOM   3113  N  N   . GLN B 1 122 ? -9.140  26.487  22.353  1.00 34.47  ? 122 GLN B N   1 
ATOM   3114  C  CA  . GLN B 1 122 ? -9.160  25.437  21.362  1.00 43.41  ? 122 GLN B CA  1 
ATOM   3115  C  C   . GLN B 1 122 ? -9.005  24.051  22.006  1.00 41.47  ? 122 GLN B C   1 
ATOM   3116  O  O   . GLN B 1 122 ? -9.757  23.137  21.698  1.00 51.42  ? 122 GLN B O   1 
ATOM   3117  C  CB  . GLN B 1 122 ? -8.067  25.690  20.333  1.00 45.88  ? 122 GLN B CB  1 
ATOM   3118  C  CG  . GLN B 1 122 ? -8.329  26.959  19.523  1.00 43.57  ? 122 GLN B CG  1 
ATOM   3119  C  CD  . GLN B 1 122 ? -7.134  27.378  18.669  1.00 52.61  ? 122 GLN B CD  1 
ATOM   3120  O  OE1 . GLN B 1 122 ? -5.975  27.090  19.007  1.00 57.70  ? 122 GLN B OE1 1 
ATOM   3121  N  NE2 . GLN B 1 122 ? -7.411  28.053  17.557  1.00 45.27  ? 122 GLN B NE2 1 
ATOM   3122  N  N   . GLN B 1 123 ? -8.060  23.926  22.932  1.00 35.33  ? 123 GLN B N   1 
ATOM   3123  C  CA  . GLN B 1 123 ? -7.872  22.680  23.666  1.00 26.05  ? 123 GLN B CA  1 
ATOM   3124  C  C   . GLN B 1 123 ? -9.103  22.327  24.499  1.00 40.35  ? 123 GLN B C   1 
ATOM   3125  O  O   . GLN B 1 123 ? -9.513  21.169  24.561  1.00 56.20  ? 123 GLN B O   1 
ATOM   3126  C  CB  . GLN B 1 123 ? -6.643  22.774  24.573  1.00 32.70  ? 123 GLN B CB  1 
ATOM   3127  C  CG  . GLN B 1 123 ? -5.335  22.990  23.832  1.00 24.00  ? 123 GLN B CG  1 
ATOM   3128  C  CD  . GLN B 1 123 ? -4.148  23.097  24.770  1.00 55.24  ? 123 GLN B CD  1 
ATOM   3129  O  OE1 . GLN B 1 123 ? -4.028  22.333  25.727  1.00 59.06  ? 123 GLN B OE1 1 
ATOM   3130  N  NE2 . GLN B 1 123 ? -3.263  24.048  24.498  1.00 41.51  ? 123 GLN B NE2 1 
ATOM   3131  N  N   . LEU B 1 124 ? -9.685  23.334  25.143  1.00 38.33  ? 124 LEU B N   1 
ATOM   3132  C  CA  . LEU B 1 124 ? -10.840 23.142  26.012  1.00 32.96  ? 124 LEU B CA  1 
ATOM   3133  C  C   . LEU B 1 124 ? -11.990 22.571  25.226  1.00 36.65  ? 124 LEU B C   1 
ATOM   3134  O  O   . LEU B 1 124 ? -12.651 21.645  25.672  1.00 48.25  ? 124 LEU B O   1 
ATOM   3135  C  CB  . LEU B 1 124 ? -11.286 24.475  26.625  1.00 33.48  ? 124 LEU B CB  1 
ATOM   3136  C  CG  . LEU B 1 124 ? -12.501 24.365  27.552  1.00 38.70  ? 124 LEU B CG  1 
ATOM   3137  C  CD1 . LEU B 1 124 ? -12.183 23.417  28.728  1.00 37.55  ? 124 LEU B CD1 1 
ATOM   3138  C  CD2 . LEU B 1 124 ? -12.914 25.695  28.088  1.00 30.33  ? 124 LEU B CD2 1 
ATOM   3139  N  N   . ILE B 1 125 ? -12.233 23.138  24.055  1.00 33.56  ? 125 ILE B N   1 
ATOM   3140  C  CA  . ILE B 1 125 ? -13.376 22.780  23.240  1.00 38.27  ? 125 ILE B CA  1 
ATOM   3141  C  C   . ILE B 1 125 ? -13.139 21.455  22.554  1.00 37.68  ? 125 ILE B C   1 
ATOM   3142  O  O   . ILE B 1 125 ? -14.058 20.678  22.388  1.00 34.58  ? 125 ILE B O   1 
ATOM   3143  C  CB  . ILE B 1 125 ? -13.641 23.834  22.162  1.00 34.36  ? 125 ILE B CB  1 
ATOM   3144  C  CG1 . ILE B 1 125 ? -14.161 25.110  22.817  1.00 30.90  ? 125 ILE B CG1 1 
ATOM   3145  C  CG2 . ILE B 1 125 ? -14.644 23.303  21.157  1.00 30.52  ? 125 ILE B CG2 1 
ATOM   3146  C  CD1 . ILE B 1 125 ? -15.516 24.914  23.504  1.00 38.96  ? 125 ILE B CD1 1 
ATOM   3147  N  N   . SER B 1 126 ? -11.909 21.196  22.148  1.00 27.89  ? 126 SER B N   1 
ATOM   3148  C  CA  . SER B 1 126 ? -11.591 19.920  21.584  1.00 33.97  ? 126 SER B CA  1 
ATOM   3149  C  C   . SER B 1 126 ? -11.836 18.813  22.599  1.00 43.51  ? 126 SER B C   1 
ATOM   3150  O  O   . SER B 1 126 ? -12.440 17.779  22.274  1.00 51.66  ? 126 SER B O   1 
ATOM   3151  C  CB  . SER B 1 126 ? -10.138 19.898  21.148  1.00 38.61  ? 126 SER B CB  1 
ATOM   3152  O  OG  . SER B 1 126 ? -9.781  18.561  20.839  1.00 55.09  ? 126 SER B OG  1 
ATOM   3153  N  N   . GLY B 1 127 ? -11.363 19.034  23.823  1.00 38.73  ? 127 GLY B N   1 
ATOM   3154  C  CA  . GLY B 1 127 ? -11.469 18.038  24.876  1.00 29.60  ? 127 GLY B CA  1 
ATOM   3155  C  C   . GLY B 1 127 ? -12.906 17.833  25.297  1.00 39.49  ? 127 GLY B C   1 
ATOM   3156  O  O   . GLY B 1 127 ? -13.301 16.708  25.587  1.00 49.90  ? 127 GLY B O   1 
ATOM   3157  N  N   . VAL B 1 128 ? -13.694 18.909  25.308  1.00 25.16  ? 128 VAL B N   1 
ATOM   3158  C  CA  . VAL B 1 128 ? -15.095 18.851  25.738  1.00 32.90  ? 128 VAL B CA  1 
ATOM   3159  C  C   . VAL B 1 128 ? -15.925 18.184  24.641  1.00 46.68  ? 128 VAL B C   1 
ATOM   3160  O  O   . VAL B 1 128 ? -16.850 17.418  24.904  1.00 43.40  ? 128 VAL B O   1 
ATOM   3161  C  CB  . VAL B 1 128 ? -15.647 20.279  26.116  1.00 36.37  ? 128 VAL B CB  1 
ATOM   3162  C  CG1 . VAL B 1 128 ? -17.148 20.372  26.069  1.00 35.37  ? 128 VAL B CG1 1 
ATOM   3163  C  CG2 . VAL B 1 128 ? -15.174 20.645  27.487  1.00 42.27  ? 128 VAL B CG2 1 
ATOM   3164  N  N   . SER B 1 129 ? -15.570 18.464  23.400  1.00 44.03  ? 129 SER B N   1 
ATOM   3165  C  CA  . SER B 1 129 ? -16.268 17.884  22.272  1.00 42.68  ? 129 SER B CA  1 
ATOM   3166  C  C   . SER B 1 129 ? -16.096 16.365  22.299  1.00 45.59  ? 129 SER B C   1 
ATOM   3167  O  O   . SER B 1 129 ? -17.051 15.628  22.055  1.00 42.35  ? 129 SER B O   1 
ATOM   3168  C  CB  . SER B 1 129 ? -15.716 18.465  20.977  1.00 45.19  ? 129 SER B CB  1 
ATOM   3169  O  OG  . SER B 1 129 ? -16.292 17.855  19.838  1.00 58.02  ? 129 SER B OG  1 
ATOM   3170  N  N   . TYR B 1 130 ? -14.880 15.918  22.616  1.00 39.90  ? 130 TYR B N   1 
ATOM   3171  C  CA  . TYR B 1 130 ? -14.563 14.499  22.704  1.00 41.67  ? 130 TYR B CA  1 
ATOM   3172  C  C   . TYR B 1 130 ? -15.377 13.824  23.804  1.00 43.13  ? 130 TYR B C   1 
ATOM   3173  O  O   . TYR B 1 130 ? -16.030 12.802  23.584  1.00 55.45  ? 130 TYR B O   1 
ATOM   3174  C  CB  . TYR B 1 130 ? -13.088 14.301  22.951  1.00 32.67  ? 130 TYR B CB  1 
ATOM   3175  C  CG  . TYR B 1 130 ? -12.704 12.860  23.104  1.00 42.62  ? 130 TYR B CG  1 
ATOM   3176  C  CD1 . TYR B 1 130 ? -12.356 12.099  22.002  1.00 41.21  ? 130 TYR B CD1 1 
ATOM   3177  C  CD2 . TYR B 1 130 ? -12.692 12.253  24.346  1.00 37.60  ? 130 TYR B CD2 1 
ATOM   3178  C  CE1 . TYR B 1 130 ? -12.003 10.786  22.130  1.00 42.30  ? 130 TYR B CE1 1 
ATOM   3179  C  CE2 . TYR B 1 130 ? -12.339 10.937  24.486  1.00 46.10  ? 130 TYR B CE2 1 
ATOM   3180  C  CZ  . TYR B 1 130 ? -11.996 10.202  23.375  1.00 47.17  ? 130 TYR B CZ  1 
ATOM   3181  O  OH  . TYR B 1 130 ? -11.649 8.869   23.498  1.00 47.93  ? 130 TYR B OH  1 
ATOM   3182  N  N   . ALA B 1 131 ? -15.371 14.408  24.984  1.00 43.51  ? 131 ALA B N   1 
ATOM   3183  C  CA  . ALA B 1 131 ? -16.170 13.849  26.068  1.00 41.53  ? 131 ALA B CA  1 
ATOM   3184  C  C   . ALA B 1 131 ? -17.640 13.784  25.747  1.00 44.18  ? 131 ALA B C   1 
ATOM   3185  O  O   . ALA B 1 131 ? -18.355 12.988  26.332  1.00 43.27  ? 131 ALA B O   1 
ATOM   3186  C  CB  . ALA B 1 131 ? -15.953 14.655  27.340  1.00 34.48  ? 131 ALA B CB  1 
ATOM   3187  N  N   . HIS B 1 132 ? -18.104 14.675  24.880  1.00 44.75  ? 132 HIS B N   1 
ATOM   3188  C  CA  . HIS B 1 132 ? -19.511 14.725  24.546  1.00 58.56  ? 132 HIS B CA  1 
ATOM   3189  C  C   . HIS B 1 132 ? -19.843 13.584  23.588  1.00 50.54  ? 132 HIS B C   1 
ATOM   3190  O  O   . HIS B 1 132 ? -20.920 13.019  23.643  1.00 52.20  ? 132 HIS B O   1 
ATOM   3191  C  CB  . HIS B 1 132 ? -19.872 16.081  23.925  1.00 64.57  ? 132 HIS B CB  1 
ATOM   3192  C  CG  . HIS B 1 132 ? -20.135 17.160  24.936  1.00 64.05  ? 132 HIS B CG  1 
ATOM   3193  N  ND1 . HIS B 1 132 ? -20.603 18.417  24.595  1.00 60.32  ? 132 HIS B ND1 1 
ATOM   3194  C  CD2 . HIS B 1 132 ? -19.997 17.163  26.282  1.00 54.02  ? 132 HIS B CD2 1 
ATOM   3195  C  CE1 . HIS B 1 132 ? -20.740 19.146  25.688  1.00 46.18  ? 132 HIS B CE1 1 
ATOM   3196  N  NE2 . HIS B 1 132 ? -20.372 18.412  26.725  1.00 45.87  ? 132 HIS B NE2 1 
ATOM   3197  N  N   . ALA B 1 133 ? -18.893 13.246  22.729  1.00 31.29  ? 133 ALA B N   1 
ATOM   3198  C  CA  . ALA B 1 133 ? -19.062 12.171  21.788  1.00 49.62  ? 133 ALA B CA  1 
ATOM   3199  C  C   . ALA B 1 133 ? -18.865 10.814  22.479  1.00 54.29  ? 133 ALA B C   1 
ATOM   3200  O  O   . ALA B 1 133 ? -19.103 9.758   21.886  1.00 60.89  ? 133 ALA B O   1 
ATOM   3201  C  CB  . ALA B 1 133 ? -18.093 12.333  20.640  1.00 41.85  ? 133 ALA B CB  1 
ATOM   3202  N  N   . MET B 1 134 ? -18.454 10.856  23.742  1.00 29.55  ? 134 MET B N   1 
ATOM   3203  C  CA  . MET B 1 134 ? -18.154 9.635   24.480  1.00 46.62  ? 134 MET B CA  1 
ATOM   3204  C  C   . MET B 1 134 ? -18.953 9.463   25.771  1.00 44.91  ? 134 MET B C   1 
ATOM   3205  O  O   . MET B 1 134 ? -18.660 8.565   26.559  1.00 45.39  ? 134 MET B O   1 
ATOM   3206  C  CB  . MET B 1 134 ? -16.657 9.561   24.790  1.00 40.13  ? 134 MET B CB  1 
ATOM   3207  C  CG  . MET B 1 134 ? -16.077 8.161   24.706  1.00 44.94  ? 134 MET B CG  1 
ATOM   3208  S  SD  . MET B 1 134 ? -15.149 7.891   23.188  1.00 44.74  ? 134 MET B SD  1 
ATOM   3209  C  CE  . MET B 1 134 ? -15.970 9.031   22.081  1.00 63.42  ? 134 MET B CE  1 
ATOM   3210  N  N   . GLN B 1 135 ? -19.957 10.305  25.998  1.00 44.68  ? 135 GLN B N   1 
ATOM   3211  C  CA  . GLN B 1 135 ? -20.751 10.175  27.236  1.00 46.91  ? 135 GLN B CA  1 
ATOM   3212  C  C   . GLN B 1 135 ? -22.170 9.755   26.979  1.00 50.07  ? 135 GLN B C   1 
ATOM   3213  O  O   . GLN B 1 135 ? -22.904 10.514  26.357  1.00 61.44  ? 135 GLN B O   1 
ATOM   3214  C  CB  . GLN B 1 135 ? -20.886 11.530  27.929  1.00 54.24  ? 135 GLN B CB  1 
ATOM   3215  C  CG  . GLN B 1 135 ? -19.827 11.875  28.942  1.00 69.51  ? 135 GLN B CG  1 
ATOM   3216  C  CD  . GLN B 1 135 ? -20.071 13.244  29.576  1.00 63.85  ? 135 GLN B CD  1 
ATOM   3217  O  OE1 . GLN B 1 135 ? -21.181 13.796  29.513  1.00 56.88  ? 135 GLN B OE1 1 
ATOM   3218  N  NE2 . GLN B 1 135 ? -19.029 13.797  30.184  1.00 60.30  ? 135 GLN B NE2 1 
ATOM   3219  N  N   . VAL B 1 136 ? -22.560 8.573   27.444  1.00 38.31  ? 136 VAL B N   1 
ATOM   3220  C  CA  . VAL B 1 136 ? -23.932 8.110   27.275  1.00 49.48  ? 136 VAL B CA  1 
ATOM   3221  C  C   . VAL B 1 136 ? -24.822 8.713   28.355  1.00 53.19  ? 136 VAL B C   1 
ATOM   3222  O  O   . VAL B 1 136 ? -26.040 8.793   28.200  1.00 53.08  ? 136 VAL B O   1 
ATOM   3223  C  CB  . VAL B 1 136 ? -24.027 6.574   27.327  1.00 42.93  ? 136 VAL B CB  1 
ATOM   3224  C  CG1 . VAL B 1 136 ? -22.642 5.954   27.250  1.00 24.69  ? 136 VAL B CG1 1 
ATOM   3225  C  CG2 . VAL B 1 136 ? -24.751 6.129   28.587  1.00 41.43  ? 136 VAL B CG2 1 
ATOM   3226  N  N   . ALA B 1 137 ? -24.199 9.139   29.447  1.00 55.88  ? 137 ALA B N   1 
ATOM   3227  C  CA  . ALA B 1 137 ? -24.913 9.762   30.553  1.00 58.20  ? 137 ALA B CA  1 
ATOM   3228  C  C   . ALA B 1 137 ? -23.968 10.943  30.746  1.00 63.92  ? 137 ALA B C   1 
ATOM   3229  O  O   . ALA B 1 137 ? -22.782 10.762  31.018  1.00 69.73  ? 137 ALA B O   1 
ATOM   3230  C  CB  . ALA B 1 137 ? -25.058 8.873   31.779  1.00 50.62  ? 137 ALA B CB  1 
ATOM   3231  N  N   . HIS B 1 138 ? -24.500 12.151  30.596  1.00 58.78  ? 138 HIS B N   1 
ATOM   3232  C  CA  . HIS B 1 138 ? -23.802 13.376  30.969  1.00 53.31  ? 138 HIS B CA  1 
ATOM   3233  C  C   . HIS B 1 138 ? -23.177 13.285  32.357  1.00 53.04  ? 138 HIS B C   1 
ATOM   3234  O  O   . HIS B 1 138 ? -23.802 12.806  33.302  1.00 47.69  ? 138 HIS B O   1 
ATOM   3235  C  CB  . HIS B 1 138 ? -24.745 14.579  30.898  1.00 32.72  ? 138 HIS B CB  1 
ATOM   3236  C  CG  . HIS B 1 138 ? -24.079 15.883  31.212  1.00 51.95  ? 138 HIS B CG  1 
ATOM   3237  N  ND1 . HIS B 1 138 ? -24.154 16.477  32.453  1.00 50.94  ? 138 HIS B ND1 1 
ATOM   3238  C  CD2 . HIS B 1 138 ? -23.321 16.705  30.447  1.00 51.73  ? 138 HIS B CD2 1 
ATOM   3239  C  CE1 . HIS B 1 138 ? -23.472 17.609  32.440  1.00 44.17  ? 138 HIS B CE1 1 
ATOM   3240  N  NE2 . HIS B 1 138 ? -22.957 17.769  31.235  1.00 49.97  ? 138 HIS B NE2 1 
ATOM   3241  N  N   . ARG B 1 139 ? -21.939 13.754  32.467  1.00 32.47  ? 139 ARG B N   1 
ATOM   3242  C  CA  . ARG B 1 139 ? -21.226 13.771  33.738  1.00 55.30  ? 139 ARG B CA  1 
ATOM   3243  C  C   . ARG B 1 139 ? -20.862 15.197  34.136  1.00 71.14  ? 139 ARG B C   1 
ATOM   3244  O  O   . ARG B 1 139 ? -21.543 16.150  33.758  1.00 89.54  ? 139 ARG B O   1 
ATOM   3245  C  CB  . ARG B 1 139 ? -19.961 12.913  33.657  1.00 51.29  ? 139 ARG B CB  1 
ATOM   3246  C  CG  . ARG B 1 139 ? -20.184 11.524  33.084  1.00 57.83  ? 139 ARG B CG  1 
ATOM   3247  C  CD  . ARG B 1 139 ? -18.952 10.652  33.263  1.00 57.72  ? 139 ARG B CD  1 
ATOM   3248  N  NE  . ARG B 1 139 ? -18.790 9.699   32.169  1.00 56.73  ? 139 ARG B NE  1 
ATOM   3249  C  CZ  . ARG B 1 139 ? -17.868 9.802   31.219  1.00 55.93  ? 139 ARG B CZ  1 
ATOM   3250  N  NH1 . ARG B 1 139 ? -17.018 10.820  31.225  1.00 70.84  ? 139 ARG B NH1 1 
ATOM   3251  N  NH2 . ARG B 1 139 ? -17.793 8.888   30.262  1.00 64.41  ? 139 ARG B NH2 1 
ATOM   3252  N  N   . ASP B 1 140 ? -19.783 15.335  34.898  1.00 61.04  ? 140 ASP B N   1 
ATOM   3253  C  CA  . ASP B 1 140 ? -19.317 16.645  35.333  1.00 53.42  ? 140 ASP B CA  1 
ATOM   3254  C  C   . ASP B 1 140 ? -17.841 16.831  35.001  1.00 42.52  ? 140 ASP B C   1 
ATOM   3255  O  O   . ASP B 1 140 ? -16.970 16.297  35.686  1.00 42.93  ? 140 ASP B O   1 
ATOM   3256  C  CB  . ASP B 1 140 ? -19.546 16.826  36.835  1.00 68.27  ? 140 ASP B CB  1 
ATOM   3257  C  CG  . ASP B 1 140 ? -19.190 18.219  37.317  1.00 72.97  ? 140 ASP B CG  1 
ATOM   3258  O  OD1 . ASP B 1 140 ? -19.036 19.122  36.470  1.00 68.18  ? 140 ASP B OD1 1 
ATOM   3259  O  OD2 . ASP B 1 140 ? -19.064 18.410  38.545  1.00 77.57  ? 140 ASP B OD2 1 
ATOM   3260  N  N   . LEU B 1 141 ? -17.570 17.592  33.945  1.00 35.70  ? 141 LEU B N   1 
ATOM   3261  C  CA  . LEU B 1 141 ? -16.203 17.843  33.505  1.00 38.75  ? 141 LEU B CA  1 
ATOM   3262  C  C   . LEU B 1 141 ? -15.509 18.866  34.397  1.00 43.81  ? 141 LEU B C   1 
ATOM   3263  O  O   . LEU B 1 141 ? -14.409 19.324  34.090  1.00 54.58  ? 141 LEU B O   1 
ATOM   3264  C  CB  . LEU B 1 141 ? -16.191 18.328  32.055  1.00 51.15  ? 141 LEU B CB  1 
ATOM   3265  C  CG  . LEU B 1 141 ? -16.494 17.285  30.979  1.00 47.91  ? 141 LEU B CG  1 
ATOM   3266  C  CD1 . LEU B 1 141 ? -17.158 16.062  31.588  1.00 52.28  ? 141 LEU B CD1 1 
ATOM   3267  C  CD2 . LEU B 1 141 ? -17.363 17.883  29.885  1.00 38.03  ? 141 LEU B CD2 1 
ATOM   3268  N  N   . LYS B 1 142 ? -16.158 19.220  35.500  1.00 42.30  ? 142 LYS B N   1 
ATOM   3269  C  CA  . LYS B 1 142 ? -15.613 20.186  36.424  1.00 49.37  ? 142 LYS B CA  1 
ATOM   3270  C  C   . LYS B 1 142 ? -14.958 21.343  35.694  1.00 47.74  ? 142 LYS B C   1 
ATOM   3271  O  O   . LYS B 1 142 ? -13.826 21.650  35.991  1.00 37.37  ? 142 LYS B O   1 
ATOM   3272  C  CB  . LYS B 1 142 ? -14.570 19.491  37.276  1.00 36.46  ? 142 LYS B CB  1 
ATOM   3273  C  CG  . LYS B 1 142 ? -15.159 18.369  38.105  1.00 53.00  ? 142 LYS B CG  1 
ATOM   3274  C  CD  . LYS B 1 142 ? -14.094 17.666  38.934  1.00 58.03  ? 142 LYS B CD  1 
ATOM   3275  C  CE  . LYS B 1 142 ? -14.630 16.373  39.483  1.00 60.82  ? 142 LYS B CE  1 
ATOM   3276  N  NZ  . LYS B 1 142 ? -15.081 15.509  38.355  1.00 66.11  ? 142 LYS B NZ  1 
ATOM   3277  N  N   . LEU B 1 143 ? -15.650 21.975  34.745  1.00 42.23  ? 143 LEU B N   1 
ATOM   3278  C  CA  . LEU B 1 143 ? -14.990 22.966  33.885  1.00 42.47  ? 143 LEU B CA  1 
ATOM   3279  C  C   . LEU B 1 143 ? -14.371 24.146  34.642  1.00 52.43  ? 143 LEU B C   1 
ATOM   3280  O  O   . LEU B 1 143 ? -13.556 24.906  34.109  1.00 61.60  ? 143 LEU B O   1 
ATOM   3281  C  CB  . LEU B 1 143 ? -15.922 23.473  32.782  1.00 46.02  ? 143 LEU B CB  1 
ATOM   3282  C  CG  . LEU B 1 143 ? -16.060 22.525  31.594  1.00 45.23  ? 143 LEU B CG  1 
ATOM   3283  C  CD1 . LEU B 1 143 ? -14.805 21.677  31.405  1.00 32.13  ? 143 LEU B CD1 1 
ATOM   3284  C  CD2 . LEU B 1 143 ? -17.205 21.632  31.822  1.00 37.08  ? 143 LEU B CD2 1 
ATOM   3285  N  N   . GLU B 1 144 ? -14.726 24.312  35.898  1.00 51.82  ? 144 GLU B N   1 
ATOM   3286  C  CA  . GLU B 1 144 ? -14.234 25.483  36.591  1.00 54.64  ? 144 GLU B CA  1 
ATOM   3287  C  C   . GLU B 1 144 ? -12.916 25.202  37.268  1.00 54.36  ? 144 GLU B C   1 
ATOM   3288  O  O   . GLU B 1 144 ? -12.409 26.016  38.037  1.00 59.63  ? 144 GLU B O   1 
ATOM   3289  C  CB  . GLU B 1 144 ? -15.263 25.964  37.600  1.00 59.87  ? 144 GLU B CB  1 
ATOM   3290  C  CG  . GLU B 1 144 ? -15.672 24.946  38.629  1.00 68.54  ? 144 GLU B CG  1 
ATOM   3291  C  CD  . GLU B 1 144 ? -17.137 24.534  38.487  1.00 90.84  ? 144 GLU B CD  1 
ATOM   3292  O  OE1 . GLU B 1 144 ? -18.016 25.213  39.078  1.00 102.72 ? 144 GLU B OE1 1 
ATOM   3293  O  OE2 . GLU B 1 144 ? -17.405 23.529  37.777  1.00 89.60  ? 144 GLU B OE2 1 
ATOM   3294  N  N   . ASN B 1 145 ? -12.364 24.023  37.002  1.00 48.06  ? 145 ASN B N   1 
ATOM   3295  C  CA  . ASN B 1 145 ? -11.122 23.600  37.636  1.00 63.24  ? 145 ASN B CA  1 
ATOM   3296  C  C   . ASN B 1 145 ? -10.205 22.841  36.685  1.00 57.51  ? 145 ASN B C   1 
ATOM   3297  O  O   . ASN B 1 145 ? -9.650  21.803  37.041  1.00 60.21  ? 145 ASN B O   1 
ATOM   3298  C  CB  . ASN B 1 145 ? -11.418 22.741  38.867  1.00 61.05  ? 145 ASN B CB  1 
ATOM   3299  C  CG  . ASN B 1 145 ? -11.494 23.556  40.142  1.00 65.08  ? 145 ASN B CG  1 
ATOM   3300  O  OD1 . ASN B 1 145 ? -10.605 24.355  40.435  1.00 77.37  ? 145 ASN B OD1 1 
ATOM   3301  N  ND2 . ASN B 1 145 ? -12.559 23.357  40.909  1.00 63.73  ? 145 ASN B ND2 1 
ATOM   3302  N  N   . THR B 1 146 ? -10.048 23.366  35.475  1.00 43.59  ? 146 THR B N   1 
ATOM   3303  C  CA  . THR B 1 146 ? -9.172  22.749  34.488  1.00 38.64  ? 146 THR B CA  1 
ATOM   3304  C  C   . THR B 1 146 ? -7.717  22.848  34.931  1.00 45.12  ? 146 THR B C   1 
ATOM   3305  O  O   . THR B 1 146 ? -7.307  23.847  35.520  1.00 50.36  ? 146 THR B O   1 
ATOM   3306  C  CB  . THR B 1 146 ? -9.330  23.405  33.106  1.00 46.83  ? 146 THR B CB  1 
ATOM   3307  O  OG1 . THR B 1 146 ? -10.721 23.494  32.774  1.00 50.76  ? 146 THR B OG1 1 
ATOM   3308  C  CG2 . THR B 1 146 ? -8.613  22.587  32.044  1.00 70.33  ? 146 THR B CG2 1 
ATOM   3309  N  N   . LEU B 1 147 ? -6.943  21.806  34.648  1.00 45.04  ? 147 LEU B N   1 
ATOM   3310  C  CA  . LEU B 1 147 ? -5.538  21.772  35.036  1.00 44.36  ? 147 LEU B CA  1 
ATOM   3311  C  C   . LEU B 1 147 ? -4.625  21.926  33.826  1.00 41.48  ? 147 LEU B C   1 
ATOM   3312  O  O   . LEU B 1 147 ? -5.092  22.045  32.695  1.00 36.34  ? 147 LEU B O   1 
ATOM   3313  C  CB  . LEU B 1 147 ? -5.218  20.470  35.772  1.00 38.67  ? 147 LEU B CB  1 
ATOM   3314  C  CG  . LEU B 1 147 ? -6.292  19.954  36.730  1.00 38.84  ? 147 LEU B CG  1 
ATOM   3315  C  CD1 . LEU B 1 147 ? -5.804  18.717  37.466  1.00 46.63  ? 147 LEU B CD1 1 
ATOM   3316  C  CD2 . LEU B 1 147 ? -6.702  21.039  37.710  1.00 37.60  ? 147 LEU B CD2 1 
ATOM   3317  N  N   . LEU B 1 148 ? -3.319  21.923  34.074  1.00 45.48  ? 148 LEU B N   1 
ATOM   3318  C  CA  . LEU B 1 148 ? -2.343  22.045  33.004  1.00 45.41  ? 148 LEU B CA  1 
ATOM   3319  C  C   . LEU B 1 148 ? -1.162  21.150  33.315  1.00 52.49  ? 148 LEU B C   1 
ATOM   3320  O  O   . LEU B 1 148 ? -0.678  21.128  34.446  1.00 64.08  ? 148 LEU B O   1 
ATOM   3321  C  CB  . LEU B 1 148 ? -1.880  23.495  32.857  1.00 48.74  ? 148 LEU B CB  1 
ATOM   3322  C  CG  . LEU B 1 148 ? -2.936  24.579  33.076  1.00 46.75  ? 148 LEU B CG  1 
ATOM   3323  C  CD1 . LEU B 1 148 ? -2.317  25.804  33.728  1.00 33.39  ? 148 LEU B CD1 1 
ATOM   3324  C  CD2 . LEU B 1 148 ? -3.604  24.948  31.762  1.00 57.65  ? 148 LEU B CD2 1 
ATOM   3325  N  N   . ASP B 1 149 ? -0.704  20.405  32.315  1.00 61.75  ? 149 ASP B N   1 
ATOM   3326  C  CA  . ASP B 1 149 ? 0.428   19.505  32.493  1.00 68.40  ? 149 ASP B CA  1 
ATOM   3327  C  C   . ASP B 1 149 ? 1.718   20.291  32.690  1.00 69.70  ? 149 ASP B C   1 
ATOM   3328  O  O   . ASP B 1 149 ? 1.775   21.488  32.415  1.00 75.11  ? 149 ASP B O   1 
ATOM   3329  C  CB  . ASP B 1 149 ? 0.560   18.569  31.290  1.00 62.88  ? 149 ASP B CB  1 
ATOM   3330  C  CG  . ASP B 1 149 ? 1.407   19.160  30.182  1.00 79.08  ? 149 ASP B CG  1 
ATOM   3331  O  OD1 . ASP B 1 149 ? 1.842   20.322  30.321  1.00 81.21  ? 149 ASP B OD1 1 
ATOM   3332  O  OD2 . ASP B 1 149 ? 1.639   18.463  29.173  1.00 89.90  ? 149 ASP B OD2 1 
ATOM   3333  N  N   . GLY B 1 150 ? 2.753   19.610  33.171  1.00 62.34  ? 150 GLY B N   1 
ATOM   3334  C  CA  . GLY B 1 150 ? 4.040   20.241  33.393  1.00 50.12  ? 150 GLY B CA  1 
ATOM   3335  C  C   . GLY B 1 150 ? 5.134   20.413  32.359  1.00 66.45  ? 150 GLY B C   1 
ATOM   3336  O  O   . GLY B 1 150 ? 6.052   19.598  32.272  1.00 90.17  ? 150 GLY B O   1 
ATOM   3337  N  N   . SER B 1 151 ? 5.035   21.477  31.569  1.00 70.59  ? 151 SER B N   1 
ATOM   3338  C  CA  . SER B 1 151 ? 5.813   21.648  30.348  1.00 80.17  ? 151 SER B CA  1 
ATOM   3339  C  C   . SER B 1 151 ? 5.539   23.003  29.706  1.00 85.57  ? 151 SER B C   1 
ATOM   3340  O  O   . SER B 1 151 ? 4.390   23.432  29.609  1.00 92.33  ? 151 SER B O   1 
ATOM   3341  C  CB  . SER B 1 151 ? 5.499   20.528  29.356  1.00 80.09  ? 151 SER B CB  1 
ATOM   3342  O  OG  . SER B 1 151 ? 4.102   20.406  29.151  1.00 68.25  ? 151 SER B OG  1 
ATOM   3343  N  N   . PRO B 1 152 ? 6.600   23.671  29.267  1.00 93.53  ? 152 PRO B N   1 
ATOM   3344  C  CA  . PRO B 1 152 ? 6.464   24.978  28.616  1.00 99.35  ? 152 PRO B CA  1 
ATOM   3345  C  C   . PRO B 1 152 ? 5.056   25.176  28.069  1.00 104.88 ? 152 PRO B C   1 
ATOM   3346  O  O   . PRO B 1 152 ? 4.211   25.764  28.745  1.00 117.66 ? 152 PRO B O   1 
ATOM   3347  C  CB  . PRO B 1 152 ? 7.470   24.896  27.468  1.00 100.88 ? 152 PRO B CB  1 
ATOM   3348  C  CG  . PRO B 1 152 ? 8.513   23.958  27.959  1.00 91.89  ? 152 PRO B CG  1 
ATOM   3349  C  CD  . PRO B 1 152 ? 7.793   22.943  28.804  1.00 95.13  ? 152 PRO B CD  1 
ATOM   3350  N  N   . ALA B 1 153 ? 4.810   24.685  26.859  1.00 97.00  ? 153 ALA B N   1 
ATOM   3351  C  CA  . ALA B 1 153 ? 3.488   24.780  26.255  1.00 89.71  ? 153 ALA B CA  1 
ATOM   3352  C  C   . ALA B 1 153 ? 2.475   24.000  27.084  1.00 88.90  ? 153 ALA B C   1 
ATOM   3353  O  O   . ALA B 1 153 ? 2.087   22.889  26.725  1.00 93.45  ? 153 ALA B O   1 
ATOM   3354  C  CB  . ALA B 1 153 ? 3.519   24.262  24.827  1.00 91.05  ? 153 ALA B CB  1 
ATOM   3355  N  N   . PRO B 1 154 ? 2.057   24.589  28.199  1.00 79.98  ? 154 PRO B N   1 
ATOM   3356  C  CA  . PRO B 1 154 ? 1.112   23.937  29.112  1.00 64.79  ? 154 PRO B CA  1 
ATOM   3357  C  C   . PRO B 1 154 ? -0.112  23.395  28.381  1.00 51.25  ? 154 PRO B C   1 
ATOM   3358  O  O   . PRO B 1 154 ? -0.836  24.151  27.733  1.00 65.38  ? 154 PRO B O   1 
ATOM   3359  C  CB  . PRO B 1 154 ? 0.706   25.069  30.061  1.00 73.56  ? 154 PRO B CB  1 
ATOM   3360  C  CG  . PRO B 1 154 ? 0.963   26.319  29.297  1.00 77.22  ? 154 PRO B CG  1 
ATOM   3361  C  CD  . PRO B 1 154 ? 2.164   26.034  28.450  1.00 81.08  ? 154 PRO B CD  1 
ATOM   3362  N  N   A ARG B 1 155 ? -0.335  22.091  28.492  0.55 49.50  ? 155 ARG B N   1 
ATOM   3363  N  N   B ARG B 1 155 ? -0.336  22.090  28.488  0.45 49.62  ? 155 ARG B N   1 
ATOM   3364  C  CA  A ARG B 1 155 ? -1.463  21.446  27.836  0.55 49.66  ? 155 ARG B CA  1 
ATOM   3365  C  CA  B ARG B 1 155 ? -1.465  21.453  27.824  0.45 49.83  ? 155 ARG B CA  1 
ATOM   3366  C  C   A ARG B 1 155 ? -2.668  21.361  28.765  0.55 47.94  ? 155 ARG B C   1 
ATOM   3367  C  C   B ARG B 1 155 ? -2.671  21.348  28.751  0.45 47.94  ? 155 ARG B C   1 
ATOM   3368  O  O   A ARG B 1 155 ? -2.595  20.763  29.837  0.55 49.87  ? 155 ARG B O   1 
ATOM   3369  O  O   B ARG B 1 155 ? -2.599  20.724  29.809  0.45 50.49  ? 155 ARG B O   1 
ATOM   3370  C  CB  A ARG B 1 155 ? -1.071  20.047  27.361  0.55 54.18  ? 155 ARG B CB  1 
ATOM   3371  C  CB  B ARG B 1 155 ? -1.071  20.064  27.317  0.45 55.28  ? 155 ARG B CB  1 
ATOM   3372  C  CG  A ARG B 1 155 ? -1.299  19.799  25.879  0.55 61.82  ? 155 ARG B CG  1 
ATOM   3373  C  CG  B ARG B 1 155 ? -1.316  19.850  25.833  0.45 61.38  ? 155 ARG B CG  1 
ATOM   3374  C  CD  A ARG B 1 155 ? -1.936  18.441  25.638  0.55 58.76  ? 155 ARG B CD  1 
ATOM   3375  C  CD  B ARG B 1 155 ? -0.199  20.450  24.996  0.45 52.09  ? 155 ARG B CD  1 
ATOM   3376  N  NE  A ARG B 1 155 ? -1.020  17.514  24.979  0.55 55.86  ? 155 ARG B NE  1 
ATOM   3377  N  NE  B ARG B 1 155 ? -0.706  21.374  23.986  0.45 48.56  ? 155 ARG B NE  1 
ATOM   3378  C  CZ  A ARG B 1 155 ? -0.632  16.352  25.494  0.55 64.39  ? 155 ARG B CZ  1 
ATOM   3379  C  CZ  B ARG B 1 155 ? -1.744  21.121  23.195  0.45 40.38  ? 155 ARG B CZ  1 
ATOM   3380  N  NH1 A ARG B 1 155 ? -1.081  15.969  26.681  0.55 62.80  ? 155 ARG B NH1 1 
ATOM   3381  N  NH1 B ARG B 1 155 ? -2.390  19.968  23.296  0.45 38.55  ? 155 ARG B NH1 1 
ATOM   3382  N  NH2 A ARG B 1 155 ? 0.205   15.573  24.824  0.55 66.01  ? 155 ARG B NH2 1 
ATOM   3383  N  NH2 B ARG B 1 155 ? -2.135  22.021  22.304  0.45 44.42  ? 155 ARG B NH2 1 
ATOM   3384  N  N   . LEU B 1 156 ? -3.786  21.876  28.295  1.00 36.75  ? 156 LEU B N   1 
ATOM   3385  C  CA  . LEU B 1 156 ? -5.018  21.832  29.078  1.00 31.57  ? 156 LEU B CA  1 
ATOM   3386  C  C   . LEU B 1 156 ? -5.398  20.395  29.444  1.00 47.92  ? 156 LEU B C   1 
ATOM   3387  O  O   . LEU B 1 156 ? -5.393  19.513  28.586  1.00 41.94  ? 156 LEU B O   1 
ATOM   3388  C  CB  . LEU B 1 156 ? -6.160  22.500  28.311  1.00 37.14  ? 156 LEU B CB  1 
ATOM   3389  C  CG  . LEU B 1 156 ? -7.429  22.805  29.108  1.00 45.10  ? 156 LEU B CG  1 
ATOM   3390  C  CD1 . LEU B 1 156 ? -7.079  23.271  30.511  1.00 57.53  ? 156 LEU B CD1 1 
ATOM   3391  C  CD2 . LEU B 1 156 ? -8.275  23.844  28.391  1.00 58.09  ? 156 LEU B CD2 1 
ATOM   3392  N  N   . LYS B 1 157 ? -5.728  20.162  30.713  1.00 38.97  ? 157 LYS B N   1 
ATOM   3393  C  CA  . LYS B 1 157 ? -6.136  18.828  31.152  1.00 35.52  ? 157 LYS B CA  1 
ATOM   3394  C  C   . LYS B 1 157 ? -7.467  18.884  31.904  1.00 44.01  ? 157 LYS B C   1 
ATOM   3395  O  O   . LYS B 1 157 ? -7.571  19.513  32.962  1.00 41.93  ? 157 LYS B O   1 
ATOM   3396  C  CB  . LYS B 1 157 ? -5.067  18.195  32.046  1.00 48.49  ? 157 LYS B CB  1 
ATOM   3397  C  CG  . LYS B 1 157 ? -3.786  17.867  31.324  1.00 52.76  ? 157 LYS B CG  1 
ATOM   3398  C  CD  . LYS B 1 157 ? -3.975  16.615  30.495  1.00 44.57  ? 157 LYS B CD  1 
ATOM   3399  C  CE  . LYS B 1 157 ? -2.798  16.397  29.555  1.00 63.50  ? 157 LYS B CE  1 
ATOM   3400  N  NZ  . LYS B 1 157 ? -2.714  14.958  29.124  1.00 74.25  ? 157 LYS B NZ  1 
ATOM   3401  N  N   . ILE B 1 158 ? -8.488  18.221  31.353  1.00 45.39  ? 158 ILE B N   1 
ATOM   3402  C  CA  . ILE B 1 158 ? -9.817  18.135  31.978  1.00 30.71  ? 158 ILE B CA  1 
ATOM   3403  C  C   . ILE B 1 158 ? -9.991  16.925  32.874  1.00 43.85  ? 158 ILE B C   1 
ATOM   3404  O  O   . ILE B 1 158 ? -9.498  15.838  32.560  1.00 41.75  ? 158 ILE B O   1 
ATOM   3405  C  CB  . ILE B 1 158 ? -10.898 17.998  30.925  1.00 28.94  ? 158 ILE B CB  1 
ATOM   3406  C  CG1 . ILE B 1 158 ? -10.868 19.185  29.978  1.00 36.03  ? 158 ILE B CG1 1 
ATOM   3407  C  CG2 . ILE B 1 158 ? -12.254 17.870  31.573  1.00 38.98  ? 158 ILE B CG2 1 
ATOM   3408  C  CD1 . ILE B 1 158 ? -11.806 19.044  28.859  1.00 41.08  ? 158 ILE B CD1 1 
ATOM   3409  N  N   . ALA B 1 159 ? -10.782 17.073  33.935  1.00 50.52  ? 159 ALA B N   1 
ATOM   3410  C  CA  . ALA B 1 159 ? -10.881 16.018  34.946  1.00 49.85  ? 159 ALA B CA  1 
ATOM   3411  C  C   . ALA B 1 159 ? -12.185 15.229  34.964  1.00 58.94  ? 159 ALA B C   1 
ATOM   3412  O  O   . ALA B 1 159 ? -12.932 15.283  35.938  1.00 68.31  ? 159 ALA B O   1 
ATOM   3413  C  CB  . ALA B 1 159 ? -10.646 16.624  36.321  1.00 50.09  ? 159 ALA B CB  1 
ATOM   3414  N  N   . ASP B 1 160 ? -12.440 14.493  33.887  1.00 60.29  ? 160 ASP B N   1 
ATOM   3415  C  CA  . ASP B 1 160 ? -13.644 13.680  33.772  1.00 58.05  ? 160 ASP B CA  1 
ATOM   3416  C  C   . ASP B 1 160 ? -13.459 12.323  34.442  1.00 57.37  ? 160 ASP B C   1 
ATOM   3417  O  O   . ASP B 1 160 ? -12.999 11.368  33.817  1.00 39.98  ? 160 ASP B O   1 
ATOM   3418  C  CB  . ASP B 1 160 ? -14.020 13.492  32.302  1.00 36.60  ? 160 ASP B CB  1 
ATOM   3419  C  CG  . ASP B 1 160 ? -15.369 12.825  32.126  1.00 51.91  ? 160 ASP B CG  1 
ATOM   3420  O  OD1 . ASP B 1 160 ? -16.049 12.578  33.144  1.00 61.19  ? 160 ASP B OD1 1 
ATOM   3421  O  OD2 . ASP B 1 160 ? -15.751 12.549  30.970  1.00 51.08  ? 160 ASP B OD2 1 
ATOM   3422  N  N   . PHE B 1 161 ? -13.819 12.243  35.718  1.00 56.48  ? 161 PHE B N   1 
ATOM   3423  C  CA  . PHE B 1 161 ? -13.698 11.002  36.473  1.00 49.85  ? 161 PHE B CA  1 
ATOM   3424  C  C   . PHE B 1 161 ? -14.135 11.198  37.919  1.00 52.70  ? 161 PHE B C   1 
ATOM   3425  O  O   . PHE B 1 161 ? -13.686 12.125  38.593  1.00 76.30  ? 161 PHE B O   1 
ATOM   3426  C  CB  . PHE B 1 161 ? -12.260 10.482  36.423  1.00 58.94  ? 161 PHE B CB  1 
ATOM   3427  C  CG  . PHE B 1 161 ? -11.275 11.353  37.148  1.00 50.67  ? 161 PHE B CG  1 
ATOM   3428  C  CD1 . PHE B 1 161 ? -10.425 12.192  36.448  1.00 54.27  ? 161 PHE B CD1 1 
ATOM   3429  C  CD2 . PHE B 1 161 ? -11.198 11.333  38.530  1.00 51.11  ? 161 PHE B CD2 1 
ATOM   3430  C  CE1 . PHE B 1 161 ? -9.518  12.994  37.112  1.00 56.95  ? 161 PHE B CE1 1 
ATOM   3431  C  CE2 . PHE B 1 161 ? -10.293 12.133  39.200  1.00 53.14  ? 161 PHE B CE2 1 
ATOM   3432  C  CZ  . PHE B 1 161 ? -9.452  12.965  38.489  1.00 51.68  ? 161 PHE B CZ  1 
ATOM   3433  N  N   . GLY B 1 162 ? -15.015 10.320  38.392  1.00 57.16  ? 162 GLY B N   1 
ATOM   3434  C  CA  . GLY B 1 162 ? -15.520 10.407  39.749  1.00 68.94  ? 162 GLY B CA  1 
ATOM   3435  C  C   . GLY B 1 162 ? -15.402 9.098   40.505  1.00 70.53  ? 162 GLY B C   1 
ATOM   3436  O  O   . GLY B 1 162 ? -16.197 8.180   40.304  1.00 83.40  ? 162 GLY B O   1 
ATOM   3437  N  N   . TYR B 1 163 ? -14.406 9.016   41.380  1.00 63.75  ? 163 TYR B N   1 
ATOM   3438  C  CA  . TYR B 1 163 ? -14.184 7.815   42.176  1.00 58.16  ? 163 TYR B CA  1 
ATOM   3439  C  C   . TYR B 1 163 ? -14.564 8.046   43.634  1.00 67.02  ? 163 TYR B C   1 
ATOM   3440  O  O   . TYR B 1 163 ? -14.218 9.070   44.221  1.00 71.22  ? 163 TYR B O   1 
ATOM   3441  C  CB  . TYR B 1 163 ? -12.724 7.369   42.078  1.00 35.97  ? 163 TYR B CB  1 
ATOM   3442  C  CG  . TYR B 1 163 ? -12.290 6.998   40.679  1.00 39.32  ? 163 TYR B CG  1 
ATOM   3443  C  CD1 . TYR B 1 163 ? -11.445 7.824   39.951  1.00 35.16  ? 163 TYR B CD1 1 
ATOM   3444  C  CD2 . TYR B 1 163 ? -12.725 5.821   40.086  1.00 42.17  ? 163 TYR B CD2 1 
ATOM   3445  C  CE1 . TYR B 1 163 ? -11.046 7.489   38.672  1.00 48.72  ? 163 TYR B CE1 1 
ATOM   3446  C  CE2 . TYR B 1 163 ? -12.332 5.477   38.808  1.00 41.57  ? 163 TYR B CE2 1 
ATOM   3447  C  CZ  . TYR B 1 163 ? -11.492 6.314   38.106  1.00 47.39  ? 163 TYR B CZ  1 
ATOM   3448  O  OH  . TYR B 1 163 ? -11.097 5.976   36.832  1.00 42.10  ? 163 TYR B OH  1 
ATOM   3449  N  N   . GLY B 1 178 ? -16.488 26.251  45.836  1.00 104.05 ? 178 GLY B N   1 
ATOM   3450  C  CA  . GLY B 1 178 ? -16.976 26.352  44.473  1.00 105.28 ? 178 GLY B CA  1 
ATOM   3451  C  C   . GLY B 1 178 ? -17.479 27.742  44.139  1.00 103.29 ? 178 GLY B C   1 
ATOM   3452  O  O   . GLY B 1 178 ? -17.592 28.598  45.018  1.00 102.56 ? 178 GLY B O   1 
ATOM   3453  N  N   . THR B 1 179 ? -17.785 27.963  42.865  1.00 98.35  ? 179 THR B N   1 
ATOM   3454  C  CA  . THR B 1 179 ? -18.309 29.245  42.410  1.00 87.74  ? 179 THR B CA  1 
ATOM   3455  C  C   . THR B 1 179 ? -19.574 29.039  41.583  1.00 79.72  ? 179 THR B C   1 
ATOM   3456  O  O   . THR B 1 179 ? -19.810 27.951  41.058  1.00 86.79  ? 179 THR B O   1 
ATOM   3457  C  CB  . THR B 1 179 ? -17.274 30.016  41.572  1.00 91.36  ? 179 THR B CB  1 
ATOM   3458  O  OG1 . THR B 1 179 ? -17.943 30.756  40.544  1.00 104.58 ? 179 THR B OG1 1 
ATOM   3459  C  CG2 . THR B 1 179 ? -16.281 29.054  40.935  1.00 87.41  ? 179 THR B CG2 1 
ATOM   3460  N  N   . PRO B 1 180 ? -20.383 30.087  41.470  1.00 67.10  ? 180 PRO B N   1 
ATOM   3461  C  CA  . PRO B 1 180 ? -21.646 30.005  40.731  1.00 59.88  ? 180 PRO B CA  1 
ATOM   3462  C  C   . PRO B 1 180 ? -21.573 30.714  39.385  1.00 63.30  ? 180 PRO B C   1 
ATOM   3463  O  O   . PRO B 1 180 ? -22.597 30.883  38.724  1.00 61.01  ? 180 PRO B O   1 
ATOM   3464  C  CB  . PRO B 1 180 ? -22.627 30.733  41.651  1.00 53.29  ? 180 PRO B CB  1 
ATOM   3465  C  CG  . PRO B 1 180 ? -21.786 31.726  42.369  1.00 34.23  ? 180 PRO B CG  1 
ATOM   3466  C  CD  . PRO B 1 180 ? -20.442 31.077  42.560  1.00 47.14  ? 180 PRO B CD  1 
ATOM   3467  N  N   . ALA B 1 181 ? -20.373 31.123  38.988  1.00 65.36  ? 181 ALA B N   1 
ATOM   3468  C  CA  . ALA B 1 181 ? -20.185 31.841  37.733  1.00 75.95  ? 181 ALA B CA  1 
ATOM   3469  C  C   . ALA B 1 181 ? -20.431 30.946  36.523  1.00 72.29  ? 181 ALA B C   1 
ATOM   3470  O  O   . ALA B 1 181 ? -21.002 31.381  35.524  1.00 72.26  ? 181 ALA B O   1 
ATOM   3471  C  CB  . ALA B 1 181 ? -18.790 32.446  37.672  1.00 82.41  ? 181 ALA B CB  1 
ATOM   3472  N  N   . TYR B 1 182 ? -19.995 29.694  36.618  1.00 60.41  ? 182 TYR B N   1 
ATOM   3473  C  CA  . TYR B 1 182 ? -20.127 28.751  35.513  1.00 49.31  ? 182 TYR B CA  1 
ATOM   3474  C  C   . TYR B 1 182 ? -21.544 28.198  35.393  1.00 49.67  ? 182 TYR B C   1 
ATOM   3475  O  O   . TYR B 1 182 ? -21.873 27.525  34.417  1.00 51.03  ? 182 TYR B O   1 
ATOM   3476  C  CB  . TYR B 1 182 ? -19.124 27.606  35.665  1.00 47.23  ? 182 TYR B CB  1 
ATOM   3477  C  CG  . TYR B 1 182 ? -17.682 28.059  35.674  1.00 43.47  ? 182 TYR B CG  1 
ATOM   3478  C  CD1 . TYR B 1 182 ? -17.125 28.641  36.803  1.00 36.77  ? 182 TYR B CD1 1 
ATOM   3479  C  CD2 . TYR B 1 182 ? -16.878 27.905  34.552  1.00 39.14  ? 182 TYR B CD2 1 
ATOM   3480  C  CE1 . TYR B 1 182 ? -15.808 29.057  36.817  1.00 33.21  ? 182 TYR B CE1 1 
ATOM   3481  C  CE2 . TYR B 1 182 ? -15.561 28.318  34.557  1.00 36.86  ? 182 TYR B CE2 1 
ATOM   3482  C  CZ  . TYR B 1 182 ? -15.031 28.893  35.691  1.00 41.84  ? 182 TYR B CZ  1 
ATOM   3483  O  OH  . TYR B 1 182 ? -13.719 29.307  35.702  1.00 43.90  ? 182 TYR B OH  1 
ATOM   3484  N  N   . ILE B 1 183 ? -22.379 28.484  36.386  1.00 44.28  ? 183 ILE B N   1 
ATOM   3485  C  CA  . ILE B 1 183 ? -23.760 28.017  36.378  1.00 43.22  ? 183 ILE B CA  1 
ATOM   3486  C  C   . ILE B 1 183 ? -24.556 28.691  35.266  1.00 50.20  ? 183 ILE B C   1 
ATOM   3487  O  O   . ILE B 1 183 ? -24.600 29.918  35.177  1.00 47.33  ? 183 ILE B O   1 
ATOM   3488  C  CB  . ILE B 1 183 ? -24.456 28.278  37.725  1.00 45.03  ? 183 ILE B CB  1 
ATOM   3489  C  CG1 . ILE B 1 183 ? -23.711 27.568  38.856  1.00 40.03  ? 183 ILE B CG1 1 
ATOM   3490  C  CG2 . ILE B 1 183 ? -25.906 27.823  37.671  1.00 36.95  ? 183 ILE B CG2 1 
ATOM   3491  C  CD1 . ILE B 1 183 ? -22.294 27.180  38.500  1.00 61.04  ? 183 ILE B CD1 1 
ATOM   3492  N  N   . ALA B 1 184 ? -25.184 27.883  34.418  1.00 55.27  ? 184 ALA B N   1 
ATOM   3493  C  CA  . ALA B 1 184 ? -25.975 28.412  33.291  1.00 36.78  ? 184 ALA B CA  1 
ATOM   3494  C  C   . ALA B 1 184 ? -27.427 28.769  33.682  1.00 39.75  ? 184 ALA B C   1 
ATOM   3495  O  O   . ALA B 1 184 ? -27.939 28.322  34.706  1.00 57.36  ? 184 ALA B O   1 
ATOM   3496  C  CB  . ALA B 1 184 ? -25.943 27.462  32.122  1.00 23.85  ? 184 ALA B CB  1 
ATOM   3497  N  N   . PRO B 1 185 ? -28.088 29.614  32.881  1.00 40.37  ? 185 PRO B N   1 
ATOM   3498  C  CA  . PRO B 1 185 ? -29.467 29.983  33.215  1.00 34.29  ? 185 PRO B CA  1 
ATOM   3499  C  C   . PRO B 1 185 ? -30.458 28.808  33.305  1.00 39.75  ? 185 PRO B C   1 
ATOM   3500  O  O   . PRO B 1 185 ? -31.186 28.772  34.299  1.00 45.66  ? 185 PRO B O   1 
ATOM   3501  C  CB  . PRO B 1 185 ? -29.836 30.945  32.094  1.00 42.59  ? 185 PRO B CB  1 
ATOM   3502  C  CG  . PRO B 1 185 ? -28.551 31.588  31.740  1.00 25.28  ? 185 PRO B CG  1 
ATOM   3503  C  CD  . PRO B 1 185 ? -27.524 30.494  31.838  1.00 36.80  ? 185 PRO B CD  1 
ATOM   3504  N  N   . GLU B 1 186 ? -30.500 27.889  32.333  1.00 33.43  ? 186 GLU B N   1 
ATOM   3505  C  CA  . GLU B 1 186 ? -31.290 26.652  32.487  1.00 48.72  ? 186 GLU B CA  1 
ATOM   3506  C  C   . GLU B 1 186 ? -31.130 25.990  33.859  1.00 44.37  ? 186 GLU B C   1 
ATOM   3507  O  O   . GLU B 1 186 ? -32.106 25.638  34.516  1.00 48.17  ? 186 GLU B O   1 
ATOM   3508  C  CB  . GLU B 1 186 ? -30.856 25.608  31.471  1.00 50.07  ? 186 GLU B CB  1 
ATOM   3509  C  CG  . GLU B 1 186 ? -30.447 26.147  30.142  1.00 44.85  ? 186 GLU B CG  1 
ATOM   3510  C  CD  . GLU B 1 186 ? -28.994 26.499  30.093  1.00 44.62  ? 186 GLU B CD  1 
ATOM   3511  O  OE1 . GLU B 1 186 ? -28.638 27.507  30.721  1.00 39.80  ? 186 GLU B OE1 1 
ATOM   3512  O  OE2 . GLU B 1 186 ? -28.217 25.785  29.425  1.00 51.60  ? 186 GLU B OE2 1 
ATOM   3513  N  N   . VAL B 1 187 ? -29.877 25.806  34.261  1.00 46.67  ? 187 VAL B N   1 
ATOM   3514  C  CA  . VAL B 1 187 ? -29.546 25.050  35.467  1.00 50.88  ? 187 VAL B CA  1 
ATOM   3515  C  C   . VAL B 1 187 ? -30.214 25.709  36.643  1.00 48.39  ? 187 VAL B C   1 
ATOM   3516  O  O   . VAL B 1 187 ? -30.600 25.059  37.609  1.00 55.47  ? 187 VAL B O   1 
ATOM   3517  C  CB  . VAL B 1 187 ? -28.015 25.052  35.744  1.00 43.31  ? 187 VAL B CB  1 
ATOM   3518  C  CG1 . VAL B 1 187 ? -27.712 24.432  37.073  1.00 33.57  ? 187 VAL B CG1 1 
ATOM   3519  C  CG2 . VAL B 1 187 ? -27.227 24.363  34.623  1.00 39.46  ? 187 VAL B CG2 1 
ATOM   3520  N  N   . LEU B 1 188 ? -30.313 27.027  36.557  1.00 41.89  ? 188 LEU B N   1 
ATOM   3521  C  CA  . LEU B 1 188 ? -30.926 27.845  37.582  1.00 40.41  ? 188 LEU B CA  1 
ATOM   3522  C  C   . LEU B 1 188 ? -32.459 27.775  37.508  1.00 51.00  ? 188 LEU B C   1 
ATOM   3523  O  O   . LEU B 1 188 ? -33.161 27.655  38.526  1.00 41.32  ? 188 LEU B O   1 
ATOM   3524  C  CB  . LEU B 1 188 ? -30.488 29.286  37.344  1.00 42.44  ? 188 LEU B CB  1 
ATOM   3525  C  CG  . LEU B 1 188 ? -29.625 29.876  38.435  1.00 43.30  ? 188 LEU B CG  1 
ATOM   3526  C  CD1 . LEU B 1 188 ? -28.891 28.735  39.099  1.00 46.13  ? 188 LEU B CD1 1 
ATOM   3527  C  CD2 . LEU B 1 188 ? -28.670 30.840  37.803  1.00 44.27  ? 188 LEU B CD2 1 
ATOM   3528  N  N   . LEU B 1 189 ? -32.977 27.855  36.287  1.00 63.06  ? 189 LEU B N   1 
ATOM   3529  C  CA  . LEU B 1 189 ? -34.408 28.075  36.086  1.00 66.37  ? 189 LEU B CA  1 
ATOM   3530  C  C   . LEU B 1 189 ? -35.189 26.794  36.150  1.00 71.69  ? 189 LEU B C   1 
ATOM   3531  O  O   . LEU B 1 189 ? -35.855 26.512  37.142  1.00 91.72  ? 189 LEU B O   1 
ATOM   3532  C  CB  . LEU B 1 189 ? -34.687 28.790  34.757  1.00 55.72  ? 189 LEU B CB  1 
ATOM   3533  C  CG  . LEU B 1 189 ? -34.407 30.299  34.796  1.00 41.27  ? 189 LEU B CG  1 
ATOM   3534  C  CD1 . LEU B 1 189 ? -34.698 30.968  33.478  1.00 46.17  ? 189 LEU B CD1 1 
ATOM   3535  C  CD2 . LEU B 1 189 ? -35.224 30.917  35.913  1.00 42.56  ? 189 LEU B CD2 1 
ATOM   3536  N  N   . LYS B 1 190 ? -35.101 26.000  35.088  1.00 63.74  ? 190 LYS B N   1 
ATOM   3537  C  CA  . LYS B 1 190 ? -35.795 24.719  35.028  1.00 78.41  ? 190 LYS B CA  1 
ATOM   3538  C  C   . LYS B 1 190 ? -35.127 23.685  35.929  1.00 90.35  ? 190 LYS B C   1 
ATOM   3539  O  O   . LYS B 1 190 ? -34.220 24.009  36.695  1.00 100.11 ? 190 LYS B O   1 
ATOM   3540  C  CB  . LYS B 1 190 ? -35.847 24.203  33.589  1.00 63.76  ? 190 LYS B CB  1 
ATOM   3541  C  CG  . LYS B 1 190 ? -35.661 25.281  32.536  1.00 61.14  ? 190 LYS B CG  1 
ATOM   3542  C  CD  . LYS B 1 190 ? -36.998 25.810  32.047  1.00 72.48  ? 190 LYS B CD  1 
ATOM   3543  C  CE  . LYS B 1 190 ? -37.495 25.028  30.843  1.00 86.74  ? 190 LYS B CE  1 
ATOM   3544  N  NZ  . LYS B 1 190 ? -38.805 24.374  31.106  1.00 91.43  ? 190 LYS B NZ  1 
ATOM   3545  N  N   . LYS B 1 191 ? -35.582 22.440  35.831  1.00 86.23  ? 191 LYS B N   1 
ATOM   3546  C  CA  . LYS B 1 191 ? -35.026 21.354  36.629  1.00 80.76  ? 191 LYS B CA  1 
ATOM   3547  C  C   . LYS B 1 191 ? -34.469 20.252  35.736  1.00 80.76  ? 191 LYS B C   1 
ATOM   3548  O  O   . LYS B 1 191 ? -33.567 19.516  36.132  1.00 71.48  ? 191 LYS B O   1 
ATOM   3549  C  CB  . LYS B 1 191 ? -36.087 20.778  37.567  1.00 78.27  ? 191 LYS B CB  1 
ATOM   3550  C  CG  . LYS B 1 191 ? -36.093 19.260  37.637  1.00 63.32  ? 191 LYS B CG  1 
ATOM   3551  C  CD  . LYS B 1 191 ? -36.724 18.768  38.929  1.00 69.91  ? 191 LYS B CD  1 
ATOM   3552  C  CE  . LYS B 1 191 ? -36.103 17.457  39.382  1.00 78.79  ? 191 LYS B CE  1 
ATOM   3553  N  NZ  . LYS B 1 191 ? -36.177 17.288  40.859  1.00 82.41  ? 191 LYS B NZ  1 
ATOM   3554  N  N   . GLU B 1 192 ? -35.016 20.146  34.530  1.00 82.25  ? 192 GLU B N   1 
ATOM   3555  C  CA  . GLU B 1 192 ? -34.565 19.150  33.567  1.00 92.82  ? 192 GLU B CA  1 
ATOM   3556  C  C   . GLU B 1 192 ? -33.962 19.829  32.344  1.00 91.08  ? 192 GLU B C   1 
ATOM   3557  O  O   . GLU B 1 192 ? -34.651 20.074  31.354  1.00 115.25 ? 192 GLU B O   1 
ATOM   3558  C  CB  . GLU B 1 192 ? -35.724 18.243  33.150  1.00 110.02 ? 192 GLU B CB  1 
ATOM   3559  C  CG  . GLU B 1 192 ? -36.573 18.801  32.020  1.00 118.93 ? 192 GLU B CG  1 
ATOM   3560  C  CD  . GLU B 1 192 ? -37.712 19.668  32.520  1.00 120.25 ? 192 GLU B CD  1 
ATOM   3561  O  OE1 . GLU B 1 192 ? -37.667 20.090  33.694  1.00 123.52 ? 192 GLU B OE1 1 
ATOM   3562  O  OE2 . GLU B 1 192 ? -38.651 19.926  31.738  1.00 114.39 ? 192 GLU B OE2 1 
ATOM   3563  N  N   . TYR B 1 193 ? -32.667 20.121  32.417  1.00 62.92  ? 193 TYR B N   1 
ATOM   3564  C  CA  . TYR B 1 193 ? -31.965 20.795  31.331  1.00 54.77  ? 193 TYR B CA  1 
ATOM   3565  C  C   . TYR B 1 193 ? -30.977 19.863  30.639  1.00 43.49  ? 193 TYR B C   1 
ATOM   3566  O  O   . TYR B 1 193 ? -30.771 18.729  31.070  1.00 45.15  ? 193 TYR B O   1 
ATOM   3567  C  CB  . TYR B 1 193 ? -31.225 22.021  31.866  1.00 52.62  ? 193 TYR B CB  1 
ATOM   3568  C  CG  . TYR B 1 193 ? -30.185 21.689  32.911  1.00 47.96  ? 193 TYR B CG  1 
ATOM   3569  C  CD1 . TYR B 1 193 ? -28.847 21.550  32.567  1.00 47.35  ? 193 TYR B CD1 1 
ATOM   3570  C  CD2 . TYR B 1 193 ? -30.541 21.507  34.240  1.00 45.28  ? 193 TYR B CD2 1 
ATOM   3571  C  CE1 . TYR B 1 193 ? -27.894 21.243  33.519  1.00 49.74  ? 193 TYR B CE1 1 
ATOM   3572  C  CE2 . TYR B 1 193 ? -29.595 21.201  35.197  1.00 44.71  ? 193 TYR B CE2 1 
ATOM   3573  C  CZ  . TYR B 1 193 ? -28.273 21.070  34.832  1.00 52.17  ? 193 TYR B CZ  1 
ATOM   3574  O  OH  . TYR B 1 193 ? -27.328 20.765  35.782  1.00 62.56  ? 193 TYR B OH  1 
ATOM   3575  N  N   . ASP B 1 194 ? -30.365 20.353  29.564  1.00 48.65  ? 194 ASP B N   1 
ATOM   3576  C  CA  . ASP B 1 194 ? -29.368 19.586  28.828  1.00 48.94  ? 194 ASP B CA  1 
ATOM   3577  C  C   . ASP B 1 194 ? -27.959 20.003  29.236  1.00 64.82  ? 194 ASP B C   1 
ATOM   3578  O  O   . ASP B 1 194 ? -27.594 21.174  29.132  1.00 83.16  ? 194 ASP B O   1 
ATOM   3579  C  CB  . ASP B 1 194 ? -29.555 19.770  27.322  1.00 45.77  ? 194 ASP B CB  1 
ATOM   3580  C  CG  . ASP B 1 194 ? -28.409 19.192  26.518  1.00 68.66  ? 194 ASP B CG  1 
ATOM   3581  O  OD1 . ASP B 1 194 ? -28.488 19.204  25.271  1.00 68.22  ? 194 ASP B OD1 1 
ATOM   3582  O  OD2 . ASP B 1 194 ? -27.428 18.725  27.133  1.00 77.56  ? 194 ASP B OD2 1 
ATOM   3583  N  N   . GLY B 1 195 ? -27.173 19.040  29.704  1.00 51.70  ? 195 GLY B N   1 
ATOM   3584  C  CA  . GLY B 1 195 ? -25.831 19.312  30.184  1.00 44.63  ? 195 GLY B CA  1 
ATOM   3585  C  C   . GLY B 1 195 ? -24.846 19.706  29.101  1.00 43.57  ? 195 GLY B C   1 
ATOM   3586  O  O   . GLY B 1 195 ? -23.820 20.322  29.383  1.00 40.93  ? 195 GLY B O   1 
ATOM   3587  N  N   . LYS B 1 196 ? -25.154 19.349  27.859  1.00 46.95  ? 196 LYS B N   1 
ATOM   3588  C  CA  . LYS B 1 196 ? -24.269 19.650  26.738  1.00 61.51  ? 196 LYS B CA  1 
ATOM   3589  C  C   . LYS B 1 196 ? -24.194 21.149  26.459  1.00 54.51  ? 196 LYS B C   1 
ATOM   3590  O  O   . LYS B 1 196 ? -23.108 21.709  26.322  1.00 58.77  ? 196 LYS B O   1 
ATOM   3591  C  CB  . LYS B 1 196 ? -24.717 18.899  25.483  1.00 72.48  ? 196 LYS B CB  1 
ATOM   3592  C  CG  . LYS B 1 196 ? -23.885 17.666  25.171  1.00 81.99  ? 196 LYS B CG  1 
ATOM   3593  C  CD  . LYS B 1 196 ? -24.765 16.456  24.911  1.00 98.08  ? 196 LYS B CD  1 
ATOM   3594  C  CE  . LYS B 1 196 ? -23.931 15.207  24.677  1.00 100.56 ? 196 LYS B CE  1 
ATOM   3595  N  NZ  . LYS B 1 196 ? -23.269 15.226  23.344  1.00 105.35 ? 196 LYS B NZ  1 
ATOM   3596  N  N   . VAL B 1 197 ? -25.354 21.791  26.375  1.00 43.68  ? 197 VAL B N   1 
ATOM   3597  C  CA  . VAL B 1 197 ? -25.419 23.214  26.127  1.00 66.18  ? 197 VAL B CA  1 
ATOM   3598  C  C   . VAL B 1 197 ? -24.990 23.942  27.406  1.00 64.75  ? 197 VAL B C   1 
ATOM   3599  O  O   . VAL B 1 197 ? -24.375 25.020  27.352  1.00 74.70  ? 197 VAL B O   1 
ATOM   3600  C  CB  . VAL B 1 197 ? -26.812 23.704  25.666  1.00 70.08  ? 197 VAL B CB  1 
ATOM   3601  C  CG1 . VAL B 1 197 ? -27.212 23.023  24.369  1.00 66.06  ? 197 VAL B CG1 1 
ATOM   3602  C  CG2 . VAL B 1 197 ? -27.850 23.477  26.760  1.00 79.95  ? 197 VAL B CG2 1 
ATOM   3603  N  N   . ALA B 1 198 ? -25.291 23.362  28.557  1.00 42.51  ? 198 ALA B N   1 
ATOM   3604  C  CA  . ALA B 1 198 ? -24.872 23.989  29.797  1.00 52.44  ? 198 ALA B CA  1 
ATOM   3605  C  C   . ALA B 1 198 ? -23.350 24.051  29.849  1.00 54.44  ? 198 ALA B C   1 
ATOM   3606  O  O   . ALA B 1 198 ? -22.777 24.980  30.409  1.00 56.75  ? 198 ALA B O   1 
ATOM   3607  C  CB  . ALA B 1 198 ? -25.411 23.219  30.982  1.00 46.15  ? 198 ALA B CB  1 
ATOM   3608  N  N   . ASP B 1 199 ? -22.703 23.046  29.265  1.00 38.18  ? 199 ASP B N   1 
ATOM   3609  C  CA  . ASP B 1 199 ? -21.249 23.008  29.188  1.00 33.49  ? 199 ASP B CA  1 
ATOM   3610  C  C   . ASP B 1 199 ? -20.685 24.123  28.316  1.00 35.70  ? 199 ASP B C   1 
ATOM   3611  O  O   . ASP B 1 199 ? -19.677 24.696  28.660  1.00 37.67  ? 199 ASP B O   1 
ATOM   3612  C  CB  . ASP B 1 199 ? -20.734 21.655  28.669  1.00 52.41  ? 199 ASP B CB  1 
ATOM   3613  C  CG  . ASP B 1 199 ? -20.817 20.534  29.710  1.00 53.82  ? 199 ASP B CG  1 
ATOM   3614  O  OD1 . ASP B 1 199 ? -20.738 19.351  29.307  1.00 54.16  ? 199 ASP B OD1 1 
ATOM   3615  O  OD2 . ASP B 1 199 ? -20.956 20.817  30.921  1.00 51.27  ? 199 ASP B OD2 1 
ATOM   3616  N  N   . VAL B 1 200 ? -21.311 24.402  27.179  1.00 30.06  ? 200 VAL B N   1 
ATOM   3617  C  CA  . VAL B 1 200 ? -20.874 25.493  26.322  1.00 32.03  ? 200 VAL B CA  1 
ATOM   3618  C  C   . VAL B 1 200 ? -20.817 26.830  27.105  1.00 34.27  ? 200 VAL B C   1 
ATOM   3619  O  O   . VAL B 1 200 ? -19.799 27.536  27.113  1.00 28.65  ? 200 VAL B O   1 
ATOM   3620  C  CB  . VAL B 1 200 ? -21.769 25.614  25.099  1.00 43.64  ? 200 VAL B CB  1 
ATOM   3621  C  CG1 . VAL B 1 200 ? -21.519 26.904  24.397  1.00 40.16  ? 200 VAL B CG1 1 
ATOM   3622  C  CG2 . VAL B 1 200 ? -21.480 24.470  24.165  1.00 40.89  ? 200 VAL B CG2 1 
ATOM   3623  N  N   . TRP B 1 201 ? -21.892 27.143  27.813  1.00 37.37  ? 201 TRP B N   1 
ATOM   3624  C  CA  . TRP B 1 201 ? -21.911 28.281  28.724  1.00 35.95  ? 201 TRP B CA  1 
ATOM   3625  C  C   . TRP B 1 201 ? -20.686 28.259  29.629  1.00 37.95  ? 201 TRP B C   1 
ATOM   3626  O  O   . TRP B 1 201 ? -19.951 29.237  29.707  1.00 41.05  ? 201 TRP B O   1 
ATOM   3627  C  CB  . TRP B 1 201 ? -23.194 28.266  29.554  1.00 32.29  ? 201 TRP B CB  1 
ATOM   3628  C  CG  . TRP B 1 201 ? -23.293 29.375  30.550  1.00 44.36  ? 201 TRP B CG  1 
ATOM   3629  C  CD1 . TRP B 1 201 ? -22.722 29.420  31.785  1.00 43.54  ? 201 TRP B CD1 1 
ATOM   3630  C  CD2 . TRP B 1 201 ? -24.035 30.591  30.410  1.00 50.06  ? 201 TRP B CD2 1 
ATOM   3631  N  NE1 . TRP B 1 201 ? -23.048 30.598  32.414  1.00 42.33  ? 201 TRP B NE1 1 
ATOM   3632  C  CE2 . TRP B 1 201 ? -23.864 31.344  31.571  1.00 39.18  ? 201 TRP B CE2 1 
ATOM   3633  C  CE3 . TRP B 1 201 ? -24.849 31.126  29.398  1.00 47.77  ? 201 TRP B CE3 1 
ATOM   3634  C  CZ2 . TRP B 1 201 ? -24.445 32.569  31.774  1.00 38.67  ? 201 TRP B CZ2 1 
ATOM   3635  C  CZ3 . TRP B 1 201 ? -25.426 32.364  29.590  1.00 43.10  ? 201 TRP B CZ3 1 
ATOM   3636  C  CH2 . TRP B 1 201 ? -25.226 33.064  30.758  1.00 42.21  ? 201 TRP B CH2 1 
ATOM   3637  N  N   . SER B 1 202 ? -20.460 27.145  30.315  1.00 49.29  ? 202 SER B N   1 
ATOM   3638  C  CA  . SER B 1 202 ? -19.273 27.025  31.163  1.00 49.31  ? 202 SER B CA  1 
ATOM   3639  C  C   . SER B 1 202 ? -17.991 27.291  30.407  1.00 36.74  ? 202 SER B C   1 
ATOM   3640  O  O   . SER B 1 202 ? -17.081 27.900  30.939  1.00 48.83  ? 202 SER B O   1 
ATOM   3641  C  CB  . SER B 1 202 ? -19.183 25.676  31.821  1.00 42.79  ? 202 SER B CB  1 
ATOM   3642  O  OG  . SER B 1 202 ? -20.012 25.665  32.957  1.00 49.91  ? 202 SER B OG  1 
ATOM   3643  N  N   . CYS B 1 203 ? -17.916 26.876  29.156  1.00 38.67  ? 203 CYS B N   1 
ATOM   3644  C  CA  . CYS B 1 203 ? -16.720 27.160  28.363  1.00 28.65  ? 203 CYS B CA  1 
ATOM   3645  C  C   . CYS B 1 203 ? -16.664 28.652  28.050  1.00 39.72  ? 203 CYS B C   1 
ATOM   3646  O  O   . CYS B 1 203 ? -15.600 29.198  27.802  1.00 35.99  ? 203 CYS B O   1 
ATOM   3647  C  CB  . CYS B 1 203 ? -16.699 26.352  27.062  1.00 30.85  ? 203 CYS B CB  1 
ATOM   3648  S  SG  . CYS B 1 203 ? -16.573 24.563  27.247  1.00 49.15  ? 203 CYS B SG  1 
ATOM   3649  N  N   . GLY B 1 204 ? -17.821 29.305  28.030  1.00 44.50  ? 204 GLY B N   1 
ATOM   3650  C  CA  . GLY B 1 204 ? -17.866 30.721  27.773  1.00 41.64  ? 204 GLY B CA  1 
ATOM   3651  C  C   . GLY B 1 204 ? -17.264 31.489  28.933  1.00 41.84  ? 204 GLY B C   1 
ATOM   3652  O  O   . GLY B 1 204 ? -16.449 32.402  28.758  1.00 30.93  ? 204 GLY B O   1 
ATOM   3653  N  N   . VAL B 1 205 ? -17.679 31.111  30.130  1.00 43.77  ? 205 VAL B N   1 
ATOM   3654  C  CA  . VAL B 1 205 ? -17.193 31.747  31.347  1.00 35.46  ? 205 VAL B CA  1 
ATOM   3655  C  C   . VAL B 1 205 ? -15.682 31.622  31.475  1.00 41.99  ? 205 VAL B C   1 
ATOM   3656  O  O   . VAL B 1 205 ? -15.022 32.557  31.877  1.00 41.29  ? 205 VAL B O   1 
ATOM   3657  C  CB  . VAL B 1 205 ? -17.832 31.118  32.599  1.00 38.72  ? 205 VAL B CB  1 
ATOM   3658  C  CG1 . VAL B 1 205 ? -17.178 31.666  33.838  1.00 40.49  ? 205 VAL B CG1 1 
ATOM   3659  C  CG2 . VAL B 1 205 ? -19.356 31.395  32.619  1.00 25.07  ? 205 VAL B CG2 1 
ATOM   3660  N  N   . THR B 1 206 ? -15.114 30.474  31.133  1.00 50.04  ? 206 THR B N   1 
ATOM   3661  C  CA  . THR B 1 206 ? -13.671 30.356  31.284  1.00 44.85  ? 206 THR B CA  1 
ATOM   3662  C  C   . THR B 1 206 ? -12.947 31.094  30.164  1.00 32.88  ? 206 THR B C   1 
ATOM   3663  O  O   . THR B 1 206 ? -11.815 31.530  30.340  1.00 48.92  ? 206 THR B O   1 
ATOM   3664  C  CB  . THR B 1 206 ? -13.124 28.875  31.564  1.00 41.79  ? 206 THR B CB  1 
ATOM   3665  O  OG1 . THR B 1 206 ? -12.329 28.411  30.468  1.00 33.01  ? 206 THR B OG1 1 
ATOM   3666  C  CG2 . THR B 1 206 ? -14.225 27.871  31.887  1.00 27.85  ? 206 THR B CG2 1 
ATOM   3667  N  N   . LEU B 1 207 ? -13.591 31.280  29.022  1.00 39.82  ? 207 LEU B N   1 
ATOM   3668  C  CA  . LEU B 1 207 ? -13.006 32.154  27.986  1.00 29.52  ? 207 LEU B CA  1 
ATOM   3669  C  C   . LEU B 1 207 ? -13.005 33.623  28.424  1.00 36.66  ? 207 LEU B C   1 
ATOM   3670  O  O   . LEU B 1 207 ? -12.037 34.343  28.214  1.00 37.00  ? 207 LEU B O   1 
ATOM   3671  C  CB  . LEU B 1 207 ? -13.771 32.064  26.678  1.00 33.02  ? 207 LEU B CB  1 
ATOM   3672  C  CG  . LEU B 1 207 ? -13.406 33.106  25.610  1.00 32.04  ? 207 LEU B CG  1 
ATOM   3673  C  CD1 . LEU B 1 207 ? -11.937 33.085  25.220  1.00 26.85  ? 207 LEU B CD1 1 
ATOM   3674  C  CD2 . LEU B 1 207 ? -14.261 32.852  24.368  1.00 30.73  ? 207 LEU B CD2 1 
ATOM   3675  N  N   . TYR B 1 208 ? -14.111 34.070  29.005  1.00 34.52  ? 208 TYR B N   1 
ATOM   3676  C  CA  . TYR B 1 208 ? -14.193 35.400  29.529  1.00 34.49  ? 208 TYR B CA  1 
ATOM   3677  C  C   . TYR B 1 208 ? -13.131 35.584  30.596  1.00 35.45  ? 208 TYR B C   1 
ATOM   3678  O  O   . TYR B 1 208 ? -12.326 36.512  30.509  1.00 34.96  ? 208 TYR B O   1 
ATOM   3679  C  CB  . TYR B 1 208 ? -15.565 35.623  30.106  1.00 35.13  ? 208 TYR B CB  1 
ATOM   3680  C  CG  . TYR B 1 208 ? -15.812 37.014  30.646  1.00 48.75  ? 208 TYR B CG  1 
ATOM   3681  C  CD1 . TYR B 1 208 ? -16.485 37.955  29.894  1.00 49.22  ? 208 TYR B CD1 1 
ATOM   3682  C  CD2 . TYR B 1 208 ? -15.400 37.369  31.924  1.00 49.52  ? 208 TYR B CD2 1 
ATOM   3683  C  CE1 . TYR B 1 208 ? -16.743 39.226  30.393  1.00 44.58  ? 208 TYR B CE1 1 
ATOM   3684  C  CE2 . TYR B 1 208 ? -15.643 38.615  32.429  1.00 57.97  ? 208 TYR B CE2 1 
ATOM   3685  C  CZ  . TYR B 1 208 ? -16.316 39.549  31.665  1.00 61.09  ? 208 TYR B CZ  1 
ATOM   3686  O  OH  . TYR B 1 208 ? -16.546 40.809  32.186  1.00 67.98  ? 208 TYR B OH  1 
ATOM   3687  N  N   . VAL B 1 209 ? -13.089 34.677  31.564  1.00 34.20  ? 209 VAL B N   1 
ATOM   3688  C  CA  . VAL B 1 209 ? -12.083 34.736  32.620  1.00 23.41  ? 209 VAL B CA  1 
ATOM   3689  C  C   . VAL B 1 209 ? -10.657 34.903  32.086  1.00 42.98  ? 209 VAL B C   1 
ATOM   3690  O  O   . VAL B 1 209 ? -9.890  35.707  32.614  1.00 50.57  ? 209 VAL B O   1 
ATOM   3691  C  CB  . VAL B 1 209 ? -12.142 33.493  33.528  1.00 42.71  ? 209 VAL B CB  1 
ATOM   3692  C  CG1 . VAL B 1 209 ? -11.183 33.649  34.697  1.00 34.64  ? 209 VAL B CG1 1 
ATOM   3693  C  CG2 . VAL B 1 209 ? -13.560 33.269  34.024  1.00 44.89  ? 209 VAL B CG2 1 
ATOM   3694  N  N   . MET B 1 210 ? -10.297 34.148  31.050  1.00 46.46  ? 210 MET B N   1 
ATOM   3695  C  CA  . MET B 1 210 ? -8.937  34.217  30.519  1.00 40.64  ? 210 MET B CA  1 
ATOM   3696  C  C   . MET B 1 210 ? -8.682  35.597  29.925  1.00 40.21  ? 210 MET B C   1 
ATOM   3697  O  O   . MET B 1 210 ? -7.585  36.130  29.994  1.00 50.48  ? 210 MET B O   1 
ATOM   3698  C  CB  . MET B 1 210 ? -8.702  33.155  29.441  1.00 24.19  ? 210 MET B CB  1 
ATOM   3699  C  CG  . MET B 1 210 ? -8.601  31.707  29.992  1.00 36.93  ? 210 MET B CG  1 
ATOM   3700  S  SD  . MET B 1 210 ? -7.916  30.556  28.810  1.00 53.17  ? 210 MET B SD  1 
ATOM   3701  C  CE  . MET B 1 210 ? -9.280  30.440  27.708  1.00 23.99  ? 210 MET B CE  1 
ATOM   3702  N  N   . LEU B 1 211 ? -9.696  36.179  29.312  1.00 41.45  ? 211 LEU B N   1 
ATOM   3703  C  CA  . LEU B 1 211 ? -9.496  37.384  28.561  1.00 25.10  ? 211 LEU B CA  1 
ATOM   3704  C  C   . LEU B 1 211 ? -9.542  38.619  29.478  1.00 43.05  ? 211 LEU B C   1 
ATOM   3705  O  O   . LEU B 1 211 ? -8.886  39.638  29.196  1.00 48.21  ? 211 LEU B O   1 
ATOM   3706  C  CB  . LEU B 1 211 ? -10.576 37.502  27.495  1.00 40.58  ? 211 LEU B CB  1 
ATOM   3707  C  CG  . LEU B 1 211 ? -10.455 36.631  26.252  1.00 47.27  ? 211 LEU B CG  1 
ATOM   3708  C  CD1 . LEU B 1 211 ? -11.670 36.817  25.322  1.00 25.14  ? 211 LEU B CD1 1 
ATOM   3709  C  CD2 . LEU B 1 211 ? -9.141  36.965  25.545  1.00 32.71  ? 211 LEU B CD2 1 
ATOM   3710  N  N   . VAL B 1 212 ? -10.299 38.514  30.569  1.00 32.68  ? 212 VAL B N   1 
ATOM   3711  C  CA  . VAL B 1 212 ? -10.609 39.648  31.423  1.00 42.61  ? 212 VAL B CA  1 
ATOM   3712  C  C   . VAL B 1 212 ? -9.980  39.585  32.812  1.00 51.51  ? 212 VAL B C   1 
ATOM   3713  O  O   . VAL B 1 212 ? -9.726  40.622  33.436  1.00 40.83  ? 212 VAL B O   1 
ATOM   3714  C  CB  . VAL B 1 212 ? -12.116 39.774  31.598  1.00 43.12  ? 212 VAL B CB  1 
ATOM   3715  C  CG1 . VAL B 1 212 ? -12.449 40.746  32.704  1.00 37.76  ? 212 VAL B CG1 1 
ATOM   3716  C  CG2 . VAL B 1 212 ? -12.767 40.198  30.297  1.00 46.67  ? 212 VAL B CG2 1 
ATOM   3717  N  N   . GLY B 1 213 ? -9.716  38.380  33.307  1.00 44.83  ? 213 GLY B N   1 
ATOM   3718  C  CA  . GLY B 1 213 ? -9.021  38.222  34.584  1.00 40.26  ? 213 GLY B CA  1 
ATOM   3719  C  C   . GLY B 1 213 ? -9.985  38.212  35.765  1.00 45.55  ? 213 GLY B C   1 
ATOM   3720  O  O   . GLY B 1 213 ? -9.595  38.023  36.921  1.00 53.93  ? 213 GLY B O   1 
ATOM   3721  N  N   . ALA B 1 214 ? -11.267 38.369  35.472  1.00 43.11  ? 214 ALA B N   1 
ATOM   3722  C  CA  . ALA B 1 214 ? -12.293 38.345  36.508  1.00 46.42  ? 214 ALA B CA  1 
ATOM   3723  C  C   . ALA B 1 214 ? -13.504 37.554  36.007  1.00 44.51  ? 214 ALA B C   1 
ATOM   3724  O  O   . ALA B 1 214 ? -13.760 37.504  34.804  1.00 48.35  ? 214 ALA B O   1 
ATOM   3725  C  CB  . ALA B 1 214 ? -12.711 39.774  36.845  1.00 31.80  ? 214 ALA B CB  1 
ATOM   3726  N  N   . TYR B 1 215 ? -14.260 36.964  36.925  1.00 41.13  ? 215 TYR B N   1 
ATOM   3727  C  CA  . TYR B 1 215 ? -15.534 36.323  36.584  1.00 48.68  ? 215 TYR B CA  1 
ATOM   3728  C  C   . TYR B 1 215 ? -16.506 37.279  35.867  1.00 56.16  ? 215 TYR B C   1 
ATOM   3729  O  O   . TYR B 1 215 ? -16.362 38.494  35.960  1.00 52.48  ? 215 TYR B O   1 
ATOM   3730  C  CB  . TYR B 1 215 ? -16.142 35.719  37.845  1.00 50.21  ? 215 TYR B CB  1 
ATOM   3731  C  CG  . TYR B 1 215 ? -15.354 34.512  38.302  1.00 50.77  ? 215 TYR B CG  1 
ATOM   3732  C  CD1 . TYR B 1 215 ? -14.993 33.522  37.387  1.00 60.15  ? 215 TYR B CD1 1 
ATOM   3733  C  CD2 . TYR B 1 215 ? -14.961 34.362  39.627  1.00 40.31  ? 215 TYR B CD2 1 
ATOM   3734  C  CE1 . TYR B 1 215 ? -14.272 32.420  37.774  1.00 60.14  ? 215 TYR B CE1 1 
ATOM   3735  C  CE2 . TYR B 1 215 ? -14.243 33.242  40.038  1.00 45.80  ? 215 TYR B CE2 1 
ATOM   3736  C  CZ  . TYR B 1 215 ? -13.899 32.278  39.102  1.00 58.27  ? 215 TYR B CZ  1 
ATOM   3737  O  OH  . TYR B 1 215 ? -13.173 31.166  39.474  1.00 66.17  ? 215 TYR B OH  1 
ATOM   3738  N  N   . PRO B 1 216 ? -17.477 36.737  35.121  1.00 47.18  ? 216 PRO B N   1 
ATOM   3739  C  CA  . PRO B 1 216 ? -18.240 37.653  34.265  1.00 40.00  ? 216 PRO B CA  1 
ATOM   3740  C  C   . PRO B 1 216 ? -19.516 38.199  34.890  1.00 59.54  ? 216 PRO B C   1 
ATOM   3741  O  O   . PRO B 1 216 ? -19.995 39.240  34.433  1.00 71.35  ? 216 PRO B O   1 
ATOM   3742  C  CB  . PRO B 1 216 ? -18.602 36.794  33.053  1.00 37.73  ? 216 PRO B CB  1 
ATOM   3743  C  CG  . PRO B 1 216 ? -17.868 35.498  33.230  1.00 45.18  ? 216 PRO B CG  1 
ATOM   3744  C  CD  . PRO B 1 216 ? -17.625 35.341  34.694  1.00 49.35  ? 216 PRO B CD  1 
ATOM   3745  N  N   . PHE B 1 217 ? -20.057 37.513  35.891  1.00 49.71  ? 217 PHE B N   1 
ATOM   3746  C  CA  . PHE B 1 217 ? -21.291 37.948  36.532  1.00 54.45  ? 217 PHE B CA  1 
ATOM   3747  C  C   . PHE B 1 217 ? -21.080 38.201  38.019  1.00 62.15  ? 217 PHE B C   1 
ATOM   3748  O  O   . PHE B 1 217 ? -21.974 38.690  38.709  1.00 67.71  ? 217 PHE B O   1 
ATOM   3749  C  CB  . PHE B 1 217 ? -22.397 36.913  36.319  1.00 56.56  ? 217 PHE B CB  1 
ATOM   3750  C  CG  . PHE B 1 217 ? -22.602 36.537  34.879  1.00 41.66  ? 217 PHE B CG  1 
ATOM   3751  C  CD1 . PHE B 1 217 ? -22.073 35.362  34.374  1.00 30.58  ? 217 PHE B CD1 1 
ATOM   3752  C  CD2 . PHE B 1 217 ? -23.321 37.361  34.029  1.00 35.68  ? 217 PHE B CD2 1 
ATOM   3753  C  CE1 . PHE B 1 217 ? -22.258 35.014  33.050  1.00 22.96  ? 217 PHE B CE1 1 
ATOM   3754  C  CE2 . PHE B 1 217 ? -23.510 37.017  32.705  1.00 34.34  ? 217 PHE B CE2 1 
ATOM   3755  C  CZ  . PHE B 1 217 ? -22.978 35.842  32.215  1.00 38.79  ? 217 PHE B CZ  1 
ATOM   3756  N  N   . GLU B 1 218 ? -19.890 37.868  38.507  1.00 80.06  ? 218 GLU B N   1 
ATOM   3757  C  CA  . GLU B 1 218 ? -19.548 38.089  39.906  1.00 86.83  ? 218 GLU B CA  1 
ATOM   3758  C  C   . GLU B 1 218 ? -19.717 39.559  40.264  1.00 91.30  ? 218 GLU B C   1 
ATOM   3759  O  O   . GLU B 1 218 ? -19.724 39.926  41.438  1.00 112.54 ? 218 GLU B O   1 
ATOM   3760  C  CB  . GLU B 1 218 ? -18.111 37.644  40.184  1.00 90.62  ? 218 GLU B CB  1 
ATOM   3761  C  CG  . GLU B 1 218 ? -17.943 36.141  40.322  1.00 99.13  ? 218 GLU B CG  1 
ATOM   3762  C  CD  . GLU B 1 218 ? -18.160 35.658  41.742  1.00 96.35  ? 218 GLU B CD  1 
ATOM   3763  O  OE1 . GLU B 1 218 ? -19.148 34.933  41.980  1.00 92.98  ? 218 GLU B OE1 1 
ATOM   3764  O  OE2 . GLU B 1 218 ? -17.342 36.005  42.618  1.00 95.02  ? 218 GLU B OE2 1 
ATOM   3765  N  N   . ASP B 1 219 ? -19.852 40.396  39.241  1.00 74.40  ? 219 ASP B N   1 
ATOM   3766  C  CA  . ASP B 1 219 ? -20.016 41.830  39.441  1.00 101.69 ? 219 ASP B CA  1 
ATOM   3767  C  C   . ASP B 1 219 ? -20.657 42.132  40.789  1.00 99.93  ? 219 ASP B C   1 
ATOM   3768  O  O   . ASP B 1 219 ? -21.502 41.375  41.270  1.00 81.92  ? 219 ASP B O   1 
ATOM   3769  C  CB  . ASP B 1 219 ? -20.857 42.433  38.315  1.00 128.37 ? 219 ASP B CB  1 
ATOM   3770  C  CG  . ASP B 1 219 ? -20.672 41.709  36.997  1.00 140.89 ? 219 ASP B CG  1 
ATOM   3771  O  OD1 . ASP B 1 219 ? -19.517 41.371  36.662  1.00 141.10 ? 219 ASP B OD1 1 
ATOM   3772  O  OD2 . ASP B 1 219 ? -21.680 41.479  36.297  1.00 147.72 ? 219 ASP B OD2 1 
ATOM   3773  N  N   . PRO B 1 220 ? -20.257 43.248  41.390  1.00 106.62 ? 220 PRO B N   1 
ATOM   3774  C  CA  . PRO B 1 220 ? -19.232 44.106  40.795  1.00 112.37 ? 220 PRO B CA  1 
ATOM   3775  C  C   . PRO B 1 220 ? -18.332 44.712  41.863  1.00 123.10 ? 220 PRO B C   1 
ATOM   3776  O  O   . PRO B 1 220 ? -17.108 44.686  41.740  1.00 119.97 ? 220 PRO B O   1 
ATOM   3777  C  CB  . PRO B 1 220 ? -20.061 45.206  40.135  1.00 107.91 ? 220 PRO B CB  1 
ATOM   3778  C  CG  . PRO B 1 220 ? -21.311 45.303  40.993  1.00 103.42 ? 220 PRO B CG  1 
ATOM   3779  C  CD  . PRO B 1 220 ? -21.427 44.036  41.818  1.00 102.30 ? 220 PRO B CD  1 
ATOM   3780  N  N   . GLU B 1 221 ? -18.950 45.257  42.905  1.00 132.69 ? 221 GLU B N   1 
ATOM   3781  C  CA  . GLU B 1 221 ? -18.238 45.885  43.973  1.00 131.39 ? 221 GLU B CA  1 
ATOM   3782  C  C   . GLU B 1 221 ? -18.030 44.831  45.005  1.00 120.77 ? 221 GLU B C   1 
ATOM   3783  O  O   . GLU B 1 221 ? -16.939 44.621  45.488  1.00 116.05 ? 221 GLU B O   1 
ATOM   3784  C  CB  . GLU B 1 221 ? -19.079 47.015  44.524  1.00 136.18 ? 221 GLU B CB  1 
ATOM   3785  C  CG  . GLU B 1 221 ? -19.290 48.124  43.530  1.00 135.71 ? 221 GLU B CG  1 
ATOM   3786  C  CD  . GLU B 1 221 ? -20.715 48.190  43.059  1.00 137.74 ? 221 GLU B CD  1 
ATOM   3787  O  OE1 . GLU B 1 221 ? -21.588 47.649  43.776  1.00 141.02 ? 221 GLU B OE1 1 
ATOM   3788  O  OE2 . GLU B 1 221 ? -20.962 48.767  41.974  1.00 132.45 ? 221 GLU B OE2 1 
ATOM   3789  N  N   . GLU B 1 222 ? -19.113 44.144  45.353  1.00 118.59 ? 222 GLU B N   1 
ATOM   3790  C  CA  . GLU B 1 222 ? -19.058 43.079  46.347  1.00 114.64 ? 222 GLU B CA  1 
ATOM   3791  C  C   . GLU B 1 222 ? -19.463 41.740  45.741  1.00 110.29 ? 222 GLU B C   1 
ATOM   3792  O  O   . GLU B 1 222 ? -20.396 41.090  46.213  1.00 111.97 ? 222 GLU B O   1 
ATOM   3793  C  CB  . GLU B 1 222 ? -19.960 43.411  47.538  1.00 113.59 ? 222 GLU B CB  1 
ATOM   3794  C  CG  . GLU B 1 222 ? -21.443 43.435  47.207  1.00 108.74 ? 222 GLU B CG  1 
ATOM   3795  C  CD  . GLU B 1 222 ? -22.317 43.404  48.445  1.00 106.18 ? 222 GLU B CD  1 
ATOM   3796  O  OE1 . GLU B 1 222 ? -23.277 44.199  48.516  1.00 101.09 ? 222 GLU B OE1 1 
ATOM   3797  O  OE2 . GLU B 1 222 ? -22.044 42.584  49.347  1.00 108.10 ? 222 GLU B OE2 1 
ATOM   3798  N  N   . PRO B 1 223 ? -18.754 41.333  44.693  1.00 105.85 ? 223 PRO B N   1 
ATOM   3799  C  CA  . PRO B 1 223 ? -19.037 40.065  44.014  1.00 107.19 ? 223 PRO B CA  1 
ATOM   3800  C  C   . PRO B 1 223 ? -19.221 38.921  45.004  1.00 110.42 ? 223 PRO B C   1 
ATOM   3801  O  O   . PRO B 1 223 ? -19.924 37.955  44.708  1.00 119.59 ? 223 PRO B O   1 
ATOM   3802  C  CB  . PRO B 1 223 ? -17.779 39.836  43.176  1.00 105.72 ? 223 PRO B CB  1 
ATOM   3803  C  CG  . PRO B 1 223 ? -16.698 40.520  43.941  1.00 100.42 ? 223 PRO B CG  1 
ATOM   3804  C  CD  . PRO B 1 223 ? -17.338 41.723  44.574  1.00 101.48 ? 223 PRO B CD  1 
ATOM   3805  N  N   . LYS B 1 224 ? -18.591 39.034  46.168  1.00 104.37 ? 224 LYS B N   1 
ATOM   3806  C  CA  . LYS B 1 224 ? -18.682 38.002  47.193  1.00 104.75 ? 224 LYS B CA  1 
ATOM   3807  C  C   . LYS B 1 224 ? -20.129 37.770  47.615  1.00 101.46 ? 224 LYS B C   1 
ATOM   3808  O  O   . LYS B 1 224 ? -20.400 37.380  48.751  1.00 116.41 ? 224 LYS B O   1 
ATOM   3809  C  CB  . LYS B 1 224 ? -17.833 38.376  48.409  1.00 116.76 ? 224 LYS B CB  1 
ATOM   3810  C  CG  . LYS B 1 224 ? -17.267 37.184  49.162  1.00 125.43 ? 224 LYS B CG  1 
ATOM   3811  C  CD  . LYS B 1 224 ? -15.866 36.842  48.682  1.00 129.41 ? 224 LYS B CD  1 
ATOM   3812  C  CE  . LYS B 1 224 ? -15.541 35.377  48.926  1.00 124.48 ? 224 LYS B CE  1 
ATOM   3813  N  NZ  . LYS B 1 224 ? -14.176 35.198  49.495  1.00 115.84 ? 224 LYS B NZ  1 
ATOM   3814  N  N   . ASN B 1 225 ? -21.056 38.015  46.694  1.00 89.89  ? 225 ASN B N   1 
ATOM   3815  C  CA  . ASN B 1 225 ? -22.476 37.834  46.969  1.00 85.70  ? 225 ASN B CA  1 
ATOM   3816  C  C   . ASN B 1 225 ? -23.148 36.916  45.954  1.00 86.62  ? 225 ASN B C   1 
ATOM   3817  O  O   . ASN B 1 225 ? -22.769 36.887  44.783  1.00 80.82  ? 225 ASN B O   1 
ATOM   3818  C  CB  . ASN B 1 225 ? -23.190 39.187  47.009  1.00 83.31  ? 225 ASN B CB  1 
ATOM   3819  C  CG  . ASN B 1 225 ? -24.686 39.050  47.211  1.00 84.74  ? 225 ASN B CG  1 
ATOM   3820  O  OD1 . ASN B 1 225 ? -25.430 40.025  47.107  1.00 78.76  ? 225 ASN B OD1 1 
ATOM   3821  N  ND2 . ASN B 1 225 ? -25.136 37.835  47.502  1.00 88.47  ? 225 ASN B ND2 1 
ATOM   3822  N  N   . PHE B 1 226 ? -24.148 36.169  46.410  1.00 85.09  ? 226 PHE B N   1 
ATOM   3823  C  CA  . PHE B 1 226 ? -24.869 35.258  45.551  1.00 85.22  ? 226 PHE B CA  1 
ATOM   3824  C  C   . PHE B 1 226 ? -26.037 35.800  44.806  1.00 80.35  ? 226 PHE B C   1 
ATOM   3825  O  O   . PHE B 1 226 ? -26.045 35.768  43.609  1.00 94.10  ? 226 PHE B O   1 
ATOM   3826  C  CB  . PHE B 1 226 ? -25.310 34.052  46.341  1.00 95.12  ? 226 PHE B CB  1 
ATOM   3827  C  CG  . PHE B 1 226 ? -24.193 33.352  46.992  1.00 106.57 ? 226 PHE B CG  1 
ATOM   3828  C  CD1 . PHE B 1 226 ? -24.240 33.034  48.320  1.00 114.19 ? 226 PHE B CD1 1 
ATOM   3829  C  CD2 . PHE B 1 226 ? -23.075 33.050  46.285  1.00 111.72 ? 226 PHE B CD2 1 
ATOM   3830  C  CE1 . PHE B 1 226 ? -23.217 32.410  48.919  1.00 118.49 ? 226 PHE B CE1 1 
ATOM   3831  C  CE2 . PHE B 1 226 ? -22.055 32.422  46.876  1.00 117.42 ? 226 PHE B CE2 1 
ATOM   3832  C  CZ  . PHE B 1 226 ? -22.127 32.098  48.199  1.00 121.09 ? 226 PHE B CZ  1 
ATOM   3833  N  N   . ARG B 1 227 ? -27.054 36.252  45.502  1.00 70.95  ? 227 ARG B N   1 
ATOM   3834  C  CA  . ARG B 1 227 ? -28.254 36.642  44.811  1.00 80.30  ? 227 ARG B CA  1 
ATOM   3835  C  C   . ARG B 1 227 ? -27.944 37.679  43.758  1.00 79.29  ? 227 ARG B C   1 
ATOM   3836  O  O   . ARG B 1 227 ? -28.554 37.717  42.713  1.00 81.32  ? 227 ARG B O   1 
ATOM   3837  C  CB  . ARG B 1 227 ? -29.329 37.117  45.798  1.00 98.58  ? 227 ARG B CB  1 
ATOM   3838  C  CG  . ARG B 1 227 ? -28.839 37.890  47.000  1.00 110.93 ? 227 ARG B CG  1 
ATOM   3839  C  CD  . ARG B 1 227 ? -28.931 37.113  48.320  1.00 113.85 ? 227 ARG B CD  1 
ATOM   3840  N  NE  . ARG B 1 227 ? -30.069 37.504  49.151  1.00 118.02 ? 227 ARG B NE  1 
ATOM   3841  C  CZ  . ARG B 1 227 ? -30.105 38.558  49.955  1.00 120.39 ? 227 ARG B CZ  1 
ATOM   3842  N  NH1 . ARG B 1 227 ? -29.065 39.359  50.062  1.00 116.55 ? 227 ARG B NH1 1 
ATOM   3843  N  NH2 . ARG B 1 227 ? -31.191 38.812  50.656  1.00 119.72 ? 227 ARG B NH2 1 
ATOM   3844  N  N   . LYS B 1 228 ? -26.947 38.478  44.043  1.00 80.42  ? 228 LYS B N   1 
ATOM   3845  C  CA  . LYS B 1 228 ? -26.573 39.517  43.140  1.00 76.47  ? 228 LYS B CA  1 
ATOM   3846  C  C   . LYS B 1 228 ? -26.011 38.902  41.890  1.00 60.82  ? 228 LYS B C   1 
ATOM   3847  O  O   . LYS B 1 228 ? -26.481 39.171  40.823  1.00 66.33  ? 228 LYS B O   1 
ATOM   3848  C  CB  . LYS B 1 228 ? -25.563 40.423  43.811  1.00 87.92  ? 228 LYS B CB  1 
ATOM   3849  C  CG  . LYS B 1 228 ? -25.662 41.863  43.404  1.00 105.79 ? 228 LYS B CG  1 
ATOM   3850  C  CD  . LYS B 1 228 ? -26.770 42.624  44.143  1.00 112.29 ? 228 LYS B CD  1 
ATOM   3851  C  CE  . LYS B 1 228 ? -27.633 43.463  43.156  1.00 147.98 ? 228 LYS B CE  1 
ATOM   3852  N  NZ  . LYS B 1 228 ? -27.819 44.918  43.521  1.00 143.78 ? 228 LYS B NZ  1 
ATOM   3853  N  N   . THR B 1 229 ? -25.013 38.055  42.037  1.00 38.58  ? 229 THR B N   1 
ATOM   3854  C  CA  . THR B 1 229 ? -24.348 37.429  40.902  1.00 56.02  ? 229 THR B CA  1 
ATOM   3855  C  C   . THR B 1 229 ? -25.291 36.496  40.150  1.00 58.97  ? 229 THR B C   1 
ATOM   3856  O  O   . THR B 1 229 ? -25.209 36.369  38.928  1.00 54.94  ? 229 THR B O   1 
ATOM   3857  C  CB  . THR B 1 229 ? -23.104 36.639  41.342  1.00 57.28  ? 229 THR B CB  1 
ATOM   3858  O  OG1 . THR B 1 229 ? -22.742 35.704  40.321  1.00 54.93  ? 229 THR B OG1 1 
ATOM   3859  C  CG2 . THR B 1 229 ? -23.381 35.889  42.636  1.00 69.04  ? 229 THR B CG2 1 
ATOM   3860  N  N   . ILE B 1 230 ? -26.186 35.846  40.885  1.00 53.78  ? 230 ILE B N   1 
ATOM   3861  C  CA  . ILE B 1 230 ? -27.149 34.933  40.284  1.00 51.29  ? 230 ILE B CA  1 
ATOM   3862  C  C   . ILE B 1 230 ? -28.139 35.687  39.406  1.00 49.99  ? 230 ILE B C   1 
ATOM   3863  O  O   . ILE B 1 230 ? -28.622 35.163  38.405  1.00 57.08  ? 230 ILE B O   1 
ATOM   3864  C  CB  . ILE B 1 230 ? -27.924 34.144  41.355  1.00 43.52  ? 230 ILE B CB  1 
ATOM   3865  C  CG1 . ILE B 1 230 ? -27.245 32.800  41.623  1.00 50.99  ? 230 ILE B CG1 1 
ATOM   3866  C  CG2 . ILE B 1 230 ? -29.366 33.937  40.923  1.00 37.51  ? 230 ILE B CG2 1 
ATOM   3867  C  CD1 . ILE B 1 230 ? -27.891 32.000  42.731  1.00 57.32  ? 230 ILE B CD1 1 
ATOM   3868  N  N   . HIS B 1 231 ? -28.435 36.925  39.788  1.00 55.78  ? 231 HIS B N   1 
ATOM   3869  C  CA  . HIS B 1 231 ? -29.366 37.757  39.034  1.00 57.66  ? 231 HIS B CA  1 
ATOM   3870  C  C   . HIS B 1 231 ? -28.754 38.210  37.712  1.00 47.28  ? 231 HIS B C   1 
ATOM   3871  O  O   . HIS B 1 231 ? -29.419 38.210  36.679  1.00 50.01  ? 231 HIS B O   1 
ATOM   3872  C  CB  . HIS B 1 231 ? -29.796 38.970  39.860  1.00 80.40  ? 231 HIS B CB  1 
ATOM   3873  C  CG  . HIS B 1 231 ? -30.754 38.640  40.962  1.00 110.70 ? 231 HIS B CG  1 
ATOM   3874  N  ND1 . HIS B 1 231 ? -31.794 37.749  40.802  1.00 118.88 ? 231 HIS B ND1 1 
ATOM   3875  C  CD2 . HIS B 1 231 ? -30.829 39.081  42.241  1.00 118.68 ? 231 HIS B CD2 1 
ATOM   3876  C  CE1 . HIS B 1 231 ? -32.469 37.656  41.933  1.00 119.08 ? 231 HIS B CE1 1 
ATOM   3877  N  NE2 . HIS B 1 231 ? -31.904 38.454  42.823  1.00 118.07 ? 231 HIS B NE2 1 
ATOM   3878  N  N   . ARG B 1 232 ? -27.483 38.594  37.754  1.00 47.52  ? 232 ARG B N   1 
ATOM   3879  C  CA  . ARG B 1 232 ? -26.770 39.008  36.553  1.00 53.06  ? 232 ARG B CA  1 
ATOM   3880  C  C   . ARG B 1 232 ? -26.736 37.861  35.550  1.00 56.47  ? 232 ARG B C   1 
ATOM   3881  O  O   . ARG B 1 232 ? -26.872 38.071  34.345  1.00 48.83  ? 232 ARG B O   1 
ATOM   3882  C  CB  . ARG B 1 232 ? -25.351 39.457  36.899  1.00 55.39  ? 232 ARG B CB  1 
ATOM   3883  C  CG  . ARG B 1 232 ? -25.284 40.465  38.034  1.00 52.08  ? 232 ARG B CG  1 
ATOM   3884  C  CD  . ARG B 1 232 ? -23.864 40.955  38.257  1.00 64.75  ? 232 ARG B CD  1 
ATOM   3885  N  NE  . ARG B 1 232 ? -23.472 41.959  37.272  1.00 87.55  ? 232 ARG B NE  1 
ATOM   3886  C  CZ  . ARG B 1 232 ? -23.240 43.236  37.557  1.00 100.74 ? 232 ARG B CZ  1 
ATOM   3887  N  NH1 . ARG B 1 232 ? -23.362 43.672  38.804  1.00 96.62  ? 232 ARG B NH1 1 
ATOM   3888  N  NH2 . ARG B 1 232 ? -22.887 44.078  36.596  1.00 102.46 ? 232 ARG B NH2 1 
ATOM   3889  N  N   . ILE B 1 233 ? -26.557 36.648  36.061  1.00 57.64  ? 233 ILE B N   1 
ATOM   3890  C  CA  . ILE B 1 233 ? -26.587 35.453  35.240  1.00 47.05  ? 233 ILE B CA  1 
ATOM   3891  C  C   . ILE B 1 233 ? -27.938 35.359  34.504  1.00 40.69  ? 233 ILE B C   1 
ATOM   3892  O  O   . ILE B 1 233 ? -27.996 35.195  33.274  1.00 33.99  ? 233 ILE B O   1 
ATOM   3893  C  CB  . ILE B 1 233 ? -26.342 34.192  36.096  1.00 41.67  ? 233 ILE B CB  1 
ATOM   3894  C  CG1 . ILE B 1 233 ? -24.899 34.149  36.571  1.00 38.67  ? 233 ILE B CG1 1 
ATOM   3895  C  CG2 . ILE B 1 233 ? -26.639 32.890  35.299  1.00 30.48  ? 233 ILE B CG2 1 
ATOM   3896  C  CD1 . ILE B 1 233 ? -24.648 33.072  37.585  1.00 20.70  ? 233 ILE B CD1 1 
ATOM   3897  N  N   . LEU B 1 234 ? -29.024 35.464  35.263  1.00 39.72  ? 234 LEU B N   1 
ATOM   3898  C  CA  . LEU B 1 234 ? -30.349 35.268  34.703  1.00 48.87  ? 234 LEU B CA  1 
ATOM   3899  C  C   . LEU B 1 234 ? -30.675 36.319  33.659  1.00 48.31  ? 234 LEU B C   1 
ATOM   3900  O  O   . LEU B 1 234 ? -31.425 36.057  32.711  1.00 52.80  ? 234 LEU B O   1 
ATOM   3901  C  CB  . LEU B 1 234 ? -31.396 35.265  35.806  1.00 49.01  ? 234 LEU B CB  1 
ATOM   3902  C  CG  . LEU B 1 234 ? -31.182 34.121  36.801  1.00 52.80  ? 234 LEU B CG  1 
ATOM   3903  C  CD1 . LEU B 1 234 ? -32.138 34.164  38.007  1.00 29.84  ? 234 LEU B CD1 1 
ATOM   3904  C  CD2 . LEU B 1 234 ? -31.296 32.789  36.038  1.00 58.20  ? 234 LEU B CD2 1 
ATOM   3905  N  N   . ASN B 1 235 ? -30.095 37.501  33.821  1.00 30.75  ? 235 ASN B N   1 
ATOM   3906  C  CA  . ASN B 1 235 ? -30.322 38.565  32.868  1.00 47.92  ? 235 ASN B CA  1 
ATOM   3907  C  C   . ASN B 1 235 ? -29.143 38.764  31.966  1.00 45.78  ? 235 ASN B C   1 
ATOM   3908  O  O   . ASN B 1 235 ? -29.100 39.715  31.186  1.00 43.77  ? 235 ASN B O   1 
ATOM   3909  C  CB  . ASN B 1 235 ? -30.654 39.852  33.586  1.00 40.97  ? 235 ASN B CB  1 
ATOM   3910  C  CG  . ASN B 1 235 ? -31.912 39.734  34.395  1.00 58.99  ? 235 ASN B CG  1 
ATOM   3911  O  OD1 . ASN B 1 235 ? -31.871 39.818  35.616  1.00 57.63  ? 235 ASN B OD1 1 
ATOM   3912  N  ND2 . ASN B 1 235 ? -33.047 39.536  33.718  1.00 69.30  ? 235 ASN B ND2 1 
ATOM   3913  N  N   . VAL B 1 236 ? -28.170 37.875  32.109  1.00 32.87  ? 236 VAL B N   1 
ATOM   3914  C  CA  . VAL B 1 236 ? -27.012 37.858  31.230  1.00 30.86  ? 236 VAL B CA  1 
ATOM   3915  C  C   . VAL B 1 236 ? -26.396 39.228  31.125  1.00 30.96  ? 236 VAL B C   1 
ATOM   3916  O  O   . VAL B 1 236 ? -26.228 39.752  30.041  1.00 40.88  ? 236 VAL B O   1 
ATOM   3917  C  CB  . VAL B 1 236 ? -27.398 37.349  29.863  1.00 30.46  ? 236 VAL B CB  1 
ATOM   3918  C  CG1 . VAL B 1 236 ? -26.164 37.106  28.972  1.00 25.28  ? 236 VAL B CG1 1 
ATOM   3919  C  CG2 . VAL B 1 236 ? -28.176 36.063  30.046  1.00 39.71  ? 236 VAL B CG2 1 
ATOM   3920  N  N   . GLN B 1 237 ? -26.068 39.800  32.280  1.00 47.14  ? 237 GLN B N   1 
ATOM   3921  C  CA  . GLN B 1 237 ? -25.501 41.140  32.355  1.00 56.67  ? 237 GLN B CA  1 
ATOM   3922  C  C   . GLN B 1 237 ? -24.014 41.107  32.695  1.00 52.48  ? 237 GLN B C   1 
ATOM   3923  O  O   . GLN B 1 237 ? -23.625 40.803  33.821  1.00 48.97  ? 237 GLN B O   1 
ATOM   3924  C  CB  . GLN B 1 237 ? -26.262 41.982  33.382  1.00 61.34  ? 237 GLN B CB  1 
ATOM   3925  C  CG  . GLN B 1 237 ? -25.375 42.694  34.387  1.00 74.56  ? 237 GLN B CG  1 
ATOM   3926  C  CD  . GLN B 1 237 ? -26.162 43.581  35.331  1.00 78.22  ? 237 GLN B CD  1 
ATOM   3927  O  OE1 . GLN B 1 237 ? -27.373 43.741  35.183  1.00 84.82  ? 237 GLN B OE1 1 
ATOM   3928  N  NE2 . GLN B 1 237 ? -25.475 44.162  36.308  1.00 62.86  ? 237 GLN B NE2 1 
ATOM   3929  N  N   . TYR B 1 238 ? -23.195 41.426  31.700  1.00 37.82  ? 238 TYR B N   1 
ATOM   3930  C  CA  . TYR B 1 238 ? -21.756 41.462  31.838  1.00 41.35  ? 238 TYR B CA  1 
ATOM   3931  C  C   . TYR B 1 238 ? -21.245 42.600  30.965  1.00 58.93  ? 238 TYR B C   1 
ATOM   3932  O  O   . TYR B 1 238 ? -21.820 42.917  29.922  1.00 54.17  ? 238 TYR B O   1 
ATOM   3933  C  CB  . TYR B 1 238 ? -21.146 40.148  31.372  1.00 42.73  ? 238 TYR B CB  1 
ATOM   3934  C  CG  . TYR B 1 238 ? -21.339 39.838  29.902  1.00 42.57  ? 238 TYR B CG  1 
ATOM   3935  C  CD1 . TYR B 1 238 ? -20.288 39.957  29.006  1.00 44.71  ? 238 TYR B CD1 1 
ATOM   3936  C  CD2 . TYR B 1 238 ? -22.574 39.441  29.416  1.00 27.73  ? 238 TYR B CD2 1 
ATOM   3937  C  CE1 . TYR B 1 238 ? -20.456 39.667  27.673  1.00 33.31  ? 238 TYR B CE1 1 
ATOM   3938  C  CE2 . TYR B 1 238 ? -22.757 39.141  28.078  1.00 27.49  ? 238 TYR B CE2 1 
ATOM   3939  C  CZ  . TYR B 1 238 ? -21.696 39.269  27.208  1.00 32.69  ? 238 TYR B CZ  1 
ATOM   3940  O  OH  . TYR B 1 238 ? -21.853 38.986  25.863  1.00 43.44  ? 238 TYR B OH  1 
ATOM   3941  N  N   . ALA B 1 239 ? -20.185 43.248  31.405  1.00 65.17  ? 239 ALA B N   1 
ATOM   3942  C  CA  . ALA B 1 239 ? -19.612 44.310  30.609  1.00 72.92  ? 239 ALA B CA  1 
ATOM   3943  C  C   . ALA B 1 239 ? -18.131 44.078  30.565  1.00 69.25  ? 239 ALA B C   1 
ATOM   3944  O  O   . ALA B 1 239 ? -17.434 44.158  31.579  1.00 71.05  ? 239 ALA B O   1 
ATOM   3945  C  CB  . ALA B 1 239 ? -19.932 45.676  31.208  1.00 84.23  ? 239 ALA B CB  1 
ATOM   3946  N  N   . ILE B 1 240 ? -17.637 43.738  29.377  1.00 58.30  ? 240 ILE B N   1 
ATOM   3947  C  CA  . ILE B 1 240 ? -16.207 43.556  29.167  1.00 56.48  ? 240 ILE B CA  1 
ATOM   3948  C  C   . ILE B 1 240 ? -15.558 44.890  29.470  1.00 68.93  ? 240 ILE B C   1 
ATOM   3949  O  O   . ILE B 1 240 ? -15.947 45.911  28.903  1.00 65.44  ? 240 ILE B O   1 
ATOM   3950  C  CB  . ILE B 1 240 ? -15.892 43.155  27.719  1.00 57.94  ? 240 ILE B CB  1 
ATOM   3951  C  CG1 . ILE B 1 240 ? -16.371 41.729  27.444  1.00 59.53  ? 240 ILE B CG1 1 
ATOM   3952  C  CG2 . ILE B 1 240 ? -14.401 43.282  27.444  1.00 47.55  ? 240 ILE B CG2 1 
ATOM   3953  C  CD1 . ILE B 1 240 ? -16.228 41.307  25.999  1.00 59.37  ? 240 ILE B CD1 1 
ATOM   3954  N  N   . PRO B 1 241 ? -14.589 44.903  30.377  1.00 63.31  ? 241 PRO B N   1 
ATOM   3955  C  CA  . PRO B 1 241 ? -14.114 46.189  30.883  1.00 56.59  ? 241 PRO B CA  1 
ATOM   3956  C  C   . PRO B 1 241 ? -13.250 47.009  29.906  1.00 58.75  ? 241 PRO B C   1 
ATOM   3957  O  O   . PRO B 1 241 ? -12.626 46.467  28.992  1.00 63.17  ? 241 PRO B O   1 
ATOM   3958  C  CB  . PRO B 1 241 ? -13.341 45.801  32.140  1.00 51.65  ? 241 PRO B CB  1 
ATOM   3959  C  CG  . PRO B 1 241 ? -12.995 44.367  31.950  1.00 47.67  ? 241 PRO B CG  1 
ATOM   3960  C  CD  . PRO B 1 241 ? -14.014 43.756  31.082  1.00 45.99  ? 241 PRO B CD  1 
ATOM   3961  N  N   . ASP B 1 242 ? -13.245 48.324  30.143  1.00 67.06  ? 242 ASP B N   1 
ATOM   3962  C  CA  . ASP B 1 242 ? -12.576 49.340  29.322  1.00 74.14  ? 242 ASP B CA  1 
ATOM   3963  C  C   . ASP B 1 242 ? -11.178 48.997  28.811  1.00 65.81  ? 242 ASP B C   1 
ATOM   3964  O  O   . ASP B 1 242 ? -10.884 49.139  27.623  1.00 51.32  ? 242 ASP B O   1 
ATOM   3965  C  CB  . ASP B 1 242 ? -12.501 50.673  30.098  1.00 94.52  ? 242 ASP B CB  1 
ATOM   3966  C  CG  . ASP B 1 242 ? -13.770 51.510  29.963  1.00 112.60 ? 242 ASP B CG  1 
ATOM   3967  O  OD1 . ASP B 1 242 ? -14.605 51.169  29.097  1.00 123.43 ? 242 ASP B OD1 1 
ATOM   3968  O  OD2 . ASP B 1 242 ? -13.929 52.508  30.708  1.00 111.05 ? 242 ASP B OD2 1 
ATOM   3969  N  N   . TYR B 1 243 ? -10.293 48.596  29.713  1.00 70.62  ? 243 TYR B N   1 
ATOM   3970  C  CA  . TYR B 1 243 ? -8.894  48.433  29.328  1.00 65.56  ? 243 TYR B CA  1 
ATOM   3971  C  C   . TYR B 1 243 ? -8.625  47.244  28.406  1.00 70.12  ? 243 TYR B C   1 
ATOM   3972  O  O   . TYR B 1 243 ? -7.643  47.248  27.665  1.00 80.35  ? 243 TYR B O   1 
ATOM   3973  C  CB  . TYR B 1 243 ? -7.983  48.397  30.548  1.00 44.85  ? 243 TYR B CB  1 
ATOM   3974  C  CG  . TYR B 1 243 ? -8.574  47.763  31.781  1.00 40.46  ? 243 TYR B CG  1 
ATOM   3975  C  CD1 . TYR B 1 243 ? -8.266  46.455  32.121  1.00 30.88  ? 243 TYR B CD1 1 
ATOM   3976  C  CD2 . TYR B 1 243 ? -9.403  48.478  32.621  1.00 36.17  ? 243 TYR B CD2 1 
ATOM   3977  C  CE1 . TYR B 1 243 ? -8.780  45.859  33.264  1.00 40.25  ? 243 TYR B CE1 1 
ATOM   3978  C  CE2 . TYR B 1 243 ? -9.924  47.895  33.766  1.00 59.12  ? 243 TYR B CE2 1 
ATOM   3979  C  CZ  . TYR B 1 243 ? -9.606  46.575  34.086  1.00 49.15  ? 243 TYR B CZ  1 
ATOM   3980  O  OH  . TYR B 1 243 ? -10.115 45.985  35.229  1.00 48.15  ? 243 TYR B OH  1 
ATOM   3981  N  N   . VAL B 1 244 ? -9.505  46.248  28.439  1.00 57.16  ? 244 VAL B N   1 
ATOM   3982  C  CA  . VAL B 1 244 ? -9.306  45.029  27.659  1.00 53.86  ? 244 VAL B CA  1 
ATOM   3983  C  C   . VAL B 1 244 ? -9.832  45.126  26.245  1.00 54.17  ? 244 VAL B C   1 
ATOM   3984  O  O   . VAL B 1 244 ? -11.039 45.204  26.047  1.00 58.08  ? 244 VAL B O   1 
ATOM   3985  C  CB  . VAL B 1 244 ? -10.040 43.855  28.285  1.00 59.30  ? 244 VAL B CB  1 
ATOM   3986  C  CG1 . VAL B 1 244 ? -9.781  42.608  27.466  1.00 73.45  ? 244 VAL B CG1 1 
ATOM   3987  C  CG2 . VAL B 1 244 ? -9.581  43.652  29.718  1.00 66.07  ? 244 VAL B CG2 1 
ATOM   3988  N  N   . HIS B 1 245 ? -8.940  45.097  25.260  1.00 48.37  ? 245 HIS B N   1 
ATOM   3989  C  CA  . HIS B 1 245 ? -9.378  45.182  23.867  1.00 58.88  ? 245 HIS B CA  1 
ATOM   3990  C  C   . HIS B 1 245 ? -9.416  43.786  23.243  1.00 65.89  ? 245 HIS B C   1 
ATOM   3991  O  O   . HIS B 1 245 ? -8.478  43.000  23.400  1.00 69.90  ? 245 HIS B O   1 
ATOM   3992  C  CB  . HIS B 1 245 ? -8.508  46.161  23.048  1.00 70.30  ? 245 HIS B CB  1 
ATOM   3993  C  CG  . HIS B 1 245 ? -8.276  47.478  23.735  1.00 89.99  ? 245 HIS B CG  1 
ATOM   3994  N  ND1 . HIS B 1 245 ? -9.174  48.526  23.675  1.00 91.45  ? 245 HIS B ND1 1 
ATOM   3995  C  CD2 . HIS B 1 245 ? -7.253  47.905  24.519  1.00 98.63  ? 245 HIS B CD2 1 
ATOM   3996  C  CE1 . HIS B 1 245 ? -8.714  49.541  24.389  1.00 95.72  ? 245 HIS B CE1 1 
ATOM   3997  N  NE2 . HIS B 1 245 ? -7.550  49.191  24.911  1.00 99.65  ? 245 HIS B NE2 1 
ATOM   3998  N  N   . ILE B 1 246 ? -10.505 43.488  22.540  1.00 63.10  ? 246 ILE B N   1 
ATOM   3999  C  CA  . ILE B 1 246 ? -10.761 42.159  22.032  1.00 46.81  ? 246 ILE B CA  1 
ATOM   4000  C  C   . ILE B 1 246 ? -11.302 42.269  20.621  1.00 47.36  ? 246 ILE B C   1 
ATOM   4001  O  O   . ILE B 1 246 ? -12.279 42.989  20.403  1.00 57.17  ? 246 ILE B O   1 
ATOM   4002  C  CB  . ILE B 1 246 ? -11.824 41.513  22.910  1.00 61.31  ? 246 ILE B CB  1 
ATOM   4003  C  CG1 . ILE B 1 246 ? -11.233 41.175  24.278  1.00 65.92  ? 246 ILE B CG1 1 
ATOM   4004  C  CG2 . ILE B 1 246 ? -12.381 40.278  22.287  1.00 69.38  ? 246 ILE B CG2 1 
ATOM   4005  C  CD1 . ILE B 1 246 ? -12.305 40.919  25.324  1.00 70.10  ? 246 ILE B CD1 1 
ATOM   4006  N  N   . SER B 1 247 ? -10.680 41.560  19.665  1.00 61.49  ? 247 SER B N   1 
ATOM   4007  C  CA  . SER B 1 247 ? -11.134 41.544  18.261  1.00 52.39  ? 247 SER B CA  1 
ATOM   4008  C  C   . SER B 1 247 ? -12.645 41.415  18.203  1.00 53.51  ? 247 SER B C   1 
ATOM   4009  O  O   . SER B 1 247 ? -13.255 40.794  19.065  1.00 60.07  ? 247 SER B O   1 
ATOM   4010  C  CB  . SER B 1 247 ? -10.492 40.388  17.500  1.00 53.45  ? 247 SER B CB  1 
ATOM   4011  O  OG  . SER B 1 247 ? -10.961 39.137  18.001  1.00 53.94  ? 247 SER B OG  1 
ATOM   4012  N  N   . PRO B 1 248 ? -13.265 42.000  17.190  1.00 59.52  ? 248 PRO B N   1 
ATOM   4013  C  CA  . PRO B 1 248 ? -14.720 41.836  17.134  1.00 53.64  ? 248 PRO B CA  1 
ATOM   4014  C  C   . PRO B 1 248 ? -15.188 40.376  16.851  1.00 62.77  ? 248 PRO B C   1 
ATOM   4015  O  O   . PRO B 1 248 ? -16.300 40.006  17.260  1.00 65.14  ? 248 PRO B O   1 
ATOM   4016  C  CB  . PRO B 1 248 ? -15.131 42.798  16.011  1.00 59.54  ? 248 PRO B CB  1 
ATOM   4017  C  CG  . PRO B 1 248 ? -13.890 42.981  15.175  1.00 64.51  ? 248 PRO B CG  1 
ATOM   4018  C  CD  . PRO B 1 248 ? -12.733 42.843  16.101  1.00 65.60  ? 248 PRO B CD  1 
ATOM   4019  N  N   . GLU B 1 249 ? -14.376 39.548  16.191  1.00 65.13  ? 249 GLU B N   1 
ATOM   4020  C  CA  . GLU B 1 249 ? -14.759 38.136  16.019  1.00 73.62  ? 249 GLU B CA  1 
ATOM   4021  C  C   . GLU B 1 249 ? -14.833 37.467  17.382  1.00 65.24  ? 249 GLU B C   1 
ATOM   4022  O  O   . GLU B 1 249 ? -15.735 36.668  17.670  1.00 59.14  ? 249 GLU B O   1 
ATOM   4023  C  CB  . GLU B 1 249 ? -13.752 37.366  15.157  1.00 80.85  ? 249 GLU B CB  1 
ATOM   4024  C  CG  . GLU B 1 249 ? -13.383 38.054  13.857  1.00 90.54  ? 249 GLU B CG  1 
ATOM   4025  C  CD  . GLU B 1 249 ? -12.437 39.238  14.082  1.00 91.07  ? 249 GLU B CD  1 
ATOM   4026  O  OE1 . GLU B 1 249 ? -11.712 39.224  15.112  1.00 86.81  ? 249 GLU B OE1 1 
ATOM   4027  O  OE2 . GLU B 1 249 ? -12.430 40.175  13.245  1.00 90.72  ? 249 GLU B OE2 1 
ATOM   4028  N  N   . CYS B 1 250 ? -13.857 37.785  18.216  1.00 47.85  ? 250 CYS B N   1 
ATOM   4029  C  CA  . CYS B 1 250 ? -13.840 37.261  19.555  1.00 35.53  ? 250 CYS B CA  1 
ATOM   4030  C  C   . CYS B 1 250 ? -15.057 37.752  20.300  1.00 47.51  ? 250 CYS B C   1 
ATOM   4031  O  O   . CYS B 1 250 ? -15.666 37.017  21.058  1.00 52.54  ? 250 CYS B O   1 
ATOM   4032  C  CB  . CYS B 1 250 ? -12.581 37.697  20.280  1.00 44.21  ? 250 CYS B CB  1 
ATOM   4033  S  SG  . CYS B 1 250 ? -12.522 37.055  21.949  1.00 52.02  ? 250 CYS B SG  1 
ATOM   4034  N  N   . ARG B 1 251 ? -15.387 39.025  20.111  1.00 50.38  ? 251 ARG B N   1 
ATOM   4035  C  CA  . ARG B 1 251 ? -16.512 39.632  20.811  1.00 52.80  ? 251 ARG B CA  1 
ATOM   4036  C  C   . ARG B 1 251 ? -17.817 38.988  20.369  1.00 55.11  ? 251 ARG B C   1 
ATOM   4037  O  O   . ARG B 1 251 ? -18.772 38.897  21.139  1.00 55.16  ? 251 ARG B O   1 
ATOM   4038  C  CB  . ARG B 1 251 ? -16.553 41.139  20.553  1.00 47.64  ? 251 ARG B CB  1 
ATOM   4039  C  CG  . ARG B 1 251 ? -17.375 41.919  21.564  1.00 48.30  ? 251 ARG B CG  1 
ATOM   4040  C  CD  . ARG B 1 251 ? -17.197 43.417  21.382  1.00 59.72  ? 251 ARG B CD  1 
ATOM   4041  N  NE  . ARG B 1 251 ? -15.824 43.839  21.645  1.00 67.79  ? 251 ARG B NE  1 
ATOM   4042  C  CZ  . ARG B 1 251 ? -15.426 44.430  22.766  1.00 65.01  ? 251 ARG B CZ  1 
ATOM   4043  N  NH1 . ARG B 1 251 ? -16.298 44.671  23.734  1.00 54.47  ? 251 ARG B NH1 1 
ATOM   4044  N  NH2 . ARG B 1 251 ? -14.156 44.780  22.921  1.00 61.46  ? 251 ARG B NH2 1 
ATOM   4045  N  N   . HIS B 1 252 ? -17.845 38.541  19.120  1.00 52.43  ? 252 HIS B N   1 
ATOM   4046  C  CA  . HIS B 1 252 ? -19.039 37.910  18.552  1.00 49.27  ? 252 HIS B CA  1 
ATOM   4047  C  C   . HIS B 1 252 ? -19.221 36.519  19.152  1.00 51.04  ? 252 HIS B C   1 
ATOM   4048  O  O   . HIS B 1 252 ? -20.302 36.165  19.619  1.00 51.46  ? 252 HIS B O   1 
ATOM   4049  C  CB  . HIS B 1 252 ? -18.956 37.820  17.028  1.00 55.69  ? 252 HIS B CB  1 
ATOM   4050  C  CG  . HIS B 1 252 ? -20.156 37.178  16.409  1.00 68.03  ? 252 HIS B CG  1 
ATOM   4051  N  ND1 . HIS B 1 252 ? -20.132 35.913  15.857  1.00 78.74  ? 252 HIS B ND1 1 
ATOM   4052  C  CD2 . HIS B 1 252 ? -21.437 37.616  16.294  1.00 68.15  ? 252 HIS B CD2 1 
ATOM   4053  C  CE1 . HIS B 1 252 ? -21.341 35.606  15.412  1.00 75.17  ? 252 HIS B CE1 1 
ATOM   4054  N  NE2 . HIS B 1 252 ? -22.148 36.621  15.667  1.00 74.16  ? 252 HIS B NE2 1 
ATOM   4055  N  N   . LEU B 1 253 ? -18.142 35.743  19.164  1.00 46.47  ? 253 LEU B N   1 
ATOM   4056  C  CA  . LEU B 1 253 ? -18.185 34.404  19.747  1.00 46.35  ? 253 LEU B CA  1 
ATOM   4057  C  C   . LEU B 1 253 ? -18.733 34.416  21.177  1.00 37.11  ? 253 LEU B C   1 
ATOM   4058  O  O   . LEU B 1 253 ? -19.654 33.656  21.509  1.00 49.27  ? 253 LEU B O   1 
ATOM   4059  C  CB  . LEU B 1 253 ? -16.805 33.741  19.709  1.00 40.46  ? 253 LEU B CB  1 
ATOM   4060  C  CG  . LEU B 1 253 ? -16.766 32.407  20.446  1.00 43.13  ? 253 LEU B CG  1 
ATOM   4061  C  CD1 . LEU B 1 253 ? -17.859 31.535  19.885  1.00 42.33  ? 253 LEU B CD1 1 
ATOM   4062  C  CD2 . LEU B 1 253 ? -15.406 31.774  20.300  1.00 30.29  ? 253 LEU B CD2 1 
ATOM   4063  N  N   . ILE B 1 254 ? -18.167 35.271  22.021  1.00 33.27  ? 254 ILE B N   1 
ATOM   4064  C  CA  . ILE B 1 254 ? -18.635 35.390  23.384  1.00 40.77  ? 254 ILE B CA  1 
ATOM   4065  C  C   . ILE B 1 254 ? -20.116 35.703  23.417  1.00 40.00  ? 254 ILE B C   1 
ATOM   4066  O  O   . ILE B 1 254 ? -20.832 35.187  24.268  1.00 50.31  ? 254 ILE B O   1 
ATOM   4067  C  CB  . ILE B 1 254 ? -17.870 36.468  24.144  1.00 45.58  ? 254 ILE B CB  1 
ATOM   4068  C  CG1 . ILE B 1 254 ? -16.427 36.011  24.350  1.00 41.59  ? 254 ILE B CG1 1 
ATOM   4069  C  CG2 . ILE B 1 254 ? -18.517 36.739  25.505  1.00 42.53  ? 254 ILE B CG2 1 
ATOM   4070  C  CD1 . ILE B 1 254 ? -15.557 37.041  24.975  1.00 50.05  ? 254 ILE B CD1 1 
ATOM   4071  N  N   . SER B 1 255 ? -20.599 36.521  22.493  1.00 37.83  ? 255 SER B N   1 
ATOM   4072  C  CA  . SER B 1 255 ? -22.004 36.945  22.590  1.00 41.62  ? 255 SER B CA  1 
ATOM   4073  C  C   . SER B 1 255 ? -22.933 35.834  22.171  1.00 38.18  ? 255 SER B C   1 
ATOM   4074  O  O   . SER B 1 255 ? -24.095 35.811  22.562  1.00 50.29  ? 255 SER B O   1 
ATOM   4075  C  CB  . SER B 1 255 ? -22.286 38.206  21.749  1.00 44.48  ? 255 SER B CB  1 
ATOM   4076  O  OG  . SER B 1 255 ? -22.221 37.905  20.350  1.00 61.09  ? 255 SER B OG  1 
ATOM   4077  N  N   . ARG B 1 256 ? -22.403 34.917  21.369  1.00 34.96  ? 256 ARG B N   1 
ATOM   4078  C  CA  . ARG B 1 256 ? -23.161 33.772  20.901  1.00 41.82  ? 256 ARG B CA  1 
ATOM   4079  C  C   . ARG B 1 256 ? -23.216 32.698  21.978  1.00 42.69  ? 256 ARG B C   1 
ATOM   4080  O  O   . ARG B 1 256 ? -24.106 31.849  21.967  1.00 44.52  ? 256 ARG B O   1 
ATOM   4081  C  CB  . ARG B 1 256 ? -22.538 33.202  19.625  1.00 43.79  ? 256 ARG B CB  1 
ATOM   4082  C  CG  . ARG B 1 256 ? -22.725 34.079  18.398  1.00 53.19  ? 256 ARG B CG  1 
ATOM   4083  C  CD  . ARG B 1 256 ? -24.164 34.047  17.910  1.00 57.57  ? 256 ARG B CD  1 
ATOM   4084  N  NE  . ARG B 1 256 ? -24.487 32.787  17.248  1.00 65.27  ? 256 ARG B NE  1 
ATOM   4085  C  CZ  . ARG B 1 256 ? -25.376 31.909  17.705  1.00 60.30  ? 256 ARG B CZ  1 
ATOM   4086  N  NH1 . ARG B 1 256 ? -26.035 32.153  18.829  1.00 39.72  ? 256 ARG B NH1 1 
ATOM   4087  N  NH2 . ARG B 1 256 ? -25.606 30.788  17.036  1.00 70.44  ? 256 ARG B NH2 1 
ATOM   4088  N  N   . ILE B 1 257 ? -22.268 32.734  22.910  1.00 45.50  ? 257 ILE B N   1 
ATOM   4089  C  CA  . ILE B 1 257 ? -22.259 31.746  23.970  1.00 22.64  ? 257 ILE B CA  1 
ATOM   4090  C  C   . ILE B 1 257 ? -23.149 32.193  25.100  1.00 35.38  ? 257 ILE B C   1 
ATOM   4091  O  O   . ILE B 1 257 ? -23.900 31.406  25.657  1.00 31.86  ? 257 ILE B O   1 
ATOM   4092  C  CB  . ILE B 1 257 ? -20.858 31.477  24.487  1.00 36.09  ? 257 ILE B CB  1 
ATOM   4093  C  CG1 . ILE B 1 257 ? -20.068 30.702  23.442  1.00 33.76  ? 257 ILE B CG1 1 
ATOM   4094  C  CG2 . ILE B 1 257 ? -20.894 30.694  25.801  1.00 22.29  ? 257 ILE B CG2 1 
ATOM   4095  C  CD1 . ILE B 1 257 ? -18.580 30.763  23.679  1.00 31.00  ? 257 ILE B CD1 1 
ATOM   4096  N  N   . PHE B 1 258 ? -23.081 33.472  25.434  1.00 43.84  ? 258 PHE B N   1 
ATOM   4097  C  CA  . PHE B 1 258 ? -23.869 33.998  26.541  1.00 46.61  ? 258 PHE B CA  1 
ATOM   4098  C  C   . PHE B 1 258 ? -25.279 34.373  26.098  1.00 51.40  ? 258 PHE B C   1 
ATOM   4099  O  O   . PHE B 1 258 ? -25.666 35.546  26.144  1.00 48.46  ? 258 PHE B O   1 
ATOM   4100  C  CB  . PHE B 1 258 ? -23.164 35.172  27.195  1.00 48.99  ? 258 PHE B CB  1 
ATOM   4101  C  CG  . PHE B 1 258 ? -21.958 34.783  27.976  1.00 49.04  ? 258 PHE B CG  1 
ATOM   4102  C  CD1 . PHE B 1 258 ? -21.853 33.526  28.513  1.00 45.73  ? 258 PHE B CD1 1 
ATOM   4103  C  CD2 . PHE B 1 258 ? -20.933 35.678  28.194  1.00 45.40  ? 258 PHE B CD2 1 
ATOM   4104  C  CE1 . PHE B 1 258 ? -20.751 33.168  29.252  1.00 37.61  ? 258 PHE B CE1 1 
ATOM   4105  C  CE2 . PHE B 1 258 ? -19.835 35.313  28.929  1.00 43.85  ? 258 PHE B CE2 1 
ATOM   4106  C  CZ  . PHE B 1 258 ? -19.754 34.051  29.451  1.00 39.13  ? 258 PHE B CZ  1 
ATOM   4107  N  N   . VAL B 1 259 ? -26.019 33.345  25.669  1.00 42.92  ? 259 VAL B N   1 
ATOM   4108  C  CA  . VAL B 1 259 ? -27.424 33.440  25.338  1.00 36.96  ? 259 VAL B CA  1 
ATOM   4109  C  C   . VAL B 1 259 ? -28.239 32.625  26.340  1.00 43.21  ? 259 VAL B C   1 
ATOM   4110  O  O   . VAL B 1 259 ? -27.950 31.439  26.560  1.00 42.06  ? 259 VAL B O   1 
ATOM   4111  C  CB  . VAL B 1 259 ? -27.679 32.904  23.916  1.00 37.71  ? 259 VAL B CB  1 
ATOM   4112  C  CG1 . VAL B 1 259 ? -29.159 32.900  23.601  1.00 45.62  ? 259 VAL B CG1 1 
ATOM   4113  C  CG2 . VAL B 1 259 ? -26.954 33.737  22.912  1.00 42.27  ? 259 VAL B CG2 1 
ATOM   4114  N  N   . ALA B 1 260 ? -29.263 33.249  26.924  1.00 44.71  ? 260 ALA B N   1 
ATOM   4115  C  CA  . ALA B 1 260 ? -30.043 32.601  27.983  1.00 41.74  ? 260 ALA B CA  1 
ATOM   4116  C  C   . ALA B 1 260 ? -30.902 31.379  27.583  1.00 47.48  ? 260 ALA B C   1 
ATOM   4117  O  O   . ALA B 1 260 ? -31.110 30.486  28.402  1.00 46.22  ? 260 ALA B O   1 
ATOM   4118  C  CB  . ALA B 1 260 ? -30.877 33.632  28.733  1.00 31.67  ? 260 ALA B CB  1 
ATOM   4119  N  N   . ASP B 1 261 ? -31.386 31.336  26.343  1.00 60.50  ? 261 ASP B N   1 
ATOM   4120  C  CA  . ASP B 1 261 ? -32.131 30.169  25.820  1.00 62.65  ? 261 ASP B CA  1 
ATOM   4121  C  C   . ASP B 1 261 ? -31.214 29.090  25.200  1.00 46.93  ? 261 ASP B C   1 
ATOM   4122  O  O   . ASP B 1 261 ? -30.551 29.292  24.167  1.00 34.93  ? 261 ASP B O   1 
ATOM   4123  C  CB  . ASP B 1 261 ? -33.242 30.585  24.825  1.00 66.90  ? 261 ASP B CB  1 
ATOM   4124  C  CG  . ASP B 1 261 ? -34.063 29.385  24.313  1.00 75.69  ? 261 ASP B CG  1 
ATOM   4125  O  OD1 . ASP B 1 261 ? -34.136 28.370  25.029  1.00 81.37  ? 261 ASP B OD1 1 
ATOM   4126  O  OD2 . ASP B 1 261 ? -34.644 29.445  23.199  1.00 81.53  ? 261 ASP B OD2 1 
ATOM   4127  N  N   . PRO B 1 262 ? -31.195 27.924  25.828  1.00 50.06  ? 262 PRO B N   1 
ATOM   4128  C  CA  . PRO B 1 262 ? -30.315 26.810  25.445  1.00 44.90  ? 262 PRO B CA  1 
ATOM   4129  C  C   . PRO B 1 262 ? -30.482 26.425  23.966  1.00 53.49  ? 262 PRO B C   1 
ATOM   4130  O  O   . PRO B 1 262 ? -29.525 26.048  23.273  1.00 70.39  ? 262 PRO B O   1 
ATOM   4131  C  CB  . PRO B 1 262 ? -30.787 25.679  26.335  1.00 42.00  ? 262 PRO B CB  1 
ATOM   4132  C  CG  . PRO B 1 262 ? -31.643 26.301  27.393  1.00 38.73  ? 262 PRO B CG  1 
ATOM   4133  C  CD  . PRO B 1 262 ? -32.177 27.558  26.860  1.00 53.15  ? 262 PRO B CD  1 
ATOM   4134  N  N   . ALA B 1 263 ? -31.700 26.529  23.468  1.00 44.62  ? 263 ALA B N   1 
ATOM   4135  C  CA  . ALA B 1 263 ? -31.930 26.248  22.059  1.00 44.22  ? 263 ALA B CA  1 
ATOM   4136  C  C   . ALA B 1 263 ? -31.222 27.232  21.128  1.00 47.70  ? 263 ALA B C   1 
ATOM   4137  O  O   . ALA B 1 263 ? -30.888 26.871  19.988  1.00 51.43  ? 263 ALA B O   1 
ATOM   4138  C  CB  . ALA B 1 263 ? -33.437 26.208  21.760  1.00 44.83  ? 263 ALA B CB  1 
ATOM   4139  N  N   . LYS B 1 264 ? -30.983 28.463  21.601  1.00 48.78  ? 264 LYS B N   1 
ATOM   4140  C  CA  . LYS B 1 264 ? -30.403 29.492  20.728  1.00 54.70  ? 264 LYS B CA  1 
ATOM   4141  C  C   . LYS B 1 264 ? -28.919 29.645  20.929  1.00 42.31  ? 264 LYS B C   1 
ATOM   4142  O  O   . LYS B 1 264 ? -28.235 30.238  20.097  1.00 46.14  ? 264 LYS B O   1 
ATOM   4143  C  CB  . LYS B 1 264 ? -31.138 30.834  20.865  1.00 67.71  ? 264 LYS B CB  1 
ATOM   4144  C  CG  . LYS B 1 264 ? -32.596 30.720  20.428  1.00 80.46  ? 264 LYS B CG  1 
ATOM   4145  C  CD  . LYS B 1 264 ? -33.333 32.032  20.504  1.00 87.46  ? 264 LYS B CD  1 
ATOM   4146  C  CE  . LYS B 1 264 ? -34.779 31.870  20.031  1.00 91.72  ? 264 LYS B CE  1 
ATOM   4147  N  NZ  . LYS B 1 264 ? -35.395 33.181  19.641  1.00 95.65  ? 264 LYS B NZ  1 
ATOM   4148  N  N   . ARG B 1 265 ? -28.414 29.096  22.030  1.00 35.30  ? 265 ARG B N   1 
ATOM   4149  C  CA  . ARG B 1 265 ? -26.977 29.190  22.322  1.00 36.80  ? 265 ARG B CA  1 
ATOM   4150  C  C   . ARG B 1 265 ? -26.190 28.469  21.222  1.00 46.62  ? 265 ARG B C   1 
ATOM   4151  O  O   . ARG B 1 265 ? -26.595 27.402  20.738  1.00 50.24  ? 265 ARG B O   1 
ATOM   4152  C  CB  . ARG B 1 265 ? -26.677 28.600  23.700  1.00 28.28  ? 265 ARG B CB  1 
ATOM   4153  C  CG  . ARG B 1 265 ? -25.205 28.720  24.180  1.00 29.58  ? 265 ARG B CG  1 
ATOM   4154  C  CD  . ARG B 1 265 ? -25.094 28.369  25.668  1.00 25.88  ? 265 ARG B CD  1 
ATOM   4155  N  NE  . ARG B 1 265 ? -26.210 28.994  26.347  1.00 29.42  ? 265 ARG B NE  1 
ATOM   4156  C  CZ  . ARG B 1 265 ? -26.835 28.462  27.376  1.00 33.54  ? 265 ARG B CZ  1 
ATOM   4157  N  NH1 . ARG B 1 265 ? -26.454 27.300  27.846  1.00 32.04  ? 265 ARG B NH1 1 
ATOM   4158  N  NH2 . ARG B 1 265 ? -27.851 29.080  27.928  1.00 36.21  ? 265 ARG B NH2 1 
ATOM   4159  N  N   . ILE B 1 266 ? -25.057 29.040  20.826  1.00 45.70  ? 266 ILE B N   1 
ATOM   4160  C  CA  . ILE B 1 266 ? -24.201 28.377  19.842  1.00 32.49  ? 266 ILE B CA  1 
ATOM   4161  C  C   . ILE B 1 266 ? -23.775 26.988  20.336  1.00 41.32  ? 266 ILE B C   1 
ATOM   4162  O  O   . ILE B 1 266 ? -23.647 26.741  21.542  1.00 50.10  ? 266 ILE B O   1 
ATOM   4163  C  CB  . ILE B 1 266 ? -22.968 29.216  19.539  1.00 24.89  ? 266 ILE B CB  1 
ATOM   4164  C  CG1 . ILE B 1 266 ? -22.312 28.763  18.248  1.00 29.80  ? 266 ILE B CG1 1 
ATOM   4165  C  CG2 . ILE B 1 266 ? -21.998 29.164  20.684  1.00 28.07  ? 266 ILE B CG2 1 
ATOM   4166  C  CD1 . ILE B 1 266 ? -21.104 29.569  17.896  1.00 27.44  ? 266 ILE B CD1 1 
ATOM   4167  N  N   . SER B 1 267 ? -23.555 26.065  19.406  1.00 57.82  ? 267 SER B N   1 
ATOM   4168  C  CA  . SER B 1 267 ? -23.193 24.695  19.766  1.00 55.06  ? 267 SER B CA  1 
ATOM   4169  C  C   . SER B 1 267 ? -21.715 24.427  19.504  1.00 49.47  ? 267 SER B C   1 
ATOM   4170  O  O   . SER B 1 267 ? -21.070 25.147  18.719  1.00 43.25  ? 267 SER B O   1 
ATOM   4171  C  CB  . SER B 1 267 ? -24.004 23.712  18.921  1.00 54.99  ? 267 SER B CB  1 
ATOM   4172  O  OG  . SER B 1 267 ? -23.502 23.690  17.582  1.00 56.28  ? 267 SER B OG  1 
ATOM   4173  N  N   . ILE B 1 268 ? -21.192 23.362  20.124  1.00 50.48  ? 268 ILE B N   1 
ATOM   4174  C  CA  . ILE B 1 268 ? -19.793 22.971  19.925  1.00 49.42  ? 268 ILE B CA  1 
ATOM   4175  C  C   . ILE B 1 268 ? -19.426 22.903  18.427  1.00 50.23  ? 268 ILE B C   1 
ATOM   4176  O  O   . ILE B 1 268 ? -18.426 23.478  17.997  1.00 49.65  ? 268 ILE B O   1 
ATOM   4177  C  CB  . ILE B 1 268 ? -19.453 21.628  20.600  1.00 42.40  ? 268 ILE B CB  1 
ATOM   4178  C  CG1 . ILE B 1 268 ? -19.690 21.687  22.105  1.00 40.91  ? 268 ILE B CG1 1 
ATOM   4179  C  CG2 . ILE B 1 268 ? -17.999 21.287  20.354  1.00 32.46  ? 268 ILE B CG2 1 
ATOM   4180  C  CD1 . ILE B 1 268 ? -18.559 22.332  22.835  1.00 55.17  ? 268 ILE B CD1 1 
ATOM   4181  N  N   . PRO B 1 269 ? -20.245 22.212  17.617  1.00 57.45  ? 269 PRO B N   1 
ATOM   4182  C  CA  . PRO B 1 269 ? -19.884 22.153  16.187  1.00 52.43  ? 269 PRO B CA  1 
ATOM   4183  C  C   . PRO B 1 269 ? -19.795 23.551  15.560  1.00 55.98  ? 269 PRO B C   1 
ATOM   4184  O  O   . PRO B 1 269 ? -18.871 23.836  14.792  1.00 55.38  ? 269 PRO B O   1 
ATOM   4185  C  CB  . PRO B 1 269 ? -21.025 21.329  15.565  1.00 51.22  ? 269 PRO B CB  1 
ATOM   4186  C  CG  . PRO B 1 269 ? -21.531 20.460  16.713  1.00 63.54  ? 269 PRO B CG  1 
ATOM   4187  C  CD  . PRO B 1 269 ? -21.402 21.352  17.950  1.00 64.78  ? 269 PRO B CD  1 
ATOM   4188  N  N   . GLU B 1 270 ? -20.741 24.415  15.913  1.00 52.96  ? 270 GLU B N   1 
ATOM   4189  C  CA  . GLU B 1 270 ? -20.749 25.786  15.418  1.00 66.30  ? 270 GLU B CA  1 
ATOM   4190  C  C   . GLU B 1 270 ? -19.522 26.557  15.898  1.00 68.51  ? 270 GLU B C   1 
ATOM   4191  O  O   . GLU B 1 270 ? -18.966 27.369  15.162  1.00 71.28  ? 270 GLU B O   1 
ATOM   4192  C  CB  . GLU B 1 270 ? -22.026 26.505  15.859  1.00 69.11  ? 270 GLU B CB  1 
ATOM   4193  C  CG  . GLU B 1 270 ? -23.274 26.070  15.109  1.00 60.57  ? 270 GLU B CG  1 
ATOM   4194  C  CD  . GLU B 1 270 ? -24.551 26.477  15.819  1.00 74.05  ? 270 GLU B CD  1 
ATOM   4195  O  OE1 . GLU B 1 270 ? -24.611 26.350  17.059  1.00 71.42  ? 270 GLU B OE1 1 
ATOM   4196  O  OE2 . GLU B 1 270 ? -25.495 26.922  15.135  1.00 85.94  ? 270 GLU B OE2 1 
ATOM   4197  N  N   . ILE B 1 271 ? -19.103 26.299  17.135  1.00 61.13  ? 271 ILE B N   1 
ATOM   4198  C  CA  . ILE B 1 271 ? -17.944 26.994  17.708  1.00 64.36  ? 271 ILE B CA  1 
ATOM   4199  C  C   . ILE B 1 271 ? -16.690 26.589  16.936  1.00 58.95  ? 271 ILE B C   1 
ATOM   4200  O  O   . ILE B 1 271 ? -15.808 27.413  16.678  1.00 56.64  ? 271 ILE B O   1 
ATOM   4201  C  CB  . ILE B 1 271 ? -17.735 26.679  19.212  1.00 33.27  ? 271 ILE B CB  1 
ATOM   4202  C  CG1 . ILE B 1 271 ? -18.859 27.281  20.039  1.00 40.42  ? 271 ILE B CG1 1 
ATOM   4203  C  CG2 . ILE B 1 271 ? -16.451 27.236  19.667  1.00 28.81  ? 271 ILE B CG2 1 
ATOM   4204  C  CD1 . ILE B 1 271 ? -18.829 26.928  21.540  1.00 41.78  ? 271 ILE B CD1 1 
ATOM   4205  N  N   . ARG B 1 272 ? -16.609 25.310  16.585  1.00 61.24  ? 272 ARG B N   1 
ATOM   4206  C  CA  . ARG B 1 272 ? -15.449 24.785  15.874  1.00 69.71  ? 272 ARG B CA  1 
ATOM   4207  C  C   . ARG B 1 272 ? -15.321 25.412  14.492  1.00 72.81  ? 272 ARG B C   1 
ATOM   4208  O  O   . ARG B 1 272 ? -14.262 25.353  13.868  1.00 72.35  ? 272 ARG B O   1 
ATOM   4209  C  CB  . ARG B 1 272 ? -15.539 23.263  15.753  1.00 81.73  ? 272 ARG B CB  1 
ATOM   4210  C  CG  . ARG B 1 272 ? -15.214 22.518  17.037  1.00 82.44  ? 272 ARG B CG  1 
ATOM   4211  C  CD  . ARG B 1 272 ? -16.074 21.273  17.184  1.00 90.53  ? 272 ARG B CD  1 
ATOM   4212  N  NE  . ARG B 1 272 ? -15.330 20.055  16.879  1.00 93.51  ? 272 ARG B NE  1 
ATOM   4213  C  CZ  . ARG B 1 272 ? -14.054 19.861  17.195  1.00 94.89  ? 272 ARG B CZ  1 
ATOM   4214  N  NH1 . ARG B 1 272 ? -13.374 20.807  17.828  1.00 87.77  ? 272 ARG B NH1 1 
ATOM   4215  N  NH2 . ARG B 1 272 ? -13.457 18.720  16.878  1.00 97.91  ? 272 ARG B NH2 1 
ATOM   4216  N  N   . ASN B 1 273 ? -16.407 26.014  14.020  1.00 80.81  ? 273 ASN B N   1 
ATOM   4217  C  CA  . ASN B 1 273 ? -16.426 26.633  12.707  1.00 81.29  ? 273 ASN B CA  1 
ATOM   4218  C  C   . ASN B 1 273 ? -16.346 28.145  12.751  1.00 71.22  ? 273 ASN B C   1 
ATOM   4219  O  O   . ASN B 1 273 ? -16.362 28.803  11.713  1.00 68.67  ? 273 ASN B O   1 
ATOM   4220  C  CB  . ASN B 1 273 ? -17.680 26.207  11.944  1.00 90.62  ? 273 ASN B CB  1 
ATOM   4221  C  CG  . ASN B 1 273 ? -17.408 25.068  10.988  1.00 87.86  ? 273 ASN B CG  1 
ATOM   4222  O  OD1 . ASN B 1 273 ? -16.299 24.956  10.447  1.00 81.19  ? 273 ASN B OD1 1 
ATOM   4223  N  ND2 . ASN B 1 273 ? -18.409 24.204  10.777  1.00 81.78  ? 273 ASN B ND2 1 
ATOM   4224  N  N   . HIS B 1 274 ? -16.256 28.699  13.949  1.00 69.10  ? 274 HIS B N   1 
ATOM   4225  C  CA  . HIS B 1 274 ? -16.253 30.149  14.076  1.00 57.14  ? 274 HIS B CA  1 
ATOM   4226  C  C   . HIS B 1 274 ? -14.920 30.728  13.625  1.00 51.26  ? 274 HIS B C   1 
ATOM   4227  O  O   . HIS B 1 274 ? -13.878 30.177  13.925  1.00 54.61  ? 274 HIS B O   1 
ATOM   4228  C  CB  . HIS B 1 274 ? -16.562 30.555  15.514  1.00 47.96  ? 274 HIS B CB  1 
ATOM   4229  C  CG  . HIS B 1 274 ? -16.921 31.997  15.665  1.00 53.89  ? 274 HIS B CG  1 
ATOM   4230  N  ND1 . HIS B 1 274 ? -15.992 33.010  15.547  1.00 41.12  ? 274 HIS B ND1 1 
ATOM   4231  C  CD2 . HIS B 1 274 ? -18.108 32.599  15.925  1.00 54.07  ? 274 HIS B CD2 1 
ATOM   4232  C  CE1 . HIS B 1 274 ? -16.591 34.172  15.734  1.00 45.33  ? 274 HIS B CE1 1 
ATOM   4233  N  NE2 . HIS B 1 274 ? -17.876 33.949  15.958  1.00 47.12  ? 274 HIS B NE2 1 
ATOM   4234  N  N   . GLU B 1 275 ? -14.969 31.838  12.895  1.00 49.81  ? 275 GLU B N   1 
ATOM   4235  C  CA  . GLU B 1 275 ? -13.766 32.551  12.492  1.00 56.36  ? 275 GLU B CA  1 
ATOM   4236  C  C   . GLU B 1 275 ? -12.711 32.644  13.590  1.00 58.57  ? 275 GLU B C   1 
ATOM   4237  O  O   . GLU B 1 275 ? -11.523 32.401  13.334  1.00 54.41  ? 275 GLU B O   1 
ATOM   4238  C  CB  . GLU B 1 275 ? -14.116 33.957  12.034  1.00 73.55  ? 275 GLU B CB  1 
ATOM   4239  C  CG  . GLU B 1 275 ? -14.122 34.128  10.537  1.00 97.56  ? 275 GLU B CG  1 
ATOM   4240  C  CD  . GLU B 1 275 ? -14.312 35.579  10.116  1.00 114.33 ? 275 GLU B CD  1 
ATOM   4241  O  OE1 . GLU B 1 275 ? -14.391 35.835  8.891   1.00 125.45 ? 275 GLU B OE1 1 
ATOM   4242  O  OE2 . GLU B 1 275 ? -14.382 36.460  11.008  1.00 111.47 ? 275 GLU B OE2 1 
ATOM   4243  N  N   . TRP B 1 276 ? -13.132 32.996  14.807  1.00 58.92  ? 276 TRP B N   1 
ATOM   4244  C  CA  . TRP B 1 276 ? -12.178 33.249  15.888  1.00 53.79  ? 276 TRP B CA  1 
ATOM   4245  C  C   . TRP B 1 276 ? -11.493 31.977  16.306  1.00 56.27  ? 276 TRP B C   1 
ATOM   4246  O  O   . TRP B 1 276 ? -10.312 31.982  16.664  1.00 58.06  ? 276 TRP B O   1 
ATOM   4247  C  CB  . TRP B 1 276 ? -12.860 33.892  17.097  1.00 49.89  ? 276 TRP B CB  1 
ATOM   4248  C  CG  . TRP B 1 276 ? -11.873 34.341  18.133  1.00 50.84  ? 276 TRP B CG  1 
ATOM   4249  C  CD1 . TRP B 1 276 ? -11.124 35.488  18.112  1.00 50.20  ? 276 TRP B CD1 1 
ATOM   4250  C  CD2 . TRP B 1 276 ? -11.504 33.639  19.336  1.00 42.31  ? 276 TRP B CD2 1 
ATOM   4251  N  NE1 . TRP B 1 276 ? -10.324 35.548  19.232  1.00 56.37  ? 276 TRP B NE1 1 
ATOM   4252  C  CE2 . TRP B 1 276 ? -10.540 34.444  19.987  1.00 47.39  ? 276 TRP B CE2 1 
ATOM   4253  C  CE3 . TRP B 1 276 ? -11.908 32.443  19.910  1.00 53.24  ? 276 TRP B CE3 1 
ATOM   4254  C  CZ2 . TRP B 1 276 ? -9.972  34.057  21.204  1.00 50.13  ? 276 TRP B CZ2 1 
ATOM   4255  C  CZ3 . TRP B 1 276 ? -11.330 32.066  21.129  1.00 61.68  ? 276 TRP B CZ3 1 
ATOM   4256  C  CH2 . TRP B 1 276 ? -10.367 32.879  21.757  1.00 50.43  ? 276 TRP B CH2 1 
ATOM   4257  N  N   . PHE B 1 277 ? -12.252 30.892  16.269  1.00 49.08  ? 277 PHE B N   1 
ATOM   4258  C  CA  . PHE B 1 277 ? -11.763 29.588  16.709  1.00 58.75  ? 277 PHE B CA  1 
ATOM   4259  C  C   . PHE B 1 277 ? -10.800 28.962  15.684  1.00 67.11  ? 277 PHE B C   1 
ATOM   4260  O  O   . PHE B 1 277 ? -9.879  28.220  16.035  1.00 65.41  ? 277 PHE B O   1 
ATOM   4261  C  CB  . PHE B 1 277 ? -12.944 28.650  16.975  1.00 57.42  ? 277 PHE B CB  1 
ATOM   4262  C  CG  . PHE B 1 277 ? -12.542 27.330  17.558  1.00 60.44  ? 277 PHE B CG  1 
ATOM   4263  C  CD1 . PHE B 1 277 ? -12.567 27.123  18.939  1.00 56.96  ? 277 PHE B CD1 1 
ATOM   4264  C  CD2 . PHE B 1 277 ? -12.136 26.286  16.729  1.00 63.75  ? 277 PHE B CD2 1 
ATOM   4265  C  CE1 . PHE B 1 277 ? -12.191 25.887  19.479  1.00 58.96  ? 277 PHE B CE1 1 
ATOM   4266  C  CE2 . PHE B 1 277 ? -11.751 25.040  17.256  1.00 58.28  ? 277 PHE B CE2 1 
ATOM   4267  C  CZ  . PHE B 1 277 ? -11.780 24.836  18.628  1.00 51.87  ? 277 PHE B CZ  1 
ATOM   4268  N  N   . LEU B 1 278 ? -11.009 29.281  14.411  1.00 71.73  ? 278 LEU B N   1 
ATOM   4269  C  CA  . LEU B 1 278 ? -10.199 28.706  13.330  1.00 74.15  ? 278 LEU B CA  1 
ATOM   4270  C  C   . LEU B 1 278 ? -8.797  29.324  13.242  1.00 73.15  ? 278 LEU B C   1 
ATOM   4271  O  O   . LEU B 1 278 ? -7.844  28.636  12.860  1.00 83.42  ? 278 LEU B O   1 
ATOM   4272  C  CB  . LEU B 1 278 ? -10.923 28.814  11.980  1.00 69.44  ? 278 LEU B CB  1 
ATOM   4273  C  CG  . LEU B 1 278 ? -12.217 27.983  11.934  1.00 71.77  ? 278 LEU B CG  1 
ATOM   4274  C  CD1 . LEU B 1 278 ? -13.202 28.505  10.894  1.00 74.78  ? 278 LEU B CD1 1 
ATOM   4275  C  CD2 . LEU B 1 278 ? -11.916 26.499  11.714  1.00 52.45  ? 278 LEU B CD2 1 
ATOM   4276  N  N   . LYS B 1 279 ? -8.683  30.603  13.595  1.00 58.86  ? 279 LYS B N   1 
ATOM   4277  C  CA  . LYS B 1 279 ? -7.397  31.299  13.602  1.00 64.45  ? 279 LYS B CA  1 
ATOM   4278  C  C   . LYS B 1 279 ? -6.331  30.466  14.330  1.00 67.72  ? 279 LYS B C   1 
ATOM   4279  O  O   . LYS B 1 279 ? -6.465  30.186  15.524  1.00 60.04  ? 279 LYS B O   1 
ATOM   4280  C  CB  . LYS B 1 279 ? -7.550  32.649  14.315  1.00 59.79  ? 279 LYS B CB  1 
ATOM   4281  C  CG  . LYS B 1 279 ? -7.096  33.866  13.534  1.00 68.32  ? 279 LYS B CG  1 
ATOM   4282  C  CD  . LYS B 1 279 ? -5.580  34.036  13.567  1.00 76.58  ? 279 LYS B CD  1 
ATOM   4283  C  CE  . LYS B 1 279 ? -5.164  35.509  13.377  1.00 83.63  ? 279 LYS B CE  1 
ATOM   4284  N  NZ  . LYS B 1 279 ? -5.052  36.284  14.664  1.00 83.38  ? 279 LYS B NZ  1 
ATOM   4285  N  N   . ASN B 1 280 ? -5.277  30.070  13.621  1.00 64.60  ? 280 ASN B N   1 
ATOM   4286  C  CA  . ASN B 1 280 ? -4.151  29.407  14.266  1.00 62.28  ? 280 ASN B CA  1 
ATOM   4287  C  C   . ASN B 1 280 ? -4.453  28.030  14.849  1.00 62.65  ? 280 ASN B C   1 
ATOM   4288  O  O   . ASN B 1 280 ? -3.749  27.581  15.753  1.00 73.68  ? 280 ASN B O   1 
ATOM   4289  C  CB  . ASN B 1 280 ? -3.601  30.290  15.400  1.00 68.09  ? 280 ASN B CB  1 
ATOM   4290  C  CG  . ASN B 1 280 ? -2.892  31.526  14.889  1.00 75.58  ? 280 ASN B CG  1 
ATOM   4291  O  OD1 . ASN B 1 280 ? -2.954  31.837  13.696  1.00 72.16  ? 280 ASN B OD1 1 
ATOM   4292  N  ND2 . ASN B 1 280 ? -2.217  32.242  15.789  1.00 79.55  ? 280 ASN B ND2 1 
ATOM   4293  N  N   . LEU B 1 281 ? -5.499  27.384  14.347  1.00 62.09  ? 281 LEU B N   1 
ATOM   4294  C  CA  . LEU B 1 281 ? -5.918  26.088  14.863  1.00 56.55  ? 281 LEU B CA  1 
ATOM   4295  C  C   . LEU B 1 281 ? -4.877  25.009  14.593  1.00 63.30  ? 281 LEU B C   1 
ATOM   4296  O  O   . LEU B 1 281 ? -4.692  24.584  13.454  1.00 62.89  ? 281 LEU B O   1 
ATOM   4297  C  CB  . LEU B 1 281 ? -7.263  25.680  14.259  1.00 56.69  ? 281 LEU B CB  1 
ATOM   4298  C  CG  . LEU B 1 281 ? -8.030  24.578  14.994  1.00 47.06  ? 281 LEU B CG  1 
ATOM   4299  C  CD1 . LEU B 1 281 ? -7.825  24.688  16.495  1.00 45.96  ? 281 LEU B CD1 1 
ATOM   4300  C  CD2 . LEU B 1 281 ? -9.508  24.630  14.646  1.00 51.41  ? 281 LEU B CD2 1 
ATOM   4301  N  N   . PRO B 1 282 ? -4.198  24.569  15.646  1.00 67.98  ? 282 PRO B N   1 
ATOM   4302  C  CA  . PRO B 1 282 ? -3.175  23.527  15.516  1.00 68.86  ? 282 PRO B CA  1 
ATOM   4303  C  C   . PRO B 1 282 ? -3.700  22.475  14.544  1.00 87.57  ? 282 PRO B C   1 
ATOM   4304  O  O   . PRO B 1 282 ? -4.873  22.108  14.608  1.00 79.06  ? 282 PRO B O   1 
ATOM   4305  C  CB  . PRO B 1 282 ? -2.996  23.039  16.953  1.00 68.72  ? 282 PRO B CB  1 
ATOM   4306  C  CG  . PRO B 1 282 ? -3.335  24.219  17.787  1.00 75.29  ? 282 PRO B CG  1 
ATOM   4307  C  CD  . PRO B 1 282 ? -4.428  24.944  17.052  1.00 74.56  ? 282 PRO B CD  1 
ATOM   4308  N  N   . ALA B 1 283 ? -2.835  22.000  13.655  1.00 96.51  ? 283 ALA B N   1 
ATOM   4309  C  CA  . ALA B 1 283 ? -3.187  20.921  12.741  1.00 98.76  ? 283 ALA B CA  1 
ATOM   4310  C  C   . ALA B 1 283 ? -3.939  19.810  13.464  1.00 108.57 ? 283 ALA B C   1 
ATOM   4311  O  O   . ALA B 1 283 ? -4.630  19.006  12.840  1.00 105.36 ? 283 ALA B O   1 
ATOM   4312  C  CB  . ALA B 1 283 ? -1.941  20.369  12.067  1.00 100.84 ? 283 ALA B CB  1 
ATOM   4313  N  N   . ASP B 1 284 ? -3.800  19.771  14.785  1.00 114.01 ? 284 ASP B N   1 
ATOM   4314  C  CA  . ASP B 1 284 ? -4.464  18.758  15.596  1.00 109.57 ? 284 ASP B CA  1 
ATOM   4315  C  C   . ASP B 1 284 ? -5.911  18.837  16.069  1.00 109.26 ? 284 ASP B C   1 
ATOM   4316  O  O   . ASP B 1 284 ? -6.762  18.066  15.627  1.00 118.44 ? 284 ASP B O   1 
ATOM   4317  C  CB  . ASP B 1 284 ? -3.736  18.571  16.928  1.00 108.29 ? 284 ASP B CB  1 
ATOM   4318  C  CG  . ASP B 1 284 ? -2.299  19.051  16.880  1.00 114.31 ? 284 ASP B CG  1 
ATOM   4319  O  OD1 . ASP B 1 284 ? -1.780  19.275  15.766  1.00 117.58 ? 284 ASP B OD1 1 
ATOM   4320  O  OD2 . ASP B 1 284 ? -1.687  19.202  17.957  1.00 115.04 ? 284 ASP B OD2 1 
ATOM   4321  N  N   . LEU B 1 285 ? -6.182  19.773  16.972  1.00 98.82  ? 285 LEU B N   1 
ATOM   4322  C  CA  . LEU B 1 285 ? -7.540  20.156  17.342  1.00 88.77  ? 285 LEU B CA  1 
ATOM   4323  C  C   . LEU B 1 285 ? -8.351  20.567  16.117  1.00 73.81  ? 285 LEU B C   1 
ATOM   4324  O  O   . LEU B 1 285 ? -9.328  19.910  15.760  1.00 61.63  ? 285 LEU B O   1 
ATOM   4325  C  CB  . LEU B 1 285 ? -7.512  21.294  18.363  1.00 90.85  ? 285 LEU B CB  1 
ATOM   4326  C  CG  . LEU B 1 285 ? -6.238  21.407  19.204  1.00 86.77  ? 285 LEU B CG  1 
ATOM   4327  C  CD1 . LEU B 1 285 ? -6.164  22.760  19.892  1.00 95.85  ? 285 LEU B CD1 1 
ATOM   4328  C  CD2 . LEU B 1 285 ? -6.165  20.278  20.220  1.00 79.17  ? 285 LEU B CD2 1 
ATOM   4329  N  N   . GLN B 1 300 ? 1.510   2.376   23.260  1.00 138.27 ? 300 GLN B N   1 
ATOM   4330  C  CA  . GLN B 1 300 ? 0.288   3.168   23.337  1.00 135.00 ? 300 GLN B CA  1 
ATOM   4331  C  C   . GLN B 1 300 ? -0.898  2.315   23.777  1.00 133.82 ? 300 GLN B C   1 
ATOM   4332  O  O   . GLN B 1 300 ? -1.946  2.841   24.153  1.00 131.20 ? 300 GLN B O   1 
ATOM   4333  C  CB  . GLN B 1 300 ? 0.000   3.832   21.998  1.00 131.58 ? 300 GLN B CB  1 
ATOM   4334  N  N   . PRO B 1 301 ? -0.725  0.999   23.728  1.00 132.23 ? 301 PRO B N   1 
ATOM   4335  C  CA  . PRO B 1 301 ? -1.785  0.070   24.130  1.00 122.95 ? 301 PRO B CA  1 
ATOM   4336  C  C   . PRO B 1 301 ? -2.059  0.143   25.628  1.00 113.76 ? 301 PRO B C   1 
ATOM   4337  O  O   . PRO B 1 301 ? -1.123  0.250   26.421  1.00 111.58 ? 301 PRO B O   1 
ATOM   4338  C  CB  . PRO B 1 301 ? -1.201  -1.297  23.770  1.00 121.80 ? 301 PRO B CB  1 
ATOM   4339  C  CG  . PRO B 1 301 ? 0.270   -1.107  23.857  1.00 126.13 ? 301 PRO B CG  1 
ATOM   4340  C  CD  . PRO B 1 301 ? 0.530   0.300   23.401  1.00 132.58 ? 301 PRO B CD  1 
ATOM   4341  N  N   . GLY B 1 302 ? -3.332  0.087   26.006  1.00 101.89 ? 302 GLY B N   1 
ATOM   4342  C  CA  . GLY B 1 302 ? -3.713  0.164   27.404  1.00 90.15  ? 302 GLY B CA  1 
ATOM   4343  C  C   . GLY B 1 302 ? -4.184  -1.162  27.965  1.00 71.34  ? 302 GLY B C   1 
ATOM   4344  O  O   . GLY B 1 302 ? -4.002  -2.211  27.347  1.00 71.23  ? 302 GLY B O   1 
ATOM   4345  N  N   . GLN B 1 303 ? -4.793  -1.112  29.144  1.00 57.75  ? 303 GLN B N   1 
ATOM   4346  C  CA  . GLN B 1 303 ? -5.300  -2.311  29.800  1.00 52.73  ? 303 GLN B CA  1 
ATOM   4347  C  C   . GLN B 1 303 ? -6.586  -2.793  29.138  1.00 40.51  ? 303 GLN B C   1 
ATOM   4348  O  O   . GLN B 1 303 ? -7.418  -1.989  28.719  1.00 44.12  ? 303 GLN B O   1 
ATOM   4349  C  CB  . GLN B 1 303 ? -5.543  -2.045  31.287  1.00 41.88  ? 303 GLN B CB  1 
ATOM   4350  C  CG  . GLN B 1 303 ? -4.623  -2.821  32.214  1.00 44.68  ? 303 GLN B CG  1 
ATOM   4351  C  CD  . GLN B 1 303 ? -5.160  -2.908  33.628  1.00 47.64  ? 303 GLN B CD  1 
ATOM   4352  O  OE1 . GLN B 1 303 ? -4.935  -3.893  34.331  1.00 55.91  ? 303 GLN B OE1 1 
ATOM   4353  N  NE2 . GLN B 1 303 ? -5.875  -1.874  34.053  1.00 43.23  ? 303 GLN B NE2 1 
ATOM   4354  N  N   . SER B 1 304 ? -6.727  -4.110  29.029  1.00 35.96  ? 304 SER B N   1 
ATOM   4355  C  CA  . SER B 1 304 ? -7.878  -4.708  28.366  1.00 43.60  ? 304 SER B CA  1 
ATOM   4356  C  C   . SER B 1 304 ? -9.055  -4.862  29.318  1.00 43.21  ? 304 SER B C   1 
ATOM   4357  O  O   . SER B 1 304 ? -8.886  -5.256  30.472  1.00 41.33  ? 304 SER B O   1 
ATOM   4358  C  CB  . SER B 1 304 ? -7.506  -6.067  27.771  1.00 52.43  ? 304 SER B CB  1 
ATOM   4359  O  OG  . SER B 1 304 ? -6.922  -6.908  28.749  1.00 56.37  ? 304 SER B OG  1 
ATOM   4360  N  N   . ILE B 1 305 ? -10.249 -4.551  28.827  1.00 41.29  ? 305 ILE B N   1 
ATOM   4361  C  CA  . ILE B 1 305 ? -11.459 -4.670  29.629  1.00 41.47  ? 305 ILE B CA  1 
ATOM   4362  C  C   . ILE B 1 305 ? -11.527 -6.035  30.300  1.00 41.49  ? 305 ILE B C   1 
ATOM   4363  O  O   . ILE B 1 305 ? -12.147 -6.191  31.352  1.00 72.12  ? 305 ILE B O   1 
ATOM   4364  C  CB  . ILE B 1 305 ? -12.722 -4.457  28.775  1.00 37.15  ? 305 ILE B CB  1 
ATOM   4365  C  CG1 . ILE B 1 305 ? -13.973 -4.830  29.572  1.00 53.84  ? 305 ILE B CG1 1 
ATOM   4366  C  CG2 . ILE B 1 305 ? -12.640 -5.271  27.494  1.00 37.26  ? 305 ILE B CG2 1 
ATOM   4367  C  CD1 . ILE B 1 305 ? -15.255 -4.719  28.778  1.00 68.15  ? 305 ILE B CD1 1 
ATOM   4368  N  N   . GLU B 1 306 ? -10.883 -7.022  29.687  1.00 25.69  ? 306 GLU B N   1 
ATOM   4369  C  CA  . GLU B 1 306 ? -10.856 -8.374  30.231  1.00 51.86  ? 306 GLU B CA  1 
ATOM   4370  C  C   . GLU B 1 306 ? -10.033 -8.428  31.511  1.00 37.58  ? 306 GLU B C   1 
ATOM   4371  O  O   . GLU B 1 306 ? -10.510 -8.884  32.549  1.00 45.69  ? 306 GLU B O   1 
ATOM   4372  C  CB  . GLU B 1 306 ? -10.293 -9.356  29.201  1.00 56.81  ? 306 GLU B CB  1 
ATOM   4373  C  CG  . GLU B 1 306 ? -11.089 -9.425  27.909  1.00 71.14  ? 306 GLU B CG  1 
ATOM   4374  C  CD  . GLU B 1 306 ? -10.415 -8.688  26.769  1.00 82.07  ? 306 GLU B CD  1 
ATOM   4375  O  OE1 . GLU B 1 306 ? -9.578  -7.803  27.044  1.00 87.21  ? 306 GLU B OE1 1 
ATOM   4376  O  OE2 . GLU B 1 306 ? -10.719 -8.995  25.598  1.00 83.99  ? 306 GLU B OE2 1 
ATOM   4377  N  N   . GLU B 1 307 ? -8.793  -7.957  31.431  1.00 25.56  ? 307 GLU B N   1 
ATOM   4378  C  CA  . GLU B 1 307 ? -7.908  -7.934  32.589  1.00 36.63  ? 307 GLU B CA  1 
ATOM   4379  C  C   . GLU B 1 307 ? -8.450  -6.992  33.657  1.00 41.39  ? 307 GLU B C   1 
ATOM   4380  O  O   . GLU B 1 307 ? -8.335  -7.260  34.852  1.00 51.44  ? 307 GLU B O   1 
ATOM   4381  C  CB  . GLU B 1 307 ? -6.498  -7.508  32.178  1.00 46.99  ? 307 GLU B CB  1 
ATOM   4382  C  CG  . GLU B 1 307 ? -5.410  -7.955  33.140  1.00 73.67  ? 307 GLU B CG  1 
ATOM   4383  C  CD  . GLU B 1 307 ? -4.211  -7.028  33.136  1.00 83.74  ? 307 GLU B CD  1 
ATOM   4384  O  OE1 . GLU B 1 307 ? -3.718  -6.687  34.232  1.00 77.45  ? 307 GLU B OE1 1 
ATOM   4385  O  OE2 . GLU B 1 307 ? -3.760  -6.641  32.038  1.00 85.72  ? 307 GLU B OE2 1 
ATOM   4386  N  N   . ILE B 1 308 ? -9.045  -5.889  33.216  1.00 42.02  ? 308 ILE B N   1 
ATOM   4387  C  CA  . ILE B 1 308 ? -9.624  -4.912  34.126  1.00 38.33  ? 308 ILE B CA  1 
ATOM   4388  C  C   . ILE B 1 308 ? -10.816 -5.503  34.868  1.00 50.88  ? 308 ILE B C   1 
ATOM   4389  O  O   . ILE B 1 308 ? -10.961 -5.319  36.076  1.00 47.57  ? 308 ILE B O   1 
ATOM   4390  C  CB  . ILE B 1 308 ? -10.081 -3.647  33.377  1.00 29.16  ? 308 ILE B CB  1 
ATOM   4391  C  CG1 . ILE B 1 308 ? -8.871  -2.832  32.919  1.00 37.50  ? 308 ILE B CG1 1 
ATOM   4392  C  CG2 . ILE B 1 308 ? -10.992 -2.808  34.258  1.00 25.93  ? 308 ILE B CG2 1 
ATOM   4393  C  CD1 . ILE B 1 308 ? -9.196  -1.801  31.862  1.00 40.85  ? 308 ILE B CD1 1 
ATOM   4394  N  N   . MET B 1 309 ? -11.667 -6.215  34.136  1.00 53.78  ? 309 MET B N   1 
ATOM   4395  C  CA  . MET B 1 309 ? -12.849 -6.831  34.723  1.00 38.87  ? 309 MET B CA  1 
ATOM   4396  C  C   . MET B 1 309 ? -12.444 -7.913  35.712  1.00 36.22  ? 309 MET B C   1 
ATOM   4397  O  O   . MET B 1 309 ? -13.041 -8.051  36.779  1.00 45.03  ? 309 MET B O   1 
ATOM   4398  C  CB  . MET B 1 309 ? -13.743 -7.424  33.632  1.00 46.15  ? 309 MET B CB  1 
ATOM   4399  C  CG  . MET B 1 309 ? -15.223 -7.146  33.823  1.00 55.65  ? 309 MET B CG  1 
ATOM   4400  S  SD  . MET B 1 309 ? -15.646 -5.419  33.527  1.00 72.89  ? 309 MET B SD  1 
ATOM   4401  C  CE  . MET B 1 309 ? -16.677 -5.564  32.073  1.00 96.33  ? 309 MET B CE  1 
ATOM   4402  N  N   . GLN B 1 310 ? -11.420 -8.681  35.356  1.00 36.70  ? 310 GLN B N   1 
ATOM   4403  C  CA  . GLN B 1 310 ? -10.933 -9.748  36.221  1.00 43.89  ? 310 GLN B CA  1 
ATOM   4404  C  C   . GLN B 1 310 ? -10.394 -9.192  37.535  1.00 47.32  ? 310 GLN B C   1 
ATOM   4405  O  O   . GLN B 1 310 ? -10.619 -9.763  38.601  1.00 39.94  ? 310 GLN B O   1 
ATOM   4406  C  CB  . GLN B 1 310 ? -9.851  -10.562 35.511  1.00 39.81  ? 310 GLN B CB  1 
ATOM   4407  C  CG  . GLN B 1 310 ? -9.642  -11.952 36.087  1.00 64.76  ? 310 GLN B CG  1 
ATOM   4408  C  CD  . GLN B 1 310 ? -8.693  -11.957 37.268  1.00 80.55  ? 310 GLN B CD  1 
ATOM   4409  O  OE1 . GLN B 1 310 ? -7.698  -11.233 37.282  1.00 88.66  ? 310 GLN B OE1 1 
ATOM   4410  N  NE2 . GLN B 1 310 ? -8.996  -12.777 38.267  1.00 81.43  ? 310 GLN B NE2 1 
ATOM   4411  N  N   . ILE B 1 311 ? -9.681  -8.074  37.451  1.00 39.22  ? 311 ILE B N   1 
ATOM   4412  C  CA  . ILE B 1 311 ? -9.095  -7.447  38.630  1.00 43.32  ? 311 ILE B CA  1 
ATOM   4413  C  C   . ILE B 1 311 ? -10.164 -6.862  39.548  1.00 43.88  ? 311 ILE B C   1 
ATOM   4414  O  O   . ILE B 1 311 ? -10.044 -6.920  40.771  1.00 42.65  ? 311 ILE B O   1 
ATOM   4415  C  CB  . ILE B 1 311 ? -8.101  -6.337  38.243  1.00 48.27  ? 311 ILE B CB  1 
ATOM   4416  C  CG1 . ILE B 1 311 ? -6.783  -6.946  37.764  1.00 36.43  ? 311 ILE B CG1 1 
ATOM   4417  C  CG2 . ILE B 1 311 ? -7.864  -5.402  39.417  1.00 43.58  ? 311 ILE B CG2 1 
ATOM   4418  C  CD1 . ILE B 1 311 ? -5.964  -6.020  36.894  1.00 44.89  ? 311 ILE B CD1 1 
ATOM   4419  N  N   . ILE B 1 312 ? -11.207 -6.296  38.949  1.00 42.75  ? 312 ILE B N   1 
ATOM   4420  C  CA  . ILE B 1 312 ? -12.290 -5.689  39.715  1.00 46.76  ? 312 ILE B CA  1 
ATOM   4421  C  C   . ILE B 1 312 ? -13.091 -6.740  40.476  1.00 43.26  ? 312 ILE B C   1 
ATOM   4422  O  O   . ILE B 1 312 ? -13.519 -6.509  41.606  1.00 51.10  ? 312 ILE B O   1 
ATOM   4423  C  CB  . ILE B 1 312 ? -13.243 -4.889  38.809  1.00 47.05  ? 312 ILE B CB  1 
ATOM   4424  C  CG1 . ILE B 1 312 ? -12.475 -3.803  38.054  1.00 44.42  ? 312 ILE B CG1 1 
ATOM   4425  C  CG2 . ILE B 1 312 ? -14.368 -4.278  39.627  1.00 28.91  ? 312 ILE B CG2 1 
ATOM   4426  C  CD1 . ILE B 1 312 ? -13.360 -2.871  37.258  1.00 52.01  ? 312 ILE B CD1 1 
ATOM   4427  N  N   . ALA B 1 313 ? -13.293 -7.894  39.849  1.00 48.10  ? 313 ALA B N   1 
ATOM   4428  C  CA  . ALA B 1 313 ? -14.047 -8.978  40.466  1.00 46.01  ? 313 ALA B CA  1 
ATOM   4429  C  C   . ALA B 1 313 ? -13.283 -9.584  41.638  1.00 41.45  ? 313 ALA B C   1 
ATOM   4430  O  O   . ALA B 1 313 ? -13.870 -9.924  42.665  1.00 42.38  ? 313 ALA B O   1 
ATOM   4431  C  CB  . ALA B 1 313 ? -14.377 -10.046 39.435  1.00 34.19  ? 313 ALA B CB  1 
ATOM   4432  N  N   . GLU B 1 314 ? -11.971 -9.718  41.477  1.00 32.40  ? 314 GLU B N   1 
ATOM   4433  C  CA  . GLU B 1 314 ? -11.125 -10.289 42.517  1.00 45.10  ? 314 GLU B CA  1 
ATOM   4434  C  C   . GLU B 1 314 ? -11.023 -9.361  43.722  1.00 55.30  ? 314 GLU B C   1 
ATOM   4435  O  O   . GLU B 1 314 ? -10.612 -9.776  44.804  1.00 69.29  ? 314 GLU B O   1 
ATOM   4436  C  CB  . GLU B 1 314 ? -9.730  -10.588 41.964  1.00 50.94  ? 314 GLU B CB  1 
ATOM   4437  C  CG  . GLU B 1 314 ? -8.816  -11.315 42.937  1.00 68.94  ? 314 GLU B CG  1 
ATOM   4438  C  CD  . GLU B 1 314 ? -7.487  -11.694 42.313  1.00 77.31  ? 314 GLU B CD  1 
ATOM   4439  O  OE1 . GLU B 1 314 ? -6.507  -11.879 43.065  1.00 75.12  ? 314 GLU B OE1 1 
ATOM   4440  O  OE2 . GLU B 1 314 ? -7.422  -11.808 41.071  1.00 80.26  ? 314 GLU B OE2 1 
ATOM   4441  N  N   . ALA B 1 315 ? -11.400 -8.102  43.525  1.00 39.86  ? 315 ALA B N   1 
ATOM   4442  C  CA  . ALA B 1 315 ? -11.336 -7.106  44.587  1.00 38.53  ? 315 ALA B CA  1 
ATOM   4443  C  C   . ALA B 1 315 ? -12.622 -7.082  45.404  1.00 50.83  ? 315 ALA B C   1 
ATOM   4444  O  O   . ALA B 1 315 ? -12.625 -6.665  46.561  1.00 48.30  ? 315 ALA B O   1 
ATOM   4445  C  CB  . ALA B 1 315 ? -11.050 -5.731  44.004  1.00 39.88  ? 315 ALA B CB  1 
ATOM   4446  N  N   . THR B 1 316 ? -13.714 -7.531  44.795  1.00 49.11  ? 316 THR B N   1 
ATOM   4447  C  CA  . THR B 1 316 ? -15.008 -7.558  45.465  1.00 48.19  ? 316 THR B CA  1 
ATOM   4448  C  C   . THR B 1 316 ? -14.977 -8.470  46.686  1.00 50.35  ? 316 THR B C   1 
ATOM   4449  O  O   . THR B 1 316 ? -15.962 -8.581  47.415  1.00 46.17  ? 316 THR B O   1 
ATOM   4450  C  CB  . THR B 1 316 ? -16.125 -8.027  44.516  1.00 54.83  ? 316 THR B CB  1 
ATOM   4451  O  OG1 . THR B 1 316 ? -15.968 -9.425  44.243  1.00 47.48  ? 316 THR B OG1 1 
ATOM   4452  C  CG2 . THR B 1 316 ? -16.074 -7.252  43.210  1.00 55.59  ? 316 THR B CG2 1 
ATOM   4453  N  N   . VAL B 1 317 ? -13.839 -9.121  46.904  1.00 44.99  ? 317 VAL B N   1 
ATOM   4454  C  CA  . VAL B 1 317 ? -13.678 -10.023 48.037  1.00 58.19  ? 317 VAL B CA  1 
ATOM   4455  C  C   . VAL B 1 317 ? -12.852 -9.376  49.144  1.00 67.84  ? 317 VAL B C   1 
ATOM   4456  O  O   . VAL B 1 317 ? -11.626 -9.480  49.159  1.00 61.10  ? 317 VAL B O   1 
ATOM   4457  C  CB  . VAL B 1 317 ? -13.008 -11.344 47.616  1.00 60.36  ? 317 VAL B CB  1 
ATOM   4458  C  CG1 . VAL B 1 317 ? -12.798 -12.240 48.825  1.00 57.34  ? 317 VAL B CG1 1 
ATOM   4459  C  CG2 . VAL B 1 317 ? -13.844 -12.048 46.560  1.00 55.48  ? 317 VAL B CG2 1 
ATOM   4460  N  N   . LEU C 1 12  ? -63.443 -48.558 23.632  1.00 103.49 ? 12  LEU C N   1 
ATOM   4461  C  CA  . LEU C 1 12  ? -64.565 -48.499 24.562  1.00 100.07 ? 12  LEU C CA  1 
ATOM   4462  C  C   . LEU C 1 12  ? -65.625 -49.537 24.211  1.00 94.46  ? 12  LEU C C   1 
ATOM   4463  O  O   . LEU C 1 12  ? -65.981 -49.704 23.045  1.00 103.50 ? 12  LEU C O   1 
ATOM   4464  C  CB  . LEU C 1 12  ? -65.183 -47.100 24.567  1.00 95.78  ? 12  LEU C CB  1 
ATOM   4465  C  CG  . LEU C 1 12  ? -64.801 -46.196 25.740  1.00 88.18  ? 12  LEU C CG  1 
ATOM   4466  C  CD1 . LEU C 1 12  ? -66.044 -45.690 26.455  1.00 83.77  ? 12  LEU C CD1 1 
ATOM   4467  C  CD2 . LEU C 1 12  ? -63.883 -46.928 26.705  1.00 83.23  ? 12  LEU C CD2 1 
ATOM   4468  N  N   . PRO C 1 13  ? -66.125 -50.232 25.227  1.00 77.84  ? 13  PRO C N   1 
ATOM   4469  C  CA  . PRO C 1 13  ? -67.152 -51.259 25.025  1.00 72.60  ? 13  PRO C CA  1 
ATOM   4470  C  C   . PRO C 1 13  ? -68.325 -50.726 24.210  1.00 76.79  ? 13  PRO C C   1 
ATOM   4471  O  O   . PRO C 1 13  ? -68.215 -49.669 23.589  1.00 87.09  ? 13  PRO C O   1 
ATOM   4472  C  CB  . PRO C 1 13  ? -67.607 -51.579 26.450  1.00 62.18  ? 13  PRO C CB  1 
ATOM   4473  C  CG  . PRO C 1 13  ? -66.433 -51.250 27.299  1.00 68.03  ? 13  PRO C CG  1 
ATOM   4474  C  CD  . PRO C 1 13  ? -65.779 -50.067 26.649  1.00 72.35  ? 13  PRO C CD  1 
ATOM   4475  N  N   . ILE C 1 14  ? -69.434 -51.457 24.216  1.00 74.32  ? 14  ILE C N   1 
ATOM   4476  C  CA  . ILE C 1 14  ? -70.625 -51.043 23.484  1.00 77.10  ? 14  ILE C CA  1 
ATOM   4477  C  C   . ILE C 1 14  ? -71.785 -50.783 24.439  1.00 77.20  ? 14  ILE C C   1 
ATOM   4478  O  O   . ILE C 1 14  ? -71.993 -51.528 25.395  1.00 83.14  ? 14  ILE C O   1 
ATOM   4479  C  CB  . ILE C 1 14  ? -71.043 -52.096 22.443  1.00 86.35  ? 14  ILE C CB  1 
ATOM   4480  C  CG1 . ILE C 1 14  ? -72.382 -52.727 22.827  1.00 90.93  ? 14  ILE C CG1 1 
ATOM   4481  C  CG2 . ILE C 1 14  ? -69.968 -53.161 22.302  1.00 78.67  ? 14  ILE C CG2 1 
ATOM   4482  C  CD1 . ILE C 1 14  ? -72.814 -53.847 21.907  1.00 84.87  ? 14  ILE C CD1 1 
ATOM   4483  N  N   . MET C 1 15  ? -72.534 -49.719 24.174  1.00 79.81  ? 15  MET C N   1 
ATOM   4484  C  CA  . MET C 1 15  ? -73.660 -49.340 25.019  1.00 87.88  ? 15  MET C CA  1 
ATOM   4485  C  C   . MET C 1 15  ? -74.279 -50.543 25.725  1.00 88.86  ? 15  MET C C   1 
ATOM   4486  O  O   . MET C 1 15  ? -74.281 -51.654 25.196  1.00 97.34  ? 15  MET C O   1 
ATOM   4487  C  CB  . MET C 1 15  ? -74.723 -48.608 24.199  1.00 77.96  ? 15  MET C CB  1 
ATOM   4488  C  CG  . MET C 1 15  ? -75.292 -47.375 24.880  1.00 83.01  ? 15  MET C CG  1 
ATOM   4489  S  SD  . MET C 1 15  ? -74.555 -47.067 26.495  1.00 64.83  ? 15  MET C SD  1 
ATOM   4490  C  CE  . MET C 1 15  ? -75.978 -46.481 27.410  1.00 59.77  ? 15  MET C CE  1 
ATOM   4491  N  N   . HIS C 1 16  ? -74.805 -50.307 26.922  1.00 77.06  ? 16  HIS C N   1 
ATOM   4492  C  CA  . HIS C 1 16  ? -75.455 -51.350 27.705  1.00 72.15  ? 16  HIS C CA  1 
ATOM   4493  C  C   . HIS C 1 16  ? -76.552 -50.738 28.569  1.00 76.10  ? 16  HIS C C   1 
ATOM   4494  O  O   . HIS C 1 16  ? -76.634 -49.517 28.699  1.00 76.87  ? 16  HIS C O   1 
ATOM   4495  C  CB  . HIS C 1 16  ? -74.435 -52.075 28.584  1.00 63.17  ? 16  HIS C CB  1 
ATOM   4496  C  CG  . HIS C 1 16  ? -73.506 -51.155 29.312  1.00 56.99  ? 16  HIS C CG  1 
ATOM   4497  N  ND1 . HIS C 1 16  ? -72.437 -50.538 28.699  1.00 62.50  ? 16  HIS C ND1 1 
ATOM   4498  C  CD2 . HIS C 1 16  ? -73.485 -50.748 30.603  1.00 47.21  ? 16  HIS C CD2 1 
ATOM   4499  C  CE1 . HIS C 1 16  ? -71.798 -49.790 29.581  1.00 66.08  ? 16  HIS C CE1 1 
ATOM   4500  N  NE2 . HIS C 1 16  ? -72.414 -49.900 30.744  1.00 65.24  ? 16  HIS C NE2 1 
ATOM   4501  N  N   . ASP C 1 17  ? -77.395 -51.581 29.156  1.00 85.96  ? 17  ASP C N   1 
ATOM   4502  C  CA  . ASP C 1 17  ? -78.490 -51.085 29.978  1.00 86.06  ? 17  ASP C CA  1 
ATOM   4503  C  C   . ASP C 1 17  ? -79.132 -49.823 29.411  1.00 78.53  ? 17  ASP C C   1 
ATOM   4504  O  O   . ASP C 1 17  ? -79.378 -48.868 30.146  1.00 70.88  ? 17  ASP C O   1 
ATOM   4505  C  CB  . ASP C 1 17  ? -78.006 -50.826 31.407  1.00 79.81  ? 17  ASP C CB  1 
ATOM   4506  C  CG  . ASP C 1 17  ? -77.078 -51.912 31.913  1.00 76.98  ? 17  ASP C CG  1 
ATOM   4507  O  OD1 . ASP C 1 17  ? -75.907 -51.945 31.480  1.00 66.65  ? 17  ASP C OD1 1 
ATOM   4508  O  OD2 . ASP C 1 17  ? -77.519 -52.733 32.743  1.00 74.52  ? 17  ASP C OD2 1 
ATOM   4509  N  N   . SER C 1 18  ? -79.392 -49.829 28.108  1.00 84.09  ? 18  SER C N   1 
ATOM   4510  C  CA  . SER C 1 18  ? -79.984 -48.679 27.434  1.00 85.86  ? 18  SER C CA  1 
ATOM   4511  C  C   . SER C 1 18  ? -81.378 -48.379 27.970  1.00 88.54  ? 18  SER C C   1 
ATOM   4512  O  O   . SER C 1 18  ? -81.897 -47.276 27.792  1.00 93.04  ? 18  SER C O   1 
ATOM   4513  C  CB  . SER C 1 18  ? -80.042 -48.915 25.924  1.00 84.51  ? 18  SER C CB  1 
ATOM   4514  O  OG  . SER C 1 18  ? -79.045 -49.833 25.512  1.00 89.11  ? 18  SER C OG  1 
ATOM   4515  N  N   . ASP C 1 19  ? -81.982 -49.365 28.622  1.00 83.32  ? 19  ASP C N   1 
ATOM   4516  C  CA  . ASP C 1 19  ? -83.312 -49.199 29.193  1.00 91.07  ? 19  ASP C CA  1 
ATOM   4517  C  C   . ASP C 1 19  ? -83.252 -48.378 30.475  1.00 89.65  ? 19  ASP C C   1 
ATOM   4518  O  O   . ASP C 1 19  ? -84.283 -48.005 31.034  1.00 88.44  ? 19  ASP C O   1 
ATOM   4519  C  CB  . ASP C 1 19  ? -83.948 -50.562 29.472  1.00 94.22  ? 19  ASP C CB  1 
ATOM   4520  C  CG  . ASP C 1 19  ? -83.035 -51.480 30.261  1.00 105.10 ? 19  ASP C CG  1 
ATOM   4521  O  OD1 . ASP C 1 19  ? -81.977 -51.872 29.726  1.00 104.95 ? 19  ASP C OD1 1 
ATOM   4522  O  OD2 . ASP C 1 19  ? -83.376 -51.808 31.417  1.00 108.69 ? 19  ASP C OD2 1 
ATOM   4523  N  N   . ARG C 1 20  ? -82.037 -48.099 30.936  1.00 79.84  ? 20  ARG C N   1 
ATOM   4524  C  CA  . ARG C 1 20  ? -81.842 -47.345 32.168  1.00 75.96  ? 20  ARG C CA  1 
ATOM   4525  C  C   . ARG C 1 20  ? -80.939 -46.135 31.954  1.00 71.19  ? 20  ARG C C   1 
ATOM   4526  O  O   . ARG C 1 20  ? -81.102 -45.106 32.609  1.00 73.26  ? 20  ARG C O   1 
ATOM   4527  C  CB  . ARG C 1 20  ? -81.255 -48.247 33.256  1.00 70.98  ? 20  ARG C CB  1 
ATOM   4528  C  CG  . ARG C 1 20  ? -82.089 -48.314 34.523  1.00 80.51  ? 20  ARG C CG  1 
ATOM   4529  C  CD  . ARG C 1 20  ? -81.993 -49.684 35.175  1.00 76.24  ? 20  ARG C CD  1 
ATOM   4530  N  NE  . ARG C 1 20  ? -80.609 -50.115 35.344  1.00 81.33  ? 20  ARG C NE  1 
ATOM   4531  C  CZ  . ARG C 1 20  ? -79.748 -49.552 36.187  1.00 81.73  ? 20  ARG C CZ  1 
ATOM   4532  N  NH1 . ARG C 1 20  ? -78.507 -50.010 36.274  1.00 75.38  ? 20  ARG C NH1 1 
ATOM   4533  N  NH2 . ARG C 1 20  ? -80.127 -48.532 36.943  1.00 73.65  ? 20  ARG C NH2 1 
ATOM   4534  N  N   . TYR C 1 21  ? -79.986 -46.264 31.037  1.00 60.81  ? 21  TYR C N   1 
ATOM   4535  C  CA  . TYR C 1 21  ? -79.034 -45.192 30.773  1.00 55.24  ? 21  TYR C CA  1 
ATOM   4536  C  C   . TYR C 1 21  ? -79.006 -44.798 29.301  1.00 58.73  ? 21  TYR C C   1 
ATOM   4537  O  O   . TYR C 1 21  ? -78.921 -45.656 28.423  1.00 58.71  ? 21  TYR C O   1 
ATOM   4538  C  CB  . TYR C 1 21  ? -77.628 -45.611 31.209  1.00 33.61  ? 21  TYR C CB  1 
ATOM   4539  C  CG  . TYR C 1 21  ? -77.467 -45.806 32.699  1.00 40.95  ? 21  TYR C CG  1 
ATOM   4540  C  CD1 . TYR C 1 21  ? -77.466 -44.721 33.565  1.00 47.80  ? 21  TYR C CD1 1 
ATOM   4541  C  CD2 . TYR C 1 21  ? -77.308 -47.074 33.239  1.00 50.28  ? 21  TYR C CD2 1 
ATOM   4542  C  CE1 . TYR C 1 21  ? -77.316 -44.895 34.927  1.00 59.20  ? 21  TYR C CE1 1 
ATOM   4543  C  CE2 . TYR C 1 21  ? -77.157 -47.258 34.599  1.00 45.27  ? 21  TYR C CE2 1 
ATOM   4544  C  CZ  . TYR C 1 21  ? -77.161 -46.166 35.438  1.00 52.27  ? 21  TYR C CZ  1 
ATOM   4545  O  OH  . TYR C 1 21  ? -77.011 -46.344 36.793  1.00 67.55  ? 21  TYR C OH  1 
ATOM   4546  N  N   . GLU C 1 22  ? -79.066 -43.497 29.037  1.00 40.95  ? 22  GLU C N   1 
ATOM   4547  C  CA  . GLU C 1 22  ? -78.911 -42.994 27.687  1.00 49.11  ? 22  GLU C CA  1 
ATOM   4548  C  C   . GLU C 1 22  ? -77.441 -42.626 27.525  1.00 50.33  ? 22  GLU C C   1 
ATOM   4549  O  O   . GLU C 1 22  ? -76.884 -41.922 28.377  1.00 63.83  ? 22  GLU C O   1 
ATOM   4550  C  CB  . GLU C 1 22  ? -79.812 -41.771 27.449  1.00 68.36  ? 22  GLU C CB  1 
ATOM   4551  C  CG  . GLU C 1 22  ? -79.664 -41.146 26.053  1.00 83.44  ? 22  GLU C CG  1 
ATOM   4552  C  CD  . GLU C 1 22  ? -80.469 -39.845 25.843  1.00 90.02  ? 22  GLU C CD  1 
ATOM   4553  O  OE1 . GLU C 1 22  ? -80.837 -39.582 24.667  1.00 92.96  ? 22  GLU C OE1 1 
ATOM   4554  O  OE2 . GLU C 1 22  ? -80.715 -39.088 26.826  1.00 82.67  ? 22  GLU C OE2 1 
ATOM   4555  N  N   . LEU C 1 23  ? -76.792 -43.110 26.466  1.00 42.12  ? 23  LEU C N   1 
ATOM   4556  C  CA  . LEU C 1 23  ? -75.424 -42.666 26.176  1.00 45.80  ? 23  LEU C CA  1 
ATOM   4557  C  C   . LEU C 1 23  ? -75.389 -41.176 25.770  1.00 56.22  ? 23  LEU C C   1 
ATOM   4558  O  O   . LEU C 1 23  ? -76.115 -40.768 24.877  1.00 43.42  ? 23  LEU C O   1 
ATOM   4559  C  CB  . LEU C 1 23  ? -74.800 -43.505 25.079  1.00 37.05  ? 23  LEU C CB  1 
ATOM   4560  C  CG  . LEU C 1 23  ? -73.505 -42.968 24.444  1.00 47.13  ? 23  LEU C CG  1 
ATOM   4561  C  CD1 . LEU C 1 23  ? -72.432 -42.702 25.448  1.00 40.89  ? 23  LEU C CD1 1 
ATOM   4562  C  CD2 . LEU C 1 23  ? -72.972 -43.942 23.410  1.00 43.42  ? 23  LEU C CD2 1 
ATOM   4563  N  N   . VAL C 1 24  ? -74.554 -40.378 26.443  1.00 52.98  ? 24  VAL C N   1 
ATOM   4564  C  CA  . VAL C 1 24  ? -74.468 -38.950 26.175  1.00 44.67  ? 24  VAL C CA  1 
ATOM   4565  C  C   . VAL C 1 24  ? -73.262 -38.638 25.301  1.00 40.12  ? 24  VAL C C   1 
ATOM   4566  O  O   . VAL C 1 24  ? -73.410 -38.089 24.216  1.00 38.75  ? 24  VAL C O   1 
ATOM   4567  C  CB  . VAL C 1 24  ? -74.423 -38.125 27.474  1.00 46.50  ? 24  VAL C CB  1 
ATOM   4568  C  CG1 . VAL C 1 24  ? -74.058 -36.700 27.165  1.00 42.42  ? 24  VAL C CG1 1 
ATOM   4569  C  CG2 . VAL C 1 24  ? -75.766 -38.160 28.174  1.00 47.20  ? 24  VAL C CG2 1 
ATOM   4570  N  N   . LYS C 1 25  ? -72.070 -39.026 25.737  1.00 26.66  ? 25  LYS C N   1 
ATOM   4571  C  CA  . LYS C 1 25  ? -70.887 -38.813 24.910  1.00 41.85  ? 25  LYS C CA  1 
ATOM   4572  C  C   . LYS C 1 25  ? -69.660 -39.529 25.454  1.00 44.64  ? 25  LYS C C   1 
ATOM   4573  O  O   . LYS C 1 25  ? -69.417 -39.526 26.660  1.00 55.42  ? 25  LYS C O   1 
ATOM   4574  C  CB  . LYS C 1 25  ? -70.594 -37.317 24.774  1.00 43.99  ? 25  LYS C CB  1 
ATOM   4575  C  CG  . LYS C 1 25  ? -69.996 -36.922 23.434  1.00 62.19  ? 25  LYS C CG  1 
ATOM   4576  C  CD  . LYS C 1 25  ? -68.683 -36.182 23.612  1.00 64.24  ? 25  LYS C CD  1 
ATOM   4577  C  CE  . LYS C 1 25  ? -68.061 -35.833 22.270  1.00 71.89  ? 25  LYS C CE  1 
ATOM   4578  N  NZ  . LYS C 1 25  ? -68.920 -36.262 21.131  1.00 74.74  ? 25  LYS C NZ  1 
ATOM   4579  N  N   . ASP C 1 26  ? -68.881 -40.139 24.565  1.00 51.49  ? 26  ASP C N   1 
ATOM   4580  C  CA  . ASP C 1 26  ? -67.640 -40.765 24.995  1.00 66.72  ? 26  ASP C CA  1 
ATOM   4581  C  C   . ASP C 1 26  ? -66.529 -39.729 25.135  1.00 71.53  ? 26  ASP C C   1 
ATOM   4582  O  O   . ASP C 1 26  ? -65.984 -39.262 24.133  1.00 74.70  ? 26  ASP C O   1 
ATOM   4583  C  CB  . ASP C 1 26  ? -67.224 -41.865 24.019  1.00 76.38  ? 26  ASP C CB  1 
ATOM   4584  C  CG  . ASP C 1 26  ? -68.102 -43.100 24.129  1.00 81.38  ? 26  ASP C CG  1 
ATOM   4585  O  OD1 . ASP C 1 26  ? -68.201 -43.871 23.139  1.00 82.98  ? 26  ASP C OD1 1 
ATOM   4586  O  OD2 . ASP C 1 26  ? -68.690 -43.290 25.218  1.00 80.04  ? 26  ASP C OD2 1 
ATOM   4587  N  N   . ILE C 1 27  ? -66.184 -39.395 26.374  1.00 80.52  ? 27  ILE C N   1 
ATOM   4588  C  CA  . ILE C 1 27  ? -65.080 -38.483 26.644  1.00 87.01  ? 27  ILE C CA  1 
ATOM   4589  C  C   . ILE C 1 27  ? -63.841 -39.271 27.057  1.00 90.10  ? 27  ILE C C   1 
ATOM   4590  O  O   . ILE C 1 27  ? -63.812 -40.496 26.946  1.00 84.93  ? 27  ILE C O   1 
ATOM   4591  C  CB  . ILE C 1 27  ? -65.436 -37.475 27.751  1.00 81.19  ? 27  ILE C CB  1 
ATOM   4592  C  CG1 . ILE C 1 27  ? -64.961 -37.988 29.112  1.00 86.77  ? 27  ILE C CG1 1 
ATOM   4593  C  CG2 . ILE C 1 27  ? -66.932 -37.210 27.769  1.00 68.73  ? 27  ILE C CG2 1 
ATOM   4594  C  CD1 . ILE C 1 27  ? -64.577 -36.889 30.077  1.00 85.64  ? 27  ILE C CD1 1 
ATOM   4595  N  N   . GLY C 1 28  ? -62.820 -38.566 27.532  1.00 97.66  ? 28  GLY C N   1 
ATOM   4596  C  CA  . GLY C 1 28  ? -62.874 -37.122 27.660  1.00 110.87 ? 28  GLY C CA  1 
ATOM   4597  C  C   . GLY C 1 28  ? -61.731 -36.586 28.499  1.00 113.71 ? 28  GLY C C   1 
ATOM   4598  O  O   . GLY C 1 28  ? -60.588 -37.020 28.359  1.00 106.25 ? 28  GLY C O   1 
ATOM   4599  N  N   . VAL C 1 34  ? -60.714 -40.197 30.210  1.00 96.05  ? 34  VAL C N   1 
ATOM   4600  C  CA  . VAL C 1 34  ? -61.252 -41.382 29.553  1.00 101.26 ? 34  VAL C CA  1 
ATOM   4601  C  C   . VAL C 1 34  ? -62.455 -41.923 30.317  1.00 103.03 ? 34  VAL C C   1 
ATOM   4602  O  O   . VAL C 1 34  ? -62.329 -42.368 31.457  1.00 113.21 ? 34  VAL C O   1 
ATOM   4603  C  CB  . VAL C 1 34  ? -60.192 -42.489 29.426  1.00 95.22  ? 34  VAL C CB  1 
ATOM   4604  C  CG1 . VAL C 1 34  ? -60.850 -43.859 29.473  1.00 98.36  ? 34  VAL C CG1 1 
ATOM   4605  C  CG2 . VAL C 1 34  ? -59.397 -42.316 28.142  1.00 91.42  ? 34  VAL C CG2 1 
ATOM   4606  N  N   . ALA C 1 35  ? -63.621 -41.880 29.682  1.00 92.98  ? 35  ALA C N   1 
ATOM   4607  C  CA  . ALA C 1 35  ? -64.852 -42.319 30.314  1.00 76.10  ? 35  ALA C CA  1 
ATOM   4608  C  C   . ALA C 1 35  ? -66.042 -42.157 29.376  1.00 69.22  ? 35  ALA C C   1 
ATOM   4609  O  O   . ALA C 1 35  ? -65.892 -41.745 28.230  1.00 80.63  ? 35  ALA C O   1 
ATOM   4610  C  CB  . ALA C 1 35  ? -65.078 -41.520 31.584  1.00 67.93  ? 35  ALA C CB  1 
ATOM   4611  N  N   . ARG C 1 36  ? -67.227 -42.459 29.880  1.00 45.98  ? 36  ARG C N   1 
ATOM   4612  C  CA  . ARG C 1 36  ? -68.425 -42.356 29.092  1.00 51.50  ? 36  ARG C CA  1 
ATOM   4613  C  C   . ARG C 1 36  ? -69.444 -41.609 29.941  1.00 53.40  ? 36  ARG C C   1 
ATOM   4614  O  O   . ARG C 1 36  ? -69.732 -42.025 31.065  1.00 59.82  ? 36  ARG C O   1 
ATOM   4615  C  CB  . ARG C 1 36  ? -68.970 -43.751 28.719  1.00 57.02  ? 36  ARG C CB  1 
ATOM   4616  C  CG  . ARG C 1 36  ? -70.104 -43.673 27.720  1.00 55.36  ? 36  ARG C CG  1 
ATOM   4617  C  CD  . ARG C 1 36  ? -70.986 -44.917 27.649  1.00 57.89  ? 36  ARG C CD  1 
ATOM   4618  N  NE  . ARG C 1 36  ? -70.272 -46.112 27.216  1.00 69.57  ? 36  ARG C NE  1 
ATOM   4619  C  CZ  . ARG C 1 36  ? -69.871 -46.353 25.972  1.00 70.54  ? 36  ARG C CZ  1 
ATOM   4620  N  NH1 . ARG C 1 36  ? -70.093 -45.482 25.005  1.00 92.79  ? 36  ARG C NH1 1 
ATOM   4621  N  NH2 . ARG C 1 36  ? -69.236 -47.467 25.696  1.00 81.68  ? 36  ARG C NH2 1 
ATOM   4622  N  N   . LEU C 1 37  ? -69.960 -40.493 29.424  1.00 45.48  ? 37  LEU C N   1 
ATOM   4623  C  CA  . LEU C 1 37  ? -71.064 -39.792 30.066  1.00 40.06  ? 37  LEU C CA  1 
ATOM   4624  C  C   . LEU C 1 37  ? -72.398 -40.451 29.711  1.00 43.60  ? 37  LEU C C   1 
ATOM   4625  O  O   . LEU C 1 37  ? -72.640 -40.822 28.564  1.00 51.32  ? 37  LEU C O   1 
ATOM   4626  C  CB  . LEU C 1 37  ? -71.103 -38.340 29.609  1.00 43.20  ? 37  LEU C CB  1 
ATOM   4627  C  CG  . LEU C 1 37  ? -70.406 -37.317 30.501  1.00 58.39  ? 37  LEU C CG  1 
ATOM   4628  C  CD1 . LEU C 1 37  ? -69.265 -37.978 31.269  1.00 61.86  ? 37  LEU C CD1 1 
ATOM   4629  C  CD2 . LEU C 1 37  ? -69.884 -36.167 29.641  1.00 52.76  ? 37  LEU C CD2 1 
ATOM   4630  N  N   . MET C 1 38  ? -73.288 -40.567 30.678  1.00 40.59  ? 38  MET C N   1 
ATOM   4631  C  CA  . MET C 1 38  ? -74.567 -41.182 30.396  1.00 37.96  ? 38  MET C CA  1 
ATOM   4632  C  C   . MET C 1 38  ? -75.560 -40.452 31.213  1.00 40.11  ? 38  MET C C   1 
ATOM   4633  O  O   . MET C 1 38  ? -75.215 -39.853 32.243  1.00 47.04  ? 38  MET C O   1 
ATOM   4634  C  CB  . MET C 1 38  ? -74.597 -42.629 30.878  1.00 39.87  ? 38  MET C CB  1 
ATOM   4635  C  CG  . MET C 1 38  ? -73.860 -43.645 30.008  1.00 50.21  ? 38  MET C CG  1 
ATOM   4636  S  SD  . MET C 1 38  ? -74.070 -45.259 30.756  1.00 82.91  ? 38  MET C SD  1 
ATOM   4637  C  CE  . MET C 1 38  ? -72.959 -46.231 29.727  1.00 64.33  ? 38  MET C CE  1 
ATOM   4638  N  N   . ARG C 1 39  ? -76.808 -40.532 30.790  1.00 34.91  ? 39  ARG C N   1 
ATOM   4639  C  CA  . ARG C 1 39  ? -77.883 -39.927 31.543  1.00 49.00  ? 39  ARG C CA  1 
ATOM   4640  C  C   . ARG C 1 39  ? -78.663 -41.101 32.058  1.00 47.73  ? 39  ARG C C   1 
ATOM   4641  O  O   . ARG C 1 39  ? -79.104 -41.944 31.289  1.00 53.60  ? 39  ARG C O   1 
ATOM   4642  C  CB  . ARG C 1 39  ? -78.766 -39.036 30.656  1.00 46.06  ? 39  ARG C CB  1 
ATOM   4643  C  CG  . ARG C 1 39  ? -79.695 -38.089 31.428  1.00 54.42  ? 39  ARG C CG  1 
ATOM   4644  C  CD  . ARG C 1 39  ? -80.678 -37.330 30.512  1.00 64.77  ? 39  ARG C CD  1 
ATOM   4645  N  NE  . ARG C 1 39  ? -81.465 -38.233 29.675  1.00 79.46  ? 39  ARG C NE  1 
ATOM   4646  C  CZ  . ARG C 1 39  ? -82.730 -38.623 29.856  1.00 74.20  ? 39  ARG C CZ  1 
ATOM   4647  N  NH1 . ARG C 1 39  ? -83.489 -38.191 30.866  1.00 61.11  ? 39  ARG C NH1 1 
ATOM   4648  N  NH2 . ARG C 1 39  ? -83.241 -39.470 28.974  1.00 72.07  ? 39  ARG C NH2 1 
ATOM   4649  N  N   . ASP C 1 40  ? -78.805 -41.192 33.364  1.00 43.63  ? 40  ASP C N   1 
ATOM   4650  C  CA  . ASP C 1 40  ? -79.627 -42.253 33.897  1.00 59.64  ? 40  ASP C CA  1 
ATOM   4651  C  C   . ASP C 1 40  ? -81.096 -41.820 33.788  1.00 65.44  ? 40  ASP C C   1 
ATOM   4652  O  O   . ASP C 1 40  ? -81.487 -40.797 34.346  1.00 81.61  ? 40  ASP C O   1 
ATOM   4653  C  CB  . ASP C 1 40  ? -79.170 -42.617 35.309  1.00 72.72  ? 40  ASP C CB  1 
ATOM   4654  C  CG  . ASP C 1 40  ? -80.263 -42.516 36.317  1.00 87.21  ? 40  ASP C CG  1 
ATOM   4655  O  OD1 . ASP C 1 40  ? -80.784 -43.564 36.749  1.00 80.76  ? 40  ASP C OD1 1 
ATOM   4656  O  OD2 . ASP C 1 40  ? -80.586 -41.373 36.691  1.00 110.10 ? 40  ASP C OD2 1 
ATOM   4657  N  N   . LYS C 1 41  ? -81.883 -42.573 33.014  1.00 68.60  ? 41  LYS C N   1 
ATOM   4658  C  CA  . LYS C 1 41  ? -83.227 -42.156 32.601  1.00 67.02  ? 41  LYS C CA  1 
ATOM   4659  C  C   . LYS C 1 41  ? -84.174 -41.812 33.757  1.00 75.70  ? 41  LYS C C   1 
ATOM   4660  O  O   . LYS C 1 41  ? -84.872 -40.805 33.706  1.00 71.52  ? 41  LYS C O   1 
ATOM   4661  C  CB  . LYS C 1 41  ? -83.870 -43.194 31.675  1.00 79.68  ? 41  LYS C CB  1 
ATOM   4662  C  CG  . LYS C 1 41  ? -83.219 -43.324 30.304  1.00 84.64  ? 41  LYS C CG  1 
ATOM   4663  C  CD  . LYS C 1 41  ? -84.252 -43.695 29.239  1.00 92.14  ? 41  LYS C CD  1 
ATOM   4664  C  CE  . LYS C 1 41  ? -83.755 -44.800 28.297  1.00 92.80  ? 41  LYS C CE  1 
ATOM   4665  N  NZ  . LYS C 1 41  ? -82.496 -44.409 27.593  1.00 94.80  ? 41  LYS C NZ  1 
ATOM   4666  N  N   . GLN C 1 42  ? -84.220 -42.652 34.786  1.00 82.64  ? 42  GLN C N   1 
ATOM   4667  C  CA  . GLN C 1 42  ? -84.961 -42.306 35.993  1.00 81.05  ? 42  GLN C CA  1 
ATOM   4668  C  C   . GLN C 1 42  ? -84.092 -41.366 36.793  1.00 82.32  ? 42  GLN C C   1 
ATOM   4669  O  O   . GLN C 1 42  ? -82.889 -41.540 36.831  1.00 90.77  ? 42  GLN C O   1 
ATOM   4670  C  CB  . GLN C 1 42  ? -85.246 -43.543 36.833  1.00 83.97  ? 42  GLN C CB  1 
ATOM   4671  C  CG  . GLN C 1 42  ? -86.288 -44.466 36.265  1.00 100.12 ? 42  GLN C CG  1 
ATOM   4672  C  CD  . GLN C 1 42  ? -86.621 -45.586 37.224  1.00 116.11 ? 42  GLN C CD  1 
ATOM   4673  O  OE1 . GLN C 1 42  ? -85.955 -45.759 38.243  1.00 122.22 ? 42  GLN C OE1 1 
ATOM   4674  N  NE2 . GLN C 1 42  ? -87.657 -46.351 36.908  1.00 118.97 ? 42  GLN C NE2 1 
ATOM   4675  N  N   . ALA C 1 43  ? -84.690 -40.384 37.448  1.00 87.66  ? 43  ALA C N   1 
ATOM   4676  C  CA  . ALA C 1 43  ? -83.924 -39.396 38.210  1.00 85.14  ? 43  ALA C CA  1 
ATOM   4677  C  C   . ALA C 1 43  ? -83.221 -38.407 37.287  1.00 80.68  ? 43  ALA C C   1 
ATOM   4678  O  O   . ALA C 1 43  ? -82.645 -37.424 37.749  1.00 93.20  ? 43  ALA C O   1 
ATOM   4679  C  CB  . ALA C 1 43  ? -82.921 -40.079 39.149  1.00 73.22  ? 43  ALA C CB  1 
ATOM   4680  N  N   . ASN C 1 44  ? -83.278 -38.679 35.987  1.00 66.06  ? 44  ASN C N   1 
ATOM   4681  C  CA  . ASN C 1 44  ? -82.756 -37.776 34.970  1.00 61.53  ? 44  ASN C CA  1 
ATOM   4682  C  C   . ASN C 1 44  ? -81.534 -37.008 35.433  1.00 67.73  ? 44  ASN C C   1 
ATOM   4683  O  O   . ASN C 1 44  ? -81.638 -35.829 35.776  1.00 79.75  ? 44  ASN C O   1 
ATOM   4684  C  CB  . ASN C 1 44  ? -83.851 -36.804 34.513  1.00 66.85  ? 44  ASN C CB  1 
ATOM   4685  C  CG  . ASN C 1 44  ? -83.374 -35.830 33.442  1.00 74.18  ? 44  ASN C CG  1 
ATOM   4686  O  OD1 . ASN C 1 44  ? -82.260 -35.930 32.930  1.00 81.56  ? 44  ASN C OD1 1 
ATOM   4687  N  ND2 . ASN C 1 44  ? -84.231 -34.878 33.097  1.00 72.61  ? 44  ASN C ND2 1 
ATOM   4688  N  N   . GLU C 1 45  ? -80.378 -37.667 35.455  1.00 61.37  ? 45  GLU C N   1 
ATOM   4689  C  CA  . GLU C 1 45  ? -79.149 -36.962 35.798  1.00 68.07  ? 45  GLU C CA  1 
ATOM   4690  C  C   . GLU C 1 45  ? -77.880 -37.559 35.199  1.00 53.25  ? 45  GLU C C   1 
ATOM   4691  O  O   . GLU C 1 45  ? -77.801 -38.762 34.971  1.00 49.05  ? 45  GLU C O   1 
ATOM   4692  C  CB  . GLU C 1 45  ? -79.012 -36.816 37.311  1.00 77.46  ? 45  GLU C CB  1 
ATOM   4693  C  CG  . GLU C 1 45  ? -78.976 -38.106 38.070  1.00 88.69  ? 45  GLU C CG  1 
ATOM   4694  C  CD  . GLU C 1 45  ? -78.663 -37.880 39.538  1.00 108.62 ? 45  GLU C CD  1 
ATOM   4695  O  OE1 . GLU C 1 45  ? -77.459 -37.731 39.870  1.00 110.84 ? 45  GLU C OE1 1 
ATOM   4696  O  OE2 . GLU C 1 45  ? -79.624 -37.835 40.348  1.00 115.14 ? 45  GLU C OE2 1 
ATOM   4697  N  N   . LEU C 1 46  ? -76.902 -36.695 34.934  1.00 55.05  ? 46  LEU C N   1 
ATOM   4698  C  CA  . LEU C 1 46  ? -75.666 -37.104 34.309  1.00 40.12  ? 46  LEU C CA  1 
ATOM   4699  C  C   . LEU C 1 46  ? -74.858 -37.964 35.232  1.00 50.08  ? 46  LEU C C   1 
ATOM   4700  O  O   . LEU C 1 46  ? -74.873 -37.782 36.440  1.00 59.52  ? 46  LEU C O   1 
ATOM   4701  C  CB  . LEU C 1 46  ? -74.830 -35.905 33.904  1.00 38.15  ? 46  LEU C CB  1 
ATOM   4702  C  CG  . LEU C 1 46  ? -75.193 -35.265 32.581  1.00 47.64  ? 46  LEU C CG  1 
ATOM   4703  C  CD1 . LEU C 1 46  ? -74.264 -34.128 32.266  1.00 30.42  ? 46  LEU C CD1 1 
ATOM   4704  C  CD2 . LEU C 1 46  ? -75.092 -36.328 31.512  1.00 61.09  ? 46  LEU C CD2 1 
ATOM   4705  N  N   . VAL C 1 47  ? -74.101 -38.870 34.637  1.00 38.90  ? 47  VAL C N   1 
ATOM   4706  C  CA  . VAL C 1 47  ? -73.367 -39.856 35.387  1.00 31.39  ? 47  VAL C CA  1 
ATOM   4707  C  C   . VAL C 1 47  ? -72.160 -40.197 34.557  1.00 29.37  ? 47  VAL C C   1 
ATOM   4708  O  O   . VAL C 1 47  ? -72.217 -40.119 33.333  1.00 35.59  ? 47  VAL C O   1 
ATOM   4709  C  CB  . VAL C 1 47  ? -74.259 -41.052 35.566  1.00 42.74  ? 47  VAL C CB  1 
ATOM   4710  C  CG1 . VAL C 1 47  ? -73.584 -42.292 35.069  1.00 40.17  ? 47  VAL C CG1 1 
ATOM   4711  C  CG2 . VAL C 1 47  ? -74.730 -41.129 36.982  1.00 46.53  ? 47  VAL C CG2 1 
ATOM   4712  N  N   . ALA C 1 48  ? -71.049 -40.517 35.186  1.00 24.22  ? 48  ALA C N   1 
ATOM   4713  C  CA  . ALA C 1 48  ? -69.876 -40.888 34.419  1.00 29.61  ? 48  ALA C CA  1 
ATOM   4714  C  C   . ALA C 1 48  ? -69.608 -42.355 34.663  1.00 48.40  ? 48  ALA C C   1 
ATOM   4715  O  O   . ALA C 1 48  ? -69.819 -42.853 35.758  1.00 49.59  ? 48  ALA C O   1 
ATOM   4716  C  CB  . ALA C 1 48  ? -68.702 -40.094 34.858  1.00 22.99  ? 48  ALA C CB  1 
ATOM   4717  N  N   . VAL C 1 49  ? -69.103 -43.045 33.656  1.00 50.84  ? 49  VAL C N   1 
ATOM   4718  C  CA  . VAL C 1 49  ? -68.843 -44.465 33.776  1.00 40.29  ? 49  VAL C CA  1 
ATOM   4719  C  C   . VAL C 1 49  ? -67.408 -44.771 33.420  1.00 50.62  ? 49  VAL C C   1 
ATOM   4720  O  O   . VAL C 1 49  ? -66.936 -44.371 32.356  1.00 47.81  ? 49  VAL C O   1 
ATOM   4721  C  CB  . VAL C 1 49  ? -69.733 -45.247 32.843  1.00 42.11  ? 49  VAL C CB  1 
ATOM   4722  C  CG1 . VAL C 1 49  ? -69.490 -46.720 32.994  1.00 35.84  ? 49  VAL C CG1 1 
ATOM   4723  C  CG2 . VAL C 1 49  ? -71.185 -44.910 33.128  1.00 42.55  ? 49  VAL C CG2 1 
ATOM   4724  N  N   . LYS C 1 50  ? -66.722 -45.472 34.327  1.00 53.70  ? 50  LYS C N   1 
ATOM   4725  C  CA  . LYS C 1 50  ? -65.342 -45.905 34.121  1.00 57.22  ? 50  LYS C CA  1 
ATOM   4726  C  C   . LYS C 1 50  ? -65.361 -47.403 33.813  1.00 52.52  ? 50  LYS C C   1 
ATOM   4727  O  O   . LYS C 1 50  ? -66.211 -48.126 34.318  1.00 70.88  ? 50  LYS C O   1 
ATOM   4728  C  CB  . LYS C 1 50  ? -64.500 -45.594 35.365  1.00 69.22  ? 50  LYS C CB  1 
ATOM   4729  C  CG  . LYS C 1 50  ? -63.048 -45.226 35.075  1.00 80.68  ? 50  LYS C CG  1 
ATOM   4730  C  CD  . LYS C 1 50  ? -62.923 -43.792 34.537  1.00 92.52  ? 50  LYS C CD  1 
ATOM   4731  C  CE  . LYS C 1 50  ? -61.571 -43.554 33.845  1.00 97.52  ? 50  LYS C CE  1 
ATOM   4732  N  NZ  . LYS C 1 50  ? -60.456 -43.156 34.755  1.00 100.80 ? 50  LYS C NZ  1 
ATOM   4733  N  N   . TYR C 1 51  ? -64.457 -47.876 32.966  1.00 57.78  ? 51  TYR C N   1 
ATOM   4734  C  CA  . TYR C 1 51  ? -64.471 -49.288 32.541  1.00 49.17  ? 51  TYR C CA  1 
ATOM   4735  C  C   . TYR C 1 51  ? -63.140 -49.993 32.781  1.00 67.63  ? 51  TYR C C   1 
ATOM   4736  O  O   . TYR C 1 51  ? -62.098 -49.558 32.275  1.00 66.81  ? 51  TYR C O   1 
ATOM   4737  C  CB  . TYR C 1 51  ? -64.803 -49.420 31.053  1.00 46.62  ? 51  TYR C CB  1 
ATOM   4738  C  CG  . TYR C 1 51  ? -66.243 -49.120 30.674  1.00 50.78  ? 51  TYR C CG  1 
ATOM   4739  C  CD1 . TYR C 1 51  ? -67.234 -50.080 30.809  1.00 33.39  ? 51  TYR C CD1 1 
ATOM   4740  C  CD2 . TYR C 1 51  ? -66.605 -47.871 30.159  1.00 48.41  ? 51  TYR C CD2 1 
ATOM   4741  C  CE1 . TYR C 1 51  ? -68.545 -49.799 30.470  1.00 40.00  ? 51  TYR C CE1 1 
ATOM   4742  C  CE2 . TYR C 1 51  ? -67.907 -47.587 29.810  1.00 29.85  ? 51  TYR C CE2 1 
ATOM   4743  C  CZ  . TYR C 1 51  ? -68.876 -48.538 29.973  1.00 39.69  ? 51  TYR C CZ  1 
ATOM   4744  O  OH  . TYR C 1 51  ? -70.180 -48.241 29.622  1.00 35.74  ? 51  TYR C OH  1 
ATOM   4745  N  N   . ILE C 1 52  ? -63.171 -51.092 33.539  1.00 74.83  ? 52  ILE C N   1 
ATOM   4746  C  CA  . ILE C 1 52  ? -61.976 -51.922 33.721  1.00 58.16  ? 52  ILE C CA  1 
ATOM   4747  C  C   . ILE C 1 52  ? -62.213 -53.255 33.045  1.00 53.16  ? 52  ILE C C   1 
ATOM   4748  O  O   . ILE C 1 52  ? -63.285 -53.818 33.207  1.00 53.75  ? 52  ILE C O   1 
ATOM   4749  C  CB  . ILE C 1 52  ? -61.643 -52.150 35.198  1.00 52.08  ? 52  ILE C CB  1 
ATOM   4750  C  CG1 . ILE C 1 52  ? -61.541 -50.813 35.917  1.00 44.31  ? 52  ILE C CG1 1 
ATOM   4751  C  CG2 . ILE C 1 52  ? -60.341 -52.927 35.330  1.00 50.40  ? 52  ILE C CG2 1 
ATOM   4752  C  CD1 . ILE C 1 52  ? -61.351 -50.946 37.399  1.00 45.04  ? 52  ILE C CD1 1 
ATOM   4753  N  N   . GLU C 1 53  ? -61.248 -53.733 32.255  1.00 74.40  ? 53  GLU C N   1 
ATOM   4754  C  CA  . GLU C 1 53  ? -61.353 -55.031 31.550  1.00 86.15  ? 53  GLU C CA  1 
ATOM   4755  C  C   . GLU C 1 53  ? -61.696 -56.197 32.479  1.00 72.20  ? 53  GLU C C   1 
ATOM   4756  O  O   . GLU C 1 53  ? -61.581 -56.089 33.691  1.00 76.98  ? 53  GLU C O   1 
ATOM   4757  C  CB  . GLU C 1 53  ? -60.030 -55.363 30.850  1.00 105.90 ? 53  GLU C CB  1 
ATOM   4758  C  CG  . GLU C 1 53  ? -59.822 -54.742 29.469  1.00 113.51 ? 53  GLU C CG  1 
ATOM   4759  C  CD  . GLU C 1 53  ? -58.349 -54.728 29.063  1.00 105.98 ? 53  GLU C CD  1 
ATOM   4760  O  OE1 . GLU C 1 53  ? -57.542 -54.053 29.750  1.00 100.94 ? 53  GLU C OE1 1 
ATOM   4761  O  OE2 . GLU C 1 53  ? -58.000 -55.397 28.064  1.00 89.39  ? 53  GLU C OE2 1 
ATOM   4762  N  N   . ARG C 1 54  ? -62.086 -57.330 31.924  1.00 74.22  ? 54  ARG C N   1 
ATOM   4763  C  CA  . ARG C 1 54  ? -62.463 -58.456 32.775  1.00 71.03  ? 54  ARG C CA  1 
ATOM   4764  C  C   . ARG C 1 54  ? -61.348 -59.414 33.204  1.00 76.20  ? 54  ARG C C   1 
ATOM   4765  O  O   . ARG C 1 54  ? -61.635 -60.482 33.733  1.00 72.63  ? 54  ARG C O   1 
ATOM   4766  C  CB  . ARG C 1 54  ? -63.574 -59.248 32.125  1.00 53.07  ? 54  ARG C CB  1 
ATOM   4767  C  CG  . ARG C 1 54  ? -64.932 -58.900 32.640  1.00 48.01  ? 54  ARG C CG  1 
ATOM   4768  C  CD  . ARG C 1 54  ? -65.922 -59.311 31.614  1.00 59.31  ? 54  ARG C CD  1 
ATOM   4769  N  NE  . ARG C 1 54  ? -67.221 -59.747 32.114  1.00 59.19  ? 54  ARG C NE  1 
ATOM   4770  C  CZ  . ARG C 1 54  ? -67.463 -60.941 32.640  1.00 59.01  ? 54  ARG C CZ  1 
ATOM   4771  N  NH1 . ARG C 1 54  ? -66.478 -61.813 32.800  1.00 67.31  ? 54  ARG C NH1 1 
ATOM   4772  N  NH2 . ARG C 1 54  ? -68.691 -61.257 33.020  1.00 52.73  ? 54  ARG C NH2 1 
ATOM   4773  N  N   . GLY C 1 55  ? -60.091 -59.033 33.007  1.00 83.11  ? 55  GLY C N   1 
ATOM   4774  C  CA  . GLY C 1 55  ? -58.983 -59.920 33.324  1.00 90.05  ? 55  GLY C CA  1 
ATOM   4775  C  C   . GLY C 1 55  ? -58.649 -60.161 34.791  1.00 82.88  ? 55  GLY C C   1 
ATOM   4776  O  O   . GLY C 1 55  ? -59.424 -59.861 35.700  1.00 56.76  ? 55  GLY C O   1 
ATOM   4777  N  N   . GLU C 1 56  ? -57.473 -60.730 35.019  1.00 97.49  ? 56  GLU C N   1 
ATOM   4778  C  CA  . GLU C 1 56  ? -56.957 -60.824 36.371  1.00 112.64 ? 56  GLU C CA  1 
ATOM   4779  C  C   . GLU C 1 56  ? -56.749 -59.393 36.830  1.00 96.63  ? 56  GLU C C   1 
ATOM   4780  O  O   . GLU C 1 56  ? -56.467 -59.129 37.998  1.00 90.98  ? 56  GLU C O   1 
ATOM   4781  C  CB  . GLU C 1 56  ? -55.624 -61.588 36.420  1.00 129.81 ? 56  GLU C CB  1 
ATOM   4782  C  CG  . GLU C 1 56  ? -54.379 -60.706 36.201  1.00 138.89 ? 56  GLU C CG  1 
ATOM   4783  C  CD  . GLU C 1 56  ? -53.128 -61.212 36.925  1.00 142.38 ? 56  GLU C CD  1 
ATOM   4784  O  OE1 . GLU C 1 56  ? -52.012 -60.786 36.543  1.00 140.45 ? 56  GLU C OE1 1 
ATOM   4785  O  OE2 . GLU C 1 56  ? -53.260 -62.017 37.876  1.00 142.63 ? 56  GLU C OE2 1 
ATOM   4786  N  N   . LYS C 1 57  ? -56.882 -58.463 35.896  1.00 86.92  ? 57  LYS C N   1 
ATOM   4787  C  CA  . LYS C 1 57  ? -56.675 -57.073 36.235  1.00 92.52  ? 57  LYS C CA  1 
ATOM   4788  C  C   . LYS C 1 57  ? -57.890 -56.455 36.914  1.00 91.30  ? 57  LYS C C   1 
ATOM   4789  O  O   . LYS C 1 57  ? -58.067 -55.240 36.882  1.00 88.17  ? 57  LYS C O   1 
ATOM   4790  C  CB  . LYS C 1 57  ? -56.295 -56.275 35.006  1.00 92.50  ? 57  LYS C CB  1 
ATOM   4791  C  CG  . LYS C 1 57  ? -57.373 -56.247 33.977  1.00 88.62  ? 57  LYS C CG  1 
ATOM   4792  C  CD  . LYS C 1 57  ? -56.824 -55.726 32.681  1.00 89.44  ? 57  LYS C CD  1 
ATOM   4793  C  CE  . LYS C 1 57  ? -55.955 -54.510 32.910  1.00 92.01  ? 57  LYS C CE  1 
ATOM   4794  N  NZ  . LYS C 1 57  ? -55.497 -53.945 31.607  1.00 97.10  ? 57  LYS C NZ  1 
ATOM   4795  N  N   . ILE C 1 58  ? -58.706 -57.299 37.535  1.00 87.36  ? 58  ILE C N   1 
ATOM   4796  C  CA  . ILE C 1 58  ? -59.801 -56.841 38.374  1.00 69.70  ? 58  ILE C CA  1 
ATOM   4797  C  C   . ILE C 1 58  ? -59.412 -57.128 39.817  1.00 86.83  ? 58  ILE C C   1 
ATOM   4798  O  O   . ILE C 1 58  ? -60.262 -57.369 40.672  1.00 106.01 ? 58  ILE C O   1 
ATOM   4799  C  CB  . ILE C 1 58  ? -61.115 -57.563 38.042  1.00 63.29  ? 58  ILE C CB  1 
ATOM   4800  C  CG1 . ILE C 1 58  ? -61.724 -56.996 36.758  1.00 66.65  ? 58  ILE C CG1 1 
ATOM   4801  C  CG2 . ILE C 1 58  ? -62.096 -57.442 39.197  1.00 58.71  ? 58  ILE C CG2 1 
ATOM   4802  C  CD1 . ILE C 1 58  ? -63.158 -56.541 36.911  1.00 57.72  ? 58  ILE C CD1 1 
ATOM   4803  N  N   . ASP C 1 59  ? -58.107 -57.104 40.068  1.00 90.60  ? 59  ASP C N   1 
ATOM   4804  C  CA  . ASP C 1 59  ? -57.545 -57.424 41.374  1.00 97.77  ? 59  ASP C CA  1 
ATOM   4805  C  C   . ASP C 1 59  ? -57.860 -56.402 42.459  1.00 98.42  ? 59  ASP C C   1 
ATOM   4806  O  O   . ASP C 1 59  ? -58.259 -55.274 42.174  1.00 101.92 ? 59  ASP C O   1 
ATOM   4807  C  CB  . ASP C 1 59  ? -56.055 -57.083 41.404  1.00 99.80  ? 59  ASP C CB  1 
ATOM   4808  C  CG  . ASP C 1 59  ? -55.770 -55.679 40.910  1.00 91.46  ? 59  ASP C CG  1 
ATOM   4809  O  OD1 . ASP C 1 59  ? -55.050 -55.537 39.900  1.00 92.00  ? 59  ASP C OD1 1 
ATOM   4810  O  OD2 . ASP C 1 59  ? -56.267 -54.718 41.532  1.00 87.06  ? 59  ASP C OD2 1 
ATOM   4811  N  N   . GLU C 1 60  ? -57.672 -56.813 43.710  1.00 94.97  ? 60  GLU C N   1 
ATOM   4812  C  CA  . GLU C 1 60  ? -58.243 -56.208 44.904  1.00 100.27 ? 60  GLU C CA  1 
ATOM   4813  C  C   . GLU C 1 60  ? -58.042 -54.698 44.914  1.00 101.81 ? 60  GLU C C   1 
ATOM   4814  O  O   . GLU C 1 60  ? -58.948 -53.946 45.272  1.00 116.75 ? 60  GLU C O   1 
ATOM   4815  C  CB  . GLU C 1 60  ? -57.627 -56.827 46.161  1.00 100.83 ? 60  GLU C CB  1 
ATOM   4816  C  CG  . GLU C 1 60  ? -57.202 -55.814 47.209  1.00 104.55 ? 60  GLU C CG  1 
ATOM   4817  C  CD  . GLU C 1 60  ? -57.508 -56.275 48.619  1.00 109.00 ? 60  GLU C CD  1 
ATOM   4818  O  OE1 . GLU C 1 60  ? -57.684 -55.413 49.504  1.00 115.88 ? 60  GLU C OE1 1 
ATOM   4819  O  OE2 . GLU C 1 60  ? -57.575 -57.502 48.844  1.00 106.48 ? 60  GLU C OE2 1 
ATOM   4820  N  N   . ASN C 1 61  ? -56.853 -54.257 44.519  1.00 88.25  ? 61  ASN C N   1 
ATOM   4821  C  CA  . ASN C 1 61  ? -56.551 -52.833 44.492  1.00 88.45  ? 61  ASN C CA  1 
ATOM   4822  C  C   . ASN C 1 61  ? -57.723 -52.051 43.916  1.00 81.04  ? 61  ASN C C   1 
ATOM   4823  O  O   . ASN C 1 61  ? -58.047 -50.960 44.383  1.00 77.33  ? 61  ASN C O   1 
ATOM   4824  C  CB  . ASN C 1 61  ? -55.284 -52.566 43.678  1.00 101.38 ? 61  ASN C CB  1 
ATOM   4825  C  CG  . ASN C 1 61  ? -54.248 -51.779 44.456  1.00 120.68 ? 61  ASN C CG  1 
ATOM   4826  O  OD1 . ASN C 1 61  ? -54.497 -51.335 45.576  1.00 128.80 ? 61  ASN C OD1 1 
ATOM   4827  N  ND2 . ASN C 1 61  ? -53.072 -51.601 43.863  1.00 124.46 ? 61  ASN C ND2 1 
ATOM   4828  N  N   . VAL C 1 62  ? -58.359 -52.625 42.899  1.00 64.76  ? 62  VAL C N   1 
ATOM   4829  C  CA  . VAL C 1 62  ? -59.534 -52.020 42.289  1.00 52.87  ? 62  VAL C CA  1 
ATOM   4830  C  C   . VAL C 1 62  ? -60.751 -52.253 43.173  1.00 57.17  ? 62  VAL C C   1 
ATOM   4831  O  O   . VAL C 1 62  ? -61.680 -51.446 43.196  1.00 64.17  ? 62  VAL C O   1 
ATOM   4832  C  CB  . VAL C 1 62  ? -59.806 -52.606 40.892  1.00 59.62  ? 62  VAL C CB  1 
ATOM   4833  C  CG1 . VAL C 1 62  ? -61.301 -52.659 40.622  1.00 46.55  ? 62  VAL C CG1 1 
ATOM   4834  C  CG2 . VAL C 1 62  ? -59.093 -51.792 39.826  1.00 63.67  ? 62  VAL C CG2 1 
ATOM   4835  N  N   . LYS C 1 63  ? -60.736 -53.364 43.901  1.00 59.05  ? 63  LYS C N   1 
ATOM   4836  C  CA  . LYS C 1 63  ? -61.824 -53.704 44.807  1.00 59.89  ? 63  LYS C CA  1 
ATOM   4837  C  C   . LYS C 1 63  ? -61.786 -52.821 46.048  1.00 56.12  ? 63  LYS C C   1 
ATOM   4838  O  O   . LYS C 1 63  ? -62.827 -52.417 46.565  1.00 55.96  ? 63  LYS C O   1 
ATOM   4839  C  CB  . LYS C 1 63  ? -61.748 -55.179 45.208  1.00 62.09  ? 63  LYS C CB  1 
ATOM   4840  C  CG  . LYS C 1 63  ? -62.298 -55.475 46.593  1.00 62.16  ? 63  LYS C CG  1 
ATOM   4841  C  CD  . LYS C 1 63  ? -62.158 -56.948 46.940  1.00 74.25  ? 63  LYS C CD  1 
ATOM   4842  C  CE  . LYS C 1 63  ? -60.804 -57.240 47.568  1.00 88.37  ? 63  LYS C CE  1 
ATOM   4843  N  NZ  . LYS C 1 63  ? -60.870 -58.377 48.529  1.00 96.37  ? 63  LYS C NZ  1 
ATOM   4844  N  N   . ARG C 1 64  ? -60.580 -52.523 46.522  1.00 44.06  ? 64  ARG C N   1 
ATOM   4845  C  CA  . ARG C 1 64  ? -60.417 -51.676 47.686  1.00 51.34  ? 64  ARG C CA  1 
ATOM   4846  C  C   . ARG C 1 64  ? -60.885 -50.253 47.390  1.00 58.63  ? 64  ARG C C   1 
ATOM   4847  O  O   . ARG C 1 64  ? -61.626 -49.653 48.177  1.00 54.32  ? 64  ARG C O   1 
ATOM   4848  C  CB  . ARG C 1 64  ? -58.959 -51.669 48.119  1.00 61.26  ? 64  ARG C CB  1 
ATOM   4849  C  CG  . ARG C 1 64  ? -58.706 -50.907 49.397  1.00 78.97  ? 64  ARG C CG  1 
ATOM   4850  C  CD  . ARG C 1 64  ? -57.697 -49.792 49.153  1.00 104.22 ? 64  ARG C CD  1 
ATOM   4851  N  NE  . ARG C 1 64  ? -56.366 -50.292 48.807  1.00 116.50 ? 64  ARG C NE  1 
ATOM   4852  C  CZ  . ARG C 1 64  ? -55.631 -49.844 47.792  1.00 121.01 ? 64  ARG C CZ  1 
ATOM   4853  N  NH1 . ARG C 1 64  ? -56.086 -48.879 46.997  1.00 113.60 ? 64  ARG C NH1 1 
ATOM   4854  N  NH2 . ARG C 1 64  ? -54.435 -50.370 47.575  1.00 130.57 ? 64  ARG C NH2 1 
ATOM   4855  N  N   . GLU C 1 65  ? -60.467 -49.725 46.245  1.00 52.63  ? 65  GLU C N   1 
ATOM   4856  C  CA  . GLU C 1 65  ? -60.872 -48.400 45.839  1.00 52.87  ? 65  GLU C CA  1 
ATOM   4857  C  C   . GLU C 1 65  ? -62.375 -48.286 45.659  1.00 51.09  ? 65  GLU C C   1 
ATOM   4858  O  O   . GLU C 1 65  ? -62.966 -47.303 46.107  1.00 51.45  ? 65  GLU C O   1 
ATOM   4859  C  CB  . GLU C 1 65  ? -60.131 -47.980 44.573  1.00 71.05  ? 65  GLU C CB  1 
ATOM   4860  C  CG  . GLU C 1 65  ? -58.691 -47.546 44.852  1.00 93.68  ? 65  GLU C CG  1 
ATOM   4861  C  CD  . GLU C 1 65  ? -57.852 -47.398 43.590  1.00 110.78 ? 65  GLU C CD  1 
ATOM   4862  O  OE1 . GLU C 1 65  ? -58.213 -47.996 42.546  1.00 106.88 ? 65  GLU C OE1 1 
ATOM   4863  O  OE2 . GLU C 1 65  ? -56.825 -46.681 43.647  1.00 121.05 ? 65  GLU C OE2 1 
ATOM   4864  N  N   . ILE C 1 66  ? -63.001 -49.281 45.028  1.00 42.06  ? 66  ILE C N   1 
ATOM   4865  C  CA  . ILE C 1 66  ? -64.443 -49.242 44.837  1.00 31.97  ? 66  ILE C CA  1 
ATOM   4866  C  C   . ILE C 1 66  ? -65.178 -49.174 46.173  1.00 45.69  ? 66  ILE C C   1 
ATOM   4867  O  O   . ILE C 1 66  ? -66.155 -48.448 46.292  1.00 44.50  ? 66  ILE C O   1 
ATOM   4868  C  CB  . ILE C 1 66  ? -64.979 -50.469 44.059  1.00 36.86  ? 66  ILE C CB  1 
ATOM   4869  C  CG1 . ILE C 1 66  ? -64.574 -50.426 42.602  1.00 34.04  ? 66  ILE C CG1 1 
ATOM   4870  C  CG2 . ILE C 1 66  ? -66.485 -50.517 44.107  1.00 20.94  ? 66  ILE C CG2 1 
ATOM   4871  C  CD1 . ILE C 1 66  ? -65.138 -51.599 41.805  1.00 41.80  ? 66  ILE C CD1 1 
ATOM   4872  N  N   . ILE C 1 67  ? -64.736 -49.967 47.143  1.00 38.87  ? 67  ILE C N   1 
ATOM   4873  C  CA  . ILE C 1 67  ? -65.400 -50.030 48.439  1.00 43.81  ? 67  ILE C CA  1 
ATOM   4874  C  C   . ILE C 1 67  ? -65.186 -48.728 49.195  1.00 46.50  ? 67  ILE C C   1 
ATOM   4875  O  O   . ILE C 1 67  ? -66.113 -48.175 49.783  1.00 53.09  ? 67  ILE C O   1 
ATOM   4876  C  CB  . ILE C 1 67  ? -64.880 -51.202 49.288  1.00 41.59  ? 67  ILE C CB  1 
ATOM   4877  C  CG1 . ILE C 1 67  ? -65.307 -52.536 48.670  1.00 36.44  ? 67  ILE C CG1 1 
ATOM   4878  C  CG2 . ILE C 1 67  ? -65.382 -51.089 50.718  1.00 37.52  ? 67  ILE C CG2 1 
ATOM   4879  C  CD1 . ILE C 1 67  ? -66.801 -52.672 48.485  1.00 28.50  ? 67  ILE C CD1 1 
ATOM   4880  N  N   . ASN C 1 68  ? -63.950 -48.240 49.160  1.00 41.13  ? 68  ASN C N   1 
ATOM   4881  C  CA  . ASN C 1 68  ? -63.599 -46.982 49.802  1.00 57.14  ? 68  ASN C CA  1 
ATOM   4882  C  C   . ASN C 1 68  ? -64.429 -45.824 49.263  1.00 66.50  ? 68  ASN C C   1 
ATOM   4883  O  O   . ASN C 1 68  ? -64.979 -45.035 50.031  1.00 78.69  ? 68  ASN C O   1 
ATOM   4884  C  CB  . ASN C 1 68  ? -62.109 -46.686 49.627  1.00 66.16  ? 68  ASN C CB  1 
ATOM   4885  C  CG  . ASN C 1 68  ? -61.235 -47.542 50.522  1.00 65.29  ? 68  ASN C CG  1 
ATOM   4886  O  OD1 . ASN C 1 68  ? -61.721 -48.186 51.451  1.00 66.90  ? 68  ASN C OD1 1 
ATOM   4887  N  ND2 . ASN C 1 68  ? -59.936 -47.553 50.246  1.00 56.83  ? 68  ASN C ND2 1 
ATOM   4888  N  N   . HIS C 1 69  ? -64.518 -45.720 47.942  1.00 59.49  ? 69  HIS C N   1 
ATOM   4889  C  CA  . HIS C 1 69  ? -65.315 -44.669 47.324  1.00 38.23  ? 69  HIS C CA  1 
ATOM   4890  C  C   . HIS C 1 69  ? -66.792 -44.883 47.630  1.00 40.74  ? 69  HIS C C   1 
ATOM   4891  O  O   . HIS C 1 69  ? -67.553 -43.927 47.773  1.00 46.91  ? 69  HIS C O   1 
ATOM   4892  C  CB  . HIS C 1 69  ? -65.089 -44.633 45.813  1.00 24.80  ? 69  HIS C CB  1 
ATOM   4893  C  CG  . HIS C 1 69  ? -65.727 -43.462 45.136  1.00 47.97  ? 69  HIS C CG  1 
ATOM   4894  N  ND1 . HIS C 1 69  ? -65.947 -43.416 43.776  1.00 67.03  ? 69  HIS C ND1 1 
ATOM   4895  C  CD2 . HIS C 1 69  ? -66.194 -42.290 45.632  1.00 45.23  ? 69  HIS C CD2 1 
ATOM   4896  C  CE1 . HIS C 1 69  ? -66.522 -42.268 43.463  1.00 65.58  ? 69  HIS C CE1 1 
ATOM   4897  N  NE2 . HIS C 1 69  ? -66.683 -41.567 44.571  1.00 62.96  ? 69  HIS C NE2 1 
ATOM   4898  N  N   . ARG C 1 70  ? -67.188 -46.147 47.731  1.00 43.14  ? 70  ARG C N   1 
ATOM   4899  C  CA  . ARG C 1 70  ? -68.568 -46.499 48.028  1.00 40.19  ? 70  ARG C CA  1 
ATOM   4900  C  C   . ARG C 1 70  ? -69.029 -45.986 49.385  1.00 43.57  ? 70  ARG C C   1 
ATOM   4901  O  O   . ARG C 1 70  ? -70.219 -45.753 49.591  1.00 55.36  ? 70  ARG C O   1 
ATOM   4902  C  CB  . ARG C 1 70  ? -68.759 -48.016 47.952  1.00 24.81  ? 70  ARG C CB  1 
ATOM   4903  C  CG  . ARG C 1 70  ? -70.203 -48.450 47.773  1.00 40.91  ? 70  ARG C CG  1 
ATOM   4904  C  CD  . ARG C 1 70  ? -70.761 -49.053 49.050  1.00 38.67  ? 70  ARG C CD  1 
ATOM   4905  N  NE  . ARG C 1 70  ? -72.156 -49.449 48.901  1.00 52.58  ? 70  ARG C NE  1 
ATOM   4906  C  CZ  . ARG C 1 70  ? -72.979 -49.683 49.917  1.00 61.00  ? 70  ARG C CZ  1 
ATOM   4907  N  NH1 . ARG C 1 70  ? -72.547 -49.561 51.165  1.00 54.80  ? 70  ARG C NH1 1 
ATOM   4908  N  NH2 . ARG C 1 70  ? -74.235 -50.041 49.687  1.00 59.78  ? 70  ARG C NH2 1 
ATOM   4909  N  N   . SER C 1 71  ? -68.095 -45.813 50.315  1.00 29.76  ? 71  SER C N   1 
ATOM   4910  C  CA  . SER C 1 71  ? -68.478 -45.380 51.658  1.00 40.91  ? 71  SER C CA  1 
ATOM   4911  C  C   . SER C 1 71  ? -68.647 -43.870 51.809  1.00 50.21  ? 71  SER C C   1 
ATOM   4912  O  O   . SER C 1 71  ? -69.165 -43.412 52.821  1.00 46.61  ? 71  SER C O   1 
ATOM   4913  C  CB  . SER C 1 71  ? -67.473 -45.846 52.682  1.00 38.91  ? 71  SER C CB  1 
ATOM   4914  O  OG  . SER C 1 71  ? -66.261 -45.186 52.455  1.00 50.18  ? 71  SER C OG  1 
ATOM   4915  N  N   . LEU C 1 72  ? -68.199 -43.105 50.818  1.00 52.86  ? 72  LEU C N   1 
ATOM   4916  C  CA  . LEU C 1 72  ? -68.224 -41.655 50.898  1.00 44.99  ? 72  LEU C CA  1 
ATOM   4917  C  C   . LEU C 1 72  ? -69.590 -41.100 50.499  1.00 49.76  ? 72  LEU C C   1 
ATOM   4918  O  O   . LEU C 1 72  ? -69.996 -41.174 49.357  1.00 49.00  ? 72  LEU C O   1 
ATOM   4919  C  CB  . LEU C 1 72  ? -67.134 -41.059 50.027  1.00 48.14  ? 72  LEU C CB  1 
ATOM   4920  C  CG  . LEU C 1 72  ? -65.712 -41.432 50.454  1.00 44.25  ? 72  LEU C CG  1 
ATOM   4921  C  CD1 . LEU C 1 72  ? -64.660 -40.840 49.547  1.00 38.50  ? 72  LEU C CD1 1 
ATOM   4922  C  CD2 . LEU C 1 72  ? -65.476 -40.952 51.849  1.00 35.29  ? 72  LEU C CD2 1 
ATOM   4923  N  N   . ARG C 1 73  ? -70.328 -40.601 51.482  1.00 36.42  ? 73  ARG C N   1 
ATOM   4924  C  CA  . ARG C 1 73  ? -71.696 -40.170 51.241  1.00 49.21  ? 73  ARG C CA  1 
ATOM   4925  C  C   . ARG C 1 73  ? -71.902 -38.731 51.670  1.00 64.35  ? 73  ARG C C   1 
ATOM   4926  O  O   . ARG C 1 73  ? -72.567 -38.464 52.670  1.00 80.25  ? 73  ARG C O   1 
ATOM   4927  C  CB  . ARG C 1 73  ? -72.678 -41.083 51.979  1.00 54.01  ? 73  ARG C CB  1 
ATOM   4928  C  CG  . ARG C 1 73  ? -73.366 -42.104 51.089  1.00 76.74  ? 73  ARG C CG  1 
ATOM   4929  C  CD  . ARG C 1 73  ? -72.728 -43.476 51.227  1.00 92.41  ? 73  ARG C CD  1 
ATOM   4930  N  NE  . ARG C 1 73  ? -73.392 -44.473 50.392  1.00 114.74 ? 73  ARG C NE  1 
ATOM   4931  C  CZ  . ARG C 1 73  ? -73.494 -45.761 50.704  1.00 116.58 ? 73  ARG C CZ  1 
ATOM   4932  N  NH1 . ARG C 1 73  ? -72.974 -46.215 51.836  1.00 115.57 ? 73  ARG C NH1 1 
ATOM   4933  N  NH2 . ARG C 1 73  ? -74.116 -46.596 49.885  1.00 104.81 ? 73  ARG C NH2 1 
ATOM   4934  N  N   . HIS C 1 74  ? -71.334 -37.800 50.914  1.00 62.56  ? 74  HIS C N   1 
ATOM   4935  C  CA  . HIS C 1 74  ? -71.474 -36.384 51.268  1.00 43.64  ? 74  HIS C CA  1 
ATOM   4936  C  C   . HIS C 1 74  ? -71.806 -35.578 50.048  1.00 31.21  ? 74  HIS C C   1 
ATOM   4937  O  O   . HIS C 1 74  ? -71.114 -35.632 49.048  1.00 37.44  ? 74  HIS C O   1 
ATOM   4938  C  CB  . HIS C 1 74  ? -70.222 -35.808 51.942  1.00 33.09  ? 74  HIS C CB  1 
ATOM   4939  C  CG  . HIS C 1 74  ? -70.463 -34.505 52.602  1.00 49.58  ? 74  HIS C CG  1 
ATOM   4940  N  ND1 . HIS C 1 74  ? -70.568 -33.319 51.884  1.00 47.51  ? 74  HIS C ND1 1 
ATOM   4941  C  CD2 . HIS C 1 74  ? -70.666 -34.179 53.893  1.00 43.19  ? 74  HIS C CD2 1 
ATOM   4942  C  CE1 . HIS C 1 74  ? -70.796 -32.337 52.717  1.00 36.88  ? 74  HIS C CE1 1 
ATOM   4943  N  NE2 . HIS C 1 74  ? -70.869 -32.821 53.949  1.00 45.35  ? 74  HIS C NE2 1 
ATOM   4944  N  N   . PRO C 1 75  ? -72.871 -34.815 50.131  1.00 36.19  ? 75  PRO C N   1 
ATOM   4945  C  CA  . PRO C 1 75  ? -73.317 -34.024 48.983  1.00 38.71  ? 75  PRO C CA  1 
ATOM   4946  C  C   . PRO C 1 75  ? -72.195 -33.176 48.370  1.00 33.08  ? 75  PRO C C   1 
ATOM   4947  O  O   . PRO C 1 75  ? -72.299 -32.797 47.204  1.00 42.15  ? 75  PRO C O   1 
ATOM   4948  C  CB  . PRO C 1 75  ? -74.437 -33.152 49.571  1.00 30.39  ? 75  PRO C CB  1 
ATOM   4949  C  CG  . PRO C 1 75  ? -74.170 -33.130 51.025  1.00 43.17  ? 75  PRO C CG  1 
ATOM   4950  C  CD  . PRO C 1 75  ? -73.610 -34.494 51.357  1.00 39.42  ? 75  PRO C CD  1 
ATOM   4951  N  N   . ASN C 1 76  ? -71.092 -32.994 49.095  1.00 27.14  ? 76  ASN C N   1 
ATOM   4952  C  CA  . ASN C 1 76  ? -69.934 -32.261 48.571  1.00 31.83  ? 76  ASN C CA  1 
ATOM   4953  C  C   . ASN C 1 76  ? -68.735 -33.116 48.107  1.00 37.35  ? 76  ASN C C   1 
ATOM   4954  O  O   . ASN C 1 76  ? -67.638 -32.598 47.909  1.00 41.34  ? 76  ASN C O   1 
ATOM   4955  C  CB  . ASN C 1 76  ? -69.469 -31.211 49.583  1.00 24.77  ? 76  ASN C CB  1 
ATOM   4956  C  CG  . ASN C 1 76  ? -70.484 -30.103 49.777  1.00 39.10  ? 76  ASN C CG  1 
ATOM   4957  O  OD1 . ASN C 1 76  ? -71.007 -29.908 50.874  1.00 43.75  ? 76  ASN C OD1 1 
ATOM   4958  N  ND2 . ASN C 1 76  ? -70.772 -29.371 48.708  1.00 28.06  ? 76  ASN C ND2 1 
ATOM   4959  N  N   . ILE C 1 77  ? -68.959 -34.416 47.934  1.00 42.85  ? 77  ILE C N   1 
ATOM   4960  C  CA  . ILE C 1 77  ? -67.959 -35.359 47.423  1.00 37.15  ? 77  ILE C CA  1 
ATOM   4961  C  C   . ILE C 1 77  ? -68.533 -36.022 46.190  1.00 34.69  ? 77  ILE C C   1 
ATOM   4962  O  O   . ILE C 1 77  ? -69.729 -36.193 46.067  1.00 39.10  ? 77  ILE C O   1 
ATOM   4963  C  CB  . ILE C 1 77  ? -67.644 -36.405 48.481  1.00 44.47  ? 77  ILE C CB  1 
ATOM   4964  C  CG1 . ILE C 1 77  ? -67.157 -35.696 49.742  1.00 40.16  ? 77  ILE C CG1 1 
ATOM   4965  C  CG2 . ILE C 1 77  ? -66.618 -37.448 47.968  1.00 54.40  ? 77  ILE C CG2 1 
ATOM   4966  C  CD1 . ILE C 1 77  ? -65.905 -36.252 50.277  1.00 56.32  ? 77  ILE C CD1 1 
ATOM   4967  N  N   . VAL C 1 78  ? -67.655 -36.407 45.270  1.00 54.99  ? 78  VAL C N   1 
ATOM   4968  C  CA  . VAL C 1 78  ? -68.067 -37.154 44.088  1.00 45.37  ? 78  VAL C CA  1 
ATOM   4969  C  C   . VAL C 1 78  ? -68.386 -38.584 44.504  1.00 47.78  ? 78  VAL C C   1 
ATOM   4970  O  O   . VAL C 1 78  ? -67.502 -39.439 44.554  1.00 53.21  ? 78  VAL C O   1 
ATOM   4971  C  CB  . VAL C 1 78  ? -66.972 -37.164 43.011  1.00 46.50  ? 78  VAL C CB  1 
ATOM   4972  C  CG1 . VAL C 1 78  ? -67.378 -38.059 41.854  1.00 42.44  ? 78  VAL C CG1 1 
ATOM   4973  C  CG2 . VAL C 1 78  ? -66.694 -35.751 42.526  1.00 41.29  ? 78  VAL C CG2 1 
ATOM   4974  N  N   . ARG C 1 79  ? -69.654 -38.832 44.810  1.00 54.08  ? 79  ARG C N   1 
ATOM   4975  C  CA  . ARG C 1 79  ? -70.079 -40.108 45.374  1.00 45.90  ? 79  ARG C CA  1 
ATOM   4976  C  C   . ARG C 1 79  ? -70.137 -41.256 44.369  1.00 58.91  ? 79  ARG C C   1 
ATOM   4977  O  O   . ARG C 1 79  ? -70.293 -41.049 43.166  1.00 49.24  ? 79  ARG C O   1 
ATOM   4978  C  CB  . ARG C 1 79  ? -71.437 -39.955 46.065  1.00 51.82  ? 79  ARG C CB  1 
ATOM   4979  C  CG  . ARG C 1 79  ? -71.397 -39.104 47.322  1.00 50.56  ? 79  ARG C CG  1 
ATOM   4980  C  CD  . ARG C 1 79  ? -72.797 -38.748 47.794  1.00 62.30  ? 79  ARG C CD  1 
ATOM   4981  N  NE  . ARG C 1 79  ? -73.428 -37.755 46.933  1.00 66.63  ? 79  ARG C NE  1 
ATOM   4982  C  CZ  . ARG C 1 79  ? -74.514 -37.064 47.263  1.00 70.75  ? 79  ARG C CZ  1 
ATOM   4983  N  NH1 . ARG C 1 79  ? -75.094 -37.256 48.439  1.00 76.41  ? 79  ARG C NH1 1 
ATOM   4984  N  NH2 . ARG C 1 79  ? -75.021 -36.179 46.415  1.00 62.87  ? 79  ARG C NH2 1 
ATOM   4985  N  N   . PHE C 1 80  ? -70.014 -42.474 44.888  1.00 57.76  ? 80  PHE C N   1 
ATOM   4986  C  CA  . PHE C 1 80  ? -70.158 -43.683 44.089  1.00 22.84  ? 80  PHE C CA  1 
ATOM   4987  C  C   . PHE C 1 80  ? -71.644 -43.986 43.952  1.00 31.32  ? 80  PHE C C   1 
ATOM   4988  O  O   . PHE C 1 80  ? -72.454 -43.487 44.731  1.00 42.36  ? 80  PHE C O   1 
ATOM   4989  C  CB  . PHE C 1 80  ? -69.427 -44.846 44.760  1.00 41.14  ? 80  PHE C CB  1 
ATOM   4990  C  CG  . PHE C 1 80  ? -69.837 -46.199 44.256  1.00 28.21  ? 80  PHE C CG  1 
ATOM   4991  C  CD1 . PHE C 1 80  ? -70.908 -46.868 44.824  1.00 29.70  ? 80  PHE C CD1 1 
ATOM   4992  C  CD2 . PHE C 1 80  ? -69.149 -46.806 43.221  1.00 31.07  ? 80  PHE C CD2 1 
ATOM   4993  C  CE1 . PHE C 1 80  ? -71.286 -48.113 44.363  1.00 33.48  ? 80  PHE C CE1 1 
ATOM   4994  C  CE2 . PHE C 1 80  ? -69.523 -48.051 42.756  1.00 44.70  ? 80  PHE C CE2 1 
ATOM   4995  C  CZ  . PHE C 1 80  ? -70.594 -48.706 43.329  1.00 34.57  ? 80  PHE C CZ  1 
ATOM   4996  N  N   . LYS C 1 81  ? -72.006 -44.792 42.960  1.00 44.68  ? 81  LYS C N   1 
ATOM   4997  C  CA  . LYS C 1 81  ? -73.417 -45.055 42.693  1.00 57.19  ? 81  LYS C CA  1 
ATOM   4998  C  C   . LYS C 1 81  ? -73.754 -46.530 42.499  1.00 48.55  ? 81  LYS C C   1 
ATOM   4999  O  O   . LYS C 1 81  ? -74.724 -47.030 43.065  1.00 58.47  ? 81  LYS C O   1 
ATOM   5000  C  CB  . LYS C 1 81  ? -73.879 -44.259 41.469  1.00 57.68  ? 81  LYS C CB  1 
ATOM   5001  C  CG  . LYS C 1 81  ? -74.133 -42.787 41.743  1.00 66.17  ? 81  LYS C CG  1 
ATOM   5002  C  CD  . LYS C 1 81  ? -75.021 -42.174 40.674  1.00 65.63  ? 81  LYS C CD  1 
ATOM   5003  C  CE  . LYS C 1 81  ? -75.700 -40.911 41.177  1.00 72.75  ? 81  LYS C CE  1 
ATOM   5004  N  NZ  . LYS C 1 81  ? -76.831 -41.217 42.094  1.00 69.58  ? 81  LYS C NZ  1 
ATOM   5005  N  N   . GLU C 1 82  ? -72.953 -47.227 41.700  1.00 43.42  ? 82  GLU C N   1 
ATOM   5006  C  CA  . GLU C 1 82  ? -73.198 -48.642 41.452  1.00 45.26  ? 82  GLU C CA  1 
ATOM   5007  C  C   . GLU C 1 82  ? -72.247 -49.235 40.420  1.00 42.19  ? 82  GLU C C   1 
ATOM   5008  O  O   . GLU C 1 82  ? -71.784 -48.544 39.514  1.00 39.76  ? 82  GLU C O   1 
ATOM   5009  C  CB  . GLU C 1 82  ? -74.644 -48.857 41.003  1.00 28.12  ? 82  GLU C CB  1 
ATOM   5010  C  CG  . GLU C 1 82  ? -74.932 -48.354 39.598  1.00 41.88  ? 82  GLU C CG  1 
ATOM   5011  C  CD  . GLU C 1 82  ? -76.167 -48.990 38.991  1.00 65.90  ? 82  GLU C CD  1 
ATOM   5012  O  OE1 . GLU C 1 82  ? -77.026 -48.247 38.472  1.00 73.01  ? 82  GLU C OE1 1 
ATOM   5013  O  OE2 . GLU C 1 82  ? -76.278 -50.233 39.031  1.00 73.70  ? 82  GLU C OE2 1 
ATOM   5014  N  N   . VAL C 1 83  ? -71.969 -50.526 40.566  1.00 41.38  ? 83  VAL C N   1 
ATOM   5015  C  CA  . VAL C 1 83  ? -71.157 -51.259 39.597  1.00 30.80  ? 83  VAL C CA  1 
ATOM   5016  C  C   . VAL C 1 83  ? -72.085 -52.092 38.761  1.00 37.43  ? 83  VAL C C   1 
ATOM   5017  O  O   . VAL C 1 83  ? -73.100 -52.588 39.249  1.00 40.66  ? 83  VAL C O   1 
ATOM   5018  C  CB  . VAL C 1 83  ? -70.110 -52.179 40.218  1.00 34.04  ? 83  VAL C CB  1 
ATOM   5019  C  CG1 . VAL C 1 83  ? -68.817 -51.472 40.397  1.00 48.48  ? 83  VAL C CG1 1 
ATOM   5020  C  CG2 . VAL C 1 83  ? -70.598 -52.741 41.522  1.00 63.87  ? 83  VAL C CG2 1 
ATOM   5021  N  N   . ILE C 1 84  ? -71.727 -52.237 37.490  1.00 43.54  ? 84  ILE C N   1 
ATOM   5022  C  CA  . ILE C 1 84  ? -72.479 -53.061 36.536  1.00 49.52  ? 84  ILE C CA  1 
ATOM   5023  C  C   . ILE C 1 84  ? -71.494 -53.946 35.801  1.00 49.64  ? 84  ILE C C   1 
ATOM   5024  O  O   . ILE C 1 84  ? -70.392 -53.516 35.467  1.00 54.56  ? 84  ILE C O   1 
ATOM   5025  C  CB  . ILE C 1 84  ? -73.154 -52.218 35.467  1.00 40.41  ? 84  ILE C CB  1 
ATOM   5026  C  CG1 . ILE C 1 84  ? -73.936 -51.079 36.092  1.00 42.41  ? 84  ILE C CG1 1 
ATOM   5027  C  CG2 . ILE C 1 84  ? -74.066 -53.057 34.641  1.00 33.15  ? 84  ILE C CG2 1 
ATOM   5028  C  CD1 . ILE C 1 84  ? -74.754 -50.318 35.092  1.00 30.99  ? 84  ILE C CD1 1 
ATOM   5029  N  N   . LEU C 1 85  ? -71.865 -55.187 35.537  1.00 57.01  ? 85  LEU C N   1 
ATOM   5030  C  CA  . LEU C 1 85  ? -70.910 -56.021 34.838  1.00 64.04  ? 85  LEU C CA  1 
ATOM   5031  C  C   . LEU C 1 85  ? -71.411 -56.210 33.423  1.00 66.67  ? 85  LEU C C   1 
ATOM   5032  O  O   . LEU C 1 85  ? -72.617 -56.364 33.189  1.00 51.35  ? 85  LEU C O   1 
ATOM   5033  C  CB  . LEU C 1 85  ? -70.576 -57.310 35.644  1.00 57.37  ? 85  LEU C CB  1 
ATOM   5034  C  CG  . LEU C 1 85  ? -70.891 -58.780 35.393  1.00 43.51  ? 85  LEU C CG  1 
ATOM   5035  C  CD1 . LEU C 1 85  ? -72.155 -58.991 34.607  1.00 56.47  ? 85  LEU C CD1 1 
ATOM   5036  C  CD2 . LEU C 1 85  ? -69.724 -59.394 34.698  1.00 50.55  ? 85  LEU C CD2 1 
ATOM   5037  N  N   . THR C 1 86  ? -70.484 -56.195 32.472  1.00 71.90  ? 86  THR C N   1 
ATOM   5038  C  CA  . THR C 1 86  ? -70.824 -56.373 31.066  1.00 74.27  ? 86  THR C CA  1 
ATOM   5039  C  C   . THR C 1 86  ? -69.966 -57.466 30.438  1.00 69.10  ? 86  THR C C   1 
ATOM   5040  O  O   . THR C 1 86  ? -68.809 -57.651 30.812  1.00 73.19  ? 86  THR C O   1 
ATOM   5041  C  CB  . THR C 1 86  ? -70.641 -55.067 30.271  1.00 71.58  ? 86  THR C CB  1 
ATOM   5042  O  OG1 . THR C 1 86  ? -69.247 -54.743 30.192  1.00 58.80  ? 86  THR C OG1 1 
ATOM   5043  C  CG2 . THR C 1 86  ? -71.385 -53.925 30.943  1.00 60.61  ? 86  THR C CG2 1 
ATOM   5044  N  N   . PRO C 1 87  ? -70.542 -58.188 29.483  1.00 70.00  ? 87  PRO C N   1 
ATOM   5045  C  CA  . PRO C 1 87  ? -69.828 -59.271 28.801  1.00 70.71  ? 87  PRO C CA  1 
ATOM   5046  C  C   . PRO C 1 87  ? -68.427 -58.847 28.375  1.00 77.99  ? 87  PRO C C   1 
ATOM   5047  O  O   . PRO C 1 87  ? -67.683 -59.655 27.822  1.00 84.75  ? 87  PRO C O   1 
ATOM   5048  C  CB  . PRO C 1 87  ? -70.693 -59.531 27.567  1.00 66.71  ? 87  PRO C CB  1 
ATOM   5049  C  CG  . PRO C 1 87  ? -72.060 -59.119 27.979  1.00 74.55  ? 87  PRO C CG  1 
ATOM   5050  C  CD  . PRO C 1 87  ? -71.876 -57.952 28.904  1.00 70.07  ? 87  PRO C CD  1 
ATOM   5051  N  N   . THR C 1 88  ? -68.082 -57.591 28.635  1.00 80.38  ? 88  THR C N   1 
ATOM   5052  C  CA  . THR C 1 88  ? -66.782 -57.056 28.252  1.00 82.48  ? 88  THR C CA  1 
ATOM   5053  C  C   . THR C 1 88  ? -65.902 -56.797 29.469  1.00 75.22  ? 88  THR C C   1 
ATOM   5054  O  O   . THR C 1 88  ? -64.788 -57.310 29.561  1.00 72.45  ? 88  THR C O   1 
ATOM   5055  C  CB  . THR C 1 88  ? -66.928 -55.747 27.456  1.00 92.03  ? 88  THR C CB  1 
ATOM   5056  O  OG1 . THR C 1 88  ? -67.808 -55.956 26.345  1.00 97.14  ? 88  THR C OG1 1 
ATOM   5057  C  CG2 . THR C 1 88  ? -65.574 -55.280 26.946  1.00 88.05  ? 88  THR C CG2 1 
ATOM   5058  N  N   . HIS C 1 89  ? -66.407 -55.994 30.400  1.00 81.92  ? 89  HIS C N   1 
ATOM   5059  C  CA  . HIS C 1 89  ? -65.649 -55.643 31.596  1.00 75.69  ? 89  HIS C CA  1 
ATOM   5060  C  C   . HIS C 1 89  ? -66.551 -55.134 32.715  1.00 57.27  ? 89  HIS C C   1 
ATOM   5061  O  O   . HIS C 1 89  ? -67.775 -55.224 32.633  1.00 49.28  ? 89  HIS C O   1 
ATOM   5062  C  CB  . HIS C 1 89  ? -64.578 -54.598 31.273  1.00 77.70  ? 89  HIS C CB  1 
ATOM   5063  C  CG  . HIS C 1 89  ? -64.687 -54.023 29.895  1.00 69.80  ? 89  HIS C CG  1 
ATOM   5064  N  ND1 . HIS C 1 89  ? -63.605 -53.512 29.214  1.00 59.57  ? 89  HIS C ND1 1 
ATOM   5065  C  CD2 . HIS C 1 89  ? -65.753 -53.875 29.072  1.00 60.91  ? 89  HIS C CD2 1 
ATOM   5066  C  CE1 . HIS C 1 89  ? -63.996 -53.076 28.030  1.00 60.56  ? 89  HIS C CE1 1 
ATOM   5067  N  NE2 . HIS C 1 89  ? -65.296 -53.284 27.919  1.00 65.25  ? 89  HIS C NE2 1 
ATOM   5068  N  N   . LEU C 1 90  ? -65.930 -54.600 33.762  1.00 58.00  ? 90  LEU C N   1 
ATOM   5069  C  CA  . LEU C 1 90  ? -66.650 -54.078 34.905  1.00 52.35  ? 90  LEU C CA  1 
ATOM   5070  C  C   . LEU C 1 90  ? -66.877 -52.603 34.636  1.00 43.94  ? 90  LEU C C   1 
ATOM   5071  O  O   . LEU C 1 90  ? -65.936 -51.877 34.304  1.00 50.29  ? 90  LEU C O   1 
ATOM   5072  C  CB  . LEU C 1 90  ? -65.781 -54.237 36.140  1.00 48.56  ? 90  LEU C CB  1 
ATOM   5073  C  CG  . LEU C 1 90  ? -66.274 -53.608 37.424  1.00 44.21  ? 90  LEU C CG  1 
ATOM   5074  C  CD1 . LEU C 1 90  ? -67.538 -54.279 37.872  1.00 30.14  ? 90  LEU C CD1 1 
ATOM   5075  C  CD2 . LEU C 1 90  ? -65.188 -53.704 38.477  1.00 38.53  ? 90  LEU C CD2 1 
ATOM   5076  N  N   . ALA C 1 91  ? -68.122 -52.168 34.766  1.00 43.71  ? 91  ALA C N   1 
ATOM   5077  C  CA  . ALA C 1 91  ? -68.467 -50.741 34.729  1.00 52.56  ? 91  ALA C CA  1 
ATOM   5078  C  C   . ALA C 1 91  ? -68.596 -50.115 36.121  1.00 38.01  ? 91  ALA C C   1 
ATOM   5079  O  O   . ALA C 1 91  ? -69.375 -50.583 36.946  1.00 47.18  ? 91  ALA C O   1 
ATOM   5080  C  CB  . ALA C 1 91  ? -69.775 -50.556 33.966  1.00 51.29  ? 91  ALA C CB  1 
ATOM   5081  N  N   . ILE C 1 92  ? -67.850 -49.050 36.378  1.00 43.47  ? 92  ILE C N   1 
ATOM   5082  C  CA  . ILE C 1 92  ? -68.012 -48.280 37.608  1.00 35.04  ? 92  ILE C CA  1 
ATOM   5083  C  C   . ILE C 1 92  ? -68.739 -46.947 37.337  1.00 49.32  ? 92  ILE C C   1 
ATOM   5084  O  O   . ILE C 1 92  ? -68.222 -46.075 36.636  1.00 36.84  ? 92  ILE C O   1 
ATOM   5085  C  CB  . ILE C 1 92  ? -66.656 -48.012 38.234  1.00 42.35  ? 92  ILE C CB  1 
ATOM   5086  C  CG1 . ILE C 1 92  ? -65.882 -49.328 38.354  1.00 40.55  ? 92  ILE C CG1 1 
ATOM   5087  C  CG2 . ILE C 1 92  ? -66.809 -47.314 39.612  1.00 66.21  ? 92  ILE C CG2 1 
ATOM   5088  C  CD1 . ILE C 1 92  ? -64.436 -49.127 38.673  1.00 37.68  ? 92  ILE C CD1 1 
ATOM   5089  N  N   . VAL C 1 93  ? -69.946 -46.810 37.884  1.00 54.02  ? 93  VAL C N   1 
ATOM   5090  C  CA  . VAL C 1 93  ? -70.773 -45.635 37.676  1.00 44.47  ? 93  VAL C CA  1 
ATOM   5091  C  C   . VAL C 1 93  ? -70.737 -44.668 38.869  1.00 45.40  ? 93  VAL C C   1 
ATOM   5092  O  O   . VAL C 1 93  ? -70.981 -45.055 40.010  1.00 39.95  ? 93  VAL C O   1 
ATOM   5093  C  CB  . VAL C 1 93  ? -72.219 -46.069 37.417  1.00 39.02  ? 93  VAL C CB  1 
ATOM   5094  C  CG1 . VAL C 1 93  ? -73.119 -44.883 37.102  1.00 23.46  ? 93  VAL C CG1 1 
ATOM   5095  C  CG2 . VAL C 1 93  ? -72.242 -47.070 36.276  1.00 42.78  ? 93  VAL C CG2 1 
ATOM   5096  N  N   . MET C 1 94  ? -70.464 -43.397 38.602  1.00 46.15  ? 94  MET C N   1 
ATOM   5097  C  CA  . MET C 1 94  ? -70.407 -42.411 39.680  1.00 56.74  ? 94  MET C CA  1 
ATOM   5098  C  C   . MET C 1 94  ? -70.961 -41.055 39.268  1.00 48.33  ? 94  MET C C   1 
ATOM   5099  O  O   . MET C 1 94  ? -71.146 -40.796 38.092  1.00 51.87  ? 94  MET C O   1 
ATOM   5100  C  CB  . MET C 1 94  ? -68.971 -42.241 40.121  1.00 62.74  ? 94  MET C CB  1 
ATOM   5101  C  CG  . MET C 1 94  ? -68.168 -41.579 39.058  1.00 66.25  ? 94  MET C CG  1 
ATOM   5102  S  SD  . MET C 1 94  ? -66.408 -41.805 39.311  1.00 88.81  ? 94  MET C SD  1 
ATOM   5103  C  CE  . MET C 1 94  ? -66.219 -43.511 38.742  1.00 58.92  ? 94  MET C CE  1 
ATOM   5104  N  N   . GLU C 1 95  ? -71.219 -40.191 40.241  1.00 36.74  ? 95  GLU C N   1 
ATOM   5105  C  CA  . GLU C 1 95  ? -71.732 -38.865 39.947  1.00 38.90  ? 95  GLU C CA  1 
ATOM   5106  C  C   . GLU C 1 95  ? -70.813 -38.132 38.970  1.00 37.43  ? 95  GLU C C   1 
ATOM   5107  O  O   . GLU C 1 95  ? -69.596 -38.306 38.994  1.00 29.80  ? 95  GLU C O   1 
ATOM   5108  C  CB  . GLU C 1 95  ? -71.814 -38.043 41.217  1.00 35.90  ? 95  GLU C CB  1 
ATOM   5109  C  CG  . GLU C 1 95  ? -73.037 -38.240 42.075  1.00 50.09  ? 95  GLU C CG  1 
ATOM   5110  C  CD  . GLU C 1 95  ? -73.034 -37.291 43.274  1.00 72.94  ? 95  GLU C CD  1 
ATOM   5111  O  OE1 . GLU C 1 95  ? -71.933 -36.963 43.776  1.00 62.89  ? 95  GLU C OE1 1 
ATOM   5112  O  OE2 . GLU C 1 95  ? -74.131 -36.866 43.699  1.00 92.38  ? 95  GLU C OE2 1 
ATOM   5113  N  N   . TYR C 1 96  ? -71.392 -37.306 38.114  1.00 30.50  ? 96  TYR C N   1 
ATOM   5114  C  CA  . TYR C 1 96  ? -70.583 -36.493 37.220  1.00 32.53  ? 96  TYR C CA  1 
ATOM   5115  C  C   . TYR C 1 96  ? -70.781 -35.009 37.568  1.00 40.00  ? 96  TYR C C   1 
ATOM   5116  O  O   . TYR C 1 96  ? -71.913 -34.542 37.710  1.00 30.03  ? 96  TYR C O   1 
ATOM   5117  C  CB  . TYR C 1 96  ? -70.981 -36.767 35.764  1.00 35.36  ? 96  TYR C CB  1 
ATOM   5118  C  CG  . TYR C 1 96  ? -70.265 -35.889 34.762  1.00 41.49  ? 96  TYR C CG  1 
ATOM   5119  C  CD1 . TYR C 1 96  ? -68.893 -35.952 34.639  1.00 37.09  ? 96  TYR C CD1 1 
ATOM   5120  C  CD2 . TYR C 1 96  ? -70.964 -34.995 33.935  1.00 34.92  ? 96  TYR C CD2 1 
ATOM   5121  C  CE1 . TYR C 1 96  ? -68.225 -35.149 33.730  1.00 45.23  ? 96  TYR C CE1 1 
ATOM   5122  C  CE2 . TYR C 1 96  ? -70.309 -34.200 33.012  1.00 31.01  ? 96  TYR C CE2 1 
ATOM   5123  C  CZ  . TYR C 1 96  ? -68.934 -34.271 32.923  1.00 45.16  ? 96  TYR C CZ  1 
ATOM   5124  O  OH  . TYR C 1 96  ? -68.254 -33.469 32.021  1.00 38.61  ? 96  TYR C OH  1 
ATOM   5125  N  N   . ALA C 1 97  ? -69.707 -34.247 37.712  1.00 34.84  ? 97  ALA C N   1 
ATOM   5126  C  CA  . ALA C 1 97  ? -69.885 -32.789 37.953  1.00 32.40  ? 97  ALA C CA  1 
ATOM   5127  C  C   . ALA C 1 97  ? -69.911 -31.990 36.637  1.00 30.82  ? 97  ALA C C   1 
ATOM   5128  O  O   . ALA C 1 97  ? -68.874 -31.787 36.001  1.00 36.36  ? 97  ALA C O   1 
ATOM   5129  C  CB  . ALA C 1 97  ? -68.823 -32.250 38.886  1.00 31.37  ? 97  ALA C CB  1 
ATOM   5130  N  N   . SER C 1 98  ? -71.101 -31.556 36.231  1.00 29.87  ? 98  SER C N   1 
ATOM   5131  C  CA  . SER C 1 98  ? -71.342 -31.070 34.867  1.00 25.01  ? 98  SER C CA  1 
ATOM   5132  C  C   . SER C 1 98  ? -71.235 -29.557 34.666  1.00 38.56  ? 98  SER C C   1 
ATOM   5133  O  O   . SER C 1 98  ? -71.543 -29.065 33.582  1.00 43.08  ? 98  SER C O   1 
ATOM   5134  C  CB  . SER C 1 98  ? -72.743 -31.459 34.462  1.00 32.05  ? 98  SER C CB  1 
ATOM   5135  O  OG  . SER C 1 98  ? -73.632 -31.226 35.532  1.00 44.15  ? 98  SER C OG  1 
ATOM   5136  N  N   . GLY C 1 99  ? -70.832 -28.822 35.699  1.00 33.33  ? 99  GLY C N   1 
ATOM   5137  C  CA  . GLY C 1 99  ? -70.670 -27.386 35.572  1.00 32.65  ? 99  GLY C CA  1 
ATOM   5138  C  C   . GLY C 1 99  ? -69.237 -26.907 35.703  1.00 29.68  ? 99  GLY C C   1 
ATOM   5139  O  O   . GLY C 1 99  ? -69.011 -25.765 36.072  1.00 50.42  ? 99  GLY C O   1 
ATOM   5140  N  N   . GLY C 1 100 ? -68.270 -27.782 35.442  1.00 39.65  ? 100 GLY C N   1 
ATOM   5141  C  CA  . GLY C 1 100 ? -66.875 -27.376 35.398  1.00 31.61  ? 100 GLY C CA  1 
ATOM   5142  C  C   . GLY C 1 100 ? -66.166 -27.178 36.722  1.00 30.36  ? 100 GLY C C   1 
ATOM   5143  O  O   . GLY C 1 100 ? -66.737 -27.452 37.779  1.00 30.67  ? 100 GLY C O   1 
ATOM   5144  N  N   . GLU C 1 101 ? -64.921 -26.697 36.651  1.00 30.95  ? 101 GLU C N   1 
ATOM   5145  C  CA  . GLU C 1 101 ? -64.119 -26.298 37.830  1.00 35.51  ? 101 GLU C CA  1 
ATOM   5146  C  C   . GLU C 1 101 ? -64.591 -25.028 38.572  1.00 35.49  ? 101 GLU C C   1 
ATOM   5147  O  O   . GLU C 1 101 ? -65.205 -24.164 37.955  1.00 41.71  ? 101 GLU C O   1 
ATOM   5148  C  CB  . GLU C 1 101 ? -62.681 -26.094 37.391  1.00 33.75  ? 101 GLU C CB  1 
ATOM   5149  C  CG  . GLU C 1 101 ? -62.183 -27.252 36.556  1.00 35.43  ? 101 GLU C CG  1 
ATOM   5150  C  CD  . GLU C 1 101 ? -60.703 -27.140 36.308  1.00 57.76  ? 101 GLU C CD  1 
ATOM   5151  O  OE1 . GLU C 1 101 ? -60.274 -26.130 35.684  1.00 67.81  ? 101 GLU C OE1 1 
ATOM   5152  O  OE2 . GLU C 1 101 ? -59.968 -28.040 36.771  1.00 64.83  ? 101 GLU C OE2 1 
ATOM   5153  N  N   . LEU C 1 102 ? -64.313 -24.937 39.884  1.00 41.94  ? 102 LEU C N   1 
ATOM   5154  C  CA  . LEU C 1 102 ? -64.611 -23.753 40.724  1.00 41.66  ? 102 LEU C CA  1 
ATOM   5155  C  C   . LEU C 1 102 ? -63.763 -22.586 40.276  1.00 39.44  ? 102 LEU C C   1 
ATOM   5156  O  O   . LEU C 1 102 ? -64.256 -21.470 40.198  1.00 40.56  ? 102 LEU C O   1 
ATOM   5157  C  CB  . LEU C 1 102 ? -64.329 -24.017 42.220  1.00 27.93  ? 102 LEU C CB  1 
ATOM   5158  C  CG  . LEU C 1 102 ? -64.378 -22.785 43.159  1.00 18.58  ? 102 LEU C CG  1 
ATOM   5159  C  CD1 . LEU C 1 102 ? -65.772 -22.139 43.201  1.00 16.87  ? 102 LEU C CD1 1 
ATOM   5160  C  CD2 . LEU C 1 102 ? -63.939 -23.128 44.576  1.00 21.18  ? 102 LEU C CD2 1 
ATOM   5161  N  N   . PHE C 1 103 ? -62.494 -22.864 39.982  1.00 28.15  ? 103 PHE C N   1 
ATOM   5162  C  CA  . PHE C 1 103 ? -61.529 -21.825 39.659  1.00 39.99  ? 103 PHE C CA  1 
ATOM   5163  C  C   . PHE C 1 103 ? -61.969 -21.120 38.387  1.00 43.13  ? 103 PHE C C   1 
ATOM   5164  O  O   . PHE C 1 103 ? -61.789 -19.909 38.229  1.00 42.99  ? 103 PHE C O   1 
ATOM   5165  C  CB  . PHE C 1 103 ? -60.124 -22.431 39.515  1.00 39.22  ? 103 PHE C CB  1 
ATOM   5166  C  CG  . PHE C 1 103 ? -59.066 -21.445 39.113  1.00 61.35  ? 103 PHE C CG  1 
ATOM   5167  C  CD1 . PHE C 1 103 ? -58.528 -21.495 37.836  1.00 61.56  ? 103 PHE C CD1 1 
ATOM   5168  C  CD2 . PHE C 1 103 ? -58.607 -20.462 40.016  1.00 70.95  ? 103 PHE C CD2 1 
ATOM   5169  C  CE1 . PHE C 1 103 ? -57.537 -20.589 37.452  1.00 73.66  ? 103 PHE C CE1 1 
ATOM   5170  C  CE2 . PHE C 1 103 ? -57.620 -19.541 39.645  1.00 67.80  ? 103 PHE C CE2 1 
ATOM   5171  C  CZ  . PHE C 1 103 ? -57.077 -19.609 38.357  1.00 67.30  ? 103 PHE C CZ  1 
ATOM   5172  N  N   . GLU C 1 104 ? -62.533 -21.905 37.475  1.00 31.87  ? 104 GLU C N   1 
ATOM   5173  C  CA  . GLU C 1 104 ? -63.000 -21.403 36.193  1.00 37.49  ? 104 GLU C CA  1 
ATOM   5174  C  C   . GLU C 1 104 ? -64.142 -20.419 36.389  1.00 39.19  ? 104 GLU C C   1 
ATOM   5175  O  O   . GLU C 1 104 ? -64.230 -19.413 35.687  1.00 45.16  ? 104 GLU C O   1 
ATOM   5176  C  CB  . GLU C 1 104 ? -63.447 -22.560 35.299  1.00 40.40  ? 104 GLU C CB  1 
ATOM   5177  C  CG  . GLU C 1 104 ? -63.681 -22.170 33.848  1.00 65.92  ? 104 GLU C CG  1 
ATOM   5178  C  CD  . GLU C 1 104 ? -62.425 -21.653 33.175  1.00 84.49  ? 104 GLU C CD  1 
ATOM   5179  O  OE1 . GLU C 1 104 ? -62.545 -20.927 32.166  1.00 77.43  ? 104 GLU C OE1 1 
ATOM   5180  O  OE2 . GLU C 1 104 ? -61.317 -21.973 33.657  1.00 92.39  ? 104 GLU C OE2 1 
ATOM   5181  N  N   . ARG C 1 105 ? -65.006 -20.714 37.354  1.00 38.54  ? 105 ARG C N   1 
ATOM   5182  C  CA  . ARG C 1 105 ? -66.119 -19.834 37.672  1.00 26.82  ? 105 ARG C CA  1 
ATOM   5183  C  C   . ARG C 1 105 ? -65.623 -18.562 38.345  1.00 36.33  ? 105 ARG C C   1 
ATOM   5184  O  O   . ARG C 1 105 ? -66.208 -17.494 38.169  1.00 36.92  ? 105 ARG C O   1 
ATOM   5185  C  CB  . ARG C 1 105 ? -67.132 -20.544 38.573  1.00 31.30  ? 105 ARG C CB  1 
ATOM   5186  C  CG  . ARG C 1 105 ? -68.282 -19.657 39.021  1.00 34.43  ? 105 ARG C CG  1 
ATOM   5187  C  CD  . ARG C 1 105 ? -69.289 -20.430 39.854  1.00 37.65  ? 105 ARG C CD  1 
ATOM   5188  N  NE  . ARG C 1 105 ? -70.653 -20.245 39.369  1.00 54.07  ? 105 ARG C NE  1 
ATOM   5189  C  CZ  . ARG C 1 105 ? -71.511 -19.362 39.869  1.00 46.00  ? 105 ARG C CZ  1 
ATOM   5190  N  NH1 . ARG C 1 105 ? -71.149 -18.578 40.874  1.00 52.67  ? 105 ARG C NH1 1 
ATOM   5191  N  NH2 . ARG C 1 105 ? -72.733 -19.264 39.365  1.00 39.27  ? 105 ARG C NH2 1 
ATOM   5192  N  N   . ILE C 1 106 ? -64.545 -18.672 39.116  1.00 33.34  ? 106 ILE C N   1 
ATOM   5193  C  CA  . ILE C 1 106 ? -64.022 -17.521 39.796  1.00 40.79  ? 106 ILE C CA  1 
ATOM   5194  C  C   . ILE C 1 106 ? -63.472 -16.545 38.779  1.00 47.19  ? 106 ILE C C   1 
ATOM   5195  O  O   . ILE C 1 106 ? -63.795 -15.344 38.795  1.00 40.41  ? 106 ILE C O   1 
ATOM   5196  C  CB  . ILE C 1 106 ? -62.926 -17.884 40.759  1.00 32.33  ? 106 ILE C CB  1 
ATOM   5197  C  CG1 . ILE C 1 106 ? -63.503 -18.660 41.940  1.00 39.41  ? 106 ILE C CG1 1 
ATOM   5198  C  CG2 . ILE C 1 106 ? -62.266 -16.628 41.271  1.00 23.88  ? 106 ILE C CG2 1 
ATOM   5199  C  CD1 . ILE C 1 106 ? -62.411 -19.173 42.865  1.00 32.03  ? 106 ILE C CD1 1 
ATOM   5200  N  N   . CYS C 1 107 ? -62.642 -17.027 37.869  1.00 35.52  ? 107 CYS C N   1 
ATOM   5201  C  CA  . CYS C 1 107 ? -62.071 -16.041 36.979  1.00 63.77  ? 107 CYS C CA  1 
ATOM   5202  C  C   . CYS C 1 107 ? -62.994 -15.560 35.841  1.00 62.42  ? 107 CYS C C   1 
ATOM   5203  O  O   . CYS C 1 107 ? -62.718 -14.523 35.253  1.00 64.84  ? 107 CYS C O   1 
ATOM   5204  C  CB  . CYS C 1 107 ? -60.634 -16.365 36.541  1.00 76.76  ? 107 CYS C CB  1 
ATOM   5205  S  SG  . CYS C 1 107 ? -60.345 -17.993 36.008  1.00 68.32  ? 107 CYS C SG  1 
ATOM   5206  N  N   . ASN C 1 108 ? -64.095 -16.263 35.578  1.00 46.42  ? 108 ASN C N   1 
ATOM   5207  C  CA  . ASN C 1 108 ? -65.119 -15.701 34.707  1.00 43.57  ? 108 ASN C CA  1 
ATOM   5208  C  C   . ASN C 1 108 ? -65.858 -14.549 35.363  1.00 47.95  ? 108 ASN C C   1 
ATOM   5209  O  O   . ASN C 1 108 ? -66.331 -13.627 34.694  1.00 40.07  ? 108 ASN C O   1 
ATOM   5210  C  CB  . ASN C 1 108 ? -66.131 -16.753 34.295  1.00 44.50  ? 108 ASN C CB  1 
ATOM   5211  C  CG  . ASN C 1 108 ? -65.600 -17.658 33.198  1.00 52.07  ? 108 ASN C CG  1 
ATOM   5212  O  OD1 . ASN C 1 108 ? -64.499 -17.453 32.674  1.00 56.24  ? 108 ASN C OD1 1 
ATOM   5213  N  ND2 . ASN C 1 108 ? -66.375 -18.670 32.852  1.00 44.52  ? 108 ASN C ND2 1 
ATOM   5214  N  N   . ALA C 1 109 ? -65.979 -14.613 36.679  1.00 47.30  ? 109 ALA C N   1 
ATOM   5215  C  CA  . ALA C 1 109 ? -66.672 -13.577 37.423  1.00 36.78  ? 109 ALA C CA  1 
ATOM   5216  C  C   . ALA C 1 109 ? -65.711 -12.463 37.850  1.00 41.24  ? 109 ALA C C   1 
ATOM   5217  O  O   . ALA C 1 109 ? -66.132 -11.455 38.420  1.00 45.44  ? 109 ALA C O   1 
ATOM   5218  C  CB  . ALA C 1 109 ? -67.329 -14.207 38.662  1.00 24.12  ? 109 ALA C CB  1 
ATOM   5219  N  N   . GLY C 1 110 ? -64.423 -12.652 37.592  1.00 39.22  ? 110 GLY C N   1 
ATOM   5220  C  CA  . GLY C 1 110 ? -63.413 -11.788 38.151  1.00 27.80  ? 110 GLY C CA  1 
ATOM   5221  C  C   . GLY C 1 110 ? -63.086 -12.149 39.595  1.00 33.84  ? 110 GLY C C   1 
ATOM   5222  O  O   . GLY C 1 110 ? -61.953 -12.551 39.906  1.00 27.71  ? 110 GLY C O   1 
ATOM   5223  N  N   . ARG C 1 111 ? -64.088 -12.047 40.465  1.00 25.11  ? 111 ARG C N   1 
ATOM   5224  C  CA  . ARG C 1 111 ? -63.969 -12.453 41.863  1.00 16.25  ? 111 ARG C CA  1 
ATOM   5225  C  C   . ARG C 1 111 ? -65.369 -12.503 42.465  1.00 27.19  ? 111 ARG C C   1 
ATOM   5226  O  O   . ARG C 1 111 ? -66.244 -11.751 42.041  1.00 32.73  ? 111 ARG C O   1 
ATOM   5227  C  CB  . ARG C 1 111 ? -63.090 -11.474 42.639  1.00 28.10  ? 111 ARG C CB  1 
ATOM   5228  C  CG  . ARG C 1 111 ? -63.752 -10.136 42.923  1.00 23.91  ? 111 ARG C CG  1 
ATOM   5229  C  CD  . ARG C 1 111 ? -62.837 -9.228  43.726  1.00 43.06  ? 111 ARG C CD  1 
ATOM   5230  N  NE  . ARG C 1 111 ? -63.122 -7.816  43.492  1.00 50.95  ? 111 ARG C NE  1 
ATOM   5231  C  CZ  . ARG C 1 111 ? -63.914 -7.076  44.262  1.00 49.50  ? 111 ARG C CZ  1 
ATOM   5232  N  NH1 . ARG C 1 111 ? -64.116 -5.798  43.973  1.00 45.44  ? 111 ARG C NH1 1 
ATOM   5233  N  NH2 . ARG C 1 111 ? -64.504 -7.612  45.321  1.00 49.45  ? 111 ARG C NH2 1 
ATOM   5234  N  N   . PHE C 1 112 ? -65.600 -13.384 43.437  1.00 31.61  ? 112 PHE C N   1 
ATOM   5235  C  CA  . PHE C 1 112 ? -66.967 -13.495 43.988  1.00 31.94  ? 112 PHE C CA  1 
ATOM   5236  C  C   . PHE C 1 112 ? -67.392 -12.406 44.990  1.00 34.13  ? 112 PHE C C   1 
ATOM   5237  O  O   . PHE C 1 112 ? -66.574 -11.788 45.649  1.00 30.10  ? 112 PHE C O   1 
ATOM   5238  C  CB  . PHE C 1 112 ? -67.145 -14.848 44.659  1.00 29.09  ? 112 PHE C CB  1 
ATOM   5239  C  CG  . PHE C 1 112 ? -67.130 -16.001 43.705  1.00 38.93  ? 112 PHE C CG  1 
ATOM   5240  C  CD1 . PHE C 1 112 ? -67.309 -15.806 42.344  1.00 33.99  ? 112 PHE C CD1 1 
ATOM   5241  C  CD2 . PHE C 1 112 ? -66.933 -17.292 44.166  1.00 39.71  ? 112 PHE C CD2 1 
ATOM   5242  C  CE1 . PHE C 1 112 ? -67.300 -16.899 41.465  1.00 31.76  ? 112 PHE C CE1 1 
ATOM   5243  C  CE2 . PHE C 1 112 ? -66.926 -18.386 43.273  1.00 36.91  ? 112 PHE C CE2 1 
ATOM   5244  C  CZ  . PHE C 1 112 ? -67.103 -18.183 41.946  1.00 39.23  ? 112 PHE C CZ  1 
ATOM   5245  N  N   . SER C 1 113 ? -68.684 -12.174 45.133  1.00 42.83  ? 113 SER C N   1 
ATOM   5246  C  CA  . SER C 1 113 ? -69.126 -11.349 46.244  1.00 27.73  ? 113 SER C CA  1 
ATOM   5247  C  C   . SER C 1 113 ? -68.825 -12.093 47.558  1.00 35.23  ? 113 SER C C   1 
ATOM   5248  O  O   . SER C 1 113 ? -68.665 -13.309 47.565  1.00 54.01  ? 113 SER C O   1 
ATOM   5249  C  CB  . SER C 1 113 ? -70.619 -11.118 46.128  1.00 21.19  ? 113 SER C CB  1 
ATOM   5250  O  OG  . SER C 1 113 ? -71.325 -12.259 46.576  1.00 36.41  ? 113 SER C OG  1 
ATOM   5251  N  N   . GLU C 1 114 ? -68.776 -11.378 48.669  1.00 33.38  ? 114 GLU C N   1 
ATOM   5252  C  CA  . GLU C 1 114 ? -68.505 -12.007 49.933  1.00 38.67  ? 114 GLU C CA  1 
ATOM   5253  C  C   . GLU C 1 114 ? -69.504 -13.144 50.206  1.00 38.77  ? 114 GLU C C   1 
ATOM   5254  O  O   . GLU C 1 114 ? -69.109 -14.210 50.638  1.00 46.86  ? 114 GLU C O   1 
ATOM   5255  C  CB  . GLU C 1 114 ? -68.472 -10.979 51.082  1.00 35.31  ? 114 GLU C CB  1 
ATOM   5256  C  CG  . GLU C 1 114 ? -68.215 -11.597 52.456  1.00 44.65  ? 114 GLU C CG  1 
ATOM   5257  C  CD  . GLU C 1 114 ? -67.843 -10.601 53.523  1.00 41.75  ? 114 GLU C CD  1 
ATOM   5258  O  OE1 . GLU C 1 114 ? -68.130 -10.855 54.698  1.00 45.49  ? 114 GLU C OE1 1 
ATOM   5259  O  OE2 . GLU C 1 114 ? -67.255 -9.569  53.196  1.00 50.89  ? 114 GLU C OE2 1 
ATOM   5260  N  N   . ASP C 1 115 ? -70.781 -12.909 49.939  1.00 33.27  ? 115 ASP C N   1 
ATOM   5261  C  CA  . ASP C 1 115 ? -71.843 -13.841 50.273  1.00 38.55  ? 115 ASP C CA  1 
ATOM   5262  C  C   . ASP C 1 115 ? -71.735 -15.111 49.451  1.00 46.41  ? 115 ASP C C   1 
ATOM   5263  O  O   . ASP C 1 115 ? -72.017 -16.203 49.922  1.00 42.95  ? 115 ASP C O   1 
ATOM   5264  C  CB  . ASP C 1 115 ? -73.214 -13.218 50.032  1.00 34.78  ? 115 ASP C CB  1 
ATOM   5265  C  CG  . ASP C 1 115 ? -73.648 -12.347 51.167  1.00 57.43  ? 115 ASP C CG  1 
ATOM   5266  O  OD1 . ASP C 1 115 ? -74.027 -11.196 50.898  1.00 75.52  ? 115 ASP C OD1 1 
ATOM   5267  O  OD2 . ASP C 1 115 ? -73.599 -12.803 52.327  1.00 67.46  ? 115 ASP C OD2 1 
ATOM   5268  N  N   . GLU C 1 116 ? -71.337 -14.953 48.208  1.00 48.54  ? 116 GLU C N   1 
ATOM   5269  C  CA  . GLU C 1 116 ? -71.164 -16.065 47.338  1.00 40.76  ? 116 GLU C CA  1 
ATOM   5270  C  C   . GLU C 1 116 ? -69.932 -16.867 47.740  1.00 46.22  ? 116 GLU C C   1 
ATOM   5271  O  O   . GLU C 1 116 ? -69.917 -18.099 47.626  1.00 38.59  ? 116 GLU C O   1 
ATOM   5272  C  CB  . GLU C 1 116 ? -71.023 -15.567 45.923  1.00 44.24  ? 116 GLU C CB  1 
ATOM   5273  C  CG  . GLU C 1 116 ? -70.848 -16.668 44.919  1.00 60.11  ? 116 GLU C CG  1 
ATOM   5274  C  CD  . GLU C 1 116 ? -70.982 -16.165 43.498  1.00 67.94  ? 116 GLU C CD  1 
ATOM   5275  O  OE1 . GLU C 1 116 ? -70.994 -14.918 43.299  1.00 81.03  ? 116 GLU C OE1 1 
ATOM   5276  O  OE2 . GLU C 1 116 ? -71.095 -17.022 42.596  1.00 66.47  ? 116 GLU C OE2 1 
ATOM   5277  N  N   . ALA C 1 117 ? -68.890 -16.185 48.201  1.00 27.15  ? 117 ALA C N   1 
ATOM   5278  C  CA  . ALA C 1 117 ? -67.714 -16.925 48.622  1.00 30.83  ? 117 ALA C CA  1 
ATOM   5279  C  C   . ALA C 1 117 ? -68.034 -17.707 49.900  1.00 37.88  ? 117 ALA C C   1 
ATOM   5280  O  O   . ALA C 1 117 ? -67.531 -18.810 50.093  1.00 39.17  ? 117 ALA C O   1 
ATOM   5281  C  CB  . ALA C 1 117 ? -66.540 -16.023 48.821  1.00 19.49  ? 117 ALA C CB  1 
ATOM   5282  N  N   . ARG C 1 118 ? -68.874 -17.147 50.762  1.00 27.60  ? 118 ARG C N   1 
ATOM   5283  C  CA  . ARG C 1 118 ? -69.268 -17.846 51.981  1.00 39.17  ? 118 ARG C CA  1 
ATOM   5284  C  C   . ARG C 1 118 ? -70.096 -19.081 51.637  1.00 35.40  ? 118 ARG C C   1 
ATOM   5285  O  O   . ARG C 1 118 ? -70.021 -20.105 52.313  1.00 33.19  ? 118 ARG C O   1 
ATOM   5286  C  CB  . ARG C 1 118 ? -70.059 -16.918 52.905  1.00 23.64  ? 118 ARG C CB  1 
ATOM   5287  C  CG  . ARG C 1 118 ? -70.081 -17.366 54.356  1.00 29.49  ? 118 ARG C CG  1 
ATOM   5288  C  CD  . ARG C 1 118 ? -71.062 -16.545 55.174  1.00 43.75  ? 118 ARG C CD  1 
ATOM   5289  N  NE  . ARG C 1 118 ? -71.464 -15.325 54.480  1.00 44.99  ? 118 ARG C NE  1 
ATOM   5290  C  CZ  . ARG C 1 118 ? -71.337 -14.104 54.984  1.00 39.52  ? 118 ARG C CZ  1 
ATOM   5291  N  NH1 . ARG C 1 118 ? -70.817 -13.936 56.192  1.00 56.65  ? 118 ARG C NH1 1 
ATOM   5292  N  NH2 . ARG C 1 118 ? -71.730 -13.049 54.283  1.00 67.59  ? 118 ARG C NH2 1 
ATOM   5293  N  N   . PHE C 1 119 ? -70.883 -18.963 50.574  1.00 36.17  ? 119 PHE C N   1 
ATOM   5294  C  CA  . PHE C 1 119 ? -71.731 -20.029 50.094  1.00 43.38  ? 119 PHE C CA  1 
ATOM   5295  C  C   . PHE C 1 119 ? -70.906 -21.265 49.711  1.00 44.17  ? 119 PHE C C   1 
ATOM   5296  O  O   . PHE C 1 119 ? -71.288 -22.376 50.039  1.00 44.78  ? 119 PHE C O   1 
ATOM   5297  C  CB  . PHE C 1 119 ? -72.554 -19.538 48.901  1.00 33.69  ? 119 PHE C CB  1 
ATOM   5298  C  CG  . PHE C 1 119 ? -73.249 -20.640 48.143  1.00 32.89  ? 119 PHE C CG  1 
ATOM   5299  C  CD1 . PHE C 1 119 ? -74.419 -21.207 48.643  1.00 30.87  ? 119 PHE C CD1 1 
ATOM   5300  C  CD2 . PHE C 1 119 ? -72.739 -21.102 46.927  1.00 27.38  ? 119 PHE C CD2 1 
ATOM   5301  C  CE1 . PHE C 1 119 ? -75.087 -22.198 47.945  1.00 32.22  ? 119 PHE C CE1 1 
ATOM   5302  C  CE2 . PHE C 1 119 ? -73.399 -22.102 46.221  1.00 35.94  ? 119 PHE C CE2 1 
ATOM   5303  C  CZ  . PHE C 1 119 ? -74.578 -22.654 46.737  1.00 38.88  ? 119 PHE C CZ  1 
ATOM   5304  N  N   . PHE C 1 120 ? -69.776 -21.051 49.037  1.00 37.17  ? 120 PHE C N   1 
ATOM   5305  C  CA  . PHE C 1 120 ? -68.913 -22.128 48.603  1.00 31.75  ? 120 PHE C CA  1 
ATOM   5306  C  C   . PHE C 1 120 ? -67.998 -22.613 49.715  1.00 35.75  ? 120 PHE C C   1 
ATOM   5307  O  O   . PHE C 1 120 ? -67.758 -23.815 49.855  1.00 38.15  ? 120 PHE C O   1 
ATOM   5308  C  CB  . PHE C 1 120 ? -68.091 -21.706 47.399  1.00 17.22  ? 120 PHE C CB  1 
ATOM   5309  C  CG  . PHE C 1 120 ? -68.859 -21.682 46.116  1.00 35.70  ? 120 PHE C CG  1 
ATOM   5310  C  CD1 . PHE C 1 120 ? -69.399 -22.848 45.601  1.00 26.85  ? 120 PHE C CD1 1 
ATOM   5311  C  CD2 . PHE C 1 120 ? -69.030 -20.503 45.401  1.00 22.19  ? 120 PHE C CD2 1 
ATOM   5312  C  CE1 . PHE C 1 120 ? -70.103 -22.836 44.409  1.00 29.13  ? 120 PHE C CE1 1 
ATOM   5313  C  CE2 . PHE C 1 120 ? -69.751 -20.482 44.220  1.00 27.36  ? 120 PHE C CE2 1 
ATOM   5314  C  CZ  . PHE C 1 120 ? -70.282 -21.661 43.721  1.00 26.08  ? 120 PHE C CZ  1 
ATOM   5315  N  N   . PHE C 1 121 ? -67.503 -21.668 50.511  1.00 30.44  ? 121 PHE C N   1 
ATOM   5316  C  CA  . PHE C 1 121 ? -66.602 -21.989 51.612  1.00 27.35  ? 121 PHE C CA  1 
ATOM   5317  C  C   . PHE C 1 121 ? -67.287 -22.855 52.682  1.00 35.63  ? 121 PHE C C   1 
ATOM   5318  O  O   . PHE C 1 121 ? -66.656 -23.751 53.260  1.00 30.53  ? 121 PHE C O   1 
ATOM   5319  C  CB  . PHE C 1 121 ? -66.080 -20.722 52.245  1.00 17.15  ? 121 PHE C CB  1 
ATOM   5320  C  CG  . PHE C 1 121 ? -65.020 -20.942 53.259  1.00 28.11  ? 121 PHE C CG  1 
ATOM   5321  C  CD1 . PHE C 1 121 ? -63.722 -21.213 52.854  1.00 28.27  ? 121 PHE C CD1 1 
ATOM   5322  C  CD2 . PHE C 1 121 ? -65.303 -20.897 54.618  1.00 17.23  ? 121 PHE C CD2 1 
ATOM   5323  C  CE1 . PHE C 1 121 ? -62.733 -21.420 53.764  1.00 31.18  ? 121 PHE C CE1 1 
ATOM   5324  C  CE2 . PHE C 1 121 ? -64.306 -21.087 55.542  1.00 21.25  ? 121 PHE C CE2 1 
ATOM   5325  C  CZ  . PHE C 1 121 ? -63.023 -21.355 55.120  1.00 17.06  ? 121 PHE C CZ  1 
ATOM   5326  N  N   . GLN C 1 122 ? -68.571 -22.600 52.935  1.00 31.38  ? 122 GLN C N   1 
ATOM   5327  C  CA  . GLN C 1 122 ? -69.339 -23.448 53.824  1.00 32.32  ? 122 GLN C CA  1 
ATOM   5328  C  C   . GLN C 1 122 ? -69.369 -24.894 53.299  1.00 35.46  ? 122 GLN C C   1 
ATOM   5329  O  O   . GLN C 1 122 ? -69.021 -25.794 54.031  1.00 23.92  ? 122 GLN C O   1 
ATOM   5330  C  CB  . GLN C 1 122 ? -70.729 -22.873 54.031  1.00 28.90  ? 122 GLN C CB  1 
ATOM   5331  C  CG  . GLN C 1 122 ? -70.692 -21.581 54.799  1.00 22.92  ? 122 GLN C CG  1 
ATOM   5332  C  CD  . GLN C 1 122 ? -72.011 -20.843 54.749  1.00 34.75  ? 122 GLN C CD  1 
ATOM   5333  O  OE1 . GLN C 1 122 ? -72.787 -21.004 53.814  1.00 39.06  ? 122 GLN C OE1 1 
ATOM   5334  N  NE2 . GLN C 1 122 ? -72.279 -20.044 55.763  1.00 28.17  ? 122 GLN C NE2 1 
ATOM   5335  N  N   . GLN C 1 123 ? -69.716 -25.101 52.029  1.00 21.17  ? 123 GLN C N   1 
ATOM   5336  C  CA  . GLN C 1 123 ? -69.628 -26.428 51.427  1.00 31.45  ? 123 GLN C CA  1 
ATOM   5337  C  C   . GLN C 1 123 ? -68.227 -27.064 51.519  1.00 38.86  ? 123 GLN C C   1 
ATOM   5338  O  O   . GLN C 1 123 ? -68.080 -28.219 51.926  1.00 40.02  ? 123 GLN C O   1 
ATOM   5339  C  CB  . GLN C 1 123 ? -70.103 -26.393 49.982  1.00 25.88  ? 123 GLN C CB  1 
ATOM   5340  C  CG  . GLN C 1 123 ? -71.541 -25.941 49.830  1.00 18.13  ? 123 GLN C CG  1 
ATOM   5341  C  CD  . GLN C 1 123 ? -71.921 -25.817 48.393  1.00 33.97  ? 123 GLN C CD  1 
ATOM   5342  O  OE1 . GLN C 1 123 ? -71.878 -26.798 47.636  1.00 29.93  ? 123 GLN C OE1 1 
ATOM   5343  N  NE2 . GLN C 1 123 ? -72.255 -24.594 47.974  1.00 24.39  ? 123 GLN C NE2 1 
ATOM   5344  N  N   . LEU C 1 124 ? -67.201 -26.304 51.164  1.00 33.95  ? 124 LEU C N   1 
ATOM   5345  C  CA  . LEU C 1 124 ? -65.828 -26.793 51.167  1.00 30.92  ? 124 LEU C CA  1 
ATOM   5346  C  C   . LEU C 1 124 ? -65.457 -27.346 52.515  1.00 43.03  ? 124 LEU C C   1 
ATOM   5347  O  O   . LEU C 1 124 ? -64.899 -28.428 52.601  1.00 37.37  ? 124 LEU C O   1 
ATOM   5348  C  CB  . LEU C 1 124 ? -64.851 -25.678 50.819  1.00 27.11  ? 124 LEU C CB  1 
ATOM   5349  C  CG  . LEU C 1 124 ? -63.378 -26.052 50.781  1.00 31.29  ? 124 LEU C CG  1 
ATOM   5350  C  CD1 . LEU C 1 124 ? -63.188 -27.196 49.789  1.00 18.44  ? 124 LEU C CD1 1 
ATOM   5351  C  CD2 . LEU C 1 124 ? -62.468 -24.865 50.419  1.00 30.42  ? 124 LEU C CD2 1 
ATOM   5352  N  N   . ILE C 1 125 ? -65.755 -26.595 53.567  1.00 38.25  ? 125 ILE C N   1 
ATOM   5353  C  CA  . ILE C 1 125 ? -65.336 -26.936 54.916  1.00 28.11  ? 125 ILE C CA  1 
ATOM   5354  C  C   . ILE C 1 125 ? -66.188 -28.097 55.400  1.00 30.72  ? 125 ILE C C   1 
ATOM   5355  O  O   . ILE C 1 125 ? -65.713 -28.986 56.086  1.00 31.33  ? 125 ILE C O   1 
ATOM   5356  C  CB  . ILE C 1 125 ? -65.519 -25.738 55.900  1.00 23.69  ? 125 ILE C CB  1 
ATOM   5357  C  CG1 . ILE C 1 125 ? -64.450 -24.678 55.673  1.00 25.21  ? 125 ILE C CG1 1 
ATOM   5358  C  CG2 . ILE C 1 125 ? -65.447 -26.179 57.322  1.00 23.70  ? 125 ILE C CG2 1 
ATOM   5359  C  CD1 . ILE C 1 125 ? -63.056 -25.168 55.891  1.00 28.24  ? 125 ILE C CD1 1 
ATOM   5360  N  N   . SER C 1 126 ? -67.456 -28.104 55.042  1.00 28.94  ? 126 SER C N   1 
ATOM   5361  C  CA  . SER C 1 126 ? -68.299 -29.213 55.426  1.00 48.16  ? 126 SER C CA  1 
ATOM   5362  C  C   . SER C 1 126 ? -67.794 -30.515 54.794  1.00 39.96  ? 126 SER C C   1 
ATOM   5363  O  O   . SER C 1 126 ? -67.752 -31.554 55.444  1.00 29.35  ? 126 SER C O   1 
ATOM   5364  C  CB  . SER C 1 126 ? -69.737 -28.979 55.018  1.00 44.58  ? 126 SER C CB  1 
ATOM   5365  O  OG  . SER C 1 126 ? -70.433 -30.203 55.181  1.00 49.57  ? 126 SER C OG  1 
ATOM   5366  N  N   . GLY C 1 127 ? -67.382 -30.438 53.538  1.00 34.97  ? 127 GLY C N   1 
ATOM   5367  C  CA  . GLY C 1 127 ? -66.915 -31.615 52.829  1.00 28.36  ? 127 GLY C CA  1 
ATOM   5368  C  C   . GLY C 1 127 ? -65.605 -32.105 53.372  1.00 38.84  ? 127 GLY C C   1 
ATOM   5369  O  O   . GLY C 1 127 ? -65.402 -33.308 53.499  1.00 38.72  ? 127 GLY C O   1 
ATOM   5370  N  N   . VAL C 1 128 ? -64.723 -31.165 53.709  1.00 44.67  ? 128 VAL C N   1 
ATOM   5371  C  CA  . VAL C 1 128 ? -63.361 -31.478 54.113  1.00 27.39  ? 128 VAL C CA  1 
ATOM   5372  C  C   . VAL C 1 128 ? -63.432 -32.020 55.516  1.00 43.23  ? 128 VAL C C   1 
ATOM   5373  O  O   . VAL C 1 128 ? -62.685 -32.909 55.872  1.00 46.77  ? 128 VAL C O   1 
ATOM   5374  C  CB  . VAL C 1 128 ? -62.451 -30.211 54.062  1.00 47.91  ? 128 VAL C CB  1 
ATOM   5375  C  CG1 . VAL C 1 128 ? -61.255 -30.324 55.037  1.00 43.61  ? 128 VAL C CG1 1 
ATOM   5376  C  CG2 . VAL C 1 128 ? -61.960 -29.968 52.646  1.00 41.42  ? 128 VAL C CG2 1 
ATOM   5377  N  N   . SER C 1 129 ? -64.345 -31.484 56.317  1.00 45.13  ? 129 SER C N   1 
ATOM   5378  C  CA  . SER C 1 129 ? -64.500 -31.929 57.702  1.00 35.20  ? 129 SER C CA  1 
ATOM   5379  C  C   . SER C 1 129 ? -64.956 -33.401 57.704  1.00 41.01  ? 129 SER C C   1 
ATOM   5380  O  O   . SER C 1 129 ? -64.496 -34.219 58.502  1.00 46.59  ? 129 SER C O   1 
ATOM   5381  C  CB  . SER C 1 129 ? -65.503 -31.026 58.423  1.00 30.42  ? 129 SER C CB  1 
ATOM   5382  O  OG  . SER C 1 129 ? -65.891 -31.530 59.670  1.00 42.70  ? 129 SER C OG  1 
ATOM   5383  N  N   . TYR C 1 130 ? -65.840 -33.725 56.787  1.00 42.06  ? 130 TYR C N   1 
ATOM   5384  C  CA  . TYR C 1 130 ? -66.339 -35.060 56.629  1.00 47.21  ? 130 TYR C CA  1 
ATOM   5385  C  C   . TYR C 1 130 ? -65.231 -35.970 56.238  1.00 41.65  ? 130 TYR C C   1 
ATOM   5386  O  O   . TYR C 1 130 ? -65.009 -36.957 56.849  1.00 40.52  ? 130 TYR C O   1 
ATOM   5387  C  CB  . TYR C 1 130 ? -67.396 -35.072 55.552  1.00 41.39  ? 130 TYR C CB  1 
ATOM   5388  C  CG  . TYR C 1 130 ? -67.954 -36.414 55.248  1.00 48.78  ? 130 TYR C CG  1 
ATOM   5389  C  CD1 . TYR C 1 130 ? -69.066 -36.864 55.871  1.00 42.72  ? 130 TYR C CD1 1 
ATOM   5390  C  CD2 . TYR C 1 130 ? -67.362 -37.227 54.337  1.00 47.33  ? 130 TYR C CD2 1 
ATOM   5391  C  CE1 . TYR C 1 130 ? -69.564 -38.062 55.595  1.00 38.79  ? 130 TYR C CE1 1 
ATOM   5392  C  CE2 . TYR C 1 130 ? -67.853 -38.427 54.070  1.00 51.15  ? 130 TYR C CE2 1 
ATOM   5393  C  CZ  . TYR C 1 130 ? -68.958 -38.843 54.692  1.00 49.05  ? 130 TYR C CZ  1 
ATOM   5394  O  OH  . TYR C 1 130 ? -69.450 -40.055 54.407  1.00 35.78  ? 130 TYR C OH  1 
ATOM   5395  N  N   . ALA C 1 131 ? -64.518 -35.621 55.204  1.00 40.89  ? 131 ALA C N   1 
ATOM   5396  C  CA  . ALA C 1 131 ? -63.430 -36.428 54.764  1.00 43.31  ? 131 ALA C CA  1 
ATOM   5397  C  C   . ALA C 1 131 ? -62.458 -36.696 55.881  1.00 57.56  ? 131 ALA C C   1 
ATOM   5398  O  O   . ALA C 1 131 ? -61.853 -37.720 55.927  1.00 54.64  ? 131 ALA C O   1 
ATOM   5399  C  CB  . ALA C 1 131 ? -62.757 -35.781 53.617  1.00 21.28  ? 131 ALA C CB  1 
ATOM   5400  N  N   . HIS C 1 132 ? -62.322 -35.759 56.790  1.00 57.28  ? 132 HIS C N   1 
ATOM   5401  C  CA  . HIS C 1 132 ? -61.335 -35.863 57.825  1.00 51.96  ? 132 HIS C CA  1 
ATOM   5402  C  C   . HIS C 1 132 ? -61.771 -36.847 58.857  1.00 55.78  ? 132 HIS C C   1 
ATOM   5403  O  O   . HIS C 1 132 ? -60.976 -37.538 59.428  1.00 66.60  ? 132 HIS C O   1 
ATOM   5404  C  CB  . HIS C 1 132 ? -61.162 -34.523 58.505  1.00 42.07  ? 132 HIS C CB  1 
ATOM   5405  C  CG  . HIS C 1 132 ? -60.162 -33.633 57.860  1.00 39.48  ? 132 HIS C CG  1 
ATOM   5406  N  ND1 . HIS C 1 132 ? -59.923 -32.366 58.307  1.00 40.87  ? 132 HIS C ND1 1 
ATOM   5407  C  CD2 . HIS C 1 132 ? -59.351 -33.815 56.800  1.00 36.33  ? 132 HIS C CD2 1 
ATOM   5408  C  CE1 . HIS C 1 132 ? -59.005 -31.805 57.554  1.00 40.64  ? 132 HIS C CE1 1 
ATOM   5409  N  NE2 . HIS C 1 132 ? -58.641 -32.664 56.632  1.00 27.41  ? 132 HIS C NE2 1 
ATOM   5410  N  N   . ALA C 1 133 ? -63.055 -36.876 59.117  1.00 51.47  ? 133 ALA C N   1 
ATOM   5411  C  CA  . ALA C 1 133 ? -63.638 -37.763 60.107  1.00 46.28  ? 133 ALA C CA  1 
ATOM   5412  C  C   . ALA C 1 133 ? -63.686 -39.177 59.539  1.00 59.75  ? 133 ALA C C   1 
ATOM   5413  O  O   . ALA C 1 133 ? -63.965 -40.149 60.242  1.00 56.64  ? 133 ALA C O   1 
ATOM   5414  C  CB  . ALA C 1 133 ? -65.027 -37.287 60.486  1.00 27.08  ? 133 ALA C CB  1 
ATOM   5415  N  N   . MET C 1 134 ? -63.401 -39.277 58.253  1.00 60.48  ? 134 MET C N   1 
ATOM   5416  C  CA  . MET C 1 134 ? -63.560 -40.522 57.553  1.00 64.14  ? 134 MET C CA  1 
ATOM   5417  C  C   . MET C 1 134 ? -62.181 -41.134 57.417  1.00 74.27  ? 134 MET C C   1 
ATOM   5418  O  O   . MET C 1 134 ? -62.000 -42.130 56.714  1.00 69.82  ? 134 MET C O   1 
ATOM   5419  C  CB  . MET C 1 134 ? -64.207 -40.254 56.191  1.00 63.81  ? 134 MET C CB  1 
ATOM   5420  C  CG  . MET C 1 134 ? -65.274 -41.222 55.809  1.00 72.62  ? 134 MET C CG  1 
ATOM   5421  S  SD  . MET C 1 134 ? -66.634 -41.317 56.985  1.00 67.50  ? 134 MET C SD  1 
ATOM   5422  C  CE  . MET C 1 134 ? -67.394 -42.842 56.385  1.00 47.44  ? 134 MET C CE  1 
ATOM   5423  N  N   . GLN C 1 135 ? -61.204 -40.536 58.091  1.00 78.62  ? 135 GLN C N   1 
ATOM   5424  C  CA  . GLN C 1 135 ? -59.831 -41.025 58.046  1.00 86.34  ? 135 GLN C CA  1 
ATOM   5425  C  C   . GLN C 1 135 ? -59.007 -40.460 59.198  1.00 97.91  ? 135 GLN C C   1 
ATOM   5426  O  O   . GLN C 1 135 ? -59.170 -40.867 60.349  1.00 98.59  ? 135 GLN C O   1 
ATOM   5427  C  CB  . GLN C 1 135 ? -59.179 -40.669 56.709  1.00 92.75  ? 135 GLN C CB  1 
ATOM   5428  C  CG  . GLN C 1 135 ? -59.197 -41.797 55.690  1.00 106.48 ? 135 GLN C CG  1 
ATOM   5429  C  CD  . GLN C 1 135 ? -58.198 -42.890 56.014  1.00 126.98 ? 135 GLN C CD  1 
ATOM   5430  O  OE1 . GLN C 1 135 ? -58.524 -43.862 56.697  1.00 137.64 ? 135 GLN C OE1 1 
ATOM   5431  N  NE2 . GLN C 1 135 ? -56.973 -42.737 55.524  1.00 129.84 ? 135 GLN C NE2 1 
ATOM   5432  N  N   . ASP C 1 140 ? -55.972 -37.973 50.542  1.00 97.06  ? 140 ASP C N   1 
ATOM   5433  C  CA  . ASP C 1 140 ? -55.636 -36.628 50.089  1.00 103.90 ? 140 ASP C CA  1 
ATOM   5434  C  C   . ASP C 1 140 ? -56.592 -36.156 48.999  1.00 111.37 ? 140 ASP C C   1 
ATOM   5435  O  O   . ASP C 1 140 ? -57.072 -36.952 48.193  1.00 111.67 ? 140 ASP C O   1 
ATOM   5436  C  CB  . ASP C 1 140 ? -54.194 -36.578 49.582  1.00 102.09 ? 140 ASP C CB  1 
ATOM   5437  C  CG  . ASP C 1 140 ? -53.357 -35.546 50.310  1.00 107.81 ? 140 ASP C CG  1 
ATOM   5438  O  OD1 . ASP C 1 140 ? -52.606 -34.806 49.639  1.00 106.78 ? 140 ASP C OD1 1 
ATOM   5439  O  OD2 . ASP C 1 140 ? -53.449 -35.473 51.553  1.00 110.02 ? 140 ASP C OD2 1 
ATOM   5440  N  N   . LEU C 1 141 ? -56.863 -34.855 48.981  1.00 115.90 ? 141 LEU C N   1 
ATOM   5441  C  CA  . LEU C 1 141 ? -57.759 -34.272 47.990  1.00 114.56 ? 141 LEU C CA  1 
ATOM   5442  C  C   . LEU C 1 141 ? -57.162 -33.003 47.391  1.00 114.52 ? 141 LEU C C   1 
ATOM   5443  O  O   . LEU C 1 141 ? -56.303 -32.364 47.998  1.00 110.76 ? 141 LEU C O   1 
ATOM   5444  C  CB  . LEU C 1 141 ? -59.124 -33.971 48.613  1.00 112.70 ? 141 LEU C CB  1 
ATOM   5445  C  CG  . LEU C 1 141 ? -59.674 -35.027 49.573  1.00 102.11 ? 141 LEU C CG  1 
ATOM   5446  C  CD1 . LEU C 1 141 ? -58.827 -36.290 49.524  1.00 94.26  ? 141 LEU C CD1 1 
ATOM   5447  C  CD2 . LEU C 1 141 ? -59.748 -34.481 50.991  1.00 85.77  ? 141 LEU C CD2 1 
ATOM   5448  N  N   . LYS C 1 142 ? -57.623 -32.644 46.197  1.00 109.92 ? 142 LYS C N   1 
ATOM   5449  C  CA  . LYS C 1 142 ? -57.120 -31.463 45.505  1.00 103.93 ? 142 LYS C CA  1 
ATOM   5450  C  C   . LYS C 1 142 ? -58.038 -30.264 45.709  1.00 95.99  ? 142 LYS C C   1 
ATOM   5451  O  O   . LYS C 1 142 ? -58.838 -29.928 44.837  1.00 102.62 ? 142 LYS C O   1 
ATOM   5452  C  CB  . LYS C 1 142 ? -56.956 -31.749 44.012  1.00 109.87 ? 142 LYS C CB  1 
ATOM   5453  C  CG  . LYS C 1 142 ? -57.061 -33.221 43.648  1.00 110.56 ? 142 LYS C CG  1 
ATOM   5454  C  CD  . LYS C 1 142 ? -58.229 -33.883 44.357  1.00 105.83 ? 142 LYS C CD  1 
ATOM   5455  C  CE  . LYS C 1 142 ? -58.965 -34.838 43.432  1.00 96.79  ? 142 LYS C CE  1 
ATOM   5456  N  NZ  . LYS C 1 142 ? -58.436 -34.775 42.042  1.00 94.02  ? 142 LYS C NZ  1 
ATOM   5457  N  N   . LEU C 1 143 ? -57.915 -29.622 46.866  1.00 83.94  ? 143 LEU C N   1 
ATOM   5458  C  CA  . LEU C 1 143 ? -58.730 -28.457 47.187  1.00 79.22  ? 143 LEU C CA  1 
ATOM   5459  C  C   . LEU C 1 143 ? -58.441 -27.315 46.219  1.00 72.13  ? 143 LEU C C   1 
ATOM   5460  O  O   . LEU C 1 143 ? -59.174 -26.329 46.166  1.00 83.47  ? 143 LEU C O   1 
ATOM   5461  C  CB  . LEU C 1 143 ? -58.479 -28.009 48.628  1.00 86.37  ? 143 LEU C CB  1 
ATOM   5462  C  CG  . LEU C 1 143 ? -58.468 -29.124 49.676  1.00 75.58  ? 143 LEU C CG  1 
ATOM   5463  C  CD1 . LEU C 1 143 ? -58.691 -28.559 51.069  1.00 90.23  ? 143 LEU C CD1 1 
ATOM   5464  C  CD2 . LEU C 1 143 ? -59.513 -30.178 49.347  1.00 51.83  ? 143 LEU C CD2 1 
ATOM   5465  N  N   . GLU C 1 144 ? -57.366 -27.463 45.452  1.00 64.71  ? 144 GLU C N   1 
ATOM   5466  C  CA  . GLU C 1 144 ? -56.983 -26.476 44.448  1.00 74.16  ? 144 GLU C CA  1 
ATOM   5467  C  C   . GLU C 1 144 ? -57.540 -26.850 43.079  1.00 68.07  ? 144 GLU C C   1 
ATOM   5468  O  O   . GLU C 1 144 ? -57.127 -26.303 42.057  1.00 69.23  ? 144 GLU C O   1 
ATOM   5469  C  CB  . GLU C 1 144 ? -55.461 -26.343 44.379  1.00 84.37  ? 144 GLU C CB  1 
ATOM   5470  C  CG  . GLU C 1 144 ? -54.753 -27.570 43.832  1.00 97.63  ? 144 GLU C CG  1 
ATOM   5471  C  CD  . GLU C 1 144 ? -53.538 -27.954 44.652  1.00 110.14 ? 144 GLU C CD  1 
ATOM   5472  O  OE1 . GLU C 1 144 ? -52.429 -27.472 44.338  1.00 110.53 ? 144 GLU C OE1 1 
ATOM   5473  O  OE2 . GLU C 1 144 ? -53.691 -28.739 45.612  1.00 111.70 ? 144 GLU C OE2 1 
ATOM   5474  N  N   . ASN C 1 145 ? -58.482 -27.786 43.072  1.00 61.15  ? 145 ASN C N   1 
ATOM   5475  C  CA  . ASN C 1 145 ? -59.094 -28.260 41.842  1.00 55.48  ? 145 ASN C CA  1 
ATOM   5476  C  C   . ASN C 1 145 ? -60.484 -28.795 42.087  1.00 57.11  ? 145 ASN C C   1 
ATOM   5477  O  O   . ASN C 1 145 ? -60.900 -29.766 41.466  1.00 60.43  ? 145 ASN C O   1 
ATOM   5478  C  CB  . ASN C 1 145 ? -58.249 -29.381 41.248  1.00 74.85  ? 145 ASN C CB  1 
ATOM   5479  C  CG  . ASN C 1 145 ? -57.453 -28.934 40.047  1.00 88.92  ? 145 ASN C CG  1 
ATOM   5480  O  OD1 . ASN C 1 145 ? -57.916 -28.087 39.282  1.00 92.87  ? 145 ASN C OD1 1 
ATOM   5481  N  ND2 . ASN C 1 145 ? -56.250 -29.493 39.869  1.00 90.49  ? 145 ASN C ND2 1 
ATOM   5482  N  N   . THR C 1 146 ? -61.211 -28.179 43.006  1.00 45.16  ? 146 THR C N   1 
ATOM   5483  C  CA  . THR C 1 146 ? -62.550 -28.636 43.280  1.00 33.93  ? 146 THR C CA  1 
ATOM   5484  C  C   . THR C 1 146 ? -63.514 -28.276 42.110  1.00 43.21  ? 146 THR C C   1 
ATOM   5485  O  O   . THR C 1 146 ? -63.269 -27.368 41.312  1.00 37.32  ? 146 THR C O   1 
ATOM   5486  C  CB  . THR C 1 146 ? -63.036 -28.118 44.626  1.00 25.37  ? 146 THR C CB  1 
ATOM   5487  O  OG1 . THR C 1 146 ? -63.511 -26.786 44.465  1.00 47.39  ? 146 THR C OG1 1 
ATOM   5488  C  CG2 . THR C 1 146 ? -61.891 -28.130 45.621  1.00 26.80  ? 146 THR C CG2 1 
ATOM   5489  N  N   . LEU C 1 147 ? -64.600 -29.029 41.987  1.00 37.20  ? 147 LEU C N   1 
ATOM   5490  C  CA  . LEU C 1 147 ? -65.486 -28.903 40.840  1.00 31.75  ? 147 LEU C CA  1 
ATOM   5491  C  C   . LEU C 1 147 ? -66.872 -28.480 41.281  1.00 34.87  ? 147 LEU C C   1 
ATOM   5492  O  O   . LEU C 1 147 ? -67.155 -28.313 42.456  1.00 27.00  ? 147 LEU C O   1 
ATOM   5493  C  CB  . LEU C 1 147 ? -65.616 -30.220 40.062  1.00 26.24  ? 147 LEU C CB  1 
ATOM   5494  C  CG  . LEU C 1 147 ? -64.328 -31.031 39.873  1.00 39.57  ? 147 LEU C CG  1 
ATOM   5495  C  CD1 . LEU C 1 147 ? -64.569 -32.254 39.020  1.00 31.00  ? 147 LEU C CD1 1 
ATOM   5496  C  CD2 . LEU C 1 147 ? -63.236 -30.152 39.262  1.00 42.23  ? 147 LEU C CD2 1 
ATOM   5497  N  N   . LEU C 1 148 ? -67.752 -28.253 40.317  1.00 29.69  ? 148 LEU C N   1 
ATOM   5498  C  CA  . LEU C 1 148 ? -69.101 -27.805 40.639  1.00 38.47  ? 148 LEU C CA  1 
ATOM   5499  C  C   . LEU C 1 148 ? -70.095 -28.570 39.794  1.00 32.51  ? 148 LEU C C   1 
ATOM   5500  O  O   . LEU C 1 148 ? -69.937 -28.652 38.577  1.00 48.54  ? 148 LEU C O   1 
ATOM   5501  C  CB  . LEU C 1 148 ? -69.245 -26.305 40.378  1.00 37.40  ? 148 LEU C CB  1 
ATOM   5502  C  CG  . LEU C 1 148 ? -68.249 -25.380 41.077  1.00 31.65  ? 148 LEU C CG  1 
ATOM   5503  C  CD1 . LEU C 1 148 ? -68.090 -24.086 40.295  1.00 46.19  ? 148 LEU C CD1 1 
ATOM   5504  C  CD2 . LEU C 1 148 ? -68.692 -25.099 42.501  1.00 26.93  ? 148 LEU C CD2 1 
ATOM   5505  N  N   . ASP C 1 149 ? -71.089 -29.166 40.442  1.00 31.11  ? 149 ASP C N   1 
ATOM   5506  C  CA  . ASP C 1 149 ? -72.164 -29.805 39.714  1.00 44.78  ? 149 ASP C CA  1 
ATOM   5507  C  C   . ASP C 1 149 ? -72.746 -28.697 38.864  1.00 50.21  ? 149 ASP C C   1 
ATOM   5508  O  O   . ASP C 1 149 ? -72.240 -27.576 38.886  1.00 69.67  ? 149 ASP C O   1 
ATOM   5509  C  CB  . ASP C 1 149 ? -73.217 -30.358 40.672  1.00 35.36  ? 149 ASP C CB  1 
ATOM   5510  C  CG  . ASP C 1 149 ? -74.141 -29.282 41.205  1.00 58.19  ? 149 ASP C CG  1 
ATOM   5511  O  OD1 . ASP C 1 149 ? -73.802 -28.088 41.076  1.00 64.98  ? 149 ASP C OD1 1 
ATOM   5512  O  OD2 . ASP C 1 149 ? -75.206 -29.632 41.756  1.00 51.95  ? 149 ASP C OD2 1 
ATOM   5513  N  N   . GLY C 1 150 ? -73.818 -29.005 38.140  1.00 57.00  ? 150 GLY C N   1 
ATOM   5514  C  CA  . GLY C 1 150 ? -74.472 -28.033 37.285  1.00 68.19  ? 150 GLY C CA  1 
ATOM   5515  C  C   . GLY C 1 150 ? -75.918 -27.761 37.658  1.00 73.89  ? 150 GLY C C   1 
ATOM   5516  O  O   . GLY C 1 150 ? -76.799 -28.587 37.426  1.00 93.02  ? 150 GLY C O   1 
ATOM   5517  N  N   . SER C 1 151 ? -76.156 -26.589 38.237  1.00 72.64  ? 151 SER C N   1 
ATOM   5518  C  CA  . SER C 1 151 ? -77.495 -26.143 38.594  1.00 73.08  ? 151 SER C CA  1 
ATOM   5519  C  C   . SER C 1 151 ? -77.292 -24.670 38.908  1.00 66.05  ? 151 SER C C   1 
ATOM   5520  O  O   . SER C 1 151 ? -76.156 -24.214 39.031  1.00 57.89  ? 151 SER C O   1 
ATOM   5521  C  CB  . SER C 1 151 ? -77.929 -27.126 39.680  1.00 70.15  ? 151 SER C CB  1 
ATOM   5522  O  OG  . SER C 1 151 ? -76.922 -27.272 40.665  1.00 54.27  ? 151 SER C OG  1 
ATOM   5523  N  N   . PRO C 1 152 ? -78.391 -23.949 39.098  1.00 68.35  ? 152 PRO C N   1 
ATOM   5524  C  CA  . PRO C 1 152 ? -78.333 -22.537 39.491  1.00 71.27  ? 152 PRO C CA  1 
ATOM   5525  C  C   . PRO C 1 152 ? -77.257 -22.091 40.483  1.00 68.59  ? 152 PRO C C   1 
ATOM   5526  O  O   . PRO C 1 152 ? -76.410 -21.272 40.127  1.00 61.99  ? 152 PRO C O   1 
ATOM   5527  C  CB  . PRO C 1 152 ? -79.666 -22.325 40.212  1.00 75.95  ? 152 PRO C CB  1 
ATOM   5528  C  CG  . PRO C 1 152 ? -80.583 -23.320 39.593  1.00 74.40  ? 152 PRO C CG  1 
ATOM   5529  C  CD  . PRO C 1 152 ? -79.736 -24.521 39.282  1.00 69.69  ? 152 PRO C CD  1 
ATOM   5530  N  N   . ALA C 1 153 ? -77.297 -22.632 41.696  1.00 74.70  ? 153 ALA C N   1 
ATOM   5531  C  CA  . ALA C 1 153 ? -76.280 -22.354 42.701  1.00 64.09  ? 153 ALA C CA  1 
ATOM   5532  C  C   . ALA C 1 153 ? -75.366 -23.565 42.842  1.00 52.72  ? 153 ALA C C   1 
ATOM   5533  O  O   . ALA C 1 153 ? -75.453 -24.314 43.813  1.00 72.89  ? 153 ALA C O   1 
ATOM   5534  C  CB  . ALA C 1 153 ? -76.926 -22.016 44.031  1.00 58.91  ? 153 ALA C CB  1 
ATOM   5535  N  N   . PRO C 1 154 ? -74.495 -23.752 41.857  1.00 45.62  ? 154 PRO C N   1 
ATOM   5536  C  CA  . PRO C 1 154 ? -73.610 -24.922 41.806  1.00 46.89  ? 154 PRO C CA  1 
ATOM   5537  C  C   . PRO C 1 154 ? -73.287 -25.505 43.177  1.00 49.52  ? 154 PRO C C   1 
ATOM   5538  O  O   . PRO C 1 154 ? -73.151 -24.770 44.154  1.00 45.13  ? 154 PRO C O   1 
ATOM   5539  C  CB  . PRO C 1 154 ? -72.338 -24.370 41.154  1.00 46.84  ? 154 PRO C CB  1 
ATOM   5540  C  CG  . PRO C 1 154 ? -72.376 -22.907 41.419  1.00 58.75  ? 154 PRO C CG  1 
ATOM   5541  C  CD  . PRO C 1 154 ? -73.823 -22.529 41.387  1.00 45.51  ? 154 PRO C CD  1 
ATOM   5542  N  N   . ARG C 1 155 ? -73.170 -26.827 43.233  1.00 49.52  ? 155 ARG C N   1 
ATOM   5543  C  CA  . ARG C 1 155 ? -72.795 -27.516 44.457  1.00 37.30  ? 155 ARG C CA  1 
ATOM   5544  C  C   . ARG C 1 155 ? -71.334 -27.930 44.374  1.00 33.69  ? 155 ARG C C   1 
ATOM   5545  O  O   . ARG C 1 155 ? -70.940 -28.677 43.480  1.00 58.50  ? 155 ARG C O   1 
ATOM   5546  C  CB  . ARG C 1 155 ? -73.682 -28.741 44.680  1.00 57.95  ? 155 ARG C CB  1 
ATOM   5547  C  CG  . ARG C 1 155 ? -75.129 -28.407 44.996  1.00 75.97  ? 155 ARG C CG  1 
ATOM   5548  C  CD  . ARG C 1 155 ? -75.411 -28.532 46.483  1.00 98.20  ? 155 ARG C CD  1 
ATOM   5549  N  NE  . ARG C 1 155 ? -75.709 -27.240 47.095  1.00 103.15 ? 155 ARG C NE  1 
ATOM   5550  C  CZ  . ARG C 1 155 ? -75.408 -26.919 48.349  1.00 104.94 ? 155 ARG C CZ  1 
ATOM   5551  N  NH1 . ARG C 1 155 ? -74.798 -27.798 49.131  1.00 109.57 ? 155 ARG C NH1 1 
ATOM   5552  N  NH2 . ARG C 1 155 ? -75.717 -25.720 48.822  1.00 103.96 ? 155 ARG C NH2 1 
ATOM   5553  N  N   . LEU C 1 156 ? -70.531 -27.432 45.306  1.00 33.40  ? 156 LEU C N   1 
ATOM   5554  C  CA  . LEU C 1 156 ? -69.118 -27.708 45.317  1.00 39.07  ? 156 LEU C CA  1 
ATOM   5555  C  C   . LEU C 1 156 ? -68.928 -29.257 45.349  1.00 29.01  ? 156 LEU C C   1 
ATOM   5556  O  O   . LEU C 1 156 ? -69.641 -29.966 46.045  1.00 28.41  ? 156 LEU C O   1 
ATOM   5557  C  CB  . LEU C 1 156 ? -68.521 -27.023 46.554  1.00 32.67  ? 156 LEU C CB  1 
ATOM   5558  C  CG  . LEU C 1 156 ? -67.107 -26.505 46.530  1.00 42.91  ? 156 LEU C CG  1 
ATOM   5559  C  CD1 . LEU C 1 156 ? -66.390 -27.157 47.657  1.00 43.81  ? 156 LEU C CD1 1 
ATOM   5560  C  CD2 . LEU C 1 156 ? -66.512 -26.909 45.236  1.00 58.69  ? 156 LEU C CD2 1 
ATOM   5561  N  N   . LYS C 1 157 ? -67.976 -29.763 44.585  1.00 25.14  ? 157 LYS C N   1 
ATOM   5562  C  CA  . LYS C 1 157 ? -67.664 -31.191 44.534  1.00 29.13  ? 157 LYS C CA  1 
ATOM   5563  C  C   . LYS C 1 157 ? -66.164 -31.446 44.672  1.00 39.49  ? 157 LYS C C   1 
ATOM   5564  O  O   . LYS C 1 157 ? -65.379 -31.037 43.820  1.00 47.58  ? 157 LYS C O   1 
ATOM   5565  C  CB  . LYS C 1 157 ? -68.162 -31.768 43.223  1.00 39.33  ? 157 LYS C CB  1 
ATOM   5566  C  CG  . LYS C 1 157 ? -69.678 -31.763 43.132  1.00 33.87  ? 157 LYS C CG  1 
ATOM   5567  C  CD  . LYS C 1 157 ? -70.238 -32.952 43.921  1.00 41.59  ? 157 LYS C CD  1 
ATOM   5568  C  CE  . LYS C 1 157 ? -71.735 -32.876 44.066  1.00 53.00  ? 157 LYS C CE  1 
ATOM   5569  N  NZ  . LYS C 1 157 ? -72.278 -34.199 44.419  1.00 56.34  ? 157 LYS C NZ  1 
ATOM   5570  N  N   . ILE C 1 158 ? -65.825 -32.281 45.622  1.00 39.55  ? 158 ILE C N   1 
ATOM   5571  C  CA  . ILE C 1 158 ? -64.477 -32.737 45.782  1.00 34.57  ? 158 ILE C CA  1 
ATOM   5572  C  C   . ILE C 1 158 ? -64.254 -34.087 45.131  1.00 49.84  ? 158 ILE C C   1 
ATOM   5573  O  O   . ILE C 1 158 ? -65.023 -34.995 45.303  1.00 44.42  ? 158 ILE C O   1 
ATOM   5574  C  CB  . ILE C 1 158 ? -64.120 -32.787 47.235  1.00 38.30  ? 158 ILE C CB  1 
ATOM   5575  C  CG1 . ILE C 1 158 ? -64.305 -31.416 47.844  1.00 36.92  ? 158 ILE C CG1 1 
ATOM   5576  C  CG2 . ILE C 1 158 ? -62.725 -33.183 47.378  1.00 34.84  ? 158 ILE C CG2 1 
ATOM   5577  C  CD1 . ILE C 1 158 ? -64.502 -31.416 49.313  1.00 39.01  ? 158 ILE C CD1 1 
ATOM   5578  N  N   . ALA C 1 159 ? -63.172 -34.185 44.378  1.00 63.63  ? 159 ALA C N   1 
ATOM   5579  C  CA  . ALA C 1 159 ? -62.813 -35.378 43.632  1.00 76.83  ? 159 ALA C CA  1 
ATOM   5580  C  C   . ALA C 1 159 ? -61.748 -36.266 44.270  1.00 97.41  ? 159 ALA C C   1 
ATOM   5581  O  O   . ALA C 1 159 ? -60.595 -35.877 44.374  1.00 99.42  ? 159 ALA C O   1 
ATOM   5582  C  CB  . ALA C 1 159 ? -62.386 -34.998 42.240  1.00 63.37  ? 159 ALA C CB  1 
ATOM   5583  N  N   . ASP C 1 160 ? -62.143 -37.474 44.663  1.00 105.77 ? 160 ASP C N   1 
ATOM   5584  C  CA  . ASP C 1 160 ? -61.208 -38.488 45.142  1.00 110.82 ? 160 ASP C CA  1 
ATOM   5585  C  C   . ASP C 1 160 ? -61.211 -39.701 44.215  1.00 112.38 ? 160 ASP C C   1 
ATOM   5586  O  O   . ASP C 1 160 ? -61.308 -40.847 44.667  1.00 105.59 ? 160 ASP C O   1 
ATOM   5587  C  CB  . ASP C 1 160 ? -61.541 -38.934 46.567  1.00 111.86 ? 160 ASP C CB  1 
ATOM   5588  C  CG  . ASP C 1 160 ? -62.054 -37.813 47.413  1.00 117.38 ? 160 ASP C CG  1 
ATOM   5589  O  OD1 . ASP C 1 160 ? -61.911 -37.846 48.651  1.00 114.42 ? 160 ASP C OD1 1 
ATOM   5590  O  OD2 . ASP C 1 160 ? -62.594 -36.874 46.834  1.00 120.99 ? 160 ASP C OD2 1 
ATOM   5591  N  N   . THR C 1 179 ? -50.401 -25.247 42.246  1.00 92.48  ? 179 THR C N   1 
ATOM   5592  C  CA  . THR C 1 179 ? -49.201 -24.410 42.168  1.00 94.99  ? 179 THR C CA  1 
ATOM   5593  C  C   . THR C 1 179 ? -48.639 -24.175 43.583  1.00 95.92  ? 179 THR C C   1 
ATOM   5594  O  O   . THR C 1 179 ? -49.019 -24.902 44.518  1.00 98.85  ? 179 THR C O   1 
ATOM   5595  C  CB  . THR C 1 179 ? -49.487 -23.104 41.380  1.00 121.49 ? 179 THR C CB  1 
ATOM   5596  O  OG1 . THR C 1 179 ? -49.707 -21.998 42.276  1.00 116.77 ? 179 THR C OG1 1 
ATOM   5597  C  CG2 . THR C 1 179 ? -50.700 -23.298 40.485  1.00 126.17 ? 179 THR C CG2 1 
ATOM   5598  N  N   . PRO C 1 180 ? -47.734 -23.185 43.757  1.00 74.92  ? 180 PRO C N   1 
ATOM   5599  C  CA  . PRO C 1 180 ? -47.079 -23.095 45.069  1.00 64.72  ? 180 PRO C CA  1 
ATOM   5600  C  C   . PRO C 1 180 ? -47.802 -22.314 46.180  1.00 62.52  ? 180 PRO C C   1 
ATOM   5601  O  O   . PRO C 1 180 ? -47.479 -22.544 47.342  1.00 52.21  ? 180 PRO C O   1 
ATOM   5602  C  CB  . PRO C 1 180 ? -45.736 -22.427 44.751  1.00 61.55  ? 180 PRO C CB  1 
ATOM   5603  C  CG  . PRO C 1 180 ? -45.794 -22.025 43.304  1.00 57.55  ? 180 PRO C CG  1 
ATOM   5604  C  CD  . PRO C 1 180 ? -47.172 -22.207 42.813  1.00 66.86  ? 180 PRO C CD  1 
ATOM   5605  N  N   . ALA C 1 181 ? -48.725 -21.411 45.872  1.00 73.64  ? 181 ALA C N   1 
ATOM   5606  C  CA  . ALA C 1 181 ? -49.411 -20.701 46.957  1.00 72.12  ? 181 ALA C CA  1 
ATOM   5607  C  C   . ALA C 1 181 ? -50.143 -21.667 47.902  1.00 70.03  ? 181 ALA C C   1 
ATOM   5608  O  O   . ALA C 1 181 ? -50.238 -21.387 49.103  1.00 71.05  ? 181 ALA C O   1 
ATOM   5609  C  CB  . ALA C 1 181 ? -50.367 -19.653 46.420  1.00 78.86  ? 181 ALA C CB  1 
ATOM   5610  N  N   . TYR C 1 182 ? -50.635 -22.804 47.391  1.00 45.38  ? 182 TYR C N   1 
ATOM   5611  C  CA  . TYR C 1 182 ? -51.370 -23.732 48.256  1.00 38.45  ? 182 TYR C CA  1 
ATOM   5612  C  C   . TYR C 1 182 ? -50.512 -24.393 49.321  1.00 51.50  ? 182 TYR C C   1 
ATOM   5613  O  O   . TYR C 1 182 ? -51.029 -25.111 50.186  1.00 59.03  ? 182 TYR C O   1 
ATOM   5614  C  CB  . TYR C 1 182 ? -52.085 -24.810 47.459  1.00 24.38  ? 182 TYR C CB  1 
ATOM   5615  C  CG  . TYR C 1 182 ? -53.338 -24.318 46.798  1.00 34.18  ? 182 TYR C CG  1 
ATOM   5616  C  CD1 . TYR C 1 182 ? -53.323 -23.905 45.471  1.00 27.28  ? 182 TYR C CD1 1 
ATOM   5617  C  CD2 . TYR C 1 182 ? -54.541 -24.247 47.503  1.00 38.59  ? 182 TYR C CD2 1 
ATOM   5618  C  CE1 . TYR C 1 182 ? -54.467 -23.440 44.844  1.00 36.46  ? 182 TYR C CE1 1 
ATOM   5619  C  CE2 . TYR C 1 182 ? -55.699 -23.781 46.888  1.00 34.32  ? 182 TYR C CE2 1 
ATOM   5620  C  CZ  . TYR C 1 182 ? -55.650 -23.382 45.548  1.00 45.04  ? 182 TYR C CZ  1 
ATOM   5621  O  OH  . TYR C 1 182 ? -56.777 -22.929 44.895  1.00 54.10  ? 182 TYR C OH  1 
ATOM   5622  N  N   . ILE C 1 183 ? -49.211 -24.145 49.274  1.00 39.18  ? 183 ILE C N   1 
ATOM   5623  C  CA  . ILE C 1 183 ? -48.290 -24.872 50.135  1.00 45.12  ? 183 ILE C CA  1 
ATOM   5624  C  C   . ILE C 1 183 ? -48.153 -24.226 51.524  1.00 43.10  ? 183 ILE C C   1 
ATOM   5625  O  O   . ILE C 1 183 ? -47.466 -23.226 51.699  1.00 43.82  ? 183 ILE C O   1 
ATOM   5626  C  CB  . ILE C 1 183 ? -46.874 -25.012 49.485  1.00 48.44  ? 183 ILE C CB  1 
ATOM   5627  C  CG1 . ILE C 1 183 ? -46.955 -25.602 48.071  1.00 44.99  ? 183 ILE C CG1 1 
ATOM   5628  C  CG2 . ILE C 1 183 ? -45.952 -25.851 50.380  1.00 52.58  ? 183 ILE C CG2 1 
ATOM   5629  C  CD1 . ILE C 1 183 ? -45.583 -25.651 47.364  1.00 36.11  ? 183 ILE C CD1 1 
ATOM   5630  N  N   . ALA C 1 184 ? -48.792 -24.816 52.517  1.00 48.01  ? 184 ALA C N   1 
ATOM   5631  C  CA  . ALA C 1 184 ? -48.576 -24.400 53.896  1.00 52.95  ? 184 ALA C CA  1 
ATOM   5632  C  C   . ALA C 1 184 ? -47.080 -24.252 54.189  1.00 52.37  ? 184 ALA C C   1 
ATOM   5633  O  O   . ALA C 1 184 ? -46.277 -24.898 53.541  1.00 49.61  ? 184 ALA C O   1 
ATOM   5634  C  CB  . ALA C 1 184 ? -49.201 -25.413 54.838  1.00 45.30  ? 184 ALA C CB  1 
ATOM   5635  N  N   . PRO C 1 185 ? -46.702 -23.364 55.132  1.00 45.66  ? 185 PRO C N   1 
ATOM   5636  C  CA  . PRO C 1 185 ? -45.319 -23.309 55.602  1.00 39.14  ? 185 PRO C CA  1 
ATOM   5637  C  C   . PRO C 1 185 ? -44.809 -24.608 56.248  1.00 46.68  ? 185 PRO C C   1 
ATOM   5638  O  O   . PRO C 1 185 ? -43.694 -25.021 55.906  1.00 57.60  ? 185 PRO C O   1 
ATOM   5639  C  CB  . PRO C 1 185 ? -45.349 -22.168 56.626  1.00 42.75  ? 185 PRO C CB  1 
ATOM   5640  C  CG  . PRO C 1 185 ? -46.378 -21.238 56.088  1.00 32.91  ? 185 PRO C CG  1 
ATOM   5641  C  CD  . PRO C 1 185 ? -47.451 -22.160 55.532  1.00 30.14  ? 185 PRO C CD  1 
ATOM   5642  N  N   . GLU C 1 186 ? -45.565 -25.236 57.149  1.00 50.49  ? 186 GLU C N   1 
ATOM   5643  C  CA  . GLU C 1 186 ? -45.167 -26.546 57.682  1.00 43.20  ? 186 GLU C CA  1 
ATOM   5644  C  C   . GLU C 1 186 ? -44.418 -27.306 56.627  1.00 47.00  ? 186 GLU C C   1 
ATOM   5645  O  O   . GLU C 1 186 ? -43.328 -27.804 56.854  1.00 56.01  ? 186 GLU C O   1 
ATOM   5646  C  CB  . GLU C 1 186 ? -46.384 -27.417 57.941  1.00 43.06  ? 186 GLU C CB  1 
ATOM   5647  C  CG  . GLU C 1 186 ? -47.330 -26.956 58.982  1.00 59.88  ? 186 GLU C CG  1 
ATOM   5648  C  CD  . GLU C 1 186 ? -48.523 -26.295 58.376  1.00 60.62  ? 186 GLU C CD  1 
ATOM   5649  O  OE1 . GLU C 1 186 ? -48.395 -25.081 58.113  1.00 68.44  ? 186 GLU C OE1 1 
ATOM   5650  O  OE2 . GLU C 1 186 ? -49.563 -26.970 58.147  1.00 56.64  ? 186 GLU C OE2 1 
ATOM   5651  N  N   . VAL C 1 187 ? -45.067 -27.412 55.475  1.00 39.85  ? 187 VAL C N   1 
ATOM   5652  C  CA  . VAL C 1 187 ? -44.622 -28.196 54.337  1.00 46.56  ? 187 VAL C CA  1 
ATOM   5653  C  C   . VAL C 1 187 ? -43.291 -27.728 53.728  1.00 56.04  ? 187 VAL C C   1 
ATOM   5654  O  O   . VAL C 1 187 ? -42.511 -28.551 53.243  1.00 68.90  ? 187 VAL C O   1 
ATOM   5655  C  CB  . VAL C 1 187 ? -45.714 -28.165 53.254  1.00 47.66  ? 187 VAL C CB  1 
ATOM   5656  C  CG1 . VAL C 1 187 ? -45.277 -28.883 51.996  1.00 50.85  ? 187 VAL C CG1 1 
ATOM   5657  C  CG2 . VAL C 1 187 ? -47.028 -28.718 53.816  1.00 40.87  ? 187 VAL C CG2 1 
ATOM   5658  N  N   . LEU C 1 188 ? -43.056 -26.422 53.737  1.00 57.34  ? 188 LEU C N   1 
ATOM   5659  C  CA  . LEU C 1 188 ? -41.800 -25.881 53.245  1.00 55.75  ? 188 LEU C CA  1 
ATOM   5660  C  C   . LEU C 1 188 ? -40.803 -25.884 54.389  1.00 59.76  ? 188 LEU C C   1 
ATOM   5661  O  O   . LEU C 1 188 ? -39.691 -25.373 54.264  1.00 74.00  ? 188 LEU C O   1 
ATOM   5662  C  CB  . LEU C 1 188 ? -41.995 -24.458 52.721  1.00 42.23  ? 188 LEU C CB  1 
ATOM   5663  C  CG  . LEU C 1 188 ? -42.420 -24.321 51.259  1.00 49.72  ? 188 LEU C CG  1 
ATOM   5664  C  CD1 . LEU C 1 188 ? -43.122 -25.584 50.783  1.00 63.56  ? 188 LEU C CD1 1 
ATOM   5665  C  CD2 . LEU C 1 188 ? -43.312 -23.106 51.073  1.00 51.43  ? 188 LEU C CD2 1 
ATOM   5666  N  N   . LEU C 1 189 ? -41.214 -26.466 55.510  1.00 55.56  ? 189 LEU C N   1 
ATOM   5667  C  CA  . LEU C 1 189 ? -40.402 -26.446 56.716  1.00 63.32  ? 189 LEU C CA  1 
ATOM   5668  C  C   . LEU C 1 189 ? -40.113 -27.828 57.296  1.00 74.22  ? 189 LEU C C   1 
ATOM   5669  O  O   . LEU C 1 189 ? -38.985 -28.096 57.709  1.00 69.29  ? 189 LEU C O   1 
ATOM   5670  C  CB  . LEU C 1 189 ? -41.054 -25.561 57.782  1.00 65.76  ? 189 LEU C CB  1 
ATOM   5671  C  CG  . LEU C 1 189 ? -40.851 -24.053 57.625  1.00 63.77  ? 189 LEU C CG  1 
ATOM   5672  C  CD1 . LEU C 1 189 ? -41.282 -23.319 58.884  1.00 63.10  ? 189 LEU C CD1 1 
ATOM   5673  C  CD2 . LEU C 1 189 ? -39.403 -23.738 57.285  1.00 53.42  ? 189 LEU C CD2 1 
ATOM   5674  N  N   . LYS C 1 190 ? -41.117 -28.696 57.342  1.00 72.01  ? 190 LYS C N   1 
ATOM   5675  C  CA  . LYS C 1 190 ? -40.957 -29.983 58.010  1.00 60.57  ? 190 LYS C CA  1 
ATOM   5676  C  C   . LYS C 1 190 ? -40.950 -31.187 57.072  1.00 75.53  ? 190 LYS C C   1 
ATOM   5677  O  O   . LYS C 1 190 ? -41.776 -31.289 56.165  1.00 71.91  ? 190 LYS C O   1 
ATOM   5678  C  CB  . LYS C 1 190 ? -42.043 -30.164 59.075  1.00 65.84  ? 190 LYS C CB  1 
ATOM   5679  C  CG  . LYS C 1 190 ? -41.650 -29.661 60.453  1.00 69.53  ? 190 LYS C CG  1 
ATOM   5680  C  CD  . LYS C 1 190 ? -41.443 -28.156 60.454  1.00 70.61  ? 190 LYS C CD  1 
ATOM   5681  C  CE  . LYS C 1 190 ? -40.515 -27.727 61.578  1.00 77.98  ? 190 LYS C CE  1 
ATOM   5682  N  NZ  . LYS C 1 190 ? -39.190 -28.401 61.490  1.00 84.57  ? 190 LYS C NZ  1 
ATOM   5683  N  N   . LYS C 1 191 ? -40.013 -32.100 57.310  1.00 83.02  ? 191 LYS C N   1 
ATOM   5684  C  CA  . LYS C 1 191 ? -39.986 -33.382 56.617  1.00 84.40  ? 191 LYS C CA  1 
ATOM   5685  C  C   . LYS C 1 191 ? -41.293 -34.141 56.814  1.00 82.10  ? 191 LYS C C   1 
ATOM   5686  O  O   . LYS C 1 191 ? -41.704 -34.919 55.954  1.00 90.83  ? 191 LYS C O   1 
ATOM   5687  C  CB  . LYS C 1 191 ? -38.807 -34.228 57.102  1.00 90.61  ? 191 LYS C CB  1 
ATOM   5688  C  CG  . LYS C 1 191 ? -38.288 -35.216 56.070  1.00 92.56  ? 191 LYS C CG  1 
ATOM   5689  C  CD  . LYS C 1 191 ? -39.340 -35.513 55.013  1.00 89.57  ? 191 LYS C CD  1 
ATOM   5690  C  CE  . LYS C 1 191 ? -39.612 -37.005 54.909  1.00 80.98  ? 191 LYS C CE  1 
ATOM   5691  N  NZ  . LYS C 1 191 ? -40.526 -37.324 53.778  1.00 79.60  ? 191 LYS C NZ  1 
ATOM   5692  N  N   . GLU C 1 192 ? -41.943 -33.909 57.950  1.00 69.98  ? 192 GLU C N   1 
ATOM   5693  C  CA  . GLU C 1 192 ? -43.193 -34.591 58.262  1.00 75.12  ? 192 GLU C CA  1 
ATOM   5694  C  C   . GLU C 1 192 ? -44.145 -33.707 59.061  1.00 81.24  ? 192 GLU C C   1 
ATOM   5695  O  O   . GLU C 1 192 ? -43.937 -33.468 60.251  1.00 82.05  ? 192 GLU C O   1 
ATOM   5696  C  CB  . GLU C 1 192 ? -42.918 -35.887 59.028  1.00 90.76  ? 192 GLU C CB  1 
ATOM   5697  C  CG  . GLU C 1 192 ? -41.828 -36.751 58.414  1.00 105.75 ? 192 GLU C CG  1 
ATOM   5698  C  CD  . GLU C 1 192 ? -42.381 -37.972 57.708  1.00 112.75 ? 192 GLU C CD  1 
ATOM   5699  O  OE1 . GLU C 1 192 ? -43.606 -38.018 57.471  1.00 108.75 ? 192 GLU C OE1 1 
ATOM   5700  O  OE2 . GLU C 1 192 ? -41.591 -38.886 57.391  1.00 113.74 ? 192 GLU C OE2 1 
ATOM   5701  N  N   . TYR C 1 193 ? -45.191 -33.226 58.399  1.00 79.80  ? 193 TYR C N   1 
ATOM   5702  C  CA  . TYR C 1 193 ? -46.222 -32.409 59.054  1.00 65.97  ? 193 TYR C CA  1 
ATOM   5703  C  C   . TYR C 1 193 ? -47.554 -33.125 59.325  1.00 67.00  ? 193 TYR C C   1 
ATOM   5704  O  O   . TYR C 1 193 ? -47.721 -34.311 59.063  1.00 76.55  ? 193 TYR C O   1 
ATOM   5705  C  CB  . TYR C 1 193 ? -46.498 -31.155 58.221  1.00 53.90  ? 193 TYR C CB  1 
ATOM   5706  C  CG  . TYR C 1 193 ? -46.780 -31.483 56.777  1.00 54.55  ? 193 TYR C CG  1 
ATOM   5707  C  CD1 . TYR C 1 193 ? -48.056 -31.793 56.348  1.00 57.63  ? 193 TYR C CD1 1 
ATOM   5708  C  CD2 . TYR C 1 193 ? -45.756 -31.502 55.844  1.00 62.49  ? 193 TYR C CD2 1 
ATOM   5709  C  CE1 . TYR C 1 193 ? -48.300 -32.112 55.015  1.00 52.83  ? 193 TYR C CE1 1 
ATOM   5710  C  CE2 . TYR C 1 193 ? -45.988 -31.813 54.525  1.00 55.27  ? 193 TYR C CE2 1 
ATOM   5711  C  CZ  . TYR C 1 193 ? -47.248 -32.117 54.119  1.00 55.71  ? 193 TYR C CZ  1 
ATOM   5712  O  OH  . TYR C 1 193 ? -47.441 -32.420 52.795  1.00 72.81  ? 193 TYR C OH  1 
ATOM   5713  N  N   . ASP C 1 194 ? -48.489 -32.370 59.872  1.00 59.11  ? 194 ASP C N   1 
ATOM   5714  C  CA  . ASP C 1 194 ? -49.874 -32.784 60.004  1.00 50.65  ? 194 ASP C CA  1 
ATOM   5715  C  C   . ASP C 1 194 ? -50.776 -32.283 58.835  1.00 50.42  ? 194 ASP C C   1 
ATOM   5716  O  O   . ASP C 1 194 ? -50.944 -31.080 58.591  1.00 53.28  ? 194 ASP C O   1 
ATOM   5717  C  CB  . ASP C 1 194 ? -50.413 -32.318 61.359  1.00 44.49  ? 194 ASP C CB  1 
ATOM   5718  C  CG  . ASP C 1 194 ? -51.864 -32.758 61.595  1.00 61.78  ? 194 ASP C CG  1 
ATOM   5719  O  OD1 . ASP C 1 194 ? -52.287 -32.797 62.773  1.00 55.42  ? 194 ASP C OD1 1 
ATOM   5720  O  OD2 . ASP C 1 194 ? -52.585 -33.056 60.606  1.00 68.02  ? 194 ASP C OD2 1 
ATOM   5721  N  N   . GLY C 1 195 ? -51.379 -33.232 58.139  1.00 53.24  ? 195 GLY C N   1 
ATOM   5722  C  CA  . GLY C 1 195 ? -52.078 -32.959 56.902  1.00 44.92  ? 195 GLY C CA  1 
ATOM   5723  C  C   . GLY C 1 195 ? -53.477 -32.405 57.061  1.00 48.85  ? 195 GLY C C   1 
ATOM   5724  O  O   . GLY C 1 195 ? -54.037 -31.956 56.081  1.00 46.10  ? 195 GLY C O   1 
ATOM   5725  N  N   . LYS C 1 196 ? -54.004 -32.420 58.280  1.00 49.66  ? 196 LYS C N   1 
ATOM   5726  C  CA  . LYS C 1 196 ? -55.316 -31.852 58.555  1.00 48.10  ? 196 LYS C CA  1 
ATOM   5727  C  C   . LYS C 1 196 ? -55.228 -30.336 58.697  1.00 52.92  ? 196 LYS C C   1 
ATOM   5728  O  O   . LYS C 1 196 ? -56.131 -29.614 58.275  1.00 49.52  ? 196 LYS C O   1 
ATOM   5729  C  CB  . LYS C 1 196 ? -55.915 -32.470 59.818  1.00 63.83  ? 196 LYS C CB  1 
ATOM   5730  C  CG  . LYS C 1 196 ? -56.084 -33.979 59.747  1.00 76.60  ? 196 LYS C CG  1 
ATOM   5731  C  CD  . LYS C 1 196 ? -57.500 -34.395 60.108  1.00 79.64  ? 196 LYS C CD  1 
ATOM   5732  C  CE  . LYS C 1 196 ? -57.743 -35.861 59.786  1.00 74.89  ? 196 LYS C CE  1 
ATOM   5733  N  NZ  . LYS C 1 196 ? -58.366 -36.584 60.928  1.00 68.04  ? 196 LYS C NZ  1 
ATOM   5734  N  N   . VAL C 1 197 ? -54.139 -29.877 59.307  1.00 43.74  ? 197 VAL C N   1 
ATOM   5735  C  CA  . VAL C 1 197 ? -53.891 -28.455 59.484  1.00 39.78  ? 197 VAL C CA  1 
ATOM   5736  C  C   . VAL C 1 197 ? -53.426 -27.856 58.168  1.00 41.66  ? 197 VAL C C   1 
ATOM   5737  O  O   . VAL C 1 197 ? -53.751 -26.714 57.846  1.00 47.46  ? 197 VAL C O   1 
ATOM   5738  C  CB  . VAL C 1 197 ? -52.826 -28.200 60.564  1.00 45.45  ? 197 VAL C CB  1 
ATOM   5739  C  CG1 . VAL C 1 197 ? -52.476 -26.722 60.624  1.00 57.14  ? 197 VAL C CG1 1 
ATOM   5740  C  CG2 . VAL C 1 197 ? -53.314 -28.695 61.915  1.00 38.83  ? 197 VAL C CG2 1 
ATOM   5741  N  N   . ALA C 1 198 ? -52.665 -28.634 57.405  1.00 46.17  ? 198 ALA C N   1 
ATOM   5742  C  CA  . ALA C 1 198 ? -52.226 -28.190 56.087  1.00 42.95  ? 198 ALA C CA  1 
ATOM   5743  C  C   . ALA C 1 198 ? -53.425 -27.972 55.177  1.00 37.10  ? 198 ALA C C   1 
ATOM   5744  O  O   . ALA C 1 198 ? -53.408 -27.106 54.313  1.00 50.11  ? 198 ALA C O   1 
ATOM   5745  C  CB  . ALA C 1 198 ? -51.295 -29.180 55.483  1.00 31.76  ? 198 ALA C CB  1 
ATOM   5746  N  N   . ASP C 1 199 ? -54.468 -28.780 55.366  1.00 32.00  ? 199 ASP C N   1 
ATOM   5747  C  CA  . ASP C 1 199 ? -55.697 -28.639 54.595  1.00 38.44  ? 199 ASP C CA  1 
ATOM   5748  C  C   . ASP C 1 199 ? -56.432 -27.323 54.870  1.00 42.72  ? 199 ASP C C   1 
ATOM   5749  O  O   . ASP C 1 199 ? -56.986 -26.725 53.955  1.00 36.21  ? 199 ASP C O   1 
ATOM   5750  C  CB  . ASP C 1 199 ? -56.622 -29.814 54.856  1.00 40.02  ? 199 ASP C CB  1 
ATOM   5751  C  CG  . ASP C 1 199 ? -56.217 -31.051 54.076  1.00 50.47  ? 199 ASP C CG  1 
ATOM   5752  O  OD1 . ASP C 1 199 ? -56.816 -32.131 54.316  1.00 44.11  ? 199 ASP C OD1 1 
ATOM   5753  O  OD2 . ASP C 1 199 ? -55.296 -30.921 53.226  1.00 46.08  ? 199 ASP C OD2 1 
ATOM   5754  N  N   . VAL C 1 200 ? -56.452 -26.901 56.132  1.00 28.13  ? 200 VAL C N   1 
ATOM   5755  C  CA  . VAL C 1 200 ? -57.084 -25.670 56.515  1.00 32.82  ? 200 VAL C CA  1 
ATOM   5756  C  C   . VAL C 1 200 ? -56.417 -24.513 55.773  1.00 35.75  ? 200 VAL C C   1 
ATOM   5757  O  O   . VAL C 1 200 ? -57.087 -23.652 55.173  1.00 39.06  ? 200 VAL C O   1 
ATOM   5758  C  CB  . VAL C 1 200 ? -57.033 -25.466 58.025  1.00 35.40  ? 200 VAL C CB  1 
ATOM   5759  C  CG1 . VAL C 1 200 ? -57.353 -24.040 58.361  1.00 45.96  ? 200 VAL C CG1 1 
ATOM   5760  C  CG2 . VAL C 1 200 ? -58.026 -26.382 58.699  1.00 34.88  ? 200 VAL C CG2 1 
ATOM   5761  N  N   . TRP C 1 201 ? -55.095 -24.514 55.767  1.00 26.01  ? 201 TRP C N   1 
ATOM   5762  C  CA  . TRP C 1 201 ? -54.362 -23.506 55.010  1.00 34.40  ? 201 TRP C CA  1 
ATOM   5763  C  C   . TRP C 1 201 ? -54.844 -23.492 53.562  1.00 35.33  ? 201 TRP C C   1 
ATOM   5764  O  O   . TRP C 1 201 ? -55.215 -22.443 53.039  1.00 38.10  ? 201 TRP C O   1 
ATOM   5765  C  CB  . TRP C 1 201 ? -52.868 -23.777 55.085  1.00 19.73  ? 201 TRP C CB  1 
ATOM   5766  C  CG  . TRP C 1 201 ? -52.055 -22.861 54.270  1.00 31.52  ? 201 TRP C CG  1 
ATOM   5767  C  CD1 . TRP C 1 201 ? -51.842 -22.940 52.933  1.00 36.10  ? 201 TRP C CD1 1 
ATOM   5768  C  CD2 . TRP C 1 201 ? -51.310 -21.750 54.720  1.00 28.03  ? 201 TRP C CD2 1 
ATOM   5769  N  NE1 . TRP C 1 201 ? -51.013 -21.933 52.514  1.00 43.49  ? 201 TRP C NE1 1 
ATOM   5770  C  CE2 . TRP C 1 201 ? -50.658 -21.161 53.633  1.00 31.34  ? 201 TRP C CE2 1 
ATOM   5771  C  CE3 . TRP C 1 201 ? -51.105 -21.149 55.983  1.00 38.53  ? 201 TRP C CE3 1 
ATOM   5772  C  CZ2 . TRP C 1 201 ? -49.860 -20.059 53.699  1.00 34.90  ? 201 TRP C CZ2 1 
ATOM   5773  C  CZ3 . TRP C 1 201 ? -50.289 -20.042 56.078  1.00 31.55  ? 201 TRP C CZ3 1 
ATOM   5774  C  CH2 . TRP C 1 201 ? -49.673 -19.516 54.945  1.00 35.69  ? 201 TRP C CH2 1 
ATOM   5775  N  N   . SER C 1 202 ? -54.879 -24.667 52.946  1.00 39.07  ? 202 SER C N   1 
ATOM   5776  C  CA  . SER C 1 202 ? -55.386 -24.812 51.590  1.00 39.61  ? 202 SER C CA  1 
ATOM   5777  C  C   . SER C 1 202 ? -56.782 -24.210 51.440  1.00 31.62  ? 202 SER C C   1 
ATOM   5778  O  O   . SER C 1 202 ? -57.074 -23.556 50.440  1.00 40.77  ? 202 SER C O   1 
ATOM   5779  C  CB  . SER C 1 202 ? -55.405 -26.286 51.180  1.00 40.29  ? 202 SER C CB  1 
ATOM   5780  O  OG  . SER C 1 202 ? -54.784 -26.472 49.921  1.00 52.91  ? 202 SER C OG  1 
ATOM   5781  N  N   . CYS C 1 203 ? -57.644 -24.430 52.430  1.00 29.50  ? 203 CYS C N   1 
ATOM   5782  C  CA  . CYS C 1 203 ? -58.989 -23.897 52.371  1.00 25.36  ? 203 CYS C CA  1 
ATOM   5783  C  C   . CYS C 1 203 ? -58.925 -22.375 52.460  1.00 37.46  ? 203 CYS C C   1 
ATOM   5784  O  O   . CYS C 1 203 ? -59.764 -21.695 51.904  1.00 35.37  ? 203 CYS C O   1 
ATOM   5785  C  CB  . CYS C 1 203 ? -59.861 -24.496 53.482  1.00 25.67  ? 203 CYS C CB  1 
ATOM   5786  S  SG  . CYS C 1 203 ? -60.169 -26.318 53.241  1.00 45.76  ? 203 CYS C SG  1 
ATOM   5787  N  N   . GLY C 1 204 ? -57.918 -21.848 53.150  1.00 25.18  ? 204 GLY C N   1 
ATOM   5788  C  CA  . GLY C 1 204 ? -57.759 -20.423 53.269  1.00 29.58  ? 204 GLY C CA  1 
ATOM   5789  C  C   . GLY C 1 204 ? -57.411 -19.839 51.915  1.00 39.68  ? 204 GLY C C   1 
ATOM   5790  O  O   . GLY C 1 204 ? -57.954 -18.807 51.539  1.00 35.46  ? 204 GLY C O   1 
ATOM   5791  N  N   . VAL C 1 205 ? -56.516 -20.500 51.180  1.00 28.96  ? 205 VAL C N   1 
ATOM   5792  C  CA  . VAL C 1 205 ? -56.082 -19.993 49.891  1.00 24.02  ? 205 VAL C CA  1 
ATOM   5793  C  C   . VAL C 1 205 ? -57.244 -19.992 48.936  1.00 32.70  ? 205 VAL C C   1 
ATOM   5794  O  O   . VAL C 1 205 ? -57.412 -19.040 48.162  1.00 39.31  ? 205 VAL C O   1 
ATOM   5795  C  CB  . VAL C 1 205 ? -54.940 -20.801 49.268  1.00 26.15  ? 205 VAL C CB  1 
ATOM   5796  C  CG1 . VAL C 1 205 ? -54.590 -20.255 47.913  1.00 24.73  ? 205 VAL C CG1 1 
ATOM   5797  C  CG2 . VAL C 1 205 ? -53.710 -20.814 50.165  1.00 25.98  ? 205 VAL C CG2 1 
ATOM   5798  N  N   . THR C 1 206 ? -58.086 -21.020 48.969  1.00 33.36  ? 206 THR C N   1 
ATOM   5799  C  CA  . THR C 1 206 ? -59.213 -20.939 48.056  1.00 41.41  ? 206 THR C CA  1 
ATOM   5800  C  C   . THR C 1 206 ? -60.274 -19.885 48.487  1.00 41.23  ? 206 THR C C   1 
ATOM   5801  O  O   . THR C 1 206 ? -60.985 -19.338 47.659  1.00 47.40  ? 206 THR C O   1 
ATOM   5802  C  CB  . THR C 1 206 ? -59.785 -22.314 47.566  1.00 28.08  ? 206 THR C CB  1 
ATOM   5803  O  OG1 . THR C 1 206 ? -61.094 -22.509 48.082  1.00 32.46  ? 206 THR C OG1 1 
ATOM   5804  C  CG2 . THR C 1 206 ? -58.912 -23.437 47.932  1.00 41.06  ? 206 THR C CG2 1 
ATOM   5805  N  N   . LEU C 1 207 ? -60.337 -19.546 49.760  1.00 38.73  ? 207 LEU C N   1 
ATOM   5806  C  CA  . LEU C 1 207 ? -61.244 -18.486 50.177  1.00 30.73  ? 207 LEU C CA  1 
ATOM   5807  C  C   . LEU C 1 207 ? -60.704 -17.151 49.724  1.00 33.08  ? 207 LEU C C   1 
ATOM   5808  O  O   . LEU C 1 207 ? -61.448 -16.284 49.299  1.00 32.34  ? 207 LEU C O   1 
ATOM   5809  C  CB  . LEU C 1 207 ? -61.422 -18.477 51.684  1.00 18.74  ? 207 LEU C CB  1 
ATOM   5810  C  CG  . LEU C 1 207 ? -62.084 -17.268 52.339  1.00 25.82  ? 207 LEU C CG  1 
ATOM   5811  C  CD1 . LEU C 1 207 ? -63.454 -16.923 51.816  1.00 20.02  ? 207 LEU C CD1 1 
ATOM   5812  C  CD2 . LEU C 1 207 ? -62.200 -17.543 53.806  1.00 24.25  ? 207 LEU C CD2 1 
ATOM   5813  N  N   . TYR C 1 208 ? -59.397 -16.988 49.827  1.00 21.34  ? 208 TYR C N   1 
ATOM   5814  C  CA  . TYR C 1 208 ? -58.758 -15.764 49.379  1.00 26.86  ? 208 TYR C CA  1 
ATOM   5815  C  C   . TYR C 1 208 ? -58.988 -15.577 47.876  1.00 32.27  ? 208 TYR C C   1 
ATOM   5816  O  O   . TYR C 1 208 ? -59.485 -14.570 47.443  1.00 39.81  ? 208 TYR C O   1 
ATOM   5817  C  CB  . TYR C 1 208 ? -57.266 -15.788 49.708  1.00 31.27  ? 208 TYR C CB  1 
ATOM   5818  C  CG  . TYR C 1 208 ? -56.514 -14.528 49.332  1.00 46.15  ? 208 TYR C CG  1 
ATOM   5819  C  CD1 . TYR C 1 208 ? -56.202 -13.551 50.286  1.00 46.40  ? 208 TYR C CD1 1 
ATOM   5820  C  CD2 . TYR C 1 208 ? -56.116 -14.317 48.039  1.00 45.97  ? 208 TYR C CD2 1 
ATOM   5821  C  CE1 . TYR C 1 208 ? -55.495 -12.394 49.927  1.00 43.16  ? 208 TYR C CE1 1 
ATOM   5822  C  CE2 . TYR C 1 208 ? -55.416 -13.181 47.671  1.00 44.67  ? 208 TYR C CE2 1 
ATOM   5823  C  CZ  . TYR C 1 208 ? -55.108 -12.229 48.607  1.00 49.07  ? 208 TYR C CZ  1 
ATOM   5824  O  OH  . TYR C 1 208 ? -54.414 -11.125 48.171  1.00 45.30  ? 208 TYR C OH  1 
ATOM   5825  N  N   . VAL C 1 209 ? -58.663 -16.591 47.091  1.00 32.48  ? 209 VAL C N   1 
ATOM   5826  C  CA  . VAL C 1 209 ? -58.902 -16.570 45.657  1.00 35.22  ? 209 VAL C CA  1 
ATOM   5827  C  C   . VAL C 1 209 ? -60.336 -16.232 45.277  1.00 34.33  ? 209 VAL C C   1 
ATOM   5828  O  O   . VAL C 1 209 ? -60.578 -15.439 44.349  1.00 38.20  ? 209 VAL C O   1 
ATOM   5829  C  CB  . VAL C 1 209 ? -58.529 -17.898 45.006  1.00 26.19  ? 209 VAL C CB  1 
ATOM   5830  C  CG1 . VAL C 1 209 ? -58.954 -17.886 43.599  1.00 36.61  ? 209 VAL C CG1 1 
ATOM   5831  C  CG2 . VAL C 1 209 ? -57.041 -18.092 45.060  1.00 28.30  ? 209 VAL C CG2 1 
ATOM   5832  N  N   . MET C 1 210 ? -61.299 -16.831 45.961  1.00 34.80  ? 210 MET C N   1 
ATOM   5833  C  CA  . MET C 1 210 ? -62.689 -16.470 45.675  1.00 36.18  ? 210 MET C CA  1 
ATOM   5834  C  C   . MET C 1 210 ? -62.922 -14.972 45.889  1.00 28.94  ? 210 MET C C   1 
ATOM   5835  O  O   . MET C 1 210 ? -63.608 -14.330 45.073  1.00 33.79  ? 210 MET C O   1 
ATOM   5836  C  CB  . MET C 1 210 ? -63.691 -17.304 46.481  1.00 35.46  ? 210 MET C CB  1 
ATOM   5837  C  CG  . MET C 1 210 ? -63.844 -18.803 45.989  1.00 29.97  ? 210 MET C CG  1 
ATOM   5838  S  SD  . MET C 1 210 ? -65.309 -19.611 46.522  1.00 36.40  ? 210 MET C SD  1 
ATOM   5839  C  CE  . MET C 1 210 ? -64.863 -19.762 48.193  1.00 19.40  ? 210 MET C CE  1 
ATOM   5840  N  N   . LEU C 1 211 ? -62.366 -14.426 46.975  1.00 24.73  ? 211 LEU C N   1 
ATOM   5841  C  CA  . LEU C 1 211 ? -62.682 -13.061 47.388  1.00 26.97  ? 211 LEU C CA  1 
ATOM   5842  C  C   . LEU C 1 211 ? -61.926 -12.047 46.538  1.00 32.69  ? 211 LEU C C   1 
ATOM   5843  O  O   . LEU C 1 211 ? -62.448 -10.971 46.239  1.00 44.06  ? 211 LEU C O   1 
ATOM   5844  C  CB  . LEU C 1 211 ? -62.375 -12.855 48.860  1.00 16.21  ? 211 LEU C CB  1 
ATOM   5845  C  CG  . LEU C 1 211 ? -63.349 -13.532 49.796  1.00 29.14  ? 211 LEU C CG  1 
ATOM   5846  C  CD1 . LEU C 1 211 ? -62.853 -13.420 51.211  1.00 38.57  ? 211 LEU C CD1 1 
ATOM   5847  C  CD2 . LEU C 1 211 ? -64.704 -12.934 49.669  1.00 23.56  ? 211 LEU C CD2 1 
ATOM   5848  N  N   . VAL C 1 212 ? -60.737 -12.433 46.100  1.00 26.71  ? 212 VAL C N   1 
ATOM   5849  C  CA  . VAL C 1 212 ? -59.805 -11.514 45.502  1.00 34.38  ? 212 VAL C CA  1 
ATOM   5850  C  C   . VAL C 1 212 ? -59.580 -11.700 44.008  1.00 45.32  ? 212 VAL C C   1 
ATOM   5851  O  O   . VAL C 1 212 ? -59.348 -10.742 43.287  1.00 45.76  ? 212 VAL C O   1 
ATOM   5852  C  CB  . VAL C 1 212 ? -58.467 -11.567 46.242  1.00 37.96  ? 212 VAL C CB  1 
ATOM   5853  C  CG1 . VAL C 1 212 ? -57.410 -10.811 45.456  1.00 43.95  ? 212 VAL C CG1 1 
ATOM   5854  C  CG2 . VAL C 1 212 ? -58.641 -10.988 47.638  1.00 19.29  ? 212 VAL C CG2 1 
ATOM   5855  N  N   . GLY C 1 213 ? -59.634 -12.932 43.539  1.00 50.78  ? 213 GLY C N   1 
ATOM   5856  C  CA  . GLY C 1 213 ? -59.551 -13.167 42.109  1.00 48.58  ? 213 GLY C CA  1 
ATOM   5857  C  C   . GLY C 1 213 ? -58.141 -13.445 41.621  1.00 52.13  ? 213 GLY C C   1 
ATOM   5858  O  O   . GLY C 1 213 ? -57.925 -13.667 40.427  1.00 49.29  ? 213 GLY C O   1 
ATOM   5859  N  N   . ALA C 1 214 ? -57.185 -13.428 42.544  1.00 55.30  ? 214 ALA C N   1 
ATOM   5860  C  CA  . ALA C 1 214 ? -55.813 -13.853 42.265  1.00 45.84  ? 214 ALA C CA  1 
ATOM   5861  C  C   . ALA C 1 214 ? -55.278 -14.595 43.484  1.00 44.48  ? 214 ALA C C   1 
ATOM   5862  O  O   . ALA C 1 214 ? -55.827 -14.468 44.568  1.00 35.28  ? 214 ALA C O   1 
ATOM   5863  C  CB  . ALA C 1 214 ? -54.947 -12.655 41.965  1.00 30.87  ? 214 ALA C CB  1 
ATOM   5864  N  N   . TYR C 1 215 ? -54.216 -15.372 43.324  1.00 42.92  ? 215 TYR C N   1 
ATOM   5865  C  CA  . TYR C 1 215 ? -53.640 -16.086 44.466  1.00 37.93  ? 215 TYR C CA  1 
ATOM   5866  C  C   . TYR C 1 215 ? -53.063 -15.142 45.508  1.00 49.28  ? 215 TYR C C   1 
ATOM   5867  O  O   . TYR C 1 215 ? -52.620 -14.066 45.167  1.00 49.78  ? 215 TYR C O   1 
ATOM   5868  C  CB  . TYR C 1 215 ? -52.534 -17.007 44.000  1.00 49.12  ? 215 TYR C CB  1 
ATOM   5869  C  CG  . TYR C 1 215 ? -53.054 -18.157 43.229  1.00 55.88  ? 215 TYR C CG  1 
ATOM   5870  C  CD1 . TYR C 1 215 ? -54.281 -18.716 43.549  1.00 61.09  ? 215 TYR C CD1 1 
ATOM   5871  C  CD2 . TYR C 1 215 ? -52.330 -18.692 42.186  1.00 65.62  ? 215 TYR C CD2 1 
ATOM   5872  C  CE1 . TYR C 1 215 ? -54.773 -19.799 42.853  1.00 66.07  ? 215 TYR C CE1 1 
ATOM   5873  C  CE2 . TYR C 1 215 ? -52.813 -19.773 41.476  1.00 73.86  ? 215 TYR C CE2 1 
ATOM   5874  C  CZ  . TYR C 1 215 ? -54.041 -20.318 41.810  1.00 69.36  ? 215 TYR C CZ  1 
ATOM   5875  O  OH  . TYR C 1 215 ? -54.528 -21.387 41.095  1.00 74.71  ? 215 TYR C OH  1 
ATOM   5876  N  N   . PRO C 1 216 ? -53.027 -15.582 46.778  1.00 58.97  ? 216 PRO C N   1 
ATOM   5877  C  CA  . PRO C 1 216 ? -52.633 -14.801 47.955  1.00 52.07  ? 216 PRO C CA  1 
ATOM   5878  C  C   . PRO C 1 216 ? -51.126 -14.559 48.145  1.00 58.71  ? 216 PRO C C   1 
ATOM   5879  O  O   . PRO C 1 216 ? -50.754 -13.576 48.808  1.00 72.29  ? 216 PRO C O   1 
ATOM   5880  C  CB  . PRO C 1 216 ? -53.163 -15.647 49.106  1.00 50.71  ? 216 PRO C CB  1 
ATOM   5881  C  CG  . PRO C 1 216 ? -53.033 -17.039 48.590  1.00 43.54  ? 216 PRO C CG  1 
ATOM   5882  C  CD  . PRO C 1 216 ? -53.475 -16.933 47.162  1.00 43.96  ? 216 PRO C CD  1 
ATOM   5883  N  N   . PHE C 1 217 ? -50.254 -15.402 47.612  1.00 46.23  ? 217 PHE C N   1 
ATOM   5884  C  CA  . PHE C 1 217 ? -48.844 -15.159 47.910  1.00 46.11  ? 217 PHE C CA  1 
ATOM   5885  C  C   . PHE C 1 217 ? -47.939 -14.961 46.667  1.00 71.03  ? 217 PHE C C   1 
ATOM   5886  O  O   . PHE C 1 217 ? -46.881 -15.580 46.554  1.00 89.89  ? 217 PHE C O   1 
ATOM   5887  C  CB  . PHE C 1 217 ? -48.309 -16.263 48.855  1.00 51.85  ? 217 PHE C CB  1 
ATOM   5888  C  CG  . PHE C 1 217 ? -49.069 -16.380 50.173  1.00 45.76  ? 217 PHE C CG  1 
ATOM   5889  C  CD1 . PHE C 1 217 ? -49.924 -17.444 50.414  1.00 42.19  ? 217 PHE C CD1 1 
ATOM   5890  C  CD2 . PHE C 1 217 ? -48.921 -15.429 51.167  1.00 43.79  ? 217 PHE C CD2 1 
ATOM   5891  C  CE1 . PHE C 1 217 ? -50.622 -17.542 51.620  1.00 43.95  ? 217 PHE C CE1 1 
ATOM   5892  C  CE2 . PHE C 1 217 ? -49.625 -15.521 52.366  1.00 42.00  ? 217 PHE C CE2 1 
ATOM   5893  C  CZ  . PHE C 1 217 ? -50.472 -16.571 52.592  1.00 37.07  ? 217 PHE C CZ  1 
ATOM   5894  N  N   . GLU C 1 218 ? -48.349 -14.096 45.743  1.00 66.77  ? 218 GLU C N   1 
ATOM   5895  C  CA  . GLU C 1 218 ? -47.595 -13.873 44.511  1.00 69.88  ? 218 GLU C CA  1 
ATOM   5896  C  C   . GLU C 1 218 ? -47.717 -12.432 44.068  1.00 78.69  ? 218 GLU C C   1 
ATOM   5897  O  O   . GLU C 1 218 ? -48.826 -11.938 43.951  1.00 89.05  ? 218 GLU C O   1 
ATOM   5898  C  CB  . GLU C 1 218 ? -48.139 -14.765 43.387  1.00 79.78  ? 218 GLU C CB  1 
ATOM   5899  C  CG  . GLU C 1 218 ? -47.908 -16.274 43.578  1.00 95.25  ? 218 GLU C CG  1 
ATOM   5900  C  CD  . GLU C 1 218 ? -48.006 -17.091 42.270  1.00 102.00 ? 218 GLU C CD  1 
ATOM   5901  O  OE1 . GLU C 1 218 ? -48.455 -18.268 42.317  1.00 103.39 ? 218 GLU C OE1 1 
ATOM   5902  O  OE2 . GLU C 1 218 ? -47.620 -16.561 41.201  1.00 100.49 ? 218 GLU C OE2 1 
ATOM   5903  N  N   . ASP C 1 219 ? -46.588 -11.774 43.826  1.00 90.21  ? 219 ASP C N   1 
ATOM   5904  C  CA  . ASP C 1 219 ? -46.592 -10.383 43.390  1.00 107.95 ? 219 ASP C CA  1 
ATOM   5905  C  C   . ASP C 1 219 ? -46.545 -10.283 41.869  1.00 106.28 ? 219 ASP C C   1 
ATOM   5906  O  O   . ASP C 1 219 ? -46.780 -11.265 41.166  1.00 100.04 ? 219 ASP C O   1 
ATOM   5907  C  CB  . ASP C 1 219 ? -45.412 -9.626  44.003  1.00 115.93 ? 219 ASP C CB  1 
ATOM   5908  C  CG  . ASP C 1 219 ? -44.296 -9.382  43.007  1.00 121.38 ? 219 ASP C CG  1 
ATOM   5909  O  OD1 . ASP C 1 219 ? -44.600 -9.057  41.840  1.00 119.66 ? 219 ASP C OD1 1 
ATOM   5910  O  OD2 . ASP C 1 219 ? -43.115 -9.514  43.391  1.00 122.11 ? 219 ASP C OD2 1 
ATOM   5911  N  N   . PRO C 1 223 ? -45.134 -13.143 39.932  1.00 108.61 ? 223 PRO C N   1 
ATOM   5912  C  CA  . PRO C 1 223 ? -45.962 -13.769 38.897  1.00 103.29 ? 223 PRO C CA  1 
ATOM   5913  C  C   . PRO C 1 223 ? -45.551 -15.215 38.640  1.00 102.39 ? 223 PRO C C   1 
ATOM   5914  O  O   . PRO C 1 223 ? -46.382 -16.034 38.251  1.00 93.37  ? 223 PRO C O   1 
ATOM   5915  C  CB  . PRO C 1 223 ? -45.674 -12.915 37.662  1.00 100.12 ? 223 PRO C CB  1 
ATOM   5916  C  CG  . PRO C 1 223 ? -44.301 -12.394 37.886  1.00 101.69 ? 223 PRO C CG  1 
ATOM   5917  C  CD  . PRO C 1 223 ? -44.179 -12.174 39.367  1.00 106.49 ? 223 PRO C CD  1 
ATOM   5918  N  N   . LYS C 1 224 ? -44.276 -15.519 38.859  1.00 99.29  ? 224 LYS C N   1 
ATOM   5919  C  CA  . LYS C 1 224 ? -43.764 -16.868 38.655  1.00 88.60  ? 224 LYS C CA  1 
ATOM   5920  C  C   . LYS C 1 224 ? -42.560 -17.140 39.549  1.00 86.38  ? 224 LYS C C   1 
ATOM   5921  O  O   . LYS C 1 224 ? -42.295 -18.283 39.918  1.00 95.49  ? 224 LYS C O   1 
ATOM   5922  C  CB  . LYS C 1 224 ? -43.388 -17.084 37.188  1.00 95.83  ? 224 LYS C CB  1 
ATOM   5923  C  CG  . LYS C 1 224 ? -43.636 -18.497 36.686  1.00 97.97  ? 224 LYS C CG  1 
ATOM   5924  C  CD  . LYS C 1 224 ? -42.330 -19.214 36.384  1.00 105.25 ? 224 LYS C CD  1 
ATOM   5925  C  CE  . LYS C 1 224 ? -42.575 -20.508 35.624  1.00 114.60 ? 224 LYS C CE  1 
ATOM   5926  N  NZ  . LYS C 1 224 ? -41.341 -20.999 34.950  1.00 116.95 ? 224 LYS C NZ  1 
ATOM   5927  N  N   . ASN C 1 225 ? -41.834 -16.082 39.895  1.00 84.62  ? 225 ASN C N   1 
ATOM   5928  C  CA  . ASN C 1 225 ? -40.666 -16.204 40.759  1.00 86.68  ? 225 ASN C CA  1 
ATOM   5929  C  C   . ASN C 1 225 ? -40.944 -17.085 41.971  1.00 73.89  ? 225 ASN C C   1 
ATOM   5930  O  O   . ASN C 1 225 ? -41.361 -16.597 43.021  1.00 58.48  ? 225 ASN C O   1 
ATOM   5931  C  CB  . ASN C 1 225 ? -40.192 -14.823 41.215  1.00 101.45 ? 225 ASN C CB  1 
ATOM   5932  C  CG  . ASN C 1 225 ? -39.128 -14.243 40.307  1.00 123.44 ? 225 ASN C CG  1 
ATOM   5933  O  OD1 . ASN C 1 225 ? -38.232 -13.528 40.758  1.00 129.31 ? 225 ASN C OD1 1 
ATOM   5934  N  ND2 . ASN C 1 225 ? -39.219 -14.547 39.017  1.00 127.97 ? 225 ASN C ND2 1 
ATOM   5935  N  N   . PHE C 1 226 ? -40.711 -18.385 41.821  1.00 72.90  ? 226 PHE C N   1 
ATOM   5936  C  CA  . PHE C 1 226 ? -40.955 -19.330 42.902  1.00 68.70  ? 226 PHE C CA  1 
ATOM   5937  C  C   . PHE C 1 226 ? -40.345 -18.850 44.213  1.00 78.45  ? 226 PHE C C   1 
ATOM   5938  O  O   . PHE C 1 226 ? -40.939 -19.009 45.279  1.00 83.68  ? 226 PHE C O   1 
ATOM   5939  C  CB  . PHE C 1 226 ? -40.402 -20.711 42.541  1.00 58.69  ? 226 PHE C CB  1 
ATOM   5940  C  CG  . PHE C 1 226 ? -40.840 -21.203 41.192  1.00 68.58  ? 226 PHE C CG  1 
ATOM   5941  C  CD1 . PHE C 1 226 ? -42.133 -20.987 40.747  1.00 67.06  ? 226 PHE C CD1 1 
ATOM   5942  C  CD2 . PHE C 1 226 ? -39.958 -21.881 40.368  1.00 89.05  ? 226 PHE C CD2 1 
ATOM   5943  C  CE1 . PHE C 1 226 ? -42.538 -21.438 39.506  1.00 87.73  ? 226 PHE C CE1 1 
ATOM   5944  C  CE2 . PHE C 1 226 ? -40.357 -22.335 39.126  1.00 98.43  ? 226 PHE C CE2 1 
ATOM   5945  C  CZ  . PHE C 1 226 ? -41.649 -22.113 38.694  1.00 97.83  ? 226 PHE C CZ  1 
ATOM   5946  N  N   . ARG C 1 227 ? -39.156 -18.264 44.129  1.00 79.01  ? 227 ARG C N   1 
ATOM   5947  C  CA  . ARG C 1 227 ? -38.464 -17.773 45.313  1.00 83.28  ? 227 ARG C CA  1 
ATOM   5948  C  C   . ARG C 1 227 ? -39.212 -16.605 45.944  1.00 84.09  ? 227 ARG C C   1 
ATOM   5949  O  O   . ARG C 1 227 ? -39.229 -16.454 47.165  1.00 81.07  ? 227 ARG C O   1 
ATOM   5950  C  CB  . ARG C 1 227 ? -37.034 -17.355 44.966  1.00 88.75  ? 227 ARG C CB  1 
ATOM   5951  C  CG  . ARG C 1 227 ? -36.552 -16.122 45.714  1.00 91.06  ? 227 ARG C CG  1 
ATOM   5952  C  CD  . ARG C 1 227 ? -35.042 -16.128 45.877  1.00 84.74  ? 227 ARG C CD  1 
ATOM   5953  N  NE  . ARG C 1 227 ? -34.639 -16.546 47.217  1.00 82.52  ? 227 ARG C NE  1 
ATOM   5954  C  CZ  . ARG C 1 227 ? -33.926 -15.794 48.051  1.00 76.06  ? 227 ARG C CZ  1 
ATOM   5955  N  NH1 . ARG C 1 227 ? -33.535 -14.582 47.684  1.00 75.15  ? 227 ARG C NH1 1 
ATOM   5956  N  NH2 . ARG C 1 227 ? -33.605 -16.255 49.252  1.00 63.11  ? 227 ARG C NH2 1 
ATOM   5957  N  N   . LYS C 1 228 ? -39.807 -15.770 45.099  1.00 84.43  ? 228 LYS C N   1 
ATOM   5958  C  CA  . LYS C 1 228 ? -40.565 -14.617 45.564  1.00 85.63  ? 228 LYS C CA  1 
ATOM   5959  C  C   . LYS C 1 228 ? -41.906 -15.074 46.119  1.00 73.76  ? 228 LYS C C   1 
ATOM   5960  O  O   . LYS C 1 228 ? -42.349 -14.608 47.169  1.00 56.95  ? 228 LYS C O   1 
ATOM   5961  C  CB  . LYS C 1 228 ? -40.778 -13.615 44.428  1.00 98.89  ? 228 LYS C CB  1 
ATOM   5962  C  CG  . LYS C 1 228 ? -39.784 -12.466 44.417  1.00 113.62 ? 228 LYS C CG  1 
ATOM   5963  C  CD  . LYS C 1 228 ? -40.487 -11.125 44.550  1.00 129.73 ? 228 LYS C CD  1 
ATOM   5964  C  CE  . LYS C 1 228 ? -39.549 -10.062 45.095  1.00 140.29 ? 228 LYS C CE  1 
ATOM   5965  N  NZ  . LYS C 1 228 ? -39.809 -8.727  44.487  1.00 142.44 ? 228 LYS C NZ  1 
ATOM   5966  N  N   . THR C 1 229 ? -42.545 -15.995 45.407  1.00 75.07  ? 229 THR C N   1 
ATOM   5967  C  CA  . THR C 1 229 ? -43.809 -16.565 45.859  1.00 62.89  ? 229 THR C CA  1 
ATOM   5968  C  C   . THR C 1 229 ? -43.623 -17.367 47.143  1.00 69.81  ? 229 THR C C   1 
ATOM   5969  O  O   . THR C 1 229 ? -44.302 -17.128 48.141  1.00 67.74  ? 229 THR C O   1 
ATOM   5970  C  CB  . THR C 1 229 ? -44.435 -17.472 44.787  1.00 51.57  ? 229 THR C CB  1 
ATOM   5971  O  OG1 . THR C 1 229 ? -44.797 -16.687 43.645  1.00 61.05  ? 229 THR C OG1 1 
ATOM   5972  C  CG2 . THR C 1 229 ? -45.673 -18.165 45.333  1.00 44.60  ? 229 THR C CG2 1 
ATOM   5973  N  N   . ILE C 1 230 ? -42.698 -18.320 47.109  1.00 74.15  ? 230 ILE C N   1 
ATOM   5974  C  CA  . ILE C 1 230 ? -42.436 -19.180 48.257  1.00 65.32  ? 230 ILE C CA  1 
ATOM   5975  C  C   . ILE C 1 230 ? -42.023 -18.374 49.483  1.00 67.10  ? 230 ILE C C   1 
ATOM   5976  O  O   . ILE C 1 230 ? -42.422 -18.684 50.605  1.00 60.36  ? 230 ILE C O   1 
ATOM   5977  C  CB  . ILE C 1 230 ? -41.342 -20.217 47.948  1.00 47.74  ? 230 ILE C CB  1 
ATOM   5978  C  CG1 . ILE C 1 230 ? -41.963 -21.492 47.374  1.00 51.96  ? 230 ILE C CG1 1 
ATOM   5979  C  CG2 . ILE C 1 230 ? -40.536 -20.530 49.198  1.00 26.30  ? 230 ILE C CG2 1 
ATOM   5980  C  CD1 . ILE C 1 230 ? -40.977 -22.373 46.642  1.00 67.24  ? 230 ILE C CD1 1 
ATOM   5981  N  N   . HIS C 1 231 ? -41.219 -17.340 49.261  1.00 77.09  ? 231 HIS C N   1 
ATOM   5982  C  CA  . HIS C 1 231 ? -40.750 -16.494 50.351  1.00 78.93  ? 231 HIS C CA  1 
ATOM   5983  C  C   . HIS C 1 231 ? -41.912 -15.781 51.031  1.00 68.12  ? 231 HIS C C   1 
ATOM   5984  O  O   . HIS C 1 231 ? -41.907 -15.586 52.246  1.00 54.46  ? 231 HIS C O   1 
ATOM   5985  C  CB  . HIS C 1 231 ? -39.727 -15.477 49.840  1.00 84.30  ? 231 HIS C CB  1 
ATOM   5986  C  CG  . HIS C 1 231 ? -38.329 -16.005 49.782  1.00 93.95  ? 231 HIS C CG  1 
ATOM   5987  N  ND1 . HIS C 1 231 ? -37.655 -16.450 50.898  1.00 96.19  ? 231 HIS C ND1 1 
ATOM   5988  C  CD2 . HIS C 1 231 ? -37.477 -16.163 48.741  1.00 98.70  ? 231 HIS C CD2 1 
ATOM   5989  C  CE1 . HIS C 1 231 ? -36.448 -16.857 50.548  1.00 96.23  ? 231 HIS C CE1 1 
ATOM   5990  N  NE2 . HIS C 1 231 ? -36.315 -16.693 49.244  1.00 99.29  ? 231 HIS C NE2 1 
ATOM   5991  N  N   . ARG C 1 232 ? -42.910 -15.401 50.241  1.00 64.90  ? 232 ARG C N   1 
ATOM   5992  C  CA  . ARG C 1 232 ? -44.096 -14.746 50.775  1.00 53.66  ? 232 ARG C CA  1 
ATOM   5993  C  C   . ARG C 1 232 ? -44.892 -15.716 51.640  1.00 62.96  ? 232 ARG C C   1 
ATOM   5994  O  O   . ARG C 1 232 ? -45.419 -15.341 52.687  1.00 65.26  ? 232 ARG C O   1 
ATOM   5995  C  CB  . ARG C 1 232 ? -44.968 -14.206 49.644  1.00 55.48  ? 232 ARG C CB  1 
ATOM   5996  C  CG  . ARG C 1 232 ? -44.306 -13.113 48.820  1.00 69.88  ? 232 ARG C CG  1 
ATOM   5997  C  CD  . ARG C 1 232 ? -45.311 -12.408 47.926  1.00 84.61  ? 232 ARG C CD  1 
ATOM   5998  N  NE  . ARG C 1 232 ? -44.811 -11.120 47.451  1.00 96.63  ? 232 ARG C NE  1 
ATOM   5999  C  CZ  . ARG C 1 232 ? -45.408 -9.955  47.680  1.00 107.85 ? 232 ARG C CZ  1 
ATOM   6000  N  NH1 . ARG C 1 232 ? -44.880 -8.834  47.209  1.00 107.60 ? 232 ARG C NH1 1 
ATOM   6001  N  NH2 . ARG C 1 232 ? -46.533 -9.911  48.380  1.00 109.38 ? 232 ARG C NH2 1 
ATOM   6002  N  N   . ILE C 1 233 ? -44.965 -16.971 51.209  1.00 50.20  ? 233 ILE C N   1 
ATOM   6003  C  CA  . ILE C 1 233 ? -45.670 -17.992 51.972  1.00 26.70  ? 233 ILE C CA  1 
ATOM   6004  C  C   . ILE C 1 233 ? -45.062 -18.154 53.362  1.00 41.54  ? 233 ILE C C   1 
ATOM   6005  O  O   . ILE C 1 233 ? -45.779 -18.246 54.357  1.00 42.59  ? 233 ILE C O   1 
ATOM   6006  C  CB  . ILE C 1 233 ? -45.642 -19.353 51.255  1.00 35.57  ? 233 ILE C CB  1 
ATOM   6007  C  CG1 . ILE C 1 233 ? -46.459 -19.293 49.963  1.00 30.62  ? 233 ILE C CG1 1 
ATOM   6008  C  CG2 . ILE C 1 233 ? -46.165 -20.447 52.170  1.00 24.24  ? 233 ILE C CG2 1 
ATOM   6009  C  CD1 . ILE C 1 233 ? -46.230 -20.470 49.043  1.00 34.35  ? 233 ILE C CD1 1 
ATOM   6010  N  N   . LEU C 1 234 ? -43.735 -18.189 53.420  1.00 48.62  ? 234 LEU C N   1 
ATOM   6011  C  CA  . LEU C 1 234 ? -43.022 -18.382 54.678  1.00 41.77  ? 234 LEU C CA  1 
ATOM   6012  C  C   . LEU C 1 234 ? -43.299 -17.264 55.677  1.00 51.93  ? 234 LEU C C   1 
ATOM   6013  O  O   . LEU C 1 234 ? -43.575 -17.521 56.848  1.00 44.30  ? 234 LEU C O   1 
ATOM   6014  C  CB  . LEU C 1 234 ? -41.517 -18.494 54.425  1.00 48.24  ? 234 LEU C CB  1 
ATOM   6015  C  CG  . LEU C 1 234 ? -40.964 -19.905 54.219  1.00 49.80  ? 234 LEU C CG  1 
ATOM   6016  C  CD1 . LEU C 1 234 ? -41.732 -20.912 55.061  1.00 35.17  ? 234 LEU C CD1 1 
ATOM   6017  C  CD2 . LEU C 1 234 ? -41.004 -20.287 52.749  1.00 71.80  ? 234 LEU C CD2 1 
ATOM   6018  N  N   . ASN C 1 235 ? -43.220 -16.023 55.210  1.00 60.01  ? 235 ASN C N   1 
ATOM   6019  C  CA  . ASN C 1 235 ? -43.439 -14.868 56.072  1.00 69.17  ? 235 ASN C CA  1 
ATOM   6020  C  C   . ASN C 1 235 ? -44.913 -14.497 56.191  1.00 66.10  ? 235 ASN C C   1 
ATOM   6021  O  O   . ASN C 1 235 ? -45.254 -13.437 56.714  1.00 58.43  ? 235 ASN C O   1 
ATOM   6022  C  CB  . ASN C 1 235 ? -42.633 -13.667 55.573  1.00 72.36  ? 235 ASN C CB  1 
ATOM   6023  C  CG  . ASN C 1 235 ? -41.137 -13.892 55.664  1.00 70.53  ? 235 ASN C CG  1 
ATOM   6024  O  OD1 . ASN C 1 235 ? -40.401 -13.646 54.709  1.00 64.71  ? 235 ASN C OD1 1 
ATOM   6025  N  ND2 . ASN C 1 235 ? -40.679 -14.362 56.818  1.00 66.24  ? 235 ASN C ND2 1 
ATOM   6026  N  N   . VAL C 1 236 ? -45.782 -15.377 55.706  1.00 69.75  ? 236 VAL C N   1 
ATOM   6027  C  CA  . VAL C 1 236 ? -47.219 -15.141 55.760  1.00 61.53  ? 236 VAL C CA  1 
ATOM   6028  C  C   . VAL C 1 236 ? -47.547 -13.694 55.410  1.00 60.50  ? 236 VAL C C   1 
ATOM   6029  O  O   . VAL C 1 236 ? -48.300 -13.030 56.122  1.00 55.70  ? 236 VAL C O   1 
ATOM   6030  C  CB  . VAL C 1 236 ? -47.792 -15.466 57.150  1.00 46.41  ? 236 VAL C CB  1 
ATOM   6031  C  CG1 . VAL C 1 236 ? -49.181 -14.872 57.302  1.00 52.47  ? 236 VAL C CG1 1 
ATOM   6032  C  CG2 . VAL C 1 236 ? -47.820 -16.968 57.374  1.00 57.42  ? 236 VAL C CG2 1 
ATOM   6033  N  N   . GLN C 1 237 ? -46.977 -13.210 54.313  1.00 58.66  ? 237 GLN C N   1 
ATOM   6034  C  CA  . GLN C 1 237 ? -47.196 -11.835 53.880  1.00 54.94  ? 237 GLN C CA  1 
ATOM   6035  C  C   . GLN C 1 237 ? -48.161 -11.763 52.702  1.00 48.12  ? 237 GLN C C   1 
ATOM   6036  O  O   . GLN C 1 237 ? -47.764 -11.935 51.550  1.00 58.11  ? 237 GLN C O   1 
ATOM   6037  C  CB  . GLN C 1 237 ? -45.867 -11.174 53.511  1.00 58.03  ? 237 GLN C CB  1 
ATOM   6038  C  CG  . GLN C 1 237 ? -44.736 -11.472 54.481  1.00 80.10  ? 237 GLN C CG  1 
ATOM   6039  C  CD  . GLN C 1 237 ? -43.670 -10.394 54.483  1.00 94.67  ? 237 GLN C CD  1 
ATOM   6040  O  OE1 . GLN C 1 237 ? -43.203 -9.969  55.539  1.00 92.78  ? 237 GLN C OE1 1 
ATOM   6041  N  NE2 . GLN C 1 237 ? -43.280 -9.946  53.295  1.00 97.61  ? 237 GLN C NE2 1 
ATOM   6042  N  N   . TYR C 1 238 ? -49.430 -11.506 53.000  1.00 52.82  ? 238 TYR C N   1 
ATOM   6043  C  CA  . TYR C 1 238 ? -50.459 -11.377 51.955  1.00 50.43  ? 238 TYR C CA  1 
ATOM   6044  C  C   . TYR C 1 238 ? -51.079 -10.008 52.118  1.00 52.78  ? 238 TYR C C   1 
ATOM   6045  O  O   . TYR C 1 238 ? -50.986 -9.421  53.203  1.00 42.52  ? 238 TYR C O   1 
ATOM   6046  C  CB  . TYR C 1 238 ? -51.564 -12.433 52.118  1.00 34.74  ? 238 TYR C CB  1 
ATOM   6047  C  CG  . TYR C 1 238 ? -52.310 -12.314 53.431  1.00 27.60  ? 238 TYR C CG  1 
ATOM   6048  C  CD1 . TYR C 1 238 ? -53.453 -11.518 53.547  1.00 26.37  ? 238 TYR C CD1 1 
ATOM   6049  C  CD2 . TYR C 1 238 ? -51.867 -12.991 54.555  1.00 29.48  ? 238 TYR C CD2 1 
ATOM   6050  C  CE1 . TYR C 1 238 ? -54.135 -11.394 54.760  1.00 23.67  ? 238 TYR C CE1 1 
ATOM   6051  C  CE2 . TYR C 1 238 ? -52.525 -12.881 55.766  1.00 26.78  ? 238 TYR C CE2 1 
ATOM   6052  C  CZ  . TYR C 1 238 ? -53.655 -12.076 55.879  1.00 32.01  ? 238 TYR C CZ  1 
ATOM   6053  O  OH  . TYR C 1 238 ? -54.286 -11.980 57.118  1.00 29.12  ? 238 TYR C OH  1 
ATOM   6054  N  N   . ALA C 1 239 ? -51.729 -9.505  51.065  1.00 55.53  ? 239 ALA C N   1 
ATOM   6055  C  CA  . ALA C 1 239 ? -52.377 -8.199  51.156  1.00 62.48  ? 239 ALA C CA  1 
ATOM   6056  C  C   . ALA C 1 239 ? -53.665 -8.061  50.359  1.00 56.06  ? 239 ALA C C   1 
ATOM   6057  O  O   . ALA C 1 239 ? -53.611 -7.937  49.124  1.00 53.26  ? 239 ALA C O   1 
ATOM   6058  C  CB  . ALA C 1 239 ? -51.402 -7.098  50.746  1.00 61.36  ? 239 ALA C CB  1 
ATOM   6059  N  N   . ILE C 1 240 ? -54.813 -8.033  51.024  1.00 42.76  ? 240 ILE C N   1 
ATOM   6060  C  CA  . ILE C 1 240 ? -56.066 -7.791  50.316  1.00 53.38  ? 240 ILE C CA  1 
ATOM   6061  C  C   . ILE C 1 240 ? -56.037 -6.410  49.658  1.00 44.96  ? 240 ILE C C   1 
ATOM   6062  O  O   . ILE C 1 240 ? -55.879 -5.400  50.342  1.00 55.22  ? 240 ILE C O   1 
ATOM   6063  C  CB  . ILE C 1 240 ? -57.274 -7.873  51.264  1.00 52.17  ? 240 ILE C CB  1 
ATOM   6064  C  CG1 . ILE C 1 240 ? -56.934 -8.726  52.487  1.00 49.51  ? 240 ILE C CG1 1 
ATOM   6065  C  CG2 . ILE C 1 240 ? -58.485 -8.434  50.536  1.00 64.88  ? 240 ILE C CG2 1 
ATOM   6066  C  CD1 . ILE C 1 240 ? -57.844 -9.918  52.671  1.00 39.33  ? 240 ILE C CD1 1 
ATOM   6067  N  N   . PRO C 1 241 ? -56.183 -6.363  48.335  1.00 41.11  ? 241 PRO C N   1 
ATOM   6068  C  CA  . PRO C 1 241 ? -56.138 -5.075  47.614  1.00 37.35  ? 241 PRO C CA  1 
ATOM   6069  C  C   . PRO C 1 241 ? -57.099 -4.067  48.224  1.00 45.99  ? 241 PRO C C   1 
ATOM   6070  O  O   . PRO C 1 241 ? -58.045 -4.490  48.889  1.00 42.90  ? 241 PRO C O   1 
ATOM   6071  C  CB  . PRO C 1 241 ? -56.586 -5.450  46.200  1.00 45.85  ? 241 PRO C CB  1 
ATOM   6072  C  CG  . PRO C 1 241 ? -56.201 -6.935  46.054  1.00 51.88  ? 241 PRO C CG  1 
ATOM   6073  C  CD  . PRO C 1 241 ? -56.435 -7.512  47.443  1.00 49.44  ? 241 PRO C CD  1 
ATOM   6074  N  N   . ASP C 1 242 ? -56.861 -2.767  48.032  1.00 56.31  ? 242 ASP C N   1 
ATOM   6075  C  CA  . ASP C 1 242 ? -57.760 -1.730  48.574  1.00 50.11  ? 242 ASP C CA  1 
ATOM   6076  C  C   . ASP C 1 242 ? -59.202 -1.807  48.043  1.00 43.70  ? 242 ASP C C   1 
ATOM   6077  O  O   . ASP C 1 242 ? -60.161 -1.664  48.804  1.00 42.59  ? 242 ASP C O   1 
ATOM   6078  C  CB  . ASP C 1 242 ? -57.205 -0.342  48.286  1.00 78.85  ? 242 ASP C CB  1 
ATOM   6079  C  CG  . ASP C 1 242 ? -56.069 0.042   49.221  1.00 97.61  ? 242 ASP C CG  1 
ATOM   6080  O  OD1 . ASP C 1 242 ? -56.002 -0.521  50.340  1.00 97.80  ? 242 ASP C OD1 1 
ATOM   6081  O  OD2 . ASP C 1 242 ? -55.249 0.910   48.835  1.00 104.01 ? 242 ASP C OD2 1 
ATOM   6082  N  N   . TYR C 1 243 ? -59.362 -2.012  46.738  1.00 43.92  ? 243 TYR C N   1 
ATOM   6083  C  CA  . TYR C 1 243 ? -60.700 -2.056  46.146  1.00 48.69  ? 243 TYR C CA  1 
ATOM   6084  C  C   . TYR C 1 243 ? -61.554 -3.266  46.556  1.00 49.91  ? 243 TYR C C   1 
ATOM   6085  O  O   . TYR C 1 243 ? -62.736 -3.349  46.193  1.00 56.65  ? 243 TYR C O   1 
ATOM   6086  C  CB  . TYR C 1 243 ? -60.603 -2.045  44.622  1.00 33.89  ? 243 TYR C CB  1 
ATOM   6087  C  CG  . TYR C 1 243 ? -59.684 -3.104  44.102  1.00 36.38  ? 243 TYR C CG  1 
ATOM   6088  C  CD1 . TYR C 1 243 ? -60.143 -4.390  43.851  1.00 48.06  ? 243 TYR C CD1 1 
ATOM   6089  C  CD2 . TYR C 1 243 ? -58.356 -2.824  43.864  1.00 39.06  ? 243 TYR C CD2 1 
ATOM   6090  C  CE1 . TYR C 1 243 ? -59.297 -5.354  43.357  1.00 38.02  ? 243 TYR C CE1 1 
ATOM   6091  C  CE2 . TYR C 1 243 ? -57.509 -3.782  43.387  1.00 35.82  ? 243 TYR C CE2 1 
ATOM   6092  C  CZ  . TYR C 1 243 ? -57.988 -5.045  43.123  1.00 41.56  ? 243 TYR C CZ  1 
ATOM   6093  O  OH  . TYR C 1 243 ? -57.118 -6.004  42.648  1.00 49.78  ? 243 TYR C OH  1 
ATOM   6094  N  N   . VAL C 1 244 ? -60.966 -4.225  47.262  1.00 41.01  ? 244 VAL C N   1 
ATOM   6095  C  CA  . VAL C 1 244 ? -61.739 -5.369  47.770  1.00 48.29  ? 244 VAL C CA  1 
ATOM   6096  C  C   . VAL C 1 244 ? -62.218 -5.082  49.180  1.00 39.51  ? 244 VAL C C   1 
ATOM   6097  O  O   . VAL C 1 244 ? -61.413 -4.930  50.077  1.00 40.67  ? 244 VAL C O   1 
ATOM   6098  C  CB  . VAL C 1 244 ? -60.928 -6.680  47.799  1.00 49.89  ? 244 VAL C CB  1 
ATOM   6099  C  CG1 . VAL C 1 244 ? -61.776 -7.780  48.405  1.00 43.37  ? 244 VAL C CG1 1 
ATOM   6100  C  CG2 . VAL C 1 244 ? -60.467 -7.061  46.387  1.00 38.45  ? 244 VAL C CG2 1 
ATOM   6101  N  N   . HIS C 1 245 ? -63.525 -4.985  49.359  1.00 34.84  ? 245 HIS C N   1 
ATOM   6102  C  CA  . HIS C 1 245 ? -64.100 -4.632  50.640  1.00 50.80  ? 245 HIS C CA  1 
ATOM   6103  C  C   . HIS C 1 245 ? -64.720 -5.871  51.253  1.00 55.13  ? 245 HIS C C   1 
ATOM   6104  O  O   . HIS C 1 245 ? -65.803 -6.281  50.847  1.00 46.60  ? 245 HIS C O   1 
ATOM   6105  C  CB  . HIS C 1 245 ? -65.204 -3.558  50.483  1.00 71.69  ? 245 HIS C CB  1 
ATOM   6106  C  CG  . HIS C 1 245 ? -64.734 -2.258  49.878  1.00 86.86  ? 245 HIS C CG  1 
ATOM   6107  N  ND1 . HIS C 1 245 ? -63.792 -1.446  50.480  1.00 79.09  ? 245 HIS C ND1 1 
ATOM   6108  C  CD2 . HIS C 1 245 ? -65.090 -1.630  48.732  1.00 89.24  ? 245 HIS C CD2 1 
ATOM   6109  C  CE1 . HIS C 1 245 ? -63.588 -0.379  49.730  1.00 78.63  ? 245 HIS C CE1 1 
ATOM   6110  N  NE2 . HIS C 1 245 ? -64.359 -0.464  48.662  1.00 86.01  ? 245 HIS C NE2 1 
ATOM   6111  N  N   . ILE C 1 246 ? -64.049 -6.463  52.234  1.00 52.69  ? 246 ILE C N   1 
ATOM   6112  C  CA  . ILE C 1 246 ? -64.676 -7.513  53.015  1.00 44.75  ? 246 ILE C CA  1 
ATOM   6113  C  C   . ILE C 1 246 ? -65.001 -7.045  54.432  1.00 41.92  ? 246 ILE C C   1 
ATOM   6114  O  O   . ILE C 1 246 ? -64.322 -6.191  54.978  1.00 54.49  ? 246 ILE C O   1 
ATOM   6115  C  CB  . ILE C 1 246 ? -63.777 -8.760  53.103  1.00 41.69  ? 246 ILE C CB  1 
ATOM   6116  C  CG1 . ILE C 1 246 ? -62.345 -8.371  53.489  1.00 28.14  ? 246 ILE C CG1 1 
ATOM   6117  C  CG2 . ILE C 1 246 ? -63.776 -9.520  51.803  1.00 47.95  ? 246 ILE C CG2 1 
ATOM   6118  C  CD1 . ILE C 1 246 ? -61.325 -9.465  53.209  1.00 39.76  ? 246 ILE C CD1 1 
ATOM   6119  N  N   . SER C 1 247 ? -66.024 -7.642  55.023  1.00 34.94  ? 247 SER C N   1 
ATOM   6120  C  CA  . SER C 1 247 ? -66.385 -7.454  56.413  1.00 33.88  ? 247 SER C CA  1 
ATOM   6121  C  C   . SER C 1 247 ? -65.224 -7.789  57.331  1.00 35.72  ? 247 SER C C   1 
ATOM   6122  O  O   . SER C 1 247 ? -64.400 -8.603  57.005  1.00 42.80  ? 247 SER C O   1 
ATOM   6123  C  CB  . SER C 1 247 ? -67.538 -8.378  56.745  1.00 41.59  ? 247 SER C CB  1 
ATOM   6124  O  OG  . SER C 1 247 ? -67.074 -9.709  56.782  1.00 46.33  ? 247 SER C OG  1 
ATOM   6125  N  N   . PRO C 1 248 ? -65.150 -7.133  58.485  1.00 36.08  ? 248 PRO C N   1 
ATOM   6126  C  CA  . PRO C 1 248 ? -64.015 -7.427  59.364  1.00 49.48  ? 248 PRO C CA  1 
ATOM   6127  C  C   . PRO C 1 248 ? -64.054 -8.847  59.951  1.00 38.60  ? 248 PRO C C   1 
ATOM   6128  O  O   . PRO C 1 248 ? -62.996 -9.374  60.261  1.00 28.64  ? 248 PRO C O   1 
ATOM   6129  C  CB  . PRO C 1 248 ? -64.139 -6.361  60.471  1.00 43.66  ? 248 PRO C CB  1 
ATOM   6130  C  CG  . PRO C 1 248 ? -65.575 -5.947  60.442  1.00 28.62  ? 248 PRO C CG  1 
ATOM   6131  C  CD  . PRO C 1 248 ? -66.033 -6.088  59.027  1.00 27.59  ? 248 PRO C CD  1 
ATOM   6132  N  N   . GLU C 1 249 ? -65.231 -9.457  60.088  1.00 21.51  ? 249 GLU C N   1 
ATOM   6133  C  CA  . GLU C 1 249 ? -65.299 -10.841 60.557  1.00 38.10  ? 249 GLU C CA  1 
ATOM   6134  C  C   . GLU C 1 249 ? -64.585 -11.695 59.521  1.00 41.88  ? 249 GLU C C   1 
ATOM   6135  O  O   . GLU C 1 249 ? -63.797 -12.575 59.841  1.00 26.02  ? 249 GLU C O   1 
ATOM   6136  C  CB  . GLU C 1 249 ? -66.736 -11.336 60.736  1.00 23.06  ? 249 GLU C CB  1 
ATOM   6137  C  CG  . GLU C 1 249 ? -67.633 -10.416 61.520  1.00 41.04  ? 249 GLU C CG  1 
ATOM   6138  C  CD  . GLU C 1 249 ? -68.085 -9.196  60.710  1.00 49.06  ? 249 GLU C CD  1 
ATOM   6139  O  OE1 . GLU C 1 249 ? -68.162 -9.278  59.476  1.00 55.09  ? 249 GLU C OE1 1 
ATOM   6140  O  OE2 . GLU C 1 249 ? -68.351 -8.133  61.294  1.00 66.28  ? 249 GLU C OE2 1 
ATOM   6141  N  N   . CYS C 1 250 ? -64.854 -11.408 58.258  1.00 34.88  ? 250 CYS C N   1 
ATOM   6142  C  CA  . CYS C 1 250 ? -64.225 -12.140 57.181  1.00 36.82  ? 250 CYS C CA  1 
ATOM   6143  C  C   . CYS C 1 250 ? -62.718 -11.967 57.238  1.00 36.97  ? 250 CYS C C   1 
ATOM   6144  O  O   . CYS C 1 250 ? -61.944 -12.936 57.060  1.00 39.90  ? 250 CYS C O   1 
ATOM   6145  C  CB  . CYS C 1 250 ? -64.764 -11.674 55.831  1.00 42.95  ? 250 CYS C CB  1 
ATOM   6146  S  SG  . CYS C 1 250 ? -63.989 -12.448 54.436  1.00 39.67  ? 250 CYS C SG  1 
ATOM   6147  N  N   . ARG C 1 251 ? -62.292 -10.730 57.466  1.00 36.28  ? 251 ARG C N   1 
ATOM   6148  C  CA  . ARG C 1 251 ? -60.876 -10.406 57.544  1.00 24.71  ? 251 ARG C CA  1 
ATOM   6149  C  C   . ARG C 1 251 ? -60.235 -11.142 58.710  1.00 26.00  ? 251 ARG C C   1 
ATOM   6150  O  O   . ARG C 1 251 ? -59.087 -11.574 58.630  1.00 28.45  ? 251 ARG C O   1 
ATOM   6151  C  CB  . ARG C 1 251 ? -60.679 -8.898  57.699  1.00 38.39  ? 251 ARG C CB  1 
ATOM   6152  C  CG  . ARG C 1 251 ? -59.712 -8.291  56.697  1.00 46.45  ? 251 ARG C CG  1 
ATOM   6153  C  CD  . ARG C 1 251 ? -59.631 -6.782  56.854  1.00 45.31  ? 251 ARG C CD  1 
ATOM   6154  N  NE  . ARG C 1 251 ? -60.367 -6.083  55.804  1.00 54.05  ? 251 ARG C NE  1 
ATOM   6155  C  CZ  . ARG C 1 251 ? -59.821 -5.643  54.676  1.00 51.20  ? 251 ARG C CZ  1 
ATOM   6156  N  NH1 . ARG C 1 251 ? -58.528 -5.827  54.448  1.00 34.33  ? 251 ARG C NH1 1 
ATOM   6157  N  NH2 . ARG C 1 251 ? -60.566 -5.017  53.776  1.00 38.70  ? 251 ARG C NH2 1 
ATOM   6158  N  N   . HIS C 1 252 ? -60.988 -11.284 59.796  1.00 27.75  ? 252 HIS C N   1 
ATOM   6159  C  CA  . HIS C 1 252 ? -60.494 -12.001 60.971  1.00 37.28  ? 252 HIS C CA  1 
ATOM   6160  C  C   . HIS C 1 252 ? -60.245 -13.464 60.655  1.00 39.52  ? 252 HIS C C   1 
ATOM   6161  O  O   . HIS C 1 252 ? -59.146 -13.973 60.877  1.00 32.87  ? 252 HIS C O   1 
ATOM   6162  C  CB  . HIS C 1 252 ? -61.474 -11.898 62.129  1.00 33.97  ? 252 HIS C CB  1 
ATOM   6163  C  CG  . HIS C 1 252 ? -60.974 -12.526 63.385  1.00 36.30  ? 252 HIS C CG  1 
ATOM   6164  N  ND1 . HIS C 1 252 ? -61.549 -13.654 63.929  1.00 39.61  ? 252 HIS C ND1 1 
ATOM   6165  C  CD2 . HIS C 1 252 ? -59.933 -12.213 64.179  1.00 27.38  ? 252 HIS C CD2 1 
ATOM   6166  C  CE1 . HIS C 1 252 ? -60.891 -13.990 65.019  1.00 38.81  ? 252 HIS C CE1 1 
ATOM   6167  N  NE2 . HIS C 1 252 ? -59.905 -13.138 65.194  1.00 30.88  ? 252 HIS C NE2 1 
ATOM   6168  N  N   . LEU C 1 253 ? -61.266 -14.132 60.118  1.00 33.15  ? 253 LEU C N   1 
ATOM   6169  C  CA  . LEU C 1 253 ? -61.154 -15.544 59.762  1.00 32.26  ? 253 LEU C CA  1 
ATOM   6170  C  C   . LEU C 1 253 ? -59.913 -15.802 58.916  1.00 26.28  ? 253 LEU C C   1 
ATOM   6171  O  O   . LEU C 1 253 ? -59.090 -16.632 59.266  1.00 35.99  ? 253 LEU C O   1 
ATOM   6172  C  CB  . LEU C 1 253 ? -62.416 -16.050 59.075  1.00 32.16  ? 253 LEU C CB  1 
ATOM   6173  C  CG  . LEU C 1 253 ? -62.265 -17.446 58.473  1.00 35.74  ? 253 LEU C CG  1 
ATOM   6174  C  CD1 . LEU C 1 253 ? -61.915 -18.468 59.548  1.00 35.12  ? 253 LEU C CD1 1 
ATOM   6175  C  CD2 . LEU C 1 253 ? -63.536 -17.849 57.792  1.00 28.65  ? 253 LEU C CD2 1 
ATOM   6176  N  N   . ILE C 1 254 ? -59.767 -15.070 57.820  1.00 33.39  ? 254 ILE C N   1 
ATOM   6177  C  CA  . ILE C 1 254 ? -58.589 -15.206 56.972  1.00 28.60  ? 254 ILE C CA  1 
ATOM   6178  C  C   . ILE C 1 254 ? -57.277 -15.106 57.767  1.00 37.65  ? 254 ILE C C   1 
ATOM   6179  O  O   . ILE C 1 254 ? -56.341 -15.862 57.512  1.00 41.77  ? 254 ILE C O   1 
ATOM   6180  C  CB  . ILE C 1 254 ? -58.553 -14.144 55.881  1.00 28.70  ? 254 ILE C CB  1 
ATOM   6181  C  CG1 . ILE C 1 254 ? -59.666 -14.383 54.876  1.00 36.49  ? 254 ILE C CG1 1 
ATOM   6182  C  CG2 . ILE C 1 254 ? -57.228 -14.183 55.173  1.00 21.58  ? 254 ILE C CG2 1 
ATOM   6183  C  CD1 . ILE C 1 254 ? -59.715 -13.374 53.833  1.00 20.72  ? 254 ILE C CD1 1 
ATOM   6184  N  N   . SER C 1 255 ? -57.200 -14.193 58.734  1.00 41.75  ? 255 SER C N   1 
ATOM   6185  C  CA  . SER C 1 255 ? -55.962 -13.980 59.474  1.00 33.20  ? 255 SER C CA  1 
ATOM   6186  C  C   . SER C 1 255 ? -55.688 -15.118 60.450  1.00 42.39  ? 255 SER C C   1 
ATOM   6187  O  O   . SER C 1 255 ? -54.543 -15.370 60.810  1.00 40.39  ? 255 SER C O   1 
ATOM   6188  C  CB  . SER C 1 255 ? -55.993 -12.645 60.234  1.00 40.61  ? 255 SER C CB  1 
ATOM   6189  O  OG  . SER C 1 255 ? -56.802 -12.750 61.391  1.00 35.59  ? 255 SER C OG  1 
ATOM   6190  N  N   . ARG C 1 256 ? -56.759 -15.793 60.853  1.00 42.94  ? 256 ARG C N   1 
ATOM   6191  C  CA  . ARG C 1 256 ? -56.665 -16.937 61.740  1.00 33.08  ? 256 ARG C CA  1 
ATOM   6192  C  C   . ARG C 1 256 ? -56.255 -18.179 60.963  1.00 35.72  ? 256 ARG C C   1 
ATOM   6193  O  O   . ARG C 1 256 ? -55.741 -19.133 61.546  1.00 49.81  ? 256 ARG C O   1 
ATOM   6194  C  CB  . ARG C 1 256 ? -57.997 -17.177 62.449  1.00 27.17  ? 256 ARG C CB  1 
ATOM   6195  C  CG  . ARG C 1 256 ? -58.269 -16.221 63.597  1.00 34.01  ? 256 ARG C CG  1 
ATOM   6196  C  CD  . ARG C 1 256 ? -57.281 -16.427 64.731  1.00 48.67  ? 256 ARG C CD  1 
ATOM   6197  N  NE  . ARG C 1 256 ? -57.512 -17.685 65.435  1.00 67.94  ? 256 ARG C NE  1 
ATOM   6198  C  CZ  . ARG C 1 256 ? -56.566 -18.586 65.682  1.00 62.54  ? 256 ARG C CZ  1 
ATOM   6199  N  NH1 . ARG C 1 256 ? -55.321 -18.369 65.284  1.00 52.00  ? 256 ARG C NH1 1 
ATOM   6200  N  NH2 . ARG C 1 256 ? -56.866 -19.704 66.330  1.00 48.96  ? 256 ARG C NH2 1 
ATOM   6201  N  N   . ILE C 1 257 ? -56.478 -18.176 59.651  1.00 29.26  ? 257 ILE C N   1 
ATOM   6202  C  CA  . ILE C 1 257 ? -56.090 -19.332 58.861  1.00 31.59  ? 257 ILE C CA  1 
ATOM   6203  C  C   . ILE C 1 257 ? -54.644 -19.216 58.417  1.00 36.62  ? 257 ILE C C   1 
ATOM   6204  O  O   . ILE C 1 257 ? -53.900 -20.203 58.454  1.00 31.93  ? 257 ILE C O   1 
ATOM   6205  C  CB  . ILE C 1 257 ? -56.990 -19.513 57.643  1.00 31.92  ? 257 ILE C CB  1 
ATOM   6206  C  CG1 . ILE C 1 257 ? -58.351 -19.997 58.071  1.00 23.48  ? 257 ILE C CG1 1 
ATOM   6207  C  CG2 . ILE C 1 257 ? -56.396 -20.492 56.693  1.00 27.83  ? 257 ILE C CG2 1 
ATOM   6208  C  CD1 . ILE C 1 257 ? -59.355 -19.927 56.991  1.00 27.06  ? 257 ILE C CD1 1 
ATOM   6209  N  N   . PHE C 1 258 ? -54.252 -18.008 57.996  1.00 39.94  ? 258 PHE C N   1 
ATOM   6210  C  CA  . PHE C 1 258 ? -52.892 -17.751 57.521  1.00 35.90  ? 258 PHE C CA  1 
ATOM   6211  C  C   . PHE C 1 258 ? -51.937 -17.471 58.672  1.00 38.44  ? 258 PHE C C   1 
ATOM   6212  O  O   . PHE C 1 258 ? -51.396 -16.383 58.806  1.00 39.53  ? 258 PHE C O   1 
ATOM   6213  C  CB  . PHE C 1 258 ? -52.870 -16.618 56.499  1.00 30.95  ? 258 PHE C CB  1 
ATOM   6214  C  CG  . PHE C 1 258 ? -53.483 -16.991 55.179  1.00 41.27  ? 258 PHE C CG  1 
ATOM   6215  C  CD1 . PHE C 1 258 ? -53.446 -18.299 54.734  1.00 41.46  ? 258 PHE C CD1 1 
ATOM   6216  C  CD2 . PHE C 1 258 ? -54.093 -16.034 54.382  1.00 32.72  ? 258 PHE C CD2 1 
ATOM   6217  C  CE1 . PHE C 1 258 ? -54.024 -18.658 53.495  1.00 33.64  ? 258 PHE C CE1 1 
ATOM   6218  C  CE2 . PHE C 1 258 ? -54.661 -16.377 53.164  1.00 44.49  ? 258 PHE C CE2 1 
ATOM   6219  C  CZ  . PHE C 1 258 ? -54.623 -17.696 52.714  1.00 32.28  ? 258 PHE C CZ  1 
ATOM   6220  N  N   . VAL C 1 259 ? -51.748 -18.492 59.494  1.00 53.79  ? 259 VAL C N   1 
ATOM   6221  C  CA  . VAL C 1 259 ? -50.766 -18.511 60.569  1.00 51.19  ? 259 VAL C CA  1 
ATOM   6222  C  C   . VAL C 1 259 ? -49.745 -19.627 60.271  1.00 44.03  ? 259 VAL C C   1 
ATOM   6223  O  O   . VAL C 1 259 ? -50.119 -20.782 59.993  1.00 57.80  ? 259 VAL C O   1 
ATOM   6224  C  CB  . VAL C 1 259 ? -51.456 -18.801 61.910  1.00 41.52  ? 259 VAL C CB  1 
ATOM   6225  C  CG1 . VAL C 1 259 ? -50.445 -18.881 63.024  1.00 43.89  ? 259 VAL C CG1 1 
ATOM   6226  C  CG2 . VAL C 1 259 ? -52.465 -17.747 62.197  1.00 34.99  ? 259 VAL C CG2 1 
ATOM   6227  N  N   . ALA C 1 260 ? -48.464 -19.300 60.321  1.00 39.21  ? 260 ALA C N   1 
ATOM   6228  C  CA  . ALA C 1 260 ? -47.434 -20.293 60.018  1.00 42.56  ? 260 ALA C CA  1 
ATOM   6229  C  C   . ALA C 1 260 ? -47.380 -21.415 61.051  1.00 48.69  ? 260 ALA C C   1 
ATOM   6230  O  O   . ALA C 1 260 ? -47.246 -22.577 60.681  1.00 55.95  ? 260 ALA C O   1 
ATOM   6231  C  CB  . ALA C 1 260 ? -46.068 -19.616 59.862  1.00 36.29  ? 260 ALA C CB  1 
ATOM   6232  N  N   . ASP C 1 261 ? -47.497 -21.099 62.337  1.00 42.96  ? 261 ASP C N   1 
ATOM   6233  C  CA  . ASP C 1 261 ? -47.352 -22.149 63.338  1.00 42.81  ? 261 ASP C CA  1 
ATOM   6234  C  C   . ASP C 1 261 ? -48.590 -23.023 63.409  1.00 40.61  ? 261 ASP C C   1 
ATOM   6235  O  O   . ASP C 1 261 ? -49.614 -22.603 63.935  1.00 41.67  ? 261 ASP C O   1 
ATOM   6236  C  CB  . ASP C 1 261 ? -47.030 -21.582 64.722  1.00 60.28  ? 261 ASP C CB  1 
ATOM   6237  C  CG  . ASP C 1 261 ? -46.802 -22.689 65.762  1.00 66.65  ? 261 ASP C CG  1 
ATOM   6238  O  OD1 . ASP C 1 261 ? -46.801 -23.883 65.361  1.00 59.61  ? 261 ASP C OD1 1 
ATOM   6239  O  OD2 . ASP C 1 261 ? -46.599 -22.367 66.966  1.00 66.43  ? 261 ASP C OD2 1 
ATOM   6240  N  N   . PRO C 1 262 ? -48.480 -24.266 62.922  1.00 42.26  ? 262 PRO C N   1 
ATOM   6241  C  CA  . PRO C 1 262 ? -49.621 -25.182 62.766  1.00 27.62  ? 262 PRO C CA  1 
ATOM   6242  C  C   . PRO C 1 262 ? -50.402 -25.272 64.044  1.00 39.48  ? 262 PRO C C   1 
ATOM   6243  O  O   . PRO C 1 262 ? -51.639 -25.280 64.072  1.00 49.34  ? 262 PRO C O   1 
ATOM   6244  C  CB  . PRO C 1 262 ? -48.973 -26.543 62.466  1.00 45.82  ? 262 PRO C CB  1 
ATOM   6245  C  CG  . PRO C 1 262 ? -47.590 -26.278 62.040  1.00 37.82  ? 262 PRO C CG  1 
ATOM   6246  C  CD  . PRO C 1 262 ? -47.188 -24.904 62.611  1.00 47.84  ? 262 PRO C CD  1 
ATOM   6247  N  N   . ALA C 1 263 ? -49.663 -25.342 65.131  1.00 52.36  ? 263 ALA C N   1 
ATOM   6248  C  CA  . ALA C 1 263 ? -50.274 -25.432 66.448  1.00 53.65  ? 263 ALA C CA  1 
ATOM   6249  C  C   . ALA C 1 263 ? -51.201 -24.270 66.698  1.00 50.91  ? 263 ALA C C   1 
ATOM   6250  O  O   . ALA C 1 263 ? -52.095 -24.370 67.529  1.00 41.00  ? 263 ALA C O   1 
ATOM   6251  C  CB  . ALA C 1 263 ? -49.179 -25.453 67.532  1.00 49.21  ? 263 ALA C CB  1 
ATOM   6252  N  N   . LYS C 1 264 ? -50.972 -23.156 65.998  1.00 46.83  ? 264 LYS C N   1 
ATOM   6253  C  CA  . LYS C 1 264 ? -51.723 -21.941 66.294  1.00 45.03  ? 264 LYS C CA  1 
ATOM   6254  C  C   . LYS C 1 264 ? -52.761 -21.601 65.232  1.00 43.11  ? 264 LYS C C   1 
ATOM   6255  O  O   . LYS C 1 264 ? -53.611 -20.747 65.447  1.00 46.85  ? 264 LYS C O   1 
ATOM   6256  C  CB  . LYS C 1 264 ? -50.772 -20.762 66.545  1.00 53.45  ? 264 LYS C CB  1 
ATOM   6257  C  CG  . LYS C 1 264 ? -49.870 -20.984 67.740  1.00 65.80  ? 264 LYS C CG  1 
ATOM   6258  C  CD  . LYS C 1 264 ? -48.933 -19.825 67.976  1.00 76.43  ? 264 LYS C CD  1 
ATOM   6259  C  CE  . LYS C 1 264 ? -48.084 -20.058 69.217  1.00 78.10  ? 264 LYS C CE  1 
ATOM   6260  N  NZ  . LYS C 1 264 ? -47.574 -18.774 69.775  1.00 83.34  ? 264 LYS C NZ  1 
ATOM   6261  N  N   . ARG C 1 265 ? -52.690 -22.277 64.089  1.00 35.28  ? 265 ARG C N   1 
ATOM   6262  C  CA  . ARG C 1 265 ? -53.668 -22.085 63.025  1.00 31.25  ? 265 ARG C CA  1 
ATOM   6263  C  C   . ARG C 1 265 ? -55.041 -22.540 63.492  1.00 37.52  ? 265 ARG C C   1 
ATOM   6264  O  O   . ARG C 1 265 ? -55.173 -23.495 64.244  1.00 40.67  ? 265 ARG C O   1 
ATOM   6265  C  CB  . ARG C 1 265 ? -53.242 -22.856 61.779  1.00 32.39  ? 265 ARG C CB  1 
ATOM   6266  C  CG  . ARG C 1 265 ? -54.130 -22.666 60.576  1.00 35.97  ? 265 ARG C CG  1 
ATOM   6267  C  CD  . ARG C 1 265 ? -53.483 -23.290 59.358  1.00 30.93  ? 265 ARG C CD  1 
ATOM   6268  N  NE  . ARG C 1 265 ? -52.090 -22.904 59.386  1.00 44.58  ? 265 ARG C NE  1 
ATOM   6269  C  CZ  . ARG C 1 265 ? -51.100 -23.646 58.910  1.00 34.95  ? 265 ARG C CZ  1 
ATOM   6270  N  NH1 . ARG C 1 265 ? -51.352 -24.824 58.361  1.00 30.82  ? 265 ARG C NH1 1 
ATOM   6271  N  NH2 . ARG C 1 265 ? -49.852 -23.201 58.995  1.00 36.48  ? 265 ARG C NH2 1 
ATOM   6272  N  N   . ILE C 1 266 ? -56.070 -21.833 63.071  1.00 41.17  ? 266 ILE C N   1 
ATOM   6273  C  CA  . ILE C 1 266 ? -57.411 -22.179 63.501  1.00 40.88  ? 266 ILE C CA  1 
ATOM   6274  C  C   . ILE C 1 266 ? -57.731 -23.598 62.995  1.00 43.33  ? 266 ILE C C   1 
ATOM   6275  O  O   . ILE C 1 266 ? -57.139 -24.059 62.027  1.00 48.86  ? 266 ILE C O   1 
ATOM   6276  C  CB  . ILE C 1 266 ? -58.426 -21.131 63.010  1.00 30.20  ? 266 ILE C CB  1 
ATOM   6277  C  CG1 . ILE C 1 266 ? -59.755 -21.288 63.738  1.00 26.99  ? 266 ILE C CG1 1 
ATOM   6278  C  CG2 . ILE C 1 266 ? -58.617 -21.206 61.485  1.00 21.16  ? 266 ILE C CG2 1 
ATOM   6279  C  CD1 . ILE C 1 266 ? -60.826 -20.362 63.218  1.00 26.26  ? 266 ILE C CD1 1 
ATOM   6280  N  N   . SER C 1 267 ? -58.659 -24.291 63.643  1.00 37.21  ? 267 SER C N   1 
ATOM   6281  C  CA  . SER C 1 267 ? -58.997 -25.652 63.257  1.00 34.95  ? 267 SER C CA  1 
ATOM   6282  C  C   . SER C 1 267 ? -60.396 -25.716 62.680  1.00 39.54  ? 267 SER C C   1 
ATOM   6283  O  O   . SER C 1 267 ? -61.233 -24.837 62.955  1.00 45.75  ? 267 SER C O   1 
ATOM   6284  C  CB  . SER C 1 267 ? -58.985 -26.543 64.484  1.00 38.69  ? 267 SER C CB  1 
ATOM   6285  O  OG  . SER C 1 267 ? -60.151 -26.280 65.266  1.00 44.09  ? 267 SER C OG  1 
ATOM   6286  N  N   . ILE C 1 268 ? -60.662 -26.768 61.907  1.00 38.25  ? 268 ILE C N   1 
ATOM   6287  C  CA  . ILE C 1 268 ? -61.991 -26.956 61.316  1.00 48.31  ? 268 ILE C CA  1 
ATOM   6288  C  C   . ILE C 1 268 ? -63.138 -26.735 62.328  1.00 41.55  ? 268 ILE C C   1 
ATOM   6289  O  O   . ILE C 1 268 ? -64.093 -26.025 62.053  1.00 38.27  ? 268 ILE C O   1 
ATOM   6290  C  CB  . ILE C 1 268 ? -62.152 -28.350 60.632  1.00 35.59  ? 268 ILE C CB  1 
ATOM   6291  C  CG1 . ILE C 1 268 ? -61.089 -28.572 59.541  1.00 32.57  ? 268 ILE C CG1 1 
ATOM   6292  C  CG2 . ILE C 1 268 ? -63.541 -28.467 60.028  1.00 32.63  ? 268 ILE C CG2 1 
ATOM   6293  C  CD1 . ILE C 1 268 ? -61.479 -27.977 58.194  1.00 26.66  ? 268 ILE C CD1 1 
ATOM   6294  N  N   . PRO C 1 269 ? -63.048 -27.348 63.510  1.00 52.24  ? 269 PRO C N   1 
ATOM   6295  C  CA  . PRO C 1 269 ? -64.163 -27.138 64.442  1.00 53.26  ? 269 PRO C CA  1 
ATOM   6296  C  C   . PRO C 1 269 ? -64.325 -25.664 64.843  1.00 57.37  ? 269 PRO C C   1 
ATOM   6297  O  O   . PRO C 1 269 ? -65.453 -25.182 64.954  1.00 55.66  ? 269 PRO C O   1 
ATOM   6298  C  CB  . PRO C 1 269 ? -63.762 -27.994 65.654  1.00 51.04  ? 269 PRO C CB  1 
ATOM   6299  C  CG  . PRO C 1 269 ? -62.921 -29.087 65.064  1.00 51.65  ? 269 PRO C CG  1 
ATOM   6300  C  CD  . PRO C 1 269 ? -62.131 -28.411 63.968  1.00 56.14  ? 269 PRO C CD  1 
ATOM   6301  N  N   . GLU C 1 270 ? -63.205 -24.965 65.005  1.00 38.86  ? 270 GLU C N   1 
ATOM   6302  C  CA  . GLU C 1 270 ? -63.224 -23.544 65.322  1.00 29.59  ? 270 GLU C CA  1 
ATOM   6303  C  C   . GLU C 1 270 ? -63.757 -22.707 64.159  1.00 46.38  ? 270 GLU C C   1 
ATOM   6304  O  O   . GLU C 1 270 ? -64.409 -21.686 64.373  1.00 48.51  ? 270 GLU C O   1 
ATOM   6305  C  CB  . GLU C 1 270 ? -61.827 -23.067 65.716  1.00 28.81  ? 270 GLU C CB  1 
ATOM   6306  C  CG  . GLU C 1 270 ? -61.438 -23.394 67.148  1.00 45.45  ? 270 GLU C CG  1 
ATOM   6307  C  CD  . GLU C 1 270 ? -59.937 -23.406 67.361  1.00 63.37  ? 270 GLU C CD  1 
ATOM   6308  O  OE1 . GLU C 1 270 ? -59.199 -23.629 66.380  1.00 67.34  ? 270 GLU C OE1 1 
ATOM   6309  O  OE2 . GLU C 1 270 ? -59.497 -23.190 68.509  1.00 65.69  ? 270 GLU C OE2 1 
ATOM   6310  N  N   . ILE C 1 271 ? -63.478 -23.136 62.931  1.00 31.42  ? 271 ILE C N   1 
ATOM   6311  C  CA  . ILE C 1 271 ? -63.936 -22.412 61.770  1.00 31.87  ? 271 ILE C CA  1 
ATOM   6312  C  C   . ILE C 1 271 ? -65.436 -22.531 61.695  1.00 45.57  ? 271 ILE C C   1 
ATOM   6313  O  O   . ILE C 1 271 ? -66.130 -21.584 61.297  1.00 37.79  ? 271 ILE C O   1 
ATOM   6314  C  CB  . ILE C 1 271 ? -63.321 -22.935 60.484  1.00 26.51  ? 271 ILE C CB  1 
ATOM   6315  C  CG1 . ILE C 1 271 ? -61.849 -22.595 60.421  1.00 17.51  ? 271 ILE C CG1 1 
ATOM   6316  C  CG2 . ILE C 1 271 ? -64.024 -22.347 59.297  1.00 25.48  ? 271 ILE C CG2 1 
ATOM   6317  C  CD1 . ILE C 1 271 ? -61.140 -23.096 59.213  1.00 27.79  ? 271 ILE C CD1 1 
ATOM   6318  N  N   . ARG C 1 272 ? -65.952 -23.702 62.054  1.00 45.57  ? 272 ARG C N   1 
ATOM   6319  C  CA  . ARG C 1 272 ? -67.388 -23.958 61.993  1.00 53.63  ? 272 ARG C CA  1 
ATOM   6320  C  C   . ARG C 1 272 ? -68.137 -23.100 63.003  1.00 53.18  ? 272 ARG C C   1 
ATOM   6321  O  O   . ARG C 1 272 ? -69.351 -22.924 62.910  1.00 64.86  ? 272 ARG C O   1 
ATOM   6322  C  CB  . ARG C 1 272 ? -67.678 -25.439 62.244  1.00 43.63  ? 272 ARG C CB  1 
ATOM   6323  C  CG  . ARG C 1 272 ? -67.136 -26.367 61.171  1.00 65.14  ? 272 ARG C CG  1 
ATOM   6324  C  CD  . ARG C 1 272 ? -66.989 -27.786 61.690  1.00 83.96  ? 272 ARG C CD  1 
ATOM   6325  N  NE  . ARG C 1 272 ? -68.238 -28.295 62.250  1.00 93.16  ? 272 ARG C NE  1 
ATOM   6326  C  CZ  . ARG C 1 272 ? -69.170 -28.929 61.545  1.00 100.12 ? 272 ARG C CZ  1 
ATOM   6327  N  NH1 . ARG C 1 272 ? -68.996 -29.133 60.246  1.00 93.60  ? 272 ARG C NH1 1 
ATOM   6328  N  NH2 . ARG C 1 272 ? -70.276 -29.357 62.138  1.00 105.12 ? 272 ARG C NH2 1 
ATOM   6329  N  N   . ASN C 1 273 ? -67.396 -22.570 63.969  1.00 51.63  ? 273 ASN C N   1 
ATOM   6330  C  CA  . ASN C 1 273 ? -67.970 -21.715 65.022  1.00 52.99  ? 273 ASN C CA  1 
ATOM   6331  C  C   . ASN C 1 273 ? -67.703 -20.232 64.849  1.00 47.74  ? 273 ASN C C   1 
ATOM   6332  O  O   . ASN C 1 273 ? -68.095 -19.425 65.676  1.00 42.87  ? 273 ASN C O   1 
ATOM   6333  C  CB  . ASN C 1 273 ? -67.488 -22.126 66.407  1.00 51.26  ? 273 ASN C CB  1 
ATOM   6334  C  CG  . ASN C 1 273 ? -68.459 -23.062 67.103  1.00 66.34  ? 273 ASN C CG  1 
ATOM   6335  O  OD1 . ASN C 1 273 ? -69.688 -22.917 66.974  1.00 65.43  ? 273 ASN C OD1 1 
ATOM   6336  N  ND2 . ASN C 1 273 ? -67.917 -24.044 67.833  1.00 62.43  ? 273 ASN C ND2 1 
ATOM   6337  N  N   . HIS C 1 274 ? -67.037 -19.880 63.764  1.00 37.93  ? 274 HIS C N   1 
ATOM   6338  C  CA  . HIS C 1 274 ? -66.689 -18.507 63.524  1.00 41.46  ? 274 HIS C CA  1 
ATOM   6339  C  C   . HIS C 1 274 ? -67.895 -17.684 63.034  1.00 47.05  ? 274 HIS C C   1 
ATOM   6340  O  O   . HIS C 1 274 ? -68.691 -18.138 62.212  1.00 54.18  ? 274 HIS C O   1 
ATOM   6341  C  CB  . HIS C 1 274 ? -65.541 -18.455 62.533  1.00 40.93  ? 274 HIS C CB  1 
ATOM   6342  C  CG  . HIS C 1 274 ? -64.891 -17.126 62.453  1.00 46.13  ? 274 HIS C CG  1 
ATOM   6343  N  ND1 . HIS C 1 274 ? -65.527 -16.019 61.933  1.00 38.55  ? 274 HIS C ND1 1 
ATOM   6344  C  CD2 . HIS C 1 274 ? -63.663 -16.719 62.833  1.00 28.45  ? 274 HIS C CD2 1 
ATOM   6345  C  CE1 . HIS C 1 274 ? -64.712 -14.986 61.990  1.00 38.45  ? 274 HIS C CE1 1 
ATOM   6346  N  NE2 . HIS C 1 274 ? -63.574 -15.384 62.535  1.00 30.36  ? 274 HIS C NE2 1 
ATOM   6347  N  N   . GLU C 1 275 ? -68.026 -16.473 63.553  1.00 49.37  ? 275 GLU C N   1 
ATOM   6348  C  CA  . GLU C 1 275 ? -69.139 -15.587 63.187  1.00 62.72  ? 275 GLU C CA  1 
ATOM   6349  C  C   . GLU C 1 275 ? -69.391 -15.507 61.689  1.00 43.23  ? 275 GLU C C   1 
ATOM   6350  O  O   . GLU C 1 275 ? -70.541 -15.492 61.265  1.00 49.31  ? 275 GLU C O   1 
ATOM   6351  C  CB  . GLU C 1 275 ? -68.891 -14.172 63.693  1.00 81.39  ? 275 GLU C CB  1 
ATOM   6352  C  CG  . GLU C 1 275 ? -69.681 -13.774 64.919  1.00 104.18 ? 275 GLU C CG  1 
ATOM   6353  C  CD  . GLU C 1 275 ? -69.463 -12.300 65.285  1.00 122.81 ? 275 GLU C CD  1 
ATOM   6354  O  OE1 . GLU C 1 275 ? -70.029 -11.849 66.305  1.00 133.94 ? 275 GLU C OE1 1 
ATOM   6355  O  OE2 . GLU C 1 275 ? -68.723 -11.594 64.556  1.00 123.75 ? 275 GLU C OE2 1 
ATOM   6356  N  N   . TRP C 1 276 ? -68.320 -15.430 60.909  1.00 31.55  ? 276 TRP C N   1 
ATOM   6357  C  CA  . TRP C 1 276 ? -68.411 -15.284 59.475  1.00 27.91  ? 276 TRP C CA  1 
ATOM   6358  C  C   . TRP C 1 276 ? -68.913 -16.552 58.835  1.00 34.01  ? 276 TRP C C   1 
ATOM   6359  O  O   . TRP C 1 276 ? -69.591 -16.517 57.792  1.00 43.14  ? 276 TRP C O   1 
ATOM   6360  C  CB  . TRP C 1 276 ? -67.055 -14.967 58.877  1.00 22.40  ? 276 TRP C CB  1 
ATOM   6361  C  CG  . TRP C 1 276 ? -67.148 -14.583 57.440  1.00 31.13  ? 276 TRP C CG  1 
ATOM   6362  C  CD1 . TRP C 1 276 ? -67.481 -13.354 56.955  1.00 38.85  ? 276 TRP C CD1 1 
ATOM   6363  C  CD2 . TRP C 1 276 ? -66.923 -15.400 56.303  1.00 39.28  ? 276 TRP C CD2 1 
ATOM   6364  N  NE1 . TRP C 1 276 ? -67.462 -13.351 55.594  1.00 40.19  ? 276 TRP C NE1 1 
ATOM   6365  C  CE2 . TRP C 1 276 ? -67.104 -14.639 55.148  1.00 40.54  ? 276 TRP C CE2 1 
ATOM   6366  C  CE3 . TRP C 1 276 ? -66.556 -16.750 56.115  1.00 33.31  ? 276 TRP C CE3 1 
ATOM   6367  C  CZ2 . TRP C 1 276 ? -66.974 -15.104 53.868  1.00 32.47  ? 276 TRP C CZ2 1 
ATOM   6368  C  CZ3 . TRP C 1 276 ? -66.403 -17.228 54.858  1.00 28.33  ? 276 TRP C CZ3 1 
ATOM   6369  C  CH2 . TRP C 1 276 ? -66.623 -16.409 53.740  1.00 35.12  ? 276 TRP C CH2 1 
ATOM   6370  N  N   . PHE C 1 277 ? -68.565 -17.679 59.448  1.00 43.75  ? 277 PHE C N   1 
ATOM   6371  C  CA  . PHE C 1 277 ? -68.971 -18.970 58.912  1.00 44.29  ? 277 PHE C CA  1 
ATOM   6372  C  C   . PHE C 1 277 ? -70.444 -19.255 59.212  1.00 34.92  ? 277 PHE C C   1 
ATOM   6373  O  O   . PHE C 1 277 ? -71.138 -19.888 58.418  1.00 51.13  ? 277 PHE C O   1 
ATOM   6374  C  CB  . PHE C 1 277 ? -68.064 -20.080 59.461  1.00 37.84  ? 277 PHE C CB  1 
ATOM   6375  C  CG  . PHE C 1 277 ? -68.306 -21.418 58.852  1.00 31.31  ? 277 PHE C CG  1 
ATOM   6376  C  CD1 . PHE C 1 277 ? -67.514 -21.878 57.812  1.00 27.31  ? 277 PHE C CD1 1 
ATOM   6377  C  CD2 . PHE C 1 277 ? -69.313 -22.223 59.324  1.00 29.81  ? 277 PHE C CD2 1 
ATOM   6378  C  CE1 . PHE C 1 277 ? -67.745 -23.125 57.252  1.00 38.81  ? 277 PHE C CE1 1 
ATOM   6379  C  CE2 . PHE C 1 277 ? -69.552 -23.460 58.758  1.00 40.50  ? 277 PHE C CE2 1 
ATOM   6380  C  CZ  . PHE C 1 277 ? -68.766 -23.909 57.720  1.00 30.52  ? 277 PHE C CZ  1 
ATOM   6381  N  N   . LEU C 1 278 ? -70.927 -18.760 60.345  1.00 33.07  ? 278 LEU C N   1 
ATOM   6382  C  CA  . LEU C 1 278 ? -72.295 -19.039 60.767  1.00 30.66  ? 278 LEU C CA  1 
ATOM   6383  C  C   . LEU C 1 278 ? -73.370 -18.263 60.008  1.00 45.03  ? 278 LEU C C   1 
ATOM   6384  O  O   . LEU C 1 278 ? -74.485 -18.737 59.868  1.00 48.02  ? 278 LEU C O   1 
ATOM   6385  C  CB  . LEU C 1 278 ? -72.433 -18.800 62.261  1.00 32.75  ? 278 LEU C CB  1 
ATOM   6386  C  CG  . LEU C 1 278 ? -71.601 -19.757 63.129  1.00 43.37  ? 278 LEU C CG  1 
ATOM   6387  C  CD1 . LEU C 1 278 ? -71.336 -19.180 64.524  1.00 31.88  ? 278 LEU C CD1 1 
ATOM   6388  C  CD2 . LEU C 1 278 ? -72.236 -21.130 63.211  1.00 29.80  ? 278 LEU C CD2 1 
ATOM   6389  N  N   . LYS C 1 279 ? -73.022 -17.083 59.513  1.00 39.68  ? 279 LYS C N   1 
ATOM   6390  C  CA  . LYS C 1 279 ? -73.924 -16.231 58.738  1.00 42.28  ? 279 LYS C CA  1 
ATOM   6391  C  C   . LYS C 1 279 ? -74.516 -16.986 57.588  1.00 32.68  ? 279 LYS C C   1 
ATOM   6392  O  O   . LYS C 1 279 ? -73.792 -17.395 56.708  1.00 32.96  ? 279 LYS C O   1 
ATOM   6393  C  CB  . LYS C 1 279 ? -73.134 -15.057 58.137  1.00 47.90  ? 279 LYS C CB  1 
ATOM   6394  C  CG  . LYS C 1 279 ? -73.667 -13.652 58.410  1.00 61.18  ? 279 LYS C CG  1 
ATOM   6395  C  CD  . LYS C 1 279 ? -74.859 -13.324 57.551  1.00 69.15  ? 279 LYS C CD  1 
ATOM   6396  C  CE  . LYS C 1 279 ? -75.007 -11.820 57.346  1.00 75.31  ? 279 LYS C CE  1 
ATOM   6397  N  NZ  . LYS C 1 279 ? -74.264 -11.329 56.145  1.00 66.70  ? 279 LYS C NZ  1 
ATOM   6398  N  N   . ASN C 1 280 ? -75.829 -17.157 57.575  1.00 39.92  ? 280 ASN C N   1 
ATOM   6399  C  CA  . ASN C 1 280 ? -76.482 -17.808 56.445  1.00 43.12  ? 280 ASN C CA  1 
ATOM   6400  C  C   . ASN C 1 280 ? -76.090 -19.277 56.234  1.00 36.99  ? 280 ASN C C   1 
ATOM   6401  O  O   . ASN C 1 280 ? -76.265 -19.796 55.135  1.00 40.94  ? 280 ASN C O   1 
ATOM   6402  C  CB  . ASN C 1 280 ? -76.166 -17.055 55.160  1.00 44.16  ? 280 ASN C CB  1 
ATOM   6403  C  CG  . ASN C 1 280 ? -76.781 -15.699 55.122  1.00 53.59  ? 280 ASN C CG  1 
ATOM   6404  O  OD1 . ASN C 1 280 ? -77.351 -15.235 56.110  1.00 46.60  ? 280 ASN C OD1 1 
ATOM   6405  N  ND2 . ASN C 1 280 ? -76.680 -15.039 53.969  1.00 74.54  ? 280 ASN C ND2 1 
ATOM   6406  N  N   . LEU C 1 281 ? -75.515 -19.915 57.246  1.00 34.72  ? 281 LEU C N   1 
ATOM   6407  C  CA  . LEU C 1 281 ? -75.094 -21.302 57.103  1.00 37.63  ? 281 LEU C CA  1 
ATOM   6408  C  C   . LEU C 1 281 ? -76.330 -22.184 57.055  1.00 39.17  ? 281 LEU C C   1 
ATOM   6409  O  O   . LEU C 1 281 ? -77.013 -22.345 58.065  1.00 52.18  ? 281 LEU C O   1 
ATOM   6410  C  CB  . LEU C 1 281 ? -74.195 -21.712 58.268  1.00 28.47  ? 281 LEU C CB  1 
ATOM   6411  C  CG  . LEU C 1 281 ? -73.936 -23.210 58.437  1.00 30.41  ? 281 LEU C CG  1 
ATOM   6412  C  CD1 . LEU C 1 281 ? -73.320 -23.793 57.177  1.00 37.28  ? 281 LEU C CD1 1 
ATOM   6413  C  CD2 . LEU C 1 281 ? -73.047 -23.469 59.642  1.00 34.02  ? 281 LEU C CD2 1 
ATOM   6414  N  N   . PRO C 1 282 ? -76.636 -22.748 55.889  1.00 32.47  ? 282 PRO C N   1 
ATOM   6415  C  CA  . PRO C 1 282 ? -77.870 -23.530 55.789  1.00 37.53  ? 282 PRO C CA  1 
ATOM   6416  C  C   . PRO C 1 282 ? -77.935 -24.437 57.007  1.00 43.55  ? 282 PRO C C   1 
ATOM   6417  O  O   . PRO C 1 282 ? -76.894 -25.042 57.319  1.00 27.19  ? 282 PRO C O   1 
ATOM   6418  C  CB  . PRO C 1 282 ? -77.647 -24.353 54.516  1.00 33.12  ? 282 PRO C CB  1 
ATOM   6419  C  CG  . PRO C 1 282 ? -76.638 -23.519 53.715  1.00 36.02  ? 282 PRO C CG  1 
ATOM   6420  C  CD  . PRO C 1 282 ? -75.712 -23.005 54.771  1.00 31.05  ? 282 PRO C CD  1 
ATOM   6421  N  N   . ALA C 1 283 ? -79.076 -24.512 57.682  1.00 40.18  ? 283 ALA C N   1 
ATOM   6422  C  CA  . ALA C 1 283 ? -79.217 -25.403 58.823  1.00 44.73  ? 283 ALA C CA  1 
ATOM   6423  C  C   . ALA C 1 283 ? -79.046 -26.827 58.324  1.00 54.23  ? 283 ALA C C   1 
ATOM   6424  O  O   . ALA C 1 283 ? -78.986 -27.775 59.106  1.00 49.34  ? 283 ALA C O   1 
ATOM   6425  C  CB  . ALA C 1 283 ? -80.575 -25.225 59.472  1.00 42.72  ? 283 ALA C CB  1 
ATOM   6426  N  N   . ASP C 1 284 ? -78.965 -26.975 57.007  1.00 79.28  ? 284 ASP C N   1 
ATOM   6427  C  CA  . ASP C 1 284 ? -78.791 -28.286 56.394  1.00 86.99  ? 284 ASP C CA  1 
ATOM   6428  C  C   . ASP C 1 284 ? -77.332 -28.724 56.448  1.00 84.31  ? 284 ASP C C   1 
ATOM   6429  O  O   . ASP C 1 284 ? -77.007 -29.766 57.017  1.00 67.69  ? 284 ASP C O   1 
ATOM   6430  C  CB  . ASP C 1 284 ? -79.282 -28.269 54.946  1.00 83.01  ? 284 ASP C CB  1 
ATOM   6431  C  CG  . ASP C 1 284 ? -80.433 -29.227 54.710  1.00 94.04  ? 284 ASP C CG  1 
ATOM   6432  O  OD1 . ASP C 1 284 ? -80.832 -29.925 55.664  1.00 95.24  ? 284 ASP C OD1 1 
ATOM   6433  O  OD2 . ASP C 1 284 ? -80.938 -29.282 53.568  1.00 100.51 ? 284 ASP C OD2 1 
ATOM   6434  N  N   . LEU C 1 285 ? -76.456 -27.921 55.853  1.00 87.73  ? 285 LEU C N   1 
ATOM   6435  C  CA  . LEU C 1 285 ? -75.030 -28.219 55.832  1.00 62.34  ? 285 LEU C CA  1 
ATOM   6436  C  C   . LEU C 1 285 ? -74.360 -28.491 57.174  1.00 68.47  ? 285 LEU C C   1 
ATOM   6437  O  O   . LEU C 1 285 ? -74.725 -27.902 58.190  1.00 88.18  ? 285 LEU C O   1 
ATOM   6438  C  CB  . LEU C 1 285 ? -74.225 -26.957 55.519  1.00 57.70  ? 285 LEU C CB  1 
ATOM   6439  C  CG  . LEU C 1 285 ? -73.689 -26.823 54.093  1.00 50.57  ? 285 LEU C CG  1 
ATOM   6440  C  CD1 . LEU C 1 285 ? -72.993 -25.484 53.908  1.00 47.46  ? 285 LEU C CD1 1 
ATOM   6441  C  CD2 . LEU C 1 285 ? -72.747 -27.969 53.763  1.00 49.79  ? 285 LEU C CD2 1 
ATOM   6442  N  N   . MET C 1 286 ? -73.378 -29.385 57.169  1.00 60.64  ? 286 MET C N   1 
ATOM   6443  C  CA  . MET C 1 286 ? -72.824 -29.980 58.379  1.00 72.94  ? 286 MET C CA  1 
ATOM   6444  C  C   . MET C 1 286 ? -73.913 -30.636 59.219  1.00 80.29  ? 286 MET C C   1 
ATOM   6445  O  O   . MET C 1 286 ? -73.830 -30.667 60.447  1.00 84.57  ? 286 MET C O   1 
ATOM   6446  C  CB  . MET C 1 286 ? -72.088 -28.923 59.204  1.00 58.16  ? 286 MET C CB  1 
ATOM   6447  C  CG  . MET C 1 286 ? -71.963 -27.575 58.514  1.00 48.79  ? 286 MET C CG  1 
ATOM   6448  S  SD  . MET C 1 286 ? -70.273 -27.205 58.009  1.00 53.75  ? 286 MET C SD  1 
ATOM   6449  C  CE  . MET C 1 286 ? -70.125 -28.219 56.540  1.00 172.70 ? 286 MET C CE  1 
ATOM   6450  N  N   . GLY C 1 302 ? -78.054 -46.946 47.366  1.00 65.36  ? 302 GLY C N   1 
ATOM   6451  C  CA  . GLY C 1 302 ? -77.577 -47.728 46.240  1.00 77.78  ? 302 GLY C CA  1 
ATOM   6452  C  C   . GLY C 1 302 ? -77.502 -49.208 46.558  1.00 81.81  ? 302 GLY C C   1 
ATOM   6453  O  O   . GLY C 1 302 ? -78.133 -49.681 47.502  1.00 83.04  ? 302 GLY C O   1 
ATOM   6454  N  N   . GLN C 1 303 ? -76.726 -49.943 45.766  1.00 73.10  ? 303 GLN C N   1 
ATOM   6455  C  CA  . GLN C 1 303 ? -76.568 -51.377 45.972  1.00 67.38  ? 303 GLN C CA  1 
ATOM   6456  C  C   . GLN C 1 303 ? -75.800 -51.663 47.255  1.00 49.86  ? 303 GLN C C   1 
ATOM   6457  O  O   . GLN C 1 303 ? -75.041 -50.823 47.735  1.00 50.60  ? 303 GLN C O   1 
ATOM   6458  C  CB  . GLN C 1 303 ? -75.862 -52.020 44.776  1.00 65.26  ? 303 GLN C CB  1 
ATOM   6459  C  CG  . GLN C 1 303 ? -74.858 -51.115 44.083  1.00 63.20  ? 303 GLN C CG  1 
ATOM   6460  C  CD  . GLN C 1 303 ? -74.342 -51.707 42.788  1.00 53.51  ? 303 GLN C CD  1 
ATOM   6461  O  OE1 . GLN C 1 303 ? -74.949 -52.616 42.223  1.00 45.28  ? 303 GLN C OE1 1 
ATOM   6462  N  NE2 . GLN C 1 303 ? -73.215 -51.193 42.309  1.00 55.99  ? 303 GLN C NE2 1 
ATOM   6463  N  N   . SER C 1 304 ? -76.006 -52.853 47.808  1.00 44.71  ? 304 SER C N   1 
ATOM   6464  C  CA  . SER C 1 304 ? -75.346 -53.246 49.047  1.00 51.09  ? 304 SER C CA  1 
ATOM   6465  C  C   . SER C 1 304 ? -73.910 -53.689 48.795  1.00 41.30  ? 304 SER C C   1 
ATOM   6466  O  O   . SER C 1 304 ? -73.534 -53.993 47.664  1.00 48.14  ? 304 SER C O   1 
ATOM   6467  C  CB  . SER C 1 304 ? -76.126 -54.368 49.734  1.00 53.29  ? 304 SER C CB  1 
ATOM   6468  O  OG  . SER C 1 304 ? -76.235 -55.501 48.891  1.00 53.08  ? 304 SER C OG  1 
ATOM   6469  N  N   . ILE C 1 305 ? -73.112 -53.724 49.856  1.00 39.94  ? 305 ILE C N   1 
ATOM   6470  C  CA  . ILE C 1 305 ? -71.725 -54.155 49.755  1.00 36.77  ? 305 ILE C CA  1 
ATOM   6471  C  C   . ILE C 1 305 ? -71.647 -55.582 49.230  1.00 47.88  ? 305 ILE C C   1 
ATOM   6472  O  O   . ILE C 1 305 ? -70.673 -55.965 48.582  1.00 50.07  ? 305 ILE C O   1 
ATOM   6473  C  CB  . ILE C 1 305 ? -71.012 -54.082 51.116  1.00 37.53  ? 305 ILE C CB  1 
ATOM   6474  C  CG1 . ILE C 1 305 ? -71.002 -52.645 51.638  1.00 43.04  ? 305 ILE C CG1 1 
ATOM   6475  C  CG2 . ILE C 1 305 ? -69.595 -54.622 51.004  1.00 37.80  ? 305 ILE C CG2 1 
ATOM   6476  C  CD1 . ILE C 1 305 ? -69.696 -52.238 52.280  1.00 39.76  ? 305 ILE C CD1 1 
ATOM   6477  N  N   . GLU C 1 306 ? -72.681 -56.365 49.515  1.00 36.58  ? 306 GLU C N   1 
ATOM   6478  C  CA  . GLU C 1 306 ? -72.742 -57.752 49.072  1.00 46.60  ? 306 GLU C CA  1 
ATOM   6479  C  C   . GLU C 1 306 ? -73.033 -57.836 47.578  1.00 49.17  ? 306 GLU C C   1 
ATOM   6480  O  O   . GLU C 1 306 ? -72.454 -58.656 46.867  1.00 45.30  ? 306 GLU C O   1 
ATOM   6481  C  CB  . GLU C 1 306 ? -73.805 -58.518 49.861  1.00 41.34  ? 306 GLU C CB  1 
ATOM   6482  C  CG  . GLU C 1 306 ? -73.459 -58.730 51.326  1.00 60.12  ? 306 GLU C CG  1 
ATOM   6483  C  CD  . GLU C 1 306 ? -73.900 -57.574 52.203  1.00 70.05  ? 306 GLU C CD  1 
ATOM   6484  O  OE1 . GLU C 1 306 ? -74.484 -56.608 51.670  1.00 63.92  ? 306 GLU C OE1 1 
ATOM   6485  O  OE2 . GLU C 1 306 ? -73.663 -57.633 53.428  1.00 64.37  ? 306 GLU C OE2 1 
ATOM   6486  N  N   . GLU C 1 307 ? -73.937 -56.982 47.109  1.00 46.35  ? 307 GLU C N   1 
ATOM   6487  C  CA  . GLU C 1 307 ? -74.291 -56.940 45.696  1.00 34.69  ? 307 GLU C CA  1 
ATOM   6488  C  C   . GLU C 1 307 ? -73.091 -56.520 44.856  1.00 30.59  ? 307 GLU C C   1 
ATOM   6489  O  O   . GLU C 1 307 ? -72.871 -57.042 43.765  1.00 43.53  ? 307 GLU C O   1 
ATOM   6490  C  CB  . GLU C 1 307 ? -75.455 -55.976 45.463  1.00 63.65  ? 307 GLU C CB  1 
ATOM   6491  C  CG  . GLU C 1 307 ? -76.794 -56.479 45.976  1.00 83.38  ? 307 GLU C CG  1 
ATOM   6492  C  CD  . GLU C 1 307 ? -77.862 -55.403 45.966  1.00 95.31  ? 307 GLU C CD  1 
ATOM   6493  O  OE1 . GLU C 1 307 ? -77.671 -54.368 46.636  1.00 94.46  ? 307 GLU C OE1 1 
ATOM   6494  O  OE2 . GLU C 1 307 ? -78.893 -55.593 45.286  1.00 98.13  ? 307 GLU C OE2 1 
ATOM   6495  N  N   . ILE C 1 308 ? -72.318 -55.572 45.376  1.00 34.94  ? 308 ILE C N   1 
ATOM   6496  C  CA  . ILE C 1 308 ? -71.135 -55.079 44.681  1.00 37.54  ? 308 ILE C CA  1 
ATOM   6497  C  C   . ILE C 1 308 ? -70.030 -56.129 44.665  1.00 34.60  ? 308 ILE C C   1 
ATOM   6498  O  O   . ILE C 1 308 ? -69.370 -56.334 43.647  1.00 33.24  ? 308 ILE C O   1 
ATOM   6499  C  CB  . ILE C 1 308 ? -70.598 -53.791 45.331  1.00 34.30  ? 308 ILE C CB  1 
ATOM   6500  C  CG1 . ILE C 1 308 ? -71.536 -52.617 45.042  1.00 37.82  ? 308 ILE C CG1 1 
ATOM   6501  C  CG2 . ILE C 1 308 ? -69.193 -53.489 44.835  1.00 27.87  ? 308 ILE C CG2 1 
ATOM   6502  C  CD1 . ILE C 1 308 ? -71.481 -51.522 46.081  1.00 26.78  ? 308 ILE C CD1 1 
ATOM   6503  N  N   . MET C 1 309 ? -69.834 -56.792 45.800  1.00 26.75  ? 309 MET C N   1 
ATOM   6504  C  CA  . MET C 1 309 ? -68.810 -57.822 45.918  1.00 38.95  ? 309 MET C CA  1 
ATOM   6505  C  C   . MET C 1 309 ? -69.063 -58.966 44.942  1.00 40.68  ? 309 MET C C   1 
ATOM   6506  O  O   . MET C 1 309 ? -68.134 -59.486 44.326  1.00 35.86  ? 309 MET C O   1 
ATOM   6507  C  CB  . MET C 1 309 ? -68.751 -58.357 47.349  1.00 23.20  ? 309 MET C CB  1 
ATOM   6508  C  CG  . MET C 1 309 ? -68.004 -57.456 48.318  1.00 31.78  ? 309 MET C CG  1 
ATOM   6509  S  SD  . MET C 1 309 ? -66.490 -56.780 47.614  1.00 51.06  ? 309 MET C SD  1 
ATOM   6510  C  CE  . MET C 1 309 ? -65.331 -58.097 47.971  1.00 44.10  ? 309 MET C CE  1 
ATOM   6511  N  N   . GLN C 1 310 ? -70.327 -59.352 44.806  1.00 28.04  ? 310 GLN C N   1 
ATOM   6512  C  CA  . GLN C 1 310 ? -70.704 -60.431 43.904  1.00 35.36  ? 310 GLN C CA  1 
ATOM   6513  C  C   . GLN C 1 310 ? -70.435 -60.053 42.452  1.00 55.87  ? 310 GLN C C   1 
ATOM   6514  O  O   . GLN C 1 310 ? -69.929 -60.860 41.673  1.00 55.91  ? 310 GLN C O   1 
ATOM   6515  C  CB  . GLN C 1 310 ? -72.179 -60.792 44.087  1.00 30.54  ? 310 GLN C CB  1 
ATOM   6516  C  CG  . GLN C 1 310 ? -72.740 -61.672 42.984  1.00 36.36  ? 310 GLN C CG  1 
ATOM   6517  C  CD  . GLN C 1 310 ? -72.545 -63.149 43.263  1.00 52.52  ? 310 GLN C CD  1 
ATOM   6518  O  OE1 . GLN C 1 310 ? -73.509 -63.885 43.470  1.00 68.59  ? 310 GLN C OE1 1 
ATOM   6519  N  NE2 . GLN C 1 310 ? -71.293 -63.590 43.269  1.00 52.16  ? 310 GLN C NE2 1 
ATOM   6520  N  N   . ILE C 1 311 ? -70.780 -58.820 42.095  1.00 56.76  ? 311 ILE C N   1 
ATOM   6521  C  CA  . ILE C 1 311 ? -70.582 -58.335 40.735  1.00 41.69  ? 311 ILE C CA  1 
ATOM   6522  C  C   . ILE C 1 311 ? -69.099 -58.211 40.403  1.00 42.64  ? 311 ILE C C   1 
ATOM   6523  O  O   . ILE C 1 311 ? -68.705 -58.297 39.241  1.00 54.31  ? 311 ILE C O   1 
ATOM   6524  C  CB  . ILE C 1 311 ? -71.268 -56.975 40.514  1.00 39.82  ? 311 ILE C CB  1 
ATOM   6525  C  CG1 . ILE C 1 311 ? -72.787 -57.146 40.475  1.00 27.44  ? 311 ILE C CG1 1 
ATOM   6526  C  CG2 . ILE C 1 311 ? -70.769 -56.330 39.231  1.00 34.71  ? 311 ILE C CG2 1 
ATOM   6527  C  CD1 . ILE C 1 311 ? -73.545 -55.842 40.387  1.00 39.93  ? 311 ILE C CD1 1 
ATOM   6528  N  N   . ILE C 1 312 ? -68.280 -58.009 41.430  1.00 43.33  ? 312 ILE C N   1 
ATOM   6529  C  CA  . ILE C 1 312 ? -66.840 -57.890 41.239  1.00 59.74  ? 312 ILE C CA  1 
ATOM   6530  C  C   . ILE C 1 312 ? -66.200 -59.259 41.041  1.00 59.29  ? 312 ILE C C   1 
ATOM   6531  O  O   . ILE C 1 312 ? -65.201 -59.392 40.334  1.00 60.55  ? 312 ILE C O   1 
ATOM   6532  C  CB  . ILE C 1 312 ? -66.170 -57.184 42.430  1.00 54.52  ? 312 ILE C CB  1 
ATOM   6533  C  CG1 . ILE C 1 312 ? -66.486 -55.688 42.411  1.00 51.04  ? 312 ILE C CG1 1 
ATOM   6534  C  CG2 . ILE C 1 312 ? -64.667 -57.414 42.407  1.00 48.93  ? 312 ILE C CG2 1 
ATOM   6535  C  CD1 . ILE C 1 312 ? -65.818 -54.908 43.522  1.00 44.76  ? 312 ILE C CD1 1 
ATOM   6536  N  N   . ALA C 1 313 ? -66.781 -60.275 41.669  1.00 51.79  ? 313 ALA C N   1 
ATOM   6537  C  CA  . ALA C 1 313 ? -66.275 -61.637 41.555  1.00 60.37  ? 313 ALA C CA  1 
ATOM   6538  C  C   . ALA C 1 313 ? -66.453 -62.166 40.136  1.00 63.12  ? 313 ALA C C   1 
ATOM   6539  O  O   . ALA C 1 313 ? -65.500 -62.632 39.513  1.00 73.60  ? 313 ALA C O   1 
ATOM   6540  C  CB  . ALA C 1 313 ? -66.971 -62.547 42.554  1.00 63.52  ? 313 ALA C CB  1 
ATOM   6541  N  N   . GLU C 1 314 ? -67.680 -62.089 39.632  1.00 48.11  ? 314 GLU C N   1 
ATOM   6542  C  CA  . GLU C 1 314 ? -67.982 -62.547 38.282  1.00 47.04  ? 314 GLU C CA  1 
ATOM   6543  C  C   . GLU C 1 314 ? -67.078 -61.873 37.256  1.00 63.41  ? 314 GLU C C   1 
ATOM   6544  O  O   . GLU C 1 314 ? -66.616 -62.507 36.308  1.00 71.53  ? 314 GLU C O   1 
ATOM   6545  C  CB  . GLU C 1 314 ? -69.450 -62.283 37.942  1.00 39.67  ? 314 GLU C CB  1 
ATOM   6546  C  CG  . GLU C 1 314 ? -70.433 -62.927 38.904  1.00 42.54  ? 314 GLU C CG  1 
ATOM   6547  C  CD  . GLU C 1 314 ? -71.842 -62.391 38.743  1.00 58.88  ? 314 GLU C CD  1 
ATOM   6548  O  OE1 . GLU C 1 314 ? -72.763 -62.934 39.387  1.00 68.01  ? 314 GLU C OE1 1 
ATOM   6549  O  OE2 . GLU C 1 314 ? -72.027 -61.428 37.970  1.00 75.50  ? 314 GLU C OE2 1 
ATOM   6550  N  N   . ALA C 1 315 ? -66.829 -60.582 37.450  1.00 59.30  ? 315 ALA C N   1 
ATOM   6551  C  CA  . ALA C 1 315 ? -65.983 -59.819 36.541  1.00 62.38  ? 315 ALA C CA  1 
ATOM   6552  C  C   . ALA C 1 315 ? -64.568 -60.384 36.501  1.00 69.81  ? 315 ALA C C   1 
ATOM   6553  O  O   . ALA C 1 315 ? -63.897 -60.329 35.471  1.00 67.61  ? 315 ALA C O   1 
ATOM   6554  C  CB  . ALA C 1 315 ? -65.959 -58.353 36.942  1.00 62.62  ? 315 ALA C CB  1 
ATOM   6555  N  N   . THR C 1 316 ? -64.120 -60.926 37.629  1.00 77.27  ? 316 THR C N   1 
ATOM   6556  C  CA  . THR C 1 316 ? -62.785 -61.506 37.720  1.00 79.26  ? 316 THR C CA  1 
ATOM   6557  C  C   . THR C 1 316 ? -62.646 -62.704 36.788  1.00 72.35  ? 316 THR C C   1 
ATOM   6558  O  O   . THR C 1 316 ? -61.537 -63.116 36.452  1.00 65.60  ? 316 THR C O   1 
ATOM   6559  C  CB  . THR C 1 316 ? -62.458 -61.948 39.158  1.00 78.54  ? 316 THR C CB  1 
ATOM   6560  O  OG1 . THR C 1 316 ? -63.263 -63.081 39.507  1.00 77.80  ? 316 THR C OG1 1 
ATOM   6561  C  CG2 . THR C 1 316 ? -62.732 -60.817 40.136  1.00 83.22  ? 316 THR C CG2 1 
ATOM   6562  N  N   . VAL C 1 317 ? -63.780 -63.260 36.377  1.00 76.74  ? 317 VAL C N   1 
ATOM   6563  C  CA  . VAL C 1 317 ? -63.789 -64.417 35.490  1.00 82.33  ? 317 VAL C CA  1 
ATOM   6564  C  C   . VAL C 1 317 ? -63.775 -63.990 34.026  1.00 79.37  ? 317 VAL C C   1 
ATOM   6565  O  O   . VAL C 1 317 ? -64.558 -63.136 33.612  1.00 63.52  ? 317 VAL C O   1 
ATOM   6566  C  CB  . VAL C 1 317 ? -65.016 -65.312 35.743  1.00 76.91  ? 317 VAL C CB  1 
ATOM   6567  C  CG1 . VAL C 1 317 ? -65.109 -65.679 37.215  1.00 53.15  ? 317 VAL C CG1 1 
ATOM   6568  C  CG2 . VAL C 1 317 ? -66.285 -64.615 35.281  1.00 83.38  ? 317 VAL C CG2 1 
ATOM   6569  N  N   . LEU D 1 12  ? -54.937 -0.184  31.886  1.00 83.07  ? 12  LEU D N   1 
ATOM   6570  C  CA  . LEU D 1 12  ? -53.706 0.249   32.538  1.00 86.43  ? 12  LEU D CA  1 
ATOM   6571  C  C   . LEU D 1 12  ? -53.902 1.583   33.249  1.00 82.80  ? 12  LEU D C   1 
ATOM   6572  O  O   . LEU D 1 12  ? -53.303 1.833   34.295  1.00 92.99  ? 12  LEU D O   1 
ATOM   6573  C  CB  . LEU D 1 12  ? -52.576 0.346   31.525  1.00 91.91  ? 12  LEU D CB  1 
ATOM   6574  N  N   . PRO D 1 13  ? -54.743 2.436   32.675  1.00 74.65  ? 13  PRO D N   1 
ATOM   6575  C  CA  . PRO D 1 13  ? -55.022 3.751   33.259  1.00 69.75  ? 13  PRO D CA  1 
ATOM   6576  C  C   . PRO D 1 13  ? -55.502 3.634   34.701  1.00 74.81  ? 13  PRO D C   1 
ATOM   6577  O  O   . PRO D 1 13  ? -55.983 2.577   35.108  1.00 74.86  ? 13  PRO D O   1 
ATOM   6578  C  CB  . PRO D 1 13  ? -56.147 4.288   32.375  1.00 69.82  ? 13  PRO D CB  1 
ATOM   6579  C  CG  . PRO D 1 13  ? -56.846 3.072   31.888  1.00 86.77  ? 13  PRO D CG  1 
ATOM   6580  C  CD  . PRO D 1 13  ? -55.785 2.020   31.721  1.00 86.73  ? 13  PRO D CD  1 
ATOM   6581  N  N   . ILE D 1 14  ? -55.369 4.714   35.462  1.00 85.34  ? 14  ILE D N   1 
ATOM   6582  C  CA  . ILE D 1 14  ? -55.788 4.722   36.857  1.00 79.09  ? 14  ILE D CA  1 
ATOM   6583  C  C   . ILE D 1 14  ? -57.304 4.617   36.981  1.00 74.18  ? 14  ILE D C   1 
ATOM   6584  O  O   . ILE D 1 14  ? -58.039 4.970   36.059  1.00 92.09  ? 14  ILE D O   1 
ATOM   6585  C  CB  . ILE D 1 14  ? -55.308 5.994   37.582  1.00 81.54  ? 14  ILE D CB  1 
ATOM   6586  C  CG1 . ILE D 1 14  ? -54.126 5.671   38.498  1.00 69.49  ? 14  ILE D CG1 1 
ATOM   6587  C  CG2 . ILE D 1 14  ? -56.446 6.618   38.374  1.00 88.29  ? 14  ILE D CG2 1 
ATOM   6588  C  CD1 . ILE D 1 14  ? -54.531 5.311   39.909  1.00 65.66  ? 14  ILE D CD1 1 
ATOM   6589  N  N   . MET D 1 15  ? -57.763 4.127   38.127  1.00 57.78  ? 15  MET D N   1 
ATOM   6590  C  CA  . MET D 1 15  ? -59.190 3.980   38.391  1.00 50.99  ? 15  MET D CA  1 
ATOM   6591  C  C   . MET D 1 15  ? -59.899 5.329   38.338  1.00 45.42  ? 15  MET D C   1 
ATOM   6592  O  O   . MET D 1 15  ? -59.295 6.367   38.607  1.00 60.64  ? 15  MET D O   1 
ATOM   6593  C  CB  . MET D 1 15  ? -59.419 3.313   39.749  1.00 36.49  ? 15  MET D CB  1 
ATOM   6594  C  CG  . MET D 1 15  ? -60.882 3.099   40.099  1.00 40.50  ? 15  MET D CG  1 
ATOM   6595  S  SD  . MET D 1 15  ? -61.701 1.923   39.005  1.00 57.54  ? 15  MET D SD  1 
ATOM   6596  C  CE  . MET D 1 15  ? -63.382 2.010   39.612  1.00 20.54  ? 15  MET D CE  1 
ATOM   6597  N  N   . HIS D 1 16  ? -61.182 5.306   37.992  1.00 54.17  ? 16  HIS D N   1 
ATOM   6598  C  CA  . HIS D 1 16  ? -61.967 6.528   37.880  1.00 62.03  ? 16  HIS D CA  1 
ATOM   6599  C  C   . HIS D 1 16  ? -63.471 6.277   37.897  1.00 62.39  ? 16  HIS D C   1 
ATOM   6600  O  O   . HIS D 1 16  ? -63.926 5.156   37.676  1.00 63.48  ? 16  HIS D O   1 
ATOM   6601  C  CB  . HIS D 1 16  ? -61.887 7.081   36.457  1.00 44.24  ? 16  HIS D CB  1 
ATOM   6602  C  CG  . HIS D 1 16  ? -62.140 6.054   35.397  1.00 54.25  ? 16  HIS D CG  1 
ATOM   6603  N  ND1 . HIS D 1 16  ? -61.180 5.154   34.989  1.00 47.16  ? 16  HIS D ND1 1 
ATOM   6604  C  CD2 . HIS D 1 16  ? -63.245 5.784   34.664  1.00 49.31  ? 16  HIS D CD2 1 
ATOM   6605  C  CE1 . HIS D 1 16  ? -61.683 4.374   34.049  1.00 39.53  ? 16  HIS D CE1 1 
ATOM   6606  N  NE2 . HIS D 1 16  ? -62.934 4.735   33.833  1.00 45.98  ? 16  HIS D NE2 1 
ATOM   6607  N  N   . ASP D 1 17  ? -64.236 7.331   38.159  1.00 47.45  ? 17  ASP D N   1 
ATOM   6608  C  CA  . ASP D 1 17  ? -65.656 7.234   38.476  1.00 59.18  ? 17  ASP D CA  1 
ATOM   6609  C  C   . ASP D 1 17  ? -65.911 6.238   39.602  1.00 63.32  ? 17  ASP D C   1 
ATOM   6610  O  O   . ASP D 1 17  ? -66.910 5.521   39.594  1.00 61.83  ? 17  ASP D O   1 
ATOM   6611  C  CB  . ASP D 1 17  ? -66.453 6.836   37.233  1.00 69.48  ? 17  ASP D CB  1 
ATOM   6612  C  CG  . ASP D 1 17  ? -66.126 7.701   36.032  1.00 72.97  ? 17  ASP D CG  1 
ATOM   6613  O  OD1 . ASP D 1 17  ? -64.927 7.874   35.730  1.00 54.96  ? 17  ASP D OD1 1 
ATOM   6614  O  OD2 . ASP D 1 17  ? -67.069 8.209   35.390  1.00 87.60  ? 17  ASP D OD2 1 
ATOM   6615  N  N   . SER D 1 18  ? -65.002 6.202   40.570  1.00 75.89  ? 18  SER D N   1 
ATOM   6616  C  CA  . SER D 1 18  ? -65.133 5.304   41.710  1.00 78.47  ? 18  SER D CA  1 
ATOM   6617  C  C   . SER D 1 18  ? -66.491 5.472   42.382  1.00 85.04  ? 18  SER D C   1 
ATOM   6618  O  O   . SER D 1 18  ? -67.064 4.512   42.896  1.00 89.77  ? 18  SER D O   1 
ATOM   6619  C  CB  . SER D 1 18  ? -64.014 5.557   42.722  1.00 78.59  ? 18  SER D CB  1 
ATOM   6620  O  OG  . SER D 1 18  ? -63.018 4.553   42.645  1.00 92.63  ? 18  SER D OG  1 
ATOM   6621  N  N   . ASP D 1 19  ? -66.999 6.699   42.373  1.00 89.18  ? 19  ASP D N   1 
ATOM   6622  C  CA  . ASP D 1 19  ? -68.283 7.003   42.990  1.00 90.33  ? 19  ASP D CA  1 
ATOM   6623  C  C   . ASP D 1 19  ? -69.441 6.497   42.139  1.00 81.85  ? 19  ASP D C   1 
ATOM   6624  O  O   . ASP D 1 19  ? -70.587 6.901   42.335  1.00 84.56  ? 19  ASP D O   1 
ATOM   6625  C  CB  . ASP D 1 19  ? -68.422 8.510   43.212  1.00 102.47 ? 19  ASP D CB  1 
ATOM   6626  C  CG  . ASP D 1 19  ? -68.780 9.255   41.941  1.00 110.54 ? 19  ASP D CG  1 
ATOM   6627  O  OD1 . ASP D 1 19  ? -69.901 9.801   41.867  1.00 113.26 ? 19  ASP D OD1 1 
ATOM   6628  O  OD2 . ASP D 1 19  ? -67.942 9.293   41.016  1.00 108.58 ? 19  ASP D OD2 1 
ATOM   6629  N  N   . ARG D 1 20  ? -69.138 5.614   41.194  1.00 76.00  ? 20  ARG D N   1 
ATOM   6630  C  CA  . ARG D 1 20  ? -70.159 5.082   40.302  1.00 71.20  ? 20  ARG D CA  1 
ATOM   6631  C  C   . ARG D 1 20  ? -69.866 3.646   39.877  1.00 63.71  ? 20  ARG D C   1 
ATOM   6632  O  O   . ARG D 1 20  ? -70.785 2.860   39.653  1.00 50.67  ? 20  ARG D O   1 
ATOM   6633  C  CB  . ARG D 1 20  ? -70.303 5.972   39.066  1.00 73.71  ? 20  ARG D CB  1 
ATOM   6634  C  CG  . ARG D 1 20  ? -71.740 6.317   38.712  1.00 75.92  ? 20  ARG D CG  1 
ATOM   6635  C  CD  . ARG D 1 20  ? -71.811 7.573   37.861  1.00 75.54  ? 20  ARG D CD  1 
ATOM   6636  N  NE  . ARG D 1 20  ? -71.087 7.423   36.603  1.00 71.70  ? 20  ARG D NE  1 
ATOM   6637  C  CZ  . ARG D 1 20  ? -71.538 6.736   35.559  1.00 71.53  ? 20  ARG D CZ  1 
ATOM   6638  N  NH1 . ARG D 1 20  ? -70.811 6.652   34.454  1.00 74.52  ? 20  ARG D NH1 1 
ATOM   6639  N  NH2 . ARG D 1 20  ? -72.717 6.132   35.620  1.00 61.55  ? 20  ARG D NH2 1 
ATOM   6640  N  N   . TYR D 1 21  ? -68.585 3.309   39.764  1.00 59.86  ? 21  TYR D N   1 
ATOM   6641  C  CA  . TYR D 1 21  ? -68.197 1.988   39.320  1.00 51.26  ? 21  TYR D CA  1 
ATOM   6642  C  C   . TYR D 1 21  ? -67.293 1.413   40.407  1.00 58.42  ? 21  TYR D C   1 
ATOM   6643  O  O   . TYR D 1 21  ? -66.393 2.102   40.893  1.00 51.19  ? 21  TYR D O   1 
ATOM   6644  C  CB  . TYR D 1 21  ? -67.418 2.081   38.005  1.00 48.28  ? 21  TYR D CB  1 
ATOM   6645  C  CG  . TYR D 1 21  ? -68.274 2.278   36.792  1.00 31.77  ? 21  TYR D CG  1 
ATOM   6646  C  CD1 . TYR D 1 21  ? -69.043 1.248   36.307  1.00 47.71  ? 21  TYR D CD1 1 
ATOM   6647  C  CD2 . TYR D 1 21  ? -68.307 3.486   36.127  1.00 35.15  ? 21  TYR D CD2 1 
ATOM   6648  C  CE1 . TYR D 1 21  ? -69.833 1.409   35.193  1.00 48.86  ? 21  TYR D CE1 1 
ATOM   6649  C  CE2 . TYR D 1 21  ? -69.098 3.667   35.006  1.00 34.82  ? 21  TYR D CE2 1 
ATOM   6650  C  CZ  . TYR D 1 21  ? -69.859 2.623   34.551  1.00 50.80  ? 21  TYR D CZ  1 
ATOM   6651  O  OH  . TYR D 1 21  ? -70.654 2.769   33.446  1.00 68.99  ? 21  TYR D OH  1 
ATOM   6652  N  N   . GLU D 1 22  ? -67.490 0.146   40.752  1.00 66.33  ? 22  GLU D N   1 
ATOM   6653  C  CA  . GLU D 1 22  ? -66.599 -0.530  41.692  1.00 53.02  ? 22  GLU D CA  1 
ATOM   6654  C  C   . GLU D 1 22  ? -65.641 -1.455  40.942  1.00 42.04  ? 22  GLU D C   1 
ATOM   6655  O  O   . GLU D 1 22  ? -66.075 -2.402  40.290  1.00 56.90  ? 22  GLU D O   1 
ATOM   6656  C  CB  . GLU D 1 22  ? -67.406 -1.325  42.720  1.00 53.17  ? 22  GLU D CB  1 
ATOM   6657  C  CG  . GLU D 1 22  ? -66.801 -2.672  43.077  1.00 77.53  ? 22  GLU D CG  1 
ATOM   6658  C  CD  . GLU D 1 22  ? -67.416 -3.275  44.324  1.00 81.47  ? 22  GLU D CD  1 
ATOM   6659  O  OE1 . GLU D 1 22  ? -66.696 -3.416  45.335  1.00 90.12  ? 22  GLU D OE1 1 
ATOM   6660  O  OE2 . GLU D 1 22  ? -68.619 -3.609  44.295  1.00 71.00  ? 22  GLU D OE2 1 
ATOM   6661  N  N   . LEU D 1 23  ? -64.342 -1.177  41.031  1.00 37.89  ? 23  LEU D N   1 
ATOM   6662  C  CA  . LEU D 1 23  ? -63.344 -2.000  40.326  1.00 36.40  ? 23  LEU D CA  1 
ATOM   6663  C  C   . LEU D 1 23  ? -63.413 -3.456  40.839  1.00 43.69  ? 23  LEU D C   1 
ATOM   6664  O  O   . LEU D 1 23  ? -63.335 -3.705  42.038  1.00 43.07  ? 23  LEU D O   1 
ATOM   6665  C  CB  . LEU D 1 23  ? -61.917 -1.438  40.462  1.00 25.78  ? 23  LEU D CB  1 
ATOM   6666  C  CG  . LEU D 1 23  ? -60.795 -2.439  40.146  1.00 41.73  ? 23  LEU D CG  1 
ATOM   6667  C  CD1 . LEU D 1 23  ? -60.919 -2.919  38.736  1.00 44.28  ? 23  LEU D CD1 1 
ATOM   6668  C  CD2 . LEU D 1 23  ? -59.429 -1.872  40.345  1.00 52.04  ? 23  LEU D CD2 1 
ATOM   6669  N  N   . VAL D 1 24  ? -63.576 -4.401  39.916  1.00 45.46  ? 24  VAL D N   1 
ATOM   6670  C  CA  . VAL D 1 24  ? -63.721 -5.812  40.242  1.00 38.63  ? 24  VAL D CA  1 
ATOM   6671  C  C   . VAL D 1 24  ? -62.405 -6.560  40.038  1.00 39.22  ? 24  VAL D C   1 
ATOM   6672  O  O   . VAL D 1 24  ? -61.868 -7.167  40.977  1.00 49.31  ? 24  VAL D O   1 
ATOM   6673  C  CB  . VAL D 1 24  ? -64.839 -6.454  39.424  1.00 39.23  ? 24  VAL D CB  1 
ATOM   6674  C  CG1 . VAL D 1 24  ? -64.827 -7.953  39.577  1.00 46.07  ? 24  VAL D CG1 1 
ATOM   6675  C  CG2 . VAL D 1 24  ? -66.179 -5.896  39.860  1.00 39.45  ? 24  VAL D CG2 1 
ATOM   6676  N  N   . LYS D 1 25  ? -61.879 -6.526  38.822  1.00 38.43  ? 25  LYS D N   1 
ATOM   6677  C  CA  . LYS D 1 25  ? -60.560 -7.069  38.573  1.00 34.73  ? 25  LYS D CA  1 
ATOM   6678  C  C   . LYS D 1 25  ? -60.013 -6.574  37.254  1.00 33.48  ? 25  LYS D C   1 
ATOM   6679  O  O   . LYS D 1 25  ? -60.758 -6.340  36.315  1.00 46.86  ? 25  LYS D O   1 
ATOM   6680  C  CB  . LYS D 1 25  ? -60.592 -8.604  38.548  1.00 42.31  ? 25  LYS D CB  1 
ATOM   6681  C  CG  . LYS D 1 25  ? -59.185 -9.208  38.547  1.00 60.44  ? 25  LYS D CG  1 
ATOM   6682  C  CD  . LYS D 1 25  ? -59.192 -10.728 38.509  1.00 87.25  ? 25  LYS D CD  1 
ATOM   6683  C  CE  . LYS D 1 25  ? -58.648 -11.291 37.192  1.00 93.57  ? 25  LYS D CE  1 
ATOM   6684  N  NZ  . LYS D 1 25  ? -59.248 -12.645 36.874  1.00 96.45  ? 25  LYS D NZ  1 
ATOM   6685  N  N   . ASP D 1 26  ? -58.693 -6.439  37.180  1.00 43.15  ? 26  ASP D N   1 
ATOM   6686  C  CA  . ASP D 1 26  ? -58.031 -6.054  35.941  1.00 45.40  ? 26  ASP D CA  1 
ATOM   6687  C  C   . ASP D 1 26  ? -57.592 -7.295  35.173  1.00 56.94  ? 26  ASP D C   1 
ATOM   6688  O  O   . ASP D 1 26  ? -56.556 -7.888  35.474  1.00 61.66  ? 26  ASP D O   1 
ATOM   6689  C  CB  . ASP D 1 26  ? -56.825 -5.159  36.231  1.00 31.69  ? 26  ASP D CB  1 
ATOM   6690  C  CG  . ASP D 1 26  ? -57.227 -3.752  36.624  1.00 53.88  ? 26  ASP D CG  1 
ATOM   6691  O  OD1 . ASP D 1 26  ? -56.444 -3.085  37.332  1.00 54.32  ? 26  ASP D OD1 1 
ATOM   6692  O  OD2 . ASP D 1 26  ? -58.325 -3.312  36.226  1.00 59.45  ? 26  ASP D OD2 1 
ATOM   6693  N  N   . ILE D 1 27  ? -58.387 -7.687  34.182  1.00 53.76  ? 27  ILE D N   1 
ATOM   6694  C  CA  . ILE D 1 27  ? -58.100 -8.879  33.392  1.00 64.91  ? 27  ILE D CA  1 
ATOM   6695  C  C   . ILE D 1 27  ? -57.017 -8.622  32.349  1.00 76.21  ? 27  ILE D C   1 
ATOM   6696  O  O   . ILE D 1 27  ? -56.552 -7.495  32.188  1.00 83.67  ? 27  ILE D O   1 
ATOM   6697  C  CB  . ILE D 1 27  ? -59.362 -9.403  32.684  1.00 67.53  ? 27  ILE D CB  1 
ATOM   6698  C  CG1 . ILE D 1 27  ? -60.275 -10.117 33.682  1.00 58.32  ? 27  ILE D CG1 1 
ATOM   6699  C  CG2 . ILE D 1 27  ? -58.985 -10.332 31.542  1.00 74.28  ? 27  ILE D CG2 1 
ATOM   6700  C  CD1 . ILE D 1 27  ? -60.022 -9.732  35.121  1.00 57.42  ? 27  ILE D CD1 1 
ATOM   6701  N  N   . GLY D 1 28  ? -56.622 -9.677  31.642  1.00 78.05  ? 28  GLY D N   1 
ATOM   6702  C  CA  . GLY D 1 28  ? -55.593 -9.569  30.624  1.00 81.67  ? 28  GLY D CA  1 
ATOM   6703  C  C   . GLY D 1 28  ? -55.630 -10.702 29.615  1.00 87.19  ? 28  GLY D C   1 
ATOM   6704  O  O   . GLY D 1 28  ? -54.914 -10.674 28.615  1.00 83.04  ? 28  GLY D O   1 
ATOM   6705  N  N   . ALA D 1 29  ? -56.465 -11.702 29.878  1.00 100.79 ? 29  ALA D N   1 
ATOM   6706  C  CA  . ALA D 1 29  ? -56.593 -12.849 28.986  1.00 108.32 ? 29  ALA D CA  1 
ATOM   6707  C  C   . ALA D 1 29  ? -58.055 -13.243 28.804  1.00 120.08 ? 29  ALA D C   1 
ATOM   6708  O  O   . ALA D 1 29  ? -58.906 -12.890 29.620  1.00 121.38 ? 29  ALA D O   1 
ATOM   6709  C  CB  . ALA D 1 29  ? -55.787 -14.024 29.515  1.00 104.97 ? 29  ALA D CB  1 
ATOM   6710  N  N   . GLY D 1 30  ? -58.341 -13.975 27.732  1.00 127.56 ? 30  GLY D N   1 
ATOM   6711  C  CA  . GLY D 1 30  ? -59.699 -14.397 27.450  1.00 135.65 ? 30  GLY D CA  1 
ATOM   6712  C  C   . GLY D 1 30  ? -60.240 -13.773 26.180  1.00 144.61 ? 30  GLY D C   1 
ATOM   6713  O  O   . GLY D 1 30  ? -59.485 -13.230 25.373  1.00 142.54 ? 30  GLY D O   1 
ATOM   6714  N  N   . ASN D 1 31  ? -61.554 -13.850 26.003  1.00 155.74 ? 31  ASN D N   1 
ATOM   6715  C  CA  . ASN D 1 31  ? -62.200 -13.297 24.820  1.00 162.44 ? 31  ASN D CA  1 
ATOM   6716  C  C   . ASN D 1 31  ? -62.564 -11.828 24.995  1.00 162.45 ? 31  ASN D C   1 
ATOM   6717  O  O   . ASN D 1 31  ? -63.579 -11.366 24.475  1.00 164.96 ? 31  ASN D O   1 
ATOM   6718  C  CB  . ASN D 1 31  ? -63.447 -14.108 24.464  1.00 162.50 ? 31  ASN D CB  1 
ATOM   6719  C  CG  . ASN D 1 31  ? -63.855 -15.062 25.568  1.00 155.47 ? 31  ASN D CG  1 
ATOM   6720  O  OD1 . ASN D 1 31  ? -63.958 -16.269 25.354  1.00 150.27 ? 31  ASN D OD1 1 
ATOM   6721  N  ND2 . ASN D 1 31  ? -64.090 -14.523 26.759  1.00 152.40 ? 31  ASN D ND2 1 
ATOM   6722  N  N   . PHE D 1 32  ? -61.732 -11.096 25.730  1.00 154.76 ? 32  PHE D N   1 
ATOM   6723  C  CA  . PHE D 1 32  ? -61.975 -9.678  25.964  1.00 140.07 ? 32  PHE D CA  1 
ATOM   6724  C  C   . PHE D 1 32  ? -60.675 -8.886  25.911  1.00 147.12 ? 32  PHE D C   1 
ATOM   6725  O  O   . PHE D 1 32  ? -60.686 -7.664  25.772  1.00 154.13 ? 32  PHE D O   1 
ATOM   6726  C  CB  . PHE D 1 32  ? -62.666 -9.468  27.312  1.00 118.69 ? 32  PHE D CB  1 
ATOM   6727  C  CG  . PHE D 1 32  ? -64.151 -9.273  27.210  1.00 109.66 ? 32  PHE D CG  1 
ATOM   6728  C  CD1 . PHE D 1 32  ? -64.693 -8.001  27.141  1.00 104.15 ? 32  PHE D CD1 1 
ATOM   6729  C  CD2 . PHE D 1 32  ? -65.006 -10.362 27.182  1.00 112.49 ? 32  PHE D CD2 1 
ATOM   6730  C  CE1 . PHE D 1 32  ? -66.060 -7.819  27.048  1.00 102.43 ? 32  PHE D CE1 1 
ATOM   6731  C  CE2 . PHE D 1 32  ? -66.374 -10.186 27.088  1.00 105.60 ? 32  PHE D CE2 1 
ATOM   6732  C  CZ  . PHE D 1 32  ? -66.901 -8.913  27.021  1.00 99.11  ? 32  PHE D CZ  1 
ATOM   6733  N  N   . GLY D 1 33  ? -59.553 -9.592  26.022  1.00 142.37 ? 33  GLY D N   1 
ATOM   6734  C  CA  . GLY D 1 33  ? -58.250 -8.956  26.004  1.00 136.94 ? 33  GLY D CA  1 
ATOM   6735  C  C   . GLY D 1 33  ? -58.073 -7.997  27.164  1.00 131.47 ? 33  GLY D C   1 
ATOM   6736  O  O   . GLY D 1 33  ? -59.026 -7.690  27.878  1.00 142.00 ? 33  GLY D O   1 
ATOM   6737  N  N   . VAL D 1 34  ? -56.847 -7.522  27.353  1.00 110.86 ? 34  VAL D N   1 
ATOM   6738  C  CA  . VAL D 1 34  ? -56.548 -6.594  28.438  1.00 94.37  ? 34  VAL D CA  1 
ATOM   6739  C  C   . VAL D 1 34  ? -57.707 -5.632  28.670  1.00 80.29  ? 34  VAL D C   1 
ATOM   6740  O  O   . VAL D 1 34  ? -57.889 -4.670  27.925  1.00 85.73  ? 34  VAL D O   1 
ATOM   6741  C  CB  . VAL D 1 34  ? -55.269 -5.786  28.152  1.00 84.96  ? 34  VAL D CB  1 
ATOM   6742  C  CG1 . VAL D 1 34  ? -55.251 -5.317  26.705  1.00 88.55  ? 34  VAL D CG1 1 
ATOM   6743  C  CG2 . VAL D 1 34  ? -55.163 -4.605  29.104  1.00 67.80  ? 34  VAL D CG2 1 
ATOM   6744  N  N   . ALA D 1 35  ? -58.491 -5.900  29.709  1.00 64.47  ? 35  ALA D N   1 
ATOM   6745  C  CA  . ALA D 1 35  ? -59.632 -5.060  30.047  1.00 42.27  ? 35  ALA D CA  1 
ATOM   6746  C  C   . ALA D 1 35  ? -59.729 -4.902  31.550  1.00 37.78  ? 35  ALA D C   1 
ATOM   6747  O  O   . ALA D 1 35  ? -58.877 -5.347  32.284  1.00 55.96  ? 35  ALA D O   1 
ATOM   6748  C  CB  . ALA D 1 35  ? -60.926 -5.633  29.481  1.00 54.02  ? 35  ALA D CB  1 
ATOM   6749  N  N   . ARG D 1 36  ? -60.783 -4.262  32.003  1.00 42.94  ? 36  ARG D N   1 
ATOM   6750  C  CA  . ARG D 1 36  ? -61.010 -4.093  33.421  1.00 44.40  ? 36  ARG D CA  1 
ATOM   6751  C  C   . ARG D 1 36  ? -62.475 -4.413  33.702  1.00 57.00  ? 36  ARG D C   1 
ATOM   6752  O  O   . ARG D 1 36  ? -63.372 -3.839  33.071  1.00 68.22  ? 36  ARG D O   1 
ATOM   6753  C  CB  . ARG D 1 36  ? -60.712 -2.653  33.855  1.00 47.51  ? 36  ARG D CB  1 
ATOM   6754  C  CG  . ARG D 1 36  ? -60.735 -2.492  35.356  1.00 55.74  ? 36  ARG D CG  1 
ATOM   6755  C  CD  . ARG D 1 36  ? -60.894 -1.066  35.837  1.00 45.73  ? 36  ARG D CD  1 
ATOM   6756  N  NE  . ARG D 1 36  ? -59.810 -0.175  35.424  1.00 56.68  ? 36  ARG D NE  1 
ATOM   6757  C  CZ  . ARG D 1 36  ? -58.590 -0.157  35.953  1.00 53.59  ? 36  ARG D CZ  1 
ATOM   6758  N  NH1 . ARG D 1 36  ? -58.260 -1.004  36.910  1.00 71.75  ? 36  ARG D NH1 1 
ATOM   6759  N  NH2 . ARG D 1 36  ? -57.690 0.702   35.517  1.00 54.69  ? 36  ARG D NH2 1 
ATOM   6760  N  N   . LEU D 1 37  ? -62.723 -5.344  34.617  1.00 45.89  ? 37  LEU D N   1 
ATOM   6761  C  CA  . LEU D 1 37  ? -64.091 -5.624  35.018  1.00 35.33  ? 37  LEU D CA  1 
ATOM   6762  C  C   . LEU D 1 37  ? -64.514 -4.619  36.085  1.00 38.41  ? 37  LEU D C   1 
ATOM   6763  O  O   . LEU D 1 37  ? -63.765 -4.352  36.991  1.00 45.17  ? 37  LEU D O   1 
ATOM   6764  C  CB  . LEU D 1 37  ? -64.212 -7.038  35.565  1.00 28.05  ? 37  LEU D CB  1 
ATOM   6765  C  CG  . LEU D 1 37  ? -64.648 -8.161  34.635  1.00 44.98  ? 37  LEU D CG  1 
ATOM   6766  C  CD1 . LEU D 1 37  ? -64.348 -7.800  33.197  1.00 52.70  ? 37  LEU D CD1 1 
ATOM   6767  C  CD2 . LEU D 1 37  ? -63.954 -9.470  35.044  1.00 36.24  ? 37  LEU D CD2 1 
ATOM   6768  N  N   . MET D 1 38  ? -65.716 -4.080  35.984  1.00 33.26  ? 38  MET D N   1 
ATOM   6769  C  CA  . MET D 1 38  ? -66.236 -3.211  37.009  1.00 33.73  ? 38  MET D CA  1 
ATOM   6770  C  C   . MET D 1 38  ? -67.655 -3.605  37.312  1.00 40.56  ? 38  MET D C   1 
ATOM   6771  O  O   . MET D 1 38  ? -68.343 -4.243  36.490  1.00 35.65  ? 38  MET D O   1 
ATOM   6772  C  CB  . MET D 1 38  ? -66.246 -1.766  36.521  1.00 33.99  ? 38  MET D CB  1 
ATOM   6773  C  CG  . MET D 1 38  ? -64.885 -1.127  36.377  1.00 31.60  ? 38  MET D CG  1 
ATOM   6774  S  SD  . MET D 1 38  ? -65.088 0.578   35.857  1.00 74.03  ? 38  MET D SD  1 
ATOM   6775  C  CE  . MET D 1 38  ? -63.367 1.023   35.617  1.00 42.30  ? 38  MET D CE  1 
ATOM   6776  N  N   . ARG D 1 39  ? -68.104 -3.199  38.490  1.00 48.18  ? 39  ARG D N   1 
ATOM   6777  C  CA  . ARG D 1 39  ? -69.502 -3.357  38.843  1.00 54.05  ? 39  ARG D CA  1 
ATOM   6778  C  C   . ARG D 1 39  ? -70.080 -1.967  38.867  1.00 62.23  ? 39  ARG D C   1 
ATOM   6779  O  O   . ARG D 1 39  ? -69.587 -1.088  39.593  1.00 61.75  ? 39  ARG D O   1 
ATOM   6780  C  CB  . ARG D 1 39  ? -69.614 -3.978  40.214  1.00 53.07  ? 39  ARG D CB  1 
ATOM   6781  C  CG  . ARG D 1 39  ? -70.919 -4.569  40.562  1.00 49.99  ? 39  ARG D CG  1 
ATOM   6782  C  CD  . ARG D 1 39  ? -70.738 -4.942  42.019  1.00 68.07  ? 39  ARG D CD  1 
ATOM   6783  N  NE  . ARG D 1 39  ? -71.767 -4.303  42.740  1.00 83.42  ? 39  ARG D NE  1 
ATOM   6784  C  CZ  . ARG D 1 39  ? -71.891 -3.322  43.621  1.00 90.70  ? 39  ARG D CZ  1 
ATOM   6785  N  NH1 . ARG D 1 39  ? -73.162 -3.116  43.868  1.00 93.35  ? 39  ARG D NH1 1 
ATOM   6786  N  NH2 . ARG D 1 39  ? -70.966 -2.617  44.271  1.00 84.18  ? 39  ARG D NH2 1 
ATOM   6787  N  N   . ASP D 1 40  ? -71.098 -1.742  38.054  1.00 49.01  ? 40  ASP D N   1 
ATOM   6788  C  CA  . ASP D 1 40  ? -71.707 -0.436  38.073  1.00 68.03  ? 40  ASP D CA  1 
ATOM   6789  C  C   . ASP D 1 40  ? -72.679 -0.396  39.250  1.00 65.23  ? 40  ASP D C   1 
ATOM   6790  O  O   . ASP D 1 40  ? -73.611 -1.185  39.314  1.00 55.98  ? 40  ASP D O   1 
ATOM   6791  C  CB  . ASP D 1 40  ? -72.317 -0.111  36.705  1.00 73.42  ? 40  ASP D CB  1 
ATOM   6792  C  CG  . ASP D 1 40  ? -73.757 0.244   36.783  1.00 73.53  ? 40  ASP D CG  1 
ATOM   6793  O  OD1 . ASP D 1 40  ? -74.088 1.439   36.662  1.00 66.09  ? 40  ASP D OD1 1 
ATOM   6794  O  OD2 . ASP D 1 40  ? -74.563 -0.685  36.956  1.00 89.19  ? 40  ASP D OD2 1 
ATOM   6795  N  N   . LYS D 1 41  ? -72.417 0.501   40.201  1.00 69.87  ? 41  LYS D N   1 
ATOM   6796  C  CA  . LYS D 1 41  ? -73.091 0.475   41.502  1.00 73.86  ? 41  LYS D CA  1 
ATOM   6797  C  C   . LYS D 1 41  ? -74.617 0.514   41.433  1.00 78.17  ? 41  LYS D C   1 
ATOM   6798  O  O   . LYS D 1 41  ? -75.287 -0.266  42.107  1.00 81.08  ? 41  LYS D O   1 
ATOM   6799  C  CB  . LYS D 1 41  ? -72.565 1.575   42.429  1.00 70.04  ? 41  LYS D CB  1 
ATOM   6800  C  CG  . LYS D 1 41  ? -71.110 1.372   42.907  1.00 69.05  ? 41  LYS D CG  1 
ATOM   6801  C  CD  . LYS D 1 41  ? -70.891 1.901   44.337  1.00 71.11  ? 41  LYS D CD  1 
ATOM   6802  C  CE  . LYS D 1 41  ? -69.612 2.716   44.472  1.00 68.74  ? 41  LYS D CE  1 
ATOM   6803  N  NZ  . LYS D 1 41  ? -68.423 1.934   44.045  1.00 74.07  ? 41  LYS D NZ  1 
ATOM   6804  N  N   . GLN D 1 42  ? -75.168 1.426   40.639  1.00 79.06  ? 42  GLN D N   1 
ATOM   6805  C  CA  . GLN D 1 42  ? -76.603 1.416   40.384  1.00 90.82  ? 42  GLN D CA  1 
ATOM   6806  C  C   . GLN D 1 42  ? -76.872 0.343   39.357  1.00 92.09  ? 42  GLN D C   1 
ATOM   6807  O  O   . GLN D 1 42  ? -76.084 0.165   38.447  1.00 103.60 ? 42  GLN D O   1 
ATOM   6808  C  CB  . GLN D 1 42  ? -77.060 2.749   39.814  1.00 108.35 ? 42  GLN D CB  1 
ATOM   6809  C  CG  . GLN D 1 42  ? -77.066 3.895   40.796  1.00 124.94 ? 42  GLN D CG  1 
ATOM   6810  C  CD  . GLN D 1 42  ? -77.652 5.149   40.185  1.00 138.76 ? 42  GLN D CD  1 
ATOM   6811  O  OE1 . GLN D 1 42  ? -77.916 5.197   38.981  1.00 142.37 ? 42  GLN D OE1 1 
ATOM   6812  N  NE2 . GLN D 1 42  ? -77.865 6.170   41.012  1.00 143.56 ? 42  GLN D NE2 1 
ATOM   6813  N  N   . ALA D 1 43  ? -77.986 -0.360  39.488  1.00 82.39  ? 43  ALA D N   1 
ATOM   6814  C  CA  . ALA D 1 43  ? -78.303 -1.468  38.581  1.00 81.00  ? 43  ALA D CA  1 
ATOM   6815  C  C   . ALA D 1 43  ? -77.444 -2.697  38.873  1.00 68.49  ? 43  ALA D C   1 
ATOM   6816  O  O   . ALA D 1 43  ? -77.643 -3.754  38.292  1.00 60.32  ? 43  ALA D O   1 
ATOM   6817  C  CB  . ALA D 1 43  ? -78.172 -1.049  37.112  1.00 82.62  ? 43  ALA D CB  1 
ATOM   6818  N  N   . ASN D 1 44  ? -76.486 -2.545  39.777  1.00 68.95  ? 44  ASN D N   1 
ATOM   6819  C  CA  . ASN D 1 44  ? -75.678 -3.661  40.236  1.00 74.77  ? 44  ASN D CA  1 
ATOM   6820  C  C   . ASN D 1 44  ? -75.437 -4.725  39.179  1.00 69.24  ? 44  ASN D C   1 
ATOM   6821  O  O   . ASN D 1 44  ? -76.055 -5.789  39.216  1.00 65.61  ? 44  ASN D O   1 
ATOM   6822  C  CB  . ASN D 1 44  ? -76.329 -4.302  41.462  1.00 78.44  ? 44  ASN D CB  1 
ATOM   6823  C  CG  . ASN D 1 44  ? -75.504 -5.446  42.041  1.00 82.15  ? 44  ASN D CG  1 
ATOM   6824  O  OD1 . ASN D 1 44  ? -74.374 -5.708  41.607  1.00 81.75  ? 44  ASN D OD1 1 
ATOM   6825  N  ND2 . ASN D 1 44  ? -76.065 -6.130  43.038  1.00 79.62  ? 44  ASN D ND2 1 
ATOM   6826  N  N   . GLU D 1 45  ? -74.535 -4.450  38.243  1.00 54.76  ? 45  GLU D N   1 
ATOM   6827  C  CA  . GLU D 1 45  ? -74.239 -5.404  37.177  1.00 57.26  ? 45  GLU D CA  1 
ATOM   6828  C  C   . GLU D 1 45  ? -72.793 -5.307  36.697  1.00 55.79  ? 45  GLU D C   1 
ATOM   6829  O  O   . GLU D 1 45  ? -72.211 -4.223  36.671  1.00 55.35  ? 45  GLU D O   1 
ATOM   6830  C  CB  . GLU D 1 45  ? -75.192 -5.200  35.999  1.00 62.31  ? 45  GLU D CB  1 
ATOM   6831  C  CG  . GLU D 1 45  ? -74.598 -4.397  34.854  1.00 90.20  ? 45  GLU D CG  1 
ATOM   6832  C  CD  . GLU D 1 45  ? -75.436 -4.469  33.593  1.00 107.99 ? 45  GLU D CD  1 
ATOM   6833  O  OE1 . GLU D 1 45  ? -74.996 -5.119  32.621  1.00 103.42 ? 45  GLU D OE1 1 
ATOM   6834  O  OE2 . GLU D 1 45  ? -76.535 -3.878  33.573  1.00 118.56 ? 45  GLU D OE2 1 
ATOM   6835  N  N   . LEU D 1 46  ? -72.222 -6.445  36.313  1.00 59.81  ? 46  LEU D N   1 
ATOM   6836  C  CA  . LEU D 1 46  ? -70.873 -6.478  35.799  1.00 54.79  ? 46  LEU D CA  1 
ATOM   6837  C  C   . LEU D 1 46  ? -70.790 -5.799  34.456  1.00 50.18  ? 46  LEU D C   1 
ATOM   6838  O  O   . LEU D 1 46  ? -71.719 -5.851  33.667  1.00 54.25  ? 46  LEU D O   1 
ATOM   6839  C  CB  . LEU D 1 46  ? -70.400 -7.921  35.659  1.00 51.46  ? 46  LEU D CB  1 
ATOM   6840  C  CG  . LEU D 1 46  ? -69.843 -8.520  36.940  1.00 50.87  ? 46  LEU D CG  1 
ATOM   6841  C  CD1 . LEU D 1 46  ? -69.327 -9.932  36.678  1.00 26.56  ? 46  LEU D CD1 1 
ATOM   6842  C  CD2 . LEU D 1 46  ? -68.735 -7.607  37.489  1.00 55.13  ? 46  LEU D CD2 1 
ATOM   6843  N  N   . VAL D 1 47  ? -69.630 -5.225  34.183  1.00 45.28  ? 47  VAL D N   1 
ATOM   6844  C  CA  . VAL D 1 47  ? -69.434 -4.455  32.978  1.00 45.98  ? 47  VAL D CA  1 
ATOM   6845  C  C   . VAL D 1 47  ? -67.962 -4.577  32.632  1.00 43.20  ? 47  VAL D C   1 
ATOM   6846  O  O   . VAL D 1 47  ? -67.132 -4.650  33.539  1.00 42.80  ? 47  VAL D O   1 
ATOM   6847  C  CB  . VAL D 1 47  ? -69.768 -2.995  33.289  1.00 33.89  ? 47  VAL D CB  1 
ATOM   6848  C  CG1 . VAL D 1 47  ? -68.622 -2.158  32.948  1.00 41.52  ? 47  VAL D CG1 1 
ATOM   6849  C  CG2 . VAL D 1 47  ? -71.047 -2.580  32.601  1.00 30.04  ? 47  VAL D CG2 1 
ATOM   6850  N  N   . ALA D 1 48  ? -67.626 -4.627  31.343  1.00 37.99  ? 48  ALA D N   1 
ATOM   6851  C  CA  . ALA D 1 48  ? -66.207 -4.644  30.945  1.00 38.56  ? 48  ALA D CA  1 
ATOM   6852  C  C   . ALA D 1 48  ? -65.797 -3.299  30.363  1.00 44.23  ? 48  ALA D C   1 
ATOM   6853  O  O   . ALA D 1 48  ? -66.567 -2.676  29.633  1.00 48.59  ? 48  ALA D O   1 
ATOM   6854  C  CB  . ALA D 1 48  ? -65.938 -5.703  29.942  1.00 30.98  ? 48  ALA D CB  1 
ATOM   6855  N  N   . VAL D 1 49  ? -64.569 -2.877  30.650  1.00 39.54  ? 49  VAL D N   1 
ATOM   6856  C  CA  . VAL D 1 49  ? -64.090 -1.598  30.161  1.00 43.23  ? 49  VAL D CA  1 
ATOM   6857  C  C   . VAL D 1 49  ? -62.838 -1.791  29.317  1.00 52.86  ? 49  VAL D C   1 
ATOM   6858  O  O   . VAL D 1 49  ? -61.886 -2.456  29.749  1.00 38.55  ? 49  VAL D O   1 
ATOM   6859  C  CB  . VAL D 1 49  ? -63.786 -0.619  31.319  1.00 38.47  ? 49  VAL D CB  1 
ATOM   6860  C  CG1 . VAL D 1 49  ? -63.340 0.695   30.784  1.00 35.29  ? 49  VAL D CG1 1 
ATOM   6861  C  CG2 . VAL D 1 49  ? -64.989 -0.447  32.221  1.00 26.06  ? 49  VAL D CG2 1 
ATOM   6862  N  N   . LYS D 1 50  ? -62.854 -1.191  28.120  1.00 52.20  ? 50  LYS D N   1 
ATOM   6863  C  CA  . LYS D 1 50  ? -61.725 -1.201  27.190  1.00 58.80  ? 50  LYS D CA  1 
ATOM   6864  C  C   . LYS D 1 50  ? -61.127 0.212   27.121  1.00 60.64  ? 50  LYS D C   1 
ATOM   6865  O  O   . LYS D 1 50  ? -61.840 1.211   27.170  1.00 54.42  ? 50  LYS D O   1 
ATOM   6866  C  CB  . LYS D 1 50  ? -62.188 -1.674  25.804  1.00 68.98  ? 50  LYS D CB  1 
ATOM   6867  C  CG  . LYS D 1 50  ? -61.170 -2.509  25.028  1.00 77.11  ? 50  LYS D CG  1 
ATOM   6868  C  CD  . LYS D 1 50  ? -61.078 -3.932  25.551  1.00 72.05  ? 50  LYS D CD  1 
ATOM   6869  C  CE  . LYS D 1 50  ? -59.759 -4.605  25.121  1.00 82.59  ? 50  LYS D CE  1 
ATOM   6870  N  NZ  . LYS D 1 50  ? -59.796 -5.279  23.781  1.00 91.03  ? 50  LYS D NZ  1 
ATOM   6871  N  N   . TYR D 1 51  ? -59.813 0.308   27.031  1.00 60.35  ? 51  TYR D N   1 
ATOM   6872  C  CA  . TYR D 1 51  ? -59.159 1.604   27.117  1.00 51.62  ? 51  TYR D CA  1 
ATOM   6873  C  C   . TYR D 1 51  ? -58.290 1.883   25.889  1.00 56.59  ? 51  TYR D C   1 
ATOM   6874  O  O   . TYR D 1 51  ? -57.408 1.081   25.545  1.00 67.45  ? 51  TYR D O   1 
ATOM   6875  C  CB  . TYR D 1 51  ? -58.264 1.657   28.357  1.00 46.79  ? 51  TYR D CB  1 
ATOM   6876  C  CG  . TYR D 1 51  ? -58.989 1.775   29.685  1.00 51.55  ? 51  TYR D CG  1 
ATOM   6877  C  CD1 . TYR D 1 51  ? -59.427 3.000   30.148  1.00 38.27  ? 51  TYR D CD1 1 
ATOM   6878  C  CD2 . TYR D 1 51  ? -59.196 0.664   30.491  1.00 45.18  ? 51  TYR D CD2 1 
ATOM   6879  C  CE1 . TYR D 1 51  ? -60.079 3.117   31.366  1.00 44.63  ? 51  TYR D CE1 1 
ATOM   6880  C  CE2 . TYR D 1 51  ? -59.840 0.772   31.708  1.00 39.41  ? 51  TYR D CE2 1 
ATOM   6881  C  CZ  . TYR D 1 51  ? -60.288 2.000   32.142  1.00 49.79  ? 51  TYR D CZ  1 
ATOM   6882  O  OH  . TYR D 1 51  ? -60.942 2.123   33.354  1.00 46.90  ? 51  TYR D OH  1 
ATOM   6883  N  N   . ILE D 1 52  ? -58.521 3.017   25.230  1.00 50.49  ? 52  ILE D N   1 
ATOM   6884  C  CA  . ILE D 1 52  ? -57.669 3.425   24.117  1.00 41.40  ? 52  ILE D CA  1 
ATOM   6885  C  C   . ILE D 1 52  ? -56.988 4.731   24.472  1.00 46.21  ? 52  ILE D C   1 
ATOM   6886  O  O   . ILE D 1 52  ? -57.629 5.631   25.033  1.00 50.57  ? 52  ILE D O   1 
ATOM   6887  C  CB  . ILE D 1 52  ? -58.462 3.644   22.839  1.00 42.71  ? 52  ILE D CB  1 
ATOM   6888  C  CG1 . ILE D 1 52  ? -59.289 2.400   22.499  1.00 52.96  ? 52  ILE D CG1 1 
ATOM   6889  C  CG2 . ILE D 1 52  ? -57.508 3.991   21.723  1.00 52.68  ? 52  ILE D CG2 1 
ATOM   6890  C  CD1 . ILE D 1 52  ? -60.194 2.559   21.308  1.00 62.93  ? 52  ILE D CD1 1 
ATOM   6891  N  N   . GLU D 1 53  ? -55.712 4.891   24.136  1.00 53.67  ? 53  GLU D N   1 
ATOM   6892  C  CA  . GLU D 1 53  ? -55.073 6.135   24.569  1.00 69.36  ? 53  GLU D CA  1 
ATOM   6893  C  C   . GLU D 1 53  ? -55.393 7.413   23.757  1.00 65.18  ? 53  GLU D C   1 
ATOM   6894  O  O   . GLU D 1 53  ? -55.490 7.405   22.528  1.00 53.27  ? 53  GLU D O   1 
ATOM   6895  C  CB  . GLU D 1 53  ? -53.574 5.961   24.846  1.00 85.49  ? 53  GLU D CB  1 
ATOM   6896  C  CG  . GLU D 1 53  ? -52.686 7.086   24.313  1.00 114.56 ? 53  GLU D CG  1 
ATOM   6897  C  CD  . GLU D 1 53  ? -51.414 6.524   23.686  1.00 132.33 ? 53  GLU D CD  1 
ATOM   6898  O  OE1 . GLU D 1 53  ? -51.498 6.024   22.533  1.00 142.25 ? 53  GLU D OE1 1 
ATOM   6899  O  OE2 . GLU D 1 53  ? -50.345 6.561   24.351  1.00 130.28 ? 53  GLU D OE2 1 
ATOM   6900  N  N   . ARG D 1 54  ? -55.580 8.486   24.521  1.00 53.56  ? 54  ARG D N   1 
ATOM   6901  C  CA  . ARG D 1 54  ? -55.833 9.848   24.070  1.00 52.92  ? 54  ARG D CA  1 
ATOM   6902  C  C   . ARG D 1 54  ? -55.215 10.308  22.728  1.00 77.17  ? 54  ARG D C   1 
ATOM   6903  O  O   . ARG D 1 54  ? -55.844 11.077  21.994  1.00 73.13  ? 54  ARG D O   1 
ATOM   6904  C  CB  . ARG D 1 54  ? -55.357 10.789  25.168  1.00 60.83  ? 54  ARG D CB  1 
ATOM   6905  C  CG  . ARG D 1 54  ? -56.334 11.863  25.575  1.00 63.82  ? 54  ARG D CG  1 
ATOM   6906  C  CD  . ARG D 1 54  ? -57.415 11.308  26.465  1.00 50.47  ? 54  ARG D CD  1 
ATOM   6907  N  NE  . ARG D 1 54  ? -57.883 12.267  27.463  1.00 45.39  ? 54  ARG D NE  1 
ATOM   6908  C  CZ  . ARG D 1 54  ? -58.098 13.563  27.248  1.00 55.99  ? 54  ARG D CZ  1 
ATOM   6909  N  NH1 . ARG D 1 54  ? -57.882 14.117  26.055  1.00 53.82  ? 54  ARG D NH1 1 
ATOM   6910  N  NH2 . ARG D 1 54  ? -58.531 14.315  28.248  1.00 70.51  ? 54  ARG D NH2 1 
ATOM   6911  N  N   . GLY D 1 55  ? -53.991 9.877   22.421  1.00 85.52  ? 55  GLY D N   1 
ATOM   6912  C  CA  . GLY D 1 55  ? -53.283 10.349  21.231  1.00 92.25  ? 55  GLY D CA  1 
ATOM   6913  C  C   . GLY D 1 55  ? -54.034 10.278  19.901  1.00 82.79  ? 55  GLY D C   1 
ATOM   6914  O  O   . GLY D 1 55  ? -55.258 10.193  19.860  1.00 70.02  ? 55  GLY D O   1 
ATOM   6915  N  N   . GLU D 1 56  ? -53.298 10.303  18.797  1.00 74.35  ? 56  GLU D N   1 
ATOM   6916  C  CA  . GLU D 1 56  ? -53.927 10.213  17.489  1.00 80.26  ? 56  GLU D CA  1 
ATOM   6917  C  C   . GLU D 1 56  ? -54.356 8.789   17.120  1.00 82.44  ? 56  GLU D C   1 
ATOM   6918  O  O   . GLU D 1 56  ? -54.747 8.526   15.982  1.00 87.72  ? 56  GLU D O   1 
ATOM   6919  C  CB  . GLU D 1 56  ? -53.002 10.790  16.421  1.00 104.43 ? 56  GLU D CB  1 
ATOM   6920  C  CG  . GLU D 1 56  ? -51.619 10.160  16.377  1.00 118.99 ? 56  GLU D CG  1 
ATOM   6921  C  CD  . GLU D 1 56  ? -50.711 10.823  15.348  1.00 136.65 ? 56  GLU D CD  1 
ATOM   6922  O  OE1 . GLU D 1 56  ? -49.735 10.175  14.906  1.00 140.58 ? 56  GLU D OE1 1 
ATOM   6923  O  OE2 . GLU D 1 56  ? -50.977 11.993  14.981  1.00 143.28 ? 56  GLU D OE2 1 
ATOM   6924  N  N   . LYS D 1 57  ? -54.282 7.877   18.087  1.00 85.43  ? 57  LYS D N   1 
ATOM   6925  C  CA  . LYS D 1 57  ? -54.737 6.496   17.909  1.00 81.10  ? 57  LYS D CA  1 
ATOM   6926  C  C   . LYS D 1 57  ? -56.249 6.422   18.033  1.00 69.02  ? 57  LYS D C   1 
ATOM   6927  O  O   . LYS D 1 57  ? -56.892 5.494   17.545  1.00 65.39  ? 57  LYS D O   1 
ATOM   6928  C  CB  . LYS D 1 57  ? -54.104 5.573   18.947  1.00 90.37  ? 57  LYS D CB  1 
ATOM   6929  C  CG  . LYS D 1 57  ? -52.641 5.251   18.690  1.00 99.50  ? 57  LYS D CG  1 
ATOM   6930  C  CD  . LYS D 1 57  ? -52.068 4.393   19.807  1.00 98.40  ? 57  LYS D CD  1 
ATOM   6931  C  CE  . LYS D 1 57  ? -52.329 2.920   19.559  1.00 100.92 ? 57  LYS D CE  1 
ATOM   6932  N  NZ  . LYS D 1 57  ? -51.068 2.168   19.306  1.00 106.14 ? 57  LYS D NZ  1 
ATOM   6933  N  N   . ILE D 1 58  ? -56.831 7.424   18.684  1.00 60.92  ? 58  ILE D N   1 
ATOM   6934  C  CA  . ILE D 1 58  ? -58.281 7.556   18.725  1.00 62.86  ? 58  ILE D CA  1 
ATOM   6935  C  C   . ILE D 1 58  ? -58.719 8.141   17.390  1.00 68.44  ? 58  ILE D C   1 
ATOM   6936  O  O   . ILE D 1 58  ? -58.888 9.352   17.257  1.00 63.49  ? 58  ILE D O   1 
ATOM   6937  C  CB  . ILE D 1 58  ? -58.736 8.477   19.867  1.00 59.43  ? 58  ILE D CB  1 
ATOM   6938  C  CG1 . ILE D 1 58  ? -60.086 9.114   19.532  1.00 65.46  ? 58  ILE D CG1 1 
ATOM   6939  C  CG2 . ILE D 1 58  ? -57.690 9.546   20.138  1.00 75.85  ? 58  ILE D CG2 1 
ATOM   6940  C  CD1 . ILE D 1 58  ? -60.176 10.580  19.895  1.00 82.72  ? 58  ILE D CD1 1 
ATOM   6941  N  N   . ASP D 1 59  ? -58.881 7.273   16.397  1.00 70.21  ? 59  ASP D N   1 
ATOM   6942  C  CA  . ASP D 1 59  ? -59.072 7.706   15.032  1.00 63.80  ? 59  ASP D CA  1 
ATOM   6943  C  C   . ASP D 1 59  ? -60.519 7.503   14.600  1.00 77.94  ? 59  ASP D C   1 
ATOM   6944  O  O   . ASP D 1 59  ? -61.436 7.645   15.401  1.00 87.00  ? 59  ASP D O   1 
ATOM   6945  C  CB  . ASP D 1 59  ? -58.129 6.951   14.119  1.00 65.87  ? 59  ASP D CB  1 
ATOM   6946  C  CG  . ASP D 1 59  ? -58.377 5.482   14.162  1.00 82.67  ? 59  ASP D CG  1 
ATOM   6947  O  OD1 . ASP D 1 59  ? -57.402 4.696   14.208  1.00 84.92  ? 59  ASP D OD1 1 
ATOM   6948  O  OD2 . ASP D 1 59  ? -59.569 5.120   14.166  1.00 90.38  ? 59  ASP D OD2 1 
ATOM   6949  N  N   . GLU D 1 60  ? -60.724 7.173   13.332  1.00 83.52  ? 60  GLU D N   1 
ATOM   6950  C  CA  . GLU D 1 60  ? -62.057 7.257   12.742  1.00 97.90  ? 60  GLU D CA  1 
ATOM   6951  C  C   . GLU D 1 60  ? -62.567 5.851   12.628  1.00 86.51  ? 60  GLU D C   1 
ATOM   6952  O  O   . GLU D 1 60  ? -63.773 5.561   12.602  1.00 86.81  ? 60  GLU D O   1 
ATOM   6953  C  CB  . GLU D 1 60  ? -61.939 7.850   11.351  1.00 116.78 ? 60  GLU D CB  1 
ATOM   6954  C  CG  . GLU D 1 60  ? -60.888 7.127   10.509  1.00 127.67 ? 60  GLU D CG  1 
ATOM   6955  C  CD  . GLU D 1 60  ? -61.449 6.627   9.178   1.00 134.66 ? 60  GLU D CD  1 
ATOM   6956  O  OE1 . GLU D 1 60  ? -62.608 6.128   9.139   1.00 133.40 ? 60  GLU D OE1 1 
ATOM   6957  O  OE2 . GLU D 1 60  ? -60.725 6.749   8.163   1.00 136.41 ? 60  GLU D OE2 1 
ATOM   6958  N  N   . ASN D 1 61  ? -61.606 4.931   12.597  1.00 72.46  ? 61  ASN D N   1 
ATOM   6959  C  CA  . ASN D 1 61  ? -61.888 3.509   12.695  1.00 76.04  ? 61  ASN D CA  1 
ATOM   6960  C  C   . ASN D 1 61  ? -62.432 3.206   14.084  1.00 77.52  ? 61  ASN D C   1 
ATOM   6961  O  O   . ASN D 1 61  ? -63.441 2.516   14.230  1.00 68.58  ? 61  ASN D O   1 
ATOM   6962  C  CB  . ASN D 1 61  ? -60.625 2.688   12.437  1.00 86.93  ? 61  ASN D CB  1 
ATOM   6963  C  CG  . ASN D 1 61  ? -60.285 2.590   10.964  1.00 103.10 ? 61  ASN D CG  1 
ATOM   6964  O  OD1 . ASN D 1 61  ? -61.020 1.985   10.184  1.00 111.04 ? 61  ASN D OD1 1 
ATOM   6965  N  ND2 . ASN D 1 61  ? -59.163 3.185   10.575  1.00 106.64 ? 61  ASN D ND2 1 
ATOM   6966  N  N   . VAL D 1 62  ? -61.761 3.735   15.104  1.00 76.42  ? 62  VAL D N   1 
ATOM   6967  C  CA  . VAL D 1 62  ? -62.261 3.636   16.468  1.00 60.78  ? 62  VAL D CA  1 
ATOM   6968  C  C   . VAL D 1 62  ? -63.633 4.275   16.613  1.00 58.28  ? 62  VAL D C   1 
ATOM   6969  O  O   . VAL D 1 62  ? -64.523 3.691   17.223  1.00 58.27  ? 62  VAL D O   1 
ATOM   6970  C  CB  . VAL D 1 62  ? -61.271 4.284   17.457  1.00 63.49  ? 62  VAL D CB  1 
ATOM   6971  C  CG1 . VAL D 1 62  ? -61.962 4.687   18.759  1.00 50.49  ? 62  VAL D CG1 1 
ATOM   6972  C  CG2 . VAL D 1 62  ? -60.100 3.337   17.697  1.00 63.78  ? 62  VAL D CG2 1 
ATOM   6973  N  N   . LYS D 1 63  ? -63.810 5.461   16.036  1.00 53.31  ? 63  LYS D N   1 
ATOM   6974  C  CA  . LYS D 1 63  ? -65.098 6.134   16.081  1.00 52.86  ? 63  LYS D CA  1 
ATOM   6975  C  C   . LYS D 1 63  ? -66.166 5.281   15.405  1.00 59.01  ? 63  LYS D C   1 
ATOM   6976  O  O   . LYS D 1 63  ? -67.285 5.112   15.919  1.00 62.34  ? 63  LYS D O   1 
ATOM   6977  C  CB  . LYS D 1 63  ? -65.011 7.500   15.397  1.00 65.11  ? 63  LYS D CB  1 
ATOM   6978  C  CG  . LYS D 1 63  ? -66.258 8.338   15.539  1.00 82.32  ? 63  LYS D CG  1 
ATOM   6979  C  CD  . LYS D 1 63  ? -66.206 9.561   14.623  1.00 101.21 ? 63  LYS D CD  1 
ATOM   6980  C  CE  . LYS D 1 63  ? -66.616 9.210   13.190  1.00 107.55 ? 63  LYS D CE  1 
ATOM   6981  N  NZ  . LYS D 1 63  ? -66.444 10.358  12.240  1.00 103.53 ? 63  LYS D NZ  1 
ATOM   6982  N  N   . ARG D 1 64  ? -65.823 4.745   14.241  1.00 64.94  ? 64  ARG D N   1 
ATOM   6983  C  CA  . ARG D 1 64  ? -66.773 3.964   13.465  1.00 73.50  ? 64  ARG D CA  1 
ATOM   6984  C  C   . ARG D 1 64  ? -67.236 2.761   14.264  1.00 72.86  ? 64  ARG D C   1 
ATOM   6985  O  O   . ARG D 1 64  ? -68.443 2.533   14.419  1.00 76.89  ? 64  ARG D O   1 
ATOM   6986  C  CB  . ARG D 1 64  ? -66.144 3.514   12.152  1.00 89.68  ? 64  ARG D CB  1 
ATOM   6987  C  CG  . ARG D 1 64  ? -67.124 2.847   11.213  1.00 95.43  ? 64  ARG D CG  1 
ATOM   6988  C  CD  . ARG D 1 64  ? -66.631 1.482   10.815  1.00 103.61 ? 64  ARG D CD  1 
ATOM   6989  N  NE  . ARG D 1 64  ? -65.401 1.556   10.038  1.00 112.83 ? 64  ARG D NE  1 
ATOM   6990  C  CZ  . ARG D 1 64  ? -64.314 0.830   10.282  1.00 123.71 ? 64  ARG D CZ  1 
ATOM   6991  N  NH1 . ARG D 1 64  ? -64.289 -0.035  11.299  1.00 124.03 ? 64  ARG D NH1 1 
ATOM   6992  N  NH2 . ARG D 1 64  ? -63.249 0.973   9.498   1.00 129.65 ? 64  ARG D NH2 1 
ATOM   6993  N  N   . GLU D 1 65  ? -66.273 2.017   14.798  1.00 65.45  ? 65  GLU D N   1 
ATOM   6994  C  CA  . GLU D 1 65  ? -66.556 0.845   15.619  1.00 59.90  ? 65  GLU D CA  1 
ATOM   6995  C  C   . GLU D 1 65  ? -67.449 1.179   16.811  1.00 57.15  ? 65  GLU D C   1 
ATOM   6996  O  O   . GLU D 1 65  ? -68.403 0.456   17.095  1.00 54.61  ? 65  GLU D O   1 
ATOM   6997  C  CB  . GLU D 1 65  ? -65.253 0.202   16.103  1.00 74.70  ? 65  GLU D CB  1 
ATOM   6998  C  CG  . GLU D 1 65  ? -64.813 -1.000  15.283  1.00 92.89  ? 65  GLU D CG  1 
ATOM   6999  C  CD  . GLU D 1 65  ? -63.328 -1.284  15.412  1.00 110.25 ? 65  GLU D CD  1 
ATOM   7000  O  OE1 . GLU D 1 65  ? -62.654 -0.588  16.200  1.00 114.32 ? 65  GLU D OE1 1 
ATOM   7001  O  OE2 . GLU D 1 65  ? -62.836 -2.204  14.725  1.00 112.14 ? 65  GLU D OE2 1 
ATOM   7002  N  N   . ILE D 1 66  ? -67.143 2.269   17.510  1.00 41.84  ? 66  ILE D N   1 
ATOM   7003  C  CA  . ILE D 1 66  ? -67.951 2.658   18.662  1.00 38.13  ? 66  ILE D CA  1 
ATOM   7004  C  C   . ILE D 1 66  ? -69.387 2.938   18.262  1.00 46.28  ? 66  ILE D C   1 
ATOM   7005  O  O   . ILE D 1 66  ? -70.301 2.600   19.009  1.00 56.52  ? 66  ILE D O   1 
ATOM   7006  C  CB  . ILE D 1 66  ? -67.406 3.887   19.391  1.00 32.70  ? 66  ILE D CB  1 
ATOM   7007  C  CG1 . ILE D 1 66  ? -66.125 3.567   20.127  1.00 26.76  ? 66  ILE D CG1 1 
ATOM   7008  C  CG2 . ILE D 1 66  ? -68.409 4.429   20.410  1.00 27.13  ? 66  ILE D CG2 1 
ATOM   7009  C  CD1 . ILE D 1 66  ? -65.600 4.790   20.898  1.00 33.65  ? 66  ILE D CD1 1 
ATOM   7010  N  N   . ILE D 1 67  ? -69.605 3.550   17.100  1.00 46.09  ? 67  ILE D N   1 
ATOM   7011  C  CA  . ILE D 1 67  ? -70.958 3.931   16.720  1.00 40.21  ? 67  ILE D CA  1 
ATOM   7012  C  C   . ILE D 1 67  ? -71.700 2.726   16.267  1.00 40.25  ? 67  ILE D C   1 
ATOM   7013  O  O   . ILE D 1 67  ? -72.851 2.518   16.634  1.00 52.68  ? 67  ILE D O   1 
ATOM   7014  C  CB  . ILE D 1 67  ? -70.993 5.005   15.608  1.00 46.55  ? 67  ILE D CB  1 
ATOM   7015  C  CG1 . ILE D 1 67  ? -71.037 6.392   16.231  1.00 45.24  ? 67  ILE D CG1 1 
ATOM   7016  C  CG2 . ILE D 1 67  ? -72.243 4.842   14.744  1.00 46.24  ? 67  ILE D CG2 1 
ATOM   7017  C  CD1 . ILE D 1 67  ? -69.963 6.620   17.233  1.00 37.01  ? 67  ILE D CD1 1 
ATOM   7018  N  N   . ASN D 1 68  ? -71.025 1.913   15.466  1.00 52.11  ? 68  ASN D N   1 
ATOM   7019  C  CA  . ASN D 1 68  ? -71.588 0.625   15.020  1.00 59.20  ? 68  ASN D CA  1 
ATOM   7020  C  C   . ASN D 1 68  ? -72.073 -0.245  16.162  1.00 48.11  ? 68  ASN D C   1 
ATOM   7021  O  O   . ASN D 1 68  ? -73.176 -0.772  16.132  1.00 63.21  ? 68  ASN D O   1 
ATOM   7022  C  CB  . ASN D 1 68  ? -70.568 -0.178  14.205  1.00 67.24  ? 68  ASN D CB  1 
ATOM   7023  C  CG  . ASN D 1 68  ? -70.605 0.166   12.715  1.00 76.76  ? 68  ASN D CG  1 
ATOM   7024  O  OD1 . ASN D 1 68  ? -71.665 0.405   12.151  1.00 86.88  ? 68  ASN D OD1 1 
ATOM   7025  N  ND2 . ASN D 1 68  ? -69.444 0.193   12.083  1.00 67.63  ? 68  ASN D ND2 1 
ATOM   7026  N  N   . HIS D 1 69  ? -71.222 -0.411  17.169  1.00 47.58  ? 69  HIS D N   1 
ATOM   7027  C  CA  . HIS D 1 69  ? -71.559 -1.230  18.325  1.00 49.53  ? 69  HIS D CA  1 
ATOM   7028  C  C   . HIS D 1 69  ? -72.679 -0.580  19.125  1.00 51.64  ? 69  HIS D C   1 
ATOM   7029  O  O   . HIS D 1 69  ? -73.555 -1.260  19.656  1.00 48.24  ? 69  HIS D O   1 
ATOM   7030  C  CB  . HIS D 1 69  ? -70.330 -1.436  19.211  1.00 51.51  ? 69  HIS D CB  1 
ATOM   7031  C  CG  . HIS D 1 69  ? -70.560 -2.373  20.355  1.00 48.35  ? 69  HIS D CG  1 
ATOM   7032  N  ND1 . HIS D 1 69  ? -69.714 -2.446  21.440  1.00 57.17  ? 69  HIS D ND1 1 
ATOM   7033  C  CD2 . HIS D 1 69  ? -71.543 -3.277  20.582  1.00 42.13  ? 69  HIS D CD2 1 
ATOM   7034  C  CE1 . HIS D 1 69  ? -70.165 -3.354  22.287  1.00 50.71  ? 69  HIS D CE1 1 
ATOM   7035  N  NE2 . HIS D 1 69  ? -71.273 -3.874  21.790  1.00 53.08  ? 69  HIS D NE2 1 
ATOM   7036  N  N   . ARG D 1 70  ? -72.643 0.747   19.202  1.00 58.59  ? 70  ARG D N   1 
ATOM   7037  C  CA  . ARG D 1 70  ? -73.662 1.502   19.914  1.00 54.52  ? 70  ARG D CA  1 
ATOM   7038  C  C   . ARG D 1 70  ? -75.060 1.292   19.342  1.00 47.42  ? 70  ARG D C   1 
ATOM   7039  O  O   . ARG D 1 70  ? -76.049 1.438   20.058  1.00 50.62  ? 70  ARG D O   1 
ATOM   7040  C  CB  . ARG D 1 70  ? -73.318 2.993   19.913  1.00 50.80  ? 70  ARG D CB  1 
ATOM   7041  C  CG  . ARG D 1 70  ? -74.088 3.808   20.938  1.00 44.09  ? 70  ARG D CG  1 
ATOM   7042  C  CD  . ARG D 1 70  ? -74.878 4.923   20.275  1.00 62.03  ? 70  ARG D CD  1 
ATOM   7043  N  NE  . ARG D 1 70  ? -75.504 5.807   21.254  1.00 59.93  ? 70  ARG D NE  1 
ATOM   7044  C  CZ  . ARG D 1 70  ? -76.501 6.640   20.976  1.00 56.15  ? 70  ARG D CZ  1 
ATOM   7045  N  NH1 . ARG D 1 70  ? -76.989 6.706   19.745  1.00 62.71  ? 70  ARG D NH1 1 
ATOM   7046  N  NH2 . ARG D 1 70  ? -77.011 7.407   21.927  1.00 45.25  ? 70  ARG D NH2 1 
ATOM   7047  N  N   . SER D 1 71  ? -75.152 0.955   18.058  1.00 37.27  ? 71  SER D N   1 
ATOM   7048  C  CA  . SER D 1 71  ? -76.464 0.792   17.453  1.00 46.33  ? 71  SER D CA  1 
ATOM   7049  C  C   . SER D 1 71  ? -77.087 -0.574  17.706  1.00 52.32  ? 71  SER D C   1 
ATOM   7050  O  O   . SER D 1 71  ? -78.276 -0.756  17.473  1.00 46.18  ? 71  SER D O   1 
ATOM   7051  C  CB  . SER D 1 71  ? -76.388 1.057   15.950  1.00 47.84  ? 71  SER D CB  1 
ATOM   7052  O  OG  . SER D 1 71  ? -75.702 0.016   15.299  1.00 63.94  ? 71  SER D OG  1 
ATOM   7053  N  N   . LEU D 1 72  ? -76.289 -1.535  18.163  1.00 51.09  ? 72  LEU D N   1 
ATOM   7054  C  CA  . LEU D 1 72  ? -76.788 -2.900  18.386  1.00 44.06  ? 72  LEU D CA  1 
ATOM   7055  C  C   . LEU D 1 72  ? -77.525 -3.021  19.711  1.00 42.95  ? 72  LEU D C   1 
ATOM   7056  O  O   . LEU D 1 72  ? -76.941 -2.858  20.775  1.00 62.16  ? 72  LEU D O   1 
ATOM   7057  C  CB  . LEU D 1 72  ? -75.637 -3.894  18.325  1.00 43.94  ? 72  LEU D CB  1 
ATOM   7058  C  CG  . LEU D 1 72  ? -74.936 -3.889  16.968  1.00 41.93  ? 72  LEU D CG  1 
ATOM   7059  C  CD1 . LEU D 1 72  ? -73.741 -4.831  16.947  1.00 48.75  ? 72  LEU D CD1 1 
ATOM   7060  C  CD2 . LEU D 1 72  ? -75.938 -4.267  15.906  1.00 33.56  ? 72  LEU D CD2 1 
ATOM   7061  N  N   . ARG D 1 73  ? -78.824 -3.289  19.637  1.00 44.93  ? 73  ARG D N   1 
ATOM   7062  C  CA  . ARG D 1 73  ? -79.657 -3.356  20.830  1.00 58.02  ? 73  ARG D CA  1 
ATOM   7063  C  C   . ARG D 1 73  ? -80.448 -4.657  20.899  1.00 65.73  ? 73  ARG D C   1 
ATOM   7064  O  O   . ARG D 1 73  ? -81.676 -4.644  20.963  1.00 90.84  ? 73  ARG D O   1 
ATOM   7065  C  CB  . ARG D 1 73  ? -80.612 -2.162  20.879  1.00 70.75  ? 73  ARG D CB  1 
ATOM   7066  C  CG  . ARG D 1 73  ? -80.608 -1.415  22.201  1.00 88.38  ? 73  ARG D CG  1 
ATOM   7067  C  CD  . ARG D 1 73  ? -79.207 -0.960  22.574  1.00 101.36 ? 73  ARG D CD  1 
ATOM   7068  N  NE  . ARG D 1 73  ? -78.879 -1.278  23.961  1.00 105.02 ? 73  ARG D NE  1 
ATOM   7069  C  CZ  . ARG D 1 73  ? -77.907 -0.690  24.652  1.00 103.21 ? 73  ARG D CZ  1 
ATOM   7070  N  NH1 . ARG D 1 73  ? -77.161 0.248   24.085  1.00 96.23  ? 73  ARG D NH1 1 
ATOM   7071  N  NH2 . ARG D 1 73  ? -77.679 -1.043  25.909  1.00 102.77 ? 73  ARG D NH2 1 
ATOM   7072  N  N   . HIS D 1 74  ? -79.737 -5.779  20.888  1.00 58.81  ? 74  HIS D N   1 
ATOM   7073  C  CA  . HIS D 1 74  ? -80.376 -7.086  20.975  1.00 55.76  ? 74  HIS D CA  1 
ATOM   7074  C  C   . HIS D 1 74  ? -79.944 -7.819  22.239  1.00 48.54  ? 74  HIS D C   1 
ATOM   7075  O  O   . HIS D 1 74  ? -78.761 -7.849  22.580  1.00 43.01  ? 74  HIS D O   1 
ATOM   7076  C  CB  . HIS D 1 74  ? -80.052 -7.927  19.740  1.00 52.01  ? 74  HIS D CB  1 
ATOM   7077  C  CG  . HIS D 1 74  ? -81.026 -9.036  19.492  1.00 45.37  ? 74  HIS D CG  1 
ATOM   7078  N  ND1 . HIS D 1 74  ? -81.018 -10.209 20.216  1.00 33.98  ? 74  HIS D ND1 1 
ATOM   7079  C  CD2 . HIS D 1 74  ? -82.038 -9.152  18.600  1.00 46.61  ? 74  HIS D CD2 1 
ATOM   7080  C  CE1 . HIS D 1 74  ? -81.984 -10.999 19.781  1.00 37.81  ? 74  HIS D CE1 1 
ATOM   7081  N  NE2 . HIS D 1 74  ? -82.617 -10.381 18.801  1.00 43.83  ? 74  HIS D NE2 1 
ATOM   7082  N  N   . PRO D 1 75  ? -80.910 -8.409  22.934  1.00 51.81  ? 75  PRO D N   1 
ATOM   7083  C  CA  . PRO D 1 75  ? -80.630 -9.147  24.170  1.00 55.23  ? 75  PRO D CA  1 
ATOM   7084  C  C   . PRO D 1 75  ? -79.509 -10.162 23.983  1.00 46.99  ? 75  PRO D C   1 
ATOM   7085  O  O   . PRO D 1 75  ? -78.659 -10.308 24.861  1.00 45.85  ? 75  PRO D O   1 
ATOM   7086  C  CB  . PRO D 1 75  ? -81.950 -9.870  24.449  1.00 64.77  ? 75  PRO D CB  1 
ATOM   7087  C  CG  . PRO D 1 75  ? -82.984 -9.034  23.780  1.00 58.90  ? 75  PRO D CG  1 
ATOM   7088  C  CD  . PRO D 1 75  ? -82.329 -8.488  22.550  1.00 50.66  ? 75  PRO D CD  1 
ATOM   7089  N  N   . ASN D 1 76  ? -79.512 -10.852 22.848  1.00 39.40  ? 76  ASN D N   1 
ATOM   7090  C  CA  . ASN D 1 76  ? -78.503 -11.863 22.560  1.00 43.88  ? 76  ASN D CA  1 
ATOM   7091  C  C   . ASN D 1 76  ? -77.242 -11.274 21.938  1.00 37.00  ? 76  ASN D C   1 
ATOM   7092  O  O   . ASN D 1 76  ? -76.491 -11.971 21.258  1.00 37.66  ? 76  ASN D O   1 
ATOM   7093  C  CB  . ASN D 1 76  ? -79.080 -12.950 21.651  1.00 31.12  ? 76  ASN D CB  1 
ATOM   7094  C  CG  . ASN D 1 76  ? -80.251 -13.676 22.282  1.00 45.13  ? 76  ASN D CG  1 
ATOM   7095  O  OD1 . ASN D 1 76  ? -80.088 -14.414 23.253  1.00 44.91  ? 76  ASN D OD1 1 
ATOM   7096  N  ND2 . ASN D 1 76  ? -81.441 -13.470 21.731  1.00 29.12  ? 76  ASN D ND2 1 
ATOM   7097  N  N   . ILE D 1 77  ? -77.014 -9.988  22.179  1.00 39.07  ? 77  ILE D N   1 
ATOM   7098  C  CA  . ILE D 1 77  ? -75.833 -9.309  21.660  1.00 29.41  ? 77  ILE D CA  1 
ATOM   7099  C  C   . ILE D 1 77  ? -75.115 -8.548  22.767  1.00 35.00  ? 77  ILE D C   1 
ATOM   7100  O  O   . ILE D 1 77  ? -75.749 -7.936  23.626  1.00 46.13  ? 77  ILE D O   1 
ATOM   7101  C  CB  . ILE D 1 77  ? -76.194 -8.332  20.527  1.00 44.31  ? 77  ILE D CB  1 
ATOM   7102  C  CG1 . ILE D 1 77  ? -76.755 -9.094  19.325  1.00 42.10  ? 77  ILE D CG1 1 
ATOM   7103  C  CG2 . ILE D 1 77  ? -74.979 -7.514  20.122  1.00 33.84  ? 77  ILE D CG2 1 
ATOM   7104  C  CD1 . ILE D 1 77  ? -76.366 -8.499  17.990  1.00 42.37  ? 77  ILE D CD1 1 
ATOM   7105  N  N   . VAL D 1 78  ? -73.787 -8.575  22.737  1.00 46.83  ? 78  VAL D N   1 
ATOM   7106  C  CA  . VAL D 1 78  ? -72.993 -7.819  23.697  1.00 56.41  ? 78  VAL D CA  1 
ATOM   7107  C  C   . VAL D 1 78  ? -73.229 -6.326  23.497  1.00 51.21  ? 78  VAL D C   1 
ATOM   7108  O  O   . VAL D 1 78  ? -72.526 -5.673  22.726  1.00 45.93  ? 78  VAL D O   1 
ATOM   7109  C  CB  . VAL D 1 78  ? -71.491 -8.123  23.553  1.00 64.93  ? 78  VAL D CB  1 
ATOM   7110  C  CG1 . VAL D 1 78  ? -70.876 -7.253  22.467  1.00 88.87  ? 78  VAL D CG1 1 
ATOM   7111  C  CG2 . VAL D 1 78  ? -70.779 -7.914  24.881  1.00 50.29  ? 78  VAL D CG2 1 
ATOM   7112  N  N   . ARG D 1 79  ? -74.232 -5.795  24.188  1.00 58.65  ? 79  ARG D N   1 
ATOM   7113  C  CA  . ARG D 1 79  ? -74.628 -4.399  24.029  1.00 65.26  ? 79  ARG D CA  1 
ATOM   7114  C  C   . ARG D 1 79  ? -73.559 -3.418  24.501  1.00 53.47  ? 79  ARG D C   1 
ATOM   7115  O  O   . ARG D 1 79  ? -72.743 -3.735  25.367  1.00 50.30  ? 79  ARG D O   1 
ATOM   7116  C  CB  . ARG D 1 79  ? -75.944 -4.132  24.763  1.00 75.56  ? 79  ARG D CB  1 
ATOM   7117  C  CG  . ARG D 1 79  ? -77.172 -4.687  24.060  1.00 85.26  ? 79  ARG D CG  1 
ATOM   7118  C  CD  . ARG D 1 79  ? -78.444 -4.348  24.819  1.00 95.77  ? 79  ARG D CD  1 
ATOM   7119  N  NE  . ARG D 1 79  ? -78.695 -5.283  25.911  1.00 104.69 ? 79  ARG D NE  1 
ATOM   7120  C  CZ  . ARG D 1 79  ? -79.861 -5.883  26.128  1.00 99.35  ? 79  ARG D CZ  1 
ATOM   7121  N  NH1 . ARG D 1 79  ? -80.889 -5.647  25.326  1.00 98.08  ? 79  ARG D NH1 1 
ATOM   7122  N  NH2 . ARG D 1 79  ? -79.998 -6.720  27.148  1.00 92.16  ? 79  ARG D NH2 1 
ATOM   7123  N  N   . PHE D 1 80  ? -73.579 -2.220  23.924  1.00 56.39  ? 80  PHE D N   1 
ATOM   7124  C  CA  . PHE D 1 80  ? -72.655 -1.158  24.300  1.00 46.86  ? 80  PHE D CA  1 
ATOM   7125  C  C   . PHE D 1 80  ? -73.264 -0.311  25.411  1.00 45.74  ? 80  PHE D C   1 
ATOM   7126  O  O   . PHE D 1 80  ? -74.472 -0.081  25.435  1.00 42.05  ? 80  PHE D O   1 
ATOM   7127  C  CB  . PHE D 1 80  ? -72.324 -0.286  23.087  1.00 47.69  ? 80  PHE D CB  1 
ATOM   7128  C  CG  . PHE D 1 80  ? -71.829 1.087   23.442  1.00 49.07  ? 80  PHE D CG  1 
ATOM   7129  C  CD1 . PHE D 1 80  ? -72.720 2.105   23.736  1.00 46.36  ? 80  PHE D CD1 1 
ATOM   7130  C  CD2 . PHE D 1 80  ? -70.472 1.360   23.478  1.00 41.57  ? 80  PHE D CD2 1 
ATOM   7131  C  CE1 . PHE D 1 80  ? -72.268 3.369   24.061  1.00 31.29  ? 80  PHE D CE1 1 
ATOM   7132  C  CE2 . PHE D 1 80  ? -70.013 2.622   23.802  1.00 42.94  ? 80  PHE D CE2 1 
ATOM   7133  C  CZ  . PHE D 1 80  ? -70.912 3.628   24.094  1.00 49.12  ? 80  PHE D CZ  1 
ATOM   7134  N  N   . LYS D 1 81  ? -72.425 0.147   26.334  1.00 48.64  ? 81  LYS D N   1 
ATOM   7135  C  CA  . LYS D 1 81  ? -72.905 0.903   27.486  1.00 53.65  ? 81  LYS D CA  1 
ATOM   7136  C  C   . LYS D 1 81  ? -72.749 2.412   27.317  1.00 57.97  ? 81  LYS D C   1 
ATOM   7137  O  O   . LYS D 1 81  ? -73.737 3.136   27.200  1.00 58.79  ? 81  LYS D O   1 
ATOM   7138  C  CB  . LYS D 1 81  ? -72.195 0.443   28.761  1.00 69.13  ? 81  LYS D CB  1 
ATOM   7139  C  CG  . LYS D 1 81  ? -73.139 0.018   29.874  1.00 71.75  ? 81  LYS D CG  1 
ATOM   7140  C  CD  . LYS D 1 81  ? -73.519 -1.448  29.745  1.00 78.24  ? 81  LYS D CD  1 
ATOM   7141  C  CE  . LYS D 1 81  ? -74.997 -1.609  29.434  1.00 83.46  ? 81  LYS D CE  1 
ATOM   7142  N  NZ  . LYS D 1 81  ? -75.821 -1.684  30.672  1.00 82.51  ? 81  LYS D NZ  1 
ATOM   7143  N  N   . GLU D 1 82  ? -71.507 2.883   27.315  1.00 50.77  ? 82  GLU D N   1 
ATOM   7144  C  CA  . GLU D 1 82  ? -71.243 4.315   27.251  1.00 47.13  ? 82  GLU D CA  1 
ATOM   7145  C  C   . GLU D 1 82  ? -69.748 4.610   27.248  1.00 51.90  ? 82  GLU D C   1 
ATOM   7146  O  O   . GLU D 1 82  ? -68.946 3.803   27.716  1.00 48.81  ? 82  GLU D O   1 
ATOM   7147  C  CB  . GLU D 1 82  ? -71.909 5.032   28.427  1.00 62.94  ? 82  GLU D CB  1 
ATOM   7148  C  CG  . GLU D 1 82  ? -70.930 5.715   29.369  1.00 70.93  ? 82  GLU D CG  1 
ATOM   7149  C  CD  . GLU D 1 82  ? -71.200 5.394   30.825  1.00 69.12  ? 82  GLU D CD  1 
ATOM   7150  O  OE1 . GLU D 1 82  ? -72.185 4.680   31.106  1.00 72.10  ? 82  GLU D OE1 1 
ATOM   7151  O  OE2 . GLU D 1 82  ? -70.428 5.857   31.688  1.00 60.63  ? 82  GLU D OE2 1 
ATOM   7152  N  N   . VAL D 1 83  ? -69.379 5.774   26.720  1.00 57.15  ? 83  VAL D N   1 
ATOM   7153  C  CA  . VAL D 1 83  ? -67.963 6.199   26.699  1.00 53.63  ? 83  VAL D CA  1 
ATOM   7154  C  C   . VAL D 1 83  ? -67.670 7.206   27.796  1.00 43.37  ? 83  VAL D C   1 
ATOM   7155  O  O   . VAL D 1 83  ? -68.485 8.066   28.115  1.00 56.04  ? 83  VAL D O   1 
ATOM   7156  C  CB  . VAL D 1 83  ? -67.488 6.817   25.358  1.00 57.88  ? 83  VAL D CB  1 
ATOM   7157  C  CG1 . VAL D 1 83  ? -66.981 5.732   24.390  1.00 54.85  ? 83  VAL D CG1 1 
ATOM   7158  C  CG2 . VAL D 1 83  ? -68.584 7.647   24.733  1.00 51.38  ? 83  VAL D CG2 1 
ATOM   7159  N  N   . ILE D 1 84  ? -66.489 7.089   28.373  1.00 44.12  ? 84  ILE D N   1 
ATOM   7160  C  CA  . ILE D 1 84  ? -66.076 7.945   29.448  1.00 42.36  ? 84  ILE D CA  1 
ATOM   7161  C  C   . ILE D 1 84  ? -64.681 8.412   29.087  1.00 50.28  ? 84  ILE D C   1 
ATOM   7162  O  O   . ILE D 1 84  ? -63.860 7.637   28.603  1.00 46.80  ? 84  ILE D O   1 
ATOM   7163  C  CB  . ILE D 1 84  ? -65.963 7.183   30.768  1.00 55.04  ? 84  ILE D CB  1 
ATOM   7164  C  CG1 . ILE D 1 84  ? -67.229 6.396   31.063  1.00 65.01  ? 84  ILE D CG1 1 
ATOM   7165  C  CG2 . ILE D 1 84  ? -65.709 8.137   31.908  1.00 38.30  ? 84  ILE D CG2 1 
ATOM   7166  C  CD1 . ILE D 1 84  ? -67.247 5.836   32.466  1.00 58.22  ? 84  ILE D CD1 1 
ATOM   7167  N  N   . LEU D 1 85  ? -64.398 9.682   29.310  1.00 53.73  ? 85  LEU D N   1 
ATOM   7168  C  CA  . LEU D 1 85  ? -63.063 10.147  29.008  1.00 57.30  ? 85  LEU D CA  1 
ATOM   7169  C  C   . LEU D 1 85  ? -62.315 10.398  30.311  1.00 65.16  ? 85  LEU D C   1 
ATOM   7170  O  O   . LEU D 1 85  ? -62.865 10.977  31.265  1.00 59.76  ? 85  LEU D O   1 
ATOM   7171  C  CB  . LEU D 1 85  ? -63.103 11.330  28.021  1.00 61.93  ? 85  LEU D CB  1 
ATOM   7172  C  CG  . LEU D 1 85  ? -62.728 12.799  28.195  1.00 71.04  ? 85  LEU D CG  1 
ATOM   7173  C  CD1 . LEU D 1 85  ? -62.952 13.292  29.594  1.00 87.04  ? 85  LEU D CD1 1 
ATOM   7174  C  CD2 . LEU D 1 85  ? -61.302 13.008  27.765  1.00 65.89  ? 85  LEU D CD2 1 
ATOM   7175  N  N   . THR D 1 86  ? -61.060 9.964   30.349  1.00 59.78  ? 86  THR D N   1 
ATOM   7176  C  CA  . THR D 1 86  ? -60.210 10.153  31.517  1.00 70.47  ? 86  THR D CA  1 
ATOM   7177  C  C   . THR D 1 86  ? -58.830 10.645  31.098  1.00 79.63  ? 86  THR D C   1 
ATOM   7178  O  O   . THR D 1 86  ? -58.171 10.031  30.259  1.00 90.40  ? 86  THR D O   1 
ATOM   7179  C  CB  . THR D 1 86  ? -60.053 8.848   32.317  1.00 72.53  ? 86  THR D CB  1 
ATOM   7180  O  OG1 . THR D 1 86  ? -58.834 8.197   31.938  1.00 63.58  ? 86  THR D OG1 1 
ATOM   7181  C  CG2 . THR D 1 86  ? -61.224 7.916   32.051  1.00 79.40  ? 86  THR D CG2 1 
ATOM   7182  N  N   . PRO D 1 87  ? -58.399 11.755  31.687  1.00 74.42  ? 87  PRO D N   1 
ATOM   7183  C  CA  . PRO D 1 87  ? -57.092 12.342  31.373  1.00 61.97  ? 87  PRO D CA  1 
ATOM   7184  C  C   . PRO D 1 87  ? -56.262 11.450  30.455  1.00 66.43  ? 87  PRO D C   1 
ATOM   7185  O  O   . PRO D 1 87  ? -55.892 11.868  29.360  1.00 69.75  ? 87  PRO D O   1 
ATOM   7186  C  CB  . PRO D 1 87  ? -56.422 12.447  32.745  1.00 63.35  ? 87  PRO D CB  1 
ATOM   7187  C  CG  . PRO D 1 87  ? -57.552 12.547  33.705  1.00 71.97  ? 87  PRO D CG  1 
ATOM   7188  C  CD  . PRO D 1 87  ? -58.643 11.691  33.138  1.00 77.73  ? 87  PRO D CD  1 
ATOM   7189  N  N   . THR D 1 88  ? -55.974 10.234  30.907  1.00 81.77  ? 88  THR D N   1 
ATOM   7190  C  CA  . THR D 1 88  ? -55.152 9.305   30.140  1.00 80.57  ? 88  THR D CA  1 
ATOM   7191  C  C   . THR D 1 88  ? -55.579 8.821   28.756  1.00 70.92  ? 88  THR D C   1 
ATOM   7192  O  O   . THR D 1 88  ? -54.869 9.028   27.773  1.00 65.65  ? 88  THR D O   1 
ATOM   7193  C  CB  . THR D 1 88  ? -54.966 7.969   30.884  1.00 82.61  ? 88  THR D CB  1 
ATOM   7194  O  OG1 . THR D 1 88  ? -54.588 8.224   32.242  1.00 84.89  ? 88  THR D OG1 1 
ATOM   7195  C  CG2 . THR D 1 88  ? -53.890 7.132   30.213  1.00 71.66  ? 88  THR D CG2 1 
ATOM   7196  N  N   . HIS D 1 89  ? -56.737 8.173   28.686  1.00 71.11  ? 89  HIS D N   1 
ATOM   7197  C  CA  . HIS D 1 89  ? -57.320 7.782   27.407  1.00 70.63  ? 89  HIS D CA  1 
ATOM   7198  C  C   . HIS D 1 89  ? -58.842 7.692   27.457  1.00 59.48  ? 89  HIS D C   1 
ATOM   7199  O  O   . HIS D 1 89  ? -59.471 8.138   28.416  1.00 51.89  ? 89  HIS D O   1 
ATOM   7200  C  CB  . HIS D 1 89  ? -56.737 6.444   26.948  1.00 78.86  ? 89  HIS D CB  1 
ATOM   7201  C  CG  . HIS D 1 89  ? -55.880 5.774   27.978  1.00 69.67  ? 89  HIS D CG  1 
ATOM   7202  N  ND1 . HIS D 1 89  ? -54.983 4.776   27.664  1.00 59.86  ? 89  HIS D ND1 1 
ATOM   7203  C  CD2 . HIS D 1 89  ? -55.783 5.961   29.315  1.00 59.66  ? 89  HIS D CD2 1 
ATOM   7204  C  CE1 . HIS D 1 89  ? -54.370 4.377   28.764  1.00 55.75  ? 89  HIS D CE1 1 
ATOM   7205  N  NE2 . HIS D 1 89  ? -54.837 5.082   29.780  1.00 61.16  ? 89  HIS D NE2 1 
ATOM   7206  N  N   . LEU D 1 90  ? -59.423 7.110   26.413  1.00 57.96  ? 90  LEU D N   1 
ATOM   7207  C  CA  . LEU D 1 90  ? -60.869 6.954   26.317  1.00 52.71  ? 90  LEU D CA  1 
ATOM   7208  C  C   . LEU D 1 90  ? -61.304 5.586   26.831  1.00 52.04  ? 90  LEU D C   1 
ATOM   7209  O  O   . LEU D 1 90  ? -60.689 4.569   26.512  1.00 52.10  ? 90  LEU D O   1 
ATOM   7210  C  CB  . LEU D 1 90  ? -61.330 7.146   24.871  1.00 37.09  ? 90  LEU D CB  1 
ATOM   7211  C  CG  . LEU D 1 90  ? -62.793 6.823   24.566  1.00 37.84  ? 90  LEU D CG  1 
ATOM   7212  C  CD1 . LEU D 1 90  ? -63.686 8.003   24.909  1.00 45.12  ? 90  LEU D CD1 1 
ATOM   7213  C  CD2 . LEU D 1 90  ? -62.959 6.428   23.108  1.00 31.91  ? 90  LEU D CD2 1 
ATOM   7214  N  N   . ALA D 1 91  ? -62.367 5.569   27.627  1.00 38.76  ? 91  ALA D N   1 
ATOM   7215  C  CA  . ALA D 1 91  ? -62.863 4.339   28.212  1.00 38.15  ? 91  ALA D CA  1 
ATOM   7216  C  C   . ALA D 1 91  ? -64.114 3.897   27.479  1.00 46.73  ? 91  ALA D C   1 
ATOM   7217  O  O   . ALA D 1 91  ? -65.074 4.649   27.411  1.00 51.86  ? 91  ALA D O   1 
ATOM   7218  C  CB  . ALA D 1 91  ? -63.186 4.558   29.676  1.00 39.96  ? 91  ALA D CB  1 
ATOM   7219  N  N   . ILE D 1 92  ? -64.120 2.678   26.945  1.00 50.90  ? 92  ILE D N   1 
ATOM   7220  C  CA  . ILE D 1 92  ? -65.318 2.138   26.303  1.00 45.71  ? 92  ILE D CA  1 
ATOM   7221  C  C   . ILE D 1 92  ? -65.966 1.062   27.189  1.00 46.03  ? 92  ILE D C   1 
ATOM   7222  O  O   . ILE D 1 92  ? -65.374 0.020   27.448  1.00 45.55  ? 92  ILE D O   1 
ATOM   7223  C  CB  . ILE D 1 92  ? -64.974 1.549   24.935  1.00 47.48  ? 92  ILE D CB  1 
ATOM   7224  C  CG1 . ILE D 1 92  ? -64.229 2.591   24.100  1.00 43.69  ? 92  ILE D CG1 1 
ATOM   7225  C  CG2 . ILE D 1 92  ? -66.226 1.048   24.215  1.00 38.89  ? 92  ILE D CG2 1 
ATOM   7226  C  CD1 . ILE D 1 92  ? -63.502 1.980   22.912  1.00 53.73  ? 92  ILE D CD1 1 
ATOM   7227  N  N   . VAL D 1 93  ? -67.175 1.324   27.666  1.00 38.88  ? 93  VAL D N   1 
ATOM   7228  C  CA  . VAL D 1 93  ? -67.823 0.464   28.639  1.00 43.00  ? 93  VAL D CA  1 
ATOM   7229  C  C   . VAL D 1 93  ? -68.921 -0.363  27.955  1.00 46.77  ? 93  VAL D C   1 
ATOM   7230  O  O   . VAL D 1 93  ? -69.757 0.189   27.229  1.00 41.81  ? 93  VAL D O   1 
ATOM   7231  C  CB  . VAL D 1 93  ? -68.437 1.305   29.765  1.00 40.72  ? 93  VAL D CB  1 
ATOM   7232  C  CG1 . VAL D 1 93  ? -69.145 0.407   30.804  1.00 40.86  ? 93  VAL D CG1 1 
ATOM   7233  C  CG2 . VAL D 1 93  ? -67.379 2.175   30.410  1.00 28.62  ? 93  VAL D CG2 1 
ATOM   7234  N  N   . MET D 1 94  ? -68.924 -1.678  28.185  1.00 36.97  ? 94  MET D N   1 
ATOM   7235  C  CA  . MET D 1 94  ? -69.924 -2.539  27.558  1.00 48.37  ? 94  MET D CA  1 
ATOM   7236  C  C   . MET D 1 94  ? -70.377 -3.671  28.462  1.00 40.25  ? 94  MET D C   1 
ATOM   7237  O  O   . MET D 1 94  ? -69.778 -3.902  29.500  1.00 51.92  ? 94  MET D O   1 
ATOM   7238  C  CB  . MET D 1 94  ? -69.394 -3.100  26.249  1.00 44.23  ? 94  MET D CB  1 
ATOM   7239  C  CG  . MET D 1 94  ? -68.244 -3.994  26.429  1.00 48.83  ? 94  MET D CG  1 
ATOM   7240  S  SD  . MET D 1 94  ? -67.340 -4.126  24.874  1.00 74.94  ? 94  MET D SD  1 
ATOM   7241  C  CE  . MET D 1 94  ? -66.186 -2.773  25.036  1.00 52.82  ? 94  MET D CE  1 
ATOM   7242  N  N   . GLU D 1 95  ? -71.435 -4.365  28.074  1.00 40.37  ? 95  GLU D N   1 
ATOM   7243  C  CA  . GLU D 1 95  ? -71.912 -5.485  28.869  1.00 46.78  ? 95  GLU D CA  1 
ATOM   7244  C  C   . GLU D 1 95  ? -70.802 -6.500  29.002  1.00 33.59  ? 95  GLU D C   1 
ATOM   7245  O  O   . GLU D 1 95  ? -69.940 -6.595  28.139  1.00 34.51  ? 95  GLU D O   1 
ATOM   7246  C  CB  . GLU D 1 95  ? -73.075 -6.166  28.199  1.00 45.26  ? 95  GLU D CB  1 
ATOM   7247  C  CG  . GLU D 1 95  ? -74.436 -5.532  28.418  1.00 70.70  ? 95  GLU D CG  1 
ATOM   7248  C  CD  . GLU D 1 95  ? -75.555 -6.367  27.781  1.00 90.34  ? 95  GLU D CD  1 
ATOM   7249  O  OE1 . GLU D 1 95  ? -75.292 -7.055  26.763  1.00 78.89  ? 95  GLU D OE1 1 
ATOM   7250  O  OE2 . GLU D 1 95  ? -76.689 -6.342  28.310  1.00 109.72 ? 95  GLU D OE2 1 
ATOM   7251  N  N   . TYR D 1 96  ? -70.795 -7.230  30.111  1.00 42.27  ? 96  TYR D N   1 
ATOM   7252  C  CA  . TYR D 1 96  ? -69.836 -8.311  30.278  1.00 38.34  ? 96  TYR D CA  1 
ATOM   7253  C  C   . TYR D 1 96  ? -70.620 -9.603  30.362  1.00 41.57  ? 96  TYR D C   1 
ATOM   7254  O  O   . TYR D 1 96  ? -71.561 -9.695  31.162  1.00 44.45  ? 96  TYR D O   1 
ATOM   7255  C  CB  . TYR D 1 96  ? -69.027 -8.113  31.542  1.00 45.49  ? 96  TYR D CB  1 
ATOM   7256  C  CG  . TYR D 1 96  ? -68.077 -9.235  31.820  1.00 43.77  ? 96  TYR D CG  1 
ATOM   7257  C  CD1 . TYR D 1 96  ? -67.102 -9.578  30.896  1.00 45.00  ? 96  TYR D CD1 1 
ATOM   7258  C  CD2 . TYR D 1 96  ? -68.135 -9.945  33.020  1.00 45.41  ? 96  TYR D CD2 1 
ATOM   7259  C  CE1 . TYR D 1 96  ? -66.205 -10.617 31.140  1.00 45.42  ? 96  TYR D CE1 1 
ATOM   7260  C  CE2 . TYR D 1 96  ? -67.241 -10.983 33.286  1.00 35.83  ? 96  TYR D CE2 1 
ATOM   7261  C  CZ  . TYR D 1 96  ? -66.279 -11.319 32.328  1.00 42.44  ? 96  TYR D CZ  1 
ATOM   7262  O  OH  . TYR D 1 96  ? -65.375 -12.346 32.533  1.00 43.68  ? 96  TYR D OH  1 
ATOM   7263  N  N   . ALA D 1 97  ? -70.293 -10.567 29.496  1.00 49.30  ? 97  ALA D N   1 
ATOM   7264  C  CA  . ALA D 1 97  ? -70.917 -11.891 29.569  1.00 37.38  ? 97  ALA D CA  1 
ATOM   7265  C  C   . ALA D 1 97  ? -70.064 -12.732 30.497  1.00 44.46  ? 97  ALA D C   1 
ATOM   7266  O  O   . ALA D 1 97  ? -68.938 -13.109 30.156  1.00 54.12  ? 97  ALA D O   1 
ATOM   7267  C  CB  . ALA D 1 97  ? -71.003 -12.527 28.206  1.00 28.13  ? 97  ALA D CB  1 
ATOM   7268  N  N   . SER D 1 98  ? -70.572 -13.014 31.689  1.00 43.95  ? 98  SER D N   1 
ATOM   7269  C  CA  . SER D 1 98  ? -69.688 -13.529 32.724  1.00 43.10  ? 98  SER D CA  1 
ATOM   7270  C  C   . SER D 1 98  ? -69.825 -15.001 32.896  1.00 33.56  ? 98  SER D C   1 
ATOM   7271  O  O   . SER D 1 98  ? -69.349 -15.523 33.884  1.00 36.63  ? 98  SER D O   1 
ATOM   7272  C  CB  . SER D 1 98  ? -69.880 -12.813 34.073  1.00 46.90  ? 98  SER D CB  1 
ATOM   7273  O  OG  . SER D 1 98  ? -71.218 -12.875 34.543  1.00 49.64  ? 98  SER D OG  1 
ATOM   7274  N  N   . GLY D 1 99  ? -70.434 -15.674 31.920  1.00 30.82  ? 99  GLY D N   1 
ATOM   7275  C  CA  . GLY D 1 99  ? -70.680 -17.097 32.039  1.00 23.94  ? 99  GLY D CA  1 
ATOM   7276  C  C   . GLY D 1 99  ? -69.751 -17.977 31.214  1.00 34.55  ? 99  GLY D C   1 
ATOM   7277  O  O   . GLY D 1 99  ? -69.957 -19.209 31.097  1.00 33.87  ? 99  GLY D O   1 
ATOM   7278  N  N   . GLY D 1 100 ? -68.717 -17.375 30.638  1.00 36.05  ? 100 GLY D N   1 
ATOM   7279  C  CA  . GLY D 1 100 ? -67.854 -18.137 29.745  1.00 36.76  ? 100 GLY D CA  1 
ATOM   7280  C  C   . GLY D 1 100 ? -68.486 -18.507 28.401  1.00 34.15  ? 100 GLY D C   1 
ATOM   7281  O  O   . GLY D 1 100 ? -69.632 -18.160 28.087  1.00 38.81  ? 100 GLY D O   1 
ATOM   7282  N  N   . GLU D 1 101 ? -67.750 -19.227 27.573  1.00 31.48  ? 101 GLU D N   1 
ATOM   7283  C  CA  . GLU D 1 101 ? -68.254 -19.425 26.246  1.00 36.39  ? 101 GLU D CA  1 
ATOM   7284  C  C   . GLU D 1 101 ? -69.163 -20.668 26.090  1.00 40.32  ? 101 GLU D C   1 
ATOM   7285  O  O   . GLU D 1 101 ? -68.871 -21.712 26.633  1.00 55.41  ? 101 GLU D O   1 
ATOM   7286  C  CB  . GLU D 1 101 ? -67.093 -19.407 25.278  1.00 39.11  ? 101 GLU D CB  1 
ATOM   7287  C  CG  . GLU D 1 101 ? -65.833 -19.880 25.835  1.00 47.80  ? 101 GLU D CG  1 
ATOM   7288  C  CD  . GLU D 1 101 ? -64.793 -20.026 24.740  1.00 62.52  ? 101 GLU D CD  1 
ATOM   7289  O  OE1 . GLU D 1 101 ? -63.746 -19.325 24.791  1.00 66.09  ? 101 GLU D OE1 1 
ATOM   7290  O  OE2 . GLU D 1 101 ? -65.053 -20.839 23.820  1.00 70.53  ? 101 GLU D OE2 1 
ATOM   7291  N  N   . LEU D 1 102 ? -70.278 -20.507 25.382  1.00 36.52  ? 102 LEU D N   1 
ATOM   7292  C  CA  . LEU D 1 102 ? -71.229 -21.571 25.066  1.00 32.95  ? 102 LEU D CA  1 
ATOM   7293  C  C   . LEU D 1 102 ? -70.554 -22.888 24.898  1.00 35.87  ? 102 LEU D C   1 
ATOM   7294  O  O   . LEU D 1 102 ? -71.044 -23.918 25.332  1.00 47.49  ? 102 LEU D O   1 
ATOM   7295  C  CB  . LEU D 1 102 ? -71.928 -21.276 23.749  1.00 22.45  ? 102 LEU D CB  1 
ATOM   7296  C  CG  . LEU D 1 102 ? -72.911 -22.303 23.202  1.00 25.45  ? 102 LEU D CG  1 
ATOM   7297  C  CD1 . LEU D 1 102 ? -74.021 -22.574 24.168  1.00 32.28  ? 102 LEU D CD1 1 
ATOM   7298  C  CD2 . LEU D 1 102 ? -73.500 -21.769 21.879  1.00 27.02  ? 102 LEU D CD2 1 
ATOM   7299  N  N   . PHE D 1 103 ? -69.422 -22.859 24.231  1.00 40.88  ? 103 PHE D N   1 
ATOM   7300  C  CA  . PHE D 1 103 ? -68.754 -24.087 23.908  1.00 40.96  ? 103 PHE D CA  1 
ATOM   7301  C  C   . PHE D 1 103 ? -68.314 -24.821 25.204  1.00 45.61  ? 103 PHE D C   1 
ATOM   7302  O  O   . PHE D 1 103 ? -68.317 -26.047 25.277  1.00 46.81  ? 103 PHE D O   1 
ATOM   7303  C  CB  . PHE D 1 103 ? -67.601 -23.802 22.945  1.00 30.85  ? 103 PHE D CB  1 
ATOM   7304  C  CG  . PHE D 1 103 ? -66.728 -24.994 22.659  1.00 50.18  ? 103 PHE D CG  1 
ATOM   7305  C  CD1 . PHE D 1 103 ? -65.482 -25.132 23.264  1.00 49.45  ? 103 PHE D CD1 1 
ATOM   7306  C  CD2 . PHE D 1 103 ? -67.155 -25.989 21.781  1.00 58.24  ? 103 PHE D CD2 1 
ATOM   7307  C  CE1 . PHE D 1 103 ? -64.681 -26.241 22.980  1.00 61.24  ? 103 PHE D CE1 1 
ATOM   7308  C  CE2 . PHE D 1 103 ? -66.357 -27.104 21.493  1.00 34.99  ? 103 PHE D CE2 1 
ATOM   7309  C  CZ  . PHE D 1 103 ? -65.129 -27.231 22.087  1.00 49.40  ? 103 PHE D CZ  1 
ATOM   7310  N  N   . GLU D 1 104 ? -67.966 -24.031 26.214  1.00 51.06  ? 104 GLU D N   1 
ATOM   7311  C  CA  . GLU D 1 104 ? -67.584 -24.563 27.511  1.00 30.95  ? 104 GLU D CA  1 
ATOM   7312  C  C   . GLU D 1 104 ? -68.756 -25.275 28.175  1.00 41.80  ? 104 GLU D C   1 
ATOM   7313  O  O   . GLU D 1 104 ? -68.569 -26.290 28.846  1.00 51.73  ? 104 GLU D O   1 
ATOM   7314  C  CB  . GLU D 1 104 ? -67.067 -23.444 28.416  1.00 28.73  ? 104 GLU D CB  1 
ATOM   7315  C  CG  . GLU D 1 104 ? -65.572 -23.501 28.680  1.00 47.90  ? 104 GLU D CG  1 
ATOM   7316  C  CD  . GLU D 1 104 ? -64.859 -22.229 28.268  1.00 87.84  ? 104 GLU D CD  1 
ATOM   7317  O  OE1 . GLU D 1 104 ? -63.864 -22.321 27.519  1.00 104.02 ? 104 GLU D OE1 1 
ATOM   7318  O  OE2 . GLU D 1 104 ? -65.292 -21.137 28.693  1.00 84.95  ? 104 GLU D OE2 1 
ATOM   7319  N  N   . ARG D 1 105 ? -69.964 -24.748 27.992  1.00 32.91  ? 105 ARG D N   1 
ATOM   7320  C  CA  . ARG D 1 105 ? -71.126 -25.363 28.597  1.00 39.11  ? 105 ARG D CA  1 
ATOM   7321  C  C   . ARG D 1 105 ? -71.445 -26.670 27.853  1.00 42.53  ? 105 ARG D C   1 
ATOM   7322  O  O   . ARG D 1 105 ? -71.912 -27.637 28.454  1.00 52.42  ? 105 ARG D O   1 
ATOM   7323  C  CB  . ARG D 1 105 ? -72.311 -24.398 28.613  1.00 27.68  ? 105 ARG D CB  1 
ATOM   7324  C  CG  . ARG D 1 105 ? -73.557 -25.019 29.228  1.00 40.09  ? 105 ARG D CG  1 
ATOM   7325  C  CD  . ARG D 1 105 ? -74.711 -24.033 29.168  1.00 51.10  ? 105 ARG D CD  1 
ATOM   7326  N  NE  . ARG D 1 105 ? -75.446 -24.000 30.431  1.00 60.38  ? 105 ARG D NE  1 
ATOM   7327  C  CZ  . ARG D 1 105 ? -76.639 -24.562 30.617  1.00 64.67  ? 105 ARG D CZ  1 
ATOM   7328  N  NH1 . ARG D 1 105 ? -77.254 -25.201 29.618  1.00 81.32  ? 105 ARG D NH1 1 
ATOM   7329  N  NH2 . ARG D 1 105 ? -77.230 -24.475 31.799  1.00 57.64  ? 105 ARG D NH2 1 
ATOM   7330  N  N   . ILE D 1 106 ? -71.166 -26.699 26.555  1.00 36.51  ? 106 ILE D N   1 
ATOM   7331  C  CA  . ILE D 1 106 ? -71.550 -27.824 25.754  1.00 45.66  ? 106 ILE D CA  1 
ATOM   7332  C  C   . ILE D 1 106 ? -70.664 -28.969 26.142  1.00 45.66  ? 106 ILE D C   1 
ATOM   7333  O  O   . ILE D 1 106 ? -71.141 -30.077 26.383  1.00 46.15  ? 106 ILE D O   1 
ATOM   7334  C  CB  . ILE D 1 106 ? -71.358 -27.587 24.277  1.00 39.26  ? 106 ILE D CB  1 
ATOM   7335  C  CG1 . ILE D 1 106 ? -72.387 -26.621 23.732  1.00 44.87  ? 106 ILE D CG1 1 
ATOM   7336  C  CG2 . ILE D 1 106 ? -71.500 -28.880 23.518  1.00 23.42  ? 106 ILE D CG2 1 
ATOM   7337  C  CD1 . ILE D 1 106 ? -72.088 -26.245 22.257  1.00 33.30  ? 106 ILE D CD1 1 
ATOM   7338  N  N   . CYS D 1 107 ? -69.361 -28.747 26.214  1.00 41.86  ? 107 CYS D N   1 
ATOM   7339  C  CA  . CYS D 1 107 ? -68.551 -29.901 26.600  1.00 57.38  ? 107 CYS D CA  1 
ATOM   7340  C  C   . CYS D 1 107 ? -68.604 -30.329 28.082  1.00 46.56  ? 107 CYS D C   1 
ATOM   7341  O  O   . CYS D 1 107 ? -68.337 -31.478 28.380  1.00 43.54  ? 107 CYS D O   1 
ATOM   7342  C  CB  . CYS D 1 107 ? -67.152 -29.958 25.948  1.00 63.62  ? 107 CYS D CB  1 
ATOM   7343  S  SG  . CYS D 1 107 ? -66.156 -28.554 25.958  1.00 66.06  ? 107 CYS D SG  1 
ATOM   7344  N  N   . ASN D 1 108 ? -68.994 -29.444 28.992  1.00 45.00  ? 108 ASN D N   1 
ATOM   7345  C  CA  . ASN D 1 108 ? -69.269 -29.888 30.353  1.00 34.63  ? 108 ASN D CA  1 
ATOM   7346  C  C   . ASN D 1 108 ? -70.480 -30.803 30.398  1.00 42.96  ? 108 ASN D C   1 
ATOM   7347  O  O   . ASN D 1 108 ? -70.519 -31.695 31.242  1.00 47.07  ? 108 ASN D O   1 
ATOM   7348  C  CB  . ASN D 1 108 ? -69.506 -28.725 31.306  1.00 40.62  ? 108 ASN D CB  1 
ATOM   7349  C  CG  . ASN D 1 108 ? -68.231 -27.969 31.629  1.00 49.25  ? 108 ASN D CG  1 
ATOM   7350  O  OD1 . ASN D 1 108 ? -67.135 -28.415 31.307  1.00 46.98  ? 108 ASN D OD1 1 
ATOM   7351  N  ND2 . ASN D 1 108 ? -68.368 -26.822 32.278  1.00 48.41  ? 108 ASN D ND2 1 
ATOM   7352  N  N   . ALA D 1 109 ? -71.460 -30.581 29.521  1.00 32.29  ? 109 ALA D N   1 
ATOM   7353  C  CA  . ALA D 1 109 ? -72.667 -31.403 29.486  1.00 30.63  ? 109 ALA D CA  1 
ATOM   7354  C  C   . ALA D 1 109 ? -72.484 -32.616 28.578  1.00 40.82  ? 109 ALA D C   1 
ATOM   7355  O  O   . ALA D 1 109 ? -73.368 -33.449 28.475  1.00 44.91  ? 109 ALA D O   1 
ATOM   7356  C  CB  . ALA D 1 109 ? -73.863 -30.561 28.986  1.00 41.58  ? 109 ALA D CB  1 
ATOM   7357  N  N   . GLY D 1 110 ? -71.324 -32.707 27.930  1.00 45.38  ? 110 GLY D N   1 
ATOM   7358  C  CA  . GLY D 1 110 ? -71.112 -33.686 26.895  1.00 32.30  ? 110 GLY D CA  1 
ATOM   7359  C  C   . GLY D 1 110 ? -71.802 -33.228 25.627  1.00 43.81  ? 110 GLY D C   1 
ATOM   7360  O  O   . GLY D 1 110 ? -71.134 -33.040 24.605  1.00 57.32  ? 110 GLY D O   1 
ATOM   7361  N  N   . ARG D 1 111 ? -73.123 -33.021 25.707  1.00 39.01  ? 111 ARG D N   1 
ATOM   7362  C  CA  . ARG D 1 111 ? -73.920 -32.539 24.578  1.00 31.24  ? 111 ARG D CA  1 
ATOM   7363  C  C   . ARG D 1 111 ? -75.265 -32.027 25.093  1.00 26.82  ? 111 ARG D C   1 
ATOM   7364  O  O   . ARG D 1 111 ? -75.678 -32.429 26.168  1.00 35.80  ? 111 ARG D O   1 
ATOM   7365  C  CB  . ARG D 1 111 ? -74.087 -33.673 23.548  1.00 39.74  ? 111 ARG D CB  1 
ATOM   7366  C  CG  . ARG D 1 111 ? -75.123 -34.758 23.890  1.00 43.54  ? 111 ARG D CG  1 
ATOM   7367  C  CD  . ARG D 1 111 ? -74.908 -36.070 23.032  1.00 50.34  ? 111 ARG D CD  1 
ATOM   7368  N  NE  . ARG D 1 111 ? -76.122 -36.552 22.382  1.00 50.55  ? 111 ARG D NE  1 
ATOM   7369  C  CZ  . ARG D 1 111 ? -76.865 -37.564 22.812  1.00 45.39  ? 111 ARG D CZ  1 
ATOM   7370  N  NH1 . ARG D 1 111 ? -76.511 -38.250 23.883  1.00 41.80  ? 111 ARG D NH1 1 
ATOM   7371  N  NH2 . ARG D 1 111 ? -77.960 -37.899 22.154  1.00 57.65  ? 111 ARG D NH2 1 
ATOM   7372  N  N   . PHE D 1 112 ? -75.933 -31.113 24.377  1.00 32.54  ? 112 PHE D N   1 
ATOM   7373  C  CA  . PHE D 1 112 ? -77.240 -30.610 24.830  1.00 30.43  ? 112 PHE D CA  1 
ATOM   7374  C  C   . PHE D 1 112 ? -78.421 -31.497 24.337  1.00 55.41  ? 112 PHE D C   1 
ATOM   7375  O  O   . PHE D 1 112 ? -78.354 -32.127 23.280  1.00 63.15  ? 112 PHE D O   1 
ATOM   7376  C  CB  . PHE D 1 112 ? -77.479 -29.169 24.370  1.00 33.32  ? 112 PHE D CB  1 
ATOM   7377  C  CG  . PHE D 1 112 ? -76.565 -28.129 25.005  1.00 32.75  ? 112 PHE D CG  1 
ATOM   7378  C  CD1 . PHE D 1 112 ? -75.812 -28.401 26.133  1.00 25.27  ? 112 PHE D CD1 1 
ATOM   7379  C  CD2 . PHE D 1 112 ? -76.483 -26.852 24.461  1.00 29.53  ? 112 PHE D CD2 1 
ATOM   7380  C  CE1 . PHE D 1 112 ? -74.981 -27.421 26.696  1.00 26.44  ? 112 PHE D CE1 1 
ATOM   7381  C  CE2 . PHE D 1 112 ? -75.659 -25.900 25.008  1.00 29.25  ? 112 PHE D CE2 1 
ATOM   7382  C  CZ  . PHE D 1 112 ? -74.892 -26.192 26.132  1.00 40.46  ? 112 PHE D CZ  1 
ATOM   7383  N  N   . SER D 1 113 ? -79.510 -31.564 25.092  1.00 50.32  ? 113 SER D N   1 
ATOM   7384  C  CA  . SER D 1 113 ? -80.711 -32.224 24.596  1.00 50.23  ? 113 SER D CA  1 
ATOM   7385  C  C   . SER D 1 113 ? -81.237 -31.418 23.397  1.00 53.04  ? 113 SER D C   1 
ATOM   7386  O  O   . SER D 1 113 ? -80.892 -30.237 23.230  1.00 56.80  ? 113 SER D O   1 
ATOM   7387  C  CB  . SER D 1 113 ? -81.783 -32.244 25.676  1.00 48.65  ? 113 SER D CB  1 
ATOM   7388  O  OG  . SER D 1 113 ? -82.374 -30.961 25.778  1.00 57.88  ? 113 SER D OG  1 
ATOM   7389  N  N   . GLU D 1 114 ? -82.086 -32.037 22.578  1.00 43.22  ? 114 GLU D N   1 
ATOM   7390  C  CA  . GLU D 1 114 ? -82.584 -31.365 21.398  1.00 41.10  ? 114 GLU D CA  1 
ATOM   7391  C  C   . GLU D 1 114 ? -83.269 -30.059 21.780  1.00 47.11  ? 114 GLU D C   1 
ATOM   7392  O  O   . GLU D 1 114 ? -83.015 -29.019 21.177  1.00 54.35  ? 114 GLU D O   1 
ATOM   7393  C  CB  . GLU D 1 114 ? -83.512 -32.281 20.579  1.00 49.39  ? 114 GLU D CB  1 
ATOM   7394  C  CG  . GLU D 1 114 ? -84.118 -31.575 19.340  1.00 59.48  ? 114 GLU D CG  1 
ATOM   7395  C  CD  . GLU D 1 114 ? -84.813 -32.517 18.338  1.00 56.17  ? 114 GLU D CD  1 
ATOM   7396  O  OE1 . GLU D 1 114 ? -85.790 -32.073 17.702  1.00 51.19  ? 114 GLU D OE1 1 
ATOM   7397  O  OE2 . GLU D 1 114 ? -84.388 -33.672 18.158  1.00 58.83  ? 114 GLU D OE2 1 
ATOM   7398  N  N   . ASP D 1 115 ? -84.107 -30.106 22.804  1.00 47.79  ? 115 ASP D N   1 
ATOM   7399  C  CA  . ASP D 1 115 ? -84.843 -28.919 23.239  1.00 44.73  ? 115 ASP D CA  1 
ATOM   7400  C  C   . ASP D 1 115 ? -83.951 -27.798 23.727  1.00 51.26  ? 115 ASP D C   1 
ATOM   7401  O  O   . ASP D 1 115 ? -84.263 -26.621 23.554  1.00 58.33  ? 115 ASP D O   1 
ATOM   7402  C  CB  . ASP D 1 115 ? -85.809 -29.265 24.357  1.00 64.52  ? 115 ASP D CB  1 
ATOM   7403  C  CG  . ASP D 1 115 ? -87.058 -29.955 23.844  1.00 87.63  ? 115 ASP D CG  1 
ATOM   7404  O  OD1 . ASP D 1 115 ? -87.345 -31.099 24.281  1.00 104.86 ? 115 ASP D OD1 1 
ATOM   7405  O  OD2 . ASP D 1 115 ? -87.757 -29.337 23.010  1.00 88.94  ? 115 ASP D OD2 1 
ATOM   7406  N  N   . GLU D 1 116 ? -82.856 -28.182 24.376  1.00 48.09  ? 116 GLU D N   1 
ATOM   7407  C  CA  . GLU D 1 116 ? -81.898 -27.227 24.906  1.00 36.37  ? 116 GLU D CA  1 
ATOM   7408  C  C   . GLU D 1 116 ? -81.169 -26.561 23.755  1.00 47.51  ? 116 GLU D C   1 
ATOM   7409  O  O   . GLU D 1 116 ? -80.983 -25.345 23.747  1.00 59.69  ? 116 GLU D O   1 
ATOM   7410  C  CB  . GLU D 1 116 ? -80.898 -27.925 25.828  1.00 56.98  ? 116 GLU D CB  1 
ATOM   7411  C  CG  . GLU D 1 116 ? -81.059 -27.574 27.297  1.00 80.23  ? 116 GLU D CG  1 
ATOM   7412  C  CD  . GLU D 1 116 ? -80.037 -28.269 28.176  1.00 96.69  ? 116 GLU D CD  1 
ATOM   7413  O  OE1 . GLU D 1 116 ? -80.026 -29.518 28.202  1.00 89.11  ? 116 GLU D OE1 1 
ATOM   7414  O  OE2 . GLU D 1 116 ? -79.244 -27.567 28.838  1.00 94.70  ? 116 GLU D OE2 1 
ATOM   7415  N  N   . ALA D 1 117 ? -80.763 -27.359 22.776  1.00 50.51  ? 117 ALA D N   1 
ATOM   7416  C  CA  . ALA D 1 117 ? -80.111 -26.806 21.597  1.00 51.48  ? 117 ALA D CA  1 
ATOM   7417  C  C   . ALA D 1 117 ? -81.030 -25.820 20.856  1.00 55.43  ? 117 ALA D C   1 
ATOM   7418  O  O   . ALA D 1 117 ? -80.569 -24.820 20.324  1.00 55.96  ? 117 ALA D O   1 
ATOM   7419  C  CB  . ALA D 1 117 ? -79.682 -27.907 20.661  1.00 33.93  ? 117 ALA D CB  1 
ATOM   7420  N  N   . ARG D 1 118 ? -82.323 -26.124 20.826  1.00 52.73  ? 118 ARG D N   1 
ATOM   7421  C  CA  . ARG D 1 118 ? -83.290 -25.269 20.148  1.00 52.94  ? 118 ARG D CA  1 
ATOM   7422  C  C   . ARG D 1 118 ? -83.464 -23.951 20.892  1.00 58.51  ? 118 ARG D C   1 
ATOM   7423  O  O   . ARG D 1 118 ? -83.606 -22.894 20.278  1.00 45.65  ? 118 ARG D O   1 
ATOM   7424  C  CB  . ARG D 1 118 ? -84.637 -25.980 20.017  1.00 56.29  ? 118 ARG D CB  1 
ATOM   7425  C  CG  . ARG D 1 118 ? -85.508 -25.455 18.886  1.00 54.32  ? 118 ARG D CG  1 
ATOM   7426  C  CD  . ARG D 1 118 ? -86.983 -25.621 19.204  1.00 67.02  ? 118 ARG D CD  1 
ATOM   7427  N  NE  . ARG D 1 118 ? -87.248 -26.856 19.938  1.00 69.82  ? 118 ARG D NE  1 
ATOM   7428  C  CZ  . ARG D 1 118 ? -87.672 -27.982 19.376  1.00 67.87  ? 118 ARG D CZ  1 
ATOM   7429  N  NH1 . ARG D 1 118 ? -87.884 -28.034 18.068  1.00 64.70  ? 118 ARG D NH1 1 
ATOM   7430  N  NH2 . ARG D 1 118 ? -87.886 -29.057 20.121  1.00 66.99  ? 118 ARG D NH2 1 
ATOM   7431  N  N   . PHE D 1 119 ? -83.449 -24.023 22.218  1.00 57.19  ? 119 PHE D N   1 
ATOM   7432  C  CA  . PHE D 1 119 ? -83.586 -22.838 23.051  1.00 49.18  ? 119 PHE D CA  1 
ATOM   7433  C  C   . PHE D 1 119 ? -82.415 -21.888 22.831  1.00 54.81  ? 119 PHE D C   1 
ATOM   7434  O  O   . PHE D 1 119 ? -82.557 -20.672 22.945  1.00 67.17  ? 119 PHE D O   1 
ATOM   7435  C  CB  . PHE D 1 119 ? -83.682 -23.233 24.526  1.00 65.70  ? 119 PHE D CB  1 
ATOM   7436  C  CG  . PHE D 1 119 ? -83.234 -22.159 25.474  1.00 75.01  ? 119 PHE D CG  1 
ATOM   7437  C  CD1 . PHE D 1 119 ? -84.155 -21.316 26.071  1.00 72.18  ? 119 PHE D CD1 1 
ATOM   7438  C  CD2 . PHE D 1 119 ? -81.892 -21.996 25.771  1.00 80.82  ? 119 PHE D CD2 1 
ATOM   7439  C  CE1 . PHE D 1 119 ? -83.746 -20.328 26.946  1.00 73.91  ? 119 PHE D CE1 1 
ATOM   7440  C  CE2 . PHE D 1 119 ? -81.477 -21.010 26.645  1.00 69.43  ? 119 PHE D CE2 1 
ATOM   7441  C  CZ  . PHE D 1 119 ? -82.405 -20.175 27.232  1.00 71.28  ? 119 PHE D CZ  1 
ATOM   7442  N  N   . PHE D 1 120 ? -81.255 -22.454 22.509  1.00 38.37  ? 120 PHE D N   1 
ATOM   7443  C  CA  . PHE D 1 120 ? -80.058 -21.662 22.258  1.00 33.06  ? 120 PHE D CA  1 
ATOM   7444  C  C   . PHE D 1 120 ? -79.979 -21.242 20.795  1.00 43.61  ? 120 PHE D C   1 
ATOM   7445  O  O   . PHE D 1 120 ? -79.498 -20.155 20.478  1.00 56.64  ? 120 PHE D O   1 
ATOM   7446  C  CB  . PHE D 1 120 ? -78.805 -22.447 22.647  1.00 35.28  ? 120 PHE D CB  1 
ATOM   7447  C  CG  . PHE D 1 120 ? -78.433 -22.313 24.095  1.00 43.76  ? 120 PHE D CG  1 
ATOM   7448  C  CD1 . PHE D 1 120 ? -78.191 -21.070 24.651  1.00 49.17  ? 120 PHE D CD1 1 
ATOM   7449  C  CD2 . PHE D 1 120 ? -78.323 -23.435 24.901  1.00 30.32  ? 120 PHE D CD2 1 
ATOM   7450  C  CE1 . PHE D 1 120 ? -77.848 -20.945 25.982  1.00 49.07  ? 120 PHE D CE1 1 
ATOM   7451  C  CE2 . PHE D 1 120 ? -77.980 -23.317 26.233  1.00 37.60  ? 120 PHE D CE2 1 
ATOM   7452  C  CZ  . PHE D 1 120 ? -77.742 -22.071 26.775  1.00 44.98  ? 120 PHE D CZ  1 
ATOM   7453  N  N   . PHE D 1 121 ? -80.454 -22.110 19.908  1.00 35.59  ? 121 PHE D N   1 
ATOM   7454  C  CA  . PHE D 1 121 ? -80.442 -21.829 18.478  1.00 35.07  ? 121 PHE D CA  1 
ATOM   7455  C  C   . PHE D 1 121 ? -81.349 -20.650 18.146  1.00 40.60  ? 121 PHE D C   1 
ATOM   7456  O  O   . PHE D 1 121 ? -80.992 -19.788 17.344  1.00 55.47  ? 121 PHE D O   1 
ATOM   7457  C  CB  . PHE D 1 121 ? -80.872 -23.066 17.685  1.00 25.85  ? 121 PHE D CB  1 
ATOM   7458  C  CG  . PHE D 1 121 ? -80.550 -22.989 16.220  1.00 26.37  ? 121 PHE D CG  1 
ATOM   7459  C  CD1 . PHE D 1 121 ? -79.237 -23.023 15.785  1.00 40.27  ? 121 PHE D CD1 1 
ATOM   7460  C  CD2 . PHE D 1 121 ? -81.560 -22.882 15.280  1.00 28.38  ? 121 PHE D CD2 1 
ATOM   7461  C  CE1 . PHE D 1 121 ? -78.937 -22.952 14.439  1.00 29.88  ? 121 PHE D CE1 1 
ATOM   7462  C  CE2 . PHE D 1 121 ? -81.266 -22.811 13.932  1.00 37.98  ? 121 PHE D CE2 1 
ATOM   7463  C  CZ  . PHE D 1 121 ? -79.953 -22.845 13.512  1.00 27.44  ? 121 PHE D CZ  1 
ATOM   7464  N  N   . GLN D 1 122 ? -82.523 -20.620 18.767  1.00 55.11  ? 122 GLN D N   1 
ATOM   7465  C  CA  . GLN D 1 122 ? -83.473 -19.537 18.550  1.00 53.29  ? 122 GLN D CA  1 
ATOM   7466  C  C   . GLN D 1 122 ? -82.813 -18.189 18.813  1.00 49.65  ? 122 GLN D C   1 
ATOM   7467  O  O   . GLN D 1 122 ? -82.903 -17.273 17.997  1.00 42.03  ? 122 GLN D O   1 
ATOM   7468  C  CB  . GLN D 1 122 ? -84.701 -19.712 19.446  1.00 49.70  ? 122 GLN D CB  1 
ATOM   7469  C  CG  . GLN D 1 122 ? -85.789 -20.579 18.834  1.00 56.93  ? 122 GLN D CG  1 
ATOM   7470  C  CD  . GLN D 1 122 ? -86.583 -21.342 19.875  1.00 46.45  ? 122 GLN D CD  1 
ATOM   7471  O  OE1 . GLN D 1 122 ? -86.291 -21.273 21.068  1.00 54.40  ? 122 GLN D OE1 1 
ATOM   7472  N  NE2 . GLN D 1 122 ? -87.595 -22.075 19.427  1.00 37.08  ? 122 GLN D NE2 1 
ATOM   7473  N  N   . GLN D 1 123 ? -82.146 -18.077 19.957  1.00 29.85  ? 123 GLN D N   1 
ATOM   7474  C  CA  . GLN D 1 123 ? -81.410 -16.856 20.304  1.00 37.82  ? 123 GLN D CA  1 
ATOM   7475  C  C   . GLN D 1 123 ? -80.299 -16.534 19.284  1.00 45.85  ? 123 GLN D C   1 
ATOM   7476  O  O   . GLN D 1 123 ? -80.176 -15.402 18.832  1.00 54.55  ? 123 GLN D O   1 
ATOM   7477  C  CB  . GLN D 1 123 ? -80.805 -16.947 21.709  1.00 34.29  ? 123 GLN D CB  1 
ATOM   7478  C  CG  . GLN D 1 123 ? -81.842 -17.177 22.801  1.00 30.92  ? 123 GLN D CG  1 
ATOM   7479  C  CD  . GLN D 1 123 ? -81.208 -17.459 24.142  1.00 47.12  ? 123 GLN D CD  1 
ATOM   7480  O  OE1 . GLN D 1 123 ? -80.408 -16.667 24.675  1.00 45.73  ? 123 GLN D OE1 1 
ATOM   7481  N  NE2 . GLN D 1 123 ? -81.563 -18.590 24.703  1.00 44.41  ? 123 GLN D NE2 1 
ATOM   7482  N  N   . LEU D 1 124 ? -79.479 -17.524 18.944  1.00 37.51  ? 124 LEU D N   1 
ATOM   7483  C  CA  . LEU D 1 124 ? -78.408 -17.333 18.003  1.00 35.45  ? 124 LEU D CA  1 
ATOM   7484  C  C   . LEU D 1 124 ? -78.947 -16.735 16.703  1.00 50.89  ? 124 LEU D C   1 
ATOM   7485  O  O   . LEU D 1 124 ? -78.385 -15.795 16.166  1.00 37.61  ? 124 LEU D O   1 
ATOM   7486  C  CB  . LEU D 1 124 ? -77.762 -18.675 17.669  1.00 35.16  ? 124 LEU D CB  1 
ATOM   7487  C  CG  . LEU D 1 124 ? -76.632 -18.536 16.667  1.00 39.12  ? 124 LEU D CG  1 
ATOM   7488  C  CD1 . LEU D 1 124 ? -75.599 -17.571 17.236  1.00 40.97  ? 124 LEU D CD1 1 
ATOM   7489  C  CD2 . LEU D 1 124 ? -76.013 -19.857 16.329  1.00 33.55  ? 124 LEU D CD2 1 
ATOM   7490  N  N   . ILE D 1 125 ? -80.034 -17.296 16.191  1.00 42.98  ? 125 ILE D N   1 
ATOM   7491  C  CA  . ILE D 1 125 ? -80.556 -16.908 14.887  1.00 36.52  ? 125 ILE D CA  1 
ATOM   7492  C  C   . ILE D 1 125 ? -81.251 -15.563 14.980  1.00 52.39  ? 125 ILE D C   1 
ATOM   7493  O  O   . ILE D 1 125 ? -81.183 -14.756 14.052  1.00 44.78  ? 125 ILE D O   1 
ATOM   7494  C  CB  . ILE D 1 125 ? -81.569 -17.923 14.354  1.00 35.65  ? 125 ILE D CB  1 
ATOM   7495  C  CG1 . ILE D 1 125 ? -80.849 -19.181 13.882  1.00 34.91  ? 125 ILE D CG1 1 
ATOM   7496  C  CG2 . ILE D 1 125 ? -82.294 -17.353 13.174  1.00 38.37  ? 125 ILE D CG2 1 
ATOM   7497  C  CD1 . ILE D 1 125 ? -79.920 -18.938 12.695  1.00 30.40  ? 125 ILE D CD1 1 
ATOM   7498  N  N   . SER D 1 126 ? -81.921 -15.318 16.102  1.00 49.92  ? 126 SER D N   1 
ATOM   7499  C  CA  . SER D 1 126 ? -82.540 -14.024 16.311  1.00 44.42  ? 126 SER D CA  1 
ATOM   7500  C  C   . SER D 1 126 ? -81.490 -12.909 16.349  1.00 47.37  ? 126 SER D C   1 
ATOM   7501  O  O   . SER D 1 126 ? -81.632 -11.861 15.713  1.00 38.48  ? 126 SER D O   1 
ATOM   7502  C  CB  . SER D 1 126 ? -83.327 -14.026 17.607  1.00 41.10  ? 126 SER D CB  1 
ATOM   7503  O  OG  . SER D 1 126 ? -83.697 -12.696 17.917  1.00 60.62  ? 126 SER D OG  1 
ATOM   7504  N  N   . GLY D 1 127 ? -80.436 -13.142 17.105  1.00 41.10  ? 127 GLY D N   1 
ATOM   7505  C  CA  . GLY D 1 127 ? -79.390 -12.160 17.221  1.00 35.33  ? 127 GLY D CA  1 
ATOM   7506  C  C   . GLY D 1 127 ? -78.653 -11.955 15.918  1.00 40.11  ? 127 GLY D C   1 
ATOM   7507  O  O   . GLY D 1 127 ? -78.280 -10.822 15.626  1.00 50.80  ? 127 GLY D O   1 
ATOM   7508  N  N   . VAL D 1 128 ? -78.425 -13.032 15.153  1.00 40.55  ? 128 VAL D N   1 
ATOM   7509  C  CA  . VAL D 1 128 ? -77.657 -12.940 13.913  1.00 19.76  ? 128 VAL D CA  1 
ATOM   7510  C  C   . VAL D 1 128 ? -78.508 -12.206 12.891  1.00 35.36  ? 128 VAL D C   1 
ATOM   7511  O  O   . VAL D 1 128 ? -78.010 -11.445 12.070  1.00 42.14  ? 128 VAL D O   1 
ATOM   7512  C  CB  . VAL D 1 128 ? -77.216 -14.345 13.406  1.00 46.93  ? 128 VAL D CB  1 
ATOM   7513  C  CG1 . VAL D 1 128 ? -76.962 -14.385 11.910  1.00 45.60  ? 128 VAL D CG1 1 
ATOM   7514  C  CG2 . VAL D 1 128 ? -75.975 -14.773 14.131  1.00 44.63  ? 128 VAL D CG2 1 
ATOM   7515  N  N   . SER D 1 129 ? -79.807 -12.435 12.962  1.00 35.45  ? 129 SER D N   1 
ATOM   7516  C  CA  . SER D 1 129 ? -80.756 -11.866 12.014  1.00 47.18  ? 129 SER D CA  1 
ATOM   7517  C  C   . SER D 1 129 ? -80.851 -10.348 12.194  1.00 57.26  ? 129 SER D C   1 
ATOM   7518  O  O   . SER D 1 129 ? -80.957 -9.599  11.222  1.00 66.44  ? 129 SER D O   1 
ATOM   7519  C  CB  . SER D 1 129 ? -82.134 -12.501 12.212  1.00 43.48  ? 129 SER D CB  1 
ATOM   7520  O  OG  . SER D 1 129 ? -83.127 -11.809 11.493  1.00 62.63  ? 129 SER D OG  1 
ATOM   7521  N  N   . TYR D 1 130 ? -80.828 -9.915  13.452  1.00 53.15  ? 130 TYR D N   1 
ATOM   7522  C  CA  . TYR D 1 130 ? -80.757 -8.517  13.810  1.00 48.09  ? 130 TYR D CA  1 
ATOM   7523  C  C   . TYR D 1 130 ? -79.470 -7.864  13.301  1.00 47.33  ? 130 TYR D C   1 
ATOM   7524  O  O   . TYR D 1 130 ? -79.515 -6.815  12.685  1.00 49.78  ? 130 TYR D O   1 
ATOM   7525  C  CB  . TYR D 1 130 ? -80.816 -8.392  15.324  1.00 60.31  ? 130 TYR D CB  1 
ATOM   7526  C  CG  . TYR D 1 130 ? -80.723 -6.976  15.816  1.00 54.48  ? 130 TYR D CG  1 
ATOM   7527  C  CD1 . TYR D 1 130 ? -81.868 -6.212  15.975  1.00 55.10  ? 130 TYR D CD1 1 
ATOM   7528  C  CD2 . TYR D 1 130 ? -79.503 -6.405  16.115  1.00 42.61  ? 130 TYR D CD2 1 
ATOM   7529  C  CE1 . TYR D 1 130 ? -81.802 -4.908  16.418  1.00 51.26  ? 130 TYR D CE1 1 
ATOM   7530  C  CE2 . TYR D 1 130 ? -79.421 -5.102  16.566  1.00 63.79  ? 130 TYR D CE2 1 
ATOM   7531  C  CZ  . TYR D 1 130 ? -80.579 -4.359  16.713  1.00 60.04  ? 130 TYR D CZ  1 
ATOM   7532  O  OH  . TYR D 1 130 ? -80.520 -3.063  17.153  1.00 64.19  ? 130 TYR D OH  1 
ATOM   7533  N  N   . ALA D 1 131 ? -78.325 -8.481  13.556  1.00 40.55  ? 131 ALA D N   1 
ATOM   7534  C  CA  . ALA D 1 131 ? -77.056 -7.950  13.065  1.00 43.27  ? 131 ALA D CA  1 
ATOM   7535  C  C   . ALA D 1 131 ? -77.049 -7.838  11.567  1.00 51.01  ? 131 ALA D C   1 
ATOM   7536  O  O   . ALA D 1 131 ? -76.359 -6.981  11.008  1.00 55.27  ? 131 ALA D O   1 
ATOM   7537  C  CB  . ALA D 1 131 ? -75.902 -8.821  13.536  1.00 39.11  ? 131 ALA D CB  1 
ATOM   7538  N  N   . HIS D 1 132 ? -77.786 -8.727  10.906  1.00 48.28  ? 132 HIS D N   1 
ATOM   7539  C  CA  . HIS D 1 132 ? -77.838 -8.743  9.450   1.00 47.97  ? 132 HIS D CA  1 
ATOM   7540  C  C   . HIS D 1 132 ? -78.629 -7.549  8.939   1.00 55.44  ? 132 HIS D C   1 
ATOM   7541  O  O   . HIS D 1 132 ? -78.284 -6.947  7.923   1.00 65.29  ? 132 HIS D O   1 
ATOM   7542  C  CB  . HIS D 1 132 ? -78.465 -10.045 8.949   1.00 46.32  ? 132 HIS D CB  1 
ATOM   7543  C  CG  . HIS D 1 132 ? -77.484 -11.166 8.794   1.00 52.34  ? 132 HIS D CG  1 
ATOM   7544  N  ND1 . HIS D 1 132 ? -77.842 -12.406 8.313   1.00 47.19  ? 132 HIS D ND1 1 
ATOM   7545  C  CD2 . HIS D 1 132 ? -76.158 -11.231 9.059   1.00 37.33  ? 132 HIS D CD2 1 
ATOM   7546  C  CE1 . HIS D 1 132 ? -76.779 -13.188 8.287   1.00 47.97  ? 132 HIS D CE1 1 
ATOM   7547  N  NE2 . HIS D 1 132 ? -75.744 -12.500 8.734   1.00 51.05  ? 132 HIS D NE2 1 
ATOM   7548  N  N   . ALA D 1 133 ? -79.692 -7.210  9.658   1.00 50.70  ? 133 ALA D N   1 
ATOM   7549  C  CA  . ALA D 1 133 ? -80.523 -6.065  9.302   1.00 49.54  ? 133 ALA D CA  1 
ATOM   7550  C  C   . ALA D 1 133 ? -79.885 -4.731  9.710   1.00 54.07  ? 133 ALA D C   1 
ATOM   7551  O  O   . ALA D 1 133 ? -80.349 -3.675  9.343   1.00 49.17  ? 133 ALA D O   1 
ATOM   7552  C  CB  . ALA D 1 133 ? -81.869 -6.202  9.953   1.00 49.83  ? 133 ALA D CB  1 
ATOM   7553  N  N   . MET D 1 134 ? -78.948 -4.726  10.602  1.00 57.56  ? 134 MET D N   1 
ATOM   7554  C  CA  . MET D 1 134 ? -78.615 -3.453  11.149  1.00 59.58  ? 134 MET D CA  1 
ATOM   7555  C  C   . MET D 1 134 ? -77.350 -3.034  10.559  1.00 64.14  ? 134 MET D C   1 
ATOM   7556  O  O   . MET D 1 134 ? -76.977 -1.898  10.608  1.00 71.94  ? 134 MET D O   1 
ATOM   7557  C  CB  . MET D 1 134 ? -78.422 -3.581  12.642  1.00 73.01  ? 134 MET D CB  1 
ATOM   7558  C  CG  . MET D 1 134 ? -79.670 -3.457  13.384  1.00 80.59  ? 134 MET D CG  1 
ATOM   7559  S  SD  . MET D 1 134 ? -79.946 -1.774  13.734  1.00 71.43  ? 134 MET D SD  1 
ATOM   7560  C  CE  . MET D 1 134 ? -81.663 -1.855  14.024  1.00 58.73  ? 134 MET D CE  1 
ATOM   7561  N  N   . GLN D 1 135 ? -76.654 -4.001  10.029  1.00 70.11  ? 135 GLN D N   1 
ATOM   7562  C  CA  . GLN D 1 135 ? -75.299 -3.773  9.675   1.00 81.11  ? 135 GLN D CA  1 
ATOM   7563  C  C   . GLN D 1 135 ? -75.184 -3.890  8.214   1.00 79.74  ? 135 GLN D C   1 
ATOM   7564  O  O   . GLN D 1 135 ? -75.555 -4.885  7.625   1.00 72.53  ? 135 GLN D O   1 
ATOM   7565  C  CB  . GLN D 1 135 ? -74.394 -4.788  10.334  1.00 90.99  ? 135 GLN D CB  1 
ATOM   7566  C  CG  . GLN D 1 135 ? -73.856 -4.347  11.647  1.00 96.86  ? 135 GLN D CG  1 
ATOM   7567  C  CD  . GLN D 1 135 ? -73.012 -5.399  12.282  1.00 95.42  ? 135 GLN D CD  1 
ATOM   7568  O  OE1 . GLN D 1 135 ? -72.987 -6.531  11.836  1.00 84.73  ? 135 GLN D OE1 1 
ATOM   7569  N  NE2 . GLN D 1 135 ? -72.295 -5.027  13.320  1.00 94.71  ? 135 GLN D NE2 1 
ATOM   7570  N  N   . VAL D 1 136 ? -74.672 -2.854  7.585   1.00 77.59  ? 136 VAL D N   1 
ATOM   7571  C  CA  . VAL D 1 136 ? -74.625 -2.813  6.151   1.00 74.32  ? 136 VAL D CA  1 
ATOM   7572  C  C   . VAL D 1 136 ? -73.494 -3.660  5.629   1.00 58.01  ? 136 VAL D C   1 
ATOM   7573  O  O   . VAL D 1 136 ? -73.689 -4.484  4.759   1.00 64.92  ? 136 VAL D O   1 
ATOM   7574  C  CB  . VAL D 1 136 ? -74.449 -1.391  5.698   1.00 74.43  ? 136 VAL D CB  1 
ATOM   7575  C  CG1 . VAL D 1 136 ? -74.075 -1.336  4.255   1.00 65.91  ? 136 VAL D CG1 1 
ATOM   7576  C  CG2 . VAL D 1 136 ? -75.683 -0.639  5.983   1.00 65.09  ? 136 VAL D CG2 1 
ATOM   7577  N  N   . ALA D 1 137 ? -72.313 -3.447  6.173   1.00 40.85  ? 137 ALA D N   1 
ATOM   7578  C  CA  . ALA D 1 137 ? -71.159 -4.215  5.792   1.00 53.21  ? 137 ALA D CA  1 
ATOM   7579  C  C   . ALA D 1 137 ? -71.081 -5.464  6.631   1.00 59.01  ? 137 ALA D C   1 
ATOM   7580  O  O   . ALA D 1 137 ? -71.012 -5.418  7.834   1.00 53.93  ? 137 ALA D O   1 
ATOM   7581  C  CB  . ALA D 1 137 ? -69.921 -3.399  5.950   1.00 45.21  ? 137 ALA D CB  1 
ATOM   7582  N  N   . HIS D 1 138 ? -71.094 -6.597  5.978   1.00 59.35  ? 138 HIS D N   1 
ATOM   7583  C  CA  . HIS D 1 138 ? -71.013 -7.848  6.673   1.00 66.14  ? 138 HIS D CA  1 
ATOM   7584  C  C   . HIS D 1 138 ? -69.755 -7.941  7.485   1.00 64.72  ? 138 HIS D C   1 
ATOM   7585  O  O   . HIS D 1 138 ? -68.705 -7.545  7.054   1.00 73.84  ? 138 HIS D O   1 
ATOM   7586  C  CB  . HIS D 1 138 ? -71.077 -9.003  5.689   1.00 74.88  ? 138 HIS D CB  1 
ATOM   7587  C  CG  . HIS D 1 138 ? -70.820 -10.326 6.312   1.00 73.78  ? 138 HIS D CG  1 
ATOM   7588  N  ND1 . HIS D 1 138 ? -69.589 -10.931 6.287   1.00 75.40  ? 138 HIS D ND1 1 
ATOM   7589  C  CD2 . HIS D 1 138 ? -71.629 -11.153 7.003   1.00 71.23  ? 138 HIS D CD2 1 
ATOM   7590  C  CE1 . HIS D 1 138 ? -69.651 -12.074 6.936   1.00 73.64  ? 138 HIS D CE1 1 
ATOM   7591  N  NE2 . HIS D 1 138 ? -70.880 -12.236 7.373   1.00 68.97  ? 138 HIS D NE2 1 
ATOM   7592  N  N   . ARG D 1 139 ? -69.881 -8.471  8.682   1.00 62.63  ? 139 ARG D N   1 
ATOM   7593  C  CA  . ARG D 1 139 ? -68.751 -8.828  9.477   1.00 73.59  ? 139 ARG D CA  1 
ATOM   7594  C  C   . ARG D 1 139 ? -68.807 -10.313 9.713   1.00 74.24  ? 139 ARG D C   1 
ATOM   7595  O  O   . ARG D 1 139 ? -69.788 -10.867 10.155  1.00 64.57  ? 139 ARG D O   1 
ATOM   7596  C  CB  . ARG D 1 139 ? -68.761 -8.104  10.811  1.00 86.26  ? 139 ARG D CB  1 
ATOM   7597  C  CG  . ARG D 1 139 ? -67.662 -8.578  11.749  1.00 90.36  ? 139 ARG D CG  1 
ATOM   7598  C  CD  . ARG D 1 139 ? -67.837 -8.091  13.164  1.00 94.26  ? 139 ARG D CD  1 
ATOM   7599  N  NE  . ARG D 1 139 ? -67.469 -6.694  13.341  1.00 104.10 ? 139 ARG D NE  1 
ATOM   7600  C  CZ  . ARG D 1 139 ? -68.239 -5.678  12.979  1.00 108.30 ? 139 ARG D CZ  1 
ATOM   7601  N  NH1 . ARG D 1 139 ? -69.400 -5.903  12.393  1.00 99.13  ? 139 ARG D NH1 1 
ATOM   7602  N  NH2 . ARG D 1 139 ? -67.843 -4.436  13.186  1.00 113.92 ? 139 ARG D NH2 1 
ATOM   7603  N  N   . ASP D 1 140 ? -67.720 -10.960 9.393   1.00 80.38  ? 140 ASP D N   1 
ATOM   7604  C  CA  . ASP D 1 140 ? -67.546 -12.380 9.671   1.00 82.18  ? 140 ASP D CA  1 
ATOM   7605  C  C   . ASP D 1 140 ? -67.824 -12.694 11.136  1.00 78.40  ? 140 ASP D C   1 
ATOM   7606  O  O   . ASP D 1 140 ? -67.176 -12.152 12.031  1.00 72.32  ? 140 ASP D O   1 
ATOM   7607  C  CB  . ASP D 1 140 ? -66.132 -12.828 9.299   1.00 80.94  ? 140 ASP D CB  1 
ATOM   7608  C  CG  . ASP D 1 140 ? -66.021 -13.267 7.853   1.00 79.93  ? 140 ASP D CG  1 
ATOM   7609  O  OD1 . ASP D 1 140 ? -67.028 -13.760 7.302   1.00 80.76  ? 140 ASP D OD1 1 
ATOM   7610  O  OD2 . ASP D 1 140 ? -64.929 -13.120 7.267   1.00 72.99  ? 140 ASP D OD2 1 
ATOM   7611  N  N   . LEU D 1 141 ? -68.790 -13.576 11.371  1.00 70.93  ? 141 LEU D N   1 
ATOM   7612  C  CA  . LEU D 1 141 ? -69.166 -13.961 12.725  1.00 77.54  ? 141 LEU D CA  1 
ATOM   7613  C  C   . LEU D 1 141 ? -68.195 -14.983 13.306  1.00 77.55  ? 141 LEU D C   1 
ATOM   7614  O  O   . LEU D 1 141 ? -67.717 -15.871 12.601  1.00 71.02  ? 141 LEU D O   1 
ATOM   7615  C  CB  . LEU D 1 141 ? -70.588 -14.524 12.743  1.00 70.24  ? 141 LEU D CB  1 
ATOM   7616  C  CG  . LEU D 1 141 ? -71.722 -13.502 12.830  1.00 77.75  ? 141 LEU D CG  1 
ATOM   7617  C  CD1 . LEU D 1 141 ? -73.024 -14.181 13.223  1.00 81.13  ? 141 LEU D CD1 1 
ATOM   7618  C  CD2 . LEU D 1 141 ? -71.372 -12.394 13.811  1.00 70.98  ? 141 LEU D CD2 1 
ATOM   7619  N  N   . LYS D 1 142 ? -67.910 -14.854 14.597  1.00 71.47  ? 142 LYS D N   1 
ATOM   7620  C  CA  . LYS D 1 142 ? -67.017 -15.783 15.279  1.00 74.73  ? 142 LYS D CA  1 
ATOM   7621  C  C   . LYS D 1 142 ? -67.812 -16.785 16.109  1.00 63.69  ? 142 LYS D C   1 
ATOM   7622  O  O   . LYS D 1 142 ? -67.319 -17.313 17.105  1.00 59.56  ? 142 LYS D O   1 
ATOM   7623  C  CB  . LYS D 1 142 ? -66.033 -15.026 16.171  1.00 94.76  ? 142 LYS D CB  1 
ATOM   7624  C  CG  . LYS D 1 142 ? -64.815 -14.491 15.435  1.00 98.99  ? 142 LYS D CG  1 
ATOM   7625  C  CD  . LYS D 1 142 ? -63.856 -15.610 15.063  1.00 89.41  ? 142 LYS D CD  1 
ATOM   7626  C  CE  . LYS D 1 142 ? -62.843 -15.147 14.030  1.00 88.52  ? 142 LYS D CE  1 
ATOM   7627  N  NZ  . LYS D 1 142 ? -61.980 -16.263 13.555  1.00 82.65  ? 142 LYS D NZ  1 
ATOM   7628  N  N   . LEU D 1 143 ? -69.047 -17.041 15.690  1.00 72.15  ? 143 LEU D N   1 
ATOM   7629  C  CA  . LEU D 1 143 ? -69.920 -17.969 16.396  1.00 66.85  ? 143 LEU D CA  1 
ATOM   7630  C  C   . LEU D 1 143 ? -69.135 -18.827 17.382  1.00 65.71  ? 143 LEU D C   1 
ATOM   7631  O  O   . LEU D 1 143 ? -69.490 -18.923 18.556  1.00 62.55  ? 143 LEU D O   1 
ATOM   7632  C  CB  . LEU D 1 143 ? -70.666 -18.861 15.403  1.00 57.57  ? 143 LEU D CB  1 
ATOM   7633  C  CG  . LEU D 1 143 ? -71.884 -18.234 14.723  1.00 70.99  ? 143 LEU D CG  1 
ATOM   7634  C  CD1 . LEU D 1 143 ? -73.163 -18.637 15.438  1.00 82.38  ? 143 LEU D CD1 1 
ATOM   7635  C  CD2 . LEU D 1 143 ? -71.747 -16.720 14.676  1.00 65.42  ? 143 LEU D CD2 1 
ATOM   7636  N  N   . GLU D 1 144 ? -68.067 -19.449 16.896  1.00 60.19  ? 144 GLU D N   1 
ATOM   7637  C  CA  . GLU D 1 144 ? -67.230 -20.298 17.735  1.00 59.62  ? 144 GLU D CA  1 
ATOM   7638  C  C   . GLU D 1 144 ? -66.655 -19.508 18.904  1.00 56.63  ? 144 GLU D C   1 
ATOM   7639  O  O   . GLU D 1 144 ? -65.589 -19.836 19.422  1.00 79.63  ? 144 GLU D O   1 
ATOM   7640  C  CB  . GLU D 1 144 ? -66.100 -20.917 16.912  1.00 79.22  ? 144 GLU D CB  1 
ATOM   7641  C  CG  . GLU D 1 144 ? -64.998 -19.940 16.535  1.00 84.62  ? 144 GLU D CG  1 
ATOM   7642  C  CD  . GLU D 1 144 ? -65.368 -19.074 15.349  1.00 92.43  ? 144 GLU D CD  1 
ATOM   7643  O  OE1 . GLU D 1 144 ? -64.569 -19.000 14.392  1.00 92.07  ? 144 GLU D OE1 1 
ATOM   7644  O  OE2 . GLU D 1 144 ? -66.458 -18.464 15.372  1.00 95.71  ? 144 GLU D OE2 1 
ATOM   7645  N  N   . ASN D 1 145 ? -67.368 -18.465 19.314  1.00 48.84  ? 145 ASN D N   1 
ATOM   7646  C  CA  . ASN D 1 145 ? -66.921 -17.623 20.417  1.00 48.97  ? 145 ASN D CA  1 
ATOM   7647  C  C   . ASN D 1 145 ? -68.080 -16.971 21.166  1.00 58.76  ? 145 ASN D C   1 
ATOM   7648  O  O   . ASN D 1 145 ? -67.874 -16.083 21.992  1.00 67.88  ? 145 ASN D O   1 
ATOM   7649  C  CB  . ASN D 1 145 ? -65.953 -16.551 19.915  1.00 68.78  ? 145 ASN D CB  1 
ATOM   7650  C  CG  . ASN D 1 145 ? -64.509 -17.012 19.944  1.00 76.35  ? 145 ASN D CG  1 
ATOM   7651  O  OD1 . ASN D 1 145 ? -64.180 -18.018 20.570  1.00 75.74  ? 145 ASN D OD1 1 
ATOM   7652  N  ND2 . ASN D 1 145 ? -63.639 -16.275 19.264  1.00 79.50  ? 145 ASN D ND2 1 
ATOM   7653  N  N   . THR D 1 146 ? -69.298 -17.418 20.875  1.00 49.59  ? 146 THR D N   1 
ATOM   7654  C  CA  . THR D 1 146 ? -70.480 -16.900 21.552  1.00 47.15  ? 146 THR D CA  1 
ATOM   7655  C  C   . THR D 1 146 ? -70.376 -17.151 23.052  1.00 45.94  ? 146 THR D C   1 
ATOM   7656  O  O   . THR D 1 146 ? -69.788 -18.143 23.480  1.00 29.89  ? 146 THR D O   1 
ATOM   7657  C  CB  . THR D 1 146 ? -71.767 -17.545 21.012  1.00 46.24  ? 146 THR D CB  1 
ATOM   7658  O  OG1 . THR D 1 146 ? -72.075 -18.715 21.778  1.00 64.91  ? 146 THR D OG1 1 
ATOM   7659  C  CG2 . THR D 1 146 ? -71.594 -17.930 19.552  1.00 36.46  ? 146 THR D CG2 1 
ATOM   7660  N  N   . LEU D 1 147 ? -70.942 -16.249 23.847  1.00 44.22  ? 147 LEU D N   1 
ATOM   7661  C  CA  . LEU D 1 147 ? -70.841 -16.351 25.293  1.00 27.32  ? 147 LEU D CA  1 
ATOM   7662  C  C   . LEU D 1 147 ? -72.215 -16.464 25.909  1.00 35.36  ? 147 LEU D C   1 
ATOM   7663  O  O   . LEU D 1 147 ? -73.217 -16.475 25.189  1.00 37.14  ? 147 LEU D O   1 
ATOM   7664  C  CB  . LEU D 1 147 ? -70.182 -15.116 25.854  1.00 41.70  ? 147 LEU D CB  1 
ATOM   7665  C  CG  . LEU D 1 147 ? -68.993 -14.553 25.100  1.00 47.81  ? 147 LEU D CG  1 
ATOM   7666  C  CD1 . LEU D 1 147 ? -68.387 -13.397 25.879  1.00 56.07  ? 147 LEU D CD1 1 
ATOM   7667  C  CD2 . LEU D 1 147 ? -67.998 -15.657 24.932  1.00 40.60  ? 147 LEU D CD2 1 
ATOM   7668  N  N   . LEU D 1 148 ? -72.255 -16.550 27.234  1.00 33.71  ? 148 LEU D N   1 
ATOM   7669  C  CA  . LEU D 1 148 ? -73.506 -16.665 27.965  1.00 42.78  ? 148 LEU D CA  1 
ATOM   7670  C  C   . LEU D 1 148 ? -73.544 -15.673 29.119  1.00 40.53  ? 148 LEU D C   1 
ATOM   7671  O  O   . LEU D 1 148 ? -72.510 -15.325 29.687  1.00 32.20  ? 148 LEU D O   1 
ATOM   7672  C  CB  . LEU D 1 148 ? -73.684 -18.088 28.498  1.00 33.18  ? 148 LEU D CB  1 
ATOM   7673  C  CG  . LEU D 1 148 ? -73.341 -19.231 27.543  1.00 40.34  ? 148 LEU D CG  1 
ATOM   7674  C  CD1 . LEU D 1 148 ? -72.787 -20.422 28.310  1.00 34.09  ? 148 LEU D CD1 1 
ATOM   7675  C  CD2 . LEU D 1 148 ? -74.562 -19.635 26.731  1.00 27.59  ? 148 LEU D CD2 1 
ATOM   7676  N  N   . ASP D 1 149 ? -74.744 -15.227 29.470  1.00 45.91  ? 149 ASP D N   1 
ATOM   7677  C  CA  . ASP D 1 149 ? -74.929 -14.338 30.609  1.00 60.48  ? 149 ASP D CA  1 
ATOM   7678  C  C   . ASP D 1 149 ? -74.674 -15.102 31.904  1.00 75.18  ? 149 ASP D C   1 
ATOM   7679  O  O   . ASP D 1 149 ? -74.836 -16.321 31.953  1.00 78.36  ? 149 ASP D O   1 
ATOM   7680  C  CB  . ASP D 1 149 ? -76.338 -13.745 30.608  1.00 61.40  ? 149 ASP D CB  1 
ATOM   7681  C  CG  . ASP D 1 149 ? -77.408 -14.783 30.875  1.00 82.94  ? 149 ASP D CG  1 
ATOM   7682  O  OD1 . ASP D 1 149 ? -77.139 -15.984 30.662  1.00 90.68  ? 149 ASP D OD1 1 
ATOM   7683  O  OD2 . ASP D 1 149 ? -78.517 -14.399 31.299  1.00 88.50  ? 149 ASP D OD2 1 
ATOM   7684  N  N   . GLY D 1 150 ? -74.268 -14.388 32.949  1.00 65.90  ? 150 GLY D N   1 
ATOM   7685  C  CA  . GLY D 1 150 ? -73.965 -15.024 34.218  1.00 50.55  ? 150 GLY D CA  1 
ATOM   7686  C  C   . GLY D 1 150 ? -75.225 -15.245 35.030  1.00 49.92  ? 150 GLY D C   1 
ATOM   7687  O  O   . GLY D 1 150 ? -75.489 -14.548 36.009  1.00 67.08  ? 150 GLY D O   1 
ATOM   7688  N  N   . SER D 1 151 ? -76.003 -16.233 34.605  1.00 52.92  ? 151 SER D N   1 
ATOM   7689  C  CA  . SER D 1 151 ? -77.278 -16.562 35.228  1.00 61.83  ? 151 SER D CA  1 
ATOM   7690  C  C   . SER D 1 151 ? -77.425 -18.074 35.339  1.00 52.95  ? 151 SER D C   1 
ATOM   7691  O  O   . SER D 1 151 ? -76.741 -18.821 34.640  1.00 68.19  ? 151 SER D O   1 
ATOM   7692  C  CB  . SER D 1 151 ? -78.437 -15.977 34.420  1.00 78.17  ? 151 SER D CB  1 
ATOM   7693  O  OG  . SER D 1 151 ? -77.966 -15.089 33.422  1.00 67.12  ? 151 SER D OG  1 
ATOM   7694  N  N   . PRO D 1 152 ? -78.320 -18.526 36.211  1.00 56.29  ? 152 PRO D N   1 
ATOM   7695  C  CA  . PRO D 1 152 ? -78.543 -19.964 36.384  1.00 52.51  ? 152 PRO D CA  1 
ATOM   7696  C  C   . PRO D 1 152 ? -79.010 -20.540 35.057  1.00 58.96  ? 152 PRO D C   1 
ATOM   7697  O  O   . PRO D 1 152 ? -78.590 -21.627 34.663  1.00 72.73  ? 152 PRO D O   1 
ATOM   7698  C  CB  . PRO D 1 152 ? -79.673 -20.017 37.411  1.00 72.04  ? 152 PRO D CB  1 
ATOM   7699  C  CG  . PRO D 1 152 ? -79.513 -18.764 38.201  1.00 62.30  ? 152 PRO D CG  1 
ATOM   7700  C  CD  . PRO D 1 152 ? -79.022 -17.728 37.231  1.00 55.23  ? 152 PRO D CD  1 
ATOM   7701  N  N   . ALA D 1 153 ? -79.863 -19.791 34.369  1.00 71.62  ? 153 ALA D N   1 
ATOM   7702  C  CA  . ALA D 1 153 ? -80.200 -20.074 32.985  1.00 71.61  ? 153 ALA D CA  1 
ATOM   7703  C  C   . ALA D 1 153 ? -79.522 -18.974 32.186  1.00 86.17  ? 153 ALA D C   1 
ATOM   7704  O  O   . ALA D 1 153 ? -79.703 -17.792 32.476  1.00 104.83 ? 153 ALA D O   1 
ATOM   7705  C  CB  . ALA D 1 153 ? -81.704 -20.037 32.781  1.00 75.27  ? 153 ALA D CB  1 
ATOM   7706  N  N   . PRO D 1 154 ? -78.710 -19.364 31.212  1.00 80.81  ? 154 PRO D N   1 
ATOM   7707  C  CA  . PRO D 1 154 ? -77.860 -18.402 30.503  1.00 71.60  ? 154 PRO D CA  1 
ATOM   7708  C  C   . PRO D 1 154 ? -78.390 -17.979 29.139  1.00 60.82  ? 154 PRO D C   1 
ATOM   7709  O  O   . PRO D 1 154 ? -78.675 -18.820 28.288  1.00 50.56  ? 154 PRO D O   1 
ATOM   7710  C  CB  . PRO D 1 154 ? -76.537 -19.159 30.340  1.00 68.29  ? 154 PRO D CB  1 
ATOM   7711  C  CG  . PRO D 1 154 ? -76.914 -20.599 30.397  1.00 58.53  ? 154 PRO D CG  1 
ATOM   7712  C  CD  . PRO D 1 154 ? -78.054 -20.673 31.368  1.00 73.42  ? 154 PRO D CD  1 
ATOM   7713  N  N   . ARG D 1 155 ? -78.508 -16.670 28.946  1.00 51.67  ? 155 ARG D N   1 
ATOM   7714  C  CA  . ARG D 1 155 ? -78.812 -16.104 27.642  1.00 48.67  ? 155 ARG D CA  1 
ATOM   7715  C  C   . ARG D 1 155 ? -77.584 -16.174 26.744  1.00 41.74  ? 155 ARG D C   1 
ATOM   7716  O  O   . ARG D 1 155 ? -76.454 -16.046 27.214  1.00 33.68  ? 155 ARG D O   1 
ATOM   7717  C  CB  . ARG D 1 155 ? -79.279 -14.656 27.785  1.00 68.08  ? 155 ARG D CB  1 
ATOM   7718  C  CG  . ARG D 1 155 ? -80.681 -14.511 28.353  1.00 89.48  ? 155 ARG D CG  1 
ATOM   7719  C  CD  . ARG D 1 155 ? -81.717 -14.418 27.245  1.00 102.38 ? 155 ARG D CD  1 
ATOM   7720  N  NE  . ARG D 1 155 ? -82.702 -15.492 27.325  1.00 111.02 ? 155 ARG D NE  1 
ATOM   7721  C  CZ  . ARG D 1 155 ? -83.706 -15.649 26.469  1.00 115.95 ? 155 ARG D CZ  1 
ATOM   7722  N  NH1 . ARG D 1 155 ? -83.860 -14.800 25.462  1.00 117.23 ? 155 ARG D NH1 1 
ATOM   7723  N  NH2 . ARG D 1 155 ? -84.556 -16.655 26.618  1.00 111.54 ? 155 ARG D NH2 1 
ATOM   7724  N  N   . LEU D 1 156 ? -77.809 -16.373 25.451  1.00 38.36  ? 156 LEU D N   1 
ATOM   7725  C  CA  . LEU D 1 156 ? -76.721 -16.401 24.484  1.00 37.75  ? 156 LEU D CA  1 
ATOM   7726  C  C   . LEU D 1 156 ? -76.299 -14.972 24.149  1.00 45.10  ? 156 LEU D C   1 
ATOM   7727  O  O   . LEU D 1 156 ? -77.137 -14.124 23.851  1.00 56.72  ? 156 LEU D O   1 
ATOM   7728  C  CB  . LEU D 1 156 ? -77.152 -17.137 23.216  1.00 36.56  ? 156 LEU D CB  1 
ATOM   7729  C  CG  . LEU D 1 156 ? -76.062 -17.907 22.470  1.00 30.98  ? 156 LEU D CG  1 
ATOM   7730  C  CD1 . LEU D 1 156 ? -76.680 -18.885 21.486  1.00 34.39  ? 156 LEU D CD1 1 
ATOM   7731  C  CD2 . LEU D 1 156 ? -75.123 -16.947 21.758  1.00 50.25  ? 156 LEU D CD2 1 
ATOM   7732  N  N   . LYS D 1 157 ? -74.996 -14.710 24.204  1.00 36.45  ? 157 LYS D N   1 
ATOM   7733  C  CA  . LYS D 1 157 ? -74.462 -13.363 23.938  1.00 47.41  ? 157 LYS D CA  1 
ATOM   7734  C  C   . LYS D 1 157 ? -73.414 -13.365 22.809  1.00 49.48  ? 157 LYS D C   1 
ATOM   7735  O  O   . LYS D 1 157 ? -72.332 -13.910 22.969  1.00 38.57  ? 157 LYS D O   1 
ATOM   7736  C  CB  . LYS D 1 157 ? -73.834 -12.796 25.214  1.00 37.94  ? 157 LYS D CB  1 
ATOM   7737  C  CG  . LYS D 1 157 ? -74.849 -12.459 26.296  1.00 47.93  ? 157 LYS D CG  1 
ATOM   7738  C  CD  . LYS D 1 157 ? -75.508 -11.107 26.019  1.00 55.83  ? 157 LYS D CD  1 
ATOM   7739  C  CE  . LYS D 1 157 ? -76.728 -10.909 26.917  1.00 65.60  ? 157 LYS D CE  1 
ATOM   7740  N  NZ  . LYS D 1 157 ? -77.166 -9.484  26.917  1.00 70.41  ? 157 LYS D NZ  1 
ATOM   7741  N  N   . ILE D 1 158 ? -73.731 -12.768 21.666  1.00 49.63  ? 158 ILE D N   1 
ATOM   7742  C  CA  . ILE D 1 158 ? -72.769 -12.637 20.564  1.00 40.25  ? 158 ILE D CA  1 
ATOM   7743  C  C   . ILE D 1 158 ? -71.818 -11.448 20.762  1.00 38.08  ? 158 ILE D C   1 
ATOM   7744  O  O   . ILE D 1 158 ? -72.247 -10.365 21.158  1.00 58.19  ? 158 ILE D O   1 
ATOM   7745  C  CB  . ILE D 1 158 ? -73.525 -12.420 19.260  1.00 50.23  ? 158 ILE D CB  1 
ATOM   7746  C  CG1 . ILE D 1 158 ? -74.501 -13.556 19.032  1.00 54.72  ? 158 ILE D CG1 1 
ATOM   7747  C  CG2 . ILE D 1 158 ? -72.572 -12.284 18.105  1.00 64.42  ? 158 ILE D CG2 1 
ATOM   7748  C  CD1 . ILE D 1 158 ? -75.358 -13.320 17.854  1.00 46.24  ? 158 ILE D CD1 1 
ATOM   7749  N  N   . ALA D 1 159 ? -70.537 -11.637 20.478  1.00 46.49  ? 159 ALA D N   1 
ATOM   7750  C  CA  . ALA D 1 159 ? -69.571 -10.530 20.529  1.00 63.44  ? 159 ALA D CA  1 
ATOM   7751  C  C   . ALA D 1 159 ? -69.418 -9.832  19.171  1.00 79.04  ? 159 ALA D C   1 
ATOM   7752  O  O   . ALA D 1 159 ? -68.921 -10.426 18.212  1.00 74.87  ? 159 ALA D O   1 
ATOM   7753  C  CB  . ALA D 1 159 ? -68.221 -11.035 21.015  1.00 67.69  ? 159 ALA D CB  1 
ATOM   7754  N  N   . ASP D 1 160 ? -69.873 -8.586  19.073  1.00 98.78  ? 160 ASP D N   1 
ATOM   7755  C  CA  . ASP D 1 160 ? -69.954 -7.888  17.779  1.00 102.98 ? 160 ASP D CA  1 
ATOM   7756  C  C   . ASP D 1 160 ? -69.426 -6.446  17.904  1.00 104.65 ? 160 ASP D C   1 
ATOM   7757  O  O   . ASP D 1 160 ? -70.066 -5.517  17.422  1.00 99.06  ? 160 ASP D O   1 
ATOM   7758  C  CB  . ASP D 1 160 ? -71.422 -7.887  17.271  1.00 78.52  ? 160 ASP D CB  1 
ATOM   7759  C  CG  . ASP D 1 160 ? -71.549 -8.205  15.768  1.00 79.08  ? 160 ASP D CG  1 
ATOM   7760  O  OD1 . ASP D 1 160 ? -70.722 -7.677  15.005  1.00 93.35  ? 160 ASP D OD1 1 
ATOM   7761  O  OD2 . ASP D 1 160 ? -72.460 -8.971  15.336  1.00 55.37  ? 160 ASP D OD2 1 
ATOM   7762  N  N   . PHE D 1 161 ? -68.271 -6.258  18.550  1.00 114.06 ? 161 PHE D N   1 
ATOM   7763  C  CA  . PHE D 1 161 ? -67.779 -4.902  18.854  1.00 126.74 ? 161 PHE D CA  1 
ATOM   7764  C  C   . PHE D 1 161 ? -66.670 -4.333  17.958  1.00 142.19 ? 161 PHE D C   1 
ATOM   7765  O  O   . PHE D 1 161 ? -66.957 -3.660  16.959  1.00 147.08 ? 161 PHE D O   1 
ATOM   7766  C  CB  . PHE D 1 161 ? -67.380 -4.740  20.330  1.00 126.83 ? 161 PHE D CB  1 
ATOM   7767  C  CG  . PHE D 1 161 ? -66.931 -6.009  21.007  1.00 129.03 ? 161 PHE D CG  1 
ATOM   7768  C  CD1 . PHE D 1 161 ? -67.841 -7.013  21.304  1.00 125.91 ? 161 PHE D CD1 1 
ATOM   7769  C  CD2 . PHE D 1 161 ? -65.609 -6.163  21.415  1.00 129.07 ? 161 PHE D CD2 1 
ATOM   7770  C  CE1 . PHE D 1 161 ? -67.437 -8.159  21.949  1.00 124.94 ? 161 PHE D CE1 1 
ATOM   7771  C  CE2 . PHE D 1 161 ? -65.196 -7.312  22.062  1.00 127.17 ? 161 PHE D CE2 1 
ATOM   7772  C  CZ  . PHE D 1 161 ? -66.111 -8.313  22.328  1.00 124.38 ? 161 PHE D CZ  1 
ATOM   7773  N  N   . GLY D 1 162 ? -65.413 -4.559  18.347  1.00 148.03 ? 162 GLY D N   1 
ATOM   7774  C  CA  . GLY D 1 162 ? -64.270 -4.053  17.595  1.00 150.04 ? 162 GLY D CA  1 
ATOM   7775  C  C   . GLY D 1 162 ? -62.959 -3.829  18.353  1.00 150.24 ? 162 GLY D C   1 
ATOM   7776  O  O   . GLY D 1 162 ? -62.481 -4.720  19.075  1.00 150.08 ? 162 GLY D O   1 
ATOM   7777  N  N   . TYR D 1 163 ? -62.381 -2.643  18.189  1.00 145.81 ? 163 TYR D N   1 
ATOM   7778  C  CA  . TYR D 1 163 ? -61.130 -2.302  18.855  1.00 129.59 ? 163 TYR D CA  1 
ATOM   7779  C  C   . TYR D 1 163 ? -60.350 -3.553  19.238  1.00 122.30 ? 163 TYR D C   1 
ATOM   7780  O  O   . TYR D 1 163 ? -60.803 -4.353  20.057  1.00 117.97 ? 163 TYR D O   1 
ATOM   7781  C  CB  . TYR D 1 163 ? -61.400 -1.451  20.097  1.00 115.42 ? 163 TYR D CB  1 
ATOM   7782  C  CG  . TYR D 1 163 ? -62.864 -1.337  20.454  1.00 96.68  ? 163 TYR D CG  1 
ATOM   7783  C  CD1 . TYR D 1 163 ? -63.442 -2.197  21.377  1.00 81.37  ? 163 TYR D CD1 1 
ATOM   7784  C  CD2 . TYR D 1 163 ? -63.669 -0.369  19.870  1.00 87.63  ? 163 TYR D CD2 1 
ATOM   7785  C  CE1 . TYR D 1 163 ? -64.780 -2.097  21.707  1.00 79.37  ? 163 TYR D CE1 1 
ATOM   7786  C  CE2 . TYR D 1 163 ? -65.007 -0.262  20.193  1.00 88.66  ? 163 TYR D CE2 1 
ATOM   7787  C  CZ  . TYR D 1 163 ? -65.558 -1.127  21.112  1.00 80.60  ? 163 TYR D CZ  1 
ATOM   7788  O  OH  . TYR D 1 163 ? -66.890 -1.026  21.439  1.00 63.59  ? 163 TYR D OH  1 
ATOM   7789  N  N   . THR D 1 179 ? -59.645 -22.337 14.179  1.00 81.89  ? 179 THR D N   1 
ATOM   7790  C  CA  . THR D 1 179 ? -60.025 -23.608 13.557  1.00 78.05  ? 179 THR D CA  1 
ATOM   7791  C  C   . THR D 1 179 ? -60.967 -23.406 12.367  1.00 72.19  ? 179 THR D C   1 
ATOM   7792  O  O   . THR D 1 179 ? -61.831 -22.520 12.374  1.00 80.05  ? 179 THR D O   1 
ATOM   7793  C  CB  . THR D 1 179 ? -60.690 -24.565 14.569  1.00 76.44  ? 179 THR D CB  1 
ATOM   7794  O  OG1 . THR D 1 179 ? -62.059 -24.195 14.764  1.00 71.43  ? 179 THR D OG1 1 
ATOM   7795  C  CG2 . THR D 1 179 ? -59.958 -24.512 15.911  1.00 83.38  ? 179 THR D CG2 1 
ATOM   7796  N  N   . PRO D 1 180 ? -60.813 -24.250 11.346  1.00 61.83  ? 180 PRO D N   1 
ATOM   7797  C  CA  . PRO D 1 180 ? -61.618 -24.184 10.128  1.00 49.99  ? 180 PRO D CA  1 
ATOM   7798  C  C   . PRO D 1 180 ? -63.047 -24.684 10.339  1.00 59.25  ? 180 PRO D C   1 
ATOM   7799  O  O   . PRO D 1 180 ? -63.915 -24.327 9.533   1.00 59.54  ? 180 PRO D O   1 
ATOM   7800  C  CB  . PRO D 1 180 ? -60.890 -25.141 9.173   1.00 44.09  ? 180 PRO D CB  1 
ATOM   7801  C  CG  . PRO D 1 180 ? -59.636 -25.581 9.893   1.00 49.27  ? 180 PRO D CG  1 
ATOM   7802  C  CD  . PRO D 1 180 ? -59.917 -25.416 11.337  1.00 60.99  ? 180 PRO D CD  1 
ATOM   7803  N  N   . ALA D 1 181 ? -63.287 -25.499 11.371  1.00 66.66  ? 181 ALA D N   1 
ATOM   7804  C  CA  . ALA D 1 181 ? -64.607 -26.121 11.601  1.00 69.28  ? 181 ALA D CA  1 
ATOM   7805  C  C   . ALA D 1 181 ? -65.809 -25.238 11.225  1.00 67.31  ? 181 ALA D C   1 
ATOM   7806  O  O   . ALA D 1 181 ? -66.775 -25.688 10.575  1.00 71.15  ? 181 ALA D O   1 
ATOM   7807  C  CB  . ALA D 1 181 ? -64.717 -26.553 13.061  1.00 77.53  ? 181 ALA D CB  1 
ATOM   7808  N  N   . TYR D 1 182 ? -65.726 -23.974 11.639  1.00 67.96  ? 182 TYR D N   1 
ATOM   7809  C  CA  . TYR D 1 182 ? -66.802 -23.004 11.452  1.00 59.06  ? 182 TYR D CA  1 
ATOM   7810  C  C   . TYR D 1 182 ? -66.808 -22.396 10.049  1.00 50.80  ? 182 TYR D C   1 
ATOM   7811  O  O   . TYR D 1 182 ? -67.843 -21.987 9.573   1.00 45.61  ? 182 TYR D O   1 
ATOM   7812  C  CB  . TYR D 1 182 ? -66.719 -21.891 12.514  1.00 51.20  ? 182 TYR D CB  1 
ATOM   7813  C  CG  . TYR D 1 182 ? -67.240 -22.334 13.849  1.00 60.89  ? 182 TYR D CG  1 
ATOM   7814  C  CD1 . TYR D 1 182 ? -66.382 -22.878 14.797  1.00 72.06  ? 182 TYR D CD1 1 
ATOM   7815  C  CD2 . TYR D 1 182 ? -68.601 -22.270 14.147  1.00 68.40  ? 182 TYR D CD2 1 
ATOM   7816  C  CE1 . TYR D 1 182 ? -66.850 -23.327 16.034  1.00 72.01  ? 182 TYR D CE1 1 
ATOM   7817  C  CE2 . TYR D 1 182 ? -69.089 -22.723 15.383  1.00 74.27  ? 182 TYR D CE2 1 
ATOM   7818  C  CZ  . TYR D 1 182 ? -68.202 -23.245 16.330  1.00 71.15  ? 182 TYR D CZ  1 
ATOM   7819  O  OH  . TYR D 1 182 ? -68.639 -23.691 17.570  1.00 51.50  ? 182 TYR D OH  1 
ATOM   7820  N  N   . ILE D 1 183 ? -65.653 -22.359 9.396   1.00 54.85  ? 183 ILE D N   1 
ATOM   7821  C  CA  . ILE D 1 183 ? -65.555 -21.764 8.065   1.00 48.37  ? 183 ILE D CA  1 
ATOM   7822  C  C   . ILE D 1 183 ? -66.359 -22.525 7.007   1.00 48.54  ? 183 ILE D C   1 
ATOM   7823  O  O   . ILE D 1 183 ? -66.260 -23.746 6.893   1.00 52.57  ? 183 ILE D O   1 
ATOM   7824  C  CB  . ILE D 1 183 ? -64.090 -21.650 7.604   1.00 44.15  ? 183 ILE D CB  1 
ATOM   7825  C  CG1 . ILE D 1 183 ? -63.371 -20.554 8.392   1.00 42.87  ? 183 ILE D CG1 1 
ATOM   7826  C  CG2 . ILE D 1 183 ? -64.022 -21.368 6.112   1.00 44.51  ? 183 ILE D CG2 1 
ATOM   7827  C  CD1 . ILE D 1 183 ? -62.004 -20.960 8.895   1.00 65.13  ? 183 ILE D CD1 1 
ATOM   7828  N  N   . ALA D 1 184 ? -67.152 -21.786 6.237   1.00 46.00  ? 184 ALA D N   1 
ATOM   7829  C  CA  . ALA D 1 184 ? -67.956 -22.351 5.148   1.00 47.66  ? 184 ALA D CA  1 
ATOM   7830  C  C   . ALA D 1 184 ? -67.145 -22.524 3.857   1.00 46.51  ? 184 ALA D C   1 
ATOM   7831  O  O   . ALA D 1 184 ? -66.277 -21.695 3.553   1.00 45.80  ? 184 ALA D O   1 
ATOM   7832  C  CB  . ALA D 1 184 ? -69.146 -21.451 4.897   1.00 45.62  ? 184 ALA D CB  1 
ATOM   7833  N  N   . PRO D 1 185 ? -67.465 -23.564 3.065   1.00 34.12  ? 185 PRO D N   1 
ATOM   7834  C  CA  . PRO D 1 185 ? -66.649 -23.969 1.901   1.00 41.59  ? 185 PRO D CA  1 
ATOM   7835  C  C   . PRO D 1 185 ? -66.251 -22.808 0.967   1.00 53.21  ? 185 PRO D C   1 
ATOM   7836  O  O   . PRO D 1 185 ? -65.053 -22.642 0.680   1.00 46.60  ? 185 PRO D O   1 
ATOM   7837  C  CB  . PRO D 1 185 ? -67.552 -24.968 1.159   1.00 46.44  ? 185 PRO D CB  1 
ATOM   7838  C  CG  . PRO D 1 185 ? -68.606 -25.388 2.146   1.00 46.11  ? 185 PRO D CG  1 
ATOM   7839  C  CD  . PRO D 1 185 ? -68.808 -24.173 3.035   1.00 41.61  ? 185 PRO D CD  1 
ATOM   7840  N  N   . GLU D 1 186 ? -67.237 -22.007 0.534   1.00 57.15  ? 186 GLU D N   1 
ATOM   7841  C  CA  . GLU D 1 186 ? -67.023 -20.835 -0.341  1.00 49.52  ? 186 GLU D CA  1 
ATOM   7842  C  C   . GLU D 1 186 ? -66.093 -19.795 0.227   1.00 46.43  ? 186 GLU D C   1 
ATOM   7843  O  O   . GLU D 1 186 ? -65.250 -19.256 -0.492  1.00 47.65  ? 186 GLU D O   1 
ATOM   7844  C  CB  . GLU D 1 186 ? -68.342 -20.148 -0.634  1.00 51.46  ? 186 GLU D CB  1 
ATOM   7845  C  CG  . GLU D 1 186 ? -69.507 -21.039 -0.272  1.00 69.82  ? 186 GLU D CG  1 
ATOM   7846  C  CD  . GLU D 1 186 ? -70.229 -20.641 1.024   1.00 60.65  ? 186 GLU D CD  1 
ATOM   7847  O  OE1 . GLU D 1 186 ? -70.172 -19.436 1.450   1.00 63.13  ? 186 GLU D OE1 1 
ATOM   7848  O  OE2 . GLU D 1 186 ? -70.885 -21.565 1.583   1.00 41.19  ? 186 GLU D OE2 1 
ATOM   7849  N  N   . VAL D 1 187 ? -66.258 -19.488 1.510   1.00 38.05  ? 187 VAL D N   1 
ATOM   7850  C  CA  . VAL D 1 187 ? -65.367 -18.539 2.167   1.00 47.73  ? 187 VAL D CA  1 
ATOM   7851  C  C   . VAL D 1 187 ? -63.922 -19.017 2.084   1.00 54.39  ? 187 VAL D C   1 
ATOM   7852  O  O   . VAL D 1 187 ? -62.987 -18.204 2.092   1.00 50.38  ? 187 VAL D O   1 
ATOM   7853  C  CB  . VAL D 1 187 ? -65.694 -18.404 3.649   1.00 48.93  ? 187 VAL D CB  1 
ATOM   7854  C  CG1 . VAL D 1 187 ? -64.618 -17.591 4.349   1.00 47.48  ? 187 VAL D CG1 1 
ATOM   7855  C  CG2 . VAL D 1 187 ? -67.075 -17.793 3.839   1.00 34.64  ? 187 VAL D CG2 1 
ATOM   7856  N  N   . LEU D 1 188 ? -63.768 -20.345 2.030   1.00 49.67  ? 188 LEU D N   1 
ATOM   7857  C  CA  . LEU D 1 188 ? -62.482 -21.049 2.000   1.00 48.50  ? 188 LEU D CA  1 
ATOM   7858  C  C   . LEU D 1 188 ? -61.880 -21.137 0.581   1.00 42.94  ? 188 LEU D C   1 
ATOM   7859  O  O   . LEU D 1 188 ? -60.682 -20.931 0.410   1.00 35.39  ? 188 LEU D O   1 
ATOM   7860  C  CB  . LEU D 1 188 ? -62.704 -22.468 2.518   1.00 52.67  ? 188 LEU D CB  1 
ATOM   7861  C  CG  . LEU D 1 188 ? -62.038 -23.190 3.693   1.00 49.53  ? 188 LEU D CG  1 
ATOM   7862  C  CD1 . LEU D 1 188 ? -61.865 -22.321 4.903   1.00 45.48  ? 188 LEU D CD1 1 
ATOM   7863  C  CD2 . LEU D 1 188 ? -62.942 -24.356 4.023   1.00 50.38  ? 188 LEU D CD2 1 
ATOM   7864  N  N   . LEU D 1 189 ? -62.700 -21.477 -0.416  1.00 47.80  ? 189 LEU D N   1 
ATOM   7865  C  CA  . LEU D 1 189 ? -62.287 -21.430 -1.829  1.00 60.56  ? 189 LEU D CA  1 
ATOM   7866  C  C   . LEU D 1 189 ? -62.214 -20.029 -2.492  1.00 69.61  ? 189 LEU D C   1 
ATOM   7867  O  O   . LEU D 1 189 ? -61.399 -19.821 -3.410  1.00 74.24  ? 189 LEU D O   1 
ATOM   7868  C  CB  . LEU D 1 189 ? -63.228 -22.270 -2.694  1.00 54.18  ? 189 LEU D CB  1 
ATOM   7869  C  CG  . LEU D 1 189 ? -63.243 -23.793 -2.535  1.00 58.03  ? 189 LEU D CG  1 
ATOM   7870  C  CD1 . LEU D 1 189 ? -61.839 -24.313 -2.196  1.00 47.26  ? 189 LEU D CD1 1 
ATOM   7871  C  CD2 . LEU D 1 189 ? -64.259 -24.210 -1.480  1.00 63.00  ? 189 LEU D CD2 1 
ATOM   7872  N  N   . LYS D 1 190 ? -63.079 -19.093 -2.073  1.00 51.61  ? 190 LYS D N   1 
ATOM   7873  C  CA  . LYS D 1 190 ? -63.283 -17.845 -2.837  1.00 49.45  ? 190 LYS D CA  1 
ATOM   7874  C  C   . LYS D 1 190 ? -63.120 -16.540 -2.036  1.00 50.97  ? 190 LYS D C   1 
ATOM   7875  O  O   . LYS D 1 190 ? -63.772 -16.312 -1.010  1.00 54.96  ? 190 LYS D O   1 
ATOM   7876  C  CB  . LYS D 1 190 ? -64.635 -17.859 -3.570  1.00 40.16  ? 190 LYS D CB  1 
ATOM   7877  C  CG  . LYS D 1 190 ? -64.662 -18.737 -4.838  1.00 44.18  ? 190 LYS D CG  1 
ATOM   7878  C  CD  . LYS D 1 190 ? -65.415 -20.044 -4.618  1.00 69.15  ? 190 LYS D CD  1 
ATOM   7879  C  CE  . LYS D 1 190 ? -66.213 -20.475 -5.852  1.00 79.21  ? 190 LYS D CE  1 
ATOM   7880  N  NZ  . LYS D 1 190 ? -65.360 -20.823 -7.020  1.00 78.74  ? 190 LYS D NZ  1 
ATOM   7881  N  N   . LYS D 1 191 ? -62.233 -15.677 -2.508  1.00 55.31  ? 191 LYS D N   1 
ATOM   7882  C  CA  . LYS D 1 191 ? -62.085 -14.389 -1.867  1.00 50.29  ? 191 LYS D CA  1 
ATOM   7883  C  C   . LYS D 1 191 ? -63.434 -13.664 -1.912  1.00 48.08  ? 191 LYS D C   1 
ATOM   7884  O  O   . LYS D 1 191 ? -63.786 -12.952 -0.977  1.00 45.74  ? 191 LYS D O   1 
ATOM   7885  C  CB  . LYS D 1 191 ? -60.980 -13.569 -2.526  1.00 46.24  ? 191 LYS D CB  1 
ATOM   7886  C  CG  . LYS D 1 191 ? -60.429 -12.465 -1.629  1.00 77.76  ? 191 LYS D CG  1 
ATOM   7887  C  CD  . LYS D 1 191 ? -59.539 -11.498 -2.406  1.00 98.68  ? 191 LYS D CD  1 
ATOM   7888  C  CE  . LYS D 1 191 ? -60.310 -10.839 -3.565  1.00 107.53 ? 191 LYS D CE  1 
ATOM   7889  N  NZ  . LYS D 1 191 ? -59.512 -9.816  -4.324  1.00 106.89 ? 191 LYS D NZ  1 
ATOM   7890  N  N   . GLU D 1 192 ? -64.208 -13.888 -2.974  1.00 43.97  ? 192 GLU D N   1 
ATOM   7891  C  CA  . GLU D 1 192 ? -65.521 -13.245 -3.089  1.00 47.69  ? 192 GLU D CA  1 
ATOM   7892  C  C   . GLU D 1 192 ? -66.743 -14.135 -2.773  1.00 50.86  ? 192 GLU D C   1 
ATOM   7893  O  O   . GLU D 1 192 ? -67.085 -15.107 -3.481  1.00 49.80  ? 192 GLU D O   1 
ATOM   7894  C  CB  . GLU D 1 192 ? -65.665 -12.483 -4.421  1.00 50.51  ? 192 GLU D CB  1 
ATOM   7895  C  CG  . GLU D 1 192 ? -64.726 -11.250 -4.526  1.00 86.22  ? 192 GLU D CG  1 
ATOM   7896  C  CD  . GLU D 1 192 ? -64.851 -10.281 -3.325  1.00 90.56  ? 192 GLU D CD  1 
ATOM   7897  O  OE1 . GLU D 1 192 ? -65.960 -10.144 -2.748  1.00 86.51  ? 192 GLU D OE1 1 
ATOM   7898  O  OE2 . GLU D 1 192 ? -63.833 -9.656  -2.951  1.00 101.04 ? 192 GLU D OE2 1 
ATOM   7899  N  N   . TYR D 1 193 ? -67.419 -13.798 -1.679  1.00 38.86  ? 193 TYR D N   1 
ATOM   7900  C  CA  . TYR D 1 193 ? -68.554 -14.593 -1.220  1.00 57.48  ? 193 TYR D CA  1 
ATOM   7901  C  C   . TYR D 1 193 ? -69.608 -13.759 -0.496  1.00 54.67  ? 193 TYR D C   1 
ATOM   7902  O  O   . TYR D 1 193 ? -69.358 -12.617 -0.113  1.00 37.90  ? 193 TYR D O   1 
ATOM   7903  C  CB  . TYR D 1 193 ? -68.070 -15.714 -0.299  1.00 54.32  ? 193 TYR D CB  1 
ATOM   7904  C  CG  . TYR D 1 193 ? -67.411 -15.212 0.965   1.00 52.12  ? 193 TYR D CG  1 
ATOM   7905  C  CD1 . TYR D 1 193 ? -68.162 -14.919 2.094   1.00 49.87  ? 193 TYR D CD1 1 
ATOM   7906  C  CD2 . TYR D 1 193 ? -66.037 -15.024 1.026   1.00 50.09  ? 193 TYR D CD2 1 
ATOM   7907  C  CE1 . TYR D 1 193 ? -67.563 -14.458 3.250   1.00 38.43  ? 193 TYR D CE1 1 
ATOM   7908  C  CE2 . TYR D 1 193 ? -65.431 -14.562 2.178   1.00 46.07  ? 193 TYR D CE2 1 
ATOM   7909  C  CZ  . TYR D 1 193 ? -66.197 -14.281 3.286   1.00 48.14  ? 193 TYR D CZ  1 
ATOM   7910  O  OH  . TYR D 1 193 ? -65.598 -13.821 4.436   1.00 56.00  ? 193 TYR D OH  1 
ATOM   7911  N  N   . ASP D 1 194 ? -70.785 -14.348 -0.309  1.00 59.81  ? 194 ASP D N   1 
ATOM   7912  C  CA  . ASP D 1 194 ? -71.871 -13.703 0.418   1.00 56.11  ? 194 ASP D CA  1 
ATOM   7913  C  C   . ASP D 1 194 ? -71.966 -13.893 1.927   1.00 56.05  ? 194 ASP D C   1 
ATOM   7914  O  O   . ASP D 1 194 ? -72.516 -14.886 2.402   1.00 47.13  ? 194 ASP D O   1 
ATOM   7915  C  CB  . ASP D 1 194 ? -73.225 -14.202 -0.087  1.00 77.84  ? 194 ASP D CB  1 
ATOM   7916  C  CG  . ASP D 1 194 ? -74.179 -13.071 -0.411  1.00 94.22  ? 194 ASP D CG  1 
ATOM   7917  O  OD1 . ASP D 1 194 ? -73.987 -12.411 -1.454  1.00 98.66  ? 194 ASP D OD1 1 
ATOM   7918  O  OD2 . ASP D 1 194 ? -75.121 -12.841 0.377   1.00 96.47  ? 194 ASP D OD2 1 
ATOM   7919  N  N   . GLY D 1 195 ? -71.424 -12.938 2.674   1.00 50.88  ? 195 GLY D N   1 
ATOM   7920  C  CA  . GLY D 1 195 ? -71.161 -13.079 4.094   1.00 52.00  ? 195 GLY D CA  1 
ATOM   7921  C  C   . GLY D 1 195 ? -72.325 -13.565 4.936   1.00 43.73  ? 195 GLY D C   1 
ATOM   7922  O  O   . GLY D 1 195 ? -72.120 -14.205 5.966   1.00 45.75  ? 195 GLY D O   1 
ATOM   7923  N  N   . LYS D 1 196 ? -73.546 -13.260 4.512   1.00 38.07  ? 196 LYS D N   1 
ATOM   7924  C  CA  . LYS D 1 196 ? -74.696 -13.592 5.293   1.00 50.85  ? 196 LYS D CA  1 
ATOM   7925  C  C   . LYS D 1 196 ? -75.026 -15.073 5.131   1.00 58.35  ? 196 LYS D C   1 
ATOM   7926  O  O   . LYS D 1 196 ? -75.494 -15.714 6.080   1.00 63.94  ? 196 LYS D O   1 
ATOM   7927  C  CB  . LYS D 1 196 ? -75.870 -12.723 4.883   1.00 58.49  ? 196 LYS D CB  1 
ATOM   7928  C  CG  . LYS D 1 196 ? -75.639 -11.230 5.182   1.00 78.83  ? 196 LYS D CG  1 
ATOM   7929  C  CD  . LYS D 1 196 ? -76.829 -10.397 4.766   1.00 77.65  ? 196 LYS D CD  1 
ATOM   7930  C  CE  . LYS D 1 196 ? -76.746 -8.998  5.311   1.00 75.74  ? 196 LYS D CE  1 
ATOM   7931  N  NZ  . LYS D 1 196 ? -77.987 -8.255  4.966   1.00 78.47  ? 196 LYS D NZ  1 
ATOM   7932  N  N   . VAL D 1 197 ? -74.802 -15.603 3.933   1.00 57.54  ? 197 VAL D N   1 
ATOM   7933  C  CA  . VAL D 1 197 ? -75.056 -17.010 3.663   1.00 52.86  ? 197 VAL D CA  1 
ATOM   7934  C  C   . VAL D 1 197 ? -74.010 -17.863 4.364   1.00 53.60  ? 197 VAL D C   1 
ATOM   7935  O  O   . VAL D 1 197 ? -74.285 -18.987 4.781   1.00 61.45  ? 197 VAL D O   1 
ATOM   7936  C  CB  . VAL D 1 197 ? -75.035 -17.312 2.155   1.00 53.20  ? 197 VAL D CB  1 
ATOM   7937  C  CG1 . VAL D 1 197 ? -75.260 -18.794 1.908   1.00 60.56  ? 197 VAL D CG1 1 
ATOM   7938  C  CG2 . VAL D 1 197 ? -76.084 -16.481 1.433   1.00 54.53  ? 197 VAL D CG2 1 
ATOM   7939  N  N   . ALA D 1 198 ? -72.806 -17.314 4.493   1.00 43.28  ? 198 ALA D N   1 
ATOM   7940  C  CA  . ALA D 1 198 ? -71.729 -17.992 5.197   1.00 48.75  ? 198 ALA D CA  1 
ATOM   7941  C  C   . ALA D 1 198 ? -72.052 -18.055 6.684   1.00 53.65  ? 198 ALA D C   1 
ATOM   7942  O  O   . ALA D 1 198 ? -71.627 -18.972 7.385   1.00 60.22  ? 198 ALA D O   1 
ATOM   7943  C  CB  . ALA D 1 198 ? -70.411 -17.274 4.967   1.00 31.20  ? 198 ALA D CB  1 
ATOM   7944  N  N   . ASP D 1 199 ? -72.811 -17.072 7.157   1.00 38.43  ? 199 ASP D N   1 
ATOM   7945  C  CA  . ASP D 1 199 ? -73.224 -17.025 8.552   1.00 35.44  ? 199 ASP D CA  1 
ATOM   7946  C  C   . ASP D 1 199 ? -74.142 -18.197 8.873   1.00 39.45  ? 199 ASP D C   1 
ATOM   7947  O  O   . ASP D 1 199 ? -74.017 -18.826 9.923   1.00 45.61  ? 199 ASP D O   1 
ATOM   7948  C  CB  . ASP D 1 199 ? -73.930 -15.703 8.858   1.00 39.36  ? 199 ASP D CB  1 
ATOM   7949  C  CG  . ASP D 1 199 ? -72.960 -14.555 9.051   1.00 50.85  ? 199 ASP D CG  1 
ATOM   7950  O  OD1 . ASP D 1 199 ? -73.420 -13.401 9.167   1.00 51.55  ? 199 ASP D OD1 1 
ATOM   7951  O  OD2 . ASP D 1 199 ? -71.738 -14.807 9.088   1.00 51.46  ? 199 ASP D OD2 1 
ATOM   7952  N  N   . VAL D 1 200 ? -75.063 -18.487 7.960   1.00 24.19  ? 200 VAL D N   1 
ATOM   7953  C  CA  . VAL D 1 200 ? -75.978 -19.608 8.128   1.00 35.80  ? 200 VAL D CA  1 
ATOM   7954  C  C   . VAL D 1 200 ? -75.195 -20.891 8.372   1.00 46.24  ? 200 VAL D C   1 
ATOM   7955  O  O   . VAL D 1 200 ? -75.488 -21.643 9.301   1.00 38.12  ? 200 VAL D O   1 
ATOM   7956  C  CB  . VAL D 1 200 ? -76.883 -19.790 6.898   1.00 45.24  ? 200 VAL D CB  1 
ATOM   7957  C  CG1 . VAL D 1 200 ? -77.492 -21.183 6.889   1.00 49.22  ? 200 VAL D CG1 1 
ATOM   7958  C  CG2 . VAL D 1 200 ? -77.970 -18.728 6.879   1.00 53.89  ? 200 VAL D CG2 1 
ATOM   7959  N  N   . TRP D 1 201 ? -74.195 -21.134 7.531   1.00 44.58  ? 201 TRP D N   1 
ATOM   7960  C  CA  . TRP D 1 201 ? -73.321 -22.295 7.694   1.00 37.89  ? 201 TRP D CA  1 
ATOM   7961  C  C   . TRP D 1 201 ? -72.743 -22.316 9.105   1.00 34.85  ? 201 TRP D C   1 
ATOM   7962  O  O   . TRP D 1 201 ? -72.914 -23.297 9.828   1.00 41.92  ? 201 TRP D O   1 
ATOM   7963  C  CB  . TRP D 1 201 ? -72.189 -22.259 6.662   1.00 37.72  ? 201 TRP D CB  1 
ATOM   7964  C  CG  . TRP D 1 201 ? -71.237 -23.365 6.765   1.00 36.52  ? 201 TRP D CG  1 
ATOM   7965  C  CD1 . TRP D 1 201 ? -70.183 -23.462 7.623   1.00 48.47  ? 201 TRP D CD1 1 
ATOM   7966  C  CD2 . TRP D 1 201 ? -71.217 -24.559 5.960   1.00 41.95  ? 201 TRP D CD2 1 
ATOM   7967  N  NE1 . TRP D 1 201 ? -69.509 -24.671 7.424   1.00 49.43  ? 201 TRP D NE1 1 
ATOM   7968  C  CE2 . TRP D 1 201 ? -70.124 -25.341 6.415   1.00 38.81  ? 201 TRP D CE2 1 
ATOM   7969  C  CE3 . TRP D 1 201 ? -72.006 -25.026 4.914   1.00 44.64  ? 201 TRP D CE3 1 
ATOM   7970  C  CZ2 . TRP D 1 201 ? -69.828 -26.572 5.838   1.00 39.01  ? 201 TRP D CZ2 1 
ATOM   7971  C  CZ3 . TRP D 1 201 ? -71.704 -26.269 4.356   1.00 52.31  ? 201 TRP D CZ3 1 
ATOM   7972  C  CH2 . TRP D 1 201 ? -70.624 -27.018 4.812   1.00 45.75  ? 201 TRP D CH2 1 
ATOM   7973  N  N   . SER D 1 202 ? -72.064 -21.236 9.493   1.00 37.86  ? 202 SER D N   1 
ATOM   7974  C  CA  . SER D 1 202 ? -71.506 -21.117 10.839  1.00 36.80  ? 202 SER D CA  1 
ATOM   7975  C  C   . SER D 1 202 ? -72.533 -21.416 11.906  1.00 43.04  ? 202 SER D C   1 
ATOM   7976  O  O   . SER D 1 202 ? -72.199 -22.039 12.904  1.00 49.12  ? 202 SER D O   1 
ATOM   7977  C  CB  . SER D 1 202 ? -70.926 -19.732 11.084  1.00 37.21  ? 202 SER D CB  1 
ATOM   7978  O  OG  . SER D 1 202 ? -69.608 -19.673 10.590  1.00 47.06  ? 202 SER D OG  1 
ATOM   7979  N  N   . CYS D 1 203 ? -73.768 -20.953 11.712  1.00 47.05  ? 203 CYS D N   1 
ATOM   7980  C  CA  . CYS D 1 203 ? -74.850 -21.243 12.652  1.00 43.19  ? 203 CYS D CA  1 
ATOM   7981  C  C   . CYS D 1 203 ? -75.190 -22.720 12.639  1.00 41.03  ? 203 CYS D C   1 
ATOM   7982  O  O   . CYS D 1 203 ? -75.674 -23.253 13.621  1.00 41.33  ? 203 CYS D O   1 
ATOM   7983  C  CB  . CYS D 1 203 ? -76.097 -20.405 12.327  1.00 40.28  ? 203 CYS D CB  1 
ATOM   7984  S  SG  . CYS D 1 203 ? -75.880 -18.623 12.636  1.00 49.98  ? 203 CYS D SG  1 
ATOM   7985  N  N   . GLY D 1 204 ? -74.960 -23.366 11.495  1.00 52.51  ? 204 GLY D N   1 
ATOM   7986  C  CA  . GLY D 1 204 ? -75.213 -24.777 11.343  1.00 40.69  ? 204 GLY D CA  1 
ATOM   7987  C  C   . GLY D 1 204 ? -74.217 -25.480 12.212  1.00 44.36  ? 204 GLY D C   1 
ATOM   7988  O  O   . GLY D 1 204 ? -74.598 -26.329 13.008  1.00 47.92  ? 204 GLY D O   1 
ATOM   7989  N  N   . VAL D 1 205 ? -72.946 -25.103 12.097  1.00 44.91  ? 205 VAL D N   1 
ATOM   7990  C  CA  . VAL D 1 205 ? -71.903 -25.814 12.818  1.00 41.47  ? 205 VAL D CA  1 
ATOM   7991  C  C   . VAL D 1 205 ? -72.154 -25.734 14.327  1.00 42.69  ? 205 VAL D C   1 
ATOM   7992  O  O   . VAL D 1 205 ? -72.008 -26.726 15.057  1.00 29.86  ? 205 VAL D O   1 
ATOM   7993  C  CB  . VAL D 1 205 ? -70.519 -25.268 12.507  1.00 40.04  ? 205 VAL D CB  1 
ATOM   7994  C  CG1 . VAL D 1 205 ? -69.507 -25.978 13.357  1.00 41.33  ? 205 VAL D CG1 1 
ATOM   7995  C  CG2 . VAL D 1 205 ? -70.191 -25.458 11.040  1.00 41.87  ? 205 VAL D CG2 1 
ATOM   7996  N  N   . THR D 1 206 ? -72.557 -24.564 14.823  1.00 39.27  ? 206 THR D N   1 
ATOM   7997  C  CA  . THR D 1 206 ? -72.788 -24.500 16.258  1.00 40.92  ? 206 THR D CA  1 
ATOM   7998  C  C   . THR D 1 206 ? -74.057 -25.243 16.698  1.00 41.15  ? 206 THR D C   1 
ATOM   7999  O  O   . THR D 1 206 ? -74.141 -25.704 17.834  1.00 33.50  ? 206 THR D O   1 
ATOM   8000  C  CB  . THR D 1 206 ? -72.628 -23.074 16.867  1.00 43.93  ? 206 THR D CB  1 
ATOM   8001  O  OG1 . THR D 1 206 ? -73.869 -22.579 17.353  1.00 31.13  ? 206 THR D OG1 1 
ATOM   8002  C  CG2 . THR D 1 206 ? -72.082 -22.121 15.869  1.00 38.46  ? 206 THR D CG2 1 
ATOM   8003  N  N   . LEU D 1 207 ? -75.024 -25.399 15.798  1.00 33.04  ? 207 LEU D N   1 
ATOM   8004  C  CA  . LEU D 1 207 ? -76.158 -26.271 16.095  1.00 32.43  ? 207 LEU D CA  1 
ATOM   8005  C  C   . LEU D 1 207 ? -75.732 -27.731 16.150  1.00 37.01  ? 207 LEU D C   1 
ATOM   8006  O  O   . LEU D 1 207 ? -76.151 -28.449 17.046  1.00 49.61  ? 207 LEU D O   1 
ATOM   8007  C  CB  . LEU D 1 207 ? -77.261 -26.105 15.060  1.00 33.62  ? 207 LEU D CB  1 
ATOM   8008  C  CG  . LEU D 1 207 ? -78.389 -27.140 15.073  1.00 37.08  ? 207 LEU D CG  1 
ATOM   8009  C  CD1 . LEU D 1 207 ? -79.125 -27.182 16.397  1.00 27.57  ? 207 LEU D CD1 1 
ATOM   8010  C  CD2 . LEU D 1 207 ? -79.370 -26.827 13.958  1.00 32.35  ? 207 LEU D CD2 1 
ATOM   8011  N  N   . TYR D 1 208 ? -74.923 -28.171 15.184  1.00 37.08  ? 208 TYR D N   1 
ATOM   8012  C  CA  . TYR D 1 208 ? -74.406 -29.534 15.188  1.00 40.77  ? 208 TYR D CA  1 
ATOM   8013  C  C   . TYR D 1 208 ? -73.648 -29.796 16.492  1.00 43.92  ? 208 TYR D C   1 
ATOM   8014  O  O   . TYR D 1 208 ? -73.952 -30.745 17.215  1.00 42.45  ? 208 TYR D O   1 
ATOM   8015  C  CB  . TYR D 1 208 ? -73.511 -29.773 13.974  1.00 37.94  ? 208 TYR D CB  1 
ATOM   8016  C  CG  . TYR D 1 208 ? -72.988 -31.199 13.828  1.00 45.16  ? 208 TYR D CG  1 
ATOM   8017  C  CD1 . TYR D 1 208 ? -73.546 -32.083 12.923  1.00 45.28  ? 208 TYR D CD1 1 
ATOM   8018  C  CD2 . TYR D 1 208 ? -71.925 -31.636 14.572  1.00 39.38  ? 208 TYR D CD2 1 
ATOM   8019  C  CE1 . TYR D 1 208 ? -73.041 -33.357 12.774  1.00 53.09  ? 208 TYR D CE1 1 
ATOM   8020  C  CE2 . TYR D 1 208 ? -71.419 -32.889 14.426  1.00 51.19  ? 208 TYR D CE2 1 
ATOM   8021  C  CZ  . TYR D 1 208 ? -71.975 -33.757 13.537  1.00 58.92  ? 208 TYR D CZ  1 
ATOM   8022  O  OH  . TYR D 1 208 ? -71.446 -35.033 13.423  1.00 61.87  ? 208 TYR D OH  1 
ATOM   8023  N  N   . VAL D 1 209 ? -72.685 -28.932 16.795  1.00 33.89  ? 209 VAL D N   1 
ATOM   8024  C  CA  . VAL D 1 209 ? -71.889 -29.088 17.994  1.00 37.93  ? 209 VAL D CA  1 
ATOM   8025  C  C   . VAL D 1 209 ? -72.750 -29.214 19.252  1.00 43.96  ? 209 VAL D C   1 
ATOM   8026  O  O   . VAL D 1 209 ? -72.493 -30.049 20.104  1.00 55.37  ? 209 VAL D O   1 
ATOM   8027  C  CB  . VAL D 1 209 ? -70.894 -27.956 18.159  1.00 37.20  ? 209 VAL D CB  1 
ATOM   8028  C  CG1 . VAL D 1 209 ? -70.295 -27.975 19.554  1.00 33.47  ? 209 VAL D CG1 1 
ATOM   8029  C  CG2 . VAL D 1 209 ? -69.815 -28.050 17.100  1.00 27.86  ? 209 VAL D CG2 1 
ATOM   8030  N  N   . MET D 1 210 ? -73.789 -28.414 19.370  1.00 45.10  ? 210 MET D N   1 
ATOM   8031  C  CA  . MET D 1 210 ? -74.643 -28.523 20.539  1.00 42.82  ? 210 MET D CA  1 
ATOM   8032  C  C   . MET D 1 210 ? -75.310 -29.899 20.637  1.00 42.10  ? 210 MET D C   1 
ATOM   8033  O  O   . MET D 1 210 ? -75.449 -30.453 21.745  1.00 47.86  ? 210 MET D O   1 
ATOM   8034  C  CB  . MET D 1 210 ? -75.714 -27.419 20.559  1.00 39.25  ? 210 MET D CB  1 
ATOM   8035  C  CG  . MET D 1 210 ? -75.157 -26.014 20.900  1.00 39.20  ? 210 MET D CG  1 
ATOM   8036  S  SD  . MET D 1 210 ? -76.420 -24.835 21.351  1.00 47.08  ? 210 MET D SD  1 
ATOM   8037  C  CE  . MET D 1 210 ? -77.239 -24.635 19.789  1.00 22.54  ? 210 MET D CE  1 
ATOM   8038  N  N   . LEU D 1 211 ? -75.731 -30.442 19.490  1.00 46.08  ? 211 LEU D N   1 
ATOM   8039  C  CA  . LEU D 1 211 ? -76.496 -31.693 19.463  1.00 37.61  ? 211 LEU D CA  1 
ATOM   8040  C  C   . LEU D 1 211 ? -75.613 -32.922 19.582  1.00 45.17  ? 211 LEU D C   1 
ATOM   8041  O  O   . LEU D 1 211 ? -76.059 -33.945 20.128  1.00 41.48  ? 211 LEU D O   1 
ATOM   8042  C  CB  . LEU D 1 211 ? -77.315 -31.800 18.188  1.00 37.86  ? 211 LEU D CB  1 
ATOM   8043  C  CG  . LEU D 1 211 ? -78.476 -30.809 18.028  1.00 50.85  ? 211 LEU D CG  1 
ATOM   8044  C  CD1 . LEU D 1 211 ? -79.063 -30.917 16.627  1.00 55.21  ? 211 LEU D CD1 1 
ATOM   8045  C  CD2 . LEU D 1 211 ? -79.552 -31.096 19.042  1.00 52.02  ? 211 LEU D CD2 1 
ATOM   8046  N  N   . VAL D 1 212 ? -74.371 -32.807 19.088  1.00 44.86  ? 212 VAL D N   1 
ATOM   8047  C  CA  . VAL D 1 212 ? -73.471 -33.949 18.968  1.00 45.78  ? 212 VAL D CA  1 
ATOM   8048  C  C   . VAL D 1 212 ? -72.303 -33.880 19.955  1.00 45.35  ? 212 VAL D C   1 
ATOM   8049  O  O   . VAL D 1 212 ? -71.710 -34.894 20.341  1.00 43.11  ? 212 VAL D O   1 
ATOM   8050  C  CB  . VAL D 1 212 ? -72.956 -34.053 17.538  1.00 43.24  ? 212 VAL D CB  1 
ATOM   8051  C  CG1 . VAL D 1 212 ? -71.864 -35.097 17.425  1.00 33.92  ? 212 VAL D CG1 1 
ATOM   8052  C  CG2 . VAL D 1 212 ? -74.101 -34.396 16.627  1.00 47.63  ? 212 VAL D CG2 1 
ATOM   8053  N  N   . GLY D 1 213 ? -72.010 -32.667 20.387  1.00 40.97  ? 213 GLY D N   1 
ATOM   8054  C  CA  . GLY D 1 213 ? -71.024 -32.493 21.409  1.00 37.61  ? 213 GLY D CA  1 
ATOM   8055  C  C   . GLY D 1 213 ? -69.678 -32.491 20.756  1.00 40.76  ? 213 GLY D C   1 
ATOM   8056  O  O   . GLY D 1 213 ? -68.676 -32.556 21.449  1.00 51.01  ? 213 GLY D O   1 
ATOM   8057  N  N   . ALA D 1 214 ? -69.643 -32.406 19.429  1.00 43.17  ? 214 ALA D N   1 
ATOM   8058  C  CA  . ALA D 1 214 ? -68.367 -32.309 18.705  1.00 39.02  ? 214 ALA D CA  1 
ATOM   8059  C  C   . ALA D 1 214 ? -68.549 -31.635 17.371  1.00 40.87  ? 214 ALA D C   1 
ATOM   8060  O  O   . ALA D 1 214 ? -69.638 -31.641 16.816  1.00 36.22  ? 214 ALA D O   1 
ATOM   8061  C  CB  . ALA D 1 214 ? -67.748 -33.689 18.482  1.00 37.39  ? 214 ALA D CB  1 
ATOM   8062  N  N   . TYR D 1 215 ? -67.461 -31.103 16.837  1.00 48.13  ? 215 TYR D N   1 
ATOM   8063  C  CA  . TYR D 1 215 ? -67.465 -30.492 15.518  1.00 49.97  ? 215 TYR D CA  1 
ATOM   8064  C  C   . TYR D 1 215 ? -67.924 -31.427 14.407  1.00 52.51  ? 215 TYR D C   1 
ATOM   8065  O  O   . TYR D 1 215 ? -67.723 -32.621 14.461  1.00 70.16  ? 215 TYR D O   1 
ATOM   8066  C  CB  . TYR D 1 215 ? -66.080 -29.979 15.222  1.00 49.26  ? 215 TYR D CB  1 
ATOM   8067  C  CG  . TYR D 1 215 ? -65.776 -28.752 16.011  1.00 52.72  ? 215 TYR D CG  1 
ATOM   8068  C  CD1 . TYR D 1 215 ? -66.720 -27.755 16.141  1.00 46.06  ? 215 TYR D CD1 1 
ATOM   8069  C  CD2 . TYR D 1 215 ? -64.564 -28.591 16.641  1.00 57.38  ? 215 TYR D CD2 1 
ATOM   8070  C  CE1 . TYR D 1 215 ? -66.462 -26.611 16.864  1.00 44.57  ? 215 TYR D CE1 1 
ATOM   8071  C  CE2 . TYR D 1 215 ? -64.292 -27.447 17.365  1.00 52.02  ? 215 TYR D CE2 1 
ATOM   8072  C  CZ  . TYR D 1 215 ? -65.249 -26.453 17.474  1.00 51.08  ? 215 TYR D CZ  1 
ATOM   8073  O  OH  . TYR D 1 215 ? -65.003 -25.289 18.203  1.00 65.40  ? 215 TYR D OH  1 
ATOM   8074  N  N   . PRO D 1 216 ? -68.515 -30.871 13.360  1.00 60.52  ? 216 PRO D N   1 
ATOM   8075  C  CA  . PRO D 1 216 ? -69.212 -31.772 12.453  1.00 58.75  ? 216 PRO D CA  1 
ATOM   8076  C  C   . PRO D 1 216 ? -68.298 -32.336 11.372  1.00 59.82  ? 216 PRO D C   1 
ATOM   8077  O  O   . PRO D 1 216 ? -68.599 -33.428 10.875  1.00 68.46  ? 216 PRO D O   1 
ATOM   8078  C  CB  . PRO D 1 216 ? -70.291 -30.863 11.846  1.00 47.65  ? 216 PRO D CB  1 
ATOM   8079  C  CG  . PRO D 1 216 ? -70.015 -29.424 12.503  1.00 45.71  ? 216 PRO D CG  1 
ATOM   8080  C  CD  . PRO D 1 216 ? -68.619 -29.475 12.916  1.00 56.30  ? 216 PRO D CD  1 
ATOM   8081  N  N   . PHE D 1 217 ? -67.237 -31.637 10.997  1.00 33.76  ? 217 PHE D N   1 
ATOM   8082  C  CA  . PHE D 1 217 ? -66.354 -32.149 9.958   1.00 50.30  ? 217 PHE D CA  1 
ATOM   8083  C  C   . PHE D 1 217 ? -65.001 -32.514 10.545  1.00 65.58  ? 217 PHE D C   1 
ATOM   8084  O  O   . PHE D 1 217 ? -64.065 -31.716 10.497  1.00 67.41  ? 217 PHE D O   1 
ATOM   8085  C  CB  . PHE D 1 217 ? -66.196 -31.122 8.836   1.00 50.00  ? 217 PHE D CB  1 
ATOM   8086  C  CG  . PHE D 1 217 ? -67.503 -30.609 8.300   1.00 49.65  ? 217 PHE D CG  1 
ATOM   8087  C  CD1 . PHE D 1 217 ? -68.008 -29.391 8.720   1.00 47.97  ? 217 PHE D CD1 1 
ATOM   8088  C  CD2 . PHE D 1 217 ? -68.229 -31.347 7.382   1.00 32.60  ? 217 PHE D CD2 1 
ATOM   8089  C  CE1 . PHE D 1 217 ? -69.210 -28.917 8.231   1.00 46.61  ? 217 PHE D CE1 1 
ATOM   8090  C  CE2 . PHE D 1 217 ? -69.432 -30.878 6.889   1.00 35.55  ? 217 PHE D CE2 1 
ATOM   8091  C  CZ  . PHE D 1 217 ? -69.923 -29.662 7.315   1.00 39.87  ? 217 PHE D CZ  1 
ATOM   8092  N  N   . GLU D 1 218 ? -64.792 -33.702 11.019  1.00 80.00  ? 218 GLU D N   1 
ATOM   8093  C  CA  . GLU D 1 218 ? -63.528 -33.893 11.636  1.00 74.42  ? 218 GLU D CA  1 
ATOM   8094  C  C   . GLU D 1 218 ? -63.259 -35.315 11.534  1.00 61.63  ? 218 GLU D C   1 
ATOM   8095  O  O   . GLU D 1 218 ? -64.157 -36.086 11.592  1.00 68.55  ? 218 GLU D O   1 
ATOM   8096  C  CB  . GLU D 1 218 ? -63.659 -33.540 13.088  1.00 64.61  ? 218 GLU D CB  1 
ATOM   8097  C  CG  . GLU D 1 218 ? -62.900 -32.367 13.486  1.00 65.42  ? 218 GLU D CG  1 
ATOM   8098  C  CD  . GLU D 1 218 ? -62.848 -32.255 14.947  1.00 83.45  ? 218 GLU D CD  1 
ATOM   8099  O  OE1 . GLU D 1 218 ? -62.259 -31.306 15.441  1.00 81.45  ? 218 GLU D OE1 1 
ATOM   8100  O  OE2 . GLU D 1 218 ? -63.407 -33.123 15.609  1.00 84.94  ? 218 GLU D OE2 1 
ATOM   8101  N  N   . ASP D 1 219 ? -62.018 -35.683 11.376  1.00 65.83  ? 219 ASP D N   1 
ATOM   8102  C  CA  . ASP D 1 219 ? -61.727 -37.069 11.436  1.00 80.82  ? 219 ASP D CA  1 
ATOM   8103  C  C   . ASP D 1 219 ? -61.615 -37.311 12.880  1.00 70.88  ? 219 ASP D C   1 
ATOM   8104  O  O   . ASP D 1 219 ? -60.666 -36.886 13.490  1.00 64.70  ? 219 ASP D O   1 
ATOM   8105  C  CB  . ASP D 1 219 ? -60.398 -37.381 10.786  1.00 95.64  ? 219 ASP D CB  1 
ATOM   8106  C  CG  . ASP D 1 219 ? -60.140 -38.851 10.707  1.00 98.28  ? 219 ASP D CG  1 
ATOM   8107  O  OD1 . ASP D 1 219 ? -60.186 -39.383 9.592   1.00 101.94 ? 219 ASP D OD1 1 
ATOM   8108  O  OD2 . ASP D 1 219 ? -59.903 -39.468 11.763  1.00 95.62  ? 219 ASP D OD2 1 
ATOM   8109  N  N   . PRO D 1 220 ? -62.610 -37.976 13.424  1.00 86.82  ? 220 PRO D N   1 
ATOM   8110  C  CA  . PRO D 1 220 ? -62.644 -38.354 14.830  1.00 95.05  ? 220 PRO D CA  1 
ATOM   8111  C  C   . PRO D 1 220 ? -61.337 -38.977 15.303  1.00 95.05  ? 220 PRO D C   1 
ATOM   8112  O  O   . PRO D 1 220 ? -61.093 -39.033 16.487  1.00 89.55  ? 220 PRO D O   1 
ATOM   8113  C  CB  . PRO D 1 220 ? -63.722 -39.417 14.838  1.00 91.27  ? 220 PRO D CB  1 
ATOM   8114  C  CG  . PRO D 1 220 ? -63.483 -40.124 13.581  1.00 94.54  ? 220 PRO D CG  1 
ATOM   8115  C  CD  . PRO D 1 220 ? -63.048 -39.082 12.572  1.00 91.79  ? 220 PRO D CD  1 
ATOM   8116  N  N   . GLU D 1 221 ? -60.501 -39.424 14.386  1.00 94.09  ? 221 GLU D N   1 
ATOM   8117  C  CA  . GLU D 1 221 ? -59.259 -40.051 14.768  1.00 85.74  ? 221 GLU D CA  1 
ATOM   8118  C  C   . GLU D 1 221 ? -58.066 -39.139 14.626  1.00 73.64  ? 221 GLU D C   1 
ATOM   8119  O  O   . GLU D 1 221 ? -57.125 -39.218 15.396  1.00 59.91  ? 221 GLU D O   1 
ATOM   8120  C  CB  . GLU D 1 221 ? -59.045 -41.254 13.887  1.00 96.29  ? 221 GLU D CB  1 
ATOM   8121  C  CG  . GLU D 1 221 ? -60.088 -41.369 12.837  1.00 109.84 ? 221 GLU D CG  1 
ATOM   8122  C  CD  . GLU D 1 221 ? -60.110 -42.739 12.222  1.00 122.57 ? 221 GLU D CD  1 
ATOM   8123  O  OE1 . GLU D 1 221 ? -59.126 -43.102 11.542  1.00 122.85 ? 221 GLU D OE1 1 
ATOM   8124  O  OE2 . GLU D 1 221 ? -61.108 -43.454 12.426  1.00 129.18 ? 221 GLU D OE2 1 
ATOM   8125  N  N   . GLU D 1 222 ? -58.111 -38.281 13.617  1.00 87.52  ? 222 GLU D N   1 
ATOM   8126  C  CA  . GLU D 1 222 ? -56.979 -37.452 13.236  1.00 91.00  ? 222 GLU D CA  1 
ATOM   8127  C  C   . GLU D 1 222 ? -57.326 -35.981 13.294  1.00 90.00  ? 222 GLU D C   1 
ATOM   8128  O  O   . GLU D 1 222 ? -56.892 -35.201 12.473  1.00 90.55  ? 222 GLU D O   1 
ATOM   8129  C  CB  . GLU D 1 222 ? -56.602 -37.793 11.811  1.00 87.15  ? 222 GLU D CB  1 
ATOM   8130  C  CG  . GLU D 1 222 ? -55.292 -38.506 11.660  1.00 81.67  ? 222 GLU D CG  1 
ATOM   8131  C  CD  . GLU D 1 222 ? -54.135 -37.566 11.745  1.00 80.23  ? 222 GLU D CD  1 
ATOM   8132  O  OE1 . GLU D 1 222 ? -54.150 -36.706 12.637  1.00 75.65  ? 222 GLU D OE1 1 
ATOM   8133  O  OE2 . GLU D 1 222 ? -53.219 -37.683 10.925  1.00 82.85  ? 222 GLU D OE2 1 
ATOM   8134  N  N   . PRO D 1 223 ? -58.143 -35.618 14.278  1.00 79.53  ? 223 PRO D N   1 
ATOM   8135  C  CA  . PRO D 1 223 ? -58.632 -34.242 14.422  1.00 76.42  ? 223 PRO D CA  1 
ATOM   8136  C  C   . PRO D 1 223 ? -57.524 -33.202 14.302  1.00 84.19  ? 223 PRO D C   1 
ATOM   8137  O  O   . PRO D 1 223 ? -57.706 -32.188 13.630  1.00 90.78  ? 223 PRO D O   1 
ATOM   8138  C  CB  . PRO D 1 223 ? -59.220 -34.228 15.835  1.00 71.87  ? 223 PRO D CB  1 
ATOM   8139  C  CG  . PRO D 1 223 ? -58.487 -35.300 16.558  1.00 70.90  ? 223 PRO D CG  1 
ATOM   8140  C  CD  . PRO D 1 223 ? -58.222 -36.370 15.542  1.00 77.23  ? 223 PRO D CD  1 
ATOM   8141  N  N   . LYS D 1 224 ? -56.392 -33.450 14.950  1.00 86.05  ? 224 LYS D N   1 
ATOM   8142  C  CA  . LYS D 1 224 ? -55.270 -32.521 14.902  1.00 93.27  ? 224 LYS D CA  1 
ATOM   8143  C  C   . LYS D 1 224 ? -54.861 -32.234 13.461  1.00 87.61  ? 224 LYS D C   1 
ATOM   8144  O  O   . LYS D 1 224 ? -53.988 -31.405 13.207  1.00 83.66  ? 224 LYS D O   1 
ATOM   8145  C  CB  . LYS D 1 224 ? -54.092 -33.072 15.689  1.00 101.01 ? 224 LYS D CB  1 
ATOM   8146  N  N   . ASN D 1 225 ? -55.498 -32.926 12.522  1.00 82.37  ? 225 ASN D N   1 
ATOM   8147  C  CA  . ASN D 1 225 ? -55.182 -32.770 11.107  1.00 74.80  ? 225 ASN D CA  1 
ATOM   8148  C  C   . ASN D 1 225 ? -56.013 -31.687 10.428  1.00 70.24  ? 225 ASN D C   1 
ATOM   8149  O  O   . ASN D 1 225 ? -57.242 -31.737 10.436  1.00 66.33  ? 225 ASN D O   1 
ATOM   8150  C  CB  . ASN D 1 225 ? -55.354 -34.101 10.372  1.00 66.43  ? 225 ASN D CB  1 
ATOM   8151  C  CG  . ASN D 1 225 ? -54.367 -34.270 9.237   1.00 64.60  ? 225 ASN D CG  1 
ATOM   8152  O  OD1 . ASN D 1 225 ? -54.296 -33.438 8.332   1.00 69.14  ? 225 ASN D OD1 1 
ATOM   8153  N  ND2 . ASN D 1 225 ? -53.596 -35.350 9.279   1.00 61.52  ? 225 ASN D ND2 1 
ATOM   8154  N  N   . PHE D 1 226 ? -55.332 -30.710 9.838   1.00 71.09  ? 226 PHE D N   1 
ATOM   8155  C  CA  . PHE D 1 226 ? -55.999 -29.618 9.138   1.00 53.82  ? 226 PHE D CA  1 
ATOM   8156  C  C   . PHE D 1 226 ? -56.460 -30.062 7.754   1.00 57.24  ? 226 PHE D C   1 
ATOM   8157  O  O   . PHE D 1 226 ? -57.600 -29.819 7.359   1.00 62.52  ? 226 PHE D O   1 
ATOM   8158  C  CB  . PHE D 1 226 ? -55.067 -28.412 9.022   1.00 49.44  ? 226 PHE D CB  1 
ATOM   8159  C  CG  . PHE D 1 226 ? -55.690 -27.226 8.344   1.00 67.29  ? 226 PHE D CG  1 
ATOM   8160  C  CD1 . PHE D 1 226 ? -56.252 -26.203 9.087   1.00 73.35  ? 226 PHE D CD1 1 
ATOM   8161  C  CD2 . PHE D 1 226 ? -55.713 -27.134 6.963   1.00 67.13  ? 226 PHE D CD2 1 
ATOM   8162  C  CE1 . PHE D 1 226 ? -56.826 -25.110 8.465   1.00 77.47  ? 226 PHE D CE1 1 
ATOM   8163  C  CE2 . PHE D 1 226 ? -56.286 -26.044 6.336   1.00 71.09  ? 226 PHE D CE2 1 
ATOM   8164  C  CZ  . PHE D 1 226 ? -56.842 -25.031 7.088   1.00 70.75  ? 226 PHE D CZ  1 
ATOM   8165  N  N   . ARG D 1 227 ? -55.564 -30.715 7.022   1.00 59.22  ? 227 ARG D N   1 
ATOM   8166  C  CA  . ARG D 1 227 ? -55.875 -31.218 5.689   1.00 53.74  ? 227 ARG D CA  1 
ATOM   8167  C  C   . ARG D 1 227 ? -57.086 -32.146 5.705   1.00 52.64  ? 227 ARG D C   1 
ATOM   8168  O  O   . ARG D 1 227 ? -57.979 -32.029 4.868   1.00 59.19  ? 227 ARG D O   1 
ATOM   8169  C  CB  . ARG D 1 227 ? -54.665 -31.940 5.092   1.00 41.93  ? 227 ARG D CB  1 
ATOM   8170  C  CG  . ARG D 1 227 ? -54.985 -33.297 4.490   1.00 67.61  ? 227 ARG D CG  1 
ATOM   8171  C  CD  . ARG D 1 227 ? -54.478 -33.403 3.062   1.00 68.05  ? 227 ARG D CD  1 
ATOM   8172  N  NE  . ARG D 1 227 ? -53.171 -32.774 2.897   1.00 68.82  ? 227 ARG D NE  1 
ATOM   8173  C  CZ  . ARG D 1 227 ? -52.301 -33.099 1.947   1.00 71.00  ? 227 ARG D CZ  1 
ATOM   8174  N  NH1 . ARG D 1 227 ? -51.134 -32.474 1.872   1.00 66.10  ? 227 ARG D NH1 1 
ATOM   8175  N  NH2 . ARG D 1 227 ? -52.595 -34.051 1.072   1.00 60.91  ? 227 ARG D NH2 1 
ATOM   8176  N  N   . LYS D 1 228 ? -57.108 -33.068 6.661   1.00 55.27  ? 228 LYS D N   1 
ATOM   8177  C  CA  . LYS D 1 228 ? -58.202 -34.023 6.778   1.00 69.49  ? 228 LYS D CA  1 
ATOM   8178  C  C   . LYS D 1 228 ? -59.529 -33.324 7.055   1.00 64.71  ? 228 LYS D C   1 
ATOM   8179  O  O   . LYS D 1 228 ? -60.569 -33.716 6.526   1.00 58.42  ? 228 LYS D O   1 
ATOM   8180  C  CB  . LYS D 1 228 ? -57.907 -35.040 7.881   1.00 66.32  ? 228 LYS D CB  1 
ATOM   8181  C  CG  . LYS D 1 228 ? -57.568 -36.430 7.370   1.00 70.11  ? 228 LYS D CG  1 
ATOM   8182  C  CD  . LYS D 1 228 ? -57.080 -37.327 8.495   1.00 81.44  ? 228 LYS D CD  1 
ATOM   8183  C  CE  . LYS D 1 228 ? -56.085 -38.358 7.988   1.00 76.45  ? 228 LYS D CE  1 
ATOM   8184  N  NZ  . LYS D 1 228 ? -55.822 -39.418 9.000   1.00 78.36  ? 228 LYS D NZ  1 
ATOM   8185  N  N   . THR D 1 229 ? -59.485 -32.291 7.889   1.00 53.70  ? 229 THR D N   1 
ATOM   8186  C  CA  . THR D 1 229 ? -60.687 -31.553 8.259   1.00 54.64  ? 229 THR D CA  1 
ATOM   8187  C  C   . THR D 1 229 ? -61.199 -30.691 7.110   1.00 55.67  ? 229 THR D C   1 
ATOM   8188  O  O   . THR D 1 229 ? -62.400 -30.643 6.847   1.00 52.11  ? 229 THR D O   1 
ATOM   8189  C  CB  . THR D 1 229 ? -60.437 -30.653 9.485   1.00 57.11  ? 229 THR D CB  1 
ATOM   8190  O  OG1 . THR D 1 229 ? -60.314 -31.464 10.660  1.00 69.82  ? 229 THR D OG1 1 
ATOM   8191  C  CG2 . THR D 1 229 ? -61.586 -29.675 9.670   1.00 57.24  ? 229 THR D CG2 1 
ATOM   8192  N  N   . ILE D 1 230 ? -60.281 -30.011 6.432   1.00 40.43  ? 230 ILE D N   1 
ATOM   8193  C  CA  . ILE D 1 230 ? -60.642 -29.117 5.338   1.00 52.13  ? 230 ILE D CA  1 
ATOM   8194  C  C   . ILE D 1 230 ? -61.306 -29.860 4.183   1.00 52.61  ? 230 ILE D C   1 
ATOM   8195  O  O   . ILE D 1 230 ? -62.238 -29.350 3.563   1.00 57.82  ? 230 ILE D O   1 
ATOM   8196  C  CB  . ILE D 1 230 ? -59.413 -28.357 4.804   1.00 45.60  ? 230 ILE D CB  1 
ATOM   8197  C  CG1 . ILE D 1 230 ? -59.734 -26.870 4.645   1.00 55.91  ? 230 ILE D CG1 1 
ATOM   8198  C  CG2 . ILE D 1 230 ? -58.953 -28.949 3.482   1.00 54.62  ? 230 ILE D CG2 1 
ATOM   8199  C  CD1 . ILE D 1 230 ? -59.095 -25.992 5.697   1.00 71.27  ? 230 ILE D CD1 1 
ATOM   8200  N  N   . HIS D 1 231 ? -60.819 -31.063 3.897   1.00 49.40  ? 231 HIS D N   1 
ATOM   8201  C  CA  . HIS D 1 231 ? -61.343 -31.851 2.789   1.00 51.56  ? 231 HIS D CA  1 
ATOM   8202  C  C   . HIS D 1 231 ? -62.782 -32.286 3.042   1.00 44.64  ? 231 HIS D C   1 
ATOM   8203  O  O   . HIS D 1 231 ? -63.555 -32.482 2.106   1.00 45.86  ? 231 HIS D O   1 
ATOM   8204  C  CB  . HIS D 1 231 ? -60.458 -33.075 2.540   1.00 42.88  ? 231 HIS D CB  1 
ATOM   8205  C  CG  . HIS D 1 231 ? -60.891 -33.907 1.374   1.00 54.85  ? 231 HIS D CG  1 
ATOM   8206  N  ND1 . HIS D 1 231 ? -60.276 -33.836 0.142   1.00 57.87  ? 231 HIS D ND1 1 
ATOM   8207  C  CD2 . HIS D 1 231 ? -61.876 -34.826 1.251   1.00 44.13  ? 231 HIS D CD2 1 
ATOM   8208  C  CE1 . HIS D 1 231 ? -60.865 -34.676 -0.689  1.00 54.29  ? 231 HIS D CE1 1 
ATOM   8209  N  NE2 . HIS D 1 231 ? -61.840 -35.289 -0.042  1.00 51.74  ? 231 HIS D NE2 1 
ATOM   8210  N  N   . ARG D 1 232 ? -63.134 -32.436 4.314   1.00 45.08  ? 232 ARG D N   1 
ATOM   8211  C  CA  . ARG D 1 232 ? -64.472 -32.876 4.694   1.00 59.10  ? 232 ARG D CA  1 
ATOM   8212  C  C   . ARG D 1 232 ? -65.495 -31.747 4.595   1.00 62.97  ? 232 ARG D C   1 
ATOM   8213  O  O   . ARG D 1 232 ? -66.694 -31.994 4.489   1.00 71.37  ? 232 ARG D O   1 
ATOM   8214  C  CB  . ARG D 1 232 ? -64.465 -33.457 6.110   1.00 56.91  ? 232 ARG D CB  1 
ATOM   8215  C  CG  . ARG D 1 232 ? -64.064 -34.921 6.174   1.00 65.55  ? 232 ARG D CG  1 
ATOM   8216  C  CD  . ARG D 1 232 ? -63.508 -35.282 7.541   1.00 59.97  ? 232 ARG D CD  1 
ATOM   8217  N  NE  . ARG D 1 232 ? -64.447 -36.087 8.317   1.00 85.51  ? 232 ARG D NE  1 
ATOM   8218  C  CZ  . ARG D 1 232 ? -65.042 -37.185 7.862   1.00 96.04  ? 232 ARG D CZ  1 
ATOM   8219  N  NH1 . ARG D 1 232 ? -64.798 -37.613 6.631   1.00 96.28  ? 232 ARG D NH1 1 
ATOM   8220  N  NH2 . ARG D 1 232 ? -65.883 -37.854 8.639   1.00 94.28  ? 232 ARG D NH2 1 
ATOM   8221  N  N   . ILE D 1 233 ? -65.013 -30.510 4.629   1.00 56.21  ? 233 ILE D N   1 
ATOM   8222  C  CA  . ILE D 1 233 ? -65.885 -29.346 4.526   1.00 54.58  ? 233 ILE D CA  1 
ATOM   8223  C  C   . ILE D 1 233 ? -66.291 -29.101 3.077   1.00 48.14  ? 233 ILE D C   1 
ATOM   8224  O  O   . ILE D 1 233 ? -67.440 -28.765 2.792   1.00 50.28  ? 233 ILE D O   1 
ATOM   8225  C  CB  . ILE D 1 233 ? -65.208 -28.082 5.086   1.00 53.54  ? 233 ILE D CB  1 
ATOM   8226  C  CG1 . ILE D 1 233 ? -65.156 -28.139 6.613   1.00 50.75  ? 233 ILE D CG1 1 
ATOM   8227  C  CG2 . ILE D 1 233 ? -65.941 -26.835 4.621   1.00 38.66  ? 233 ILE D CG2 1 
ATOM   8228  C  CD1 . ILE D 1 233 ? -63.851 -27.648 7.198   1.00 36.15  ? 233 ILE D CD1 1 
ATOM   8229  N  N   . LEU D 1 234 ? -65.330 -29.240 2.170   1.00 40.64  ? 234 LEU D N   1 
ATOM   8230  C  CA  . LEU D 1 234 ? -65.566 -28.980 0.756   1.00 51.31  ? 234 LEU D CA  1 
ATOM   8231  C  C   . LEU D 1 234 ? -66.469 -30.045 0.149   1.00 43.80  ? 234 LEU D C   1 
ATOM   8232  O  O   . LEU D 1 234 ? -67.156 -29.801 -0.842  1.00 68.15  ? 234 LEU D O   1 
ATOM   8233  C  CB  . LEU D 1 234 ? -64.240 -28.914 -0.003  1.00 49.56  ? 234 LEU D CB  1 
ATOM   8234  C  CG  . LEU D 1 234 ? -63.124 -28.121 0.679   1.00 53.08  ? 234 LEU D CG  1 
ATOM   8235  C  CD1 . LEU D 1 234 ? -61.852 -28.150 -0.152  1.00 51.84  ? 234 LEU D CD1 1 
ATOM   8236  C  CD2 . LEU D 1 234 ? -63.564 -26.690 0.943   1.00 46.60  ? 234 LEU D CD2 1 
ATOM   8237  N  N   . ASN D 1 235 ? -66.465 -31.226 0.755   1.00 45.44  ? 235 ASN D N   1 
ATOM   8238  C  CA  . ASN D 1 235 ? -67.295 -32.327 0.289   1.00 60.35  ? 235 ASN D CA  1 
ATOM   8239  C  C   . ASN D 1 235 ? -68.458 -32.586 1.237   1.00 59.08  ? 235 ASN D C   1 
ATOM   8240  O  O   . ASN D 1 235 ? -69.165 -33.586 1.112   1.00 67.84  ? 235 ASN D O   1 
ATOM   8241  C  CB  . ASN D 1 235 ? -66.453 -33.592 0.119   1.00 69.52  ? 235 ASN D CB  1 
ATOM   8242  C  CG  . ASN D 1 235 ? -65.020 -33.287 -0.267  1.00 62.21  ? 235 ASN D CG  1 
ATOM   8243  O  OD1 . ASN D 1 235 ? -64.150 -33.149 0.593   1.00 80.99  ? 235 ASN D OD1 1 
ATOM   8244  N  ND2 . ASN D 1 235 ? -64.768 -33.176 -1.565  1.00 42.42  ? 235 ASN D ND2 1 
ATOM   8245  N  N   . VAL D 1 236 ? -68.650 -31.675 2.185   1.00 50.90  ? 236 VAL D N   1 
ATOM   8246  C  CA  . VAL D 1 236 ? -69.733 -31.788 3.153   1.00 60.24  ? 236 VAL D CA  1 
ATOM   8247  C  C   . VAL D 1 236 ? -69.805 -33.192 3.744   1.00 59.94  ? 236 VAL D C   1 
ATOM   8248  O  O   . VAL D 1 236 ? -70.878 -33.788 3.823   1.00 60.84  ? 236 VAL D O   1 
ATOM   8249  C  CB  . VAL D 1 236 ? -71.091 -31.433 2.521   1.00 58.76  ? 236 VAL D CB  1 
ATOM   8250  C  CG1 . VAL D 1 236 ? -72.162 -31.326 3.594   1.00 74.57  ? 236 VAL D CG1 1 
ATOM   8251  C  CG2 . VAL D 1 236 ? -70.985 -30.136 1.735   1.00 36.15  ? 236 VAL D CG2 1 
ATOM   8252  N  N   . GLN D 1 237 ? -68.655 -33.713 4.160   1.00 56.34  ? 237 GLN D N   1 
ATOM   8253  C  CA  . GLN D 1 237 ? -68.588 -35.040 4.758   1.00 54.27  ? 237 GLN D CA  1 
ATOM   8254  C  C   . GLN D 1 237 ? -68.868 -34.976 6.255   1.00 48.16  ? 237 GLN D C   1 
ATOM   8255  O  O   . GLN D 1 237 ? -68.006 -34.587 7.041   1.00 64.57  ? 237 GLN D O   1 
ATOM   8256  C  CB  . GLN D 1 237 ? -67.218 -35.673 4.506   1.00 60.52  ? 237 GLN D CB  1 
ATOM   8257  C  CG  . GLN D 1 237 ? -66.599 -35.301 3.169   1.00 81.25  ? 237 GLN D CG  1 
ATOM   8258  C  CD  . GLN D 1 237 ? -65.797 -36.435 2.563   1.00 83.38  ? 237 GLN D CD  1 
ATOM   8259  O  OE1 . GLN D 1 237 ? -65.954 -36.764 1.387   1.00 80.11  ? 237 GLN D OE1 1 
ATOM   8260  N  NE2 . GLN D 1 237 ? -64.929 -37.041 3.366   1.00 74.33  ? 237 GLN D NE2 1 
ATOM   8261  N  N   . TYR D 1 238 ? -70.080 -35.358 6.642   1.00 38.38  ? 238 TYR D N   1 
ATOM   8262  C  CA  . TYR D 1 238 ? -70.483 -35.336 8.042   1.00 50.47  ? 238 TYR D CA  1 
ATOM   8263  C  C   . TYR D 1 238 ? -71.556 -36.383 8.313   1.00 60.92  ? 238 TYR D C   1 
ATOM   8264  O  O   . TYR D 1 238 ? -72.373 -36.683 7.444   1.00 64.78  ? 238 TYR D O   1 
ATOM   8265  C  CB  . TYR D 1 238 ? -71.004 -33.950 8.424   1.00 34.45  ? 238 TYR D CB  1 
ATOM   8266  C  CG  . TYR D 1 238 ? -72.450 -33.721 8.047   1.00 43.32  ? 238 TYR D CG  1 
ATOM   8267  C  CD1 . TYR D 1 238 ? -73.472 -33.980 8.949   1.00 47.59  ? 238 TYR D CD1 1 
ATOM   8268  C  CD2 . TYR D 1 238 ? -72.793 -33.250 6.787   1.00 38.26  ? 238 TYR D CD2 1 
ATOM   8269  C  CE1 . TYR D 1 238 ? -74.794 -33.774 8.608   1.00 44.93  ? 238 TYR D CE1 1 
ATOM   8270  C  CE2 . TYR D 1 238 ? -74.112 -33.042 6.437   1.00 39.32  ? 238 TYR D CE2 1 
ATOM   8271  C  CZ  . TYR D 1 238 ? -75.108 -33.305 7.352   1.00 38.22  ? 238 TYR D CZ  1 
ATOM   8272  O  OH  . TYR D 1 238 ? -76.424 -33.099 7.009   1.00 47.65  ? 238 TYR D OH  1 
ATOM   8273  N  N   . ALA D 1 239 ? -71.552 -36.936 9.521   1.00 64.65  ? 239 ALA D N   1 
ATOM   8274  C  CA  . ALA D 1 239 ? -72.553 -37.951 9.900   1.00 62.06  ? 239 ALA D CA  1 
ATOM   8275  C  C   . ALA D 1 239 ? -72.941 -37.826 11.359  1.00 56.18  ? 239 ALA D C   1 
ATOM   8276  O  O   . ALA D 1 239 ? -72.072 -37.956 12.225  1.00 46.25  ? 239 ALA D O   1 
ATOM   8277  C  CB  . ALA D 1 239 ? -71.990 -39.345 9.671   1.00 56.71  ? 239 ALA D CB  1 
ATOM   8278  N  N   . ILE D 1 240 ? -74.220 -37.624 11.655  1.00 42.30  ? 240 ILE D N   1 
ATOM   8279  C  CA  . ILE D 1 240 ? -74.668 -37.611 13.044  1.00 38.09  ? 240 ILE D CA  1 
ATOM   8280  C  C   . ILE D 1 240 ? -74.584 -39.020 13.632  1.00 58.01  ? 240 ILE D C   1 
ATOM   8281  O  O   . ILE D 1 240 ? -75.181 -39.953 13.095  1.00 67.00  ? 240 ILE D O   1 
ATOM   8282  C  CB  . ILE D 1 240 ? -76.112 -37.097 13.166  1.00 40.22  ? 240 ILE D CB  1 
ATOM   8283  C  CG1 . ILE D 1 240 ? -76.166 -35.592 12.899  1.00 45.16  ? 240 ILE D CG1 1 
ATOM   8284  C  CG2 . ILE D 1 240 ? -76.679 -37.421 14.538  1.00 47.59  ? 240 ILE D CG2 1 
ATOM   8285  C  CD1 . ILE D 1 240 ? -77.085 -35.206 11.762  1.00 43.31  ? 240 ILE D CD1 1 
ATOM   8286  N  N   . PRO D 1 241 ? -73.844 -39.181 14.728  1.00 54.62  ? 241 PRO D N   1 
ATOM   8287  C  CA  . PRO D 1 241 ? -73.654 -40.509 15.315  1.00 47.59  ? 241 PRO D CA  1 
ATOM   8288  C  C   . PRO D 1 241 ? -74.959 -41.118 15.813  1.00 68.42  ? 241 PRO D C   1 
ATOM   8289  O  O   . PRO D 1 241 ? -75.885 -40.384 16.162  1.00 60.68  ? 241 PRO D O   1 
ATOM   8290  C  CB  . PRO D 1 241 ? -72.672 -40.263 16.469  1.00 48.43  ? 241 PRO D CB  1 
ATOM   8291  C  CG  . PRO D 1 241 ? -72.568 -38.789 16.626  1.00 47.06  ? 241 PRO D CG  1 
ATOM   8292  C  CD  . PRO D 1 241 ? -72.947 -38.182 15.325  1.00 51.33  ? 241 PRO D CD  1 
ATOM   8293  N  N   . ASP D 1 242 ? -75.023 -42.454 15.828  1.00 81.11  ? 242 ASP D N   1 
ATOM   8294  C  CA  . ASP D 1 242 ? -76.261 -43.190 16.124  1.00 78.70  ? 242 ASP D CA  1 
ATOM   8295  C  C   . ASP D 1 242 ? -76.774 -43.072 17.556  1.00 63.08  ? 242 ASP D C   1 
ATOM   8296  O  O   . ASP D 1 242 ? -77.956 -43.313 17.798  1.00 57.74  ? 242 ASP D O   1 
ATOM   8297  C  CB  . ASP D 1 242 ? -76.122 -44.664 15.746  1.00 102.54 ? 242 ASP D CB  1 
ATOM   8298  C  CG  . ASP D 1 242 ? -74.716 -45.011 15.307  1.00 124.84 ? 242 ASP D CG  1 
ATOM   8299  O  OD1 . ASP D 1 242 ? -74.384 -44.745 14.125  1.00 130.34 ? 242 ASP D OD1 1 
ATOM   8300  O  OD2 . ASP D 1 242 ? -73.944 -45.541 16.140  1.00 131.55 ? 242 ASP D OD2 1 
ATOM   8301  N  N   . TYR D 1 243 ? -75.911 -42.711 18.504  1.00 64.50  ? 243 TYR D N   1 
ATOM   8302  C  CA  . TYR D 1 243 ? -76.435 -42.397 19.833  1.00 64.28  ? 243 TYR D CA  1 
ATOM   8303  C  C   . TYR D 1 243 ? -77.273 -41.123 19.872  1.00 70.46  ? 243 TYR D C   1 
ATOM   8304  O  O   . TYR D 1 243 ? -78.192 -40.995 20.696  1.00 73.22  ? 243 TYR D O   1 
ATOM   8305  C  CB  . TYR D 1 243 ? -75.372 -42.383 20.918  1.00 47.19  ? 243 TYR D CB  1 
ATOM   8306  C  CG  . TYR D 1 243 ? -74.057 -41.727 20.614  1.00 48.51  ? 243 TYR D CG  1 
ATOM   8307  C  CD1 . TYR D 1 243 ? -73.722 -40.502 21.179  1.00 43.25  ? 243 TYR D CD1 1 
ATOM   8308  C  CD2 . TYR D 1 243 ? -73.098 -42.380 19.852  1.00 54.41  ? 243 TYR D CD2 1 
ATOM   8309  C  CE1 . TYR D 1 243 ? -72.467 -39.934 20.955  1.00 41.64  ? 243 TYR D CE1 1 
ATOM   8310  C  CE2 . TYR D 1 243 ? -71.860 -41.808 19.608  1.00 53.45  ? 243 TYR D CE2 1 
ATOM   8311  C  CZ  . TYR D 1 243 ? -71.552 -40.584 20.163  1.00 55.15  ? 243 TYR D CZ  1 
ATOM   8312  O  OH  . TYR D 1 243 ? -70.316 -40.021 19.918  1.00 68.32  ? 243 TYR D OH  1 
ATOM   8313  N  N   . VAL D 1 244 ? -76.985 -40.192 18.969  1.00 58.47  ? 244 VAL D N   1 
ATOM   8314  C  CA  . VAL D 1 244 ? -77.710 -38.943 18.984  1.00 47.85  ? 244 VAL D CA  1 
ATOM   8315  C  C   . VAL D 1 244 ? -79.010 -39.183 18.275  1.00 58.97  ? 244 VAL D C   1 
ATOM   8316  O  O   . VAL D 1 244 ? -79.025 -39.479 17.085  1.00 63.99  ? 244 VAL D O   1 
ATOM   8317  C  CB  . VAL D 1 244 ? -76.945 -37.837 18.281  1.00 53.65  ? 244 VAL D CB  1 
ATOM   8318  C  CG1 . VAL D 1 244 ? -77.676 -36.524 18.460  1.00 58.01  ? 244 VAL D CG1 1 
ATOM   8319  C  CG2 . VAL D 1 244 ? -75.487 -37.785 18.795  1.00 50.64  ? 244 VAL D CG2 1 
ATOM   8320  N  N   . HIS D 1 245 ? -80.102 -39.082 19.023  1.00 65.31  ? 245 HIS D N   1 
ATOM   8321  C  CA  . HIS D 1 245 ? -81.429 -39.239 18.446  1.00 77.57  ? 245 HIS D CA  1 
ATOM   8322  C  C   . HIS D 1 245 ? -82.028 -37.877 18.149  1.00 67.56  ? 245 HIS D C   1 
ATOM   8323  O  O   . HIS D 1 245 ? -82.129 -37.015 19.018  1.00 59.77  ? 245 HIS D O   1 
ATOM   8324  C  CB  . HIS D 1 245 ? -82.334 -40.087 19.354  1.00 87.90  ? 245 HIS D CB  1 
ATOM   8325  C  CG  . HIS D 1 245 ? -81.871 -41.504 19.497  1.00 99.01  ? 245 HIS D CG  1 
ATOM   8326  N  ND1 . HIS D 1 245 ? -81.157 -42.157 18.514  1.00 100.97 ? 245 HIS D ND1 1 
ATOM   8327  C  CD2 . HIS D 1 245 ? -81.997 -42.390 20.518  1.00 102.18 ? 245 HIS D CD2 1 
ATOM   8328  C  CE1 . HIS D 1 245 ? -80.872 -43.383 18.914  1.00 99.19  ? 245 HIS D CE1 1 
ATOM   8329  N  NE2 . HIS D 1 245 ? -81.372 -43.549 20.125  1.00 103.67 ? 245 HIS D NE2 1 
ATOM   8330  N  N   . ILE D 1 246 ? -82.421 -37.681 16.903  1.00 67.07  ? 246 ILE D N   1 
ATOM   8331  C  CA  . ILE D 1 246 ? -82.766 -36.346 16.462  1.00 64.43  ? 246 ILE D CA  1 
ATOM   8332  C  C   . ILE D 1 246 ? -84.053 -36.393 15.685  1.00 57.18  ? 246 ILE D C   1 
ATOM   8333  O  O   . ILE D 1 246 ? -84.197 -37.163 14.730  1.00 60.41  ? 246 ILE D O   1 
ATOM   8334  C  CB  . ILE D 1 246 ? -81.655 -35.754 15.567  1.00 58.04  ? 246 ILE D CB  1 
ATOM   8335  C  CG1 . ILE D 1 246 ? -80.880 -34.681 16.299  1.00 56.46  ? 246 ILE D CG1 1 
ATOM   8336  C  CG2 . ILE D 1 246 ? -82.226 -35.091 14.335  1.00 71.88  ? 246 ILE D CG2 1 
ATOM   8337  C  CD1 . ILE D 1 246 ? -79.968 -33.913 15.330  1.00 58.12  ? 246 ILE D CD1 1 
ATOM   8338  N  N   . SER D 1 247 ? -85.002 -35.567 16.093  1.00 50.62  ? 247 SER D N   1 
ATOM   8339  C  CA  . SER D 1 247 ? -86.247 -35.517 15.359  1.00 47.12  ? 247 SER D CA  1 
ATOM   8340  C  C   . SER D 1 247 ? -85.933 -35.321 13.889  1.00 52.62  ? 247 SER D C   1 
ATOM   8341  O  O   . SER D 1 247 ? -84.934 -34.715 13.539  1.00 54.37  ? 247 SER D O   1 
ATOM   8342  C  CB  . SER D 1 247 ? -87.114 -34.395 15.863  1.00 53.55  ? 247 SER D CB  1 
ATOM   8343  O  OG  . SER D 1 247 ? -86.562 -33.155 15.472  1.00 73.98  ? 247 SER D OG  1 
ATOM   8344  N  N   . PRO D 1 248 ? -86.765 -35.877 13.008  1.00 71.97  ? 248 PRO D N   1 
ATOM   8345  C  CA  . PRO D 1 248 ? -86.440 -35.730 11.586  1.00 71.36  ? 248 PRO D CA  1 
ATOM   8346  C  C   . PRO D 1 248 ? -86.563 -34.269 11.111  1.00 66.02  ? 248 PRO D C   1 
ATOM   8347  O  O   . PRO D 1 248 ? -85.860 -33.859 10.190  1.00 67.80  ? 248 PRO D O   1 
ATOM   8348  C  CB  . PRO D 1 248 ? -87.447 -36.666 10.892  1.00 64.97  ? 248 PRO D CB  1 
ATOM   8349  C  CG  . PRO D 1 248 ? -88.560 -36.809 11.864  1.00 72.51  ? 248 PRO D CG  1 
ATOM   8350  C  CD  . PRO D 1 248 ? -87.928 -36.748 13.232  1.00 77.23  ? 248 PRO D CD  1 
ATOM   8351  N  N   . GLU D 1 249 ? -87.419 -33.473 11.729  1.00 69.19  ? 249 GLU D N   1 
ATOM   8352  C  CA  . GLU D 1 249 ? -87.448 -32.056 11.370  1.00 74.43  ? 249 GLU D CA  1 
ATOM   8353  C  C   . GLU D 1 249 ? -86.064 -31.463 11.647  1.00 67.75  ? 249 GLU D C   1 
ATOM   8354  O  O   . GLU D 1 249 ? -85.502 -30.722 10.837  1.00 58.24  ? 249 GLU D O   1 
ATOM   8355  C  CB  . GLU D 1 249 ? -88.500 -31.287 12.180  1.00 87.28  ? 249 GLU D CB  1 
ATOM   8356  C  CG  . GLU D 1 249 ? -89.878 -31.934 12.228  1.00 95.98  ? 249 GLU D CG  1 
ATOM   8357  C  CD  . GLU D 1 249 ? -89.931 -33.116 13.183  1.00 98.24  ? 249 GLU D CD  1 
ATOM   8358  O  OE1 . GLU D 1 249 ? -89.148 -33.119 14.166  1.00 97.96  ? 249 GLU D OE1 1 
ATOM   8359  O  OE2 . GLU D 1 249 ? -90.748 -34.040 12.951  1.00 100.90 ? 249 GLU D OE2 1 
ATOM   8360  N  N   . CYS D 1 250 ? -85.514 -31.794 12.809  1.00 60.32  ? 250 CYS D N   1 
ATOM   8361  C  CA  . CYS D 1 250 ? -84.204 -31.296 13.165  1.00 47.35  ? 250 CYS D CA  1 
ATOM   8362  C  C   . CYS D 1 250 ? -83.206 -31.755 12.142  1.00 51.08  ? 250 CYS D C   1 
ATOM   8363  O  O   . CYS D 1 250 ? -82.292 -31.010 11.793  1.00 62.70  ? 250 CYS D O   1 
ATOM   8364  C  CB  . CYS D 1 250 ? -83.789 -31.778 14.549  1.00 42.13  ? 250 CYS D CB  1 
ATOM   8365  S  SG  . CYS D 1 250 ? -82.160 -31.127 15.103  1.00 65.59  ? 250 CYS D SG  1 
ATOM   8366  N  N   . ARG D 1 251 ? -83.345 -33.002 11.704  1.00 56.28  ? 251 ARG D N   1 
ATOM   8367  C  CA  . ARG D 1 251 ? -82.405 -33.593 10.763  1.00 55.06  ? 251 ARG D CA  1 
ATOM   8368  C  C   . ARG D 1 251 ? -82.524 -32.913 9.411   1.00 49.97  ? 251 ARG D C   1 
ATOM   8369  O  O   . ARG D 1 251 ? -81.545 -32.785 8.678   1.00 44.36  ? 251 ARG D O   1 
ATOM   8370  C  CB  . ARG D 1 251 ? -82.658 -35.095 10.622  1.00 59.54  ? 251 ARG D CB  1 
ATOM   8371  C  CG  . ARG D 1 251 ? -81.477 -35.874 10.071  1.00 69.13  ? 251 ARG D CG  1 
ATOM   8372  C  CD  . ARG D 1 251 ? -81.744 -37.369 10.088  1.00 68.80  ? 251 ARG D CD  1 
ATOM   8373  N  NE  . ARG D 1 251 ? -81.899 -37.882 11.446  1.00 61.64  ? 251 ARG D NE  1 
ATOM   8374  C  CZ  . ARG D 1 251 ? -80.955 -38.538 12.110  1.00 54.61  ? 251 ARG D CZ  1 
ATOM   8375  N  NH1 . ARG D 1 251 ? -79.779 -38.765 11.541  1.00 40.50  ? 251 ARG D NH1 1 
ATOM   8376  N  NH2 . ARG D 1 251 ? -81.184 -38.966 13.342  1.00 58.39  ? 251 ARG D NH2 1 
ATOM   8377  N  N   . HIS D 1 252 ? -83.735 -32.475 9.089   1.00 53.05  ? 252 HIS D N   1 
ATOM   8378  C  CA  . HIS D 1 252 ? -83.976 -31.772 7.838   1.00 60.76  ? 252 HIS D CA  1 
ATOM   8379  C  C   . HIS D 1 252 ? -83.310 -30.386 7.842   1.00 65.59  ? 252 HIS D C   1 
ATOM   8380  O  O   . HIS D 1 252 ? -82.576 -30.037 6.918   1.00 60.06  ? 252 HIS D O   1 
ATOM   8381  C  CB  . HIS D 1 252 ? -85.475 -31.619 7.590   1.00 66.12  ? 252 HIS D CB  1 
ATOM   8382  C  CG  . HIS D 1 252 ? -85.795 -30.929 6.304   1.00 68.48  ? 252 HIS D CG  1 
ATOM   8383  N  ND1 . HIS D 1 252 ? -86.342 -29.666 6.247   1.00 64.31  ? 252 HIS D ND1 1 
ATOM   8384  C  CD2 . HIS D 1 252 ? -85.619 -31.325 5.018   1.00 71.01  ? 252 HIS D CD2 1 
ATOM   8385  C  CE1 . HIS D 1 252 ? -86.491 -29.312 4.979   1.00 67.72  ? 252 HIS D CE1 1 
ATOM   8386  N  NE2 . HIS D 1 252 ? -86.062 -30.304 4.215   1.00 76.01  ? 252 HIS D NE2 1 
ATOM   8387  N  N   . LEU D 1 253 ? -83.555 -29.607 8.895   1.00 59.92  ? 253 LEU D N   1 
ATOM   8388  C  CA  . LEU D 1 253 ? -82.955 -28.287 9.007   1.00 52.78  ? 253 LEU D CA  1 
ATOM   8389  C  C   . LEU D 1 253 ? -81.452 -28.365 8.794   1.00 50.89  ? 253 LEU D C   1 
ATOM   8390  O  O   . LEU D 1 253 ? -80.903 -27.668 7.937   1.00 48.17  ? 253 LEU D O   1 
ATOM   8391  C  CB  . LEU D 1 253 ? -83.282 -27.658 10.357  1.00 59.52  ? 253 LEU D CB  1 
ATOM   8392  C  CG  . LEU D 1 253 ? -82.594 -26.322 10.608  1.00 57.61  ? 253 LEU D CG  1 
ATOM   8393  C  CD1 . LEU D 1 253 ? -82.920 -25.366 9.471   1.00 52.33  ? 253 LEU D CD1 1 
ATOM   8394  C  CD2 . LEU D 1 253 ? -83.016 -25.733 11.968  1.00 51.27  ? 253 LEU D CD2 1 
ATOM   8395  N  N   . ILE D 1 254 ? -80.781 -29.239 9.538   1.00 45.04  ? 254 ILE D N   1 
ATOM   8396  C  CA  . ILE D 1 254 ? -79.338 -29.340 9.406   1.00 36.47  ? 254 ILE D CA  1 
ATOM   8397  C  C   . ILE D 1 254 ? -78.931 -29.621 7.976   1.00 40.11  ? 254 ILE D C   1 
ATOM   8398  O  O   . ILE D 1 254 ? -77.899 -29.158 7.523   1.00 37.70  ? 254 ILE D O   1 
ATOM   8399  C  CB  . ILE D 1 254 ? -78.779 -30.437 10.301  1.00 54.10  ? 254 ILE D CB  1 
ATOM   8400  C  CG1 . ILE D 1 254 ? -78.868 -30.042 11.777  1.00 46.08  ? 254 ILE D CG1 1 
ATOM   8401  C  CG2 . ILE D 1 254 ? -77.323 -30.760 9.959   1.00 53.88  ? 254 ILE D CG2 1 
ATOM   8402  C  CD1 . ILE D 1 254 ? -78.482 -31.219 12.691  1.00 50.97  ? 254 ILE D CD1 1 
ATOM   8403  N  N   . SER D 1 255 ? -79.728 -30.396 7.256   1.00 41.29  ? 255 SER D N   1 
ATOM   8404  C  CA  . SER D 1 255 ? -79.319 -30.811 5.905   1.00 47.85  ? 255 SER D CA  1 
ATOM   8405  C  C   . SER D 1 255 ? -79.519 -29.665 4.928   1.00 52.59  ? 255 SER D C   1 
ATOM   8406  O  O   . SER D 1 255 ? -78.875 -29.604 3.882   1.00 51.39  ? 255 SER D O   1 
ATOM   8407  C  CB  . SER D 1 255 ? -80.102 -32.048 5.439   1.00 50.65  ? 255 SER D CB  1 
ATOM   8408  O  OG  . SER D 1 255 ? -81.458 -31.708 5.171   1.00 63.05  ? 255 SER D OG  1 
ATOM   8409  N  N   . ARG D 1 256 ? -80.428 -28.763 5.284   1.00 46.83  ? 256 ARG D N   1 
ATOM   8410  C  CA  . ARG D 1 256 ? -80.691 -27.591 4.473   1.00 51.26  ? 256 ARG D CA  1 
ATOM   8411  C  C   . ARG D 1 256 ? -79.617 -26.552 4.713   1.00 53.31  ? 256 ARG D C   1 
ATOM   8412  O  O   . ARG D 1 256 ? -79.474 -25.617 3.908   1.00 54.97  ? 256 ARG D O   1 
ATOM   8413  C  CB  . ARG D 1 256 ? -82.059 -26.988 4.813   1.00 44.12  ? 256 ARG D CB  1 
ATOM   8414  C  CG  . ARG D 1 256 ? -83.242 -27.828 4.328   1.00 53.01  ? 256 ARG D CG  1 
ATOM   8415  C  CD  . ARG D 1 256 ? -83.442 -27.694 2.810   1.00 63.35  ? 256 ARG D CD  1 
ATOM   8416  N  NE  . ARG D 1 256 ? -83.948 -26.363 2.445   1.00 66.92  ? 256 ARG D NE  1 
ATOM   8417  C  CZ  . ARG D 1 256 ? -83.293 -25.489 1.678   1.00 68.98  ? 256 ARG D CZ  1 
ATOM   8418  N  NH1 . ARG D 1 256 ? -82.101 -25.804 1.154   1.00 61.15  ? 256 ARG D NH1 1 
ATOM   8419  N  NH2 . ARG D 1 256 ? -83.845 -24.301 1.424   1.00 69.72  ? 256 ARG D NH2 1 
ATOM   8420  N  N   . ILE D 1 257 ? -78.883 -26.681 5.820   1.00 32.84  ? 257 ILE D N   1 
ATOM   8421  C  CA  . ILE D 1 257 ? -77.878 -25.678 6.123   1.00 39.68  ? 257 ILE D CA  1 
ATOM   8422  C  C   . ILE D 1 257 ? -76.560 -26.098 5.506   1.00 51.80  ? 257 ILE D C   1 
ATOM   8423  O  O   . ILE D 1 257 ? -75.806 -25.282 4.953   1.00 44.40  ? 257 ILE D O   1 
ATOM   8424  C  CB  . ILE D 1 257 ? -77.711 -25.418 7.640   1.00 38.12  ? 257 ILE D CB  1 
ATOM   8425  C  CG1 . ILE D 1 257 ? -78.842 -24.531 8.168   1.00 37.89  ? 257 ILE D CG1 1 
ATOM   8426  C  CG2 . ILE D 1 257 ? -76.391 -24.750 7.915   1.00 35.48  ? 257 ILE D CG2 1 
ATOM   8427  C  CD1 . ILE D 1 257 ? -78.965 -24.596 9.683   1.00 39.60  ? 257 ILE D CD1 1 
ATOM   8428  N  N   . PHE D 1 258 ? -76.273 -27.383 5.610   1.00 51.78  ? 258 PHE D N   1 
ATOM   8429  C  CA  . PHE D 1 258 ? -75.013 -27.881 5.104   1.00 49.60  ? 258 PHE D CA  1 
ATOM   8430  C  C   . PHE D 1 258 ? -75.145 -28.202 3.621   1.00 57.69  ? 258 PHE D C   1 
ATOM   8431  O  O   . PHE D 1 258 ? -75.123 -29.367 3.206   1.00 55.18  ? 258 PHE D O   1 
ATOM   8432  C  CB  . PHE D 1 258 ? -74.550 -29.095 5.904   1.00 47.10  ? 258 PHE D CB  1 
ATOM   8433  C  CG  . PHE D 1 258 ? -74.063 -28.751 7.283   1.00 52.75  ? 258 PHE D CG  1 
ATOM   8434  C  CD1 . PHE D 1 258 ? -73.517 -27.491 7.539   1.00 52.57  ? 258 PHE D CD1 1 
ATOM   8435  C  CD2 . PHE D 1 258 ? -74.147 -29.669 8.325   1.00 37.52  ? 258 PHE D CD2 1 
ATOM   8436  C  CE1 . PHE D 1 258 ? -73.074 -27.155 8.817   1.00 40.09  ? 258 PHE D CE1 1 
ATOM   8437  C  CE2 . PHE D 1 258 ? -73.705 -29.333 9.592   1.00 45.99  ? 258 PHE D CE2 1 
ATOM   8438  C  CZ  . PHE D 1 258 ? -73.168 -28.071 9.840   1.00 39.27  ? 258 PHE D CZ  1 
ATOM   8439  N  N   . VAL D 1 259 ? -75.312 -27.141 2.844   1.00 55.21  ? 259 VAL D N   1 
ATOM   8440  C  CA  . VAL D 1 259 ? -75.293 -27.206 1.391   1.00 50.85  ? 259 VAL D CA  1 
ATOM   8441  C  C   . VAL D 1 259 ? -74.094 -26.372 0.874   1.00 55.73  ? 259 VAL D C   1 
ATOM   8442  O  O   . VAL D 1 259 ? -73.968 -25.192 1.208   1.00 46.91  ? 259 VAL D O   1 
ATOM   8443  C  CB  . VAL D 1 259 ? -76.615 -26.674 0.847   1.00 53.85  ? 259 VAL D CB  1 
ATOM   8444  C  CG1 . VAL D 1 259 ? -76.581 -26.610 -0.664  1.00 58.95  ? 259 VAL D CG1 1 
ATOM   8445  C  CG2 . VAL D 1 259 ? -77.777 -27.534 1.355   1.00 52.33  ? 259 VAL D CG2 1 
ATOM   8446  N  N   . ALA D 1 260 ? -73.186 -26.983 0.110   1.00 58.65  ? 260 ALA D N   1 
ATOM   8447  C  CA  . ALA D 1 260 ? -71.918 -26.329 -0.235  1.00 44.99  ? 260 ALA D CA  1 
ATOM   8448  C  C   . ALA D 1 260 ? -72.098 -25.111 -1.133  1.00 53.51  ? 260 ALA D C   1 
ATOM   8449  O  O   . ALA D 1 260 ? -71.327 -24.141 -1.074  1.00 56.98  ? 260 ALA D O   1 
ATOM   8450  C  CB  . ALA D 1 260 ? -70.974 -27.332 -0.899  1.00 45.06  ? 260 ALA D CB  1 
ATOM   8451  N  N   . ASP D 1 261 ? -73.121 -25.191 -1.977  1.00 56.65  ? 261 ASP D N   1 
ATOM   8452  C  CA  . ASP D 1 261 ? -73.481 -24.136 -2.908  1.00 65.96  ? 261 ASP D CA  1 
ATOM   8453  C  C   . ASP D 1 261 ? -74.289 -23.054 -2.198  1.00 59.66  ? 261 ASP D C   1 
ATOM   8454  O  O   . ASP D 1 261 ? -75.436 -23.288 -1.813  1.00 64.22  ? 261 ASP D O   1 
ATOM   8455  C  CB  . ASP D 1 261 ? -74.289 -24.744 -4.062  1.00 78.62  ? 261 ASP D CB  1 
ATOM   8456  C  CG  . ASP D 1 261 ? -74.660 -23.730 -5.146  1.00 84.92  ? 261 ASP D CG  1 
ATOM   8457  O  OD1 . ASP D 1 261 ? -74.044 -22.624 -5.220  1.00 72.61  ? 261 ASP D OD1 1 
ATOM   8458  O  OD2 . ASP D 1 261 ? -75.581 -24.079 -5.934  1.00 87.18  ? 261 ASP D OD2 1 
ATOM   8459  N  N   . PRO D 1 262 ? -73.699 -21.857 -2.043  1.00 53.66  ? 262 PRO D N   1 
ATOM   8460  C  CA  . PRO D 1 262 ? -74.359 -20.737 -1.345  1.00 62.07  ? 262 PRO D CA  1 
ATOM   8461  C  C   . PRO D 1 262 ? -75.726 -20.449 -1.934  1.00 64.62  ? 262 PRO D C   1 
ATOM   8462  O  O   . PRO D 1 262 ? -76.639 -20.013 -1.229  1.00 72.74  ? 262 PRO D O   1 
ATOM   8463  C  CB  . PRO D 1 262 ? -73.433 -19.539 -1.617  1.00 43.42  ? 262 PRO D CB  1 
ATOM   8464  C  CG  . PRO D 1 262 ? -72.130 -20.122 -1.976  1.00 41.23  ? 262 PRO D CG  1 
ATOM   8465  C  CD  . PRO D 1 262 ? -72.418 -21.455 -2.647  1.00 43.47  ? 262 PRO D CD  1 
ATOM   8466  N  N   . ALA D 1 263 ? -75.864 -20.706 -3.228  1.00 68.37  ? 263 ALA D N   1 
ATOM   8467  C  CA  . ALA D 1 263 ? -77.066 -20.316 -3.938  1.00 63.95  ? 263 ALA D CA  1 
ATOM   8468  C  C   . ALA D 1 263 ? -78.271 -21.089 -3.418  1.00 61.53  ? 263 ALA D C   1 
ATOM   8469  O  O   . ALA D 1 263 ? -79.415 -20.653 -3.541  1.00 54.43  ? 263 ALA D O   1 
ATOM   8470  C  CB  . ALA D 1 263 ? -76.878 -20.514 -5.441  1.00 62.87  ? 263 ALA D CB  1 
ATOM   8471  N  N   . LYS D 1 264 ? -78.004 -22.223 -2.791  1.00 64.32  ? 264 LYS D N   1 
ATOM   8472  C  CA  . LYS D 1 264 ? -79.054 -23.169 -2.447  1.00 64.06  ? 264 LYS D CA  1 
ATOM   8473  C  C   . LYS D 1 264 ? -79.180 -23.434 -0.950  1.00 69.40  ? 264 LYS D C   1 
ATOM   8474  O  O   . LYS D 1 264 ? -80.096 -24.151 -0.508  1.00 64.68  ? 264 LYS D O   1 
ATOM   8475  C  CB  . LYS D 1 264 ? -78.803 -24.478 -3.178  1.00 70.53  ? 264 LYS D CB  1 
ATOM   8476  C  CG  . LYS D 1 264 ? -78.865 -24.300 -4.677  1.00 82.27  ? 264 LYS D CG  1 
ATOM   8477  C  CD  . LYS D 1 264 ? -78.631 -25.585 -5.416  1.00 86.90  ? 264 LYS D CD  1 
ATOM   8478  C  CE  . LYS D 1 264 ? -78.769 -25.354 -6.907  1.00 101.51 ? 264 LYS D CE  1 
ATOM   8479  N  NZ  . LYS D 1 264 ? -79.054 -26.627 -7.622  1.00 108.72 ? 264 LYS D NZ  1 
ATOM   8480  N  N   . ARG D 1 265 ? -78.262 -22.868 -0.172  1.00 59.92  ? 265 ARG D N   1 
ATOM   8481  C  CA  . ARG D 1 265 ? -78.338 -22.988 1.272   1.00 49.83  ? 265 ARG D CA  1 
ATOM   8482  C  C   . ARG D 1 265 ? -79.574 -22.241 1.759   1.00 38.14  ? 265 ARG D C   1 
ATOM   8483  O  O   . ARG D 1 265 ? -79.902 -21.167 1.249   1.00 53.57  ? 265 ARG D O   1 
ATOM   8484  C  CB  . ARG D 1 265 ? -77.075 -22.379 1.905   1.00 56.69  ? 265 ARG D CB  1 
ATOM   8485  C  CG  . ARG D 1 265 ? -76.963 -22.536 3.431   1.00 48.96  ? 265 ARG D CG  1 
ATOM   8486  C  CD  . ARG D 1 265 ? -75.545 -22.267 3.881   1.00 41.16  ? 265 ARG D CD  1 
ATOM   8487  N  NE  . ARG D 1 265 ? -74.633 -22.872 2.926   1.00 40.57  ? 265 ARG D NE  1 
ATOM   8488  C  CZ  . ARG D 1 265 ? -73.456 -22.363 2.599   1.00 32.77  ? 265 ARG D CZ  1 
ATOM   8489  N  NH1 . ARG D 1 265 ? -73.035 -21.252 3.166   1.00 32.49  ? 265 ARG D NH1 1 
ATOM   8490  N  NH2 . ARG D 1 265 ? -72.707 -22.973 1.700   1.00 25.93  ? 265 ARG D NH2 1 
ATOM   8491  N  N   . ILE D 1 266 ? -80.241 -22.789 2.756   1.00 35.53  ? 266 ILE D N   1 
ATOM   8492  C  CA  . ILE D 1 266 ? -81.386 -22.118 3.358   1.00 38.49  ? 266 ILE D CA  1 
ATOM   8493  C  C   . ILE D 1 266 ? -80.960 -20.744 3.905   1.00 44.10  ? 266 ILE D C   1 
ATOM   8494  O  O   . ILE D 1 266 ? -79.786 -20.505 4.166   1.00 48.77  ? 266 ILE D O   1 
ATOM   8495  C  CB  . ILE D 1 266 ? -81.970 -23.004 4.472   1.00 45.21  ? 266 ILE D CB  1 
ATOM   8496  C  CG1 . ILE D 1 266 ? -83.379 -22.566 4.842   1.00 38.53  ? 266 ILE D CG1 1 
ATOM   8497  C  CG2 . ILE D 1 266 ? -81.035 -23.020 5.672   1.00 41.98  ? 266 ILE D CG2 1 
ATOM   8498  C  CD1 . ILE D 1 266 ? -84.004 -23.450 5.898   1.00 33.71  ? 266 ILE D CD1 1 
ATOM   8499  N  N   . SER D 1 267 ? -81.911 -19.839 4.076   1.00 43.36  ? 267 SER D N   1 
ATOM   8500  C  CA  . SER D 1 267 ? -81.605 -18.483 4.507   1.00 41.71  ? 267 SER D CA  1 
ATOM   8501  C  C   . SER D 1 267 ? -82.220 -18.233 5.863   1.00 48.87  ? 267 SER D C   1 
ATOM   8502  O  O   . SER D 1 267 ? -83.159 -18.948 6.269   1.00 51.66  ? 267 SER D O   1 
ATOM   8503  C  CB  . SER D 1 267 ? -82.221 -17.472 3.534   1.00 47.16  ? 267 SER D CB  1 
ATOM   8504  O  OG  . SER D 1 267 ? -83.646 -17.469 3.680   1.00 62.67  ? 267 SER D OG  1 
ATOM   8505  N  N   . ILE D 1 268 ? -81.724 -17.195 6.543   1.00 44.34  ? 268 ILE D N   1 
ATOM   8506  C  CA  . ILE D 1 268 ? -82.243 -16.825 7.852   1.00 46.01  ? 268 ILE D CA  1 
ATOM   8507  C  C   . ILE D 1 268 ? -83.765 -16.728 7.866   1.00 56.56  ? 268 ILE D C   1 
ATOM   8508  O  O   . ILE D 1 268 ? -84.418 -17.315 8.731   1.00 75.08  ? 268 ILE D O   1 
ATOM   8509  C  CB  . ILE D 1 268 ? -81.650 -15.516 8.373   1.00 49.88  ? 268 ILE D CB  1 
ATOM   8510  C  CG1 . ILE D 1 268 ? -80.132 -15.620 8.499   1.00 46.25  ? 268 ILE D CG1 1 
ATOM   8511  C  CG2 . ILE D 1 268 ? -82.229 -15.209 9.736   1.00 57.17  ? 268 ILE D CG2 1 
ATOM   8512  C  CD1 . ILE D 1 268 ? -79.682 -16.345 9.732   1.00 44.95  ? 268 ILE D CD1 1 
ATOM   8513  N  N   . PRO D 1 269 ? -84.349 -16.023 6.901   1.00 55.01  ? 269 PRO D N   1 
ATOM   8514  C  CA  . PRO D 1 269 ? -85.816 -15.953 6.924   1.00 63.58  ? 269 PRO D CA  1 
ATOM   8515  C  C   . PRO D 1 269 ? -86.467 -17.336 6.863   1.00 61.87  ? 269 PRO D C   1 
ATOM   8516  O  O   . PRO D 1 269 ? -87.396 -17.598 7.635   1.00 67.57  ? 269 PRO D O   1 
ATOM   8517  C  CB  . PRO D 1 269 ? -86.147 -15.137 5.667   1.00 61.25  ? 269 PRO D CB  1 
ATOM   8518  C  CG  . PRO D 1 269 ? -84.927 -14.251 5.502   1.00 57.55  ? 269 PRO D CG  1 
ATOM   8519  C  CD  . PRO D 1 269 ? -83.763 -15.142 5.880   1.00 53.71  ? 269 PRO D CD  1 
ATOM   8520  N  N   . GLU D 1 270 ? -85.991 -18.209 5.977   1.00 53.35  ? 270 GLU D N   1 
ATOM   8521  C  CA  . GLU D 1 270 ? -86.581 -19.534 5.840   1.00 49.82  ? 270 GLU D CA  1 
ATOM   8522  C  C   . GLU D 1 270 ? -86.353 -20.348 7.128   1.00 63.61  ? 270 GLU D C   1 
ATOM   8523  O  O   . GLU D 1 270 ? -87.225 -21.121 7.553   1.00 68.70  ? 270 GLU D O   1 
ATOM   8524  C  CB  . GLU D 1 270 ? -85.987 -20.248 4.630   1.00 50.95  ? 270 GLU D CB  1 
ATOM   8525  C  CG  . GLU D 1 270 ? -86.080 -19.443 3.324   1.00 65.54  ? 270 GLU D CG  1 
ATOM   8526  C  CD  . GLU D 1 270 ? -85.300 -20.079 2.153   1.00 86.63  ? 270 GLU D CD  1 
ATOM   8527  O  OE1 . GLU D 1 270 ? -84.058 -20.102 2.204   1.00 91.31  ? 270 GLU D OE1 1 
ATOM   8528  O  OE2 . GLU D 1 270 ? -85.912 -20.560 1.168   1.00 98.36  ? 270 GLU D OE2 1 
ATOM   8529  N  N   . ILE D 1 271 ? -85.196 -20.149 7.765   1.00 58.73  ? 271 ILE D N   1 
ATOM   8530  C  CA  . ILE D 1 271 ? -84.906 -20.834 9.027   1.00 66.51  ? 271 ILE D CA  1 
ATOM   8531  C  C   . ILE D 1 271 ? -85.921 -20.438 10.091  1.00 67.19  ? 271 ILE D C   1 
ATOM   8532  O  O   . ILE D 1 271 ? -86.383 -21.274 10.877  1.00 73.55  ? 271 ILE D O   1 
ATOM   8533  C  CB  . ILE D 1 271 ? -83.463 -20.531 9.568   1.00 47.65  ? 271 ILE D CB  1 
ATOM   8534  C  CG1 . ILE D 1 271 ? -82.403 -21.185 8.675   1.00 41.33  ? 271 ILE D CG1 1 
ATOM   8535  C  CG2 . ILE D 1 271 ? -83.295 -21.050 10.987  1.00 42.01  ? 271 ILE D CG2 1 
ATOM   8536  C  CD1 . ILE D 1 271 ? -80.997 -20.822 9.069   1.00 34.19  ? 271 ILE D CD1 1 
ATOM   8537  N  N   . ARG D 1 272 ? -86.278 -19.159 10.102  1.00 55.93  ? 272 ARG D N   1 
ATOM   8538  C  CA  . ARG D 1 272 ? -87.248 -18.641 11.057  1.00 63.64  ? 272 ARG D CA  1 
ATOM   8539  C  C   . ARG D 1 272 ? -88.646 -19.188 10.787  1.00 61.62  ? 272 ARG D C   1 
ATOM   8540  O  O   . ARG D 1 272 ? -89.567 -18.966 11.571  1.00 65.96  ? 272 ARG D O   1 
ATOM   8541  C  CB  . ARG D 1 272 ? -87.266 -17.112 11.025  1.00 68.79  ? 272 ARG D CB  1 
ATOM   8542  C  CG  . ARG D 1 272 ? -86.277 -16.461 11.978  1.00 70.98  ? 272 ARG D CG  1 
ATOM   8543  C  CD  . ARG D 1 272 ? -85.638 -15.232 11.355  1.00 83.67  ? 272 ARG D CD  1 
ATOM   8544  N  NE  . ARG D 1 272 ? -86.632 -14.232 10.976  1.00 97.22  ? 272 ARG D NE  1 
ATOM   8545  C  CZ  . ARG D 1 272 ? -87.203 -13.386 11.827  1.00 109.27 ? 272 ARG D CZ  1 
ATOM   8546  N  NH1 . ARG D 1 272 ? -88.098 -12.509 11.394  1.00 119.20 ? 272 ARG D NH1 1 
ATOM   8547  N  NH2 . ARG D 1 272 ? -86.879 -13.416 13.112  1.00 105.70 ? 272 ARG D NH2 1 
ATOM   8548  N  N   . ASN D 1 273 ? -88.802 -19.902 9.676   1.00 52.38  ? 273 ASN D N   1 
ATOM   8549  C  CA  . ASN D 1 273 ? -90.099 -20.477 9.327   1.00 64.78  ? 273 ASN D CA  1 
ATOM   8550  C  C   . ASN D 1 273 ? -90.091 -21.974 9.374   1.00 71.59  ? 273 ASN D C   1 
ATOM   8551  O  O   . ASN D 1 273 ? -91.086 -22.637 9.074   1.00 79.61  ? 273 ASN D O   1 
ATOM   8552  C  CB  . ASN D 1 273 ? -90.563 -20.020 7.951   1.00 84.96  ? 273 ASN D CB  1 
ATOM   8553  C  CG  . ASN D 1 273 ? -91.505 -18.831 8.038   1.00 99.72  ? 273 ASN D CG  1 
ATOM   8554  O  OD1 . ASN D 1 273 ? -92.304 -18.719 8.988   1.00 110.58 ? 273 ASN D OD1 1 
ATOM   8555  N  ND2 . ASN D 1 273 ? -91.410 -17.926 7.064   1.00 96.07  ? 273 ASN D ND2 1 
ATOM   8556  N  N   . HIS D 1 274 ? -88.965 -22.531 9.772   1.00 70.49  ? 274 HIS D N   1 
ATOM   8557  C  CA  . HIS D 1 274 ? -88.865 -23.970 9.754   1.00 71.75  ? 274 HIS D CA  1 
ATOM   8558  C  C   . HIS D 1 274 ? -89.612 -24.585 10.939  1.00 68.46  ? 274 HIS D C   1 
ATOM   8559  O  O   . HIS D 1 274 ? -89.562 -24.058 12.056  1.00 70.48  ? 274 HIS D O   1 
ATOM   8560  C  CB  . HIS D 1 274 ? -87.401 -24.374 9.739   1.00 73.29  ? 274 HIS D CB  1 
ATOM   8561  C  CG  . HIS D 1 274 ? -87.189 -25.802 9.397   1.00 59.09  ? 274 HIS D CG  1 
ATOM   8562  N  ND1 . HIS D 1 274 ? -87.540 -26.823 10.251  1.00 64.10  ? 274 HIS D ND1 1 
ATOM   8563  C  CD2 . HIS D 1 274 ? -86.657 -26.389 8.297   1.00 56.34  ? 274 HIS D CD2 1 
ATOM   8564  C  CE1 . HIS D 1 274 ? -87.224 -27.980 9.700   1.00 77.05  ? 274 HIS D CE1 1 
ATOM   8565  N  NE2 . HIS D 1 274 ? -86.690 -27.743 8.511   1.00 69.69  ? 274 HIS D NE2 1 
ATOM   8566  N  N   . GLU D 1 275 ? -90.314 -25.687 10.679  1.00 66.28  ? 275 GLU D N   1 
ATOM   8567  C  CA  . GLU D 1 275 ? -91.033 -26.423 11.723  1.00 83.71  ? 275 GLU D CA  1 
ATOM   8568  C  C   . GLU D 1 275 ? -90.232 -26.601 13.011  1.00 77.95  ? 275 GLU D C   1 
ATOM   8569  O  O   . GLU D 1 275 ? -90.776 -26.438 14.113  1.00 81.89  ? 275 GLU D O   1 
ATOM   8570  C  CB  . GLU D 1 275 ? -91.423 -27.811 11.222  1.00 97.49  ? 275 GLU D CB  1 
ATOM   8571  C  CG  . GLU D 1 275 ? -92.889 -27.950 10.866  1.00 108.53 ? 275 GLU D CG  1 
ATOM   8572  C  CD  . GLU D 1 275 ? -93.269 -29.383 10.548  1.00 114.33 ? 275 GLU D CD  1 
ATOM   8573  O  OE1 . GLU D 1 275 ? -94.444 -29.613 10.187  1.00 120.40 ? 275 GLU D OE1 1 
ATOM   8574  O  OE2 . GLU D 1 275 ? -92.391 -30.272 10.658  1.00 109.63 ? 275 GLU D OE2 1 
ATOM   8575  N  N   . TRP D 1 276 ? -88.961 -26.960 12.879  1.00 62.77  ? 276 TRP D N   1 
ATOM   8576  C  CA  . TRP D 1 276 ? -88.129 -27.222 14.045  1.00 62.91  ? 276 TRP D CA  1 
ATOM   8577  C  C   . TRP D 1 276 ? -87.815 -25.945 14.816  1.00 59.09  ? 276 TRP D C   1 
ATOM   8578  O  O   . TRP D 1 276 ? -87.663 -25.969 16.037  1.00 66.70  ? 276 TRP D O   1 
ATOM   8579  C  CB  . TRP D 1 276 ? -86.831 -27.922 13.641  1.00 61.64  ? 276 TRP D CB  1 
ATOM   8580  C  CG  . TRP D 1 276 ? -86.040 -28.413 14.811  1.00 61.59  ? 276 TRP D CG  1 
ATOM   8581  C  CD1 . TRP D 1 276 ? -86.258 -29.554 15.526  1.00 72.58  ? 276 TRP D CD1 1 
ATOM   8582  C  CD2 . TRP D 1 276 ? -84.905 -27.776 15.409  1.00 60.52  ? 276 TRP D CD2 1 
ATOM   8583  N  NE1 . TRP D 1 276 ? -85.329 -29.669 16.531  1.00 73.64  ? 276 TRP D NE1 1 
ATOM   8584  C  CE2 . TRP D 1 276 ? -84.486 -28.590 16.481  1.00 64.42  ? 276 TRP D CE2 1 
ATOM   8585  C  CE3 . TRP D 1 276 ? -84.202 -26.598 15.143  1.00 68.98  ? 276 TRP D CE3 1 
ATOM   8586  C  CZ2 . TRP D 1 276 ? -83.396 -28.264 17.285  1.00 75.59  ? 276 TRP D CZ2 1 
ATOM   8587  C  CZ3 . TRP D 1 276 ? -83.120 -26.276 15.942  1.00 62.42  ? 276 TRP D CZ3 1 
ATOM   8588  C  CH2 . TRP D 1 276 ? -82.728 -27.106 17.000  1.00 71.42  ? 276 TRP D CH2 1 
ATOM   8589  N  N   . PHE D 1 277 ? -87.719 -24.833 14.098  1.00 61.71  ? 277 PHE D N   1 
ATOM   8590  C  CA  . PHE D 1 277 ? -87.367 -23.570 14.714  1.00 59.05  ? 277 PHE D CA  1 
ATOM   8591  C  C   . PHE D 1 277 ? -88.571 -22.965 15.432  1.00 69.47  ? 277 PHE D C   1 
ATOM   8592  O  O   . PHE D 1 277 ? -88.429 -22.223 16.415  1.00 76.83  ? 277 PHE D O   1 
ATOM   8593  C  CB  . PHE D 1 277 ? -86.830 -22.618 13.659  1.00 47.21  ? 277 PHE D CB  1 
ATOM   8594  C  CG  . PHE D 1 277 ? -86.346 -21.316 14.219  1.00 54.23  ? 277 PHE D CG  1 
ATOM   8595  C  CD1 . PHE D 1 277 ? -85.012 -21.128 14.526  1.00 66.31  ? 277 PHE D CD1 1 
ATOM   8596  C  CD2 . PHE D 1 277 ? -87.231 -20.271 14.443  1.00 61.98  ? 277 PHE D CD2 1 
ATOM   8597  C  CE1 . PHE D 1 277 ? -84.567 -19.935 15.050  1.00 67.87  ? 277 PHE D CE1 1 
ATOM   8598  C  CE2 . PHE D 1 277 ? -86.795 -19.066 14.966  1.00 64.05  ? 277 PHE D CE2 1 
ATOM   8599  C  CZ  . PHE D 1 277 ? -85.455 -18.898 15.263  1.00 66.29  ? 277 PHE D CZ  1 
ATOM   8600  N  N   . LEU D 1 278 ? -89.764 -23.282 14.948  1.00 67.34  ? 278 LEU D N   1 
ATOM   8601  C  CA  . LEU D 1 278 ? -90.973 -22.674 15.501  1.00 65.68  ? 278 LEU D CA  1 
ATOM   8602  C  C   . LEU D 1 278 ? -91.406 -23.320 16.834  1.00 80.39  ? 278 LEU D C   1 
ATOM   8603  O  O   . LEU D 1 278 ? -91.959 -22.641 17.711  1.00 87.26  ? 278 LEU D O   1 
ATOM   8604  C  CB  . LEU D 1 278 ? -92.088 -22.734 14.466  1.00 65.52  ? 278 LEU D CB  1 
ATOM   8605  C  CG  . LEU D 1 278 ? -91.839 -21.864 13.223  1.00 70.81  ? 278 LEU D CG  1 
ATOM   8606  C  CD1 . LEU D 1 278 ? -92.624 -22.364 12.006  1.00 80.75  ? 278 LEU D CD1 1 
ATOM   8607  C  CD2 . LEU D 1 278 ? -92.133 -20.384 13.543  1.00 57.02  ? 278 LEU D CD2 1 
ATOM   8608  N  N   . LYS D 1 279 ? -91.148 -24.615 16.978  1.00 83.90  ? 279 LYS D N   1 
ATOM   8609  C  CA  . LYS D 1 279 ? -91.517 -25.336 18.192  1.00 81.65  ? 279 LYS D CA  1 
ATOM   8610  C  C   . LYS D 1 279 ? -90.984 -24.650 19.446  1.00 78.18  ? 279 LYS D C   1 
ATOM   8611  O  O   . LYS D 1 279 ? -89.774 -24.552 19.644  1.00 83.42  ? 279 LYS D O   1 
ATOM   8612  C  CB  . LYS D 1 279 ? -91.009 -26.778 18.130  1.00 91.72  ? 279 LYS D CB  1 
ATOM   8613  C  CG  . LYS D 1 279 ? -91.978 -27.752 17.483  1.00 98.49  ? 279 LYS D CG  1 
ATOM   8614  C  CD  . LYS D 1 279 ? -91.393 -29.154 17.426  1.00 102.52 ? 279 LYS D CD  1 
ATOM   8615  C  CE  . LYS D 1 279 ? -90.659 -29.394 16.117  1.00 109.14 ? 279 LYS D CE  1 
ATOM   8616  N  NZ  . LYS D 1 279 ? -89.808 -30.616 16.173  1.00 111.88 ? 279 LYS D NZ  1 
ATOM   8617  N  N   . ASN D 1 280 ? -91.895 -24.182 20.293  1.00 79.73  ? 280 ASN D N   1 
ATOM   8618  C  CA  . ASN D 1 280 ? -91.519 -23.565 21.571  1.00 81.04  ? 280 ASN D CA  1 
ATOM   8619  C  C   . ASN D 1 280 ? -90.892 -22.180 21.467  1.00 65.64  ? 280 ASN D C   1 
ATOM   8620  O  O   . ASN D 1 280 ? -90.198 -21.743 22.397  1.00 60.13  ? 280 ASN D O   1 
ATOM   8621  C  CB  . ASN D 1 280 ? -90.552 -24.473 22.350  1.00 95.38  ? 280 ASN D CB  1 
ATOM   8622  C  CG  . ASN D 1 280 ? -91.226 -25.722 22.886  1.00 101.80 ? 280 ASN D CG  1 
ATOM   8623  O  OD1 . ASN D 1 280 ? -92.377 -26.018 22.536  1.00 107.21 ? 280 ASN D OD1 1 
ATOM   8624  N  ND2 . ASN D 1 280 ? -90.510 -26.468 23.737  1.00 95.63  ? 280 ASN D ND2 1 
ATOM   8625  N  N   . LEU D 1 281 ? -91.121 -21.475 20.367  1.00 59.14  ? 281 LEU D N   1 
ATOM   8626  C  CA  . LEU D 1 281 ? -90.469 -20.164 20.249  1.00 72.21  ? 281 LEU D CA  1 
ATOM   8627  C  C   . LEU D 1 281 ? -91.083 -19.166 21.246  1.00 71.79  ? 281 LEU D C   1 
ATOM   8628  O  O   . LEU D 1 281 ? -92.300 -19.041 21.325  1.00 79.64  ? 281 LEU D O   1 
ATOM   8629  C  CB  . LEU D 1 281 ? -90.553 -19.636 18.815  1.00 61.15  ? 281 LEU D CB  1 
ATOM   8630  C  CG  . LEU D 1 281 ? -89.815 -18.317 18.562  1.00 64.27  ? 281 LEU D CG  1 
ATOM   8631  C  CD1 . LEU D 1 281 ? -88.306 -18.436 18.832  1.00 53.84  ? 281 LEU D CD1 1 
ATOM   8632  C  CD2 . LEU D 1 281 ? -90.071 -17.870 17.137  1.00 56.06  ? 281 LEU D CD2 1 
ATOM   8633  N  N   . PRO D 1 282 ? -90.340 -18.118 21.714  1.00 65.06  ? 282 PRO D N   1 
ATOM   8634  C  CA  . PRO D 1 282 ? -90.889 -16.866 22.404  1.00 77.96  ? 282 PRO D CA  1 
ATOM   8635  C  C   . PRO D 1 282 ? -91.438 -15.593 21.548  1.00 104.03 ? 282 PRO D C   1 
ATOM   8636  O  O   . PRO D 1 282 ? -91.601 -15.928 20.376  1.00 108.90 ? 282 PRO D O   1 
ATOM   8637  C  CB  . PRO D 1 282 ? -89.723 -16.435 23.297  1.00 78.03  ? 282 PRO D CB  1 
ATOM   8638  C  CG  . PRO D 1 282 ? -88.955 -17.704 23.550  1.00 57.53  ? 282 PRO D CG  1 
ATOM   8639  C  CD  . PRO D 1 282 ? -89.058 -18.543 22.300  1.00 53.65  ? 282 PRO D CD  1 
ATOM   8640  N  N   . ALA D 1 283 ? -91.811 -14.323 21.969  1.00 96.37  ? 283 ALA D N   1 
ATOM   8641  C  CA  . ALA D 1 283 ? -91.444 -13.462 23.114  1.00 88.13  ? 283 ALA D CA  1 
ATOM   8642  C  C   . ALA D 1 283 ? -90.556 -12.221 22.775  1.00 118.51 ? 283 ALA D C   1 
ATOM   8643  O  O   . ALA D 1 283 ? -91.092 -11.137 22.480  1.00 125.81 ? 283 ALA D O   1 
ATOM   8644  C  CB  . ALA D 1 283 ? -90.822 -14.316 24.259  1.00 98.15  ? 283 ALA D CB  1 
ATOM   8645  N  N   . ASP D 1 296 ? -85.495 6.475   16.338  1.00 90.78  ? 296 ASP D N   1 
ATOM   8646  C  CA  . ASP D 1 296 ? -84.324 5.607   16.356  1.00 97.85  ? 296 ASP D CA  1 
ATOM   8647  C  C   . ASP D 1 296 ? -83.387 5.970   17.504  1.00 106.31 ? 296 ASP D C   1 
ATOM   8648  O  O   . ASP D 1 296 ? -82.922 5.097   18.237  1.00 106.67 ? 296 ASP D O   1 
ATOM   8649  C  CB  . ASP D 1 296 ? -83.589 5.680   15.027  1.00 95.24  ? 296 ASP D CB  1 
ATOM   8650  N  N   . GLU D 1 297 ? -83.114 7.262   17.653  1.00 107.42 ? 297 GLU D N   1 
ATOM   8651  C  CA  . GLU D 1 297 ? -82.236 7.742   18.712  1.00 109.48 ? 297 GLU D CA  1 
ATOM   8652  C  C   . GLU D 1 297 ? -82.963 7.777   20.051  1.00 122.58 ? 297 GLU D C   1 
ATOM   8653  O  O   . GLU D 1 297 ? -82.426 7.348   21.072  1.00 125.74 ? 297 GLU D O   1 
ATOM   8654  C  CB  . GLU D 1 297 ? -81.696 9.132   18.371  1.00 95.32  ? 297 GLU D CB  1 
ATOM   8655  C  CG  . GLU D 1 297 ? -80.864 9.762   19.475  1.00 88.12  ? 297 GLU D CG  1 
ATOM   8656  C  CD  . GLU D 1 297 ? -79.410 9.338   19.422  1.00 89.74  ? 297 GLU D CD  1 
ATOM   8657  O  OE1 . GLU D 1 297 ? -78.650 9.697   20.347  1.00 85.08  ? 297 GLU D OE1 1 
ATOM   8658  O  OE2 . GLU D 1 297 ? -79.026 8.647   18.455  1.00 90.22  ? 297 GLU D OE2 1 
ATOM   8659  N  N   . SER D 1 298 ? -84.189 8.290   20.039  1.00 129.14 ? 298 SER D N   1 
ATOM   8660  C  CA  . SER D 1 298 ? -84.995 8.379   21.250  1.00 132.05 ? 298 SER D CA  1 
ATOM   8661  C  C   . SER D 1 298 ? -85.251 6.996   21.836  1.00 138.31 ? 298 SER D C   1 
ATOM   8662  O  O   . SER D 1 298 ? -86.144 6.818   22.665  1.00 139.00 ? 298 SER D O   1 
ATOM   8663  C  CB  . SER D 1 298 ? -86.322 9.081   20.958  1.00 126.82 ? 298 SER D CB  1 
ATOM   8664  O  OG  . SER D 1 298 ? -86.771 8.797   19.644  1.00 123.01 ? 298 SER D OG  1 
ATOM   8665  N  N   . ASP D 1 299 ? -84.462 6.020   21.400  1.00 143.26 ? 299 ASP D N   1 
ATOM   8666  C  CA  . ASP D 1 299 ? -84.602 4.650   21.876  1.00 146.06 ? 299 ASP D CA  1 
ATOM   8667  C  C   . ASP D 1 299 ? -83.239 4.000   22.085  1.00 141.15 ? 299 ASP D C   1 
ATOM   8668  O  O   . ASP D 1 299 ? -83.002 2.876   21.643  1.00 145.07 ? 299 ASP D O   1 
ATOM   8669  C  CB  . ASP D 1 299 ? -85.433 3.824   20.892  1.00 154.02 ? 299 ASP D CB  1 
ATOM   8670  C  CG  . ASP D 1 299 ? -85.253 2.332   21.088  1.00 163.54 ? 299 ASP D CG  1 
ATOM   8671  O  OD1 . ASP D 1 299 ? -85.001 1.908   22.236  1.00 170.61 ? 299 ASP D OD1 1 
ATOM   8672  O  OD2 . ASP D 1 299 ? -85.363 1.583   20.095  1.00 161.68 ? 299 ASP D OD2 1 
ATOM   8673  N  N   . GLN D 1 300 ? -82.346 4.715   22.761  1.00 134.74 ? 300 GLN D N   1 
ATOM   8674  C  CA  . GLN D 1 300 ? -81.009 4.206   23.039  1.00 134.39 ? 300 GLN D CA  1 
ATOM   8675  C  C   . GLN D 1 300 ? -80.856 3.239   24.208  1.00 139.60 ? 300 GLN D C   1 
ATOM   8676  O  O   . GLN D 1 300 ? -80.650 2.041   24.011  1.00 144.77 ? 300 GLN D O   1 
ATOM   8677  C  CB  . GLN D 1 300 ? -80.053 5.354   23.322  1.00 129.56 ? 300 GLN D CB  1 
ATOM   8678  N  N   . PRO D 1 301 ? -80.964 3.764   25.424  1.00 131.21 ? 301 PRO D N   1 
ATOM   8679  C  CA  . PRO D 1 301 ? -80.855 5.210   25.624  1.00 120.14 ? 301 PRO D CA  1 
ATOM   8680  C  C   . PRO D 1 301 ? -79.814 5.542   26.687  1.00 95.01  ? 301 PRO D C   1 
ATOM   8681  O  O   . PRO D 1 301 ? -80.100 5.442   27.879  1.00 87.57  ? 301 PRO D O   1 
ATOM   8682  C  CB  . PRO D 1 301 ? -82.248 5.585   26.123  1.00 125.32 ? 301 PRO D CB  1 
ATOM   8683  C  CG  . PRO D 1 301 ? -82.717 4.368   26.863  1.00 126.20 ? 301 PRO D CG  1 
ATOM   8684  C  CD  . PRO D 1 301 ? -81.989 3.167   26.298  1.00 129.16 ? 301 PRO D CD  1 
ATOM   8685  N  N   . GLY D 1 302 ? -78.619 5.931   26.255  1.00 73.28  ? 302 GLY D N   1 
ATOM   8686  C  CA  . GLY D 1 302 ? -77.540 6.228   27.178  1.00 65.41  ? 302 GLY D CA  1 
ATOM   8687  C  C   . GLY D 1 302 ? -77.033 7.653   27.094  1.00 67.00  ? 302 GLY D C   1 
ATOM   8688  O  O   . GLY D 1 302 ? -77.217 8.440   28.022  1.00 81.48  ? 302 GLY D O   1 
ATOM   8689  N  N   . GLN D 1 303 ? -76.387 7.988   25.982  1.00 60.42  ? 303 GLN D N   1 
ATOM   8690  C  CA  . GLN D 1 303 ? -75.801 9.312   25.815  1.00 61.78  ? 303 GLN D CA  1 
ATOM   8691  C  C   . GLN D 1 303 ? -75.910 9.800   24.374  1.00 78.89  ? 303 GLN D C   1 
ATOM   8692  O  O   . GLN D 1 303 ? -75.051 9.508   23.543  1.00 105.17 ? 303 GLN D O   1 
ATOM   8693  C  CB  . GLN D 1 303 ? -74.337 9.316   26.259  1.00 53.61  ? 303 GLN D CB  1 
ATOM   8694  C  CG  . GLN D 1 303 ? -73.931 8.107   27.085  1.00 71.86  ? 303 GLN D CG  1 
ATOM   8695  C  CD  . GLN D 1 303 ? -72.427 7.970   27.209  1.00 70.46  ? 303 GLN D CD  1 
ATOM   8696  O  OE1 . GLN D 1 303 ? -71.738 8.904   27.618  1.00 44.45  ? 303 GLN D OE1 1 
ATOM   8697  N  NE2 . GLN D 1 303 ? -71.908 6.800   26.856  1.00 78.73  ? 303 GLN D NE2 1 
ATOM   8698  N  N   . SER D 1 304 ? -76.970 10.547  24.088  1.00 60.88  ? 304 SER D N   1 
ATOM   8699  C  CA  . SER D 1 304 ? -77.166 11.126  22.766  1.00 60.18  ? 304 SER D CA  1 
ATOM   8700  C  C   . SER D 1 304 ? -75.899 11.000  21.930  1.00 63.70  ? 304 SER D C   1 
ATOM   8701  O  O   . SER D 1 304 ? -74.790 11.156  22.441  1.00 62.82  ? 304 SER D O   1 
ATOM   8702  C  CB  . SER D 1 304 ? -77.570 12.596  22.884  1.00 71.23  ? 304 SER D CB  1 
ATOM   8703  O  OG  . SER D 1 304 ? -76.527 13.366  23.455  1.00 53.80  ? 304 SER D OG  1 
ATOM   8704  N  N   . ILE D 1 305 ? -76.072 10.712  20.644  1.00 56.77  ? 305 ILE D N   1 
ATOM   8705  C  CA  . ILE D 1 305 ? -74.945 10.568  19.732  1.00 54.52  ? 305 ILE D CA  1 
ATOM   8706  C  C   . ILE D 1 305 ? -74.078 11.820  19.740  1.00 52.89  ? 305 ILE D C   1 
ATOM   8707  O  O   . ILE D 1 305 ? -72.870 11.753  19.518  1.00 62.52  ? 305 ILE D O   1 
ATOM   8708  C  CB  . ILE D 1 305 ? -75.416 10.283  18.294  1.00 49.10  ? 305 ILE D CB  1 
ATOM   8709  C  CG1 . ILE D 1 305 ? -74.217 10.000  17.387  1.00 58.47  ? 305 ILE D CG1 1 
ATOM   8710  C  CG2 . ILE D 1 305 ? -76.233 11.448  17.760  1.00 46.91  ? 305 ILE D CG2 1 
ATOM   8711  C  CD1 . ILE D 1 305 ? -73.580 8.649   17.625  1.00 63.89  ? 305 ILE D CD1 1 
ATOM   8712  N  N   . GLU D 1 306 ? -74.704 12.963  20.001  1.00 43.16  ? 306 GLU D N   1 
ATOM   8713  C  CA  . GLU D 1 306 ? -73.988 14.229  20.066  1.00 54.13  ? 306 GLU D CA  1 
ATOM   8714  C  C   . GLU D 1 306 ? -73.084 14.264  21.292  1.00 61.66  ? 306 GLU D C   1 
ATOM   8715  O  O   . GLU D 1 306 ? -72.009 14.863  21.269  1.00 64.93  ? 306 GLU D O   1 
ATOM   8716  C  CB  . GLU D 1 306 ? -74.972 15.400  20.105  1.00 49.19  ? 306 GLU D CB  1 
ATOM   8717  C  CG  . GLU D 1 306 ? -75.877 15.491  18.888  1.00 67.34  ? 306 GLU D CG  1 
ATOM   8718  C  CD  . GLU D 1 306 ? -77.196 14.771  19.088  1.00 79.59  ? 306 GLU D CD  1 
ATOM   8719  O  OE1 . GLU D 1 306 ? -77.462 14.318  20.220  1.00 87.83  ? 306 GLU D OE1 1 
ATOM   8720  O  OE2 . GLU D 1 306 ? -77.967 14.659  18.112  1.00 67.54  ? 306 GLU D OE2 1 
ATOM   8721  N  N   . GLU D 1 307 ? -73.530 13.615  22.362  1.00 65.26  ? 307 GLU D N   1 
ATOM   8722  C  CA  . GLU D 1 307 ? -72.770 13.564  23.604  1.00 55.39  ? 307 GLU D CA  1 
ATOM   8723  C  C   . GLU D 1 307 ? -71.577 12.626  23.468  1.00 46.52  ? 307 GLU D C   1 
ATOM   8724  O  O   . GLU D 1 307 ? -70.478 12.933  23.927  1.00 49.35  ? 307 GLU D O   1 
ATOM   8725  C  CB  . GLU D 1 307 ? -73.665 13.112  24.759  1.00 69.40  ? 307 GLU D CB  1 
ATOM   8726  C  CG  . GLU D 1 307 ? -73.028 13.257  26.131  1.00 85.76  ? 307 GLU D CG  1 
ATOM   8727  C  CD  . GLU D 1 307 ? -74.054 13.322  27.245  1.00 102.18 ? 307 GLU D CD  1 
ATOM   8728  O  OE1 . GLU D 1 307 ? -75.121 12.689  27.109  1.00 93.93  ? 307 GLU D OE1 1 
ATOM   8729  O  OE2 . GLU D 1 307 ? -73.793 14.006  28.256  1.00 114.40 ? 307 GLU D OE2 1 
ATOM   8730  N  N   . ILE D 1 308 ? -71.803 11.481  22.833  1.00 40.08  ? 308 ILE D N   1 
ATOM   8731  C  CA  . ILE D 1 308 ? -70.746 10.501  22.623  1.00 43.74  ? 308 ILE D CA  1 
ATOM   8732  C  C   . ILE D 1 308 ? -69.702 11.031  21.649  1.00 43.19  ? 308 ILE D C   1 
ATOM   8733  O  O   . ILE D 1 308 ? -68.501 10.871  21.862  1.00 45.28  ? 308 ILE D O   1 
ATOM   8734  C  CB  . ILE D 1 308 ? -71.309 9.173   22.086  1.00 49.00  ? 308 ILE D CB  1 
ATOM   8735  C  CG1 . ILE D 1 308 ? -71.941 8.366   23.220  1.00 39.43  ? 308 ILE D CG1 1 
ATOM   8736  C  CG2 . ILE D 1 308 ? -70.214 8.369   21.401  1.00 42.53  ? 308 ILE D CG2 1 
ATOM   8737  C  CD1 . ILE D 1 308 ? -73.248 7.708   22.843  1.00 47.03  ? 308 ILE D CD1 1 
ATOM   8738  N  N   . MET D 1 309 ? -70.170 11.663  20.577  1.00 55.68  ? 309 MET D N   1 
ATOM   8739  C  CA  . MET D 1 309 ? -69.280 12.232  19.574  1.00 49.78  ? 309 MET D CA  1 
ATOM   8740  C  C   . MET D 1 309 ? -68.411 13.325  20.182  1.00 46.65  ? 309 MET D C   1 
ATOM   8741  O  O   . MET D 1 309 ? -67.236 13.460  19.843  1.00 45.86  ? 309 MET D O   1 
ATOM   8742  C  CB  . MET D 1 309 ? -70.085 12.793  18.401  1.00 46.30  ? 309 MET D CB  1 
ATOM   8743  C  CG  . MET D 1 309 ? -69.677 12.241  17.047  1.00 67.76  ? 309 MET D CG  1 
ATOM   8744  S  SD  . MET D 1 309 ? -69.743 10.442  16.984  1.00 53.22  ? 309 MET D SD  1 
ATOM   8745  C  CE  . MET D 1 309 ? -68.127 10.069  16.309  1.00 50.01  ? 309 MET D CE  1 
ATOM   8746  N  N   . GLN D 1 310 ? -68.999 14.105  21.083  1.00 46.79  ? 310 GLN D N   1 
ATOM   8747  C  CA  . GLN D 1 310 ? -68.279 15.183  21.749  1.00 47.91  ? 310 GLN D CA  1 
ATOM   8748  C  C   . GLN D 1 310 ? -67.153 14.633  22.617  1.00 55.25  ? 310 GLN D C   1 
ATOM   8749  O  O   . GLN D 1 310 ? -66.085 15.236  22.719  1.00 60.51  ? 310 GLN D O   1 
ATOM   8750  C  CB  . GLN D 1 310 ? -69.236 16.020  22.599  1.00 56.06  ? 310 GLN D CB  1 
ATOM   8751  C  CG  . GLN D 1 310 ? -68.890 17.498  22.650  1.00 73.62  ? 310 GLN D CG  1 
ATOM   8752  C  CD  . GLN D 1 310 ? -68.059 17.861  23.864  1.00 89.91  ? 310 GLN D CD  1 
ATOM   8753  O  OE1 . GLN D 1 310 ? -67.239 17.070  24.328  1.00 92.16  ? 310 GLN D OE1 1 
ATOM   8754  N  NE2 . GLN D 1 310 ? -68.268 19.064  24.386  1.00 94.11  ? 310 GLN D NE2 1 
ATOM   8755  N  N   . ILE D 1 311 ? -67.399 13.485  23.240  1.00 65.97  ? 311 ILE D N   1 
ATOM   8756  C  CA  . ILE D 1 311 ? -66.402 12.859  24.101  1.00 58.97  ? 311 ILE D CA  1 
ATOM   8757  C  C   . ILE D 1 311 ? -65.276 12.244  23.279  1.00 55.52  ? 311 ILE D C   1 
ATOM   8758  O  O   . ILE D 1 311 ? -64.125 12.211  23.712  1.00 56.43  ? 311 ILE D O   1 
ATOM   8759  C  CB  . ILE D 1 311 ? -67.030 11.774  24.994  1.00 62.27  ? 311 ILE D CB  1 
ATOM   8760  C  CG1 . ILE D 1 311 ? -68.057 12.395  25.942  1.00 57.37  ? 311 ILE D CG1 1 
ATOM   8761  C  CG2 . ILE D 1 311 ? -65.953 11.039  25.775  1.00 63.93  ? 311 ILE D CG2 1 
ATOM   8762  C  CD1 . ILE D 1 311 ? -68.417 11.510  27.114  1.00 53.56  ? 311 ILE D CD1 1 
ATOM   8763  N  N   . ILE D 1 312 ? -65.617 11.759  22.090  1.00 49.34  ? 312 ILE D N   1 
ATOM   8764  C  CA  . ILE D 1 312 ? -64.633 11.153  21.201  1.00 50.54  ? 312 ILE D CA  1 
ATOM   8765  C  C   . ILE D 1 312 ? -63.693 12.208  20.632  1.00 56.87  ? 312 ILE D C   1 
ATOM   8766  O  O   . ILE D 1 312 ? -62.487 11.988  20.527  1.00 48.75  ? 312 ILE D O   1 
ATOM   8767  C  CB  . ILE D 1 312 ? -65.310 10.398  20.042  1.00 52.69  ? 312 ILE D CB  1 
ATOM   8768  C  CG1 . ILE D 1 312 ? -66.068 9.180   20.569  1.00 55.28  ? 312 ILE D CG1 1 
ATOM   8769  C  CG2 . ILE D 1 312 ? -64.279 9.983   19.004  1.00 49.03  ? 312 ILE D CG2 1 
ATOM   8770  C  CD1 . ILE D 1 312 ? -66.734 8.361   19.486  1.00 57.28  ? 312 ILE D CD1 1 
ATOM   8771  N  N   . ALA D 1 313 ? -64.253 13.355  20.264  1.00 52.27  ? 313 ALA D N   1 
ATOM   8772  C  CA  . ALA D 1 313 ? -63.466 14.447  19.709  1.00 53.42  ? 313 ALA D CA  1 
ATOM   8773  C  C   . ALA D 1 313 ? -62.478 14.984  20.738  1.00 46.49  ? 313 ALA D C   1 
ATOM   8774  O  O   . ALA D 1 313 ? -61.284 15.103  20.464  1.00 52.15  ? 313 ALA D O   1 
ATOM   8775  C  CB  . ALA D 1 313 ? -64.376 15.560  19.216  1.00 58.40  ? 313 ALA D CB  1 
ATOM   8776  N  N   . GLU D 1 314 ? -62.984 15.305  21.923  1.00 49.72  ? 314 GLU D N   1 
ATOM   8777  C  CA  . GLU D 1 314 ? -62.148 15.819  23.000  1.00 58.85  ? 314 GLU D CA  1 
ATOM   8778  C  C   . GLU D 1 314 ? -61.090 14.799  23.404  1.00 62.77  ? 314 GLU D C   1 
ATOM   8779  O  O   . GLU D 1 314 ? -60.175 15.107  24.166  1.00 69.73  ? 314 GLU D O   1 
ATOM   8780  C  CB  . GLU D 1 314 ? -63.006 16.191  24.210  1.00 68.21  ? 314 GLU D CB  1 
ATOM   8781  C  CG  . GLU D 1 314 ? -62.743 17.586  24.752  1.00 84.30  ? 314 GLU D CG  1 
ATOM   8782  C  CD  . GLU D 1 314 ? -62.590 17.605  26.260  1.00 85.77  ? 314 GLU D CD  1 
ATOM   8783  O  OE1 . GLU D 1 314 ? -61.441 17.692  26.741  1.00 85.67  ? 314 GLU D OE1 1 
ATOM   8784  O  OE2 . GLU D 1 314 ? -63.619 17.534  26.963  1.00 78.14  ? 314 GLU D OE2 1 
ATOM   8785  N  N   . ALA D 1 315 ? -61.221 13.583  22.883  1.00 56.04  ? 315 ALA D N   1 
ATOM   8786  C  CA  . ALA D 1 315 ? -60.281 12.513  23.191  1.00 57.90  ? 315 ALA D CA  1 
ATOM   8787  C  C   . ALA D 1 315 ? -59.153 12.456  22.167  1.00 62.54  ? 315 ALA D C   1 
ATOM   8788  O  O   . ALA D 1 315 ? -58.043 12.024  22.474  1.00 63.28  ? 315 ALA D O   1 
ATOM   8789  C  CB  . ALA D 1 315 ? -61.003 11.177  23.259  1.00 67.47  ? 315 ALA D CB  1 
ATOM   8790  N  N   . THR D 1 316 ? -59.447 12.896  20.947  1.00 70.45  ? 316 THR D N   1 
ATOM   8791  C  CA  . THR D 1 316 ? -58.458 12.897  19.875  1.00 75.35  ? 316 THR D CA  1 
ATOM   8792  C  C   . THR D 1 316 ? -57.212 13.676  20.277  1.00 71.63  ? 316 THR D C   1 
ATOM   8793  O  O   . THR D 1 316 ? -56.097 13.322  19.896  1.00 75.61  ? 316 THR D O   1 
ATOM   8794  C  CB  . THR D 1 316 ? -59.031 13.501  18.581  1.00 77.68  ? 316 THR D CB  1 
ATOM   8795  O  OG1 . THR D 1 316 ? -59.659 14.755  18.873  1.00 76.75  ? 316 THR D OG1 1 
ATOM   8796  C  CG2 . THR D 1 316 ? -60.052 12.559  17.961  1.00 70.03  ? 316 THR D CG2 1 
ATOM   8797  N  N   . VAL D 1 317 ? -57.409 14.741  21.046  1.00 64.41  ? 317 VAL D N   1 
ATOM   8798  C  CA  . VAL D 1 317 ? -56.301 15.573  21.500  1.00 80.30  ? 317 VAL D CA  1 
ATOM   8799  C  C   . VAL D 1 317 ? -55.127 14.720  21.967  1.00 88.41  ? 317 VAL D C   1 
ATOM   8800  O  O   . VAL D 1 317 ? -54.979 14.450  23.159  1.00 88.37  ? 317 VAL D O   1 
ATOM   8801  C  CB  . VAL D 1 317 ? -56.731 16.508  22.644  1.00 87.34  ? 317 VAL D CB  1 
ATOM   8802  C  CG1 . VAL D 1 317 ? -55.519 16.964  23.440  1.00 96.60  ? 317 VAL D CG1 1 
ATOM   8803  C  CG2 . VAL D 1 317 ? -57.497 17.701  22.094  1.00 72.26  ? 317 VAL D CG2 1 
ATOM   8804  N  N   . PRO E 1 13  ? -12.129 54.631  68.495  1.00 86.59  ? 13  PRO E N   1 
ATOM   8805  C  CA  . PRO E 1 13  ? -12.111 55.734  69.461  1.00 82.05  ? 13  PRO E CA  1 
ATOM   8806  C  C   . PRO E 1 13  ? -11.135 55.467  70.601  1.00 81.91  ? 13  PRO E C   1 
ATOM   8807  O  O   . PRO E 1 13  ? -10.243 54.630  70.463  1.00 88.48  ? 13  PRO E O   1 
ATOM   8808  C  CB  . PRO E 1 13  ? -13.545 55.752  69.990  1.00 77.43  ? 13  PRO E CB  1 
ATOM   8809  C  CG  . PRO E 1 13  ? -14.357 55.211  68.871  1.00 84.80  ? 13  PRO E CG  1 
ATOM   8810  C  CD  . PRO E 1 13  ? -13.498 54.177  68.199  1.00 95.15  ? 13  PRO E CD  1 
ATOM   8811  N  N   . ILE E 1 14  ? -11.306 56.175  71.712  1.00 73.66  ? 14  ILE E N   1 
ATOM   8812  C  CA  . ILE E 1 14  ? -10.431 56.011  72.865  1.00 71.07  ? 14  ILE E CA  1 
ATOM   8813  C  C   . ILE E 1 14  ? -11.321 55.367  73.923  1.00 88.15  ? 14  ILE E C   1 
ATOM   8814  O  O   . ILE E 1 14  ? -12.045 54.413  73.639  1.00 117.93 ? 14  ILE E O   1 
ATOM   8815  C  CB  . ILE E 1 14  ? -9.943  57.368  73.399  1.00 73.49  ? 14  ILE E CB  1 
ATOM   8816  C  CG1 . ILE E 1 14  ? -8.638  57.198  74.178  1.00 72.05  ? 14  ILE E CG1 1 
ATOM   8817  C  CG2 . ILE E 1 14  ? -11.009 58.012  74.271  1.00 82.00  ? 14  ILE E CG2 1 
ATOM   8818  C  CD1 . ILE E 1 14  ? -8.365  58.317  75.160  1.00 74.46  ? 14  ILE E CD1 1 
ATOM   8819  N  N   . MET E 1 15  ? -11.267 55.898  75.139  1.00 68.49  ? 15  MET E N   1 
ATOM   8820  C  CA  . MET E 1 15  ? -12.024 55.340  76.252  1.00 58.71  ? 15  MET E CA  1 
ATOM   8821  C  C   . MET E 1 15  ? -12.888 56.426  76.879  1.00 72.88  ? 15  MET E C   1 
ATOM   8822  O  O   . MET E 1 15  ? -12.375 57.389  77.448  1.00 85.56  ? 15  MET E O   1 
ATOM   8823  C  CB  . MET E 1 15  ? -11.088 54.735  77.300  1.00 56.38  ? 15  MET E CB  1 
ATOM   8824  C  CG  . MET E 1 15  ? -11.794 53.876  78.337  1.00 52.49  ? 15  MET E CG  1 
ATOM   8825  S  SD  . MET E 1 15  ? -13.177 52.941  77.652  1.00 81.82  ? 15  MET E SD  1 
ATOM   8826  C  CE  . MET E 1 15  ? -14.122 52.595  79.133  1.00 27.07  ? 15  MET E CE  1 
ATOM   8827  N  N   . HIS E 1 16  ? -14.203 56.272  76.763  1.00 67.59  ? 16  HIS E N   1 
ATOM   8828  C  CA  . HIS E 1 16  ? -15.132 57.293  77.228  1.00 67.47  ? 16  HIS E CA  1 
ATOM   8829  C  C   . HIS E 1 16  ? -15.987 56.836  78.406  1.00 69.37  ? 16  HIS E C   1 
ATOM   8830  O  O   . HIS E 1 16  ? -16.272 55.649  78.562  1.00 66.40  ? 16  HIS E O   1 
ATOM   8831  C  CB  . HIS E 1 16  ? -16.037 57.743  76.080  1.00 68.76  ? 16  HIS E CB  1 
ATOM   8832  C  CG  . HIS E 1 16  ? -16.652 56.610  75.319  1.00 77.90  ? 16  HIS E CG  1 
ATOM   8833  N  ND1 . HIS E 1 16  ? -17.944 56.181  75.536  1.00 70.32  ? 16  HIS E ND1 1 
ATOM   8834  C  CD2 . HIS E 1 16  ? -16.152 55.816  74.343  1.00 69.91  ? 16  HIS E CD2 1 
ATOM   8835  C  CE1 . HIS E 1 16  ? -18.213 55.172  74.727  1.00 71.38  ? 16  HIS E CE1 1 
ATOM   8836  N  NE2 . HIS E 1 16  ? -17.143 54.931  73.992  1.00 68.94  ? 16  HIS E NE2 1 
ATOM   8837  N  N   . ASP E 1 17  ? -16.394 57.798  79.226  1.00 77.47  ? 17  ASP E N   1 
ATOM   8838  C  CA  . ASP E 1 17  ? -17.296 57.546  80.345  1.00 74.30  ? 17  ASP E CA  1 
ATOM   8839  C  C   . ASP E 1 17  ? -16.845 56.336  81.155  1.00 70.10  ? 17  ASP E C   1 
ATOM   8840  O  O   . ASP E 1 17  ? -17.617 55.405  81.379  1.00 72.18  ? 17  ASP E O   1 
ATOM   8841  C  CB  . ASP E 1 17  ? -18.725 57.335  79.843  1.00 78.69  ? 17  ASP E CB  1 
ATOM   8842  C  CG  . ASP E 1 17  ? -18.953 57.927  78.467  1.00 83.70  ? 17  ASP E CG  1 
ATOM   8843  O  OD1 . ASP E 1 17  ? -19.780 58.856  78.348  1.00 78.29  ? 17  ASP E OD1 1 
ATOM   8844  O  OD2 . ASP E 1 17  ? -18.304 57.466  77.504  1.00 86.41  ? 17  ASP E OD2 1 
ATOM   8845  N  N   . SER E 1 18  ? -15.590 56.358  81.591  1.00 83.68  ? 18  SER E N   1 
ATOM   8846  C  CA  . SER E 1 18  ? -15.025 55.252  82.356  1.00 93.09  ? 18  SER E CA  1 
ATOM   8847  C  C   . SER E 1 18  ? -15.598 55.188  83.769  1.00 90.81  ? 18  SER E C   1 
ATOM   8848  O  O   . SER E 1 18  ? -15.397 54.208  84.484  1.00 91.90  ? 18  SER E O   1 
ATOM   8849  C  CB  . SER E 1 18  ? -13.501 55.368  82.414  1.00 97.94  ? 18  SER E CB  1 
ATOM   8850  O  OG  . SER E 1 18  ? -13.093 56.152  83.521  1.00 102.91 ? 18  SER E OG  1 
ATOM   8851  N  N   . ASP E 1 19  ? -16.310 56.240  84.164  1.00 92.33  ? 19  ASP E N   1 
ATOM   8852  C  CA  . ASP E 1 19  ? -16.903 56.304  85.493  1.00 104.29 ? 19  ASP E CA  1 
ATOM   8853  C  C   . ASP E 1 19  ? -18.272 55.634  85.521  1.00 98.04  ? 19  ASP E C   1 
ATOM   8854  O  O   . ASP E 1 19  ? -19.066 55.860  86.432  1.00 94.89  ? 19  ASP E O   1 
ATOM   8855  C  CB  . ASP E 1 19  ? -17.023 57.758  85.954  1.00 118.99 ? 19  ASP E CB  1 
ATOM   8856  C  CG  . ASP E 1 19  ? -18.105 58.516  85.212  1.00 125.91 ? 19  ASP E CG  1 
ATOM   8857  O  OD1 . ASP E 1 19  ? -18.129 59.762  85.302  1.00 126.63 ? 19  ASP E OD1 1 
ATOM   8858  O  OD2 . ASP E 1 19  ? -18.931 57.866  84.536  1.00 126.93 ? 19  ASP E OD2 1 
ATOM   8859  N  N   . ARG E 1 20  ? -18.541 54.808  84.516  1.00 97.58  ? 20  ARG E N   1 
ATOM   8860  C  CA  . ARG E 1 20  ? -19.822 54.118  84.415  1.00 90.95  ? 20  ARG E CA  1 
ATOM   8861  C  C   . ARG E 1 20  ? -19.691 52.813  83.637  1.00 82.91  ? 20  ARG E C   1 
ATOM   8862  O  O   . ARG E 1 20  ? -20.566 51.950  83.701  1.00 72.32  ? 20  ARG E O   1 
ATOM   8863  C  CB  . ARG E 1 20  ? -20.861 55.023  83.747  1.00 97.61  ? 20  ARG E CB  1 
ATOM   8864  C  CG  . ARG E 1 20  ? -22.301 54.665  84.072  1.00 102.29 ? 20  ARG E CG  1 
ATOM   8865  C  CD  . ARG E 1 20  ? -23.254 55.763  83.631  1.00 102.44 ? 20  ARG E CD  1 
ATOM   8866  N  NE  . ARG E 1 20  ? -24.029 55.376  82.455  1.00 102.45 ? 20  ARG E NE  1 
ATOM   8867  C  CZ  . ARG E 1 20  ? -23.900 55.938  81.259  1.00 88.94  ? 20  ARG E CZ  1 
ATOM   8868  N  NH1 . ARG E 1 20  ? -23.022 56.915  81.074  1.00 79.28  ? 20  ARG E NH1 1 
ATOM   8869  N  NH2 . ARG E 1 20  ? -24.647 55.526  80.244  1.00 78.75  ? 20  ARG E NH2 1 
ATOM   8870  N  N   . TYR E 1 21  ? -18.593 52.677  82.901  1.00 81.43  ? 21  TYR E N   1 
ATOM   8871  C  CA  . TYR E 1 21  ? -18.364 51.502  82.092  1.00 75.02  ? 21  TYR E CA  1 
ATOM   8872  C  C   . TYR E 1 21  ? -16.918 51.085  82.316  1.00 73.88  ? 21  TYR E C   1 
ATOM   8873  O  O   . TYR E 1 21  ? -16.022 51.921  82.236  1.00 72.90  ? 21  TYR E O   1 
ATOM   8874  C  CB  . TYR E 1 21  ? -18.573 51.838  80.612  1.00 71.21  ? 21  TYR E CB  1 
ATOM   8875  C  CG  . TYR E 1 21  ? -20.017 51.866  80.185  1.00 74.34  ? 21  TYR E CG  1 
ATOM   8876  C  CD1 . TYR E 1 21  ? -20.749 50.683  80.060  1.00 62.39  ? 21  TYR E CD1 1 
ATOM   8877  C  CD2 . TYR E 1 21  ? -20.650 53.066  79.899  1.00 75.34  ? 21  TYR E CD2 1 
ATOM   8878  C  CE1 . TYR E 1 21  ? -22.076 50.690  79.679  1.00 57.95  ? 21  TYR E CE1 1 
ATOM   8879  C  CE2 . TYR E 1 21  ? -21.980 53.088  79.504  1.00 73.09  ? 21  TYR E CE2 1 
ATOM   8880  C  CZ  . TYR E 1 21  ? -22.687 51.890  79.397  1.00 70.45  ? 21  TYR E CZ  1 
ATOM   8881  O  OH  . TYR E 1 21  ? -24.006 51.896  79.009  1.00 78.55  ? 21  TYR E OH  1 
ATOM   8882  N  N   . GLU E 1 22  ? -16.681 49.808  82.609  1.00 68.87  ? 22  GLU E N   1 
ATOM   8883  C  CA  . GLU E 1 22  ? -15.313 49.295  82.633  1.00 58.73  ? 22  GLU E CA  1 
ATOM   8884  C  C   . GLU E 1 22  ? -14.961 48.752  81.244  1.00 50.54  ? 22  GLU E C   1 
ATOM   8885  O  O   . GLU E 1 22  ? -15.732 48.005  80.652  1.00 50.18  ? 22  GLU E O   1 
ATOM   8886  C  CB  . GLU E 1 22  ? -15.128 48.221  83.707  1.00 61.49  ? 22  GLU E CB  1 
ATOM   8887  C  CG  . GLU E 1 22  ? -13.686 47.697  83.785  1.00 84.78  ? 22  GLU E CG  1 
ATOM   8888  C  CD  . GLU E 1 22  ? -13.491 46.536  84.775  1.00 104.52 ? 22  GLU E CD  1 
ATOM   8889  O  OE1 . GLU E 1 22  ? -12.356 46.393  85.304  1.00 108.77 ? 22  GLU E OE1 1 
ATOM   8890  O  OE2 . GLU E 1 22  ? -14.457 45.761  85.009  1.00 113.44 ? 22  GLU E OE2 1 
ATOM   8891  N  N   . LEU E 1 23  ? -13.825 49.173  80.698  1.00 43.24  ? 23  LEU E N   1 
ATOM   8892  C  CA  . LEU E 1 23  ? -13.384 48.629  79.423  1.00 43.53  ? 23  LEU E CA  1 
ATOM   8893  C  C   . LEU E 1 23  ? -12.962 47.165  79.661  1.00 51.70  ? 23  LEU E C   1 
ATOM   8894  O  O   . LEU E 1 23  ? -12.243 46.866  80.597  1.00 43.21  ? 23  LEU E O   1 
ATOM   8895  C  CB  . LEU E 1 23  ? -12.240 49.456  78.824  1.00 43.61  ? 23  LEU E CB  1 
ATOM   8896  C  CG  . LEU E 1 23  ? -11.420 48.807  77.701  1.00 50.06  ? 23  LEU E CG  1 
ATOM   8897  C  CD1 . LEU E 1 23  ? -12.293 48.322  76.564  1.00 45.81  ? 23  LEU E CD1 1 
ATOM   8898  C  CD2 . LEU E 1 23  ? -10.354 49.763  77.160  1.00 60.36  ? 23  LEU E CD2 1 
ATOM   8899  N  N   . VAL E 1 24  ? -13.445 46.263  78.819  1.00 49.17  ? 24  VAL E N   1 
ATOM   8900  C  CA  . VAL E 1 24  ? -13.136 44.854  78.946  1.00 48.48  ? 24  VAL E CA  1 
ATOM   8901  C  C   . VAL E 1 24  ? -12.121 44.401  77.901  1.00 46.72  ? 24  VAL E C   1 
ATOM   8902  O  O   . VAL E 1 24  ? -11.034 43.938  78.259  1.00 53.89  ? 24  VAL E O   1 
ATOM   8903  C  CB  . VAL E 1 24  ? -14.406 43.995  78.871  1.00 55.89  ? 24  VAL E CB  1 
ATOM   8904  C  CG1 . VAL E 1 24  ? -14.046 42.533  78.668  1.00 57.06  ? 24  VAL E CG1 1 
ATOM   8905  C  CG2 . VAL E 1 24  ? -15.231 44.175  80.138  1.00 49.54  ? 24  VAL E CG2 1 
ATOM   8906  N  N   . LYS E 1 25  ? -12.426 44.599  76.623  1.00 36.06  ? 25  LYS E N   1 
ATOM   8907  C  CA  . LYS E 1 25  ? -11.457 44.303  75.569  1.00 50.50  ? 25  LYS E CA  1 
ATOM   8908  C  C   . LYS E 1 25  ? -11.873 44.858  74.208  1.00 58.97  ? 25  LYS E C   1 
ATOM   8909  O  O   . LYS E 1 25  ? -13.045 44.792  73.841  1.00 62.67  ? 25  LYS E O   1 
ATOM   8910  C  CB  . LYS E 1 25  ? -11.224 42.794  75.468  1.00 65.92  ? 25  LYS E CB  1 
ATOM   8911  C  CG  . LYS E 1 25  ? -9.762  42.386  75.534  1.00 74.08  ? 25  LYS E CG  1 
ATOM   8912  C  CD  . LYS E 1 25  ? -9.331  41.668  74.266  1.00 74.46  ? 25  LYS E CD  1 
ATOM   8913  C  CE  . LYS E 1 25  ? -7.818  41.560  74.184  1.00 77.19  ? 25  LYS E CE  1 
ATOM   8914  N  NZ  . LYS E 1 25  ? -7.323  41.771  72.796  1.00 79.87  ? 25  LYS E NZ  1 
ATOM   8915  N  N   . ASP E 1 26  ? -10.914 45.399  73.458  1.00 62.88  ? 26  ASP E N   1 
ATOM   8916  C  CA  . ASP E 1 26  ? -11.209 45.866  72.114  1.00 73.32  ? 26  ASP E CA  1 
ATOM   8917  C  C   . ASP E 1 26  ? -11.182 44.708  71.124  1.00 84.37  ? 26  ASP E C   1 
ATOM   8918  O  O   . ASP E 1 26  ? -10.113 44.231  70.739  1.00 86.89  ? 26  ASP E O   1 
ATOM   8919  C  CB  . ASP E 1 26  ? -10.221 46.964  71.691  1.00 72.76  ? 26  ASP E CB  1 
ATOM   8920  C  CG  . ASP E 1 26  ? -10.491 48.296  72.378  1.00 71.43  ? 26  ASP E CG  1 
ATOM   8921  O  OD1 . ASP E 1 26  ? -9.561  49.132  72.452  1.00 73.44  ? 26  ASP E OD1 1 
ATOM   8922  O  OD2 . ASP E 1 26  ? -11.633 48.501  72.836  1.00 57.62  ? 26  ASP E OD2 1 
ATOM   8923  N  N   . ILE E 1 27  ? -12.364 44.256  70.718  1.00 89.31  ? 27  ILE E N   1 
ATOM   8924  C  CA  . ILE E 1 27  ? -12.478 43.164  69.762  1.00 81.95  ? 27  ILE E CA  1 
ATOM   8925  C  C   . ILE E 1 27  ? -12.264 43.693  68.328  1.00 90.64  ? 27  ILE E C   1 
ATOM   8926  O  O   . ILE E 1 27  ? -12.537 44.873  68.034  1.00 84.82  ? 27  ILE E O   1 
ATOM   8927  C  CB  . ILE E 1 27  ? -13.832 42.415  69.932  1.00 108.07 ? 27  ILE E CB  1 
ATOM   8928  C  CG1 . ILE E 1 27  ? -14.043 41.392  68.811  1.00 116.26 ? 27  ILE E CG1 1 
ATOM   8929  C  CG2 . ILE E 1 27  ? -14.995 43.395  69.953  1.00 107.54 ? 27  ILE E CG2 1 
ATOM   8930  C  CD1 . ILE E 1 27  ? -15.517 41.086  68.516  1.00 118.81 ? 27  ILE E CD1 1 
ATOM   8931  N  N   . GLY E 1 28  ? -11.719 42.824  67.473  1.00 102.56 ? 28  GLY E N   1 
ATOM   8932  C  CA  . GLY E 1 28  ? -11.317 43.176  66.116  1.00 110.78 ? 28  GLY E CA  1 
ATOM   8933  C  C   . GLY E 1 28  ? -12.353 42.887  65.038  1.00 116.29 ? 28  GLY E C   1 
ATOM   8934  O  O   . GLY E 1 28  ? -13.024 43.800  64.564  1.00 123.05 ? 28  GLY E O   1 
ATOM   8935  N  N   . VAL E 1 34  ? -15.320 45.174  64.519  1.00 84.24  ? 34  VAL E N   1 
ATOM   8936  C  CA  . VAL E 1 34  ? -14.452 46.080  65.282  1.00 87.25  ? 34  VAL E CA  1 
ATOM   8937  C  C   . VAL E 1 34  ? -15.213 46.906  66.337  1.00 90.63  ? 34  VAL E C   1 
ATOM   8938  O  O   . VAL E 1 34  ? -15.568 48.063  66.119  1.00 96.42  ? 34  VAL E O   1 
ATOM   8939  C  CB  . VAL E 1 34  ? -13.569 46.958  64.342  1.00 78.96  ? 34  VAL E CB  1 
ATOM   8940  C  CG1 . VAL E 1 34  ? -14.338 47.370  63.086  1.00 82.37  ? 34  VAL E CG1 1 
ATOM   8941  C  CG2 . VAL E 1 34  ? -12.987 48.157  65.088  1.00 79.88  ? 34  VAL E CG2 1 
ATOM   8942  N  N   . ALA E 1 35  ? -15.448 46.275  67.487  1.00 84.12  ? 35  ALA E N   1 
ATOM   8943  C  CA  . ALA E 1 35  ? -16.254 46.830  68.570  1.00 79.92  ? 35  ALA E CA  1 
ATOM   8944  C  C   . ALA E 1 35  ? -15.452 46.851  69.874  1.00 64.65  ? 35  ALA E C   1 
ATOM   8945  O  O   . ALA E 1 35  ? -14.279 46.499  69.907  1.00 52.44  ? 35  ALA E O   1 
ATOM   8946  C  CB  . ALA E 1 35  ? -17.525 46.004  68.748  1.00 77.91  ? 35  ALA E CB  1 
ATOM   8947  N  N   . ARG E 1 36  ? -16.093 47.288  70.950  1.00 53.94  ? 36  ARG E N   1 
ATOM   8948  C  CA  . ARG E 1 36  ? -15.427 47.363  72.243  1.00 57.84  ? 36  ARG E CA  1 
ATOM   8949  C  C   . ARG E 1 36  ? -16.323 46.786  73.325  1.00 54.33  ? 36  ARG E C   1 
ATOM   8950  O  O   . ARG E 1 36  ? -17.441 47.258  73.528  1.00 65.56  ? 36  ARG E O   1 
ATOM   8951  C  CB  . ARG E 1 36  ? -15.064 48.811  72.578  1.00 62.42  ? 36  ARG E CB  1 
ATOM   8952  C  CG  . ARG E 1 36  ? -14.058 48.955  73.708  1.00 59.90  ? 36  ARG E CG  1 
ATOM   8953  C  CD  . ARG E 1 36  ? -14.330 50.201  74.535  1.00 56.67  ? 36  ARG E CD  1 
ATOM   8954  N  NE  . ARG E 1 36  ? -13.959 51.421  73.824  1.00 77.05  ? 36  ARG E NE  1 
ATOM   8955  C  CZ  . ARG E 1 36  ? -12.709 51.777  73.550  1.00 71.30  ? 36  ARG E CZ  1 
ATOM   8956  N  NH1 . ARG E 1 36  ? -11.699 51.005  73.929  1.00 70.93  ? 36  ARG E NH1 1 
ATOM   8957  N  NH2 . ARG E 1 36  ? -12.466 52.906  72.898  1.00 68.03  ? 36  ARG E NH2 1 
ATOM   8958  N  N   . LEU E 1 37  ? -15.838 45.762  74.018  1.00 48.00  ? 37  LEU E N   1 
ATOM   8959  C  CA  . LEU E 1 37  ? -16.642 45.135  75.047  1.00 38.64  ? 37  LEU E CA  1 
ATOM   8960  C  C   . LEU E 1 37  ? -16.471 45.964  76.295  1.00 41.36  ? 37  LEU E C   1 
ATOM   8961  O  O   . LEU E 1 37  ? -15.358 46.374  76.623  1.00 41.83  ? 37  LEU E O   1 
ATOM   8962  C  CB  . LEU E 1 37  ? -16.139 43.719  75.323  1.00 31.42  ? 37  LEU E CB  1 
ATOM   8963  C  CG  . LEU E 1 37  ? -16.853 42.549  74.685  1.00 49.93  ? 37  LEU E CG  1 
ATOM   8964  C  CD1 . LEU E 1 37  ? -17.491 43.004  73.399  1.00 51.42  ? 37  LEU E CD1 1 
ATOM   8965  C  CD2 . LEU E 1 37  ? -15.852 41.426  74.437  1.00 54.72  ? 37  LEU E CD2 1 
ATOM   8966  N  N   . MET E 1 38  ? -17.555 46.200  77.013  1.00 31.77  ? 38  MET E N   1 
ATOM   8967  C  CA  . MET E 1 38  ? -17.455 46.917  78.285  1.00 47.44  ? 38  MET E CA  1 
ATOM   8968  C  C   . MET E 1 38  ? -18.324 46.244  79.306  1.00 44.82  ? 38  MET E C   1 
ATOM   8969  O  O   . MET E 1 38  ? -19.263 45.530  78.967  1.00 46.64  ? 38  MET E O   1 
ATOM   8970  C  CB  . MET E 1 38  ? -17.942 48.349  78.142  1.00 63.12  ? 38  MET E CB  1 
ATOM   8971  C  CG  . MET E 1 38  ? -17.046 49.274  77.321  1.00 66.21  ? 38  MET E CG  1 
ATOM   8972  S  SD  . MET E 1 38  ? -17.787 50.908  77.287  1.00 88.25  ? 38  MET E SD  1 
ATOM   8973  C  CE  . MET E 1 38  ? -16.717 51.753  76.112  1.00 169.45 ? 38  MET E CE  1 
ATOM   8974  N  N   . ARG E 1 39  ? -18.015 46.469  80.560  1.00 50.45  ? 39  ARG E N   1 
ATOM   8975  C  CA  . ARG E 1 39  ? -18.867 45.983  81.613  1.00 63.17  ? 39  ARG E CA  1 
ATOM   8976  C  C   . ARG E 1 39  ? -19.525 47.233  82.155  1.00 71.41  ? 39  ARG E C   1 
ATOM   8977  O  O   . ARG E 1 39  ? -18.844 48.197  82.540  1.00 75.98  ? 39  ARG E O   1 
ATOM   8978  C  CB  . ARG E 1 39  ? -18.054 45.286  82.711  1.00 67.50  ? 39  ARG E CB  1 
ATOM   8979  C  CG  . ARG E 1 39  ? -18.899 44.462  83.668  1.00 71.15  ? 39  ARG E CG  1 
ATOM   8980  C  CD  . ARG E 1 39  ? -18.099 43.860  84.825  1.00 77.64  ? 39  ARG E CD  1 
ATOM   8981  N  NE  . ARG E 1 39  ? -17.377 44.888  85.558  1.00 89.66  ? 39  ARG E NE  1 
ATOM   8982  C  CZ  . ARG E 1 39  ? -17.682 45.409  86.749  1.00 96.94  ? 39  ARG E CZ  1 
ATOM   8983  N  NH1 . ARG E 1 39  ? -18.732 45.006  87.457  1.00 107.05 ? 39  ARG E NH1 1 
ATOM   8984  N  NH2 . ARG E 1 39  ? -16.892 46.360  87.234  1.00 84.75  ? 39  ARG E NH2 1 
ATOM   8985  N  N   . ASP E 1 40  ? -20.845 47.262  82.155  1.00 76.83  ? 40  ASP E N   1 
ATOM   8986  C  CA  . ASP E 1 40  ? -21.497 48.404  82.768  1.00 85.99  ? 40  ASP E CA  1 
ATOM   8987  C  C   . ASP E 1 40  ? -21.557 48.190  84.281  1.00 78.64  ? 40  ASP E C   1 
ATOM   8988  O  O   . ASP E 1 40  ? -22.146 47.227  84.752  1.00 77.24  ? 40  ASP E O   1 
ATOM   8989  C  CB  . ASP E 1 40  ? -22.854 48.647  82.114  1.00 96.42  ? 40  ASP E CB  1 
ATOM   8990  C  CG  . ASP E 1 40  ? -23.979 48.639  83.093  1.00 107.63 ? 40  ASP E CG  1 
ATOM   8991  O  OD1 . ASP E 1 40  ? -24.498 49.728  83.419  1.00 96.47  ? 40  ASP E OD1 1 
ATOM   8992  O  OD2 . ASP E 1 40  ? -24.345 47.528  83.529  1.00 125.63 ? 40  ASP E OD2 1 
ATOM   8993  N  N   . LYS E 1 41  ? -20.930 49.092  85.029  1.00 85.37  ? 41  LYS E N   1 
ATOM   8994  C  CA  . LYS E 1 41  ? -20.873 48.977  86.482  1.00 90.53  ? 41  LYS E CA  1 
ATOM   8995  C  C   . LYS E 1 41  ? -22.262 49.009  87.112  1.00 95.73  ? 41  LYS E C   1 
ATOM   8996  O  O   . LYS E 1 41  ? -22.430 48.661  88.281  1.00 87.59  ? 41  LYS E O   1 
ATOM   8997  C  CB  . LYS E 1 41  ? -20.000 50.087  87.072  1.00 90.63  ? 41  LYS E CB  1 
ATOM   8998  C  CG  . LYS E 1 41  ? -18.813 50.471  86.201  1.00 89.00  ? 41  LYS E CG  1 
ATOM   8999  C  CD  . LYS E 1 41  ? -17.515 50.447  86.992  1.00 87.27  ? 41  LYS E CD  1 
ATOM   9000  C  CE  . LYS E 1 41  ? -16.853 51.815  87.010  1.00 78.17  ? 41  LYS E CE  1 
ATOM   9001  N  NZ  . LYS E 1 41  ? -15.634 51.857  86.155  1.00 64.38  ? 41  LYS E NZ  1 
ATOM   9002  N  N   . GLN E 1 42  ? -23.255 49.426  86.332  1.00 110.12 ? 42  GLN E N   1 
ATOM   9003  C  CA  . GLN E 1 42  ? -24.627 49.507  86.822  1.00 122.01 ? 42  GLN E CA  1 
ATOM   9004  C  C   . GLN E 1 42  ? -25.282 48.187  87.215  1.00 122.28 ? 42  GLN E C   1 
ATOM   9005  O  O   . GLN E 1 42  ? -25.492 47.914  88.397  1.00 126.06 ? 42  GLN E O   1 
ATOM   9006  C  CB  . GLN E 1 42  ? -25.535 50.146  85.770  1.00 126.85 ? 42  GLN E CB  1 
ATOM   9007  C  CG  . GLN E 1 42  ? -26.313 51.350  86.275  1.00 127.95 ? 42  GLN E CG  1 
ATOM   9008  C  CD  . GLN E 1 42  ? -26.077 51.618  87.748  1.00 131.19 ? 42  GLN E CD  1 
ATOM   9009  O  OE1 . GLN E 1 42  ? -26.765 51.070  88.609  1.00 127.14 ? 42  GLN E OE1 1 
ATOM   9010  N  NE2 . GLN E 1 42  ? -25.100 52.466  88.045  1.00 135.60 ? 42  GLN E NE2 1 
ATOM   9011  N  N   . ALA E 1 43  ? -25.594 47.369  86.214  1.00 110.40 ? 43  ALA E N   1 
ATOM   9012  C  CA  . ALA E 1 43  ? -26.186 46.059  86.448  1.00 100.36 ? 43  ALA E CA  1 
ATOM   9013  C  C   . ALA E 1 43  ? -25.136 44.965  86.289  1.00 94.97  ? 43  ALA E C   1 
ATOM   9014  O  O   . ALA E 1 43  ? -25.465 43.783  86.199  1.00 82.99  ? 43  ALA E O   1 
ATOM   9015  C  CB  . ALA E 1 43  ? -27.348 45.824  85.498  1.00 95.43  ? 43  ALA E CB  1 
ATOM   9016  N  N   . ASN E 1 44  ? -23.872 45.371  86.253  1.00 99.34  ? 44  ASN E N   1 
ATOM   9017  C  CA  . ASN E 1 44  ? -22.767 44.432  86.104  1.00 100.70 ? 44  ASN E CA  1 
ATOM   9018  C  C   . ASN E 1 44  ? -23.026 43.400  85.013  1.00 87.26  ? 44  ASN E C   1 
ATOM   9019  O  O   . ASN E 1 44  ? -23.148 42.207  85.291  1.00 83.04  ? 44  ASN E O   1 
ATOM   9020  C  CB  . ASN E 1 44  ? -22.477 43.730  87.432  1.00 110.02 ? 44  ASN E CB  1 
ATOM   9021  C  CG  . ASN E 1 44  ? -21.249 42.845  87.367  1.00 113.71 ? 44  ASN E CG  1 
ATOM   9022  O  OD1 . ASN E 1 44  ? -20.262 43.179  86.711  1.00 116.70 ? 44  ASN E OD1 1 
ATOM   9023  N  ND2 . ASN E 1 44  ? -21.303 41.707  88.050  1.00 109.49 ? 44  ASN E ND2 1 
ATOM   9024  N  N   . GLU E 1 45  ? -23.109 43.865  83.771  1.00 82.42  ? 45  GLU E N   1 
ATOM   9025  C  CA  . GLU E 1 45  ? -23.348 42.979  82.639  1.00 85.32  ? 45  GLU E CA  1 
ATOM   9026  C  C   . GLU E 1 45  ? -22.593 43.439  81.396  1.00 79.27  ? 45  GLU E C   1 
ATOM   9027  O  O   . GLU E 1 45  ? -22.545 44.630  81.091  1.00 76.21  ? 45  GLU E O   1 
ATOM   9028  C  CB  . GLU E 1 45  ? -24.845 42.881  82.339  1.00 94.12  ? 45  GLU E CB  1 
ATOM   9029  C  CG  . GLU E 1 45  ? -25.557 44.221  82.272  1.00 106.30 ? 45  GLU E CG  1 
ATOM   9030  C  CD  . GLU E 1 45  ? -27.058 44.075  82.116  1.00 119.71 ? 45  GLU E CD  1 
ATOM   9031  O  OE1 . GLU E 1 45  ? -27.646 44.811  81.296  1.00 123.99 ? 45  GLU E OE1 1 
ATOM   9032  O  OE2 . GLU E 1 45  ? -27.650 43.223  82.811  1.00 120.85 ? 45  GLU E OE2 1 
ATOM   9033  N  N   . LEU E 1 46  ? -22.005 42.483  80.685  1.00 71.94  ? 46  LEU E N   1 
ATOM   9034  C  CA  . LEU E 1 46  ? -21.268 42.770  79.471  1.00 64.06  ? 46  LEU E CA  1 
ATOM   9035  C  C   . LEU E 1 46  ? -22.144 43.448  78.458  1.00 72.14  ? 46  LEU E C   1 
ATOM   9036  O  O   . LEU E 1 46  ? -23.348 43.161  78.346  1.00 76.53  ? 46  LEU E O   1 
ATOM   9037  C  CB  . LEU E 1 46  ? -20.701 41.497  78.848  1.00 52.44  ? 46  LEU E CB  1 
ATOM   9038  C  CG  . LEU E 1 46  ? -19.405 40.977  79.453  1.00 56.76  ? 46  LEU E CG  1 
ATOM   9039  C  CD1 . LEU E 1 46  ? -18.966 39.739  78.724  1.00 51.11  ? 46  LEU E CD1 1 
ATOM   9040  C  CD2 . LEU E 1 46  ? -18.325 42.032  79.364  1.00 58.20  ? 46  LEU E CD2 1 
ATOM   9041  N  N   . VAL E 1 47  ? -21.497 44.301  77.673  1.00 68.13  ? 47  VAL E N   1 
ATOM   9042  C  CA  . VAL E 1 47  ? -22.183 45.164  76.743  1.00 58.03  ? 47  VAL E CA  1 
ATOM   9043  C  C   . VAL E 1 47  ? -21.236 45.386  75.579  1.00 54.74  ? 47  VAL E C   1 
ATOM   9044  O  O   . VAL E 1 47  ? -20.020 45.399  75.773  1.00 52.22  ? 47  VAL E O   1 
ATOM   9045  C  CB  . VAL E 1 47  ? -22.481 46.473  77.459  1.00 61.13  ? 47  VAL E CB  1 
ATOM   9046  C  CG1 . VAL E 1 47  ? -21.945 47.648  76.673  1.00 75.23  ? 47  VAL E CG1 1 
ATOM   9047  C  CG2 . VAL E 1 47  ? -23.959 46.573  77.776  1.00 55.37  ? 47  VAL E CG2 1 
ATOM   9048  N  N   . ALA E 1 48  ? -21.761 45.503  74.368  1.00 44.76  ? 48  ALA E N   1 
ATOM   9049  C  CA  . ALA E 1 48  ? -20.878 45.771  73.247  1.00 49.02  ? 48  ALA E CA  1 
ATOM   9050  C  C   . ALA E 1 48  ? -21.121 47.194  72.798  1.00 56.59  ? 48  ALA E C   1 
ATOM   9051  O  O   . ALA E 1 48  ? -22.234 47.681  72.884  1.00 62.74  ? 48  ALA E O   1 
ATOM   9052  C  CB  . ALA E 1 48  ? -21.158 44.834  72.129  1.00 38.19  ? 48  ALA E CB  1 
ATOM   9053  N  N   . VAL E 1 49  ? -20.094 47.855  72.294  1.00 62.34  ? 49  VAL E N   1 
ATOM   9054  C  CA  . VAL E 1 49  ? -20.232 49.229  71.846  1.00 58.73  ? 49  VAL E CA  1 
ATOM   9055  C  C   . VAL E 1 49  ? -19.760 49.319  70.403  1.00 60.58  ? 49  VAL E C   1 
ATOM   9056  O  O   . VAL E 1 49  ? -18.680 48.829  70.055  1.00 53.34  ? 49  VAL E O   1 
ATOM   9057  C  CB  . VAL E 1 49  ? -19.408 50.170  72.739  1.00 49.43  ? 49  VAL E CB  1 
ATOM   9058  C  CG1 . VAL E 1 49  ? -19.619 51.592  72.322  1.00 55.66  ? 49  VAL E CG1 1 
ATOM   9059  C  CG2 . VAL E 1 49  ? -19.814 50.001  74.196  1.00 47.31  ? 49  VAL E CG2 1 
ATOM   9060  N  N   . LYS E 1 50  ? -20.587 49.929  69.562  1.00 67.36  ? 50  LYS E N   1 
ATOM   9061  C  CA  . LYS E 1 50  ? -20.234 50.198  68.174  1.00 74.87  ? 50  LYS E CA  1 
ATOM   9062  C  C   . LYS E 1 50  ? -20.034 51.709  67.992  1.00 67.14  ? 50  LYS E C   1 
ATOM   9063  O  O   . LYS E 1 50  ? -20.725 52.521  68.630  1.00 72.78  ? 50  LYS E O   1 
ATOM   9064  C  CB  . LYS E 1 50  ? -21.342 49.705  67.255  1.00 87.77  ? 50  LYS E CB  1 
ATOM   9065  C  CG  . LYS E 1 50  ? -20.858 49.191  65.914  1.00 95.71  ? 50  LYS E CG  1 
ATOM   9066  C  CD  . LYS E 1 50  ? -20.276 47.792  66.042  1.00 107.94 ? 50  LYS E CD  1 
ATOM   9067  C  CE  . LYS E 1 50  ? -19.427 47.424  64.813  1.00 113.45 ? 50  LYS E CE  1 
ATOM   9068  N  NZ  . LYS E 1 50  ? -20.189 46.814  63.666  1.00 112.74 ? 50  LYS E NZ  1 
ATOM   9069  N  N   . TYR E 1 51  ? -19.088 52.091  67.136  1.00 57.64  ? 51  TYR E N   1 
ATOM   9070  C  CA  . TYR E 1 51  ? -18.706 53.496  67.036  1.00 74.86  ? 51  TYR E CA  1 
ATOM   9071  C  C   . TYR E 1 51  ? -18.853 54.015  65.607  1.00 83.36  ? 51  TYR E C   1 
ATOM   9072  O  O   . TYR E 1 51  ? -18.316 53.396  64.668  1.00 71.73  ? 51  TYR E O   1 
ATOM   9073  C  CB  . TYR E 1 51  ? -17.259 53.704  67.511  1.00 59.78  ? 51  TYR E CB  1 
ATOM   9074  C  CG  . TYR E 1 51  ? -17.054 53.628  69.005  1.00 59.17  ? 51  TYR E CG  1 
ATOM   9075  C  CD1 . TYR E 1 51  ? -17.353 54.712  69.830  1.00 60.64  ? 51  TYR E CD1 1 
ATOM   9076  C  CD2 . TYR E 1 51  ? -16.532 52.482  69.595  1.00 47.54  ? 51  TYR E CD2 1 
ATOM   9077  C  CE1 . TYR E 1 51  ? -17.154 54.644  71.212  1.00 66.68  ? 51  TYR E CE1 1 
ATOM   9078  C  CE2 . TYR E 1 51  ? -16.330 52.410  70.973  1.00 48.15  ? 51  TYR E CE2 1 
ATOM   9079  C  CZ  . TYR E 1 51  ? -16.643 53.486  71.770  1.00 64.15  ? 51  TYR E CZ  1 
ATOM   9080  O  OH  . TYR E 1 51  ? -16.438 53.421  73.132  1.00 78.91  ? 51  TYR E OH  1 
ATOM   9081  N  N   . ILE E 1 52  ? -19.575 55.130  65.444  1.00 83.30  ? 52  ILE E N   1 
ATOM   9082  C  CA  . ILE E 1 52  ? -19.666 55.791  64.135  1.00 87.79  ? 52  ILE E CA  1 
ATOM   9083  C  C   . ILE E 1 52  ? -19.159 57.231  64.211  1.00 77.50  ? 52  ILE E C   1 
ATOM   9084  O  O   . ILE E 1 52  ? -19.470 57.936  65.189  1.00 50.68  ? 52  ILE E O   1 
ATOM   9085  C  CB  . ILE E 1 52  ? -21.116 55.844  63.609  1.00 94.20  ? 52  ILE E CB  1 
ATOM   9086  C  CG1 . ILE E 1 52  ? -21.736 54.445  63.579  1.00 80.56  ? 52  ILE E CG1 1 
ATOM   9087  C  CG2 . ILE E 1 52  ? -21.146 56.477  62.223  1.00 99.33  ? 52  ILE E CG2 1 
ATOM   9088  C  CD1 . ILE E 1 52  ? -23.215 54.451  63.275  1.00 76.30  ? 52  ILE E CD1 1 
ATOM   9089  N  N   . GLU E 1 53  ? -18.411 57.657  63.181  1.00 88.30  ? 53  GLU E N   1 
ATOM   9090  C  CA  . GLU E 1 53  ? -17.950 59.056  62.996  1.00 106.91 ? 53  GLU E CA  1 
ATOM   9091  C  C   . GLU E 1 53  ? -18.776 60.341  63.121  1.00 113.90 ? 53  GLU E C   1 
ATOM   9092  O  O   . GLU E 1 53  ? -19.893 60.435  62.618  1.00 125.92 ? 53  GLU E O   1 
ATOM   9093  C  CB  . GLU E 1 53  ? -17.816 59.361  61.511  1.00 120.79 ? 53  GLU E CB  1 
ATOM   9094  C  CG  . GLU E 1 53  ? -16.429 59.730  61.090  1.00 133.64 ? 53  GLU E CG  1 
ATOM   9095  C  CD  . GLU E 1 53  ? -15.563 58.505  60.907  1.00 145.29 ? 53  GLU E CD  1 
ATOM   9096  O  OE1 . GLU E 1 53  ? -15.677 57.854  59.842  1.00 152.14 ? 53  GLU E OE1 1 
ATOM   9097  O  OE2 . GLU E 1 53  ? -14.782 58.187  61.830  1.00 144.84 ? 53  GLU E OE2 1 
ATOM   9098  N  N   . ARG E 1 54  ? -18.185 61.352  63.748  1.00 108.00 ? 54  ARG E N   1 
ATOM   9099  C  CA  . ARG E 1 54  ? -18.893 62.527  64.227  1.00 118.04 ? 54  ARG E CA  1 
ATOM   9100  C  C   . ARG E 1 54  ? -19.588 63.204  63.052  1.00 140.05 ? 54  ARG E C   1 
ATOM   9101  O  O   . ARG E 1 54  ? -20.585 63.913  63.222  1.00 151.95 ? 54  ARG E O   1 
ATOM   9102  C  CB  . ARG E 1 54  ? -17.909 63.496  64.885  1.00 115.51 ? 54  ARG E CB  1 
ATOM   9103  C  CG  . ARG E 1 54  ? -18.568 64.672  65.561  1.00 108.20 ? 54  ARG E CG  1 
ATOM   9104  C  CD  . ARG E 1 54  ? -19.679 64.180  66.444  1.00 97.53  ? 54  ARG E CD  1 
ATOM   9105  N  NE  . ARG E 1 54  ? -19.263 64.159  67.833  1.00 91.58  ? 54  ARG E NE  1 
ATOM   9106  C  CZ  . ARG E 1 54  ? -19.480 65.158  68.678  1.00 87.46  ? 54  ARG E CZ  1 
ATOM   9107  N  NH1 . ARG E 1 54  ? -20.118 66.250  68.267  1.00 81.21  ? 54  ARG E NH1 1 
ATOM   9108  N  NH2 . ARG E 1 54  ? -19.068 65.065  69.934  1.00 89.41  ? 54  ARG E NH2 1 
ATOM   9109  N  N   . GLY E 1 55  ? -19.064 62.956  61.854  1.00 143.47 ? 55  GLY E N   1 
ATOM   9110  C  CA  . GLY E 1 55  ? -19.470 63.666  60.652  1.00 144.93 ? 55  GLY E CA  1 
ATOM   9111  C  C   . GLY E 1 55  ? -20.951 63.715  60.318  1.00 141.74 ? 55  GLY E C   1 
ATOM   9112  O  O   . GLY E 1 55  ? -21.801 63.260  61.088  1.00 131.61 ? 55  GLY E O   1 
ATOM   9113  N  N   . GLU E 1 56  ? -21.254 64.289  59.156  1.00 149.71 ? 56  GLU E N   1 
ATOM   9114  C  CA  . GLU E 1 56  ? -22.624 64.364  58.668  1.00 157.22 ? 56  GLU E CA  1 
ATOM   9115  C  C   . GLU E 1 56  ? -23.147 62.962  58.384  1.00 147.36 ? 56  GLU E C   1 
ATOM   9116  O  O   . GLU E 1 56  ? -24.358 62.741  58.347  1.00 148.13 ? 56  GLU E O   1 
ATOM   9117  C  CB  . GLU E 1 56  ? -22.724 65.238  57.402  1.00 168.04 ? 56  GLU E CB  1 
ATOM   9118  C  CG  . GLU E 1 56  ? -21.965 64.703  56.168  1.00 171.72 ? 56  GLU E CG  1 
ATOM   9119  C  CD  . GLU E 1 56  ? -22.351 65.400  54.850  1.00 169.77 ? 56  GLU E CD  1 
ATOM   9120  O  OE1 . GLU E 1 56  ? -21.588 65.279  53.859  1.00 165.03 ? 56  GLU E OE1 1 
ATOM   9121  O  OE2 . GLU E 1 56  ? -23.418 66.057  54.801  1.00 169.08 ? 56  GLU E OE2 1 
ATOM   9122  N  N   . LYS E 1 57  ? -22.230 62.016  58.194  1.00 133.21 ? 57  LYS E N   1 
ATOM   9123  C  CA  . LYS E 1 57  ? -22.594 60.644  57.846  1.00 124.34 ? 57  LYS E CA  1 
ATOM   9124  C  C   . LYS E 1 57  ? -23.016 59.956  59.144  1.00 113.17 ? 57  LYS E C   1 
ATOM   9125  O  O   . LYS E 1 57  ? -22.699 58.786  59.382  1.00 101.97 ? 57  LYS E O   1 
ATOM   9126  C  CB  . LYS E 1 57  ? -21.379 59.885  57.330  1.00 126.48 ? 57  LYS E CB  1 
ATOM   9127  C  CG  . LYS E 1 57  ? -20.190 59.935  58.257  1.00 126.16 ? 57  LYS E CG  1 
ATOM   9128  C  CD  . LYS E 1 57  ? -19.058 59.132  57.665  1.00 121.32 ? 57  LYS E CD  1 
ATOM   9129  C  CE  . LYS E 1 57  ? -19.573 57.814  57.111  1.00 110.11 ? 57  LYS E CE  1 
ATOM   9130  N  NZ  . LYS E 1 57  ? -18.456 57.036  56.519  1.00 102.54 ? 57  LYS E NZ  1 
ATOM   9131  N  N   . ILE E 1 58  ? -23.854 60.626  59.903  1.00 116.40 ? 58  ILE E N   1 
ATOM   9132  C  CA  . ILE E 1 58  ? -24.837 60.011  60.743  1.00 119.93 ? 58  ILE E CA  1 
ATOM   9133  C  C   . ILE E 1 58  ? -26.101 59.860  59.890  1.00 145.28 ? 58  ILE E C   1 
ATOM   9134  O  O   . ILE E 1 58  ? -27.198 59.795  60.445  1.00 155.76 ? 58  ILE E O   1 
ATOM   9135  C  CB  . ILE E 1 58  ? -25.132 60.872  61.985  1.00 107.59 ? 58  ILE E CB  1 
ATOM   9136  C  CG1 . ILE E 1 58  ? -24.888 60.066  63.263  1.00 97.37  ? 58  ILE E CG1 1 
ATOM   9137  C  CG2 . ILE E 1 58  ? -26.553 61.413  61.945  1.00 111.83 ? 58  ILE E CG2 1 
ATOM   9138  C  CD1 . ILE E 1 58  ? -23.467 60.153  63.776  1.00 87.18  ? 58  ILE E CD1 1 
ATOM   9139  N  N   . ASP E 1 59  ? -25.990 59.817  58.552  1.00 155.78 ? 59  ASP E N   1 
ATOM   9140  C  CA  . ASP E 1 59  ? -27.271 59.856  57.797  1.00 163.41 ? 59  ASP E CA  1 
ATOM   9141  C  C   . ASP E 1 59  ? -28.371 58.840  58.193  1.00 168.75 ? 59  ASP E C   1 
ATOM   9142  O  O   . ASP E 1 59  ? -28.254 58.124  59.201  1.00 173.37 ? 59  ASP E O   1 
ATOM   9143  C  CB  . ASP E 1 59  ? -27.130 59.221  56.378  1.00 103.57 ? 59  ASP E CB  1 
ATOM   9144  C  CG  . ASP E 1 59  ? -27.056 57.678  56.388  1.00 109.20 ? 59  ASP E CG  1 
ATOM   9145  O  OD1 . ASP E 1 59  ? -26.693 57.084  55.345  1.00 105.90 ? 59  ASP E OD1 1 
ATOM   9146  O  OD2 . ASP E 1 59  ? -27.369 57.052  57.416  1.00 116.75 ? 59  ASP E OD2 1 
ATOM   9147  N  N   . GLU E 1 60  ? -29.570 59.081  57.693  1.00 167.07 ? 60  GLU E N   1 
ATOM   9148  C  CA  . GLU E 1 60  ? -30.940 59.046  58.201  1.00 162.50 ? 60  GLU E CA  1 
ATOM   9149  C  C   . GLU E 1 60  ? -31.254 57.623  57.969  1.00 159.97 ? 60  GLU E C   1 
ATOM   9150  O  O   . GLU E 1 60  ? -32.373 57.133  58.112  1.00 162.59 ? 60  GLU E O   1 
ATOM   9151  C  CB  . GLU E 1 60  ? -31.853 59.941  57.369  1.00 160.12 ? 60  GLU E CB  1 
ATOM   9152  C  CG  . GLU E 1 60  ? -31.201 60.500  56.114  1.00 160.12 ? 60  GLU E CG  1 
ATOM   9153  C  CD  . GLU E 1 60  ? -32.084 60.367  54.890  1.00 158.79 ? 60  GLU E CD  1 
ATOM   9154  O  OE1 . GLU E 1 60  ? -32.881 59.406  54.832  1.00 154.16 ? 60  GLU E OE1 1 
ATOM   9155  O  OE2 . GLU E 1 60  ? -31.982 61.222  53.985  1.00 159.77 ? 60  GLU E OE2 1 
ATOM   9156  N  N   . ASN E 1 61  ? -30.213 56.899  57.570  1.00 154.79 ? 61  ASN E N   1 
ATOM   9157  C  CA  . ASN E 1 61  ? -30.314 55.466  57.337  1.00 148.85 ? 61  ASN E CA  1 
ATOM   9158  C  C   . ASN E 1 61  ? -29.730 54.703  58.517  1.00 144.06 ? 61  ASN E C   1 
ATOM   9159  O  O   . ASN E 1 61  ? -30.241 53.655  58.911  1.00 147.67 ? 61  ASN E O   1 
ATOM   9160  C  CB  . ASN E 1 61  ? -29.592 55.080  56.046  1.00 149.62 ? 61  ASN E CB  1 
ATOM   9161  C  CG  . ASN E 1 61  ? -29.867 53.649  55.631  1.00 154.65 ? 61  ASN E CG  1 
ATOM   9162  O  OD1 . ASN E 1 61  ? -30.761 52.995  56.168  1.00 163.54 ? 61  ASN E OD1 1 
ATOM   9163  N  ND2 . ASN E 1 61  ? -29.097 53.154  54.669  1.00 148.61 ? 61  ASN E ND2 1 
ATOM   9164  N  N   . VAL E 1 62  ? -28.655 55.246  59.080  1.00 132.23 ? 62  VAL E N   1 
ATOM   9165  C  CA  . VAL E 1 62  ? -28.032 54.669  60.260  1.00 118.67 ? 62  VAL E CA  1 
ATOM   9166  C  C   . VAL E 1 62  ? -28.814 55.080  61.501  1.00 123.30 ? 62  VAL E C   1 
ATOM   9167  O  O   . VAL E 1 62  ? -28.876 54.340  62.483  1.00 132.25 ? 62  VAL E O   1 
ATOM   9168  C  CB  . VAL E 1 62  ? -26.573 55.130  60.408  1.00 102.62 ? 62  VAL E CB  1 
ATOM   9169  C  CG1 . VAL E 1 62  ? -26.431 56.069  61.596  1.00 85.99  ? 62  VAL E CG1 1 
ATOM   9170  C  CG2 . VAL E 1 62  ? -25.650 53.931  60.554  1.00 104.90 ? 62  VAL E CG2 1 
ATOM   9171  N  N   . LYS E 1 63  ? -29.413 56.265  61.445  1.00 120.10 ? 63  LYS E N   1 
ATOM   9172  C  CA  . LYS E 1 63  ? -30.224 56.768  62.546  1.00 123.28 ? 63  LYS E CA  1 
ATOM   9173  C  C   . LYS E 1 63  ? -31.562 56.040  62.598  1.00 124.36 ? 63  LYS E C   1 
ATOM   9174  O  O   . LYS E 1 63  ? -32.135 55.848  63.669  1.00 128.45 ? 63  LYS E O   1 
ATOM   9175  C  CB  . LYS E 1 63  ? -30.450 58.274  62.401  1.00 120.03 ? 63  LYS E CB  1 
ATOM   9176  C  CG  . LYS E 1 63  ? -31.447 58.848  63.394  1.00 116.07 ? 63  LYS E CG  1 
ATOM   9177  C  CD  . LYS E 1 63  ? -32.616 59.511  62.684  1.00 111.06 ? 63  LYS E CD  1 
ATOM   9178  C  CE  . LYS E 1 63  ? -33.272 60.561  63.564  1.00 107.24 ? 63  LYS E CE  1 
ATOM   9179  N  NZ  . LYS E 1 63  ? -33.133 61.929  62.993  1.00 107.14 ? 63  LYS E NZ  1 
ATOM   9180  N  N   . ARG E 1 64  ? -32.053 55.635  61.431  1.00 119.59 ? 64  ARG E N   1 
ATOM   9181  C  CA  . ARG E 1 64  ? -33.304 54.895  61.347  1.00 125.85 ? 64  ARG E CA  1 
ATOM   9182  C  C   . ARG E 1 64  ? -33.132 53.503  61.940  1.00 115.69 ? 64  ARG E C   1 
ATOM   9183  O  O   . ARG E 1 64  ? -33.960 53.046  62.728  1.00 112.31 ? 64  ARG E O   1 
ATOM   9184  C  CB  . ARG E 1 64  ? -33.773 54.795  59.894  1.00 141.23 ? 64  ARG E CB  1 
ATOM   9185  C  CG  . ARG E 1 64  ? -33.414 53.483  59.215  1.00 150.84 ? 64  ARG E CG  1 
ATOM   9186  C  CD  . ARG E 1 64  ? -32.395 53.696  58.108  1.00 156.84 ? 64  ARG E CD  1 
ATOM   9187  N  NE  . ARG E 1 64  ? -32.956 54.442  56.986  1.00 155.72 ? 64  ARG E NE  1 
ATOM   9188  C  CZ  . ARG E 1 64  ? -33.209 53.918  55.791  1.00 154.95 ? 64  ARG E CZ  1 
ATOM   9189  N  NH1 . ARG E 1 64  ? -32.950 52.638  55.559  1.00 153.63 ? 64  ARG E NH1 1 
ATOM   9190  N  NH2 . ARG E 1 64  ? -33.720 54.672  54.828  1.00 154.18 ? 64  ARG E NH2 1 
ATOM   9191  N  N   . GLU E 1 65  ? -32.048 52.836  61.559  1.00 106.20 ? 65  GLU E N   1 
ATOM   9192  C  CA  . GLU E 1 65  ? -31.746 51.508  62.075  1.00 94.83  ? 65  GLU E CA  1 
ATOM   9193  C  C   . GLU E 1 65  ? -31.596 51.544  63.591  1.00 78.46  ? 65  GLU E C   1 
ATOM   9194  O  O   . GLU E 1 65  ? -31.898 50.568  64.278  1.00 92.90  ? 65  GLU E O   1 
ATOM   9195  C  CB  . GLU E 1 65  ? -30.471 50.961  61.430  1.00 100.40 ? 65  GLU E CB  1 
ATOM   9196  C  CG  . GLU E 1 65  ? -30.135 51.595  60.090  1.00 112.09 ? 65  GLU E CG  1 
ATOM   9197  C  CD  . GLU E 1 65  ? -29.235 50.719  59.241  1.00 131.15 ? 65  GLU E CD  1 
ATOM   9198  O  OE1 . GLU E 1 65  ? -28.061 51.095  59.036  1.00 137.30 ? 65  GLU E OE1 1 
ATOM   9199  O  OE2 . GLU E 1 65  ? -29.699 49.657  58.776  1.00 136.47 ? 65  GLU E OE2 1 
ATOM   9200  N  N   . ILE E 1 66  ? -31.128 52.675  64.107  1.00 53.23  ? 66  ILE E N   1 
ATOM   9201  C  CA  . ILE E 1 66  ? -30.959 52.848  65.544  1.00 61.84  ? 66  ILE E CA  1 
ATOM   9202  C  C   . ILE E 1 66  ? -32.311 52.866  66.244  1.00 74.03  ? 66  ILE E C   1 
ATOM   9203  O  O   . ILE E 1 66  ? -32.460 52.333  67.344  1.00 76.12  ? 66  ILE E O   1 
ATOM   9204  C  CB  . ILE E 1 66  ? -30.211 54.153  65.872  1.00 57.34  ? 66  ILE E CB  1 
ATOM   9205  C  CG1 . ILE E 1 66  ? -28.731 54.029  65.507  1.00 57.16  ? 66  ILE E CG1 1 
ATOM   9206  C  CG2 . ILE E 1 66  ? -30.373 54.502  67.343  1.00 52.17  ? 66  ILE E CG2 1 
ATOM   9207  C  CD1 . ILE E 1 66  ? -27.869 55.135  66.074  1.00 62.09  ? 66  ILE E CD1 1 
ATOM   9208  N  N   . ILE E 1 67  ? -33.294 53.483  65.598  1.00 87.20  ? 67  ILE E N   1 
ATOM   9209  C  CA  . ILE E 1 67  ? -34.649 53.576  66.160  1.00 86.18  ? 67  ILE E CA  1 
ATOM   9210  C  C   . ILE E 1 67  ? -35.330 52.236  66.027  1.00 84.85  ? 67  ILE E C   1 
ATOM   9211  O  O   . ILE E 1 67  ? -36.015 51.778  66.958  1.00 81.04  ? 67  ILE E O   1 
ATOM   9212  C  CB  . ILE E 1 67  ? -35.514 54.639  65.449  1.00 94.79  ? 67  ILE E CB  1 
ATOM   9213  C  CG1 . ILE E 1 67  ? -35.425 55.983  66.168  1.00 93.57  ? 67  ILE E CG1 1 
ATOM   9214  C  CG2 . ILE E 1 67  ? -36.975 54.210  65.465  1.00 101.60 ? 67  ILE E CG2 1 
ATOM   9215  C  CD1 . ILE E 1 67  ? -34.018 56.456  66.353  1.00 94.76  ? 67  ILE E CD1 1 
ATOM   9216  N  N   . ASN E 1 68  ? -35.153 51.614  64.857  1.00 91.76  ? 68  ASN E N   1 
ATOM   9217  C  CA  . ASN E 1 68  ? -35.642 50.254  64.623  1.00 93.06  ? 68  ASN E CA  1 
ATOM   9218  C  C   . ASN E 1 68  ? -35.172 49.292  65.698  1.00 84.68  ? 68  ASN E C   1 
ATOM   9219  O  O   . ASN E 1 68  ? -35.974 48.595  66.305  1.00 84.09  ? 68  ASN E O   1 
ATOM   9220  C  CB  . ASN E 1 68  ? -35.181 49.748  63.256  1.00 100.50 ? 68  ASN E CB  1 
ATOM   9221  C  CG  . ASN E 1 68  ? -36.155 50.101  62.155  1.00 113.59 ? 68  ASN E CG  1 
ATOM   9222  O  OD1 . ASN E 1 68  ? -37.363 50.071  62.358  1.00 125.91 ? 68  ASN E OD1 1 
ATOM   9223  N  ND2 . ASN E 1 68  ? -35.637 50.441  60.988  1.00 111.44 ? 68  ASN E ND2 1 
ATOM   9224  N  N   . HIS E 1 69  ? -33.861 49.262  65.916  1.00 77.58  ? 69  HIS E N   1 
ATOM   9225  C  CA  . HIS E 1 69  ? -33.263 48.374  66.898  1.00 70.24  ? 69  HIS E CA  1 
ATOM   9226  C  C   . HIS E 1 69  ? -33.839 48.735  68.267  1.00 66.64  ? 69  HIS E C   1 
ATOM   9227  O  O   . HIS E 1 69  ? -34.150 47.867  69.088  1.00 63.42  ? 69  HIS E O   1 
ATOM   9228  C  CB  . HIS E 1 69  ? -31.749 48.562  66.829  1.00 74.72  ? 69  HIS E CB  1 
ATOM   9229  C  CG  . HIS E 1 69  ? -30.962 47.600  67.667  1.00 87.71  ? 69  HIS E CG  1 
ATOM   9230  N  ND1 . HIS E 1 69  ? -31.474 46.950  68.762  1.00 89.34  ? 69  HIS E ND1 1 
ATOM   9231  C  CD2 . HIS E 1 69  ? -29.658 47.204  67.557  1.00 91.92  ? 69  HIS E CD2 1 
ATOM   9232  C  CE1 . HIS E 1 69  ? -30.530 46.175  69.296  1.00 90.85  ? 69  HIS E CE1 1 
ATOM   9233  N  NE2 . HIS E 1 69  ? -29.429 46.324  68.583  1.00 91.13  ? 69  HIS E NE2 1 
ATOM   9234  N  N   . ARG E 1 70  ? -34.032 50.032  68.485  1.00 66.83  ? 70  ARG E N   1 
ATOM   9235  C  CA  . ARG E 1 70  ? -34.432 50.521  69.798  1.00 65.30  ? 70  ARG E CA  1 
ATOM   9236  C  C   . ARG E 1 70  ? -35.804 49.971  70.198  1.00 75.34  ? 70  ARG E C   1 
ATOM   9237  O  O   . ARG E 1 70  ? -36.113 49.767  71.388  1.00 71.36  ? 70  ARG E O   1 
ATOM   9238  C  CB  . ARG E 1 70  ? -34.417 52.054  69.805  1.00 61.55  ? 70  ARG E CB  1 
ATOM   9239  C  CG  . ARG E 1 70  ? -34.337 52.688  71.190  1.00 57.79  ? 70  ARG E CG  1 
ATOM   9240  C  CD  . ARG E 1 70  ? -35.706 52.773  71.763  1.00 67.15  ? 70  ARG E CD  1 
ATOM   9241  N  NE  . ARG E 1 70  ? -35.727 53.225  73.146  1.00 87.09  ? 70  ARG E NE  1 
ATOM   9242  C  CZ  . ARG E 1 70  ? -36.792 53.803  73.696  1.00 99.84  ? 70  ARG E CZ  1 
ATOM   9243  N  NH1 . ARG E 1 70  ? -37.883 54.000  72.961  1.00 103.18 ? 70  ARG E NH1 1 
ATOM   9244  N  NH2 . ARG E 1 70  ? -36.774 54.191  74.962  1.00 100.15 ? 70  ARG E NH2 1 
ATOM   9245  N  N   . SER E 1 71  ? -36.617 49.693  69.191  1.00 80.97  ? 71  SER E N   1 
ATOM   9246  C  CA  . SER E 1 71  ? -37.977 49.233  69.447  1.00 79.96  ? 71  SER E CA  1 
ATOM   9247  C  C   . SER E 1 71  ? -38.081 47.735  69.792  1.00 77.97  ? 71  SER E C   1 
ATOM   9248  O  O   . SER E 1 71  ? -39.137 47.290  70.257  1.00 76.24  ? 71  SER E O   1 
ATOM   9249  C  CB  . SER E 1 71  ? -38.857 49.533  68.236  1.00 80.12  ? 71  SER E CB  1 
ATOM   9250  O  OG  . SER E 1 71  ? -38.499 48.680  67.150  1.00 79.03  ? 71  SER E OG  1 
ATOM   9251  N  N   . LEU E 1 72  ? -37.012 46.966  69.556  1.00 71.37  ? 72  LEU E N   1 
ATOM   9252  C  CA  . LEU E 1 72  ? -37.034 45.503  69.770  1.00 59.10  ? 72  LEU E CA  1 
ATOM   9253  C  C   . LEU E 1 72  ? -36.788 45.123  71.227  1.00 62.90  ? 72  LEU E C   1 
ATOM   9254  O  O   . LEU E 1 72  ? -35.682 45.307  71.759  1.00 69.87  ? 72  LEU E O   1 
ATOM   9255  C  CB  . LEU E 1 72  ? -36.023 44.817  68.869  1.00 48.08  ? 72  LEU E CB  1 
ATOM   9256  C  CG  . LEU E 1 72  ? -36.294 45.066  67.392  1.00 53.38  ? 72  LEU E CG  1 
ATOM   9257  C  CD1 . LEU E 1 72  ? -35.216 44.461  66.535  1.00 55.53  ? 72  LEU E CD1 1 
ATOM   9258  C  CD2 . LEU E 1 72  ? -37.636 44.473  67.043  1.00 52.85  ? 72  LEU E CD2 1 
ATOM   9259  N  N   . ARG E 1 73  ? -37.848 44.661  71.885  1.00 59.79  ? 73  ARG E N   1 
ATOM   9260  C  CA  . ARG E 1 73  ? -37.812 44.345  73.308  1.00 67.14  ? 73  ARG E CA  1 
ATOM   9261  C  C   . ARG E 1 73  ? -38.203 42.893  73.531  1.00 75.31  ? 73  ARG E C   1 
ATOM   9262  O  O   . ARG E 1 73  ? -39.280 42.591  74.047  1.00 79.39  ? 73  ARG E O   1 
ATOM   9263  C  CB  . ARG E 1 73  ? -38.748 45.269  74.087  1.00 83.67  ? 73  ARG E CB  1 
ATOM   9264  C  CG  . ARG E 1 73  ? -38.198 46.668  74.299  1.00 101.44 ? 73  ARG E CG  1 
ATOM   9265  C  CD  . ARG E 1 73  ? -36.717 46.633  74.638  1.00 116.45 ? 73  ARG E CD  1 
ATOM   9266  N  NE  . ARG E 1 73  ? -36.488 46.569  76.078  1.00 123.27 ? 73  ARG E NE  1 
ATOM   9267  C  CZ  . ARG E 1 73  ? -35.310 46.314  76.638  1.00 126.94 ? 73  ARG E CZ  1 
ATOM   9268  N  NH1 . ARG E 1 73  ? -34.245 46.097  75.877  1.00 124.56 ? 73  ARG E NH1 1 
ATOM   9269  N  NH2 . ARG E 1 73  ? -35.197 46.276  77.958  1.00 130.63 ? 73  ARG E NH2 1 
ATOM   9270  N  N   . HIS E 1 74  ? -37.310 42.002  73.130  1.00 75.56  ? 74  HIS E N   1 
ATOM   9271  C  CA  . HIS E 1 74  ? -37.529 40.537  73.204  1.00 65.69  ? 74  HIS E CA  1 
ATOM   9272  C  C   . HIS E 1 74  ? -36.242 39.850  73.625  1.00 57.60  ? 74  HIS E C   1 
ATOM   9273  O  O   . HIS E 1 74  ? -35.185 40.144  73.082  1.00 64.20  ? 74  HIS E O   1 
ATOM   9274  C  CB  . HIS E 1 74  ? -37.974 39.993  71.830  1.00 63.97  ? 74  HIS E CB  1 
ATOM   9275  C  CG  . HIS E 1 74  ? -38.394 38.540  71.824  1.00 72.05  ? 74  HIS E CG  1 
ATOM   9276  N  ND1 . HIS E 1 74  ? -37.489 37.495  71.733  1.00 79.19  ? 74  HIS E ND1 1 
ATOM   9277  C  CD2 . HIS E 1 74  ? -39.621 37.970  71.831  1.00 58.01  ? 74  HIS E CD2 1 
ATOM   9278  C  CE1 . HIS E 1 74  ? -38.150 36.349  71.712  1.00 62.72  ? 74  HIS E CE1 1 
ATOM   9279  N  NE2 . HIS E 1 74  ? -39.439 36.599  71.778  1.00 39.43  ? 74  HIS E NE2 1 
ATOM   9280  N  N   . PRO E 1 75  ? -36.331 38.910  74.571  1.00 62.69  ? 75  PRO E N   1 
ATOM   9281  C  CA  . PRO E 1 75  ? -35.180 38.230  75.199  1.00 54.72  ? 75  PRO E CA  1 
ATOM   9282  C  C   . PRO E 1 75  ? -34.436 37.236  74.286  1.00 55.25  ? 75  PRO E C   1 
ATOM   9283  O  O   . PRO E 1 75  ? -33.362 36.739  74.635  1.00 73.69  ? 75  PRO E O   1 
ATOM   9284  C  CB  . PRO E 1 75  ? -35.822 37.478  76.366  1.00 42.23  ? 75  PRO E CB  1 
ATOM   9285  C  CG  . PRO E 1 75  ? -37.189 37.132  75.861  1.00 43.05  ? 75  PRO E CG  1 
ATOM   9286  C  CD  . PRO E 1 75  ? -37.617 38.334  75.014  1.00 56.85  ? 75  PRO E CD  1 
ATOM   9287  N  N   . ASN E 1 76  ? -35.051 36.902  73.156  1.00 41.03  ? 76  ASN E N   1 
ATOM   9288  C  CA  . ASN E 1 76  ? -34.443 35.991  72.194  1.00 46.44  ? 76  ASN E CA  1 
ATOM   9289  C  C   . ASN E 1 76  ? -33.662 36.735  71.119  1.00 57.00  ? 76  ASN E C   1 
ATOM   9290  O  O   . ASN E 1 76  ? -33.038 36.127  70.251  1.00 63.65  ? 76  ASN E O   1 
ATOM   9291  C  CB  . ASN E 1 76  ? -35.502 35.089  71.561  1.00 36.88  ? 76  ASN E CB  1 
ATOM   9292  C  CG  . ASN E 1 76  ? -35.857 33.907  72.440  1.00 48.10  ? 76  ASN E CG  1 
ATOM   9293  O  OD1 . ASN E 1 76  ? -35.140 33.588  73.388  1.00 53.50  ? 76  ASN E OD1 1 
ATOM   9294  N  ND2 . ASN E 1 76  ? -36.968 33.250  72.130  1.00 55.04  ? 76  ASN E ND2 1 
ATOM   9295  N  N   . ILE E 1 77  ? -33.695 38.063  71.203  1.00 45.87  ? 77  ILE E N   1 
ATOM   9296  C  CA  . ILE E 1 77  ? -33.025 38.932  70.239  1.00 53.99  ? 77  ILE E CA  1 
ATOM   9297  C  C   . ILE E 1 77  ? -32.202 40.016  70.934  1.00 50.16  ? 77  ILE E C   1 
ATOM   9298  O  O   . ILE E 1 77  ? -32.520 40.432  72.047  1.00 53.57  ? 77  ILE E O   1 
ATOM   9299  C  CB  . ILE E 1 77  ? -34.038 39.608  69.297  1.00 59.80  ? 77  ILE E CB  1 
ATOM   9300  C  CG1 . ILE E 1 77  ? -34.057 38.906  67.939  1.00 65.27  ? 77  ILE E CG1 1 
ATOM   9301  C  CG2 . ILE E 1 77  ? -33.710 41.084  69.135  1.00 49.45  ? 77  ILE E CG2 1 
ATOM   9302  C  CD1 . ILE E 1 77  ? -34.969 39.564  66.926  1.00 53.50  ? 77  ILE E CD1 1 
ATOM   9303  N  N   . VAL E 1 78  ? -31.142 40.466  70.268  1.00 59.08  ? 78  VAL E N   1 
ATOM   9304  C  CA  . VAL E 1 78  ? -30.258 41.495  70.812  1.00 70.18  ? 78  VAL E CA  1 
ATOM   9305  C  C   . VAL E 1 78  ? -30.949 42.850  70.956  1.00 60.31  ? 78  VAL E C   1 
ATOM   9306  O  O   . VAL E 1 78  ? -31.780 43.224  70.129  1.00 54.91  ? 78  VAL E O   1 
ATOM   9307  C  CB  . VAL E 1 78  ? -28.996 41.667  69.946  1.00 78.23  ? 78  VAL E CB  1 
ATOM   9308  C  CG1 . VAL E 1 78  ? -28.000 42.585  70.637  1.00 90.77  ? 78  VAL E CG1 1 
ATOM   9309  C  CG2 . VAL E 1 78  ? -28.368 40.315  69.648  1.00 69.76  ? 78  VAL E CG2 1 
ATOM   9310  N  N   . ARG E 1 79  ? -30.600 43.580  72.010  1.00 57.24  ? 79  ARG E N   1 
ATOM   9311  C  CA  . ARG E 1 79  ? -31.180 44.895  72.258  1.00 73.04  ? 79  ARG E CA  1 
ATOM   9312  C  C   . ARG E 1 79  ? -30.093 45.920  72.561  1.00 69.90  ? 79  ARG E C   1 
ATOM   9313  O  O   . ARG E 1 79  ? -28.982 45.560  72.951  1.00 61.63  ? 79  ARG E O   1 
ATOM   9314  C  CB  . ARG E 1 79  ? -32.180 44.831  73.414  1.00 83.93  ? 79  ARG E CB  1 
ATOM   9315  C  CG  . ARG E 1 79  ? -32.121 43.540  74.215  1.00 85.43  ? 79  ARG E CG  1 
ATOM   9316  C  CD  . ARG E 1 79  ? -33.514 43.003  74.500  1.00 80.21  ? 79  ARG E CD  1 
ATOM   9317  N  NE  . ARG E 1 79  ? -33.525 42.086  75.636  1.00 78.20  ? 79  ARG E NE  1 
ATOM   9318  C  CZ  . ARG E 1 79  ? -34.580 41.875  76.415  1.00 81.21  ? 79  ARG E CZ  1 
ATOM   9319  N  NH1 . ARG E 1 79  ? -35.718 42.515  76.182  1.00 76.28  ? 79  ARG E NH1 1 
ATOM   9320  N  NH2 . ARG E 1 79  ? -34.500 41.022  77.428  1.00 84.43  ? 79  ARG E NH2 1 
ATOM   9321  N  N   . PHE E 1 80  ? -30.416 47.196  72.379  1.00 80.02  ? 80  PHE E N   1 
ATOM   9322  C  CA  . PHE E 1 80  ? -29.452 48.265  72.630  1.00 71.51  ? 80  PHE E CA  1 
ATOM   9323  C  C   . PHE E 1 80  ? -29.840 49.117  73.837  1.00 72.87  ? 80  PHE E C   1 
ATOM   9324  O  O   . PHE E 1 80  ? -30.943 49.657  73.903  1.00 82.25  ? 80  PHE E O   1 
ATOM   9325  C  CB  . PHE E 1 80  ? -29.302 49.147  71.388  1.00 64.54  ? 80  PHE E CB  1 
ATOM   9326  C  CG  . PHE E 1 80  ? -30.033 50.456  71.481  1.00 67.47  ? 80  PHE E CG  1 
ATOM   9327  C  CD1 . PHE E 1 80  ? -29.375 51.651  71.244  1.00 65.74  ? 80  PHE E CD1 1 
ATOM   9328  C  CD2 . PHE E 1 80  ? -31.379 50.491  71.805  1.00 67.03  ? 80  PHE E CD2 1 
ATOM   9329  C  CE1 . PHE E 1 80  ? -30.044 52.856  71.328  1.00 74.94  ? 80  PHE E CE1 1 
ATOM   9330  C  CE2 . PHE E 1 80  ? -32.054 51.693  71.893  1.00 65.50  ? 80  PHE E CE2 1 
ATOM   9331  C  CZ  . PHE E 1 80  ? -31.386 52.877  71.654  1.00 77.75  ? 80  PHE E CZ  1 
ATOM   9332  N  N   . LYS E 1 81  ? -28.920 49.220  74.791  1.00 77.74  ? 81  LYS E N   1 
ATOM   9333  C  CA  . LYS E 1 81  ? -29.142 49.979  76.020  1.00 72.16  ? 81  LYS E CA  1 
ATOM   9334  C  C   . LYS E 1 81  ? -29.329 51.484  75.821  1.00 69.62  ? 81  LYS E C   1 
ATOM   9335  O  O   . LYS E 1 81  ? -30.175 52.101  76.467  1.00 80.11  ? 81  LYS E O   1 
ATOM   9336  C  CB  . LYS E 1 81  ? -28.000 49.726  77.009  1.00 62.18  ? 81  LYS E CB  1 
ATOM   9337  C  CG  . LYS E 1 81  ? -27.634 48.261  77.172  1.00 83.25  ? 81  LYS E CG  1 
ATOM   9338  C  CD  . LYS E 1 81  ? -27.666 47.844  78.633  1.00 93.85  ? 81  LYS E CD  1 
ATOM   9339  C  CE  . LYS E 1 81  ? -27.498 46.340  78.783  1.00 101.83 ? 81  LYS E CE  1 
ATOM   9340  N  NZ  . LYS E 1 81  ? -28.654 45.719  79.485  1.00 102.98 ? 81  LYS E NZ  1 
ATOM   9341  N  N   . GLU E 1 82  ? -28.531 52.070  74.934  1.00 65.72  ? 82  GLU E N   1 
ATOM   9342  C  CA  . GLU E 1 82  ? -28.508 53.524  74.758  1.00 66.75  ? 82  GLU E CA  1 
ATOM   9343  C  C   . GLU E 1 82  ? -27.375 54.060  73.877  1.00 64.96  ? 82  GLU E C   1 
ATOM   9344  O  O   . GLU E 1 82  ? -26.358 53.396  73.676  1.00 68.25  ? 82  GLU E O   1 
ATOM   9345  C  CB  . GLU E 1 82  ? -28.467 54.218  76.123  1.00 84.76  ? 82  GLU E CB  1 
ATOM   9346  C  CG  . GLU E 1 82  ? -27.211 55.039  76.363  1.00 96.59  ? 82  GLU E CG  1 
ATOM   9347  C  CD  . GLU E 1 82  ? -26.360 54.485  77.487  1.00 102.83 ? 82  GLU E CD  1 
ATOM   9348  O  OE1 . GLU E 1 82  ? -26.452 53.269  77.761  1.00 115.50 ? 82  GLU E OE1 1 
ATOM   9349  O  OE2 . GLU E 1 82  ? -25.599 55.263  78.098  1.00 94.94  ? 82  GLU E OE2 1 
ATOM   9350  N  N   . VAL E 1 83  ? -27.568 55.274  73.365  1.00 69.72  ? 83  VAL E N   1 
ATOM   9351  C  CA  . VAL E 1 83  ? -26.542 55.989  72.599  1.00 65.17  ? 83  VAL E CA  1 
ATOM   9352  C  C   . VAL E 1 83  ? -25.836 57.006  73.486  1.00 68.20  ? 83  VAL E C   1 
ATOM   9353  O  O   . VAL E 1 83  ? -26.455 57.639  74.359  1.00 55.50  ? 83  VAL E O   1 
ATOM   9354  C  CB  . VAL E 1 83  ? -27.099 56.733  71.381  1.00 65.19  ? 83  VAL E CB  1 
ATOM   9355  C  CG1 . VAL E 1 83  ? -27.111 55.827  70.164  1.00 47.90  ? 83  VAL E CG1 1 
ATOM   9356  C  CG2 . VAL E 1 83  ? -28.481 57.323  71.690  1.00 64.03  ? 83  VAL E CG2 1 
ATOM   9357  N  N   . ILE E 1 84  ? -24.532 57.136  73.259  1.00 73.30  ? 84  ILE E N   1 
ATOM   9358  C  CA  . ILE E 1 84  ? -23.701 58.079  73.992  1.00 79.17  ? 84  ILE E CA  1 
ATOM   9359  C  C   . ILE E 1 84  ? -22.915 58.865  72.972  1.00 78.85  ? 84  ILE E C   1 
ATOM   9360  O  O   . ILE E 1 84  ? -22.411 58.289  71.990  1.00 62.78  ? 84  ILE E O   1 
ATOM   9361  C  CB  . ILE E 1 84  ? -22.678 57.371  74.879  1.00 77.68  ? 84  ILE E CB  1 
ATOM   9362  C  CG1 . ILE E 1 84  ? -23.356 56.286  75.709  1.00 74.04  ? 84  ILE E CG1 1 
ATOM   9363  C  CG2 . ILE E 1 84  ? -21.989 58.390  75.776  1.00 81.00  ? 84  ILE E CG2 1 
ATOM   9364  C  CD1 . ILE E 1 84  ? -22.474 55.751  76.778  1.00 73.71  ? 84  ILE E CD1 1 
ATOM   9365  N  N   . LEU E 1 85  ? -22.812 60.177  73.174  1.00 84.91  ? 85  LEU E N   1 
ATOM   9366  C  CA  . LEU E 1 85  ? -22.007 60.955  72.245  1.00 82.03  ? 85  LEU E CA  1 
ATOM   9367  C  C   . LEU E 1 85  ? -20.647 61.312  72.878  1.00 71.85  ? 85  LEU E C   1 
ATOM   9368  O  O   . LEU E 1 85  ? -20.555 61.659  74.067  1.00 57.99  ? 85  LEU E O   1 
ATOM   9369  C  CB  . LEU E 1 85  ? -22.818 62.118  71.660  1.00 78.36  ? 85  LEU E CB  1 
ATOM   9370  C  CG  . LEU E 1 85  ? -22.645 63.632  71.820  1.00 85.72  ? 85  LEU E CG  1 
ATOM   9371  C  CD1 . LEU E 1 85  ? -22.009 64.061  73.145  1.00 93.15  ? 85  LEU E CD1 1 
ATOM   9372  C  CD2 . LEU E 1 85  ? -21.859 64.142  70.646  1.00 84.31  ? 85  LEU E CD2 1 
ATOM   9373  N  N   . THR E 1 86  ? -19.597 61.215  72.069  1.00 73.18  ? 86  THR E N   1 
ATOM   9374  C  CA  . THR E 1 86  ? -18.246 61.517  72.523  1.00 92.84  ? 86  THR E CA  1 
ATOM   9375  C  C   . THR E 1 86  ? -17.849 62.822  71.845  1.00 113.14 ? 86  THR E C   1 
ATOM   9376  O  O   . THR E 1 86  ? -18.619 63.390  71.072  1.00 127.02 ? 86  THR E O   1 
ATOM   9377  C  CB  . THR E 1 86  ? -17.378 60.249  72.593  1.00 92.61  ? 86  THR E CB  1 
ATOM   9378  O  OG1 . THR E 1 86  ? -17.109 59.777  71.267  1.00 76.09  ? 86  THR E OG1 1 
ATOM   9379  C  CG2 . THR E 1 86  ? -18.089 59.158  73.380  1.00 93.67  ? 86  THR E CG2 1 
ATOM   9380  N  N   . PRO E 1 87  ? -16.642 63.293  72.139  1.00 113.28 ? 87  PRO E N   1 
ATOM   9381  C  CA  . PRO E 1 87  ? -15.928 64.305  71.355  1.00 113.36 ? 87  PRO E CA  1 
ATOM   9382  C  C   . PRO E 1 87  ? -15.869 64.091  69.847  1.00 110.83 ? 87  PRO E C   1 
ATOM   9383  O  O   . PRO E 1 87  ? -15.841 65.061  69.091  1.00 130.54 ? 87  PRO E O   1 
ATOM   9384  C  CB  . PRO E 1 87  ? -14.936 64.886  72.364  1.00 115.86 ? 87  PRO E CB  1 
ATOM   9385  C  CG  . PRO E 1 87  ? -15.591 64.689  73.683  1.00 114.93 ? 87  PRO E CG  1 
ATOM   9386  C  CD  . PRO E 1 87  ? -16.343 63.394  73.578  1.00 113.00 ? 87  PRO E CD  1 
ATOM   9387  N  N   . THR E 1 88  ? -15.851 62.833  69.419  1.00 85.77  ? 88  THR E N   1 
ATOM   9388  C  CA  . THR E 1 88  ? -15.224 62.184  68.274  1.00 80.85  ? 88  THR E CA  1 
ATOM   9389  C  C   . THR E 1 88  ? -16.213 61.335  67.480  1.00 75.23  ? 88  THR E C   1 
ATOM   9390  O  O   . THR E 1 88  ? -16.238 61.387  66.251  1.00 77.45  ? 88  THR E O   1 
ATOM   9391  C  CB  . THR E 1 88  ? -14.042 61.298  68.707  1.00 101.75 ? 88  THR E CB  1 
ATOM   9392  O  OG1 . THR E 1 88  ? -13.031 61.315  67.692  1.00 109.86 ? 88  THR E OG1 1 
ATOM   9393  C  CG2 . THR E 1 88  ? -14.505 59.867  68.931  1.00 114.70 ? 88  THR E CG2 1 
ATOM   9394  N  N   . HIS E 1 89  ? -17.023 60.553  68.185  1.00 75.56  ? 89  HIS E N   1 
ATOM   9395  C  CA  . HIS E 1 89  ? -18.000 59.667  67.525  1.00 73.15  ? 89  HIS E CA  1 
ATOM   9396  C  C   . HIS E 1 89  ? -19.284 59.536  68.316  1.00 75.83  ? 89  HIS E C   1 
ATOM   9397  O  O   . HIS E 1 89  ? -19.403 59.988  69.476  1.00 70.11  ? 89  HIS E O   1 
ATOM   9398  C  CB  . HIS E 1 89  ? -17.513 58.215  67.333  1.00 56.30  ? 89  HIS E CB  1 
ATOM   9399  C  CG  . HIS E 1 89  ? -16.055 58.077  67.044  1.00 67.04  ? 89  HIS E CG  1 
ATOM   9400  N  ND1 . HIS E 1 89  ? -15.568 57.325  65.991  1.00 55.96  ? 89  HIS E ND1 1 
ATOM   9401  C  CD2 . HIS E 1 89  ? -14.969 58.556  67.695  1.00 82.20  ? 89  HIS E CD2 1 
ATOM   9402  C  CE1 . HIS E 1 89  ? -14.248 57.368  65.993  1.00 65.32  ? 89  HIS E CE1 1 
ATOM   9403  N  NE2 . HIS E 1 89  ? -13.859 58.115  67.013  1.00 82.12  ? 89  HIS E NE2 1 
ATOM   9404  N  N   . LEU E 1 90  ? -20.225 58.849  67.666  1.00 66.27  ? 90  LEU E N   1 
ATOM   9405  C  CA  . LEU E 1 90  ? -21.458 58.404  68.285  1.00 67.03  ? 90  LEU E CA  1 
ATOM   9406  C  C   . LEU E 1 90  ? -21.233 56.969  68.704  1.00 67.26  ? 90  LEU E C   1 
ATOM   9407  O  O   . LEU E 1 90  ? -20.781 56.131  67.895  1.00 51.31  ? 90  LEU E O   1 
ATOM   9408  C  CB  . LEU E 1 90  ? -22.589 58.450  67.271  1.00 60.48  ? 90  LEU E CB  1 
ATOM   9409  C  CG  . LEU E 1 90  ? -23.926 57.862  67.723  1.00 61.64  ? 90  LEU E CG  1 
ATOM   9410  C  CD1 . LEU E 1 90  ? -24.561 58.697  68.849  1.00 65.26  ? 90  LEU E CD1 1 
ATOM   9411  C  CD2 . LEU E 1 90  ? -24.853 57.735  66.529  1.00 73.47  ? 90  LEU E CD2 1 
ATOM   9412  N  N   . ALA E 1 91  ? -21.533 56.697  69.970  1.00 67.68  ? 91  ALA E N   1 
ATOM   9413  C  CA  . ALA E 1 91  ? -21.393 55.360  70.523  1.00 78.67  ? 91  ALA E CA  1 
ATOM   9414  C  C   . ALA E 1 91  ? -22.759 54.704  70.581  1.00 75.94  ? 91  ALA E C   1 
ATOM   9415  O  O   . ALA E 1 91  ? -23.689 55.254  71.181  1.00 80.36  ? 91  ALA E O   1 
ATOM   9416  C  CB  . ALA E 1 91  ? -20.790 55.430  71.928  1.00 85.34  ? 91  ALA E CB  1 
ATOM   9417  N  N   . ILE E 1 92  ? -22.881 53.529  69.971  1.00 68.32  ? 92  ILE E N   1 
ATOM   9418  C  CA  . ILE E 1 92  ? -24.099 52.725  70.108  1.00 71.65  ? 92  ILE E CA  1 
ATOM   9419  C  C   . ILE E 1 92  ? -23.874 51.509  71.010  1.00 58.98  ? 92  ILE E C   1 
ATOM   9420  O  O   . ILE E 1 92  ? -23.139 50.596  70.643  1.00 46.88  ? 92  ILE E O   1 
ATOM   9421  C  CB  . ILE E 1 92  ? -24.558 52.243  68.734  1.00 80.81  ? 92  ILE E CB  1 
ATOM   9422  C  CG1 . ILE E 1 92  ? -24.642 53.437  67.777  1.00 69.86  ? 92  ILE E CG1 1 
ATOM   9423  C  CG2 . ILE E 1 92  ? -25.902 51.536  68.826  1.00 83.48  ? 92  ILE E CG2 1 
ATOM   9424  C  CD1 . ILE E 1 92  ? -24.762 53.020  66.328  1.00 46.47  ? 92  ILE E CD1 1 
ATOM   9425  N  N   . VAL E 1 93  ? -24.514 51.508  72.174  1.00 59.61  ? 93  VAL E N   1 
ATOM   9426  C  CA  . VAL E 1 93  ? -24.346 50.449  73.170  1.00 58.06  ? 93  VAL E CA  1 
ATOM   9427  C  C   . VAL E 1 93  ? -25.518 49.443  73.148  1.00 65.06  ? 93  VAL E C   1 
ATOM   9428  O  O   . VAL E 1 93  ? -26.698 49.831  73.149  1.00 59.73  ? 93  VAL E O   1 
ATOM   9429  C  CB  . VAL E 1 93  ? -24.262 51.069  74.541  1.00 49.69  ? 93  VAL E CB  1 
ATOM   9430  C  CG1 . VAL E 1 93  ? -24.103 50.022  75.608  1.00 51.80  ? 93  VAL E CG1 1 
ATOM   9431  C  CG2 . VAL E 1 93  ? -23.112 52.057  74.554  1.00 50.66  ? 93  VAL E CG2 1 
ATOM   9432  N  N   . MET E 1 94  ? -25.183 48.158  73.122  1.00 66.35  ? 94  MET E N   1 
ATOM   9433  C  CA  . MET E 1 94  ? -26.194 47.109  73.072  1.00 56.66  ? 94  MET E CA  1 
ATOM   9434  C  C   . MET E 1 94  ? -25.756 45.878  73.856  1.00 59.88  ? 94  MET E C   1 
ATOM   9435  O  O   . MET E 1 94  ? -24.584 45.735  74.202  1.00 56.45  ? 94  MET E O   1 
ATOM   9436  C  CB  . MET E 1 94  ? -26.491 46.724  71.622  1.00 34.00  ? 94  MET E CB  1 
ATOM   9437  C  CG  . MET E 1 94  ? -25.434 45.834  70.991  1.00 44.70  ? 94  MET E CG  1 
ATOM   9438  S  SD  . MET E 1 94  ? -25.217 46.149  69.230  1.00 78.05  ? 94  MET E SD  1 
ATOM   9439  C  CE  . MET E 1 94  ? -24.402 47.742  69.268  1.00 80.13  ? 94  MET E CE  1 
ATOM   9440  N  N   . GLU E 1 95  ? -26.706 44.992  74.132  1.00 64.76  ? 95  GLU E N   1 
ATOM   9441  C  CA  . GLU E 1 95  ? -26.418 43.760  74.852  1.00 60.80  ? 95  GLU E CA  1 
ATOM   9442  C  C   . GLU E 1 95  ? -25.358 42.948  74.119  1.00 63.26  ? 95  GLU E C   1 
ATOM   9443  O  O   . GLU E 1 95  ? -25.273 42.988  72.892  1.00 53.08  ? 95  GLU E O   1 
ATOM   9444  C  CB  . GLU E 1 95  ? -27.689 42.927  75.016  1.00 72.54  ? 95  GLU E CB  1 
ATOM   9445  C  CG  . GLU E 1 95  ? -28.479 43.239  76.275  1.00 94.33  ? 95  GLU E CG  1 
ATOM   9446  C  CD  . GLU E 1 95  ? -29.581 42.230  76.532  1.00 112.84 ? 95  GLU E CD  1 
ATOM   9447  O  OE1 . GLU E 1 95  ? -29.956 41.504  75.588  1.00 106.53 ? 95  GLU E OE1 1 
ATOM   9448  O  OE2 . GLU E 1 95  ? -30.071 42.163  77.679  1.00 123.28 ? 95  GLU E OE2 1 
ATOM   9449  N  N   . TYR E 1 96  ? -24.550 42.213  74.875  1.00 54.83  ? 96  TYR E N   1 
ATOM   9450  C  CA  . TYR E 1 96  ? -23.505 41.387  74.285  1.00 59.14  ? 96  TYR E CA  1 
ATOM   9451  C  C   . TYR E 1 96  ? -23.751 39.904  74.538  1.00 50.91  ? 96  TYR E C   1 
ATOM   9452  O  O   . TYR E 1 96  ? -23.896 39.473  75.681  1.00 49.96  ? 96  TYR E O   1 
ATOM   9453  C  CB  . TYR E 1 96  ? -22.129 41.789  74.822  1.00 52.88  ? 96  TYR E CB  1 
ATOM   9454  C  CG  . TYR E 1 96  ? -21.005 40.911  74.322  1.00 46.11  ? 96  TYR E CG  1 
ATOM   9455  C  CD1 . TYR E 1 96  ? -20.643 40.909  72.982  1.00 42.39  ? 96  TYR E CD1 1 
ATOM   9456  C  CD2 . TYR E 1 96  ? -20.309 40.079  75.188  1.00 48.75  ? 96  TYR E CD2 1 
ATOM   9457  C  CE1 . TYR E 1 96  ? -19.618 40.107  72.520  1.00 34.63  ? 96  TYR E CE1 1 
ATOM   9458  C  CE2 . TYR E 1 96  ? -19.283 39.274  74.735  1.00 39.39  ? 96  TYR E CE2 1 
ATOM   9459  C  CZ  . TYR E 1 96  ? -18.942 39.292  73.400  1.00 35.94  ? 96  TYR E CZ  1 
ATOM   9460  O  OH  . TYR E 1 96  ? -17.920 38.492  72.944  1.00 50.98  ? 96  TYR E OH  1 
ATOM   9461  N  N   . ALA E 1 97  ? -23.794 39.129  73.460  1.00 37.67  ? 97  ALA E N   1 
ATOM   9462  C  CA  . ALA E 1 97  ? -23.977 37.688  73.556  1.00 37.03  ? 97  ALA E CA  1 
ATOM   9463  C  C   . ALA E 1 97  ? -22.629 37.006  73.755  1.00 45.12  ? 97  ALA E C   1 
ATOM   9464  O  O   . ALA E 1 97  ? -21.974 36.610  72.792  1.00 42.74  ? 97  ALA E O   1 
ATOM   9465  C  CB  . ALA E 1 97  ? -24.664 37.157  72.311  1.00 45.69  ? 97  ALA E CB  1 
ATOM   9466  N  N   . SER E 1 98  ? -22.216 36.880  75.012  1.00 44.73  ? 98  SER E N   1 
ATOM   9467  C  CA  . SER E 1 98  ? -20.930 36.278  75.340  1.00 55.42  ? 98  SER E CA  1 
ATOM   9468  C  C   . SER E 1 98  ? -21.036 34.762  75.452  1.00 62.69  ? 98  SER E C   1 
ATOM   9469  O  O   . SER E 1 98  ? -20.844 34.197  76.528  1.00 77.34  ? 98  SER E O   1 
ATOM   9470  C  CB  . SER E 1 98  ? -20.389 36.860  76.646  1.00 64.67  ? 98  SER E CB  1 
ATOM   9471  O  OG  . SER E 1 98  ? -21.358 36.781  77.677  1.00 62.30  ? 98  SER E OG  1 
ATOM   9472  N  N   . GLY E 1 99  ? -21.341 34.107  74.338  1.00 57.84  ? 99  GLY E N   1 
ATOM   9473  C  CA  . GLY E 1 99  ? -21.480 32.664  74.326  1.00 37.99  ? 99  GLY E CA  1 
ATOM   9474  C  C   . GLY E 1 99  ? -21.193 32.039  72.976  1.00 48.27  ? 99  GLY E C   1 
ATOM   9475  O  O   . GLY E 1 99  ? -21.363 30.834  72.797  1.00 55.52  ? 99  GLY E O   1 
ATOM   9476  N  N   . GLY E 1 100 ? -20.757 32.854  72.021  1.00 41.38  ? 100 GLY E N   1 
ATOM   9477  C  CA  . GLY E 1 100 ? -20.455 32.353  70.695  1.00 31.96  ? 100 GLY E CA  1 
ATOM   9478  C  C   . GLY E 1 100 ? -21.596 31.999  69.746  1.00 32.94  ? 100 GLY E C   1 
ATOM   9479  O  O   . GLY E 1 100 ? -22.785 31.958  70.076  1.00 49.73  ? 100 GLY E O   1 
ATOM   9480  N  N   . GLU E 1 101 ? -21.225 31.723  68.515  1.00 28.49  ? 101 GLU E N   1 
ATOM   9481  C  CA  . GLU E 1 101 ? -22.228 31.345  67.571  1.00 38.55  ? 101 GLU E CA  1 
ATOM   9482  C  C   . GLU E 1 101 ? -22.818 30.018  67.980  1.00 40.79  ? 101 GLU E C   1 
ATOM   9483  O  O   . GLU E 1 101 ? -22.126 29.127  68.455  1.00 55.37  ? 101 GLU E O   1 
ATOM   9484  C  CB  . GLU E 1 101 ? -21.622 31.274  66.179  1.00 49.20  ? 101 GLU E CB  1 
ATOM   9485  C  CG  . GLU E 1 101 ? -20.803 32.507  65.854  1.00 48.59  ? 101 GLU E CG  1 
ATOM   9486  C  CD  . GLU E 1 101 ? -19.905 32.264  64.660  1.00 79.70  ? 101 GLU E CD  1 
ATOM   9487  O  OE1 . GLU E 1 101 ? -18.730 32.690  64.698  1.00 102.28 ? 101 GLU E OE1 1 
ATOM   9488  O  OE2 . GLU E 1 101 ? -20.376 31.627  63.693  1.00 70.89  ? 101 GLU E OE2 1 
ATOM   9489  N  N   . LEU E 1 102 ? -24.125 29.915  67.820  1.00 57.72  ? 102 LEU E N   1 
ATOM   9490  C  CA  . LEU E 1 102 ? -24.857 28.659  67.924  1.00 53.83  ? 102 LEU E CA  1 
ATOM   9491  C  C   . LEU E 1 102 ? -24.185 27.597  67.100  1.00 48.79  ? 102 LEU E C   1 
ATOM   9492  O  O   . LEU E 1 102 ? -24.118 26.448  67.504  1.00 50.79  ? 102 LEU E O   1 
ATOM   9493  C  CB  . LEU E 1 102 ? -26.281 28.840  67.386  1.00 38.88  ? 102 LEU E CB  1 
ATOM   9494  C  CG  . LEU E 1 102 ? -27.113 27.567  67.201  1.00 39.95  ? 102 LEU E CG  1 
ATOM   9495  C  CD1 . LEU E 1 102 ? -27.383 26.889  68.550  1.00 39.13  ? 102 LEU E CD1 1 
ATOM   9496  C  CD2 . LEU E 1 102 ? -28.398 27.903  66.532  1.00 40.74  ? 102 LEU E CD2 1 
ATOM   9497  N  N   . PHE E 1 103 ? -23.712 27.979  65.924  1.00 42.20  ? 103 PHE E N   1 
ATOM   9498  C  CA  . PHE E 1 103 ? -23.089 27.023  65.022  1.00 40.74  ? 103 PHE E CA  1 
ATOM   9499  C  C   . PHE E 1 103 ? -21.870 26.377  65.692  1.00 47.35  ? 103 PHE E C   1 
ATOM   9500  O  O   . PHE E 1 103 ? -21.570 25.203  65.490  1.00 37.81  ? 103 PHE E O   1 
ATOM   9501  C  CB  . PHE E 1 103 ? -22.684 27.739  63.743  1.00 31.84  ? 103 PHE E CB  1 
ATOM   9502  C  CG  . PHE E 1 103 ? -22.006 26.855  62.733  1.00 53.15  ? 103 PHE E CG  1 
ATOM   9503  C  CD1 . PHE E 1 103 ? -20.665 27.049  62.423  1.00 53.71  ? 103 PHE E CD1 1 
ATOM   9504  C  CD2 . PHE E 1 103 ? -22.702 25.851  62.079  1.00 51.83  ? 103 PHE E CD2 1 
ATOM   9505  C  CE1 . PHE E 1 103 ? -20.030 26.269  61.486  1.00 49.59  ? 103 PHE E CE1 1 
ATOM   9506  C  CE2 . PHE E 1 103 ? -22.068 25.055  61.132  1.00 59.71  ? 103 PHE E CE2 1 
ATOM   9507  C  CZ  . PHE E 1 103 ? -20.734 25.267  60.840  1.00 55.54  ? 103 PHE E CZ  1 
ATOM   9508  N  N   . GLU E 1 104 ? -21.175 27.160  66.500  1.00 40.90  ? 104 GLU E N   1 
ATOM   9509  C  CA  . GLU E 1 104 ? -19.959 26.706  67.133  1.00 44.90  ? 104 GLU E CA  1 
ATOM   9510  C  C   . GLU E 1 104 ? -20.301 25.616  68.127  1.00 50.75  ? 104 GLU E C   1 
ATOM   9511  O  O   . GLU E 1 104 ? -19.556 24.660  68.306  1.00 53.41  ? 104 GLU E O   1 
ATOM   9512  C  CB  . GLU E 1 104 ? -19.265 27.870  67.852  1.00 43.30  ? 104 GLU E CB  1 
ATOM   9513  C  CG  . GLU E 1 104 ? -17.766 27.835  67.735  1.00 75.70  ? 104 GLU E CG  1 
ATOM   9514  C  CD  . GLU E 1 104 ? -17.295 27.682  66.285  1.00 91.73  ? 104 GLU E CD  1 
ATOM   9515  O  OE1 . GLU E 1 104 ? -16.557 26.706  66.002  1.00 96.67  ? 104 GLU E OE1 1 
ATOM   9516  O  OE2 . GLU E 1 104 ? -17.665 28.534  65.437  1.00 91.52  ? 104 GLU E OE2 1 
ATOM   9517  N  N   . ARG E 1 105 ? -21.435 25.764  68.791  1.00 44.93  ? 105 ARG E N   1 
ATOM   9518  C  CA  . ARG E 1 105 ? -21.840 24.785  69.795  1.00 36.03  ? 105 ARG E CA  1 
ATOM   9519  C  C   . ARG E 1 105 ? -22.299 23.504  69.104  1.00 41.92  ? 105 ARG E C   1 
ATOM   9520  O  O   . ARG E 1 105 ? -22.143 22.381  69.634  1.00 36.85  ? 105 ARG E O   1 
ATOM   9521  C  CB  . ARG E 1 105 ? -22.972 25.322  70.648  1.00 35.07  ? 105 ARG E CB  1 
ATOM   9522  C  CG  . ARG E 1 105 ? -23.495 24.368  71.678  1.00 32.56  ? 105 ARG E CG  1 
ATOM   9523  C  CD  . ARG E 1 105 ? -24.600 25.019  72.500  1.00 41.72  ? 105 ARG E CD  1 
ATOM   9524  N  NE  . ARG E 1 105 ? -24.410 24.812  73.928  1.00 49.16  ? 105 ARG E NE  1 
ATOM   9525  C  CZ  . ARG E 1 105 ? -25.095 23.933  74.645  1.00 59.36  ? 105 ARG E CZ  1 
ATOM   9526  N  NH1 . ARG E 1 105 ? -26.023 23.209  74.060  1.00 66.12  ? 105 ARG E NH1 1 
ATOM   9527  N  NH2 . ARG E 1 105 ? -24.858 23.787  75.945  1.00 72.83  ? 105 ARG E NH2 1 
ATOM   9528  N  N   . ILE E 1 106 ? -22.871 23.670  67.918  1.00 44.09  ? 106 ILE E N   1 
ATOM   9529  C  CA  . ILE E 1 106 ? -23.365 22.531  67.209  1.00 39.67  ? 106 ILE E CA  1 
ATOM   9530  C  C   . ILE E 1 106 ? -22.189 21.707  66.788  1.00 50.81  ? 106 ILE E C   1 
ATOM   9531  O  O   . ILE E 1 106 ? -22.174 20.498  67.001  1.00 65.95  ? 106 ILE E O   1 
ATOM   9532  C  CB  . ILE E 1 106 ? -24.129 22.911  65.976  1.00 36.18  ? 106 ILE E CB  1 
ATOM   9533  C  CG1 . ILE E 1 106 ? -25.434 23.619  66.342  1.00 37.16  ? 106 ILE E CG1 1 
ATOM   9534  C  CG2 . ILE E 1 106 ? -24.390 21.675  65.154  1.00 27.40  ? 106 ILE E CG2 1 
ATOM   9535  C  CD1 . ILE E 1 106 ? -26.190 24.098  65.090  1.00 41.74  ? 106 ILE E CD1 1 
ATOM   9536  N  N   . CYS E 1 107 ? -21.178 22.316  66.190  1.00 47.71  ? 107 CYS E N   1 
ATOM   9537  C  CA  . CYS E 1 107 ? -20.130 21.431  65.727  1.00 56.39  ? 107 CYS E CA  1 
ATOM   9538  C  C   . CYS E 1 107 ? -19.182 20.952  66.820  1.00 52.08  ? 107 CYS E C   1 
ATOM   9539  O  O   . CYS E 1 107 ? -18.495 19.967  66.618  1.00 52.01  ? 107 CYS E O   1 
ATOM   9540  C  CB  . CYS E 1 107 ? -19.454 21.845  64.405  1.00 58.53  ? 107 CYS E CB  1 
ATOM   9541  S  SG  . CYS E 1 107 ? -18.976 23.516  64.235  1.00 77.41  ? 107 CYS E SG  1 
ATOM   9542  N  N   . ASN E 1 108 ? -19.196 21.584  67.993  1.00 37.35  ? 108 ASN E N   1 
ATOM   9543  C  CA  . ASN E 1 108 ? -18.503 21.005  69.143  1.00 42.99  ? 108 ASN E CA  1 
ATOM   9544  C  C   . ASN E 1 108 ? -19.200 19.741  69.646  1.00 58.59  ? 108 ASN E C   1 
ATOM   9545  O  O   . ASN E 1 108 ? -18.563 18.836  70.169  1.00 66.16  ? 108 ASN E O   1 
ATOM   9546  C  CB  . ASN E 1 108 ? -18.376 21.985  70.300  1.00 39.01  ? 108 ASN E CB  1 
ATOM   9547  C  CG  . ASN E 1 108 ? -17.313 23.003  70.062  1.00 49.23  ? 108 ASN E CG  1 
ATOM   9548  O  OD1 . ASN E 1 108 ? -16.546 22.915  69.086  1.00 59.96  ? 108 ASN E OD1 1 
ATOM   9549  N  ND2 . ASN E 1 108 ? -17.242 23.972  70.943  1.00 39.15  ? 108 ASN E ND2 1 
ATOM   9550  N  N   . ALA E 1 109 ? -20.512 19.687  69.505  1.00 54.82  ? 109 ALA E N   1 
ATOM   9551  C  CA  . ALA E 1 109 ? -21.264 18.543  69.983  1.00 44.69  ? 109 ALA E CA  1 
ATOM   9552  C  C   . ALA E 1 109 ? -21.441 17.516  68.875  1.00 39.89  ? 109 ALA E C   1 
ATOM   9553  O  O   . ALA E 1 109 ? -22.021 16.443  69.085  1.00 35.50  ? 109 ALA E O   1 
ATOM   9554  C  CB  . ALA E 1 109 ? -22.642 18.991  70.483  1.00 40.52  ? 109 ALA E CB  1 
ATOM   9555  N  N   . GLY E 1 110 ? -20.966 17.851  67.685  1.00 47.99  ? 110 GLY E N   1 
ATOM   9556  C  CA  . GLY E 1 110 ? -21.197 17.012  66.517  1.00 38.52  ? 110 GLY E CA  1 
ATOM   9557  C  C   . GLY E 1 110 ? -22.566 17.277  65.922  1.00 44.74  ? 110 GLY E C   1 
ATOM   9558  O  O   . GLY E 1 110 ? -22.695 17.814  64.810  1.00 43.05  ? 110 GLY E O   1 
ATOM   9559  N  N   . ARG E 1 111 ? -23.592 16.857  66.660  1.00 44.62  ? 111 ARG E N   1 
ATOM   9560  C  CA  . ARG E 1 111 ? -24.971 17.171  66.333  1.00 45.37  ? 111 ARG E CA  1 
ATOM   9561  C  C   . ARG E 1 111 ? -25.741 17.103  67.636  1.00 42.65  ? 111 ARG E C   1 
ATOM   9562  O  O   . ARG E 1 111 ? -25.248 16.517  68.608  1.00 47.92  ? 111 ARG E O   1 
ATOM   9563  C  CB  . ARG E 1 111 ? -25.534 16.211  65.267  1.00 42.35  ? 111 ARG E CB  1 
ATOM   9564  C  CG  . ARG E 1 111 ? -26.040 14.853  65.800  1.00 39.60  ? 111 ARG E CG  1 
ATOM   9565  C  CD  . ARG E 1 111 ? -26.341 13.807  64.653  1.00 38.39  ? 111 ARG E CD  1 
ATOM   9566  N  NE  . ARG E 1 111 ? -27.477 12.971  65.046  1.00 57.19  ? 111 ARG E NE  1 
ATOM   9567  C  CZ  . ARG E 1 111 ? -27.358 11.740  65.509  1.00 58.33  ? 111 ARG E CZ  1 
ATOM   9568  N  NH1 . ARG E 1 111 ? -26.161 11.181  65.564  1.00 62.27  ? 111 ARG E NH1 1 
ATOM   9569  N  NH2 . ARG E 1 111 ? -28.430 11.058  65.880  1.00 61.24  ? 111 ARG E NH2 1 
ATOM   9570  N  N   . PHE E 1 112 ? -26.929 17.700  67.662  1.00 39.93  ? 112 PHE E N   1 
ATOM   9571  C  CA  . PHE E 1 112 ? -27.680 17.859  68.896  1.00 45.08  ? 112 PHE E CA  1 
ATOM   9572  C  C   . PHE E 1 112 ? -28.750 16.813  69.025  1.00 40.78  ? 112 PHE E C   1 
ATOM   9573  O  O   . PHE E 1 112 ? -29.331 16.386  68.031  1.00 35.35  ? 112 PHE E O   1 
ATOM   9574  C  CB  . PHE E 1 112 ? -28.476 19.157  68.888  1.00 51.95  ? 112 PHE E CB  1 
ATOM   9575  C  CG  . PHE E 1 112 ? -27.716 20.356  69.266  1.00 42.41  ? 112 PHE E CG  1 
ATOM   9576  C  CD1 . PHE E 1 112 ? -26.356 20.426  69.096  1.00 54.65  ? 112 PHE E CD1 1 
ATOM   9577  C  CD2 . PHE E 1 112 ? -28.384 21.451  69.789  1.00 57.74  ? 112 PHE E CD2 1 
ATOM   9578  C  CE1 . PHE E 1 112 ? -25.676 21.575  69.441  1.00 41.11  ? 112 PHE E CE1 1 
ATOM   9579  C  CE2 . PHE E 1 112 ? -27.711 22.598  70.138  1.00 64.01  ? 112 PHE E CE2 1 
ATOM   9580  C  CZ  . PHE E 1 112 ? -26.361 22.656  69.964  1.00 51.39  ? 112 PHE E CZ  1 
ATOM   9581  N  N   . SER E 1 113 ? -29.102 16.485  70.263  1.00 49.75  ? 113 SER E N   1 
ATOM   9582  C  CA  . SER E 1 113 ? -30.248 15.627  70.466  1.00 34.57  ? 113 SER E CA  1 
ATOM   9583  C  C   . SER E 1 113 ? -31.499 16.368  69.954  1.00 52.27  ? 113 SER E C   1 
ATOM   9584  O  O   . SER E 1 113 ? -31.520 17.594  69.873  1.00 58.13  ? 113 SER E O   1 
ATOM   9585  C  CB  . SER E 1 113 ? -30.402 15.250  71.936  1.00 37.25  ? 113 SER E CB  1 
ATOM   9586  O  OG  . SER E 1 113 ? -31.016 16.291  72.672  1.00 59.50  ? 113 SER E OG  1 
ATOM   9587  N  N   . GLU E 1 114 ? -32.529 15.617  69.598  1.00 46.00  ? 114 GLU E N   1 
ATOM   9588  C  CA  . GLU E 1 114 ? -33.769 16.203  69.152  1.00 45.46  ? 114 GLU E CA  1 
ATOM   9589  C  C   . GLU E 1 114 ? -34.307 17.183  70.186  1.00 46.02  ? 114 GLU E C   1 
ATOM   9590  O  O   . GLU E 1 114 ? -34.746 18.262  69.817  1.00 49.70  ? 114 GLU E O   1 
ATOM   9591  C  CB  . GLU E 1 114 ? -34.803 15.107  68.841  1.00 50.87  ? 114 GLU E CB  1 
ATOM   9592  C  CG  . GLU E 1 114 ? -36.171 15.624  68.399  1.00 58.44  ? 114 GLU E CG  1 
ATOM   9593  C  CD  . GLU E 1 114 ? -37.062 14.545  67.759  1.00 63.32  ? 114 GLU E CD  1 
ATOM   9594  O  OE1 . GLU E 1 114 ? -38.307 14.668  67.828  1.00 64.56  ? 114 GLU E OE1 1 
ATOM   9595  O  OE2 . GLU E 1 114 ? -36.530 13.584  67.172  1.00 55.15  ? 114 GLU E OE2 1 
ATOM   9596  N  N   . ASP E 1 115 ? -34.282 16.798  71.458  1.00 43.72  ? 115 ASP E N   1 
ATOM   9597  C  CA  . ASP E 1 115 ? -34.826 17.629  72.529  1.00 46.10  ? 115 ASP E CA  1 
ATOM   9598  C  C   . ASP E 1 115 ? -34.093 18.961  72.653  1.00 51.15  ? 115 ASP E C   1 
ATOM   9599  O  O   . ASP E 1 115 ? -34.698 19.989  72.960  1.00 46.76  ? 115 ASP E O   1 
ATOM   9600  C  CB  . ASP E 1 115 ? -34.769 16.882  73.862  1.00 63.99  ? 115 ASP E CB  1 
ATOM   9601  C  CG  . ASP E 1 115 ? -36.100 16.268  74.243  1.00 81.98  ? 115 ASP E CG  1 
ATOM   9602  O  OD1 . ASP E 1 115 ? -36.209 15.730  75.365  1.00 82.51  ? 115 ASP E OD1 1 
ATOM   9603  O  OD2 . ASP E 1 115 ? -37.039 16.320  73.421  1.00 87.90  ? 115 ASP E OD2 1 
ATOM   9604  N  N   . GLU E 1 116 ? -32.783 18.915  72.429  1.00 37.98  ? 116 GLU E N   1 
ATOM   9605  C  CA  . GLU E 1 116 ? -31.933 20.092  72.524  1.00 51.26  ? 116 GLU E CA  1 
ATOM   9606  C  C   . GLU E 1 116 ? -32.160 21.016  71.338  1.00 54.87  ? 116 GLU E C   1 
ATOM   9607  O  O   . GLU E 1 116 ? -32.148 22.238  71.485  1.00 42.01  ? 116 GLU E O   1 
ATOM   9608  C  CB  . GLU E 1 116 ? -30.460 19.684  72.601  1.00 54.96  ? 116 GLU E CB  1 
ATOM   9609  C  CG  . GLU E 1 116 ? -29.488 20.792  72.233  1.00 74.87  ? 116 GLU E CG  1 
ATOM   9610  C  CD  . GLU E 1 116 ? -28.531 21.126  73.359  1.00 88.42  ? 116 GLU E CD  1 
ATOM   9611  O  OE1 . GLU E 1 116 ? -27.304 21.090  73.129  1.00 81.67  ? 116 GLU E OE1 1 
ATOM   9612  O  OE2 . GLU E 1 116 ? -29.005 21.424  74.476  1.00 97.80  ? 116 GLU E OE2 1 
ATOM   9613  N  N   . ALA E 1 117 ? -32.368 20.433  70.162  1.00 38.72  ? 117 ALA E N   1 
ATOM   9614  C  CA  . ALA E 1 117 ? -32.659 21.231  68.985  1.00 35.07  ? 117 ALA E CA  1 
ATOM   9615  C  C   . ALA E 1 117 ? -34.022 21.923  69.119  1.00 39.10  ? 117 ALA E C   1 
ATOM   9616  O  O   . ALA E 1 117 ? -34.165 23.051  68.688  1.00 43.55  ? 117 ALA E O   1 
ATOM   9617  C  CB  . ALA E 1 117 ? -32.608 20.391  67.724  1.00 29.23  ? 117 ALA E CB  1 
ATOM   9618  N  N   . ARG E 1 118 ? -34.992 21.267  69.748  1.00 37.57  ? 118 ARG E N   1 
ATOM   9619  C  CA  . ARG E 1 118 ? -36.314 21.842  69.902  1.00 41.82  ? 118 ARG E CA  1 
ATOM   9620  C  C   . ARG E 1 118 ? -36.154 23.013  70.829  1.00 50.06  ? 118 ARG E C   1 
ATOM   9621  O  O   . ARG E 1 118 ? -36.703 24.096  70.581  1.00 59.12  ? 118 ARG E O   1 
ATOM   9622  C  CB  . ARG E 1 118 ? -37.295 20.835  70.494  1.00 39.13  ? 118 ARG E CB  1 
ATOM   9623  C  CG  . ARG E 1 118 ? -38.746 21.082  70.140  1.00 45.00  ? 118 ARG E CG  1 
ATOM   9624  C  CD  . ARG E 1 118 ? -39.682 20.469  71.160  1.00 49.53  ? 118 ARG E CD  1 
ATOM   9625  N  NE  . ARG E 1 118 ? -39.190 19.182  71.665  1.00 53.61  ? 118 ARG E NE  1 
ATOM   9626  C  CZ  . ARG E 1 118 ? -39.400 18.021  71.066  1.00 53.20  ? 118 ARG E CZ  1 
ATOM   9627  N  NH1 . ARG E 1 118 ? -40.078 17.978  69.935  1.00 64.21  ? 118 ARG E NH1 1 
ATOM   9628  N  NH2 . ARG E 1 118 ? -38.927 16.907  71.585  1.00 59.69  ? 118 ARG E NH2 1 
ATOM   9629  N  N   . PHE E 1 119 ? -35.361 22.807  71.875  1.00 37.57  ? 119 PHE E N   1 
ATOM   9630  C  CA  . PHE E 1 119 ? -35.076 23.850  72.864  1.00 39.56  ? 119 PHE E CA  1 
ATOM   9631  C  C   . PHE E 1 119 ? -34.596 25.174  72.249  1.00 44.62  ? 119 PHE E C   1 
ATOM   9632  O  O   . PHE E 1 119 ? -34.968 26.246  72.719  1.00 39.75  ? 119 PHE E O   1 
ATOM   9633  C  CB  . PHE E 1 119 ? -34.049 23.344  73.896  1.00 31.63  ? 119 PHE E CB  1 
ATOM   9634  C  CG  . PHE E 1 119 ? -33.516 24.420  74.821  1.00 40.89  ? 119 PHE E CG  1 
ATOM   9635  C  CD1 . PHE E 1 119 ? -34.261 24.856  75.914  1.00 47.77  ? 119 PHE E CD1 1 
ATOM   9636  C  CD2 . PHE E 1 119 ? -32.267 25.004  74.590  1.00 43.32  ? 119 PHE E CD2 1 
ATOM   9637  C  CE1 . PHE E 1 119 ? -33.772 25.838  76.768  1.00 45.35  ? 119 PHE E CE1 1 
ATOM   9638  C  CE2 . PHE E 1 119 ? -31.771 25.988  75.439  1.00 44.33  ? 119 PHE E CE2 1 
ATOM   9639  C  CZ  . PHE E 1 119 ? -32.526 26.409  76.527  1.00 36.90  ? 119 PHE E CZ  1 
ATOM   9640  N  N   . PHE E 1 120 ? -33.765 25.088  71.216  1.00 36.24  ? 120 PHE E N   1 
ATOM   9641  C  CA  . PHE E 1 120 ? -33.251 26.270  70.541  1.00 34.90  ? 120 PHE E CA  1 
ATOM   9642  C  C   . PHE E 1 120 ? -34.193 26.777  69.445  1.00 39.43  ? 120 PHE E C   1 
ATOM   9643  O  O   . PHE E 1 120 ? -34.370 27.976  69.263  1.00 48.41  ? 120 PHE E O   1 
ATOM   9644  C  CB  . PHE E 1 120 ? -31.867 25.976  69.954  1.00 36.44  ? 120 PHE E CB  1 
ATOM   9645  C  CG  . PHE E 1 120 ? -30.779 25.980  70.968  1.00 32.37  ? 120 PHE E CG  1 
ATOM   9646  C  CD1 . PHE E 1 120 ? -30.488 27.131  71.689  1.00 41.17  ? 120 PHE E CD1 1 
ATOM   9647  C  CD2 . PHE E 1 120 ? -30.033 24.849  71.202  1.00 30.02  ? 120 PHE E CD2 1 
ATOM   9648  C  CE1 . PHE E 1 120 ? -29.485 27.143  72.646  1.00 29.43  ? 120 PHE E CE1 1 
ATOM   9649  C  CE2 . PHE E 1 120 ? -29.034 24.846  72.153  1.00 26.38  ? 120 PHE E CE2 1 
ATOM   9650  C  CZ  . PHE E 1 120 ? -28.759 26.008  72.878  1.00 36.55  ? 120 PHE E CZ  1 
ATOM   9651  N  N   . PHE E 1 121 ? -34.798 25.838  68.730  1.00 36.72  ? 121 PHE E N   1 
ATOM   9652  C  CA  . PHE E 1 121 ? -35.736 26.173  67.670  1.00 36.84  ? 121 PHE E CA  1 
ATOM   9653  C  C   . PHE E 1 121 ? -36.939 26.957  68.191  1.00 45.48  ? 121 PHE E C   1 
ATOM   9654  O  O   . PHE E 1 121 ? -37.408 27.874  67.521  1.00 50.10  ? 121 PHE E O   1 
ATOM   9655  C  CB  . PHE E 1 121 ? -36.183 24.909  66.973  1.00 31.01  ? 121 PHE E CB  1 
ATOM   9656  C  CG  . PHE E 1 121 ? -36.952 25.139  65.720  1.00 35.48  ? 121 PHE E CG  1 
ATOM   9657  C  CD1 . PHE E 1 121 ? -36.316 25.580  64.573  1.00 35.16  ? 121 PHE E CD1 1 
ATOM   9658  C  CD2 . PHE E 1 121 ? -38.314 24.856  65.663  1.00 37.53  ? 121 PHE E CD2 1 
ATOM   9659  C  CE1 . PHE E 1 121 ? -37.033 25.758  63.407  1.00 47.37  ? 121 PHE E CE1 1 
ATOM   9660  C  CE2 . PHE E 1 121 ? -39.031 25.032  64.499  1.00 26.92  ? 121 PHE E CE2 1 
ATOM   9661  C  CZ  . PHE E 1 121 ? -38.391 25.482  63.372  1.00 37.33  ? 121 PHE E CZ  1 
ATOM   9662  N  N   . GLN E 1 122 ? -37.432 26.606  69.377  1.00 48.63  ? 122 GLN E N   1 
ATOM   9663  C  CA  . GLN E 1 122 ? -38.546 27.329  69.978  1.00 43.93  ? 122 GLN E CA  1 
ATOM   9664  C  C   . GLN E 1 122 ? -38.125 28.774  70.215  1.00 43.21  ? 122 GLN E C   1 
ATOM   9665  O  O   . GLN E 1 122 ? -38.868 29.698  69.889  1.00 42.14  ? 122 GLN E O   1 
ATOM   9666  C  CB  . GLN E 1 122 ? -39.028 26.660  71.269  1.00 30.62  ? 122 GLN E CB  1 
ATOM   9667  C  CG  . GLN E 1 122 ? -39.580 25.275  71.009  1.00 34.28  ? 122 GLN E CG  1 
ATOM   9668  C  CD  . GLN E 1 122 ? -39.744 24.466  72.266  1.00 38.76  ? 122 GLN E CD  1 
ATOM   9669  O  OE1 . GLN E 1 122 ? -38.981 24.617  73.227  1.00 35.75  ? 122 GLN E OE1 1 
ATOM   9670  N  NE2 . GLN E 1 122 ? -40.758 23.607  72.280  1.00 35.21  ? 122 GLN E NE2 1 
ATOM   9671  N  N   . GLN E 1 123 ? -36.928 28.985  70.753  1.00 41.95  ? 123 GLN E N   1 
ATOM   9672  C  CA  . GLN E 1 123 ? -36.436 30.352  70.912  1.00 35.49  ? 123 GLN E CA  1 
ATOM   9673  C  C   . GLN E 1 123 ? -36.277 31.082  69.585  1.00 36.77  ? 123 GLN E C   1 
ATOM   9674  O  O   . GLN E 1 123 ? -36.667 32.236  69.441  1.00 37.15  ? 123 GLN E O   1 
ATOM   9675  C  CB  . GLN E 1 123 ? -35.113 30.354  71.648  1.00 38.68  ? 123 GLN E CB  1 
ATOM   9676  C  CG  . GLN E 1 123 ? -35.222 29.830  73.041  1.00 34.39  ? 123 GLN E CG  1 
ATOM   9677  C  CD  . GLN E 1 123 ? -33.884 29.753  73.709  1.00 43.41  ? 123 GLN E CD  1 
ATOM   9678  O  OE1 . GLN E 1 123 ? -33.215 30.769  73.886  1.00 62.53  ? 123 GLN E OE1 1 
ATOM   9679  N  NE2 . GLN E 1 123 ? -33.468 28.544  74.078  1.00 48.50  ? 123 GLN E NE2 1 
ATOM   9680  N  N   . LEU E 1 124 ? -35.701 30.414  68.610  1.00 40.45  ? 124 LEU E N   1 
ATOM   9681  C  CA  . LEU E 1 124 ? -35.457 31.020  67.316  1.00 42.93  ? 124 LEU E CA  1 
ATOM   9682  C  C   . LEU E 1 124 ? -36.780 31.507  66.746  1.00 54.18  ? 124 LEU E C   1 
ATOM   9683  O  O   . LEU E 1 124 ? -36.870 32.634  66.252  1.00 49.34  ? 124 LEU E O   1 
ATOM   9684  C  CB  . LEU E 1 124 ? -34.852 29.991  66.360  1.00 34.27  ? 124 LEU E CB  1 
ATOM   9685  C  CG  . LEU E 1 124 ? -34.633 30.472  64.925  1.00 41.96  ? 124 LEU E CG  1 
ATOM   9686  C  CD1 . LEU E 1 124 ? -33.709 31.697  64.950  1.00 52.01  ? 124 LEU E CD1 1 
ATOM   9687  C  CD2 . LEU E 1 124 ? -34.072 29.354  64.038  1.00 37.19  ? 124 LEU E CD2 1 
ATOM   9688  N  N   . ILE E 1 125 ? -37.811 30.654  66.813  1.00 55.53  ? 125 ILE E N   1 
ATOM   9689  C  CA  . ILE E 1 125 ? -39.084 30.934  66.149  1.00 44.62  ? 125 ILE E CA  1 
ATOM   9690  C  C   . ILE E 1 125 ? -39.830 32.000  66.923  1.00 46.51  ? 125 ILE E C   1 
ATOM   9691  O  O   . ILE E 1 125 ? -40.509 32.834  66.343  1.00 48.64  ? 125 ILE E O   1 
ATOM   9692  C  CB  . ILE E 1 125 ? -39.975 29.685  66.058  1.00 29.13  ? 125 ILE E CB  1 
ATOM   9693  C  CG1 . ILE E 1 125 ? -39.399 28.723  65.015  1.00 44.92  ? 125 ILE E CG1 1 
ATOM   9694  C  CG2 . ILE E 1 125 ? -41.384 30.100  65.689  1.00 18.59  ? 125 ILE E CG2 1 
ATOM   9695  C  CD1 . ILE E 1 125 ? -39.424 29.303  63.558  1.00 48.35  ? 125 ILE E CD1 1 
ATOM   9696  N  N   . SER E 1 126 ? -39.706 31.969  68.237  1.00 33.53  ? 126 SER E N   1 
ATOM   9697  C  CA  . SER E 1 126 ? -40.304 33.003  69.050  1.00 36.00  ? 126 SER E CA  1 
ATOM   9698  C  C   . SER E 1 126 ? -39.704 34.356  68.738  1.00 51.49  ? 126 SER E C   1 
ATOM   9699  O  O   . SER E 1 126 ? -40.424 35.345  68.576  1.00 52.74  ? 126 SER E O   1 
ATOM   9700  C  CB  . SER E 1 126 ? -40.072 32.714  70.513  1.00 34.30  ? 126 SER E CB  1 
ATOM   9701  O  OG  . SER E 1 126 ? -40.449 33.836  71.268  1.00 46.70  ? 126 SER E OG  1 
ATOM   9702  N  N   . GLY E 1 127 ? -38.378 34.392  68.661  1.00 52.25  ? 127 GLY E N   1 
ATOM   9703  C  CA  . GLY E 1 127 ? -37.652 35.612  68.350  1.00 43.82  ? 127 GLY E CA  1 
ATOM   9704  C  C   . GLY E 1 127 ? -37.991 36.140  66.972  1.00 45.18  ? 127 GLY E C   1 
ATOM   9705  O  O   . GLY E 1 127 ? -38.195 37.336  66.807  1.00 45.61  ? 127 GLY E O   1 
ATOM   9706  N  N   . VAL E 1 128 ? -38.068 35.252  65.986  1.00 40.79  ? 128 VAL E N   1 
ATOM   9707  C  CA  . VAL E 1 128 ? -38.283 35.649  64.589  1.00 43.98  ? 128 VAL E CA  1 
ATOM   9708  C  C   . VAL E 1 128 ? -39.713 36.104  64.375  1.00 50.80  ? 128 VAL E C   1 
ATOM   9709  O  O   . VAL E 1 128 ? -40.002 36.981  63.568  1.00 54.80  ? 128 VAL E O   1 
ATOM   9710  C  CB  . VAL E 1 128 ? -37.981 34.490  63.622  1.00 40.52  ? 128 VAL E CB  1 
ATOM   9711  C  CG1 . VAL E 1 128 ? -38.689 34.695  62.289  1.00 40.05  ? 128 VAL E CG1 1 
ATOM   9712  C  CG2 . VAL E 1 128 ? -36.482 34.360  63.424  1.00 37.66  ? 128 VAL E CG2 1 
ATOM   9713  N  N   . SER E 1 129 ? -40.619 35.492  65.120  1.00 59.83  ? 129 SER E N   1 
ATOM   9714  C  CA  . SER E 1 129 ? -42.036 35.840  65.067  1.00 51.25  ? 129 SER E CA  1 
ATOM   9715  C  C   . SER E 1 129 ? -42.233 37.249  65.603  1.00 54.99  ? 129 SER E C   1 
ATOM   9716  O  O   . SER E 1 129 ? -43.002 38.019  65.065  1.00 60.98  ? 129 SER E O   1 
ATOM   9717  C  CB  . SER E 1 129 ? -42.844 34.838  65.909  1.00 42.18  ? 129 SER E CB  1 
ATOM   9718  O  OG  . SER E 1 129 ? -44.196 35.244  66.033  1.00 54.16  ? 129 SER E OG  1 
ATOM   9719  N  N   . TYR E 1 130 ? -41.539 37.572  66.680  1.00 47.63  ? 130 TYR E N   1 
ATOM   9720  C  CA  . TYR E 1 130 ? -41.584 38.910  67.247  1.00 49.05  ? 130 TYR E CA  1 
ATOM   9721  C  C   . TYR E 1 130 ? -41.054 39.962  66.247  1.00 66.71  ? 130 TYR E C   1 
ATOM   9722  O  O   . TYR E 1 130 ? -41.699 40.994  65.992  1.00 63.28  ? 130 TYR E O   1 
ATOM   9723  C  CB  . TYR E 1 130 ? -40.761 38.946  68.519  1.00 42.43  ? 130 TYR E CB  1 
ATOM   9724  C  CG  . TYR E 1 130 ? -40.697 40.297  69.157  1.00 47.68  ? 130 TYR E CG  1 
ATOM   9725  C  CD1 . TYR E 1 130 ? -41.598 40.653  70.149  1.00 59.40  ? 130 TYR E CD1 1 
ATOM   9726  C  CD2 . TYR E 1 130 ? -39.726 41.223  68.780  1.00 45.92  ? 130 TYR E CD2 1 
ATOM   9727  C  CE1 . TYR E 1 130 ? -41.537 41.905  70.755  1.00 60.43  ? 130 TYR E CE1 1 
ATOM   9728  C  CE2 . TYR E 1 130 ? -39.648 42.475  69.380  1.00 52.77  ? 130 TYR E CE2 1 
ATOM   9729  C  CZ  . TYR E 1 130 ? -40.553 42.812  70.357  1.00 63.59  ? 130 TYR E CZ  1 
ATOM   9730  O  OH  . TYR E 1 130 ? -40.486 44.056  70.945  1.00 73.04  ? 130 TYR E OH  1 
ATOM   9731  N  N   . ALA E 1 131 ? -39.885 39.692  65.665  1.00 65.08  ? 131 ALA E N   1 
ATOM   9732  C  CA  . ALA E 1 131 ? -39.310 40.612  64.701  1.00 54.68  ? 131 ALA E CA  1 
ATOM   9733  C  C   . ALA E 1 131 ? -40.256 40.845  63.542  1.00 64.95  ? 131 ALA E C   1 
ATOM   9734  O  O   . ALA E 1 131 ? -40.250 41.899  62.938  1.00 53.28  ? 131 ALA E O   1 
ATOM   9735  C  CB  . ALA E 1 131 ? -37.971 40.092  64.202  1.00 32.46  ? 131 ALA E CB  1 
ATOM   9736  N  N   . HIS E 1 132 ? -41.026 39.820  63.198  1.00 66.73  ? 132 HIS E N   1 
ATOM   9737  C  CA  . HIS E 1 132 ? -41.925 39.895  62.057  1.00 59.89  ? 132 HIS E CA  1 
ATOM   9738  C  C   . HIS E 1 132 ? -43.117 40.787  62.391  1.00 71.67  ? 132 HIS E C   1 
ATOM   9739  O  O   . HIS E 1 132 ? -43.639 41.497  61.534  1.00 75.10  ? 132 HIS E O   1 
ATOM   9740  C  CB  . HIS E 1 132 ? -42.394 38.501  61.657  1.00 60.14  ? 132 HIS E CB  1 
ATOM   9741  C  CG  . HIS E 1 132 ? -41.405 37.750  60.812  1.00 62.87  ? 132 HIS E CG  1 
ATOM   9742  N  ND1 . HIS E 1 132 ? -41.679 36.518  60.247  1.00 60.58  ? 132 HIS E ND1 1 
ATOM   9743  C  CD2 . HIS E 1 132 ? -40.147 38.071  60.425  1.00 58.47  ? 132 HIS E CD2 1 
ATOM   9744  C  CE1 . HIS E 1 132 ? -40.632 36.119  59.543  1.00 63.85  ? 132 HIS E CE1 1 
ATOM   9745  N  NE2 . HIS E 1 132 ? -39.690 37.041  59.633  1.00 61.40  ? 132 HIS E NE2 1 
ATOM   9746  N  N   . ALA E 1 133 ? -43.537 40.760  63.648  1.00 64.74  ? 133 ALA E N   1 
ATOM   9747  C  CA  . ALA E 1 133 ? -44.658 41.579  64.077  1.00 60.86  ? 133 ALA E CA  1 
ATOM   9748  C  C   . ALA E 1 133 ? -44.195 43.015  64.342  1.00 64.09  ? 133 ALA E C   1 
ATOM   9749  O  O   . ALA E 1 133 ? -44.992 43.903  64.611  1.00 60.14  ? 133 ALA E O   1 
ATOM   9750  C  CB  . ALA E 1 133 ? -45.300 40.975  65.336  1.00 48.93  ? 133 ALA E CB  1 
ATOM   9751  N  N   . MET E 1 134 ? -42.894 43.237  64.273  1.00 74.45  ? 134 MET E N   1 
ATOM   9752  C  CA  . MET E 1 134 ? -42.338 44.518  64.648  1.00 63.19  ? 134 MET E CA  1 
ATOM   9753  C  C   . MET E 1 134 ? -41.898 45.211  63.373  1.00 64.38  ? 134 MET E C   1 
ATOM   9754  O  O   . MET E 1 134 ? -41.290 46.282  63.412  1.00 75.72  ? 134 MET E O   1 
ATOM   9755  C  CB  . MET E 1 134 ? -41.155 44.297  65.587  1.00 75.95  ? 134 MET E CB  1 
ATOM   9756  C  CG  . MET E 1 134 ? -41.102 45.247  66.759  1.00 84.63  ? 134 MET E CG  1 
ATOM   9757  S  SD  . MET E 1 134 ? -42.555 45.145  67.856  1.00 80.25  ? 134 MET E SD  1 
ATOM   9758  C  CE  . MET E 1 134 ? -42.179 46.599  68.866  1.00 69.47  ? 134 MET E CE  1 
ATOM   9759  N  N   . GLN E 1 135 ? -42.248 44.577  62.250  1.00 72.29  ? 135 GLN E N   1 
ATOM   9760  C  CA  . GLN E 1 135 ? -41.997 45.089  60.902  1.00 84.46  ? 135 GLN E CA  1 
ATOM   9761  C  C   . GLN E 1 135 ? -40.534 45.555  60.738  1.00 93.81  ? 135 GLN E C   1 
ATOM   9762  O  O   . GLN E 1 135 ? -39.656 44.939  61.362  1.00 93.41  ? 135 GLN E O   1 
ATOM   9763  C  CB  . GLN E 1 135 ? -43.043 46.152  60.556  1.00 93.95  ? 135 GLN E CB  1 
ATOM   9764  C  CG  . GLN E 1 135 ? -44.471 45.637  60.550  1.00 109.63 ? 135 GLN E CG  1 
ATOM   9765  C  CD  . GLN E 1 135 ? -44.658 44.455  59.624  1.00 122.76 ? 135 GLN E CD  1 
ATOM   9766  O  OE1 . GLN E 1 135 ? -45.749 43.889  59.537  1.00 123.25 ? 135 GLN E OE1 1 
ATOM   9767  N  NE2 . GLN E 1 135 ? -43.590 44.073  58.923  1.00 126.60 ? 135 GLN E NE2 1 
ATOM   9768  N  N   . LEU E 1 143 ? -29.508 35.382  60.912  1.00 76.96  ? 143 LEU E N   1 
ATOM   9769  C  CA  . LEU E 1 143 ? -30.143 34.098  60.576  1.00 98.22  ? 143 LEU E CA  1 
ATOM   9770  C  C   . LEU E 1 143 ? -29.196 32.892  60.604  1.00 90.88  ? 143 LEU E C   1 
ATOM   9771  O  O   . LEU E 1 143 ? -29.475 31.898  61.285  1.00 94.47  ? 143 LEU E O   1 
ATOM   9772  C  CB  . LEU E 1 143 ? -30.850 34.163  59.211  1.00 102.88 ? 143 LEU E CB  1 
ATOM   9773  C  CG  . LEU E 1 143 ? -32.301 34.656  59.110  1.00 98.43  ? 143 LEU E CG  1 
ATOM   9774  C  CD1 . LEU E 1 143 ? -32.936 34.873  60.487  1.00 80.35  ? 143 LEU E CD1 1 
ATOM   9775  C  CD2 . LEU E 1 143 ? -32.402 35.910  58.230  1.00 104.80 ? 143 LEU E CD2 1 
ATOM   9776  N  N   . GLU E 1 144 ? -28.098 32.985  59.854  1.00 69.12  ? 144 GLU E N   1 
ATOM   9777  C  CA  . GLU E 1 144 ? -27.088 31.931  59.790  1.00 76.20  ? 144 GLU E CA  1 
ATOM   9778  C  C   . GLU E 1 144 ? -25.967 32.159  60.808  1.00 72.31  ? 144 GLU E C   1 
ATOM   9779  O  O   . GLU E 1 144 ? -24.904 31.547  60.750  1.00 73.83  ? 144 GLU E O   1 
ATOM   9780  C  CB  . GLU E 1 144 ? -26.513 31.859  58.377  1.00 89.10  ? 144 GLU E CB  1 
ATOM   9781  C  CG  . GLU E 1 144 ? -25.932 33.153  57.874  1.00 103.64 ? 144 GLU E CG  1 
ATOM   9782  C  CD  . GLU E 1 144 ? -26.720 33.733  56.729  1.00 122.54 ? 144 GLU E CD  1 
ATOM   9783  O  OE1 . GLU E 1 144 ? -26.448 33.345  55.563  1.00 131.76 ? 144 GLU E OE1 1 
ATOM   9784  O  OE2 . GLU E 1 144 ? -27.612 34.569  57.000  1.00 125.31 ? 144 GLU E OE2 1 
ATOM   9785  N  N   . ASN E 1 145 ? -26.228 33.045  61.754  1.00 66.34  ? 145 ASN E N   1 
ATOM   9786  C  CA  . ASN E 1 145 ? -25.193 33.561  62.625  1.00 67.78  ? 145 ASN E CA  1 
ATOM   9787  C  C   . ASN E 1 145 ? -25.771 33.989  63.954  1.00 61.29  ? 145 ASN E C   1 
ATOM   9788  O  O   . ASN E 1 145 ? -25.365 35.003  64.520  1.00 60.31  ? 145 ASN E O   1 
ATOM   9789  C  CB  . ASN E 1 145 ? -24.521 34.771  61.981  1.00 81.41  ? 145 ASN E CB  1 
ATOM   9790  C  CG  . ASN E 1 145 ? -23.175 34.436  61.398  1.00 89.81  ? 145 ASN E CG  1 
ATOM   9791  O  OD1 . ASN E 1 145 ? -22.458 33.582  61.932  1.00 97.74  ? 145 ASN E OD1 1 
ATOM   9792  N  ND2 . ASN E 1 145 ? -22.815 35.100  60.298  1.00 79.19  ? 145 ASN E ND2 1 
ATOM   9793  N  N   . THR E 1 146 ? -26.733 33.219  64.451  1.00 44.76  ? 146 THR E N   1 
ATOM   9794  C  CA  . THR E 1 146 ? -27.343 33.497  65.744  1.00 53.12  ? 146 THR E CA  1 
ATOM   9795  C  C   . THR E 1 146 ? -26.351 33.174  66.852  1.00 56.84  ? 146 THR E C   1 
ATOM   9796  O  O   . THR E 1 146 ? -25.548 32.251  66.721  1.00 54.62  ? 146 THR E O   1 
ATOM   9797  C  CB  . THR E 1 146 ? -28.623 32.673  65.952  1.00 57.82  ? 146 THR E CB  1 
ATOM   9798  O  OG1 . THR E 1 146 ? -28.312 31.478  66.678  1.00 57.29  ? 146 THR E OG1 1 
ATOM   9799  C  CG2 . THR E 1 146 ? -29.238 32.300  64.613  1.00 48.80  ? 146 THR E CG2 1 
ATOM   9800  N  N   . LEU E 1 147 ? -26.399 33.936  67.939  1.00 55.22  ? 147 LEU E N   1 
ATOM   9801  C  CA  . LEU E 1 147 ? -25.448 33.740  69.026  1.00 39.88  ? 147 LEU E CA  1 
ATOM   9802  C  C   . LEU E 1 147 ? -26.110 33.110  70.251  1.00 45.08  ? 147 LEU E C   1 
ATOM   9803  O  O   . LEU E 1 147 ? -27.284 32.707  70.206  1.00 46.28  ? 147 LEU E O   1 
ATOM   9804  C  CB  . LEU E 1 147 ? -24.874 35.091  69.423  1.00 48.55  ? 147 LEU E CB  1 
ATOM   9805  C  CG  . LEU E 1 147 ? -24.511 36.023  68.262  1.00 57.42  ? 147 LEU E CG  1 
ATOM   9806  C  CD1 . LEU E 1 147 ? -23.817 37.234  68.814  1.00 59.76  ? 147 LEU E CD1 1 
ATOM   9807  C  CD2 . LEU E 1 147 ? -23.629 35.332  67.244  1.00 38.44  ? 147 LEU E CD2 1 
ATOM   9808  N  N   . LEU E 1 148 ? -25.343 33.015  71.331  1.00 39.59  ? 148 LEU E N   1 
ATOM   9809  C  CA  . LEU E 1 148 ? -25.835 32.469  72.586  1.00 38.14  ? 148 LEU E CA  1 
ATOM   9810  C  C   . LEU E 1 148 ? -25.513 33.406  73.743  1.00 42.89  ? 148 LEU E C   1 
ATOM   9811  O  O   . LEU E 1 148 ? -24.448 34.020  73.781  1.00 48.06  ? 148 LEU E O   1 
ATOM   9812  C  CB  . LEU E 1 148 ? -25.230 31.087  72.842  1.00 28.26  ? 148 LEU E CB  1 
ATOM   9813  C  CG  . LEU E 1 148 ? -25.580 29.999  71.826  1.00 39.97  ? 148 LEU E CG  1 
ATOM   9814  C  CD1 . LEU E 1 148 ? -24.896 28.688  72.181  1.00 36.64  ? 148 LEU E CD1 1 
ATOM   9815  C  CD2 . LEU E 1 148 ? -27.087 29.815  71.736  1.00 32.36  ? 148 LEU E CD2 1 
ATOM   9816  N  N   . ASP E 1 149 ? -26.453 33.541  74.669  1.00 42.06  ? 149 ASP E N   1 
ATOM   9817  C  CA  . ASP E 1 149 ? -26.222 34.304  75.887  1.00 44.05  ? 149 ASP E CA  1 
ATOM   9818  C  C   . ASP E 1 149 ? -25.297 33.499  76.789  1.00 70.58  ? 149 ASP E C   1 
ATOM   9819  O  O   . ASP E 1 149 ? -25.236 32.275  76.680  1.00 71.65  ? 149 ASP E O   1 
ATOM   9820  C  CB  . ASP E 1 149 ? -27.540 34.599  76.600  1.00 42.68  ? 149 ASP E CB  1 
ATOM   9821  C  CG  . ASP E 1 149 ? -27.791 33.668  77.768  1.00 71.00  ? 149 ASP E CG  1 
ATOM   9822  O  OD1 . ASP E 1 149 ? -27.346 32.503  77.706  1.00 81.16  ? 149 ASP E OD1 1 
ATOM   9823  O  OD2 . ASP E 1 149 ? -28.433 34.100  78.747  1.00 77.35  ? 149 ASP E OD2 1 
ATOM   9824  N  N   . GLY E 1 150 ? -24.574 34.172  77.678  1.00 92.90  ? 150 GLY E N   1 
ATOM   9825  C  CA  . GLY E 1 150 ? -23.694 33.454  78.579  1.00 89.02  ? 150 GLY E CA  1 
ATOM   9826  C  C   . GLY E 1 150 ? -24.464 33.048  79.817  1.00 88.35  ? 150 GLY E C   1 
ATOM   9827  O  O   . GLY E 1 150 ? -24.816 33.877  80.655  1.00 105.46 ? 150 GLY E O   1 
ATOM   9828  N  N   . SER E 1 151 ? -24.727 31.750  79.918  1.00 81.91  ? 151 SER E N   1 
ATOM   9829  C  CA  . SER E 1 151 ? -25.519 31.190  81.003  1.00 77.02  ? 151 SER E CA  1 
ATOM   9830  C  C   . SER E 1 151 ? -25.226 29.703  81.135  1.00 77.87  ? 151 SER E C   1 
ATOM   9831  O  O   . SER E 1 151 ? -24.635 29.101  80.239  1.00 84.08  ? 151 SER E O   1 
ATOM   9832  C  CB  . SER E 1 151 ? -27.010 31.411  80.749  1.00 77.73  ? 151 SER E CB  1 
ATOM   9833  O  OG  . SER E 1 151 ? -27.230 32.594  80.001  1.00 84.31  ? 151 SER E OG  1 
ATOM   9834  N  N   . PRO E 1 152 ? -25.639 29.117  82.255  1.00 78.78  ? 152 PRO E N   1 
ATOM   9835  C  CA  . PRO E 1 152 ? -25.531 27.668  82.440  1.00 85.08  ? 152 PRO E CA  1 
ATOM   9836  C  C   . PRO E 1 152 ? -26.282 26.987  81.309  1.00 97.14  ? 152 PRO E C   1 
ATOM   9837  O  O   . PRO E 1 152 ? -25.793 26.027  80.713  1.00 114.61 ? 152 PRO E O   1 
ATOM   9838  C  CB  . PRO E 1 152 ? -26.248 27.435  83.769  1.00 78.35  ? 152 PRO E CB  1 
ATOM   9839  C  CG  . PRO E 1 152 ? -26.074 28.714  84.513  1.00 76.96  ? 152 PRO E CG  1 
ATOM   9840  C  CD  . PRO E 1 152 ? -26.106 29.800  83.474  1.00 73.37  ? 152 PRO E CD  1 
ATOM   9841  N  N   . ALA E 1 153 ? -27.469 27.506  81.016  1.00 97.41  ? 153 ALA E N   1 
ATOM   9842  C  CA  . ALA E 1 153 ? -28.234 27.087  79.852  1.00 97.92  ? 153 ALA E CA  1 
ATOM   9843  C  C   . ALA E 1 153 ? -28.278 28.261  78.882  1.00 82.73  ? 153 ALA E C   1 
ATOM   9844  O  O   . ALA E 1 153 ? -28.696 29.360  79.245  1.00 76.67  ? 153 ALA E O   1 
ATOM   9845  C  CB  . ALA E 1 153 ? -29.639 26.673  80.256  1.00 101.38 ? 153 ALA E CB  1 
ATOM   9846  N  N   . PRO E 1 154 ? -27.829 28.033  77.653  1.00 75.34  ? 154 PRO E N   1 
ATOM   9847  C  CA  . PRO E 1 154 ? -27.699 29.112  76.665  1.00 61.55  ? 154 PRO E CA  1 
ATOM   9848  C  C   . PRO E 1 154 ? -29.033 29.663  76.163  1.00 50.38  ? 154 PRO E C   1 
ATOM   9849  O  O   . PRO E 1 154 ? -29.969 28.900  75.920  1.00 65.37  ? 154 PRO E O   1 
ATOM   9850  C  CB  . PRO E 1 154 ? -26.947 28.438  75.515  1.00 73.63  ? 154 PRO E CB  1 
ATOM   9851  C  CG  . PRO E 1 154 ? -26.156 27.359  76.171  1.00 85.07  ? 154 PRO E CG  1 
ATOM   9852  C  CD  . PRO E 1 154 ? -27.007 26.861  77.305  1.00 83.14  ? 154 PRO E CD  1 
ATOM   9853  N  N   . ARG E 1 155 ? -29.105 30.982  76.006  1.00 55.18  ? 155 ARG E N   1 
ATOM   9854  C  CA  . ARG E 1 155 ? -30.274 31.632  75.436  1.00 51.70  ? 155 ARG E CA  1 
ATOM   9855  C  C   . ARG E 1 155 ? -29.927 32.112  74.033  1.00 39.44  ? 155 ARG E C   1 
ATOM   9856  O  O   . ARG E 1 155 ? -28.934 32.808  73.832  1.00 50.97  ? 155 ARG E O   1 
ATOM   9857  C  CB  . ARG E 1 155 ? -30.711 32.812  76.304  1.00 53.10  ? 155 ARG E CB  1 
ATOM   9858  C  CG  . ARG E 1 155 ? -31.316 32.410  77.637  1.00 55.38  ? 155 ARG E CG  1 
ATOM   9859  C  CD  . ARG E 1 155 ? -32.829 32.320  77.550  1.00 75.46  ? 155 ARG E CD  1 
ATOM   9860  N  NE  . ARG E 1 155 ? -33.316 30.981  77.870  1.00 78.29  ? 155 ARG E NE  1 
ATOM   9861  C  CZ  . ARG E 1 155 ? -34.489 30.499  77.473  1.00 81.27  ? 155 ARG E CZ  1 
ATOM   9862  N  NH1 . ARG E 1 155 ? -35.302 31.247  76.740  1.00 78.14  ? 155 ARG E NH1 1 
ATOM   9863  N  NH2 . ARG E 1 155 ? -34.850 29.269  77.811  1.00 88.26  ? 155 ARG E NH2 1 
ATOM   9864  N  N   . LEU E 1 156 ? -30.750 31.726  73.066  1.00 35.10  ? 156 LEU E N   1 
ATOM   9865  C  CA  . LEU E 1 156 ? -30.499 32.025  71.678  1.00 35.69  ? 156 LEU E CA  1 
ATOM   9866  C  C   . LEU E 1 156 ? -30.612 33.546  71.535  1.00 48.63  ? 156 LEU E C   1 
ATOM   9867  O  O   . LEU E 1 156 ? -31.531 34.145  72.084  1.00 60.59  ? 156 LEU E O   1 
ATOM   9868  C  CB  . LEU E 1 156 ? -31.572 31.349  70.843  1.00 39.81  ? 156 LEU E CB  1 
ATOM   9869  C  CG  . LEU E 1 156 ? -31.219 30.957  69.425  1.00 42.24  ? 156 LEU E CG  1 
ATOM   9870  C  CD1 . LEU E 1 156 ? -32.198 31.579  68.517  1.00 51.64  ? 156 LEU E CD1 1 
ATOM   9871  C  CD2 . LEU E 1 156 ? -29.872 31.486  69.121  1.00 58.49  ? 156 LEU E CD2 1 
ATOM   9872  N  N   . LYS E 1 157 ? -29.681 34.180  70.825  1.00 55.44  ? 157 LYS E N   1 
ATOM   9873  C  CA  . LYS E 1 157 ? -29.702 35.632  70.633  1.00 54.59  ? 157 LYS E CA  1 
ATOM   9874  C  C   . LYS E 1 157 ? -29.569 35.980  69.164  1.00 56.38  ? 157 LYS E C   1 
ATOM   9875  O  O   . LYS E 1 157 ? -28.546 35.696  68.549  1.00 60.48  ? 157 LYS E O   1 
ATOM   9876  C  CB  . LYS E 1 157 ? -28.582 36.290  71.431  1.00 51.10  ? 157 LYS E CB  1 
ATOM   9877  C  CG  . LYS E 1 157 ? -28.790 36.180  72.930  1.00 53.58  ? 157 LYS E CG  1 
ATOM   9878  C  CD  . LYS E 1 157 ? -29.780 37.236  73.398  1.00 54.62  ? 157 LYS E CD  1 
ATOM   9879  C  CE  . LYS E 1 157 ? -30.175 37.022  74.860  1.00 55.98  ? 157 LYS E CE  1 
ATOM   9880  N  NZ  . LYS E 1 157 ? -30.754 38.274  75.441  1.00 62.65  ? 157 LYS E NZ  1 
ATOM   9881  N  N   . ILE E 1 158 ? -30.613 36.566  68.592  1.00 53.96  ? 158 ILE E N   1 
ATOM   9882  C  CA  . ILE E 1 158 ? -30.582 37.021  67.212  1.00 50.74  ? 158 ILE E CA  1 
ATOM   9883  C  C   . ILE E 1 158 ? -30.005 38.444  67.073  1.00 65.32  ? 158 ILE E C   1 
ATOM   9884  O  O   . ILE E 1 158 ? -30.336 39.343  67.873  1.00 63.85  ? 158 ILE E O   1 
ATOM   9885  C  CB  . ILE E 1 158 ? -31.988 37.049  66.668  1.00 51.69  ? 158 ILE E CB  1 
ATOM   9886  C  CG1 . ILE E 1 158 ? -32.597 35.667  66.796  1.00 45.09  ? 158 ILE E CG1 1 
ATOM   9887  C  CG2 . ILE E 1 158 ? -31.997 37.520  65.215  1.00 63.78  ? 158 ILE E CG2 1 
ATOM   9888  C  CD1 . ILE E 1 158 ? -34.049 35.630  66.392  1.00 41.74  ? 158 ILE E CD1 1 
ATOM   9889  N  N   . ALA E 1 159 ? -29.158 38.644  66.057  1.00 72.64  ? 159 ALA E N   1 
ATOM   9890  C  CA  . ALA E 1 159 ? -28.528 39.950  65.787  1.00 70.53  ? 159 ALA E CA  1 
ATOM   9891  C  C   . ALA E 1 159 ? -29.244 40.782  64.725  1.00 84.58  ? 159 ALA E C   1 
ATOM   9892  O  O   . ALA E 1 159 ? -29.560 40.268  63.662  1.00 93.82  ? 159 ALA E O   1 
ATOM   9893  C  CB  . ALA E 1 159 ? -27.077 39.742  65.381  1.00 51.24  ? 159 ALA E CB  1 
ATOM   9894  N  N   . THR E 1 179 ? -22.954 31.068  53.239  1.00 107.02 ? 179 THR E N   1 
ATOM   9895  C  CA  . THR E 1 179 ? -22.940 30.104  52.140  1.00 104.08 ? 179 THR E CA  1 
ATOM   9896  C  C   . THR E 1 179 ? -24.352 29.918  51.578  1.00 95.93  ? 179 THR E C   1 
ATOM   9897  O  O   . THR E 1 179 ? -25.302 30.521  52.088  1.00 90.90  ? 179 THR E O   1 
ATOM   9898  C  CB  . THR E 1 179 ? -22.274 28.745  52.540  1.00 119.35 ? 179 THR E CB  1 
ATOM   9899  O  OG1 . THR E 1 179 ? -23.009 28.111  53.596  1.00 113.56 ? 179 THR E OG1 1 
ATOM   9900  C  CG2 . THR E 1 179 ? -20.833 28.959  52.980  1.00 122.02 ? 179 THR E CG2 1 
ATOM   9901  N  N   . PRO E 1 180 ? -24.500 29.085  50.527  1.00 88.35  ? 180 PRO E N   1 
ATOM   9902  C  CA  . PRO E 1 180 ? -25.743 29.107  49.754  1.00 81.15  ? 180 PRO E CA  1 
ATOM   9903  C  C   . PRO E 1 180 ? -26.843 28.155  50.205  1.00 93.82  ? 180 PRO E C   1 
ATOM   9904  O  O   . PRO E 1 180 ? -27.664 27.825  49.361  1.00 98.99  ? 180 PRO E O   1 
ATOM   9905  C  CB  . PRO E 1 180 ? -25.283 28.684  48.355  1.00 76.80  ? 180 PRO E CB  1 
ATOM   9906  C  CG  . PRO E 1 180 ? -23.960 27.964  48.562  1.00 83.94  ? 180 PRO E CG  1 
ATOM   9907  C  CD  . PRO E 1 180 ? -23.577 28.063  50.009  1.00 85.96  ? 180 PRO E CD  1 
ATOM   9908  N  N   . ALA E 1 181 ? -26.882 27.709  51.456  1.00 88.82  ? 181 ALA E N   1 
ATOM   9909  C  CA  . ALA E 1 181 ? -28.009 26.876  51.857  1.00 74.14  ? 181 ALA E CA  1 
ATOM   9910  C  C   . ALA E 1 181 ? -29.031 27.728  52.591  1.00 64.57  ? 181 ALA E C   1 
ATOM   9911  O  O   . ALA E 1 181 ? -30.237 27.600  52.348  1.00 65.88  ? 181 ALA E O   1 
ATOM   9912  C  CB  . ALA E 1 181 ? -27.568 25.685  52.698  1.00 77.37  ? 181 ALA E CB  1 
ATOM   9913  N  N   . TYR E 1 182 ? -28.555 28.616  53.462  1.00 53.40  ? 182 TYR E N   1 
ATOM   9914  C  CA  . TYR E 1 182 ? -29.454 29.500  54.196  1.00 57.61  ? 182 TYR E CA  1 
ATOM   9915  C  C   . TYR E 1 182 ? -30.431 30.262  53.299  1.00 67.67  ? 182 TYR E C   1 
ATOM   9916  O  O   . TYR E 1 182 ? -31.469 30.711  53.768  1.00 77.86  ? 182 TYR E O   1 
ATOM   9917  C  CB  . TYR E 1 182 ? -28.670 30.476  55.062  1.00 58.92  ? 182 TYR E CB  1 
ATOM   9918  C  CG  . TYR E 1 182 ? -28.414 29.902  56.418  1.00 66.32  ? 182 TYR E CG  1 
ATOM   9919  C  CD1 . TYR E 1 182 ? -27.236 29.203  56.692  1.00 76.37  ? 182 TYR E CD1 1 
ATOM   9920  C  CD2 . TYR E 1 182 ? -29.362 30.019  57.423  1.00 61.89  ? 182 TYR E CD2 1 
ATOM   9921  C  CE1 . TYR E 1 182 ? -26.993 28.639  57.957  1.00 76.35  ? 182 TYR E CE1 1 
ATOM   9922  C  CE2 . TYR E 1 182 ? -29.139 29.461  58.689  1.00 71.14  ? 182 TYR E CE2 1 
ATOM   9923  C  CZ  . TYR E 1 182 ? -27.952 28.766  58.955  1.00 79.58  ? 182 TYR E CZ  1 
ATOM   9924  O  OH  . TYR E 1 182 ? -27.718 28.216  60.212  1.00 81.72  ? 182 TYR E OH  1 
ATOM   9925  N  N   . ILE E 1 183 ? -30.096 30.374  52.015  1.00 68.16  ? 183 ILE E N   1 
ATOM   9926  C  CA  . ILE E 1 183 ? -30.831 31.168  51.029  1.00 60.59  ? 183 ILE E CA  1 
ATOM   9927  C  C   . ILE E 1 183 ? -32.018 30.416  50.394  1.00 62.04  ? 183 ILE E C   1 
ATOM   9928  O  O   . ILE E 1 183 ? -31.838 29.415  49.680  1.00 55.63  ? 183 ILE E O   1 
ATOM   9929  C  CB  . ILE E 1 183 ? -29.868 31.630  49.902  1.00 68.28  ? 183 ILE E CB  1 
ATOM   9930  C  CG1 . ILE E 1 183 ? -29.200 32.970  50.257  1.00 77.20  ? 183 ILE E CG1 1 
ATOM   9931  C  CG2 . ILE E 1 183 ? -30.604 31.755  48.591  1.00 66.01  ? 183 ILE E CG2 1 
ATOM   9932  C  CD1 . ILE E 1 183 ? -28.224 32.890  51.426  1.00 86.68  ? 183 ILE E CD1 1 
ATOM   9933  N  N   . ALA E 1 184 ? -33.232 30.905  50.641  1.00 63.34  ? 184 ALA E N   1 
ATOM   9934  C  CA  . ALA E 1 184 ? -34.420 30.288  50.055  1.00 57.68  ? 184 ALA E CA  1 
ATOM   9935  C  C   . ALA E 1 184 ? -34.277 30.197  48.540  1.00 51.39  ? 184 ALA E C   1 
ATOM   9936  O  O   . ALA E 1 184 ? -33.414 30.861  47.979  1.00 63.78  ? 184 ALA E O   1 
ATOM   9937  C  CB  . ALA E 1 184 ? -35.629 31.089  50.413  1.00 67.39  ? 184 ALA E CB  1 
ATOM   9938  N  N   . PRO E 1 185 ? -35.117 29.394  47.897  1.00 32.61  ? 185 PRO E N   1 
ATOM   9939  C  CA  . PRO E 1 185 ? -35.086 29.262  46.438  1.00 40.85  ? 185 PRO E CA  1 
ATOM   9940  C  C   . PRO E 1 185 ? -35.639 30.510  45.756  1.00 56.85  ? 185 PRO E C   1 
ATOM   9941  O  O   . PRO E 1 185 ? -35.096 30.956  44.746  1.00 49.21  ? 185 PRO E O   1 
ATOM   9942  C  CB  . PRO E 1 185 ? -36.005 28.067  46.180  1.00 41.12  ? 185 PRO E CB  1 
ATOM   9943  C  CG  . PRO E 1 185 ? -35.916 27.257  47.421  1.00 34.74  ? 185 PRO E CG  1 
ATOM   9944  C  CD  . PRO E 1 185 ? -35.770 28.242  48.543  1.00 39.40  ? 185 PRO E CD  1 
ATOM   9945  N  N   . GLU E 1 186 ? -36.711 31.063  46.312  1.00 60.02  ? 186 GLU E N   1 
ATOM   9946  C  CA  . GLU E 1 186 ? -37.322 32.269  45.766  1.00 63.16  ? 186 GLU E CA  1 
ATOM   9947  C  C   . GLU E 1 186 ? -36.367 33.453  45.863  1.00 63.80  ? 186 GLU E C   1 
ATOM   9948  O  O   . GLU E 1 186 ? -36.197 34.207  44.906  1.00 58.05  ? 186 GLU E O   1 
ATOM   9949  C  CB  . GLU E 1 186 ? -38.627 32.586  46.499  1.00 69.94  ? 186 GLU E CB  1 
ATOM   9950  C  CG  . GLU E 1 186 ? -39.142 31.450  47.367  1.00 77.30  ? 186 GLU E CG  1 
ATOM   9951  C  CD  . GLU E 1 186 ? -38.798 31.634  48.832  1.00 74.86  ? 186 GLU E CD  1 
ATOM   9952  O  OE1 . GLU E 1 186 ? -38.583 32.790  49.252  1.00 69.59  ? 186 GLU E OE1 1 
ATOM   9953  O  OE2 . GLU E 1 186 ? -38.744 30.624  49.563  1.00 81.31  ? 186 GLU E OE2 1 
ATOM   9954  N  N   . VAL E 1 187 ? -35.744 33.607  47.027  1.00 66.05  ? 187 VAL E N   1 
ATOM   9955  C  CA  . VAL E 1 187 ? -34.786 34.683  47.242  1.00 66.84  ? 187 VAL E CA  1 
ATOM   9956  C  C   . VAL E 1 187 ? -33.605 34.544  46.291  1.00 62.95  ? 187 VAL E C   1 
ATOM   9957  O  O   . VAL E 1 187 ? -32.736 35.413  46.231  1.00 66.95  ? 187 VAL E O   1 
ATOM   9958  C  CB  . VAL E 1 187 ? -34.260 34.692  48.689  1.00 58.32  ? 187 VAL E CB  1 
ATOM   9959  C  CG1 . VAL E 1 187 ? -33.120 35.687  48.834  1.00 39.76  ? 187 VAL E CG1 1 
ATOM   9960  C  CG2 . VAL E 1 187 ? -35.384 35.013  49.661  1.00 55.93  ? 187 VAL E CG2 1 
ATOM   9961  N  N   . LEU E 1 188 ? -33.582 33.442  45.549  1.00 50.63  ? 188 LEU E N   1 
ATOM   9962  C  CA  . LEU E 1 188 ? -32.503 33.174  44.607  1.00 52.33  ? 188 LEU E CA  1 
ATOM   9963  C  C   . LEU E 1 188 ? -32.847 33.682  43.213  1.00 59.43  ? 188 LEU E C   1 
ATOM   9964  O  O   . LEU E 1 188 ? -32.101 34.466  42.628  1.00 62.51  ? 188 LEU E O   1 
ATOM   9965  C  CB  . LEU E 1 188 ? -32.201 31.675  44.556  1.00 55.90  ? 188 LEU E CB  1 
ATOM   9966  C  CG  . LEU E 1 188 ? -30.747 31.267  44.799  1.00 53.77  ? 188 LEU E CG  1 
ATOM   9967  C  CD1 . LEU E 1 188 ? -29.857 32.495  44.891  1.00 66.75  ? 188 LEU E CD1 1 
ATOM   9968  C  CD2 . LEU E 1 188 ? -30.630 30.421  46.057  1.00 50.83  ? 188 LEU E CD2 1 
ATOM   9969  N  N   . LEU E 1 189 ? -33.979 33.229  42.685  1.00 67.02  ? 189 LEU E N   1 
ATOM   9970  C  CA  . LEU E 1 189 ? -34.409 33.619  41.348  1.00 74.05  ? 189 LEU E CA  1 
ATOM   9971  C  C   . LEU E 1 189 ? -35.658 34.492  41.393  1.00 73.72  ? 189 LEU E C   1 
ATOM   9972  O  O   . LEU E 1 189 ? -36.764 34.024  41.126  1.00 93.61  ? 189 LEU E O   1 
ATOM   9973  C  CB  . LEU E 1 189 ? -34.667 32.378  40.491  1.00 63.86  ? 189 LEU E CB  1 
ATOM   9974  C  CG  . LEU E 1 189 ? -35.261 31.169  41.216  1.00 63.19  ? 189 LEU E CG  1 
ATOM   9975  C  CD1 . LEU E 1 189 ? -35.480 30.017  40.250  1.00 56.02  ? 189 LEU E CD1 1 
ATOM   9976  C  CD2 . LEU E 1 189 ? -34.368 30.741  42.371  1.00 72.47  ? 189 LEU E CD2 1 
ATOM   9977  N  N   . LYS E 1 190 ? -35.479 35.763  41.737  1.00 61.89  ? 190 LYS E N   1 
ATOM   9978  C  CA  . LYS E 1 190 ? -36.601 36.691  41.820  1.00 76.42  ? 190 LYS E CA  1 
ATOM   9979  C  C   . LYS E 1 190 ? -36.239 37.935  42.623  1.00 80.60  ? 190 LYS E C   1 
ATOM   9980  O  O   . LYS E 1 190 ? -35.526 37.855  43.624  1.00 74.69  ? 190 LYS E O   1 
ATOM   9981  C  CB  . LYS E 1 190 ? -37.819 36.003  42.438  1.00 71.59  ? 190 LYS E CB  1 
ATOM   9982  C  CG  . LYS E 1 190 ? -38.947 35.738  41.455  1.00 78.54  ? 190 LYS E CG  1 
ATOM   9983  C  CD  . LYS E 1 190 ? -39.364 34.277  41.471  1.00 85.77  ? 190 LYS E CD  1 
ATOM   9984  C  CE  . LYS E 1 190 ? -39.226 33.648  40.096  1.00 92.16  ? 190 LYS E CE  1 
ATOM   9985  N  NZ  . LYS E 1 190 ? -40.207 32.548  39.887  1.00 90.64  ? 190 LYS E NZ  1 
ATOM   9986  N  N   . LYS E 1 191 ? -36.736 39.084  42.178  1.00 92.56  ? 191 LYS E N   1 
ATOM   9987  C  CA  . LYS E 1 191 ? -36.464 40.347  42.853  1.00 111.64 ? 191 LYS E CA  1 
ATOM   9988  C  C   . LYS E 1 191 ? -37.635 40.764  43.734  1.00 113.84 ? 191 LYS E C   1 
ATOM   9989  O  O   . LYS E 1 191 ? -37.482 41.583  44.639  1.00 115.29 ? 191 LYS E O   1 
ATOM   9990  C  CB  . LYS E 1 191 ? -36.158 41.444  41.831  1.00 115.20 ? 191 LYS E CB  1 
ATOM   9991  C  CG  . LYS E 1 191 ? -35.866 42.802  42.446  1.00 111.22 ? 191 LYS E CG  1 
ATOM   9992  C  CD  . LYS E 1 191 ? -36.594 43.912  41.706  1.00 99.41  ? 191 LYS E CD  1 
ATOM   9993  C  CE  . LYS E 1 191 ? -37.056 43.449  40.334  1.00 89.45  ? 191 LYS E CE  1 
ATOM   9994  N  NZ  . LYS E 1 191 ? -36.137 42.433  39.753  1.00 82.47  ? 191 LYS E NZ  1 
ATOM   9995  N  N   . GLU E 1 192 ? -38.805 40.198  43.460  1.00 110.72 ? 192 GLU E N   1 
ATOM   9996  C  CA  . GLU E 1 192 ? -40.005 40.512  44.224  1.00 113.43 ? 192 GLU E CA  1 
ATOM   9997  C  C   . GLU E 1 192 ? -40.453 39.315  45.055  1.00 100.61 ? 192 GLU E C   1 
ATOM   9998  O  O   . GLU E 1 192 ? -41.511 38.737  44.808  1.00 102.28 ? 192 GLU E O   1 
ATOM   9999  C  CB  . GLU E 1 192 ? -41.133 40.957  43.292  1.00 124.08 ? 192 GLU E CB  1 
ATOM   10000 C  CG  . GLU E 1 192 ? -40.867 42.273  42.582  1.00 130.01 ? 192 GLU E CG  1 
ATOM   10001 C  CD  . GLU E 1 192 ? -40.785 43.446  43.540  1.00 128.56 ? 192 GLU E CD  1 
ATOM   10002 O  OE1 . GLU E 1 192 ? -40.203 44.485  43.162  1.00 124.00 ? 192 GLU E OE1 1 
ATOM   10003 O  OE2 . GLU E 1 192 ? -41.302 43.328  44.671  1.00 125.84 ? 192 GLU E OE2 1 
ATOM   10004 N  N   . TYR E 1 193 ? -39.640 38.946  46.040  1.00 82.51  ? 193 TYR E N   1 
ATOM   10005 C  CA  . TYR E 1 193 ? -39.956 37.821  46.911  1.00 80.47  ? 193 TYR E CA  1 
ATOM   10006 C  C   . TYR E 1 193 ? -40.490 38.298  48.256  1.00 72.09  ? 193 TYR E C   1 
ATOM   10007 O  O   . TYR E 1 193 ? -40.040 39.311  48.790  1.00 64.57  ? 193 TYR E O   1 
ATOM   10008 C  CB  . TYR E 1 193 ? -38.722 36.941  47.118  1.00 75.78  ? 193 TYR E CB  1 
ATOM   10009 C  CG  . TYR E 1 193 ? -37.721 37.511  48.097  1.00 69.30  ? 193 TYR E CG  1 
ATOM   10010 C  CD1 . TYR E 1 193 ? -37.944 37.447  49.465  1.00 66.66  ? 193 TYR E CD1 1 
ATOM   10011 C  CD2 . TYR E 1 193 ? -36.551 38.111  47.652  1.00 55.26  ? 193 TYR E CD2 1 
ATOM   10012 C  CE1 . TYR E 1 193 ? -37.032 37.967  50.363  1.00 61.44  ? 193 TYR E CE1 1 
ATOM   10013 C  CE2 . TYR E 1 193 ? -35.633 38.632  48.543  1.00 58.11  ? 193 TYR E CE2 1 
ATOM   10014 C  CZ  . TYR E 1 193 ? -35.878 38.558  49.896  1.00 63.16  ? 193 TYR E CZ  1 
ATOM   10015 O  OH  . TYR E 1 193 ? -34.967 39.076  50.786  1.00 76.85  ? 193 TYR E OH  1 
ATOM   10016 N  N   . ASP E 1 194 ? -41.453 37.561  48.800  1.00 62.14  ? 194 ASP E N   1 
ATOM   10017 C  CA  . ASP E 1 194 ? -42.050 37.913  50.097  1.00 57.14  ? 194 ASP E CA  1 
ATOM   10018 C  C   . ASP E 1 194 ? -40.978 38.354  51.097  1.00 64.10  ? 194 ASP E C   1 
ATOM   10019 O  O   . ASP E 1 194 ? -40.593 39.528  51.101  1.00 84.52  ? 194 ASP E O   1 
ATOM   10020 C  CB  . ASP E 1 194 ? -42.913 36.778  50.675  1.00 62.27  ? 194 ASP E CB  1 
ATOM   10021 C  CG  . ASP E 1 194 ? -43.697 37.211  51.958  1.00 64.96  ? 194 ASP E CG  1 
ATOM   10022 O  OD1 . ASP E 1 194 ? -44.902 36.846  52.113  1.00 58.59  ? 194 ASP E OD1 1 
ATOM   10023 O  OD2 . ASP E 1 194 ? -43.103 37.898  52.828  1.00 51.84  ? 194 ASP E OD2 1 
ATOM   10024 N  N   . GLY E 1 195 ? -40.492 37.437  51.937  1.00 56.05  ? 195 GLY E N   1 
ATOM   10025 C  CA  . GLY E 1 195 ? -39.406 37.777  52.844  1.00 60.98  ? 195 GLY E CA  1 
ATOM   10026 C  C   . GLY E 1 195 ? -39.513 37.096  54.187  1.00 65.63  ? 195 GLY E C   1 
ATOM   10027 O  O   . GLY E 1 195 ? -38.552 36.555  54.748  1.00 73.81  ? 195 GLY E O   1 
ATOM   10028 N  N   . LYS E 1 196 ? -40.717 37.132  54.716  1.00 60.71  ? 196 LYS E N   1 
ATOM   10029 C  CA  . LYS E 1 196 ? -41.033 36.416  55.930  1.00 64.90  ? 196 LYS E CA  1 
ATOM   10030 C  C   . LYS E 1 196 ? -41.073 34.901  55.690  1.00 64.84  ? 196 LYS E C   1 
ATOM   10031 O  O   . LYS E 1 196 ? -40.697 34.119  56.573  1.00 61.25  ? 196 LYS E O   1 
ATOM   10032 C  CB  . LYS E 1 196 ? -42.363 36.917  56.461  1.00 54.99  ? 196 LYS E CB  1 
ATOM   10033 C  CG  . LYS E 1 196 ? -42.301 38.340  56.947  1.00 60.33  ? 196 LYS E CG  1 
ATOM   10034 C  CD  . LYS E 1 196 ? -43.667 38.786  57.456  1.00 73.98  ? 196 LYS E CD  1 
ATOM   10035 C  CE  . LYS E 1 196 ? -43.577 40.134  58.175  1.00 78.98  ? 196 LYS E CE  1 
ATOM   10036 N  NZ  . LYS E 1 196 ? -44.886 40.540  58.778  1.00 87.65  ? 196 LYS E NZ  1 
ATOM   10037 N  N   . VAL E 1 197 ? -41.499 34.514  54.492  1.00 56.54  ? 197 VAL E N   1 
ATOM   10038 C  CA  . VAL E 1 197 ? -41.491 33.119  54.082  1.00 52.81  ? 197 VAL E CA  1 
ATOM   10039 C  C   . VAL E 1 197 ? -40.059 32.654  53.848  1.00 58.76  ? 197 VAL E C   1 
ATOM   10040 O  O   . VAL E 1 197 ? -39.717 31.508  54.135  1.00 71.55  ? 197 VAL E O   1 
ATOM   10041 C  CB  . VAL E 1 197 ? -42.309 32.905  52.796  1.00 44.95  ? 197 VAL E CB  1 
ATOM   10042 C  CG1 . VAL E 1 197 ? -42.270 31.444  52.380  1.00 51.54  ? 197 VAL E CG1 1 
ATOM   10043 C  CG2 . VAL E 1 197 ? -43.741 33.371  52.995  1.00 40.68  ? 197 VAL E CG2 1 
ATOM   10044 N  N   . ALA E 1 198 ? -39.221 33.549  53.331  1.00 49.62  ? 198 ALA E N   1 
ATOM   10045 C  CA  . ALA E 1 198 ? -37.820 33.225  53.116  1.00 51.74  ? 198 ALA E CA  1 
ATOM   10046 C  C   . ALA E 1 198 ? -37.160 32.920  54.453  1.00 57.60  ? 198 ALA E C   1 
ATOM   10047 O  O   . ALA E 1 198 ? -36.275 32.048  54.537  1.00 67.62  ? 198 ALA E O   1 
ATOM   10048 C  CB  . ALA E 1 198 ? -37.094 34.338  52.410  1.00 47.40  ? 198 ALA E CB  1 
ATOM   10049 N  N   . ASP E 1 199 ? -37.599 33.623  55.496  1.00 42.96  ? 199 ASP E N   1 
ATOM   10050 C  CA  . ASP E 1 199 ? -37.036 33.441  56.831  1.00 43.30  ? 199 ASP E CA  1 
ATOM   10051 C  C   . ASP E 1 199 ? -37.364 32.072  57.402  1.00 53.53  ? 199 ASP E C   1 
ATOM   10052 O  O   . ASP E 1 199 ? -36.536 31.454  58.065  1.00 62.70  ? 199 ASP E O   1 
ATOM   10053 C  CB  . ASP E 1 199 ? -37.549 34.523  57.765  1.00 52.72  ? 199 ASP E CB  1 
ATOM   10054 C  CG  . ASP E 1 199 ? -36.840 35.833  57.565  1.00 61.55  ? 199 ASP E CG  1 
ATOM   10055 O  OD1 . ASP E 1 199 ? -37.329 36.852  58.091  1.00 57.54  ? 199 ASP E OD1 1 
ATOM   10056 O  OD2 . ASP E 1 199 ? -35.792 35.832  56.887  1.00 65.43  ? 199 ASP E OD2 1 
ATOM   10057 N  N   . VAL E 1 200 ? -38.577 31.599  57.143  1.00 42.85  ? 200 VAL E N   1 
ATOM   10058 C  CA  . VAL E 1 200 ? -38.968 30.275  57.579  1.00 51.42  ? 200 VAL E CA  1 
ATOM   10059 C  C   . VAL E 1 200 ? -38.033 29.217  56.999  1.00 46.25  ? 200 VAL E C   1 
ATOM   10060 O  O   . VAL E 1 200 ? -37.631 28.279  57.684  1.00 48.46  ? 200 VAL E O   1 
ATOM   10061 C  CB  . VAL E 1 200 ? -40.438 29.978  57.209  1.00 50.81  ? 200 VAL E CB  1 
ATOM   10062 C  CG1 . VAL E 1 200 ? -40.708 28.496  57.307  1.00 46.84  ? 200 VAL E CG1 1 
ATOM   10063 C  CG2 . VAL E 1 200 ? -41.361 30.749  58.129  1.00 44.33  ? 200 VAL E CG2 1 
ATOM   10064 N  N   . TRP E 1 201 ? -37.664 29.382  55.741  1.00 41.74  ? 201 TRP E N   1 
ATOM   10065 C  CA  . TRP E 1 201 ? -36.768 28.434  55.095  1.00 46.48  ? 201 TRP E CA  1 
ATOM   10066 C  C   . TRP E 1 201 ? -35.459 28.471  55.858  1.00 53.93  ? 201 TRP E C   1 
ATOM   10067 O  O   . TRP E 1 201 ? -34.939 27.444  56.288  1.00 55.60  ? 201 TRP E O   1 
ATOM   10068 C  CB  . TRP E 1 201 ? -36.530 28.853  53.655  1.00 30.65  ? 201 TRP E CB  1 
ATOM   10069 C  CG  . TRP E 1 201 ? -35.531 28.068  52.938  1.00 37.49  ? 201 TRP E CG  1 
ATOM   10070 C  CD1 . TRP E 1 201 ? -34.192 28.229  53.001  1.00 28.33  ? 201 TRP E CD1 1 
ATOM   10071 C  CD2 . TRP E 1 201 ? -35.766 26.989  52.010  1.00 41.18  ? 201 TRP E CD2 1 
ATOM   10072 N  NE1 . TRP E 1 201 ? -33.568 27.326  52.168  1.00 39.59  ? 201 TRP E NE1 1 
ATOM   10073 C  CE2 . TRP E 1 201 ? -34.525 26.543  51.548  1.00 37.89  ? 201 TRP E CE2 1 
ATOM   10074 C  CE3 . TRP E 1 201 ? -36.909 26.345  51.535  1.00 46.90  ? 201 TRP E CE3 1 
ATOM   10075 C  CZ2 . TRP E 1 201 ? -34.375 25.501  50.654  1.00 44.38  ? 201 TRP E CZ2 1 
ATOM   10076 C  CZ3 . TRP E 1 201 ? -36.760 25.303  50.635  1.00 56.17  ? 201 TRP E CZ3 1 
ATOM   10077 C  CH2 . TRP E 1 201 ? -35.502 24.897  50.204  1.00 50.65  ? 201 TRP E CH2 1 
ATOM   10078 N  N   . SER E 1 202 ? -34.943 29.666  56.062  1.00 46.06  ? 202 SER E N   1 
ATOM   10079 C  CA  . SER E 1 202 ? -33.743 29.826  56.857  1.00 49.71  ? 202 SER E CA  1 
ATOM   10080 C  C   . SER E 1 202 ? -33.840 29.177  58.201  1.00 51.65  ? 202 SER E C   1 
ATOM   10081 O  O   . SER E 1 202 ? -32.857 28.638  58.684  1.00 60.71  ? 202 SER E O   1 
ATOM   10082 C  CB  . SER E 1 202 ? -33.400 31.298  57.061  1.00 43.78  ? 202 SER E CB  1 
ATOM   10083 O  OG  . SER E 1 202 ? -32.747 31.782  55.909  1.00 67.08  ? 202 SER E OG  1 
ATOM   10084 N  N   . CYS E 1 203 ? -35.004 29.253  58.833  1.00 46.19  ? 203 CYS E N   1 
ATOM   10085 C  CA  . CYS E 1 203 ? -35.189 28.591  60.124  1.00 46.79  ? 203 CYS E CA  1 
ATOM   10086 C  C   . CYS E 1 203 ? -35.165 27.077  59.958  1.00 39.92  ? 203 CYS E C   1 
ATOM   10087 O  O   . CYS E 1 203 ? -34.752 26.348  60.852  1.00 37.88  ? 203 CYS E O   1 
ATOM   10088 C  CB  . CYS E 1 203 ? -36.486 29.045  60.780  1.00 49.03  ? 203 CYS E CB  1 
ATOM   10089 S  SG  . CYS E 1 203 ? -36.435 30.758  61.279  1.00 51.69  ? 203 CYS E SG  1 
ATOM   10090 N  N   . GLY E 1 204 ? -35.589 26.604  58.795  1.00 39.32  ? 204 GLY E N   1 
ATOM   10091 C  CA  . GLY E 1 204 ? -35.553 25.176  58.516  1.00 40.61  ? 204 GLY E CA  1 
ATOM   10092 C  C   . GLY E 1 204 ? -34.105 24.717  58.450  1.00 53.38  ? 204 GLY E C   1 
ATOM   10093 O  O   . GLY E 1 204 ? -33.732 23.733  59.081  1.00 54.44  ? 204 GLY E O   1 
ATOM   10094 N  N   . VAL E 1 205 ? -33.272 25.459  57.718  1.00 49.11  ? 205 VAL E N   1 
ATOM   10095 C  CA  . VAL E 1 205 ? -31.878 25.066  57.544  1.00 53.63  ? 205 VAL E CA  1 
ATOM   10096 C  C   . VAL E 1 205 ? -31.170 25.000  58.890  1.00 51.13  ? 205 VAL E C   1 
ATOM   10097 O  O   . VAL E 1 205 ? -30.370 24.108  59.114  1.00 49.23  ? 205 VAL E O   1 
ATOM   10098 C  CB  . VAL E 1 205 ? -31.093 26.038  56.641  1.00 52.05  ? 205 VAL E CB  1 
ATOM   10099 C  CG1 . VAL E 1 205 ? -29.657 25.625  56.593  1.00 37.80  ? 205 VAL E CG1 1 
ATOM   10100 C  CG2 . VAL E 1 205 ? -31.683 26.071  55.220  1.00 52.24  ? 205 VAL E CG2 1 
ATOM   10101 N  N   . THR E 1 206 ? -31.449 25.930  59.799  1.00 39.59  ? 206 THR E N   1 
ATOM   10102 C  CA  . THR E 1 206 ? -30.733 25.852  61.060  1.00 37.28  ? 206 THR E CA  1 
ATOM   10103 C  C   . THR E 1 206 ? -31.284 24.734  61.955  1.00 43.15  ? 206 THR E C   1 
ATOM   10104 O  O   . THR E 1 206 ? -30.570 24.214  62.798  1.00 43.19  ? 206 THR E O   1 
ATOM   10105 C  CB  . THR E 1 206 ? -30.488 27.240  61.819  1.00 33.05  ? 206 THR E CB  1 
ATOM   10106 O  OG1 . THR E 1 206 ? -31.283 27.312  63.001  1.00 38.69  ? 206 THR E OG1 1 
ATOM   10107 C  CG2 . THR E 1 206 ? -30.752 28.416  60.951  1.00 34.74  ? 206 THR E CG2 1 
ATOM   10108 N  N   . LEU E 1 207 ? -32.539 24.345  61.753  1.00 53.65  ? 207 LEU E N   1 
ATOM   10109 C  CA  . LEU E 1 207 ? -33.077 23.179  62.461  1.00 47.09  ? 207 LEU E CA  1 
ATOM   10110 C  C   . LEU E 1 207 ? -32.402 21.926  61.943  1.00 43.60  ? 207 LEU E C   1 
ATOM   10111 O  O   . LEU E 1 207 ? -32.004 21.054  62.708  1.00 49.68  ? 207 LEU E O   1 
ATOM   10112 C  CB  . LEU E 1 207 ? -34.587 23.066  62.262  1.00 40.59  ? 207 LEU E CB  1 
ATOM   10113 C  CG  . LEU E 1 207 ? -35.230 21.773  62.766  1.00 39.18  ? 207 LEU E CG  1 
ATOM   10114 C  CD1 . LEU E 1 207 ? -34.959 21.571  64.262  1.00 40.80  ? 207 LEU E CD1 1 
ATOM   10115 C  CD2 . LEU E 1 207 ? -36.682 21.816  62.521  1.00 25.74  ? 207 LEU E CD2 1 
ATOM   10116 N  N   . TYR E 1 208 ? -32.251 21.839  60.630  1.00 37.03  ? 208 TYR E N   1 
ATOM   10117 C  CA  . TYR E 1 208 ? -31.601 20.668  60.024  1.00 40.36  ? 208 TYR E CA  1 
ATOM   10118 C  C   . TYR E 1 208 ? -30.183 20.562  60.545  1.00 40.40  ? 208 TYR E C   1 
ATOM   10119 O  O   . TYR E 1 208 ? -29.785 19.527  61.044  1.00 46.39  ? 208 TYR E O   1 
ATOM   10120 C  CB  . TYR E 1 208 ? -31.606 20.792  58.507  1.00 30.83  ? 208 TYR E CB  1 
ATOM   10121 C  CG  . TYR E 1 208 ? -31.022 19.632  57.768  1.00 33.57  ? 208 TYR E CG  1 
ATOM   10122 C  CD1 . TYR E 1 208 ? -31.835 18.660  57.190  1.00 37.62  ? 208 TYR E CD1 1 
ATOM   10123 C  CD2 . TYR E 1 208 ? -29.657 19.528  57.612  1.00 44.56  ? 208 TYR E CD2 1 
ATOM   10124 C  CE1 . TYR E 1 208 ? -31.285 17.614  56.479  1.00 38.18  ? 208 TYR E CE1 1 
ATOM   10125 C  CE2 . TYR E 1 208 ? -29.100 18.485  56.910  1.00 50.24  ? 208 TYR E CE2 1 
ATOM   10126 C  CZ  . TYR E 1 208 ? -29.908 17.522  56.351  1.00 51.03  ? 208 TYR E CZ  1 
ATOM   10127 O  OH  . TYR E 1 208 ? -29.319 16.474  55.667  1.00 60.17  ? 208 TYR E OH  1 
ATOM   10128 N  N   . VAL E 1 209 ? -29.428 21.645  60.447  1.00 44.41  ? 209 VAL E N   1 
ATOM   10129 C  CA  . VAL E 1 209 ? -28.056 21.668  60.940  1.00 43.94  ? 209 VAL E CA  1 
ATOM   10130 C  C   . VAL E 1 209 ? -27.950 21.244  62.403  1.00 43.17  ? 209 VAL E C   1 
ATOM   10131 O  O   . VAL E 1 209 ? -27.040 20.507  62.778  1.00 49.82  ? 209 VAL E O   1 
ATOM   10132 C  CB  . VAL E 1 209 ? -27.417 23.044  60.738  1.00 49.40  ? 209 VAL E CB  1 
ATOM   10133 C  CG1 . VAL E 1 209 ? -26.090 23.130  61.484  1.00 30.33  ? 209 VAL E CG1 1 
ATOM   10134 C  CG2 . VAL E 1 209 ? -27.232 23.298  59.252  1.00 56.29  ? 209 VAL E CG2 1 
ATOM   10135 N  N   . MET E 1 210 ? -28.870 21.682  63.237  1.00 29.25  ? 210 MET E N   1 
ATOM   10136 C  CA  . MET E 1 210 ? -28.797 21.269  64.624  1.00 35.87  ? 210 MET E CA  1 
ATOM   10137 C  C   . MET E 1 210 ? -28.972 19.725  64.782  1.00 43.90  ? 210 MET E C   1 
ATOM   10138 O  O   . MET E 1 210 ? -28.347 19.081  65.635  1.00 40.82  ? 210 MET E O   1 
ATOM   10139 C  CB  . MET E 1 210 ? -29.825 22.016  65.463  1.00 27.43  ? 210 MET E CB  1 
ATOM   10140 C  CG  . MET E 1 210 ? -29.464 23.467  65.785  1.00 17.97  ? 210 MET E CG  1 
ATOM   10141 S  SD  . MET E 1 210 ? -30.429 24.120  67.133  1.00 40.47  ? 210 MET E SD  1 
ATOM   10142 C  CE  . MET E 1 210 ? -32.000 24.212  66.354  1.00 22.43  ? 210 MET E CE  1 
ATOM   10143 N  N   . LEU E 1 211 ? -29.827 19.140  63.961  1.00 30.41  ? 211 LEU E N   1 
ATOM   10144 C  CA  . LEU E 1 211 ? -30.190 17.743  64.112  1.00 34.04  ? 211 LEU E CA  1 
ATOM   10145 C  C   . LEU E 1 211 ? -29.177 16.835  63.435  1.00 49.35  ? 211 LEU E C   1 
ATOM   10146 O  O   . LEU E 1 211 ? -28.980 15.682  63.845  1.00 48.96  ? 211 LEU E O   1 
ATOM   10147 C  CB  . LEU E 1 211 ? -31.583 17.472  63.528  1.00 22.30  ? 211 LEU E CB  1 
ATOM   10148 C  CG  . LEU E 1 211 ? -32.766 18.081  64.293  1.00 32.50  ? 211 LEU E CG  1 
ATOM   10149 C  CD1 . LEU E 1 211 ? -34.010 17.957  63.462  1.00 40.10  ? 211 LEU E CD1 1 
ATOM   10150 C  CD2 . LEU E 1 211 ? -32.975 17.441  65.629  1.00 17.14  ? 211 LEU E CD2 1 
ATOM   10151 N  N   . VAL E 1 212 ? -28.522 17.360  62.407  1.00 51.09  ? 212 VAL E N   1 
ATOM   10152 C  CA  . VAL E 1 212 ? -27.694 16.526  61.530  1.00 41.12  ? 212 VAL E CA  1 
ATOM   10153 C  C   . VAL E 1 212 ? -26.203 16.844  61.607  1.00 45.06  ? 212 VAL E C   1 
ATOM   10154 O  O   . VAL E 1 212 ? -25.376 15.980  61.371  1.00 51.77  ? 212 VAL E O   1 
ATOM   10155 C  CB  . VAL E 1 212 ? -28.132 16.682  60.058  1.00 36.57  ? 212 VAL E CB  1 
ATOM   10156 C  CG1 . VAL E 1 212 ? -27.119 16.050  59.143  1.00 29.33  ? 212 VAL E CG1 1 
ATOM   10157 C  CG2 . VAL E 1 212 ? -29.534 16.098  59.846  1.00 35.66  ? 212 VAL E CG2 1 
ATOM   10158 N  N   . GLY E 1 213 ? -25.853 18.077  61.936  1.00 39.94  ? 213 GLY E N   1 
ATOM   10159 C  CA  . GLY E 1 213 ? -24.459 18.397  62.100  1.00 46.87  ? 213 GLY E CA  1 
ATOM   10160 C  C   . GLY E 1 213 ? -23.878 18.813  60.773  1.00 55.66  ? 213 GLY E C   1 
ATOM   10161 O  O   . GLY E 1 213 ? -22.703 19.169  60.696  1.00 62.50  ? 213 GLY E O   1 
ATOM   10162 N  N   . ALA E 1 214 ? -24.699 18.772  59.727  1.00 51.56  ? 214 ALA E N   1 
ATOM   10163 C  CA  . ALA E 1 214 ? -24.310 19.318  58.421  1.00 49.45  ? 214 ALA E CA  1 
ATOM   10164 C  C   . ALA E 1 214 ? -25.429 20.115  57.764  1.00 45.43  ? 214 ALA E C   1 
ATOM   10165 O  O   . ALA E 1 214 ? -26.599 19.902  58.074  1.00 59.14  ? 214 ALA E O   1 
ATOM   10166 C  CB  . ALA E 1 214 ? -23.881 18.219  57.510  1.00 45.09  ? 214 ALA E CB  1 
ATOM   10167 N  N   . TYR E 1 215 ? -25.067 21.008  56.849  1.00 53.57  ? 215 TYR E N   1 
ATOM   10168 C  CA  . TYR E 1 215 ? -26.051 21.779  56.101  1.00 58.43  ? 215 TYR E CA  1 
ATOM   10169 C  C   . TYR E 1 215 ? -26.872 20.859  55.207  1.00 58.37  ? 215 TYR E C   1 
ATOM   10170 O  O   . TYR E 1 215 ? -26.531 19.691  55.025  1.00 50.03  ? 215 TYR E O   1 
ATOM   10171 C  CB  . TYR E 1 215 ? -25.363 22.854  55.258  1.00 45.44  ? 215 TYR E CB  1 
ATOM   10172 C  CG  . TYR E 1 215 ? -24.768 23.981  56.070  1.00 47.45  ? 215 TYR E CG  1 
ATOM   10173 C  CD1 . TYR E 1 215 ? -25.549 24.713  56.954  1.00 57.99  ? 215 TYR E CD1 1 
ATOM   10174 C  CD2 . TYR E 1 215 ? -23.425 24.314  55.952  1.00 63.49  ? 215 TYR E CD2 1 
ATOM   10175 C  CE1 . TYR E 1 215 ? -25.009 25.744  57.698  1.00 59.57  ? 215 TYR E CE1 1 
ATOM   10176 C  CE2 . TYR E 1 215 ? -22.877 25.343  56.692  1.00 65.90  ? 215 TYR E CE2 1 
ATOM   10177 C  CZ  . TYR E 1 215 ? -23.674 26.055  57.563  1.00 71.84  ? 215 TYR E CZ  1 
ATOM   10178 O  OH  . TYR E 1 215 ? -23.132 27.082  58.302  1.00 85.83  ? 215 TYR E OH  1 
ATOM   10179 N  N   . PRO E 1 216 ? -27.954 21.389  54.647  1.00 57.06  ? 216 PRO E N   1 
ATOM   10180 C  CA  . PRO E 1 216 ? -28.810 20.609  53.748  1.00 43.38  ? 216 PRO E CA  1 
ATOM   10181 C  C   . PRO E 1 216 ? -28.491 20.900  52.286  1.00 58.23  ? 216 PRO E C   1 
ATOM   10182 O  O   . PRO E 1 216 ? -27.827 21.892  51.988  1.00 66.97  ? 216 PRO E O   1 
ATOM   10183 C  CB  . PRO E 1 216 ? -30.218 21.101  54.092  1.00 28.62  ? 216 PRO E CB  1 
ATOM   10184 C  CG  . PRO E 1 216 ? -30.015 22.467  54.638  1.00 49.26  ? 216 PRO E CG  1 
ATOM   10185 C  CD  . PRO E 1 216 ? -28.712 22.421  55.374  1.00 52.85  ? 216 PRO E CD  1 
ATOM   10186 N  N   . PHE E 1 217 ? -28.958 20.039  51.388  1.00 53.57  ? 217 PHE E N   1 
ATOM   10187 C  CA  . PHE E 1 217 ? -28.711 20.214  49.962  1.00 71.44  ? 217 PHE E CA  1 
ATOM   10188 C  C   . PHE E 1 217 ? -27.217 20.298  49.669  1.00 68.69  ? 217 PHE E C   1 
ATOM   10189 O  O   . PHE E 1 217 ? -26.506 19.295  49.724  1.00 64.53  ? 217 PHE E O   1 
ATOM   10190 C  CB  . PHE E 1 217 ? -29.418 21.469  49.445  1.00 69.69  ? 217 PHE E CB  1 
ATOM   10191 C  CG  . PHE E 1 217 ? -30.708 21.773  50.151  1.00 59.77  ? 217 PHE E CG  1 
ATOM   10192 C  CD1 . PHE E 1 217 ? -31.866 21.083  49.835  1.00 58.96  ? 217 PHE E CD1 1 
ATOM   10193 C  CD2 . PHE E 1 217 ? -30.764 22.749  51.131  1.00 59.61  ? 217 PHE E CD2 1 
ATOM   10194 C  CE1 . PHE E 1 217 ? -33.053 21.360  50.483  1.00 53.80  ? 217 PHE E CE1 1 
ATOM   10195 C  CE2 . PHE E 1 217 ? -31.949 23.031  51.783  1.00 51.70  ? 217 PHE E CE2 1 
ATOM   10196 C  CZ  . PHE E 1 217 ? -33.095 22.335  51.458  1.00 52.03  ? 217 PHE E CZ  1 
ATOM   10197 N  N   . GLU E 1 222 ? -19.993 16.945  46.882  1.00 114.65 ? 222 GLU E N   1 
ATOM   10198 C  CA  . GLU E 1 222 ? -18.849 17.479  47.612  1.00 117.51 ? 222 GLU E CA  1 
ATOM   10199 C  C   . GLU E 1 222 ? -19.233 18.721  48.406  1.00 121.11 ? 222 GLU E C   1 
ATOM   10200 O  O   . GLU E 1 222 ? -20.415 18.992  48.620  1.00 122.37 ? 222 GLU E O   1 
ATOM   10201 C  CB  . GLU E 1 222 ? -17.704 17.803  46.650  1.00 20.00  ? 222 GLU E CB  1 
ATOM   10202 N  N   . PRO E 1 223 ? -18.228 19.473  48.843  1.00 121.33 ? 223 PRO E N   1 
ATOM   10203 C  CA  . PRO E 1 223 ? -18.461 20.697  49.615  1.00 115.57 ? 223 PRO E CA  1 
ATOM   10204 C  C   . PRO E 1 223 ? -18.508 21.928  48.718  1.00 115.27 ? 223 PRO E C   1 
ATOM   10205 O  O   . PRO E 1 223 ? -19.519 22.628  48.683  1.00 111.70 ? 223 PRO E O   1 
ATOM   10206 C  CB  . PRO E 1 223 ? -17.241 20.761  50.534  1.00 113.90 ? 223 PRO E CB  1 
ATOM   10207 C  CG  . PRO E 1 223 ? -16.846 19.341  50.721  1.00 114.99 ? 223 PRO E CG  1 
ATOM   10208 C  CD  . PRO E 1 223 ? -17.152 18.649  49.421  1.00 119.53 ? 223 PRO E CD  1 
ATOM   10209 N  N   . LYS E 1 224 ? -17.419 22.183  47.999  1.00 126.31 ? 224 LYS E N   1 
ATOM   10210 C  CA  . LYS E 1 224 ? -17.347 23.328  47.101  1.00 133.96 ? 224 LYS E CA  1 
ATOM   10211 C  C   . LYS E 1 224 ? -18.417 23.244  46.017  1.00 123.83 ? 224 LYS E C   1 
ATOM   10212 O  O   . LYS E 1 224 ? -19.322 24.076  45.959  1.00 123.98 ? 224 LYS E O   1 
ATOM   10213 C  CB  . LYS E 1 224 ? -15.959 23.424  46.464  1.00 143.59 ? 224 LYS E CB  1 
ATOM   10214 C  CG  . LYS E 1 224 ? -14.820 23.052  47.400  1.00 141.29 ? 224 LYS E CG  1 
ATOM   10215 C  CD  . LYS E 1 224 ? -13.499 23.631  46.921  1.00 135.17 ? 224 LYS E CD  1 
ATOM   10216 C  CE  . LYS E 1 224 ? -12.974 24.681  47.887  1.00 132.01 ? 224 LYS E CE  1 
ATOM   10217 N  NZ  . LYS E 1 224 ? -12.687 25.973  47.204  1.00 126.95 ? 224 LYS E NZ  1 
ATOM   10218 N  N   . ASN E 1 225 ? -18.307 22.233  45.161  1.00 113.30 ? 225 ASN E N   1 
ATOM   10219 C  CA  . ASN E 1 225 ? -19.265 22.039  44.079  1.00 101.21 ? 225 ASN E CA  1 
ATOM   10220 C  C   . ASN E 1 225 ? -20.518 22.888  44.267  1.00 97.05  ? 225 ASN E C   1 
ATOM   10221 O  O   . ASN E 1 225 ? -21.365 22.583  45.106  1.00 85.54  ? 225 ASN E O   1 
ATOM   10222 C  CB  . ASN E 1 225 ? -19.641 20.562  43.955  1.00 90.06  ? 225 ASN E CB  1 
ATOM   10223 C  CG  . ASN E 1 225 ? -20.294 20.238  42.627  1.00 92.36  ? 225 ASN E CG  1 
ATOM   10224 O  OD1 . ASN E 1 225 ? -20.621 21.133  41.849  1.00 89.95  ? 225 ASN E OD1 1 
ATOM   10225 N  ND2 . ASN E 1 225 ? -20.488 18.952  42.362  1.00 95.06  ? 225 ASN E ND2 1 
ATOM   10226 N  N   . PHE E 1 226 ? -20.627 23.954  43.482  1.00 98.41  ? 226 PHE E N   1 
ATOM   10227 C  CA  . PHE E 1 226 ? -21.762 24.864  43.580  1.00 88.49  ? 226 PHE E CA  1 
ATOM   10228 C  C   . PHE E 1 226 ? -22.924 24.408  42.703  1.00 74.23  ? 226 PHE E C   1 
ATOM   10229 O  O   . PHE E 1 226 ? -24.077 24.427  43.132  1.00 67.47  ? 226 PHE E O   1 
ATOM   10230 C  CB  . PHE E 1 226 ? -21.348 26.291  43.218  1.00 79.98  ? 226 PHE E CB  1 
ATOM   10231 C  CG  . PHE E 1 226 ? -21.298 27.219  44.396  1.00 87.60  ? 226 PHE E CG  1 
ATOM   10232 C  CD1 . PHE E 1 226 ? -22.246 28.215  44.552  1.00 90.76  ? 226 PHE E CD1 1 
ATOM   10233 C  CD2 . PHE E 1 226 ? -20.304 27.093  45.352  1.00 102.12 ? 226 PHE E CD2 1 
ATOM   10234 C  CE1 . PHE E 1 226 ? -22.202 29.072  45.637  1.00 105.22 ? 226 PHE E CE1 1 
ATOM   10235 C  CE2 . PHE E 1 226 ? -20.255 27.945  46.441  1.00 111.18 ? 226 PHE E CE2 1 
ATOM   10236 C  CZ  . PHE E 1 226 ? -21.205 28.935  46.583  1.00 110.98 ? 226 PHE E CZ  1 
ATOM   10237 N  N   . ARG E 1 227 ? -22.612 23.995  41.480  1.00 69.17  ? 227 ARG E N   1 
ATOM   10238 C  CA  . ARG E 1 227 ? -23.629 23.506  40.559  1.00 62.39  ? 227 ARG E CA  1 
ATOM   10239 C  C   . ARG E 1 227 ? -24.533 22.490  41.248  1.00 65.93  ? 227 ARG E C   1 
ATOM   10240 O  O   . ARG E 1 227 ? -25.748 22.494  41.056  1.00 70.81  ? 227 ARG E O   1 
ATOM   10241 C  CB  . ARG E 1 227 ? -22.978 22.881  39.326  1.00 57.14  ? 227 ARG E CB  1 
ATOM   10242 C  CG  . ARG E 1 227 ? -23.957 22.514  38.224  1.00 73.28  ? 227 ARG E CG  1 
ATOM   10243 C  CD  . ARG E 1 227 ? -23.284 22.534  36.862  1.00 87.00  ? 227 ARG E CD  1 
ATOM   10244 N  NE  . ARG E 1 227 ? -22.098 23.384  36.853  1.00 93.18  ? 227 ARG E NE  1 
ATOM   10245 C  CZ  . ARG E 1 227 ? -21.817 24.265  35.898  1.00 93.94  ? 227 ARG E CZ  1 
ATOM   10246 N  NH1 . ARG E 1 227 ? -22.639 24.415  34.868  1.00 96.82  ? 227 ARG E NH1 1 
ATOM   10247 N  NH2 . ARG E 1 227 ? -20.715 24.997  35.972  1.00 93.05  ? 227 ARG E NH2 1 
ATOM   10248 N  N   . LYS E 1 228 ? -23.931 21.621  42.054  1.00 59.64  ? 228 LYS E N   1 
ATOM   10249 C  CA  . LYS E 1 228 ? -24.680 20.604  42.780  1.00 63.23  ? 228 LYS E CA  1 
ATOM   10250 C  C   . LYS E 1 228 ? -25.475 21.223  43.924  1.00 61.99  ? 228 LYS E C   1 
ATOM   10251 O  O   . LYS E 1 228 ? -26.688 21.041  44.020  1.00 65.08  ? 228 LYS E O   1 
ATOM   10252 C  CB  . LYS E 1 228 ? -23.738 19.524  43.316  1.00 85.47  ? 228 LYS E CB  1 
ATOM   10253 C  CG  . LYS E 1 228 ? -24.350 18.132  43.353  1.00 97.36  ? 228 LYS E CG  1 
ATOM   10254 C  CD  . LYS E 1 228 ? -23.625 17.236  44.343  1.00 101.00 ? 228 LYS E CD  1 
ATOM   10255 C  CE  . LYS E 1 228 ? -22.902 16.103  43.634  1.00 102.59 ? 228 LYS E CE  1 
ATOM   10256 N  NZ  . LYS E 1 228 ? -23.760 14.894  43.501  1.00 100.68 ? 228 LYS E NZ  1 
ATOM   10257 N  N   . THR E 1 229 ? -24.784 21.956  44.791  1.00 55.67  ? 229 THR E N   1 
ATOM   10258 C  CA  . THR E 1 229 ? -25.436 22.616  45.916  1.00 51.74  ? 229 THR E CA  1 
ATOM   10259 C  C   . THR E 1 229 ? -26.651 23.403  45.442  1.00 61.60  ? 229 THR E C   1 
ATOM   10260 O  O   . THR E 1 229 ? -27.769 22.888  45.430  1.00 42.92  ? 229 THR E O   1 
ATOM   10261 C  CB  . THR E 1 229 ? -24.474 23.566  46.649  1.00 59.29  ? 229 THR E CB  1 
ATOM   10262 O  OG1 . THR E 1 229 ? -23.601 22.807  47.496  1.00 69.29  ? 229 THR E OG1 1 
ATOM   10263 C  CG2 . THR E 1 229 ? -25.251 24.560  47.495  1.00 60.31  ? 229 THR E CG2 1 
ATOM   10264 N  N   . ILE E 1 230 ? -26.427 24.652  45.049  1.00 79.01  ? 230 ILE E N   1 
ATOM   10265 C  CA  . ILE E 1 230 ? -27.505 25.492  44.543  1.00 78.01  ? 230 ILE E CA  1 
ATOM   10266 C  C   . ILE E 1 230 ? -28.592 24.646  43.887  1.00 76.62  ? 230 ILE E C   1 
ATOM   10267 O  O   . ILE E 1 230 ? -29.758 24.710  44.274  1.00 91.12  ? 230 ILE E O   1 
ATOM   10268 C  CB  . ILE E 1 230 ? -26.987 26.524  43.526  1.00 65.93  ? 230 ILE E CB  1 
ATOM   10269 C  CG1 . ILE E 1 230 ? -26.837 27.895  44.188  1.00 73.79  ? 230 ILE E CG1 1 
ATOM   10270 C  CG2 . ILE E 1 230 ? -27.920 26.605  42.331  1.00 54.69  ? 230 ILE E CG2 1 
ATOM   10271 C  CD1 . ILE E 1 230 ? -25.466 28.510  44.013  1.00 79.56  ? 230 ILE E CD1 1 
ATOM   10272 N  N   . HIS E 1 231 ? -28.207 23.853  42.893  1.00 57.99  ? 231 HIS E N   1 
ATOM   10273 C  CA  . HIS E 1 231 ? -29.159 22.998  42.196  1.00 65.51  ? 231 HIS E CA  1 
ATOM   10274 C  C   . HIS E 1 231 ? -30.025 22.229  43.188  1.00 70.74  ? 231 HIS E C   1 
ATOM   10275 O  O   . HIS E 1 231 ? -31.251 22.226  43.083  1.00 70.15  ? 231 HIS E O   1 
ATOM   10276 C  CB  . HIS E 1 231 ? -28.438 22.026  41.262  1.00 69.13  ? 231 HIS E CB  1 
ATOM   10277 C  CG  . HIS E 1 231 ? -29.358 21.264  40.359  1.00 87.76  ? 231 HIS E CG  1 
ATOM   10278 N  ND1 . HIS E 1 231 ? -30.156 21.881  39.419  1.00 90.66  ? 231 HIS E ND1 1 
ATOM   10279 C  CD2 . HIS E 1 231 ? -29.610 19.938  40.255  1.00 100.46 ? 231 HIS E CD2 1 
ATOM   10280 C  CE1 . HIS E 1 231 ? -30.858 20.966  38.774  1.00 89.12  ? 231 HIS E CE1 1 
ATOM   10281 N  NE2 . HIS E 1 231 ? -30.545 19.780  39.262  1.00 99.28  ? 231 HIS E NE2 1 
ATOM   10282 N  N   . ARG E 1 232 ? -29.379 21.580  44.151  1.00 70.88  ? 232 ARG E N   1 
ATOM   10283 C  CA  . ARG E 1 232 ? -30.093 20.839  45.182  1.00 64.75  ? 232 ARG E CA  1 
ATOM   10284 C  C   . ARG E 1 232 ? -31.154 21.725  45.820  1.00 63.92  ? 232 ARG E C   1 
ATOM   10285 O  O   . ARG E 1 232 ? -32.322 21.348  45.907  1.00 53.86  ? 232 ARG E O   1 
ATOM   10286 C  CB  . ARG E 1 232 ? -29.121 20.326  46.246  1.00 84.03  ? 232 ARG E CB  1 
ATOM   10287 C  CG  . ARG E 1 232 ? -29.330 18.870  46.626  1.00 99.32  ? 232 ARG E CG  1 
ATOM   10288 C  CD  . ARG E 1 232 ? -28.436 17.950  45.808  1.00 106.74 ? 232 ARG E CD  1 
ATOM   10289 N  NE  . ARG E 1 232 ? -28.448 16.583  46.320  1.00 117.58 ? 232 ARG E NE  1 
ATOM   10290 C  CZ  . ARG E 1 232 ? -29.118 15.581  45.760  1.00 126.42 ? 232 ARG E CZ  1 
ATOM   10291 N  NH1 . ARG E 1 232 ? -29.837 15.791  44.666  1.00 132.68 ? 232 ARG E NH1 1 
ATOM   10292 N  NH2 . ARG E 1 232 ? -29.071 14.369  46.295  1.00 122.73 ? 232 ARG E NH2 1 
ATOM   10293 N  N   . ILE E 1 233 ? -30.740 22.909  46.260  1.00 58.95  ? 233 ILE E N   1 
ATOM   10294 C  CA  . ILE E 1 233 ? -31.673 23.892  46.816  1.00 52.16  ? 233 ILE E CA  1 
ATOM   10295 C  C   . ILE E 1 233 ? -32.904 24.064  45.917  1.00 59.65  ? 233 ILE E C   1 
ATOM   10296 O  O   . ILE E 1 233 ? -34.027 23.827  46.356  1.00 70.83  ? 233 ILE E O   1 
ATOM   10297 C  CB  . ILE E 1 233 ? -30.991 25.248  46.952  1.00 47.59  ? 233 ILE E CB  1 
ATOM   10298 C  CG1 . ILE E 1 233 ? -29.929 25.148  48.035  1.00 52.17  ? 233 ILE E CG1 1 
ATOM   10299 C  CG2 . ILE E 1 233 ? -32.002 26.358  47.284  1.00 40.13  ? 233 ILE E CG2 1 
ATOM   10300 C  CD1 . ILE E 1 233 ? -29.137 26.373  48.167  1.00 61.58  ? 233 ILE E CD1 1 
ATOM   10301 N  N   . LEU E 1 234 ? -32.678 24.426  44.660  1.00 59.93  ? 234 LEU E N   1 
ATOM   10302 C  CA  . LEU E 1 234 ? -33.765 24.607  43.706  1.00 60.92  ? 234 LEU E CA  1 
ATOM   10303 C  C   . LEU E 1 234 ? -34.658 23.371  43.561  1.00 66.29  ? 234 LEU E C   1 
ATOM   10304 O  O   . LEU E 1 234 ? -35.862 23.497  43.341  1.00 65.14  ? 234 LEU E O   1 
ATOM   10305 C  CB  . LEU E 1 234 ? -33.213 25.019  42.340  1.00 58.68  ? 234 LEU E CB  1 
ATOM   10306 C  CG  . LEU E 1 234 ? -32.805 26.486  42.192  1.00 51.50  ? 234 LEU E CG  1 
ATOM   10307 C  CD1 . LEU E 1 234 ? -32.850 27.196  43.535  1.00 41.56  ? 234 LEU E CD1 1 
ATOM   10308 C  CD2 . LEU E 1 234 ? -31.424 26.600  41.566  1.00 47.36  ? 234 LEU E CD2 1 
ATOM   10309 N  N   . ASN E 1 235 ? -34.072 22.182  43.677  1.00 62.72  ? 235 ASN E N   1 
ATOM   10310 C  CA  . ASN E 1 235 ? -34.829 20.951  43.504  1.00 67.85  ? 235 ASN E CA  1 
ATOM   10311 C  C   . ASN E 1 235 ? -35.256 20.383  44.846  1.00 69.06  ? 235 ASN E C   1 
ATOM   10312 O  O   . ASN E 1 235 ? -35.743 19.256  44.935  1.00 75.72  ? 235 ASN E O   1 
ATOM   10313 C  CB  . ASN E 1 235 ? -34.011 19.920  42.725  1.00 84.22  ? 235 ASN E CB  1 
ATOM   10314 C  CG  . ASN E 1 235 ? -33.696 20.376  41.314  1.00 93.24  ? 235 ASN E CG  1 
ATOM   10315 O  OD1 . ASN E 1 235 ? -32.735 19.912  40.700  1.00 121.11 ? 235 ASN E OD1 1 
ATOM   10316 N  ND2 . ASN E 1 235 ? -34.505 21.290  40.793  1.00 56.60  ? 235 ASN E ND2 1 
ATOM   10317 N  N   . VAL E 1 236 ? -35.056 21.191  45.883  1.00 50.60  ? 236 VAL E N   1 
ATOM   10318 C  CA  . VAL E 1 236 ? -35.355 20.795  47.246  1.00 67.51  ? 236 VAL E CA  1 
ATOM   10319 C  C   . VAL E 1 236 ? -34.916 19.361  47.476  1.00 69.03  ? 236 VAL E C   1 
ATOM   10320 O  O   . VAL E 1 236 ? -35.583 18.610  48.187  1.00 61.32  ? 236 VAL E O   1 
ATOM   10321 C  CB  . VAL E 1 236 ? -36.857 20.921  47.555  1.00 72.54  ? 236 VAL E CB  1 
ATOM   10322 C  CG1 . VAL E 1 236 ? -37.132 20.551  49.003  1.00 68.58  ? 236 VAL E CG1 1 
ATOM   10323 C  CG2 . VAL E 1 236 ? -37.343 22.331  47.257  1.00 70.36  ? 236 VAL E CG2 1 
ATOM   10324 N  N   . GLN E 1 237 ? -33.796 18.973  46.872  1.00 71.54  ? 237 GLN E N   1 
ATOM   10325 C  CA  . GLN E 1 237 ? -33.332 17.596  47.037  1.00 65.63  ? 237 GLN E CA  1 
ATOM   10326 C  C   . GLN E 1 237 ? -32.438 17.540  48.259  1.00 59.60  ? 237 GLN E C   1 
ATOM   10327 O  O   . GLN E 1 237 ? -31.268 17.937  48.214  1.00 73.61  ? 237 GLN E O   1 
ATOM   10328 C  CB  . GLN E 1 237 ? -32.607 17.096  45.784  1.00 85.33  ? 237 GLN E CB  1 
ATOM   10329 C  CG  . GLN E 1 237 ? -33.564 16.630  44.666  1.00 101.72 ? 237 GLN E CG  1 
ATOM   10330 C  CD  . GLN E 1 237 ? -32.954 16.724  43.270  1.00 112.57 ? 237 GLN E CD  1 
ATOM   10331 O  OE1 . GLN E 1 237 ? -33.677 16.686  42.267  1.00 114.66 ? 237 GLN E OE1 1 
ATOM   10332 N  NE2 . GLN E 1 237 ? -31.623 16.855  43.199  1.00 115.96 ? 237 GLN E NE2 1 
ATOM   10333 N  N   . TYR E 1 238 ? -33.006 17.096  49.370  1.00 44.95  ? 238 TYR E N   1 
ATOM   10334 C  CA  . TYR E 1 238 ? -32.223 16.946  50.588  1.00 48.41  ? 238 TYR E CA  1 
ATOM   10335 C  C   . TYR E 1 238 ? -32.536 15.578  51.159  1.00 51.98  ? 238 TYR E C   1 
ATOM   10336 O  O   . TYR E 1 238 ? -33.531 14.938  50.775  1.00 53.86  ? 238 TYR E O   1 
ATOM   10337 C  CB  . TYR E 1 238 ? -32.594 18.014  51.614  1.00 55.59  ? 238 TYR E CB  1 
ATOM   10338 C  CG  . TYR E 1 238 ? -33.913 17.761  52.326  1.00 48.29  ? 238 TYR E CG  1 
ATOM   10339 C  CD1 . TYR E 1 238 ? -33.965 17.046  53.521  1.00 45.92  ? 238 TYR E CD1 1 
ATOM   10340 C  CD2 . TYR E 1 238 ? -35.103 18.243  51.807  1.00 45.83  ? 238 TYR E CD2 1 
ATOM   10341 C  CE1 . TYR E 1 238 ? -35.181 16.808  54.172  1.00 47.45  ? 238 TYR E CE1 1 
ATOM   10342 C  CE2 . TYR E 1 238 ? -36.316 18.021  52.443  1.00 41.51  ? 238 TYR E CE2 1 
ATOM   10343 C  CZ  . TYR E 1 238 ? -36.354 17.298  53.619  1.00 50.73  ? 238 TYR E CZ  1 
ATOM   10344 O  OH  . TYR E 1 238 ? -37.570 17.083  54.238  1.00 62.78  ? 238 TYR E OH  1 
ATOM   10345 N  N   . ALA E 1 239 ? -31.690 15.125  52.079  1.00 52.40  ? 239 ALA E N   1 
ATOM   10346 C  CA  . ALA E 1 239 ? -31.915 13.845  52.750  1.00 60.77  ? 239 ALA E CA  1 
ATOM   10347 C  C   . ALA E 1 239 ? -31.275 13.848  54.115  1.00 61.62  ? 239 ALA E C   1 
ATOM   10348 O  O   . ALA E 1 239 ? -30.085 14.196  54.253  1.00 58.35  ? 239 ALA E O   1 
ATOM   10349 C  CB  . ALA E 1 239 ? -31.367 12.698  51.919  1.00 56.90  ? 239 ALA E CB  1 
ATOM   10350 N  N   . ILE E 1 240 ? -32.066 13.481  55.125  1.00 65.02  ? 240 ILE E N   1 
ATOM   10351 C  CA  . ILE E 1 240 ? -31.504 13.277  56.452  1.00 59.96  ? 240 ILE E CA  1 
ATOM   10352 C  C   . ILE E 1 240 ? -30.972 11.843  56.447  1.00 67.04  ? 240 ILE E C   1 
ATOM   10353 O  O   . ILE E 1 240 ? -31.693 10.923  56.036  1.00 80.62  ? 240 ILE E O   1 
ATOM   10354 C  CB  . ILE E 1 240 ? -32.523 13.548  57.652  1.00 65.30  ? 240 ILE E CB  1 
ATOM   10355 C  CG1 . ILE E 1 240 ? -33.097 12.251  58.214  1.00 83.23  ? 240 ILE E CG1 1 
ATOM   10356 C  CG2 . ILE E 1 240 ? -33.672 14.524  57.304  1.00 50.34  ? 240 ILE E CG2 1 
ATOM   10357 C  CD1 . ILE E 1 240 ? -33.537 12.389  59.661  1.00 88.86  ? 240 ILE E CD1 1 
ATOM   10358 N  N   . PRO E 1 241 ? -29.696 11.653  56.850  1.00 67.39  ? 241 PRO E N   1 
ATOM   10359 C  CA  . PRO E 1 241 ? -29.037 10.338  56.978  1.00 63.72  ? 241 PRO E CA  1 
ATOM   10360 C  C   . PRO E 1 241 ? -29.604 9.441   58.068  1.00 62.99  ? 241 PRO E C   1 
ATOM   10361 O  O   . PRO E 1 241 ? -30.447 9.863   58.859  1.00 71.39  ? 241 PRO E O   1 
ATOM   10362 C  CB  . PRO E 1 241 ? -27.586 10.691  57.268  1.00 66.08  ? 241 PRO E CB  1 
ATOM   10363 C  CG  . PRO E 1 241 ? -27.621 12.080  57.763  1.00 75.61  ? 241 PRO E CG  1 
ATOM   10364 C  CD  . PRO E 1 241 ? -28.742 12.754  57.043  1.00 74.64  ? 241 PRO E CD  1 
ATOM   10365 N  N   . ASP E 1 242 ? -29.119 8.206   58.120  1.00 65.32  ? 242 ASP E N   1 
ATOM   10366 C  CA  . ASP E 1 242 ? -29.847 7.120   58.787  1.00 66.30  ? 242 ASP E CA  1 
ATOM   10367 C  C   . ASP E 1 242 ? -29.370 6.879   60.208  1.00 71.73  ? 242 ASP E C   1 
ATOM   10368 O  O   . ASP E 1 242 ? -30.121 6.341   61.041  1.00 68.51  ? 242 ASP E O   1 
ATOM   10369 C  CB  . ASP E 1 242 ? -29.715 5.855   57.957  1.00 79.81  ? 242 ASP E CB  1 
ATOM   10370 C  CG  . ASP E 1 242 ? -29.669 6.159   56.461  1.00 93.51  ? 242 ASP E CG  1 
ATOM   10371 O  OD1 . ASP E 1 242 ? -30.397 5.472   55.700  1.00 92.06  ? 242 ASP E OD1 1 
ATOM   10372 O  OD2 . ASP E 1 242 ? -28.911 7.090   56.046  1.00 96.35  ? 242 ASP E OD2 1 
ATOM   10373 N  N   . TYR E 1 243 ? -28.128 7.273   60.502  1.00 63.53  ? 243 TYR E N   1 
ATOM   10374 C  CA  . TYR E 1 243 ? -27.691 7.248   61.888  1.00 52.10  ? 243 TYR E CA  1 
ATOM   10375 C  C   . TYR E 1 243 ? -28.433 8.323   62.644  1.00 50.63  ? 243 TYR E C   1 
ATOM   10376 O  O   . TYR E 1 243 ? -28.387 8.361   63.875  1.00 59.63  ? 243 TYR E O   1 
ATOM   10377 C  CB  . TYR E 1 243 ? -26.185 7.443   62.021  1.00 39.99  ? 243 TYR E CB  1 
ATOM   10378 C  CG  . TYR E 1 243 ? -25.583 8.670   61.376  1.00 44.69  ? 243 TYR E CG  1 
ATOM   10379 C  CD1 . TYR E 1 243 ? -25.371 9.842   62.116  1.00 40.46  ? 243 TYR E CD1 1 
ATOM   10380 C  CD2 . TYR E 1 243 ? -25.173 8.656   60.049  1.00 41.09  ? 243 TYR E CD2 1 
ATOM   10381 C  CE1 . TYR E 1 243 ? -24.762 10.964  61.550  1.00 32.56  ? 243 TYR E CE1 1 
ATOM   10382 C  CE2 . TYR E 1 243 ? -24.570 9.796   59.461  1.00 36.75  ? 243 TYR E CE2 1 
ATOM   10383 C  CZ  . TYR E 1 243 ? -24.367 10.937  60.224  1.00 57.11  ? 243 TYR E CZ  1 
ATOM   10384 O  OH  . TYR E 1 243 ? -23.772 12.059  59.662  1.00 73.37  ? 243 TYR E OH  1 
ATOM   10385 N  N   . VAL E 1 244 ? -29.122 9.184   61.888  1.00 47.29  ? 244 VAL E N   1 
ATOM   10386 C  CA  . VAL E 1 244 ? -29.934 10.274  62.439  1.00 57.04  ? 244 VAL E CA  1 
ATOM   10387 C  C   . VAL E 1 244 ? -31.367 9.818   62.715  1.00 53.45  ? 244 VAL E C   1 
ATOM   10388 O  O   . VAL E 1 244 ? -32.207 9.811   61.824  1.00 64.88  ? 244 VAL E O   1 
ATOM   10389 C  CB  . VAL E 1 244 ? -29.957 11.514  61.497  1.00 49.41  ? 244 VAL E CB  1 
ATOM   10390 C  CG1 . VAL E 1 244 ? -30.844 12.643  62.071  1.00 41.16  ? 244 VAL E CG1 1 
ATOM   10391 C  CG2 . VAL E 1 244 ? -28.552 12.010  61.231  1.00 27.98  ? 244 VAL E CG2 1 
ATOM   10392 N  N   . HIS E 1 245 ? -31.641 9.435   63.955  1.00 55.43  ? 245 HIS E N   1 
ATOM   10393 C  CA  . HIS E 1 245 ? -32.982 8.999   64.324  1.00 63.22  ? 245 HIS E CA  1 
ATOM   10394 C  C   . HIS E 1 245 ? -33.835 10.198  64.712  1.00 56.67  ? 245 HIS E C   1 
ATOM   10395 O  O   . HIS E 1 245 ? -33.554 10.897  65.689  1.00 55.89  ? 245 HIS E O   1 
ATOM   10396 C  CB  . HIS E 1 245 ? -32.951 8.002   65.485  1.00 78.15  ? 245 HIS E CB  1 
ATOM   10397 C  CG  . HIS E 1 245 ? -32.091 6.797   65.244  1.00 90.70  ? 245 HIS E CG  1 
ATOM   10398 N  ND1 . HIS E 1 245 ? -32.187 6.027   64.104  1.00 86.57  ? 245 HIS E ND1 1 
ATOM   10399 C  CD2 . HIS E 1 245 ? -31.139 6.215   66.018  1.00 96.78  ? 245 HIS E CD2 1 
ATOM   10400 C  CE1 . HIS E 1 245 ? -31.315 5.035   64.178  1.00 93.26  ? 245 HIS E CE1 1 
ATOM   10401 N  NE2 . HIS E 1 245 ? -30.672 5.124   65.329  1.00 96.43  ? 245 HIS E NE2 1 
ATOM   10402 N  N   . ILE E 1 246 ? -34.902 10.405  63.957  1.00 55.78  ? 246 ILE E N   1 
ATOM   10403 C  CA  . ILE E 1 246 ? -35.767 11.550  64.156  1.00 58.39  ? 246 ILE E CA  1 
ATOM   10404 C  C   . ILE E 1 246 ? -37.240 11.140  64.350  1.00 56.08  ? 246 ILE E C   1 
ATOM   10405 O  O   . ILE E 1 246 ? -37.741 10.276  63.612  1.00 47.08  ? 246 ILE E O   1 
ATOM   10406 C  CB  . ILE E 1 246 ? -35.572 12.489  62.970  1.00 50.35  ? 246 ILE E CB  1 
ATOM   10407 C  CG1 . ILE E 1 246 ? -34.298 13.263  63.209  1.00 53.14  ? 246 ILE E CG1 1 
ATOM   10408 C  CG2 . ILE E 1 246 ? -36.736 13.441  62.793  1.00 67.80  ? 246 ILE E CG2 1 
ATOM   10409 C  CD1 . ILE E 1 246 ? -34.345 14.038  64.468  1.00 60.61  ? 246 ILE E CD1 1 
ATOM   10410 N  N   . SER E 1 247 ? -37.922 11.724  65.346  1.00 40.15  ? 247 SER E N   1 
ATOM   10411 C  CA  . SER E 1 247 ? -39.351 11.467  65.495  1.00 42.99  ? 247 SER E CA  1 
ATOM   10412 C  C   . SER E 1 247 ? -40.075 11.813  64.205  1.00 54.93  ? 247 SER E C   1 
ATOM   10413 O  O   . SER E 1 247 ? -39.691 12.744  63.489  1.00 51.48  ? 247 SER E O   1 
ATOM   10414 C  CB  . SER E 1 247 ? -39.947 12.285  66.627  1.00 58.91  ? 247 SER E CB  1 
ATOM   10415 O  OG  . SER E 1 247 ? -40.012 13.654  66.282  1.00 64.31  ? 247 SER E OG  1 
ATOM   10416 N  N   . PRO E 1 248 ? -41.127 11.056  63.882  1.00 61.47  ? 248 PRO E N   1 
ATOM   10417 C  CA  . PRO E 1 248 ? -41.779 11.393  62.614  1.00 58.47  ? 248 PRO E CA  1 
ATOM   10418 C  C   . PRO E 1 248 ? -42.428 12.767  62.642  1.00 48.08  ? 248 PRO E C   1 
ATOM   10419 O  O   . PRO E 1 248 ? -42.515 13.386  61.588  1.00 43.96  ? 248 PRO E O   1 
ATOM   10420 C  CB  . PRO E 1 248 ? -42.818 10.276  62.432  1.00 52.28  ? 248 PRO E CB  1 
ATOM   10421 C  CG  . PRO E 1 248 ? -42.983 9.674   63.798  1.00 57.36  ? 248 PRO E CG  1 
ATOM   10422 C  CD  . PRO E 1 248 ? -41.687 9.848   64.513  1.00 52.03  ? 248 PRO E CD  1 
ATOM   10423 N  N   . GLU E 1 249 ? -42.869 13.252  63.801  1.00 43.54  ? 249 GLU E N   1 
ATOM   10424 C  CA  . GLU E 1 249 ? -43.437 14.604  63.849  1.00 46.85  ? 249 GLU E CA  1 
ATOM   10425 C  C   . GLU E 1 249 ? -42.349 15.569  63.401  1.00 50.95  ? 249 GLU E C   1 
ATOM   10426 O  O   . GLU E 1 249 ? -42.573 16.453  62.577  1.00 47.12  ? 249 GLU E O   1 
ATOM   10427 C  CB  . GLU E 1 249 ? -43.921 14.981  65.250  1.00 44.53  ? 249 GLU E CB  1 
ATOM   10428 C  CG  . GLU E 1 249 ? -44.810 13.979  65.919  1.00 58.14  ? 249 GLU E CG  1 
ATOM   10429 C  CD  . GLU E 1 249 ? -44.039 12.779  66.435  1.00 70.28  ? 249 GLU E CD  1 
ATOM   10430 O  OE1 . GLU E 1 249 ? -42.837 12.919  66.750  1.00 72.28  ? 249 GLU E OE1 1 
ATOM   10431 O  OE2 . GLU E 1 249 ? -44.638 11.689  66.520  1.00 86.64  ? 249 GLU E OE2 1 
ATOM   10432 N  N   . CYS E 1 250 ? -41.160 15.375  63.945  1.00 39.27  ? 250 CYS E N   1 
ATOM   10433 C  CA  . CYS E 1 250 ? -40.025 16.201  63.577  1.00 44.02  ? 250 CYS E CA  1 
ATOM   10434 C  C   . CYS E 1 250 ? -39.779 16.137  62.078  1.00 43.15  ? 250 CYS E C   1 
ATOM   10435 O  O   . CYS E 1 250 ? -39.531 17.142  61.425  1.00 38.47  ? 250 CYS E O   1 
ATOM   10436 C  CB  . CYS E 1 250 ? -38.785 15.735  64.337  1.00 51.93  ? 250 CYS E CB  1 
ATOM   10437 S  SG  . CYS E 1 250 ? -37.306 16.674  64.025  1.00 61.11  ? 250 CYS E SG  1 
ATOM   10438 N  N   . ARG E 1 251 ? -39.841 14.926  61.536  1.00 56.74  ? 251 ARG E N   1 
ATOM   10439 C  CA  . ARG E 1 251 ? -39.619 14.715  60.112  1.00 49.14  ? 251 ARG E CA  1 
ATOM   10440 C  C   . ARG E 1 251 ? -40.691 15.415  59.286  1.00 54.52  ? 251 ARG E C   1 
ATOM   10441 O  O   . ARG E 1 251 ? -40.433 15.867  58.171  1.00 46.94  ? 251 ARG E O   1 
ATOM   10442 C  CB  . ARG E 1 251 ? -39.599 13.220  59.790  1.00 44.49  ? 251 ARG E CB  1 
ATOM   10443 C  CG  . ARG E 1 251 ? -38.775 12.860  58.567  1.00 48.86  ? 251 ARG E CG  1 
ATOM   10444 C  CD  . ARG E 1 251 ? -38.785 11.362  58.318  1.00 63.86  ? 251 ARG E CD  1 
ATOM   10445 N  NE  . ARG E 1 251 ? -37.740 10.676  59.072  1.00 63.13  ? 251 ARG E NE  1 
ATOM   10446 C  CZ  . ARG E 1 251 ? -36.498 10.501  58.634  1.00 63.99  ? 251 ARG E CZ  1 
ATOM   10447 N  NH1 . ARG E 1 251 ? -36.141 10.961  57.444  1.00 56.53  ? 251 ARG E NH1 1 
ATOM   10448 N  NH2 . ARG E 1 251 ? -35.611 9.865   59.388  1.00 61.78  ? 251 ARG E NH2 1 
ATOM   10449 N  N   . HIS E 1 252 ? -41.894 15.503  59.843  1.00 52.79  ? 252 HIS E N   1 
ATOM   10450 C  CA  . HIS E 1 252 ? -43.000 16.155  59.161  1.00 54.30  ? 252 HIS E CA  1 
ATOM   10451 C  C   . HIS E 1 252 ? -42.759 17.657  59.078  1.00 56.51  ? 252 HIS E C   1 
ATOM   10452 O  O   . HIS E 1 252 ? -42.763 18.231  58.004  1.00 50.52  ? 252 HIS E O   1 
ATOM   10453 C  CB  . HIS E 1 252 ? -44.321 15.889  59.865  1.00 56.37  ? 252 HIS E CB  1 
ATOM   10454 C  CG  . HIS E 1 252 ? -45.492 16.491  59.155  1.00 60.66  ? 252 HIS E CG  1 
ATOM   10455 N  ND1 . HIS E 1 252 ? -46.194 17.560  59.658  1.00 46.82  ? 252 HIS E ND1 1 
ATOM   10456 C  CD2 . HIS E 1 252 ? -46.058 16.194  57.953  1.00 58.94  ? 252 HIS E CD2 1 
ATOM   10457 C  CE1 . HIS E 1 252 ? -47.157 17.889  58.810  1.00 47.90  ? 252 HIS E CE1 1 
ATOM   10458 N  NE2 . HIS E 1 252 ? -47.094 17.077  57.770  1.00 56.71  ? 252 HIS E NE2 1 
ATOM   10459 N  N   . LEU E 1 253 ? -42.508 18.275  60.227  1.00 48.49  ? 253 LEU E N   1 
ATOM   10460 C  CA  . LEU E 1 253 ? -42.203 19.699  60.289  1.00 44.44  ? 253 LEU E CA  1 
ATOM   10461 C  C   . LEU E 1 253 ? -41.157 20.111  59.262  1.00 45.56  ? 253 LEU E C   1 
ATOM   10462 O  O   . LEU E 1 253 ? -41.359 21.074  58.497  1.00 50.51  ? 253 LEU E O   1 
ATOM   10463 C  CB  . LEU E 1 253 ? -41.747 20.101  61.688  1.00 38.57  ? 253 LEU E CB  1 
ATOM   10464 C  CG  . LEU E 1 253 ? -41.304 21.562  61.753  1.00 37.37  ? 253 LEU E CG  1 
ATOM   10465 C  CD1 . LEU E 1 253 ? -42.405 22.495  61.235  1.00 32.24  ? 253 LEU E CD1 1 
ATOM   10466 C  CD2 . LEU E 1 253 ? -40.963 21.916  63.165  1.00 37.44  ? 253 LEU E CD2 1 
ATOM   10467 N  N   . ILE E 1 254 ? -40.042 19.388  59.230  1.00 45.83  ? 254 ILE E N   1 
ATOM   10468 C  CA  . ILE E 1 254 ? -38.974 19.721  58.292  1.00 47.61  ? 254 ILE E CA  1 
ATOM   10469 C  C   . ILE E 1 254 ? -39.506 19.686  56.859  1.00 52.49  ? 254 ILE E C   1 
ATOM   10470 O  O   . ILE E 1 254 ? -39.189 20.582  56.047  1.00 53.90  ? 254 ILE E O   1 
ATOM   10471 C  CB  . ILE E 1 254 ? -37.772 18.787  58.425  1.00 45.06  ? 254 ILE E CB  1 
ATOM   10472 C  CG1 . ILE E 1 254 ? -37.086 18.988  59.764  1.00 44.75  ? 254 ILE E CG1 1 
ATOM   10473 C  CG2 . ILE E 1 254 ? -36.780 19.035  57.305  1.00 45.58  ? 254 ILE E CG2 1 
ATOM   10474 C  CD1 . ILE E 1 254 ? -35.963 17.979  60.015  1.00 35.43  ? 254 ILE E CD1 1 
ATOM   10475 N  N   . SER E 1 255 ? -40.330 18.677  56.544  1.00 41.99  ? 255 SER E N   1 
ATOM   10476 C  CA  . SER E 1 255 ? -40.804 18.534  55.172  1.00 41.61  ? 255 SER E CA  1 
ATOM   10477 C  C   . SER E 1 255 ? -41.763 19.662  54.768  1.00 49.65  ? 255 SER E C   1 
ATOM   10478 O  O   . SER E 1 255 ? -41.939 19.954  53.574  1.00 48.63  ? 255 SER E O   1 
ATOM   10479 C  CB  . SER E 1 255 ? -41.479 17.172  54.963  1.00 37.30  ? 255 SER E CB  1 
ATOM   10480 O  OG  . SER E 1 255 ? -42.737 17.128  55.609  1.00 44.51  ? 255 SER E OG  1 
ATOM   10481 N  N   . ARG E 1 256 ? -42.403 20.264  55.766  1.00 49.15  ? 256 ARG E N   1 
ATOM   10482 C  CA  . ARG E 1 256 ? -43.354 21.336  55.539  1.00 39.32  ? 256 ARG E CA  1 
ATOM   10483 C  C   . ARG E 1 256 ? -42.616 22.663  55.370  1.00 47.06  ? 256 ARG E C   1 
ATOM   10484 O  O   . ARG E 1 256 ? -43.136 23.606  54.806  1.00 43.55  ? 256 ARG E O   1 
ATOM   10485 C  CB  . ARG E 1 256 ? -44.307 21.432  56.727  1.00 41.91  ? 256 ARG E CB  1 
ATOM   10486 C  CG  . ARG E 1 256 ? -45.333 20.311  56.785  1.00 44.48  ? 256 ARG E CG  1 
ATOM   10487 C  CD  . ARG E 1 256 ? -46.410 20.494  55.735  1.00 43.93  ? 256 ARG E CD  1 
ATOM   10488 N  NE  . ARG E 1 256 ? -47.284 21.615  56.048  1.00 65.43  ? 256 ARG E NE  1 
ATOM   10489 C  CZ  . ARG E 1 256 ? -47.442 22.697  55.283  1.00 65.38  ? 256 ARG E CZ  1 
ATOM   10490 N  NH1 . ARG E 1 256 ? -46.790 22.808  54.124  1.00 50.23  ? 256 ARG E NH1 1 
ATOM   10491 N  NH2 . ARG E 1 256 ? -48.267 23.664  55.682  1.00 60.87  ? 256 ARG E NH2 1 
ATOM   10492 N  N   . ILE E 1 257 ? -41.394 22.748  55.881  1.00 52.38  ? 257 ILE E N   1 
ATOM   10493 C  CA  . ILE E 1 257 ? -40.594 23.961  55.716  1.00 45.66  ? 257 ILE E CA  1 
ATOM   10494 C  C   . ILE E 1 257 ? -39.818 23.947  54.396  1.00 48.64  ? 257 ILE E C   1 
ATOM   10495 O  O   . ILE E 1 257 ? -39.718 24.967  53.725  1.00 52.48  ? 257 ILE E O   1 
ATOM   10496 C  CB  . ILE E 1 257 ? -39.603 24.121  56.840  1.00 47.19  ? 257 ILE E CB  1 
ATOM   10497 C  CG1 . ILE E 1 257 ? -40.326 24.428  58.150  1.00 46.06  ? 257 ILE E CG1 1 
ATOM   10498 C  CG2 . ILE E 1 257 ? -38.607 25.188  56.502  1.00 39.25  ? 257 ILE E CG2 1 
ATOM   10499 C  CD1 . ILE E 1 257 ? -39.412 24.350  59.377  1.00 39.45  ? 257 ILE E CD1 1 
ATOM   10500 N  N   . PHE E 1 258 ? -39.292 22.787  54.015  1.00 37.85  ? 258 PHE E N   1 
ATOM   10501 C  CA  . PHE E 1 258 ? -38.552 22.666  52.758  1.00 40.55  ? 258 PHE E CA  1 
ATOM   10502 C  C   . PHE E 1 258 ? -39.488 22.419  51.570  1.00 55.97  ? 258 PHE E C   1 
ATOM   10503 O  O   . PHE E 1 258 ? -39.532 21.323  50.955  1.00 46.73  ? 258 PHE E O   1 
ATOM   10504 C  CB  . PHE E 1 258 ? -37.460 21.593  52.859  1.00 48.11  ? 258 PHE E CB  1 
ATOM   10505 C  CG  . PHE E 1 258 ? -36.320 21.988  53.757  1.00 46.61  ? 258 PHE E CG  1 
ATOM   10506 C  CD1 . PHE E 1 258 ? -36.006 23.334  53.941  1.00 45.47  ? 258 PHE E CD1 1 
ATOM   10507 C  CD2 . PHE E 1 258 ? -35.585 21.035  54.436  1.00 44.71  ? 258 PHE E CD2 1 
ATOM   10508 C  CE1 . PHE E 1 258 ? -34.972 23.712  54.778  1.00 51.99  ? 258 PHE E CE1 1 
ATOM   10509 C  CE2 . PHE E 1 258 ? -34.539 21.406  55.249  1.00 41.57  ? 258 PHE E CE2 1 
ATOM   10510 C  CZ  . PHE E 1 258 ? -34.240 22.759  55.431  1.00 45.02  ? 258 PHE E CZ  1 
ATOM   10511 N  N   . VAL E 1 259 ? -40.262 23.458  51.273  1.00 54.06  ? 259 VAL E N   1 
ATOM   10512 C  CA  . VAL E 1 259 ? -41.149 23.471  50.119  1.00 51.05  ? 259 VAL E CA  1 
ATOM   10513 C  C   . VAL E 1 259 ? -40.752 24.678  49.266  1.00 49.80  ? 259 VAL E C   1 
ATOM   10514 O  O   . VAL E 1 259 ? -40.662 25.814  49.756  1.00 41.62  ? 259 VAL E O   1 
ATOM   10515 C  CB  . VAL E 1 259 ? -42.615 23.598  50.562  1.00 58.52  ? 259 VAL E CB  1 
ATOM   10516 C  CG1 . VAL E 1 259 ? -43.510 23.728  49.358  1.00 66.16  ? 259 VAL E CG1 1 
ATOM   10517 C  CG2 . VAL E 1 259 ? -43.035 22.385  51.405  1.00 69.09  ? 259 VAL E CG2 1 
ATOM   10518 N  N   . ALA E 1 260 ? -40.488 24.461  47.989  1.00 60.91  ? 260 ALA E N   1 
ATOM   10519 C  CA  . ALA E 1 260 ? -39.992 25.562  47.172  1.00 59.47  ? 260 ALA E CA  1 
ATOM   10520 C  C   . ALA E 1 260 ? -41.026 26.674  46.901  1.00 62.32  ? 260 ALA E C   1 
ATOM   10521 O  O   . ALA E 1 260 ? -40.667 27.837  46.758  1.00 64.99  ? 260 ALA E O   1 
ATOM   10522 C  CB  . ALA E 1 260 ? -39.426 25.026  45.881  1.00 41.66  ? 260 ALA E CB  1 
ATOM   10523 N  N   . ASP E 1 261 ? -42.303 26.313  46.827  1.00 57.93  ? 261 ASP E N   1 
ATOM   10524 C  CA  . ASP E 1 261 ? -43.352 27.281  46.532  1.00 65.32  ? 261 ASP E CA  1 
ATOM   10525 C  C   . ASP E 1 261 ? -43.687 28.080  47.770  1.00 62.01  ? 261 ASP E C   1 
ATOM   10526 O  O   . ASP E 1 261 ? -44.361 27.581  48.667  1.00 51.64  ? 261 ASP E O   1 
ATOM   10527 C  CB  . ASP E 1 261 ? -44.621 26.562  46.073  1.00 74.92  ? 261 ASP E CB  1 
ATOM   10528 C  CG  . ASP E 1 261 ? -45.668 27.513  45.515  1.00 72.20  ? 261 ASP E CG  1 
ATOM   10529 O  OD1 . ASP E 1 261 ? -45.596 28.736  45.786  1.00 51.49  ? 261 ASP E OD1 1 
ATOM   10530 O  OD2 . ASP E 1 261 ? -46.571 27.025  44.800  1.00 84.40  ? 261 ASP E OD2 1 
ATOM   10531 N  N   . PRO E 1 262 ? -43.265 29.346  47.806  1.00 62.20  ? 262 PRO E N   1 
ATOM   10532 C  CA  . PRO E 1 262 ? -43.428 30.096  49.052  1.00 69.13  ? 262 PRO E CA  1 
ATOM   10533 C  C   . PRO E 1 262 ? -44.893 30.041  49.486  1.00 68.78  ? 262 PRO E C   1 
ATOM   10534 O  O   . PRO E 1 262 ? -45.194 30.059  50.693  1.00 73.93  ? 262 PRO E O   1 
ATOM   10535 C  CB  . PRO E 1 262 ? -43.022 31.532  48.666  1.00 62.08  ? 262 PRO E CB  1 
ATOM   10536 C  CG  . PRO E 1 262 ? -42.326 31.413  47.359  1.00 61.22  ? 262 PRO E CG  1 
ATOM   10537 C  CD  . PRO E 1 262 ? -42.917 30.214  46.674  1.00 59.32  ? 262 PRO E CD  1 
ATOM   10538 N  N   . ALA E 1 263 ? -45.791 29.967  48.503  1.00 63.92  ? 263 ALA E N   1 
ATOM   10539 C  CA  . ALA E 1 263 ? -47.222 29.919  48.777  1.00 63.34  ? 263 ALA E CA  1 
ATOM   10540 C  C   . ALA E 1 263 ? -47.563 28.703  49.633  1.00 63.00  ? 263 ALA E C   1 
ATOM   10541 O  O   . ALA E 1 263 ? -48.489 28.728  50.443  1.00 70.54  ? 263 ALA E O   1 
ATOM   10542 C  CB  . ALA E 1 263 ? -48.029 29.902  47.466  1.00 51.59  ? 263 ALA E CB  1 
ATOM   10543 N  N   . LYS E 1 264 ? -46.818 27.627  49.467  1.00 37.25  ? 264 LYS E N   1 
ATOM   10544 C  CA  . LYS E 1 264 ? -47.205 26.399  50.127  1.00 41.54  ? 264 LYS E CA  1 
ATOM   10545 C  C   . LYS E 1 264 ? -46.365 26.050  51.339  1.00 46.53  ? 264 LYS E C   1 
ATOM   10546 O  O   . LYS E 1 264 ? -46.660 25.099  52.047  1.00 45.08  ? 264 LYS E O   1 
ATOM   10547 C  CB  . LYS E 1 264 ? -47.216 25.262  49.126  1.00 51.92  ? 264 LYS E CB  1 
ATOM   10548 C  CG  . LYS E 1 264 ? -48.199 25.516  48.008  1.00 63.52  ? 264 LYS E CG  1 
ATOM   10549 C  CD  . LYS E 1 264 ? -48.215 24.394  47.011  1.00 78.54  ? 264 LYS E CD  1 
ATOM   10550 C  CE  . LYS E 1 264 ? -49.263 24.660  45.935  1.00 87.57  ? 264 LYS E CE  1 
ATOM   10551 N  NZ  . LYS E 1 264 ? -49.643 23.403  45.225  1.00 92.98  ? 264 LYS E NZ  1 
ATOM   10552 N  N   . ARG E 1 265 ? -45.328 26.840  51.590  1.00 47.93  ? 265 ARG E N   1 
ATOM   10553 C  CA  . ARG E 1 265 ? -44.456 26.608  52.725  1.00 40.68  ? 265 ARG E CA  1 
ATOM   10554 C  C   . ARG E 1 265 ? -45.217 26.919  54.000  1.00 45.20  ? 265 ARG E C   1 
ATOM   10555 O  O   . ARG E 1 265 ? -46.049 27.822  54.028  1.00 43.62  ? 265 ARG E O   1 
ATOM   10556 C  CB  . ARG E 1 265 ? -43.207 27.480  52.619  1.00 46.97  ? 265 ARG E CB  1 
ATOM   10557 C  CG  . ARG E 1 265 ? -42.182 27.271  53.713  1.00 44.66  ? 265 ARG E CG  1 
ATOM   10558 C  CD  . ARG E 1 265 ? -40.921 27.988  53.328  1.00 44.04  ? 265 ARG E CD  1 
ATOM   10559 N  NE  . ARG E 1 265 ? -40.656 27.715  51.926  1.00 45.94  ? 265 ARG E NE  1 
ATOM   10560 C  CZ  . ARG E 1 265 ? -40.006 28.556  51.140  1.00 49.34  ? 265 ARG E CZ  1 
ATOM   10561 N  NH1 . ARG E 1 265 ? -39.582 29.706  51.640  1.00 36.21  ? 265 ARG E NH1 1 
ATOM   10562 N  NH2 . ARG E 1 265 ? -39.798 28.248  49.864  1.00 49.38  ? 265 ARG E NH2 1 
ATOM   10563 N  N   . ILE E 1 266 ? -44.934 26.168  55.057  1.00 48.37  ? 266 ILE E N   1 
ATOM   10564 C  CA  . ILE E 1 266 ? -45.599 26.382  56.332  1.00 48.16  ? 266 ILE E CA  1 
ATOM   10565 C  C   . ILE E 1 266 ? -45.242 27.772  56.840  1.00 42.36  ? 266 ILE E C   1 
ATOM   10566 O  O   . ILE E 1 266 ? -44.193 28.313  56.492  1.00 50.78  ? 266 ILE E O   1 
ATOM   10567 C  CB  . ILE E 1 266 ? -45.200 25.283  57.359  1.00 38.94  ? 266 ILE E CB  1 
ATOM   10568 C  CG1 . ILE E 1 266 ? -46.191 25.223  58.508  1.00 36.54  ? 266 ILE E CG1 1 
ATOM   10569 C  CG2 . ILE E 1 266 ? -43.812 25.512  57.884  1.00 38.08  ? 266 ILE E CG2 1 
ATOM   10570 C  CD1 . ILE E 1 266 ? -45.828 24.230  59.552  1.00 31.08  ? 266 ILE E CD1 1 
ATOM   10571 N  N   . SER E 1 267 ? -46.113 28.364  57.649  1.00 49.63  ? 267 SER E N   1 
ATOM   10572 C  CA  . SER E 1 267 ? -45.914 29.739  58.136  1.00 49.87  ? 267 SER E CA  1 
ATOM   10573 C  C   . SER E 1 267 ? -45.627 29.720  59.619  1.00 43.48  ? 267 SER E C   1 
ATOM   10574 O  O   . SER E 1 267 ? -45.989 28.766  60.304  1.00 46.91  ? 267 SER E O   1 
ATOM   10575 C  CB  . SER E 1 267 ? -47.181 30.564  57.923  1.00 37.32  ? 267 SER E CB  1 
ATOM   10576 O  OG  . SER E 1 267 ? -48.198 30.163  58.846  1.00 43.69  ? 267 SER E OG  1 
ATOM   10577 N  N   . ILE E 1 268 ? -45.019 30.796  60.116  1.00 40.76  ? 268 ILE E N   1 
ATOM   10578 C  CA  . ILE E 1 268 ? -44.676 30.899  61.527  1.00 39.65  ? 268 ILE E CA  1 
ATOM   10579 C  C   . ILE E 1 268 ? -45.864 30.500  62.421  1.00 45.63  ? 268 ILE E C   1 
ATOM   10580 O  O   . ILE E 1 268 ? -45.726 29.666  63.328  1.00 52.86  ? 268 ILE E O   1 
ATOM   10581 C  CB  . ILE E 1 268 ? -44.171 32.321  61.887  1.00 38.79  ? 268 ILE E CB  1 
ATOM   10582 C  CG1 . ILE E 1 268 ? -42.909 32.658  61.122  1.00 41.29  ? 268 ILE E CG1 1 
ATOM   10583 C  CG2 . ILE E 1 268 ? -43.837 32.413  63.332  1.00 45.22  ? 268 ILE E CG2 1 
ATOM   10584 C  CD1 . ILE E 1 268 ? -41.662 32.019  61.740  1.00 52.88  ? 268 ILE E CD1 1 
ATOM   10585 N  N   . PRO E 1 269 ? -47.039 31.079  62.168  1.00 44.72  ? 269 PRO E N   1 
ATOM   10586 C  CA  . PRO E 1 269 ? -48.148 30.720  63.053  1.00 47.42  ? 269 PRO E CA  1 
ATOM   10587 C  C   . PRO E 1 269 ? -48.410 29.232  63.034  1.00 47.15  ? 269 PRO E C   1 
ATOM   10588 O  O   . PRO E 1 269 ? -48.644 28.690  64.100  1.00 45.42  ? 269 PRO E O   1 
ATOM   10589 C  CB  . PRO E 1 269 ? -49.320 31.499  62.466  1.00 43.29  ? 269 PRO E CB  1 
ATOM   10590 C  CG  . PRO E 1 269 ? -48.668 32.707  61.857  1.00 37.95  ? 269 PRO E CG  1 
ATOM   10591 C  CD  . PRO E 1 269 ? -47.399 32.167  61.244  1.00 35.21  ? 269 PRO E CD  1 
ATOM   10592 N  N   . GLU E 1 270 ? -48.343 28.593  61.870  1.00 37.48  ? 270 GLU E N   1 
ATOM   10593 C  CA  . GLU E 1 270 ? -48.598 27.157  61.764  1.00 35.23  ? 270 GLU E CA  1 
ATOM   10594 C  C   . GLU E 1 270 ? -47.493 26.338  62.468  1.00 46.48  ? 270 GLU E C   1 
ATOM   10595 O  O   . GLU E 1 270 ? -47.751 25.320  63.126  1.00 48.64  ? 270 GLU E O   1 
ATOM   10596 C  CB  . GLU E 1 270 ? -48.715 26.750  60.296  1.00 30.12  ? 270 GLU E CB  1 
ATOM   10597 C  CG  . GLU E 1 270 ? -49.832 27.452  59.539  1.00 40.27  ? 270 GLU E CG  1 
ATOM   10598 C  CD  . GLU E 1 270 ? -49.787 27.207  58.048  1.00 50.66  ? 270 GLU E CD  1 
ATOM   10599 O  OE1 . GLU E 1 270 ? -48.766 27.486  57.406  1.00 58.99  ? 270 GLU E OE1 1 
ATOM   10600 O  OE2 . GLU E 1 270 ? -50.780 26.724  57.497  1.00 70.51  ? 270 GLU E OE2 1 
ATOM   10601 N  N   . ILE E 1 271 ? -46.254 26.794  62.343  1.00 40.97  ? 271 ILE E N   1 
ATOM   10602 C  CA  . ILE E 1 271 ? -45.159 26.155  63.047  1.00 41.64  ? 271 ILE E CA  1 
ATOM   10603 C  C   . ILE E 1 271 ? -45.352 26.202  64.557  1.00 53.49  ? 271 ILE E C   1 
ATOM   10604 O  O   . ILE E 1 271 ? -45.020 25.233  65.247  1.00 47.57  ? 271 ILE E O   1 
ATOM   10605 C  CB  . ILE E 1 271 ? -43.822 26.833  62.747  1.00 35.23  ? 271 ILE E CB  1 
ATOM   10606 C  CG1 . ILE E 1 271 ? -43.403 26.564  61.317  1.00 40.11  ? 271 ILE E CG1 1 
ATOM   10607 C  CG2 . ILE E 1 271 ? -42.751 26.312  63.669  1.00 35.10  ? 271 ILE E CG2 1 
ATOM   10608 C  CD1 . ILE E 1 271 ? -42.118 27.307  60.906  1.00 31.51  ? 271 ILE E CD1 1 
ATOM   10609 N  N   . ARG E 1 272 ? -45.837 27.331  65.078  1.00 47.77  ? 272 ARG E N   1 
ATOM   10610 C  CA  . ARG E 1 272 ? -46.108 27.425  66.512  1.00 47.03  ? 272 ARG E CA  1 
ATOM   10611 C  C   . ARG E 1 272 ? -47.204 26.452  66.975  1.00 43.85  ? 272 ARG E C   1 
ATOM   10612 O  O   . ARG E 1 272 ? -47.374 26.232  68.172  1.00 50.24  ? 272 ARG E O   1 
ATOM   10613 C  CB  . ARG E 1 272 ? -46.511 28.839  66.909  1.00 48.74  ? 272 ARG E CB  1 
ATOM   10614 C  CG  . ARG E 1 272 ? -45.651 29.944  66.321  1.00 60.75  ? 272 ARG E CG  1 
ATOM   10615 C  CD  . ARG E 1 272 ? -46.146 31.298  66.794  1.00 66.21  ? 272 ARG E CD  1 
ATOM   10616 N  NE  . ARG E 1 272 ? -45.958 31.422  68.227  1.00 72.03  ? 272 ARG E NE  1 
ATOM   10617 C  CZ  . ARG E 1 272 ? -45.118 32.282  68.776  1.00 105.20 ? 272 ARG E CZ  1 
ATOM   10618 N  NH1 . ARG E 1 272 ? -44.426 33.110  67.995  1.00 125.16 ? 272 ARG E NH1 1 
ATOM   10619 N  NH2 . ARG E 1 272 ? -44.981 32.327  70.099  1.00 111.76 ? 272 ARG E NH2 1 
ATOM   10620 N  N   . ASN E 1 273 ? -47.959 25.915  66.026  1.00 39.40  ? 273 ASN E N   1 
ATOM   10621 C  CA  . ASN E 1 273 ? -49.060 25.026  66.358  1.00 53.43  ? 273 ASN E CA  1 
ATOM   10622 C  C   . ASN E 1 273 ? -48.757 23.591  65.968  1.00 40.59  ? 273 ASN E C   1 
ATOM   10623 O  O   . ASN E 1 273 ? -49.636 22.731  66.004  1.00 49.10  ? 273 ASN E O   1 
ATOM   10624 C  CB  . ASN E 1 273 ? -50.349 25.496  65.685  1.00 69.27  ? 273 ASN E CB  1 
ATOM   10625 C  CG  . ASN E 1 273 ? -51.478 25.707  66.673  1.00 84.42  ? 273 ASN E CG  1 
ATOM   10626 O  OD1 . ASN E 1 273 ? -51.247 26.054  67.832  1.00 68.05  ? 273 ASN E OD1 1 
ATOM   10627 N  ND2 . ASN E 1 273 ? -52.709 25.497  66.221  1.00 95.64  ? 273 ASN E ND2 1 
ATOM   10628 N  N   . HIS E 1 274 ? -47.508 23.332  65.596  1.00 29.78  ? 274 HIS E N   1 
ATOM   10629 C  CA  . HIS E 1 274 ? -47.130 22.003  65.186  1.00 41.68  ? 274 HIS E CA  1 
ATOM   10630 C  C   . HIS E 1 274 ? -46.858 21.104  66.399  1.00 48.60  ? 274 HIS E C   1 
ATOM   10631 O  O   . HIS E 1 274 ? -46.303 21.540  67.386  1.00 52.78  ? 274 HIS E O   1 
ATOM   10632 C  CB  . HIS E 1 274 ? -45.929 22.079  64.264  1.00 37.34  ? 274 HIS E CB  1 
ATOM   10633 C  CG  . HIS E 1 274 ? -45.640 20.808  63.548  1.00 41.22  ? 274 HIS E CG  1 
ATOM   10634 N  ND1 . HIS E 1 274 ? -45.146 19.697  64.184  1.00 40.30  ? 274 HIS E ND1 1 
ATOM   10635 C  CD2 . HIS E 1 274 ? -45.772 20.471  62.242  1.00 45.26  ? 274 HIS E CD2 1 
ATOM   10636 C  CE1 . HIS E 1 274 ? -44.993 18.722  63.305  1.00 44.05  ? 274 HIS E CE1 1 
ATOM   10637 N  NE2 . HIS E 1 274 ? -45.372 19.170  62.119  1.00 40.14  ? 274 HIS E NE2 1 
ATOM   10638 N  N   . GLU E 1 275 ? -47.273 19.848  66.319  1.00 49.31  ? 275 GLU E N   1 
ATOM   10639 C  CA  . GLU E 1 275 ? -47.101 18.903  67.417  1.00 57.35  ? 275 GLU E CA  1 
ATOM   10640 C  C   . GLU E 1 275 ? -45.681 18.900  67.962  1.00 53.31  ? 275 GLU E C   1 
ATOM   10641 O  O   . GLU E 1 275 ? -45.471 18.842  69.179  1.00 45.12  ? 275 GLU E O   1 
ATOM   10642 C  CB  . GLU E 1 275 ? -47.438 17.486  66.955  1.00 58.29  ? 275 GLU E CB  1 
ATOM   10643 C  CG  . GLU E 1 275 ? -48.763 16.950  67.455  1.00 79.45  ? 275 GLU E CG  1 
ATOM   10644 C  CD  . GLU E 1 275 ? -48.969 15.483  67.081  1.00 110.62 ? 275 GLU E CD  1 
ATOM   10645 O  OE1 . GLU E 1 275 ? -50.045 14.931  67.412  1.00 120.79 ? 275 GLU E OE1 1 
ATOM   10646 O  OE2 . GLU E 1 275 ? -48.057 14.883  66.457  1.00 116.23 ? 275 GLU E OE2 1 
ATOM   10647 N  N   . TRP E 1 276 ? -44.714 18.933  67.048  1.00 42.16  ? 276 TRP E N   1 
ATOM   10648 C  CA  . TRP E 1 276 ? -43.312 18.872  67.422  1.00 41.25  ? 276 TRP E CA  1 
ATOM   10649 C  C   . TRP E 1 276 ? -42.858 20.119  68.144  1.00 47.67  ? 276 TRP E C   1 
ATOM   10650 O  O   . TRP E 1 276 ? -41.999 20.052  69.016  1.00 59.02  ? 276 TRP E O   1 
ATOM   10651 C  CB  . TRP E 1 276 ? -42.433 18.682  66.204  1.00 39.89  ? 276 TRP E CB  1 
ATOM   10652 C  CG  . TRP E 1 276 ? -41.014 18.372  66.582  1.00 44.64  ? 276 TRP E CG  1 
ATOM   10653 C  CD1 . TRP E 1 276 ? -40.516 17.157  66.950  1.00 46.70  ? 276 TRP E CD1 1 
ATOM   10654 C  CD2 . TRP E 1 276 ? -39.910 19.290  66.639  1.00 49.16  ? 276 TRP E CD2 1 
ATOM   10655 N  NE1 . TRP E 1 276 ? -39.173 17.258  67.217  1.00 42.75  ? 276 TRP E NE1 1 
ATOM   10656 C  CE2 . TRP E 1 276 ? -38.779 18.553  67.030  1.00 48.58  ? 276 TRP E CE2 1 
ATOM   10657 C  CE3 . TRP E 1 276 ? -39.771 20.651  66.377  1.00 46.57  ? 276 TRP E CE3 1 
ATOM   10658 C  CZ2 . TRP E 1 276 ? -37.526 19.138  67.181  1.00 43.74  ? 276 TRP E CZ2 1 
ATOM   10659 C  CZ3 . TRP E 1 276 ? -38.529 21.224  66.524  1.00 48.92  ? 276 TRP E CZ3 1 
ATOM   10660 C  CH2 . TRP E 1 276 ? -37.424 20.474  66.931  1.00 47.21  ? 276 TRP E CH2 1 
ATOM   10661 N  N   . PHE E 1 277 ? -43.425 21.261  67.761  1.00 50.02  ? 277 PHE E N   1 
ATOM   10662 C  CA  . PHE E 1 277 ? -43.047 22.528  68.359  1.00 41.09  ? 277 PHE E CA  1 
ATOM   10663 C  C   . PHE E 1 277 ? -43.652 22.670  69.756  1.00 43.12  ? 277 PHE E C   1 
ATOM   10664 O  O   . PHE E 1 277 ? -43.067 23.284  70.634  1.00 32.32  ? 277 PHE E O   1 
ATOM   10665 C  CB  . PHE E 1 277 ? -43.485 23.679  67.456  1.00 41.54  ? 277 PHE E CB  1 
ATOM   10666 C  CG  . PHE E 1 277 ? -43.025 25.016  67.924  1.00 30.59  ? 277 PHE E CG  1 
ATOM   10667 C  CD1 . PHE E 1 277 ? -41.890 25.582  67.403  1.00 25.91  ? 277 PHE E CD1 1 
ATOM   10668 C  CD2 . PHE E 1 277 ? -43.738 25.693  68.885  1.00 36.61  ? 277 PHE E CD2 1 
ATOM   10669 C  CE1 . PHE E 1 277 ? -41.452 26.808  67.838  1.00 32.56  ? 277 PHE E CE1 1 
ATOM   10670 C  CE2 . PHE E 1 277 ? -43.327 26.924  69.330  1.00 43.19  ? 277 PHE E CE2 1 
ATOM   10671 C  CZ  . PHE E 1 277 ? -42.173 27.491  68.802  1.00 45.75  ? 277 PHE E CZ  1 
ATOM   10672 N  N   . LEU E 1 278 ? -44.823 22.086  69.964  1.00 53.83  ? 278 LEU E N   1 
ATOM   10673 C  CA  . LEU E 1 278 ? -45.539 22.265  71.222  1.00 51.58  ? 278 LEU E CA  1 
ATOM   10674 C  C   . LEU E 1 278 ? -44.939 21.454  72.368  1.00 44.98  ? 278 LEU E C   1 
ATOM   10675 O  O   . LEU E 1 278 ? -45.027 21.848  73.513  1.00 43.80  ? 278 LEU E O   1 
ATOM   10676 C  CB  . LEU E 1 278 ? -47.015 21.915  71.034  1.00 47.42  ? 278 LEU E CB  1 
ATOM   10677 C  CG  . LEU E 1 278 ? -47.756 22.884  70.105  1.00 46.68  ? 278 LEU E CG  1 
ATOM   10678 C  CD1 . LEU E 1 278 ? -49.072 22.267  69.595  1.00 36.74  ? 278 LEU E CD1 1 
ATOM   10679 C  CD2 . LEU E 1 278 ? -47.981 24.208  70.793  1.00 33.44  ? 278 LEU E CD2 1 
ATOM   10680 N  N   . LYS E 1 279 ? -44.336 20.319  72.043  1.00 38.85  ? 279 LYS E N   1 
ATOM   10681 C  CA  . LYS E 1 279 ? -43.678 19.456  73.024  1.00 51.81  ? 279 LYS E CA  1 
ATOM   10682 C  C   . LYS E 1 279 ? -42.716 20.253  73.903  1.00 61.21  ? 279 LYS E C   1 
ATOM   10683 O  O   . LYS E 1 279 ? -41.725 20.790  73.410  1.00 57.94  ? 279 LYS E O   1 
ATOM   10684 C  CB  . LYS E 1 279 ? -42.867 18.382  72.295  1.00 64.67  ? 279 LYS E CB  1 
ATOM   10685 C  CG  . LYS E 1 279 ? -43.156 16.937  72.673  1.00 85.11  ? 279 LYS E CG  1 
ATOM   10686 C  CD  . LYS E 1 279 ? -42.494 16.551  73.998  1.00 92.89  ? 279 LYS E CD  1 
ATOM   10687 C  CE  . LYS E 1 279 ? -42.226 15.043  74.099  1.00 91.86  ? 279 LYS E CE  1 
ATOM   10688 N  NZ  . LYS E 1 279 ? -40.869 14.665  73.576  1.00 88.71  ? 279 LYS E NZ  1 
ATOM   10689 N  N   . ASN E 1 280 ? -42.994 20.318  75.198  1.00 52.27  ? 280 ASN E N   1 
ATOM   10690 C  CA  . ASN E 1 280 ? -42.079 20.941  76.131  1.00 40.84  ? 280 ASN E CA  1 
ATOM   10691 C  C   . ASN E 1 280 ? -41.969 22.448  75.992  1.00 56.64  ? 280 ASN E C   1 
ATOM   10692 O  O   . ASN E 1 280 ? -41.002 23.047  76.468  1.00 55.37  ? 280 ASN E O   1 
ATOM   10693 C  CB  . ASN E 1 280 ? -40.698 20.321  76.002  1.00 47.96  ? 280 ASN E CB  1 
ATOM   10694 C  CG  . ASN E 1 280 ? -40.644 18.900  76.549  1.00 78.90  ? 280 ASN E CG  1 
ATOM   10695 O  OD1 . ASN E 1 280 ? -41.671 18.303  76.887  1.00 91.13  ? 280 ASN E OD1 1 
ATOM   10696 N  ND2 . ASN E 1 280 ? -39.441 18.349  76.636  1.00 88.95  ? 280 ASN E ND2 1 
ATOM   10697 N  N   . LEU E 1 281 ? -42.959 23.067  75.363  1.00 60.41  ? 281 LEU E N   1 
ATOM   10698 C  CA  . LEU E 1 281 ? -42.925 24.504  75.160  1.00 57.28  ? 281 LEU E CA  1 
ATOM   10699 C  C   . LEU E 1 281 ? -43.015 25.197  76.505  1.00 48.21  ? 281 LEU E C   1 
ATOM   10700 O  O   . LEU E 1 281 ? -43.992 24.998  77.232  1.00 52.01  ? 281 LEU E O   1 
ATOM   10701 C  CB  . LEU E 1 281 ? -44.076 24.963  74.260  1.00 54.65  ? 281 LEU E CB  1 
ATOM   10702 C  CG  . LEU E 1 281 ? -43.646 25.787  73.037  1.00 38.96  ? 281 LEU E CG  1 
ATOM   10703 C  CD1 . LEU E 1 281 ? -44.673 26.849  72.671  1.00 34.97  ? 281 LEU E CD1 1 
ATOM   10704 C  CD2 . LEU E 1 281 ? -42.280 26.419  73.215  1.00 34.07  ? 281 LEU E CD2 1 
ATOM   10705 N  N   . PRO E 1 282 ? -41.986 25.987  76.858  1.00 44.94  ? 282 PRO E N   1 
ATOM   10706 C  CA  . PRO E 1 282 ? -42.047 26.735  78.120  1.00 44.44  ? 282 PRO E CA  1 
ATOM   10707 C  C   . PRO E 1 282 ? -43.166 27.745  78.042  1.00 47.35  ? 282 PRO E C   1 
ATOM   10708 O  O   . PRO E 1 282 ? -43.484 28.236  76.969  1.00 47.76  ? 282 PRO E O   1 
ATOM   10709 C  CB  . PRO E 1 282 ? -40.690 27.443  78.192  1.00 34.22  ? 282 PRO E CB  1 
ATOM   10710 C  CG  . PRO E 1 282 ? -39.774 26.595  77.325  1.00 39.96  ? 282 PRO E CG  1 
ATOM   10711 C  CD  . PRO E 1 282 ? -40.661 26.088  76.209  1.00 38.87  ? 282 PRO E CD  1 
ATOM   10712 N  N   . ALA E 1 283 ? -43.767 28.043  79.174  1.00 43.82  ? 283 ALA E N   1 
ATOM   10713 C  CA  . ALA E 1 283 ? -44.909 28.914  79.208  1.00 37.03  ? 283 ALA E CA  1 
ATOM   10714 C  C   . ALA E 1 283 ? -44.549 30.284  78.617  1.00 51.78  ? 283 ALA E C   1 
ATOM   10715 O  O   . ALA E 1 283 ? -45.400 31.009  78.118  1.00 61.44  ? 283 ALA E O   1 
ATOM   10716 C  CB  . ALA E 1 283 ? -45.348 29.054  80.630  1.00 52.00  ? 283 ALA E CB  1 
ATOM   10717 N  N   . ASP E 1 284 ? -43.268 30.628  78.691  1.00 73.14  ? 284 ASP E N   1 
ATOM   10718 C  CA  . ASP E 1 284 ? -42.792 31.922  78.216  1.00 77.47  ? 284 ASP E CA  1 
ATOM   10719 C  C   . ASP E 1 284 ? -42.793 32.014  76.694  1.00 66.51  ? 284 ASP E C   1 
ATOM   10720 O  O   . ASP E 1 284 ? -43.085 33.068  76.128  1.00 61.89  ? 284 ASP E O   1 
ATOM   10721 C  CB  . ASP E 1 284 ? -41.389 32.205  78.758  1.00 91.11  ? 284 ASP E CB  1 
ATOM   10722 C  CG  . ASP E 1 284 ? -41.224 31.773  80.201  1.00 108.87 ? 284 ASP E CG  1 
ATOM   10723 O  OD1 . ASP E 1 284 ? -40.472 32.441  80.941  1.00 119.07 ? 284 ASP E OD1 1 
ATOM   10724 O  OD2 . ASP E 1 284 ? -41.847 30.765  80.596  1.00 107.67 ? 284 ASP E OD2 1 
ATOM   10725 N  N   . LEU E 1 285 ? -42.464 30.909  76.035  1.00 50.74  ? 285 LEU E N   1 
ATOM   10726 C  CA  . LEU E 1 285 ? -42.399 30.879  74.579  1.00 46.70  ? 285 LEU E CA  1 
ATOM   10727 C  C   . LEU E 1 285 ? -43.753 30.548  73.960  1.00 59.22  ? 285 LEU E C   1 
ATOM   10728 O  O   . LEU E 1 285 ? -43.875 30.423  72.742  1.00 68.67  ? 285 LEU E O   1 
ATOM   10729 C  CB  . LEU E 1 285 ? -41.345 29.874  74.111  1.00 58.12  ? 285 LEU E CB  1 
ATOM   10730 C  CG  . LEU E 1 285 ? -39.905 30.161  74.541  1.00 61.02  ? 285 LEU E CG  1 
ATOM   10731 C  CD1 . LEU E 1 285 ? -38.946 29.168  73.906  1.00 60.35  ? 285 LEU E CD1 1 
ATOM   10732 C  CD2 . LEU E 1 285 ? -39.516 31.588  74.190  1.00 47.43  ? 285 LEU E CD2 1 
ATOM   10733 N  N   . MET E 1 286 ? -44.767 30.404  74.805  1.00 63.28  ? 286 MET E N   1 
ATOM   10734 C  CA  . MET E 1 286 ? -46.113 30.094  74.338  1.00 60.38  ? 286 MET E CA  1 
ATOM   10735 C  C   . MET E 1 286 ? -46.946 31.362  74.194  1.00 56.49  ? 286 MET E C   1 
ATOM   10736 O  O   . MET E 1 286 ? -47.464 31.657  73.117  1.00 51.67  ? 286 MET E O   1 
ATOM   10737 C  CB  . MET E 1 286 ? -46.801 29.118  75.295  1.00 44.82  ? 286 MET E CB  1 
ATOM   10738 C  CG  . MET E 1 286 ? -47.703 28.107  74.606  1.00 47.73  ? 286 MET E CG  1 
ATOM   10739 S  SD  . MET E 1 286 ? -48.441 26.931  75.754  1.00 62.95  ? 286 MET E SD  1 
ATOM   10740 C  CE  . MET E 1 286 ? -47.483 25.462  75.396  1.00 49.09  ? 286 MET E CE  1 
ATOM   10741 N  N   . ASN E 1 287 ? -47.070 32.108  75.286  1.00 58.06  ? 287 ASN E N   1 
ATOM   10742 C  CA  . ASN E 1 287 ? -47.847 33.341  75.289  1.00 68.24  ? 287 ASN E CA  1 
ATOM   10743 C  C   . ASN E 1 287 ? -47.207 34.431  74.438  1.00 70.41  ? 287 ASN E C   1 
ATOM   10744 O  O   . ASN E 1 287 ? -46.314 34.163  73.635  1.00 72.35  ? 287 ASN E O   1 
ATOM   10745 C  CB  . ASN E 1 287 ? -48.051 33.841  76.720  1.00 68.09  ? 287 ASN E CB  1 
ATOM   10746 C  CG  . ASN E 1 287 ? -48.690 32.799  77.615  1.00 69.80  ? 287 ASN E CG  1 
ATOM   10747 O  OD1 . ASN E 1 287 ? -49.559 32.042  77.183  1.00 61.78  ? 287 ASN E OD1 1 
ATOM   10748 N  ND2 . ASN E 1 287 ? -48.261 32.755  78.871  1.00 66.45  ? 287 ASN E ND2 1 
ATOM   10749 N  N   . GLY E 1 302 ? -35.580 53.640  79.236  1.00 124.98 ? 302 GLY E N   1 
ATOM   10750 C  CA  . GLY E 1 302 ? -34.770 54.649  78.579  1.00 115.81 ? 302 GLY E CA  1 
ATOM   10751 C  C   . GLY E 1 302 ? -33.987 54.089  77.408  1.00 113.15 ? 302 GLY E C   1 
ATOM   10752 O  O   . GLY E 1 302 ? -33.826 52.876  77.281  1.00 115.36 ? 302 GLY E O   1 
ATOM   10753 N  N   . GLN E 1 303 ? -33.500 54.977  76.548  1.00 111.19 ? 303 GLN E N   1 
ATOM   10754 C  CA  . GLN E 1 303 ? -33.707 56.409  76.724  1.00 106.28 ? 303 GLN E CA  1 
ATOM   10755 C  C   . GLN E 1 303 ? -34.930 56.886  75.947  1.00 119.03 ? 303 GLN E C   1 
ATOM   10756 O  O   . GLN E 1 303 ? -35.333 56.265  74.964  1.00 125.37 ? 303 GLN E O   1 
ATOM   10757 C  CB  . GLN E 1 303 ? -32.467 57.188  76.280  1.00 20.00  ? 303 GLN E CB  1 
ATOM   10758 C  CG  . GLN E 1 303 ? -31.171 56.701  76.907  1.00 20.00  ? 303 GLN E CG  1 
ATOM   10759 C  CD  . GLN E 1 303 ? -29.978 56.877  75.990  1.00 20.00  ? 303 GLN E CD  1 
ATOM   10760 O  OE1 . GLN E 1 303 ? -30.113 57.340  74.858  1.00 20.00  ? 303 GLN E OE1 1 
ATOM   10761 N  NE2 . GLN E 1 303 ? -28.799 56.506  76.475  1.00 20.00  ? 303 GLN E NE2 1 
ATOM   10762 N  N   . SER E 1 304 ? -35.515 57.991  76.396  1.00 119.59 ? 304 SER E N   1 
ATOM   10763 C  CA  . SER E 1 304 ? -36.703 58.554  75.748  1.00 118.43 ? 304 SER E CA  1 
ATOM   10764 C  C   . SER E 1 304 ? -36.394 59.058  74.343  1.00 104.28 ? 304 SER E C   1 
ATOM   10765 O  O   . SER E 1 304 ? -35.589 59.974  74.180  1.00 102.11 ? 304 SER E O   1 
ATOM   10766 C  CB  . SER E 1 304 ? -37.284 59.691  76.592  1.00 20.00  ? 304 SER E CB  1 
ATOM   10767 O  OG  . SER E 1 304 ? -36.375 60.774  76.684  1.00 20.00  ? 304 SER E OG  1 
ATOM   10768 N  N   . ILE E 1 305 ? -37.028 58.458  73.341  1.00 95.54  ? 305 ILE E N   1 
ATOM   10769 C  CA  . ILE E 1 305 ? -36.806 58.850  71.955  1.00 89.51  ? 305 ILE E CA  1 
ATOM   10770 C  C   . ILE E 1 305 ? -36.277 60.277  71.870  1.00 104.02 ? 305 ILE E C   1 
ATOM   10771 O  O   . ILE E 1 305 ? -35.394 60.574  71.065  1.00 106.58 ? 305 ILE E O   1 
ATOM   10772 C  CB  . ILE E 1 305 ? -38.095 58.735  71.121  1.00 20.00  ? 305 ILE E CB  1 
ATOM   10773 C  CG1 . ILE E 1 305 ? -38.897 57.504  71.548  1.00 20.00  ? 305 ILE E CG1 1 
ATOM   10774 C  CG2 . ILE E 1 305 ? -37.766 58.674  69.638  1.00 20.00  ? 305 ILE E CG2 1 
ATOM   10775 C  CD1 . ILE E 1 305 ? -40.395 57.694  71.471  1.00 20.00  ? 305 ILE E CD1 1 
ATOM   10776 N  N   . GLU E 1 306 ? -36.821 61.155  72.705  1.00 116.05 ? 306 GLU E N   1 
ATOM   10777 C  CA  . GLU E 1 306 ? -36.388 62.546  72.740  1.00 126.53 ? 306 GLU E CA  1 
ATOM   10778 C  C   . GLU E 1 306 ? -34.871 62.653  72.853  1.00 129.84 ? 306 GLU E C   1 
ATOM   10779 O  O   . GLU E 1 306 ? -34.183 62.935  71.872  1.00 131.65 ? 306 GLU E O   1 
ATOM   10780 C  CB  . GLU E 1 306 ? -37.055 63.283  73.903  1.00 20.00  ? 306 GLU E CB  1 
ATOM   10781 N  N   . GLU E 1 307 ? -34.356 62.427  74.057  1.00 126.10 ? 307 GLU E N   1 
ATOM   10782 C  CA  . GLU E 1 307 ? -32.923 62.517  74.310  1.00 120.81 ? 307 GLU E CA  1 
ATOM   10783 C  C   . GLU E 1 307 ? -32.105 61.905  73.177  1.00 118.68 ? 307 GLU E C   1 
ATOM   10784 O  O   . GLU E 1 307 ? -31.242 62.564  72.598  1.00 126.67 ? 307 GLU E O   1 
ATOM   10785 C  CB  . GLU E 1 307 ? -32.575 61.833  75.633  1.00 20.00  ? 307 GLU E CB  1 
ATOM   10786 N  N   . ILE E 1 308 ? -32.379 60.642  72.867  1.00 109.73 ? 308 ILE E N   1 
ATOM   10787 C  CA  . ILE E 1 308 ? -31.651 59.939  71.816  1.00 107.09 ? 308 ILE E CA  1 
ATOM   10788 C  C   . ILE E 1 308 ? -31.475 60.811  70.578  1.00 106.96 ? 308 ILE E C   1 
ATOM   10789 O  O   . ILE E 1 308 ? -30.748 60.451  69.652  1.00 90.17  ? 308 ILE E O   1 
ATOM   10790 C  CB  . ILE E 1 308 ? -32.376 58.632  71.441  1.00 20.00  ? 308 ILE E CB  1 
ATOM   10791 N  N   . MET E 1 309 ? -32.144 61.959  70.567  1.00 115.17 ? 309 MET E N   1 
ATOM   10792 C  CA  . MET E 1 309 ? -32.053 62.882  69.442  1.00 110.83 ? 309 MET E CA  1 
ATOM   10793 C  C   . MET E 1 309 ? -30.882 63.841  69.617  1.00 121.27 ? 309 MET E C   1 
ATOM   10794 O  O   . MET E 1 309 ? -29.874 63.740  68.919  1.00 124.62 ? 309 MET E O   1 
ATOM   10795 C  CB  . MET E 1 309 ? -33.357 63.665  69.282  1.00 20.00  ? 309 MET E CB  1 
ATOM   10796 N  N   . GLN E 1 310 ? -31.023 64.772  70.556  1.00 125.14 ? 310 GLN E N   1 
ATOM   10797 C  CA  . GLN E 1 310 ? -29.970 65.742  70.828  1.00 124.29 ? 310 GLN E CA  1 
ATOM   10798 C  C   . GLN E 1 310 ? -28.607 65.150  70.494  1.00 134.50 ? 310 GLN E C   1 
ATOM   10799 O  O   . GLN E 1 310 ? -27.692 65.861  70.081  1.00 142.97 ? 310 GLN E O   1 
ATOM   10800 C  CB  . GLN E 1 310 ? -30.012 66.191  72.290  1.00 20.00  ? 310 GLN E CB  1 
ATOM   10801 N  N   . ILE E 1 311 ? -28.485 63.839  70.677  1.00 127.45 ? 311 ILE E N   1 
ATOM   10802 C  CA  . ILE E 1 311 ? -27.247 63.129  70.381  1.00 111.83 ? 311 ILE E CA  1 
ATOM   10803 C  C   . ILE E 1 311 ? -27.107 62.905  68.881  1.00 108.22 ? 311 ILE E C   1 
ATOM   10804 O  O   . ILE E 1 311 ? -26.287 63.543  68.222  1.00 115.86 ? 311 ILE E O   1 
ATOM   10805 C  CB  . ILE E 1 311 ? -27.199 61.783  71.128  1.00 20.00  ? 311 ILE E CB  1 
ATOM   10806 C  CG1 . ILE E 1 311 ? -27.116 62.014  72.639  1.00 20.00  ? 311 ILE E CG1 1 
ATOM   10807 C  CG2 . ILE E 1 311 ? -26.022 60.948  70.648  1.00 20.00  ? 311 ILE E CG2 1 
ATOM   10808 C  CD1 . ILE E 1 311 ? -27.329 60.762  73.460  1.00 20.00  ? 311 ILE E CD1 1 
ATOM   10809 N  N   . ILE E 1 312 ? -27.914 61.995  68.346  1.00 98.84  ? 312 ILE E N   1 
ATOM   10810 C  CA  . ILE E 1 312 ? -27.901 61.718  66.917  1.00 102.52 ? 312 ILE E CA  1 
ATOM   10811 C  C   . ILE E 1 312 ? -27.725 63.016  66.139  1.00 105.13 ? 312 ILE E C   1 
ATOM   10812 O  O   . ILE E 1 312 ? -27.150 63.029  65.051  1.00 109.30 ? 312 ILE E O   1 
ATOM   10813 C  CB  . ILE E 1 312 ? -29.195 61.003  66.484  1.00 20.00  ? 312 ILE E CB  1 
ATOM   10814 N  N   . ALA E 1 313 ? -28.223 64.107  66.711  1.00 91.45  ? 313 ALA E N   1 
ATOM   10815 C  CA  . ALA E 1 313 ? -28.103 65.421  66.097  1.00 90.32  ? 313 ALA E CA  1 
ATOM   10816 C  C   . ALA E 1 313 ? -26.919 66.177  66.686  1.00 97.43  ? 313 ALA E C   1 
ATOM   10817 O  O   . ALA E 1 313 ? -25.978 66.529  65.975  1.00 101.03 ? 313 ALA E O   1 
ATOM   10818 C  CB  . ALA E 1 313 ? -29.386 66.214  66.283  1.00 85.41  ? 313 ALA E CB  1 
ATOM   10819 N  N   . GLU E 1 314 ? -26.972 66.420  67.992  1.00 107.28 ? 314 GLU E N   1 
ATOM   10820 C  CA  . GLU E 1 314 ? -25.897 67.121  68.684  1.00 116.70 ? 314 GLU E CA  1 
ATOM   10821 C  C   . GLU E 1 314 ? -24.550 66.821  68.038  1.00 122.83 ? 314 GLU E C   1 
ATOM   10822 O  O   . GLU E 1 314 ? -23.632 67.640  68.084  1.00 126.77 ? 314 GLU E O   1 
ATOM   10823 C  CB  . GLU E 1 314 ? -25.868 66.730  70.162  1.00 118.64 ? 314 GLU E CB  1 
ATOM   10824 C  CG  . GLU E 1 314 ? -26.272 67.850  71.110  1.00 125.80 ? 314 GLU E CG  1 
ATOM   10825 C  CD  . GLU E 1 314 ? -26.279 67.410  72.561  1.00 132.58 ? 314 GLU E CD  1 
ATOM   10826 O  OE1 . GLU E 1 314 ? -25.971 66.229  72.826  1.00 137.30 ? 314 GLU E OE1 1 
ATOM   10827 O  OE2 . GLU E 1 314 ? -26.594 68.244  73.435  1.00 129.69 ? 314 GLU E OE2 1 
ATOM   10828 N  N   . ALA E 1 315 ? -24.438 65.642  67.435  1.00 118.65 ? 315 ALA E N   1 
ATOM   10829 C  CA  . ALA E 1 315 ? -23.206 65.230  66.774  1.00 113.36 ? 315 ALA E CA  1 
ATOM   10830 C  C   . ALA E 1 315 ? -23.480 64.753  65.352  1.00 98.40  ? 315 ALA E C   1 
ATOM   10831 O  O   . ALA E 1 315 ? -23.036 63.677  64.952  1.00 92.09  ? 315 ALA E O   1 
ATOM   10832 C  CB  . ALA E 1 315 ? -22.512 64.140  67.576  1.00 115.41 ? 315 ALA E CB  1 
ATOM   10833 N  N   . THR E 1 316 ? -24.213 65.562  64.595  1.00 95.92  ? 316 THR E N   1 
ATOM   10834 C  CA  . THR E 1 316 ? -24.552 65.223  63.218  1.00 102.80 ? 316 THR E CA  1 
ATOM   10835 C  C   . THR E 1 316 ? -23.899 66.189  62.236  1.00 106.34 ? 316 THR E C   1 
ATOM   10836 O  O   . THR E 1 316 ? -22.675 66.237  62.118  1.00 107.70 ? 316 THR E O   1 
ATOM   10837 C  CB  . THR E 1 316 ? -26.074 65.231  62.997  1.00 110.32 ? 316 THR E CB  1 
ATOM   10838 O  OG1 . THR E 1 316 ? -26.743 65.150  64.261  1.00 118.21 ? 316 THR E OG1 1 
ATOM   10839 C  CG2 . THR E 1 316 ? -26.492 64.054  62.130  1.00 110.40 ? 316 THR E CG2 1 
ATOM   10840 N  N   . LEU F 1 12  ? -46.569 -49.026 29.171  1.00 84.39  ? 12  LEU F N   1 
ATOM   10841 C  CA  . LEU F 1 12  ? -45.531 -49.987 28.822  1.00 79.70  ? 12  LEU F CA  1 
ATOM   10842 C  C   . LEU F 1 12  ? -45.526 -51.167 29.787  1.00 87.95  ? 12  LEU F C   1 
ATOM   10843 O  O   . LEU F 1 12  ? -46.279 -51.189 30.760  1.00 96.13  ? 12  LEU F O   1 
ATOM   10844 C  CB  . LEU F 1 12  ? -44.158 -49.312 28.812  1.00 75.50  ? 12  LEU F CB  1 
ATOM   10845 C  CG  . LEU F 1 12  ? -44.007 -48.094 27.899  1.00 73.55  ? 12  LEU F CG  1 
ATOM   10846 C  CD1 . LEU F 1 12  ? -42.540 -47.742 27.714  1.00 67.35  ? 12  LEU F CD1 1 
ATOM   10847 C  CD2 . LEU F 1 12  ? -44.676 -48.344 26.557  1.00 72.87  ? 12  LEU F CD2 1 
ATOM   10848 N  N   . PRO F 1 13  ? -44.672 -52.148 29.510  1.00 88.17  ? 13  PRO F N   1 
ATOM   10849 C  CA  . PRO F 1 13  ? -44.559 -53.334 30.363  1.00 86.51  ? 13  PRO F CA  1 
ATOM   10850 C  C   . PRO F 1 13  ? -43.139 -53.519 30.887  1.00 75.02  ? 13  PRO F C   1 
ATOM   10851 O  O   . PRO F 1 13  ? -42.189 -53.024 30.280  1.00 77.63  ? 13  PRO F O   1 
ATOM   10852 C  CB  . PRO F 1 13  ? -44.918 -54.476 29.412  1.00 90.81  ? 13  PRO F CB  1 
ATOM   10853 C  CG  . PRO F 1 13  ? -44.503 -53.982 28.073  1.00 83.46  ? 13  PRO F CG  1 
ATOM   10854 C  CD  . PRO F 1 13  ? -44.748 -52.499 28.081  1.00 88.35  ? 13  PRO F CD  1 
ATOM   10855 N  N   . ILE F 1 14  ? -43.001 -54.224 32.004  1.00 67.56  ? 14  ILE F N   1 
ATOM   10856 C  CA  . ILE F 1 14  ? -41.691 -54.463 32.596  1.00 80.19  ? 14  ILE F CA  1 
ATOM   10857 C  C   . ILE F 1 14  ? -40.651 -54.762 31.521  1.00 75.05  ? 14  ILE F C   1 
ATOM   10858 O  O   . ILE F 1 14  ? -40.969 -55.335 30.480  1.00 72.69  ? 14  ILE F O   1 
ATOM   10859 C  CB  . ILE F 1 14  ? -41.730 -55.627 33.603  1.00 81.69  ? 14  ILE F CB  1 
ATOM   10860 C  CG1 . ILE F 1 14  ? -40.405 -56.392 33.585  1.00 79.00  ? 14  ILE F CG1 1 
ATOM   10861 C  CG2 . ILE F 1 14  ? -42.893 -56.557 33.297  1.00 89.85  ? 14  ILE F CG2 1 
ATOM   10862 C  CD1 . ILE F 1 14  ? -39.489 -56.051 34.738  1.00 80.15  ? 14  ILE F CD1 1 
ATOM   10863 N  N   . MET F 1 15  ? -39.409 -54.368 31.779  1.00 80.57  ? 15  MET F N   1 
ATOM   10864 C  CA  . MET F 1 15  ? -38.326 -54.580 30.828  1.00 75.67  ? 15  MET F CA  1 
ATOM   10865 C  C   . MET F 1 15  ? -38.181 -56.058 30.483  1.00 73.82  ? 15  MET F C   1 
ATOM   10866 O  O   . MET F 1 15  ? -38.485 -56.928 31.298  1.00 94.51  ? 15  MET F O   1 
ATOM   10867 C  CB  . MET F 1 15  ? -37.008 -54.033 31.381  1.00 56.14  ? 15  MET F CB  1 
ATOM   10868 C  CG  . MET F 1 15  ? -35.800 -54.322 30.506  1.00 48.94  ? 15  MET F CG  1 
ATOM   10869 S  SD  . MET F 1 15  ? -35.791 -53.357 28.983  1.00 68.15  ? 15  MET F SD  1 
ATOM   10870 C  CE  . MET F 1 15  ? -34.244 -53.890 28.254  1.00 35.53  ? 15  MET F CE  1 
ATOM   10871 N  N   . HIS F 1 16  ? -37.715 -56.332 29.270  1.00 48.06  ? 16  HIS F N   1 
ATOM   10872 C  CA  . HIS F 1 16  ? -37.534 -57.699 28.803  1.00 59.47  ? 16  HIS F CA  1 
ATOM   10873 C  C   . HIS F 1 16  ? -36.452 -57.781 27.737  1.00 65.60  ? 16  HIS F C   1 
ATOM   10874 O  O   . HIS F 1 16  ? -36.097 -56.774 27.126  1.00 58.66  ? 16  HIS F O   1 
ATOM   10875 C  CB  . HIS F 1 16  ? -38.803 -58.193 28.111  1.00 56.75  ? 16  HIS F CB  1 
ATOM   10876 C  CG  . HIS F 1 16  ? -39.099 -57.489 26.823  1.00 68.06  ? 16  HIS F CG  1 
ATOM   10877 N  ND1 . HIS F 1 16  ? -39.927 -56.389 26.749  1.00 63.87  ? 16  HIS F ND1 1 
ATOM   10878 C  CD2 . HIS F 1 16  ? -38.674 -57.724 25.560  1.00 71.50  ? 16  HIS F CD2 1 
ATOM   10879 C  CE1 . HIS F 1 16  ? -40.001 -55.979 25.495  1.00 54.37  ? 16  HIS F CE1 1 
ATOM   10880 N  NE2 . HIS F 1 16  ? -39.249 -56.773 24.753  1.00 67.13  ? 16  HIS F NE2 1 
ATOM   10881 N  N   . ASP F 1 17  ? -35.924 -58.981 27.521  1.00 67.56  ? 17  ASP F N   1 
ATOM   10882 C  CA  . ASP F 1 17  ? -34.868 -59.186 26.535  1.00 74.75  ? 17  ASP F CA  1 
ATOM   10883 C  C   . ASP F 1 17  ? -33.665 -58.295 26.825  1.00 80.68  ? 17  ASP F C   1 
ATOM   10884 O  O   . ASP F 1 17  ? -32.950 -57.884 25.912  1.00 74.42  ? 17  ASP F O   1 
ATOM   10885 C  CB  . ASP F 1 17  ? -35.393 -58.913 25.124  1.00 82.06  ? 17  ASP F CB  1 
ATOM   10886 C  CG  . ASP F 1 17  ? -35.842 -60.175 24.416  1.00 86.46  ? 17  ASP F CG  1 
ATOM   10887 O  OD1 . ASP F 1 17  ? -35.079 -60.686 23.569  1.00 91.15  ? 17  ASP F OD1 1 
ATOM   10888 O  OD2 . ASP F 1 17  ? -36.957 -60.656 24.706  1.00 89.32  ? 17  ASP F OD2 1 
ATOM   10889 N  N   . SER F 1 18  ? -33.448 -58.002 28.103  1.00 92.66  ? 18  SER F N   1 
ATOM   10890 C  CA  . SER F 1 18  ? -32.344 -57.145 28.517  1.00 82.57  ? 18  SER F CA  1 
ATOM   10891 C  C   . SER F 1 18  ? -30.992 -57.781 28.213  1.00 66.95  ? 18  SER F C   1 
ATOM   10892 O  O   . SER F 1 18  ? -29.948 -57.150 28.377  1.00 63.68  ? 18  SER F O   1 
ATOM   10893 C  CB  . SER F 1 18  ? -32.447 -56.825 30.010  1.00 90.27  ? 18  SER F CB  1 
ATOM   10894 O  OG  . SER F 1 18  ? -31.226 -56.307 30.505  1.00 103.92 ? 18  SER F OG  1 
ATOM   10895 N  N   . ASP F 1 19  ? -31.016 -59.034 27.772  1.00 59.39  ? 19  ASP F N   1 
ATOM   10896 C  CA  . ASP F 1 19  ? -29.789 -59.756 27.460  1.00 55.38  ? 19  ASP F CA  1 
ATOM   10897 C  C   . ASP F 1 19  ? -29.219 -59.333 26.111  1.00 63.17  ? 19  ASP F C   1 
ATOM   10898 O  O   . ASP F 1 19  ? -28.122 -59.743 25.734  1.00 54.59  ? 19  ASP F O   1 
ATOM   10899 C  CB  . ASP F 1 19  ? -30.036 -61.266 27.480  1.00 63.05  ? 19  ASP F CB  1 
ATOM   10900 C  CG  . ASP F 1 19  ? -30.627 -61.777 26.181  1.00 61.13  ? 19  ASP F CG  1 
ATOM   10901 O  OD1 . ASP F 1 19  ? -29.850 -62.179 25.291  1.00 56.24  ? 19  ASP F OD1 1 
ATOM   10902 O  OD2 . ASP F 1 19  ? -31.869 -61.778 26.051  1.00 62.00  ? 19  ASP F OD2 1 
ATOM   10903 N  N   . ARG F 1 20  ? -29.969 -58.508 25.388  1.00 74.04  ? 20  ARG F N   1 
ATOM   10904 C  CA  . ARG F 1 20  ? -29.541 -58.037 24.077  1.00 63.71  ? 20  ARG F CA  1 
ATOM   10905 C  C   . ARG F 1 20  ? -29.961 -56.590 23.837  1.00 57.56  ? 20  ARG F C   1 
ATOM   10906 O  O   . ARG F 1 20  ? -29.508 -55.952 22.887  1.00 54.45  ? 20  ARG F O   1 
ATOM   10907 C  CB  . ARG F 1 20  ? -30.107 -58.936 22.976  1.00 71.20  ? 20  ARG F CB  1 
ATOM   10908 C  CG  . ARG F 1 20  ? -31.388 -59.657 23.363  1.00 88.83  ? 20  ARG F CG  1 
ATOM   10909 C  CD  . ARG F 1 20  ? -31.781 -60.689 22.318  1.00 87.65  ? 20  ARG F CD  1 
ATOM   10910 N  NE  . ARG F 1 20  ? -33.098 -60.417 21.749  1.00 86.42  ? 20  ARG F NE  1 
ATOM   10911 C  CZ  . ARG F 1 20  ? -33.297 -59.890 20.545  1.00 74.76  ? 20  ARG F CZ  1 
ATOM   10912 N  NH1 . ARG F 1 20  ? -34.530 -59.676 20.109  1.00 71.43  ? 20  ARG F NH1 1 
ATOM   10913 N  NH2 . ARG F 1 20  ? -32.263 -59.577 19.777  1.00 56.66  ? 20  ARG F NH2 1 
ATOM   10914 N  N   . TYR F 1 21  ? -30.830 -56.079 24.703  1.00 32.62  ? 21  TYR F N   1 
ATOM   10915 C  CA  . TYR F 1 21  ? -31.329 -54.716 24.571  1.00 53.92  ? 21  TYR F CA  1 
ATOM   10916 C  C   . TYR F 1 21  ? -31.201 -53.943 25.877  1.00 58.41  ? 21  TYR F C   1 
ATOM   10917 O  O   . TYR F 1 21  ? -31.752 -54.348 26.900  1.00 53.46  ? 21  TYR F O   1 
ATOM   10918 C  CB  . TYR F 1 21  ? -32.796 -54.728 24.133  1.00 49.57  ? 21  TYR F CB  1 
ATOM   10919 C  CG  . TYR F 1 21  ? -33.009 -54.960 22.654  1.00 55.52  ? 21  TYR F CG  1 
ATOM   10920 C  CD1 . TYR F 1 21  ? -32.459 -54.103 21.711  1.00 58.56  ? 21  TYR F CD1 1 
ATOM   10921 C  CD2 . TYR F 1 21  ? -33.768 -56.030 22.203  1.00 54.44  ? 21  TYR F CD2 1 
ATOM   10922 C  CE1 . TYR F 1 21  ? -32.654 -54.309 20.359  1.00 59.11  ? 21  TYR F CE1 1 
ATOM   10923 C  CE2 . TYR F 1 21  ? -33.969 -56.245 20.854  1.00 47.94  ? 21  TYR F CE2 1 
ATOM   10924 C  CZ  . TYR F 1 21  ? -33.410 -55.382 19.936  1.00 58.03  ? 21  TYR F CZ  1 
ATOM   10925 O  OH  . TYR F 1 21  ? -33.609 -55.592 18.591  1.00 53.28  ? 21  TYR F OH  1 
ATOM   10926 N  N   . GLU F 1 22  ? -30.502 -52.815 25.851  1.00 63.20  ? 22  GLU F N   1 
ATOM   10927 C  CA  . GLU F 1 22  ? -30.383 -51.983 27.045  1.00 61.72  ? 22  GLU F CA  1 
ATOM   10928 C  C   . GLU F 1 22  ? -31.438 -50.880 27.044  1.00 45.63  ? 22  GLU F C   1 
ATOM   10929 O  O   . GLU F 1 22  ? -31.488 -50.071 26.119  1.00 54.09  ? 22  GLU F O   1 
ATOM   10930 C  CB  . GLU F 1 22  ? -28.982 -51.377 27.139  1.00 67.97  ? 22  GLU F CB  1 
ATOM   10931 C  CG  . GLU F 1 22  ? -28.954 -49.861 27.055  1.00 84.72  ? 22  GLU F CG  1 
ATOM   10932 C  CD  . GLU F 1 22  ? -27.703 -49.267 27.673  1.00 90.16  ? 22  GLU F CD  1 
ATOM   10933 O  OE1 . GLU F 1 22  ? -27.676 -49.091 28.909  1.00 82.59  ? 22  GLU F OE1 1 
ATOM   10934 O  OE2 . GLU F 1 22  ? -26.748 -48.978 26.923  1.00 90.15  ? 22  GLU F OE2 1 
ATOM   10935 N  N   . LEU F 1 23  ? -32.283 -50.844 28.073  1.00 33.72  ? 23  LEU F N   1 
ATOM   10936 C  CA  . LEU F 1 23  ? -33.337 -49.815 28.133  1.00 41.64  ? 23  LEU F CA  1 
ATOM   10937 C  C   . LEU F 1 23  ? -32.700 -48.428 28.208  1.00 46.45  ? 23  LEU F C   1 
ATOM   10938 O  O   . LEU F 1 23  ? -31.848 -48.211 29.036  1.00 54.53  ? 23  LEU F O   1 
ATOM   10939 C  CB  . LEU F 1 23  ? -34.265 -50.031 29.332  1.00 34.89  ? 23  LEU F CB  1 
ATOM   10940 C  CG  . LEU F 1 23  ? -35.142 -48.835 29.720  1.00 54.25  ? 23  LEU F CG  1 
ATOM   10941 C  CD1 . LEU F 1 23  ? -35.957 -48.283 28.536  1.00 54.80  ? 23  LEU F CD1 1 
ATOM   10942 C  CD2 . LEU F 1 23  ? -36.080 -49.191 30.889  1.00 53.66  ? 23  LEU F CD2 1 
ATOM   10943 N  N   . VAL F 1 24  ? -33.099 -47.512 27.325  1.00 55.21  ? 24  VAL F N   1 
ATOM   10944 C  CA  . VAL F 1 24  ? -32.507 -46.179 27.257  1.00 30.86  ? 24  VAL F CA  1 
ATOM   10945 C  C   . VAL F 1 24  ? -33.434 -45.172 27.922  1.00 39.40  ? 24  VAL F C   1 
ATOM   10946 O  O   . VAL F 1 24  ? -33.036 -44.506 28.882  1.00 54.91  ? 24  VAL F O   1 
ATOM   10947 C  CB  . VAL F 1 24  ? -32.209 -45.750 25.821  1.00 37.73  ? 24  VAL F CB  1 
ATOM   10948 C  CG1 . VAL F 1 24  ? -31.850 -44.263 25.793  1.00 55.06  ? 24  VAL F CG1 1 
ATOM   10949 C  CG2 . VAL F 1 24  ? -31.077 -46.561 25.228  1.00 29.88  ? 24  VAL F CG2 1 
ATOM   10950 N  N   . LYS F 1 25  ? -34.666 -45.050 27.433  1.00 35.32  ? 25  LYS F N   1 
ATOM   10951 C  CA  . LYS F 1 25  ? -35.650 -44.206 28.113  1.00 39.89  ? 25  LYS F CA  1 
ATOM   10952 C  C   . LYS F 1 25  ? -37.046 -44.549 27.669  1.00 48.88  ? 25  LYS F C   1 
ATOM   10953 O  O   . LYS F 1 25  ? -37.245 -44.948 26.526  1.00 49.57  ? 25  LYS F O   1 
ATOM   10954 C  CB  . LYS F 1 25  ? -35.403 -42.700 27.849  1.00 39.70  ? 25  LYS F CB  1 
ATOM   10955 C  CG  . LYS F 1 25  ? -36.278 -41.788 28.710  1.00 56.74  ? 25  LYS F CG  1 
ATOM   10956 C  CD  . LYS F 1 25  ? -36.017 -40.313 28.476  1.00 86.68  ? 25  LYS F CD  1 
ATOM   10957 C  CE  . LYS F 1 25  ? -37.234 -39.639 27.854  1.00 105.50 ? 25  LYS F CE  1 
ATOM   10958 N  NZ  . LYS F 1 25  ? -36.853 -38.443 27.024  1.00 108.37 ? 25  LYS F NZ  1 
ATOM   10959 N  N   . ASP F 1 26  ? -38.015 -44.377 28.561  1.00 49.12  ? 26  ASP F N   1 
ATOM   10960 C  CA  . ASP F 1 26  ? -39.414 -44.595 28.222  1.00 51.99  ? 26  ASP F CA  1 
ATOM   10961 C  C   . ASP F 1 26  ? -40.039 -43.293 27.735  1.00 55.10  ? 26  ASP F C   1 
ATOM   10962 O  O   . ASP F 1 26  ? -40.877 -42.703 28.417  1.00 58.93  ? 26  ASP F O   1 
ATOM   10963 C  CB  . ASP F 1 26  ? -40.183 -45.131 29.429  1.00 67.64  ? 26  ASP F CB  1 
ATOM   10964 C  CG  . ASP F 1 26  ? -40.157 -46.645 29.511  1.00 67.26  ? 26  ASP F CG  1 
ATOM   10965 O  OD1 . ASP F 1 26  ? -40.768 -47.201 30.447  1.00 69.18  ? 26  ASP F OD1 1 
ATOM   10966 O  OD2 . ASP F 1 26  ? -39.527 -47.278 28.640  1.00 61.51  ? 26  ASP F OD2 1 
ATOM   10967 N  N   . ILE F 1 27  ? -39.620 -42.848 26.555  1.00 64.41  ? 27  ILE F N   1 
ATOM   10968 C  CA  . ILE F 1 27  ? -40.109 -41.599 25.983  1.00 65.42  ? 27  ILE F CA  1 
ATOM   10969 C  C   . ILE F 1 27  ? -41.632 -41.559 25.928  1.00 70.71  ? 27  ILE F C   1 
ATOM   10970 O  O   . ILE F 1 27  ? -42.293 -42.597 25.973  1.00 70.05  ? 27  ILE F O   1 
ATOM   10971 C  CB  . ILE F 1 27  ? -39.546 -41.370 24.568  1.00 64.61  ? 27  ILE F CB  1 
ATOM   10972 C  CG1 . ILE F 1 27  ? -40.644 -41.560 23.521  1.00 68.41  ? 27  ILE F CG1 1 
ATOM   10973 C  CG2 . ILE F 1 27  ? -38.380 -42.308 24.300  1.00 68.02  ? 27  ILE F CG2 1 
ATOM   10974 C  CD1 . ILE F 1 27  ? -40.137 -41.539 22.096  1.00 68.55  ? 27  ILE F CD1 1 
ATOM   10975 N  N   . GLY F 1 28  ? -42.181 -40.354 25.829  1.00 80.26  ? 28  GLY F N   1 
ATOM   10976 C  CA  . GLY F 1 28  ? -43.619 -40.170 25.793  1.00 86.58  ? 28  GLY F CA  1 
ATOM   10977 C  C   . GLY F 1 28  ? -44.163 -39.975 24.391  1.00 104.10 ? 28  GLY F C   1 
ATOM   10978 O  O   . GLY F 1 28  ? -44.578 -40.933 23.739  1.00 121.11 ? 28  GLY F O   1 
ATOM   10979 N  N   . ALA F 1 29  ? -44.162 -38.730 23.926  1.00 101.22 ? 29  ALA F N   1 
ATOM   10980 C  CA  . ALA F 1 29  ? -44.703 -38.408 22.610  1.00 106.72 ? 29  ALA F CA  1 
ATOM   10981 C  C   . ALA F 1 29  ? -43.644 -37.840 21.670  1.00 107.39 ? 29  ALA F C   1 
ATOM   10982 O  O   . ALA F 1 29  ? -42.617 -37.323 22.110  1.00 104.93 ? 29  ALA F O   1 
ATOM   10983 C  CB  . ALA F 1 29  ? -45.871 -37.442 22.740  1.00 110.02 ? 29  ALA F CB  1 
ATOM   10984 N  N   . GLY F 1 30  ? -43.909 -37.941 20.372  1.00 106.69 ? 30  GLY F N   1 
ATOM   10985 C  CA  . GLY F 1 30  ? -43.011 -37.434 19.356  1.00 103.69 ? 30  GLY F CA  1 
ATOM   10986 C  C   . GLY F 1 30  ? -43.511 -38.215 18.172  1.00 110.55 ? 30  GLY F C   1 
ATOM   10987 O  O   . GLY F 1 30  ? -44.550 -38.865 18.314  1.00 109.33 ? 30  GLY F O   1 
ATOM   10988 N  N   . ASN F 1 31  ? -42.814 -38.184 17.035  1.00 116.89 ? 31  ASN F N   1 
ATOM   10989 C  CA  . ASN F 1 31  ? -43.322 -38.889 15.852  1.00 116.50 ? 31  ASN F CA  1 
ATOM   10990 C  C   . ASN F 1 31  ? -43.269 -40.420 15.970  1.00 98.75  ? 31  ASN F C   1 
ATOM   10991 O  O   . ASN F 1 31  ? -43.902 -41.128 15.190  1.00 92.43  ? 31  ASN F O   1 
ATOM   10992 C  CB  . ASN F 1 31  ? -42.699 -38.377 14.537  1.00 126.12 ? 31  ASN F CB  1 
ATOM   10993 C  CG  . ASN F 1 31  ? -43.761 -38.059 13.470  1.00 130.73 ? 31  ASN F CG  1 
ATOM   10994 O  OD1 . ASN F 1 31  ? -44.948 -37.940 13.788  1.00 131.89 ? 31  ASN F OD1 1 
ATOM   10995 N  ND2 . ASN F 1 31  ? -43.337 -37.919 12.208  1.00 128.33 ? 31  ASN F ND2 1 
ATOM   10996 N  N   . PHE F 1 32  ? -42.543 -40.917 16.972  1.00 93.68  ? 32  PHE F N   1 
ATOM   10997 C  CA  . PHE F 1 32  ? -42.541 -42.349 17.287  1.00 86.97  ? 32  PHE F CA  1 
ATOM   10998 C  C   . PHE F 1 32  ? -43.640 -42.727 18.290  1.00 91.12  ? 32  PHE F C   1 
ATOM   10999 O  O   . PHE F 1 32  ? -43.584 -43.788 18.911  1.00 89.83  ? 32  PHE F O   1 
ATOM   11000 C  CB  . PHE F 1 32  ? -41.157 -42.808 17.776  1.00 74.05  ? 32  PHE F CB  1 
ATOM   11001 C  CG  . PHE F 1 32  ? -40.120 -42.885 16.675  1.00 73.13  ? 32  PHE F CG  1 
ATOM   11002 C  CD1 . PHE F 1 32  ? -40.057 -43.992 15.832  1.00 65.19  ? 32  PHE F CD1 1 
ATOM   11003 C  CD2 . PHE F 1 32  ? -39.226 -41.838 16.469  1.00 61.58  ? 32  PHE F CD2 1 
ATOM   11004 C  CE1 . PHE F 1 32  ? -39.121 -44.054 14.816  1.00 52.52  ? 32  PHE F CE1 1 
ATOM   11005 C  CE2 . PHE F 1 32  ? -38.272 -41.898 15.458  1.00 59.16  ? 32  PHE F CE2 1 
ATOM   11006 C  CZ  . PHE F 1 32  ? -38.224 -43.006 14.627  1.00 57.61  ? 32  PHE F CZ  1 
ATOM   11007 N  N   . GLY F 1 33  ? -44.645 -41.861 18.417  1.00 94.52  ? 33  GLY F N   1 
ATOM   11008 C  CA  . GLY F 1 33  ? -45.723 -42.049 19.378  1.00 89.31  ? 33  GLY F CA  1 
ATOM   11009 C  C   . GLY F 1 33  ? -45.180 -42.092 20.796  1.00 91.93  ? 33  GLY F C   1 
ATOM   11010 O  O   . GLY F 1 33  ? -44.117 -41.510 21.071  1.00 87.82  ? 33  GLY F O   1 
ATOM   11011 N  N   . VAL F 1 34  ? -45.923 -42.755 21.690  1.00 89.53  ? 34  VAL F N   1 
ATOM   11012 C  CA  . VAL F 1 34  ? -45.426 -43.156 23.011  1.00 92.52  ? 34  VAL F CA  1 
ATOM   11013 C  C   . VAL F 1 34  ? -44.752 -44.524 22.864  1.00 91.92  ? 34  VAL F C   1 
ATOM   11014 O  O   . VAL F 1 34  ? -45.292 -45.419 22.214  1.00 97.04  ? 34  VAL F O   1 
ATOM   11015 C  CB  . VAL F 1 34  ? -46.557 -43.250 24.075  1.00 63.42  ? 34  VAL F CB  1 
ATOM   11016 C  CG1 . VAL F 1