data_3V5I
# 
_entry.id   3V5I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3V5I         
RCSB  RCSB069620   
WWPDB D_1000069620 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3QWD 'Crystal structure of ClpP from Staphylococcus aureus' unspecified 
PDB 3V5E .                                                      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3V5I 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'List, A.'   1 
'Gersch, M.' 2 
'Groll, M.'  3 
'Sieber, S.' 4 
# 
_citation.id                        primary 
_citation.title                     
;Insights into structural network responsible for oligomerization and activity of bacterial virulence regulator caseinolytic protease P (ClpP) protein.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                9484 
_citation.page_last                 9494 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22291011 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.336222 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gersch, M.'   1 
primary 'List, A.'     2 
primary 'Groll, M.'    3 
primary 'Sieber, S.A.' 4 
# 
_cell.entry_id           3V5I 
_cell.length_a           97.550 
_cell.length_b           109.730 
_cell.length_c           171.410 
_cell.angle_alpha        73.10 
_cell.angle_beta         78.68 
_cell.angle_gamma        71.46 
_cell.Z_PDB              28 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3V5I 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'ATP-dependent Clp protease proteolytic subunit' 22562.680 28  3.4.21.92 S98A ? ? 
2 water   nat water                                            18.015    677 ?         ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endopeptidase Clp' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDT
IQHIKPDVQTICIGMAAAMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQ
SIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETKWSHPQFEK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDT
IQHIKPDVQTICIGMAAAMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQ
SIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETKWSHPQFEK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   LEU n 
1 4   ILE n 
1 5   PRO n 
1 6   THR n 
1 7   VAL n 
1 8   ILE n 
1 9   GLU n 
1 10  THR n 
1 11  THR n 
1 12  ASN n 
1 13  ARG n 
1 14  GLY n 
1 15  GLU n 
1 16  ARG n 
1 17  ALA n 
1 18  TYR n 
1 19  ASP n 
1 20  ILE n 
1 21  TYR n 
1 22  SER n 
1 23  ARG n 
1 24  LEU n 
1 25  LEU n 
1 26  LYS n 
1 27  ASP n 
1 28  ARG n 
1 29  ILE n 
1 30  ILE n 
1 31  MET n 
1 32  LEU n 
1 33  GLY n 
1 34  SER n 
1 35  GLN n 
1 36  ILE n 
1 37  ASP n 
1 38  ASP n 
1 39  ASN n 
1 40  VAL n 
1 41  ALA n 
1 42  ASN n 
1 43  SER n 
1 44  ILE n 
1 45  VAL n 
1 46  SER n 
1 47  GLN n 
1 48  LEU n 
1 49  LEU n 
1 50  PHE n 
1 51  LEU n 
1 52  GLN n 
1 53  ALA n 
1 54  GLN n 
1 55  ASP n 
1 56  SER n 
1 57  GLU n 
1 58  LYS n 
1 59  ASP n 
1 60  ILE n 
1 61  TYR n 
1 62  LEU n 
1 63  TYR n 
1 64  ILE n 
1 65  ASN n 
1 66  SER n 
1 67  PRO n 
1 68  GLY n 
1 69  GLY n 
1 70  SER n 
1 71  VAL n 
1 72  THR n 
1 73  ALA n 
1 74  GLY n 
1 75  PHE n 
1 76  ALA n 
1 77  ILE n 
1 78  TYR n 
1 79  ASP n 
1 80  THR n 
1 81  ILE n 
1 82  GLN n 
1 83  HIS n 
1 84  ILE n 
1 85  LYS n 
1 86  PRO n 
1 87  ASP n 
1 88  VAL n 
1 89  GLN n 
1 90  THR n 
1 91  ILE n 
1 92  CYS n 
1 93  ILE n 
1 94  GLY n 
1 95  MET n 
1 96  ALA n 
1 97  ALA n 
1 98  ALA n 
1 99  MET n 
1 100 GLY n 
1 101 SER n 
1 102 PHE n 
1 103 LEU n 
1 104 LEU n 
1 105 ALA n 
1 106 ALA n 
1 107 GLY n 
1 108 ALA n 
1 109 LYS n 
1 110 GLY n 
1 111 LYS n 
1 112 ARG n 
1 113 PHE n 
1 114 ALA n 
1 115 LEU n 
1 116 PRO n 
1 117 ASN n 
1 118 ALA n 
1 119 GLU n 
1 120 VAL n 
1 121 MET n 
1 122 ILE n 
1 123 HIS n 
1 124 GLN n 
1 125 PRO n 
1 126 LEU n 
1 127 GLY n 
1 128 GLY n 
1 129 ALA n 
1 130 GLN n 
1 131 GLY n 
1 132 GLN n 
1 133 ALA n 
1 134 THR n 
1 135 GLU n 
1 136 ILE n 
1 137 GLU n 
1 138 ILE n 
1 139 ALA n 
1 140 ALA n 
1 141 ASN n 
1 142 HIS n 
1 143 ILE n 
1 144 LEU n 
1 145 LYS n 
1 146 THR n 
1 147 ARG n 
1 148 GLU n 
1 149 LYS n 
1 150 LEU n 
1 151 ASN n 
1 152 ARG n 
1 153 ILE n 
1 154 LEU n 
1 155 SER n 
1 156 GLU n 
1 157 ARG n 
1 158 THR n 
1 159 GLY n 
1 160 GLN n 
1 161 SER n 
1 162 ILE n 
1 163 GLU n 
1 164 LYS n 
1 165 ILE n 
1 166 GLN n 
1 167 LYS n 
1 168 ASP n 
1 169 THR n 
1 170 ASP n 
1 171 ARG n 
1 172 ASP n 
1 173 ASN n 
1 174 PHE n 
1 175 LEU n 
1 176 THR n 
1 177 ALA n 
1 178 GLU n 
1 179 GLU n 
1 180 ALA n 
1 181 LYS n 
1 182 GLU n 
1 183 TYR n 
1 184 GLY n 
1 185 LEU n 
1 186 ILE n 
1 187 ASP n 
1 188 GLU n 
1 189 VAL n 
1 190 MET n 
1 191 VAL n 
1 192 PRO n 
1 193 GLU n 
1 194 THR n 
1 195 LYS n 
1 196 TRP n 
1 197 SER n 
1 198 HIS n 
1 199 PRO n 
1 200 GLN n 
1 201 PHE n 
1 202 GLU n 
1 203 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'clpP, SAOUHSC_00790' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'NCTC 8325' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus subsp. aureus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     93061 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmide 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET301 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CLPP_STAA8 
_struct_ref.pdbx_db_accession          Q2G036 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDT
IQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQ
SIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3V5I A 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
2  1 3V5I B 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
3  1 3V5I C 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
4  1 3V5I D 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
5  1 3V5I E 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
6  1 3V5I F 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
7  1 3V5I G 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
8  1 3V5I H 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
9  1 3V5I I 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
10 1 3V5I J 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
11 1 3V5I K 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
12 1 3V5I L 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
13 1 3V5I M 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
14 1 3V5I N 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
15 1 3V5I O 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
16 1 3V5I P 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
17 1 3V5I Q 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
18 1 3V5I R 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
19 1 3V5I S 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
20 1 3V5I T 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
21 1 3V5I U 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
22 1 3V5I V 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
23 1 3V5I W 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
24 1 3V5I X 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
25 1 3V5I Y 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
26 1 3V5I Z 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
27 1 3V5I a 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
28 1 3V5I b 1 ? 195 ? Q2G036 1 ? 195 ? 1 195 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3V5I ALA A 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  1   
1  3V5I TRP A 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 2   
1  3V5I SER A 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 3   
1  3V5I HIS A 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 4   
1  3V5I PRO A 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 5   
1  3V5I GLN A 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 6   
1  3V5I PHE A 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 7   
1  3V5I GLU A 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 8   
1  3V5I LYS A 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 9   
2  3V5I ALA B 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  10  
2  3V5I TRP B 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 11  
2  3V5I SER B 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 12  
2  3V5I HIS B 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 13  
2  3V5I PRO B 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 14  
2  3V5I GLN B 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 15  
2  3V5I PHE B 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 16  
2  3V5I GLU B 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 17  
2  3V5I LYS B 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 18  
3  3V5I ALA C 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  19  
3  3V5I TRP C 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 20  
3  3V5I SER C 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 21  
3  3V5I HIS C 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 22  
3  3V5I PRO C 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 23  
3  3V5I GLN C 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 24  
3  3V5I PHE C 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 25  
3  3V5I GLU C 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 26  
3  3V5I LYS C 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 27  
4  3V5I ALA D 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  28  
4  3V5I TRP D 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 29  
4  3V5I SER D 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 30  
4  3V5I HIS D 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 31  
4  3V5I PRO D 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 32  
4  3V5I GLN D 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 33  
4  3V5I PHE D 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 34  
4  3V5I GLU D 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 35  
4  3V5I LYS D 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 36  
5  3V5I ALA E 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  37  
5  3V5I TRP E 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 38  
5  3V5I SER E 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 39  
5  3V5I HIS E 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 40  
5  3V5I PRO E 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 41  
5  3V5I GLN E 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 42  
5  3V5I PHE E 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 43  
5  3V5I GLU E 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 44  
5  3V5I LYS E 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 45  
6  3V5I ALA F 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  46  
6  3V5I TRP F 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 47  
6  3V5I SER F 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 48  
6  3V5I HIS F 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 49  
6  3V5I PRO F 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 50  
6  3V5I GLN F 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 51  
6  3V5I PHE F 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 52  
6  3V5I GLU F 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 53  
6  3V5I LYS F 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 54  
7  3V5I ALA G 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  55  
7  3V5I TRP G 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 56  
7  3V5I SER G 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 57  
7  3V5I HIS G 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 58  
7  3V5I PRO G 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 59  
7  3V5I GLN G 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 60  
7  3V5I PHE G 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 61  
7  3V5I GLU G 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 62  
7  3V5I LYS G 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 63  
8  3V5I ALA H 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  64  
8  3V5I TRP H 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 65  
8  3V5I SER H 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 66  
8  3V5I HIS H 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 67  
8  3V5I PRO H 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 68  
8  3V5I GLN H 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 69  
8  3V5I PHE H 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 70  
8  3V5I GLU H 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 71  
8  3V5I LYS H 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 72  
9  3V5I ALA I 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  73  
9  3V5I TRP I 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 74  
9  3V5I SER I 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 75  
9  3V5I HIS I 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 76  
9  3V5I PRO I 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 77  
9  3V5I GLN I 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 78  
9  3V5I PHE I 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 79  
9  3V5I GLU I 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 80  
9  3V5I LYS I 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 81  
10 3V5I ALA J 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  82  
10 3V5I TRP J 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 83  
10 3V5I SER J 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 84  
10 3V5I HIS J 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 85  
10 3V5I PRO J 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 86  
10 3V5I GLN J 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 87  
10 3V5I PHE J 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 88  
10 3V5I GLU J 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 89  
10 3V5I LYS J 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 90  
11 3V5I ALA K 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  91  
11 3V5I TRP K 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 92  
11 3V5I SER K 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 93  
11 3V5I HIS K 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 94  
11 3V5I PRO K 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 95  
11 3V5I GLN K 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 96  
11 3V5I PHE K 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 97  
11 3V5I GLU K 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 98  
11 3V5I LYS K 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 99  
12 3V5I ALA L 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  100 
12 3V5I TRP L 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 101 
12 3V5I SER L 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 102 
12 3V5I HIS L 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 103 
12 3V5I PRO L 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 104 
12 3V5I GLN L 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 105 
12 3V5I PHE L 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 106 
12 3V5I GLU L 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 107 
12 3V5I LYS L 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 108 
13 3V5I ALA M 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  109 
13 3V5I TRP M 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 110 
13 3V5I SER M 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 111 
13 3V5I HIS M 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 112 
13 3V5I PRO M 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 113 
13 3V5I GLN M 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 114 
13 3V5I PHE M 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 115 
13 3V5I GLU M 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 116 
13 3V5I LYS M 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 117 
14 3V5I ALA N 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  118 
14 3V5I TRP N 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 119 
14 3V5I SER N 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 120 
14 3V5I HIS N 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 121 
14 3V5I PRO N 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 122 
14 3V5I GLN N 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 123 
14 3V5I PHE N 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 124 
14 3V5I GLU N 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 125 
14 3V5I LYS N 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 126 
15 3V5I ALA O 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  127 
15 3V5I TRP O 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 128 
15 3V5I SER O 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 129 
15 3V5I HIS O 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 130 
15 3V5I PRO O 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 131 
15 3V5I GLN O 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 132 
15 3V5I PHE O 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 133 
15 3V5I GLU O 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 134 
15 3V5I LYS O 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 135 
16 3V5I ALA P 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  136 
16 3V5I TRP P 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 137 
16 3V5I SER P 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 138 
16 3V5I HIS P 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 139 
16 3V5I PRO P 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 140 
16 3V5I GLN P 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 141 
16 3V5I PHE P 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 142 
16 3V5I GLU P 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 143 
16 3V5I LYS P 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 144 
17 3V5I ALA Q 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  145 
17 3V5I TRP Q 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 146 
17 3V5I SER Q 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 147 
17 3V5I HIS Q 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 148 
17 3V5I PRO Q 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 149 
17 3V5I GLN Q 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 150 
17 3V5I PHE Q 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 151 
17 3V5I GLU Q 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 152 
17 3V5I LYS Q 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 153 
18 3V5I ALA R 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  154 
18 3V5I TRP R 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 155 
18 3V5I SER R 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 156 
18 3V5I HIS R 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 157 
18 3V5I PRO R 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 158 
18 3V5I GLN R 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 159 
18 3V5I PHE R 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 160 
18 3V5I GLU R 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 161 
18 3V5I LYS R 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 162 
19 3V5I ALA S 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  163 
19 3V5I TRP S 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 164 
19 3V5I SER S 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 165 
19 3V5I HIS S 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 166 
19 3V5I PRO S 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 167 
19 3V5I GLN S 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 168 
19 3V5I PHE S 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 169 
19 3V5I GLU S 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 170 
19 3V5I LYS S 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 171 
20 3V5I ALA T 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  172 
20 3V5I TRP T 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 173 
20 3V5I SER T 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 174 
20 3V5I HIS T 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 175 
20 3V5I PRO T 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 176 
20 3V5I GLN T 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 177 
20 3V5I PHE T 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 178 
20 3V5I GLU T 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 179 
20 3V5I LYS T 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 180 
21 3V5I ALA U 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  181 
21 3V5I TRP U 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 182 
21 3V5I SER U 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 183 
21 3V5I HIS U 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 184 
21 3V5I PRO U 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 185 
21 3V5I GLN U 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 186 
21 3V5I PHE U 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 187 
21 3V5I GLU U 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 188 
21 3V5I LYS U 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 189 
22 3V5I ALA V 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  190 
22 3V5I TRP V 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 191 
22 3V5I SER V 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 192 
22 3V5I HIS V 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 193 
22 3V5I PRO V 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 194 
22 3V5I GLN V 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 195 
22 3V5I PHE V 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 196 
22 3V5I GLU V 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 197 
22 3V5I LYS V 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 198 
23 3V5I ALA W 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  199 
23 3V5I TRP W 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 200 
23 3V5I SER W 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 201 
23 3V5I HIS W 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 202 
23 3V5I PRO W 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 203 
23 3V5I GLN W 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 204 
23 3V5I PHE W 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 205 
23 3V5I GLU W 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 206 
23 3V5I LYS W 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 207 
24 3V5I ALA X 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  208 
24 3V5I TRP X 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 209 
24 3V5I SER X 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 210 
24 3V5I HIS X 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 211 
24 3V5I PRO X 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 212 
24 3V5I GLN X 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 213 
24 3V5I PHE X 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 214 
24 3V5I GLU X 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 215 
24 3V5I LYS X 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 216 
25 3V5I ALA Y 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  217 
25 3V5I TRP Y 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 218 
25 3V5I SER Y 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 219 
25 3V5I HIS Y 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 220 
25 3V5I PRO Y 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 221 
25 3V5I GLN Y 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 222 
25 3V5I PHE Y 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 223 
25 3V5I GLU Y 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 224 
25 3V5I LYS Y 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 225 
26 3V5I ALA Z 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  226 
26 3V5I TRP Z 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 227 
26 3V5I SER Z 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 228 
26 3V5I HIS Z 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 229 
26 3V5I PRO Z 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 230 
26 3V5I GLN Z 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 231 
26 3V5I PHE Z 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 232 
26 3V5I GLU Z 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 233 
26 3V5I LYS Z 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 234 
27 3V5I ALA a 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  235 
27 3V5I TRP a 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 236 
27 3V5I SER a 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 237 
27 3V5I HIS a 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 238 
27 3V5I PRO a 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 239 
27 3V5I GLN a 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 240 
27 3V5I PHE a 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 241 
27 3V5I GLU a 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 242 
27 3V5I LYS a 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 243 
28 3V5I ALA b 98  ? UNP Q2G036 SER 98 'ENGINEERED MUTATION' 98  244 
28 3V5I TRP b 196 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      196 245 
28 3V5I SER b 197 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      197 246 
28 3V5I HIS b 198 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      198 247 
28 3V5I PRO b 199 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      199 248 
28 3V5I GLN b 200 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      200 249 
28 3V5I PHE b 201 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      201 250 
28 3V5I GLU b 202 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      202 251 
28 3V5I LYS b 203 ? UNP Q2G036 ?   ?  'EXPRESSION TAG'      203 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3V5I 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   53.01 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'0.18 M Magnesium acetate, 0.1 M Sodium cacodylate, 12% MPD, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-11-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double-crystal fixed-exit monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3V5I 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             25.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   150830 
_reflns.number_all                   157772 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_netI_over_sigmaI        5.55 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   96.5 
_reflns_shell.Rmerge_I_obs           0.393 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.67 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3V5I 
_refine.ls_number_reflns_obs                     143288 
_refine.ls_number_reflns_all                     150830 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.80 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    95.62 
_refine.ls_R_factor_obs                          0.21730 
_refine.ls_R_factor_R_work                       0.21603 
_refine.ls_R_factor_R_free                       0.24151 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  7542 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               86.520 
_refine.aniso_B[1][1]                            4.42 
_refine.aniso_B[2][2]                            -1.84 
_refine.aniso_B[3][3]                            -2.96 
_refine.aniso_B[1][2]                            -1.67 
_refine.aniso_B[1][3]                            3.05 
_refine.aniso_B[2][3]                            0.41 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.pdbx_starting_model                      3QWD 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.371 
_refine.overall_SU_ML                            0.304 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             32.930 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        39788 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             677 
_refine_hist.number_atoms_total               40465 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        24.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       0.012  0.019  ? 40292 ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1.357  1.974  ? 54376 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 5.344  5.000  ? 5096  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 36.680 25.385 ? 1820  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 16.237 15.000 ? 7392  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 12.796 15.000 ? 224   ? 'X-RAY DIFFRACTION' 
r_chiral_restr         0.095  0.200  ? 6328  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   0.005  0.021  ? 29820 ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.870 
_refine_ls_shell.number_reflns_R_work             10337 
_refine_ls_shell.R_factor_R_work                  0.349 
_refine_ls_shell.percent_reflns_obs               96.57 
_refine_ls_shell.R_factor_R_free                  0.357 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             544 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1  given ? 1.000000  0.000000  0.000000  0.000000  1.000000  0.000000  0.000000  0.000000  1.000000  0.00000    0.00000   0.00000 
2  given ? 0.612840  -0.278482 0.739510  0.239231  0.957311  0.162248  -0.753124 0.077482  0.653300  14.22802   12.16527  
-32.80698  
3  given ? -0.229332 -0.385553 0.893732  0.253107  0.862994  0.437240  -0.939864 0.326482  -0.100326 -4.79300   21.99991  
-63.67568  
4  given ? -0.894401 -0.238647 0.378277  0.047437  0.790370  0.610790  -0.444742 0.564236  -0.695588 -41.65689  21.89986  
-69.39188  
5  given ? -0.892843 0.055409  -0.446946 -0.233287 0.791987  0.564211  0.385238  0.608019  -0.694194 -68.60879  12.12808  
-45.16394  
6  given ? -0.197812 0.257766  -0.945742 -0.385960 0.866389  0.316866  0.901058  0.427699  -0.071895 -64.78250  -0.74090  -9.82493 
7  given ? 0.631455  0.231255  -0.740126 -0.269900 0.960355  0.069795  0.726924  0.155687  0.668837  -34.80478  -5.32518  9.45954 
8  given ? 0.694918  -0.151567 0.702934  -0.148197 -0.986736 -0.066254 0.703652  -0.058131 -0.708163 14.73225   3.57076   
-33.04937  
9  given ? 0.988304  0.137923  -0.065049 0.137838  -0.990438 -0.005824 -0.065230 -0.003210 -0.997865 -2.20293   13.77246  
-64.96279  
10 given ? 0.547341  0.355716  -0.757551 0.354705  -0.918456 -0.174992 -0.758025 -0.172926 -0.628883 -38.76703  14.38516  
-72.65258  
11 given ? -0.314699 0.342526  -0.885235 0.347366  -0.826365 -0.443235 -0.883347 -0.446986 0.141074  -67.24151  5.09557   
-50.14194  
12 given ? -0.941938 0.118455  -0.314198 0.108638  -0.777880 -0.618951 -0.317726 -0.617147 0.719847  -65.68723  -7.62028  
-14.83545  
13 given ? -0.859687 -0.157411 0.485964  -0.163248 -0.816788 -0.553361 0.484034  -0.555049 0.676485  -37.36406  -12.89384 6.20315 
14 given ? -0.139601 -0.283156 0.948860  -0.279438 -0.908030 -0.312084 0.949961  -0.308714 0.047637  -1.55738   -8.22059  -1.13756 
15 given ? -0.205489 -0.343942 0.916230  -0.525158 -0.751250 -0.399791 0.825823  -0.563319 -0.026250 70.91398   -53.72794 48.82568 
16 given ? 0.621286  -0.421777 0.660384  -0.423086 -0.889932 -0.170349 0.659547  -0.173564 -0.731351 108.55198  -15.27111 
-56.91235  
17 given ? 0.986522  -0.143844 -0.077991 -0.152735 -0.980515 -0.123539 -0.058701 0.133786  -0.989270 43.96880   14.05837  
-152.06322 
18 given ? 0.617568  0.279246  -0.735276 0.081288  -0.952505 -0.293472 -0.782306 0.121470  -0.610936 -73.49903  12.04142  
-164.94968 
19 given ? -0.203148 0.524664  -0.826716 0.101834  -0.828421 -0.550770 -0.973838 -0.196076 0.114864  -155.96939 -19.79066 
-86.67632  
20 given ? -0.869789 0.409804  -0.274822 -0.106128 -0.699310 -0.706897 -0.481875 -0.585685 0.651744  -140.68433 -57.97894 25.60225 
21 given ? -0.866108 0.026013  0.499179  -0.386712 -0.667629 -0.636180 0.316717  -0.744040 0.588299  -39.76838  -72.55490 85.27555 
22 given ? 0.512633  -0.527414 0.677526  0.496931  0.825755  0.266811  -0.700190 0.199907  0.685398  106.12038  44.11281  
-15.31763  
23 given ? -0.326340 -0.412120 0.850681  0.487097  0.697944  0.524987  -0.810086 0.585688  -0.027025 56.76730   76.95535  
-117.80689 
24 given ? -0.927272 -0.018289 0.373943  0.268643  0.663172  0.698594  -0.260765 0.748243  -0.610028 -57.25275  80.79517  
-146.82852 
25 given ? -0.842951 0.354214  -0.404927 -0.000278 0.752379  0.658730  0.537990  0.555390  -0.634121 -151.44670 52.56436  
-81.14070  
26 given ? -0.126959 0.420715  -0.898265 -0.116204 0.893049  0.434696  0.985078  0.159570  -0.064492 -154.03682 13.43832  31.27200 
27 given ? 0.667954  0.133643  -0.732104 0.016343  0.980872  0.193966  0.744023  -0.141526 0.652993  -64.40492  -6.52636  
103.99892  
28 given ? 0.958130  -0.284952 -0.028110 0.286269  0.951187  0.115299  -0.006117 -0.118518 0.992933  52.08113   6.26383   84.05774 
# 
_struct.entry_id                  3V5I 
_struct.title                     'The crystal structure of the mutant ClpP S98A (Staphylococcus aureus)' 
_struct.pdbx_descriptor           'ATP-dependent Clp protease proteolytic subunit (E.C.3.4.21.92)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3V5I 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Hydrolase, whole proteome' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE A  20  ? LYS A  26  ? ILE A 20  LYS A 26  1 ? 7  
HELX_P HELX_P2   2   ASP A  37  ? ASP A  55  ? ASP A 37  ASP A 55  1 ? 19 
HELX_P HELX_P3   3   SER A  70  ? ILE A  84  ? SER A 70  ILE A 84  1 ? 15 
HELX_P HELX_P4   4   ALA A  98  ? ALA A  105 ? ALA A 98  ALA A 105 1 ? 8  
HELX_P HELX_P5   5   ALA A  133 ? GLY A  159 ? ALA A 133 GLY A 159 1 ? 27 
HELX_P HELX_P6   6   SER A  161 ? THR A  169 ? SER A 161 THR A 169 1 ? 9  
HELX_P HELX_P7   7   ALA A  177 ? TYR A  183 ? ALA A 177 TYR A 183 1 ? 7  
HELX_P HELX_P8   8   ILE B  20  ? LYS B  26  ? ILE B 20  LYS B 26  1 ? 7  
HELX_P HELX_P9   9   ASP B  37  ? ASP B  55  ? ASP B 37  ASP B 55  1 ? 19 
HELX_P HELX_P10  10  SER B  70  ? ILE B  84  ? SER B 70  ILE B 84  1 ? 15 
HELX_P HELX_P11  11  ALA B  98  ? ALA B  105 ? ALA B 98  ALA B 105 1 ? 8  
HELX_P HELX_P12  12  ALA B  133 ? GLY B  159 ? ALA B 133 GLY B 159 1 ? 27 
HELX_P HELX_P13  13  SER B  161 ? THR B  169 ? SER B 161 THR B 169 1 ? 9  
HELX_P HELX_P14  14  ALA B  177 ? GLY B  184 ? ALA B 177 GLY B 184 1 ? 8  
HELX_P HELX_P15  15  ILE C  20  ? LYS C  26  ? ILE C 20  LYS C 26  1 ? 7  
HELX_P HELX_P16  16  ASP C  37  ? ASP C  55  ? ASP C 37  ASP C 55  1 ? 19 
HELX_P HELX_P17  17  SER C  70  ? ILE C  84  ? SER C 70  ILE C 84  1 ? 15 
HELX_P HELX_P18  18  ALA C  98  ? ALA C  105 ? ALA C 98  ALA C 105 1 ? 8  
HELX_P HELX_P19  19  ALA C  133 ? GLY C  159 ? ALA C 133 GLY C 159 1 ? 27 
HELX_P HELX_P20  20  SER C  161 ? THR C  169 ? SER C 161 THR C 169 1 ? 9  
HELX_P HELX_P21  21  ALA C  177 ? GLY C  184 ? ALA C 177 GLY C 184 1 ? 8  
HELX_P HELX_P22  22  ILE D  20  ? ASP D  27  ? ILE D 20  ASP D 27  1 ? 8  
HELX_P HELX_P23  23  ASP D  37  ? ASP D  55  ? ASP D 37  ASP D 55  1 ? 19 
HELX_P HELX_P24  24  SER D  70  ? ILE D  84  ? SER D 70  ILE D 84  1 ? 15 
HELX_P HELX_P25  25  ALA D  98  ? ALA D  105 ? ALA D 98  ALA D 105 1 ? 8  
HELX_P HELX_P26  26  ALA D  133 ? GLY D  159 ? ALA D 133 GLY D 159 1 ? 27 
HELX_P HELX_P27  27  SER D  161 ? THR D  169 ? SER D 161 THR D 169 1 ? 9  
HELX_P HELX_P28  28  ALA D  177 ? GLY D  184 ? ALA D 177 GLY D 184 1 ? 8  
HELX_P HELX_P29  29  ILE E  20  ? LYS E  26  ? ILE E 20  LYS E 26  1 ? 7  
HELX_P HELX_P30  30  ASP E  37  ? ASP E  55  ? ASP E 37  ASP E 55  1 ? 19 
HELX_P HELX_P31  31  SER E  70  ? ILE E  84  ? SER E 70  ILE E 84  1 ? 15 
HELX_P HELX_P32  32  ALA E  98  ? ALA E  105 ? ALA E 98  ALA E 105 1 ? 8  
HELX_P HELX_P33  33  ALA E  133 ? GLY E  159 ? ALA E 133 GLY E 159 1 ? 27 
HELX_P HELX_P34  34  SER E  161 ? THR E  169 ? SER E 161 THR E 169 1 ? 9  
HELX_P HELX_P35  35  ALA E  177 ? GLY E  184 ? ALA E 177 GLY E 184 1 ? 8  
HELX_P HELX_P36  36  ILE F  20  ? LYS F  26  ? ILE F 20  LYS F 26  1 ? 7  
HELX_P HELX_P37  37  ASP F  37  ? ASP F  55  ? ASP F 37  ASP F 55  1 ? 19 
HELX_P HELX_P38  38  SER F  70  ? ILE F  84  ? SER F 70  ILE F 84  1 ? 15 
HELX_P HELX_P39  39  ALA F  98  ? ALA F  105 ? ALA F 98  ALA F 105 1 ? 8  
HELX_P HELX_P40  40  ALA F  133 ? GLY F  159 ? ALA F 133 GLY F 159 1 ? 27 
HELX_P HELX_P41  41  SER F  161 ? THR F  169 ? SER F 161 THR F 169 1 ? 9  
HELX_P HELX_P42  42  ALA F  177 ? GLY F  184 ? ALA F 177 GLY F 184 1 ? 8  
HELX_P HELX_P43  43  ILE G  20  ? LYS G  26  ? ILE G 20  LYS G 26  1 ? 7  
HELX_P HELX_P44  44  ASP G  37  ? ASP G  55  ? ASP G 37  ASP G 55  1 ? 19 
HELX_P HELX_P45  45  SER G  70  ? ILE G  84  ? SER G 70  ILE G 84  1 ? 15 
HELX_P HELX_P46  46  ALA G  98  ? ALA G  105 ? ALA G 98  ALA G 105 1 ? 8  
HELX_P HELX_P47  47  ALA G  133 ? GLY G  159 ? ALA G 133 GLY G 159 1 ? 27 
HELX_P HELX_P48  48  SER G  161 ? THR G  169 ? SER G 161 THR G 169 1 ? 9  
HELX_P HELX_P49  49  ALA G  177 ? GLY G  184 ? ALA G 177 GLY G 184 1 ? 8  
HELX_P HELX_P50  50  ILE H  20  ? LYS H  26  ? ILE H 20  LYS H 26  1 ? 7  
HELX_P HELX_P51  51  ASP H  37  ? ASP H  55  ? ASP H 37  ASP H 55  1 ? 19 
HELX_P HELX_P52  52  SER H  70  ? ILE H  84  ? SER H 70  ILE H 84  1 ? 15 
HELX_P HELX_P53  53  ALA H  98  ? ALA H  105 ? ALA H 98  ALA H 105 1 ? 8  
HELX_P HELX_P54  54  ALA H  133 ? GLY H  159 ? ALA H 133 GLY H 159 1 ? 27 
HELX_P HELX_P55  55  SER H  161 ? THR H  169 ? SER H 161 THR H 169 1 ? 9  
HELX_P HELX_P56  56  ALA H  177 ? TYR H  183 ? ALA H 177 TYR H 183 1 ? 7  
HELX_P HELX_P57  57  ILE I  20  ? LYS I  26  ? ILE I 20  LYS I 26  1 ? 7  
HELX_P HELX_P58  58  ASP I  37  ? ASP I  55  ? ASP I 37  ASP I 55  1 ? 19 
HELX_P HELX_P59  59  SER I  70  ? ILE I  84  ? SER I 70  ILE I 84  1 ? 15 
HELX_P HELX_P60  60  ALA I  98  ? ALA I  105 ? ALA I 98  ALA I 105 1 ? 8  
HELX_P HELX_P61  61  ALA I  133 ? GLY I  159 ? ALA I 133 GLY I 159 1 ? 27 
HELX_P HELX_P62  62  SER I  161 ? THR I  169 ? SER I 161 THR I 169 1 ? 9  
HELX_P HELX_P63  63  ALA I  177 ? TYR I  183 ? ALA I 177 TYR I 183 1 ? 7  
HELX_P HELX_P64  64  ILE J  20  ? LYS J  26  ? ILE J 20  LYS J 26  1 ? 7  
HELX_P HELX_P65  65  ASP J  37  ? ASP J  55  ? ASP J 37  ASP J 55  1 ? 19 
HELX_P HELX_P66  66  SER J  70  ? ILE J  84  ? SER J 70  ILE J 84  1 ? 15 
HELX_P HELX_P67  67  ALA J  98  ? ALA J  105 ? ALA J 98  ALA J 105 1 ? 8  
HELX_P HELX_P68  68  ALA J  133 ? GLY J  159 ? ALA J 133 GLY J 159 1 ? 27 
HELX_P HELX_P69  69  SER J  161 ? THR J  169 ? SER J 161 THR J 169 1 ? 9  
HELX_P HELX_P70  70  THR J  176 ? TYR J  183 ? THR J 176 TYR J 183 1 ? 8  
HELX_P HELX_P71  71  ILE K  20  ? LYS K  26  ? ILE K 20  LYS K 26  1 ? 7  
HELX_P HELX_P72  72  ASP K  37  ? ASP K  55  ? ASP K 37  ASP K 55  1 ? 19 
HELX_P HELX_P73  73  SER K  70  ? ILE K  84  ? SER K 70  ILE K 84  1 ? 15 
HELX_P HELX_P74  74  ALA K  98  ? ALA K  105 ? ALA K 98  ALA K 105 1 ? 8  
HELX_P HELX_P75  75  ALA K  133 ? GLY K  159 ? ALA K 133 GLY K 159 1 ? 27 
HELX_P HELX_P76  76  SER K  161 ? THR K  169 ? SER K 161 THR K 169 1 ? 9  
HELX_P HELX_P77  77  ALA K  177 ? GLY K  184 ? ALA K 177 GLY K 184 1 ? 8  
HELX_P HELX_P78  78  ILE L  20  ? LYS L  26  ? ILE L 20  LYS L 26  1 ? 7  
HELX_P HELX_P79  79  ASP L  37  ? ASP L  55  ? ASP L 37  ASP L 55  1 ? 19 
HELX_P HELX_P80  80  SER L  70  ? ILE L  84  ? SER L 70  ILE L 84  1 ? 15 
HELX_P HELX_P81  81  ALA L  98  ? ALA L  105 ? ALA L 98  ALA L 105 1 ? 8  
HELX_P HELX_P82  82  ALA L  133 ? GLY L  159 ? ALA L 133 GLY L 159 1 ? 27 
HELX_P HELX_P83  83  SER L  161 ? THR L  169 ? SER L 161 THR L 169 1 ? 9  
HELX_P HELX_P84  84  ALA L  177 ? GLY L  184 ? ALA L 177 GLY L 184 1 ? 8  
HELX_P HELX_P85  85  ILE M  20  ? LYS M  26  ? ILE M 20  LYS M 26  1 ? 7  
HELX_P HELX_P86  86  ASP M  37  ? ASP M  55  ? ASP M 37  ASP M 55  1 ? 19 
HELX_P HELX_P87  87  SER M  70  ? ILE M  84  ? SER M 70  ILE M 84  1 ? 15 
HELX_P HELX_P88  88  ALA M  98  ? ALA M  105 ? ALA M 98  ALA M 105 1 ? 8  
HELX_P HELX_P89  89  ALA M  133 ? GLY M  159 ? ALA M 133 GLY M 159 1 ? 27 
HELX_P HELX_P90  90  SER M  161 ? THR M  169 ? SER M 161 THR M 169 1 ? 9  
HELX_P HELX_P91  91  ALA M  177 ? TYR M  183 ? ALA M 177 TYR M 183 1 ? 7  
HELX_P HELX_P92  92  ILE N  20  ? LYS N  26  ? ILE N 20  LYS N 26  1 ? 7  
HELX_P HELX_P93  93  ASP N  37  ? ASP N  55  ? ASP N 37  ASP N 55  1 ? 19 
HELX_P HELX_P94  94  SER N  70  ? ILE N  84  ? SER N 70  ILE N 84  1 ? 15 
HELX_P HELX_P95  95  ALA N  98  ? ALA N  106 ? ALA N 98  ALA N 106 1 ? 9  
HELX_P HELX_P96  96  ALA N  133 ? GLY N  159 ? ALA N 133 GLY N 159 1 ? 27 
HELX_P HELX_P97  97  SER N  161 ? THR N  169 ? SER N 161 THR N 169 1 ? 9  
HELX_P HELX_P98  98  ALA N  177 ? TYR N  183 ? ALA N 177 TYR N 183 1 ? 7  
HELX_P HELX_P99  99  ILE O  20  ? LYS O  26  ? ILE O 20  LYS O 26  1 ? 7  
HELX_P HELX_P100 100 ASP O  37  ? ASP O  55  ? ASP O 37  ASP O 55  1 ? 19 
HELX_P HELX_P101 101 SER O  70  ? ILE O  84  ? SER O 70  ILE O 84  1 ? 15 
HELX_P HELX_P102 102 ALA O  98  ? ALA O  105 ? ALA O 98  ALA O 105 1 ? 8  
HELX_P HELX_P103 103 ALA O  133 ? GLY O  159 ? ALA O 133 GLY O 159 1 ? 27 
HELX_P HELX_P104 104 SER O  161 ? THR O  169 ? SER O 161 THR O 169 1 ? 9  
HELX_P HELX_P105 105 ALA O  177 ? TYR O  183 ? ALA O 177 TYR O 183 1 ? 7  
HELX_P HELX_P106 106 ILE P  20  ? LYS P  26  ? ILE P 20  LYS P 26  1 ? 7  
HELX_P HELX_P107 107 ASP P  37  ? ASP P  55  ? ASP P 37  ASP P 55  1 ? 19 
HELX_P HELX_P108 108 SER P  70  ? ILE P  84  ? SER P 70  ILE P 84  1 ? 15 
HELX_P HELX_P109 109 ALA P  98  ? ALA P  105 ? ALA P 98  ALA P 105 1 ? 8  
HELX_P HELX_P110 110 ALA P  133 ? GLY P  159 ? ALA P 133 GLY P 159 1 ? 27 
HELX_P HELX_P111 111 SER P  161 ? THR P  169 ? SER P 161 THR P 169 1 ? 9  
HELX_P HELX_P112 112 ALA P  177 ? TYR P  183 ? ALA P 177 TYR P 183 1 ? 7  
HELX_P HELX_P113 113 ILE Q  20  ? ASP Q  27  ? ILE Q 20  ASP Q 27  1 ? 8  
HELX_P HELX_P114 114 ASP Q  37  ? ASP Q  55  ? ASP Q 37  ASP Q 55  1 ? 19 
HELX_P HELX_P115 115 SER Q  70  ? ILE Q  84  ? SER Q 70  ILE Q 84  1 ? 15 
HELX_P HELX_P116 116 ALA Q  98  ? ALA Q  105 ? ALA Q 98  ALA Q 105 1 ? 8  
HELX_P HELX_P117 117 ALA Q  133 ? GLY Q  159 ? ALA Q 133 GLY Q 159 1 ? 27 
HELX_P HELX_P118 118 SER Q  161 ? THR Q  169 ? SER Q 161 THR Q 169 1 ? 9  
HELX_P HELX_P119 119 ALA Q  177 ? TYR Q  183 ? ALA Q 177 TYR Q 183 1 ? 7  
HELX_P HELX_P120 120 ILE R  20  ? LYS R  26  ? ILE R 20  LYS R 26  1 ? 7  
HELX_P HELX_P121 121 ASP R  37  ? ASP R  55  ? ASP R 37  ASP R 55  1 ? 19 
HELX_P HELX_P122 122 SER R  70  ? ILE R  84  ? SER R 70  ILE R 84  1 ? 15 
HELX_P HELX_P123 123 ALA R  98  ? ALA R  106 ? ALA R 98  ALA R 106 1 ? 9  
HELX_P HELX_P124 124 ALA R  133 ? GLY R  159 ? ALA R 133 GLY R 159 1 ? 27 
HELX_P HELX_P125 125 SER R  161 ? THR R  169 ? SER R 161 THR R 169 1 ? 9  
HELX_P HELX_P126 126 ALA R  177 ? GLY R  184 ? ALA R 177 GLY R 184 1 ? 8  
HELX_P HELX_P127 127 ILE S  20  ? LYS S  26  ? ILE S 20  LYS S 26  1 ? 7  
HELX_P HELX_P128 128 ASP S  37  ? ASP S  55  ? ASP S 37  ASP S 55  1 ? 19 
HELX_P HELX_P129 129 SER S  70  ? ILE S  84  ? SER S 70  ILE S 84  1 ? 15 
HELX_P HELX_P130 130 ALA S  98  ? ALA S  105 ? ALA S 98  ALA S 105 1 ? 8  
HELX_P HELX_P131 131 ALA S  133 ? GLY S  159 ? ALA S 133 GLY S 159 1 ? 27 
HELX_P HELX_P132 132 SER S  161 ? THR S  169 ? SER S 161 THR S 169 1 ? 9  
HELX_P HELX_P133 133 ALA S  177 ? TYR S  183 ? ALA S 177 TYR S 183 1 ? 7  
HELX_P HELX_P134 134 ILE T  20  ? LYS T  26  ? ILE T 20  LYS T 26  1 ? 7  
HELX_P HELX_P135 135 ASP T  37  ? ASP T  55  ? ASP T 37  ASP T 55  1 ? 19 
HELX_P HELX_P136 136 SER T  70  ? ILE T  84  ? SER T 70  ILE T 84  1 ? 15 
HELX_P HELX_P137 137 ALA T  98  ? ALA T  105 ? ALA T 98  ALA T 105 1 ? 8  
HELX_P HELX_P138 138 ALA T  133 ? GLY T  159 ? ALA T 133 GLY T 159 1 ? 27 
HELX_P HELX_P139 139 SER T  161 ? THR T  169 ? SER T 161 THR T 169 1 ? 9  
HELX_P HELX_P140 140 ALA T  177 ? TYR T  183 ? ALA T 177 TYR T 183 1 ? 7  
HELX_P HELX_P141 141 ILE U  20  ? LYS U  26  ? ILE U 20  LYS U 26  1 ? 7  
HELX_P HELX_P142 142 ASP U  37  ? ASP U  55  ? ASP U 37  ASP U 55  1 ? 19 
HELX_P HELX_P143 143 SER U  70  ? ILE U  84  ? SER U 70  ILE U 84  1 ? 15 
HELX_P HELX_P144 144 ALA U  98  ? ALA U  105 ? ALA U 98  ALA U 105 1 ? 8  
HELX_P HELX_P145 145 ALA U  133 ? GLY U  159 ? ALA U 133 GLY U 159 1 ? 27 
HELX_P HELX_P146 146 SER U  161 ? THR U  169 ? SER U 161 THR U 169 1 ? 9  
HELX_P HELX_P147 147 ALA U  177 ? GLY U  184 ? ALA U 177 GLY U 184 1 ? 8  
HELX_P HELX_P148 148 ILE V  20  ? LYS V  26  ? ILE V 20  LYS V 26  1 ? 7  
HELX_P HELX_P149 149 ASP V  37  ? ASP V  55  ? ASP V 37  ASP V 55  1 ? 19 
HELX_P HELX_P150 150 SER V  70  ? ILE V  84  ? SER V 70  ILE V 84  1 ? 15 
HELX_P HELX_P151 151 ALA V  98  ? ALA V  105 ? ALA V 98  ALA V 105 1 ? 8  
HELX_P HELX_P152 152 ALA V  133 ? GLY V  159 ? ALA V 133 GLY V 159 1 ? 27 
HELX_P HELX_P153 153 SER V  161 ? THR V  169 ? SER V 161 THR V 169 1 ? 9  
HELX_P HELX_P154 154 ALA V  177 ? GLY V  184 ? ALA V 177 GLY V 184 1 ? 8  
HELX_P HELX_P155 155 ILE W  20  ? LYS W  26  ? ILE W 20  LYS W 26  1 ? 7  
HELX_P HELX_P156 156 ASP W  37  ? ASP W  55  ? ASP W 37  ASP W 55  1 ? 19 
HELX_P HELX_P157 157 SER W  70  ? ILE W  84  ? SER W 70  ILE W 84  1 ? 15 
HELX_P HELX_P158 158 ALA W  98  ? ALA W  105 ? ALA W 98  ALA W 105 1 ? 8  
HELX_P HELX_P159 159 ALA W  133 ? GLY W  159 ? ALA W 133 GLY W 159 1 ? 27 
HELX_P HELX_P160 160 SER W  161 ? THR W  169 ? SER W 161 THR W 169 1 ? 9  
HELX_P HELX_P161 161 ALA W  177 ? GLY W  184 ? ALA W 177 GLY W 184 1 ? 8  
HELX_P HELX_P162 162 ILE X  20  ? LYS X  26  ? ILE X 20  LYS X 26  1 ? 7  
HELX_P HELX_P163 163 ASP X  37  ? ASP X  55  ? ASP X 37  ASP X 55  1 ? 19 
HELX_P HELX_P164 164 SER X  70  ? ILE X  84  ? SER X 70  ILE X 84  1 ? 15 
HELX_P HELX_P165 165 ALA X  98  ? ALA X  105 ? ALA X 98  ALA X 105 1 ? 8  
HELX_P HELX_P166 166 ALA X  133 ? GLY X  159 ? ALA X 133 GLY X 159 1 ? 27 
HELX_P HELX_P167 167 SER X  161 ? THR X  169 ? SER X 161 THR X 169 1 ? 9  
HELX_P HELX_P168 168 ALA X  177 ? TYR X  183 ? ALA X 177 TYR X 183 1 ? 7  
HELX_P HELX_P169 169 ILE Y  20  ? LYS Y  26  ? ILE Y 20  LYS Y 26  1 ? 7  
HELX_P HELX_P170 170 ASP Y  37  ? ASP Y  55  ? ASP Y 37  ASP Y 55  1 ? 19 
HELX_P HELX_P171 171 SER Y  70  ? ILE Y  84  ? SER Y 70  ILE Y 84  1 ? 15 
HELX_P HELX_P172 172 ALA Y  98  ? ALA Y  105 ? ALA Y 98  ALA Y 105 1 ? 8  
HELX_P HELX_P173 173 ALA Y  133 ? GLY Y  159 ? ALA Y 133 GLY Y 159 1 ? 27 
HELX_P HELX_P174 174 SER Y  161 ? THR Y  169 ? SER Y 161 THR Y 169 1 ? 9  
HELX_P HELX_P175 175 ALA Y  177 ? GLY Y  184 ? ALA Y 177 GLY Y 184 1 ? 8  
HELX_P HELX_P176 176 ILE Z  20  ? LYS Z  26  ? ILE Z 20  LYS Z 26  1 ? 7  
HELX_P HELX_P177 177 ASP Z  37  ? ASP Z  55  ? ASP Z 37  ASP Z 55  1 ? 19 
HELX_P HELX_P178 178 SER Z  70  ? ILE Z  84  ? SER Z 70  ILE Z 84  1 ? 15 
HELX_P HELX_P179 179 ALA Z  98  ? ALA Z  105 ? ALA Z 98  ALA Z 105 1 ? 8  
HELX_P HELX_P180 180 ALA Z  133 ? GLY Z  159 ? ALA Z 133 GLY Z 159 1 ? 27 
HELX_P HELX_P181 181 SER Z  161 ? THR Z  169 ? SER Z 161 THR Z 169 1 ? 9  
HELX_P HELX_P182 182 ALA Z  177 ? GLY Z  184 ? ALA Z 177 GLY Z 184 1 ? 8  
HELX_P HELX_P183 183 ILE AA 20  ? LYS AA 26  ? ILE a 20  LYS a 26  1 ? 7  
HELX_P HELX_P184 184 ASP AA 37  ? ASP AA 55  ? ASP a 37  ASP a 55  1 ? 19 
HELX_P HELX_P185 185 SER AA 70  ? ILE AA 84  ? SER a 70  ILE a 84  1 ? 15 
HELX_P HELX_P186 186 ALA AA 98  ? ALA AA 105 ? ALA a 98  ALA a 105 1 ? 8  
HELX_P HELX_P187 187 ALA AA 133 ? GLY AA 159 ? ALA a 133 GLY a 159 1 ? 27 
HELX_P HELX_P188 188 SER AA 161 ? THR AA 169 ? SER a 161 THR a 169 1 ? 9  
HELX_P HELX_P189 189 ALA AA 177 ? GLY AA 184 ? ALA a 177 GLY a 184 1 ? 8  
HELX_P HELX_P190 190 ILE BA 20  ? LYS BA 26  ? ILE b 20  LYS b 26  1 ? 7  
HELX_P HELX_P191 191 ASP BA 37  ? ASP BA 55  ? ASP b 37  ASP b 55  1 ? 19 
HELX_P HELX_P192 192 SER BA 70  ? ILE BA 84  ? SER b 70  ILE b 84  1 ? 15 
HELX_P HELX_P193 193 ALA BA 98  ? ALA BA 105 ? ALA b 98  ALA b 105 1 ? 8  
HELX_P HELX_P194 194 ALA BA 133 ? GLY BA 159 ? ALA b 133 GLY b 159 1 ? 27 
HELX_P HELX_P195 195 SER BA 161 ? THR BA 169 ? SER b 161 THR b 169 1 ? 9  
HELX_P HELX_P196 196 ALA BA 177 ? GLY BA 184 ? ALA b 177 GLY b 184 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 5 ? 
C  ? 5 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 5 ? 
G  ? 5 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 5 ? 
K  ? 5 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 5 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 2 ? 
R  ? 5 ? 
S  ? 5 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 5 ? 
W  ? 5 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 5 ? 
AE ? 5 ? 
AF ? 2 ? 
AG ? 5 ? 
AH ? 5 ? 
AI ? 2 ? 
AJ ? 5 ? 
AK ? 5 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 5 ? 
AO ? 2 ? 
AP ? 5 ? 
AQ ? 5 ? 
AR ? 2 ? 
AS ? 5 ? 
AT ? 5 ? 
AU ? 2 ? 
AV ? 5 ? 
AW ? 5 ? 
AX ? 2 ? 
AY ? 5 ? 
AZ ? 5 ? 
BA ? 2 ? 
BB ? 2 ? 
BC ? 5 ? 
BD ? 5 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 5 ? 
BH ? 5 ? 
BI ? 2 ? 
BJ ? 2 ? 
BK ? 5 ? 
BL ? 5 ? 
BM ? 2 ? 
BN ? 2 ? 
BO ? 5 ? 
BP ? 5 ? 
BQ ? 2 ? 
BR ? 2 ? 
BS ? 5 ? 
BT ? 5 ? 
BU ? 2 ? 
BV ? 2 ? 
BW ? 5 ? 
BX ? 5 ? 
BY ? 2 ? 
BZ ? 2 ? 
CA ? 5 ? 
CB ? 5 ? 
CC ? 2 ? 
CD ? 5 ? 
CE ? 5 ? 
CF ? 2 ? 
CG ? 5 ? 
CH ? 5 ? 
CI ? 2 ? 
CJ ? 5 ? 
CK ? 5 ? 
CL ? 2 ? 
CM ? 5 ? 
CN ? 5 ? 
CO ? 2 ? 
CP ? 5 ? 
CQ ? 5 ? 
CR ? 2 ? 
CS ? 5 ? 
CT ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? parallel      
B  2 3 ? parallel      
B  3 4 ? parallel      
B  4 5 ? anti-parallel 
C  1 2 ? parallel      
C  2 3 ? parallel      
C  3 4 ? parallel      
C  4 5 ? parallel      
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? parallel      
F  2 3 ? parallel      
F  3 4 ? parallel      
F  4 5 ? anti-parallel 
G  1 2 ? parallel      
G  2 3 ? parallel      
G  3 4 ? parallel      
G  4 5 ? parallel      
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? parallel      
J  2 3 ? parallel      
J  3 4 ? parallel      
J  4 5 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
K  3 4 ? parallel      
K  4 5 ? parallel      
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? parallel      
N  2 3 ? parallel      
N  3 4 ? parallel      
N  4 5 ? anti-parallel 
O  1 2 ? parallel      
O  2 3 ? parallel      
O  3 4 ? parallel      
O  4 5 ? parallel      
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? parallel      
R  2 3 ? parallel      
R  3 4 ? parallel      
R  4 5 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
S  3 4 ? parallel      
S  4 5 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? parallel      
V  2 3 ? parallel      
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
W  1 2 ? parallel      
W  2 3 ? parallel      
W  3 4 ? parallel      
W  4 5 ? parallel      
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? parallel      
Z  2 3 ? parallel      
Z  3 4 ? parallel      
Z  4 5 ? anti-parallel 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? parallel      
AD 4 5 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? parallel      
AG 2 3 ? parallel      
AG 3 4 ? parallel      
AG 4 5 ? anti-parallel 
AH 1 2 ? parallel      
AH 2 3 ? parallel      
AH 3 4 ? parallel      
AH 4 5 ? parallel      
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? parallel      
AJ 3 4 ? parallel      
AJ 4 5 ? anti-parallel 
AK 1 2 ? parallel      
AK 2 3 ? parallel      
AK 3 4 ? parallel      
AK 4 5 ? parallel      
AL 1 2 ? anti-parallel 
AM 1 2 ? parallel      
AM 2 3 ? parallel      
AM 3 4 ? parallel      
AM 4 5 ? anti-parallel 
AN 1 2 ? parallel      
AN 2 3 ? parallel      
AN 3 4 ? parallel      
AN 4 5 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AP 2 3 ? parallel      
AP 3 4 ? parallel      
AP 4 5 ? anti-parallel 
AQ 1 2 ? parallel      
AQ 2 3 ? parallel      
AQ 3 4 ? parallel      
AQ 4 5 ? parallel      
AR 1 2 ? anti-parallel 
AS 1 2 ? parallel      
AS 2 3 ? parallel      
AS 3 4 ? parallel      
AS 4 5 ? anti-parallel 
AT 1 2 ? parallel      
AT 2 3 ? parallel      
AT 3 4 ? parallel      
AT 4 5 ? parallel      
AU 1 2 ? anti-parallel 
AV 1 2 ? parallel      
AV 2 3 ? parallel      
AV 3 4 ? parallel      
AV 4 5 ? anti-parallel 
AW 1 2 ? parallel      
AW 2 3 ? parallel      
AW 3 4 ? parallel      
AW 4 5 ? parallel      
AX 1 2 ? anti-parallel 
AY 1 2 ? parallel      
AY 2 3 ? parallel      
AY 3 4 ? parallel      
AY 4 5 ? anti-parallel 
AZ 1 2 ? parallel      
AZ 2 3 ? parallel      
AZ 3 4 ? parallel      
AZ 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? parallel      
BC 3 4 ? parallel      
BC 4 5 ? anti-parallel 
BD 1 2 ? parallel      
BD 2 3 ? parallel      
BD 3 4 ? parallel      
BD 4 5 ? parallel      
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? parallel      
BG 2 3 ? parallel      
BG 3 4 ? parallel      
BG 4 5 ? anti-parallel 
BH 1 2 ? parallel      
BH 2 3 ? parallel      
BH 3 4 ? parallel      
BH 4 5 ? parallel      
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BK 1 2 ? parallel      
BK 2 3 ? parallel      
BK 3 4 ? parallel      
BK 4 5 ? anti-parallel 
BL 1 2 ? parallel      
BL 2 3 ? parallel      
BL 3 4 ? parallel      
BL 4 5 ? parallel      
BM 1 2 ? anti-parallel 
BN 1 2 ? anti-parallel 
BO 1 2 ? parallel      
BO 2 3 ? parallel      
BO 3 4 ? parallel      
BO 4 5 ? anti-parallel 
BP 1 2 ? parallel      
BP 2 3 ? parallel      
BP 3 4 ? parallel      
BP 4 5 ? parallel      
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? parallel      
BS 2 3 ? parallel      
BS 3 4 ? parallel      
BS 4 5 ? anti-parallel 
BT 1 2 ? parallel      
BT 2 3 ? parallel      
BT 3 4 ? parallel      
BT 4 5 ? parallel      
BU 1 2 ? anti-parallel 
BV 1 2 ? anti-parallel 
BW 1 2 ? parallel      
BW 2 3 ? parallel      
BW 3 4 ? parallel      
BW 4 5 ? anti-parallel 
BX 1 2 ? parallel      
BX 2 3 ? parallel      
BX 3 4 ? parallel      
BX 4 5 ? parallel      
BY 1 2 ? anti-parallel 
BZ 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? anti-parallel 
CB 1 2 ? parallel      
CB 2 3 ? parallel      
CB 3 4 ? parallel      
CB 4 5 ? parallel      
CC 1 2 ? anti-parallel 
CD 1 2 ? parallel      
CD 2 3 ? parallel      
CD 3 4 ? parallel      
CD 4 5 ? anti-parallel 
CE 1 2 ? parallel      
CE 2 3 ? parallel      
CE 3 4 ? parallel      
CE 4 5 ? parallel      
CF 1 2 ? anti-parallel 
CG 1 2 ? parallel      
CG 2 3 ? parallel      
CG 3 4 ? parallel      
CG 4 5 ? anti-parallel 
CH 1 2 ? parallel      
CH 2 3 ? parallel      
CH 3 4 ? parallel      
CH 4 5 ? parallel      
CI 1 2 ? anti-parallel 
CJ 1 2 ? parallel      
CJ 2 3 ? parallel      
CJ 3 4 ? parallel      
CJ 4 5 ? anti-parallel 
CK 1 2 ? parallel      
CK 2 3 ? parallel      
CK 3 4 ? parallel      
CK 4 5 ? parallel      
CL 1 2 ? anti-parallel 
CM 1 2 ? parallel      
CM 2 3 ? parallel      
CM 3 4 ? parallel      
CM 4 5 ? anti-parallel 
CN 1 2 ? parallel      
CN 2 3 ? parallel      
CN 3 4 ? parallel      
CN 4 5 ? parallel      
CO 1 2 ? anti-parallel 
CP 1 2 ? parallel      
CP 2 3 ? parallel      
CP 3 4 ? parallel      
CP 4 5 ? anti-parallel 
CQ 1 2 ? parallel      
CQ 2 3 ? parallel      
CQ 3 4 ? parallel      
CQ 4 5 ? parallel      
CR 1 2 ? anti-parallel 
CS 1 2 ? parallel      
CS 2 3 ? parallel      
CS 3 4 ? parallel      
CS 4 5 ? anti-parallel 
CT 1 2 ? parallel      
CT 2 3 ? parallel      
CT 3 4 ? parallel      
CT 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 THR A  6   ? VAL A  7   ? THR A 6   VAL A 7   
A  2 TYR A  18  ? ASP A  19  ? TYR A 18  ASP A 19  
B  1 ILE A  29  ? LEU A  32  ? ILE A 29  LEU A 32  
B  2 ILE A  60  ? SER A  66  ? ILE A 60  SER A 66  
B  3 VAL A  88  ? ALA A  97  ? VAL A 88  ALA A 97  
B  4 GLU A  119 ? ILE A  122 ? GLU A 119 ILE A 122 
B  5 ASN A  173 ? THR A  176 ? ASN A 173 THR A 176 
C  1 ILE A  29  ? LEU A  32  ? ILE A 29  LEU A 32  
C  2 ILE A  60  ? SER A  66  ? ILE A 60  SER A 66  
C  3 VAL A  88  ? ALA A  97  ? VAL A 88  ALA A 97  
C  4 ARG A  112 ? ALA A  114 ? ARG A 112 ALA A 114 
C  5 GLU A  188 ? VAL A  189 ? GLU A 188 VAL A 189 
D  1 LEU A  126 ? GLN A  132 ? LEU A 126 GLN A 132 
D  2 LEU K  126 ? GLN K  132 ? LEU K 126 GLN K 132 
E  1 THR B  6   ? VAL B  7   ? THR B 6   VAL B 7   
E  2 TYR B  18  ? ASP B  19  ? TYR B 18  ASP B 19  
F  1 ILE B  29  ? LEU B  32  ? ILE B 29  LEU B 32  
F  2 ILE B  60  ? SER B  66  ? ILE B 60  SER B 66  
F  3 VAL B  88  ? ALA B  97  ? VAL B 88  ALA B 97  
F  4 GLU B  119 ? ILE B  122 ? GLU B 119 ILE B 122 
F  5 ASN B  173 ? THR B  176 ? ASN B 173 THR B 176 
G  1 ILE B  29  ? LEU B  32  ? ILE B 29  LEU B 32  
G  2 ILE B  60  ? SER B  66  ? ILE B 60  SER B 66  
G  3 VAL B  88  ? ALA B  97  ? VAL B 88  ALA B 97  
G  4 ARG B  112 ? ALA B  114 ? ARG B 112 ALA B 114 
G  5 GLU B  188 ? VAL B  189 ? GLU B 188 VAL B 189 
H  1 LEU B  126 ? GLN B  132 ? LEU B 126 GLN B 132 
H  2 LEU J  126 ? GLN J  132 ? LEU J 126 GLN J 132 
I  1 THR C  6   ? VAL C  7   ? THR C 6   VAL C 7   
I  2 TYR C  18  ? ASP C  19  ? TYR C 18  ASP C 19  
J  1 ILE C  29  ? LEU C  32  ? ILE C 29  LEU C 32  
J  2 ILE C  60  ? SER C  66  ? ILE C 60  SER C 66  
J  3 VAL C  88  ? ALA C  97  ? VAL C 88  ALA C 97  
J  4 GLU C  119 ? ILE C  122 ? GLU C 119 ILE C 122 
J  5 ASN C  173 ? THR C  176 ? ASN C 173 THR C 176 
K  1 ILE C  29  ? LEU C  32  ? ILE C 29  LEU C 32  
K  2 ILE C  60  ? SER C  66  ? ILE C 60  SER C 66  
K  3 VAL C  88  ? ALA C  97  ? VAL C 88  ALA C 97  
K  4 ARG C  112 ? ALA C  114 ? ARG C 112 ALA C 114 
K  5 GLU C  188 ? VAL C  189 ? GLU C 188 VAL C 189 
L  1 LEU C  126 ? GLN C  132 ? LEU C 126 GLN C 132 
L  2 LEU I  126 ? GLN I  132 ? LEU I 126 GLN I 132 
M  1 THR D  6   ? VAL D  7   ? THR D 6   VAL D 7   
M  2 TYR D  18  ? ASP D  19  ? TYR D 18  ASP D 19  
N  1 ILE D  29  ? LEU D  32  ? ILE D 29  LEU D 32  
N  2 ILE D  60  ? SER D  66  ? ILE D 60  SER D 66  
N  3 VAL D  88  ? ALA D  97  ? VAL D 88  ALA D 97  
N  4 GLU D  119 ? ILE D  122 ? GLU D 119 ILE D 122 
N  5 ASN D  173 ? THR D  176 ? ASN D 173 THR D 176 
O  1 ILE D  29  ? LEU D  32  ? ILE D 29  LEU D 32  
O  2 ILE D  60  ? SER D  66  ? ILE D 60  SER D 66  
O  3 VAL D  88  ? ALA D  97  ? VAL D 88  ALA D 97  
O  4 ARG D  112 ? ALA D  114 ? ARG D 112 ALA D 114 
O  5 GLU D  188 ? VAL D  189 ? GLU D 188 VAL D 189 
P  1 LEU D  126 ? GLN D  132 ? LEU D 126 GLN D 132 
P  2 LEU H  126 ? GLN H  132 ? LEU H 126 GLN H 132 
Q  1 THR E  6   ? VAL E  7   ? THR E 6   VAL E 7   
Q  2 TYR E  18  ? ASP E  19  ? TYR E 18  ASP E 19  
R  1 ILE E  29  ? LEU E  32  ? ILE E 29  LEU E 32  
R  2 ILE E  60  ? SER E  66  ? ILE E 60  SER E 66  
R  3 VAL E  88  ? ALA E  97  ? VAL E 88  ALA E 97  
R  4 GLU E  119 ? ILE E  122 ? GLU E 119 ILE E 122 
R  5 ASN E  173 ? THR E  176 ? ASN E 173 THR E 176 
S  1 ILE E  29  ? LEU E  32  ? ILE E 29  LEU E 32  
S  2 ILE E  60  ? SER E  66  ? ILE E 60  SER E 66  
S  3 VAL E  88  ? ALA E  97  ? VAL E 88  ALA E 97  
S  4 ARG E  112 ? ALA E  114 ? ARG E 112 ALA E 114 
S  5 GLU E  188 ? VAL E  189 ? GLU E 188 VAL E 189 
T  1 LEU E  126 ? GLN E  132 ? LEU E 126 GLN E 132 
T  2 LEU N  126 ? GLN N  132 ? LEU N 126 GLN N 132 
U  1 THR F  6   ? VAL F  7   ? THR F 6   VAL F 7   
U  2 TYR F  18  ? ASP F  19  ? TYR F 18  ASP F 19  
V  1 ILE F  29  ? LEU F  32  ? ILE F 29  LEU F 32  
V  2 ILE F  60  ? SER F  66  ? ILE F 60  SER F 66  
V  3 VAL F  88  ? ALA F  97  ? VAL F 88  ALA F 97  
V  4 GLU F  119 ? ILE F  122 ? GLU F 119 ILE F 122 
V  5 ASN F  173 ? THR F  176 ? ASN F 173 THR F 176 
W  1 ILE F  29  ? LEU F  32  ? ILE F 29  LEU F 32  
W  2 ILE F  60  ? SER F  66  ? ILE F 60  SER F 66  
W  3 VAL F  88  ? ALA F  97  ? VAL F 88  ALA F 97  
W  4 ARG F  112 ? ALA F  114 ? ARG F 112 ALA F 114 
W  5 GLU F  188 ? VAL F  189 ? GLU F 188 VAL F 189 
X  1 LEU F  126 ? GLN F  132 ? LEU F 126 GLN F 132 
X  2 LEU M  126 ? GLN M  132 ? LEU M 126 GLN M 132 
Y  1 THR G  6   ? VAL G  7   ? THR G 6   VAL G 7   
Y  2 TYR G  18  ? ASP G  19  ? TYR G 18  ASP G 19  
Z  1 ILE G  29  ? LEU G  32  ? ILE G 29  LEU G 32  
Z  2 ILE G  60  ? SER G  66  ? ILE G 60  SER G 66  
Z  3 VAL G  88  ? ALA G  97  ? VAL G 88  ALA G 97  
Z  4 GLU G  119 ? ILE G  122 ? GLU G 119 ILE G 122 
Z  5 ASN G  173 ? THR G  176 ? ASN G 173 THR G 176 
AA 1 ILE G  29  ? LEU G  32  ? ILE G 29  LEU G 32  
AA 2 ILE G  60  ? SER G  66  ? ILE G 60  SER G 66  
AA 3 VAL G  88  ? ALA G  97  ? VAL G 88  ALA G 97  
AA 4 ARG G  112 ? ALA G  114 ? ARG G 112 ALA G 114 
AA 5 GLU G  188 ? VAL G  189 ? GLU G 188 VAL G 189 
AB 1 LEU G  126 ? GLN G  132 ? LEU G 126 GLN G 132 
AB 2 LEU L  126 ? GLN L  132 ? LEU L 126 GLN L 132 
AC 1 THR H  6   ? VAL H  7   ? THR H 6   VAL H 7   
AC 2 TYR H  18  ? ASP H  19  ? TYR H 18  ASP H 19  
AD 1 ILE H  29  ? LEU H  32  ? ILE H 29  LEU H 32  
AD 2 ILE H  60  ? SER H  66  ? ILE H 60  SER H 66  
AD 3 VAL H  88  ? ALA H  97  ? VAL H 88  ALA H 97  
AD 4 GLU H  119 ? ILE H  122 ? GLU H 119 ILE H 122 
AD 5 ASN H  173 ? THR H  176 ? ASN H 173 THR H 176 
AE 1 ILE H  29  ? LEU H  32  ? ILE H 29  LEU H 32  
AE 2 ILE H  60  ? SER H  66  ? ILE H 60  SER H 66  
AE 3 VAL H  88  ? ALA H  97  ? VAL H 88  ALA H 97  
AE 4 ARG H  112 ? ALA H  114 ? ARG H 112 ALA H 114 
AE 5 GLU H  188 ? VAL H  189 ? GLU H 188 VAL H 189 
AF 1 THR I  6   ? VAL I  7   ? THR I 6   VAL I 7   
AF 2 TYR I  18  ? ASP I  19  ? TYR I 18  ASP I 19  
AG 1 ILE I  29  ? LEU I  32  ? ILE I 29  LEU I 32  
AG 2 ILE I  60  ? SER I  66  ? ILE I 60  SER I 66  
AG 3 VAL I  88  ? ALA I  97  ? VAL I 88  ALA I 97  
AG 4 GLU I  119 ? ILE I  122 ? GLU I 119 ILE I 122 
AG 5 ASN I  173 ? THR I  176 ? ASN I 173 THR I 176 
AH 1 ILE I  29  ? LEU I  32  ? ILE I 29  LEU I 32  
AH 2 ILE I  60  ? SER I  66  ? ILE I 60  SER I 66  
AH 3 VAL I  88  ? ALA I  97  ? VAL I 88  ALA I 97  
AH 4 ARG I  112 ? ALA I  114 ? ARG I 112 ALA I 114 
AH 5 GLU I  188 ? VAL I  189 ? GLU I 188 VAL I 189 
AI 1 THR J  6   ? VAL J  7   ? THR J 6   VAL J 7   
AI 2 TYR J  18  ? ASP J  19  ? TYR J 18  ASP J 19  
AJ 1 ILE J  29  ? LEU J  32  ? ILE J 29  LEU J 32  
AJ 2 ILE J  60  ? SER J  66  ? ILE J 60  SER J 66  
AJ 3 VAL J  88  ? ALA J  97  ? VAL J 88  ALA J 97  
AJ 4 GLU J  119 ? ILE J  122 ? GLU J 119 ILE J 122 
AJ 5 ASN J  173 ? LEU J  175 ? ASN J 173 LEU J 175 
AK 1 ILE J  29  ? LEU J  32  ? ILE J 29  LEU J 32  
AK 2 ILE J  60  ? SER J  66  ? ILE J 60  SER J 66  
AK 3 VAL J  88  ? ALA J  97  ? VAL J 88  ALA J 97  
AK 4 ARG J  112 ? ALA J  114 ? ARG J 112 ALA J 114 
AK 5 GLU J  188 ? VAL J  189 ? GLU J 188 VAL J 189 
AL 1 THR K  6   ? VAL K  7   ? THR K 6   VAL K 7   
AL 2 TYR K  18  ? ASP K  19  ? TYR K 18  ASP K 19  
AM 1 ILE K  29  ? LEU K  32  ? ILE K 29  LEU K 32  
AM 2 ILE K  60  ? SER K  66  ? ILE K 60  SER K 66  
AM 3 VAL K  88  ? ALA K  97  ? VAL K 88  ALA K 97  
AM 4 GLU K  119 ? ILE K  122 ? GLU K 119 ILE K 122 
AM 5 ASN K  173 ? THR K  176 ? ASN K 173 THR K 176 
AN 1 ILE K  29  ? LEU K  32  ? ILE K 29  LEU K 32  
AN 2 ILE K  60  ? SER K  66  ? ILE K 60  SER K 66  
AN 3 VAL K  88  ? ALA K  97  ? VAL K 88  ALA K 97  
AN 4 ARG K  112 ? ALA K  114 ? ARG K 112 ALA K 114 
AN 5 GLU K  188 ? VAL K  189 ? GLU K 188 VAL K 189 
AO 1 THR L  6   ? VAL L  7   ? THR L 6   VAL L 7   
AO 2 TYR L  18  ? ASP L  19  ? TYR L 18  ASP L 19  
AP 1 ILE L  29  ? LEU L  32  ? ILE L 29  LEU L 32  
AP 2 ILE L  60  ? SER L  66  ? ILE L 60  SER L 66  
AP 3 VAL L  88  ? ALA L  97  ? VAL L 88  ALA L 97  
AP 4 GLU L  119 ? ILE L  122 ? GLU L 119 ILE L 122 
AP 5 ASN L  173 ? THR L  176 ? ASN L 173 THR L 176 
AQ 1 ILE L  29  ? LEU L  32  ? ILE L 29  LEU L 32  
AQ 2 ILE L  60  ? SER L  66  ? ILE L 60  SER L 66  
AQ 3 VAL L  88  ? ALA L  97  ? VAL L 88  ALA L 97  
AQ 4 ARG L  112 ? ALA L  114 ? ARG L 112 ALA L 114 
AQ 5 GLU L  188 ? VAL L  189 ? GLU L 188 VAL L 189 
AR 1 THR M  6   ? VAL M  7   ? THR M 6   VAL M 7   
AR 2 TYR M  18  ? ASP M  19  ? TYR M 18  ASP M 19  
AS 1 ILE M  29  ? LEU M  32  ? ILE M 29  LEU M 32  
AS 2 ILE M  60  ? SER M  66  ? ILE M 60  SER M 66  
AS 3 VAL M  88  ? ALA M  97  ? VAL M 88  ALA M 97  
AS 4 GLU M  119 ? ILE M  122 ? GLU M 119 ILE M 122 
AS 5 ASN M  173 ? THR M  176 ? ASN M 173 THR M 176 
AT 1 ILE M  29  ? LEU M  32  ? ILE M 29  LEU M 32  
AT 2 ILE M  60  ? SER M  66  ? ILE M 60  SER M 66  
AT 3 VAL M  88  ? ALA M  97  ? VAL M 88  ALA M 97  
AT 4 ARG M  112 ? ALA M  114 ? ARG M 112 ALA M 114 
AT 5 GLU M  188 ? VAL M  189 ? GLU M 188 VAL M 189 
AU 1 THR N  6   ? VAL N  7   ? THR N 6   VAL N 7   
AU 2 TYR N  18  ? ASP N  19  ? TYR N 18  ASP N 19  
AV 1 ILE N  29  ? LEU N  32  ? ILE N 29  LEU N 32  
AV 2 ILE N  60  ? SER N  66  ? ILE N 60  SER N 66  
AV 3 VAL N  88  ? ALA N  97  ? VAL N 88  ALA N 97  
AV 4 GLU N  119 ? ILE N  122 ? GLU N 119 ILE N 122 
AV 5 ASN N  173 ? THR N  176 ? ASN N 173 THR N 176 
AW 1 ILE N  29  ? LEU N  32  ? ILE N 29  LEU N 32  
AW 2 ILE N  60  ? SER N  66  ? ILE N 60  SER N 66  
AW 3 VAL N  88  ? ALA N  97  ? VAL N 88  ALA N 97  
AW 4 ARG N  112 ? ALA N  114 ? ARG N 112 ALA N 114 
AW 5 GLU N  188 ? VAL N  189 ? GLU N 188 VAL N 189 
AX 1 THR O  6   ? VAL O  7   ? THR O 6   VAL O 7   
AX 2 TYR O  18  ? ASP O  19  ? TYR O 18  ASP O 19  
AY 1 ILE O  29  ? LEU O  32  ? ILE O 29  LEU O 32  
AY 2 ILE O  60  ? SER O  66  ? ILE O 60  SER O 66  
AY 3 VAL O  88  ? ALA O  97  ? VAL O 88  ALA O 97  
AY 4 GLU O  119 ? ILE O  122 ? GLU O 119 ILE O 122 
AY 5 ASN O  173 ? THR O  176 ? ASN O 173 THR O 176 
AZ 1 ILE O  29  ? LEU O  32  ? ILE O 29  LEU O 32  
AZ 2 ILE O  60  ? SER O  66  ? ILE O 60  SER O 66  
AZ 3 VAL O  88  ? ALA O  97  ? VAL O 88  ALA O 97  
AZ 4 ARG O  112 ? ALA O  114 ? ARG O 112 ALA O 114 
AZ 5 GLU O  188 ? VAL O  189 ? GLU O 188 VAL O 189 
BA 1 LEU O  126 ? GLN O  132 ? LEU O 126 GLN O 132 
BA 2 LEU Y  126 ? GLN Y  132 ? LEU Y 126 GLN Y 132 
BB 1 THR P  6   ? VAL P  7   ? THR P 6   VAL P 7   
BB 2 TYR P  18  ? ASP P  19  ? TYR P 18  ASP P 19  
BC 1 ILE P  29  ? LEU P  32  ? ILE P 29  LEU P 32  
BC 2 ILE P  60  ? SER P  66  ? ILE P 60  SER P 66  
BC 3 VAL P  88  ? ALA P  97  ? VAL P 88  ALA P 97  
BC 4 GLU P  119 ? ILE P  122 ? GLU P 119 ILE P 122 
BC 5 ASN P  173 ? THR P  176 ? ASN P 173 THR P 176 
BD 1 ILE P  29  ? LEU P  32  ? ILE P 29  LEU P 32  
BD 2 ILE P  60  ? SER P  66  ? ILE P 60  SER P 66  
BD 3 VAL P  88  ? ALA P  97  ? VAL P 88  ALA P 97  
BD 4 ARG P  112 ? ALA P  114 ? ARG P 112 ALA P 114 
BD 5 GLU P  188 ? VAL P  189 ? GLU P 188 VAL P 189 
BE 1 LEU P  126 ? GLN P  132 ? LEU P 126 GLN P 132 
BE 2 LEU X  126 ? GLN X  132 ? LEU X 126 GLN X 132 
BF 1 THR Q  6   ? VAL Q  7   ? THR Q 6   VAL Q 7   
BF 2 TYR Q  18  ? ASP Q  19  ? TYR Q 18  ASP Q 19  
BG 1 ILE Q  29  ? LEU Q  32  ? ILE Q 29  LEU Q 32  
BG 2 ILE Q  60  ? SER Q  66  ? ILE Q 60  SER Q 66  
BG 3 VAL Q  88  ? ALA Q  97  ? VAL Q 88  ALA Q 97  
BG 4 GLU Q  119 ? ILE Q  122 ? GLU Q 119 ILE Q 122 
BG 5 ASN Q  173 ? THR Q  176 ? ASN Q 173 THR Q 176 
BH 1 ILE Q  29  ? LEU Q  32  ? ILE Q 29  LEU Q 32  
BH 2 ILE Q  60  ? SER Q  66  ? ILE Q 60  SER Q 66  
BH 3 VAL Q  88  ? ALA Q  97  ? VAL Q 88  ALA Q 97  
BH 4 ARG Q  112 ? ALA Q  114 ? ARG Q 112 ALA Q 114 
BH 5 GLU Q  188 ? VAL Q  189 ? GLU Q 188 VAL Q 189 
BI 1 LEU Q  126 ? GLN Q  132 ? LEU Q 126 GLN Q 132 
BI 2 LEU W  126 ? GLN W  132 ? LEU W 126 GLN W 132 
BJ 1 THR R  6   ? VAL R  7   ? THR R 6   VAL R 7   
BJ 2 TYR R  18  ? ASP R  19  ? TYR R 18  ASP R 19  
BK 1 ILE R  29  ? LEU R  32  ? ILE R 29  LEU R 32  
BK 2 ILE R  60  ? SER R  66  ? ILE R 60  SER R 66  
BK 3 VAL R  88  ? ALA R  97  ? VAL R 88  ALA R 97  
BK 4 GLU R  119 ? ILE R  122 ? GLU R 119 ILE R 122 
BK 5 ASN R  173 ? THR R  176 ? ASN R 173 THR R 176 
BL 1 ILE R  29  ? LEU R  32  ? ILE R 29  LEU R 32  
BL 2 ILE R  60  ? SER R  66  ? ILE R 60  SER R 66  
BL 3 VAL R  88  ? ALA R  97  ? VAL R 88  ALA R 97  
BL 4 ARG R  112 ? ALA R  114 ? ARG R 112 ALA R 114 
BL 5 GLU R  188 ? VAL R  189 ? GLU R 188 VAL R 189 
BM 1 LEU R  126 ? GLN R  132 ? LEU R 126 GLN R 132 
BM 2 LEU V  126 ? GLN V  132 ? LEU V 126 GLN V 132 
BN 1 THR S  6   ? VAL S  7   ? THR S 6   VAL S 7   
BN 2 TYR S  18  ? ASP S  19  ? TYR S 18  ASP S 19  
BO 1 ILE S  29  ? LEU S  32  ? ILE S 29  LEU S 32  
BO 2 ILE S  60  ? SER S  66  ? ILE S 60  SER S 66  
BO 3 VAL S  88  ? ALA S  97  ? VAL S 88  ALA S 97  
BO 4 GLU S  119 ? ILE S  122 ? GLU S 119 ILE S 122 
BO 5 ASN S  173 ? THR S  176 ? ASN S 173 THR S 176 
BP 1 ILE S  29  ? LEU S  32  ? ILE S 29  LEU S 32  
BP 2 ILE S  60  ? SER S  66  ? ILE S 60  SER S 66  
BP 3 VAL S  88  ? ALA S  97  ? VAL S 88  ALA S 97  
BP 4 ARG S  112 ? ALA S  114 ? ARG S 112 ALA S 114 
BP 5 GLU S  188 ? VAL S  189 ? GLU S 188 VAL S 189 
BQ 1 LEU S  126 ? GLN S  132 ? LEU S 126 GLN S 132 
BQ 2 LEU BA 126 ? GLN BA 132 ? LEU b 126 GLN b 132 
BR 1 THR T  6   ? VAL T  7   ? THR T 6   VAL T 7   
BR 2 TYR T  18  ? ASP T  19  ? TYR T 18  ASP T 19  
BS 1 ILE T  29  ? LEU T  32  ? ILE T 29  LEU T 32  
BS 2 ILE T  60  ? SER T  66  ? ILE T 60  SER T 66  
BS 3 VAL T  88  ? ALA T  97  ? VAL T 88  ALA T 97  
BS 4 GLU T  119 ? ILE T  122 ? GLU T 119 ILE T 122 
BS 5 ASN T  173 ? THR T  176 ? ASN T 173 THR T 176 
BT 1 ILE T  29  ? LEU T  32  ? ILE T 29  LEU T 32  
BT 2 ILE T  60  ? SER T  66  ? ILE T 60  SER T 66  
BT 3 VAL T  88  ? ALA T  97  ? VAL T 88  ALA T 97  
BT 4 ARG T  112 ? ALA T  114 ? ARG T 112 ALA T 114 
BT 5 GLU T  188 ? VAL T  189 ? GLU T 188 VAL T 189 
BU 1 LEU T  126 ? GLN T  132 ? LEU T 126 GLN T 132 
BU 2 LEU AA 126 ? GLN AA 132 ? LEU a 126 GLN a 132 
BV 1 THR U  6   ? VAL U  7   ? THR U 6   VAL U 7   
BV 2 TYR U  18  ? ASP U  19  ? TYR U 18  ASP U 19  
BW 1 ILE U  29  ? LEU U  32  ? ILE U 29  LEU U 32  
BW 2 ILE U  60  ? SER U  66  ? ILE U 60  SER U 66  
BW 3 VAL U  88  ? ALA U  97  ? VAL U 88  ALA U 97  
BW 4 GLU U  119 ? ILE U  122 ? GLU U 119 ILE U 122 
BW 5 ASN U  173 ? THR U  176 ? ASN U 173 THR U 176 
BX 1 ILE U  29  ? LEU U  32  ? ILE U 29  LEU U 32  
BX 2 ILE U  60  ? SER U  66  ? ILE U 60  SER U 66  
BX 3 VAL U  88  ? ALA U  97  ? VAL U 88  ALA U 97  
BX 4 ARG U  112 ? ALA U  114 ? ARG U 112 ALA U 114 
BX 5 GLU U  188 ? VAL U  189 ? GLU U 188 VAL U 189 
BY 1 LEU U  126 ? GLN U  132 ? LEU U 126 GLN U 132 
BY 2 LEU Z  126 ? GLN Z  132 ? LEU Z 126 GLN Z 132 
BZ 1 THR V  6   ? VAL V  7   ? THR V 6   VAL V 7   
BZ 2 TYR V  18  ? ASP V  19  ? TYR V 18  ASP V 19  
CA 1 ILE V  29  ? LEU V  32  ? ILE V 29  LEU V 32  
CA 2 ILE V  60  ? SER V  66  ? ILE V 60  SER V 66  
CA 3 VAL V  88  ? ALA V  97  ? VAL V 88  ALA V 97  
CA 4 GLU V  119 ? ILE V  122 ? GLU V 119 ILE V 122 
CA 5 ASN V  173 ? THR V  176 ? ASN V 173 THR V 176 
CB 1 ILE V  29  ? LEU V  32  ? ILE V 29  LEU V 32  
CB 2 ILE V  60  ? SER V  66  ? ILE V 60  SER V 66  
CB 3 VAL V  88  ? ALA V  97  ? VAL V 88  ALA V 97  
CB 4 ARG V  112 ? ALA V  114 ? ARG V 112 ALA V 114 
CB 5 GLU V  188 ? VAL V  189 ? GLU V 188 VAL V 189 
CC 1 THR W  6   ? VAL W  7   ? THR W 6   VAL W 7   
CC 2 TYR W  18  ? ASP W  19  ? TYR W 18  ASP W 19  
CD 1 ILE W  29  ? LEU W  32  ? ILE W 29  LEU W 32  
CD 2 ILE W  60  ? SER W  66  ? ILE W 60  SER W 66  
CD 3 VAL W  88  ? ALA W  97  ? VAL W 88  ALA W 97  
CD 4 GLU W  119 ? ILE W  122 ? GLU W 119 ILE W 122 
CD 5 ASN W  173 ? THR W  176 ? ASN W 173 THR W 176 
CE 1 ILE W  29  ? LEU W  32  ? ILE W 29  LEU W 32  
CE 2 ILE W  60  ? SER W  66  ? ILE W 60  SER W 66  
CE 3 VAL W  88  ? ALA W  97  ? VAL W 88  ALA W 97  
CE 4 ARG W  112 ? ALA W  114 ? ARG W 112 ALA W 114 
CE 5 GLU W  188 ? VAL W  189 ? GLU W 188 VAL W 189 
CF 1 THR X  6   ? VAL X  7   ? THR X 6   VAL X 7   
CF 2 TYR X  18  ? ASP X  19  ? TYR X 18  ASP X 19  
CG 1 ILE X  29  ? LEU X  32  ? ILE X 29  LEU X 32  
CG 2 ILE X  60  ? SER X  66  ? ILE X 60  SER X 66  
CG 3 VAL X  88  ? ALA X  97  ? VAL X 88  ALA X 97  
CG 4 GLU X  119 ? ILE X  122 ? GLU X 119 ILE X 122 
CG 5 ASN X  173 ? THR X  176 ? ASN X 173 THR X 176 
CH 1 ILE X  29  ? LEU X  32  ? ILE X 29  LEU X 32  
CH 2 ILE X  60  ? SER X  66  ? ILE X 60  SER X 66  
CH 3 VAL X  88  ? ALA X  97  ? VAL X 88  ALA X 97  
CH 4 ARG X  112 ? ALA X  114 ? ARG X 112 ALA X 114 
CH 5 GLU X  188 ? VAL X  189 ? GLU X 188 VAL X 189 
CI 1 THR Y  6   ? VAL Y  7   ? THR Y 6   VAL Y 7   
CI 2 TYR Y  18  ? ASP Y  19  ? TYR Y 18  ASP Y 19  
CJ 1 ILE Y  29  ? LEU Y  32  ? ILE Y 29  LEU Y 32  
CJ 2 ILE Y  60  ? SER Y  66  ? ILE Y 60  SER Y 66  
CJ 3 VAL Y  88  ? ALA Y  97  ? VAL Y 88  ALA Y 97  
CJ 4 GLU Y  119 ? ILE Y  122 ? GLU Y 119 ILE Y 122 
CJ 5 ASN Y  173 ? THR Y  176 ? ASN Y 173 THR Y 176 
CK 1 ILE Y  29  ? LEU Y  32  ? ILE Y 29  LEU Y 32  
CK 2 ILE Y  60  ? SER Y  66  ? ILE Y 60  SER Y 66  
CK 3 VAL Y  88  ? ALA Y  97  ? VAL Y 88  ALA Y 97  
CK 4 ARG Y  112 ? ALA Y  114 ? ARG Y 112 ALA Y 114 
CK 5 GLU Y  188 ? VAL Y  189 ? GLU Y 188 VAL Y 189 
CL 1 THR Z  6   ? VAL Z  7   ? THR Z 6   VAL Z 7   
CL 2 TYR Z  18  ? ASP Z  19  ? TYR Z 18  ASP Z 19  
CM 1 ILE Z  29  ? LEU Z  32  ? ILE Z 29  LEU Z 32  
CM 2 ILE Z  60  ? SER Z  66  ? ILE Z 60  SER Z 66  
CM 3 VAL Z  88  ? ALA Z  97  ? VAL Z 88  ALA Z 97  
CM 4 GLU Z  119 ? ILE Z  122 ? GLU Z 119 ILE Z 122 
CM 5 ASN Z  173 ? THR Z  176 ? ASN Z 173 THR Z 176 
CN 1 ILE Z  29  ? LEU Z  32  ? ILE Z 29  LEU Z 32  
CN 2 ILE Z  60  ? SER Z  66  ? ILE Z 60  SER Z 66  
CN 3 VAL Z  88  ? ALA Z  97  ? VAL Z 88  ALA Z 97  
CN 4 ARG Z  112 ? ALA Z  114 ? ARG Z 112 ALA Z 114 
CN 5 GLU Z  188 ? VAL Z  189 ? GLU Z 188 VAL Z 189 
CO 1 THR AA 6   ? VAL AA 7   ? THR a 6   VAL a 7   
CO 2 TYR AA 18  ? ASP AA 19  ? TYR a 18  ASP a 19  
CP 1 ILE AA 29  ? LEU AA 32  ? ILE a 29  LEU a 32  
CP 2 ILE AA 60  ? SER AA 66  ? ILE a 60  SER a 66  
CP 3 VAL AA 88  ? ALA AA 97  ? VAL a 88  ALA a 97  
CP 4 GLU AA 119 ? ILE AA 122 ? GLU a 119 ILE a 122 
CP 5 ASN AA 173 ? THR AA 176 ? ASN a 173 THR a 176 
CQ 1 ILE AA 29  ? LEU AA 32  ? ILE a 29  LEU a 32  
CQ 2 ILE AA 60  ? SER AA 66  ? ILE a 60  SER a 66  
CQ 3 VAL AA 88  ? ALA AA 97  ? VAL a 88  ALA a 97  
CQ 4 ARG AA 112 ? ALA AA 114 ? ARG a 112 ALA a 114 
CQ 5 GLU AA 188 ? VAL AA 189 ? GLU a 188 VAL a 189 
CR 1 THR BA 6   ? VAL BA 7   ? THR b 6   VAL b 7   
CR 2 TYR BA 18  ? ASP BA 19  ? TYR b 18  ASP b 19  
CS 1 ILE BA 29  ? LEU BA 32  ? ILE b 29  LEU b 32  
CS 2 ILE BA 60  ? SER BA 66  ? ILE b 60  SER b 66  
CS 3 VAL BA 88  ? ALA BA 97  ? VAL b 88  ALA b 97  
CS 4 GLU BA 119 ? ILE BA 122 ? GLU b 119 ILE b 122 
CS 5 ASN BA 173 ? THR BA 176 ? ASN b 173 THR b 176 
CT 1 ILE BA 29  ? LEU BA 32  ? ILE b 29  LEU b 32  
CT 2 ILE BA 60  ? SER BA 66  ? ILE b 60  SER b 66  
CT 3 VAL BA 88  ? ALA BA 97  ? VAL b 88  ALA b 97  
CT 4 ARG BA 112 ? ALA BA 114 ? ARG b 112 ALA b 114 
CT 5 GLU BA 188 ? VAL BA 189 ? GLU b 188 VAL b 189 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL A  7   ? N VAL A 7   O TYR A  18  ? O TYR A 18  
B  1 2 N ILE A  30  ? N ILE A 30  O TYR A  61  ? O TYR A 61  
B  2 3 N ILE A  60  ? N ILE A 60  O GLN A  89  ? O GLN A 89  
B  3 4 N ALA A  96  ? N ALA A 96  O GLU A  119 ? O GLU A 119 
B  4 5 N VAL A  120 ? N VAL A 120 O LEU A  175 ? O LEU A 175 
C  1 2 N ILE A  30  ? N ILE A 30  O TYR A  61  ? O TYR A 61  
C  2 3 N ILE A  60  ? N ILE A 60  O GLN A  89  ? O GLN A 89  
C  3 4 N THR A  90  ? N THR A 90  O PHE A  113 ? O PHE A 113 
C  4 5 O ARG A  112 ? O ARG A 112 N GLU A  188 ? N GLU A 188 
D  1 2 N GLY A  127 ? N GLY A 127 O GLY K  131 ? O GLY K 131 
E  1 2 N VAL B  7   ? N VAL B 7   O TYR B  18  ? O TYR B 18  
F  1 2 N ILE B  30  ? N ILE B 30  O TYR B  61  ? O TYR B 61  
F  2 3 N ILE B  60  ? N ILE B 60  O GLN B  89  ? O GLN B 89  
F  3 4 N ALA B  96  ? N ALA B 96  O GLU B  119 ? O GLU B 119 
F  4 5 N VAL B  120 ? N VAL B 120 O LEU B  175 ? O LEU B 175 
G  1 2 N ILE B  30  ? N ILE B 30  O TYR B  61  ? O TYR B 61  
G  2 3 N ILE B  60  ? N ILE B 60  O GLN B  89  ? O GLN B 89  
G  3 4 N THR B  90  ? N THR B 90  O PHE B  113 ? O PHE B 113 
G  4 5 O ARG B  112 ? O ARG B 112 N GLU B  188 ? N GLU B 188 
H  1 2 N GLY B  131 ? N GLY B 131 O GLY J  127 ? O GLY J 127 
I  1 2 N VAL C  7   ? N VAL C 7   O TYR C  18  ? O TYR C 18  
J  1 2 N ILE C  30  ? N ILE C 30  O TYR C  61  ? O TYR C 61  
J  2 3 N ILE C  60  ? N ILE C 60  O GLN C  89  ? O GLN C 89  
J  3 4 N ALA C  96  ? N ALA C 96  O GLU C  119 ? O GLU C 119 
J  4 5 N VAL C  120 ? N VAL C 120 O LEU C  175 ? O LEU C 175 
K  1 2 N ILE C  30  ? N ILE C 30  O TYR C  61  ? O TYR C 61  
K  2 3 N ILE C  60  ? N ILE C 60  O GLN C  89  ? O GLN C 89  
K  3 4 N THR C  90  ? N THR C 90  O PHE C  113 ? O PHE C 113 
K  4 5 O ARG C  112 ? O ARG C 112 N GLU C  188 ? N GLU C 188 
L  1 2 N GLY C  127 ? N GLY C 127 O GLY I  131 ? O GLY I 131 
M  1 2 N VAL D  7   ? N VAL D 7   O TYR D  18  ? O TYR D 18  
N  1 2 N ILE D  30  ? N ILE D 30  O TYR D  61  ? O TYR D 61  
N  2 3 N LEU D  62  ? N LEU D 62  O GLN D  89  ? O GLN D 89  
N  3 4 N ALA D  96  ? N ALA D 96  O GLU D  119 ? O GLU D 119 
N  4 5 N VAL D  120 ? N VAL D 120 O LEU D  175 ? O LEU D 175 
O  1 2 N ILE D  30  ? N ILE D 30  O TYR D  61  ? O TYR D 61  
O  2 3 N LEU D  62  ? N LEU D 62  O GLN D  89  ? O GLN D 89  
O  3 4 N THR D  90  ? N THR D 90  O PHE D  113 ? O PHE D 113 
O  4 5 O ARG D  112 ? O ARG D 112 N GLU D  188 ? N GLU D 188 
P  1 2 N GLY D  131 ? N GLY D 131 O GLY H  127 ? O GLY H 127 
Q  1 2 N VAL E  7   ? N VAL E 7   O TYR E  18  ? O TYR E 18  
R  1 2 N ILE E  30  ? N ILE E 30  O TYR E  61  ? O TYR E 61  
R  2 3 N ILE E  60  ? N ILE E 60  O GLN E  89  ? O GLN E 89  
R  3 4 N GLY E  94  ? N GLY E 94  O GLU E  119 ? O GLU E 119 
R  4 5 N VAL E  120 ? N VAL E 120 O LEU E  175 ? O LEU E 175 
S  1 2 N ILE E  30  ? N ILE E 30  O TYR E  61  ? O TYR E 61  
S  2 3 N ILE E  60  ? N ILE E 60  O GLN E  89  ? O GLN E 89  
S  3 4 N THR E  90  ? N THR E 90  O PHE E  113 ? O PHE E 113 
S  4 5 O ARG E  112 ? O ARG E 112 N GLU E  188 ? N GLU E 188 
T  1 2 N GLY E  131 ? N GLY E 131 O GLY N  127 ? O GLY N 127 
U  1 2 N VAL F  7   ? N VAL F 7   O TYR F  18  ? O TYR F 18  
V  1 2 N ILE F  30  ? N ILE F 30  O TYR F  61  ? O TYR F 61  
V  2 3 N ILE F  60  ? N ILE F 60  O GLN F  89  ? O GLN F 89  
V  3 4 N ALA F  96  ? N ALA F 96  O GLU F  119 ? O GLU F 119 
V  4 5 N VAL F  120 ? N VAL F 120 O LEU F  175 ? O LEU F 175 
W  1 2 N ILE F  30  ? N ILE F 30  O TYR F  61  ? O TYR F 61  
W  2 3 N ILE F  60  ? N ILE F 60  O GLN F  89  ? O GLN F 89  
W  3 4 N THR F  90  ? N THR F 90  O PHE F  113 ? O PHE F 113 
W  4 5 O ARG F  112 ? O ARG F 112 N GLU F  188 ? N GLU F 188 
X  1 2 N GLY F  131 ? N GLY F 131 O GLY M  127 ? O GLY M 127 
Y  1 2 N VAL G  7   ? N VAL G 7   O TYR G  18  ? O TYR G 18  
Z  1 2 N ILE G  30  ? N ILE G 30  O TYR G  61  ? O TYR G 61  
Z  2 3 N ILE G  60  ? N ILE G 60  O GLN G  89  ? O GLN G 89  
Z  3 4 N GLY G  94  ? N GLY G 94  O GLU G  119 ? O GLU G 119 
Z  4 5 N VAL G  120 ? N VAL G 120 O LEU G  175 ? O LEU G 175 
AA 1 2 N ILE G  30  ? N ILE G 30  O TYR G  61  ? O TYR G 61  
AA 2 3 N ILE G  60  ? N ILE G 60  O GLN G  89  ? O GLN G 89  
AA 3 4 N THR G  90  ? N THR G 90  O PHE G  113 ? O PHE G 113 
AA 4 5 O ARG G  112 ? O ARG G 112 N GLU G  188 ? N GLU G 188 
AB 1 2 N GLY G  127 ? N GLY G 127 O GLY L  131 ? O GLY L 131 
AC 1 2 N VAL H  7   ? N VAL H 7   O TYR H  18  ? O TYR H 18  
AD 1 2 N ILE H  30  ? N ILE H 30  O TYR H  61  ? O TYR H 61  
AD 2 3 N ILE H  60  ? N ILE H 60  O GLN H  89  ? O GLN H 89  
AD 3 4 N ALA H  96  ? N ALA H 96  O GLU H  119 ? O GLU H 119 
AD 4 5 N VAL H  120 ? N VAL H 120 O LEU H  175 ? O LEU H 175 
AE 1 2 N ILE H  30  ? N ILE H 30  O TYR H  61  ? O TYR H 61  
AE 2 3 N ILE H  60  ? N ILE H 60  O GLN H  89  ? O GLN H 89  
AE 3 4 N THR H  90  ? N THR H 90  O PHE H  113 ? O PHE H 113 
AE 4 5 O ARG H  112 ? O ARG H 112 N GLU H  188 ? N GLU H 188 
AF 1 2 N VAL I  7   ? N VAL I 7   O TYR I  18  ? O TYR I 18  
AG 1 2 N ILE I  30  ? N ILE I 30  O TYR I  61  ? O TYR I 61  
AG 2 3 N ILE I  60  ? N ILE I 60  O GLN I  89  ? O GLN I 89  
AG 3 4 N ALA I  96  ? N ALA I 96  O GLU I  119 ? O GLU I 119 
AG 4 5 N VAL I  120 ? N VAL I 120 O LEU I  175 ? O LEU I 175 
AH 1 2 N ILE I  30  ? N ILE I 30  O TYR I  61  ? O TYR I 61  
AH 2 3 N ILE I  60  ? N ILE I 60  O GLN I  89  ? O GLN I 89  
AH 3 4 N THR I  90  ? N THR I 90  O PHE I  113 ? O PHE I 113 
AH 4 5 O ARG I  112 ? O ARG I 112 N GLU I  188 ? N GLU I 188 
AI 1 2 N VAL J  7   ? N VAL J 7   O TYR J  18  ? O TYR J 18  
AJ 1 2 N ILE J  30  ? N ILE J 30  O TYR J  61  ? O TYR J 61  
AJ 2 3 N ILE J  60  ? N ILE J 60  O GLN J  89  ? O GLN J 89  
AJ 3 4 N ALA J  96  ? N ALA J 96  O GLU J  119 ? O GLU J 119 
AJ 4 5 N VAL J  120 ? N VAL J 120 O LEU J  175 ? O LEU J 175 
AK 1 2 N ILE J  30  ? N ILE J 30  O TYR J  61  ? O TYR J 61  
AK 2 3 N ILE J  60  ? N ILE J 60  O GLN J  89  ? O GLN J 89  
AK 3 4 N THR J  90  ? N THR J 90  O PHE J  113 ? O PHE J 113 
AK 4 5 O ARG J  112 ? O ARG J 112 N GLU J  188 ? N GLU J 188 
AL 1 2 N VAL K  7   ? N VAL K 7   O TYR K  18  ? O TYR K 18  
AM 1 2 N ILE K  30  ? N ILE K 30  O TYR K  61  ? O TYR K 61  
AM 2 3 N ILE K  60  ? N ILE K 60  O GLN K  89  ? O GLN K 89  
AM 3 4 N ALA K  96  ? N ALA K 96  O GLU K  119 ? O GLU K 119 
AM 4 5 N VAL K  120 ? N VAL K 120 O LEU K  175 ? O LEU K 175 
AN 1 2 N ILE K  30  ? N ILE K 30  O TYR K  61  ? O TYR K 61  
AN 2 3 N ILE K  60  ? N ILE K 60  O GLN K  89  ? O GLN K 89  
AN 3 4 N THR K  90  ? N THR K 90  O PHE K  113 ? O PHE K 113 
AN 4 5 O ARG K  112 ? O ARG K 112 N GLU K  188 ? N GLU K 188 
AO 1 2 N VAL L  7   ? N VAL L 7   O TYR L  18  ? O TYR L 18  
AP 1 2 N ILE L  30  ? N ILE L 30  O TYR L  61  ? O TYR L 61  
AP 2 3 N ILE L  60  ? N ILE L 60  O GLN L  89  ? O GLN L 89  
AP 3 4 N ALA L  96  ? N ALA L 96  O GLU L  119 ? O GLU L 119 
AP 4 5 N VAL L  120 ? N VAL L 120 O LEU L  175 ? O LEU L 175 
AQ 1 2 N ILE L  30  ? N ILE L 30  O TYR L  61  ? O TYR L 61  
AQ 2 3 N ILE L  60  ? N ILE L 60  O GLN L  89  ? O GLN L 89  
AQ 3 4 N THR L  90  ? N THR L 90  O PHE L  113 ? O PHE L 113 
AQ 4 5 O ARG L  112 ? O ARG L 112 N GLU L  188 ? N GLU L 188 
AR 1 2 N VAL M  7   ? N VAL M 7   O TYR M  18  ? O TYR M 18  
AS 1 2 N ILE M  30  ? N ILE M 30  O TYR M  61  ? O TYR M 61  
AS 2 3 N ILE M  60  ? N ILE M 60  O GLN M  89  ? O GLN M 89  
AS 3 4 N GLY M  94  ? N GLY M 94  O GLU M  119 ? O GLU M 119 
AS 4 5 N VAL M  120 ? N VAL M 120 O LEU M  175 ? O LEU M 175 
AT 1 2 N ILE M  30  ? N ILE M 30  O TYR M  61  ? O TYR M 61  
AT 2 3 N ILE M  60  ? N ILE M 60  O GLN M  89  ? O GLN M 89  
AT 3 4 N THR M  90  ? N THR M 90  O PHE M  113 ? O PHE M 113 
AT 4 5 O ARG M  112 ? O ARG M 112 N GLU M  188 ? N GLU M 188 
AU 1 2 N VAL N  7   ? N VAL N 7   O TYR N  18  ? O TYR N 18  
AV 1 2 N ILE N  30  ? N ILE N 30  O TYR N  61  ? O TYR N 61  
AV 2 3 N ILE N  60  ? N ILE N 60  O GLN N  89  ? O GLN N 89  
AV 3 4 N GLY N  94  ? N GLY N 94  O GLU N  119 ? O GLU N 119 
AV 4 5 N VAL N  120 ? N VAL N 120 O LEU N  175 ? O LEU N 175 
AW 1 2 N ILE N  30  ? N ILE N 30  O TYR N  61  ? O TYR N 61  
AW 2 3 N ILE N  60  ? N ILE N 60  O GLN N  89  ? O GLN N 89  
AW 3 4 N THR N  90  ? N THR N 90  O PHE N  113 ? O PHE N 113 
AW 4 5 O ARG N  112 ? O ARG N 112 N GLU N  188 ? N GLU N 188 
AX 1 2 N VAL O  7   ? N VAL O 7   O TYR O  18  ? O TYR O 18  
AY 1 2 N LEU O  32  ? N LEU O 32  O ASN O  65  ? O ASN O 65  
AY 2 3 N ILE O  60  ? N ILE O 60  O GLN O  89  ? O GLN O 89  
AY 3 4 N GLY O  94  ? N GLY O 94  O GLU O  119 ? O GLU O 119 
AY 4 5 N VAL O  120 ? N VAL O 120 O LEU O  175 ? O LEU O 175 
AZ 1 2 N LEU O  32  ? N LEU O 32  O ASN O  65  ? O ASN O 65  
AZ 2 3 N ILE O  60  ? N ILE O 60  O GLN O  89  ? O GLN O 89  
AZ 3 4 N THR O  90  ? N THR O 90  O PHE O  113 ? O PHE O 113 
AZ 4 5 O ARG O  112 ? O ARG O 112 N GLU O  188 ? N GLU O 188 
BA 1 2 N GLY O  131 ? N GLY O 131 O GLY Y  127 ? O GLY Y 127 
BB 1 2 N VAL P  7   ? N VAL P 7   O TYR P  18  ? O TYR P 18  
BC 1 2 N ILE P  30  ? N ILE P 30  O TYR P  61  ? O TYR P 61  
BC 2 3 N ILE P  60  ? N ILE P 60  O GLN P  89  ? O GLN P 89  
BC 3 4 N ALA P  96  ? N ALA P 96  O GLU P  119 ? O GLU P 119 
BC 4 5 N VAL P  120 ? N VAL P 120 O LEU P  175 ? O LEU P 175 
BD 1 2 N ILE P  30  ? N ILE P 30  O TYR P  61  ? O TYR P 61  
BD 2 3 N ILE P  60  ? N ILE P 60  O GLN P  89  ? O GLN P 89  
BD 3 4 N THR P  90  ? N THR P 90  O PHE P  113 ? O PHE P 113 
BD 4 5 O ARG P  112 ? O ARG P 112 N GLU P  188 ? N GLU P 188 
BE 1 2 N GLY P  127 ? N GLY P 127 O GLY X  131 ? O GLY X 131 
BF 1 2 N VAL Q  7   ? N VAL Q 7   O TYR Q  18  ? O TYR Q 18  
BG 1 2 N ILE Q  30  ? N ILE Q 30  O TYR Q  61  ? O TYR Q 61  
BG 2 3 N ILE Q  60  ? N ILE Q 60  O GLN Q  89  ? O GLN Q 89  
BG 3 4 N ALA Q  96  ? N ALA Q 96  O GLU Q  119 ? O GLU Q 119 
BG 4 5 N VAL Q  120 ? N VAL Q 120 O LEU Q  175 ? O LEU Q 175 
BH 1 2 N ILE Q  30  ? N ILE Q 30  O TYR Q  61  ? O TYR Q 61  
BH 2 3 N ILE Q  60  ? N ILE Q 60  O GLN Q  89  ? O GLN Q 89  
BH 3 4 N THR Q  90  ? N THR Q 90  O PHE Q  113 ? O PHE Q 113 
BH 4 5 O ARG Q  112 ? O ARG Q 112 N GLU Q  188 ? N GLU Q 188 
BI 1 2 N GLY Q  131 ? N GLY Q 131 O GLY W  127 ? O GLY W 127 
BJ 1 2 N VAL R  7   ? N VAL R 7   O TYR R  18  ? O TYR R 18  
BK 1 2 N ILE R  30  ? N ILE R 30  O TYR R  61  ? O TYR R 61  
BK 2 3 N ILE R  60  ? N ILE R 60  O GLN R  89  ? O GLN R 89  
BK 3 4 N ALA R  96  ? N ALA R 96  O GLU R  119 ? O GLU R 119 
BK 4 5 N VAL R  120 ? N VAL R 120 O LEU R  175 ? O LEU R 175 
BL 1 2 N ILE R  30  ? N ILE R 30  O TYR R  61  ? O TYR R 61  
BL 2 3 N ILE R  60  ? N ILE R 60  O GLN R  89  ? O GLN R 89  
BL 3 4 N THR R  90  ? N THR R 90  O PHE R  113 ? O PHE R 113 
BL 4 5 O ARG R  112 ? O ARG R 112 N GLU R  188 ? N GLU R 188 
BM 1 2 N GLY R  131 ? N GLY R 131 O GLY V  127 ? O GLY V 127 
BN 1 2 N VAL S  7   ? N VAL S 7   O TYR S  18  ? O TYR S 18  
BO 1 2 N ILE S  30  ? N ILE S 30  O TYR S  61  ? O TYR S 61  
BO 2 3 N ILE S  60  ? N ILE S 60  O GLN S  89  ? O GLN S 89  
BO 3 4 N ALA S  96  ? N ALA S 96  O MET S  121 ? O MET S 121 
BO 4 5 N VAL S  120 ? N VAL S 120 O LEU S  175 ? O LEU S 175 
BP 1 2 N ILE S  30  ? N ILE S 30  O TYR S  61  ? O TYR S 61  
BP 2 3 N ILE S  60  ? N ILE S 60  O GLN S  89  ? O GLN S 89  
BP 3 4 N THR S  90  ? N THR S 90  O PHE S  113 ? O PHE S 113 
BP 4 5 O ARG S  112 ? O ARG S 112 N GLU S  188 ? N GLU S 188 
BQ 1 2 N GLY S  131 ? N GLY S 131 O GLY BA 127 ? O GLY b 127 
BR 1 2 N VAL T  7   ? N VAL T 7   O TYR T  18  ? O TYR T 18  
BS 1 2 N ILE T  30  ? N ILE T 30  O TYR T  61  ? O TYR T 61  
BS 2 3 N ILE T  60  ? N ILE T 60  O GLN T  89  ? O GLN T 89  
BS 3 4 N ALA T  96  ? N ALA T 96  O GLU T  119 ? O GLU T 119 
BS 4 5 N VAL T  120 ? N VAL T 120 O LEU T  175 ? O LEU T 175 
BT 1 2 N ILE T  30  ? N ILE T 30  O TYR T  61  ? O TYR T 61  
BT 2 3 N ILE T  60  ? N ILE T 60  O GLN T  89  ? O GLN T 89  
BT 3 4 N THR T  90  ? N THR T 90  O PHE T  113 ? O PHE T 113 
BT 4 5 O ARG T  112 ? O ARG T 112 N GLU T  188 ? N GLU T 188 
BU 1 2 N GLY T  131 ? N GLY T 131 O GLY AA 127 ? O GLY a 127 
BV 1 2 N VAL U  7   ? N VAL U 7   O TYR U  18  ? O TYR U 18  
BW 1 2 N ILE U  30  ? N ILE U 30  O TYR U  61  ? O TYR U 61  
BW 2 3 N ILE U  60  ? N ILE U 60  O GLN U  89  ? O GLN U 89  
BW 3 4 N GLY U  94  ? N GLY U 94  O GLU U  119 ? O GLU U 119 
BW 4 5 N VAL U  120 ? N VAL U 120 O LEU U  175 ? O LEU U 175 
BX 1 2 N ILE U  30  ? N ILE U 30  O TYR U  61  ? O TYR U 61  
BX 2 3 N ILE U  60  ? N ILE U 60  O GLN U  89  ? O GLN U 89  
BX 3 4 N THR U  90  ? N THR U 90  O PHE U  113 ? O PHE U 113 
BX 4 5 O ARG U  112 ? O ARG U 112 N GLU U  188 ? N GLU U 188 
BY 1 2 N GLY U  127 ? N GLY U 127 O GLY Z  131 ? O GLY Z 131 
BZ 1 2 N VAL V  7   ? N VAL V 7   O TYR V  18  ? O TYR V 18  
CA 1 2 N ILE V  30  ? N ILE V 30  O TYR V  61  ? O TYR V 61  
CA 2 3 N ILE V  60  ? N ILE V 60  O GLN V  89  ? O GLN V 89  
CA 3 4 N ALA V  96  ? N ALA V 96  O GLU V  119 ? O GLU V 119 
CA 4 5 N VAL V  120 ? N VAL V 120 O LEU V  175 ? O LEU V 175 
CB 1 2 N ILE V  30  ? N ILE V 30  O TYR V  61  ? O TYR V 61  
CB 2 3 N ILE V  60  ? N ILE V 60  O GLN V  89  ? O GLN V 89  
CB 3 4 N THR V  90  ? N THR V 90  O PHE V  113 ? O PHE V 113 
CB 4 5 O ARG V  112 ? O ARG V 112 N GLU V  188 ? N GLU V 188 
CC 1 2 N VAL W  7   ? N VAL W 7   O TYR W  18  ? O TYR W 18  
CD 1 2 N ILE W  30  ? N ILE W 30  O TYR W  61  ? O TYR W 61  
CD 2 3 N ILE W  60  ? N ILE W 60  O GLN W  89  ? O GLN W 89  
CD 3 4 N GLY W  94  ? N GLY W 94  O GLU W  119 ? O GLU W 119 
CD 4 5 N VAL W  120 ? N VAL W 120 O LEU W  175 ? O LEU W 175 
CE 1 2 N ILE W  30  ? N ILE W 30  O TYR W  61  ? O TYR W 61  
CE 2 3 N ILE W  60  ? N ILE W 60  O GLN W  89  ? O GLN W 89  
CE 3 4 N THR W  90  ? N THR W 90  O PHE W  113 ? O PHE W 113 
CE 4 5 O ARG W  112 ? O ARG W 112 N GLU W  188 ? N GLU W 188 
CF 1 2 N VAL X  7   ? N VAL X 7   O TYR X  18  ? O TYR X 18  
CG 1 2 N ILE X  30  ? N ILE X 30  O TYR X  61  ? O TYR X 61  
CG 2 3 N ILE X  60  ? N ILE X 60  O GLN X  89  ? O GLN X 89  
CG 3 4 N ALA X  96  ? N ALA X 96  O MET X  121 ? O MET X 121 
CG 4 5 N VAL X  120 ? N VAL X 120 O LEU X  175 ? O LEU X 175 
CH 1 2 N ILE X  30  ? N ILE X 30  O TYR X  61  ? O TYR X 61  
CH 2 3 N ILE X  60  ? N ILE X 60  O GLN X  89  ? O GLN X 89  
CH 3 4 N THR X  90  ? N THR X 90  O PHE X  113 ? O PHE X 113 
CH 4 5 O ARG X  112 ? O ARG X 112 N GLU X  188 ? N GLU X 188 
CI 1 2 N VAL Y  7   ? N VAL Y 7   O TYR Y  18  ? O TYR Y 18  
CJ 1 2 N ILE Y  30  ? N ILE Y 30  O TYR Y  61  ? O TYR Y 61  
CJ 2 3 N ILE Y  60  ? N ILE Y 60  O GLN Y  89  ? O GLN Y 89  
CJ 3 4 N ALA Y  96  ? N ALA Y 96  O GLU Y  119 ? O GLU Y 119 
CJ 4 5 N VAL Y  120 ? N VAL Y 120 O LEU Y  175 ? O LEU Y 175 
CK 1 2 N ILE Y  30  ? N ILE Y 30  O TYR Y  61  ? O TYR Y 61  
CK 2 3 N ILE Y  60  ? N ILE Y 60  O GLN Y  89  ? O GLN Y 89  
CK 3 4 N THR Y  90  ? N THR Y 90  O PHE Y  113 ? O PHE Y 113 
CK 4 5 O ARG Y  112 ? O ARG Y 112 N GLU Y  188 ? N GLU Y 188 
CL 1 2 N VAL Z  7   ? N VAL Z 7   O TYR Z  18  ? O TYR Z 18  
CM 1 2 N ILE Z  30  ? N ILE Z 30  O TYR Z  61  ? O TYR Z 61  
CM 2 3 N ILE Z  60  ? N ILE Z 60  O GLN Z  89  ? O GLN Z 89  
CM 3 4 N ALA Z  96  ? N ALA Z 96  O GLU Z  119 ? O GLU Z 119 
CM 4 5 N VAL Z  120 ? N VAL Z 120 O LEU Z  175 ? O LEU Z 175 
CN 1 2 N ILE Z  30  ? N ILE Z 30  O TYR Z  61  ? O TYR Z 61  
CN 2 3 N ILE Z  60  ? N ILE Z 60  O GLN Z  89  ? O GLN Z 89  
CN 3 4 N THR Z  90  ? N THR Z 90  O PHE Z  113 ? O PHE Z 113 
CN 4 5 O ARG Z  112 ? O ARG Z 112 N GLU Z  188 ? N GLU Z 188 
CO 1 2 N VAL AA 7   ? N VAL a 7   O TYR AA 18  ? O TYR a 18  
CP 1 2 N ILE AA 30  ? N ILE a 30  O TYR AA 61  ? O TYR a 61  
CP 2 3 N ILE AA 60  ? N ILE a 60  O GLN AA 89  ? O GLN a 89  
CP 3 4 N GLY AA 94  ? N GLY a 94  O GLU AA 119 ? O GLU a 119 
CP 4 5 N VAL AA 120 ? N VAL a 120 O LEU AA 175 ? O LEU a 175 
CQ 1 2 N ILE AA 30  ? N ILE a 30  O TYR AA 61  ? O TYR a 61  
CQ 2 3 N ILE AA 60  ? N ILE a 60  O GLN AA 89  ? O GLN a 89  
CQ 3 4 N THR AA 90  ? N THR a 90  O PHE AA 113 ? O PHE a 113 
CQ 4 5 O ARG AA 112 ? O ARG a 112 N GLU AA 188 ? N GLU a 188 
CR 1 2 N VAL BA 7   ? N VAL b 7   O TYR BA 18  ? O TYR b 18  
CS 1 2 N ILE BA 30  ? N ILE b 30  O TYR BA 61  ? O TYR b 61  
CS 2 3 N ILE BA 60  ? N ILE b 60  O GLN BA 89  ? O GLN b 89  
CS 3 4 N ALA BA 96  ? N ALA b 96  O GLU BA 119 ? O GLU b 119 
CS 4 5 N VAL BA 120 ? N VAL b 120 O LEU BA 175 ? O LEU b 175 
CT 1 2 N ILE BA 30  ? N ILE b 30  O TYR BA 61  ? O TYR b 61  
CT 2 3 N ILE BA 60  ? N ILE b 60  O GLN BA 89  ? O GLN b 89  
CT 3 4 N THR BA 90  ? N THR b 90  O PHE BA 113 ? O PHE b 113 
CT 4 5 O ARG BA 112 ? O ARG b 112 N GLU BA 188 ? N GLU b 188 
# 
_database_PDB_matrix.entry_id          3V5I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3V5I 
_atom_sites.fract_transf_matrix[1][1]   0.010251 
_atom_sites.fract_transf_matrix[1][2]   -0.003438 
_atom_sites.fract_transf_matrix[1][3]   -0.001246 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009612 
_atom_sites.fract_transf_matrix[2][3]   -0.002435 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006138 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ILE A  1 4   ? -32.109  -20.117 -53.442  1.00 110.16 ? 4   ILE A N   1 
ATOM   2     C CA  . ILE A  1 4   ? -32.975  -20.631 -52.332  1.00 113.54 ? 4   ILE A CA  1 
ATOM   3     C C   . ILE A  1 4   ? -33.486  -22.080 -52.563  1.00 110.65 ? 4   ILE A C   1 
ATOM   4     O O   . ILE A  1 4   ? -33.126  -22.951 -51.792  1.00 114.77 ? 4   ILE A O   1 
ATOM   5     C CB  . ILE A  1 4   ? -34.015  -19.558 -51.774  1.00 116.29 ? 4   ILE A CB  1 
ATOM   6     C CG1 . ILE A  1 4   ? -34.805  -20.060 -50.545  1.00 123.87 ? 4   ILE A CG1 1 
ATOM   7     C CG2 . ILE A  1 4   ? -34.916  -18.956 -52.847  1.00 109.61 ? 4   ILE A CG2 1 
ATOM   8     C CD1 . ILE A  1 4   ? -35.498  -18.957 -49.761  1.00 130.68 ? 4   ILE A CD1 1 
ATOM   9     N N   . PRO A  1 5   ? -34.256  -22.380 -53.639  1.00 105.03 ? 5   PRO A N   1 
ATOM   10    C CA  . PRO A  1 5   ? -34.803  -23.744 -53.721  1.00 104.87 ? 5   PRO A CA  1 
ATOM   11    C C   . PRO A  1 5   ? -33.874  -24.841 -54.223  1.00 102.78 ? 5   PRO A C   1 
ATOM   12    O O   . PRO A  1 5   ? -32.901  -24.557 -54.888  1.00 100.99 ? 5   PRO A O   1 
ATOM   13    C CB  . PRO A  1 5   ? -35.981  -23.607 -54.681  1.00 102.64 ? 5   PRO A CB  1 
ATOM   14    C CG  . PRO A  1 5   ? -35.845  -22.303 -55.342  1.00 99.73  ? 5   PRO A CG  1 
ATOM   15    C CD  . PRO A  1 5   ? -34.631  -21.600 -54.824  1.00 100.53 ? 5   PRO A CD  1 
ATOM   16    N N   . THR A  1 6   ? -34.221  -26.090 -53.902  1.00 104.37 ? 6   THR A N   1 
ATOM   17    C CA  . THR A  1 6   ? -33.390  -27.299 -54.109  1.00 103.49 ? 6   THR A CA  1 
ATOM   18    C C   . THR A  1 6   ? -33.912  -28.219 -55.236  1.00 101.35 ? 6   THR A C   1 
ATOM   19    O O   . THR A  1 6   ? -35.114  -28.366 -55.423  1.00 103.06 ? 6   THR A O   1 
ATOM   20    C CB  . THR A  1 6   ? -33.317  -28.102 -52.790  1.00 108.60 ? 6   THR A CB  1 
ATOM   21    O OG1 . THR A  1 6   ? -32.822  -27.260 -51.753  1.00 113.43 ? 6   THR A OG1 1 
ATOM   22    C CG2 . THR A  1 6   ? -32.430  -29.307 -52.883  1.00 107.96 ? 6   THR A CG2 1 
ATOM   23    N N   . VAL A  1 7   ? -33.001  -28.822 -55.991  1.00 99.73  ? 7   VAL A N   1 
ATOM   24    C CA  . VAL A  1 7   ? -33.357  -29.765 -57.059  1.00 99.90  ? 7   VAL A CA  1 
ATOM   25    C C   . VAL A  1 7   ? -32.675  -31.114 -56.837  1.00 100.51 ? 7   VAL A C   1 
ATOM   26    O O   . VAL A  1 7   ? -31.543  -31.166 -56.359  1.00 100.33 ? 7   VAL A O   1 
ATOM   27    C CB  . VAL A  1 7   ? -32.979  -29.219 -58.441  1.00 99.70  ? 7   VAL A CB  1 
ATOM   28    C CG1 . VAL A  1 7   ? -33.422  -30.169 -59.516  1.00 102.76 ? 7   VAL A CG1 1 
ATOM   29    C CG2 . VAL A  1 7   ? -33.610  -27.864 -58.676  1.00 99.03  ? 7   VAL A CG2 1 
ATOM   30    N N   . ILE A  1 8   ? -33.374  -32.202 -57.170  1.00 102.51 ? 8   ILE A N   1 
ATOM   31    C CA  . ILE A  1 8   ? -32.836  -33.600 -57.056  1.00 103.28 ? 8   ILE A CA  1 
ATOM   32    C C   . ILE A  1 8   ? -32.342  -34.232 -58.345  1.00 104.53 ? 8   ILE A C   1 
ATOM   33    O O   . ILE A  1 8   ? -32.831  -33.923 -59.422  1.00 107.01 ? 8   ILE A O   1 
ATOM   34    C CB  . ILE A  1 8   ? -33.904  -34.560 -56.543  1.00 106.94 ? 8   ILE A CB  1 
ATOM   35    C CG1 . ILE A  1 8   ? -35.277  -34.213 -57.189  1.00 111.00 ? 8   ILE A CG1 1 
ATOM   36    C CG2 . ILE A  1 8   ? -33.908  -34.547 -55.016  1.00 108.17 ? 8   ILE A CG2 1 
ATOM   37    C CD1 . ILE A  1 8   ? -35.687  -35.090 -58.375  1.00 115.75 ? 8   ILE A CD1 1 
ATOM   38    N N   . GLU A  1 9   ? -31.388  -35.143 -58.227  1.00 104.43 ? 9   GLU A N   1 
ATOM   39    C CA  . GLU A  1 9   ? -30.844  -35.841 -59.395  1.00 107.46 ? 9   GLU A CA  1 
ATOM   40    C C   . GLU A  1 9   ? -30.227  -37.176 -59.000  1.00 107.70 ? 9   GLU A C   1 
ATOM   41    O O   . GLU A  1 9   ? -30.780  -38.227 -59.300  1.00 110.31 ? 9   GLU A O   1 
ATOM   42    C CB  . GLU A  1 9   ? -29.819  -34.942 -60.080  1.00 108.70 ? 9   GLU A CB  1 
ATOM   43    C CG  . GLU A  1 9   ? -29.840  -35.011 -61.599  1.00 114.91 ? 9   GLU A CG  1 
ATOM   44    C CD  . GLU A  1 9   ? -29.801  -33.639 -62.251  1.00 116.75 ? 9   GLU A CD  1 
ATOM   45    O OE1 . GLU A  1 9   ? -28.752  -33.313 -62.872  1.00 121.55 ? 9   GLU A OE1 1 
ATOM   46    O OE2 . GLU A  1 9   ? -30.818  -32.899 -62.143  1.00 114.59 ? 9   GLU A OE2 1 
ATOM   47    N N   . ARG A  1 16  ? -28.582  -36.958 -55.930  1.00 104.28 ? 16  ARG A N   1 
ATOM   48    C CA  . ARG A  1 16  ? -27.825  -35.804 -55.415  1.00 105.51 ? 16  ARG A CA  1 
ATOM   49    C C   . ARG A  1 16  ? -28.593  -34.482 -55.431  1.00 104.27 ? 16  ARG A C   1 
ATOM   50    O O   . ARG A  1 16  ? -29.422  -34.252 -56.297  1.00 102.67 ? 16  ARG A O   1 
ATOM   51    C CB  . ARG A  1 16  ? -26.501  -35.658 -56.155  1.00 108.55 ? 16  ARG A CB  1 
ATOM   52    C CG  . ARG A  1 16  ? -25.627  -36.917 -56.070  1.00 110.81 ? 16  ARG A CG  1 
ATOM   53    C CD  . ARG A  1 16  ? -24.869  -37.066 -54.739  1.00 114.21 ? 16  ARG A CD  1 
ATOM   54    N NE  . ARG A  1 16  ? -23.947  -38.219 -54.684  1.00 117.07 ? 16  ARG A NE  1 
ATOM   55    C CZ  . ARG A  1 16  ? -23.077  -38.422 -53.697  1.00 122.36 ? 16  ARG A CZ  1 
ATOM   56    N NH1 . ARG A  1 16  ? -22.284  -39.484 -53.717  1.00 125.02 ? 16  ARG A NH1 1 
ATOM   57    N NH2 . ARG A  1 16  ? -22.999  -37.551 -52.688  1.00 126.42 ? 16  ARG A NH2 1 
ATOM   58    N N   . ALA A  1 17  ? -28.309  -33.621 -54.457  1.00 106.37 ? 17  ALA A N   1 
ATOM   59    C CA  . ALA A  1 17  ? -29.064  -32.361 -54.251  1.00 105.79 ? 17  ALA A CA  1 
ATOM   60    C C   . ALA A  1 17  ? -28.321  -31.075 -54.646  1.00 107.24 ? 17  ALA A C   1 
ATOM   61    O O   . ALA A  1 17  ? -27.194  -30.851 -54.234  1.00 112.02 ? 17  ALA A O   1 
ATOM   62    C CB  . ALA A  1 17  ? -29.554  -32.260 -52.806  1.00 109.36 ? 17  ALA A CB  1 
ATOM   63    N N   . TYR A  1 18  ? -28.972  -30.232 -55.441  1.00 104.59 ? 18  TYR A N   1 
ATOM   64    C CA  . TYR A  1 18  ? -28.446  -28.900 -55.795  1.00 106.42 ? 18  TYR A CA  1 
ATOM   65    C C   . TYR A  1 18  ? -29.313  -27.749 -55.332  1.00 105.26 ? 18  TYR A C   1 
ATOM   66    O O   . TYR A  1 18  ? -30.506  -27.902 -55.189  1.00 102.64 ? 18  TYR A O   1 
ATOM   67    C CB  . TYR A  1 18  ? -28.423  -28.713 -57.292  1.00 105.74 ? 18  TYR A CB  1 
ATOM   68    C CG  . TYR A  1 18  ? -27.636  -29.694 -58.040  1.00 108.43 ? 18  TYR A CG  1 
ATOM   69    C CD1 . TYR A  1 18  ? -26.264  -29.531 -58.219  1.00 114.87 ? 18  TYR A CD1 1 
ATOM   70    C CD2 . TYR A  1 18  ? -28.259  -30.782 -58.619  1.00 106.57 ? 18  TYR A CD2 1 
ATOM   71    C CE1 . TYR A  1 18  ? -25.527  -30.457 -58.945  1.00 118.97 ? 18  TYR A CE1 1 
ATOM   72    C CE2 . TYR A  1 18  ? -27.535  -31.720 -59.337  1.00 110.13 ? 18  TYR A CE2 1 
ATOM   73    C CZ  . TYR A  1 18  ? -26.183  -31.548 -59.499  1.00 116.05 ? 18  TYR A CZ  1 
ATOM   74    O OH  . TYR A  1 18  ? -25.523  -32.490 -60.228  1.00 120.82 ? 18  TYR A OH  1 
ATOM   75    N N   . ASP A  1 19  ? -28.728  -26.574 -55.182  1.00 108.46 ? 19  ASP A N   1 
ATOM   76    C CA  . ASP A  1 19  ? -29.549  -25.380 -55.156  1.00 106.75 ? 19  ASP A CA  1 
ATOM   77    C C   . ASP A  1 19  ? -29.770  -25.006 -56.607  1.00 103.87 ? 19  ASP A C   1 
ATOM   78    O O   . ASP A  1 19  ? -28.984  -25.389 -57.466  1.00 105.90 ? 19  ASP A O   1 
ATOM   79    C CB  . ASP A  1 19  ? -28.891  -24.252 -54.359  1.00 112.67 ? 19  ASP A CB  1 
ATOM   80    C CG  . ASP A  1 19  ? -27.617  -23.731 -55.006  1.00 117.70 ? 19  ASP A CG  1 
ATOM   81    O OD1 . ASP A  1 19  ? -27.673  -22.843 -55.875  1.00 116.90 ? 19  ASP A OD1 1 
ATOM   82    O OD2 . ASP A  1 19  ? -26.534  -24.191 -54.625  1.00 124.19 ? 19  ASP A OD2 1 
ATOM   83    N N   . ILE A  1 20  ? -30.831  -24.261 -56.878  1.00 100.87 ? 20  ILE A N   1 
ATOM   84    C CA  . ILE A  1 20  ? -31.194  -23.951 -58.244  1.00 99.60  ? 20  ILE A CA  1 
ATOM   85    C C   . ILE A  1 20  ? -30.041  -23.404 -59.107  1.00 103.91 ? 20  ILE A C   1 
ATOM   86    O O   . ILE A  1 20  ? -29.897  -23.817 -60.250  1.00 106.08 ? 20  ILE A O   1 
ATOM   87    C CB  . ILE A  1 20  ? -32.462  -23.079 -58.323  1.00 97.08  ? 20  ILE A CB  1 
ATOM   88    C CG1 . ILE A  1 20  ? -33.052  -23.111 -59.734  1.00 97.40  ? 20  ILE A CG1 1 
ATOM   89    C CG2 . ILE A  1 20  ? -32.204  -21.648 -57.867  1.00 97.81  ? 20  ILE A CG2 1 
ATOM   90    C CD1 . ILE A  1 20  ? -33.878  -24.327 -60.004  1.00 97.96  ? 20  ILE A CD1 1 
ATOM   91    N N   . TYR A  1 21  ? -29.228  -22.483 -58.569  1.00 78.15  ? 21  TYR A N   1 
ATOM   92    C CA  . TYR A  1 21  ? -28.080  -21.905 -59.306  1.00 77.38  ? 21  TYR A CA  1 
ATOM   93    C C   . TYR A  1 21  ? -27.055  -22.972 -59.694  1.00 77.98  ? 21  TYR A C   1 
ATOM   94    O O   . TYR A  1 21  ? -26.530  -22.964 -60.805  1.00 77.99  ? 21  TYR A O   1 
ATOM   95    C CB  . TYR A  1 21  ? -27.413  -20.772 -58.521  1.00 76.51  ? 21  TYR A CB  1 
ATOM   96    C CG  . TYR A  1 21  ? -28.406  -19.709 -58.124  1.00 76.17  ? 21  TYR A CG  1 
ATOM   97    C CD1 . TYR A  1 21  ? -29.021  -18.902 -59.095  1.00 75.86  ? 21  TYR A CD1 1 
ATOM   98    C CD2 . TYR A  1 21  ? -28.777  -19.529 -56.792  1.00 76.41  ? 21  TYR A CD2 1 
ATOM   99    C CE1 . TYR A  1 21  ? -29.955  -17.938 -58.732  1.00 75.81  ? 21  TYR A CE1 1 
ATOM   100   C CE2 . TYR A  1 21  ? -29.707  -18.577 -56.438  1.00 76.38  ? 21  TYR A CE2 1 
ATOM   101   C CZ  . TYR A  1 21  ? -30.288  -17.784 -57.407  1.00 76.09  ? 21  TYR A CZ  1 
ATOM   102   O OH  . TYR A  1 21  ? -31.224  -16.830 -57.043  1.00 76.30  ? 21  TYR A OH  1 
ATOM   103   N N   . SER A  1 22  ? -26.793  -23.912 -58.793  1.00 78.72  ? 22  SER A N   1 
ATOM   104   C CA  . SER A  1 22  ? -25.845  -24.987 -59.052  1.00 79.60  ? 22  SER A CA  1 
ATOM   105   C C   . SER A  1 22  ? -26.378  -25.900 -60.124  1.00 80.56  ? 22  SER A C   1 
ATOM   106   O O   . SER A  1 22  ? -25.642  -26.395 -60.980  1.00 81.15  ? 22  SER A O   1 
ATOM   107   C CB  . SER A  1 22  ? -25.655  -25.806 -57.802  1.00 80.44  ? 22  SER A CB  1 
ATOM   108   O OG  . SER A  1 22  ? -25.227  -24.983 -56.757  1.00 79.80  ? 22  SER A OG  1 
ATOM   109   N N   . ARG A  1 23  ? -27.676  -26.138 -60.071  1.00 80.95  ? 23  ARG A N   1 
ATOM   110   C CA  . ARG A  1 23  ? -28.307  -26.944 -61.093  1.00 82.04  ? 23  ARG A CA  1 
ATOM   111   C C   . ARG A  1 23  ? -28.112  -26.309 -62.462  1.00 81.65  ? 23  ARG A C   1 
ATOM   112   O O   . ARG A  1 23  ? -27.744  -26.979 -63.398  1.00 82.59  ? 23  ARG A O   1 
ATOM   113   C CB  . ARG A  1 23  ? -29.787  -27.146 -60.776  1.00 82.61  ? 23  ARG A CB  1 
ATOM   114   C CG  . ARG A  1 23  ? -30.568  -27.946 -61.800  1.00 83.98  ? 23  ARG A CG  1 
ATOM   115   C CD  . ARG A  1 23  ? -29.985  -29.337 -62.053  1.00 85.46  ? 23  ARG A CD  1 
ATOM   116   N NE  . ARG A  1 23  ? -30.564  -29.958 -63.247  1.00 86.83  ? 23  ARG A NE  1 
ATOM   117   C CZ  . ARG A  1 23  ? -30.201  -29.694 -64.504  1.00 86.89  ? 23  ARG A CZ  1 
ATOM   118   N NH1 . ARG A  1 23  ? -29.240  -28.808 -64.801  1.00 85.63  ? 23  ARG A NH1 1 
ATOM   119   N NH2 . ARG A  1 23  ? -30.805  -30.324 -65.483  1.00 88.43  ? 23  ARG A NH2 1 
ATOM   120   N N   . LEU A  1 24  ? -28.338  -25.008 -62.558  1.00 80.44  ? 24  LEU A N   1 
ATOM   121   C CA  . LEU A  1 24  ? -28.101  -24.288 -63.779  1.00 80.10  ? 24  LEU A CA  1 
ATOM   122   C C   . LEU A  1 24  ? -26.621  -24.258 -64.187  1.00 79.97  ? 24  LEU A C   1 
ATOM   123   O O   . LEU A  1 24  ? -26.310  -24.204 -65.381  1.00 80.41  ? 24  LEU A O   1 
ATOM   124   C CB  . LEU A  1 24  ? -28.645  -22.879 -63.640  1.00 78.98  ? 24  LEU A CB  1 
ATOM   125   C CG  . LEU A  1 24  ? -29.982  -22.593 -64.317  1.00 79.45  ? 24  LEU A CG  1 
ATOM   126   C CD1 . LEU A  1 24  ? -31.007  -23.681 -64.084  1.00 80.70  ? 24  LEU A CD1 1 
ATOM   127   C CD2 . LEU A  1 24  ? -30.500  -21.243 -63.862  1.00 78.52  ? 24  LEU A CD2 1 
ATOM   128   N N   . LEU A  1 25  ? -25.725  -24.294 -63.196  1.00 79.60  ? 25  LEU A N   1 
ATOM   129   C CA  . LEU A  1 25  ? -24.279  -24.233 -63.452  1.00 79.67  ? 25  LEU A CA  1 
ATOM   130   C C   . LEU A  1 25  ? -23.831  -25.494 -64.141  1.00 81.21  ? 25  LEU A C   1 
ATOM   131   O O   . LEU A  1 25  ? -22.917  -25.474 -64.956  1.00 81.69  ? 25  LEU A O   1 
ATOM   132   C CB  . LEU A  1 25  ? -23.486  -24.046 -62.162  1.00 79.23  ? 25  LEU A CB  1 
ATOM   133   C CG  . LEU A  1 25  ? -21.974  -23.934 -62.329  1.00 79.49  ? 25  LEU A CG  1 
ATOM   134   C CD1 . LEU A  1 25  ? -21.639  -22.712 -63.169  1.00 78.72  ? 25  LEU A CD1 1 
ATOM   135   C CD2 . LEU A  1 25  ? -21.285  -23.881 -60.972  1.00 79.40  ? 25  LEU A CD2 1 
ATOM   136   N N   . LYS A  1 26  ? -24.495  -26.591 -63.811  1.00 82.18  ? 26  LYS A N   1 
ATOM   137   C CA  . LYS A  1 26  ? -24.291  -27.865 -64.487  1.00 83.94  ? 26  LYS A CA  1 
ATOM   138   C C   . LYS A  1 26  ? -24.489  -27.756 -65.996  1.00 84.54  ? 26  LYS A C   1 
ATOM   139   O O   . LYS A  1 26  ? -23.872  -28.509 -66.723  1.00 85.98  ? 26  LYS A O   1 
ATOM   140   C CB  . LYS A  1 26  ? -25.263  -28.881 -63.916  1.00 84.85  ? 26  LYS A CB  1 
ATOM   141   C CG  . LYS A  1 26  ? -24.776  -30.296 -63.892  1.00 86.72  ? 26  LYS A CG  1 
ATOM   142   C CD  . LYS A  1 26  ? -25.903  -31.183 -63.401  1.00 87.67  ? 26  LYS A CD  1 
ATOM   143   C CE  . LYS A  1 26  ? -25.555  -32.664 -63.407  1.00 89.82  ? 26  LYS A CE  1 
ATOM   144   N NZ  . LYS A  1 26  ? -25.527  -33.178 -64.792  1.00 91.25  ? 26  LYS A NZ  1 
ATOM   145   N N   . ASP A  1 27  ? -25.343  -26.826 -66.450  1.00 83.67  ? 27  ASP A N   1 
ATOM   146   C CA  . ASP A  1 27  ? -25.607  -26.580 -67.884  1.00 84.30  ? 27  ASP A CA  1 
ATOM   147   C C   . ASP A  1 27  ? -24.828  -25.401 -68.384  1.00 83.38  ? 27  ASP A C   1 
ATOM   148   O O   . ASP A  1 27  ? -25.217  -24.786 -69.367  1.00 83.47  ? 27  ASP A O   1 
ATOM   149   C CB  . ASP A  1 27  ? -27.083  -26.278 -68.145  1.00 84.25  ? 27  ASP A CB  1 
ATOM   150   C CG  . ASP A  1 27  ? -27.975  -27.450 -67.846  1.00 85.51  ? 27  ASP A CG  1 
ATOM   151   O OD1 . ASP A  1 27  ? -29.223  -27.256 -67.911  1.00 85.64  ? 27  ASP A OD1 1 
ATOM   152   O OD2 . ASP A  1 27  ? -27.441  -28.557 -67.532  1.00 86.54  ? 27  ASP A OD2 1 
ATOM   153   N N   . ARG A  1 28  ? -23.756  -25.056 -67.688  1.00 82.63  ? 28  ARG A N   1 
ATOM   154   C CA  . ARG A  1 28  ? -22.881  -23.935 -68.066  1.00 81.90  ? 28  ARG A CA  1 
ATOM   155   C C   . ARG A  1 28  ? -23.548  -22.534 -68.013  1.00 80.46  ? 28  ARG A C   1 
ATOM   156   O O   . ARG A  1 28  ? -23.080  -21.576 -68.658  1.00 80.16  ? 28  ARG A O   1 
ATOM   157   C CB  . ARG A  1 28  ? -22.225  -24.221 -69.418  1.00 83.32  ? 28  ARG A CB  1 
ATOM   158   C CG  . ARG A  1 28  ? -21.521  -25.578 -69.488  1.00 85.02  ? 28  ARG A CG  1 
ATOM   159   C CD  . ARG A  1 28  ? -20.915  -25.811 -70.851  1.00 86.66  ? 28  ARG A CD  1 
ATOM   160   N NE  . ARG A  1 28  ? -19.726  -25.010 -71.081  1.00 86.46  ? 28  ARG A NE  1 
ATOM   161   C CZ  . ARG A  1 28  ? -18.549  -25.193 -70.474  1.00 86.73  ? 28  ARG A CZ  1 
ATOM   162   N NH1 . ARG A  1 28  ? -18.385  -26.140 -69.563  1.00 87.15  ? 28  ARG A NH1 1 
ATOM   163   N NH2 . ARG A  1 28  ? -17.515  -24.410 -70.778  1.00 86.75  ? 28  ARG A NH2 1 
ATOM   164   N N   . ILE A  1 29  ? -24.608  -22.412 -67.203  1.00 79.76  ? 29  ILE A N   1 
ATOM   165   C CA  . ILE A  1 29  ? -25.250  -21.112 -66.947  1.00 78.56  ? 29  ILE A CA  1 
ATOM   166   C C   . ILE A  1 29  ? -24.767  -20.446 -65.658  1.00 77.41  ? 29  ILE A C   1 
ATOM   167   O O   . ILE A  1 29  ? -24.754  -21.079 -64.614  1.00 77.42  ? 29  ILE A O   1 
ATOM   168   C CB  . ILE A  1 29  ? -26.787  -21.226 -66.941  1.00 78.78  ? 29  ILE A CB  1 
ATOM   169   C CG1 . ILE A  1 29  ? -27.277  -21.667 -68.324  1.00 80.07  ? 29  ILE A CG1 1 
ATOM   170   C CG2 . ILE A  1 29  ? -27.407  -19.884 -66.603  1.00 77.77  ? 29  ILE A CG2 1 
ATOM   171   C CD1 . ILE A  1 29  ? -28.720  -22.125 -68.359  1.00 80.81  ? 29  ILE A CD1 1 
ATOM   172   N N   . ILE A  1 30  ? -24.353  -19.184 -65.756  1.00 76.63  ? 30  ILE A N   1 
ATOM   173   C CA  . ILE A  1 30  ? -24.020  -18.383 -64.583  1.00 75.70  ? 30  ILE A CA  1 
ATOM   174   C C   . ILE A  1 30  ? -24.980  -17.214 -64.406  1.00 75.03  ? 30  ILE A C   1 
ATOM   175   O O   . ILE A  1 30  ? -25.212  -16.450 -65.361  1.00 75.06  ? 30  ILE A O   1 
ATOM   176   C CB  . ILE A  1 30  ? -22.590  -17.838 -64.628  1.00 75.58  ? 30  ILE A CB  1 
ATOM   177   C CG1 . ILE A  1 30  ? -21.578  -18.984 -64.705  1.00 76.49  ? 30  ILE A CG1 1 
ATOM   178   C CG2 . ILE A  1 30  ? -22.355  -16.981 -63.378  1.00 74.82  ? 30  ILE A CG2 1 
ATOM   179   C CD1 . ILE A  1 30  ? -20.168  -18.557 -65.053  1.00 76.81  ? 30  ILE A CD1 1 
ATOM   180   N N   . MET A  1 31  ? -25.541  -17.081 -63.197  1.00 74.66  ? 31  MET A N   1 
ATOM   181   C CA  . MET A  1 31  ? -26.435  -15.932 -62.880  1.00 74.24  ? 31  MET A CA  1 
ATOM   182   C C   . MET A  1 31  ? -25.697  -14.815 -62.147  1.00 73.66  ? 31  MET A C   1 
ATOM   183   O O   . MET A  1 31  ? -25.059  -15.047 -61.104  1.00 73.57  ? 31  MET A O   1 
ATOM   184   C CB  . MET A  1 31  ? -27.626  -16.362 -62.045  1.00 74.50  ? 31  MET A CB  1 
ATOM   185   C CG  . MET A  1 31  ? -28.397  -17.530 -62.649  1.00 75.29  ? 31  MET A CG  1 
ATOM   186   S SD  . MET A  1 31  ? -29.097  -17.218 -64.289  1.00 75.84  ? 31  MET A SD  1 
ATOM   187   C CE  . MET A  1 31  ? -30.400  -16.045 -63.921  1.00 75.85  ? 31  MET A CE  1 
ATOM   188   N N   . LEU A  1 32  ? -25.741  -13.616 -62.717  1.00 73.47  ? 32  LEU A N   1 
ATOM   189   C CA  . LEU A  1 32  ? -25.260  -12.430 -62.002  1.00 73.13  ? 32  LEU A CA  1 
ATOM   190   C C   . LEU A  1 32  ? -26.464  -11.568 -61.665  1.00 73.21  ? 32  LEU A C   1 
ATOM   191   O O   . LEU A  1 32  ? -26.991  -10.866 -62.532  1.00 73.40  ? 32  LEU A O   1 
ATOM   192   C CB  . LEU A  1 32  ? -24.240  -11.659 -62.831  1.00 73.10  ? 32  LEU A CB  1 
ATOM   193   C CG  . LEU A  1 32  ? -23.766  -10.309 -62.299  1.00 72.98  ? 32  LEU A CG  1 
ATOM   194   C CD1 . LEU A  1 32  ? -23.243  -10.474 -60.890  1.00 72.92  ? 32  LEU A CD1 1 
ATOM   195   C CD2 . LEU A  1 32  ? -22.700  -9.703  -63.221  1.00 73.17  ? 32  LEU A CD2 1 
ATOM   196   N N   . GLY A  1 33  ? -26.917  -11.652 -60.417  1.00 73.28  ? 33  GLY A N   1 
ATOM   197   C CA  . GLY A  1 33  ? -28.179  -11.040 -60.041  1.00 73.67  ? 33  GLY A CA  1 
ATOM   198   C C   . GLY A  1 33  ? -28.035  -9.932  -59.026  1.00 73.79  ? 33  GLY A C   1 
ATOM   199   O O   . GLY A  1 33  ? -29.019  -9.488  -58.436  1.00 74.33  ? 33  GLY A O   1 
ATOM   200   N N   . SER A  1 34  ? -26.817  -9.460  -58.830  1.00 73.51  ? 34  SER A N   1 
ATOM   201   C CA  . SER A  1 34  ? -26.570  -8.573  -57.738  1.00 73.83  ? 34  SER A CA  1 
ATOM   202   C C   . SER A  1 34  ? -25.573  -7.505  -58.115  1.00 73.78  ? 34  SER A C   1 
ATOM   203   O O   . SER A  1 34  ? -25.090  -7.511  -59.237  1.00 73.49  ? 34  SER A O   1 
ATOM   204   C CB  . SER A  1 34  ? -26.034  -9.394  -56.580  1.00 73.92  ? 34  SER A CB  1 
ATOM   205   O OG  . SER A  1 34  ? -24.754  -9.908  -56.901  1.00 73.59  ? 34  SER A OG  1 
ATOM   206   N N   . GLN A  1 35  ? -25.275  -6.595  -57.177  1.00 74.26  ? 35  GLN A N   1 
ATOM   207   C CA  . GLN A  1 35  ? -24.220  -5.607  -57.362  1.00 74.44  ? 35  GLN A CA  1 
ATOM   208   C C   . GLN A  1 35  ? -22.881  -6.339  -57.379  1.00 74.17  ? 35  GLN A C   1 
ATOM   209   O O   . GLN A  1 35  ? -22.759  -7.403  -56.790  1.00 74.07  ? 35  GLN A O   1 
ATOM   210   C CB  . GLN A  1 35  ? -24.258  -4.491  -56.287  1.00 75.31  ? 35  GLN A CB  1 
ATOM   211   C CG  . GLN A  1 35  ? -23.611  -4.826  -54.938  1.00 75.75  ? 35  GLN A CG  1 
ATOM   212   C CD  . GLN A  1 35  ? -24.075  -6.201  -54.356  1.00 75.51  ? 35  GLN A CD  1 
ATOM   213   O OE1 . GLN A  1 35  ? -25.310  -6.487  -54.242  1.00 75.59  ? 35  GLN A OE1 1 
ATOM   214   N NE2 . GLN A  1 35  ? -23.092  -7.066  -53.990  1.00 75.42  ? 35  GLN A NE2 1 
ATOM   215   N N   . ILE A  1 36  ? -21.898  -5.777  -58.071  1.00 74.24  ? 36  ILE A N   1 
ATOM   216   C CA  . ILE A  1 36  ? -20.607  -6.410  -58.226  1.00 74.23  ? 36  ILE A CA  1 
ATOM   217   C C   . ILE A  1 36  ? -19.639  -5.906  -57.163  1.00 74.97  ? 36  ILE A C   1 
ATOM   218   O O   . ILE A  1 36  ? -19.298  -4.711  -57.136  1.00 75.52  ? 36  ILE A O   1 
ATOM   219   C CB  . ILE A  1 36  ? -20.030  -6.075  -59.617  1.00 74.20  ? 36  ILE A CB  1 
ATOM   220   C CG1 . ILE A  1 36  ? -20.937  -6.634  -60.717  1.00 73.72  ? 36  ILE A CG1 1 
ATOM   221   C CG2 . ILE A  1 36  ? -18.602  -6.588  -59.795  1.00 74.53  ? 36  ILE A CG2 1 
ATOM   222   C CD1 . ILE A  1 36  ? -20.810  -5.875  -62.014  1.00 73.94  ? 36  ILE A CD1 1 
ATOM   223   N N   . ASP A  1 37  ? -19.216  -6.811  -56.285  1.00 75.17  ? 37  ASP A N   1 
ATOM   224   C CA  . ASP A  1 37  ? -18.146  -6.532  -55.339  1.00 76.09  ? 37  ASP A CA  1 
ATOM   225   C C   . ASP A  1 37  ? -17.146  -7.688  -55.325  1.00 76.31  ? 37  ASP A C   1 
ATOM   226   O O   . ASP A  1 37  ? -17.275  -8.665  -56.100  1.00 75.75  ? 37  ASP A O   1 
ATOM   227   C CB  . ASP A  1 37  ? -18.713  -6.292  -53.946  1.00 76.66  ? 37  ASP A CB  1 
ATOM   228   C CG  . ASP A  1 37  ? -19.432  -7.512  -53.383  1.00 76.38  ? 37  ASP A CG  1 
ATOM   229   O OD1 . ASP A  1 37  ? -20.448  -7.309  -52.673  1.00 76.57  ? 37  ASP A OD1 1 
ATOM   230   O OD2 . ASP A  1 37  ? -19.008  -8.678  -53.632  1.00 76.15  ? 37  ASP A OD2 1 
ATOM   231   N N   . ASP A  1 38  ? -16.175  -7.611  -54.420  1.00 77.35  ? 38  ASP A N   1 
ATOM   232   C CA  . ASP A  1 38  ? -15.149  -8.653  -54.368  1.00 77.89  ? 38  ASP A CA  1 
ATOM   233   C C   . ASP A  1 38  ? -15.668  -10.086 -54.204  1.00 77.51  ? 38  ASP A C   1 
ATOM   234   O O   . ASP A  1 38  ? -15.151  -10.998 -54.850  1.00 77.56  ? 38  ASP A O   1 
ATOM   235   C CB  . ASP A  1 38  ? -14.069  -8.326  -53.349  1.00 79.34  ? 38  ASP A CB  1 
ATOM   236   C CG  . ASP A  1 38  ? -13.050  -7.317  -53.888  1.00 80.05  ? 38  ASP A CG  1 
ATOM   237   O OD1 . ASP A  1 38  ? -11.998  -7.113  -53.209  1.00 81.47  ? 38  ASP A OD1 1 
ATOM   238   O OD2 . ASP A  1 38  ? -13.293  -6.722  -54.989  1.00 79.36  ? 38  ASP A OD2 1 
ATOM   239   N N   . ASN A  1 39  ? -16.686  -10.272 -53.367  1.00 77.31  ? 39  ASN A N   1 
ATOM   240   C CA  . ASN A  1 39  ? -17.305  -11.594 -53.195  1.00 77.06  ? 39  ASN A CA  1 
ATOM   241   C C   . ASN A  1 39  ? -17.948  -12.100 -54.459  1.00 76.07  ? 39  ASN A C   1 
ATOM   242   O O   . ASN A  1 39  ? -17.663  -13.224 -54.909  1.00 76.15  ? 39  ASN A O   1 
ATOM   243   C CB  . ASN A  1 39  ? -18.375  -11.588 -52.103  1.00 77.19  ? 39  ASN A CB  1 
ATOM   244   C CG  . ASN A  1 39  ? -17.791  -11.777 -50.722  1.00 78.49  ? 39  ASN A CG  1 
ATOM   245   O OD1 . ASN A  1 39  ? -16.579  -11.700 -50.524  1.00 79.35  ? 39  ASN A OD1 1 
ATOM   246   N ND2 . ASN A  1 39  ? -18.641  -12.025 -49.758  1.00 78.86  ? 39  ASN A ND2 1 
ATOM   247   N N   . VAL A  1 40  ? -18.827  -11.272 -55.020  1.00 75.34  ? 40  VAL A N   1 
ATOM   248   C CA  . VAL A  1 40  ? -19.491  -11.637 -56.248  1.00 74.59  ? 40  VAL A CA  1 
ATOM   249   C C   . VAL A  1 40  ? -18.447  -11.968 -57.344  1.00 74.72  ? 40  VAL A C   1 
ATOM   250   O O   . VAL A  1 40  ? -18.516  -13.028 -57.973  1.00 74.69  ? 40  VAL A O   1 
ATOM   251   C CB  . VAL A  1 40  ? -20.472  -10.551 -56.674  1.00 74.09  ? 40  VAL A CB  1 
ATOM   252   C CG1 . VAL A  1 40  ? -21.004  -10.853 -58.049  1.00 73.57  ? 40  VAL A CG1 1 
ATOM   253   C CG2 . VAL A  1 40  ? -21.602  -10.477 -55.688  1.00 74.18  ? 40  VAL A CG2 1 
ATOM   254   N N   . ALA A  1 41  ? -17.460  -11.088 -57.538  1.00 75.10  ? 41  ALA A N   1 
ATOM   255   C CA  . ALA A  1 41  ? -16.395  -11.346 -58.522  1.00 75.52  ? 41  ALA A CA  1 
ATOM   256   C C   . ALA A  1 41  ? -15.719  -12.663 -58.221  1.00 76.21  ? 41  ALA A C   1 
ATOM   257   O O   . ALA A  1 41  ? -15.546  -13.492 -59.102  1.00 76.37  ? 41  ALA A O   1 
ATOM   258   C CB  . ALA A  1 41  ? -15.354  -10.243 -58.505  1.00 76.16  ? 41  ALA A CB  1 
ATOM   259   N N   . ASN A  1 42  ? -15.337  -12.860 -56.967  1.00 76.82  ? 42  ASN A N   1 
ATOM   260   C CA  . ASN A  1 42  ? -14.633  -14.063 -56.602  1.00 77.75  ? 42  ASN A CA  1 
ATOM   261   C C   . ASN A  1 42  ? -15.415  -15.322 -56.939  1.00 77.44  ? 42  ASN A C   1 
ATOM   262   O O   . ASN A  1 42  ? -14.847  -16.351 -57.306  1.00 78.19  ? 42  ASN A O   1 
ATOM   263   C CB  . ASN A  1 42  ? -14.310  -14.047 -55.134  1.00 78.55  ? 42  ASN A CB  1 
ATOM   264   C CG  . ASN A  1 42  ? -13.124  -14.928 -54.793  1.00 80.00  ? 42  ASN A CG  1 
ATOM   265   O OD1 . ASN A  1 42  ? -13.184  -15.684 -53.818  1.00 80.67  ? 42  ASN A OD1 1 
ATOM   266   N ND2 . ASN A  1 42  ? -12.021  -14.833 -55.586  1.00 80.73  ? 42  ASN A ND2 1 
ATOM   267   N N   . SER A  1 43  ? -16.731  -15.225 -56.832  1.00 76.52  ? 43  SER A N   1 
ATOM   268   C CA  . SER A  1 43  ? -17.597  -16.328 -57.146  1.00 76.31  ? 43  SER A CA  1 
ATOM   269   C C   . SER A  1 43  ? -17.711  -16.502 -58.644  1.00 76.05  ? 43  SER A C   1 
ATOM   270   O O   . SER A  1 43  ? -17.536  -17.606 -59.158  1.00 76.62  ? 43  SER A O   1 
ATOM   271   C CB  . SER A  1 43  ? -18.961  -16.063 -56.544  1.00 75.66  ? 43  SER A CB  1 
ATOM   272   O OG  . SER A  1 43  ? -19.797  -17.187 -56.663  1.00 75.72  ? 43  SER A OG  1 
ATOM   273   N N   . ILE A  1 44  ? -18.004  -15.421 -59.350  1.00 75.39  ? 44  ILE A N   1 
ATOM   274   C CA  . ILE A  1 44  ? -18.147  -15.487 -60.810  1.00 75.30  ? 44  ILE A CA  1 
ATOM   275   C C   . ILE A  1 44  ? -16.873  -16.038 -61.490  1.00 76.30  ? 44  ILE A C   1 
ATOM   276   O O   . ILE A  1 44  ? -16.925  -16.983 -62.270  1.00 76.81  ? 44  ILE A O   1 
ATOM   277   C CB  . ILE A  1 44  ? -18.523  -14.126 -61.428  1.00 74.70  ? 44  ILE A CB  1 
ATOM   278   C CG1 . ILE A  1 44  ? -19.801  -13.528 -60.807  1.00 73.98  ? 44  ILE A CG1 1 
ATOM   279   C CG2 . ILE A  1 44  ? -18.621  -14.255 -62.937  1.00 74.88  ? 44  ILE A CG2 1 
ATOM   280   C CD1 . ILE A  1 44  ? -21.058  -14.297 -61.080  1.00 73.78  ? 44  ILE A CD1 1 
ATOM   281   N N   . VAL A  1 45  ? -15.732  -15.446 -61.175  1.00 76.80  ? 45  VAL A N   1 
ATOM   282   C CA  . VAL A  1 45  ? -14.444  -15.932 -61.627  1.00 78.04  ? 45  VAL A CA  1 
ATOM   283   C C   . VAL A  1 45  ? -14.319  -17.417 -61.355  1.00 78.86  ? 45  VAL A C   1 
ATOM   284   O O   . VAL A  1 45  ? -14.088  -18.200 -62.282  1.00 79.63  ? 45  VAL A O   1 
ATOM   285   C CB  . VAL A  1 45  ? -13.303  -15.178 -60.938  1.00 78.68  ? 45  VAL A CB  1 
ATOM   286   C CG1 . VAL A  1 45  ? -11.970  -15.840 -61.228  1.00 80.28  ? 45  VAL A CG1 1 
ATOM   287   C CG2 . VAL A  1 45  ? -13.273  -13.723 -61.405  1.00 78.21  ? 45  VAL A CG2 1 
ATOM   288   N N   . SER A  1 46  ? -14.500  -17.825 -60.109  1.00 78.88  ? 46  SER A N   1 
ATOM   289   C CA  . SER A  1 46  ? -14.440  -19.248 -59.794  1.00 79.80  ? 46  SER A CA  1 
ATOM   290   C C   . SER A  1 46  ? -15.337  -20.118 -60.665  1.00 79.67  ? 46  SER A C   1 
ATOM   291   O O   . SER A  1 46  ? -14.932  -21.205 -61.099  1.00 80.86  ? 46  SER A O   1 
ATOM   292   C CB  . SER A  1 46  ? -14.750  -19.496 -58.334  1.00 79.79  ? 46  SER A CB  1 
ATOM   293   O OG  . SER A  1 46  ? -13.671  -19.054 -57.550  1.00 80.59  ? 46  SER A OG  1 
ATOM   294   N N   . GLN A  1 47  ? -16.558  -19.648 -60.908  1.00 78.46  ? 47  GLN A N   1 
ATOM   295   C CA  . GLN A  1 47  ? -17.464  -20.366 -61.784  1.00 78.46  ? 47  GLN A CA  1 
ATOM   296   C C   . GLN A  1 47  ? -16.900  -20.508 -63.197  1.00 79.23  ? 47  GLN A C   1 
ATOM   297   O O   . GLN A  1 47  ? -16.916  -21.619 -63.776  1.00 80.26  ? 47  GLN A O   1 
ATOM   298   C CB  . GLN A  1 47  ? -18.827  -19.712 -61.792  1.00 77.25  ? 47  GLN A CB  1 
ATOM   299   C CG  . GLN A  1 47  ? -19.638  -20.105 -60.574  1.00 77.00  ? 47  GLN A CG  1 
ATOM   300   C CD  . GLN A  1 47  ? -20.872  -19.230 -60.389  1.00 75.96  ? 47  GLN A CD  1 
ATOM   301   O OE1 . GLN A  1 47  ? -21.909  -19.450 -61.037  1.00 75.84  ? 47  GLN A OE1 1 
ATOM   302   N NE2 . GLN A  1 47  ? -20.765  -18.217 -59.501  1.00 75.42  ? 47  GLN A NE2 1 
ATOM   303   N N   . LEU A  1 48  ? -16.370  -19.399 -63.721  1.00 78.94  ? 48  LEU A N   1 
ATOM   304   C CA  . LEU A  1 48  ? -15.747  -19.398 -65.036  1.00 79.84  ? 48  LEU A CA  1 
ATOM   305   C C   . LEU A  1 48  ? -14.598  -20.385 -65.108  1.00 81.52  ? 48  LEU A C   1 
ATOM   306   O O   . LEU A  1 48  ? -14.584  -21.213 -65.990  1.00 82.60  ? 48  LEU A O   1 
ATOM   307   C CB  . LEU A  1 48  ? -15.312  -18.001 -65.434  1.00 79.41  ? 48  LEU A CB  1 
ATOM   308   C CG  . LEU A  1 48  ? -16.448  -17.000 -65.709  1.00 78.12  ? 48  LEU A CG  1 
ATOM   309   C CD1 . LEU A  1 48  ? -15.918  -15.583 -65.803  1.00 77.82  ? 48  LEU A CD1 1 
ATOM   310   C CD2 . LEU A  1 48  ? -17.188  -17.321 -66.996  1.00 78.44  ? 48  LEU A CD2 1 
ATOM   311   N N   . LEU A  1 49  ? -13.677  -20.339 -64.152  1.00 81.96  ? 49  LEU A N   1 
ATOM   312   C CA  . LEU A  1 49  ? -12.524  -21.238 -64.174  1.00 83.83  ? 49  LEU A CA  1 
ATOM   313   C C   . LEU A  1 49  ? -12.956  -22.680 -64.135  1.00 84.66  ? 49  LEU A C   1 
ATOM   314   O O   . LEU A  1 49  ? -12.395  -23.526 -64.849  1.00 86.35  ? 49  LEU A O   1 
ATOM   315   C CB  . LEU A  1 49  ? -11.579  -20.961 -63.015  1.00 84.27  ? 49  LEU A CB  1 
ATOM   316   C CG  . LEU A  1 49  ? -10.758  -19.685 -63.143  1.00 84.23  ? 49  LEU A CG  1 
ATOM   317   C CD1 . LEU A  1 49  ? -9.815   -19.591 -61.951  1.00 85.07  ? 49  LEU A CD1 1 
ATOM   318   C CD2 . LEU A  1 49  ? -9.976   -19.607 -64.451  1.00 85.49  ? 49  LEU A CD2 1 
ATOM   319   N N   . PHE A  1 50  ? -13.965  -22.957 -63.320  1.00 83.68  ? 50  PHE A N   1 
ATOM   320   C CA  . PHE A  1 50  ? -14.470  -24.306 -63.156  1.00 84.50  ? 50  PHE A CA  1 
ATOM   321   C C   . PHE A  1 50  ? -15.091  -24.787 -64.437  1.00 84.91  ? 50  PHE A C   1 
ATOM   322   O O   . PHE A  1 50  ? -14.854  -25.924 -64.830  1.00 86.54  ? 50  PHE A O   1 
ATOM   323   C CB  . PHE A  1 50  ? -15.525  -24.347 -62.065  1.00 83.36  ? 50  PHE A CB  1 
ATOM   324   C CG  . PHE A  1 50  ? -16.370  -25.592 -62.080  1.00 84.01  ? 50  PHE A CG  1 
ATOM   325   C CD1 . PHE A  1 50  ? -15.888  -26.789 -61.571  1.00 85.63  ? 50  PHE A CD1 1 
ATOM   326   C CD2 . PHE A  1 50  ? -17.661  -25.556 -62.595  1.00 83.19  ? 50  PHE A CD2 1 
ATOM   327   C CE1 . PHE A  1 50  ? -16.679  -27.912 -61.586  1.00 86.36  ? 50  PHE A CE1 1 
ATOM   328   C CE2 . PHE A  1 50  ? -18.460  -26.676 -62.599  1.00 83.94  ? 50  PHE A CE2 1 
ATOM   329   C CZ  . PHE A  1 50  ? -17.962  -27.848 -62.105  1.00 85.51  ? 50  PHE A CZ  1 
ATOM   330   N N   . LEU A  1 51  ? -15.883  -23.931 -65.077  1.00 83.64  ? 51  LEU A N   1 
ATOM   331   C CA  . LEU A  1 51  ? -16.540  -24.315 -66.314  1.00 84.14  ? 51  LEU A CA  1 
ATOM   332   C C   . LEU A  1 51  ? -15.558  -24.651 -67.435  1.00 85.91  ? 51  LEU A C   1 
ATOM   333   O O   . LEU A  1 51  ? -15.792  -25.577 -68.243  1.00 87.29  ? 51  LEU A O   1 
ATOM   334   C CB  . LEU A  1 51  ? -17.527  -23.264 -66.768  1.00 82.67  ? 51  LEU A CB  1 
ATOM   335   C CG  . LEU A  1 51  ? -18.831  -23.229 -65.976  1.00 81.45  ? 51  LEU A CG  1 
ATOM   336   C CD1 . LEU A  1 51  ? -19.773  -22.238 -66.648  1.00 80.45  ? 51  LEU A CD1 1 
ATOM   337   C CD2 . LEU A  1 51  ? -19.496  -24.599 -65.829  1.00 82.39  ? 51  LEU A CD2 1 
ATOM   338   N N   . GLN A  1 52  ? -14.450  -23.917 -67.460  1.00 86.09  ? 52  GLN A N   1 
ATOM   339   C CA  . GLN A  1 52  ? -13.403  -24.150 -68.438  1.00 87.96  ? 52  GLN A CA  1 
ATOM   340   C C   . GLN A  1 52  ? -12.725  -25.485 -68.235  1.00 90.01  ? 52  GLN A C   1 
ATOM   341   O O   . GLN A  1 52  ? -12.564  -26.225 -69.202  1.00 91.79  ? 52  GLN A O   1 
ATOM   342   C CB  . GLN A  1 52  ? -12.358  -23.065 -68.374  1.00 87.85  ? 52  GLN A CB  1 
ATOM   343   C CG  . GLN A  1 52  ? -11.285  -23.258 -69.422  1.00 89.99  ? 52  GLN A CG  1 
ATOM   344   C CD  . GLN A  1 52  ? -10.178  -22.217 -69.329  1.00 90.18  ? 52  GLN A CD  1 
ATOM   345   O OE1 . GLN A  1 52  ? -9.617   -21.968 -68.261  1.00 89.89  ? 52  GLN A OE1 1 
ATOM   346   N NE2 . GLN A  1 52  ? -9.849   -21.611 -70.459  1.00 90.88  ? 52  GLN A NE2 1 
ATOM   347   N N   . ALA A  1 53  ? -12.318  -25.764 -66.991  1.00 89.97  ? 53  ALA A N   1 
ATOM   348   C CA  . ALA A  1 53  ? -11.723  -27.050 -66.597  1.00 91.99  ? 53  ALA A CA  1 
ATOM   349   C C   . ALA A  1 53  ? -12.613  -28.260 -66.929  1.00 92.78  ? 53  ALA A C   1 
ATOM   350   O O   . ALA A  1 53  ? -12.110  -29.378 -67.133  1.00 95.02  ? 53  ALA A O   1 
ATOM   351   C CB  . ALA A  1 53  ? -11.378  -27.049 -65.119  1.00 91.61  ? 53  ALA A CB  1 
ATOM   352   N N   . GLN A  1 54  ? -13.924  -28.022 -66.995  1.00 91.15  ? 54  GLN A N   1 
ATOM   353   C CA  . GLN A  1 54  ? -14.894  -29.070 -67.315  1.00 91.86  ? 54  GLN A CA  1 
ATOM   354   C C   . GLN A  1 54  ? -14.898  -29.405 -68.800  1.00 93.40  ? 54  GLN A C   1 
ATOM   355   O O   . GLN A  1 54  ? -14.975  -30.573 -69.199  1.00 95.36  ? 54  GLN A O   1 
ATOM   356   C CB  . GLN A  1 54  ? -16.297  -28.621 -66.892  1.00 89.79  ? 54  GLN A CB  1 
ATOM   357   C CG  . GLN A  1 54  ? -16.503  -28.580 -65.400  1.00 88.73  ? 54  GLN A CG  1 
ATOM   358   C CD  . GLN A  1 54  ? -16.779  -29.956 -64.854  1.00 90.12  ? 54  GLN A CD  1 
ATOM   359   O OE1 . GLN A  1 54  ? -17.914  -30.425 -64.910  1.00 90.01  ? 54  GLN A OE1 1 
ATOM   360   N NE2 . GLN A  1 54  ? -15.747  -30.622 -64.327  1.00 91.67  ? 54  GLN A NE2 1 
ATOM   361   N N   . ASP A  1 55  ? -14.822  -28.351 -69.601  1.00 92.64  ? 55  ASP A N   1 
ATOM   362   C CA  . ASP A  1 55  ? -14.930  -28.433 -71.044  1.00 93.93  ? 55  ASP A CA  1 
ATOM   363   C C   . ASP A  1 55  ? -14.512  -27.057 -71.575  1.00 92.97  ? 55  ASP A C   1 
ATOM   364   O O   . ASP A  1 55  ? -15.155  -26.049 -71.275  1.00 90.85  ? 55  ASP A O   1 
ATOM   365   C CB  . ASP A  1 55  ? -16.380  -28.745 -71.445  1.00 93.54  ? 55  ASP A CB  1 
ATOM   366   C CG  . ASP A  1 55  ? -16.540  -28.923 -72.937  1.00 95.22  ? 55  ASP A CG  1 
ATOM   367   O OD1 . ASP A  1 55  ? -16.052  -28.043 -73.683  1.00 95.20  ? 55  ASP A OD1 1 
ATOM   368   O OD2 . ASP A  1 55  ? -17.136  -29.956 -73.367  1.00 96.75  ? 55  ASP A OD2 1 
ATOM   369   N N   . SER A  1 56  ? -13.437  -27.004 -72.353  1.00 94.71  ? 56  SER A N   1 
ATOM   370   C CA  . SER A  1 56  ? -12.951  -25.716 -72.811  1.00 94.04  ? 56  SER A CA  1 
ATOM   371   C C   . SER A  1 56  ? -13.496  -25.319 -74.182  1.00 94.51  ? 56  SER A C   1 
ATOM   372   O O   . SER A  1 56  ? -13.133  -24.264 -74.707  1.00 94.24  ? 56  SER A O   1 
ATOM   373   C CB  . SER A  1 56  ? -11.430  -25.677 -72.770  1.00 95.61  ? 56  SER A CB  1 
ATOM   374   O OG  . SER A  1 56  ? -10.910  -26.834 -73.364  1.00 98.35  ? 56  SER A OG  1 
ATOM   375   N N   . GLU A  1 57  ? -14.383  -26.142 -74.741  1.00 95.35  ? 57  GLU A N   1 
ATOM   376   C CA  . GLU A  1 57  ? -14.982  -25.883 -76.068  1.00 96.16  ? 57  GLU A CA  1 
ATOM   377   C C   . GLU A  1 57  ? -16.397  -25.302 -75.944  1.00 94.16  ? 57  GLU A C   1 
ATOM   378   O O   . GLU A  1 57  ? -16.697  -24.278 -76.540  1.00 93.52  ? 57  GLU A O   1 
ATOM   379   C CB  . GLU A  1 57  ? -15.086  -27.161 -76.908  1.00 98.86  ? 57  GLU A CB  1 
ATOM   380   C CG  . GLU A  1 57  ? -14.123  -28.288 -76.569  1.00 100.83 ? 57  GLU A CG  1 
ATOM   381   C CD  . GLU A  1 57  ? -12.865  -28.221 -77.425  1.00 103.19 ? 57  GLU A CD  1 
ATOM   382   O OE1 . GLU A  1 57  ? -11.938  -27.473 -76.997  1.00 102.53 ? 57  GLU A OE1 1 
ATOM   383   O OE2 . GLU A  1 57  ? -12.798  -28.889 -78.517  1.00 105.85 ? 57  GLU A OE2 1 
ATOM   384   N N   . LYS A  1 58  ? -17.261  -25.971 -75.171  1.00 93.39  ? 58  LYS A N   1 
ATOM   385   C CA  . LYS A  1 58  ? -18.681  -25.633 -75.095  1.00 92.02  ? 58  LYS A CA  1 
ATOM   386   C C   . LYS A  1 58  ? -18.800  -24.288 -74.426  1.00 89.61  ? 58  LYS A C   1 
ATOM   387   O O   . LYS A  1 58  ? -18.193  -24.033 -73.368  1.00 88.48  ? 58  LYS A O   1 
ATOM   388   C CB  . LYS A  1 58  ? -19.474  -26.704 -74.350  1.00 92.02  ? 58  LYS A CB  1 
ATOM   389   C CG  . LYS A  1 58  ? -20.024  -27.765 -75.288  1.00 94.28  ? 58  LYS A CG  1 
ATOM   390   C CD  . LYS A  1 58  ? -21.014  -28.696 -74.623  1.00 94.29  ? 58  LYS A CD  1 
ATOM   391   C CE  . LYS A  1 58  ? -20.293  -29.664 -73.706  1.00 94.86  ? 58  LYS A CE  1 
ATOM   392   N NZ  . LYS A  1 58  ? -21.161  -30.833 -73.401  1.00 95.87  ? 58  LYS A NZ  1 
ATOM   393   N N   . ASP A  1 59  ? -19.547  -23.392 -75.046  1.00 89.02  ? 59  ASP A N   1 
ATOM   394   C CA  . ASP A  1 59  ? -19.533  -22.061 -74.501  1.00 87.07  ? 59  ASP A CA  1 
ATOM   395   C C   . ASP A  1 59  ? -20.457  -21.859 -73.303  1.00 85.18  ? 59  ASP A C   1 
ATOM   396   O O   . ASP A  1 59  ? -21.217  -22.757 -72.947  1.00 85.38  ? 59  ASP A O   1 
ATOM   397   C CB  . ASP A  1 59  ? -19.581  -20.964 -75.600  1.00 87.35  ? 59  ASP A CB  1 
ATOM   398   C CG  . ASP A  1 59  ? -20.773  -21.076 -76.541  1.00 88.18  ? 59  ASP A CG  1 
ATOM   399   O OD1 . ASP A  1 59  ? -21.853  -21.527 -76.065  1.00 87.66  ? 59  ASP A OD1 1 
ATOM   400   O OD2 . ASP A  1 59  ? -20.611  -20.652 -77.719  1.00 89.45  ? 59  ASP A OD2 1 
ATOM   401   N N   . ILE A  1 60  ? -20.320  -20.697 -72.666  1.00 83.57  ? 60  ILE A N   1 
ATOM   402   C CA  . ILE A  1 60  ? -20.864  -20.394 -71.353  1.00 81.89  ? 60  ILE A CA  1 
ATOM   403   C C   . ILE A  1 60  ? -21.924  -19.305 -71.467  1.00 80.89  ? 60  ILE A C   1 
ATOM   404   O O   . ILE A  1 60  ? -21.799  -18.384 -72.275  1.00 81.04  ? 60  ILE A O   1 
ATOM   405   C CB  . ILE A  1 60  ? -19.725  -19.930 -70.428  1.00 81.17  ? 60  ILE A CB  1 
ATOM   406   C CG1 . ILE A  1 60  ? -18.812  -21.105 -70.118  1.00 82.28  ? 60  ILE A CG1 1 
ATOM   407   C CG2 . ILE A  1 60  ? -20.271  -19.368 -69.129  1.00 79.55  ? 60  ILE A CG2 1 
ATOM   408   C CD1 . ILE A  1 60  ? -17.465  -20.693 -69.593  1.00 82.28  ? 60  ILE A CD1 1 
ATOM   409   N N   . TYR A  1 61  ? -22.960  -19.410 -70.642  1.00 80.06  ? 61  TYR A N   1 
ATOM   410   C CA  . TYR A  1 61  ? -24.016  -18.409 -70.616  1.00 79.28  ? 61  TYR A CA  1 
ATOM   411   C C   . TYR A  1 61  ? -23.951  -17.604 -69.314  1.00 77.81  ? 61  TYR A C   1 
ATOM   412   O O   . TYR A  1 61  ? -24.061  -18.197 -68.228  1.00 77.41  ? 61  TYR A O   1 
ATOM   413   C CB  . TYR A  1 61  ? -25.382  -19.075 -70.805  1.00 79.87  ? 61  TYR A CB  1 
ATOM   414   C CG  . TYR A  1 61  ? -25.406  -19.907 -72.049  1.00 81.55  ? 61  TYR A CG  1 
ATOM   415   C CD1 . TYR A  1 61  ? -25.016  -21.247 -72.010  1.00 82.53  ? 61  TYR A CD1 1 
ATOM   416   C CD2 . TYR A  1 61  ? -25.785  -19.356 -73.276  1.00 82.41  ? 61  TYR A CD2 1 
ATOM   417   C CE1 . TYR A  1 61  ? -25.007  -22.028 -73.151  1.00 84.34  ? 61  TYR A CE1 1 
ATOM   418   C CE2 . TYR A  1 61  ? -25.782  -20.131 -74.428  1.00 84.22  ? 61  TYR A CE2 1 
ATOM   419   C CZ  . TYR A  1 61  ? -25.382  -21.467 -74.360  1.00 85.19  ? 61  TYR A CZ  1 
ATOM   420   O OH  . TYR A  1 61  ? -25.355  -22.255 -75.499  1.00 87.24  ? 61  TYR A OH  1 
ATOM   421   N N   . LEU A  1 62  ? -23.731  -16.285 -69.440  1.00 77.24  ? 62  LEU A N   1 
ATOM   422   C CA  . LEU A  1 62  ? -23.742  -15.342 -68.313  1.00 76.09  ? 62  LEU A CA  1 
ATOM   423   C C   . LEU A  1 62  ? -24.942  -14.385 -68.372  1.00 75.80  ? 62  LEU A C   1 
ATOM   424   O O   . LEU A  1 62  ? -24.969  -13.460 -69.209  1.00 76.08  ? 62  LEU A O   1 
ATOM   425   C CB  . LEU A  1 62  ? -22.451  -14.524 -68.287  1.00 75.90  ? 62  LEU A CB  1 
ATOM   426   C CG  . LEU A  1 62  ? -22.243  -13.509 -67.151  1.00 74.99  ? 62  LEU A CG  1 
ATOM   427   C CD1 . LEU A  1 62  ? -22.311  -14.200 -65.805  1.00 74.56  ? 62  LEU A CD1 1 
ATOM   428   C CD2 . LEU A  1 62  ? -20.917  -12.784 -67.261  1.00 75.14  ? 62  LEU A CD2 1 
ATOM   429   N N   . TYR A  1 63  ? -25.931  -14.630 -67.511  1.00 75.48  ? 63  TYR A N   1 
ATOM   430   C CA  . TYR A  1 63  ? -27.086  -13.757 -67.421  1.00 75.41  ? 63  TYR A CA  1 
ATOM   431   C C   . TYR A  1 63  ? -26.726  -12.614 -66.500  1.00 74.64  ? 63  TYR A C   1 
ATOM   432   O O   . TYR A  1 63  ? -26.090  -12.803 -65.452  1.00 74.12  ? 63  TYR A O   1 
ATOM   433   C CB  . TYR A  1 63  ? -28.313  -14.496 -66.890  1.00 75.69  ? 63  TYR A CB  1 
ATOM   434   C CG  . TYR A  1 63  ? -28.959  -15.385 -67.910  1.00 76.75  ? 63  TYR A CG  1 
ATOM   435   C CD1 . TYR A  1 63  ? -28.508  -16.702 -68.105  1.00 77.22  ? 63  TYR A CD1 1 
ATOM   436   C CD2 . TYR A  1 63  ? -30.007  -14.922 -68.698  1.00 77.54  ? 63  TYR A CD2 1 
ATOM   437   C CE1 . TYR A  1 63  ? -29.090  -17.531 -69.058  1.00 78.44  ? 63  TYR A CE1 1 
ATOM   438   C CE2 . TYR A  1 63  ? -30.598  -15.745 -69.642  1.00 78.77  ? 63  TYR A CE2 1 
ATOM   439   C CZ  . TYR A  1 63  ? -30.143  -17.045 -69.818  1.00 79.21  ? 63  TYR A CZ  1 
ATOM   440   O OH  . TYR A  1 63  ? -30.743  -17.852 -70.768  1.00 80.66  ? 63  TYR A OH  1 
ATOM   441   N N   . ILE A  1 64  ? -27.112  -11.414 -66.907  1.00 74.78  ? 64  ILE A N   1 
ATOM   442   C CA  . ILE A  1 64  ? -26.729  -10.204 -66.180  1.00 74.32  ? 64  ILE A CA  1 
ATOM   443   C C   . ILE A  1 64  ? -27.955  -9.342  -65.846  1.00 74.59  ? 64  ILE A C   1 
ATOM   444   O O   . ILE A  1 64  ? -28.631  -8.789  -66.742  1.00 75.27  ? 64  ILE A O   1 
ATOM   445   C CB  . ILE A  1 64  ? -25.705  -9.349  -66.954  1.00 74.46  ? 64  ILE A CB  1 
ATOM   446   C CG1 . ILE A  1 64  ? -24.440  -10.153 -67.275  1.00 74.46  ? 64  ILE A CG1 1 
ATOM   447   C CG2 . ILE A  1 64  ? -25.358  -8.119  -66.139  1.00 74.18  ? 64  ILE A CG2 1 
ATOM   448   C CD1 . ILE A  1 64  ? -23.443  -9.454  -68.189  1.00 74.91  ? 64  ILE A CD1 1 
ATOM   449   N N   . ASN A  1 65  ? -28.248  -9.288  -64.547  1.00 74.29  ? 65  ASN A N   1 
ATOM   450   C CA  . ASN A  1 65  ? -29.125  -8.304  -63.981  1.00 74.65  ? 65  ASN A CA  1 
ATOM   451   C C   . ASN A  1 65  ? -28.410  -7.638  -62.799  1.00 74.27  ? 65  ASN A C   1 
ATOM   452   O O   . ASN A  1 65  ? -28.419  -8.157  -61.692  1.00 74.07  ? 65  ASN A O   1 
ATOM   453   C CB  . ASN A  1 65  ? -30.401  -8.960  -63.562  1.00 75.10  ? 65  ASN A CB  1 
ATOM   454   C CG  . ASN A  1 65  ? -31.362  -7.976  -62.969  1.00 75.77  ? 65  ASN A CG  1 
ATOM   455   O OD1 . ASN A  1 65  ? -31.310  -6.796  -63.266  1.00 76.09  ? 65  ASN A OD1 1 
ATOM   456   N ND2 . ASN A  1 65  ? -32.242  -8.456  -62.117  1.00 76.16  ? 65  ASN A ND2 1 
ATOM   457   N N   . SER A  1 66  ? -27.752  -6.511  -63.053  1.00 74.35  ? 66  SER A N   1 
ATOM   458   C CA  . SER A  1 66  ? -26.879  -5.899  -62.056  1.00 74.17  ? 66  SER A CA  1 
ATOM   459   C C   . SER A  1 66  ? -26.841  -4.380  -62.135  1.00 74.76  ? 66  SER A C   1 
ATOM   460   O O   . SER A  1 66  ? -26.732  -3.844  -63.220  1.00 75.05  ? 66  SER A O   1 
ATOM   461   C CB  . SER A  1 66  ? -25.452  -6.421  -62.203  1.00 73.69  ? 66  SER A CB  1 
ATOM   462   O OG  . SER A  1 66  ? -24.556  -5.612  -61.435  1.00 73.80  ? 66  SER A OG  1 
ATOM   463   N N   . PRO A  1 67  ? -26.906  -3.696  -60.972  1.00 75.11  ? 67  PRO A N   1 
ATOM   464   C CA  . PRO A  1 67  ? -26.774  -2.232  -60.958  1.00 75.87  ? 67  PRO A CA  1 
ATOM   465   C C   . PRO A  1 67  ? -25.320  -1.790  -61.059  1.00 75.76  ? 67  PRO A C   1 
ATOM   466   O O   . PRO A  1 67  ? -25.064  -0.607  -61.169  1.00 76.47  ? 67  PRO A O   1 
ATOM   467   C CB  . PRO A  1 67  ? -27.393  -1.830  -59.610  1.00 76.50  ? 67  PRO A CB  1 
ATOM   468   C CG  . PRO A  1 67  ? -27.176  -3.016  -58.727  1.00 75.89  ? 67  PRO A CG  1 
ATOM   469   C CD  . PRO A  1 67  ? -27.160  -4.244  -59.615  1.00 75.07  ? 67  PRO A CD  1 
ATOM   470   N N   . GLY A  1 68  ? -24.377  -2.722  -61.032  1.00 75.08  ? 68  GLY A N   1 
ATOM   471   C CA  . GLY A  1 68  ? -22.967  -2.341  -61.147  1.00 75.20  ? 68  GLY A CA  1 
ATOM   472   C C   . GLY A  1 68  ? -22.153  -2.585  -59.886  1.00 75.24  ? 68  GLY A C   1 
ATOM   473   O O   . GLY A  1 68  ? -22.399  -3.535  -59.147  1.00 74.86  ? 68  GLY A O   1 
ATOM   474   N N   . GLY A  1 69  ? -21.151  -1.753  -59.645  1.00 75.86  ? 69  GLY A N   1 
ATOM   475   C CA  . GLY A  1 69  ? -20.380  -1.897  -58.437  1.00 76.20  ? 69  GLY A CA  1 
ATOM   476   C C   . GLY A  1 69  ? -18.930  -1.590  -58.663  1.00 76.71  ? 69  GLY A C   1 
ATOM   477   O O   . GLY A  1 69  ? -18.599  -0.821  -59.542  1.00 77.09  ? 69  GLY A O   1 
ATOM   478   N N   . SER A  1 70  ? -18.076  -2.240  -57.876  1.00 76.89  ? 70  SER A N   1 
ATOM   479   C CA  . SER A  1 70  ? -16.635  -2.036  -57.878  1.00 77.68  ? 70  SER A CA  1 
ATOM   480   C C   . SER A  1 70  ? -15.995  -2.211  -59.260  1.00 77.57  ? 70  SER A C   1 
ATOM   481   O O   . SER A  1 70  ? -16.181  -3.233  -59.936  1.00 76.84  ? 70  SER A O   1 
ATOM   482   C CB  . SER A  1 70  ? -16.007  -2.980  -56.854  1.00 77.91  ? 70  SER A CB  1 
ATOM   483   O OG  . SER A  1 70  ? -14.612  -3.033  -56.976  1.00 78.74  ? 70  SER A OG  1 
ATOM   484   N N   . VAL A  1 71  ? -15.242  -1.203  -59.678  1.00 78.49  ? 71  VAL A N   1 
ATOM   485   C CA  . VAL A  1 71  ? -14.586  -1.240  -60.986  1.00 78.71  ? 71  VAL A CA  1 
ATOM   486   C C   . VAL A  1 71  ? -13.536  -2.322  -61.069  1.00 78.92  ? 71  VAL A C   1 
ATOM   487   O O   . VAL A  1 71  ? -13.508  -3.071  -62.045  1.00 78.58  ? 71  VAL A O   1 
ATOM   488   C CB  . VAL A  1 71  ? -14.005  0.127   -61.374  1.00 79.90  ? 71  VAL A CB  1 
ATOM   489   C CG1 . VAL A  1 71  ? -13.066  0.012   -62.562  1.00 80.50  ? 71  VAL A CG1 1 
ATOM   490   C CG2 . VAL A  1 71  ? -15.154  1.065   -61.716  1.00 79.74  ? 71  VAL A CG2 1 
ATOM   491   N N   . THR A  1 72  ? -12.698  -2.419  -60.046  1.00 79.69  ? 72  THR A N   1 
ATOM   492   C CA  . THR A  1 72  ? -11.707  -3.483  -60.016  1.00 80.13  ? 72  THR A CA  1 
ATOM   493   C C   . THR A  1 72  ? -12.350  -4.875  -59.936  1.00 79.07  ? 72  THR A C   1 
ATOM   494   O O   . THR A  1 72  ? -11.906  -5.795  -60.638  1.00 79.16  ? 72  THR A O   1 
ATOM   495   C CB  . THR A  1 72  ? -10.647  -3.330  -58.906  1.00 81.46  ? 72  THR A CB  1 
ATOM   496   O OG1 . THR A  1 72  ? -11.257  -3.505  -57.628  1.00 81.14  ? 72  THR A OG1 1 
ATOM   497   C CG2 . THR A  1 72  ? -9.959   -1.995  -58.987  1.00 82.75  ? 72  THR A CG2 1 
ATOM   498   N N   . ALA A  1 73  ? -13.394  -5.035  -59.122  1.00 78.26  ? 73  ALA A N   1 
ATOM   499   C CA  . ALA A  1 73  ? -14.076  -6.323  -59.082  1.00 77.39  ? 73  ALA A CA  1 
ATOM   500   C C   . ALA A  1 73  ? -14.633  -6.686  -60.463  1.00 76.70  ? 73  ALA A C   1 
ATOM   501   O O   . ALA A  1 73  ? -14.569  -7.829  -60.887  1.00 76.55  ? 73  ALA A O   1 
ATOM   502   C CB  . ALA A  1 73  ? -15.174  -6.334  -58.033  1.00 76.82  ? 73  ALA A CB  1 
ATOM   503   N N   . GLY A  1 74  ? -15.160  -5.696  -61.165  1.00 76.50  ? 74  GLY A N   1 
ATOM   504   C CA  . GLY A  1 74  ? -15.646  -5.887  -62.522  1.00 76.16  ? 74  GLY A CA  1 
ATOM   505   C C   . GLY A  1 74  ? -14.540  -6.364  -63.428  1.00 76.91  ? 74  GLY A C   1 
ATOM   506   O O   . GLY A  1 74  ? -14.748  -7.277  -64.247  1.00 76.77  ? 74  GLY A O   1 
ATOM   507   N N   . PHE A  1 75  ? -13.357  -5.765  -63.272  1.00 77.93  ? 75  PHE A N   1 
ATOM   508   C CA  . PHE A  1 75  ? -12.230  -6.131  -64.129  1.00 78.98  ? 75  PHE A CA  1 
ATOM   509   C C   . PHE A  1 75  ? -11.744  -7.539  -63.869  1.00 79.22  ? 75  PHE A C   1 
ATOM   510   O O   . PHE A  1 75  ? -11.344  -8.219  -64.805  1.00 79.80  ? 75  PHE A O   1 
ATOM   511   C CB  . PHE A  1 75  ? -11.080  -5.126  -64.063  1.00 80.28  ? 75  PHE A CB  1 
ATOM   512   C CG  . PHE A  1 75  ? -11.227  -3.993  -65.023  1.00 80.63  ? 75  PHE A CG  1 
ATOM   513   C CD1 . PHE A  1 75  ? -11.273  -2.671  -64.565  1.00 80.94  ? 75  PHE A CD1 1 
ATOM   514   C CD2 . PHE A  1 75  ? -11.333  -4.245  -66.403  1.00 80.86  ? 75  PHE A CD2 1 
ATOM   515   C CE1 . PHE A  1 75  ? -11.422  -1.617  -65.471  1.00 81.45  ? 75  PHE A CE1 1 
ATOM   516   C CE2 . PHE A  1 75  ? -11.470  -3.200  -67.315  1.00 81.38  ? 75  PHE A CE2 1 
ATOM   517   C CZ  . PHE A  1 75  ? -11.520  -1.883  -66.846  1.00 81.65  ? 75  PHE A CZ  1 
ATOM   518   N N   . ALA A  1 76  ? -11.805  -8.000  -62.624  1.00 78.96  ? 76  ALA A N   1 
ATOM   519   C CA  . ALA A  1 76  ? -11.434  -9.375  -62.355  1.00 79.30  ? 76  ALA A CA  1 
ATOM   520   C C   . ALA A  1 76  ? -12.330  -10.264 -63.223  1.00 78.58  ? 76  ALA A C   1 
ATOM   521   O O   . ALA A  1 76  ? -11.836  -11.187 -63.878  1.00 79.31  ? 76  ALA A O   1 
ATOM   522   C CB  . ALA A  1 76  ? -11.577  -9.695  -60.891  1.00 79.12  ? 76  ALA A CB  1 
ATOM   523   N N   . ILE A  1 77  ? -13.631  -9.965  -63.275  1.00 77.40  ? 77  ILE A N   1 
ATOM   524   C CA  . ILE A  1 77  ? -14.547  -10.732 -64.118  1.00 76.90  ? 77  ILE A CA  1 
ATOM   525   C C   . ILE A  1 77  ? -14.153  -10.580 -65.601  1.00 77.62  ? 77  ILE A C   1 
ATOM   526   O O   . ILE A  1 77  ? -13.878  -11.584 -66.279  1.00 78.27  ? 77  ILE A O   1 
ATOM   527   C CB  . ILE A  1 77  ? -16.033  -10.363 -63.878  1.00 75.75  ? 77  ILE A CB  1 
ATOM   528   C CG1 . ILE A  1 77  ? -16.443  -10.720 -62.438  1.00 75.29  ? 77  ILE A CG1 1 
ATOM   529   C CG2 . ILE A  1 77  ? -16.933  -11.063 -64.886  1.00 75.54  ? 77  ILE A CG2 1 
ATOM   530   C CD1 . ILE A  1 77  ? -17.857  -10.330 -62.052  1.00 74.44  ? 77  ILE A CD1 1 
ATOM   531   N N   . TYR A  1 78  ? -14.095  -9.331  -66.071  1.00 77.73  ? 78  TYR A N   1 
ATOM   532   C CA  . TYR A  1 78  ? -13.769  -9.023  -67.456  1.00 78.57  ? 78  TYR A CA  1 
ATOM   533   C C   . TYR A  1 78  ? -12.514  -9.786  -67.942  1.00 79.96  ? 78  TYR A C   1 
ATOM   534   O O   . TYR A  1 78  ? -12.550  -10.555 -68.937  1.00 80.59  ? 78  TYR A O   1 
ATOM   535   C CB  . TYR A  1 78  ? -13.572  -7.513  -67.631  1.00 78.82  ? 78  TYR A CB  1 
ATOM   536   C CG  . TYR A  1 78  ? -13.147  -7.144  -69.030  1.00 79.93  ? 78  TYR A CG  1 
ATOM   537   C CD1 . TYR A  1 78  ? -14.083  -6.771  -69.983  1.00 79.79  ? 78  TYR A CD1 1 
ATOM   538   C CD2 . TYR A  1 78  ? -11.794  -7.189  -69.403  1.00 81.37  ? 78  TYR A CD2 1 
ATOM   539   C CE1 . TYR A  1 78  ? -13.700  -6.447  -71.264  1.00 81.01  ? 78  TYR A CE1 1 
ATOM   540   C CE2 . TYR A  1 78  ? -11.393  -6.858  -70.685  1.00 82.62  ? 78  TYR A CE2 1 
ATOM   541   C CZ  . TYR A  1 78  ? -12.355  -6.495  -71.624  1.00 82.42  ? 78  TYR A CZ  1 
ATOM   542   O OH  . TYR A  1 78  ? -11.989  -6.173  -72.940  1.00 83.85  ? 78  TYR A OH  1 
ATOM   543   N N   . ASP A  1 79  ? -11.401  -9.576  -67.246  1.00 80.68  ? 79  ASP A N   1 
ATOM   544   C CA  . ASP A  1 79  ? -10.183  -10.245 -67.618  1.00 82.25  ? 79  ASP A CA  1 
ATOM   545   C C   . ASP A  1 79  ? -10.307  -11.756 -67.641  1.00 82.44  ? 79  ASP A C   1 
ATOM   546   O O   . ASP A  1 79  ? -9.749   -12.407 -68.533  1.00 83.76  ? 79  ASP A O   1 
ATOM   547   C CB  . ASP A  1 79  ? -9.028   -9.801  -66.750  1.00 83.14  ? 79  ASP A CB  1 
ATOM   548   C CG  . ASP A  1 79  ? -8.384   -8.537  -67.276  1.00 84.05  ? 79  ASP A CG  1 
ATOM   549   O OD1 . ASP A  1 79  ? -7.362   -8.096  -66.709  1.00 85.12  ? 79  ASP A OD1 1 
ATOM   550   O OD2 . ASP A  1 79  ? -8.902   -7.968  -68.274  1.00 83.87  ? 79  ASP A OD2 1 
ATOM   551   N N   . THR A  1 80  ? -11.041  -12.318 -66.683  1.00 81.33  ? 80  THR A N   1 
ATOM   552   C CA  . THR A  1 80  ? -11.252  -13.765 -66.658  1.00 81.57  ? 80  THR A CA  1 
ATOM   553   C C   . THR A  1 80  ? -12.044  -14.234 -67.876  1.00 81.55  ? 80  THR A C   1 
ATOM   554   O O   . THR A  1 80  ? -11.642  -15.207 -68.505  1.00 82.77  ? 80  THR A O   1 
ATOM   555   C CB  . THR A  1 80  ? -11.897  -14.234 -65.345  1.00 80.54  ? 80  THR A CB  1 
ATOM   556   O OG1 . THR A  1 80  ? -10.997  -13.919 -64.284  1.00 81.03  ? 80  THR A OG1 1 
ATOM   557   C CG2 . THR A  1 80  ? -12.099  -15.748 -65.348  1.00 81.00  ? 80  THR A CG2 1 
ATOM   558   N N   . ILE A  1 81  ? -13.132  -13.545 -68.223  1.00 80.43  ? 81  ILE A N   1 
ATOM   559   C CA  . ILE A  1 81  ? -13.874  -13.864 -69.436  1.00 80.66  ? 81  ILE A CA  1 
ATOM   560   C C   . ILE A  1 81  ? -12.919  -13.922 -70.642  1.00 82.40  ? 81  ILE A C   1 
ATOM   561   O O   . ILE A  1 81  ? -12.915  -14.918 -71.377  1.00 83.44  ? 81  ILE A O   1 
ATOM   562   C CB  . ILE A  1 81  ? -15.025  -12.870 -69.704  1.00 79.58  ? 81  ILE A CB  1 
ATOM   563   C CG1 . ILE A  1 81  ? -16.113  -13.001 -68.636  1.00 78.16  ? 81  ILE A CG1 1 
ATOM   564   C CG2 . ILE A  1 81  ? -15.617  -13.084 -71.093  1.00 80.25  ? 81  ILE A CG2 1 
ATOM   565   C CD1 . ILE A  1 81  ? -17.124  -11.870 -68.618  1.00 77.24  ? 81  ILE A CD1 1 
ATOM   566   N N   . GLN A  1 82  ? -12.091  -12.884 -70.829  1.00 82.94  ? 82  GLN A N   1 
ATOM   567   C CA  . GLN A  1 82  ? -11.183  -12.817 -71.995  1.00 84.79  ? 82  GLN A CA  1 
ATOM   568   C C   . GLN A  1 82  ? -10.115  -13.883 -71.912  1.00 86.34  ? 82  GLN A C   1 
ATOM   569   O O   . GLN A  1 82  ? -9.609   -14.326 -72.925  1.00 88.06  ? 82  GLN A O   1 
ATOM   570   C CB  . GLN A  1 82  ? -10.503  -11.438 -72.164  1.00 85.23  ? 82  GLN A CB  1 
ATOM   571   C CG  . GLN A  1 82  ? -11.414  -10.206 -72.259  1.00 84.05  ? 82  GLN A CG  1 
ATOM   572   C CD  . GLN A  1 82  ? -12.812  -10.471 -72.844  1.00 83.28  ? 82  GLN A CD  1 
ATOM   573   O OE1 . GLN A  1 82  ? -13.803  -9.884  -72.397  1.00 81.93  ? 82  GLN A OE1 1 
ATOM   574   N NE2 . GLN A  1 82  ? -12.895  -11.375 -73.819  1.00 84.34  ? 82  GLN A NE2 1 
ATOM   575   N N   . HIS A  1 83  ? -9.763   -14.300 -70.708  1.00 85.97  ? 83  HIS A N   1 
ATOM   576   C CA  . HIS A  1 83  ? -8.640   -15.199 -70.545  1.00 87.69  ? 83  HIS A CA  1 
ATOM   577   C C   . HIS A  1 83  ? -8.967   -16.630 -70.835  1.00 88.33  ? 83  HIS A C   1 
ATOM   578   O O   . HIS A  1 83  ? -8.109   -17.377 -71.235  1.00 90.29  ? 83  HIS A O   1 
ATOM   579   C CB  . HIS A  1 83  ? -8.097   -15.085 -69.140  1.00 87.34  ? 83  HIS A CB  1 
ATOM   580   C CG  . HIS A  1 83  ? -6.933   -15.997 -68.875  1.00 89.30  ? 83  HIS A CG  1 
ATOM   581   N ND1 . HIS A  1 83  ? -7.045   -17.114 -68.107  1.00 89.36  ? 83  HIS A ND1 1 
ATOM   582   C CD2 . HIS A  1 83  ? -5.601   -15.954 -69.339  1.00 91.58  ? 83  HIS A CD2 1 
ATOM   583   C CE1 . HIS A  1 83  ? -5.844   -17.743 -68.057  1.00 91.56  ? 83  HIS A CE1 1 
ATOM   584   N NE2 . HIS A  1 83  ? -4.959   -17.026 -68.817  1.00 92.94  ? 83  HIS A NE2 1 
ATOM   585   N N   . ILE A  1 84  ? -10.212  -17.032 -70.626  1.00 86.89  ? 84  ILE A N   1 
ATOM   586   C CA  . ILE A  1 84  ? -10.588  -18.433 -70.772  1.00 87.54  ? 84  ILE A CA  1 
ATOM   587   C C   . ILE A  1 84  ? -10.895  -18.752 -72.223  1.00 88.70  ? 84  ILE A C   1 
ATOM   588   O O   . ILE A  1 84  ? -11.154  -17.851 -73.018  1.00 88.50  ? 84  ILE A O   1 
ATOM   589   C CB  . ILE A  1 84  ? -11.773  -18.839 -69.827  1.00 85.78  ? 84  ILE A CB  1 
ATOM   590   C CG1 . ILE A  1 84  ? -13.013  -17.984 -70.071  1.00 84.10  ? 84  ILE A CG1 1 
ATOM   591   C CG2 . ILE A  1 84  ? -11.347  -18.786 -68.366  1.00 85.19  ? 84  ILE A CG2 1 
ATOM   592   C CD1 . ILE A  1 84  ? -14.294  -18.644 -69.633  1.00 83.07  ? 84  ILE A CD1 1 
ATOM   593   N N   . LYS A  1 85  ? -10.866  -20.041 -72.552  1.00 90.10  ? 85  LYS A N   1 
ATOM   594   C CA  . LYS A  1 85  ? -11.073  -20.516 -73.920  1.00 91.69  ? 85  LYS A CA  1 
ATOM   595   C C   . LYS A  1 85  ? -12.532  -20.398 -74.368  1.00 90.51  ? 85  LYS A C   1 
ATOM   596   O O   . LYS A  1 85  ? -12.794  -19.824 -75.426  1.00 90.96  ? 85  LYS A O   1 
ATOM   597   C CB  . LYS A  1 85  ? -10.549  -21.943 -74.083  1.00 93.85  ? 85  LYS A CB  1 
ATOM   598   C CG  . LYS A  1 85  ? -9.049   -22.045 -73.896  1.00 95.63  ? 85  LYS A CG  1 
ATOM   599   C CD  . LYS A  1 85  ? -8.553   -23.423 -74.279  1.00 98.21  ? 85  LYS A CD  1 
ATOM   600   C CE  . LYS A  1 85  ? -7.208   -23.327 -74.999  1.00 100.85 ? 85  LYS A CE  1 
ATOM   601   N NZ  . LYS A  1 85  ? -7.114   -24.271 -76.145  1.00 103.52 ? 85  LYS A NZ  1 
ATOM   602   N N   . PRO A  1 86  ? -13.494  -20.898 -73.555  1.00 89.13  ? 86  PRO A N   1 
ATOM   603   C CA  . PRO A  1 86  ? -14.874  -20.912 -74.046  1.00 88.46  ? 86  PRO A CA  1 
ATOM   604   C C   . PRO A  1 86  ? -15.381  -19.525 -74.349  1.00 87.21  ? 86  PRO A C   1 
ATOM   605   O O   . PRO A  1 86  ? -14.988  -18.601 -73.664  1.00 86.06  ? 86  PRO A O   1 
ATOM   606   C CB  . PRO A  1 86  ? -15.654  -21.481 -72.853  1.00 87.10  ? 86  PRO A CB  1 
ATOM   607   C CG  . PRO A  1 86  ? -14.663  -22.294 -72.101  1.00 87.93  ? 86  PRO A CG  1 
ATOM   608   C CD  . PRO A  1 86  ? -13.399  -21.490 -72.210  1.00 88.41  ? 86  PRO A CD  1 
ATOM   609   N N   . ASP A  1 87  ? -16.222  -19.376 -75.367  1.00 87.64  ? 87  ASP A N   1 
ATOM   610   C CA  . ASP A  1 87  ? -16.942  -18.133 -75.567  1.00 86.46  ? 87  ASP A CA  1 
ATOM   611   C C   . ASP A  1 87  ? -17.870  -17.953 -74.391  1.00 84.45  ? 87  ASP A C   1 
ATOM   612   O O   . ASP A  1 87  ? -18.404  -18.948 -73.868  1.00 84.30  ? 87  ASP A O   1 
ATOM   613   C CB  . ASP A  1 87  ? -17.764  -18.163 -76.847  1.00 87.59  ? 87  ASP A CB  1 
ATOM   614   C CG  . ASP A  1 87  ? -16.929  -17.893 -78.061  1.00 89.51  ? 87  ASP A CG  1 
ATOM   615   O OD1 . ASP A  1 87  ? -17.432  -18.079 -79.204  1.00 90.97  ? 87  ASP A OD1 1 
ATOM   616   O OD2 . ASP A  1 87  ? -15.748  -17.517 -77.854  1.00 89.74  ? 87  ASP A OD2 1 
ATOM   617   N N   . VAL A  1 88  ? -18.047  -16.700 -73.950  1.00 83.08  ? 88  VAL A N   1 
ATOM   618   C CA  . VAL A  1 88  ? -18.999  -16.410 -72.892  1.00 81.39  ? 88  VAL A CA  1 
ATOM   619   C C   . VAL A  1 88  ? -20.102  -15.557 -73.482  1.00 81.10  ? 88  VAL A C   1 
ATOM   620   O O   . VAL A  1 88  ? -19.862  -14.411 -73.855  1.00 81.04  ? 88  VAL A O   1 
ATOM   621   C CB  . VAL A  1 88  ? -18.318  -15.709 -71.714  1.00 80.25  ? 88  VAL A CB  1 
ATOM   622   C CG1 . VAL A  1 88  ? -19.357  -15.312 -70.682  1.00 78.74  ? 88  VAL A CG1 1 
ATOM   623   C CG2 . VAL A  1 88  ? -17.279  -16.639 -71.099  1.00 80.78  ? 88  VAL A CG2 1 
ATOM   624   N N   . GLN A  1 89  ? -21.300  -16.118 -73.604  1.00 81.15  ? 89  GLN A N   1 
ATOM   625   C CA  . GLN A  1 89  ? -22.431  -15.306 -74.052  1.00 81.00  ? 89  GLN A CA  1 
ATOM   626   C C   . GLN A  1 89  ? -22.890  -14.454 -72.881  1.00 79.41  ? 89  GLN A C   1 
ATOM   627   O O   . GLN A  1 89  ? -22.877  -14.918 -71.731  1.00 78.54  ? 89  GLN A O   1 
ATOM   628   C CB  . GLN A  1 89  ? -23.585  -16.168 -74.551  1.00 81.83  ? 89  GLN A CB  1 
ATOM   629   C CG  . GLN A  1 89  ? -23.152  -17.272 -75.473  1.00 83.53  ? 89  GLN A CG  1 
ATOM   630   C CD  . GLN A  1 89  ? -24.258  -17.760 -76.424  1.00 84.92  ? 89  GLN A CD  1 
ATOM   631   O OE1 . GLN A  1 89  ? -25.328  -17.132 -76.566  1.00 84.76  ? 89  GLN A OE1 1 
ATOM   632   N NE2 . GLN A  1 89  ? -23.989  -18.889 -77.104  1.00 86.57  ? 89  GLN A NE2 1 
ATOM   633   N N   . THR A  1 90  ? -23.285  -13.217 -73.163  1.00 79.23  ? 90  THR A N   1 
ATOM   634   C CA  . THR A  1 90  ? -23.862  -12.367 -72.133  1.00 78.04  ? 90  THR A CA  1 
ATOM   635   C C   . THR A  1 90  ? -25.303  -12.015 -72.498  1.00 78.37  ? 90  THR A C   1 
ATOM   636   O O   . THR A  1 90  ? -25.591  -11.640 -73.644  1.00 79.43  ? 90  THR A O   1 
ATOM   637   C CB  . THR A  1 90  ? -23.047  -11.099 -71.935  1.00 77.66  ? 90  THR A CB  1 
ATOM   638   O OG1 . THR A  1 90  ? -22.878  -10.479 -73.200  1.00 78.72  ? 90  THR A OG1 1 
ATOM   639   C CG2 . THR A  1 90  ? -21.699  -11.407 -71.320  1.00 77.36  ? 90  THR A CG2 1 
ATOM   640   N N   . ILE A  1 91  ? -26.209  -12.188 -71.530  1.00 77.70  ? 91  ILE A N   1 
ATOM   641   C CA  . ILE A  1 91  ? -27.632  -11.954 -71.745  1.00 78.20  ? 91  ILE A CA  1 
ATOM   642   C C   . ILE A  1 91  ? -28.180  -11.033 -70.649  1.00 77.39  ? 91  ILE A C   1 
ATOM   643   O O   . ILE A  1 91  ? -28.272  -11.399 -69.464  1.00 76.61  ? 91  ILE A O   1 
ATOM   644   C CB  . ILE A  1 91  ? -28.442  -13.263 -71.736  1.00 78.73  ? 91  ILE A CB  1 
ATOM   645   C CG1 . ILE A  1 91  ? -27.854  -14.269 -72.729  1.00 79.71  ? 91  ILE A CG1 1 
ATOM   646   C CG2 . ILE A  1 91  ? -29.924  -12.978 -72.015  1.00 79.54  ? 91  ILE A CG2 1 
ATOM   647   C CD1 . ILE A  1 91  ? -27.633  -15.639 -72.157  1.00 79.61  ? 91  ILE A CD1 1 
ATOM   648   N N   . CYS A  1 92  ? -28.548  -9.821  -71.041  1.00 77.79  ? 92  CYS A N   1 
ATOM   649   C CA  . CYS A  1 92  ? -29.052  -8.863  -70.096  1.00 77.35  ? 92  CYS A CA  1 
ATOM   650   C C   . CYS A  1 92  ? -30.552  -9.046  -69.833  1.00 77.93  ? 92  CYS A C   1 
ATOM   651   O O   . CYS A  1 92  ? -31.377  -8.910  -70.740  1.00 79.09  ? 92  CYS A O   1 
ATOM   652   C CB  . CYS A  1 92  ? -28.788  -7.456  -70.588  1.00 77.75  ? 92  CYS A CB  1 
ATOM   653   S SG  . CYS A  1 92  ? -29.573  -6.259  -69.469  1.00 77.64  ? 92  CYS A SG  1 
ATOM   654   N N   . ILE A  1 93  ? -30.899  -9.349  -68.590  1.00 77.32  ? 93  ILE A N   1 
ATOM   655   C CA  . ILE A  1 93  ? -32.303  -9.400  -68.185  1.00 78.01  ? 93  ILE A CA  1 
ATOM   656   C C   . ILE A  1 93  ? -32.519  -8.344  -67.106  1.00 77.75  ? 93  ILE A C   1 
ATOM   657   O O   . ILE A  1 93  ? -31.660  -8.151  -66.228  1.00 76.80  ? 93  ILE A O   1 
ATOM   658   C CB  . ILE A  1 93  ? -32.698  -10.784 -67.626  1.00 77.92  ? 93  ILE A CB  1 
ATOM   659   C CG1 . ILE A  1 93  ? -31.798  -11.158 -66.440  1.00 76.72  ? 93  ILE A CG1 1 
ATOM   660   C CG2 . ILE A  1 93  ? -32.669  -11.840 -68.733  1.00 78.58  ? 93  ILE A CG2 1 
ATOM   661   C CD1 . ILE A  1 93  ? -32.118  -12.488 -65.817  1.00 76.74  ? 93  ILE A CD1 1 
ATOM   662   N N   . GLY A  1 94  ? -33.643  -7.643  -67.163  1.00 78.82  ? 94  GLY A N   1 
ATOM   663   C CA  . GLY A  1 94  ? -33.868  -6.556  -66.199  1.00 78.90  ? 94  GLY A CA  1 
ATOM   664   C C   . GLY A  1 94  ? -33.100  -5.256  -66.440  1.00 78.81  ? 94  GLY A C   1 
ATOM   665   O O   . GLY A  1 94  ? -33.627  -4.318  -67.089  1.00 79.92  ? 94  GLY A O   1 
ATOM   666   N N   . MET A  1 95  ? -31.873  -5.184  -65.912  1.00 77.70  ? 95  MET A N   1 
ATOM   667   C CA  . MET A  1 95  ? -31.063  -3.961  -65.978  1.00 77.70  ? 95  MET A CA  1 
ATOM   668   C C   . MET A  1 95  ? -29.599  -4.338  -65.943  1.00 76.64  ? 95  MET A C   1 
ATOM   669   O O   . MET A  1 95  ? -29.178  -5.171  -65.140  1.00 75.84  ? 95  MET A O   1 
ATOM   670   C CB  . MET A  1 95  ? -31.394  -3.032  -64.795  1.00 78.05  ? 95  MET A CB  1 
ATOM   671   C CG  . MET A  1 95  ? -30.467  -1.833  -64.535  1.00 78.09  ? 95  MET A CG  1 
ATOM   672   S SD  . MET A  1 95  ? -30.458  -0.491  -65.784  1.00 79.27  ? 95  MET A SD  1 
ATOM   673   C CE  . MET A  1 95  ? -31.842  0.551   -65.270  1.00 80.89  ? 95  MET A CE  1 
ATOM   674   N N   . ALA A  1 96  ? -28.824  -3.743  -66.835  1.00 76.83  ? 96  ALA A N   1 
ATOM   675   C CA  . ALA A  1 96  ? -27.386  -3.831  -66.723  1.00 76.15  ? 96  ALA A CA  1 
ATOM   676   C C   . ALA A  1 96  ? -26.855  -2.400  -66.740  1.00 76.67  ? 96  ALA A C   1 
ATOM   677   O O   . ALA A  1 96  ? -26.917  -1.700  -67.765  1.00 77.49  ? 96  ALA A O   1 
ATOM   678   C CB  . ALA A  1 96  ? -26.790  -4.680  -67.847  1.00 76.10  ? 96  ALA A CB  1 
ATOM   679   N N   . ALA A  1 97  ? -26.362  -1.977  -65.580  1.00 76.37  ? 97  ALA A N   1 
ATOM   680   C CA  . ALA A  1 97  ? -25.955  -0.600  -65.356  1.00 77.04  ? 97  ALA A CA  1 
ATOM   681   C C   . ALA A  1 97  ? -24.490  -0.516  -64.957  1.00 76.70  ? 97  ALA A C   1 
ATOM   682   O O   . ALA A  1 97  ? -23.988  -1.392  -64.238  1.00 75.95  ? 97  ALA A O   1 
ATOM   683   C CB  . ALA A  1 97  ? -26.830  0.051   -64.300  1.00 77.54  ? 97  ALA A CB  1 
ATOM   684   N N   . ALA A  1 98  ? -23.813  0.542   -65.427  1.00 77.45  ? 98  ALA A N   1 
ATOM   685   C CA  . ALA A  1 98  ? -22.436  0.834   -65.010  1.00 77.51  ? 98  ALA A CA  1 
ATOM   686   C C   . ALA A  1 98  ? -21.539  -0.370  -65.339  1.00 76.81  ? 98  ALA A C   1 
ATOM   687   O O   . ALA A  1 98  ? -21.607  -0.899  -66.443  1.00 76.79  ? 98  ALA A O   1 
ATOM   688   C CB  . ALA A  1 98  ? -22.376  1.213   -63.517  1.00 77.57  ? 98  ALA A CB  1 
ATOM   689   N N   . MET A  1 99  ? -20.732  -0.816  -64.385  1.00 76.45  ? 99  MET A N   1 
ATOM   690   C CA  . MET A  1 99  ? -19.861  -1.943  -64.598  1.00 76.04  ? 99  MET A CA  1 
ATOM   691   C C   . MET A  1 99  ? -20.660  -3.170  -65.091  1.00 75.38  ? 99  MET A C   1 
ATOM   692   O O   . MET A  1 99  ? -20.113  -4.038  -65.789  1.00 75.34  ? 99  MET A O   1 
ATOM   693   C CB  . MET A  1 99  ? -19.086  -2.248  -63.323  1.00 75.91  ? 99  MET A CB  1 
ATOM   694   C CG  . MET A  1 99  ? -17.848  -3.102  -63.506  1.00 76.00  ? 99  MET A CG  1 
ATOM   695   S SD  . MET A  1 99  ? -16.499  -2.379  -64.481  1.00 77.12  ? 99  MET A SD  1 
ATOM   696   C CE  . MET A  1 99  ? -16.851  -0.602  -64.331  1.00 77.84  ? 99  MET A CE  1 
ATOM   697   N N   . GLY A  1 100 ? -21.954  -3.233  -64.756  1.00 75.09  ? 100 GLY A N   1 
ATOM   698   C CA  . GLY A  1 100 ? -22.829  -4.268  -65.299  1.00 74.74  ? 100 GLY A CA  1 
ATOM   699   C C   . GLY A  1 100 ? -22.906  -4.218  -66.818  1.00 75.27  ? 100 GLY A C   1 
ATOM   700   O O   . GLY A  1 100 ? -22.724  -5.232  -67.490  1.00 75.22  ? 100 GLY A O   1 
ATOM   701   N N   . SER A  1 101 ? -23.182  -3.037  -67.367  1.00 75.97  ? 101 SER A N   1 
ATOM   702   C CA  . SER A  1 101 ? -23.281  -2.906  -68.804  1.00 76.72  ? 101 SER A CA  1 
ATOM   703   C C   . SER A  1 101 ? -21.888  -3.080  -69.411  1.00 77.02  ? 101 SER A C   1 
ATOM   704   O O   . SER A  1 101 ? -21.752  -3.528  -70.559  1.00 77.58  ? 101 SER A O   1 
ATOM   705   C CB  . SER A  1 101 ? -23.886  -1.576  -69.192  1.00 77.62  ? 101 SER A CB  1 
ATOM   706   O OG  . SER A  1 101 ? -22.963  -0.545  -68.922  1.00 78.00  ? 101 SER A OG  1 
ATOM   707   N N   . PHE A  1 102 ? -20.841  -2.746  -68.650  1.00 76.88  ? 102 PHE A N   1 
ATOM   708   C CA  . PHE A  1 102 ? -19.466  -2.973  -69.130  1.00 77.36  ? 102 PHE A CA  1 
ATOM   709   C C   . PHE A  1 102 ? -19.266  -4.468  -69.411  1.00 77.06  ? 102 PHE A C   1 
ATOM   710   O O   . PHE A  1 102 ? -18.806  -4.845  -70.475  1.00 77.78  ? 102 PHE A O   1 
ATOM   711   C CB  . PHE A  1 102 ? -18.463  -2.469  -68.112  1.00 77.38  ? 102 PHE A CB  1 
ATOM   712   C CG  . PHE A  1 102 ? -17.050  -2.504  -68.581  1.00 78.20  ? 102 PHE A CG  1 
ATOM   713   C CD1 . PHE A  1 102 ? -16.541  -1.508  -69.449  1.00 79.36  ? 102 PHE A CD1 1 
ATOM   714   C CD2 . PHE A  1 102 ? -16.186  -3.512  -68.156  1.00 78.06  ? 102 PHE A CD2 1 
ATOM   715   C CE1 . PHE A  1 102 ? -15.214  -1.545  -69.890  1.00 80.35  ? 102 PHE A CE1 1 
ATOM   716   C CE2 . PHE A  1 102 ? -14.852  -3.547  -68.613  1.00 79.10  ? 102 PHE A CE2 1 
ATOM   717   C CZ  . PHE A  1 102 ? -14.373  -2.561  -69.470  1.00 80.24  ? 102 PHE A CZ  1 
ATOM   718   N N   . LEU A  1 103 ? -19.666  -5.313  -68.466  1.00 76.18  ? 103 LEU A N   1 
ATOM   719   C CA  . LEU A  1 103 ? -19.543  -6.751  -68.623  1.00 76.01  ? 103 LEU A CA  1 
ATOM   720   C C   . LEU A  1 103 ? -20.444  -7.308  -69.716  1.00 76.34  ? 103 LEU A C   1 
ATOM   721   O O   . LEU A  1 103 ? -20.041  -8.247  -70.441  1.00 76.86  ? 103 LEU A O   1 
ATOM   722   C CB  . LEU A  1 103 ? -19.838  -7.474  -67.316  1.00 75.17  ? 103 LEU A CB  1 
ATOM   723   C CG  . LEU A  1 103 ? -18.851  -7.231  -66.170  1.00 75.06  ? 103 LEU A CG  1 
ATOM   724   C CD1 . LEU A  1 103 ? -19.314  -7.982  -64.920  1.00 74.40  ? 103 LEU A CD1 1 
ATOM   725   C CD2 . LEU A  1 103 ? -17.409  -7.560  -66.543  1.00 75.80  ? 103 LEU A CD2 1 
ATOM   726   N N   . LEU A  1 104 ? -21.652  -6.745  -69.834  1.00 76.26  ? 104 LEU A N   1 
ATOM   727   C CA  . LEU A  1 104 ? -22.574  -7.119  -70.920  1.00 76.86  ? 104 LEU A CA  1 
ATOM   728   C C   . LEU A  1 104 ? -21.873  -7.003  -72.256  1.00 77.99  ? 104 LEU A C   1 
ATOM   729   O O   . LEU A  1 104 ? -21.956  -7.904  -73.077  1.00 78.62  ? 104 LEU A O   1 
ATOM   730   C CB  . LEU A  1 104 ? -23.809  -6.233  -70.926  1.00 77.00  ? 104 LEU A CB  1 
ATOM   731   C CG  . LEU A  1 104 ? -24.842  -6.461  -72.004  1.00 77.88  ? 104 LEU A CG  1 
ATOM   732   C CD1 . LEU A  1 104 ? -25.388  -7.867  -71.996  1.00 77.75  ? 104 LEU A CD1 1 
ATOM   733   C CD2 . LEU A  1 104 ? -25.951  -5.455  -71.780  1.00 78.13  ? 104 LEU A CD2 1 
ATOM   734   N N   . ALA A  1 105 ? -21.161  -5.894  -72.449  1.00 78.42  ? 105 ALA A N   1 
ATOM   735   C CA  . ALA A  1 105 ? -20.491  -5.578  -73.695  1.00 79.71  ? 105 ALA A CA  1 
ATOM   736   C C   . ALA A  1 105 ? -19.232  -6.411  -73.860  1.00 80.09  ? 105 ALA A C   1 
ATOM   737   O O   . ALA A  1 105 ? -18.642  -6.445  -74.941  1.00 81.36  ? 105 ALA A O   1 
ATOM   738   C CB  . ALA A  1 105 ? -20.170  -4.092  -73.736  1.00 80.18  ? 105 ALA A CB  1 
ATOM   739   N N   . ALA A  1 106 ? -18.836  -7.095  -72.794  1.00 79.19  ? 106 ALA A N   1 
ATOM   740   C CA  . ALA A  1 106 ? -17.591  -7.873  -72.804  1.00 79.69  ? 106 ALA A CA  1 
ATOM   741   C C   . ALA A  1 106 ? -17.773  -9.349  -73.205  1.00 80.01  ? 106 ALA A C   1 
ATOM   742   O O   . ALA A  1 106 ? -16.823  -10.112 -73.181  1.00 80.58  ? 106 ALA A O   1 
ATOM   743   C CB  . ALA A  1 106 ? -16.914  -7.777  -71.452  1.00 78.92  ? 106 ALA A CB  1 
ATOM   744   N N   . GLY A  1 107 ? -18.994  -9.745  -73.560  1.00 79.86  ? 107 GLY A N   1 
ATOM   745   C CA  . GLY A  1 107 ? -19.242  -11.088 -74.022  1.00 80.42  ? 107 GLY A CA  1 
ATOM   746   C C   . GLY A  1 107 ? -18.680  -11.290 -75.408  1.00 82.16  ? 107 GLY A C   1 
ATOM   747   O O   . GLY A  1 107 ? -18.406  -10.333 -76.109  1.00 82.88  ? 107 GLY A O   1 
ATOM   748   N N   . ALA A  1 108 ? -18.498  -12.544 -75.803  1.00 83.03  ? 108 ALA A N   1 
ATOM   749   C CA  . ALA A  1 108 ? -18.002  -12.888 -77.105  1.00 84.95  ? 108 ALA A CA  1 
ATOM   750   C C   . ALA A  1 108 ? -18.808  -12.200 -78.180  1.00 85.75  ? 108 ALA A C   1 
ATOM   751   O O   . ALA A  1 108 ? -20.035  -12.206 -78.150  1.00 85.27  ? 108 ALA A O   1 
ATOM   752   C CB  . ALA A  1 108 ? -18.050  -14.385 -77.290  1.00 85.78  ? 108 ALA A CB  1 
ATOM   753   N N   . LYS A  1 109 ? -18.097  -11.603 -79.137  1.00 87.19  ? 109 LYS A N   1 
ATOM   754   C CA  . LYS A  1 109 ? -18.737  -10.849 -80.231  1.00 88.29  ? 109 LYS A CA  1 
ATOM   755   C C   . LYS A  1 109 ? -19.708  -11.736 -81.038  1.00 89.40  ? 109 LYS A C   1 
ATOM   756   O O   . LYS A  1 109 ? -19.392  -12.897 -81.345  1.00 90.39  ? 109 LYS A O   1 
ATOM   757   C CB  . LYS A  1 109 ? -17.704  -10.174 -81.130  1.00 89.95  ? 109 LYS A CB  1 
ATOM   758   C CG  . LYS A  1 109 ? -16.925  -9.045  -80.472  1.00 89.15  ? 109 LYS A CG  1 
ATOM   759   C CD  . LYS A  1 109 ? -15.867  -8.493  -81.452  1.00 91.17  ? 109 LYS A CD  1 
ATOM   760   C CE  . LYS A  1 109 ? -14.803  -7.616  -80.776  1.00 90.77  ? 109 LYS A CE  1 
ATOM   761   N NZ  . LYS A  1 109 ? -15.411  -6.483  -79.982  1.00 89.18  ? 109 LYS A NZ  1 
ATOM   762   N N   . GLY A  1 110 ? -20.897  -11.192 -81.332  1.00 89.37  ? 110 GLY A N   1 
ATOM   763   C CA  . GLY A  1 110 ? -21.996  -11.958 -81.950  1.00 90.37  ? 110 GLY A CA  1 
ATOM   764   C C   . GLY A  1 110 ? -22.885  -12.692 -80.939  1.00 88.90  ? 110 GLY A C   1 
ATOM   765   O O   . GLY A  1 110 ? -23.963  -13.173 -81.290  1.00 89.59  ? 110 GLY A O   1 
ATOM   766   N N   . LYS A  1 111 ? -22.438  -12.775 -79.682  1.00 87.08  ? 111 LYS A N   1 
ATOM   767   C CA  . LYS A  1 111 ? -23.180  -13.486 -78.637  1.00 85.77  ? 111 LYS A CA  1 
ATOM   768   C C   . LYS A  1 111 ? -23.475  -12.642 -77.353  1.00 83.76  ? 111 LYS A C   1 
ATOM   769   O O   . LYS A  1 111 ? -23.396  -13.152 -76.209  1.00 82.50  ? 111 LYS A O   1 
ATOM   770   C CB  . LYS A  1 111 ? -22.441  -14.767 -78.256  1.00 85.85  ? 111 LYS A CB  1 
ATOM   771   C CG  . LYS A  1 111 ? -22.075  -15.615 -79.443  1.00 88.01  ? 111 LYS A CG  1 
ATOM   772   C CD  . LYS A  1 111 ? -21.755  -17.040 -79.043  1.00 88.31  ? 111 LYS A CD  1 
ATOM   773   C CE  . LYS A  1 111 ? -21.030  -17.756 -80.173  1.00 90.66  ? 111 LYS A CE  1 
ATOM   774   N NZ  . LYS A  1 111 ? -20.048  -18.680 -79.555  1.00 90.70  ? 111 LYS A NZ  1 
ATOM   775   N N   . ARG A  1 112 ? -23.807  -11.361 -77.557  1.00 83.70  ? 112 ARG A N   1 
ATOM   776   C CA  . ARG A  1 112 ? -24.185  -10.440 -76.487  1.00 82.22  ? 112 ARG A CA  1 
ATOM   777   C C   . ARG A  1 112 ? -25.617  -10.027 -76.742  1.00 82.63  ? 112 ARG A C   1 
ATOM   778   O O   . ARG A  1 112 ? -25.933  -9.382  -77.733  1.00 83.88  ? 112 ARG A O   1 
ATOM   779   C CB  . ARG A  1 112 ? -23.260  -9.225  -76.477  1.00 82.08  ? 112 ARG A CB  1 
ATOM   780   C CG  . ARG A  1 112 ? -21.807  -9.567  -76.213  1.00 81.92  ? 112 ARG A CG  1 
ATOM   781   C CD  . ARG A  1 112 ? -20.930  -8.363  -76.475  1.00 82.31  ? 112 ARG A CD  1 
ATOM   782   N NE  . ARG A  1 112 ? -21.265  -7.701  -77.737  1.00 83.78  ? 112 ARG A NE  1 
ATOM   783   C CZ  . ARG A  1 112 ? -20.621  -6.643  -78.218  1.00 84.56  ? 112 ARG A CZ  1 
ATOM   784   N NH1 . ARG A  1 112 ? -19.599  -6.114  -77.549  1.00 84.03  ? 112 ARG A NH1 1 
ATOM   785   N NH2 . ARG A  1 112 ? -21.004  -6.108  -79.370  1.00 86.07  ? 112 ARG A NH2 1 
ATOM   786   N N   . PHE A  1 113 ? -26.489  -10.427 -75.838  1.00 81.78  ? 113 PHE A N   1 
ATOM   787   C CA  . PHE A  1 113 ? -27.926  -10.264 -76.040  1.00 82.42  ? 113 PHE A CA  1 
ATOM   788   C C   . PHE A  1 113 ? -28.559  -9.427  -74.935  1.00 81.39  ? 113 PHE A C   1 
ATOM   789   O O   . PHE A  1 113 ? -27.964  -9.227  -73.889  1.00 80.08  ? 113 PHE A O   1 
ATOM   790   C CB  . PHE A  1 113 ? -28.623  -11.643 -76.063  1.00 82.89  ? 113 PHE A CB  1 
ATOM   791   C CG  . PHE A  1 113 ? -28.041  -12.629 -77.034  1.00 84.07  ? 113 PHE A CG  1 
ATOM   792   C CD1 . PHE A  1 113 ? -27.068  -13.547 -76.615  1.00 83.51  ? 113 PHE A CD1 1 
ATOM   793   C CD2 . PHE A  1 113 ? -28.477  -12.659 -78.363  1.00 85.98  ? 113 PHE A CD2 1 
ATOM   794   C CE1 . PHE A  1 113 ? -26.527  -14.467 -77.512  1.00 84.86  ? 113 PHE A CE1 1 
ATOM   795   C CE2 . PHE A  1 113 ? -27.946  -13.577 -79.257  1.00 87.32  ? 113 PHE A CE2 1 
ATOM   796   C CZ  . PHE A  1 113 ? -26.975  -14.486 -78.830  1.00 86.77  ? 113 PHE A CZ  1 
ATOM   797   N N   . ALA A  1 114 ? -29.772  -8.950  -75.191  1.00 77.10  ? 114 ALA A N   1 
ATOM   798   C CA  . ALA A  1 114 ? -30.646  -8.368  -74.175  1.00 76.86  ? 114 ALA A CA  1 
ATOM   799   C C   . ALA A  1 114 ? -32.073  -8.774  -74.488  1.00 76.98  ? 114 ALA A C   1 
ATOM   800   O O   . ALA A  1 114 ? -32.463  -8.851  -75.646  1.00 76.51  ? 114 ALA A O   1 
ATOM   801   C CB  . ALA A  1 114 ? -30.538  -6.854  -74.170  1.00 76.01  ? 114 ALA A CB  1 
ATOM   802   N N   . LEU A  1 115 ? -32.854  -9.038  -73.456  1.00 77.96  ? 115 LEU A N   1 
ATOM   803   C CA  . LEU A  1 115 ? -34.278  -9.282  -73.653  1.00 78.43  ? 115 LEU A CA  1 
ATOM   804   C C   . LEU A  1 115 ? -34.998  -7.971  -74.009  1.00 77.85  ? 115 LEU A C   1 
ATOM   805   O O   . LEU A  1 115 ? -34.503  -6.891  -73.710  1.00 77.47  ? 115 LEU A O   1 
ATOM   806   C CB  . LEU A  1 115 ? -34.883  -9.981  -72.421  1.00 80.46  ? 115 LEU A CB  1 
ATOM   807   C CG  . LEU A  1 115 ? -34.294  -11.354 -72.125  1.00 81.80  ? 115 LEU A CG  1 
ATOM   808   C CD1 . LEU A  1 115 ? -35.272  -12.204 -71.348  1.00 84.28  ? 115 LEU A CD1 1 
ATOM   809   C CD2 . LEU A  1 115 ? -33.960  -12.054 -73.418  1.00 80.99  ? 115 LEU A CD2 1 
ATOM   810   N N   . PRO A  1 116 ? -36.168  -8.060  -74.647  1.00 78.10  ? 116 PRO A N   1 
ATOM   811   C CA  . PRO A  1 116 ? -36.740  -6.852  -75.249  1.00 77.93  ? 116 PRO A CA  1 
ATOM   812   C C   . PRO A  1 116 ? -36.952  -5.691  -74.289  1.00 78.92  ? 116 PRO A C   1 
ATOM   813   O O   . PRO A  1 116 ? -36.791  -4.563  -74.694  1.00 78.77  ? 116 PRO A O   1 
ATOM   814   C CB  . PRO A  1 116 ? -38.086  -7.317  -75.799  1.00 78.66  ? 116 PRO A CB  1 
ATOM   815   C CG  . PRO A  1 116 ? -38.019  -8.804  -75.826  1.00 78.66  ? 116 PRO A CG  1 
ATOM   816   C CD  . PRO A  1 116 ? -37.057  -9.226  -74.762  1.00 78.98  ? 116 PRO A CD  1 
ATOM   817   N N   . ASN A  1 117 ? -37.315  -5.953  -73.040  1.00 80.36  ? 117 ASN A N   1 
ATOM   818   C CA  . ASN A  1 117 ? -37.597  -4.866  -72.123  1.00 81.79  ? 117 ASN A CA  1 
ATOM   819   C C   . ASN A  1 117 ? -36.496  -4.574  -71.118  1.00 81.55  ? 117 ASN A C   1 
ATOM   820   O O   . ASN A  1 117 ? -36.697  -3.772  -70.209  1.00 83.00  ? 117 ASN A O   1 
ATOM   821   C CB  . ASN A  1 117 ? -38.911  -5.115  -71.415  1.00 84.42  ? 117 ASN A CB  1 
ATOM   822   C CG  . ASN A  1 117 ? -40.091  -5.103  -72.370  1.00 85.03  ? 117 ASN A CG  1 
ATOM   823   O OD1 . ASN A  1 117 ? -40.768  -6.122  -72.556  1.00 85.58  ? 117 ASN A OD1 1 
ATOM   824   N ND2 . ASN A  1 117 ? -40.344  -3.952  -72.987  1.00 85.23  ? 117 ASN A ND2 1 
ATOM   825   N N   . ALA A  1 118 ? -35.347  -5.226  -71.286  1.00 80.06  ? 118 ALA A N   1 
ATOM   826   C CA  . ALA A  1 118 ? -34.174  -4.958  -70.462  1.00 79.75  ? 118 ALA A CA  1 
ATOM   827   C C   . ALA A  1 118 ? -33.639  -3.559  -70.729  1.00 78.94  ? 118 ALA A C   1 
ATOM   828   O O   . ALA A  1 118 ? -33.815  -3.011  -71.811  1.00 78.33  ? 118 ALA A O   1 
ATOM   829   C CB  . ALA A  1 118 ? -33.074  -5.990  -70.683  1.00 78.88  ? 118 ALA A CB  1 
ATOM   830   N N   . GLU A  1 119 ? -33.015  -2.971  -69.719  1.00 79.31  ? 119 GLU A N   1 
ATOM   831   C CA  . GLU A  1 119 ? -32.487  -1.639  -69.801  1.00 78.94  ? 119 GLU A CA  1 
ATOM   832   C C   . GLU A  1 119 ? -30.972  -1.662  -69.585  1.00 77.77  ? 119 GLU A C   1 
ATOM   833   O O   . GLU A  1 119 ? -30.417  -2.482  -68.810  1.00 77.93  ? 119 GLU A O   1 
ATOM   834   C CB  . GLU A  1 119 ? -33.132  -0.774  -68.730  1.00 80.84  ? 119 GLU A CB  1 
ATOM   835   C CG  . GLU A  1 119 ? -34.316  0.031   -69.230  1.00 82.29  ? 119 GLU A CG  1 
ATOM   836   C CD  . GLU A  1 119 ? -35.040  0.770   -68.092  1.00 85.01  ? 119 GLU A CD  1 
ATOM   837   O OE1 . GLU A  1 119 ? -36.238  1.157   -68.266  1.00 87.16  ? 119 GLU A OE1 1 
ATOM   838   O OE2 . GLU A  1 119 ? -34.411  0.959   -67.004  1.00 85.37  ? 119 GLU A OE2 1 
ATOM   839   N N   . VAL A  1 120 ? -30.304  -0.741  -70.258  1.00 77.07  ? 120 VAL A N   1 
ATOM   840   C CA  . VAL A  1 120 ? -28.883  -0.598  -70.113  1.00 76.31  ? 120 VAL A CA  1 
ATOM   841   C C   . VAL A  1 120 ? -28.629  0.841   -69.712  1.00 76.76  ? 120 VAL A C   1 
ATOM   842   O O   . VAL A  1 120 ? -29.315  1.759   -70.180  1.00 77.54  ? 120 VAL A O   1 
ATOM   843   C CB  . VAL A  1 120 ? -28.151  -0.953  -71.418  1.00 75.58  ? 120 VAL A CB  1 
ATOM   844   C CG1 . VAL A  1 120 ? -26.669  -0.706  -71.270  1.00 75.35  ? 120 VAL A CG1 1 
ATOM   845   C CG2 . VAL A  1 120 ? -28.358  -2.413  -71.754  1.00 75.44  ? 120 VAL A CG2 1 
ATOM   846   N N   . MET A  1 121 ? -27.667  1.047   -68.821  1.00 76.60  ? 121 MET A N   1 
ATOM   847   C CA  . MET A  1 121 ? -27.317  2.397   -68.431  1.00 77.08  ? 121 MET A CA  1 
ATOM   848   C C   . MET A  1 121 ? -25.816  2.492   -68.348  1.00 76.36  ? 121 MET A C   1 
ATOM   849   O O   . MET A  1 121 ? -25.170  1.635   -67.755  1.00 76.01  ? 121 MET A O   1 
ATOM   850   C CB  . MET A  1 121 ? -27.990  2.776   -67.108  1.00 78.35  ? 121 MET A CB  1 
ATOM   851   C CG  . MET A  1 121 ? -27.768  4.220   -66.677  1.00 79.25  ? 121 MET A CG  1 
ATOM   852   S SD  . MET A  1 121 ? -26.316  4.395   -65.583  1.00 78.63  ? 121 MET A SD  1 
ATOM   853   C CE  . MET A  1 121 ? -27.047  4.038   -63.987  1.00 80.25  ? 121 MET A CE  1 
ATOM   854   N N   . ILE A  1 122 ? -25.265  3.528   -68.961  1.00 76.57  ? 122 ILE A N   1 
ATOM   855   C CA  . ILE A  1 122 ? -23.842  3.778   -68.860  1.00 76.31  ? 122 ILE A CA  1 
ATOM   856   C C   . ILE A  1 122 ? -23.609  5.151   -68.210  1.00 77.00  ? 122 ILE A C   1 
ATOM   857   O O   . ILE A  1 122 ? -24.430  6.068   -68.351  1.00 78.06  ? 122 ILE A O   1 
ATOM   858   C CB  . ILE A  1 122 ? -23.163  3.670   -70.244  1.00 76.51  ? 122 ILE A CB  1 
ATOM   859   C CG1 . ILE A  1 122 ? -23.808  4.654   -71.239  1.00 77.61  ? 122 ILE A CG1 1 
ATOM   860   C CG2 . ILE A  1 122 ? -23.225  2.222   -70.743  1.00 76.03  ? 122 ILE A CG2 1 
ATOM   861   C CD1 . ILE A  1 122 ? -23.082  4.814   -72.551  1.00 78.62  ? 122 ILE A CD1 1 
ATOM   862   N N   . HIS A  1 123 ? -22.514  5.273   -67.471  1.00 76.71  ? 123 HIS A N   1 
ATOM   863   C CA  . HIS A  1 123 ? -22.077  6.549   -66.905  1.00 77.38  ? 123 HIS A CA  1 
ATOM   864   C C   . HIS A  1 123 ? -20.648  6.474   -66.396  1.00 76.96  ? 123 HIS A C   1 
ATOM   865   O O   . HIS A  1 123 ? -20.043  5.403   -66.357  1.00 76.40  ? 123 HIS A O   1 
ATOM   866   C CB  . HIS A  1 123 ? -23.059  7.049   -65.832  1.00 78.13  ? 123 HIS A CB  1 
ATOM   867   C CG  . HIS A  1 123 ? -23.013  6.279   -64.515  1.00 77.81  ? 123 HIS A CG  1 
ATOM   868   N ND1 . HIS A  1 123 ? -23.247  6.850   -63.325  1.00 77.06  ? 123 HIS A ND1 1 
ATOM   869   C CD2 . HIS A  1 123 ? -22.705  4.950   -64.245  1.00 78.75  ? 123 HIS A CD2 1 
ATOM   870   C CE1 . HIS A  1 123 ? -23.125  5.935   -62.341  1.00 77.59  ? 123 HIS A CE1 1 
ATOM   871   N NE2 . HIS A  1 123 ? -22.783  4.780   -62.898  1.00 78.58  ? 123 HIS A NE2 1 
ATOM   872   N N   . GLN A  1 124 ? -20.072  7.602   -66.010  1.00 77.54  ? 124 GLN A N   1 
ATOM   873   C CA  . GLN A  1 124 ? -18.683  7.598   -65.540  1.00 77.32  ? 124 GLN A CA  1 
ATOM   874   C C   . GLN A  1 124 ? -18.543  6.985   -64.149  1.00 76.78  ? 124 GLN A C   1 
ATOM   875   O O   . GLN A  1 124 ? -19.522  6.903   -63.411  1.00 76.93  ? 124 GLN A O   1 
ATOM   876   C CB  . GLN A  1 124 ? -18.054  8.996   -65.612  1.00 78.32  ? 124 GLN A CB  1 
ATOM   877   C CG  . GLN A  1 124 ? -18.832  10.080  -64.914  1.00 79.09  ? 124 GLN A CG  1 
ATOM   878   C CD  . GLN A  1 124 ? -18.110  11.402  -64.935  1.00 80.34  ? 124 GLN A CD  1 
ATOM   879   O OE1 . GLN A  1 124 ? -18.667  12.430  -65.338  1.00 81.99  ? 124 GLN A OE1 1 
ATOM   880   N NE2 . GLN A  1 124 ? -16.859  11.388  -64.505  1.00 79.94  ? 124 GLN A NE2 1 
ATOM   881   N N   . PRO A  1 125 ? -17.324  6.548   -63.796  1.00 76.67  ? 125 PRO A N   1 
ATOM   882   C CA  . PRO A  1 125 ? -17.122  5.901   -62.485  1.00 76.67  ? 125 PRO A CA  1 
ATOM   883   C C   . PRO A  1 125 ? -17.199  6.894   -61.366  1.00 76.97  ? 125 PRO A C   1 
ATOM   884   O O   . PRO A  1 125 ? -16.892  8.056   -61.579  1.00 77.15  ? 125 PRO A O   1 
ATOM   885   C CB  . PRO A  1 125 ? -15.691  5.332   -62.574  1.00 76.99  ? 125 PRO A CB  1 
ATOM   886   C CG  . PRO A  1 125 ? -15.013  6.119   -63.663  1.00 77.28  ? 125 PRO A CG  1 
ATOM   887   C CD  . PRO A  1 125 ? -16.098  6.533   -64.623  1.00 77.11  ? 125 PRO A CD  1 
ATOM   888   N N   . LEU A  1 126 ? -17.583  6.423   -60.184  1.00 77.44  ? 126 LEU A N   1 
ATOM   889   C CA  . LEU A  1 126 ? -17.747  7.263   -58.995  1.00 78.17  ? 126 LEU A CA  1 
ATOM   890   C C   . LEU A  1 126 ? -16.654  6.905   -58.016  1.00 78.48  ? 126 LEU A C   1 
ATOM   891   O O   . LEU A  1 126 ? -16.186  5.784   -58.025  1.00 78.63  ? 126 LEU A O   1 
ATOM   892   C CB  . LEU A  1 126 ? -19.096  6.992   -58.370  1.00 79.27  ? 126 LEU A CB  1 
ATOM   893   C CG  . LEU A  1 126 ? -20.281  7.166   -59.313  1.00 79.28  ? 126 LEU A CG  1 
ATOM   894   C CD1 . LEU A  1 126 ? -21.385  6.196   -58.931  1.00 80.28  ? 126 LEU A CD1 1 
ATOM   895   C CD2 . LEU A  1 126 ? -20.780  8.601   -59.264  1.00 80.23  ? 126 LEU A CD2 1 
ATOM   896   N N   . GLY A  1 127 ? -16.229  7.846   -57.182  1.00 78.87  ? 127 GLY A N   1 
ATOM   897   C CA  . GLY A  1 127 ? -15.219  7.547   -56.161  1.00 79.39  ? 127 GLY A CA  1 
ATOM   898   C C   . GLY A  1 127 ? -15.191  8.623   -55.094  1.00 80.11  ? 127 GLY A C   1 
ATOM   899   O O   . GLY A  1 127 ? -16.143  9.387   -54.943  1.00 80.72  ? 127 GLY A O   1 
ATOM   900   N N   . GLY A  1 128 ? -14.108  8.697   -54.346  1.00 80.37  ? 128 GLY A N   1 
ATOM   901   C CA  . GLY A  1 128 ? -14.027  9.632   -53.243  1.00 81.23  ? 128 GLY A CA  1 
ATOM   902   C C   . GLY A  1 128 ? -12.572  9.796   -52.856  1.00 81.01  ? 128 GLY A C   1 
ATOM   903   O O   . GLY A  1 128 ? -11.744  8.962   -53.191  1.00 80.80  ? 128 GLY A O   1 
ATOM   904   N N   . ALA A  1 129 ? -12.253  10.887  -52.172  1.00 81.35  ? 129 ALA A N   1 
ATOM   905   C CA  . ALA A  1 129 ? -10.905  11.156  -51.695  1.00 81.30  ? 129 ALA A CA  1 
ATOM   906   C C   . ALA A  1 129 ? -11.030  12.063  -50.498  1.00 82.34  ? 129 ALA A C   1 
ATOM   907   O O   . ALA A  1 129 ? -11.766  13.047  -50.510  1.00 82.70  ? 129 ALA A O   1 
ATOM   908   C CB  . ALA A  1 129 ? -10.079  11.830  -52.763  1.00 80.24  ? 129 ALA A CB  1 
ATOM   909   N N   . GLN A  1 130 ? -10.315  11.711  -49.447  1.00 83.26  ? 130 GLN A N   1 
ATOM   910   C CA  . GLN A  1 130 ? -10.328  12.463  -48.203  1.00 84.56  ? 130 GLN A CA  1 
ATOM   911   C C   . GLN A  1 130 ? -8.875   12.750  -47.813  1.00 84.28  ? 130 GLN A C   1 
ATOM   912   O O   . GLN A  1 130 ? -7.995   11.964  -48.098  1.00 84.00  ? 130 GLN A O   1 
ATOM   913   C CB  . GLN A  1 130 ? -11.026  11.621  -47.136  1.00 86.77  ? 130 GLN A CB  1 
ATOM   914   C CG  . GLN A  1 130 ? -11.557  12.430  -45.968  1.00 88.79  ? 130 GLN A CG  1 
ATOM   915   C CD  . GLN A  1 130 ? -12.655  13.422  -46.379  1.00 89.01  ? 130 GLN A CD  1 
ATOM   916   O OE1 . GLN A  1 130 ? -13.419  13.196  -47.337  1.00 88.27  ? 130 GLN A OE1 1 
ATOM   917   N NE2 . GLN A  1 130 ? -12.734  14.536  -45.648  1.00 90.35  ? 130 GLN A NE2 1 
ATOM   918   N N   . GLY A  1 131 ? -8.598   13.889  -47.210  1.00 84.59  ? 131 GLY A N   1 
ATOM   919   C CA  . GLY A  1 131 ? -7.264   14.125  -46.664  1.00 84.62  ? 131 GLY A CA  1 
ATOM   920   C C   . GLY A  1 131 ? -6.531   15.310  -47.245  1.00 83.57  ? 131 GLY A C   1 
ATOM   921   O O   . GLY A  1 131 ? -7.132   16.303  -47.631  1.00 83.45  ? 131 GLY A O   1 
ATOM   922   N N   . GLN A  1 132 ? -5.211   15.197  -47.282  1.00 83.31  ? 132 GLN A N   1 
ATOM   923   C CA  . GLN A  1 132 ? -4.337   16.248  -47.778  1.00 82.79  ? 132 GLN A CA  1 
ATOM   924   C C   . GLN A  1 132 ? -4.473   16.500  -49.284  1.00 82.04  ? 132 GLN A C   1 
ATOM   925   O O   . GLN A  1 132 ? -4.838   15.603  -50.037  1.00 81.65  ? 132 GLN A O   1 
ATOM   926   C CB  . GLN A  1 132 ? -2.898   15.873  -47.467  1.00 83.18  ? 132 GLN A CB  1 
ATOM   927   C CG  . GLN A  1 132 ? -2.563   15.806  -46.000  1.00 84.22  ? 132 GLN A CG  1 
ATOM   928   C CD  . GLN A  1 132 ? -1.082   15.590  -45.766  1.00 84.83  ? 132 GLN A CD  1 
ATOM   929   O OE1 . GLN A  1 132 ? -0.535   14.546  -46.109  1.00 85.43  ? 132 GLN A OE1 1 
ATOM   930   N NE2 . GLN A  1 132 ? -0.430   16.566  -45.174  1.00 85.00  ? 132 GLN A NE2 1 
ATOM   931   N N   . ALA A  1 133 ? -4.154   17.721  -49.711  1.00 82.19  ? 133 ALA A N   1 
ATOM   932   C CA  . ALA A  1 133 ? -4.153   18.104  -51.127  1.00 82.19  ? 133 ALA A CA  1 
ATOM   933   C C   . ALA A  1 133 ? -3.392   17.099  -52.005  1.00 82.10  ? 133 ALA A C   1 
ATOM   934   O O   . ALA A  1 133 ? -3.854   16.700  -53.068  1.00 81.96  ? 133 ALA A O   1 
ATOM   935   C CB  . ALA A  1 133 ? -3.584   19.510  -51.291  1.00 83.10  ? 133 ALA A CB  1 
ATOM   936   N N   . THR A  1 134 ? -2.231   16.672  -51.536  1.00 82.52  ? 134 THR A N   1 
ATOM   937   C CA  . THR A  1 134 ? -1.434   15.690  -52.227  1.00 83.16  ? 134 THR A CA  1 
ATOM   938   C C   . THR A  1 134 ? -2.172   14.358  -52.419  1.00 82.75  ? 134 THR A C   1 
ATOM   939   O O   . THR A  1 134 ? -2.139   13.749  -53.506  1.00 83.11  ? 134 THR A O   1 
ATOM   940   C CB  . THR A  1 134 ? -0.161   15.461  -51.420  1.00 84.11  ? 134 THR A CB  1 
ATOM   941   O OG1 . THR A  1 134 ? 0.604    16.657  -51.480  1.00 84.69  ? 134 THR A OG1 1 
ATOM   942   C CG2 . THR A  1 134 ? 0.678    14.296  -51.978  1.00 85.49  ? 134 THR A CG2 1 
ATOM   943   N N   . GLU A  1 135 ? -2.835   13.918  -51.354  1.00 82.37  ? 135 GLU A N   1 
ATOM   944   C CA  . GLU A  1 135 ? -3.594   12.677  -51.363  1.00 82.34  ? 135 GLU A CA  1 
ATOM   945   C C   . GLU A  1 135 ? -4.774   12.750  -52.301  1.00 81.41  ? 135 GLU A C   1 
ATOM   946   O O   . GLU A  1 135 ? -5.017   11.806  -53.042  1.00 81.45  ? 135 GLU A O   1 
ATOM   947   C CB  . GLU A  1 135 ? -4.060   12.323  -49.954  1.00 82.80  ? 135 GLU A CB  1 
ATOM   948   C CG  . GLU A  1 135 ? -2.943   11.759  -49.091  1.00 84.26  ? 135 GLU A CG  1 
ATOM   949   C CD  . GLU A  1 135 ? -3.288   11.687  -47.601  1.00 85.21  ? 135 GLU A CD  1 
ATOM   950   O OE1 . GLU A  1 135 ? -4.112   12.514  -47.105  1.00 84.73  ? 135 GLU A OE1 1 
ATOM   951   O OE2 . GLU A  1 135 ? -2.705   10.803  -46.905  1.00 86.97  ? 135 GLU A OE2 1 
ATOM   952   N N   . ILE A  1 136 ? -5.503   13.865  -52.267  1.00 80.88  ? 136 ILE A N   1 
ATOM   953   C CA  . ILE A  1 136 ? -6.643   14.068  -53.155  1.00 80.38  ? 136 ILE A CA  1 
ATOM   954   C C   . ILE A  1 136 ? -6.204   14.032  -54.634  1.00 80.49  ? 136 ILE A C   1 
ATOM   955   O O   . ILE A  1 136 ? -6.886   13.424  -55.492  1.00 80.19  ? 136 ILE A O   1 
ATOM   956   C CB  . ILE A  1 136 ? -7.371   15.365  -52.822  1.00 80.59  ? 136 ILE A CB  1 
ATOM   957   C CG1 . ILE A  1 136 ? -8.059   15.202  -51.489  1.00 80.99  ? 136 ILE A CG1 1 
ATOM   958   C CG2 . ILE A  1 136 ? -8.400   15.717  -53.884  1.00 80.60  ? 136 ILE A CG2 1 
ATOM   959   C CD1 . ILE A  1 136 ? -8.427   16.501  -50.809  1.00 81.85  ? 136 ILE A CD1 1 
ATOM   960   N N   . GLU A  1 137 ? -5.055   14.663  -54.919  1.00 81.24  ? 137 GLU A N   1 
ATOM   961   C CA  . GLU A  1 137 ? -4.503   14.686  -56.252  1.00 82.15  ? 137 GLU A CA  1 
ATOM   962   C C   . GLU A  1 137 ? -4.214   13.288  -56.735  1.00 82.44  ? 137 GLU A C   1 
ATOM   963   O O   . GLU A  1 137 ? -4.529   12.970  -57.875  1.00 82.78  ? 137 GLU A O   1 
ATOM   964   C CB  . GLU A  1 137 ? -3.239   15.495  -56.271  1.00 83.44  ? 137 GLU A CB  1 
ATOM   965   C CG  . GLU A  1 137 ? -2.635   15.669  -57.651  1.00 85.20  ? 137 GLU A CG  1 
ATOM   966   C CD  . GLU A  1 137 ? -1.303   16.398  -57.615  1.00 86.98  ? 137 GLU A CD  1 
ATOM   967   O OE1 . GLU A  1 137 ? -0.567   16.248  -56.614  1.00 86.80  ? 137 GLU A OE1 1 
ATOM   968   O OE2 . GLU A  1 137 ? -0.989   17.119  -58.595  1.00 88.89  ? 137 GLU A OE2 1 
ATOM   969   N N   . ILE A  1 138 ? -3.625   12.452  -55.881  1.00 82.69  ? 138 ILE A N   1 
ATOM   970   C CA  . ILE A  1 138 ? -3.324   11.051  -56.247  1.00 83.58  ? 138 ILE A CA  1 
ATOM   971   C C   . ILE A  1 138 ? -4.590   10.253  -56.576  1.00 82.62  ? 138 ILE A C   1 
ATOM   972   O O   . ILE A  1 138 ? -4.631   9.506   -57.550  1.00 83.24  ? 138 ILE A O   1 
ATOM   973   C CB  . ILE A  1 138 ? -2.494   10.340  -55.166  1.00 84.62  ? 138 ILE A CB  1 
ATOM   974   C CG1 . ILE A  1 138 ? -1.061   10.872  -55.195  1.00 86.18  ? 138 ILE A CG1 1 
ATOM   975   C CG2 . ILE A  1 138 ? -2.516   8.839   -55.369  1.00 85.79  ? 138 ILE A CG2 1 
ATOM   976   C CD1 . ILE A  1 138 ? -0.342   10.858  -53.856  1.00 86.76  ? 138 ILE A CD1 1 
ATOM   977   N N   . ALA A  1 139 ? -5.622   10.457  -55.769  1.00 81.40  ? 139 ALA A N   1 
ATOM   978   C CA  . ALA A  1 139 ? -6.896   9.842   -55.988  1.00 80.65  ? 139 ALA A CA  1 
ATOM   979   C C   . ALA A  1 139 ? -7.541   10.345  -57.266  1.00 80.12  ? 139 ALA A C   1 
ATOM   980   O O   . ALA A  1 139 ? -8.089   9.566   -58.024  1.00 80.00  ? 139 ALA A O   1 
ATOM   981   C CB  . ALA A  1 139 ? -7.803   10.102  -54.804  1.00 80.17  ? 139 ALA A CB  1 
ATOM   982   N N   . ALA A  1 140 ? -7.480   11.642  -57.510  1.00 80.10  ? 140 ALA A N   1 
ATOM   983   C CA  . ALA A  1 140 ? -8.105   12.214  -58.702  1.00 80.19  ? 140 ALA A CA  1 
ATOM   984   C C   . ALA A  1 140 ? -7.485   11.653  -59.957  1.00 81.19  ? 140 ALA A C   1 
ATOM   985   O O   . ALA A  1 140 ? -8.189   11.236  -60.869  1.00 81.09  ? 140 ALA A O   1 
ATOM   986   C CB  . ALA A  1 140 ? -7.999   13.725  -58.688  1.00 80.78  ? 140 ALA A CB  1 
ATOM   987   N N   . ASN A  1 141 ? -6.157   11.624  -59.980  1.00 82.45  ? 141 ASN A N   1 
ATOM   988   C CA  . ASN A  1 141 ? -5.394   11.059  -61.097  1.00 84.22  ? 141 ASN A CA  1 
ATOM   989   C C   . ASN A  1 141 ? -5.732   9.610   -61.363  1.00 84.12  ? 141 ASN A C   1 
ATOM   990   O O   . ASN A  1 141 ? -5.888   9.220   -62.510  1.00 85.01  ? 141 ASN A O   1 
ATOM   991   C CB  . ASN A  1 141 ? -3.897   11.172  -60.832  1.00 86.00  ? 141 ASN A CB  1 
ATOM   992   C CG  . ASN A  1 141 ? -3.402   12.602  -60.929  1.00 86.87  ? 141 ASN A CG  1 
ATOM   993   O OD1 . ASN A  1 141 ? -4.078   13.437  -61.525  1.00 86.85  ? 141 ASN A OD1 1 
ATOM   994   N ND2 . ASN A  1 141 ? -2.221   12.897  -60.353  1.00 87.98  ? 141 ASN A ND2 1 
ATOM   995   N N   . HIS A  1 142 ? -5.846   8.827   -60.291  1.00 83.39  ? 142 HIS A N   1 
ATOM   996   C CA  . HIS A  1 142 ? -6.209   7.425   -60.389  1.00 83.61  ? 142 HIS A CA  1 
ATOM   997   C C   . HIS A  1 142 ? -7.584   7.195   -60.974  1.00 82.28  ? 142 HIS A C   1 
ATOM   998   O O   . HIS A  1 142 ? -7.764   6.303   -61.820  1.00 82.94  ? 142 HIS A O   1 
ATOM   999   C CB  . HIS A  1 142 ? -6.101   6.749   -59.038  1.00 83.65  ? 142 HIS A CB  1 
ATOM   1000  C CG  . HIS A  1 142 ? -6.426   5.293   -59.092  1.00 84.50  ? 142 HIS A CG  1 
ATOM   1001  N ND1 . HIS A  1 142 ? -7.426   4.743   -58.378  1.00 83.75  ? 142 HIS A ND1 1 
ATOM   1002  C CD2 . HIS A  1 142 ? -5.876   4.266   -59.863  1.00 86.55  ? 142 HIS A CD2 1 
ATOM   1003  C CE1 . HIS A  1 142 ? -7.503   3.427   -58.651  1.00 85.14  ? 142 HIS A CE1 1 
ATOM   1004  N NE2 . HIS A  1 142 ? -6.548   3.132   -59.563  1.00 86.84  ? 142 HIS A NE2 1 
ATOM   1005  N N   . ILE A  1 143 ? -8.575   7.979   -60.546  1.00 83.35  ? 143 ILE A N   1 
ATOM   1006  C CA  . ILE A  1 143 ? -9.925   7.766   -61.063  1.00 81.56  ? 143 ILE A CA  1 
ATOM   1007  C C   . ILE A  1 143 ? -10.048  8.243   -62.507  1.00 81.99  ? 143 ILE A C   1 
ATOM   1008  O O   . ILE A  1 143 ? -10.733  7.619   -63.306  1.00 81.05  ? 143 ILE A O   1 
ATOM   1009  C CB  . ILE A  1 143 ? -11.042  8.325   -60.143  1.00 80.45  ? 143 ILE A CB  1 
ATOM   1010  C CG1 . ILE A  1 143 ? -12.389  7.720   -60.527  1.00 78.74  ? 143 ILE A CG1 1 
ATOM   1011  C CG2 . ILE A  1 143 ? -11.142  9.843   -60.210  1.00 81.33  ? 143 ILE A CG2 1 
ATOM   1012  C CD1 . ILE A  1 143 ? -13.529  8.078   -59.592  1.00 77.86  ? 143 ILE A CD1 1 
ATOM   1013  N N   . LEU A  1 144 ? -9.353   9.332   -62.844  1.00 83.67  ? 144 LEU A N   1 
ATOM   1014  C CA  . LEU A  1 144 ? -9.334   9.811   -64.233  1.00 84.57  ? 144 LEU A CA  1 
ATOM   1015  C C   . LEU A  1 144 ? -8.688   8.803   -65.149  1.00 85.23  ? 144 LEU A C   1 
ATOM   1016  O O   . LEU A  1 144 ? -9.164   8.594   -66.245  1.00 85.05  ? 144 LEU A O   1 
ATOM   1017  C CB  . LEU A  1 144 ? -8.633   11.151  -64.354  1.00 86.67  ? 144 LEU A CB  1 
ATOM   1018  C CG  . LEU A  1 144 ? -9.402   12.344  -63.781  1.00 86.44  ? 144 LEU A CG  1 
ATOM   1019  C CD1 . LEU A  1 144 ? -8.467   13.542  -63.633  1.00 88.89  ? 144 LEU A CD1 1 
ATOM   1020  C CD2 . LEU A  1 144 ? -10.631  12.693  -64.607  1.00 85.58  ? 144 LEU A CD2 1 
ATOM   1021  N N   . LYS A  1 145 ? -7.620   8.162   -64.676  1.00 86.16  ? 145 LYS A N   1 
ATOM   1022  C CA  . LYS A  1 145 ? -6.943   7.093   -65.425  1.00 87.06  ? 145 LYS A CA  1 
ATOM   1023  C C   . LYS A  1 145 ? -7.862   5.892   -65.589  1.00 85.20  ? 145 LYS A C   1 
ATOM   1024  O O   . LYS A  1 145 ? -7.984   5.329   -66.677  1.00 85.50  ? 145 LYS A O   1 
ATOM   1025  C CB  . LYS A  1 145 ? -5.637   6.680   -64.757  1.00 88.66  ? 145 LYS A CB  1 
ATOM   1026  C CG  . LYS A  1 145 ? -4.644   6.207   -65.775  1.00 90.83  ? 145 LYS A CG  1 
ATOM   1027  C CD  . LYS A  1 145 ? -3.257   5.970   -65.195  1.00 93.00  ? 145 LYS A CD  1 
ATOM   1028  C CE  . LYS A  1 145 ? -2.355   5.375   -66.281  1.00 95.34  ? 145 LYS A CE  1 
ATOM   1029  N NZ  . LYS A  1 145 ? -1.010   4.937   -65.809  1.00 97.74  ? 145 LYS A NZ  1 
ATOM   1030  N N   . THR A  1 146 ? -8.533   5.520   -64.508  1.00 83.52  ? 146 THR A N   1 
ATOM   1031  C CA  . THR A  1 146 ? -9.495   4.447   -64.571  1.00 81.91  ? 146 THR A CA  1 
ATOM   1032  C C   . THR A  1 146 ? -10.562  4.756   -65.630  1.00 81.13  ? 146 THR A C   1 
ATOM   1033  O O   . THR A  1 146 ? -10.935  3.881   -66.400  1.00 80.90  ? 146 THR A O   1 
ATOM   1034  C CB  . THR A  1 146 ? -10.089  4.126   -63.177  1.00 80.53  ? 146 THR A CB  1 
ATOM   1035  O OG1 . THR A  1 146 ? -9.043   3.687   -62.301  1.00 81.56  ? 146 THR A OG1 1 
ATOM   1036  C CG2 . THR A  1 146 ? -11.125  3.022   -63.256  1.00 79.15  ? 146 THR A CG2 1 
ATOM   1037  N N   . ARG A  1 147 ? -11.028  5.996   -65.702  1.00 81.00  ? 147 ARG A N   1 
ATOM   1038  C CA  . ARG A  1 147 ? -12.041  6.343   -66.718  1.00 80.54  ? 147 ARG A CA  1 
ATOM   1039  C C   . ARG A  1 147 ? -11.497  6.144   -68.169  1.00 82.06  ? 147 ARG A C   1 
ATOM   1040  O O   . ARG A  1 147 ? -12.195  5.651   -69.066  1.00 81.74  ? 147 ARG A O   1 
ATOM   1041  C CB  . ARG A  1 147 ? -12.586  7.779   -66.506  1.00 80.52  ? 147 ARG A CB  1 
ATOM   1042  C CG  . ARG A  1 147 ? -13.889  7.998   -67.258  1.00 79.79  ? 147 ARG A CG  1 
ATOM   1043  C CD  . ARG A  1 147 ? -14.351  9.432   -67.278  1.00 80.30  ? 147 ARG A CD  1 
ATOM   1044  N NE  . ARG A  1 147 ? -15.612  9.510   -68.010  1.00 79.77  ? 147 ARG A NE  1 
ATOM   1045  C CZ  . ARG A  1 147 ? -16.218  10.649  -68.340  1.00 80.41  ? 147 ARG A CZ  1 
ATOM   1046  N NH1 . ARG A  1 147 ? -15.665  11.819  -68.005  1.00 81.64  ? 147 ARG A NH1 1 
ATOM   1047  N NH2 . ARG A  1 147 ? -17.380  10.627  -69.002  1.00 80.07  ? 147 ARG A NH2 1 
ATOM   1048  N N   . GLU A  1 148 ? -10.240  6.530   -68.380  1.00 83.97  ? 148 GLU A N   1 
ATOM   1049  C CA  . GLU A  1 148 ? -9.638   6.379   -69.678  1.00 85.82  ? 148 GLU A CA  1 
ATOM   1050  C C   . GLU A  1 148 ? -9.596   4.927   -70.032  1.00 85.66  ? 148 GLU A C   1 
ATOM   1051  O O   . GLU A  1 148 ? -10.004  4.555   -71.120  1.00 86.03  ? 148 GLU A O   1 
ATOM   1052  C CB  . GLU A  1 148 ? -8.239   6.957   -69.702  1.00 88.17  ? 148 GLU A CB  1 
ATOM   1053  C CG  . GLU A  1 148 ? -8.203   8.452   -69.959  1.00 89.31  ? 148 GLU A CG  1 
ATOM   1054  C CD  . GLU A  1 148 ? -6.802   9.023   -69.776  1.00 91.78  ? 148 GLU A CD  1 
ATOM   1055  O OE1 . GLU A  1 148 ? -6.668   10.265  -69.689  1.00 92.84  ? 148 GLU A OE1 1 
ATOM   1056  O OE2 . GLU A  1 148 ? -5.827   8.225   -69.721  1.00 92.90  ? 148 GLU A OE2 1 
ATOM   1057  N N   . LYS A  1 149 ? -9.116   4.119   -69.095  1.00 85.31  ? 149 LYS A N   1 
ATOM   1058  C CA  . LYS A  1 149 ? -9.071   2.692   -69.274  1.00 85.30  ? 149 LYS A CA  1 
ATOM   1059  C C   . LYS A  1 149 ? -10.450  2.152   -69.644  1.00 83.67  ? 149 LYS A C   1 
ATOM   1060  O O   . LYS A  1 149 ? -10.562  1.380   -70.568  1.00 84.35  ? 149 LYS A O   1 
ATOM   1061  C CB  . LYS A  1 149 ? -8.529   2.020   -68.025  1.00 85.05  ? 149 LYS A CB  1 
ATOM   1062  C CG  . LYS A  1 149 ? -8.494   0.511   -68.117  1.00 85.25  ? 149 LYS A CG  1 
ATOM   1063  C CD  . LYS A  1 149 ? -7.445   -0.094  -67.192  1.00 86.28  ? 149 LYS A CD  1 
ATOM   1064  C CE  . LYS A  1 149 ? -8.030   -0.738  -65.940  1.00 84.72  ? 149 LYS A CE  1 
ATOM   1065  N NZ  . LYS A  1 149 ? -6.942   -1.200  -65.033  1.00 86.03  ? 149 LYS A NZ  1 
ATOM   1066  N N   . LEU A  1 150 ? -11.497  2.561   -68.946  1.00 81.79  ? 150 LEU A N   1 
ATOM   1067  C CA  . LEU A  1 150 ? -12.824  2.020   -69.213  1.00 80.44  ? 150 LEU A CA  1 
ATOM   1068  C C   . LEU A  1 150 ? -13.314  2.452   -70.576  1.00 81.09  ? 150 LEU A C   1 
ATOM   1069  O O   . LEU A  1 150 ? -13.857  1.640   -71.323  1.00 81.19  ? 150 LEU A O   1 
ATOM   1070  C CB  . LEU A  1 150 ? -13.833  2.457   -68.149  1.00 78.65  ? 150 LEU A CB  1 
ATOM   1071  C CG  . LEU A  1 150 ? -13.733  1.774   -66.787  1.00 77.88  ? 150 LEU A CG  1 
ATOM   1072  C CD1 . LEU A  1 150 ? -14.438  2.567   -65.714  1.00 76.71  ? 150 LEU A CD1 1 
ATOM   1073  C CD2 . LEU A  1 150 ? -14.293  0.370   -66.864  1.00 77.50  ? 150 LEU A CD2 1 
ATOM   1074  N N   . ASN A  1 151 ? -13.130  3.735   -70.895  1.00 81.75  ? 151 ASN A N   1 
ATOM   1075  C CA  . ASN A  1 151 ? -13.585  4.292   -72.173  1.00 82.65  ? 151 ASN A CA  1 
ATOM   1076  C C   . ASN A  1 151 ? -12.887  3.639   -73.359  1.00 84.57  ? 151 ASN A C   1 
ATOM   1077  O O   . ASN A  1 151 ? -13.522  3.346   -74.369  1.00 85.01  ? 151 ASN A O   1 
ATOM   1078  C CB  . ASN A  1 151 ? -13.379  5.797   -72.198  1.00 83.38  ? 151 ASN A CB  1 
ATOM   1079  C CG  . ASN A  1 151 ? -14.375  6.529   -71.359  1.00 81.83  ? 151 ASN A CG  1 
ATOM   1080  O OD1 . ASN A  1 151 ? -15.191  5.921   -70.669  1.00 80.18  ? 151 ASN A OD1 1 
ATOM   1081  N ND2 . ASN A  1 151 ? -14.323  7.840   -71.397  1.00 82.60  ? 151 ASN A ND2 1 
ATOM   1082  N N   . ARG A  1 152 ? -11.581  3.410   -73.210  1.00 85.94  ? 152 ARG A N   1 
ATOM   1083  C CA  . ARG A  1 152 ? -10.767  2.772   -74.223  1.00 88.14  ? 152 ARG A CA  1 
ATOM   1084  C C   . ARG A  1 152 ? -11.331  1.397   -74.551  1.00 87.72  ? 152 ARG A C   1 
ATOM   1085  O O   . ARG A  1 152 ? -11.623  1.103   -75.713  1.00 88.87  ? 152 ARG A O   1 
ATOM   1086  C CB  . ARG A  1 152 ? -9.318   2.659   -73.751  1.00 89.63  ? 152 ARG A CB  1 
ATOM   1087  C CG  . ARG A  1 152 ? -8.358   2.183   -74.827  1.00 92.48  ? 152 ARG A CG  1 
ATOM   1088  C CD  . ARG A  1 152 ? -6.948   2.031   -74.268  1.00 94.10  ? 152 ARG A CD  1 
ATOM   1089  N NE  . ARG A  1 152 ? -6.768   0.823   -73.438  1.00 93.36  ? 152 ARG A NE  1 
ATOM   1090  C CZ  . ARG A  1 152 ? -6.421   0.827   -72.143  1.00 92.42  ? 152 ARG A CZ  1 
ATOM   1091  N NH1 . ARG A  1 152 ? -6.287   -0.340  -71.489  1.00 92.08  ? 152 ARG A NH1 1 
ATOM   1092  N NH2 . ARG A  1 152 ? -6.208   1.991   -71.495  1.00 92.05  ? 152 ARG A NH2 1 
ATOM   1093  N N   . ILE A  1 153 ? -11.499  0.560   -73.531  1.00 86.30  ? 153 ILE A N   1 
ATOM   1094  C CA  . ILE A  1 153 ? -11.976  -0.805  -73.731  1.00 86.14  ? 153 ILE A CA  1 
ATOM   1095  C C   . ILE A  1 153 ? -13.394  -0.815  -74.273  1.00 85.12  ? 153 ILE A C   1 
ATOM   1096  O O   . ILE A  1 153 ? -13.726  -1.620  -75.145  1.00 86.03  ? 153 ILE A O   1 
ATOM   1097  C CB  . ILE A  1 153 ? -11.853  -1.650  -72.466  1.00 85.09  ? 153 ILE A CB  1 
ATOM   1098  C CG1 . ILE A  1 153 ? -10.383  -1.793  -72.122  1.00 86.68  ? 153 ILE A CG1 1 
ATOM   1099  C CG2 . ILE A  1 153 ? -12.472  -3.003  -72.676  1.00 85.06  ? 153 ILE A CG2 1 
ATOM   1100  C CD1 . ILE A  1 153 ? -10.111  -2.453  -70.796  1.00 85.95  ? 153 ILE A CD1 1 
ATOM   1101  N N   . LEU A  1 154 ? -14.218  0.100   -73.791  1.00 83.51  ? 154 LEU A N   1 
ATOM   1102  C CA  . LEU A  1 154 ? -15.579  0.231   -74.289  1.00 82.77  ? 154 LEU A CA  1 
ATOM   1103  C C   . LEU A  1 154 ? -15.639  0.657   -75.766  1.00 84.50  ? 154 LEU A C   1 
ATOM   1104  O O   . LEU A  1 154 ? -16.483  0.145   -76.535  1.00 84.82  ? 154 LEU A O   1 
ATOM   1105  C CB  . LEU A  1 154 ? -16.349  1.217   -73.446  1.00 81.09  ? 154 LEU A CB  1 
ATOM   1106  C CG  . LEU A  1 154 ? -17.842  0.953   -73.417  1.00 79.97  ? 154 LEU A CG  1 
ATOM   1107  C CD1 . LEU A  1 154 ? -18.152  -0.445  -72.902  1.00 79.41  ? 154 LEU A CD1 1 
ATOM   1108  C CD2 . LEU A  1 154 ? -18.472  2.003   -72.522  1.00 78.66  ? 154 LEU A CD2 1 
ATOM   1109  N N   . SER A  1 155 ? -14.751  1.583   -76.150  1.00 85.84  ? 155 SER A N   1 
ATOM   1110  C CA  . SER A  1 155 ? -14.555  1.977   -77.551  1.00 88.03  ? 155 SER A CA  1 
ATOM   1111  C C   . SER A  1 155 ? -14.286  0.759   -78.447  1.00 89.67  ? 155 SER A C   1 
ATOM   1112  O O   . SER A  1 155 ? -14.906  0.604   -79.499  1.00 90.69  ? 155 SER A O   1 
ATOM   1113  C CB  . SER A  1 155 ? -13.385  2.962   -77.656  1.00 89.59  ? 155 SER A CB  1 
ATOM   1114  O OG  . SER A  1 155 ? -13.287  3.545   -78.939  1.00 91.82  ? 155 SER A OG  1 
ATOM   1115  N N   . GLU A  1 156 ? -13.374  -0.111  -78.009  1.00 90.11  ? 156 GLU A N   1 
ATOM   1116  C CA  . GLU A  1 156 ? -13.003  -1.312  -78.769  1.00 91.97  ? 156 GLU A CA  1 
ATOM   1117  C C   . GLU A  1 156 ? -14.135  -2.285  -78.979  1.00 91.26  ? 156 GLU A C   1 
ATOM   1118  O O   . GLU A  1 156 ? -14.131  -2.997  -79.964  1.00 93.13  ? 156 GLU A O   1 
ATOM   1119  C CB  . GLU A  1 156 ? -11.872  -2.076  -78.085  1.00 92.55  ? 156 GLU A CB  1 
ATOM   1120  C CG  . GLU A  1 156 ? -10.529  -1.349  -78.117  1.00 94.27  ? 156 GLU A CG  1 
ATOM   1121  C CD  . GLU A  1 156 ? -9.565   -1.822  -77.022  1.00 94.16  ? 156 GLU A CD  1 
ATOM   1122  O OE1 . GLU A  1 156 ? -9.934   -2.771  -76.228  1.00 92.77  ? 156 GLU A OE1 1 
ATOM   1123  O OE2 . GLU A  1 156 ? -8.441   -1.223  -76.960  1.00 95.69  ? 156 GLU A OE2 1 
ATOM   1124  N N   . ARG A  1 157 ? -15.083  -2.343  -78.045  1.00 88.83  ? 157 ARG A N   1 
ATOM   1125  C CA  . ARG A  1 157 ? -16.104  -3.394  -78.052  1.00 88.27  ? 157 ARG A CA  1 
ATOM   1126  C C   . ARG A  1 157 ? -17.432  -2.937  -78.628  1.00 87.82  ? 157 ARG A C   1 
ATOM   1127  O O   . ARG A  1 157 ? -18.249  -3.769  -79.036  1.00 88.18  ? 157 ARG A O   1 
ATOM   1128  C CB  . ARG A  1 157 ? -16.297  -3.932  -76.644  1.00 86.37  ? 157 ARG A CB  1 
ATOM   1129  C CG  . ARG A  1 157 ? -14.993  -4.385  -76.043  1.00 87.01  ? 157 ARG A CG  1 
ATOM   1130  C CD  . ARG A  1 157 ? -15.215  -5.392  -74.952  1.00 86.02  ? 157 ARG A CD  1 
ATOM   1131  N NE  . ARG A  1 157 ? -14.268  -6.474  -75.103  1.00 87.89  ? 157 ARG A NE  1 
ATOM   1132  C CZ  . ARG A  1 157 ? -14.495  -7.546  -75.839  1.00 89.42  ? 157 ARG A CZ  1 
ATOM   1133  N NH1 . ARG A  1 157 ? -15.654  -7.696  -76.497  1.00 89.28  ? 157 ARG A NH1 1 
ATOM   1134  N NH2 . ARG A  1 157 ? -13.553  -8.467  -75.896  1.00 91.32  ? 157 ARG A NH2 1 
ATOM   1135  N N   . THR A  1 158 ? -17.643  -1.624  -78.655  1.00 87.26  ? 158 THR A N   1 
ATOM   1136  C CA  . THR A  1 158 ? -18.828  -1.051  -79.255  1.00 87.19  ? 158 THR A CA  1 
ATOM   1137  C C   . THR A  1 158 ? -18.562  -0.545  -80.657  1.00 89.52  ? 158 THR A C   1 
ATOM   1138  O O   . THR A  1 158 ? -19.480  -0.508  -81.482  1.00 90.30  ? 158 THR A O   1 
ATOM   1139  C CB  . THR A  1 158 ? -19.343  0.136   -78.439  1.00 85.45  ? 158 THR A CB  1 
ATOM   1140  O OG1 . THR A  1 158 ? -18.306  1.127   -78.319  1.00 85.88  ? 158 THR A OG1 1 
ATOM   1141  C CG2 . THR A  1 158 ? -19.803  -0.338  -77.066  1.00 83.33  ? 158 THR A CG2 1 
ATOM   1142  N N   . GLY A  1 159 ? -17.320  -0.131  -80.923  1.00 90.87  ? 159 GLY A N   1 
ATOM   1143  C CA  . GLY A  1 159 ? -16.979  0.504   -82.191  1.00 93.35  ? 159 GLY A CA  1 
ATOM   1144  C C   . GLY A  1 159 ? -17.176  2.008   -82.200  1.00 93.21  ? 159 GLY A C   1 
ATOM   1145  O O   . GLY A  1 159 ? -16.987  2.651   -83.224  1.00 95.38  ? 159 GLY A O   1 
ATOM   1146  N N   . GLN A  1 160 ? -17.553  2.580   -81.059  1.00 90.92  ? 160 GLN A N   1 
ATOM   1147  C CA  . GLN A  1 160 ? -17.741  4.032   -80.929  1.00 90.83  ? 160 GLN A CA  1 
ATOM   1148  C C   . GLN A  1 160 ? -16.408  4.660   -80.572  1.00 91.54  ? 160 GLN A C   1 
ATOM   1149  O O   . GLN A  1 160 ? -15.562  4.019   -79.954  1.00 91.11  ? 160 GLN A O   1 
ATOM   1150  C CB  . GLN A  1 160 ? -18.775  4.335   -79.837  1.00 88.34  ? 160 GLN A CB  1 
ATOM   1151  C CG  . GLN A  1 160 ? -20.112  3.628   -79.992  1.00 87.59  ? 160 GLN A CG  1 
ATOM   1152  C CD  . GLN A  1 160 ? -21.013  4.288   -81.023  1.00 89.00  ? 160 GLN A CD  1 
ATOM   1153  O OE1 . GLN A  1 160 ? -20.663  5.292   -81.640  1.00 90.56  ? 160 GLN A OE1 1 
ATOM   1154  N NE2 . GLN A  1 160 ? -22.180  3.711   -81.225  1.00 88.70  ? 160 GLN A NE2 1 
ATOM   1155  N N   . SER A  1 161 ? -16.218  5.916   -80.944  1.00 92.84  ? 161 SER A N   1 
ATOM   1156  C CA  . SER A  1 161 ? -14.967  6.604   -80.618  1.00 93.85  ? 161 SER A CA  1 
ATOM   1157  C C   . SER A  1 161 ? -14.872  6.968   -79.144  1.00 91.64  ? 161 SER A C   1 
ATOM   1158  O O   . SER A  1 161 ? -15.884  7.234   -78.486  1.00 89.74  ? 161 SER A O   1 
ATOM   1159  C CB  . SER A  1 161 ? -14.825  7.869   -81.438  1.00 96.18  ? 161 SER A CB  1 
ATOM   1160  O OG  . SER A  1 161 ? -15.767  8.834   -81.017  1.00 95.09  ? 161 SER A OG  1 
ATOM   1161  N N   . ILE A  1 162 ? -13.645  6.994   -78.638  1.00 92.19  ? 162 ILE A N   1 
ATOM   1162  C CA  . ILE A  1 162 ? -13.381  7.429   -77.270  1.00 90.62  ? 162 ILE A CA  1 
ATOM   1163  C C   . ILE A  1 162 ? -14.094  8.756   -76.943  1.00 90.17  ? 162 ILE A C   1 
ATOM   1164  O O   . ILE A  1 162 ? -14.711  8.871   -75.865  1.00 88.08  ? 162 ILE A O   1 
ATOM   1165  C CB  . ILE A  1 162 ? -11.869  7.517   -77.019  1.00 92.16  ? 162 ILE A CB  1 
ATOM   1166  C CG1 . ILE A  1 162 ? -11.286  6.114   -76.821  1.00 91.93  ? 162 ILE A CG1 1 
ATOM   1167  C CG2 . ILE A  1 162 ? -11.576  8.393   -75.819  1.00 91.34  ? 162 ILE A CG2 1 
ATOM   1168  C CD1 . ILE A  1 162 ? -9.802   6.018   -77.125  1.00 94.48  ? 162 ILE A CD1 1 
ATOM   1169  N N   . GLU A  1 163 ? -14.042  9.723   -77.878  1.00 92.34  ? 163 GLU A N   1 
ATOM   1170  C CA  . GLU A  1 163 ? -14.665  11.048  -77.687  1.00 92.49  ? 163 GLU A CA  1 
ATOM   1171  C C   . GLU A  1 163 ? -16.157  10.970  -77.477  1.00 90.67  ? 163 GLU A C   1 
ATOM   1172  O O   . GLU A  1 163 ? -16.702  11.674  -76.602  1.00 89.59  ? 163 GLU A O   1 
ATOM   1173  C CB  . GLU A  1 163 ? -14.414  11.989  -78.846  1.00 95.48  ? 163 GLU A CB  1 
ATOM   1174  C CG  . GLU A  1 163 ? -12.963  12.439  -78.945  1.00 97.79  ? 163 GLU A CG  1 
ATOM   1175  C CD  . GLU A  1 163 ? -12.013  11.318  -79.434  1.00 98.72  ? 163 GLU A CD  1 
ATOM   1176  O OE1 . GLU A  1 163 ? -12.428  10.461  -80.296  1.00 98.91  ? 163 GLU A OE1 1 
ATOM   1177  O OE2 . GLU A  1 163 ? -10.842  11.303  -78.951  1.00 99.51  ? 163 GLU A OE2 1 
ATOM   1178  N N   . LYS A  1 164 ? -16.822  10.131  -78.271  1.00 90.57  ? 164 LYS A N   1 
ATOM   1179  C CA  . LYS A  1 164 ? -18.264  9.915   -78.097  1.00 89.02  ? 164 LYS A CA  1 
ATOM   1180  C C   . LYS A  1 164 ? -18.626  9.279   -76.730  1.00 86.34  ? 164 LYS A C   1 
ATOM   1181  O O   . LYS A  1 164 ? -19.577  9.718   -76.068  1.00 85.23  ? 164 LYS A O   1 
ATOM   1182  C CB  . LYS A  1 164 ? -18.856  9.098   -79.237  1.00 89.75  ? 164 LYS A CB  1 
ATOM   1183  C CG  . LYS A  1 164 ? -20.353  8.922   -79.120  1.00 88.58  ? 164 LYS A CG  1 
ATOM   1184  C CD  . LYS A  1 164 ? -20.926  8.267   -80.357  1.00 89.82  ? 164 LYS A CD  1 
ATOM   1185  C CE  . LYS A  1 164 ? -22.299  7.676   -80.076  1.00 88.45  ? 164 LYS A CE  1 
ATOM   1186  N NZ  . LYS A  1 164 ? -23.299  8.742   -79.821  1.00 88.46  ? 164 LYS A NZ  1 
ATOM   1187  N N   . ILE A  1 165 ? -17.858  8.261   -76.324  1.00 85.60  ? 165 ILE A N   1 
ATOM   1188  C CA  . ILE A  1 165 ? -18.072  7.577   -75.052  1.00 83.41  ? 165 ILE A CA  1 
ATOM   1189  C C   . ILE A  1 165 ? -17.966  8.609   -73.929  1.00 82.79  ? 165 ILE A C   1 
ATOM   1190  O O   . ILE A  1 165 ? -18.869  8.736   -73.108  1.00 81.43  ? 165 ILE A O   1 
ATOM   1191  C CB  . ILE A  1 165 ? -17.036  6.450   -74.826  1.00 83.28  ? 165 ILE A CB  1 
ATOM   1192  C CG1 . ILE A  1 165 ? -17.017  5.446   -75.988  1.00 84.35  ? 165 ILE A CG1 1 
ATOM   1193  C CG2 . ILE A  1 165 ? -17.274  5.766   -73.494  1.00 81.27  ? 165 ILE A CG2 1 
ATOM   1194  C CD1 . ILE A  1 165 ? -18.207  4.518   -76.073  1.00 83.29  ? 165 ILE A CD1 1 
ATOM   1195  N N   . GLN A  1 166 ? -16.863  9.355   -73.930  1.00 84.09  ? 166 GLN A N   1 
ATOM   1196  C CA  . GLN A  1 166 ? -16.620  10.386  -72.945  1.00 83.98  ? 166 GLN A CA  1 
ATOM   1197  C C   . GLN A  1 166 ? -17.837  11.285  -72.831  1.00 83.77  ? 166 GLN A C   1 
ATOM   1198  O O   . GLN A  1 166 ? -18.362  11.482  -71.731  1.00 82.52  ? 166 GLN A O   1 
ATOM   1199  C CB  . GLN A  1 166 ? -15.384  11.199  -73.300  1.00 86.10  ? 166 GLN A CB  1 
ATOM   1200  C CG  . GLN A  1 166 ? -15.067  12.301  -72.291  1.00 86.33  ? 166 GLN A CG  1 
ATOM   1201  C CD  . GLN A  1 166 ? -14.232  11.850  -71.087  1.00 85.46  ? 166 GLN A CD  1 
ATOM   1202  O OE1 . GLN A  1 166 ? -14.071  10.659  -70.805  1.00 84.28  ? 166 GLN A OE1 1 
ATOM   1203  N NE2 . GLN A  1 166 ? -13.703  12.816  -70.368  1.00 86.27  ? 166 GLN A NE2 1 
ATOM   1204  N N   . LYS A  1 167 ? -18.316  11.801  -73.958  1.00 85.19  ? 167 LYS A N   1 
ATOM   1205  C CA  . LYS A  1 167 ? -19.496  12.664  -73.923  1.00 85.35  ? 167 LYS A CA  1 
ATOM   1206  C C   . LYS A  1 167 ? -20.793  11.973  -73.421  1.00 83.54  ? 167 LYS A C   1 
ATOM   1207  O O   . LYS A  1 167 ? -21.575  12.588  -72.686  1.00 83.15  ? 167 LYS A O   1 
ATOM   1208  C CB  . LYS A  1 167 ? -19.724  13.330  -75.280  1.00 87.56  ? 167 LYS A CB  1 
ATOM   1209  C CG  . LYS A  1 167 ? -20.964  14.215  -75.316  1.00 88.07  ? 167 LYS A CG  1 
ATOM   1210  C CD  . LYS A  1 167 ? -21.053  14.994  -76.619  1.00 90.67  ? 167 LYS A CD  1 
ATOM   1211  C CE  . LYS A  1 167 ? -20.105  16.199  -76.608  1.00 92.67  ? 167 LYS A CE  1 
ATOM   1212  N NZ  . LYS A  1 167 ? -19.673  16.616  -77.976  1.00 95.43  ? 167 LYS A NZ  1 
ATOM   1213  N N   . ASP A  1 168 ? -21.005  10.715  -73.823  1.00 82.74  ? 168 ASP A N   1 
ATOM   1214  C CA  . ASP A  1 168 ? -22.246  9.993   -73.559  1.00 81.51  ? 168 ASP A CA  1 
ATOM   1215  C C   . ASP A  1 168 ? -22.271  9.461   -72.149  1.00 79.72  ? 168 ASP A C   1 
ATOM   1216  O O   . ASP A  1 168 ? -23.337  9.114   -71.641  1.00 78.87  ? 168 ASP A O   1 
ATOM   1217  C CB  . ASP A  1 168 ? -22.423  8.821   -74.514  1.00 81.63  ? 168 ASP A CB  1 
ATOM   1218  C CG  . ASP A  1 168 ? -22.837  9.249   -75.913  1.00 83.48  ? 168 ASP A CG  1 
ATOM   1219  O OD1 . ASP A  1 168 ? -23.212  10.434  -76.072  1.00 84.54  ? 168 ASP A OD1 1 
ATOM   1220  O OD2 . ASP A  1 168 ? -22.777  8.410   -76.855  1.00 84.11  ? 168 ASP A OD2 1 
ATOM   1221  N N   . THR A  1 169 ? -21.114  9.384   -71.504  1.00 79.38  ? 169 THR A N   1 
ATOM   1222  C CA  . THR A  1 169 ? -21.081  8.929   -70.123  1.00 77.94  ? 169 THR A CA  1 
ATOM   1223  C C   . THR A  1 169 ? -20.861  10.020  -69.052  1.00 78.02  ? 169 THR A C   1 
ATOM   1224  O O   . THR A  1 169 ? -20.693  9.723   -67.858  1.00 77.10  ? 169 THR A O   1 
ATOM   1225  C CB  . THR A  1 169 ? -20.074  7.803   -69.942  1.00 77.43  ? 169 THR A CB  1 
ATOM   1226  O OG1 . THR A  1 169 ? -18.745  8.277   -70.196  1.00 78.50  ? 169 THR A OG1 1 
ATOM   1227  C CG2 . THR A  1 169 ? -20.415  6.689   -70.860  1.00 77.45  ? 169 THR A CG2 1 
ATOM   1228  N N   . ASP A  1 170 ? -20.888  11.284  -69.472  1.00 79.36  ? 170 ASP A N   1 
ATOM   1229  C CA  . ASP A  1 170 ? -20.779  12.412  -68.540  1.00 79.83  ? 170 ASP A CA  1 
ATOM   1230  C C   . ASP A  1 170 ? -21.829  12.377  -67.424  1.00 78.90  ? 170 ASP A C   1 
ATOM   1231  O O   . ASP A  1 170 ? -21.509  12.631  -66.258  1.00 78.65  ? 170 ASP A O   1 
ATOM   1232  C CB  . ASP A  1 170 ? -20.871  13.738  -69.274  1.00 81.70  ? 170 ASP A CB  1 
ATOM   1233  C CG  . ASP A  1 170 ? -20.463  14.907  -68.404  1.00 82.61  ? 170 ASP A CG  1 
ATOM   1234  O OD1 . ASP A  1 170 ? -21.314  15.820  -68.201  1.00 83.41  ? 170 ASP A OD1 1 
ATOM   1235  O OD2 . ASP A  1 170 ? -19.294  14.907  -67.919  1.00 82.73  ? 170 ASP A OD2 1 
ATOM   1236  N N   . ARG A  1 171 ? -23.075  12.071  -67.790  1.00 78.67  ? 171 ARG A N   1 
ATOM   1237  C CA  . ARG A  1 171 ? -24.149  11.882  -66.828  1.00 78.04  ? 171 ARG A CA  1 
ATOM   1238  C C   . ARG A  1 171 ? -24.760  10.515  -67.061  1.00 77.00  ? 171 ARG A C   1 
ATOM   1239  O O   . ARG A  1 171 ? -24.315  9.794   -67.940  1.00 76.82  ? 171 ARG A O   1 
ATOM   1240  C CB  . ARG A  1 171 ? -25.204  12.948  -67.019  1.00 79.31  ? 171 ARG A CB  1 
ATOM   1241  C CG  . ARG A  1 171 ? -24.676  14.381  -66.977  1.00 80.79  ? 171 ARG A CG  1 
ATOM   1242  C CD  . ARG A  1 171 ? -24.725  14.956  -65.595  1.00 80.95  ? 171 ARG A CD  1 
ATOM   1243  N NE  . ARG A  1 171 ? -24.330  16.334  -65.614  1.00 82.67  ? 171 ARG A NE  1 
ATOM   1244  C CZ  . ARG A  1 171 ? -24.192  17.063  -64.517  1.00 83.33  ? 171 ARG A CZ  1 
ATOM   1245  N NH1 . ARG A  1 171 ? -24.445  16.529  -63.339  1.00 82.38  ? 171 ARG A NH1 1 
ATOM   1246  N NH2 . ARG A  1 171 ? -23.808  18.330  -64.593  1.00 85.18  ? 171 ARG A NH2 1 
ATOM   1247  N N   . ASP A  1 172 ? -25.773  10.152  -66.270  1.00 76.59  ? 172 ASP A N   1 
ATOM   1248  C CA  . ASP A  1 172 ? -26.457  8.867   -66.407  1.00 75.91  ? 172 ASP A CA  1 
ATOM   1249  C C   . ASP A  1 172 ? -27.096  8.832   -67.761  1.00 76.64  ? 172 ASP A C   1 
ATOM   1250  O O   . ASP A  1 172 ? -27.810  9.758   -68.128  1.00 77.73  ? 172 ASP A O   1 
ATOM   1251  C CB  . ASP A  1 172 ? -27.541  8.731   -65.351  1.00 75.91  ? 172 ASP A CB  1 
ATOM   1252  C CG  . ASP A  1 172 ? -27.002  8.248   -64.005  1.00 75.14  ? 172 ASP A CG  1 
ATOM   1253  O OD1 . ASP A  1 172 ? -25.790  7.961   -63.918  1.00 74.55  ? 172 ASP A OD1 1 
ATOM   1254  O OD2 . ASP A  1 172 ? -27.807  8.131   -63.034  1.00 75.35  ? 172 ASP A OD2 1 
ATOM   1255  N N   . ASN A  1 173 ? -26.835  7.767   -68.509  1.00 76.27  ? 173 ASN A N   1 
ATOM   1256  C CA  . ASN A  1 173 ? -27.384  7.605   -69.860  1.00 77.13  ? 173 ASN A CA  1 
ATOM   1257  C C   . ASN A  1 173 ? -28.149  6.311   -70.005  1.00 76.87  ? 173 ASN A C   1 
ATOM   1258  O O   . ASN A  1 173 ? -27.546  5.224   -70.060  1.00 76.26  ? 173 ASN A O   1 
ATOM   1259  C CB  . ASN A  1 173 ? -26.256  7.617   -70.872  1.00 77.51  ? 173 ASN A CB  1 
ATOM   1260  C CG  . ASN A  1 173 ? -26.743  7.801   -72.277  1.00 78.83  ? 173 ASN A CG  1 
ATOM   1261  O OD1 . ASN A  1 173 ? -27.944  7.822   -72.565  1.00 79.44  ? 173 ASN A OD1 1 
ATOM   1262  N ND2 . ASN A  1 173 ? -25.805  7.938   -73.170  1.00 79.53  ? 173 ASN A ND2 1 
ATOM   1263  N N   . PHE A  1 174 ? -29.472  6.433   -70.049  1.00 77.59  ? 174 PHE A N   1 
ATOM   1264  C CA  . PHE A  1 174 ? -30.343  5.260   -70.080  1.00 77.66  ? 174 PHE A CA  1 
ATOM   1265  C C   . PHE A  1 174 ? -30.702  4.876   -71.500  1.00 78.68  ? 174 PHE A C   1 
ATOM   1266  O O   . PHE A  1 174 ? -31.188  5.705   -72.270  1.00 79.85  ? 174 PHE A O   1 
ATOM   1267  C CB  . PHE A  1 174 ? -31.624  5.492   -69.267  1.00 78.20  ? 174 PHE A CB  1 
ATOM   1268  C CG  . PHE A  1 174 ? -31.402  5.537   -67.798  1.00 77.41  ? 174 PHE A CG  1 
ATOM   1269  C CD1 . PHE A  1 174 ? -31.336  4.363   -67.052  1.00 76.75  ? 174 PHE A CD1 1 
ATOM   1270  C CD2 . PHE A  1 174 ? -31.263  6.753   -67.156  1.00 77.57  ? 174 PHE A CD2 1 
ATOM   1271  C CE1 . PHE A  1 174 ? -31.138  4.403   -65.685  1.00 76.27  ? 174 PHE A CE1 1 
ATOM   1272  C CE2 . PHE A  1 174 ? -31.075  6.813   -65.784  1.00 77.09  ? 174 PHE A CE2 1 
ATOM   1273  C CZ  . PHE A  1 174 ? -31.011  5.633   -65.048  1.00 76.43  ? 174 PHE A CZ  1 
ATOM   1274  N N   . LEU A  1 175 ? -30.488  3.604   -71.815  1.00 78.46  ? 175 LEU A N   1 
ATOM   1275  C CA  . LEU A  1 175 ? -30.682  3.070   -73.148  1.00 79.53  ? 175 LEU A CA  1 
ATOM   1276  C C   . LEU A  1 175 ? -31.699  1.925   -73.153  1.00 80.10  ? 175 LEU A C   1 
ATOM   1277  O O   . LEU A  1 175 ? -31.729  1.102   -72.231  1.00 79.41  ? 175 LEU A O   1 
ATOM   1278  C CB  . LEU A  1 175 ? -29.341  2.549   -73.629  1.00 79.15  ? 175 LEU A CB  1 
ATOM   1279  C CG  . LEU A  1 175 ? -28.354  3.406   -74.426  1.00 79.61  ? 175 LEU A CG  1 
ATOM   1280  C CD1 . LEU A  1 175 ? -28.347  4.878   -74.037  1.00 79.59  ? 175 LEU A CD1 1 
ATOM   1281  C CD2 . LEU A  1 175 ? -26.959  2.828   -74.256  1.00 78.94  ? 175 LEU A CD2 1 
ATOM   1282  N N   . THR A  1 176 ? -32.551  1.880   -74.172  1.00 81.60  ? 176 THR A N   1 
ATOM   1283  C CA  . THR A  1 176 ? -33.416  0.721   -74.366  1.00 82.51  ? 176 THR A CA  1 
ATOM   1284  C C   . THR A  1 176 ? -32.595  -0.436  -74.957  1.00 82.52  ? 176 THR A C   1 
ATOM   1285  O O   . THR A  1 176 ? -31.437  -0.246  -75.357  1.00 82.05  ? 176 THR A O   1 
ATOM   1286  C CB  . THR A  1 176 ? -34.601  1.027   -75.293  1.00 84.42  ? 176 THR A CB  1 
ATOM   1287  O OG1 . THR A  1 176 ? -34.134  1.301   -76.628  1.00 85.33  ? 176 THR A OG1 1 
ATOM   1288  C CG2 . THR A  1 176 ? -35.396  2.182   -74.786  1.00 84.78  ? 176 THR A CG2 1 
ATOM   1289  N N   . ALA A  1 177 ? -33.175  -1.632  -75.026  1.00 83.32  ? 177 ALA A N   1 
ATOM   1290  C CA  . ALA A  1 177 ? -32.483  -2.745  -75.674  1.00 83.77  ? 177 ALA A CA  1 
ATOM   1291  C C   . ALA A  1 177 ? -32.086  -2.403  -77.118  1.00 84.90  ? 177 ALA A C   1 
ATOM   1292  O O   . ALA A  1 177 ? -30.947  -2.655  -77.523  1.00 84.75  ? 177 ALA A O   1 
ATOM   1293  C CB  . ALA A  1 177 ? -33.314  -4.021  -75.610  1.00 84.94  ? 177 ALA A CB  1 
ATOM   1294  N N   . GLU A  1 178 ? -33.008  -1.814  -77.884  1.00 86.27  ? 178 GLU A N   1 
ATOM   1295  C CA  . GLU A  1 178 ? -32.713  -1.424  -79.275  1.00 87.68  ? 178 GLU A CA  1 
ATOM   1296  C C   . GLU A  1 178 ? -31.587  -0.410  -79.332  1.00 86.81  ? 178 GLU A C   1 
ATOM   1297  O O   . GLU A  1 178 ? -30.661  -0.565  -80.125  1.00 87.43  ? 178 GLU A O   1 
ATOM   1298  C CB  . GLU A  1 178 ? -33.930  -0.861  -79.998  1.00 89.45  ? 178 GLU A CB  1 
ATOM   1299  C CG  . GLU A  1 178 ? -34.985  -1.893  -80.352  1.00 91.10  ? 178 GLU A CG  1 
ATOM   1300  C CD  . GLU A  1 178 ? -34.540  -2.905  -81.409  1.00 92.53  ? 178 GLU A CD  1 
ATOM   1301  O OE1 . GLU A  1 178 ? -33.669  -2.583  -82.280  1.00 93.02  ? 178 GLU A OE1 1 
ATOM   1302  O OE2 . GLU A  1 178 ? -35.084  -4.045  -81.375  1.00 93.46  ? 178 GLU A OE2 1 
ATOM   1303  N N   . GLU A  1 179 ? -31.644  0.607   -78.468  1.00 85.61  ? 179 GLU A N   1 
ATOM   1304  C CA  . GLU A  1 179 ? -30.622  1.655   -78.444  1.00 84.99  ? 179 GLU A CA  1 
ATOM   1305  C C   . GLU A  1 179 ? -29.269  1.084   -78.052  1.00 83.86  ? 179 GLU A C   1 
ATOM   1306  O O   . GLU A  1 179 ? -28.232  1.525   -78.554  1.00 84.17  ? 179 GLU A O   1 
ATOM   1307  C CB  . GLU A  1 179 ? -30.998  2.779   -77.492  1.00 84.10  ? 179 GLU A CB  1 
ATOM   1308  C CG  . GLU A  1 179 ? -32.129  3.685   -77.951  1.00 85.53  ? 179 GLU A CG  1 
ATOM   1309  C CD  . GLU A  1 179 ? -32.734  4.514   -76.814  1.00 84.84  ? 179 GLU A CD  1 
ATOM   1310  O OE1 . GLU A  1 179 ? -32.484  4.252   -75.603  1.00 83.28  ? 179 GLU A OE1 1 
ATOM   1311  O OE2 . GLU A  1 179 ? -33.502  5.445   -77.115  1.00 86.11  ? 179 GLU A OE2 1 
ATOM   1312  N N   . ALA A  1 180 ? -29.280  0.099   -77.168  1.00 82.84  ? 180 ALA A N   1 
ATOM   1313  C CA  . ALA A  1 180 ? -28.060  -0.574  -76.779  1.00 82.05  ? 180 ALA A CA  1 
ATOM   1314  C C   . ALA A  1 180 ? -27.417  -1.335  -77.951  1.00 83.49  ? 180 ALA A C   1 
ATOM   1315  O O   . ALA A  1 180 ? -26.181  -1.360  -78.089  1.00 83.49  ? 180 ALA A O   1 
ATOM   1316  C CB  . ALA A  1 180 ? -28.330  -1.521  -75.636  1.00 81.07  ? 180 ALA A CB  1 
ATOM   1317  N N   . LYS A  1 181 ? -28.252  -1.977  -78.775  1.00 84.96  ? 181 LYS A N   1 
ATOM   1318  C CA  . LYS A  1 181 ? -27.778  -2.681  -79.964  1.00 86.73  ? 181 LYS A CA  1 
ATOM   1319  C C   . LYS A  1 181 ? -27.217  -1.671  -80.944  1.00 87.78  ? 181 LYS A C   1 
ATOM   1320  O O   . LYS A  1 181 ? -26.122  -1.865  -81.473  1.00 88.57  ? 181 LYS A O   1 
ATOM   1321  C CB  . LYS A  1 181 ? -28.912  -3.466  -80.617  1.00 88.30  ? 181 LYS A CB  1 
ATOM   1322  C CG  . LYS A  1 181 ? -28.539  -4.139  -81.925  1.00 90.52  ? 181 LYS A CG  1 
ATOM   1323  C CD  . LYS A  1 181 ? -29.767  -4.757  -82.559  1.00 92.24  ? 181 LYS A CD  1 
ATOM   1324  C CE  . LYS A  1 181 ? -29.540  -5.073  -84.028  1.00 94.82  ? 181 LYS A CE  1 
ATOM   1325  N NZ  . LYS A  1 181 ? -30.843  -5.438  -84.650  1.00 96.64  ? 181 LYS A NZ  1 
ATOM   1326  N N   . GLU A  1 182 ? -27.965  -0.586  -81.156  1.00 88.01  ? 182 GLU A N   1 
ATOM   1327  C CA  . GLU A  1 182 ? -27.525  0.533   -81.996  1.00 89.14  ? 182 GLU A CA  1 
ATOM   1328  C C   . GLU A  1 182 ? -26.171  1.103   -81.564  1.00 88.30  ? 182 GLU A C   1 
ATOM   1329  O O   . GLU A  1 182 ? -25.397  1.561   -82.368  1.00 89.66  ? 182 GLU A O   1 
ATOM   1330  C CB  . GLU A  1 182 ? -28.587  1.631   -81.977  1.00 89.33  ? 182 GLU A CB  1 
ATOM   1331  C CG  . GLU A  1 182 ? -28.331  2.756   -82.973  1.00 91.05  ? 182 GLU A CG  1 
ATOM   1332  C CD  . GLU A  1 182 ? -28.532  2.301   -84.413  1.00 93.59  ? 182 GLU A CD  1 
ATOM   1333  O OE1 . GLU A  1 182 ? -27.863  2.843   -85.340  1.00 95.30  ? 182 GLU A OE1 1 
ATOM   1334  O OE2 . GLU A  1 182 ? -29.368  1.374   -84.614  1.00 94.10  ? 182 GLU A OE2 1 
ATOM   1335  N N   . TYR A  1 183 ? -25.917  1.056   -80.268  1.00 86.25  ? 183 TYR A N   1 
ATOM   1336  C CA  . TYR A  1 183 ? -24.731  1.628   -79.680  1.00 85.41  ? 183 TYR A CA  1 
ATOM   1337  C C   . TYR A  1 183 ? -23.589  0.667   -79.829  1.00 85.80  ? 183 TYR A C   1 
ATOM   1338  O O   . TYR A  1 183 ? -22.445  1.068   -79.764  1.00 85.97  ? 183 TYR A O   1 
ATOM   1339  C CB  . TYR A  1 183 ? -24.963  1.922   -78.185  1.00 83.28  ? 183 TYR A CB  1 
ATOM   1340  C CG  . TYR A  1 183 ? -24.068  3.009   -77.661  1.00 82.76  ? 183 TYR A CG  1 
ATOM   1341  C CD1 . TYR A  1 183 ? -24.453  4.347   -77.748  1.00 83.13  ? 183 TYR A CD1 1 
ATOM   1342  C CD2 . TYR A  1 183 ? -22.828  2.706   -77.096  1.00 82.18  ? 183 TYR A CD2 1 
ATOM   1343  C CE1 . TYR A  1 183 ? -23.619  5.362   -77.294  1.00 82.96  ? 183 TYR A CE1 1 
ATOM   1344  C CE2 . TYR A  1 183 ? -21.987  3.709   -76.638  1.00 81.98  ? 183 TYR A CE2 1 
ATOM   1345  C CZ  . TYR A  1 183 ? -22.380  5.035   -76.745  1.00 82.38  ? 183 TYR A CZ  1 
ATOM   1346  O OH  . TYR A  1 183 ? -21.545  6.029   -76.296  1.00 82.44  ? 183 TYR A OH  1 
ATOM   1347  N N   . GLY A  1 184 ? -23.894  -0.611  -80.006  1.00 86.15  ? 184 GLY A N   1 
ATOM   1348  C CA  . GLY A  1 184 ? -22.854  -1.641  -80.057  1.00 86.69  ? 184 GLY A CA  1 
ATOM   1349  C C   . GLY A  1 184 ? -22.487  -2.291  -78.728  1.00 85.01  ? 184 GLY A C   1 
ATOM   1350  O O   . GLY A  1 184 ? -21.459  -2.951  -78.616  1.00 85.44  ? 184 GLY A O   1 
ATOM   1351  N N   . LEU A  1 185 ? -23.334  -2.114  -77.713  1.00 83.35  ? 185 LEU A N   1 
ATOM   1352  C CA  . LEU A  1 185 ? -23.155  -2.789  -76.414  1.00 81.97  ? 185 LEU A CA  1 
ATOM   1353  C C   . LEU A  1 185 ? -23.605  -4.249  -76.479  1.00 82.65  ? 185 LEU A C   1 
ATOM   1354  O O   . LEU A  1 185 ? -23.056  -5.133  -75.784  1.00 82.42  ? 185 LEU A O   1 
ATOM   1355  C CB  . LEU A  1 185 ? -23.908  -2.067  -75.299  1.00 80.31  ? 185 LEU A CB  1 
ATOM   1356  C CG  . LEU A  1 185 ? -23.363  -0.690  -74.936  1.00 79.62  ? 185 LEU A CG  1 
ATOM   1357  C CD1 . LEU A  1 185 ? -24.454  0.087   -74.285  1.00 78.71  ? 185 LEU A CD1 1 
ATOM   1358  C CD2 . LEU A  1 185 ? -22.152  -0.720  -74.029  1.00 78.89  ? 185 LEU A CD2 1 
ATOM   1359  N N   . ILE A  1 186 ? -24.619  -4.487  -77.308  1.00 83.70  ? 186 ILE A N   1 
ATOM   1360  C CA  . ILE A  1 186 ? -25.102  -5.830  -77.599  1.00 84.86  ? 186 ILE A CA  1 
ATOM   1361  C C   . ILE A  1 186 ? -25.206  -6.035  -79.111  1.00 87.02  ? 186 ILE A C   1 
ATOM   1362  O O   . ILE A  1 186 ? -25.211  -5.079  -79.882  1.00 87.52  ? 186 ILE A O   1 
ATOM   1363  C CB  . ILE A  1 186 ? -26.477  -6.091  -76.942  1.00 84.32  ? 186 ILE A CB  1 
ATOM   1364  C CG1 . ILE A  1 186 ? -27.488  -5.029  -77.378  1.00 84.34  ? 186 ILE A CG1 1 
ATOM   1365  C CG2 . ILE A  1 186 ? -26.325  -6.158  -75.430  1.00 82.63  ? 186 ILE A CG2 1 
ATOM   1366  C CD1 . ILE A  1 186 ? -28.922  -5.387  -77.107  1.00 84.67  ? 186 ILE A CD1 1 
ATOM   1367  N N   . ASP A  1 187 ? -25.324  -7.294  -79.518  1.00 88.53  ? 187 ASP A N   1 
ATOM   1368  C CA  . ASP A  1 187 ? -25.467  -7.666  -80.928  1.00 90.92  ? 187 ASP A CA  1 
ATOM   1369  C C   . ASP A  1 187 ? -26.915  -7.863  -81.314  1.00 91.74  ? 187 ASP A C   1 
ATOM   1370  O O   . ASP A  1 187 ? -27.349  -7.416  -82.367  1.00 93.11  ? 187 ASP A O   1 
ATOM   1371  C CB  . ASP A  1 187 ? -24.658  -8.921  -81.213  1.00 92.53  ? 187 ASP A CB  1 
ATOM   1372  C CG  . ASP A  1 187 ? -23.212  -8.795  -80.747  1.00 91.95  ? 187 ASP A CG  1 
ATOM   1373  O OD1 . ASP A  1 187 ? -22.478  -8.003  -81.382  1.00 92.47  ? 187 ASP A OD1 1 
ATOM   1374  O OD2 . ASP A  1 187 ? -22.814  -9.462  -79.743  1.00 91.17  ? 187 ASP A OD2 1 
ATOM   1375  N N   . GLU A  1 188 ? -27.678  -8.499  -80.442  1.00 185.00 ? 188 GLU A N   1 
ATOM   1376  C CA  . GLU A  1 188 ? -29.029  -8.876  -80.780  1.00 169.45 ? 188 GLU A CA  1 
ATOM   1377  C C   . GLU A  1 188 ? -29.956  -8.614  -79.613  1.00 149.72 ? 188 GLU A C   1 
ATOM   1378  O O   . GLU A  1 188 ? -29.548  -8.771  -78.474  1.00 147.99 ? 188 GLU A O   1 
ATOM   1379  C CB  . GLU A  1 188 ? -29.033  -10.365 -81.131  1.00 174.44 ? 188 GLU A CB  1 
ATOM   1380  C CG  . GLU A  1 188 ? -30.199  -10.809 -81.992  1.00 169.58 ? 188 GLU A CG  1 
ATOM   1381  C CD  . GLU A  1 188 ? -30.373  -9.904  -83.193  1.00 180.01 ? 188 GLU A CD  1 
ATOM   1382  O OE1 . GLU A  1 188 ? -29.743  -10.172 -84.239  1.00 202.94 ? 188 GLU A OE1 1 
ATOM   1383  O OE2 . GLU A  1 188 ? -31.129  -8.909  -83.064  1.00 169.07 ? 188 GLU A OE2 1 
ATOM   1384  N N   . VAL A  1 189 ? -31.190  -8.201  -79.875  1.00 139.61 ? 189 VAL A N   1 
ATOM   1385  C CA  . VAL A  1 189 ? -32.198  -8.251  -78.808  1.00 126.41 ? 189 VAL A CA  1 
ATOM   1386  C C   . VAL A  1 189 ? -33.091  -9.467  -79.021  1.00 120.59 ? 189 VAL A C   1 
ATOM   1387  O O   . VAL A  1 189 ? -33.753  -9.566  -80.050  1.00 122.25 ? 189 VAL A O   1 
ATOM   1388  C CB  . VAL A  1 189 ? -32.998  -6.935  -78.624  1.00 124.14 ? 189 VAL A CB  1 
ATOM   1389  C CG1 . VAL A  1 189 ? -32.343  -5.798  -79.365  1.00 134.28 ? 189 VAL A CG1 1 
ATOM   1390  C CG2 . VAL A  1 189 ? -34.452  -7.052  -79.030  1.00 119.53 ? 189 VAL A CG2 1 
ATOM   1391  N N   . MET A  1 190 ? -33.076  -10.413 -78.079  1.00 117.20 ? 190 MET A N   1 
ATOM   1392  C CA  . MET A  1 190 ? -33.786  -11.693 -78.246  1.00 114.98 ? 190 MET A CA  1 
ATOM   1393  C C   . MET A  1 190 ? -35.297  -11.525 -78.294  1.00 109.64 ? 190 MET A C   1 
ATOM   1394  O O   . MET A  1 190 ? -35.933  -11.330 -77.279  1.00 107.04 ? 190 MET A O   1 
ATOM   1395  C CB  . MET A  1 190 ? -33.423  -12.680 -77.145  1.00 115.91 ? 190 MET A CB  1 
ATOM   1396  C CG  . MET A  1 190 ? -31.946  -12.753 -76.826  1.00 125.06 ? 190 MET A CG  1 
ATOM   1397  S SD  . MET A  1 190 ? -31.384  -14.369 -76.265  1.00 134.25 ? 190 MET A SD  1 
ATOM   1398  C CE  . MET A  1 190 ? -32.281  -14.583 -74.731  1.00 128.77 ? 190 MET A CE  1 
ATOM   1399  N N   . VAL A  1 191 ? -35.867  -11.619 -79.483  1.00 112.78 ? 191 VAL A N   1 
ATOM   1400  C CA  . VAL A  1 191 ? -37.304  -11.480 -79.666  1.00 112.61 ? 191 VAL A CA  1 
ATOM   1401  C C   . VAL A  1 191 ? -37.989  -12.734 -79.108  1.00 112.31 ? 191 VAL A C   1 
ATOM   1402  O O   . VAL A  1 191 ? -37.459  -13.834 -79.239  1.00 114.41 ? 191 VAL A O   1 
ATOM   1403  C CB  . VAL A  1 191 ? -37.655  -11.178 -81.159  1.00 120.91 ? 191 VAL A CB  1 
ATOM   1404  C CG1 . VAL A  1 191 ? -37.395  -12.377 -82.059  1.00 129.11 ? 191 VAL A CG1 1 
ATOM   1405  C CG2 . VAL A  1 191 ? -39.082  -10.646 -81.324  1.00 124.72 ? 191 VAL A CG2 1 
ATOM   1406  N N   . PRO A  1 192 ? -39.143  -12.555 -78.431  1.00 113.55 ? 192 PRO A N   1 
ATOM   1407  C CA  . PRO A  1 192 ? -39.829  -13.676 -77.805  1.00 117.00 ? 192 PRO A CA  1 
ATOM   1408  C C   . PRO A  1 192 ? -40.051  -14.806 -78.778  1.00 121.74 ? 192 PRO A C   1 
ATOM   1409  O O   . PRO A  1 192 ? -40.481  -14.587 -79.908  1.00 126.91 ? 192 PRO A O   1 
ATOM   1410  C CB  . PRO A  1 192 ? -41.172  -13.081 -77.382  1.00 124.75 ? 192 PRO A CB  1 
ATOM   1411  C CG  . PRO A  1 192 ? -40.905  -11.635 -77.170  1.00 123.51 ? 192 PRO A CG  1 
ATOM   1412  C CD  . PRO A  1 192 ? -39.781  -11.264 -78.095  1.00 116.22 ? 192 PRO A CD  1 
ATOM   1413  N N   . GLU A  1 193 ? -39.753  -16.009 -78.319  1.00 123.39 ? 193 GLU A N   1 
ATOM   1414  C CA  . GLU A  1 193 ? -39.898  -17.211 -79.113  1.00 131.50 ? 193 GLU A CA  1 
ATOM   1415  C C   . GLU A  1 193 ? -41.299  -17.827 -78.982  1.00 140.66 ? 193 GLU A C   1 
ATOM   1416  O O   . GLU A  1 193 ? -42.112  -17.769 -79.909  1.00 148.74 ? 193 GLU A O   1 
ATOM   1417  C CB  . GLU A  1 193 ? -38.844  -18.194 -78.645  1.00 132.79 ? 193 GLU A CB  1 
ATOM   1418  C CG  . GLU A  1 193 ? -38.776  -19.488 -79.417  1.00 145.04 ? 193 GLU A CG  1 
ATOM   1419  C CD  . GLU A  1 193 ? -37.738  -20.422 -78.824  1.00 149.89 ? 193 GLU A CD  1 
ATOM   1420  O OE1 . GLU A  1 193 ? -37.220  -21.292 -79.571  1.00 162.97 ? 193 GLU A OE1 1 
ATOM   1421  O OE2 . GLU A  1 193 ? -37.440  -20.277 -77.611  1.00 144.55 ? 193 GLU A OE2 1 
ATOM   1422  N N   . ILE B  1 4   ? -20.586  -19.546 -52.997  1.00 204.73 ? 4   ILE B N   1 
ATOM   1423  C CA  . ILE B  1 4   ? -22.061  -19.743 -52.950  1.00 203.00 ? 4   ILE B CA  1 
ATOM   1424  C C   . ILE B  1 4   ? -22.545  -21.018 -53.718  1.00 196.81 ? 4   ILE B C   1 
ATOM   1425  O O   . ILE B  1 4   ? -23.145  -21.879 -53.100  1.00 196.44 ? 4   ILE B O   1 
ATOM   1426  C CB  . ILE B  1 4   ? -22.845  -18.398 -53.186  1.00 205.94 ? 4   ILE B CB  1 
ATOM   1427  C CG1 . ILE B  1 4   ? -24.369  -18.574 -53.089  1.00 204.25 ? 4   ILE B CG1 1 
ATOM   1428  C CG2 . ILE B  1 4   ? -22.418  -17.665 -54.456  1.00 205.45 ? 4   ILE B CG2 1 
ATOM   1429  C CD1 . ILE B  1 4   ? -25.133  -17.273 -52.883  1.00 208.84 ? 4   ILE B CD1 1 
ATOM   1430  N N   . PRO B  1 5   ? -22.238  -21.191 -55.021  1.00 193.19 ? 5   PRO B N   1 
ATOM   1431  C CA  . PRO B  1 5   ? -22.901  -22.320 -55.669  1.00 189.05 ? 5   PRO B CA  1 
ATOM   1432  C C   . PRO B  1 5   ? -22.211  -23.690 -55.498  1.00 187.70 ? 5   PRO B C   1 
ATOM   1433  O O   . PRO B  1 5   ? -21.034  -23.763 -55.153  1.00 188.90 ? 5   PRO B O   1 
ATOM   1434  C CB  . PRO B  1 5   ? -22.946  -21.897 -57.140  1.00 187.37 ? 5   PRO B CB  1 
ATOM   1435  C CG  . PRO B  1 5   ? -21.959  -20.789 -57.284  1.00 190.30 ? 5   PRO B CG  1 
ATOM   1436  C CD  . PRO B  1 5   ? -21.341  -20.501 -55.952  1.00 193.61 ? 5   PRO B CD  1 
ATOM   1437  N N   . THR B  1 6   ? -22.961  -24.757 -55.768  1.00 185.85 ? 6   THR B N   1 
ATOM   1438  C CA  . THR B  1 6   ? -22.570  -26.152 -55.500  1.00 185.99 ? 6   THR B CA  1 
ATOM   1439  C C   . THR B  1 6   ? -22.239  -26.965 -56.781  1.00 183.80 ? 6   THR B C   1 
ATOM   1440  O O   . THR B  1 6   ? -22.853  -26.756 -57.831  1.00 182.35 ? 6   THR B O   1 
ATOM   1441  C CB  . THR B  1 6   ? -23.703  -26.850 -54.710  1.00 187.68 ? 6   THR B CB  1 
ATOM   1442  O OG1 . THR B  1 6   ? -23.997  -26.076 -53.552  1.00 190.64 ? 6   THR B OG1 1 
ATOM   1443  C CG2 . THR B  1 6   ? -23.335  -28.252 -54.269  1.00 189.75 ? 6   THR B CG2 1 
ATOM   1444  N N   . VAL B  1 7   ? -21.271  -27.883 -56.691  1.00 184.42 ? 7   VAL B N   1 
ATOM   1445  C CA  . VAL B  1 7   ? -20.906  -28.767 -57.810  1.00 183.63 ? 7   VAL B CA  1 
ATOM   1446  C C   . VAL B  1 7   ? -20.967  -30.248 -57.403  1.00 186.02 ? 7   VAL B C   1 
ATOM   1447  O O   . VAL B  1 7   ? -20.633  -30.594 -56.269  1.00 188.28 ? 7   VAL B O   1 
ATOM   1448  C CB  . VAL B  1 7   ? -19.495  -28.449 -58.335  1.00 182.87 ? 7   VAL B CB  1 
ATOM   1449  C CG1 . VAL B  1 7   ? -19.178  -29.312 -59.536  1.00 182.94 ? 7   VAL B CG1 1 
ATOM   1450  C CG2 . VAL B  1 7   ? -19.382  -26.988 -58.712  1.00 182.10 ? 7   VAL B CG2 1 
ATOM   1451  N N   . ILE B  1 8   ? -21.379  -31.110 -58.338  1.00 186.72 ? 8   ILE B N   1 
ATOM   1452  C CA  . ILE B  1 8   ? -21.483  -32.576 -58.118  1.00 190.44 ? 8   ILE B CA  1 
ATOM   1453  C C   . ILE B  1 8   ? -20.322  -33.408 -58.661  1.00 191.90 ? 8   ILE B C   1 
ATOM   1454  O O   . ILE B  1 8   ? -19.698  -33.033 -59.654  1.00 190.10 ? 8   ILE B O   1 
ATOM   1455  C CB  . ILE B  1 8   ? -22.762  -33.172 -58.756  1.00 192.23 ? 8   ILE B CB  1 
ATOM   1456  C CG1 . ILE B  1 8   ? -23.036  -32.528 -60.127  1.00 190.06 ? 8   ILE B CG1 1 
ATOM   1457  C CG2 . ILE B  1 8   ? -23.941  -33.085 -57.786  1.00 193.30 ? 8   ILE B CG2 1 
ATOM   1458  C CD1 . ILE B  1 8   ? -22.598  -33.349 -61.323  1.00 192.70 ? 8   ILE B CD1 1 
ATOM   1459  N N   . GLU B  1 9   ? -20.077  -34.558 -58.028  1.00 196.04 ? 9   GLU B N   1 
ATOM   1460  C CA  . GLU B  1 9   ? -19.033  -35.484 -58.459  1.00 198.44 ? 9   GLU B CA  1 
ATOM   1461  C C   . GLU B  1 9   ? -19.297  -36.887 -57.945  1.00 204.90 ? 9   GLU B C   1 
ATOM   1462  O O   . GLU B  1 9   ? -19.655  -37.772 -58.716  1.00 208.65 ? 9   GLU B O   1 
ATOM   1463  C CB  . GLU B  1 9   ? -17.672  -35.005 -57.974  1.00 196.38 ? 9   GLU B CB  1 
ATOM   1464  C CG  . GLU B  1 9   ? -16.575  -35.168 -59.006  1.00 195.51 ? 9   GLU B CG  1 
ATOM   1465  C CD  . GLU B  1 9   ? -15.761  -33.901 -59.181  1.00 191.07 ? 9   GLU B CD  1 
ATOM   1466  O OE1 . GLU B  1 9   ? -14.590  -33.893 -58.754  1.00 190.85 ? 9   GLU B OE1 1 
ATOM   1467  O OE2 . GLU B  1 9   ? -16.292  -32.909 -59.732  1.00 188.47 ? 9   GLU B OE2 1 
ATOM   1468  N N   . ARG B  1 16  ? -20.535  -36.839 -54.813  1.00 211.12 ? 16  ARG B N   1 
ATOM   1469  C CA  . ARG B  1 16  ? -20.226  -35.995 -53.664  1.00 210.41 ? 16  ARG B CA  1 
ATOM   1470  C C   . ARG B  1 16  ? -20.382  -34.503 -54.010  1.00 203.75 ? 16  ARG B C   1 
ATOM   1471  O O   . ARG B  1 16  ? -20.200  -34.120 -55.171  1.00 199.34 ? 16  ARG B O   1 
ATOM   1472  C CB  . ARG B  1 16  ? -18.821  -36.317 -53.144  1.00 212.58 ? 16  ARG B CB  1 
ATOM   1473  C CG  . ARG B  1 16  ? -18.649  -37.746 -52.629  1.00 220.67 ? 16  ARG B CG  1 
ATOM   1474  C CD  . ARG B  1 16  ? -19.187  -37.938 -51.209  1.00 227.50 ? 16  ARG B CD  1 
ATOM   1475  N NE  . ARG B  1 16  ? -18.981  -39.287 -50.672  1.00 236.76 ? 16  ARG B NE  1 
ATOM   1476  C CZ  . ARG B  1 16  ? -19.250  -39.656 -49.420  1.00 245.03 ? 16  ARG B CZ  1 
ATOM   1477  N NH1 . ARG B  1 16  ? -19.027  -40.901 -49.036  1.00 254.30 ? 16  ARG B NH1 1 
ATOM   1478  N NH2 . ARG B  1 16  ? -19.736  -38.790 -48.545  1.00 245.19 ? 16  ARG B NH2 1 
ATOM   1479  N N   . ALA B  1 17  ? -20.716  -33.680 -53.007  1.00 221.82 ? 17  ALA B N   1 
ATOM   1480  C CA  . ALA B  1 17  ? -21.052  -32.253 -53.206  1.00 203.74 ? 17  ALA B CA  1 
ATOM   1481  C C   . ALA B  1 17  ? -19.986  -31.223 -52.722  1.00 193.60 ? 17  ALA B C   1 
ATOM   1482  O O   . ALA B  1 17  ? -19.499  -31.317 -51.600  1.00 200.02 ? 17  ALA B O   1 
ATOM   1483  C CB  . ALA B  1 17  ? -22.410  -31.957 -52.577  1.00 204.50 ? 17  ALA B CB  1 
ATOM   1484  N N   . TYR B  1 18  ? -19.633  -30.253 -53.566  1.00 180.06 ? 18  TYR B N   1 
ATOM   1485  C CA  . TYR B  1 18  ? -18.706  -29.204 -53.179  1.00 171.41 ? 18  TYR B CA  1 
ATOM   1486  C C   . TYR B  1 18  ? -19.336  -27.828 -53.325  1.00 160.57 ? 18  TYR B C   1 
ATOM   1487  O O   . TYR B  1 18  ? -20.267  -27.648 -54.100  1.00 157.38 ? 18  TYR B O   1 
ATOM   1488  C CB  . TYR B  1 18  ? -17.516  -29.165 -54.119  1.00 166.83 ? 18  TYR B CB  1 
ATOM   1489  C CG  . TYR B  1 18  ? -16.697  -30.379 -54.202  1.00 177.68 ? 18  TYR B CG  1 
ATOM   1490  C CD1 . TYR B  1 18  ? -15.706  -30.636 -53.268  1.00 183.69 ? 18  TYR B CD1 1 
ATOM   1491  C CD2 . TYR B  1 18  ? -16.863  -31.239 -55.253  1.00 183.96 ? 18  TYR B CD2 1 
ATOM   1492  C CE1 . TYR B  1 18  ? -14.917  -31.762 -53.358  1.00 195.90 ? 18  TYR B CE1 1 
ATOM   1493  C CE2 . TYR B  1 18  ? -16.097  -32.377 -55.358  1.00 196.99 ? 18  TYR B CE2 1 
ATOM   1494  C CZ  . TYR B  1 18  ? -15.125  -32.636 -54.412  1.00 202.78 ? 18  TYR B CZ  1 
ATOM   1495  O OH  . TYR B  1 18  ? -14.385  -33.788 -54.558  1.00 218.01 ? 18  TYR B OH  1 
ATOM   1496  N N   . ASP B  1 19  ? -18.787  -26.837 -52.635  1.00 156.68 ? 19  ASP B N   1 
ATOM   1497  C CA  . ASP B  1 19  ? -19.006  -25.455 -53.047  1.00 147.60 ? 19  ASP B CA  1 
ATOM   1498  C C   . ASP B  1 19  ? -17.945  -25.100 -54.079  1.00 140.68 ? 19  ASP B C   1 
ATOM   1499  O O   . ASP B  1 19  ? -16.873  -25.703 -54.093  1.00 142.63 ? 19  ASP B O   1 
ATOM   1500  C CB  . ASP B  1 19  ? -18.915  -24.502 -51.865  1.00 149.75 ? 19  ASP B CB  1 
ATOM   1501  C CG  . ASP B  1 19  ? -17.518  -24.418 -51.287  1.00 151.52 ? 19  ASP B CG  1 
ATOM   1502  O OD1 . ASP B  1 19  ? -16.714  -23.609 -51.757  1.00 145.34 ? 19  ASP B OD1 1 
ATOM   1503  O OD2 . ASP B  1 19  ? -17.212  -25.158 -50.346  1.00 160.62 ? 19  ASP B OD2 1 
ATOM   1504  N N   . ILE B  1 20  ? -18.217  -24.108 -54.915  1.00 134.45 ? 20  ILE B N   1 
ATOM   1505  C CA  . ILE B  1 20  ? -17.340  -23.835 -56.041  1.00 130.05 ? 20  ILE B CA  1 
ATOM   1506  C C   . ILE B  1 20  ? -15.858  -23.716 -55.680  1.00 129.10 ? 20  ILE B C   1 
ATOM   1507  O O   . ILE B  1 20  ? -15.004  -24.185 -56.410  1.00 128.98 ? 20  ILE B O   1 
ATOM   1508  C CB  . ILE B  1 20  ? -17.845  -22.659 -56.884  1.00 126.41 ? 20  ILE B CB  1 
ATOM   1509  C CG1 . ILE B  1 20  ? -17.161  -22.644 -58.234  1.00 125.17 ? 20  ILE B CG1 1 
ATOM   1510  C CG2 . ILE B  1 20  ? -17.642  -21.340 -56.171  1.00 125.41 ? 20  ILE B CG2 1 
ATOM   1511  C CD1 . ILE B  1 20  ? -17.711  -23.647 -59.194  1.00 129.28 ? 20  ILE B CD1 1 
ATOM   1512  N N   . TYR B  1 21  ? -15.558  -23.115 -54.543  1.00 130.22 ? 21  TYR B N   1 
ATOM   1513  C CA  . TYR B  1 21  ? -14.164  -22.908 -54.128  1.00 130.41 ? 21  TYR B CA  1 
ATOM   1514  C C   . TYR B  1 21  ? -13.478  -24.227 -53.781  1.00 135.79 ? 21  TYR B C   1 
ATOM   1515  O O   . TYR B  1 21  ? -12.305  -24.428 -54.072  1.00 135.51 ? 21  TYR B O   1 
ATOM   1516  C CB  . TYR B  1 21  ? -14.062  -21.906 -52.960  1.00 133.50 ? 21  TYR B CB  1 
ATOM   1517  C CG  . TYR B  1 21  ? -14.712  -20.588 -53.259  1.00 131.57 ? 21  TYR B CG  1 
ATOM   1518  C CD1 . TYR B  1 21  ? -14.173  -19.737 -54.212  1.00 127.50 ? 21  TYR B CD1 1 
ATOM   1519  C CD2 . TYR B  1 21  ? -15.872  -20.196 -52.614  1.00 135.95 ? 21  TYR B CD2 1 
ATOM   1520  C CE1 . TYR B  1 21  ? -14.766  -18.518 -54.510  1.00 128.74 ? 21  TYR B CE1 1 
ATOM   1521  C CE2 . TYR B  1 21  ? -16.475  -18.988 -52.912  1.00 136.62 ? 21  TYR B CE2 1 
ATOM   1522  C CZ  . TYR B  1 21  ? -15.910  -18.150 -53.860  1.00 133.44 ? 21  TYR B CZ  1 
ATOM   1523  O OH  . TYR B  1 21  ? -16.472  -16.946 -54.188  1.00 136.91 ? 21  TYR B OH  1 
ATOM   1524  N N   . SER B  1 22  ? -14.223  -25.126 -53.165  1.00 142.43 ? 22  SER B N   1 
ATOM   1525  C CA  . SER B  1 22  ? -13.699  -26.432 -52.786  1.00 151.31 ? 22  SER B CA  1 
ATOM   1526  C C   . SER B  1 22  ? -13.402  -27.276 -54.003  1.00 151.78 ? 22  SER B C   1 
ATOM   1527  O O   . SER B  1 22  ? -12.440  -28.049 -54.032  1.00 157.87 ? 22  SER B O   1 
ATOM   1528  C CB  . SER B  1 22  ? -14.722  -27.166 -51.939  1.00 160.48 ? 22  SER B CB  1 
ATOM   1529  O OG  . SER B  1 22  ? -15.044  -26.394 -50.810  1.00 162.67 ? 22  SER B OG  1 
ATOM   1530  N N   . ARG B  1 23  ? -14.267  -27.131 -54.997  1.00 147.56 ? 23  ARG B N   1 
ATOM   1531  C CA  . ARG B  1 23  ? -14.110  -27.804 -56.261  1.00 149.97 ? 23  ARG B CA  1 
ATOM   1532  C C   . ARG B  1 23  ? -12.806  -27.348 -56.903  1.00 146.07 ? 23  ARG B C   1 
ATOM   1533  O O   . ARG B  1 23  ? -12.044  -28.178 -57.390  1.00 152.69 ? 23  ARG B O   1 
ATOM   1534  C CB  . ARG B  1 23  ? -15.325  -27.554 -57.159  1.00 147.35 ? 23  ARG B CB  1 
ATOM   1535  C CG  . ARG B  1 23  ? -15.226  -28.176 -58.537  1.00 152.47 ? 23  ARG B CG  1 
ATOM   1536  C CD  . ARG B  1 23  ? -14.961  -29.676 -58.509  1.00 165.83 ? 23  ARG B CD  1 
ATOM   1537  N NE  . ARG B  1 23  ? -14.577  -30.198 -59.826  1.00 173.28 ? 23  ARG B NE  1 
ATOM   1538  C CZ  . ARG B  1 23  ? -13.344  -30.146 -60.331  1.00 174.37 ? 23  ARG B CZ  1 
ATOM   1539  N NH1 . ARG B  1 23  ? -12.352  -29.598 -59.641  1.00 167.57 ? 23  ARG B NH1 1 
ATOM   1540  N NH2 . ARG B  1 23  ? -13.100  -30.646 -61.535  1.00 183.94 ? 23  ARG B NH2 1 
ATOM   1541  N N   . LEU B  1 24  ? -12.533  -26.047 -56.869  1.00 137.38 ? 24  LEU B N   1 
ATOM   1542  C CA  . LEU B  1 24  ? -11.296  -25.523 -57.420  1.00 134.33 ? 24  LEU B CA  1 
ATOM   1543  C C   . LEU B  1 24  ? -10.094  -25.934 -56.592  1.00 138.12 ? 24  LEU B C   1 
ATOM   1544  O O   . LEU B  1 24  ? -8.990   -26.069 -57.100  1.00 139.41 ? 24  LEU B O   1 
ATOM   1545  C CB  . LEU B  1 24  ? -11.364  -24.000 -57.540  1.00 126.82 ? 24  LEU B CB  1 
ATOM   1546  C CG  . LEU B  1 24  ? -11.628  -23.389 -58.914  1.00 124.88 ? 24  LEU B CG  1 
ATOM   1547  C CD1 . LEU B  1 24  ? -12.755  -24.074 -59.664  1.00 128.52 ? 24  LEU B CD1 1 
ATOM   1548  C CD2 . LEU B  1 24  ? -11.938  -21.918 -58.749  1.00 120.76 ? 24  LEU B CD2 1 
ATOM   1549  N N   . LEU B  1 25  ? -10.309  -26.136 -55.308  1.00 84.62  ? 25  LEU B N   1 
ATOM   1550  C CA  . LEU B  1 25  ? -9.218   -26.464 -54.425  1.00 84.15  ? 25  LEU B CA  1 
ATOM   1551  C C   . LEU B  1 25  ? -8.700   -27.855 -54.784  1.00 86.07  ? 25  LEU B C   1 
ATOM   1552  O O   . LEU B  1 25  ? -7.502   -28.138 -54.684  1.00 86.51  ? 25  LEU B O   1 
ATOM   1553  C CB  . LEU B  1 25  ? -9.664   -26.366 -52.955  1.00 83.15  ? 25  LEU B CB  1 
ATOM   1554  C CG  . LEU B  1 25  ? -8.621   -26.688 -51.884  1.00 82.96  ? 25  LEU B CG  1 
ATOM   1555  C CD1 . LEU B  1 25  ? -7.452   -25.707 -51.916  1.00 82.06  ? 25  LEU B CD1 1 
ATOM   1556  C CD2 . LEU B  1 25  ? -9.248   -26.748 -50.505  1.00 82.70  ? 25  LEU B CD2 1 
ATOM   1557  N N   . LYS B  1 26  ? -9.615   -28.711 -55.228  1.00 87.59  ? 26  LYS B N   1 
ATOM   1558  C CA  . LYS B  1 26  ? -9.289   -30.046 -55.709  1.00 90.03  ? 26  LYS B CA  1 
ATOM   1559  C C   . LYS B  1 26  ? -8.261   -30.001 -56.853  1.00 91.22  ? 26  LYS B C   1 
ATOM   1560  O O   . LYS B  1 26  ? -7.501   -30.954 -57.055  1.00 93.21  ? 26  LYS B O   1 
ATOM   1561  C CB  . LYS B  1 26  ? -10.564  -30.705 -56.205  1.00 91.72  ? 26  LYS B CB  1 
ATOM   1562  C CG  . LYS B  1 26  ? -10.575  -32.214 -56.104  1.00 94.38  ? 26  LYS B CG  1 
ATOM   1563  C CD  . LYS B  1 26  ? -11.863  -32.727 -56.712  1.00 96.33  ? 26  LYS B CD  1 
ATOM   1564  C CE  . LYS B  1 26  ? -11.986  -34.243 -56.593  1.00 99.49  ? 26  LYS B CE  1 
ATOM   1565  N NZ  . LYS B  1 26  ? -11.089  -34.924 -57.547  1.00 101.86 ? 26  LYS B NZ  1 
ATOM   1566  N N   . ASP B  1 27  ? -8.259   -28.894 -57.604  1.00 90.42  ? 27  ASP B N   1 
ATOM   1567  C CA  . ASP B  1 27  ? -7.284   -28.654 -58.671  1.00 91.74  ? 27  ASP B CA  1 
ATOM   1568  C C   . ASP B  1 27  ? -6.138   -27.786 -58.215  1.00 90.39  ? 27  ASP B C   1 
ATOM   1569  O O   . ASP B  1 27  ? -5.477   -27.161 -59.047  1.00 91.16  ? 27  ASP B O   1 
ATOM   1570  C CB  . ASP B  1 27  ? -7.930   -27.981 -59.889  1.00 92.49  ? 27  ASP B CB  1 
ATOM   1571  C CG  . ASP B  1 27  ? -8.980   -28.850 -60.563  1.00 94.59  ? 27  ASP B CG  1 
ATOM   1572  O OD1 . ASP B  1 27  ? -9.652   -28.320 -61.469  1.00 95.38  ? 27  ASP B OD1 1 
ATOM   1573  O OD2 . ASP B  1 27  ? -9.136   -30.051 -60.200  1.00 95.80  ? 27  ASP B OD2 1 
ATOM   1574  N N   . ARG B  1 28  ? -5.910   -27.745 -56.906  1.00 88.76  ? 28  ARG B N   1 
ATOM   1575  C CA  . ARG B  1 28  ? -4.823   -26.958 -56.317  1.00 87.71  ? 28  ARG B CA  1 
ATOM   1576  C C   . ARG B  1 28  ? -4.925   -25.431 -56.544  1.00 86.33  ? 28  ARG B C   1 
ATOM   1577  O O   . ARG B  1 28  ? -3.916   -24.712 -56.493  1.00 86.31  ? 28  ARG B O   1 
ATOM   1578  C CB  . ARG B  1 28  ? -3.459   -27.506 -56.774  1.00 89.85  ? 28  ARG B CB  1 
ATOM   1579  C CG  . ARG B  1 28  ? -3.311   -28.997 -56.510  1.00 91.66  ? 28  ARG B CG  1 
ATOM   1580  C CD  . ARG B  1 28  ? -1.971   -29.537 -56.954  1.00 94.23  ? 28  ARG B CD  1 
ATOM   1581  N NE  . ARG B  1 28  ? -0.860   -29.139 -56.097  1.00 93.77  ? 28  ARG B NE  1 
ATOM   1582  C CZ  . ARG B  1 28  ? -0.615   -29.629 -54.887  1.00 93.51  ? 28  ARG B CZ  1 
ATOM   1583  N NH1 . ARG B  1 28  ? -1.422   -30.526 -54.341  1.00 93.59  ? 28  ARG B NH1 1 
ATOM   1584  N NH2 . ARG B  1 28  ? 0.444    -29.201 -54.212  1.00 93.50  ? 28  ARG B NH2 1 
ATOM   1585  N N   . ILE B  1 29  ? -6.142   -24.946 -56.779  1.00 85.56  ? 29  ILE B N   1 
ATOM   1586  C CA  . ILE B  1 29  ? -6.407   -23.506 -56.873  1.00 84.52  ? 29  ILE B CA  1 
ATOM   1587  C C   . ILE B  1 29  ? -6.960   -22.895 -55.570  1.00 82.59  ? 29  ILE B C   1 
ATOM   1588  O O   . ILE B  1 29  ? -7.916   -23.400 -55.008  1.00 82.15  ? 29  ILE B O   1 
ATOM   1589  C CB  . ILE B  1 29  ? -7.373   -23.191 -58.028  1.00 85.45  ? 29  ILE B CB  1 
ATOM   1590  C CG1 . ILE B  1 29  ? -6.756   -23.638 -59.364  1.00 87.85  ? 29  ILE B CG1 1 
ATOM   1591  C CG2 . ILE B  1 29  ? -7.765   -21.705 -58.001  1.00 84.64  ? 29  ILE B CG2 1 
ATOM   1592  C CD1 . ILE B  1 29  ? -7.735   -23.671 -60.519  1.00 89.41  ? 29  ILE B CD1 1 
ATOM   1593  N N   . ILE B  1 30  ? -6.344   -21.817 -55.098  1.00 81.87  ? 30  ILE B N   1 
ATOM   1594  C CA  . ILE B  1 30  ? -6.846   -21.071 -53.946  1.00 80.55  ? 30  ILE B CA  1 
ATOM   1595  C C   . ILE B  1 30  ? -7.274   -19.669 -54.375  1.00 80.58  ? 30  ILE B C   1 
ATOM   1596  O O   . ILE B  1 30  ? -6.488   -18.940 -55.011  1.00 81.34  ? 30  ILE B O   1 
ATOM   1597  C CB  . ILE B  1 30  ? -5.786   -20.960 -52.850  1.00 80.17  ? 30  ILE B CB  1 
ATOM   1598  C CG1 . ILE B  1 30  ? -5.466   -22.343 -52.294  1.00 80.47  ? 30  ILE B CG1 1 
ATOM   1599  C CG2 . ILE B  1 30  ? -6.259   -20.050 -51.742  1.00 79.32  ? 30  ILE B CG2 1 
ATOM   1600  C CD1 . ILE B  1 30  ? -4.222   -22.350 -51.431  1.00 80.71  ? 30  ILE B CD1 1 
ATOM   1601  N N   . MET B  1 31  ? -8.514   -19.299 -54.045  1.00 80.17  ? 31  MET B N   1 
ATOM   1602  C CA  . MET B  1 31  ? -8.994   -17.922 -54.278  1.00 80.51  ? 31  MET B CA  1 
ATOM   1603  C C   . MET B  1 31  ? -8.832   -16.997 -53.070  1.00 80.02  ? 31  MET B C   1 
ATOM   1604  O O   . MET B  1 31  ? -9.280   -17.311 -51.981  1.00 79.43  ? 31  MET B O   1 
ATOM   1605  C CB  . MET B  1 31  ? -10.452  -17.935 -54.709  1.00 81.00  ? 31  MET B CB  1 
ATOM   1606  C CG  . MET B  1 31  ? -10.729  -18.918 -55.829  1.00 81.85  ? 31  MET B CG  1 
ATOM   1607  S SD  . MET B  1 31  ? -9.763   -18.526 -57.296  1.00 83.30  ? 31  MET B SD  1 
ATOM   1608  C CE  . MET B  1 31  ? -10.563  -17.019 -57.871  1.00 84.49  ? 31  MET B CE  1 
ATOM   1609  N N   . LEU B  1 32  ? -8.158   -15.873 -53.267  1.00 80.68  ? 32  LEU B N   1 
ATOM   1610  C CA  . LEU B  1 32  ? -8.097   -14.814 -52.262  1.00 80.84  ? 32  LEU B CA  1 
ATOM   1611  C C   . LEU B  1 32  ? -8.855   -13.668 -52.859  1.00 82.03  ? 32  LEU B C   1 
ATOM   1612  O O   . LEU B  1 32  ? -8.394   -13.031 -53.794  1.00 83.19  ? 32  LEU B O   1 
ATOM   1613  C CB  . LEU B  1 32  ? -6.653   -14.421 -51.945  1.00 81.21  ? 32  LEU B CB  1 
ATOM   1614  C CG  . LEU B  1 32  ? -6.420   -13.205 -51.046  1.00 82.00  ? 32  LEU B CG  1 
ATOM   1615  C CD1 . LEU B  1 32  ? -7.231   -13.295 -49.764  1.00 81.52  ? 32  LEU B CD1 1 
ATOM   1616  C CD2 . LEU B  1 32  ? -4.943   -13.009 -50.722  1.00 82.63  ? 32  LEU B CD2 1 
ATOM   1617  N N   . GLY B  1 33  ? -10.057  -13.445 -52.353  1.00 82.14  ? 33  GLY B N   1 
ATOM   1618  C CA  . GLY B  1 33  ? -10.949  -12.461 -52.971  1.00 83.65  ? 33  GLY B CA  1 
ATOM   1619  C C   . GLY B  1 33  ? -11.468  -11.439 -51.998  1.00 84.61  ? 33  GLY B C   1 
ATOM   1620  O O   . GLY B  1 33  ? -12.502  -10.841 -52.256  1.00 85.96  ? 33  GLY B O   1 
ATOM   1621  N N   . SER B  1 34  ? -10.757  -11.224 -50.892  1.00 84.33  ? 34  SER B N   1 
ATOM   1622  C CA  . SER B  1 34  ? -11.239  -10.369 -49.834  1.00 85.54  ? 34  SER B CA  1 
ATOM   1623  C C   . SER B  1 34  ? -10.077  -9.666  -49.149  1.00 86.17  ? 34  SER B C   1 
ATOM   1624  O O   . SER B  1 34  ? -8.924   -9.912  -49.495  1.00 85.58  ? 34  SER B O   1 
ATOM   1625  C CB  . SER B  1 34  ? -12.010  -11.221 -48.820  1.00 84.84  ? 34  SER B CB  1 
ATOM   1626  O OG  . SER B  1 34  ? -11.108  -12.066 -48.121  1.00 83.52  ? 34  SER B OG  1 
ATOM   1627  N N   . GLN B  1 35  ? -10.374  -8.808  -48.169  1.00 87.75  ? 35  GLN B N   1 
ATOM   1628  C CA  . GLN B  1 35  ? -9.329   -8.209  -47.367  1.00 88.69  ? 35  GLN B CA  1 
ATOM   1629  C C   . GLN B  1 35  ? -8.688   -9.327  -46.542  1.00 87.06  ? 35  GLN B C   1 
ATOM   1630  O O   . GLN B  1 35  ? -9.316   -10.352 -46.294  1.00 85.77  ? 35  GLN B O   1 
ATOM   1631  C CB  . GLN B  1 35  ? -9.873   -7.059  -46.498  1.00 91.26  ? 35  GLN B CB  1 
ATOM   1632  C CG  . GLN B  1 35  ? -10.547  -7.475  -45.193  1.00 91.46  ? 35  GLN B CG  1 
ATOM   1633  C CD  . GLN B  1 35  ? -11.579  -8.609  -45.382  1.00 89.85  ? 35  GLN B CD  1 
ATOM   1634  O OE1 . GLN B  1 35  ? -12.439  -8.554  -46.289  1.00 89.91  ? 35  GLN B OE1 1 
ATOM   1635  N NE2 . GLN B  1 35  ? -11.484  -9.651  -44.545  1.00 88.75  ? 35  GLN B NE2 1 
ATOM   1636  N N   . ILE B  1 36  ? -7.440   -9.114  -46.148  1.00 87.50  ? 36  ILE B N   1 
ATOM   1637  C CA  . ILE B  1 36  ? -6.662   -10.068 -45.378  1.00 86.51  ? 36  ILE B CA  1 
ATOM   1638  C C   . ILE B  1 36  ? -6.753   -9.779  -43.875  1.00 87.96  ? 36  ILE B C   1 
ATOM   1639  O O   . ILE B  1 36  ? -6.289   -8.764  -43.391  1.00 89.99  ? 36  ILE B O   1 
ATOM   1640  C CB  . ILE B  1 36  ? -5.181   -10.011 -45.813  1.00 86.69  ? 36  ILE B CB  1 
ATOM   1641  C CG1 . ILE B  1 36  ? -5.040   -10.353 -47.300  1.00 85.71  ? 36  ILE B CG1 1 
ATOM   1642  C CG2 . ILE B  1 36  ? -4.319   -10.948 -44.981  1.00 86.17  ? 36  ILE B CG2 1 
ATOM   1643  C CD1 . ILE B  1 36  ? -3.809   -9.769  -47.947  1.00 86.99  ? 36  ILE B CD1 1 
ATOM   1644  N N   . ASP B  1 37  ? -7.361   -10.687 -43.136  1.00 87.30  ? 37  ASP B N   1 
ATOM   1645  C CA  . ASP B  1 37  ? -7.369   -10.615 -41.685  1.00 88.90  ? 37  ASP B CA  1 
ATOM   1646  C C   . ASP B  1 37  ? -7.053   -12.002 -41.143  1.00 87.80  ? 37  ASP B C   1 
ATOM   1647  O O   . ASP B  1 37  ? -6.833   -12.934 -41.929  1.00 85.89  ? 37  ASP B O   1 
ATOM   1648  C CB  . ASP B  1 37  ? -8.730   -10.149 -41.179  1.00 90.35  ? 37  ASP B CB  1 
ATOM   1649  C CG  . ASP B  1 37  ? -9.885   -11.104 -41.575  1.00 88.94  ? 37  ASP B CG  1 
ATOM   1650  O OD1 . ASP B  1 37  ? -11.008  -10.621 -41.817  1.00 89.80  ? 37  ASP B OD1 1 
ATOM   1651  O OD2 . ASP B  1 37  ? -9.711   -12.347 -41.629  1.00 87.33  ? 37  ASP B OD2 1 
ATOM   1652  N N   . ASP B  1 38  ? -7.059   -12.152 -39.820  1.00 89.38  ? 38  ASP B N   1 
ATOM   1653  C CA  . ASP B  1 38  ? -6.712   -13.431 -39.208  1.00 88.97  ? 38  ASP B CA  1 
ATOM   1654  C C   . ASP B  1 38  ? -7.539   -14.641 -39.681  1.00 87.31  ? 38  ASP B C   1 
ATOM   1655  O O   . ASP B  1 38  ? -6.984   -15.742 -39.814  1.00 86.37  ? 38  ASP B O   1 
ATOM   1656  C CB  . ASP B  1 38  ? -6.711   -13.330 -37.690  1.00 91.54  ? 38  ASP B CB  1 
ATOM   1657  C CG  . ASP B  1 38  ? -5.480   -12.610 -37.149  1.00 93.26  ? 38  ASP B CG  1 
ATOM   1658  O OD1 . ASP B  1 38  ? -5.281   -12.595 -35.898  1.00 95.67  ? 38  ASP B OD1 1 
ATOM   1659  O OD2 . ASP B  1 38  ? -4.714   -12.067 -37.975  1.00 92.56  ? 38  ASP B OD2 1 
ATOM   1660  N N   . ASN B  1 39  ? -8.830   -14.455 -39.960  1.00 87.29  ? 39  ASN B N   1 
ATOM   1661  C CA  . ASN B  1 39  ? -9.646   -15.558 -40.491  1.00 86.06  ? 39  ASN B CA  1 
ATOM   1662  C C   . ASN B  1 39  ? -9.235   -15.989 -41.871  1.00 83.93  ? 39  ASN B C   1 
ATOM   1663  O O   . ASN B  1 39  ? -9.060   -17.163 -42.151  1.00 83.05  ? 39  ASN B O   1 
ATOM   1664  C CB  . ASN B  1 39  ? -11.108  -15.187 -40.558  1.00 86.88  ? 39  ASN B CB  1 
ATOM   1665  C CG  . ASN B  1 39  ? -11.823  -15.451 -39.263  1.00 89.10  ? 39  ASN B CG  1 
ATOM   1666  O OD1 . ASN B  1 39  ? -11.203  -15.758 -38.229  1.00 90.24  ? 39  ASN B OD1 1 
ATOM   1667  N ND2 . ASN B  1 39  ? -13.147  -15.312 -39.292  1.00 90.17  ? 39  ASN B ND2 1 
ATOM   1668  N N   . VAL B  1 40  ? -9.111   -15.002 -42.739  1.00 83.55  ? 40  VAL B N   1 
ATOM   1669  C CA  . VAL B  1 40  ? -8.704   -15.251 -44.090  1.00 82.06  ? 40  VAL B CA  1 
ATOM   1670  C C   . VAL B  1 40  ? -7.327   -15.929 -44.099  1.00 81.54  ? 40  VAL B C   1 
ATOM   1671  O O   . VAL B  1 40  ? -7.160   -16.994 -44.721  1.00 80.60  ? 40  VAL B O   1 
ATOM   1672  C CB  . VAL B  1 40  ? -8.742   -13.969 -44.926  1.00 82.40  ? 40  VAL B CB  1 
ATOM   1673  C CG1 . VAL B  1 40  ? -8.080   -14.204 -46.268  1.00 81.37  ? 40  VAL B CG1 1 
ATOM   1674  C CG2 . VAL B  1 40  ? -10.183  -13.535 -45.132  1.00 83.02  ? 40  VAL B CG2 1 
ATOM   1675  N N   . ALA B  1 41  ? -6.371   -15.356 -43.368  1.00 82.54  ? 41  ALA B N   1 
ATOM   1676  C CA  . ALA B  1 41  ? -5.035   -15.939 -43.265  1.00 82.58  ? 41  ALA B CA  1 
ATOM   1677  C C   . ALA B  1 41  ? -5.127   -17.365 -42.796  1.00 82.37  ? 41  ALA B C   1 
ATOM   1678  O O   . ALA B  1 41  ? -4.532   -18.263 -43.392  1.00 81.82  ? 41  ALA B O   1 
ATOM   1679  C CB  . ALA B  1 41  ? -4.172   -15.145 -42.312  1.00 84.24  ? 41  ALA B CB  1 
ATOM   1680  N N   . ASN B  1 42  ? -5.896   -17.578 -41.739  1.00 83.22  ? 42  ASN B N   1 
ATOM   1681  C CA  . ASN B  1 42  ? -6.022   -18.908 -41.186  1.00 83.60  ? 42  ASN B CA  1 
ATOM   1682  C C   . ASN B  1 42  ? -6.579   -19.921 -42.188  1.00 82.40  ? 42  ASN B C   1 
ATOM   1683  O O   . ASN B  1 42  ? -6.169   -21.078 -42.219  1.00 82.60  ? 42  ASN B O   1 
ATOM   1684  C CB  . ASN B  1 42  ? -6.874   -18.869 -39.946  1.00 85.16  ? 42  ASN B CB  1 
ATOM   1685  C CG  . ASN B  1 42  ? -6.597   -20.048 -39.039  1.00 86.50  ? 42  ASN B CG  1 
ATOM   1686  O OD1 . ASN B  1 42  ? -7.541   -20.767 -38.636  1.00 87.29  ? 42  ASN B OD1 1 
ATOM   1687  N ND2 . ASN B  1 42  ? -5.289   -20.292 -38.721  1.00 87.16  ? 42  ASN B ND2 1 
ATOM   1688  N N   . SER B  1 43  ? -7.486   -19.472 -43.037  1.00 81.51  ? 43  SER B N   1 
ATOM   1689  C CA  . SER B  1 43  ? -8.033   -20.316 -44.058  1.00 80.70  ? 43  SER B CA  1 
ATOM   1690  C C   . SER B  1 43  ? -7.009   -20.575 -45.167  1.00 79.95  ? 43  SER B C   1 
ATOM   1691  O O   . SER B  1 43  ? -6.788   -21.731 -45.545  1.00 80.06  ? 43  SER B O   1 
ATOM   1692  C CB  . SER B  1 43  ? -9.268   -19.645 -44.622  1.00 80.40  ? 43  SER B CB  1 
ATOM   1693  O OG  . SER B  1 43  ? -9.967   -20.505 -45.495  1.00 80.08  ? 43  SER B OG  1 
ATOM   1694  N N   . ILE B  1 44  ? -6.395   -19.504 -45.693  1.00 79.64  ? 44  ILE B N   1 
ATOM   1695  C CA  . ILE B  1 44  ? -5.373   -19.623 -46.744  1.00 79.44  ? 44  ILE B CA  1 
ATOM   1696  C C   . ILE B  1 44  ? -4.261   -20.561 -46.278  1.00 80.15  ? 44  ILE B C   1 
ATOM   1697  O O   . ILE B  1 44  ? -3.964   -21.523 -46.961  1.00 80.31  ? 44  ILE B O   1 
ATOM   1698  C CB  . ILE B  1 44  ? -4.763   -18.273 -47.192  1.00 79.63  ? 44  ILE B CB  1 
ATOM   1699  C CG1 . ILE B  1 44  ? -5.830   -17.295 -47.707  1.00 79.39  ? 44  ILE B CG1 1 
ATOM   1700  C CG2 . ILE B  1 44  ? -3.736   -18.496 -48.279  1.00 79.92  ? 44  ILE B CG2 1 
ATOM   1701  C CD1 . ILE B  1 44  ? -6.638   -17.752 -48.905  1.00 78.91  ? 44  ILE B CD1 1 
ATOM   1702  N N   . VAL B  1 45  ? -3.666   -20.298 -45.118  1.00 80.97  ? 45  VAL B N   1 
ATOM   1703  C CA  . VAL B  1 45  ? -2.603   -21.142 -44.586  1.00 82.08  ? 45  VAL B CA  1 
ATOM   1704  C C   . VAL B  1 45  ? -3.068   -22.621 -44.551  1.00 82.37  ? 45  VAL B C   1 
ATOM   1705  O O   . VAL B  1 45  ? -2.369   -23.539 -45.054  1.00 83.05  ? 45  VAL B O   1 
ATOM   1706  C CB  . VAL B  1 45  ? -2.136   -20.650 -43.195  1.00 83.29  ? 45  VAL B CB  1 
ATOM   1707  C CG1 . VAL B  1 45  ? -1.299   -21.693 -42.478  1.00 84.83  ? 45  VAL B CG1 1 
ATOM   1708  C CG2 . VAL B  1 45  ? -1.344   -19.354 -43.309  1.00 83.68  ? 45  VAL B CG2 1 
ATOM   1709  N N   . SER B  1 46  ? -4.255   -22.865 -43.995  1.00 82.26  ? 46  SER B N   1 
ATOM   1710  C CA  . SER B  1 46  ? -4.756   -24.233 -43.937  1.00 82.97  ? 46  SER B CA  1 
ATOM   1711  C C   . SER B  1 46  ? -4.849   -24.873 -45.299  1.00 82.54  ? 46  SER B C   1 
ATOM   1712  O O   . SER B  1 46  ? -4.578   -26.060 -45.450  1.00 83.66  ? 46  SER B O   1 
ATOM   1713  C CB  . SER B  1 46  ? -6.112   -24.273 -43.280  1.00 83.17  ? 46  SER B CB  1 
ATOM   1714  O OG  . SER B  1 46  ? -5.941   -24.014 -41.912  1.00 84.37  ? 46  SER B OG  1 
ATOM   1715  N N   . GLN B  1 47  ? -5.243   -24.093 -46.294  1.00 81.31  ? 47  GLN B N   1 
ATOM   1716  C CA  . GLN B  1 47  ? -5.351   -24.613 -47.645  1.00 81.25  ? 47  GLN B CA  1 
ATOM   1717  C C   . GLN B  1 47  ? -3.975   -24.996 -48.194  1.00 82.11  ? 47  GLN B C   1 
ATOM   1718  O O   . GLN B  1 47  ? -3.785   -26.083 -48.759  1.00 83.20  ? 47  GLN B O   1 
ATOM   1719  C CB  . GLN B  1 47  ? -6.062   -23.618 -48.552  1.00 80.17  ? 47  GLN B CB  1 
ATOM   1720  C CG  . GLN B  1 47  ? -7.575   -23.654 -48.406  1.00 79.95  ? 47  GLN B CG  1 
ATOM   1721  C CD  . GLN B  1 47  ? -8.261   -22.458 -49.033  1.00 79.21  ? 47  GLN B CD  1 
ATOM   1722  O OE1 . GLN B  1 47  ? -8.499   -22.401 -50.235  1.00 79.23  ? 47  GLN B OE1 1 
ATOM   1723  N NE2 . GLN B  1 47  ? -8.598   -21.491 -48.195  1.00 78.96  ? 47  GLN B NE2 1 
ATOM   1724  N N   . LEU B  1 48  ? -3.014   -24.114 -47.985  1.00 82.03  ? 48  LEU B N   1 
ATOM   1725  C CA  . LEU B  1 48  ? -1.650   -24.383 -48.357  1.00 83.26  ? 48  LEU B CA  1 
ATOM   1726  C C   . LEU B  1 48  ? -1.136   -25.657 -47.696  1.00 84.87  ? 48  LEU B C   1 
ATOM   1727  O O   . LEU B  1 48  ? -0.654   -26.546 -48.409  1.00 86.21  ? 48  LEU B O   1 
ATOM   1728  C CB  . LEU B  1 48  ? -0.752   -23.182 -48.048  1.00 83.30  ? 48  LEU B CB  1 
ATOM   1729  C CG  . LEU B  1 48  ? -1.033   -21.915 -48.848  1.00 82.41  ? 48  LEU B CG  1 
ATOM   1730  C CD1 . LEU B  1 48  ? -0.248   -20.781 -48.230  1.00 82.85  ? 48  LEU B CD1 1 
ATOM   1731  C CD2 . LEU B  1 48  ? -0.674   -22.070 -50.313  1.00 83.08  ? 48  LEU B CD2 1 
ATOM   1732  N N   . LEU B  1 49  ? -1.246   -25.771 -46.366  1.00 85.18  ? 49  LEU B N   1 
ATOM   1733  C CA  . LEU B  1 49  ? -0.740   -26.970 -45.677  1.00 87.18  ? 49  LEU B CA  1 
ATOM   1734  C C   . LEU B  1 49  ? -1.404   -28.221 -46.208  1.00 87.94  ? 49  LEU B C   1 
ATOM   1735  O O   . LEU B  1 49  ? -0.732   -29.247 -46.452  1.00 89.95  ? 49  LEU B O   1 
ATOM   1736  C CB  . LEU B  1 49  ? -0.937   -26.885 -44.179  1.00 87.71  ? 49  LEU B CB  1 
ATOM   1737  C CG  . LEU B  1 49  ? -0.028   -25.880 -43.475  1.00 87.98  ? 49  LEU B CG  1 
ATOM   1738  C CD1 . LEU B  1 49  ? -0.296   -25.902 -41.973  1.00 89.03  ? 49  LEU B CD1 1 
ATOM   1739  C CD2 . LEU B  1 49  ? 1.437    -26.143 -43.766  1.00 89.65  ? 49  LEU B CD2 1 
ATOM   1740  N N   . PHE B  1 50  ? -2.712   -28.131 -46.427  1.00 86.72  ? 50  PHE B N   1 
ATOM   1741  C CA  . PHE B  1 50  ? -3.457   -29.276 -46.938  1.00 87.70  ? 50  PHE B CA  1 
ATOM   1742  C C   . PHE B  1 50  ? -2.979   -29.717 -48.307  1.00 88.46  ? 50  PHE B C   1 
ATOM   1743  O O   . PHE B  1 50  ? -2.808   -30.904 -48.531  1.00 90.55  ? 50  PHE B O   1 
ATOM   1744  C CB  . PHE B  1 50  ? -4.935   -28.945 -47.023  1.00 86.43  ? 50  PHE B CB  1 
ATOM   1745  C CG  . PHE B  1 50  ? -5.725   -29.909 -47.857  1.00 87.42  ? 50  PHE B CG  1 
ATOM   1746  C CD1 . PHE B  1 50  ? -6.033   -31.180 -47.387  1.00 89.59  ? 50  PHE B CD1 1 
ATOM   1747  C CD2 . PHE B  1 50  ? -6.177   -29.526 -49.111  1.00 86.56  ? 50  PHE B CD2 1 
ATOM   1748  C CE1 . PHE B  1 50  ? -6.782   -32.052 -48.159  1.00 90.88  ? 50  PHE B CE1 1 
ATOM   1749  C CE2 . PHE B  1 50  ? -6.922   -30.388 -49.890  1.00 87.80  ? 50  PHE B CE2 1 
ATOM   1750  C CZ  . PHE B  1 50  ? -7.222   -31.657 -49.414  1.00 89.96  ? 50  PHE B CZ  1 
ATOM   1751  N N   . LEU B  1 51  ? -2.792   -28.753 -49.209  1.00 87.15  ? 51  LEU B N   1 
ATOM   1752  C CA  . LEU B  1 51  ? -2.357   -29.020 -50.575  1.00 88.13  ? 51  LEU B CA  1 
ATOM   1753  C C   . LEU B  1 51  ? -0.977   -29.658 -50.639  1.00 90.39  ? 51  LEU B C   1 
ATOM   1754  O O   . LEU B  1 51  ? -0.703   -30.510 -51.501  1.00 92.41  ? 51  LEU B O   1 
ATOM   1755  C CB  . LEU B  1 51  ? -2.381   -27.743 -51.402  1.00 86.65  ? 51  LEU B CB  1 
ATOM   1756  C CG  . LEU B  1 51  ? -3.765   -27.289 -51.883  1.00 85.26  ? 51  LEU B CG  1 
ATOM   1757  C CD1 . LEU B  1 51  ? -3.590   -26.110 -52.825  1.00 84.57  ? 51  LEU B CD1 1 
ATOM   1758  C CD2 . LEU B  1 51  ? -4.542   -28.409 -52.566  1.00 86.57  ? 51  LEU B CD2 1 
ATOM   1759  N N   . GLN B  1 52  ? -0.121   -29.259 -49.706  1.00 90.44  ? 52  GLN B N   1 
ATOM   1760  C CA  . GLN B  1 52  ? 1.194    -29.849 -49.610  1.00 92.91  ? 52  GLN B CA  1 
ATOM   1761  C C   . GLN B  1 52  ? 1.098    -31.302 -49.190  1.00 95.21  ? 52  GLN B C   1 
ATOM   1762  O O   . GLN B  1 52  ? 1.691    -32.158 -49.830  1.00 97.74  ? 52  GLN B O   1 
ATOM   1763  C CB  . GLN B  1 52  ? 2.058    -29.093 -48.621  1.00 92.75  ? 52  GLN B CB  1 
ATOM   1764  C CG  . GLN B  1 52  ? 3.463    -29.651 -48.564  1.00 95.68  ? 52  GLN B CG  1 
ATOM   1765  C CD  . GLN B  1 52  ? 4.310    -28.994 -47.492  1.00 96.03  ? 52  GLN B CD  1 
ATOM   1766  O OE1 . GLN B  1 52  ? 3.855    -28.793 -46.372  1.00 95.15  ? 52  GLN B OE1 1 
ATOM   1767  N NE2 . GLN B  1 52  ? 5.558    -28.667 -47.831  1.00 97.74  ? 52  GLN B NE2 1 
ATOM   1768  N N   . ALA B  1 53  ? 0.360    -31.576 -48.118  1.00 94.76  ? 53  ALA B N   1 
ATOM   1769  C CA  . ALA B  1 53  ? 0.148    -32.935 -47.645  1.00 97.23  ? 53  ALA B CA  1 
ATOM   1770  C C   . ALA B  1 53  ? -0.459   -33.861 -48.723  1.00 98.53  ? 53  ALA B C   1 
ATOM   1771  O O   . ALA B  1 53  ? -0.305   -35.074 -48.683  1.00 101.49 ? 53  ALA B O   1 
ATOM   1772  C CB  . ALA B  1 53  ? -0.724   -32.905 -46.405  1.00 96.52  ? 53  ALA B CB  1 
ATOM   1773  N N   . GLN B  1 54  ? -1.143   -33.278 -49.693  1.00 96.67  ? 54  GLN B N   1 
ATOM   1774  C CA  . GLN B  1 54  ? -1.735   -34.054 -50.776  1.00 98.08  ? 54  GLN B CA  1 
ATOM   1775  C C   . GLN B  1 54  ? -0.687   -34.487 -51.789  1.00 100.54 ? 54  GLN B C   1 
ATOM   1776  O O   . GLN B  1 54  ? -0.696   -35.634 -52.261  1.00 103.54 ? 54  GLN B O   1 
ATOM   1777  C CB  . GLN B  1 54  ? -2.777   -33.210 -51.495  1.00 95.62  ? 54  GLN B CB  1 
ATOM   1778  C CG  . GLN B  1 54  ? -4.033   -32.993 -50.677  1.00 94.00  ? 54  GLN B CG  1 
ATOM   1779  C CD  . GLN B  1 54  ? -4.956   -34.193 -50.746  1.00 96.11  ? 54  GLN B CD  1 
ATOM   1780  O OE1 . GLN B  1 54  ? -5.697   -34.343 -51.711  1.00 96.44  ? 54  GLN B OE1 1 
ATOM   1781  N NE2 . GLN B  1 54  ? -4.920   -35.056 -49.726  1.00 97.94  ? 54  GLN B NE2 1 
ATOM   1782  N N   . ASP B  1 55  ? 0.210    -33.549 -52.114  1.00 99.64  ? 55  ASP B N   1 
ATOM   1783  C CA  . ASP B  1 55  ? 1.229    -33.706 -53.150  1.00 101.98 ? 55  ASP B CA  1 
ATOM   1784  C C   . ASP B  1 55  ? 2.226    -32.570 -52.969  1.00 100.88 ? 55  ASP B C   1 
ATOM   1785  O O   . ASP B  1 55  ? 1.866    -31.401 -53.107  1.00 98.20  ? 55  ASP B O   1 
ATOM   1786  C CB  . ASP B  1 55  ? 0.568    -33.612 -54.538  1.00 102.07 ? 55  ASP B CB  1 
ATOM   1787  C CG  . ASP B  1 55  ? 1.541    -33.865 -55.680  1.00 105.16 ? 55  ASP B CG  1 
ATOM   1788  O OD1 . ASP B  1 55  ? 2.642    -33.262 -55.678  1.00 105.53 ? 55  ASP B OD1 1 
ATOM   1789  O OD2 . ASP B  1 55  ? 1.190    -34.666 -56.578  1.00 107.56 ? 55  ASP B OD2 1 
ATOM   1790  N N   . SER B  1 56  ? 3.468    -32.892 -52.652  1.00 103.27 ? 56  SER B N   1 
ATOM   1791  C CA  . SER B  1 56  ? 4.426    -31.834 -52.385  1.00 102.62 ? 56  SER B CA  1 
ATOM   1792  C C   . SER B  1 56  ? 5.237    -31.411 -53.616  1.00 104.30 ? 56  SER B C   1 
ATOM   1793  O O   . SER B  1 56  ? 6.132    -30.557 -53.505  1.00 104.44 ? 56  SER B O   1 
ATOM   1794  C CB  . SER B  1 56  ? 5.335    -32.200 -51.214  1.00 104.27 ? 56  SER B CB  1 
ATOM   1795  O OG  . SER B  1 56  ? 5.846    -33.507 -51.381  1.00 108.05 ? 56  SER B OG  1 
ATOM   1796  N N   . GLU B  1 57  ? 4.906    -31.983 -54.778  1.00 105.89 ? 57  GLU B N   1 
ATOM   1797  C CA  . GLU B  1 57  ? 5.594    -31.660 -56.043  1.00 108.09 ? 57  GLU B CA  1 
ATOM   1798  C C   . GLU B  1 57  ? 4.775    -30.710 -56.901  1.00 105.90 ? 57  GLU B C   1 
ATOM   1799  O O   . GLU B  1 57  ? 5.307    -29.703 -57.377  1.00 105.95 ? 57  GLU B O   1 
ATOM   1800  C CB  . GLU B  1 57  ? 5.842    -32.909 -56.891  1.00 112.21 ? 57  GLU B CB  1 
ATOM   1801  C CG  . GLU B  1 57  ? 5.907    -34.229 -56.138  1.00 114.20 ? 57  GLU B CG  1 
ATOM   1802  C CD  . GLU B  1 57  ? 7.321    -34.580 -55.736  1.00 117.53 ? 57  GLU B CD  1 
ATOM   1803  O OE1 . GLU B  1 57  ? 7.729    -34.130 -54.631  1.00 116.12 ? 57  GLU B OE1 1 
ATOM   1804  O OE2 . GLU B  1 57  ? 8.018    -35.273 -56.536  1.00 121.85 ? 57  GLU B OE2 1 
ATOM   1805  N N   . LYS B  1 58  ? 3.492    -31.049 -57.115  1.00 104.46 ? 58  LYS B N   1 
ATOM   1806  C CA  . LYS B  1 58  ? 2.616    -30.310 -58.039  1.00 103.04 ? 58  LYS B CA  1 
ATOM   1807  C C   . LYS B  1 58  ? 2.347    -28.930 -57.504  1.00 99.65  ? 58  LYS B C   1 
ATOM   1808  O O   . LYS B  1 58  ? 1.926    -28.766 -56.355  1.00 97.22  ? 58  LYS B O   1 
ATOM   1809  C CB  . LYS B  1 58  ? 1.306    -31.056 -58.316  1.00 102.72 ? 58  LYS B CB  1 
ATOM   1810  C CG  . LYS B  1 58  ? 1.409    -32.024 -59.511  1.00 106.61 ? 58  LYS B CG  1 
ATOM   1811  C CD  . LYS B  1 58  ? 0.067    -32.570 -59.995  1.00 106.63 ? 58  LYS B CD  1 
ATOM   1812  C CE  . LYS B  1 58  ? -0.469   -33.588 -59.011  1.00 106.40 ? 58  LYS B CE  1 
ATOM   1813  N NZ  . LYS B  1 58  ? -1.454   -34.474 -59.672  1.00 108.30 ? 58  LYS B NZ  1 
ATOM   1814  N N   . ASP B  1 59  ? 2.636    -27.917 -58.307  1.00 99.92  ? 59  ASP B N   1 
ATOM   1815  C CA  . ASP B  1 59  ? 2.559    -26.585 -57.748  1.00 97.34  ? 59  ASP B CA  1 
ATOM   1816  C C   . ASP B  1 59  ? 1.125    -26.042 -57.631  1.00 94.41  ? 59  ASP B C   1 
ATOM   1817  O O   . ASP B  1 59  ? 0.186    -26.642 -58.168  1.00 94.55  ? 59  ASP B O   1 
ATOM   1818  C CB  . ASP B  1 59  ? 3.619    -25.623 -58.339  1.00 99.05  ? 59  ASP B CB  1 
ATOM   1819  C CG  . ASP B  1 59  ? 3.553    -25.487 -59.828  1.00 101.33 ? 59  ASP B CG  1 
ATOM   1820  O OD1 . ASP B  1 59  ? 2.444    -25.616 -60.383  1.00 100.56 ? 59  ASP B OD1 1 
ATOM   1821  O OD2 . ASP B  1 59  ? 4.596    -25.186 -60.421  1.00 104.11 ? 59  ASP B OD2 1 
ATOM   1822  N N   . ILE B  1 60  ? 0.990    -24.950 -56.868  1.00 92.15  ? 60  ILE B N   1 
ATOM   1823  C CA  . ILE B  1 60  ? -0.286   -24.394 -56.395  1.00 89.45  ? 60  ILE B CA  1 
ATOM   1824  C C   . ILE B  1 60  ? -0.581   -23.043 -57.024  1.00 89.00  ? 60  ILE B C   1 
ATOM   1825  O O   . ILE B  1 60  ? 0.329    -22.246 -57.279  1.00 90.07  ? 60  ILE B O   1 
ATOM   1826  C CB  . ILE B  1 60  ? -0.217   -24.192 -54.895  1.00 87.73  ? 60  ILE B CB  1 
ATOM   1827  C CG1 . ILE B  1 60  ? -0.103   -25.549 -54.202  1.00 88.35  ? 60  ILE B CG1 1 
ATOM   1828  C CG2 . ILE B  1 60  ? -1.430   -23.418 -54.411  1.00 85.41  ? 60  ILE B CG2 1 
ATOM   1829  C CD1 . ILE B  1 60  ? 0.405    -25.492 -52.768  1.00 87.79  ? 60  ILE B CD1 1 
ATOM   1830  N N   . TYR B  1 61  ? -1.855   -22.778 -57.264  1.00 87.78  ? 61  TYR B N   1 
ATOM   1831  C CA  . TYR B  1 61  ? -2.259   -21.529 -57.908  1.00 87.74  ? 61  TYR B CA  1 
ATOM   1832  C C   . TYR B  1 61  ? -3.039   -20.660 -56.936  1.00 85.52  ? 61  TYR B C   1 
ATOM   1833  O O   . TYR B  1 61  ? -4.099   -21.061 -56.455  1.00 84.22  ? 61  TYR B O   1 
ATOM   1834  C CB  . TYR B  1 61  ? -3.086   -21.820 -59.167  1.00 88.96  ? 61  TYR B CB  1 
ATOM   1835  C CG  . TYR B  1 61  ? -2.382   -22.735 -60.138  1.00 91.63  ? 61  TYR B CG  1 
ATOM   1836  C CD1 . TYR B  1 61  ? -2.496   -24.113 -60.031  1.00 92.17  ? 61  TYR B CD1 1 
ATOM   1837  C CD2 . TYR B  1 61  ? -1.587   -22.212 -61.148  1.00 94.08  ? 61  TYR B CD2 1 
ATOM   1838  C CE1 . TYR B  1 61  ? -1.846   -24.947 -60.906  1.00 95.07  ? 61  TYR B CE1 1 
ATOM   1839  C CE2 . TYR B  1 61  ? -0.928   -23.035 -62.043  1.00 97.03  ? 61  TYR B CE2 1 
ATOM   1840  C CZ  . TYR B  1 61  ? -1.063   -24.401 -61.911  1.00 97.49  ? 61  TYR B CZ  1 
ATOM   1841  O OH  . TYR B  1 61  ? -0.412   -25.225 -62.788  1.00 100.85 ? 61  TYR B OH  1 
ATOM   1842  N N   . LEU B  1 62  ? -2.498   -19.479 -56.651  1.00 88.43  ? 62  LEU B N   1 
ATOM   1843  C CA  . LEU B  1 62  ? -3.118   -18.514 -55.734  1.00 87.52  ? 62  LEU B CA  1 
ATOM   1844  C C   . LEU B  1 62  ? -3.597   -17.276 -56.477  1.00 86.66  ? 62  LEU B C   1 
ATOM   1845  O O   . LEU B  1 62  ? -2.806   -16.402 -56.809  1.00 86.70  ? 62  LEU B O   1 
ATOM   1846  C CB  . LEU B  1 62  ? -2.129   -18.119 -54.632  1.00 87.86  ? 62  LEU B CB  1 
ATOM   1847  C CG  . LEU B  1 62  ? -2.642   -17.126 -53.587  1.00 87.05  ? 62  LEU B CG  1 
ATOM   1848  C CD1 . LEU B  1 62  ? -3.842   -17.697 -52.855  1.00 86.74  ? 62  LEU B CD1 1 
ATOM   1849  C CD2 . LEU B  1 62  ? -1.560   -16.739 -52.591  1.00 87.48  ? 62  LEU B CD2 1 
ATOM   1850  N N   . TYR B  1 63  ? -4.885   -17.208 -56.759  1.00 85.99  ? 63  TYR B N   1 
ATOM   1851  C CA  . TYR B  1 63  ? -5.456   -16.006 -57.370  1.00 85.23  ? 63  TYR B CA  1 
ATOM   1852  C C   . TYR B  1 63  ? -5.645   -14.919 -56.330  1.00 84.67  ? 63  TYR B C   1 
ATOM   1853  O O   . TYR B  1 63  ? -6.059   -15.195 -55.212  1.00 84.56  ? 63  TYR B O   1 
ATOM   1854  C CB  . TYR B  1 63  ? -6.779   -16.321 -58.052  1.00 84.83  ? 63  TYR B CB  1 
ATOM   1855  C CG  . TYR B  1 63  ? -6.613   -17.081 -59.348  1.00 85.30  ? 63  TYR B CG  1 
ATOM   1856  C CD1 . TYR B  1 63  ? -6.492   -18.466 -59.352  1.00 85.97  ? 63  TYR B CD1 1 
ATOM   1857  C CD2 . TYR B  1 63  ? -6.581   -16.414 -60.566  1.00 85.17  ? 63  TYR B CD2 1 
ATOM   1858  C CE1 . TYR B  1 63  ? -6.349   -19.169 -60.542  1.00 86.45  ? 63  TYR B CE1 1 
ATOM   1859  C CE2 . TYR B  1 63  ? -6.442   -17.095 -61.757  1.00 85.64  ? 63  TYR B CE2 1 
ATOM   1860  C CZ  . TYR B  1 63  ? -6.327   -18.468 -61.745  1.00 86.26  ? 63  TYR B CZ  1 
ATOM   1861  O OH  . TYR B  1 63  ? -6.188   -19.140 -62.935  1.00 86.77  ? 63  TYR B OH  1 
ATOM   1862  N N   . ILE B  1 64  ? -5.315   -13.690 -56.686  1.00 84.40  ? 64  ILE B N   1 
ATOM   1863  C CA  . ILE B  1 64  ? -5.324   -12.609 -55.712  1.00 83.99  ? 64  ILE B CA  1 
ATOM   1864  C C   . ILE B  1 64  ? -6.081   -11.395 -56.223  1.00 83.40  ? 64  ILE B C   1 
ATOM   1865  O O   . ILE B  1 64  ? -5.686   -10.775 -57.194  1.00 83.51  ? 64  ILE B O   1 
ATOM   1866  C CB  . ILE B  1 64  ? -3.916   -12.143 -55.320  1.00 84.45  ? 64  ILE B CB  1 
ATOM   1867  C CG1 . ILE B  1 64  ? -3.100   -13.270 -54.690  1.00 85.17  ? 64  ILE B CG1 1 
ATOM   1868  C CG2 . ILE B  1 64  ? -4.026   -10.974 -54.373  1.00 84.01  ? 64  ILE B CG2 1 
ATOM   1869  C CD1 . ILE B  1 64  ? -1.625   -12.946 -54.525  1.00 85.83  ? 64  ILE B CD1 1 
ATOM   1870  N N   . ASN B  1 65  ? -7.192   -11.096 -55.563  1.00 82.89  ? 65  ASN B N   1 
ATOM   1871  C CA  . ASN B  1 65  ? -7.959   -9.871  -55.740  1.00 82.42  ? 65  ASN B CA  1 
ATOM   1872  C C   . ASN B  1 65  ? -8.295   -9.361  -54.355  1.00 82.15  ? 65  ASN B C   1 
ATOM   1873  O O   . ASN B  1 65  ? -9.296   -9.780  -53.777  1.00 81.95  ? 65  ASN B O   1 
ATOM   1874  C CB  . ASN B  1 65  ? -9.245   -10.125 -56.509  1.00 82.18  ? 65  ASN B CB  1 
ATOM   1875  C CG  . ASN B  1 65  ? -10.035  -8.858  -56.744  1.00 81.85  ? 65  ASN B CG  1 
ATOM   1876  O OD1 . ASN B  1 65  ? -9.483   -7.772  -56.754  1.00 81.86  ? 65  ASN B OD1 1 
ATOM   1877  N ND2 . ASN B  1 65  ? -11.332  -8.991  -56.939  1.00 81.64  ? 65  ASN B ND2 1 
ATOM   1878  N N   . SER B  1 66  ? -7.444   -8.473  -53.836  1.00 82.22  ? 66  SER B N   1 
ATOM   1879  C CA  . SER B  1 66  ? -7.497   -8.061  -52.451  1.00 82.08  ? 66  SER B CA  1 
ATOM   1880  C C   . SER B  1 66  ? -7.077   -6.613  -52.230  1.00 82.01  ? 66  SER B C   1 
ATOM   1881  O O   . SER B  1 66  ? -6.097   -6.146  -52.802  1.00 82.29  ? 66  SER B O   1 
ATOM   1882  C CB  . SER B  1 66  ? -6.612   -8.986  -51.607  1.00 82.48  ? 66  SER B CB  1 
ATOM   1883  O OG  . SER B  1 66  ? -6.413   -8.446  -50.315  1.00 82.44  ? 66  SER B OG  1 
ATOM   1884  N N   . PRO B  1 67  ? -7.803   -5.896  -51.354  1.00 81.73  ? 67  PRO B N   1 
ATOM   1885  C CA  . PRO B  1 67  ? -7.380   -4.521  -51.017  1.00 81.75  ? 67  PRO B CA  1 
ATOM   1886  C C   . PRO B  1 67  ? -6.294   -4.469  -49.971  1.00 81.99  ? 67  PRO B C   1 
ATOM   1887  O O   . PRO B  1 67  ? -5.829   -3.378  -49.672  1.00 82.08  ? 67  PRO B O   1 
ATOM   1888  C CB  . PRO B  1 67  ? -8.644   -3.900  -50.443  1.00 81.45  ? 67  PRO B CB  1 
ATOM   1889  C CG  . PRO B  1 67  ? -9.452   -5.048  -49.921  1.00 81.34  ? 67  PRO B CG  1 
ATOM   1890  C CD  . PRO B  1 67  ? -9.080   -6.272  -50.702  1.00 81.48  ? 67  PRO B CD  1 
ATOM   1891  N N   . GLY B  1 68  ? -5.890   -5.622  -49.432  1.00 82.18  ? 68  GLY B N   1 
ATOM   1892  C CA  . GLY B  1 68  ? -4.859   -5.685  -48.388  1.00 82.52  ? 68  GLY B CA  1 
ATOM   1893  C C   . GLY B  1 68  ? -5.460   -5.995  -47.024  1.00 82.40  ? 68  GLY B C   1 
ATOM   1894  O O   . GLY B  1 68  ? -6.517   -6.613  -46.924  1.00 82.20  ? 68  GLY B O   1 
ATOM   1895  N N   . GLY B  1 69  ? -4.790   -5.573  -45.957  1.00 82.60  ? 69  GLY B N   1 
ATOM   1896  C CA  . GLY B  1 69  ? -5.289   -5.830  -44.611  1.00 82.58  ? 69  GLY B CA  1 
ATOM   1897  C C   . GLY B  1 69  ? -4.171   -5.974  -43.619  1.00 83.05  ? 69  GLY B C   1 
ATOM   1898  O O   . GLY B  1 69  ? -3.142   -5.367  -43.786  1.00 83.29  ? 69  GLY B O   1 
ATOM   1899  N N   . SER B  1 70  ? -4.382   -6.789  -42.592  1.00 83.27  ? 70  SER B N   1 
ATOM   1900  C CA  . SER B  1 70  ? -3.431   -6.971  -41.509  1.00 83.80  ? 70  SER B CA  1 
ATOM   1901  C C   . SER B  1 70  ? -2.049   -7.449  -41.946  1.00 84.40  ? 70  SER B C   1 
ATOM   1902  O O   . SER B  1 70  ? -1.898   -8.462  -42.644  1.00 84.66  ? 70  SER B O   1 
ATOM   1903  C CB  . SER B  1 70  ? -3.985   -7.951  -40.499  1.00 84.04  ? 70  SER B CB  1 
ATOM   1904  O OG  . SER B  1 70  ? -2.943   -8.386  -39.635  1.00 84.71  ? 70  SER B OG  1 
ATOM   1905  N N   . VAL B  1 71  ? -1.034   -6.710  -41.522  1.00 84.70  ? 71  VAL B N   1 
ATOM   1906  C CA  . VAL B  1 71  ? 0.339    -7.018  -41.907  1.00 85.39  ? 71  VAL B CA  1 
ATOM   1907  C C   . VAL B  1 71  ? 0.772    -8.373  -41.338  1.00 86.11  ? 71  VAL B C   1 
ATOM   1908  O O   . VAL B  1 71  ? 1.377    -9.185  -42.044  1.00 86.64  ? 71  VAL B O   1 
ATOM   1909  C CB  . VAL B  1 71  ? 1.302    -5.898  -41.481  1.00 85.64  ? 71  VAL B CB  1 
ATOM   1910  C CG1 . VAL B  1 71  ? 2.740    -6.374  -41.561  1.00 86.57  ? 71  VAL B CG1 1 
ATOM   1911  C CG2 . VAL B  1 71  ? 1.075    -4.667  -42.356  1.00 85.15  ? 71  VAL B CG2 1 
ATOM   1912  N N   . THR B  1 72  ? 0.445    -8.637  -40.076  1.00 86.23  ? 72  THR B N   1 
ATOM   1913  C CA  . THR B  1 72  ? 0.835    -9.915  -39.490  1.00 87.05  ? 72  THR B CA  1 
ATOM   1914  C C   . THR B  1 72  ? 0.053    -11.055 -40.116  1.00 87.00  ? 72  THR B C   1 
ATOM   1915  O O   . THR B  1 72  ? 0.603    -12.111 -40.363  1.00 87.74  ? 72  THR B O   1 
ATOM   1916  C CB  . THR B  1 72  ? 0.718    -9.957  -37.959  1.00 87.32  ? 72  THR B CB  1 
ATOM   1917  O OG1 . THR B  1 72  ? -0.649   -9.847  -37.567  1.00 86.69  ? 72  THR B OG1 1 
ATOM   1918  C CG2 . THR B  1 72  ? 1.544    -8.860  -37.325  1.00 87.44  ? 72  THR B CG2 1 
ATOM   1919  N N   . ALA B  1 73  ? -1.224   -10.843 -40.406  1.00 86.22  ? 73  ALA B N   1 
ATOM   1920  C CA  . ALA B  1 73  ? -1.981   -11.883 -41.077  1.00 86.19  ? 73  ALA B CA  1 
ATOM   1921  C C   . ALA B  1 73  ? -1.368   -12.169 -42.433  1.00 86.35  ? 73  ALA B C   1 
ATOM   1922  O O   . ALA B  1 73  ? -1.295   -13.315 -42.834  1.00 86.86  ? 73  ALA B O   1 
ATOM   1923  C CB  . ALA B  1 73  ? -3.439   -11.503 -41.214  1.00 85.37  ? 73  ALA B CB  1 
ATOM   1924  N N   . GLY B  1 74  ? -0.919   -11.119 -43.121  1.00 86.01  ? 74  GLY B N   1 
ATOM   1925  C CA  . GLY B  1 74  ? -0.214   -11.251 -44.396  1.00 86.27  ? 74  GLY B CA  1 
ATOM   1926  C C   . GLY B  1 74  ? 1.041    -12.098 -44.247  1.00 87.36  ? 74  GLY B C   1 
ATOM   1927  O O   . GLY B  1 74  ? 1.312    -12.994 -45.061  1.00 87.84  ? 74  GLY B O   1 
ATOM   1928  N N   . PHE B  1 75  ? 1.799    -11.841 -43.190  1.00 87.83  ? 75  PHE B N   1 
ATOM   1929  C CA  . PHE B  1 75  ? 3.021    -12.576 -42.991  1.00 89.00  ? 75  PHE B CA  1 
ATOM   1930  C C   . PHE B  1 75  ? 2.784    -14.032 -42.717  1.00 89.65  ? 75  PHE B C   1 
ATOM   1931  O O   . PHE B  1 75  ? 3.565    -14.861 -43.147  1.00 90.59  ? 75  PHE B O   1 
ATOM   1932  C CB  . PHE B  1 75  ? 3.923    -11.936 -41.938  1.00 89.44  ? 75  PHE B CB  1 
ATOM   1933  C CG  . PHE B  1 75  ? 4.825    -10.876 -42.502  1.00 89.50  ? 75  PHE B CG  1 
ATOM   1934  C CD1 . PHE B  1 75  ? 4.742    -9.564  -42.066  1.00 88.92  ? 75  PHE B CD1 1 
ATOM   1935  C CD2 . PHE B  1 75  ? 5.746    -11.192 -43.511  1.00 90.22  ? 75  PHE B CD2 1 
ATOM   1936  C CE1 . PHE B  1 75  ? 5.571    -8.589  -42.611  1.00 89.07  ? 75  PHE B CE1 1 
ATOM   1937  C CE2 . PHE B  1 75  ? 6.577    -10.227 -44.056  1.00 90.38  ? 75  PHE B CE2 1 
ATOM   1938  C CZ  . PHE B  1 75  ? 6.490    -8.921  -43.602  1.00 89.81  ? 75  PHE B CZ  1 
ATOM   1939  N N   . ALA B  1 76  ? 1.708    -14.365 -42.024  1.00 89.26  ? 76  ALA B N   1 
ATOM   1940  C CA  . ALA B  1 76  ? 1.367    -15.769 -41.834  1.00 89.91  ? 76  ALA B CA  1 
ATOM   1941  C C   . ALA B  1 76  ? 1.250    -16.467 -43.196  1.00 90.00  ? 76  ALA B C   1 
ATOM   1942  O O   . ALA B  1 76  ? 1.742    -17.590 -43.377  1.00 91.01  ? 76  ALA B O   1 
ATOM   1943  C CB  . ALA B  1 76  ? 0.083    -15.911 -41.038  1.00 89.40  ? 76  ALA B CB  1 
ATOM   1944  N N   . ILE B  1 77  ? 0.619    -15.802 -44.156  1.00 89.04  ? 77  ILE B N   1 
ATOM   1945  C CA  . ILE B  1 77  ? 0.488    -16.363 -45.488  1.00 89.08  ? 77  ILE B CA  1 
ATOM   1946  C C   . ILE B  1 77  ? 1.863    -16.405 -46.179  1.00 89.90  ? 77  ILE B C   1 
ATOM   1947  O O   . ILE B  1 77  ? 2.296    -17.453 -46.681  1.00 90.78  ? 77  ILE B O   1 
ATOM   1948  C CB  . ILE B  1 77  ? -0.539   -15.593 -46.334  1.00 87.92  ? 77  ILE B CB  1 
ATOM   1949  C CG1 . ILE B  1 77  ? -1.926   -15.654 -45.679  1.00 87.29  ? 77  ILE B CG1 1 
ATOM   1950  C CG2 . ILE B  1 77  ? -0.567   -16.158 -47.740  1.00 88.05  ? 77  ILE B CG2 1 
ATOM   1951  C CD1 . ILE B  1 77  ? -3.018   -14.889 -46.400  1.00 86.25  ? 77  ILE B CD1 1 
ATOM   1952  N N   . TYR B  1 78  ? 2.554    -15.268 -46.175  1.00 89.71  ? 78  TYR B N   1 
ATOM   1953  C CA  . TYR B  1 78  ? 3.861    -15.155 -46.800  1.00 90.53  ? 78  TYR B CA  1 
ATOM   1954  C C   . TYR B  1 78  ? 4.787    -16.286 -46.340  1.00 91.95  ? 78  TYR B C   1 
ATOM   1955  O O   . TYR B  1 78  ? 5.309    -17.068 -47.149  1.00 92.78  ? 78  TYR B O   1 
ATOM   1956  C CB  . TYR B  1 78  ? 4.484    -13.793 -46.498  1.00 90.28  ? 78  TYR B CB  1 
ATOM   1957  C CG  . TYR B  1 78  ? 5.888    -13.672 -47.032  1.00 91.28  ? 78  TYR B CG  1 
ATOM   1958  C CD1 . TYR B  1 78  ? 6.134    -13.136 -48.300  1.00 91.16  ? 78  TYR B CD1 1 
ATOM   1959  C CD2 . TYR B  1 78  ? 6.984    -14.125 -46.290  1.00 92.48  ? 78  TYR B CD2 1 
ATOM   1960  C CE1 . TYR B  1 78  ? 7.423    -13.043 -48.805  1.00 92.20  ? 78  TYR B CE1 1 
ATOM   1961  C CE2 . TYR B  1 78  ? 8.280    -14.034 -46.787  1.00 93.54  ? 78  TYR B CE2 1 
ATOM   1962  C CZ  . TYR B  1 78  ? 8.492    -13.490 -48.043  1.00 93.40  ? 78  TYR B CZ  1 
ATOM   1963  O OH  . TYR B  1 78  ? 9.770    -13.392 -48.547  1.00 94.55  ? 78  TYR B OH  1 
ATOM   1964  N N   . ASP B  1 79  ? 4.976    -16.372 -45.031  1.00 92.30  ? 79  ASP B N   1 
ATOM   1965  C CA  . ASP B  1 79  ? 5.864    -17.364 -44.466  1.00 93.75  ? 79  ASP B CA  1 
ATOM   1966  C C   . ASP B  1 79  ? 5.431    -18.770 -44.797  1.00 94.33  ? 79  ASP B C   1 
ATOM   1967  O O   . ASP B  1 79  ? 6.264    -19.620 -45.068  1.00 95.63  ? 79  ASP B O   1 
ATOM   1968  C CB  . ASP B  1 79  ? 6.012    -17.168 -42.957  1.00 93.97  ? 79  ASP B CB  1 
ATOM   1969  C CG  . ASP B  1 79  ? 7.105    -16.169 -42.599  1.00 94.27  ? 79  ASP B CG  1 
ATOM   1970  O OD1 . ASP B  1 79  ? 7.335    -15.963 -41.389  1.00 94.53  ? 79  ASP B OD1 1 
ATOM   1971  O OD2 . ASP B  1 79  ? 7.741    -15.607 -43.525  1.00 94.31  ? 79  ASP B OD2 1 
ATOM   1972  N N   . THR B  1 80  ? 4.132    -19.014 -44.806  1.00 93.47  ? 80  THR B N   1 
ATOM   1973  C CA  . THR B  1 80  ? 3.660    -20.335 -45.158  1.00 94.03  ? 80  THR B CA  1 
ATOM   1974  C C   . THR B  1 80  ? 3.950    -20.663 -46.608  1.00 94.28  ? 80  THR B C   1 
ATOM   1975  O O   . THR B  1 80  ? 4.368    -21.775 -46.901  1.00 95.45  ? 80  THR B O   1 
ATOM   1976  C CB  . THR B  1 80  ? 2.179    -20.504 -44.861  1.00 93.12  ? 80  THR B CB  1 
ATOM   1977  O OG1 . THR B  1 80  ? 1.976    -20.273 -43.469  1.00 93.08  ? 80  THR B OG1 1 
ATOM   1978  C CG2 . THR B  1 80  ? 1.716    -21.914 -45.206  1.00 93.83  ? 80  THR B CG2 1 
ATOM   1979  N N   . ILE B  1 81  ? 3.747    -19.696 -47.502  1.00 93.28  ? 81  ILE B N   1 
ATOM   1980  C CA  . ILE B  1 81  ? 4.128    -19.892 -48.890  1.00 93.58  ? 81  ILE B CA  1 
ATOM   1981  C C   . ILE B  1 81  ? 5.605    -20.293 -48.987  1.00 95.10  ? 81  ILE B C   1 
ATOM   1982  O O   . ILE B  1 81  ? 5.919    -21.320 -49.601  1.00 96.11  ? 81  ILE B O   1 
ATOM   1983  C CB  . ILE B  1 81  ? 3.849    -18.667 -49.770  1.00 92.44  ? 81  ILE B CB  1 
ATOM   1984  C CG1 . ILE B  1 81  ? 2.337    -18.440 -49.888  1.00 91.14  ? 81  ILE B CG1 1 
ATOM   1985  C CG2 . ILE B  1 81  ? 4.499    -18.849 -51.149  1.00 93.02  ? 81  ILE B CG2 1 
ATOM   1986  C CD1 . ILE B  1 81  ? 1.938    -17.109 -50.506  1.00 90.00  ? 81  ILE B CD1 1 
ATOM   1987  N N   . GLN B  1 82  ? 6.499    -19.524 -48.356  1.00 95.38  ? 82  GLN B N   1 
ATOM   1988  C CA  . GLN B  1 82  ? 7.943    -19.828 -48.423  1.00 96.93  ? 82  GLN B CA  1 
ATOM   1989  C C   . GLN B  1 82  ? 8.300    -21.182 -47.792  1.00 98.39  ? 82  GLN B C   1 
ATOM   1990  O O   . GLN B  1 82  ? 9.237    -21.869 -48.237  1.00 99.85  ? 82  GLN B O   1 
ATOM   1991  C CB  . GLN B  1 82  ? 8.809    -18.711 -47.811  1.00 96.98  ? 82  GLN B CB  1 
ATOM   1992  C CG  . GLN B  1 82  ? 8.619    -17.308 -48.383  1.00 95.79  ? 82  GLN B CG  1 
ATOM   1993  C CD  . GLN B  1 82  ? 8.147    -17.257 -49.856  1.00 95.25  ? 82  GLN B CD  1 
ATOM   1994  O OE1 . GLN B  1 82  ? 7.295    -16.422 -50.224  1.00 93.93  ? 82  GLN B OE1 1 
ATOM   1995  N NE2 . GLN B  1 82  ? 8.686    -18.134 -50.695  1.00 96.33  ? 82  GLN B NE2 1 
ATOM   1996  N N   . HIS B  1 83  ? 7.532    -21.576 -46.782  1.00 98.10  ? 83  HIS B N   1 
ATOM   1997  C CA  . HIS B  1 83  ? 7.862    -22.751 -46.007  1.00 99.53  ? 83  HIS B CA  1 
ATOM   1998  C C   . HIS B  1 83  ? 7.525    -24.061 -46.675  1.00 100.28 ? 83  HIS B C   1 
ATOM   1999  O O   . HIS B  1 83  ? 8.195    -25.070 -46.427  1.00 101.94 ? 83  HIS B O   1 
ATOM   2000  C CB  . HIS B  1 83  ? 7.212    -22.659 -44.637  1.00 99.07  ? 83  HIS B CB  1 
ATOM   2001  C CG  . HIS B  1 83  ? 7.508    -23.838 -43.751  1.00 100.61 ? 83  HIS B CG  1 
ATOM   2002  N ND1 . HIS B  1 83  ? 6.609    -24.829 -43.542  1.00 100.77 ? 83  HIS B ND1 1 
ATOM   2003  C CD2 . HIS B  1 83  ? 8.657    -24.186 -43.043  1.00 102.21 ? 83  HIS B CD2 1 
ATOM   2004  C CE1 . HIS B  1 83  ? 7.145    -25.757 -42.730  1.00 102.39 ? 83  HIS B CE1 1 
ATOM   2005  N NE2 . HIS B  1 83  ? 8.401    -25.361 -42.422  1.00 103.27 ? 83  HIS B NE2 1 
ATOM   2006  N N   . ILE B  1 84  ? 6.496    -24.078 -47.515  1.00 99.20  ? 84  ILE B N   1 
ATOM   2007  C CA  . ILE B  1 84  ? 6.068    -25.326 -48.128  1.00 99.86  ? 84  ILE B CA  1 
ATOM   2008  C C   . ILE B  1 84  ? 6.891    -25.650 -49.373  1.00 100.77 ? 84  ILE B C   1 
ATOM   2009  O O   . ILE B  1 84  ? 7.513    -24.756 -49.960  1.00 100.48 ? 84  ILE B O   1 
ATOM   2010  C CB  . ILE B  1 84  ? 4.564    -25.353 -48.454  1.00 98.49  ? 84  ILE B CB  1 
ATOM   2011  C CG1 . ILE B  1 84  ? 4.193    -24.211 -49.407  1.00 97.01  ? 84  ILE B CG1 1 
ATOM   2012  C CG2 . ILE B  1 84  ? 3.744    -25.354 -47.170  1.00 98.01  ? 84  ILE B CG2 1 
ATOM   2013  C CD1 . ILE B  1 84  ? 2.881    -24.432 -50.133  1.00 96.02  ? 84  ILE B CD1 1 
ATOM   2014  N N   . LYS B  1 85  ? 6.891    -26.929 -49.757  1.00 101.97 ? 85  LYS B N   1 
ATOM   2015  C CA  . LYS B  1 85  ? 7.667    -27.430 -50.892  1.00 103.11 ? 85  LYS B CA  1 
ATOM   2016  C C   . LYS B  1 85  ? 7.154    -26.980 -52.258  1.00 102.01 ? 85  LYS B C   1 
ATOM   2017  O O   . LYS B  1 85  ? 7.938    -26.502 -53.062  1.00 102.30 ? 85  LYS B O   1 
ATOM   2018  C CB  . LYS B  1 85  ? 7.775    -28.953 -50.857  1.00 104.80 ? 85  LYS B CB  1 
ATOM   2019  C CG  . LYS B  1 85  ? 8.569    -29.473 -49.673  1.00 106.36 ? 85  LYS B CG  1 
ATOM   2020  C CD  . LYS B  1 85  ? 8.795    -30.965 -49.789  1.00 108.27 ? 85  LYS B CD  1 
ATOM   2021  C CE  . LYS B  1 85  ? 10.168   -31.319 -49.243  1.00 110.30 ? 85  LYS B CE  1 
ATOM   2022  N NZ  . LYS B  1 85  ? 10.854   -32.367 -50.067  1.00 112.23 ? 85  LYS B NZ  1 
ATOM   2023  N N   . PRO B  1 86  ? 5.842    -27.134 -52.534  1.00 100.85 ? 86  PRO B N   1 
ATOM   2024  C CA  . PRO B  1 86  ? 5.385    -26.764 -53.873  1.00 99.97  ? 86  PRO B CA  1 
ATOM   2025  C C   . PRO B  1 86  ? 5.612    -25.290 -54.151  1.00 98.84  ? 86  PRO B C   1 
ATOM   2026  O O   . PRO B  1 86  ? 5.609    -24.479 -53.226  1.00 98.17  ? 86  PRO B O   1 
ATOM   2027  C CB  . PRO B  1 86  ? 3.882    -27.059 -53.833  1.00 98.87  ? 86  PRO B CB  1 
ATOM   2028  C CG  . PRO B  1 86  ? 3.714    -28.059 -52.725  1.00 99.77  ? 86  PRO B CG  1 
ATOM   2029  C CD  . PRO B  1 86  ? 4.734    -27.645 -51.702  1.00 100.39 ? 86  PRO B CD  1 
ATOM   2030  N N   . ASP B  1 87  ? 5.856    -24.967 -55.420  1.00 98.76  ? 87  ASP B N   1 
ATOM   2031  C CA  . ASP B  1 87  ? 5.850    -23.587 -55.919  1.00 97.62  ? 87  ASP B CA  1 
ATOM   2032  C C   . ASP B  1 87  ? 4.439    -23.034 -55.814  1.00 95.90  ? 87  ASP B C   1 
ATOM   2033  O O   . ASP B  1 87  ? 3.450    -23.733 -56.081  1.00 95.58  ? 87  ASP B O   1 
ATOM   2034  C CB  . ASP B  1 87  ? 6.307    -23.530 -57.384  1.00 98.07  ? 87  ASP B CB  1 
ATOM   2035  C CG  . ASP B  1 87  ? 7.802    -23.680 -57.536  1.00 99.69  ? 87  ASP B CG  1 
ATOM   2036  O OD1 . ASP B  1 87  ? 8.283    -23.775 -58.688  1.00 100.36 ? 87  ASP B OD1 1 
ATOM   2037  O OD2 . ASP B  1 87  ? 8.507    -23.689 -56.502  1.00 100.38 ? 87  ASP B OD2 1 
ATOM   2038  N N   . VAL B  1 88  ? 4.327    -21.780 -55.413  1.00 94.86  ? 88  VAL B N   1 
ATOM   2039  C CA  . VAL B  1 88  ? 3.016    -21.177 -55.399  1.00 93.33  ? 88  VAL B CA  1 
ATOM   2040  C C   . VAL B  1 88  ? 2.981    -20.099 -56.461  1.00 92.62  ? 88  VAL B C   1 
ATOM   2041  O O   . VAL B  1 88  ? 3.723    -19.120 -56.386  1.00 92.62  ? 88  VAL B O   1 
ATOM   2042  C CB  . VAL B  1 88  ? 2.679    -20.624 -54.009  1.00 92.68  ? 88  VAL B CB  1 
ATOM   2043  C CG1 . VAL B  1 88  ? 1.392    -19.823 -54.062  1.00 91.17  ? 88  VAL B CG1 1 
ATOM   2044  C CG2 . VAL B  1 88  ? 2.602    -21.760 -52.983  1.00 93.44  ? 88  VAL B CG2 1 
ATOM   2045  N N   . GLN B  1 89  ? 2.160    -20.295 -57.484  1.00 92.15  ? 89  GLN B N   1 
ATOM   2046  C CA  . GLN B  1 89  ? 2.015    -19.270 -58.517  1.00 91.50  ? 89  GLN B CA  1 
ATOM   2047  C C   . GLN B  1 89  ? 1.054    -18.277 -57.964  1.00 90.17  ? 89  GLN B C   1 
ATOM   2048  O O   . GLN B  1 89  ? 0.090    -18.668 -57.322  1.00 89.66  ? 89  GLN B O   1 
ATOM   2049  C CB  . GLN B  1 89  ? 1.469    -19.834 -59.832  1.00 91.54  ? 89  GLN B CB  1 
ATOM   2050  C CG  . GLN B  1 89  ? 2.242    -21.062 -60.306  1.00 92.94  ? 89  GLN B CG  1 
ATOM   2051  C CD  . GLN B  1 89  ? 2.136    -21.354 -61.788  1.00 93.22  ? 89  GLN B CD  1 
ATOM   2052  O OE1 . GLN B  1 89  ? 1.654    -20.538 -62.574  1.00 92.45  ? 89  GLN B OE1 1 
ATOM   2053  N NE2 . GLN B  1 89  ? 2.601    -22.537 -62.180  1.00 94.42  ? 89  GLN B NE2 1 
ATOM   2054  N N   . THR B  1 90  ? 1.330    -16.996 -58.185  1.00 89.74  ? 90  THR B N   1 
ATOM   2055  C CA  . THR B  1 90  ? 0.408    -15.933 -57.836  1.00 88.55  ? 90  THR B CA  1 
ATOM   2056  C C   . THR B  1 90  ? -0.120   -15.264 -59.103  1.00 88.06  ? 90  THR B C   1 
ATOM   2057  O O   . THR B  1 90  ? 0.652    -14.915 -60.011  1.00 88.57  ? 90  THR B O   1 
ATOM   2058  C CB  . THR B  1 90  ? 1.061    -14.916 -56.884  1.00 88.46  ? 90  THR B CB  1 
ATOM   2059  O OG1 . THR B  1 90  ? 2.263    -14.406 -57.462  1.00 89.17  ? 90  THR B OG1 1 
ATOM   2060  C CG2 . THR B  1 90  ? 1.413    -15.584 -55.560  1.00 88.89  ? 90  THR B CG2 1 
ATOM   2061  N N   . ILE B  1 91  ? -1.444   -15.122 -59.173  1.00 87.17  ? 91  ILE B N   1 
ATOM   2062  C CA  . ILE B  1 91  ? -2.093   -14.497 -60.312  1.00 86.71  ? 91  ILE B CA  1 
ATOM   2063  C C   . ILE B  1 91  ? -2.987   -13.380 -59.830  1.00 85.77  ? 91  ILE B C   1 
ATOM   2064  O O   . ILE B  1 91  ? -3.969   -13.637 -59.174  1.00 85.26  ? 91  ILE B O   1 
ATOM   2065  C CB  . ILE B  1 91  ? -2.951   -15.501 -61.056  1.00 86.69  ? 91  ILE B CB  1 
ATOM   2066  C CG1 . ILE B  1 91  ? -2.095   -16.688 -61.455  1.00 87.72  ? 91  ILE B CG1 1 
ATOM   2067  C CG2 . ILE B  1 91  ? -3.576   -14.853 -62.275  1.00 86.32  ? 91  ILE B CG2 1 
ATOM   2068  C CD1 . ILE B  1 91  ? -2.749   -18.035 -61.271  1.00 87.90  ? 91  ILE B CD1 1 
ATOM   2069  N N   . CYS B  1 92  ? -2.652   -12.142 -60.161  1.00 85.66  ? 92  CYS B N   1 
ATOM   2070  C CA  . CYS B  1 92  ? -3.462   -11.015 -59.753  1.00 84.90  ? 92  CYS B CA  1 
ATOM   2071  C C   . CYS B  1 92  ? -4.601   -10.726 -60.713  1.00 84.47  ? 92  CYS B C   1 
ATOM   2072  O O   . CYS B  1 92  ? -4.367   -10.404 -61.861  1.00 84.75  ? 92  CYS B O   1 
ATOM   2073  C CB  . CYS B  1 92  ? -2.588   -9.783  -59.633  1.00 85.09  ? 92  CYS B CB  1 
ATOM   2074  S SG  . CYS B  1 92  ? -3.582   -8.318  -59.344  1.00 84.32  ? 92  CYS B SG  1 
ATOM   2075  N N   . ILE B  1 93  ? -5.831   -10.827 -60.239  1.00 83.88  ? 93  ILE B N   1 
ATOM   2076  C CA  . ILE B  1 93  ? -6.993   -10.424 -61.032  1.00 83.50  ? 93  ILE B CA  1 
ATOM   2077  C C   . ILE B  1 93  ? -7.661   -9.258  -60.316  1.00 82.99  ? 93  ILE B C   1 
ATOM   2078  O O   . ILE B  1 93  ? -7.728   -9.252  -59.104  1.00 82.78  ? 93  ILE B O   1 
ATOM   2079  C CB  . ILE B  1 93  ? -8.019   -11.567 -61.185  1.00 83.36  ? 93  ILE B CB  1 
ATOM   2080  C CG1 . ILE B  1 93  ? -8.402   -12.138 -59.830  1.00 83.14  ? 93  ILE B CG1 1 
ATOM   2081  C CG2 . ILE B  1 93  ? -7.456   -12.670 -62.032  1.00 83.92  ? 93  ILE B CG2 1 
ATOM   2082  C CD1 . ILE B  1 93  ? -9.541   -13.109 -59.919  1.00 83.03  ? 93  ILE B CD1 1 
ATOM   2083  N N   . GLY B  1 94  ? -8.162   -8.277  -61.053  1.00 82.89  ? 94  GLY B N   1 
ATOM   2084  C CA  . GLY B  1 94  ? -8.802   -7.113  -60.435  1.00 82.55  ? 94  GLY B CA  1 
ATOM   2085  C C   . GLY B  1 94  ? -7.850   -6.092  -59.816  1.00 82.68  ? 94  GLY B C   1 
ATOM   2086  O O   . GLY B  1 94  ? -7.436   -5.132  -60.486  1.00 82.97  ? 94  GLY B O   1 
ATOM   2087  N N   . MET B  1 95  ? -7.509   -6.294  -58.536  1.00 82.55  ? 95  MET B N   1 
ATOM   2088  C CA  . MET B  1 95  ? -6.658   -5.368  -57.773  1.00 82.67  ? 95  MET B CA  1 
ATOM   2089  C C   . MET B  1 95  ? -5.858   -6.128  -56.734  1.00 82.79  ? 95  MET B C   1 
ATOM   2090  O O   . MET B  1 95  ? -6.389   -7.013  -56.091  1.00 82.58  ? 95  MET B O   1 
ATOM   2091  C CB  . MET B  1 95  ? -7.530   -4.290  -57.109  1.00 82.33  ? 95  MET B CB  1 
ATOM   2092  C CG  . MET B  1 95  ? -6.861   -3.430  -56.038  1.00 82.39  ? 95  MET B CG  1 
ATOM   2093  S SD  . MET B  1 95  ? -5.562   -2.279  -56.610  1.00 82.96  ? 95  MET B SD  1 
ATOM   2094  C CE  . MET B  1 95  ? -6.482   -0.803  -57.149  1.00 82.97  ? 95  MET B CE  1 
ATOM   2095  N N   . ALA B  1 96  ? -4.581   -5.801  -56.591  1.00 83.22  ? 96  ALA B N   1 
ATOM   2096  C CA  . ALA B  1 96  ? -3.780   -6.313  -55.485  1.00 83.42  ? 96  ALA B CA  1 
ATOM   2097  C C   . ALA B  1 96  ? -3.087   -5.131  -54.839  1.00 83.55  ? 96  ALA B C   1 
ATOM   2098  O O   . ALA B  1 96  ? -2.092   -4.606  -55.356  1.00 84.05  ? 96  ALA B O   1 
ATOM   2099  C CB  . ALA B  1 96  ? -2.766   -7.341  -55.949  1.00 84.04  ? 96  ALA B CB  1 
ATOM   2100  N N   . ALA B  1 97  ? -3.625   -4.706  -53.703  1.00 83.17  ? 97  ALA B N   1 
ATOM   2101  C CA  . ALA B  1 97  ? -3.123   -3.522  -53.023  1.00 83.26  ? 97  ALA B CA  1 
ATOM   2102  C C   . ALA B  1 97  ? -2.505   -3.835  -51.676  1.00 83.39  ? 97  ALA B C   1 
ATOM   2103  O O   . ALA B  1 97  ? -2.847   -4.825  -51.034  1.00 83.26  ? 97  ALA B O   1 
ATOM   2104  C CB  . ALA B  1 97  ? -4.229   -2.502  -52.865  1.00 82.83  ? 97  ALA B CB  1 
ATOM   2105  N N   . ALA B  1 98  ? -1.589   -2.966  -51.259  1.00 83.73  ? 98  ALA B N   1 
ATOM   2106  C CA  . ALA B  1 98  ? -0.924   -3.050  -49.956  1.00 83.93  ? 98  ALA B CA  1 
ATOM   2107  C C   . ALA B  1 98  ? -0.442   -4.466  -49.707  1.00 84.25  ? 98  ALA B C   1 
ATOM   2108  O O   . ALA B  1 98  ? 0.260    -5.011  -50.541  1.00 84.73  ? 98  ALA B O   1 
ATOM   2109  C CB  . ALA B  1 98  ? -1.852   -2.573  -48.845  1.00 83.43  ? 98  ALA B CB  1 
ATOM   2110  N N   . MET B  1 99  ? -0.827   -5.072  -48.589  1.00 84.09  ? 99  MET B N   1 
ATOM   2111  C CA  . MET B  1 99  ? -0.391   -6.441  -48.282  1.00 84.52  ? 99  MET B CA  1 
ATOM   2112  C C   . MET B  1 99  ? -0.775   -7.431  -49.386  1.00 84.53  ? 99  MET B C   1 
ATOM   2113  O O   . MET B  1 99  ? -0.119   -8.437  -49.562  1.00 85.12  ? 99  MET B O   1 
ATOM   2114  C CB  . MET B  1 99  ? -0.932   -6.890  -46.929  1.00 84.35  ? 99  MET B CB  1 
ATOM   2115  C CG  . MET B  1 99  ? -0.185   -8.064  -46.322  1.00 85.04  ? 99  MET B CG  1 
ATOM   2116  S SD  . MET B  1 99  ? 1.583    -7.840  -46.002  1.00 85.97  ? 99  MET B SD  1 
ATOM   2117  C CE  . MET B  1 99  ? 1.676    -6.064  -45.681  1.00 85.59  ? 99  MET B CE  1 
ATOM   2118  N N   . GLY B  1 100 ? -1.822   -7.119  -50.142  1.00 83.98  ? 100 GLY B N   1 
ATOM   2119  C CA  . GLY B  1 100 ? -2.187   -7.910  -51.308  1.00 83.99  ? 100 GLY B CA  1 
ATOM   2120  C C   . GLY B  1 100 ? -1.075   -7.967  -52.349  1.00 84.62  ? 100 GLY B C   1 
ATOM   2121  O O   . GLY B  1 100 ? -0.679   -9.043  -52.814  1.00 85.09  ? 100 GLY B O   1 
ATOM   2122  N N   . SER B  1 101 ? -0.564   -6.803  -52.728  1.00 84.71  ? 101 SER B N   1 
ATOM   2123  C CA  . SER B  1 101 ? 0.526    -6.752  -53.684  1.00 85.41  ? 101 SER B CA  1 
ATOM   2124  C C   . SER B  1 101 ? 1.796    -7.369  -53.091  1.00 86.22  ? 101 SER B C   1 
ATOM   2125  O O   . SER B  1 101 ? 2.564    -7.989  -53.805  1.00 86.93  ? 101 SER B O   1 
ATOM   2126  C CB  . SER B  1 101 ? 0.763    -5.318  -54.127  1.00 85.42  ? 101 SER B CB  1 
ATOM   2127  O OG  . SER B  1 101 ? 1.340    -4.557  -53.078  1.00 85.54  ? 101 SER B OG  1 
ATOM   2128  N N   . PHE B  1 102 ? 2.003    -7.218  -51.790  1.00 86.20  ? 102 PHE B N   1 
ATOM   2129  C CA  . PHE B  1 102 ? 3.113    -7.892  -51.123  1.00 87.02  ? 102 PHE B CA  1 
ATOM   2130  C C   . PHE B  1 102 ? 3.079    -9.409  -51.366  1.00 87.43  ? 102 PHE B C   1 
ATOM   2131  O O   . PHE B  1 102 ? 4.110    -10.016 -51.679  1.00 88.37  ? 102 PHE B O   1 
ATOM   2132  C CB  . PHE B  1 102 ? 3.108    -7.593  -49.628  1.00 86.87  ? 102 PHE B CB  1 
ATOM   2133  C CG  . PHE B  1 102 ? 4.310    -8.101  -48.899  1.00 87.80  ? 102 PHE B CG  1 
ATOM   2134  C CD1 . PHE B  1 102 ? 5.496    -7.378  -48.916  1.00 88.47  ? 102 PHE B CD1 1 
ATOM   2135  C CD2 . PHE B  1 102 ? 4.264    -9.285  -48.171  1.00 88.13  ? 102 PHE B CD2 1 
ATOM   2136  C CE1 . PHE B  1 102 ? 6.636    -7.839  -48.243  1.00 89.46  ? 102 PHE B CE1 1 
ATOM   2137  C CE2 . PHE B  1 102 ? 5.399    -9.743  -47.487  1.00 89.13  ? 102 PHE B CE2 1 
ATOM   2138  C CZ  . PHE B  1 102 ? 6.587    -9.019  -47.523  1.00 89.79  ? 102 PHE B CZ  1 
ATOM   2139  N N   . LEU B  1 103 ? 1.902    -10.013 -51.226  1.00 86.82  ? 103 LEU B N   1 
ATOM   2140  C CA  . LEU B  1 103 ? 1.733    -11.444 -51.465  1.00 87.20  ? 103 LEU B CA  1 
ATOM   2141  C C   . LEU B  1 103 ? 1.865    -11.797 -52.960  1.00 87.48  ? 103 LEU B C   1 
ATOM   2142  O O   . LEU B  1 103 ? 2.399    -12.842 -53.316  1.00 88.26  ? 103 LEU B O   1 
ATOM   2143  C CB  . LEU B  1 103 ? 0.393    -11.925 -50.891  1.00 86.52  ? 103 LEU B CB  1 
ATOM   2144  C CG  . LEU B  1 103 ? 0.202    -11.864 -49.363  1.00 86.39  ? 103 LEU B CG  1 
ATOM   2145  C CD1 . LEU B  1 103 ? -1.173   -12.393 -48.984  1.00 85.84  ? 103 LEU B CD1 1 
ATOM   2146  C CD2 . LEU B  1 103 ? 1.270    -12.613 -48.583  1.00 87.37  ? 103 LEU B CD2 1 
ATOM   2147  N N   . LEU B  1 104 ? 1.391    -10.917 -53.832  1.00 86.93  ? 104 LEU B N   1 
ATOM   2148  C CA  . LEU B  1 104 ? 1.535    -11.135 -55.251  1.00 87.22  ? 104 LEU B CA  1 
ATOM   2149  C C   . LEU B  1 104 ? 2.995    -11.373 -55.586  1.00 88.36  ? 104 LEU B C   1 
ATOM   2150  O O   . LEU B  1 104 ? 3.329    -12.326 -56.289  1.00 89.02  ? 104 LEU B O   1 
ATOM   2151  C CB  . LEU B  1 104 ? 1.037    -9.920  -56.023  1.00 86.65  ? 104 LEU B CB  1 
ATOM   2152  C CG  . LEU B  1 104 ? 1.101    -9.979  -57.547  1.00 86.93  ? 104 LEU B CG  1 
ATOM   2153  C CD1 . LEU B  1 104 ? 0.319    -11.164 -58.120  1.00 86.82  ? 104 LEU B CD1 1 
ATOM   2154  C CD2 . LEU B  1 104 ? 0.576    -8.680  -58.102  1.00 86.42  ? 104 LEU B CD2 1 
ATOM   2155  N N   . ALA B  1 105 ? 3.852    -10.498 -55.059  1.00 88.65  ? 105 ALA B N   1 
ATOM   2156  C CA  . ALA B  1 105 ? 5.305    -10.520 -55.268  1.00 89.82  ? 105 ALA B CA  1 
ATOM   2157  C C   . ALA B  1 105 ? 5.983    -11.671 -54.537  1.00 90.68  ? 105 ALA B C   1 
ATOM   2158  O O   . ALA B  1 105 ? 7.169    -11.946 -54.755  1.00 91.84  ? 105 ALA B O   1 
ATOM   2159  C CB  . ALA B  1 105 ? 5.901    -9.202  -54.820  1.00 89.85  ? 105 ALA B CB  1 
ATOM   2160  N N   . ALA B  1 106 ? 5.228    -12.350 -53.679  1.00 90.24  ? 106 ALA B N   1 
ATOM   2161  C CA  . ALA B  1 106 ? 5.789    -13.438 -52.892  1.00 91.11  ? 106 ALA B CA  1 
ATOM   2162  C C   . ALA B  1 106 ? 5.636    -14.829 -53.536  1.00 91.68  ? 106 ALA B C   1 
ATOM   2163  O O   . ALA B  1 106 ? 6.131    -15.833 -53.001  1.00 92.60  ? 106 ALA B O   1 
ATOM   2164  C CB  . ALA B  1 106 ? 5.209    -13.423 -51.492  1.00 90.56  ? 106 ALA B CB  1 
ATOM   2165  N N   . GLY B  1 107 ? 4.958    -14.896 -54.679  1.00 91.22  ? 107 GLY B N   1 
ATOM   2166  C CA  . GLY B  1 107 ? 4.901    -16.142 -55.453  1.00 91.86  ? 107 GLY B CA  1 
ATOM   2167  C C   . GLY B  1 107 ? 6.271    -16.586 -55.934  1.00 93.33  ? 107 GLY B C   1 
ATOM   2168  O O   . GLY B  1 107 ? 7.205    -15.767 -56.008  1.00 93.76  ? 107 GLY B O   1 
ATOM   2169  N N   . ALA B  1 108 ? 6.391    -17.878 -56.250  1.00 94.20  ? 108 ALA B N   1 
ATOM   2170  C CA  . ALA B  1 108 ? 7.617    -18.456 -56.823  1.00 95.76  ? 108 ALA B CA  1 
ATOM   2171  C C   . ALA B  1 108 ? 8.106    -17.652 -58.011  1.00 95.90  ? 108 ALA B C   1 
ATOM   2172  O O   . ALA B  1 108 ? 7.314    -17.325 -58.900  1.00 95.07  ? 108 ALA B O   1 
ATOM   2173  C CB  . ALA B  1 108 ? 7.367    -19.888 -57.250  1.00 96.47  ? 108 ALA B CB  1 
ATOM   2174  N N   . LYS B  1 109 ? 9.402    -17.332 -58.023  1.00 97.04  ? 109 LYS B N   1 
ATOM   2175  C CA  . LYS B  1 109 ? 9.989    -16.512 -59.087  1.00 97.37  ? 109 LYS B CA  1 
ATOM   2176  C C   . LYS B  1 109 ? 9.793    -17.136 -60.468  1.00 97.76  ? 109 LYS B C   1 
ATOM   2177  O O   . LYS B  1 109 ? 9.948    -18.340 -60.647  1.00 98.65  ? 109 LYS B O   1 
ATOM   2178  C CB  . LYS B  1 109 ? 11.463   -16.230 -58.813  1.00 98.78  ? 109 LYS B CB  1 
ATOM   2179  C CG  . LYS B  1 109 ? 11.722   -15.335 -57.603  1.00 98.37  ? 109 LYS B CG  1 
ATOM   2180  C CD  . LYS B  1 109 ? 13.222   -15.151 -57.372  1.00 99.95  ? 109 LYS B CD  1 
ATOM   2181  C CE  . LYS B  1 109 ? 13.551   -14.597 -55.987  1.00 99.81  ? 109 LYS B CE  1 
ATOM   2182  N NZ  . LYS B  1 109 ? 13.011   -13.229 -55.779  1.00 98.46  ? 109 LYS B NZ  1 
ATOM   2183  N N   . GLY B  1 110 ? 9.412    -16.304 -61.432  1.00 97.12  ? 110 GLY B N   1 
ATOM   2184  C CA  . GLY B  1 110 ? 9.073    -16.778 -62.767  1.00 97.31  ? 110 GLY B CA  1 
ATOM   2185  C C   . GLY B  1 110 ? 7.607    -17.120 -62.925  1.00 96.02  ? 110 GLY B C   1 
ATOM   2186  O O   . GLY B  1 110 ? 7.136    -17.274 -64.050  1.00 95.90  ? 110 GLY B O   1 
ATOM   2187  N N   . LYS B  1 111 ? 6.883    -17.237 -61.808  1.00 95.12  ? 111 LYS B N   1 
ATOM   2188  C CA  . LYS B  1 111 ? 5.469    -17.654 -61.826  1.00 94.01  ? 111 LYS B CA  1 
ATOM   2189  C C   . LYS B  1 111 ? 4.547    -16.666 -61.086  1.00 92.56  ? 111 LYS B C   1 
ATOM   2190  O O   . LYS B  1 111 ? 3.581    -17.068 -60.436  1.00 91.82  ? 111 LYS B O   1 
ATOM   2191  C CB  . LYS B  1 111 ? 5.310    -19.078 -61.264  1.00 94.53  ? 111 LYS B CB  1 
ATOM   2192  C CG  . LYS B  1 111 ? 6.261    -20.092 -61.881  1.00 96.13  ? 111 LYS B CG  1 
ATOM   2193  C CD  . LYS B  1 111 ? 5.810    -21.511 -61.626  1.00 96.56  ? 111 LYS B CD  1 
ATOM   2194  C CE  . LYS B  1 111 ? 6.902    -22.498 -61.948  1.00 98.36  ? 111 LYS B CE  1 
ATOM   2195  N NZ  . LYS B  1 111 ? 6.855    -23.597 -60.960  1.00 98.97  ? 111 LYS B NZ  1 
ATOM   2196  N N   . ARG B  1 112 ? 4.851    -15.378 -61.188  1.00 92.25  ? 112 ARG B N   1 
ATOM   2197  C CA  . ARG B  1 112 ? 4.009    -14.350 -60.616  1.00 91.00  ? 112 ARG B CA  1 
ATOM   2198  C C   . ARG B  1 112 ? 3.381    -13.595 -61.782  1.00 90.46  ? 112 ARG B C   1 
ATOM   2199  O O   . ARG B  1 112 ? 4.094    -13.011 -62.591  1.00 91.03  ? 112 ARG B O   1 
ATOM   2200  C CB  . ARG B  1 112 ? 4.834    -13.435 -59.714  1.00 91.17  ? 112 ARG B CB  1 
ATOM   2201  C CG  . ARG B  1 112 ? 5.480    -14.180 -58.562  1.00 91.81  ? 112 ARG B CG  1 
ATOM   2202  C CD  . ARG B  1 112 ? 6.486    -13.322 -57.845  1.00 92.22  ? 112 ARG B CD  1 
ATOM   2203  N NE  . ARG B  1 112 ? 7.355    -12.659 -58.806  1.00 92.93  ? 112 ARG B NE  1 
ATOM   2204  C CZ  . ARG B  1 112 ? 8.362    -11.843 -58.490  1.00 93.51  ? 112 ARG B CZ  1 
ATOM   2205  N NH1 . ARG B  1 112 ? 8.673    -11.576 -57.220  1.00 93.47  ? 112 ARG B NH1 1 
ATOM   2206  N NH2 . ARG B  1 112 ? 9.073    -11.295 -59.464  1.00 94.23  ? 112 ARG B NH2 1 
ATOM   2207  N N   . PHE B  1 113 ? 2.051    -13.631 -61.883  1.00 89.47  ? 113 PHE B N   1 
ATOM   2208  C CA  . PHE B  1 113 ? 1.354    -13.086 -63.056  1.00 89.05  ? 113 PHE B CA  1 
ATOM   2209  C C   . PHE B  1 113 ? 0.329    -12.011 -62.682  1.00 87.95  ? 113 PHE B C   1 
ATOM   2210  O O   . PHE B  1 113 ? -0.047   -11.882 -61.523  1.00 87.41  ? 113 PHE B O   1 
ATOM   2211  C CB  . PHE B  1 113 ? 0.637    -14.211 -63.823  1.00 89.07  ? 113 PHE B CB  1 
ATOM   2212  C CG  . PHE B  1 113 ? 1.511    -15.381 -64.159  1.00 90.20  ? 113 PHE B CG  1 
ATOM   2213  C CD1 . PHE B  1 113 ? 1.600    -16.472 -63.308  1.00 90.51  ? 113 PHE B CD1 1 
ATOM   2214  C CD2 . PHE B  1 113 ? 2.237    -15.399 -65.338  1.00 91.07  ? 113 PHE B CD2 1 
ATOM   2215  C CE1 . PHE B  1 113 ? 2.408    -17.560 -63.631  1.00 91.69  ? 113 PHE B CE1 1 
ATOM   2216  C CE2 . PHE B  1 113 ? 3.053    -16.482 -65.665  1.00 92.24  ? 113 PHE B CE2 1 
ATOM   2217  C CZ  . PHE B  1 113 ? 3.134    -17.571 -64.809  1.00 92.56  ? 113 PHE B CZ  1 
ATOM   2218  N N   . ALA B  1 114 ? -0.120   -11.250 -63.674  1.00 87.72  ? 114 ALA B N   1 
ATOM   2219  C CA  . ALA B  1 114 ? -1.275   -10.380 -63.535  1.00 86.80  ? 114 ALA B CA  1 
ATOM   2220  C C   . ALA B  1 114 ? -2.021   -10.361 -64.853  1.00 86.72  ? 114 ALA B C   1 
ATOM   2221  O O   . ALA B  1 114 ? -1.407   -10.365 -65.913  1.00 87.39  ? 114 ALA B O   1 
ATOM   2222  C CB  . ALA B  1 114 ? -0.848   -8.975  -63.178  1.00 86.75  ? 114 ALA B CB  1 
ATOM   2223  N N   . LEU B  1 115 ? -3.346   -10.324 -64.805  1.00 85.97  ? 115 LEU B N   1 
ATOM   2224  C CA  . LEU B  1 115 ? -4.114   -10.175 -66.034  1.00 85.91  ? 115 LEU B CA  1 
ATOM   2225  C C   . LEU B  1 115 ? -3.990   -8.748  -66.578  1.00 86.02  ? 115 LEU B C   1 
ATOM   2226  O O   . LEU B  1 115 ? -3.636   -7.832  -65.842  1.00 85.91  ? 115 LEU B O   1 
ATOM   2227  C CB  . LEU B  1 115 ? -5.561   -10.607 -65.838  1.00 85.21  ? 115 LEU B CB  1 
ATOM   2228  C CG  . LEU B  1 115 ? -5.752   -12.065 -65.436  1.00 85.23  ? 115 LEU B CG  1 
ATOM   2229  C CD1 . LEU B  1 115 ? -7.146   -12.527 -65.798  1.00 84.81  ? 115 LEU B CD1 1 
ATOM   2230  C CD2 . LEU B  1 115 ? -4.729   -12.923 -66.148  1.00 86.07  ? 115 LEU B CD2 1 
ATOM   2231  N N   . PRO B  1 116 ? -4.238   -8.557  -67.886  1.00 86.32  ? 116 PRO B N   1 
ATOM   2232  C CA  . PRO B  1 116 ? -3.857   -7.280  -68.508  1.00 86.73  ? 116 PRO B CA  1 
ATOM   2233  C C   . PRO B  1 116 ? -4.435   -6.054  -67.800  1.00 86.23  ? 116 PRO B C   1 
ATOM   2234  O O   . PRO B  1 116 ? -3.767   -5.044  -67.690  1.00 86.58  ? 116 PRO B O   1 
ATOM   2235  C CB  . PRO B  1 116 ? -4.414   -7.377  -69.930  1.00 87.01  ? 116 PRO B CB  1 
ATOM   2236  C CG  . PRO B  1 116 ? -4.691   -8.810  -70.146  1.00 86.94  ? 116 PRO B CG  1 
ATOM   2237  C CD  . PRO B  1 116 ? -4.985   -9.420  -68.810  1.00 86.32  ? 116 PRO B CD  1 
ATOM   2238  N N   . ASN B  1 117 ? -5.657   -6.131  -67.311  1.00 85.51  ? 117 ASN B N   1 
ATOM   2239  C CA  . ASN B  1 117 ? -6.250   -4.949  -66.752  1.00 85.18  ? 117 ASN B CA  1 
ATOM   2240  C C   . ASN B  1 117 ? -6.249   -4.886  -65.235  1.00 84.67  ? 117 ASN B C   1 
ATOM   2241  O O   . ASN B  1 117 ? -6.802   -3.951  -64.665  1.00 84.39  ? 117 ASN B O   1 
ATOM   2242  C CB  . ASN B  1 117 ? -7.644   -4.764  -67.303  1.00 84.91  ? 117 ASN B CB  1 
ATOM   2243  C CG  . ASN B  1 117 ? -7.632   -4.473  -68.781  1.00 85.50  ? 117 ASN B CG  1 
ATOM   2244  O OD1 . ASN B  1 117 ? -8.144   -5.269  -69.575  1.00 85.53  ? 117 ASN B OD1 1 
ATOM   2245  N ND2 . ASN B  1 117 ? -7.032   -3.339  -69.169  1.00 86.06  ? 117 ASN B ND2 1 
ATOM   2246  N N   . ALA B  1 118 ? -5.618   -5.867  -64.593  1.00 84.64  ? 118 ALA B N   1 
ATOM   2247  C CA  . ALA B  1 118 ? -5.451   -5.867  -63.155  1.00 84.29  ? 118 ALA B CA  1 
ATOM   2248  C C   . ALA B  1 118 ? -4.566   -4.699  -62.721  1.00 84.58  ? 118 ALA B C   1 
ATOM   2249  O O   . ALA B  1 118 ? -3.750   -4.224  -63.485  1.00 85.19  ? 118 ALA B O   1 
ATOM   2250  C CB  . ALA B  1 118 ? -4.892   -7.190  -62.675  1.00 84.40  ? 118 ALA B CB  1 
ATOM   2251  N N   . GLU B  1 119 ? -4.766   -4.228  -61.496  1.00 84.19  ? 119 GLU B N   1 
ATOM   2252  C CA  . GLU B  1 119 ? -4.052   -3.085  -60.945  1.00 84.42  ? 119 GLU B CA  1 
ATOM   2253  C C   . GLU B  1 119 ? -3.322   -3.524  -59.709  1.00 84.38  ? 119 GLU B C   1 
ATOM   2254  O O   . GLU B  1 119 ? -3.764   -4.445  -58.994  1.00 83.99  ? 119 GLU B O   1 
ATOM   2255  C CB  . GLU B  1 119 ? -5.023   -1.982  -60.552  1.00 84.07  ? 119 GLU B CB  1 
ATOM   2256  C CG  . GLU B  1 119 ? -5.243   -0.945  -61.641  1.00 84.47  ? 119 GLU B CG  1 
ATOM   2257  C CD  . GLU B  1 119 ? -6.367   0.031   -61.293  1.00 84.21  ? 119 GLU B CD  1 
ATOM   2258  O OE1 . GLU B  1 119 ? -6.832   0.747   -62.215  1.00 84.54  ? 119 GLU B OE1 1 
ATOM   2259  O OE2 . GLU B  1 119 ? -6.783   0.079   -60.102  1.00 83.76  ? 119 GLU B OE2 1 
ATOM   2260  N N   . VAL B  1 120 ? -2.199   -2.868  -59.461  1.00 84.88  ? 120 VAL B N   1 
ATOM   2261  C CA  . VAL B  1 120 ? -1.401   -3.143  -58.293  1.00 84.97  ? 120 VAL B CA  1 
ATOM   2262  C C   . VAL B  1 120 ? -1.177   -1.817  -57.623  1.00 85.00  ? 120 VAL B C   1 
ATOM   2263  O O   . VAL B  1 120 ? -0.961   -0.807  -58.297  1.00 85.38  ? 120 VAL B O   1 
ATOM   2264  C CB  . VAL B  1 120 ? -0.060   -3.781  -58.685  1.00 85.75  ? 120 VAL B CB  1 
ATOM   2265  C CG1 . VAL B  1 120 ? 0.850    -3.915  -57.484  1.00 86.00  ? 120 VAL B CG1 1 
ATOM   2266  C CG2 . VAL B  1 120 ? -0.297   -5.140  -59.315  1.00 85.78  ? 120 VAL B CG2 1 
ATOM   2267  N N   . MET B  1 121 ? -1.245   -1.800  -56.303  1.00 84.68  ? 121 MET B N   1 
ATOM   2268  C CA  . MET B  1 121 ? -0.958   -0.579  -55.574  1.00 84.77  ? 121 MET B CA  1 
ATOM   2269  C C   . MET B  1 121 ? -0.038   -0.903  -54.427  1.00 84.98  ? 121 MET B C   1 
ATOM   2270  O O   . MET B  1 121 ? -0.217   -1.908  -53.761  1.00 84.71  ? 121 MET B O   1 
ATOM   2271  C CB  . MET B  1 121 ? -2.255   0.089   -55.101  1.00 84.17  ? 121 MET B CB  1 
ATOM   2272  C CG  . MET B  1 121 ? -2.082   1.465   -54.461  1.00 84.33  ? 121 MET B CG  1 
ATOM   2273  S SD  . MET B  1 121 ? -1.958   1.392   -52.651  1.00 84.04  ? 121 MET B SD  1 
ATOM   2274  C CE  . MET B  1 121 ? -3.702   1.390   -52.163  1.00 83.32  ? 121 MET B CE  1 
ATOM   2275  N N   . ILE B  1 122 ? 0.975    -0.076  -54.228  1.00 85.54  ? 122 ILE B N   1 
ATOM   2276  C CA  . ILE B  1 122 ? 1.866    -0.228  -53.079  1.00 85.81  ? 122 ILE B CA  1 
ATOM   2277  C C   . ILE B  1 122 ? 1.848    1.049   -52.249  1.00 85.77  ? 122 ILE B C   1 
ATOM   2278  O O   . ILE B  1 122 ? 1.640    2.129   -52.799  1.00 85.89  ? 122 ILE B O   1 
ATOM   2279  C CB  . ILE B  1 122 ? 3.299    -0.592  -53.505  1.00 86.73  ? 122 ILE B CB  1 
ATOM   2280  C CG1 . ILE B  1 122 ? 3.849    0.447   -54.478  1.00 87.36  ? 122 ILE B CG1 1 
ATOM   2281  C CG2 . ILE B  1 122 ? 3.327    -1.991  -54.123  1.00 86.84  ? 122 ILE B CG2 1 
ATOM   2282  C CD1 . ILE B  1 122 ? 5.322    0.272   -54.777  1.00 88.42  ? 122 ILE B CD1 1 
ATOM   2283  N N   . HIS B  1 123 ? 2.008    0.928   -50.933  1.00 85.63  ? 123 HIS B N   1 
ATOM   2284  C CA  . HIS B  1 123 ? 2.109    2.092   -50.052  1.00 85.68  ? 123 HIS B CA  1 
ATOM   2285  C C   . HIS B  1 123 ? 2.594    1.659   -48.702  1.00 85.73  ? 123 HIS B C   1 
ATOM   2286  O O   . HIS B  1 123 ? 2.749    0.455   -48.467  1.00 85.71  ? 123 HIS B O   1 
ATOM   2287  C CB  . HIS B  1 123 ? 0.787    2.878   -50.000  1.00 85.10  ? 123 HIS B CB  1 
ATOM   2288  C CG  . HIS B  1 123 ? -0.316   2.233   -49.161  1.00 84.38  ? 123 HIS B CG  1 
ATOM   2289  N ND1 . HIS B  1 123 ? -0.525   0.891   -49.115  1.00 84.13  ? 123 HIS B ND1 1 
ATOM   2290  C CD2 . HIS B  1 123 ? -1.310   2.805   -48.356  1.00 83.96  ? 123 HIS B CD2 1 
ATOM   2291  C CE1 . HIS B  1 123 ? -1.570   0.615   -48.305  1.00 83.59  ? 123 HIS B CE1 1 
ATOM   2292  N NE2 . HIS B  1 123 ? -2.056   1.778   -47.845  1.00 83.49  ? 123 HIS B NE2 1 
ATOM   2293  N N   . GLN B  1 124 ? 2.852    2.611   -47.806  1.00 85.86  ? 124 GLN B N   1 
ATOM   2294  C CA  . GLN B  1 124 ? 3.353    2.265   -46.471  1.00 85.98  ? 124 GLN B CA  1 
ATOM   2295  C C   . GLN B  1 124 ? 2.254    1.696   -45.570  1.00 85.28  ? 124 GLN B C   1 
ATOM   2296  O O   . GLN B  1 124 ? 1.046    1.872   -45.855  1.00 84.70  ? 124 GLN B O   1 
ATOM   2297  C CB  . GLN B  1 124 ? 4.121    3.419   -45.798  1.00 86.48  ? 124 GLN B CB  1 
ATOM   2298  C CG  . GLN B  1 124 ? 3.400    4.745   -45.728  1.00 86.24  ? 124 GLN B CG  1 
ATOM   2299  C CD  . GLN B  1 124 ? 4.214    5.810   -44.994  1.00 86.81  ? 124 GLN B CD  1 
ATOM   2300  O OE1 . GLN B  1 124 ? 4.412    6.914   -45.501  1.00 87.21  ? 124 GLN B OE1 1 
ATOM   2301  N NE2 . GLN B  1 124 ? 4.674    5.491   -43.792  1.00 86.92  ? 124 GLN B NE2 1 
ATOM   2302  N N   . PRO B  1 125 ? 2.665    0.968   -44.512  1.00 85.43  ? 125 PRO B N   1 
ATOM   2303  C CA  . PRO B  1 125 ? 1.661    0.444   -43.593  1.00 84.89  ? 125 PRO B CA  1 
ATOM   2304  C C   . PRO B  1 125 ? 0.986    1.558   -42.753  1.00 84.59  ? 125 PRO B C   1 
ATOM   2305  O O   . PRO B  1 125 ? 1.577    2.628   -42.503  1.00 84.92  ? 125 PRO B O   1 
ATOM   2306  C CB  . PRO B  1 125 ? 2.453    -0.530  -42.711  1.00 85.34  ? 125 PRO B CB  1 
ATOM   2307  C CG  . PRO B  1 125 ? 3.874    -0.126  -42.843  1.00 86.12  ? 125 PRO B CG  1 
ATOM   2308  C CD  . PRO B  1 125 ? 4.041    0.596   -44.136  1.00 86.21  ? 125 PRO B CD  1 
ATOM   2309  N N   . LEU B  1 126 ? -0.252   1.293   -42.346  1.00 84.04  ? 126 LEU B N   1 
ATOM   2310  C CA  . LEU B  1 126 ? -1.042   2.209   -41.545  1.00 83.80  ? 126 LEU B CA  1 
ATOM   2311  C C   . LEU B  1 126 ? -1.221   1.633   -40.151  1.00 83.79  ? 126 LEU B C   1 
ATOM   2312  O O   . LEU B  1 126 ? -1.289   0.440   -39.986  1.00 83.77  ? 126 LEU B O   1 
ATOM   2313  C CB  . LEU B  1 126 ? -2.410   2.379   -42.198  1.00 83.32  ? 126 LEU B CB  1 
ATOM   2314  C CG  . LEU B  1 126 ? -2.427   2.784   -43.682  1.00 83.33  ? 126 LEU B CG  1 
ATOM   2315  C CD1 . LEU B  1 126 ? -3.644   2.222   -44.425  1.00 82.89  ? 126 LEU B CD1 1 
ATOM   2316  C CD2 . LEU B  1 126 ? -2.350   4.304   -43.812  1.00 83.58  ? 126 LEU B CD2 1 
ATOM   2317  N N   . GLY B  1 127 ? -1.318   2.475   -39.142  1.00 83.87  ? 127 GLY B N   1 
ATOM   2318  C CA  . GLY B  1 127 ? -1.592   1.986   -37.799  1.00 83.90  ? 127 GLY B CA  1 
ATOM   2319  C C   . GLY B  1 127 ? -2.136   3.103   -36.930  1.00 83.88  ? 127 GLY B C   1 
ATOM   2320  O O   . GLY B  1 127 ? -2.637   4.118   -37.420  1.00 83.77  ? 127 GLY B O   1 
ATOM   2321  N N   . GLY B  1 128 ? -2.028   2.918   -35.625  1.00 84.09  ? 128 GLY B N   1 
ATOM   2322  C CA  . GLY B  1 128 ? -2.488   3.916   -34.678  1.00 84.17  ? 128 GLY B CA  1 
ATOM   2323  C C   . GLY B  1 128 ? -1.838   3.705   -33.324  1.00 84.58  ? 128 GLY B C   1 
ATOM   2324  O O   . GLY B  1 128 ? -1.302   2.630   -33.031  1.00 84.78  ? 128 GLY B O   1 
ATOM   2325  N N   . ALA B  1 129 ? -1.879   4.734   -32.485  1.00 84.79  ? 129 ALA B N   1 
ATOM   2326  C CA  . ALA B  1 129 ? -1.386   4.627   -31.105  1.00 85.21  ? 129 ALA B CA  1 
ATOM   2327  C C   . ALA B  1 129 ? -2.192   5.573   -30.260  1.00 85.26  ? 129 ALA B C   1 
ATOM   2328  O O   . ALA B  1 129 ? -2.446   6.694   -30.669  1.00 85.23  ? 129 ALA B O   1 
ATOM   2329  C CB  . ALA B  1 129 ? 0.095    4.973   -31.024  1.00 85.70  ? 129 ALA B CB  1 
ATOM   2330  N N   . GLN B  1 130 ? -2.611   5.107   -29.099  1.00 85.43  ? 130 GLN B N   1 
ATOM   2331  C CA  . GLN B  1 130 ? -3.376   5.916   -28.179  1.00 85.59  ? 130 GLN B CA  1 
ATOM   2332  C C   . GLN B  1 130 ? -2.722   5.822   -26.799  1.00 86.10  ? 130 GLN B C   1 
ATOM   2333  O O   . GLN B  1 130 ? -2.194   4.777   -26.416  1.00 86.29  ? 130 GLN B O   1 
ATOM   2334  C CB  . GLN B  1 130 ? -4.804   5.398   -28.154  1.00 85.34  ? 130 GLN B CB  1 
ATOM   2335  C CG  . GLN B  1 130 ? -5.838   6.397   -27.665  1.00 85.49  ? 130 GLN B CG  1 
ATOM   2336  C CD  . GLN B  1 130 ? -5.954   7.637   -28.559  1.00 85.40  ? 130 GLN B CD  1 
ATOM   2337  O OE1 . GLN B  1 130 ? -5.712   7.588   -29.792  1.00 85.10  ? 130 GLN B OE1 1 
ATOM   2338  N NE2 . GLN B  1 130 ? -6.331   8.774   -27.938  1.00 85.78  ? 130 GLN B NE2 1 
ATOM   2339  N N   . GLY B  1 131 ? -2.702   6.908   -26.052  1.00 86.42  ? 131 GLY B N   1 
ATOM   2340  C CA  . GLY B  1 131 ? -2.236   6.798   -24.681  1.00 86.93  ? 131 GLY B CA  1 
ATOM   2341  C C   . GLY B  1 131 ? -1.080   7.680   -24.290  1.00 87.37  ? 131 GLY B C   1 
ATOM   2342  O O   . GLY B  1 131 ? -0.946   8.813   -24.763  1.00 87.38  ? 131 GLY B O   1 
ATOM   2343  N N   . GLN B  1 132 ? -0.253   7.153   -23.398  1.00 87.83  ? 132 GLN B N   1 
ATOM   2344  C CA  . GLN B  1 132 ? 0.874    7.893   -22.865  1.00 88.36  ? 132 GLN B CA  1 
ATOM   2345  C C   . GLN B  1 132 ? 1.994    8.062   -23.896  1.00 88.39  ? 132 GLN B C   1 
ATOM   2346  O O   . GLN B  1 132 ? 2.148    7.240   -24.827  1.00 88.11  ? 132 GLN B O   1 
ATOM   2347  C CB  . GLN B  1 132 ? 1.415    7.174   -21.642  1.00 88.93  ? 132 GLN B CB  1 
ATOM   2348  C CG  . GLN B  1 132 ? 0.479    7.126   -20.436  1.00 89.12  ? 132 GLN B CG  1 
ATOM   2349  C CD  . GLN B  1 132 ? 1.152    6.524   -19.216  1.00 89.81  ? 132 GLN B CD  1 
ATOM   2350  O OE1 . GLN B  1 132 ? 1.532    5.365   -19.221  1.00 89.98  ? 132 GLN B OE1 1 
ATOM   2351  N NE2 . GLN B  1 132 ? 1.316    7.319   -18.177  1.00 90.29  ? 132 GLN B NE2 1 
ATOM   2352  N N   . ALA B  1 133 ? 2.775    9.132   -23.720  1.00 88.81  ? 133 ALA B N   1 
ATOM   2353  C CA  . ALA B  1 133 ? 3.928    9.407   -24.583  1.00 89.04  ? 133 ALA B CA  1 
ATOM   2354  C C   . ALA B  1 133 ? 4.809    8.152   -24.795  1.00 89.25  ? 133 ALA B C   1 
ATOM   2355  O O   . ALA B  1 133 ? 5.160    7.803   -25.927  1.00 89.09  ? 133 ALA B O   1 
ATOM   2356  C CB  . ALA B  1 133 ? 4.727    10.575  -24.026  1.00 89.67  ? 133 ALA B CB  1 
ATOM   2357  N N   . THR B  1 134 ? 5.124    7.475   -23.698  1.00 89.68  ? 134 THR B N   1 
ATOM   2358  C CA  . THR B  1 134 ? 5.876    6.233   -23.701  1.00 90.05  ? 134 THR B CA  1 
ATOM   2359  C C   . THR B  1 134 ? 5.226    5.152   -24.581  1.00 89.50  ? 134 THR B C   1 
ATOM   2360  O O   . THR B  1 134 ? 5.892    4.501   -25.390  1.00 89.64  ? 134 THR B O   1 
ATOM   2361  C CB  . THR B  1 134 ? 6.027    5.759   -22.248  1.00 90.62  ? 134 THR B CB  1 
ATOM   2362  O OG1 . THR B  1 134 ? 6.885    6.679   -21.577  1.00 91.25  ? 134 THR B OG1 1 
ATOM   2363  C CG2 . THR B  1 134 ? 6.634    4.359   -22.142  1.00 91.11  ? 134 THR B CG2 1 
ATOM   2364  N N   . GLU B  1 135 ? 3.922    4.978   -24.432  1.00 88.94  ? 135 GLU B N   1 
ATOM   2365  C CA  . GLU B  1 135 ? 3.170    4.003   -25.233  1.00 88.42  ? 135 GLU B CA  1 
ATOM   2366  C C   . GLU B  1 135 ? 3.156    4.330   -26.720  1.00 87.94  ? 135 GLU B C   1 
ATOM   2367  O O   . GLU B  1 135 ? 3.297    3.440   -27.556  1.00 87.82  ? 135 GLU B O   1 
ATOM   2368  C CB  . GLU B  1 135 ? 1.736    3.887   -24.727  1.00 88.02  ? 135 GLU B CB  1 
ATOM   2369  C CG  . GLU B  1 135 ? 1.634    3.214   -23.374  1.00 88.53  ? 135 GLU B CG  1 
ATOM   2370  C CD  . GLU B  1 135 ? 0.253    3.338   -22.750  1.00 88.30  ? 135 GLU B CD  1 
ATOM   2371  O OE1 . GLU B  1 135 ? -0.419   4.395   -22.869  1.00 87.98  ? 135 GLU B OE1 1 
ATOM   2372  O OE2 . GLU B  1 135 ? -0.176   2.356   -22.116  1.00 88.54  ? 135 GLU B OE2 1 
ATOM   2373  N N   . ILE B  1 136 ? 2.988    5.614   -27.037  1.00 87.76  ? 136 ILE B N   1 
ATOM   2374  C CA  . ILE B  1 136 ? 2.982    6.064   -28.415  1.00 87.42  ? 136 ILE B CA  1 
ATOM   2375  C C   . ILE B  1 136 ? 4.326    5.794   -29.048  1.00 87.87  ? 136 ILE B C   1 
ATOM   2376  O O   . ILE B  1 136 ? 4.397    5.309   -30.197  1.00 87.65  ? 136 ILE B O   1 
ATOM   2377  C CB  . ILE B  1 136 ? 2.584    7.533   -28.520  1.00 87.33  ? 136 ILE B CB  1 
ATOM   2378  C CG1 . ILE B  1 136 ? 1.108    7.662   -28.187  1.00 86.88  ? 136 ILE B CG1 1 
ATOM   2379  C CG2 . ILE B  1 136 ? 2.819    8.088   -29.912  1.00 87.20  ? 136 ILE B CG2 1 
ATOM   2380  C CD1 . ILE B  1 136 ? 0.698    9.082   -27.854  1.00 87.03  ? 136 ILE B CD1 1 
ATOM   2381  N N   . GLU B  1 137 ? 5.389    6.075   -28.285  1.00 88.57  ? 137 GLU B N   1 
ATOM   2382  C CA  . GLU B  1 137 ? 6.758    5.803   -28.726  1.00 89.21  ? 137 GLU B CA  1 
ATOM   2383  C C   . GLU B  1 137 ? 6.982    4.331   -29.048  1.00 89.32  ? 137 GLU B C   1 
ATOM   2384  O O   . GLU B  1 137 ? 7.536    3.998   -30.100  1.00 89.45  ? 137 GLU B O   1 
ATOM   2385  C CB  . GLU B  1 137 ? 7.759    6.271   -27.689  1.00 90.02  ? 137 GLU B CB  1 
ATOM   2386  C CG  . GLU B  1 137 ? 9.195    6.177   -28.158  1.00 90.83  ? 137 GLU B CG  1 
ATOM   2387  C CD  . GLU B  1 137 ? 10.154   6.413   -27.034  1.00 91.71  ? 137 GLU B CD  1 
ATOM   2388  O OE1 . GLU B  1 137 ? 9.778    6.141   -25.867  1.00 91.73  ? 137 GLU B OE1 1 
ATOM   2389  O OE2 . GLU B  1 137 ? 11.284   6.859   -27.346  1.00 92.43  ? 137 GLU B OE2 1 
ATOM   2390  N N   . ILE B  1 138 ? 6.537    3.457   -28.159  1.00 89.33  ? 138 ILE B N   1 
ATOM   2391  C CA  . ILE B  1 138 ? 6.636    2.038   -28.428  1.00 89.48  ? 138 ILE B CA  1 
ATOM   2392  C C   . ILE B  1 138 ? 5.905    1.632   -29.713  1.00 88.79  ? 138 ILE B C   1 
ATOM   2393  O O   . ILE B  1 138 ? 6.467    0.883   -30.530  1.00 89.05  ? 138 ILE B O   1 
ATOM   2394  C CB  . ILE B  1 138 ? 6.166    1.215   -27.231  1.00 89.67  ? 138 ILE B CB  1 
ATOM   2395  C CG1 . ILE B  1 138 ? 7.204    1.303   -26.121  1.00 90.60  ? 138 ILE B CG1 1 
ATOM   2396  C CG2 . ILE B  1 138 ? 5.925    -0.233  -27.628  1.00 89.71  ? 138 ILE B CG2 1 
ATOM   2397  C CD1 . ILE B  1 138 ? 6.622    1.152   -24.737  1.00 90.73  ? 138 ILE B CD1 1 
ATOM   2398  N N   . ALA B  1 139 ? 4.687    2.136   -29.900  1.00 88.01  ? 139 ALA B N   1 
ATOM   2399  C CA  . ALA B  1 139 ? 3.938    1.856   -31.120  1.00 87.37  ? 139 ALA B CA  1 
ATOM   2400  C C   . ALA B  1 139 ? 4.608    2.403   -32.384  1.00 87.42  ? 139 ALA B C   1 
ATOM   2401  O O   . ALA B  1 139 ? 4.641    1.718   -33.416  1.00 87.30  ? 139 ALA B O   1 
ATOM   2402  C CB  . ALA B  1 139 ? 2.527    2.389   -31.009  1.00 86.67  ? 139 ALA B CB  1 
ATOM   2403  N N   . ALA B  1 140 ? 5.115    3.635   -32.301  1.00 87.64  ? 140 ALA B N   1 
ATOM   2404  C CA  . ALA B  1 140 ? 5.806    4.266   -33.427  1.00 87.84  ? 140 ALA B CA  1 
ATOM   2405  C C   . ALA B  1 140 ? 7.040    3.457   -33.854  1.00 88.55  ? 140 ALA B C   1 
ATOM   2406  O O   . ALA B  1 140 ? 7.218    3.169   -35.050  1.00 88.52  ? 140 ALA B O   1 
ATOM   2407  C CB  . ALA B  1 140 ? 6.210    5.685   -33.083  1.00 88.15  ? 140 ALA B CB  1 
ATOM   2408  N N   . ASN B  1 141 ? 7.884    3.089   -32.883  1.00 89.25  ? 141 ASN B N   1 
ATOM   2409  C CA  . ASN B  1 141 ? 9.020    2.239   -33.143  1.00 90.07  ? 141 ASN B CA  1 
ATOM   2410  C C   . ASN B  1 141 ? 8.614    0.944   -33.821  1.00 89.84  ? 141 ASN B C   1 
ATOM   2411  O O   . ASN B  1 141 ? 9.232    0.546   -34.801  1.00 90.21  ? 141 ASN B O   1 
ATOM   2412  C CB  . ASN B  1 141 ? 9.766    1.937   -31.858  1.00 90.85  ? 141 ASN B CB  1 
ATOM   2413  C CG  . ASN B  1 141 ? 10.521   3.137   -31.329  1.00 91.36  ? 141 ASN B CG  1 
ATOM   2414  O OD1 . ASN B  1 141 ? 10.740   4.129   -32.041  1.00 91.33  ? 141 ASN B OD1 1 
ATOM   2415  N ND2 . ASN B  1 141 ? 10.924   3.060   -30.066  1.00 91.90  ? 141 ASN B ND2 1 
ATOM   2416  N N   . HIS B  1 142 ? 7.563    0.299   -33.319  1.00 89.29  ? 142 HIS B N   1 
ATOM   2417  C CA  . HIS B  1 142 ? 7.103    -0.956  -33.885  1.00 89.11  ? 142 HIS B CA  1 
ATOM   2418  C C   . HIS B  1 142 ? 6.677    -0.812  -35.323  1.00 88.56  ? 142 HIS B C   1 
ATOM   2419  O O   . HIS B  1 142 ? 7.048    -1.636  -36.168  1.00 88.85  ? 142 HIS B O   1 
ATOM   2420  C CB  . HIS B  1 142 ? 5.983    -1.552  -33.045  1.00 88.67  ? 142 HIS B CB  1 
ATOM   2421  C CG  . HIS B  1 142 ? 5.474    -2.878  -33.577  1.00 88.56  ? 142 HIS B CG  1 
ATOM   2422  N ND1 . HIS B  1 142 ? 4.180    -3.069  -33.974  1.00 87.74  ? 142 HIS B ND1 1 
ATOM   2423  C CD2 . HIS B  1 142 ? 6.140    -4.086  -33.809  1.00 89.28  ? 142 HIS B CD2 1 
ATOM   2424  C CE1 . HIS B  1 142 ? 4.024    -4.340  -34.402  1.00 87.91  ? 142 HIS B CE1 1 
ATOM   2425  N NE2 . HIS B  1 142 ? 5.224    -4.964  -34.299  1.00 88.86  ? 142 HIS B NE2 1 
ATOM   2426  N N   . ILE B  1 143 ? 5.907    0.230   -35.630  1.00 87.86  ? 143 ILE B N   1 
ATOM   2427  C CA  . ILE B  1 143 ? 5.425    0.360   -37.000  1.00 87.38  ? 143 ILE B CA  1 
ATOM   2428  C C   . ILE B  1 143 ? 6.565    0.735   -37.965  1.00 87.97  ? 143 ILE B C   1 
ATOM   2429  O O   . ILE B  1 143 ? 6.584    0.291   -39.108  1.00 87.94  ? 143 ILE B O   1 
ATOM   2430  C CB  . ILE B  1 143 ? 4.160    1.245   -37.141  1.00 86.55  ? 143 ILE B CB  1 
ATOM   2431  C CG1 . ILE B  1 143 ? 3.481    0.976   -38.481  1.00 86.06  ? 143 ILE B CG1 1 
ATOM   2432  C CG2 . ILE B  1 143 ? 4.501    2.714   -37.031  1.00 86.70  ? 143 ILE B CG2 1 
ATOM   2433  C CD1 . ILE B  1 143 ? 2.158    1.684   -38.655  1.00 85.34  ? 143 ILE B CD1 1 
ATOM   2434  N N   . LEU B  1 144 ? 7.520    1.528   -37.495  1.00 88.59  ? 144 LEU B N   1 
ATOM   2435  C CA  . LEU B  1 144 ? 8.682    1.862   -38.317  1.00 89.34  ? 144 LEU B CA  1 
ATOM   2436  C C   . LEU B  1 144 ? 9.508    0.614   -38.597  1.00 90.06  ? 144 LEU B C   1 
ATOM   2437  O O   . LEU B  1 144 ? 9.968    0.392   -39.733  1.00 90.40  ? 144 LEU B O   1 
ATOM   2438  C CB  . LEU B  1 144 ? 9.547    2.964   -37.678  1.00 89.96  ? 144 LEU B CB  1 
ATOM   2439  C CG  . LEU B  1 144 ? 8.903    4.358   -37.669  1.00 89.47  ? 144 LEU B CG  1 
ATOM   2440  C CD1 . LEU B  1 144 ? 9.624    5.264   -36.692  1.00 90.06  ? 144 LEU B CD1 1 
ATOM   2441  C CD2 . LEU B  1 144 ? 8.809    5.009   -39.050  1.00 89.40  ? 144 LEU B CD2 1 
ATOM   2442  N N   . LYS B  1 145 ? 9.670    -0.216  -37.568  1.00 90.37  ? 145 LYS B N   1 
ATOM   2443  C CA  . LYS B  1 145 ? 10.378   -1.470  -37.731  1.00 91.16  ? 145 LYS B CA  1 
ATOM   2444  C C   . LYS B  1 145 ? 9.666    -2.398  -38.718  1.00 90.69  ? 145 LYS B C   1 
ATOM   2445  O O   . LYS B  1 145 ? 10.303   -3.008  -39.566  1.00 91.30  ? 145 LYS B O   1 
ATOM   2446  C CB  . LYS B  1 145 ? 10.595   -2.160  -36.391  1.00 91.64  ? 145 LYS B CB  1 
ATOM   2447  C CG  . LYS B  1 145 ? 11.879   -2.955  -36.411  1.00 92.96  ? 145 LYS B CG  1 
ATOM   2448  C CD  . LYS B  1 145 ? 12.242   -3.543  -35.066  1.00 93.64  ? 145 LYS B CD  1 
ATOM   2449  C CE  . LYS B  1 145 ? 13.441   -4.475  -35.263  1.00 95.06  ? 145 LYS B CE  1 
ATOM   2450  N NZ  . LYS B  1 145 ? 13.793   -5.288  -34.059  1.00 95.91  ? 145 LYS B NZ  1 
ATOM   2451  N N   . THR B  1 146 ? 8.346    -2.473  -38.622  1.00 89.68  ? 146 THR B N   1 
ATOM   2452  C CA  . THR B  1 146 ? 7.559    -3.232  -39.575  1.00 89.17  ? 146 THR B CA  1 
ATOM   2453  C C   . THR B  1 146 ? 7.753    -2.713  -41.008  1.00 89.11  ? 146 THR B C   1 
ATOM   2454  O O   . THR B  1 146 ? 7.812    -3.509  -41.941  1.00 89.28  ? 146 THR B O   1 
ATOM   2455  C CB  . THR B  1 146 ? 6.066    -3.280  -39.159  1.00 88.16  ? 146 THR B CB  1 
ATOM   2456  O OG1 . THR B  1 146 ? 5.947    -3.981  -37.916  1.00 88.40  ? 146 THR B OG1 1 
ATOM   2457  C CG2 . THR B  1 146 ? 5.241    -4.024  -40.176  1.00 87.67  ? 146 THR B CG2 1 
ATOM   2458  N N   . ARG B  1 147 ? 7.883    -1.400  -41.189  1.00 88.97  ? 147 ARG B N   1 
ATOM   2459  C CA  . ARG B  1 147 ? 8.069    -0.872  -42.530  1.00 89.02  ? 147 ARG B CA  1 
ATOM   2460  C C   . ARG B  1 147 ? 9.410    -1.294  -43.105  1.00 90.14  ? 147 ARG B C   1 
ATOM   2461  O O   . ARG B  1 147 ? 9.505    -1.645  -44.280  1.00 90.29  ? 147 ARG B O   1 
ATOM   2462  C CB  . ARG B  1 147 ? 7.940    0.643   -42.573  1.00 88.79  ? 147 ARG B CB  1 
ATOM   2463  C CG  . ARG B  1 147 ? 7.738    1.153   -43.990  1.00 88.66  ? 147 ARG B CG  1 
ATOM   2464  C CD  . ARG B  1 147 ? 7.837    2.652   -44.095  1.00 88.74  ? 147 ARG B CD  1 
ATOM   2465  N NE  . ARG B  1 147 ? 7.663    3.033   -45.481  1.00 88.75  ? 147 ARG B NE  1 
ATOM   2466  C CZ  . ARG B  1 147 ? 7.787    4.271   -45.932  1.00 88.99  ? 147 ARG B CZ  1 
ATOM   2467  N NH1 . ARG B  1 147 ? 8.102    5.238   -45.084  1.00 89.24  ? 147 ARG B NH1 1 
ATOM   2468  N NH2 . ARG B  1 147 ? 7.592    4.542   -47.226  1.00 89.05  ? 147 ARG B NH2 1 
ATOM   2469  N N   . GLU B  1 148 ? 10.443   -1.256  -42.273  1.00 90.99  ? 148 GLU B N   1 
ATOM   2470  C CA  . GLU B  1 148 ? 11.746   -1.716  -42.694  1.00 92.22  ? 148 GLU B CA  1 
ATOM   2471  C C   . GLU B  1 148 ? 11.704   -3.170  -43.150  1.00 92.48  ? 148 GLU B C   1 
ATOM   2472  O O   . GLU B  1 148 ? 12.231   -3.499  -44.222  1.00 93.07  ? 148 GLU B O   1 
ATOM   2473  C CB  . GLU B  1 148 ? 12.751   -1.574  -41.566  1.00 93.11  ? 148 GLU B CB  1 
ATOM   2474  C CG  . GLU B  1 148 ? 13.393   -0.210  -41.504  1.00 93.49  ? 148 GLU B CG  1 
ATOM   2475  C CD  . GLU B  1 148 ? 14.314   -0.061  -40.302  1.00 94.35  ? 148 GLU B CD  1 
ATOM   2476  O OE1 . GLU B  1 148 ? 14.627   1.111   -39.967  1.00 94.48  ? 148 GLU B OE1 1 
ATOM   2477  O OE2 . GLU B  1 148 ? 14.727   -1.094  -39.692  1.00 94.96  ? 148 GLU B OE2 1 
ATOM   2478  N N   . LYS B  1 149 ? 11.087   -4.033  -42.335  1.00 92.13  ? 149 LYS B N   1 
ATOM   2479  C CA  . LYS B  1 149 ? 10.935   -5.451  -42.649  1.00 92.39  ? 149 LYS B CA  1 
ATOM   2480  C C   . LYS B  1 149 ? 10.203   -5.630  -43.964  1.00 91.76  ? 149 LYS B C   1 
ATOM   2481  O O   . LYS B  1 149 ? 10.597   -6.448  -44.776  1.00 92.37  ? 149 LYS B O   1 
ATOM   2482  C CB  . LYS B  1 149 ? 10.183   -6.168  -41.538  1.00 92.00  ? 149 LYS B CB  1 
ATOM   2483  C CG  . LYS B  1 149 ? 9.886    -7.628  -41.825  1.00 92.25  ? 149 LYS B CG  1 
ATOM   2484  C CD  . LYS B  1 149 ? 9.690    -8.411  -40.526  1.00 92.51  ? 149 LYS B CD  1 
ATOM   2485  C CE  . LYS B  1 149 ? 8.221    -8.690  -40.197  1.00 91.43  ? 149 LYS B CE  1 
ATOM   2486  N NZ  . LYS B  1 149 ? 8.055    -9.346  -38.865  1.00 91.78  ? 149 LYS B NZ  1 
ATOM   2487  N N   . LEU B  1 150 ? 9.157    -4.854  -44.187  1.00 90.64  ? 150 LEU B N   1 
ATOM   2488  C CA  . LEU B  1 150 ? 8.413    -4.984  -45.422  1.00 90.06  ? 150 LEU B CA  1 
ATOM   2489  C C   . LEU B  1 150 ? 9.256    -4.570  -46.612  1.00 90.71  ? 150 LEU B C   1 
ATOM   2490  O O   . LEU B  1 150 ? 9.391    -5.322  -47.588  1.00 91.05  ? 150 LEU B O   1 
ATOM   2491  C CB  . LEU B  1 150 ? 7.105    -4.179  -45.371  1.00 88.83  ? 150 LEU B CB  1 
ATOM   2492  C CG  . LEU B  1 150 ? 5.991    -4.801  -44.542  1.00 88.13  ? 150 LEU B CG  1 
ATOM   2493  C CD1 . LEU B  1 150 ? 4.950    -3.741  -44.239  1.00 87.20  ? 150 LEU B CD1 1 
ATOM   2494  C CD2 . LEU B  1 150 ? 5.368    -5.976  -45.263  1.00 87.96  ? 150 LEU B CD2 1 
ATOM   2495  N N   . ASN B  1 151 ? 9.828    -3.374  -46.520  1.00 90.96  ? 151 ASN B N   1 
ATOM   2496  C CA  . ASN B  1 151 ? 10.697   -2.860  -47.565  1.00 91.72  ? 151 ASN B CA  1 
ATOM   2497  C C   . ASN B  1 151 ? 11.860   -3.789  -47.891  1.00 93.01  ? 151 ASN B C   1 
ATOM   2498  O O   . ASN B  1 151 ? 12.134   -4.029  -49.059  1.00 93.45  ? 151 ASN B O   1 
ATOM   2499  C CB  . ASN B  1 151 ? 11.199   -1.473  -47.190  1.00 91.95  ? 151 ASN B CB  1 
ATOM   2500  C CG  . ASN B  1 151 ? 10.103   -0.426  -47.268  1.00 90.89  ? 151 ASN B CG  1 
ATOM   2501  O OD1 . ASN B  1 151 ? 8.946    -0.732  -47.604  1.00 89.97  ? 151 ASN B OD1 1 
ATOM   2502  N ND2 . ASN B  1 151 ? 10.463   0.827   -46.977  1.00 91.10  ? 151 ASN B ND2 1 
ATOM   2503  N N   . ARG B  1 152 ? 12.524   -4.316  -46.862  1.00 93.69  ? 152 ARG B N   1 
ATOM   2504  C CA  . ARG B  1 152 ? 13.632   -5.245  -47.050  1.00 95.06  ? 152 ARG B CA  1 
ATOM   2505  C C   . ARG B  1 152 ? 13.216   -6.448  -47.904  1.00 95.05  ? 152 ARG B C   1 
ATOM   2506  O O   . ARG B  1 152 ? 13.861   -6.770  -48.908  1.00 95.93  ? 152 ARG B O   1 
ATOM   2507  C CB  . ARG B  1 152 ? 14.186   -5.707  -45.696  1.00 95.70  ? 152 ARG B CB  1 
ATOM   2508  C CG  . ARG B  1 152 ? 15.458   -6.540  -45.797  1.00 97.37  ? 152 ARG B CG  1 
ATOM   2509  C CD  . ARG B  1 152 ? 15.901   -7.064  -44.442  1.00 98.01  ? 152 ARG B CD  1 
ATOM   2510  N NE  . ARG B  1 152 ? 15.066   -8.173  -43.956  1.00 97.54  ? 152 ARG B NE  1 
ATOM   2511  C CZ  . ARG B  1 152 ? 14.297   -8.134  -42.857  1.00 96.71  ? 152 ARG B CZ  1 
ATOM   2512  N NH1 . ARG B  1 152 ? 13.573   -9.216  -42.512  1.00 96.45  ? 152 ARG B NH1 1 
ATOM   2513  N NH2 . ARG B  1 152 ? 14.237   -7.022  -42.097  1.00 96.20  ? 152 ARG B NH2 1 
ATOM   2514  N N   . ILE B  1 153 ? 12.133   -7.103  -47.506  1.00 94.13  ? 153 ILE B N   1 
ATOM   2515  C CA  . ILE B  1 153 ? 11.686   -8.293  -48.212  1.00 94.14  ? 153 ILE B CA  1 
ATOM   2516  C C   . ILE B  1 153 ? 11.180   -7.968  -49.608  1.00 93.63  ? 153 ILE B C   1 
ATOM   2517  O O   . ILE B  1 153 ? 11.361   -8.750  -50.538  1.00 94.16  ? 153 ILE B O   1 
ATOM   2518  C CB  . ILE B  1 153 ? 10.617   -9.051  -47.431  1.00 93.35  ? 153 ILE B CB  1 
ATOM   2519  C CG1 . ILE B  1 153 ? 11.199   -9.549  -46.111  1.00 94.10  ? 153 ILE B CG1 1 
ATOM   2520  C CG2 . ILE B  1 153 ? 10.074   -10.198 -48.270  1.00 93.32  ? 153 ILE B CG2 1 
ATOM   2521  C CD1 . ILE B  1 153 ? 10.188   -10.169 -45.179  1.00 93.42  ? 153 ILE B CD1 1 
ATOM   2522  N N   . LEU B  1 154 ? 10.557   -6.808  -49.756  1.00 92.68  ? 154 LEU B N   1 
ATOM   2523  C CA  . LEU B  1 154 ? 10.140   -6.361  -51.070  1.00 92.31  ? 154 LEU B CA  1 
ATOM   2524  C C   . LEU B  1 154 ? 11.334   -6.081  -52.012  1.00 93.52  ? 154 LEU B C   1 
ATOM   2525  O O   . LEU B  1 154 ? 11.311   -6.447  -53.204  1.00 93.78  ? 154 LEU B O   1 
ATOM   2526  C CB  . LEU B  1 154 ? 9.271    -5.133  -50.937  1.00 91.22  ? 154 LEU B CB  1 
ATOM   2527  C CG  . LEU B  1 154 ? 8.239    -4.956  -52.044  1.00 90.44  ? 154 LEU B CG  1 
ATOM   2528  C CD1 . LEU B  1 154 ? 7.362    -6.192  -52.194  1.00 89.96  ? 154 LEU B CD1 1 
ATOM   2529  C CD2 . LEU B  1 154 ? 7.383    -3.729  -51.738  1.00 89.50  ? 154 LEU B CD2 1 
ATOM   2530  N N   . SER B  1 155 ? 12.370   -5.436  -51.466  1.00 94.32  ? 155 SER B N   1 
ATOM   2531  C CA  . SER B  1 155 ? 13.631   -5.204  -52.165  1.00 95.70  ? 155 SER B CA  1 
ATOM   2532  C C   . SER B  1 155 ? 14.202   -6.503  -52.742  1.00 96.75  ? 155 SER B C   1 
ATOM   2533  O O   . SER B  1 155 ? 14.548   -6.563  -53.921  1.00 97.38  ? 155 SER B O   1 
ATOM   2534  C CB  . SER B  1 155 ? 14.643   -4.576  -51.214  1.00 96.49  ? 155 SER B CB  1 
ATOM   2535  O OG  . SER B  1 155 ? 15.819   -4.209  -51.903  1.00 97.86  ? 155 SER B OG  1 
ATOM   2536  N N   . GLU B  1 156 ? 14.278   -7.539  -51.905  1.00 97.00  ? 156 GLU B N   1 
ATOM   2537  C CA  . GLU B  1 156 ? 14.733   -8.868  -52.323  1.00 98.04  ? 156 GLU B CA  1 
ATOM   2538  C C   . GLU B  1 156 ? 13.940   -9.476  -53.467  1.00 97.54  ? 156 GLU B C   1 
ATOM   2539  O O   . GLU B  1 156 ? 14.529   -10.162 -54.306  1.00 98.62  ? 156 GLU B O   1 
ATOM   2540  C CB  . GLU B  1 156 ? 14.688   -9.857  -51.160  1.00 98.22  ? 156 GLU B CB  1 
ATOM   2541  C CG  . GLU B  1 156 ? 15.672   -9.541  -50.052  1.00 99.11  ? 156 GLU B CG  1 
ATOM   2542  C CD  . GLU B  1 156 ? 15.322   -10.211 -48.729  1.00 98.88  ? 156 GLU B CD  1 
ATOM   2543  O OE1 . GLU B  1 156 ? 14.342   -10.993 -48.667  1.00 98.13  ? 156 GLU B OE1 1 
ATOM   2544  O OE2 . GLU B  1 156 ? 16.031   -9.942  -47.732  1.00 99.52  ? 156 GLU B OE2 1 
ATOM   2545  N N   . ARG B  1 157 ? 12.628   -9.250  -53.505  1.00 96.02  ? 157 ARG B N   1 
ATOM   2546  C CA  . ARG B  1 157 ? 11.790   -9.946  -54.472  1.00 95.53  ? 157 ARG B CA  1 
ATOM   2547  C C   . ARG B  1 157 ? 11.508   -9.166  -55.761  1.00 95.21  ? 157 ARG B C   1 
ATOM   2548  O O   . ARG B  1 157 ? 11.049   -9.737  -56.743  1.00 95.11  ? 157 ARG B O   1 
ATOM   2549  C CB  . ARG B  1 157 ? 10.497   -10.370 -53.811  1.00 94.26  ? 157 ARG B CB  1 
ATOM   2550  C CG  . ARG B  1 157 ? 10.759   -11.097 -52.528  1.00 94.65  ? 157 ARG B CG  1 
ATOM   2551  C CD  . ARG B  1 157 ? 9.531    -11.873 -52.140  1.00 93.73  ? 157 ARG B CD  1 
ATOM   2552  N NE  . ARG B  1 157 ? 9.907    -13.215 -51.697  1.00 94.69  ? 157 ARG B NE  1 
ATOM   2553  C CZ  . ARG B  1 157 ? 10.041   -14.265 -52.508  1.00 95.41  ? 157 ARG B CZ  1 
ATOM   2554  N NH1 . ARG B  1 157 ? 9.839    -14.160 -53.833  1.00 95.27  ? 157 ARG B NH1 1 
ATOM   2555  N NH2 . ARG B  1 157 ? 10.372   -15.426 -51.978  1.00 96.36  ? 157 ARG B NH2 1 
ATOM   2556  N N   . THR B  1 158 ? 11.770   -7.866  -55.742  1.00 95.09  ? 158 THR B N   1 
ATOM   2557  C CA  . THR B  1 158 ? 11.600   -7.030  -56.924  1.00 94.98  ? 158 THR B CA  1 
ATOM   2558  C C   . THR B  1 158 ? 12.941   -6.673  -57.559  1.00 96.48  ? 158 THR B C   1 
ATOM   2559  O O   . THR B  1 158 ? 13.004   -6.361  -58.741  1.00 96.81  ? 158 THR B O   1 
ATOM   2560  C CB  . THR B  1 158 ? 10.923   -5.698  -56.564  1.00 93.93  ? 158 THR B CB  1 
ATOM   2561  O OG1 . THR B  1 158 ? 11.695   -5.036  -55.545  1.00 94.35  ? 158 THR B OG1 1 
ATOM   2562  C CG2 . THR B  1 158 ? 9.486    -5.927  -56.092  1.00 92.48  ? 158 THR B CG2 1 
ATOM   2563  N N   . GLY B  1 159 ? 14.005   -6.700  -56.758  1.00 97.45  ? 159 GLY B N   1 
ATOM   2564  C CA  . GLY B  1 159 ? 15.323   -6.296  -57.208  1.00 98.99  ? 159 GLY B CA  1 
ATOM   2565  C C   . GLY B  1 159 ? 15.543   -4.795  -57.106  1.00 98.91  ? 159 GLY B C   1 
ATOM   2566  O O   . GLY B  1 159 ? 16.603   -4.292  -57.467  1.00 100.20 ? 159 GLY B O   1 
ATOM   2567  N N   . GLN B  1 160 ? 14.540   -4.066  -56.622  1.00 97.51  ? 160 GLN B N   1 
ATOM   2568  C CA  . GLN B  1 160 ? 14.687   -2.620  -56.396  1.00 97.43  ? 160 GLN B CA  1 
ATOM   2569  C C   . GLN B  1 160 ? 15.420   -2.348  -55.077  1.00 97.85  ? 160 GLN B C   1 
ATOM   2570  O O   . GLN B  1 160 ? 15.333   -3.145  -54.142  1.00 97.61  ? 160 GLN B O   1 
ATOM   2571  C CB  . GLN B  1 160 ? 13.313   -1.946  -56.376  1.00 95.89  ? 160 GLN B CB  1 
ATOM   2572  C CG  . GLN B  1 160 ? 12.444   -2.272  -57.577  1.00 95.36  ? 160 GLN B CG  1 
ATOM   2573  C CD  . GLN B  1 160 ? 12.828   -1.493  -58.826  1.00 96.14  ? 160 GLN B CD  1 
ATOM   2574  O OE1 . GLN B  1 160 ? 13.761   -0.683  -58.823  1.00 97.12  ? 160 GLN B OE1 1 
ATOM   2575  N NE2 . GLN B  1 160 ? 12.101   -1.735  -59.908  1.00 95.77  ? 160 GLN B NE2 1 
ATOM   2576  N N   . SER B  1 161 ? 16.133   -1.231  -54.990  1.00 98.54  ? 161 SER B N   1 
ATOM   2577  C CA  . SER B  1 161 ? 16.796   -0.881  -53.734  1.00 98.93  ? 161 SER B CA  1 
ATOM   2578  C C   . SER B  1 161 ? 15.810   -0.442  -52.637  1.00 97.49  ? 161 SER B C   1 
ATOM   2579  O O   . SER B  1 161 ? 14.744   0.133   -52.911  1.00 96.37  ? 161 SER B O   1 
ATOM   2580  C CB  . SER B  1 161 ? 17.821   0.223   -53.948  1.00 100.13 ? 161 SER B CB  1 
ATOM   2581  O OG  . SER B  1 161 ? 17.179   1.469   -54.143  1.00 99.41  ? 161 SER B OG  1 
ATOM   2582  N N   . ILE B  1 162 ? 16.192   -0.708  -51.392  1.00 97.65  ? 162 ILE B N   1 
ATOM   2583  C CA  . ILE B  1 162 ? 15.432   -0.288  -50.231  1.00 96.52  ? 162 ILE B CA  1 
ATOM   2584  C C   . ILE B  1 162 ? 15.099   1.202   -50.314  1.00 96.11  ? 162 ILE B C   1 
ATOM   2585  O O   . ILE B  1 162 ? 13.964   1.586   -50.026  1.00 94.87  ? 162 ILE B O   1 
ATOM   2586  C CB  . ILE B  1 162 ? 16.193   -0.635  -48.942  1.00 97.15  ? 162 ILE B CB  1 
ATOM   2587  C CG1 . ILE B  1 162 ? 16.020   -2.121  -48.597  1.00 97.11  ? 162 ILE B CG1 1 
ATOM   2588  C CG2 . ILE B  1 162 ? 15.754   0.247   -47.781  1.00 96.39  ? 162 ILE B CG2 1 
ATOM   2589  C CD1 . ILE B  1 162 ? 17.127   -2.661  -47.698  1.00 98.34  ? 162 ILE B CD1 1 
ATOM   2590  N N   . GLU B  1 163 ? 16.052   2.033   -50.744  1.00 97.22  ? 163 GLU B N   1 
ATOM   2591  C CA  . GLU B  1 163 ? 15.819   3.491   -50.841  1.00 97.04  ? 163 GLU B CA  1 
ATOM   2592  C C   . GLU B  1 163 ? 14.724   3.861   -51.817  1.00 96.18  ? 163 GLU B C   1 
ATOM   2593  O O   . GLU B  1 163 ? 13.955   4.774   -51.560  1.00 95.43  ? 163 GLU B O   1 
ATOM   2594  C CB  . GLU B  1 163 ? 17.077   4.245   -51.232  1.00 98.58  ? 163 GLU B CB  1 
ATOM   2595  C CG  . GLU B  1 163 ? 18.150   4.263   -50.148  1.00 99.50  ? 163 GLU B CG  1 
ATOM   2596  C CD  . GLU B  1 163 ? 18.873   2.924   -49.993  1.00 100.26 ? 163 GLU B CD  1 
ATOM   2597  O OE1 . GLU B  1 163 ? 19.095   2.186   -50.998  1.00 100.79 ? 163 GLU B OE1 1 
ATOM   2598  O OE2 . GLU B  1 163 ? 19.218   2.615   -48.837  1.00 100.41 ? 163 GLU B OE2 1 
ATOM   2599  N N   . LYS B  1 164 ? 14.677   3.158   -52.943  1.00 96.38  ? 164 LYS B N   1 
ATOM   2600  C CA  . LYS B  1 164 ? 13.664   3.415   -53.953  1.00 95.66  ? 164 LYS B CA  1 
ATOM   2601  C C   . LYS B  1 164 ? 12.270   2.974   -53.473  1.00 94.11  ? 164 LYS B C   1 
ATOM   2602  O O   . LYS B  1 164 ? 11.272   3.684   -53.700  1.00 93.33  ? 164 LYS B O   1 
ATOM   2603  C CB  . LYS B  1 164 ? 14.019   2.758   -55.293  1.00 96.37  ? 164 LYS B CB  1 
ATOM   2604  C CG  . LYS B  1 164 ? 12.993   3.044   -56.377  1.00 95.72  ? 164 LYS B CG  1 
ATOM   2605  C CD  . LYS B  1 164 ? 13.331   2.364   -57.679  1.00 96.44  ? 164 LYS B CD  1 
ATOM   2606  C CE  . LYS B  1 164 ? 12.128   2.252   -58.602  1.00 95.56  ? 164 LYS B CE  1 
ATOM   2607  N NZ  . LYS B  1 164 ? 11.531   3.559   -58.998  1.00 95.34  ? 164 LYS B NZ  1 
ATOM   2608  N N   . ILE B  1 165 ? 12.202   1.814   -52.815  1.00 93.78  ? 165 ILE B N   1 
ATOM   2609  C CA  . ILE B  1 165 ? 10.942   1.314   -52.243  1.00 92.45  ? 165 ILE B CA  1 
ATOM   2610  C C   . ILE B  1 165 ? 10.385   2.346   -51.258  1.00 91.79  ? 165 ILE B C   1 
ATOM   2611  O O   . ILE B  1 165 ? 9.196    2.714   -51.343  1.00 90.83  ? 165 ILE B O   1 
ATOM   2612  C CB  . ILE B  1 165 ? 11.116   -0.042  -51.509  1.00 92.44  ? 165 ILE B CB  1 
ATOM   2613  C CG1 . ILE B  1 165 ? 11.759   -1.112  -52.416  1.00 93.27  ? 165 ILE B CG1 1 
ATOM   2614  C CG2 . ILE B  1 165 ? 9.781    -0.519  -50.949  1.00 91.14  ? 165 ILE B CG2 1 
ATOM   2615  C CD1 . ILE B  1 165 ? 10.832   -1.695  -53.459  1.00 92.65  ? 165 ILE B CD1 1 
ATOM   2616  N N   . GLN B  1 166 ? 11.264   2.810   -50.354  1.00 92.40  ? 166 GLN B N   1 
ATOM   2617  C CA  . GLN B  1 166 ? 10.914   3.804   -49.351  1.00 91.97  ? 166 GLN B CA  1 
ATOM   2618  C C   . GLN B  1 166 ? 10.270   5.000   -50.012  1.00 91.71  ? 166 GLN B C   1 
ATOM   2619  O O   . GLN B  1 166 ? 9.170    5.392   -49.638  1.00 90.80  ? 166 GLN B O   1 
ATOM   2620  C CB  . GLN B  1 166 ? 12.132   4.219   -48.523  1.00 92.93  ? 166 GLN B CB  1 
ATOM   2621  C CG  . GLN B  1 166 ? 11.861   5.275   -47.446  1.00 92.61  ? 166 GLN B CG  1 
ATOM   2622  C CD  . GLN B  1 166 ? 11.335   4.721   -46.118  1.00 91.87  ? 166 GLN B CD  1 
ATOM   2623  O OE1 . GLN B  1 166 ? 10.943   3.563   -46.002  1.00 91.43  ? 166 GLN B OE1 1 
ATOM   2624  N NE2 . GLN B  1 166 ? 11.321   5.564   -45.114  1.00 91.80  ? 166 GLN B NE2 1 
ATOM   2625  N N   . LYS B  1 167 ? 10.927   5.558   -51.012  1.00 92.60  ? 167 LYS B N   1 
ATOM   2626  C CA  . LYS B  1 167 ? 10.397   6.732   -51.686  1.00 92.57  ? 167 LYS B CA  1 
ATOM   2627  C C   . LYS B  1 167 ? 9.084    6.435   -52.421  1.00 91.63  ? 167 LYS B C   1 
ATOM   2628  O O   . LYS B  1 167 ? 8.149    7.237   -52.354  1.00 91.10  ? 167 LYS B O   1 
ATOM   2629  C CB  . LYS B  1 167 ? 11.431   7.337   -52.630  1.00 93.88  ? 167 LYS B CB  1 
ATOM   2630  C CG  . LYS B  1 167 ? 10.904   8.495   -53.458  1.00 94.02  ? 167 LYS B CG  1 
ATOM   2631  C CD  . LYS B  1 167 ? 12.016   9.192   -54.225  1.00 95.48  ? 167 LYS B CD  1 
ATOM   2632  C CE  . LYS B  1 167 ? 12.866   10.057  -53.289  1.00 96.21  ? 167 LYS B CE  1 
ATOM   2633  N NZ  . LYS B  1 167 ? 14.225   10.310  -53.838  1.00 97.78  ? 167 LYS B NZ  1 
ATOM   2634  N N   . ASP B  1 168 ? 9.014    5.282   -53.096  1.00 91.50  ? 168 ASP B N   1 
ATOM   2635  C CA  . ASP B  1 168 ? 7.864    4.911   -53.937  1.00 90.75  ? 168 ASP B CA  1 
ATOM   2636  C C   . ASP B  1 168 ? 6.607    4.533   -53.164  1.00 89.53  ? 168 ASP B C   1 
ATOM   2637  O O   . ASP B  1 168 ? 5.506    4.540   -53.731  1.00 88.92  ? 168 ASP B O   1 
ATOM   2638  C CB  . ASP B  1 168 ? 8.232    3.750   -54.873  1.00 91.08  ? 168 ASP B CB  1 
ATOM   2639  C CG  . ASP B  1 168 ? 9.146    4.174   -56.043  1.00 92.27  ? 168 ASP B CG  1 
ATOM   2640  O OD1 . ASP B  1 168 ? 9.361    5.403   -56.233  1.00 92.78  ? 168 ASP B OD1 1 
ATOM   2641  O OD2 . ASP B  1 168 ? 9.632    3.269   -56.771  1.00 92.76  ? 168 ASP B OD2 1 
ATOM   2642  N N   . THR B  1 169 ? 6.778    4.178   -51.892  1.00 89.28  ? 169 THR B N   1 
ATOM   2643  C CA  . THR B  1 169 ? 5.652    3.824   -51.033  1.00 88.25  ? 169 THR B CA  1 
ATOM   2644  C C   . THR B  1 169 ? 5.274    4.923   -50.001  1.00 88.00  ? 169 THR B C   1 
ATOM   2645  O O   . THR B  1 169 ? 4.438    4.699   -49.116  1.00 87.28  ? 169 THR B O   1 
ATOM   2646  C CB  . THR B  1 169 ? 5.875    2.472   -50.331  1.00 88.09  ? 169 THR B CB  1 
ATOM   2647  O OG1 . THR B  1 169 ? 7.005    2.559   -49.463  1.00 88.75  ? 169 THR B OG1 1 
ATOM   2648  C CG2 . THR B  1 169 ? 6.108    1.402   -51.339  1.00 88.34  ? 169 THR B CG2 1 
ATOM   2649  N N   . ASP B  1 170 ? 5.855    6.117   -50.131  1.00 88.66  ? 170 ASP B N   1 
ATOM   2650  C CA  . ASP B  1 170 ? 5.526    7.220   -49.222  1.00 88.54  ? 170 ASP B CA  1 
ATOM   2651  C C   . ASP B  1 170 ? 4.037    7.565   -49.263  1.00 87.76  ? 170 ASP B C   1 
ATOM   2652  O O   . ASP B  1 170 ? 3.419    7.820   -48.240  1.00 87.30  ? 170 ASP B O   1 
ATOM   2653  C CB  . ASP B  1 170 ? 6.357    8.457   -49.542  1.00 89.51  ? 170 ASP B CB  1 
ATOM   2654  C CG  . ASP B  1 170 ? 6.224    9.530   -48.486  1.00 89.54  ? 170 ASP B CG  1 
ATOM   2655  O OD1 . ASP B  1 170 ? 5.771    10.644  -48.820  1.00 89.74  ? 170 ASP B OD1 1 
ATOM   2656  O OD2 . ASP B  1 170 ? 6.561    9.265   -47.313  1.00 89.43  ? 170 ASP B OD2 1 
ATOM   2657  N N   . ARG B  1 171 ? 3.476    7.577   -50.462  1.00 87.69  ? 171 ARG B N   1 
ATOM   2658  C CA  . ARG B  1 171 ? 2.060    7.768   -50.641  1.00 87.05  ? 171 ARG B CA  1 
ATOM   2659  C C   . ARG B  1 171 ? 1.533    6.592   -51.466  1.00 86.59  ? 171 ARG B C   1 
ATOM   2660  O O   . ARG B  1 171 ? 2.291    5.699   -51.828  1.00 86.80  ? 171 ARG B O   1 
ATOM   2661  C CB  . ARG B  1 171 ? 1.794    9.082   -51.367  1.00 87.56  ? 171 ARG B CB  1 
ATOM   2662  C CG  . ARG B  1 171 ? 2.455    10.317  -50.763  1.00 88.25  ? 171 ARG B CG  1 
ATOM   2663  C CD  . ARG B  1 171 ? 1.516    11.012  -49.807  1.00 87.89  ? 171 ARG B CD  1 
ATOM   2664  N NE  . ARG B  1 171 ? 2.106    12.231  -49.289  1.00 88.60  ? 171 ARG B NE  1 
ATOM   2665  C CZ  . ARG B  1 171 ? 1.560    12.962  -48.323  1.00 88.51  ? 171 ARG B CZ  1 
ATOM   2666  N NH1 . ARG B  1 171 ? 0.410    12.581  -47.777  1.00 87.75  ? 171 ARG B NH1 1 
ATOM   2667  N NH2 . ARG B  1 171 ? 2.156    14.077  -47.906  1.00 89.25  ? 171 ARG B NH2 1 
ATOM   2668  N N   . ASP B  1 172 ? 0.226    6.584   -51.742  1.00 86.04  ? 172 ASP B N   1 
ATOM   2669  C CA  . ASP B  1 172 ? -0.394   5.558   -52.576  1.00 85.63  ? 172 ASP B CA  1 
ATOM   2670  C C   . ASP B  1 172 ? 0.219    5.603   -53.965  1.00 86.24  ? 172 ASP B C   1 
ATOM   2671  O O   . ASP B  1 172 ? 0.254    6.657   -54.616  1.00 86.77  ? 172 ASP B O   1 
ATOM   2672  C CB  . ASP B  1 172 ? -1.902   5.786   -52.699  1.00 85.12  ? 172 ASP B CB  1 
ATOM   2673  C CG  . ASP B  1 172 ? -2.680   5.350   -51.461  1.00 84.46  ? 172 ASP B CG  1 
ATOM   2674  O OD1 . ASP B  1 172 ? -2.085   4.842   -50.467  1.00 84.36  ? 172 ASP B OD1 1 
ATOM   2675  O OD2 . ASP B  1 172 ? -3.926   5.533   -51.490  1.00 84.13  ? 172 ASP B OD2 1 
ATOM   2676  N N   . ASN B  1 173 ? 0.684    4.450   -54.428  1.00 86.24  ? 173 ASN B N   1 
ATOM   2677  C CA  . ASN B  1 173 ? 1.308    4.358   -55.735  1.00 86.88  ? 173 ASN B CA  1 
ATOM   2678  C C   . ASN B  1 173 ? 0.609    3.329   -56.602  1.00 86.49  ? 173 ASN B C   1 
ATOM   2679  O O   . ASN B  1 173 ? 0.756    2.119   -56.394  1.00 86.24  ? 173 ASN B O   1 
ATOM   2680  C CB  . ASN B  1 173 ? 2.775    4.004   -55.560  1.00 87.56  ? 173 ASN B CB  1 
ATOM   2681  C CG  . ASN B  1 173 ? 3.579    4.216   -56.808  1.00 88.46  ? 173 ASN B CG  1 
ATOM   2682  O OD1 . ASN B  1 173 ? 3.065    4.613   -57.859  1.00 88.59  ? 173 ASN B OD1 1 
ATOM   2683  N ND2 . ASN B  1 173 ? 4.862    3.946   -56.698  1.00 89.19  ? 173 ASN B ND2 1 
ATOM   2684  N N   . PHE B  1 174 ? -0.152   3.818   -57.576  1.00 86.52  ? 174 PHE B N   1 
ATOM   2685  C CA  . PHE B  1 174 ? -0.911   2.947   -58.478  1.00 86.19  ? 174 PHE B CA  1 
ATOM   2686  C C   . PHE B  1 174 ? -0.128   2.537   -59.718  1.00 86.85  ? 174 PHE B C   1 
ATOM   2687  O O   . PHE B  1 174 ? 0.432    3.371   -60.432  1.00 87.61  ? 174 PHE B O   1 
ATOM   2688  C CB  . PHE B  1 174 ? -2.252   3.578   -58.870  1.00 85.89  ? 174 PHE B CB  1 
ATOM   2689  C CG  . PHE B  1 174 ? -3.215   3.682   -57.725  1.00 85.21  ? 174 PHE B CG  1 
ATOM   2690  C CD1 . PHE B  1 174 ? -3.971   2.575   -57.320  1.00 84.52  ? 174 PHE B CD1 1 
ATOM   2691  C CD2 . PHE B  1 174 ? -3.361   4.883   -57.020  1.00 85.35  ? 174 PHE B CD2 1 
ATOM   2692  C CE1 . PHE B  1 174 ? -4.857   2.677   -56.237  1.00 83.99  ? 174 PHE B CE1 1 
ATOM   2693  C CE2 . PHE B  1 174 ? -4.240   4.987   -55.952  1.00 84.81  ? 174 PHE B CE2 1 
ATOM   2694  C CZ  . PHE B  1 174 ? -4.990   3.884   -55.563  1.00 84.14  ? 174 PHE B CZ  1 
ATOM   2695  N N   . LEU B  1 175 ? -0.114   1.237   -59.959  1.00 86.64  ? 175 LEU B N   1 
ATOM   2696  C CA  . LEU B  1 175 ? 0.667    0.629   -61.011  1.00 87.28  ? 175 LEU B CA  1 
ATOM   2697  C C   . LEU B  1 175 ? -0.205   -0.171  -61.975  1.00 86.98  ? 175 LEU B C   1 
ATOM   2698  O O   . LEU B  1 175 ? -1.101   -0.888  -61.540  1.00 86.24  ? 175 LEU B O   1 
ATOM   2699  C CB  . LEU B  1 175 ? 1.694    -0.303  -60.365  1.00 87.52  ? 175 LEU B CB  1 
ATOM   2700  C CG  . LEU B  1 175 ? 3.094    0.227   -60.012  1.00 88.37  ? 175 LEU B CG  1 
ATOM   2701  C CD1 . LEU B  1 175 ? 3.140    1.650   -59.469  1.00 88.46  ? 175 LEU B CD1 1 
ATOM   2702  C CD2 . LEU B  1 175 ? 3.716    -0.719  -59.003  1.00 88.35  ? 175 LEU B CD2 1 
ATOM   2703  N N   . THR B  1 176 ? 0.038    -0.056  -63.278  1.00 87.60  ? 176 THR B N   1 
ATOM   2704  C CA  . THR B  1 176 ? -0.640   -0.926  -64.232  1.00 87.42  ? 176 THR B CA  1 
ATOM   2705  C C   . THR B  1 176 ? 0.058    -2.287  -64.225  1.00 87.61  ? 176 THR B C   1 
ATOM   2706  O O   . THR B  1 176 ? 1.147    -2.423  -63.645  1.00 88.04  ? 176 THR B O   1 
ATOM   2707  C CB  . THR B  1 176 ? -0.617   -0.375  -65.670  1.00 88.11  ? 176 THR B CB  1 
ATOM   2708  O OG1 . THR B  1 176 ? 0.730    -0.347  -66.158  1.00 89.10  ? 176 THR B OG1 1 
ATOM   2709  C CG2 . THR B  1 176 ? -1.224   0.988   -65.741  1.00 88.14  ? 176 THR B CG2 1 
ATOM   2710  N N   . ALA B  1 177 ? -0.541   -3.291  -64.866  1.00 87.38  ? 177 ALA B N   1 
ATOM   2711  C CA  . ALA B  1 177 ? 0.107    -4.592  -64.942  1.00 87.70  ? 177 ALA B CA  1 
ATOM   2712  C C   . ALA B  1 177 ? 1.516    -4.485  -65.548  1.00 88.83  ? 177 ALA B C   1 
ATOM   2713  O O   . ALA B  1 177 ? 2.492    -5.030  -65.010  1.00 89.29  ? 177 ALA B O   1 
ATOM   2714  C CB  . ALA B  1 177 ? -0.755   -5.569  -65.717  1.00 87.43  ? 177 ALA B CB  1 
ATOM   2715  N N   . GLU B  1 178 ? 1.635    -3.751  -66.652  1.00 89.39  ? 178 GLU B N   1 
ATOM   2716  C CA  . GLU B  1 178 ? 2.949    -3.533  -67.264  1.00 90.59  ? 178 GLU B CA  1 
ATOM   2717  C C   . GLU B  1 178 ? 3.906    -2.895  -66.260  1.00 90.92  ? 178 GLU B C   1 
ATOM   2718  O O   . GLU B  1 178 ? 5.010    -3.403  -66.051  1.00 91.65  ? 178 GLU B O   1 
ATOM   2719  C CB  . GLU B  1 178 ? 2.872    -2.695  -68.550  1.00 91.20  ? 178 GLU B CB  1 
ATOM   2720  C CG  . GLU B  1 178 ? 2.321    -3.427  -69.764  1.00 91.28  ? 178 GLU B CG  1 
ATOM   2721  C CD  . GLU B  1 178 ? 3.144    -4.644  -70.199  1.00 91.98  ? 178 GLU B CD  1 
ATOM   2722  O OE1 . GLU B  1 178 ? 4.411    -4.658  -70.047  1.00 92.90  ? 178 GLU B OE1 1 
ATOM   2723  O OE2 . GLU B  1 178 ? 2.502    -5.609  -70.709  1.00 91.69  ? 178 GLU B OE2 1 
ATOM   2724  N N   . GLU B  1 179 ? 3.476    -1.802  -65.626  1.00 90.45  ? 179 GLU B N   1 
ATOM   2725  C CA  . GLU B  1 179 ? 4.337    -1.090  -64.680  1.00 90.78  ? 179 GLU B CA  1 
ATOM   2726  C C   . GLU B  1 179 ? 4.762    -1.989  -63.517  1.00 90.54  ? 179 GLU B C   1 
ATOM   2727  O O   . GLU B  1 179 ? 5.873    -1.844  -62.980  1.00 91.22  ? 179 GLU B O   1 
ATOM   2728  C CB  . GLU B  1 179 ? 3.655    0.156   -64.144  1.00 90.26  ? 179 GLU B CB  1 
ATOM   2729  C CG  . GLU B  1 179 ? 3.554    1.274   -65.145  1.00 90.85  ? 179 GLU B CG  1 
ATOM   2730  C CD  . GLU B  1 179 ? 2.544    2.339   -64.752  1.00 90.27  ? 179 GLU B CD  1 
ATOM   2731  O OE1 . GLU B  1 179 ? 1.777    2.176   -63.774  1.00 89.33  ? 179 GLU B OE1 1 
ATOM   2732  O OE2 . GLU B  1 179 ? 2.497    3.362   -65.444  1.00 90.86  ? 179 GLU B OE2 1 
ATOM   2733  N N   . ALA B  1 180 ? 3.864    -2.909  -63.145  1.00 89.67  ? 180 ALA B N   1 
ATOM   2734  C CA  . ALA B  1 180 ? 4.102    -3.852  -62.070  1.00 89.44  ? 180 ALA B CA  1 
ATOM   2735  C C   . ALA B  1 180 ? 5.210    -4.821  -62.457  1.00 90.44  ? 180 ALA B C   1 
ATOM   2736  O O   . ALA B  1 180 ? 6.070    -5.156  -61.631  1.00 90.88  ? 180 ALA B O   1 
ATOM   2737  C CB  . ALA B  1 180 ? 2.825    -4.592  -61.751  1.00 88.42  ? 180 ALA B CB  1 
ATOM   2738  N N   . LYS B  1 181 ? 5.177    -5.254  -63.722  1.00 90.86  ? 181 LYS B N   1 
ATOM   2739  C CA  . LYS B  1 181 ? 6.204    -6.131  -64.289  1.00 91.97  ? 181 LYS B CA  1 
ATOM   2740  C C   . LYS B  1 181 ? 7.564    -5.420  -64.337  1.00 93.14  ? 181 LYS B C   1 
ATOM   2741  O O   . LYS B  1 181 ? 8.592    -5.977  -63.930  1.00 93.98  ? 181 LYS B O   1 
ATOM   2742  C CB  . LYS B  1 181 ? 5.773    -6.629  -65.689  1.00 92.16  ? 181 LYS B CB  1 
ATOM   2743  C CG  . LYS B  1 181 ? 6.802    -7.513  -66.383  1.00 93.41  ? 181 LYS B CG  1 
ATOM   2744  C CD  . LYS B  1 181 ? 6.404    -7.777  -67.810  1.00 93.66  ? 181 LYS B CD  1 
ATOM   2745  C CE  . LYS B  1 181 ? 7.593    -8.275  -68.596  1.00 95.15  ? 181 LYS B CE  1 
ATOM   2746  N NZ  . LYS B  1 181 ? 7.174    -8.353  -70.017  1.00 95.40  ? 181 LYS B NZ  1 
ATOM   2747  N N   . GLU B  1 182 ? 7.529    -4.187  -64.831  1.00 116.86 ? 182 GLU B N   1 
ATOM   2748  C CA  . GLU B  1 182 ? 8.691    -3.317  -64.904  1.00 121.04 ? 182 GLU B CA  1 
ATOM   2749  C C   . GLU B  1 182 ? 9.314    -3.114  -63.535  1.00 118.59 ? 182 GLU B C   1 
ATOM   2750  O O   . GLU B  1 182 ? 10.517   -2.996  -63.419  1.00 121.93 ? 182 GLU B O   1 
ATOM   2751  C CB  . GLU B  1 182 ? 8.292    -1.969  -65.506  1.00 123.48 ? 182 GLU B CB  1 
ATOM   2752  C CG  . GLU B  1 182 ? 9.448    -1.040  -65.822  1.00 130.23 ? 182 GLU B CG  1 
ATOM   2753  C CD  . GLU B  1 182 ? 10.304   -1.540  -66.978  1.00 137.85 ? 182 GLU B CD  1 
ATOM   2754  O OE1 . GLU B  1 182 ? 11.534   -1.296  -66.975  1.00 143.19 ? 182 GLU B OE1 1 
ATOM   2755  O OE2 . GLU B  1 182 ? 9.743    -2.184  -67.892  1.00 139.37 ? 182 GLU B OE2 1 
ATOM   2756  N N   . TYR B  1 183 ? 8.489    -3.092  -62.500  1.00 113.65 ? 183 TYR B N   1 
ATOM   2757  C CA  . TYR B  1 183 ? 8.960    -2.857  -61.159  1.00 112.23 ? 183 TYR B CA  1 
ATOM   2758  C C   . TYR B  1 183 ? 9.577    -4.117  -60.569  1.00 112.37 ? 183 TYR B C   1 
ATOM   2759  O O   . TYR B  1 183 ? 10.392   -4.046  -59.662  1.00 112.91 ? 183 TYR B O   1 
ATOM   2760  C CB  . TYR B  1 183 ? 7.800    -2.375  -60.297  1.00 109.21 ? 183 TYR B CB  1 
ATOM   2761  C CG  . TYR B  1 183 ? 8.212    -1.545  -59.113  1.00 109.95 ? 183 TYR B CG  1 
ATOM   2762  C CD1 . TYR B  1 183 ? 8.351    -0.183  -59.229  1.00 112.79 ? 183 TYR B CD1 1 
ATOM   2763  C CD2 . TYR B  1 183 ? 8.455    -2.132  -57.880  1.00 109.22 ? 183 TYR B CD2 1 
ATOM   2764  C CE1 . TYR B  1 183 ? 8.726    0.577   -58.145  1.00 114.56 ? 183 TYR B CE1 1 
ATOM   2765  C CE2 . TYR B  1 183 ? 8.845    -1.380  -56.797  1.00 110.75 ? 183 TYR B CE2 1 
ATOM   2766  C CZ  . TYR B  1 183 ? 8.971    -0.026  -56.930  1.00 113.25 ? 183 TYR B CZ  1 
ATOM   2767  O OH  . TYR B  1 183 ? 9.334    0.729   -55.842  1.00 115.83 ? 183 TYR B OH  1 
ATOM   2768  N N   . GLY B  1 184 ? 9.188    -5.271  -61.093  1.00 112.91 ? 184 GLY B N   1 
ATOM   2769  C CA  . GLY B  1 184 ? 9.620    -6.551  -60.544  1.00 114.88 ? 184 GLY B CA  1 
ATOM   2770  C C   . GLY B  1 184 ? 8.670    -7.187  -59.536  1.00 113.02 ? 184 GLY B C   1 
ATOM   2771  O O   . GLY B  1 184 ? 9.060    -8.102  -58.818  1.00 115.84 ? 184 GLY B O   1 
ATOM   2772  N N   . LEU B  1 185 ? 7.426    -6.708  -59.469  1.00 109.66 ? 185 LEU B N   1 
ATOM   2773  C CA  . LEU B  1 185 ? 6.421    -7.299  -58.583  1.00 109.38 ? 185 LEU B CA  1 
ATOM   2774  C C   . LEU B  1 185 ? 5.854    -8.574  -59.194  1.00 111.42 ? 185 LEU B C   1 
ATOM   2775  O O   . LEU B  1 185 ? 5.540    -9.525  -58.485  1.00 114.48 ? 185 LEU B O   1 
ATOM   2776  C CB  . LEU B  1 185 ? 5.301    -6.306  -58.287  1.00 106.51 ? 185 LEU B CB  1 
ATOM   2777  C CG  . LEU B  1 185 ? 5.682    -5.105  -57.431  1.00 106.46 ? 185 LEU B CG  1 
ATOM   2778  C CD1 . LEU B  1 185 ? 4.727    -3.968  -57.720  1.00 105.15 ? 185 LEU B CD1 1 
ATOM   2779  C CD2 . LEU B  1 185 ? 5.717    -5.434  -55.947  1.00 109.09 ? 185 LEU B CD2 1 
ATOM   2780  N N   . ILE B  1 186 ? 5.725    -8.573  -60.515  1.00 111.02 ? 186 ILE B N   1 
ATOM   2781  C CA  . ILE B  1 186 ? 5.311    -9.748  -61.264  1.00 114.05 ? 186 ILE B CA  1 
ATOM   2782  C C   . ILE B  1 186 ? 6.338    -10.035 -62.345  1.00 118.31 ? 186 ILE B C   1 
ATOM   2783  O O   . ILE B  1 186 ? 7.167    -9.184  -62.648  1.00 118.06 ? 186 ILE B O   1 
ATOM   2784  C CB  . ILE B  1 186 ? 3.927    -9.571  -61.914  1.00 110.92 ? 186 ILE B CB  1 
ATOM   2785  C CG1 . ILE B  1 186 ? 3.858    -8.286  -62.736  1.00 107.77 ? 186 ILE B CG1 1 
ATOM   2786  C CG2 . ILE B  1 186 ? 2.856    -9.571  -60.855  1.00 109.14 ? 186 ILE B CG2 1 
ATOM   2787  C CD1 . ILE B  1 186 ? 2.653    -8.186  -63.644  1.00 105.91 ? 186 ILE B CD1 1 
ATOM   2788  N N   . ASP B  1 187 ? 6.271    -11.231 -62.926  1.00 123.65 ? 187 ASP B N   1 
ATOM   2789  C CA  . ASP B  1 187 ? 7.190    -11.656 -63.972  1.00 130.24 ? 187 ASP B CA  1 
ATOM   2790  C C   . ASP B  1 187 ? 6.569    -11.459 -65.345  1.00 130.53 ? 187 ASP B C   1 
ATOM   2791  O O   . ASP B  1 187 ? 7.230    -11.009 -66.272  1.00 133.88 ? 187 ASP B O   1 
ATOM   2792  C CB  . ASP B  1 187 ? 7.569    -13.118 -63.758  1.00 138.60 ? 187 ASP B CB  1 
ATOM   2793  C CG  . ASP B  1 187 ? 8.115    -13.384 -62.366  1.00 139.53 ? 187 ASP B CG  1 
ATOM   2794  O OD1 . ASP B  1 187 ? 9.195    -12.876 -62.048  1.00 139.62 ? 187 ASP B OD1 1 
ATOM   2795  O OD2 . ASP B  1 187 ? 7.480    -14.107 -61.578  1.00 141.12 ? 187 ASP B OD2 1 
ATOM   2796  N N   . GLU B  1 188 ? 5.284    -11.765 -65.454  1.00 127.72 ? 188 GLU B N   1 
ATOM   2797  C CA  . GLU B  1 188 ? 4.599    -11.787 -66.733  1.00 128.80 ? 188 GLU B CA  1 
ATOM   2798  C C   . GLU B  1 188 ? 3.202    -11.209 -66.612  1.00 121.40 ? 188 GLU B C   1 
ATOM   2799  O O   . GLU B  1 188 ? 2.549    -11.400 -65.603  1.00 118.06 ? 188 GLU B O   1 
ATOM   2800  C CB  . GLU B  1 188 ? 4.494    -13.240 -67.215  1.00 136.78 ? 188 GLU B CB  1 
ATOM   2801  C CG  . GLU B  1 188 ? 4.313    -13.412 -68.710  1.00 141.93 ? 188 GLU B CG  1 
ATOM   2802  C CD  . GLU B  1 188 ? 5.325    -12.592 -69.486  1.00 145.34 ? 188 GLU B CD  1 
ATOM   2803  O OE1 . GLU B  1 188 ? 6.407    -13.156 -69.822  1.00 154.73 ? 188 GLU B OE1 1 
ATOM   2804  O OE2 . GLU B  1 188 ? 5.035    -11.384 -69.727  1.00 139.88 ? 188 GLU B OE2 1 
ATOM   2805  N N   . VAL B  1 189 ? 2.739    -10.502 -67.635  1.00 120.09 ? 189 VAL B N   1 
ATOM   2806  C CA  . VAL B  1 189 ? 1.319    -10.194 -67.720  1.00 114.85 ? 189 VAL B CA  1 
ATOM   2807  C C   . VAL B  1 189 ? 0.673    -11.133 -68.736  1.00 118.62 ? 189 VAL B C   1 
ATOM   2808  O O   . VAL B  1 189 ? 1.026    -11.126 -69.901  1.00 123.55 ? 189 VAL B O   1 
ATOM   2809  C CB  . VAL B  1 189 ? 1.003    -8.686  -67.961  1.00 110.82 ? 189 VAL B CB  1 
ATOM   2810  C CG1 . VAL B  1 189 ? 2.231    -7.823  -67.740  1.00 112.31 ? 189 VAL B CG1 1 
ATOM   2811  C CG2 . VAL B  1 189 ? 0.388    -8.414  -69.324  1.00 112.54 ? 189 VAL B CG2 1 
ATOM   2812  N N   . MET B  1 190 ? -0.250   -11.966 -68.263  1.00 117.60 ? 190 MET B N   1 
ATOM   2813  C CA  . MET B  1 190 ? -0.895   -12.992 -69.082  1.00 121.92 ? 190 MET B CA  1 
ATOM   2814  C C   . MET B  1 190 ? -1.762   -12.401 -70.190  1.00 119.61 ? 190 MET B C   1 
ATOM   2815  O O   . MET B  1 190 ? -2.890   -11.994 -69.964  1.00 113.96 ? 190 MET B O   1 
ATOM   2816  C CB  . MET B  1 190 ? -1.738   -13.936 -68.225  1.00 122.06 ? 190 MET B CB  1 
ATOM   2817  C CG  . MET B  1 190 ? -1.058   -14.462 -66.972  1.00 124.82 ? 190 MET B CG  1 
ATOM   2818  S SD  . MET B  1 190 ? -1.563   -16.135 -66.477  1.00 133.16 ? 190 MET B SD  1 
ATOM   2819  C CE  . MET B  1 190 ? -3.323   -15.968 -66.160  1.00 127.69 ? 190 MET B CE  1 
ATOM   2820  N N   . VAL B  1 191 ? -1.224   -12.372 -71.397  1.00 125.30 ? 191 VAL B N   1 
ATOM   2821  C CA  . VAL B  1 191 ? -1.945   -11.885 -72.563  1.00 125.29 ? 191 VAL B CA  1 
ATOM   2822  C C   . VAL B  1 191 ? -3.089   -12.856 -72.902  1.00 125.96 ? 191 VAL B C   1 
ATOM   2823  O O   . VAL B  1 191 ? -2.920   -14.073 -72.787  1.00 131.51 ? 191 VAL B O   1 
ATOM   2824  C CB  . VAL B  1 191 ? -0.957   -11.624 -73.753  1.00 133.77 ? 191 VAL B CB  1 
ATOM   2825  C CG1 . VAL B  1 191 ? -0.383   -12.916 -74.326  1.00 144.13 ? 191 VAL B CG1 1 
ATOM   2826  C CG2 . VAL B  1 191 ? -1.581   -10.756 -74.844  1.00 134.11 ? 191 VAL B CG2 1 
ATOM   2827  N N   . PRO B  1 192 ? -4.270   -12.315 -73.266  1.00 121.00 ? 192 PRO B N   1 
ATOM   2828  C CA  . PRO B  1 192 ? -5.423   -13.149 -73.589  1.00 121.25 ? 192 PRO B CA  1 
ATOM   2829  C C   . PRO B  1 192 ? -5.098   -14.230 -74.596  1.00 130.96 ? 192 PRO B C   1 
ATOM   2830  O O   . PRO B  1 192 ? -4.479   -13.973 -75.630  1.00 136.97 ? 192 PRO B O   1 
ATOM   2831  C CB  . PRO B  1 192 ? -6.425   -12.169 -74.188  1.00 116.50 ? 192 PRO B CB  1 
ATOM   2832  C CG  . PRO B  1 192 ? -6.088   -10.865 -73.572  1.00 111.69 ? 192 PRO B CG  1 
ATOM   2833  C CD  . PRO B  1 192 ? -4.626   -10.883 -73.224  1.00 115.24 ? 192 PRO B CD  1 
ATOM   2834  N N   . GLU B  1 193 ? -5.535   -15.435 -74.266  1.00 133.98 ? 193 GLU B N   1 
ATOM   2835  C CA  . GLU B  1 193 ? -5.317   -16.614 -75.077  1.00 144.82 ? 193 GLU B CA  1 
ATOM   2836  C C   . GLU B  1 193 ? -6.442   -16.784 -76.107  1.00 145.50 ? 193 GLU B C   1 
ATOM   2837  O O   . GLU B  1 193 ? -6.253   -16.554 -77.305  1.00 150.62 ? 193 GLU B O   1 
ATOM   2838  C CB  . GLU B  1 193 ? -5.233   -17.829 -74.149  1.00 149.46 ? 193 GLU B CB  1 
ATOM   2839  C CG  . GLU B  1 193 ? -4.928   -19.162 -74.820  1.00 163.10 ? 193 GLU B CG  1 
ATOM   2840  C CD  . GLU B  1 193 ? -4.953   -20.304 -73.825  1.00 168.66 ? 193 GLU B CD  1 
ATOM   2841  O OE1 . GLU B  1 193 ? -4.296   -21.342 -74.082  1.00 181.70 ? 193 GLU B OE1 1 
ATOM   2842  O OE2 . GLU B  1 193 ? -5.627   -20.155 -72.779  1.00 161.49 ? 193 GLU B OE2 1 
ATOM   2843  N N   . ILE C  1 4   ? -14.056  -22.453 -43.815  1.00 91.37  ? 4   ILE C N   1 
ATOM   2844  C CA  . ILE C  1 4   ? -15.008  -22.203 -44.898  1.00 93.43  ? 4   ILE C CA  1 
ATOM   2845  C C   . ILE C  1 4   ? -15.009  -23.324 -45.987  1.00 94.44  ? 4   ILE C C   1 
ATOM   2846  O O   . ILE C  1 4   ? -16.042  -23.947 -46.158  1.00 96.03  ? 4   ILE C O   1 
ATOM   2847  C CB  . ILE C  1 4   ? -15.009  -20.693 -45.396  1.00 94.80  ? 4   ILE C CB  1 
ATOM   2848  C CG1 . ILE C  1 4   ? -16.112  -20.418 -46.462  1.00 97.62  ? 4   ILE C CG1 1 
ATOM   2849  C CG2 . ILE C  1 4   ? -13.621  -20.169 -45.824  1.00 94.31  ? 4   ILE C CG2 1 
ATOM   2850  C CD1 . ILE C  1 4   ? -16.305  -18.952 -46.797  1.00 100.08 ? 4   ILE C CD1 1 
ATOM   2851  N N   . PRO C  1 5   ? -13.889  -23.620 -46.696  1.00 94.26  ? 5   PRO C N   1 
ATOM   2852  C CA  . PRO C  1 5   ? -14.081  -24.598 -47.790  1.00 96.30  ? 5   PRO C CA  1 
ATOM   2853  C C   . PRO C  1 5   ? -14.133  -26.098 -47.384  1.00 97.13  ? 5   PRO C C   1 
ATOM   2854  O O   . PRO C  1 5   ? -13.696  -26.475 -46.295  1.00 95.85  ? 5   PRO C O   1 
ATOM   2855  C CB  . PRO C  1 5   ? -12.904  -24.306 -48.736  1.00 96.80  ? 5   PRO C CB  1 
ATOM   2856  C CG  . PRO C  1 5   ? -11.914  -23.516 -47.939  1.00 94.89  ? 5   PRO C CG  1 
ATOM   2857  C CD  . PRO C  1 5   ? -12.469  -23.258 -46.561  1.00 93.14  ? 5   PRO C CD  1 
ATOM   2858  N N   . THR C  1 6   ? -14.658  -26.925 -48.295  1.00 99.96  ? 6   THR C N   1 
ATOM   2859  C CA  . THR C  1 6   ? -14.931  -28.369 -48.104  1.00 102.42 ? 6   THR C CA  1 
ATOM   2860  C C   . THR C  1 6   ? -13.975  -29.321 -48.889  1.00 105.02 ? 6   THR C C   1 
ATOM   2861  O O   . THR C  1 6   ? -13.566  -29.011 -50.007  1.00 105.99 ? 6   THR C O   1 
ATOM   2862  C CB  . THR C  1 6   ? -16.391  -28.663 -48.489  1.00 105.14 ? 6   THR C CB  1 
ATOM   2863  O OG1 . THR C  1 6   ? -17.221  -27.763 -47.762  1.00 103.54 ? 6   THR C OG1 1 
ATOM   2864  C CG2 . THR C  1 6   ? -16.807  -30.106 -48.178  1.00 108.56 ? 6   THR C CG2 1 
ATOM   2865  N N   . VAL C  1 7   ? -13.633  -30.466 -48.281  1.00 106.81 ? 7   VAL C N   1 
ATOM   2866  C CA  . VAL C  1 7   ? -12.767  -31.485 -48.879  1.00 110.54 ? 7   VAL C CA  1 
ATOM   2867  C C   . VAL C  1 7   ? -13.502  -32.828 -48.880  1.00 115.38 ? 7   VAL C C   1 
ATOM   2868  O O   . VAL C  1 7   ? -14.266  -33.119 -47.946  1.00 115.29 ? 7   VAL C O   1 
ATOM   2869  C CB  . VAL C  1 7   ? -11.413  -31.618 -48.113  1.00 109.59 ? 7   VAL C CB  1 
ATOM   2870  C CG1 . VAL C  1 7   ? -10.504  -32.649 -48.779  1.00 114.54 ? 7   VAL C CG1 1 
ATOM   2871  C CG2 . VAL C  1 7   ? -10.716  -30.271 -48.013  1.00 105.45 ? 7   VAL C CG2 1 
ATOM   2872  N N   . ILE C  1 8   ? -13.263  -33.634 -49.918  1.00 120.26 ? 8   ILE C N   1 
ATOM   2873  C CA  . ILE C  1 8   ? -13.833  -35.002 -50.041  1.00 126.46 ? 8   ILE C CA  1 
ATOM   2874  C C   . ILE C  1 8   ? -12.875  -36.161 -49.708  1.00 131.04 ? 8   ILE C C   1 
ATOM   2875  O O   . ILE C  1 8   ? -11.643  -36.029 -49.848  1.00 130.73 ? 8   ILE C O   1 
ATOM   2876  C CB  . ILE C  1 8   ? -14.316  -35.275 -51.469  1.00 130.72 ? 8   ILE C CB  1 
ATOM   2877  C CG1 . ILE C  1 8   ? -13.305  -34.691 -52.487  1.00 129.98 ? 8   ILE C CG1 1 
ATOM   2878  C CG2 . ILE C  1 8   ? -15.750  -34.787 -51.625  1.00 129.75 ? 8   ILE C CG2 1 
ATOM   2879  C CD1 . ILE C  1 8   ? -12.309  -35.675 -53.091  1.00 135.90 ? 8   ILE C CD1 1 
ATOM   2880  N N   . GLU C  1 9   ? -13.449  -37.304 -49.316  1.00 136.24 ? 9   GLU C N   1 
ATOM   2881  C CA  . GLU C  1 9   ? -12.672  -38.506 -48.997  1.00 142.22 ? 9   GLU C CA  1 
ATOM   2882  C C   . GLU C  1 9   ? -13.539  -39.751 -49.089  1.00 149.92 ? 9   GLU C C   1 
ATOM   2883  O O   . GLU C  1 9   ? -13.407  -40.541 -50.030  1.00 156.75 ? 9   GLU C O   1 
ATOM   2884  C CB  . GLU C  1 9   ? -12.054  -38.399 -47.599  1.00 139.12 ? 9   GLU C CB  1 
ATOM   2885  C CG  . GLU C  1 9   ? -10.624  -38.910 -47.519  1.00 142.36 ? 9   GLU C CG  1 
ATOM   2886  C CD  . GLU C  1 9   ? -9.701   -37.917 -46.829  1.00 135.98 ? 9   GLU C CD  1 
ATOM   2887  O OE1 . GLU C  1 9   ? -9.294   -38.213 -45.682  1.00 136.08 ? 9   GLU C OE1 1 
ATOM   2888  O OE2 . GLU C  1 9   ? -9.398   -36.839 -47.418  1.00 131.37 ? 9   GLU C OE2 1 
ATOM   2889  N N   . ARG C  1 16  ? -16.722  -39.103 -47.838  1.00 145.87 ? 16  ARG C N   1 
ATOM   2890  C CA  . ARG C  1 16  ? -17.133  -38.301 -46.696  1.00 140.06 ? 16  ARG C CA  1 
ATOM   2891  C C   . ARG C  1 16  ? -16.629  -36.837 -46.834  1.00 131.94 ? 16  ARG C C   1 
ATOM   2892  O O   . ARG C  1 16  ? -15.571  -36.590 -47.431  1.00 130.54 ? 16  ARG C O   1 
ATOM   2893  C CB  . ARG C  1 16  ? -16.684  -38.977 -45.385  1.00 141.58 ? 16  ARG C CB  1 
ATOM   2894  C CG  . ARG C  1 16  ? -17.273  -40.375 -45.151  1.00 150.39 ? 16  ARG C CG  1 
ATOM   2895  C CD  . ARG C  1 16  ? -18.724  -40.345 -44.666  1.00 151.73 ? 16  ARG C CD  1 
ATOM   2896  N NE  . ARG C  1 16  ? -19.280  -41.667 -44.345  1.00 160.81 ? 16  ARG C NE  1 
ATOM   2897  C CZ  . ARG C  1 16  ? -20.445  -41.866 -43.726  1.00 163.73 ? 16  ARG C CZ  1 
ATOM   2898  N NH1 . ARG C  1 16  ? -20.870  -43.102 -43.479  1.00 172.92 ? 16  ARG C NH1 1 
ATOM   2899  N NH2 . ARG C  1 16  ? -21.192  -40.832 -43.347  1.00 158.31 ? 16  ARG C NH2 1 
ATOM   2900  N N   . ALA C  1 17  ? -17.401  -35.877 -46.304  1.00 127.56 ? 17  ALA C N   1 
ATOM   2901  C CA  . ALA C  1 17  ? -17.116  -34.431 -46.452  1.00 121.05 ? 17  ALA C CA  1 
ATOM   2902  C C   . ALA C  1 17  ? -16.579  -33.730 -45.177  1.00 115.99 ? 17  ALA C C   1 
ATOM   2903  O O   . ALA C  1 17  ? -17.188  -33.847 -44.108  1.00 116.11 ? 17  ALA C O   1 
ATOM   2904  C CB  . ALA C  1 17  ? -18.360  -33.717 -46.955  1.00 120.73 ? 17  ALA C CB  1 
ATOM   2905  N N   . TYR C  1 18  ? -15.457  -33.007 -45.288  1.00 112.16 ? 18  TYR C N   1 
ATOM   2906  C CA  . TYR C  1 18  ? -14.897  -32.217 -44.167  1.00 107.63 ? 18  TYR C CA  1 
ATOM   2907  C C   . TYR C  1 18  ? -14.874  -30.737 -44.485  1.00 103.42 ? 18  TYR C C   1 
ATOM   2908  O O   . TYR C  1 18  ? -14.826  -30.359 -45.639  1.00 103.65 ? 18  TYR C O   1 
ATOM   2909  C CB  . TYR C  1 18  ? -13.431  -32.551 -43.937  1.00 107.46 ? 18  TYR C CB  1 
ATOM   2910  C CG  . TYR C  1 18  ? -13.138  -33.952 -43.593  1.00 112.19 ? 18  TYR C CG  1 
ATOM   2911  C CD1 . TYR C  1 18  ? -13.242  -34.399 -42.280  1.00 112.76 ? 18  TYR C CD1 1 
ATOM   2912  C CD2 . TYR C  1 18  ? -12.725  -34.845 -44.570  1.00 116.88 ? 18  TYR C CD2 1 
ATOM   2913  C CE1 . TYR C  1 18  ? -12.963  -35.728 -41.949  1.00 118.14 ? 18  TYR C CE1 1 
ATOM   2914  C CE2 . TYR C  1 18  ? -12.450  -36.168 -44.257  1.00 122.50 ? 18  TYR C CE2 1 
ATOM   2915  C CZ  . TYR C  1 18  ? -12.566  -36.604 -42.946  1.00 123.17 ? 18  TYR C CZ  1 
ATOM   2916  O OH  . TYR C  1 18  ? -12.285  -37.915 -42.640  1.00 129.61 ? 18  TYR C OH  1 
ATOM   2917  N N   . ASP C  1 19  ? -14.838  -29.888 -43.474  1.00 100.16 ? 19  ASP C N   1 
ATOM   2918  C CA  . ASP C  1 19  ? -14.345  -28.541 -43.714  1.00 96.92  ? 19  ASP C CA  1 
ATOM   2919  C C   . ASP C  1 19  ? -12.826  -28.586 -43.596  1.00 95.86  ? 19  ASP C C   1 
ATOM   2920  O O   . ASP C  1 19  ? -12.284  -29.489 -42.965  1.00 97.02  ? 19  ASP C O   1 
ATOM   2921  C CB  . ASP C  1 19  ? -14.928  -27.560 -42.717  1.00 94.89  ? 19  ASP C CB  1 
ATOM   2922  C CG  . ASP C  1 19  ? -14.467  -27.826 -41.296  1.00 93.86  ? 19  ASP C CG  1 
ATOM   2923  O OD1 . ASP C  1 19  ? -13.434  -27.247 -40.899  1.00 91.79  ? 19  ASP C OD1 1 
ATOM   2924  O OD2 . ASP C  1 19  ? -15.137  -28.616 -40.580  1.00 95.62  ? 19  ASP C OD2 1 
ATOM   2925  N N   . ILE C  1 20  ? -12.145  -27.610 -44.178  1.00 94.34  ? 20  ILE C N   1 
ATOM   2926  C CA  . ILE C  1 20  ? -10.687  -27.624 -44.218  1.00 94.19  ? 20  ILE C CA  1 
ATOM   2927  C C   . ILE C  1 20  ? -9.983   -27.854 -42.867  1.00 93.29  ? 20  ILE C C   1 
ATOM   2928  O O   . ILE C  1 20  ? -8.971   -28.562 -42.799  1.00 94.95  ? 20  ILE C O   1 
ATOM   2929  C CB  . ILE C  1 20  ? -10.110  -26.394 -44.957  1.00 93.21  ? 20  ILE C CB  1 
ATOM   2930  C CG1 . ILE C  1 20  ? -8.657   -26.628 -45.365  1.00 94.59  ? 20  ILE C CG1 1 
ATOM   2931  C CG2 . ILE C  1 20  ? -10.195  -25.144 -44.120  1.00 90.87  ? 20  ILE C CG2 1 
ATOM   2932  C CD1 . ILE C  1 20  ? -8.505   -27.534 -46.561  1.00 97.85  ? 20  ILE C CD1 1 
ATOM   2933  N N   . TYR C  1 21  ? -10.519  -27.292 -41.793  1.00 91.34  ? 21  TYR C N   1 
ATOM   2934  C CA  . TYR C  1 21  ? -9.908   -27.460 -40.473  1.00 90.69  ? 21  TYR C CA  1 
ATOM   2935  C C   . TYR C  1 21  ? -10.025  -28.880 -39.958  1.00 93.06  ? 21  TYR C C   1 
ATOM   2936  O O   . TYR C  1 21  ? -9.091   -29.402 -39.346  1.00 94.08  ? 21  TYR C O   1 
ATOM   2937  C CB  . TYR C  1 21  ? -10.475  -26.445 -39.458  1.00 88.65  ? 21  TYR C CB  1 
ATOM   2938  C CG  . TYR C  1 21  ? -10.347  -25.008 -39.924  1.00 87.44  ? 21  TYR C CG  1 
ATOM   2939  C CD1 . TYR C  1 21  ? -9.105   -24.405 -40.036  1.00 87.21  ? 21  TYR C CD1 1 
ATOM   2940  C CD2 . TYR C  1 21  ? -11.469  -24.267 -40.284  1.00 87.45  ? 21  TYR C CD2 1 
ATOM   2941  C CE1 . TYR C  1 21  ? -8.972   -23.102 -40.485  1.00 87.08  ? 21  TYR C CE1 1 
ATOM   2942  C CE2 . TYR C  1 21  ? -11.357  -22.957 -40.740  1.00 87.38  ? 21  TYR C CE2 1 
ATOM   2943  C CZ  . TYR C  1 21  ? -10.097  -22.383 -40.839  1.00 87.23  ? 21  TYR C CZ  1 
ATOM   2944  O OH  . TYR C  1 21  ? -9.956   -21.101 -41.308  1.00 88.06  ? 21  TYR C OH  1 
ATOM   2945  N N   . SER C  1 22  ? -11.166  -29.503 -40.235  1.00 94.66  ? 22  SER C N   1 
ATOM   2946  C CA  . SER C  1 22  ? -11.435  -30.872 -39.831  1.00 98.03  ? 22  SER C CA  1 
ATOM   2947  C C   . SER C  1 22  ? -10.529  -31.821 -40.575  1.00 101.33 ? 22  SER C C   1 
ATOM   2948  O O   . SER C  1 22  ? -10.035  -32.798 -40.011  1.00 104.33 ? 22  SER C O   1 
ATOM   2949  C CB  . SER C  1 22  ? -12.882  -31.224 -40.150  1.00 99.78  ? 22  SER C CB  1 
ATOM   2950  O OG  . SER C  1 22  ? -13.769  -30.343 -39.495  1.00 97.63  ? 22  SER C OG  1 
ATOM   2951  N N   . ARG C  1 23  ? -10.335  -31.529 -41.852  1.00 101.45 ? 23  ARG C N   1 
ATOM   2952  C CA  . ARG C  1 23  ? -9.435   -32.295 -42.678  1.00 105.05 ? 23  ARG C CA  1 
ATOM   2953  C C   . ARG C  1 23  ? -8.036   -32.286 -42.080  1.00 105.24 ? 23  ARG C C   1 
ATOM   2954  O O   . ARG C  1 23  ? -7.404   -33.340 -41.966  1.00 109.56 ? 23  ARG C O   1 
ATOM   2955  C CB  . ARG C  1 23  ? -9.443   -31.777 -44.113  1.00 104.90 ? 23  ARG C CB  1 
ATOM   2956  C CG  . ARG C  1 23  ? -8.516   -32.520 -45.065  1.00 109.28 ? 23  ARG C CG  1 
ATOM   2957  C CD  . ARG C  1 23  ? -8.747   -34.037 -45.128  1.00 115.10 ? 23  ARG C CD  1 
ATOM   2958  N NE  . ARG C  1 23  ? -7.649   -34.750 -45.795  1.00 120.15 ? 23  ARG C NE  1 
ATOM   2959  C CZ  . ARG C  1 23  ? -6.492   -35.080 -45.213  1.00 122.13 ? 23  ARG C CZ  1 
ATOM   2960  N NH1 . ARG C  1 23  ? -6.241   -34.770 -43.943  1.00 119.24 ? 23  ARG C NH1 1 
ATOM   2961  N NH2 . ARG C  1 23  ? -5.570   -35.727 -45.904  1.00 127.66 ? 23  ARG C NH2 1 
ATOM   2962  N N   . LEU C  1 24  ? -7.573   -31.116 -41.659  1.00 101.37 ? 24  LEU C N   1 
ATOM   2963  C CA  . LEU C  1 24  ? -6.276   -31.004 -41.002  1.00 101.71 ? 24  LEU C CA  1 
ATOM   2964  C C   . LEU C  1 24  ? -6.219   -31.661 -39.626  1.00 102.72 ? 24  LEU C C   1 
ATOM   2965  O O   . LEU C  1 24  ? -5.174   -32.099 -39.164  1.00 105.17 ? 24  LEU C O   1 
ATOM   2966  C CB  . LEU C  1 24  ? -5.875   -29.539 -40.908  1.00 98.02  ? 24  LEU C CB  1 
ATOM   2967  C CG  . LEU C  1 24  ? -4.871   -28.977 -41.919  1.00 98.96  ? 24  LEU C CG  1 
ATOM   2968  C CD1 . LEU C  1 24  ? -5.144   -29.422 -43.349  1.00 101.25 ? 24  LEU C CD1 1 
ATOM   2969  C CD2 . LEU C  1 24  ? -4.840   -27.460 -41.830  1.00 95.75  ? 24  LEU C CD2 1 
ATOM   2970  N N   . LEU C  1 25  ? -7.361   -31.721 -38.965  1.00 101.35 ? 25  LEU C N   1 
ATOM   2971  C CA  . LEU C  1 25  ? -7.425   -32.308 -37.637  1.00 102.55 ? 25  LEU C CA  1 
ATOM   2972  C C   . LEU C  1 25  ? -7.200   -33.800 -37.740  1.00 108.31 ? 25  LEU C C   1 
ATOM   2973  O O   . LEU C  1 25  ? -6.651   -34.422 -36.836  1.00 110.96 ? 25  LEU C O   1 
ATOM   2974  C CB  . LEU C  1 25  ? -8.775   -31.999 -36.983  1.00 100.46 ? 25  LEU C CB  1 
ATOM   2975  C CG  . LEU C  1 25  ? -8.978   -32.532 -35.570  1.00 101.85 ? 25  LEU C CG  1 
ATOM   2976  C CD1 . LEU C  1 25  ? -7.940   -31.957 -34.615  1.00 100.30 ? 25  LEU C CD1 1 
ATOM   2977  C CD2 . LEU C  1 25  ? -10.401  -32.249 -35.110  1.00 100.68 ? 25  LEU C CD2 1 
ATOM   2978  N N   . LYS C  1 26  ? -7.625   -34.366 -38.860  1.00 90.81  ? 26  LYS C N   1 
ATOM   2979  C CA  . LYS C  1 26  ? -7.388   -35.762 -39.172  1.00 91.85  ? 26  LYS C CA  1 
ATOM   2980  C C   . LYS C  1 26  ? -5.908   -36.121 -39.142  1.00 91.44  ? 26  LYS C C   1 
ATOM   2981  O O   . LYS C  1 26  ? -5.571   -37.247 -38.836  1.00 91.69  ? 26  LYS C O   1 
ATOM   2982  C CB  . LYS C  1 26  ? -7.950   -36.052 -40.542  1.00 94.54  ? 26  LYS C CB  1 
ATOM   2983  C CG  . LYS C  1 26  ? -8.448   -37.464 -40.695  1.00 96.24  ? 26  LYS C CG  1 
ATOM   2984  C CD  . LYS C  1 26  ? -8.974   -37.661 -42.106  1.00 99.60  ? 26  LYS C CD  1 
ATOM   2985  C CE  . LYS C  1 26  ? -9.390   -39.106 -42.379  1.00 101.97 ? 26  LYS C CE  1 
ATOM   2986  N NZ  . LYS C  1 26  ? -8.216   -40.015 -42.500  1.00 101.40 ? 26  LYS C NZ  1 
ATOM   2987  N N   . ASP C  1 27  ? -5.051   -35.143 -39.466  1.00 91.45  ? 27  ASP C N   1 
ATOM   2988  C CA  . ASP C  1 27  ? -3.569   -35.246 -39.426  1.00 91.99  ? 27  ASP C CA  1 
ATOM   2989  C C   . ASP C  1 27  ? -2.973   -34.668 -38.144  1.00 90.73  ? 27  ASP C C   1 
ATOM   2990  O O   . ASP C  1 27  ? -1.787   -34.312 -38.102  1.00 91.91  ? 27  ASP C O   1 
ATOM   2991  C CB  . ASP C  1 27  ? -2.945   -34.501 -40.608  1.00 94.19  ? 27  ASP C CB  1 
ATOM   2992  C CG  . ASP C  1 27  ? -3.275   -35.131 -41.939  1.00 96.42  ? 27  ASP C CG  1 
ATOM   2993  O OD1 . ASP C  1 27  ? -2.861   -34.533 -42.961  1.00 98.96  ? 27  ASP C OD1 1 
ATOM   2994  O OD2 . ASP C  1 27  ? -3.941   -36.202 -41.982  1.00 96.27  ? 27  ASP C OD2 1 
ATOM   2995  N N   . ARG C  1 28  ? -3.806   -34.556 -37.110  1.00 89.06  ? 28  ARG C N   1 
ATOM   2996  C CA  . ARG C  1 28  ? -3.385   -34.065 -35.785  1.00 88.26  ? 28  ARG C CA  1 
ATOM   2997  C C   . ARG C  1 28  ? -2.933   -32.590 -35.773  1.00 88.37  ? 28  ARG C C   1 
ATOM   2998  O O   . ARG C  1 28  ? -2.173   -32.156 -34.896  1.00 88.80  ? 28  ARG C O   1 
ATOM   2999  C CB  . ARG C  1 28  ? -2.321   -35.002 -35.161  1.00 89.39  ? 28  ARG C CB  1 
ATOM   3000  C CG  . ARG C  1 28  ? -2.729   -36.476 -35.171  1.00 89.75  ? 28  ARG C CG  1 
ATOM   3001  C CD  . ARG C  1 28  ? -1.675   -37.412 -34.583  1.00 91.39  ? 28  ARG C CD  1 
ATOM   3002  N NE  . ARG C  1 28  ? -1.527   -37.288 -33.131  1.00 91.77  ? 28  ARG C NE  1 
ATOM   3003  C CZ  . ARG C  1 28  ? -2.394   -37.763 -32.226  1.00 91.68  ? 28  ARG C CZ  1 
ATOM   3004  N NH1 . ARG C  1 28  ? -3.513   -38.401 -32.596  1.00 91.29  ? 28  ARG C NH1 1 
ATOM   3005  N NH2 . ARG C  1 28  ? -2.136   -37.595 -30.929  1.00 92.77  ? 28  ARG C NH2 1 
ATOM   3006  N N   . ILE C  1 29  ? -3.422   -31.817 -36.730  1.00 88.60  ? 29  ILE C N   1 
ATOM   3007  C CA  . ILE C  1 29  ? -3.119   -30.396 -36.736  1.00 89.11  ? 29  ILE C CA  1 
ATOM   3008  C C   . ILE C  1 29  ? -4.295   -29.566 -36.197  1.00 87.50  ? 29  ILE C C   1 
ATOM   3009  O O   . ILE C  1 29  ? -5.425   -29.706 -36.659  1.00 87.18  ? 29  ILE C O   1 
ATOM   3010  C CB  . ILE C  1 29  ? -2.775   -29.915 -38.148  1.00 91.46  ? 29  ILE C CB  1 
ATOM   3011  C CG1 . ILE C  1 29  ? -1.484   -30.574 -38.651  1.00 93.80  ? 29  ILE C CG1 1 
ATOM   3012  C CG2 . ILE C  1 29  ? -2.672   -28.399 -38.172  1.00 92.42  ? 29  ILE C CG2 1 
ATOM   3013  C CD1 . ILE C  1 29  ? -1.240   -30.403 -40.136  1.00 96.78  ? 29  ILE C CD1 1 
ATOM   3014  N N   . ILE C  1 30  ? -4.016   -28.700 -35.224  1.00 87.08  ? 30  ILE C N   1 
ATOM   3015  C CA  . ILE C  1 30  ? -4.989   -27.727 -34.707  1.00 85.98  ? 30  ILE C CA  1 
ATOM   3016  C C   . ILE C  1 30  ? -4.623   -26.282 -35.094  1.00 87.24  ? 30  ILE C C   1 
ATOM   3017  O O   . ILE C  1 30  ? -3.485   -25.843 -34.904  1.00 88.76  ? 30  ILE C O   1 
ATOM   3018  C CB  . ILE C  1 30  ? -5.108   -27.824 -33.178  1.00 84.93  ? 30  ILE C CB  1 
ATOM   3019  C CG1 . ILE C  1 30  ? -5.563   -29.219 -32.787  1.00 84.45  ? 30  ILE C CG1 1 
ATOM   3020  C CG2 . ILE C  1 30  ? -6.086   -26.782 -32.649  1.00 84.14  ? 30  ILE C CG2 1 
ATOM   3021  C CD1 . ILE C  1 30  ? -5.397   -29.483 -31.321  1.00 84.55  ? 30  ILE C CD1 1 
ATOM   3022  N N   . MET C  1 31  ? -5.597   -25.546 -35.627  1.00 87.31  ? 31  MET C N   1 
ATOM   3023  C CA  . MET C  1 31  ? -5.391   -24.139 -35.976  1.00 88.90  ? 31  MET C CA  1 
ATOM   3024  C C   . MET C  1 31  ? -5.948   -23.211 -34.902  1.00 87.72  ? 31  MET C C   1 
ATOM   3025  O O   . MET C  1 31  ? -7.122   -23.271 -34.568  1.00 86.44  ? 31  MET C O   1 
ATOM   3026  C CB  . MET C  1 31  ? -6.021   -23.818 -37.332  1.00 90.75  ? 31  MET C CB  1 
ATOM   3027  C CG  . MET C  1 31  ? -5.564   -24.736 -38.467  1.00 92.41  ? 31  MET C CG  1 
ATOM   3028  S SD  . MET C  1 31  ? -3.763   -24.745 -38.760  1.00 94.96  ? 31  MET C SD  1 
ATOM   3029  C CE  . MET C  1 31  ? -3.495   -23.079 -39.420  1.00 98.72  ? 31  MET C CE  1 
ATOM   3030  N N   . LEU C  1 32  ? -5.089   -22.376 -34.338  1.00 88.70  ? 32  LEU C N   1 
ATOM   3031  C CA  . LEU C  1 32  ? -5.540   -21.299 -33.487  1.00 88.27  ? 32  LEU C CA  1 
ATOM   3032  C C   . LEU C  1 32  ? -5.329   -19.977 -34.222  1.00 90.78  ? 32  LEU C C   1 
ATOM   3033  O O   . LEU C  1 32  ? -4.219   -19.459 -34.287  1.00 93.24  ? 32  LEU C O   1 
ATOM   3034  C CB  . LEU C  1 32  ? -4.800   -21.323 -32.161  1.00 88.17  ? 32  LEU C CB  1 
ATOM   3035  C CG  . LEU C  1 32  ? -5.074   -20.155 -31.211  1.00 88.33  ? 32  LEU C CG  1 
ATOM   3036  C CD1 . LEU C  1 32  ? -6.562   -19.947 -30.956  1.00 86.50  ? 32  LEU C CD1 1 
ATOM   3037  C CD2 . LEU C  1 32  ? -4.329   -20.346 -29.899  1.00 88.94  ? 32  LEU C CD2 1 
ATOM   3038  N N   . GLY C  1 33  ? -6.408   -19.449 -34.793  1.00 90.90  ? 33  GLY C N   1 
ATOM   3039  C CA  . GLY C  1 33  ? -6.318   -18.293 -35.676  1.00 93.96  ? 33  GLY C CA  1 
ATOM   3040  C C   . GLY C  1 33  ? -7.139   -17.106 -35.217  1.00 94.01  ? 33  GLY C C   1 
ATOM   3041  O O   . GLY C  1 33  ? -7.457   -16.239 -36.008  1.00 96.55  ? 33  GLY C O   1 
ATOM   3042  N N   . SER C  1 34  ? -7.475   -17.048 -33.940  1.00 91.73  ? 34  SER C N   1 
ATOM   3043  C CA  . SER C  1 34  ? -8.326   -15.982 -33.433  1.00 91.78  ? 34  SER C CA  1 
ATOM   3044  C C   . SER C  1 34  ? -7.928   -15.585 -32.015  1.00 90.89  ? 34  SER C C   1 
ATOM   3045  O O   . SER C  1 34  ? -7.022   -16.170 -31.446  1.00 90.49  ? 34  SER C O   1 
ATOM   3046  C CB  . SER C  1 34  ? -9.782   -16.438 -33.464  1.00 90.48  ? 34  SER C CB  1 
ATOM   3047  O OG  . SER C  1 34  ? -9.968   -17.488 -32.535  1.00 88.06  ? 34  SER C OG  1 
ATOM   3048  N N   . GLN C  1 35  ? -8.609   -14.595 -31.445  1.00 91.07  ? 35  GLN C N   1 
ATOM   3049  C CA  . GLN C  1 35  ? -8.440   -14.255 -30.025  1.00 90.45  ? 35  GLN C CA  1 
ATOM   3050  C C   . GLN C  1 35  ? -8.907   -15.429 -29.164  1.00 88.12  ? 35  GLN C C   1 
ATOM   3051  O O   . GLN C  1 35  ? -9.719   -16.264 -29.597  1.00 86.99  ? 35  GLN C O   1 
ATOM   3052  C CB  . GLN C  1 35  ? -9.170   -12.938 -29.632  1.00 91.40  ? 35  GLN C CB  1 
ATOM   3053  C CG  . GLN C  1 35  ? -10.685  -13.027 -29.387  1.00 90.24  ? 35  GLN C CG  1 
ATOM   3054  C CD  . GLN C  1 35  ? -11.434  -13.841 -30.477  1.00 89.96  ? 35  GLN C CD  1 
ATOM   3055  O OE1 . GLN C  1 35  ? -11.293  -13.574 -31.703  1.00 91.63  ? 35  GLN C OE1 1 
ATOM   3056  N NE2 . GLN C  1 35  ? -12.219  -14.857 -30.038  1.00 88.56  ? 35  GLN C NE2 1 
ATOM   3057  N N   . ILE C  1 36  ? -8.393   -15.490 -27.945  1.00 88.14  ? 36  ILE C N   1 
ATOM   3058  C CA  . ILE C  1 36  ? -8.671   -16.609 -27.062  1.00 86.88  ? 36  ILE C CA  1 
ATOM   3059  C C   . ILE C  1 36  ? -9.757   -16.245 -26.086  1.00 86.80  ? 36  ILE C C   1 
ATOM   3060  O O   . ILE C  1 36  ? -9.548   -15.401 -25.232  1.00 87.94  ? 36  ILE C O   1 
ATOM   3061  C CB  . ILE C  1 36  ? -7.417   -17.024 -26.275  1.00 87.96  ? 36  ILE C CB  1 
ATOM   3062  C CG1 . ILE C  1 36  ? -6.330   -17.525 -27.235  1.00 88.55  ? 36  ILE C CG1 1 
ATOM   3063  C CG2 . ILE C  1 36  ? -7.740   -18.092 -25.240  1.00 87.49  ? 36  ILE C CG2 1 
ATOM   3064  C CD1 . ILE C  1 36  ? -4.926   -17.358 -26.686  1.00 91.19  ? 36  ILE C CD1 1 
ATOM   3065  N N   . ASP C  1 37  ? -10.913  -16.879 -26.230  1.00 86.04  ? 37  ASP C N   1 
ATOM   3066  C CA  . ASP C  1 37  ? -12.004  -16.757 -25.266  1.00 86.67  ? 37  ASP C CA  1 
ATOM   3067  C C   . ASP C  1 37  ? -12.537  -18.152 -24.885  1.00 86.70  ? 37  ASP C C   1 
ATOM   3068  O O   . ASP C  1 37  ? -12.046  -19.165 -25.369  1.00 85.94  ? 37  ASP C O   1 
ATOM   3069  C CB  . ASP C  1 37  ? -13.128  -15.862 -25.818  1.00 87.30  ? 37  ASP C CB  1 
ATOM   3070  C CG  . ASP C  1 37  ? -13.770  -16.427 -27.082  1.00 87.23  ? 37  ASP C CG  1 
ATOM   3071  O OD1 . ASP C  1 37  ? -14.123  -15.641 -27.975  1.00 88.05  ? 37  ASP C OD1 1 
ATOM   3072  O OD2 . ASP C  1 37  ? -13.945  -17.654 -27.199  1.00 86.90  ? 37  ASP C OD2 1 
ATOM   3073  N N   . ASP C  1 38  ? -13.561  -18.198 -24.045  1.00 88.10  ? 38  ASP C N   1 
ATOM   3074  C CA  . ASP C  1 38  ? -14.083  -19.463 -23.582  1.00 89.17  ? 38  ASP C CA  1 
ATOM   3075  C C   . ASP C  1 38  ? -14.513  -20.449 -24.698  1.00 88.77  ? 38  ASP C C   1 
ATOM   3076  O O   . ASP C  1 38  ? -14.292  -21.659 -24.576  1.00 89.01  ? 38  ASP C O   1 
ATOM   3077  C CB  . ASP C  1 38  ? -15.197  -19.241 -22.567  1.00 91.74  ? 38  ASP C CB  1 
ATOM   3078  C CG  . ASP C  1 38  ? -14.664  -18.949 -21.185  1.00 93.04  ? 38  ASP C CG  1 
ATOM   3079  O OD1 . ASP C  1 38  ? -15.455  -18.932 -20.216  1.00 95.77  ? 38  ASP C OD1 1 
ATOM   3080  O OD2 . ASP C  1 38  ? -13.443  -18.747 -21.056  1.00 92.02  ? 38  ASP C OD2 1 
ATOM   3081  N N   . ASN C  1 39  ? -15.115  -19.950 -25.774  1.00 88.69  ? 39  ASN C N   1 
ATOM   3082  C CA  . ASN C  1 39  ? -15.501  -20.811 -26.893  1.00 88.93  ? 39  ASN C CA  1 
ATOM   3083  C C   . ASN C  1 39  ? -14.310  -21.406 -27.576  1.00 86.97  ? 39  ASN C C   1 
ATOM   3084  O O   . ASN C  1 39  ? -14.252  -22.606 -27.794  1.00 87.10  ? 39  ASN C O   1 
ATOM   3085  C CB  . ASN C  1 39  ? -16.278  -20.030 -27.926  1.00 89.98  ? 39  ASN C CB  1 
ATOM   3086  C CG  . ASN C  1 39  ? -17.742  -19.963 -27.612  1.00 93.11  ? 39  ASN C CG  1 
ATOM   3087  O OD1 . ASN C  1 39  ? -18.210  -20.325 -26.527  1.00 94.61  ? 39  ASN C OD1 1 
ATOM   3088  N ND2 . ASN C  1 39  ? -18.487  -19.485 -28.568  1.00 94.91  ? 39  ASN C ND2 1 
ATOM   3089  N N   . VAL C  1 40  ? -13.367  -20.551 -27.944  1.00 85.70  ? 40  VAL C N   1 
ATOM   3090  C CA  . VAL C  1 40  ? -12.148  -20.992 -28.582  1.00 84.52  ? 40  VAL C CA  1 
ATOM   3091  C C   . VAL C  1 40  ? -11.418  -22.018 -27.678  1.00 84.20  ? 40  VAL C C   1 
ATOM   3092  O O   . VAL C  1 40  ? -11.042  -23.094 -28.143  1.00 83.88  ? 40  VAL C O   1 
ATOM   3093  C CB  . VAL C  1 40  ? -11.267  -19.781 -28.949  1.00 84.37  ? 40  VAL C CB  1 
ATOM   3094  C CG1 . VAL C  1 40  ? -9.869   -20.208 -29.335  1.00 84.02  ? 40  VAL C CG1 1 
ATOM   3095  C CG2 . VAL C  1 40  ? -11.926  -18.998 -30.076  1.00 85.32  ? 40  VAL C CG2 1 
ATOM   3096  N N   . ALA C  1 41  ? -11.249  -21.703 -26.395  1.00 84.77  ? 41  ALA C N   1 
ATOM   3097  C CA  . ALA C  1 41  ? -10.593  -22.616 -25.473  1.00 85.40  ? 41  ALA C CA  1 
ATOM   3098  C C   . ALA C  1 41  ? -11.340  -23.951 -25.452  1.00 86.16  ? 41  ALA C C   1 
ATOM   3099  O O   . ALA C  1 41  ? -10.754  -25.029 -25.616  1.00 86.14  ? 41  ALA C O   1 
ATOM   3100  C CB  . ALA C  1 41  ? -10.543  -22.010 -24.086  1.00 86.83  ? 41  ALA C CB  1 
ATOM   3101  N N   . ASN C  1 42  ? -12.654  -23.874 -25.293  1.00 87.36  ? 42  ASN C N   1 
ATOM   3102  C CA  . ASN C  1 42  ? -13.485  -25.067 -25.245  1.00 89.14  ? 42  ASN C CA  1 
ATOM   3103  C C   . ASN C  1 42  ? -13.343  -25.969 -26.487  1.00 88.34  ? 42  ASN C C   1 
ATOM   3104  O O   . ASN C  1 42  ? -13.329  -27.192 -26.384  1.00 89.43  ? 42  ASN C O   1 
ATOM   3105  C CB  . ASN C  1 42  ? -14.935  -24.674 -25.018  1.00 91.38  ? 42  ASN C CB  1 
ATOM   3106  C CG  . ASN C  1 42  ? -15.740  -25.800 -24.410  1.00 94.75  ? 42  ASN C CG  1 
ATOM   3107  O OD1 . ASN C  1 42  ? -16.785  -26.193 -24.951  1.00 96.88  ? 42  ASN C OD1 1 
ATOM   3108  N ND2 . ASN C  1 42  ? -15.251  -26.364 -23.280  1.00 96.10  ? 42  ASN C ND2 1 
ATOM   3109  N N   . SER C  1 43  ? -13.215  -25.360 -27.658  1.00 80.94  ? 43  SER C N   1 
ATOM   3110  C CA  . SER C  1 43  ? -12.927  -26.089 -28.879  1.00 81.74  ? 43  SER C CA  1 
ATOM   3111  C C   . SER C  1 43  ? -11.499  -26.659 -28.892  1.00 82.17  ? 43  SER C C   1 
ATOM   3112  O O   . SER C  1 43  ? -11.310  -27.821 -29.210  1.00 83.19  ? 43  SER C O   1 
ATOM   3113  C CB  . SER C  1 43  ? -13.100  -25.142 -30.040  1.00 81.51  ? 43  SER C CB  1 
ATOM   3114  O OG  . SER C  1 43  ? -13.052  -25.834 -31.258  1.00 82.45  ? 43  SER C OG  1 
ATOM   3115  N N   . ILE C  1 44  ? -10.498  -25.843 -28.563  1.00 81.60  ? 44  ILE C N   1 
ATOM   3116  C CA  . ILE C  1 44  ? -9.114   -26.285 -28.626  1.00 82.19  ? 44  ILE C CA  1 
ATOM   3117  C C   . ILE C  1 44  ? -8.935   -27.450 -27.646  1.00 82.84  ? 44  ILE C C   1 
ATOM   3118  O O   . ILE C  1 44  ? -8.374   -28.497 -28.008  1.00 83.95  ? 44  ILE C O   1 
ATOM   3119  C CB  . ILE C  1 44  ? -8.081   -25.170 -28.290  1.00 81.63  ? 44  ILE C CB  1 
ATOM   3120  C CG1 . ILE C  1 44  ? -8.173   -23.961 -29.244  1.00 81.22  ? 44  ILE C CG1 1 
ATOM   3121  C CG2 . ILE C  1 44  ? -6.668   -25.724 -28.242  1.00 82.50  ? 44  ILE C CG2 1 
ATOM   3122  C CD1 . ILE C  1 44  ? -7.885   -24.230 -30.698  1.00 82.06  ? 44  ILE C CD1 1 
ATOM   3123  N N   . VAL C  1 45  ? -9.413   -27.283 -26.412  1.00 82.34  ? 45  VAL C N   1 
ATOM   3124  C CA  . VAL C  1 45  ? -9.347   -28.362 -25.423  1.00 83.12  ? 45  VAL C CA  1 
ATOM   3125  C C   . VAL C  1 45  ? -10.006  -29.646 -25.968  1.00 84.25  ? 45  VAL C C   1 
ATOM   3126  O O   . VAL C  1 45  ? -9.399   -30.707 -25.991  1.00 85.43  ? 45  VAL C O   1 
ATOM   3127  C CB  . VAL C  1 45  ? -9.982   -27.944 -24.080  1.00 82.57  ? 45  VAL C CB  1 
ATOM   3128  C CG1 . VAL C  1 45  ? -10.167  -29.134 -23.150  1.00 83.63  ? 45  VAL C CG1 1 
ATOM   3129  C CG2 . VAL C  1 45  ? -9.136   -26.885 -23.401  1.00 81.84  ? 45  VAL C CG2 1 
ATOM   3130  N N   . SER C  1 46  ? -11.235  -29.560 -26.432  1.00 84.10  ? 46  SER C N   1 
ATOM   3131  C CA  . SER C  1 46  ? -11.876  -30.728 -26.995  1.00 85.33  ? 46  SER C CA  1 
ATOM   3132  C C   . SER C  1 46  ? -11.039  -31.393 -28.086  1.00 86.29  ? 46  SER C C   1 
ATOM   3133  O O   . SER C  1 46  ? -10.981  -32.614 -28.175  1.00 87.69  ? 46  SER C O   1 
ATOM   3134  C CB  . SER C  1 46  ? -13.238  -30.352 -27.555  1.00 85.08  ? 46  SER C CB  1 
ATOM   3135  O OG  . SER C  1 46  ? -14.093  -29.953 -26.506  1.00 84.61  ? 46  SER C OG  1 
ATOM   3136  N N   . GLN C  1 47  ? -10.401  -30.589 -28.933  1.00 85.75  ? 47  GLN C N   1 
ATOM   3137  C CA  . GLN C  1 47  ? -9.584   -31.144 -30.011  1.00 86.82  ? 47  GLN C CA  1 
ATOM   3138  C C   . GLN C  1 47  ? -8.407   -31.901 -29.434  1.00 87.73  ? 47  GLN C C   1 
ATOM   3139  O O   . GLN C  1 47  ? -8.112   -33.003 -29.883  1.00 89.24  ? 47  GLN C O   1 
ATOM   3140  C CB  . GLN C  1 47  ? -9.121   -30.066 -30.986  1.00 86.22  ? 47  GLN C CB  1 
ATOM   3141  C CG  . GLN C  1 47  ? -10.170  -29.701 -32.025  1.00 86.12  ? 47  GLN C CG  1 
ATOM   3142  C CD  . GLN C  1 47  ? -9.835   -28.397 -32.697  1.00 85.38  ? 47  GLN C CD  1 
ATOM   3143  O OE1 . GLN C  1 47  ? -9.006   -28.350 -33.606  1.00 86.06  ? 47  GLN C OE1 1 
ATOM   3144  N NE2 . GLN C  1 47  ? -10.462  -27.314 -32.228  1.00 84.15  ? 47  GLN C NE2 1 
ATOM   3145  N N   . LEU C  1 48  ? -7.756   -31.329 -28.430  1.00 87.01  ? 48  LEU C N   1 
ATOM   3146  C CA  . LEU C  1 48  ? -6.665   -32.005 -27.760  1.00 87.98  ? 48  LEU C CA  1 
ATOM   3147  C C   . LEU C  1 48  ? -7.128   -33.326 -27.135  1.00 89.21  ? 48  LEU C C   1 
ATOM   3148  O O   . LEU C  1 48  ? -6.538   -34.376 -27.415  1.00 90.82  ? 48  LEU C O   1 
ATOM   3149  C CB  . LEU C  1 48  ? -6.024   -31.120 -26.708  1.00 87.07  ? 48  LEU C CB  1 
ATOM   3150  C CG  . LEU C  1 48  ? -5.258   -29.893 -27.230  1.00 86.30  ? 48  LEU C CG  1 
ATOM   3151  C CD1 . LEU C  1 48  ? -4.986   -28.871 -26.120  1.00 85.26  ? 48  LEU C CD1 1 
ATOM   3152  C CD2 . LEU C  1 48  ? -3.960   -30.263 -27.945  1.00 87.59  ? 48  LEU C CD2 1 
ATOM   3153  N N   . LEU C  1 49  ? -8.185   -33.303 -26.322  1.00 88.71  ? 49  LEU C N   1 
ATOM   3154  C CA  . LEU C  1 49  ? -8.686   -34.546 -25.718  1.00 90.09  ? 49  LEU C CA  1 
ATOM   3155  C C   . LEU C  1 49  ? -9.026   -35.596 -26.769  1.00 91.55  ? 49  LEU C C   1 
ATOM   3156  O O   . LEU C  1 49  ? -8.717   -36.781 -26.593  1.00 93.30  ? 49  LEU C O   1 
ATOM   3157  C CB  . LEU C  1 49  ? -9.909   -34.309 -24.841  1.00 89.49  ? 49  LEU C CB  1 
ATOM   3158  C CG  . LEU C  1 49  ? -9.657   -33.510 -23.574  1.00 88.51  ? 49  LEU C CG  1 
ATOM   3159  C CD1 . LEU C  1 49  ? -10.948  -33.385 -22.779  1.00 88.27  ? 49  LEU C CD1 1 
ATOM   3160  C CD2 . LEU C  1 49  ? -8.580   -34.153 -22.737  1.00 89.59  ? 49  LEU C CD2 1 
ATOM   3161  N N   . PHE C  1 50  ? -9.658   -35.169 -27.859  1.00 91.03  ? 50  PHE C N   1 
ATOM   3162  C CA  . PHE C  1 50  ? -10.008  -36.085 -28.930  1.00 92.48  ? 50  PHE C CA  1 
ATOM   3163  C C   . PHE C  1 50  ? -8.772   -36.685 -29.559  1.00 93.78  ? 50  PHE C C   1 
ATOM   3164  O O   . PHE C  1 50  ? -8.717   -37.896 -29.781  1.00 95.67  ? 50  PHE C O   1 
ATOM   3165  C CB  . PHE C  1 50  ? -10.804  -35.382 -30.006  1.00 91.71  ? 50  PHE C CB  1 
ATOM   3166  C CG  . PHE C  1 50  ? -10.884  -36.144 -31.284  1.00 93.22  ? 50  PHE C CG  1 
ATOM   3167  C CD1 . PHE C  1 50  ? -11.735  -37.247 -31.408  1.00 94.79  ? 50  PHE C CD1 1 
ATOM   3168  C CD2 . PHE C  1 50  ? -10.123  -35.748 -32.377  1.00 93.26  ? 50  PHE C CD2 1 
ATOM   3169  C CE1 . PHE C  1 50  ? -11.818  -37.942 -32.607  1.00 96.34  ? 50  PHE C CE1 1 
ATOM   3170  C CE2 . PHE C  1 50  ? -10.193  -36.447 -33.578  1.00 94.82  ? 50  PHE C CE2 1 
ATOM   3171  C CZ  . PHE C  1 50  ? -11.044  -37.541 -33.693  1.00 96.34  ? 50  PHE C CZ  1 
ATOM   3172  N N   . LEU C  1 51  ? -7.785   -35.850 -29.856  1.00 92.99  ? 51  LEU C N   1 
ATOM   3173  C CA  . LEU C  1 51  ? -6.583   -36.346 -30.495  1.00 94.38  ? 51  LEU C CA  1 
ATOM   3174  C C   . LEU C  1 51  ? -5.810   -37.382 -29.635  1.00 95.94  ? 51  LEU C C   1 
ATOM   3175  O O   . LEU C  1 51  ? -5.216   -38.331 -30.156  1.00 97.87  ? 51  LEU C O   1 
ATOM   3176  C CB  . LEU C  1 51  ? -5.691   -35.177 -30.880  1.00 93.34  ? 51  LEU C CB  1 
ATOM   3177  C CG  . LEU C  1 51  ? -6.129   -34.420 -32.131  1.00 92.71  ? 51  LEU C CG  1 
ATOM   3178  C CD1 . LEU C  1 51  ? -5.050   -33.387 -32.449  1.00 92.17  ? 51  LEU C CD1 1 
ATOM   3179  C CD2 . LEU C  1 51  ? -6.401   -35.344 -33.323  1.00 94.41  ? 51  LEU C CD2 1 
ATOM   3180  N N   . GLN C  1 52  ? -5.824   -37.185 -28.324  1.00 95.26  ? 52  GLN C N   1 
ATOM   3181  C CA  . GLN C  1 52  ? -5.215   -38.114 -27.410  1.00 96.77  ? 52  GLN C CA  1 
ATOM   3182  C C   . GLN C  1 52  ? -5.950   -39.453 -27.372  1.00 98.57  ? 52  GLN C C   1 
ATOM   3183  O O   . GLN C  1 52  ? -5.330   -40.503 -27.414  1.00 100.65 ? 52  GLN C O   1 
ATOM   3184  C CB  . GLN C  1 52  ? -5.184   -37.524 -26.023  1.00 95.66  ? 52  GLN C CB  1 
ATOM   3185  C CG  . GLN C  1 52  ? -4.462   -38.432 -25.063  1.00 97.38  ? 52  GLN C CG  1 
ATOM   3186  C CD  . GLN C  1 52  ? -4.602   -37.982 -23.637  1.00 96.57  ? 52  GLN C CD  1 
ATOM   3187  O OE1 . GLN C  1 52  ? -5.701   -37.593 -23.201  1.00 95.44  ? 52  GLN C OE1 1 
ATOM   3188  N NE2 . GLN C  1 52  ? -3.493   -38.042 -22.887  1.00 97.32  ? 52  GLN C NE2 1 
ATOM   3189  N N   . ALA C  1 53  ? -7.274   -39.428 -27.288  1.00 97.98  ? 53  ALA C N   1 
ATOM   3190  C CA  . ALA C  1 53  ? -8.065   -40.673 -27.352  1.00 99.85  ? 53  ALA C CA  1 
ATOM   3191  C C   . ALA C  1 53  ? -7.835   -41.472 -28.650  1.00 101.59 ? 53  ALA C C   1 
ATOM   3192  O O   . ALA C  1 53  ? -7.996   -42.678 -28.677  1.00 103.77 ? 53  ALA C O   1 
ATOM   3193  C CB  . ALA C  1 53  ? -9.540   -40.369 -27.178  1.00 98.95  ? 53  ALA C CB  1 
ATOM   3194  N N   . GLN C  1 54  ? -7.456   -40.781 -29.718  1.00 100.78 ? 54  GLN C N   1 
ATOM   3195  C CA  . GLN C  1 54  ? -7.174   -41.400 -31.008  1.00 102.40 ? 54  GLN C CA  1 
ATOM   3196  C C   . GLN C  1 54  ? -5.872   -42.150 -31.001  1.00 104.32 ? 54  GLN C C   1 
ATOM   3197  O O   . GLN C  1 54  ? -5.769   -43.220 -31.569  1.00 106.59 ? 54  GLN C O   1 
ATOM   3198  C CB  . GLN C  1 54  ? -7.090   -40.328 -32.090  1.00 101.02 ? 54  GLN C CB  1 
ATOM   3199  C CG  . GLN C  1 54  ? -8.417   -39.688 -32.413  1.00 99.63  ? 54  GLN C CG  1 
ATOM   3200  C CD  . GLN C  1 54  ? -9.235   -40.566 -33.330  1.00 101.32 ? 54  GLN C CD  1 
ATOM   3201  O OE1 . GLN C  1 54  ? -9.016   -40.562 -34.556  1.00 102.03 ? 54  GLN C OE1 1 
ATOM   3202  N NE2 . GLN C  1 54  ? -10.178  -41.344 -32.753  1.00 102.19 ? 54  GLN C NE2 1 
ATOM   3203  N N   . ASP C  1 55  ? -4.874   -41.554 -30.370  1.00 103.53 ? 55  ASP C N   1 
ATOM   3204  C CA  . ASP C  1 55  ? -3.519   -42.052 -30.368  1.00 105.24 ? 55  ASP C CA  1 
ATOM   3205  C C   . ASP C  1 55  ? -2.767   -41.204 -29.362  1.00 103.89 ? 55  ASP C C   1 
ATOM   3206  O O   . ASP C  1 55  ? -2.639   -39.990 -29.543  1.00 101.95 ? 55  ASP C O   1 
ATOM   3207  C CB  . ASP C  1 55  ? -2.892   -41.891 -31.760  1.00 105.94 ? 55  ASP C CB  1 
ATOM   3208  C CG  . ASP C  1 55  ? -1.501   -42.493 -31.848  1.00 108.14 ? 55  ASP C CG  1 
ATOM   3209  O OD1 . ASP C  1 55  ? -0.639   -42.142 -30.994  1.00 107.85 ? 55  ASP C OD1 1 
ATOM   3210  O OD2 . ASP C  1 55  ? -1.271   -43.317 -32.768  1.00 110.32 ? 55  ASP C OD2 1 
ATOM   3211  N N   . SER C  1 56  ? -2.265   -41.831 -28.303  1.00 105.08 ? 56  SER C N   1 
ATOM   3212  C CA  . SER C  1 56  ? -1.599   -41.071 -27.245  1.00 103.99 ? 56  SER C CA  1 
ATOM   3213  C C   . SER C  1 56  ? -0.075   -40.964 -27.415  1.00 105.10 ? 56  SER C C   1 
ATOM   3214  O O   . SER C  1 56  ? 0.610    -40.387 -26.552  1.00 104.55 ? 56  SER C O   1 
ATOM   3215  C CB  . SER C  1 56  ? -1.973   -41.613 -25.859  1.00 104.47 ? 56  SER C CB  1 
ATOM   3216  O OG  . SER C  1 56  ? -1.769   -43.006 -25.788  1.00 107.22 ? 56  SER C OG  1 
ATOM   3217  N N   . GLU C  1 57  ? 0.441    -41.480 -28.532  1.00 106.76 ? 57  GLU C N   1 
ATOM   3218  C CA  . GLU C  1 57  ? 1.881    -41.456 -28.814  1.00 108.23 ? 57  GLU C CA  1 
ATOM   3219  C C   . GLU C  1 57  ? 2.222    -40.379 -29.813  1.00 107.06 ? 57  GLU C C   1 
ATOM   3220  O O   . GLU C  1 57  ? 3.085    -39.549 -29.546  1.00 106.54 ? 57  GLU C O   1 
ATOM   3221  C CB  . GLU C  1 57  ? 2.366    -42.780 -29.412  1.00 111.36 ? 57  GLU C CB  1 
ATOM   3222  C CG  . GLU C  1 57  ? 1.544    -44.000 -29.049  1.00 112.73 ? 57  GLU C CG  1 
ATOM   3223  C CD  . GLU C  1 57  ? 2.073    -44.689 -27.818  1.00 114.31 ? 57  GLU C CD  1 
ATOM   3224  O OE1 . GLU C  1 57  ? 1.643    -44.306 -26.702  1.00 112.88 ? 57  GLU C OE1 1 
ATOM   3225  O OE2 . GLU C  1 57  ? 2.925    -45.592 -27.981  1.00 117.13 ? 57  GLU C OE2 1 
ATOM   3226  N N   . LYS C  1 58  ? 1.562    -40.411 -30.974  1.00 106.89 ? 58  LYS C N   1 
ATOM   3227  C CA  . LYS C  1 58  ? 1.883    -39.504 -32.084  1.00 106.26 ? 58  LYS C CA  1 
ATOM   3228  C C   . LYS C  1 58  ? 1.626    -38.058 -31.688  1.00 103.52 ? 58  LYS C C   1 
ATOM   3229  O O   . LYS C  1 58  ? 0.538    -37.713 -31.190  1.00 101.65 ? 58  LYS C O   1 
ATOM   3230  C CB  . LYS C  1 58  ? 1.090    -39.867 -33.339  1.00 106.72 ? 58  LYS C CB  1 
ATOM   3231  C CG  . LYS C  1 58  ? 1.787    -40.915 -34.192  1.00 109.73 ? 58  LYS C CG  1 
ATOM   3232  C CD  . LYS C  1 58  ? 1.149    -41.075 -35.559  1.00 110.25 ? 58  LYS C CD  1 
ATOM   3233  C CE  . LYS C  1 58  ? -0.145   -41.867 -35.465  1.00 110.28 ? 58  LYS C CE  1 
ATOM   3234  N NZ  . LYS C  1 58  ? -0.537   -42.459 -36.775  1.00 111.93 ? 58  LYS C NZ  1 
ATOM   3235  N N   . ASP C  1 59  ? 2.615    -37.202 -31.875  1.00 103.41 ? 59  ASP C N   1 
ATOM   3236  C CA  . ASP C  1 59  ? 2.428    -35.877 -31.344  1.00 101.06 ? 59  ASP C CA  1 
ATOM   3237  C C   . ASP C  1 59  ? 1.544    -34.969 -32.202  1.00 99.35  ? 59  ASP C C   1 
ATOM   3238  O O   . ASP C  1 59  ? 1.147    -35.355 -33.311  1.00 100.08 ? 59  ASP C O   1 
ATOM   3239  C CB  . ASP C  1 59  ? 3.725    -35.245 -30.810  1.00 101.45 ? 59  ASP C CB  1 
ATOM   3240  C CG  . ASP C  1 59  ? 4.837    -35.172 -31.824  1.00 103.28 ? 59  ASP C CG  1 
ATOM   3241  O OD1 . ASP C  1 59  ? 4.534    -34.993 -33.023  1.00 103.35 ? 59  ASP C OD1 1 
ATOM   3242  O OD2 . ASP C  1 59  ? 6.016    -35.246 -31.390  1.00 104.72 ? 59  ASP C OD2 1 
ATOM   3243  N N   . ILE C  1 60  ? 1.207    -33.803 -31.635  1.00 97.23  ? 60  ILE C N   1 
ATOM   3244  C CA  . ILE C  1 60  ? 0.178    -32.901 -32.139  1.00 95.41  ? 60  ILE C CA  1 
ATOM   3245  C C   . ILE C  1 60  ? 0.775    -31.571 -32.583  1.00 94.78  ? 60  ILE C C   1 
ATOM   3246  O O   . ILE C  1 60  ? 1.712    -31.069 -31.979  1.00 94.89  ? 60  ILE C O   1 
ATOM   3247  C CB  . ILE C  1 60  ? -0.851   -32.629 -31.036  1.00 93.59  ? 60  ILE C CB  1 
ATOM   3248  C CG1 . ILE C  1 60  ? -1.643   -33.900 -30.749  1.00 94.30  ? 60  ILE C CG1 1 
ATOM   3249  C CG2 . ILE C  1 60  ? -1.780   -31.493 -31.446  1.00 91.77  ? 60  ILE C CG2 1 
ATOM   3250  C CD1 . ILE C  1 60  ? -2.324   -33.928 -29.407  1.00 93.27  ? 60  ILE C CD1 1 
ATOM   3251  N N   . TYR C  1 61  ? 0.212    -30.994 -33.633  1.00 94.29  ? 61  TYR C N   1 
ATOM   3252  C CA  . TYR C  1 61  ? 0.690    -29.722 -34.137  1.00 93.88  ? 61  TYR C CA  1 
ATOM   3253  C C   . TYR C  1 61  ? -0.355   -28.627 -33.876  1.00 91.74  ? 61  TYR C C   1 
ATOM   3254  O O   . TYR C  1 61  ? -1.493   -28.723 -34.354  1.00 91.13  ? 61  TYR C O   1 
ATOM   3255  C CB  . TYR C  1 61  ? 1.022    -29.837 -35.627  1.00 95.43  ? 61  TYR C CB  1 
ATOM   3256  C CG  . TYR C  1 61  ? 1.980    -30.968 -35.916  1.00 97.77  ? 61  TYR C CG  1 
ATOM   3257  C CD1 . TYR C  1 61  ? 1.505    -32.251 -36.174  1.00 98.77  ? 61  TYR C CD1 1 
ATOM   3258  C CD2 . TYR C  1 61  ? 3.360    -30.760 -35.906  1.00 99.17  ? 61  TYR C CD2 1 
ATOM   3259  C CE1 . TYR C  1 61  ? 2.373    -33.296 -36.416  1.00 101.10 ? 61  TYR C CE1 1 
ATOM   3260  C CE2 . TYR C  1 61  ? 4.234    -31.792 -36.158  1.00 101.51 ? 61  TYR C CE2 1 
ATOM   3261  C CZ  . TYR C  1 61  ? 3.735    -33.063 -36.407  1.00 102.47 ? 61  TYR C CZ  1 
ATOM   3262  O OH  . TYR C  1 61  ? 4.585    -34.126 -36.661  1.00 105.01 ? 61  TYR C OH  1 
ATOM   3263  N N   . LEU C  1 62  ? 0.044    -27.614 -33.099  1.00 90.80  ? 62  LEU C N   1 
ATOM   3264  C CA  . LEU C  1 62  ? -0.774   -26.444 -32.804  1.00 89.00  ? 62  LEU C CA  1 
ATOM   3265  C C   . LEU C  1 62  ? -0.202   -25.164 -33.448  1.00 89.14  ? 62  LEU C C   1 
ATOM   3266  O O   . LEU C  1 62  ? 0.778    -24.574 -32.955  1.00 89.44  ? 62  LEU C O   1 
ATOM   3267  C CB  . LEU C  1 62  ? -0.879   -26.260 -31.295  1.00 87.92  ? 62  LEU C CB  1 
ATOM   3268  C CG  . LEU C  1 62  ? -1.734   -25.096 -30.808  1.00 86.20  ? 62  LEU C CG  1 
ATOM   3269  C CD1 . LEU C  1 62  ? -3.168   -25.244 -31.293  1.00 85.44  ? 62  LEU C CD1 1 
ATOM   3270  C CD2 . LEU C  1 62  ? -1.670   -25.014 -29.291  1.00 85.50  ? 62  LEU C CD2 1 
ATOM   3271  N N   . TYR C  1 63  ? -0.806   -24.746 -34.555  1.00 89.12  ? 63  TYR C N   1 
ATOM   3272  C CA  . TYR C  1 63  ? -0.418   -23.499 -35.187  1.00 89.33  ? 63  TYR C CA  1 
ATOM   3273  C C   . TYR C  1 63  ? -1.070   -22.377 -34.405  1.00 87.67  ? 63  TYR C C   1 
ATOM   3274  O O   . TYR C  1 63  ? -2.230   -22.491 -33.977  1.00 86.42  ? 63  TYR C O   1 
ATOM   3275  C CB  . TYR C  1 63  ? -0.837   -23.475 -36.661  1.00 90.15  ? 63  TYR C CB  1 
ATOM   3276  C CG  . TYR C  1 63  ? 0.033    -24.333 -37.534  1.00 92.18  ? 63  TYR C CG  1 
ATOM   3277  C CD1 . TYR C  1 63  ? -0.230   -25.694 -37.695  1.00 92.81  ? 63  TYR C CD1 1 
ATOM   3278  C CD2 . TYR C  1 63  ? 1.153    -23.793 -38.183  1.00 93.70  ? 63  TYR C CD2 1 
ATOM   3279  C CE1 . TYR C  1 63  ? 0.583    -26.493 -38.492  1.00 94.89  ? 63  TYR C CE1 1 
ATOM   3280  C CE2 . TYR C  1 63  ? 1.972    -24.579 -38.985  1.00 95.80  ? 63  TYR C CE2 1 
ATOM   3281  C CZ  . TYR C  1 63  ? 1.682    -25.919 -39.138  1.00 96.36  ? 63  TYR C CZ  1 
ATOM   3282  O OH  . TYR C  1 63  ? 2.493    -26.682 -39.930  1.00 98.62  ? 63  TYR C OH  1 
ATOM   3283  N N   . ILE C  1 64  ? -0.313   -21.306 -34.199  1.00 87.85  ? 64  ILE C N   1 
ATOM   3284  C CA  . ILE C  1 64  ? -0.775   -20.168 -33.417  1.00 86.56  ? 64  ILE C CA  1 
ATOM   3285  C C   . ILE C  1 64  ? -0.619   -18.828 -34.174  1.00 87.01  ? 64  ILE C C   1 
ATOM   3286  O O   . ILE C  1 64  ? 0.486    -18.382 -34.459  1.00 88.26  ? 64  ILE C O   1 
ATOM   3287  C CB  . ILE C  1 64  ? -0.027   -20.085 -32.075  1.00 86.35  ? 64  ILE C CB  1 
ATOM   3288  C CG1 . ILE C  1 64  ? -0.233   -21.348 -31.255  1.00 86.02  ? 64  ILE C CG1 1 
ATOM   3289  C CG2 . ILE C  1 64  ? -0.515   -18.902 -31.276  1.00 85.19  ? 64  ILE C CG2 1 
ATOM   3290  C CD1 . ILE C  1 64  ? 0.567    -21.393 -29.965  1.00 86.12  ? 64  ILE C CD1 1 
ATOM   3291  N N   . ASN C  1 65  ? -1.739   -18.204 -34.507  1.00 86.20  ? 65  ASN C N   1 
ATOM   3292  C CA  . ASN C  1 65  ? -1.755   -16.835 -34.935  1.00 86.49  ? 65  ASN C CA  1 
ATOM   3293  C C   . ASN C  1 65  ? -2.857   -16.166 -34.160  1.00 85.02  ? 65  ASN C C   1 
ATOM   3294  O O   . ASN C  1 65  ? -4.005   -16.196 -34.590  1.00 84.51  ? 65  ASN C O   1 
ATOM   3295  C CB  . ASN C  1 65  ? -2.043   -16.755 -36.423  1.00 87.50  ? 65  ASN C CB  1 
ATOM   3296  C CG  . ASN C  1 65  ? -2.060   -15.317 -36.950  1.00 88.10  ? 65  ASN C CG  1 
ATOM   3297  O OD1 . ASN C  1 65  ? -1.454   -14.398 -36.388  1.00 88.27  ? 65  ASN C OD1 1 
ATOM   3298  N ND2 . ASN C  1 65  ? -2.768   -15.124 -38.052  1.00 88.60  ? 65  ASN C ND2 1 
ATOM   3299  N N   . SER C  1 66  ? -2.509   -15.578 -33.017  1.00 84.52  ? 66  SER C N   1 
ATOM   3300  C CA  . SER C  1 66  ? -3.499   -15.029 -32.096  1.00 83.24  ? 66  SER C CA  1 
ATOM   3301  C C   . SER C  1 66  ? -3.056   -13.735 -31.404  1.00 83.36  ? 66  SER C C   1 
ATOM   3302  O O   . SER C  1 66  ? -1.891   -13.606 -30.996  1.00 84.05  ? 66  SER C O   1 
ATOM   3303  C CB  . SER C  1 66  ? -3.855   -16.073 -31.041  1.00 82.27  ? 66  SER C CB  1 
ATOM   3304  O OG  . SER C  1 66  ? -4.571   -15.495 -29.965  1.00 81.29  ? 66  SER C OG  1 
ATOM   3305  N N   . PRO C  1 67  ? -3.995   -12.778 -31.241  1.00 82.85  ? 67  PRO C N   1 
ATOM   3306  C CA  . PRO C  1 67  ? -3.673   -11.572 -30.479  1.00 83.03  ? 67  PRO C CA  1 
ATOM   3307  C C   . PRO C  1 67  ? -3.760   -11.773 -28.952  1.00 82.12  ? 67  PRO C C   1 
ATOM   3308  O O   . PRO C  1 67  ? -3.459   -10.860 -28.192  1.00 82.34  ? 67  PRO C O   1 
ATOM   3309  C CB  . PRO C  1 67  ? -4.713   -10.565 -30.978  1.00 83.05  ? 67  PRO C CB  1 
ATOM   3310  C CG  . PRO C  1 67  ? -5.870   -11.397 -31.393  1.00 82.29  ? 67  PRO C CG  1 
ATOM   3311  C CD  . PRO C  1 67  ? -5.357   -12.732 -31.816  1.00 82.37  ? 67  PRO C CD  1 
ATOM   3312  N N   . GLY C  1 68  ? -4.152   -12.965 -28.515  1.00 81.32  ? 68  GLY C N   1 
ATOM   3313  C CA  . GLY C  1 68  ? -4.295   -13.242 -27.095  1.00 80.62  ? 68  GLY C CA  1 
ATOM   3314  C C   . GLY C  1 68  ? -5.748   -13.244 -26.680  1.00 79.69  ? 68  GLY C C   1 
ATOM   3315  O O   . GLY C  1 68  ? -6.638   -13.539 -27.484  1.00 79.46  ? 68  GLY C O   1 
ATOM   3316  N N   . GLY C  1 69  ? -6.007   -12.919 -25.422  1.00 79.31  ? 69  GLY C N   1 
ATOM   3317  C CA  . GLY C  1 69  ? -7.387   -12.987 -24.925  1.00 78.62  ? 69  GLY C CA  1 
ATOM   3318  C C   . GLY C  1 69  ? -7.465   -13.352 -23.467  1.00 78.31  ? 69  GLY C C   1 
ATOM   3319  O O   . GLY C  1 69  ? -6.559   -13.024 -22.706  1.00 78.66  ? 69  GLY C O   1 
ATOM   3320  N N   . SER C  1 70  ? -8.537   -14.034 -23.090  1.00 77.84  ? 70  SER C N   1 
ATOM   3321  C CA  . SER C  1 70  ? -8.798   -14.344 -21.698  1.00 77.72  ? 70  SER C CA  1 
ATOM   3322  C C   . SER C  1 70  ? -7.693   -15.164 -21.048  1.00 77.98  ? 70  SER C C   1 
ATOM   3323  O O   . SER C  1 70  ? -7.272   -16.197 -21.557  1.00 78.08  ? 70  SER C O   1 
ATOM   3324  C CB  . SER C  1 70  ? -10.094  -15.102 -21.585  1.00 77.43  ? 70  SER C CB  1 
ATOM   3325  O OG  . SER C  1 70  ? -10.159  -15.736 -20.334  1.00 77.51  ? 70  SER C OG  1 
ATOM   3326  N N   . VAL C  1 71  ? -7.206   -14.718 -19.913  1.00 78.28  ? 71  VAL C N   1 
ATOM   3327  C CA  . VAL C  1 71  ? -6.144   -15.446 -19.244  1.00 78.74  ? 71  VAL C CA  1 
ATOM   3328  C C   . VAL C  1 71  ? -6.626   -16.827 -18.775  1.00 78.68  ? 71  VAL C C   1 
ATOM   3329  O O   . VAL C  1 71  ? -5.929   -17.815 -18.983  1.00 79.03  ? 71  VAL C O   1 
ATOM   3330  C CB  . VAL C  1 71  ? -5.558   -14.627 -18.084  1.00 79.25  ? 71  VAL C CB  1 
ATOM   3331  C CG1 . VAL C  1 71  ? -4.721   -15.505 -17.165  1.00 79.84  ? 71  VAL C CG1 1 
ATOM   3332  C CG2 . VAL C  1 71  ? -4.743   -13.450 -18.623  1.00 79.67  ? 71  VAL C CG2 1 
ATOM   3333  N N   . THR C  1 72  ? -7.816   -16.914 -18.180  1.00 78.44  ? 72  THR C N   1 
ATOM   3334  C CA  . THR C  1 72  ? -8.338   -18.205 -17.733  1.00 78.61  ? 72  THR C CA  1 
ATOM   3335  C C   . THR C  1 72  ? -8.633   -19.129 -18.892  1.00 78.45  ? 72  THR C C   1 
ATOM   3336  O O   . THR C  1 72  ? -8.372   -20.306 -18.818  1.00 78.88  ? 72  THR C O   1 
ATOM   3337  C CB  . THR C  1 72  ? -9.570   -18.125 -16.792  1.00 78.67  ? 72  THR C CB  1 
ATOM   3338  O OG1 . THR C  1 72  ? -10.703  -17.564 -17.476  1.00 78.24  ? 72  THR C OG1 1 
ATOM   3339  C CG2 . THR C  1 72  ? -9.250   -17.340 -15.525  1.00 79.08  ? 72  THR C CG2 1 
ATOM   3340  N N   . ALA C  1 73  ? -9.168   -18.608 -19.975  1.00 78.02  ? 73  ALA C N   1 
ATOM   3341  C CA  . ALA C  1 73  ? -9.396   -19.436 -21.144  1.00 78.02  ? 73  ALA C CA  1 
ATOM   3342  C C   . ALA C  1 73  ? -8.073   -19.952 -21.652  1.00 78.42  ? 73  ALA C C   1 
ATOM   3343  O O   . ALA C  1 73  ? -7.985   -21.101 -22.065  1.00 78.81  ? 73  ALA C O   1 
ATOM   3344  C CB  . ALA C  1 73  ? -10.087  -18.646 -22.234  1.00 77.66  ? 73  ALA C CB  1 
ATOM   3345  N N   . GLY C  1 74  ? -7.043   -19.101 -21.618  1.00 78.53  ? 74  GLY C N   1 
ATOM   3346  C CA  . GLY C  1 74  ? -5.701   -19.495 -22.003  1.00 79.15  ? 74  GLY C CA  1 
ATOM   3347  C C   . GLY C  1 74  ? -5.237   -20.640 -21.139  1.00 79.76  ? 74  GLY C C   1 
ATOM   3348  O O   . GLY C  1 74  ? -4.657   -21.615 -21.658  1.00 80.39  ? 74  GLY C O   1 
ATOM   3349  N N   . PHE C  1 75  ? -5.498   -20.541 -19.829  1.00 79.75  ? 75  PHE C N   1 
ATOM   3350  C CA  . PHE C  1 75  ? -5.018   -21.553 -18.896  1.00 80.53  ? 75  PHE C CA  1 
ATOM   3351  C C   . PHE C  1 75  ? -5.720   -22.878 -19.067  1.00 80.80  ? 75  PHE C C   1 
ATOM   3352  O O   . PHE C  1 75  ? -5.108   -23.916 -18.859  1.00 81.70  ? 75  PHE C O   1 
ATOM   3353  C CB  . PHE C  1 75  ? -5.085   -21.071 -17.462  1.00 80.67  ? 75  PHE C CB  1 
ATOM   3354  C CG  . PHE C  1 75  ? -3.837   -20.386 -17.005  1.00 81.20  ? 75  PHE C CG  1 
ATOM   3355  C CD1 . PHE C  1 75  ? -3.894   -19.085 -16.513  1.00 80.93  ? 75  PHE C CD1 1 
ATOM   3356  C CD2 . PHE C  1 75  ? -2.598   -21.034 -17.058  1.00 82.17  ? 75  PHE C CD2 1 
ATOM   3357  C CE1 . PHE C  1 75  ? -2.731   -18.442 -16.067  1.00 81.63  ? 75  PHE C CE1 1 
ATOM   3358  C CE2 . PHE C  1 75  ? -1.434   -20.383 -16.622  1.00 82.87  ? 75  PHE C CE2 1 
ATOM   3359  C CZ  . PHE C  1 75  ? -1.508   -19.088 -16.123  1.00 82.59  ? 75  PHE C CZ  1 
ATOM   3360  N N   . ALA C  1 76  ? -6.985   -22.860 -19.468  1.00 80.22  ? 76  ALA C N   1 
ATOM   3361  C CA  . ALA C  1 76  ? -7.662   -24.106 -19.837  1.00 80.63  ? 76  ALA C CA  1 
ATOM   3362  C C   . ALA C  1 76  ? -6.870   -24.836 -20.930  1.00 81.17  ? 76  ALA C C   1 
ATOM   3363  O O   . ALA C  1 76  ? -6.660   -26.039 -20.836  1.00 82.09  ? 76  ALA C O   1 
ATOM   3364  C CB  . ALA C  1 76  ? -9.085   -23.843 -20.287  1.00 80.05  ? 76  ALA C CB  1 
ATOM   3365  N N   . ILE C  1 77  ? -6.426   -24.111 -21.951  1.00 80.79  ? 77  ILE C N   1 
ATOM   3366  C CA  . ILE C  1 77  ? -5.616   -24.695 -22.994  1.00 81.47  ? 77  ILE C CA  1 
ATOM   3367  C C   . ILE C  1 77  ? -4.231   -25.110 -22.435  1.00 82.45  ? 77  ILE C C   1 
ATOM   3368  O O   . ILE C  1 77  ? -3.773   -26.269 -22.621  1.00 83.52  ? 77  ILE C O   1 
ATOM   3369  C CB  . ILE C  1 77  ? -5.453   -23.736 -24.188  1.00 81.05  ? 77  ILE C CB  1 
ATOM   3370  C CG1 . ILE C  1 77  ? -6.828   -23.398 -24.784  1.00 80.32  ? 77  ILE C CG1 1 
ATOM   3371  C CG2 . ILE C  1 77  ? -4.534   -24.316 -25.253  1.00 81.98  ? 77  ILE C CG2 1 
ATOM   3372  C CD1 . ILE C  1 77  ? -6.808   -22.383 -25.922  1.00 80.02  ? 77  ILE C CD1 1 
ATOM   3373  N N   . TYR C  1 78  ? -3.562   -24.194 -21.741  1.00 82.30  ? 78  TYR C N   1 
ATOM   3374  C CA  . TYR C  1 78  ? -2.241   -24.492 -21.231  1.00 83.38  ? 78  TYR C CA  1 
ATOM   3375  C C   . TYR C  1 78  ? -2.245   -25.792 -20.405  1.00 84.32  ? 78  TYR C C   1 
ATOM   3376  O O   . TYR C  1 78  ? -1.433   -26.722 -20.656  1.00 85.57  ? 78  TYR C O   1 
ATOM   3377  C CB  . TYR C  1 78  ? -1.706   -23.328 -20.404  1.00 83.17  ? 78  TYR C CB  1 
ATOM   3378  C CG  . TYR C  1 78  ? -0.422   -23.649 -19.696  1.00 84.44  ? 78  TYR C CG  1 
ATOM   3379  C CD1 . TYR C  1 78  ? 0.776    -23.285 -20.239  1.00 85.23  ? 78  TYR C CD1 1 
ATOM   3380  C CD2 . TYR C  1 78  ? -0.419   -24.340 -18.487  1.00 85.07  ? 78  TYR C CD2 1 
ATOM   3381  C CE1 . TYR C  1 78  ? 1.960    -23.587 -19.601  1.00 86.61  ? 78  TYR C CE1 1 
ATOM   3382  C CE2 . TYR C  1 78  ? 0.758    -24.659 -17.839  1.00 86.44  ? 78  TYR C CE2 1 
ATOM   3383  C CZ  . TYR C  1 78  ? 1.945    -24.276 -18.393  1.00 87.20  ? 78  TYR C CZ  1 
ATOM   3384  O OH  . TYR C  1 78  ? 3.108    -24.606 -17.733  1.00 88.76  ? 78  TYR C OH  1 
ATOM   3385  N N   . ASP C  1 79  ? -3.152   -25.860 -19.430  1.00 83.93  ? 79  ASP C N   1 
ATOM   3386  C CA  . ASP C  1 79  ? -3.226   -27.025 -18.555  1.00 84.98  ? 79  ASP C CA  1 
ATOM   3387  C C   . ASP C  1 79  ? -3.565   -28.308 -19.314  1.00 85.70  ? 79  ASP C C   1 
ATOM   3388  O O   . ASP C  1 79  ? -3.006   -29.376 -19.001  1.00 87.11  ? 79  ASP C O   1 
ATOM   3389  C CB  . ASP C  1 79  ? -4.189   -26.796 -17.388  1.00 84.58  ? 79  ASP C CB  1 
ATOM   3390  C CG  . ASP C  1 79  ? -3.528   -26.060 -16.210  1.00 84.79  ? 79  ASP C CG  1 
ATOM   3391  O OD1 . ASP C  1 79  ? -4.228   -25.807 -15.210  1.00 84.65  ? 79  ASP C OD1 1 
ATOM   3392  O OD2 . ASP C  1 79  ? -2.321   -25.737 -16.274  1.00 85.27  ? 79  ASP C OD2 1 
ATOM   3393  N N   . THR C  1 80  ? -4.430   -28.209 -20.320  1.00 84.93  ? 80  THR C N   1 
ATOM   3394  C CA  . THR C  1 80  ? -4.781   -29.385 -21.115  1.00 85.73  ? 80  THR C CA  1 
ATOM   3395  C C   . THR C  1 80  ? -3.570   -29.890 -21.936  1.00 86.82  ? 80  THR C C   1 
ATOM   3396  O O   . THR C  1 80  ? -3.337   -31.099 -22.044  1.00 88.21  ? 80  THR C O   1 
ATOM   3397  C CB  . THR C  1 80  ? -6.007   -29.117 -22.018  1.00 84.81  ? 80  THR C CB  1 
ATOM   3398  O OG1 . THR C  1 80  ? -7.145   -28.780 -21.211  1.00 84.15  ? 80  THR C OG1 1 
ATOM   3399  C CG2 . THR C  1 80  ? -6.347   -30.336 -22.864  1.00 85.82  ? 80  THR C CG2 1 
ATOM   3400  N N   . ILE C  1 81  ? -2.801   -28.957 -22.498  1.00 86.38  ? 81  ILE C N   1 
ATOM   3401  C CA  . ILE C  1 81  ? -1.572   -29.322 -23.198  1.00 87.60  ? 81  ILE C CA  1 
ATOM   3402  C C   . ILE C  1 81  ? -0.686   -30.097 -22.237  1.00 89.06  ? 81  ILE C C   1 
ATOM   3403  O O   . ILE C  1 81  ? -0.240   -31.177 -22.586  1.00 90.56  ? 81  ILE C O   1 
ATOM   3404  C CB  . ILE C  1 81  ? -0.812   -28.101 -23.788  1.00 87.12  ? 81  ILE C CB  1 
ATOM   3405  C CG1 . ILE C  1 81  ? -1.649   -27.447 -24.910  1.00 86.03  ? 81  ILE C CG1 1 
ATOM   3406  C CG2 . ILE C  1 81  ? 0.560    -28.521 -24.300  1.00 88.74  ? 81  ILE C CG2 1 
ATOM   3407  C CD1 . ILE C  1 81  ? -1.137   -26.117 -25.428  1.00 85.51  ? 81  ILE C CD1 1 
ATOM   3408  N N   . GLN C  1 82  ? -0.460   -29.582 -21.026  1.00 88.82  ? 82  GLN C N   1 
ATOM   3409  C CA  . GLN C  1 82  ? 0.459    -30.256 -20.107  1.00 90.40  ? 82  GLN C CA  1 
ATOM   3410  C C   . GLN C  1 82  ? -0.126   -31.560 -19.630  1.00 91.39  ? 82  GLN C C   1 
ATOM   3411  O O   . GLN C  1 82  ? 0.593    -32.460 -19.270  1.00 93.13  ? 82  GLN C O   1 
ATOM   3412  C CB  . GLN C  1 82  ? 0.831    -29.395 -18.890  1.00 90.10  ? 82  GLN C CB  1 
ATOM   3413  C CG  . GLN C  1 82  ? 1.405    -28.004 -19.164  1.00 89.29  ? 82  GLN C CG  1 
ATOM   3414  C CD  . GLN C  1 82  ? 2.211    -27.894 -20.459  1.00 89.80  ? 82  GLN C CD  1 
ATOM   3415  O OE1 . GLN C  1 82  ? 2.232    -26.831 -21.093  1.00 88.90  ? 82  GLN C OE1 1 
ATOM   3416  N NE2 . GLN C  1 82  ? 2.853    -28.993 -20.874  1.00 91.42  ? 82  GLN C NE2 1 
ATOM   3417  N N   . HIS C  1 83  ? -1.439   -31.676 -19.636  1.00 90.48  ? 83  HIS C N   1 
ATOM   3418  C CA  . HIS C  1 83  ? -2.077   -32.854 -19.045  1.00 91.56  ? 83  HIS C CA  1 
ATOM   3419  C C   . HIS C  1 83  ? -2.088   -34.082 -19.928  1.00 92.91  ? 83  HIS C C   1 
ATOM   3420  O O   . HIS C  1 83  ? -2.066   -35.214 -19.426  1.00 94.57  ? 83  HIS C O   1 
ATOM   3421  C CB  . HIS C  1 83  ? -3.491   -32.518 -18.602  1.00 90.37  ? 83  HIS C CB  1 
ATOM   3422  C CG  . HIS C  1 83  ? -4.222   -33.682 -17.977  1.00 91.62  ? 83  HIS C CG  1 
ATOM   3423  N ND1 . HIS C  1 83  ? -5.183   -34.371 -18.639  1.00 91.85  ? 83  HIS C ND1 1 
ATOM   3424  C CD2 . HIS C  1 83  ? -4.097   -34.284 -16.712  1.00 92.96  ? 83  HIS C CD2 1 
ATOM   3425  C CE1 . HIS C  1 83  ? -5.661   -35.358 -17.842  1.00 93.28  ? 83  HIS C CE1 1 
ATOM   3426  N NE2 . HIS C  1 83  ? -4.996   -35.301 -16.660  1.00 93.96  ? 83  HIS C NE2 1 
ATOM   3427  N N   . ILE C  1 84  ? -2.128   -33.878 -21.244  1.00 92.39  ? 84  ILE C N   1 
ATOM   3428  C CA  . ILE C  1 84  ? -2.240   -35.006 -22.175  1.00 93.72  ? 84  ILE C CA  1 
ATOM   3429  C C   . ILE C  1 84  ? -0.892   -35.631 -22.470  1.00 95.57  ? 84  ILE C C   1 
ATOM   3430  O O   . ILE C  1 84  ? 0.140    -34.994 -22.279  1.00 95.57  ? 84  ILE C O   1 
ATOM   3431  C CB  . ILE C  1 84  ? -2.958   -34.623 -23.489  1.00 92.66  ? 84  ILE C CB  1 
ATOM   3432  C CG1 . ILE C  1 84  ? -2.218   -33.498 -24.226  1.00 91.74  ? 84  ILE C CG1 1 
ATOM   3433  C CG2 . ILE C  1 84  ? -4.418   -34.273 -23.201  1.00 91.33  ? 84  ILE C CG2 1 
ATOM   3434  C CD1 . ILE C  1 84  ? -2.555   -33.400 -25.696  1.00 91.52  ? 84  ILE C CD1 1 
ATOM   3435  N N   . LYS C  1 85  ? -0.906   -36.875 -22.931  1.00 97.35  ? 85  LYS C N   1 
ATOM   3436  C CA  . LYS C  1 85  ? 0.329    -37.621 -23.156  1.00 99.52  ? 85  LYS C CA  1 
ATOM   3437  C C   . LYS C  1 85  ? 1.118    -37.128 -24.361  1.00 99.53  ? 85  LYS C C   1 
ATOM   3438  O O   . LYS C  1 85  ? 2.311    -36.873 -24.227  1.00 100.34 ? 85  LYS C O   1 
ATOM   3439  C CB  . LYS C  1 85  ? 0.069    -39.128 -23.261  1.00 101.69 ? 85  LYS C CB  1 
ATOM   3440  C CG  . LYS C  1 85  ? -0.479   -39.734 -21.981  1.00 102.33 ? 85  LYS C CG  1 
ATOM   3441  C CD  . LYS C  1 85  ? -0.652   -41.244 -22.128  1.00 104.83 ? 85  LYS C CD  1 
ATOM   3442  C CE  . LYS C  1 85  ? -0.375   -41.979 -20.817  1.00 106.60 ? 85  LYS C CE  1 
ATOM   3443  N NZ  . LYS C  1 85  ? 0.485    -43.180 -21.013  1.00 109.60 ? 85  LYS C NZ  1 
ATOM   3444  N N   . PRO C  1 86  ? 0.470    -36.987 -25.534  1.00 98.82  ? 86  PRO C N   1 
ATOM   3445  C CA  . PRO C  1 86  ? 1.248    -36.562 -26.705  1.00 99.14  ? 86  PRO C CA  1 
ATOM   3446  C C   . PRO C  1 86  ? 1.964    -35.214 -26.521  1.00 97.95  ? 86  PRO C C   1 
ATOM   3447  O O   . PRO C  1 86  ? 1.470    -34.321 -25.817  1.00 96.13  ? 86  PRO C O   1 
ATOM   3448  C CB  . PRO C  1 86  ? 0.187    -36.443 -27.808  1.00 98.22  ? 86  PRO C CB  1 
ATOM   3449  C CG  . PRO C  1 86  ? -0.964   -37.287 -27.343  1.00 98.34  ? 86  PRO C CG  1 
ATOM   3450  C CD  . PRO C  1 86  ? -0.965   -37.128 -25.856  1.00 97.83  ? 86  PRO C CD  1 
ATOM   3451  N N   . ASP C  1 87  ? 3.133    -35.095 -27.138  1.00 99.21  ? 87  ASP C N   1 
ATOM   3452  C CA  . ASP C  1 87  ? 3.819    -33.828 -27.236  1.00 98.40  ? 87  ASP C CA  1 
ATOM   3453  C C   . ASP C  1 87  ? 3.002    -32.904 -28.102  1.00 96.59  ? 87  ASP C C   1 
ATOM   3454  O O   . ASP C  1 87  ? 2.431    -33.336 -29.114  1.00 96.83  ? 87  ASP C O   1 
ATOM   3455  C CB  . ASP C  1 87  ? 5.193    -34.012 -27.878  1.00 100.53 ? 87  ASP C CB  1 
ATOM   3456  C CG  . ASP C  1 87  ? 6.217    -34.502 -26.910  1.00 102.22 ? 87  ASP C CG  1 
ATOM   3457  O OD1 . ASP C  1 87  ? 7.356    -34.779 -27.349  1.00 104.31 ? 87  ASP C OD1 1 
ATOM   3458  O OD2 . ASP C  1 87  ? 5.876    -34.603 -25.708  1.00 101.61 ? 87  ASP C OD2 1 
ATOM   3459  N N   . VAL C  1 88  ? 2.927    -31.630 -27.708  1.00 94.95  ? 88  VAL C N   1 
ATOM   3460  C CA  . VAL C  1 88  ? 2.235    -30.653 -28.540  1.00 93.44  ? 88  VAL C CA  1 
ATOM   3461  C C   . VAL C  1 88  ? 3.276    -29.673 -29.095  1.00 93.88  ? 88  VAL C C   1 
ATOM   3462  O O   . VAL C  1 88  ? 3.879    -28.889 -28.348  1.00 93.59  ? 88  VAL C O   1 
ATOM   3463  C CB  . VAL C  1 88  ? 1.095    -29.936 -27.776  1.00 91.29  ? 88  VAL C CB  1 
ATOM   3464  C CG1 . VAL C  1 88  ? 0.459    -28.864 -28.647  1.00 89.98  ? 88  VAL C CG1 1 
ATOM   3465  C CG2 . VAL C  1 88  ? 0.039    -30.926 -27.314  1.00 91.14  ? 88  VAL C CG2 1 
ATOM   3466  N N   . GLN C  1 89  ? 3.518    -29.743 -30.403  1.00 94.82  ? 89  GLN C N   1 
ATOM   3467  C CA  . GLN C  1 89  ? 4.388    -28.777 -31.057  1.00 95.37  ? 89  GLN C CA  1 
ATOM   3468  C C   . GLN C  1 89  ? 3.587    -27.506 -31.208  1.00 93.43  ? 89  GLN C C   1 
ATOM   3469  O O   . GLN C  1 89  ? 2.384    -27.550 -31.496  1.00 92.22  ? 89  GLN C O   1 
ATOM   3470  C CB  . GLN C  1 89  ? 4.843    -29.269 -32.430  1.00 97.18  ? 89  GLN C CB  1 
ATOM   3471  C CG  . GLN C  1 89  ? 5.406    -30.666 -32.386  1.00 99.20  ? 89  GLN C CG  1 
ATOM   3472  C CD  . GLN C  1 89  ? 6.415    -30.986 -33.491  1.00 101.64 ? 89  GLN C CD  1 
ATOM   3473  O OE1 . GLN C  1 89  ? 6.920    -30.103 -34.182  1.00 102.02 ? 89  GLN C OE1 1 
ATOM   3474  N NE2 . GLN C  1 89  ? 6.720    -32.272 -33.649  1.00 103.53 ? 89  GLN C NE2 1 
ATOM   3475  N N   . THR C  1 90  ? 4.240    -26.374 -30.992  1.00 93.30  ? 90  THR C N   1 
ATOM   3476  C CA  . THR C  1 90  ? 3.603    -25.087 -31.235  1.00 91.83  ? 90  THR C CA  1 
ATOM   3477  C C   . THR C  1 90  ? 4.387    -24.399 -32.333  1.00 93.09  ? 90  THR C C   1 
ATOM   3478  O O   . THR C  1 90  ? 5.617    -24.404 -32.337  1.00 94.73  ? 90  THR C O   1 
ATOM   3479  C CB  . THR C  1 90  ? 3.502    -24.237 -29.954  1.00 90.55  ? 90  THR C CB  1 
ATOM   3480  O OG1 . THR C  1 90  ? 4.781    -24.162 -29.313  1.00 91.79  ? 90  THR C OG1 1 
ATOM   3481  C CG2 . THR C  1 90  ? 2.495    -24.856 -28.989  1.00 89.29  ? 90  THR C CG2 1 
ATOM   3482  N N   . ILE C  1 91  ? 3.660    -23.860 -33.301  1.00 92.55  ? 91  ILE C N   1 
ATOM   3483  C CA  . ILE C  1 91  ? 4.264    -23.160 -34.436  1.00 93.83  ? 91  ILE C CA  1 
ATOM   3484  C C   . ILE C  1 91  ? 3.576    -21.812 -34.590  1.00 92.57  ? 91  ILE C C   1 
ATOM   3485  O O   . ILE C  1 91  ? 2.363    -21.753 -34.845  1.00 91.30  ? 91  ILE C O   1 
ATOM   3486  C CB  . ILE C  1 91  ? 4.083    -23.962 -35.724  1.00 95.01  ? 91  ILE C CB  1 
ATOM   3487  C CG1 . ILE C  1 91  ? 4.636    -25.378 -35.534  1.00 96.32  ? 91  ILE C CG1 1 
ATOM   3488  C CG2 . ILE C  1 91  ? 4.742    -23.243 -36.893  1.00 96.59  ? 91  ILE C CG2 1 
ATOM   3489  C CD1 . ILE C  1 91  ? 3.709    -26.482 -36.014  1.00 96.21  ? 91  ILE C CD1 1 
ATOM   3490  N N   . CYS C  1 92  ? 4.336    -20.734 -34.416  1.00 93.08  ? 92  CYS C N   1 
ATOM   3491  C CA  . CYS C  1 92  ? 3.755    -19.405 -34.523  1.00 92.15  ? 92  CYS C CA  1 
ATOM   3492  C C   . CYS C  1 92  ? 3.833    -18.922 -35.954  1.00 93.39  ? 92  CYS C C   1 
ATOM   3493  O O   . CYS C  1 92  ? 4.928    -18.818 -36.516  1.00 95.34  ? 92  CYS C O   1 
ATOM   3494  C CB  . CYS C  1 92  ? 4.474    -18.422 -33.606  1.00 92.23  ? 92  CYS C CB  1 
ATOM   3495  S SG  . CYS C  1 92  ? 3.960    -16.706 -33.859  1.00 91.71  ? 92  CYS C SG  1 
ATOM   3496  N N   . ILE C  1 93  ? 2.675    -18.644 -36.542  1.00 92.47  ? 93  ILE C N   1 
ATOM   3497  C CA  . ILE C  1 93  ? 2.606    -17.974 -37.841  1.00 93.59  ? 93  ILE C CA  1 
ATOM   3498  C C   . ILE C  1 93  ? 1.930    -16.611 -37.668  1.00 92.64  ? 93  ILE C C   1 
ATOM   3499  O O   . ILE C  1 93  ? 0.963    -16.493 -36.926  1.00 90.85  ? 93  ILE C O   1 
ATOM   3500  C CB  . ILE C  1 93  ? 1.828    -18.810 -38.878  1.00 93.80  ? 93  ILE C CB  1 
ATOM   3501  C CG1 . ILE C  1 93  ? 0.414    -19.114 -38.397  1.00 91.79  ? 93  ILE C CG1 1 
ATOM   3502  C CG2 . ILE C  1 93  ? 2.552    -20.114 -39.134  1.00 95.10  ? 93  ILE C CG2 1 
ATOM   3503  C CD1 . ILE C  1 93  ? -0.439   -19.847 -39.402  1.00 92.07  ? 93  ILE C CD1 1 
ATOM   3504  N N   . GLY C  1 94  ? 2.430    -15.581 -38.337  1.00 94.01  ? 94  GLY C N   1 
ATOM   3505  C CA  . GLY C  1 94  ? 1.857    -14.241 -38.204  1.00 93.45  ? 94  GLY C CA  1 
ATOM   3506  C C   . GLY C  1 94  ? 2.261    -13.521 -36.928  1.00 92.82  ? 94  GLY C C   1 
ATOM   3507  O O   . GLY C  1 94  ? 3.239    -12.779 -36.905  1.00 94.20  ? 94  GLY C O   1 
ATOM   3508  N N   . MET C  1 95  ? 1.484    -13.731 -35.870  1.00 90.88  ? 95  MET C N   1 
ATOM   3509  C CA  . MET C  1 95  ? 1.648    -13.026 -34.602  1.00 90.16  ? 95  MET C CA  1 
ATOM   3510  C C   . MET C  1 95  ? 1.191    -13.936 -33.461  1.00 88.53  ? 95  MET C C   1 
ATOM   3511  O O   . MET C  1 95  ? 0.155    -14.612 -33.565  1.00 87.40  ? 95  MET C O   1 
ATOM   3512  C CB  . MET C  1 95  ? 0.818    -11.730 -34.591  1.00 89.70  ? 95  MET C CB  1 
ATOM   3513  C CG  . MET C  1 95  ? 0.725    -10.979 -33.242  1.00 88.85  ? 95  MET C CG  1 
ATOM   3514  S SD  . MET C  1 95  ? 2.299    -10.230 -32.591  1.00 90.43  ? 95  MET C SD  1 
ATOM   3515  C CE  . MET C  1 95  ? 2.368    -8.595  -33.375  1.00 92.00  ? 95  MET C CE  1 
ATOM   3516  N N   . ALA C  1 96  ? 1.976    -13.968 -32.386  1.00 88.60  ? 96  ALA C N   1 
ATOM   3517  C CA  . ALA C  1 96  ? 1.537    -14.568 -31.159  1.00 87.20  ? 96  ALA C CA  1 
ATOM   3518  C C   . ALA C  1 96  ? 1.768    -13.545 -30.067  1.00 87.01  ? 96  ALA C C   1 
ATOM   3519  O O   . ALA C  1 96  ? 2.906    -13.318 -29.661  1.00 88.13  ? 96  ALA C O   1 
ATOM   3520  C CB  . ALA C  1 96  ? 2.308    -15.828 -30.883  1.00 87.73  ? 96  ALA C CB  1 
ATOM   3521  N N   . ALA C  1 97  ? 0.683    -12.922 -29.603  1.00 85.79  ? 97  ALA C N   1 
ATOM   3522  C CA  . ALA C  1 97  ? 0.757    -11.874 -28.588  1.00 85.68  ? 97  ALA C CA  1 
ATOM   3523  C C   . ALA C  1 97  ? 0.053    -12.232 -27.291  1.00 84.33  ? 97  ALA C C   1 
ATOM   3524  O O   . ALA C  1 97  ? -0.902   -13.006 -27.279  1.00 83.25  ? 97  ALA C O   1 
ATOM   3525  C CB  . ALA C  1 97  ? 0.183    -10.597 -29.134  1.00 85.88  ? 97  ALA C CB  1 
ATOM   3526  N N   . ALA C  1 98  ? 0.530    -11.653 -26.198  1.00 84.58  ? 98  ALA C N   1 
ATOM   3527  C CA  . ALA C  1 98  ? -0.085   -11.837 -24.886  1.00 83.57  ? 98  ALA C CA  1 
ATOM   3528  C C   . ALA C  1 98  ? -0.277   -13.321 -24.581  1.00 82.93  ? 98  ALA C C   1 
ATOM   3529  O O   . ALA C  1 98  ? 0.664    -14.092 -24.718  1.00 83.69  ? 98  ALA C O   1 
ATOM   3530  C CB  . ALA C  1 98  ? -1.401   -11.066 -24.800  1.00 82.69  ? 98  ALA C CB  1 
ATOM   3531  N N   . MET C  1 99  ? -1.490   -13.723 -24.201  1.00 81.76  ? 99  MET C N   1 
ATOM   3532  C CA  . MET C  1 99  ? -1.758   -15.123 -23.870  1.00 81.31  ? 99  MET C CA  1 
ATOM   3533  C C   . MET C  1 99  ? -1.422   -16.055 -25.041  1.00 81.75  ? 99  MET C C   1 
ATOM   3534  O O   . MET C  1 99  ? -1.104   -17.240 -24.842  1.00 82.00  ? 99  MET C O   1 
ATOM   3535  C CB  . MET C  1 99  ? -3.197   -15.292 -23.409  1.00 80.21  ? 99  MET C CB  1 
ATOM   3536  C CG  . MET C  1 99  ? -3.478   -16.588 -22.655  1.00 79.95  ? 99  MET C CG  1 
ATOM   3537  S SD  . MET C  1 99  ? -2.672   -16.863 -21.046  1.00 80.48  ? 99  MET C SD  1 
ATOM   3538  C CE  . MET C  1 99  ? -2.327   -15.136 -20.610  1.00 80.73  ? 99  MET C CE  1 
ATOM   3539  N N   . GLY C  1 100 ? -1.466   -15.498 -26.252  1.00 82.04  ? 100 GLY C N   1 
ATOM   3540  C CA  . GLY C  1 100 ? -0.989   -16.192 -27.442  1.00 82.80  ? 100 GLY C CA  1 
ATOM   3541  C C   . GLY C  1 100 ? 0.466    -16.634 -27.324  1.00 84.07  ? 100 GLY C C   1 
ATOM   3542  O O   . GLY C  1 100 ? 0.792    -17.806 -27.534  1.00 84.53  ? 100 GLY C O   1 
ATOM   3543  N N   . SER C  1 101 ? 1.350    -15.701 -26.996  1.00 84.86  ? 101 SER C N   1 
ATOM   3544  C CA  . SER C  1 101 ? 2.750    -16.017 -26.868  1.00 86.31  ? 101 SER C CA  1 
ATOM   3545  C C   . SER C  1 101 ? 2.980    -16.930 -25.664  1.00 86.19  ? 101 SER C C   1 
ATOM   3546  O O   . SER C  1 101 ? 3.896    -17.751 -25.672  1.00 87.32  ? 101 SER C O   1 
ATOM   3547  C CB  . SER C  1 101 ? 3.559    -14.740 -26.749  1.00 87.31  ? 101 SER C CB  1 
ATOM   3548  O OG  . SER C  1 101 ? 3.378    -14.144 -25.483  1.00 86.77  ? 101 SER C OG  1 
ATOM   3549  N N   . PHE C  1 102 ? 2.128    -16.808 -24.650  1.00 84.99  ? 102 PHE C N   1 
ATOM   3550  C CA  . PHE C  1 102 ? 2.199    -17.688 -23.502  1.00 84.93  ? 102 PHE C CA  1 
ATOM   3551  C C   . PHE C  1 102 ? 2.016    -19.132 -23.937  1.00 85.02  ? 102 PHE C C   1 
ATOM   3552  O O   . PHE C  1 102 ? 2.755    -20.018 -23.516  1.00 85.97  ? 102 PHE C O   1 
ATOM   3553  C CB  . PHE C  1 102 ? 1.144    -17.310 -22.480  1.00 83.71  ? 102 PHE C CB  1 
ATOM   3554  C CG  . PHE C  1 102 ? 1.266    -18.059 -21.181  1.00 83.87  ? 102 PHE C CG  1 
ATOM   3555  C CD1 . PHE C  1 102 ? 2.183    -17.657 -20.207  1.00 84.77  ? 102 PHE C CD1 1 
ATOM   3556  C CD2 . PHE C  1 102 ? 0.448    -19.158 -20.919  1.00 83.31  ? 102 PHE C CD2 1 
ATOM   3557  C CE1 . PHE C  1 102 ? 2.281    -18.335 -19.001  1.00 85.09  ? 102 PHE C CE1 1 
ATOM   3558  C CE2 . PHE C  1 102 ? 0.558    -19.845 -19.715  1.00 83.68  ? 102 PHE C CE2 1 
ATOM   3559  C CZ  . PHE C  1 102 ? 1.471    -19.434 -18.753  1.00 84.56  ? 102 PHE C CZ  1 
ATOM   3560  N N   . LEU C  1 103 ? 1.038    -19.363 -24.797  1.00 84.23  ? 103 LEU C N   1 
ATOM   3561  C CA  . LEU C  1 103 ? 0.749    -20.702 -25.268  1.00 84.40  ? 103 LEU C CA  1 
ATOM   3562  C C   . LEU C  1 103 ? 1.831    -21.189 -26.198  1.00 85.88  ? 103 LEU C C   1 
ATOM   3563  O O   . LEU C  1 103 ? 2.149    -22.372 -26.204  1.00 86.68  ? 103 LEU C O   1 
ATOM   3564  C CB  . LEU C  1 103 ? -0.597   -20.751 -25.978  1.00 83.35  ? 103 LEU C CB  1 
ATOM   3565  C CG  . LEU C  1 103 ? -1.841   -20.598 -25.104  1.00 82.10  ? 103 LEU C CG  1 
ATOM   3566  C CD1 . LEU C  1 103 ? -3.085   -20.684 -25.977  1.00 81.40  ? 103 LEU C CD1 1 
ATOM   3567  C CD2 . LEU C  1 103 ? -1.923   -21.611 -23.968  1.00 82.22  ? 103 LEU C CD2 1 
ATOM   3568  N N   . LEU C  1 104 ? 2.392    -20.278 -26.983  1.00 86.45  ? 104 LEU C N   1 
ATOM   3569  C CA  . LEU C  1 104 ? 3.531    -20.595 -27.844  1.00 88.15  ? 104 LEU C CA  1 
ATOM   3570  C C   . LEU C  1 104 ? 4.627    -21.236 -27.024  1.00 89.39  ? 104 LEU C C   1 
ATOM   3571  O O   . LEU C  1 104 ? 5.125    -22.306 -27.377  1.00 90.56  ? 104 LEU C O   1 
ATOM   3572  C CB  . LEU C  1 104 ? 4.071    -19.336 -28.546  1.00 88.80  ? 104 LEU C CB  1 
ATOM   3573  C CG  . LEU C  1 104 ? 5.212    -19.492 -29.559  1.00 90.78  ? 104 LEU C CG  1 
ATOM   3574  C CD1 . LEU C  1 104 ? 4.924    -20.515 -30.657  1.00 91.23  ? 104 LEU C CD1 1 
ATOM   3575  C CD2 . LEU C  1 104 ? 5.537    -18.132 -30.148  1.00 91.34  ? 104 LEU C CD2 1 
ATOM   3576  N N   . ALA C  1 105 ? 4.965    -20.588 -25.911  1.00 89.27  ? 105 ALA C N   1 
ATOM   3577  C CA  . ALA C  1 105 ? 6.048    -21.013 -25.042  1.00 90.60  ? 105 ALA C CA  1 
ATOM   3578  C C   . ALA C  1 105 ? 5.677    -22.261 -24.280  1.00 90.41  ? 105 ALA C C   1 
ATOM   3579  O O   . ALA C  1 105 ? 6.541    -22.873 -23.632  1.00 91.75  ? 105 ALA C O   1 
ATOM   3580  C CB  . ALA C  1 105 ? 6.392    -19.902 -24.077  1.00 90.54  ? 105 ALA C CB  1 
ATOM   3581  N N   . ALA C  1 106 ? 4.399    -22.641 -24.356  1.00 88.96  ? 106 ALA C N   1 
ATOM   3582  C CA  . ALA C  1 106 ? 3.909    -23.805 -23.610  1.00 88.84  ? 106 ALA C CA  1 
ATOM   3583  C C   . ALA C  1 106 ? 4.003    -25.139 -24.364  1.00 89.84  ? 106 ALA C C   1 
ATOM   3584  O O   . ALA C  1 106 ? 3.669    -26.184 -23.802  1.00 90.08  ? 106 ALA C O   1 
ATOM   3585  C CB  . ALA C  1 106 ? 2.491    -23.564 -23.119  1.00 87.06  ? 106 ALA C CB  1 
ATOM   3586  N N   . GLY C  1 107 ? 4.445    -25.105 -25.626  1.00 90.61  ? 107 GLY C N   1 
ATOM   3587  C CA  . GLY C  1 107 ? 4.657    -26.329 -26.408  1.00 91.89  ? 107 GLY C CA  1 
ATOM   3588  C C   . GLY C  1 107 ? 5.775    -27.172 -25.818  1.00 93.80  ? 107 GLY C C   1 
ATOM   3589  O O   . GLY C  1 107 ? 6.589    -26.678 -25.016  1.00 94.36  ? 107 GLY C O   1 
ATOM   3590  N N   . ALA C  1 108 ? 5.808    -28.448 -26.207  1.00 94.98  ? 108 ALA C N   1 
ATOM   3591  C CA  . ALA C  1 108 ? 6.834    -29.399 -25.744  1.00 97.13  ? 108 ALA C CA  1 
ATOM   3592  C C   . ALA C  1 108 ? 8.233    -28.855 -26.033  1.00 98.75  ? 108 ALA C C   1 
ATOM   3593  O O   . ALA C  1 108 ? 8.500    -28.359 -27.146  1.00 99.07  ? 108 ALA C O   1 
ATOM   3594  C CB  . ALA C  1 108 ? 6.635    -30.756 -26.398  1.00 98.34  ? 108 ALA C CB  1 
ATOM   3595  N N   . LYS C  1 109 ? 9.110    -28.922 -25.028  1.00 99.93  ? 109 LYS C N   1 
ATOM   3596  C CA  . LYS C  1 109 ? 10.481   -28.369 -25.160  1.00 101.71 ? 109 LYS C CA  1 
ATOM   3597  C C   . LYS C  1 109 ? 11.229   -29.008 -26.320  1.00 103.86 ? 109 LYS C C   1 
ATOM   3598  O O   . LYS C  1 109 ? 11.161   -30.217 -26.508  1.00 104.93 ? 109 LYS C O   1 
ATOM   3599  C CB  . LYS C  1 109 ? 11.292   -28.498 -23.858  1.00 102.94 ? 109 LYS C CB  1 
ATOM   3600  C CG  . LYS C  1 109 ? 10.780   -27.627 -22.713  1.00 101.19 ? 109 LYS C CG  1 
ATOM   3601  C CD  . LYS C  1 109 ? 11.567   -27.878 -21.427  1.00 102.66 ? 109 LYS C CD  1 
ATOM   3602  C CE  . LYS C  1 109 ? 10.903   -27.295 -20.174  1.00 101.07 ? 109 LYS C CE  1 
ATOM   3603  N NZ  . LYS C  1 109 ? 10.630   -25.818 -20.245  1.00 99.50  ? 109 LYS C NZ  1 
ATOM   3604  N N   . GLY C  1 110 ? 11.905   -28.173 -27.104  1.00 104.60 ? 110 GLY C N   1 
ATOM   3605  C CA  . GLY C  1 110 ? 12.518   -28.601 -28.363  1.00 106.59 ? 110 GLY C CA  1 
ATOM   3606  C C   . GLY C  1 110 ? 11.584   -28.573 -29.571  1.00 105.43 ? 110 GLY C C   1 
ATOM   3607  O O   . GLY C  1 110 ? 12.036   -28.724 -30.704  1.00 106.99 ? 110 GLY C O   1 
ATOM   3608  N N   . LYS C  1 111 ? 10.281   -28.391 -29.345  1.00 102.89 ? 111 LYS C N   1 
ATOM   3609  C CA  . LYS C  1 111 ? 9.311    -28.391 -30.440  1.00 101.84 ? 111 LYS C CA  1 
ATOM   3610  C C   . LYS C  1 111 ? 8.409    -27.139 -30.460  1.00 99.44  ? 111 LYS C C   1 
ATOM   3611  O O   . LYS C  1 111 ? 7.220    -27.201 -30.786  1.00 97.85  ? 111 LYS C O   1 
ATOM   3612  C CB  . LYS C  1 111 ? 8.484    -29.673 -30.421  1.00 101.63 ? 111 LYS C CB  1 
ATOM   3613  C CG  . LYS C  1 111 ? 9.327    -30.938 -30.358  1.00 104.16 ? 111 LYS C CG  1 
ATOM   3614  C CD  . LYS C  1 111 ? 8.522    -32.176 -30.710  1.00 104.35 ? 111 LYS C CD  1 
ATOM   3615  C CE  . LYS C  1 111 ? 9.239    -33.426 -30.239  1.00 106.68 ? 111 LYS C CE  1 
ATOM   3616  N NZ  . LYS C  1 111 ? 8.224    -34.443 -29.863  1.00 106.14 ? 111 LYS C NZ  1 
ATOM   3617  N N   . ARG C  1 112 ? 8.999    -25.999 -30.119  1.00 99.40  ? 112 ARG C N   1 
ATOM   3618  C CA  . ARG C  1 112 ? 8.333    -24.712 -30.204  1.00 97.61  ? 112 ARG C CA  1 
ATOM   3619  C C   . ARG C  1 112 ? 8.990    -23.888 -31.310  1.00 98.86  ? 112 ARG C C   1 
ATOM   3620  O O   . ARG C  1 112 ? 10.160   -23.525 -31.234  1.00 100.59 ? 112 ARG C O   1 
ATOM   3621  C CB  . ARG C  1 112 ? 8.406    -23.992 -28.869  1.00 96.66  ? 112 ARG C CB  1 
ATOM   3622  C CG  . ARG C  1 112 ? 7.763    -24.783 -27.750  1.00 95.63  ? 112 ARG C CG  1 
ATOM   3623  C CD  . ARG C  1 112 ? 8.067    -24.187 -26.394  1.00 95.27  ? 112 ARG C CD  1 
ATOM   3624  N NE  . ARG C  1 112 ? 9.490    -23.898 -26.281  1.00 97.31  ? 112 ARG C NE  1 
ATOM   3625  C CZ  . ARG C  1 112 ? 10.081   -23.419 -25.197  1.00 97.71  ? 112 ARG C CZ  1 
ATOM   3626  N NH1 . ARG C  1 112 ? 9.390    -23.187 -24.099  1.00 96.22  ? 112 ARG C NH1 1 
ATOM   3627  N NH2 . ARG C  1 112 ? 11.377   -23.187 -25.210  1.00 99.81  ? 112 ARG C NH2 1 
ATOM   3628  N N   . PHE C  1 113 ? 8.220    -23.598 -32.348  1.00 98.17  ? 113 PHE C N   1 
ATOM   3629  C CA  . PHE C  1 113 ? 8.757    -22.966 -33.549  1.00 99.61  ? 113 PHE C CA  1 
ATOM   3630  C C   . PHE C  1 113 ? 8.102    -21.627 -33.861  1.00 98.31  ? 113 PHE C C   1 
ATOM   3631  O O   . PHE C  1 113 ? 7.037    -21.311 -33.340  1.00 96.19  ? 113 PHE C O   1 
ATOM   3632  C CB  . PHE C  1 113 ? 8.587    -23.897 -34.766  1.00 100.71 ? 113 PHE C CB  1 
ATOM   3633  C CG  . PHE C  1 113 ? 9.134    -25.291 -34.560  1.00 102.17 ? 113 PHE C CG  1 
ATOM   3634  C CD1 . PHE C  1 113 ? 8.297    -26.324 -34.124  1.00 101.10 ? 113 PHE C CD1 1 
ATOM   3635  C CD2 . PHE C  1 113 ? 10.476   -25.577 -34.816  1.00 104.83 ? 113 PHE C CD2 1 
ATOM   3636  C CE1 . PHE C  1 113 ? 8.788    -27.608 -33.945  1.00 102.65 ? 113 PHE C CE1 1 
ATOM   3637  C CE2 . PHE C  1 113 ? 10.976   -26.868 -34.633  1.00 106.39 ? 113 PHE C CE2 1 
ATOM   3638  C CZ  . PHE C  1 113 ? 10.132   -27.884 -34.200  1.00 105.30 ? 113 PHE C CZ  1 
ATOM   3639  N N   . ALA C  1 114 ? 8.749    -20.845 -34.718  1.00 99.82  ? 114 ALA C N   1 
ATOM   3640  C CA  . ALA C  1 114 ? 8.115    -19.684 -35.326  1.00 99.08  ? 114 ALA C CA  1 
ATOM   3641  C C   . ALA C  1 114 ? 8.625    -19.564 -36.743  1.00 101.20 ? 114 ALA C C   1 
ATOM   3642  O O   . ALA C  1 114 ? 9.769    -19.863 -37.001  1.00 103.42 ? 114 ALA C O   1 
ATOM   3643  C CB  . ALA C  1 114 ? 8.440    -18.422 -34.550  1.00 98.77  ? 114 ALA C CB  1 
ATOM   3644  N N   . LEU C  1 115 ? 7.782    -19.127 -37.665  1.00 100.70 ? 115 LEU C N   1 
ATOM   3645  C CA  . LEU C  1 115 ? 8.234    -18.882 -39.026  1.00 102.85 ? 115 LEU C CA  1 
ATOM   3646  C C   . LEU C  1 115 ? 9.053    -17.591 -39.072  1.00 104.21 ? 115 LEU C C   1 
ATOM   3647  O O   . LEU C  1 115 ? 8.944    -16.769 -38.169  1.00 103.06 ? 115 LEU C O   1 
ATOM   3648  C CB  . LEU C  1 115 ? 7.052    -18.881 -39.997  1.00 102.07 ? 115 LEU C CB  1 
ATOM   3649  C CG  . LEU C  1 115 ? 6.302    -20.225 -40.106  1.00 101.24 ? 115 LEU C CG  1 
ATOM   3650  C CD1 . LEU C  1 115 ? 5.578    -20.339 -41.438  1.00 101.78 ? 115 LEU C CD1 1 
ATOM   3651  C CD2 . LEU C  1 115 ? 7.265    -21.387 -39.965  1.00 102.80 ? 115 LEU C CD2 1 
ATOM   3652  N N   . PRO C  1 116 ? 9.909    -17.423 -40.106  1.00 106.89 ? 116 PRO C N   1 
ATOM   3653  C CA  . PRO C  1 116 ? 10.921   -16.342 -40.047  1.00 108.71 ? 116 PRO C CA  1 
ATOM   3654  C C   . PRO C  1 116 ? 10.366   -14.935 -39.779  1.00 107.60 ? 116 PRO C C   1 
ATOM   3655  O O   . PRO C  1 116 ? 11.009   -14.154 -39.084  1.00 108.13 ? 116 PRO C O   1 
ATOM   3656  C CB  . PRO C  1 116 ? 11.589   -16.384 -41.427  1.00 111.68 ? 116 PRO C CB  1 
ATOM   3657  C CG  . PRO C  1 116 ? 11.221   -17.693 -42.035  1.00 111.69 ? 116 PRO C CG  1 
ATOM   3658  C CD  . PRO C  1 116 ? 9.960    -18.171 -41.383  1.00 108.55 ? 116 PRO C CD  1 
ATOM   3659  N N   . ASN C  1 117 ? 9.192    -14.622 -40.317  1.00 99.06  ? 117 ASN C N   1 
ATOM   3660  C CA  . ASN C  1 117 ? 8.645    -13.278 -40.186  1.00 99.99  ? 117 ASN C CA  1 
ATOM   3661  C C   . ASN C  1 117 ? 7.492    -13.148 -39.206  1.00 98.56  ? 117 ASN C C   1 
ATOM   3662  O O   . ASN C  1 117 ? 6.827    -12.101 -39.157  1.00 99.35  ? 117 ASN C O   1 
ATOM   3663  C CB  . ASN C  1 117 ? 8.228    -12.727 -41.547  1.00 101.89 ? 117 ASN C CB  1 
ATOM   3664  C CG  . ASN C  1 117 ? 9.397    -12.581 -42.486  1.00 103.74 ? 117 ASN C CG  1 
ATOM   3665  O OD1 . ASN C  1 117 ? 9.476    -13.270 -43.497  1.00 104.11 ? 117 ASN C OD1 1 
ATOM   3666  N ND2 . ASN C  1 117 ? 10.324   -11.698 -42.145  1.00 105.07 ? 117 ASN C ND2 1 
ATOM   3667  N N   . ALA C  1 118 ? 7.255    -14.206 -38.438  1.00 96.71  ? 118 ALA C N   1 
ATOM   3668  C CA  . ALA C  1 118 ? 6.277    -14.180 -37.363  1.00 95.35  ? 118 ALA C CA  1 
ATOM   3669  C C   . ALA C  1 118 ? 6.758    -13.250 -36.253  1.00 95.33  ? 118 ALA C C   1 
ATOM   3670  O O   . ALA C  1 118 ? 7.954    -13.060 -36.068  1.00 95.98  ? 118 ALA C O   1 
ATOM   3671  C CB  . ALA C  1 118 ? 6.038    -15.583 -36.823  1.00 93.81  ? 118 ALA C CB  1 
ATOM   3672  N N   . GLU C  1 119 ? 5.814    -12.659 -35.536  1.00 94.79  ? 119 GLU C N   1 
ATOM   3673  C CA  . GLU C  1 119 ? 6.112    -11.733 -34.460  1.00 94.81  ? 119 GLU C CA  1 
ATOM   3674  C C   . GLU C  1 119 ? 5.576    -12.273 -33.162  1.00 93.02  ? 119 GLU C C   1 
ATOM   3675  O O   . GLU C  1 119 ? 4.575    -12.991 -33.124  1.00 92.04  ? 119 GLU C O   1 
ATOM   3676  C CB  . GLU C  1 119 ? 5.482    -10.371 -34.733  1.00 96.13  ? 119 GLU C CB  1 
ATOM   3677  C CG  . GLU C  1 119 ? 6.418    -9.417  -35.461  1.00 98.41  ? 119 GLU C CG  1 
ATOM   3678  C CD  . GLU C  1 119 ? 5.725    -8.157  -35.929  1.00 100.22 ? 119 GLU C CD  1 
ATOM   3679  O OE1 . GLU C  1 119 ? 6.298    -7.495  -36.828  1.00 102.49 ? 119 GLU C OE1 1 
ATOM   3680  O OE2 . GLU C  1 119 ? 4.617    -7.838  -35.402  1.00 99.59  ? 119 GLU C OE2 1 
ATOM   3681  N N   . VAL C  1 120 ? 6.257    -11.922 -32.090  1.00 92.86  ? 120 VAL C N   1 
ATOM   3682  C CA  . VAL C  1 120 ? 5.851    -12.325 -30.755  1.00 91.42  ? 120 VAL C CA  1 
ATOM   3683  C C   . VAL C  1 120 ? 5.810    -11.057 -29.912  1.00 91.78  ? 120 VAL C C   1 
ATOM   3684  O O   . VAL C  1 120 ? 6.696    -10.194 -30.014  1.00 93.19  ? 120 VAL C O   1 
ATOM   3685  C CB  . VAL C  1 120 ? 6.831    -13.368 -30.155  1.00 91.06  ? 120 VAL C CB  1 
ATOM   3686  C CG1 . VAL C  1 120 ? 6.487    -13.703 -28.714  1.00 89.97  ? 120 VAL C CG1 1 
ATOM   3687  C CG2 . VAL C  1 120 ? 6.807    -14.632 -30.978  1.00 90.82  ? 120 VAL C CG2 1 
ATOM   3688  N N   . MET C  1 121 ? 4.785    -10.937 -29.084  1.00 90.73  ? 121 MET C N   1 
ATOM   3689  C CA  . MET C  1 121 ? 4.692    -9.798  -28.211  1.00 90.99  ? 121 MET C CA  1 
ATOM   3690  C C   . MET C  1 121 ? 4.299    -10.277 -26.831  1.00 89.56  ? 121 MET C C   1 
ATOM   3691  O O   . MET C  1 121 ? 3.406    -11.111 -26.669  1.00 88.46  ? 121 MET C O   1 
ATOM   3692  C CB  . MET C  1 121 ? 3.698    -8.761  -28.767  1.00 91.75  ? 121 MET C CB  1 
ATOM   3693  C CG  . MET C  1 121 ? 3.590    -7.460  -27.957  1.00 92.36  ? 121 MET C CG  1 
ATOM   3694  S SD  . MET C  1 121 ? 2.319    -7.448  -26.648  1.00 90.74  ? 121 MET C SD  1 
ATOM   3695  C CE  . MET C  1 121 ? 0.851    -6.984  -27.562  1.00 91.43  ? 121 MET C CE  1 
ATOM   3696  N N   . ILE C  1 122 ? 4.993    -9.756  -25.835  1.00 89.86  ? 122 ILE C N   1 
ATOM   3697  C CA  . ILE C  1 122 ? 4.660    -10.073 -24.455  1.00 88.78  ? 122 ILE C CA  1 
ATOM   3698  C C   . ILE C  1 122 ? 4.345    -8.779  -23.683  1.00 89.06  ? 122 ILE C C   1 
ATOM   3699  O O   . ILE C  1 122 ? 4.929    -7.720  -23.964  1.00 90.48  ? 122 ILE C O   1 
ATOM   3700  C CB  . ILE C  1 122 ? 5.803    -10.881 -23.773  1.00 88.99  ? 122 ILE C CB  1 
ATOM   3701  C CG1 . ILE C  1 122 ? 7.126    -10.107 -23.843  1.00 90.70  ? 122 ILE C CG1 1 
ATOM   3702  C CG2 . ILE C  1 122 ? 5.926    -12.265 -24.393  1.00 88.65  ? 122 ILE C CG2 1 
ATOM   3703  C CD1 . ILE C  1 122 ? 8.222    -10.668 -22.950  1.00 91.37  ? 122 ILE C CD1 1 
ATOM   3704  N N   . HIS C  1 123 ? 3.426    -8.854  -22.724  1.00 87.94  ? 123 HIS C N   1 
ATOM   3705  C CA  . HIS C  1 123 ? 3.109    -7.688  -21.875  1.00 88.14  ? 123 HIS C CA  1 
ATOM   3706  C C   . HIS C  1 123 ? 2.283    -8.133  -20.704  1.00 86.81  ? 123 HIS C C   1 
ATOM   3707  O O   . HIS C  1 123 ? 1.875    -9.309  -20.654  1.00 85.92  ? 123 HIS C O   1 
ATOM   3708  C CB  . HIS C  1 123 ? 2.428    -6.561  -22.672  1.00 88.99  ? 123 HIS C CB  1 
ATOM   3709  C CG  . HIS C  1 123 ? 0.983    -6.843  -23.073  1.00 88.22  ? 123 HIS C CG  1 
ATOM   3710  N ND1 . HIS C  1 123 ? 0.522    -8.080  -23.381  1.00 87.28  ? 123 HIS C ND1 1 
ATOM   3711  C CD2 . HIS C  1 123 ? -0.100   -5.977  -23.242  1.00 88.67  ? 123 HIS C CD2 1 
ATOM   3712  C CE1 . HIS C  1 123 ? -0.789   -8.012  -23.703  1.00 87.16  ? 123 HIS C CE1 1 
ATOM   3713  N NE2 . HIS C  1 123 ? -1.168   -6.730  -23.625  1.00 88.01  ? 123 HIS C NE2 1 
ATOM   3714  N N   . GLN C  1 124 ? 2.034    -7.243  -19.749  1.00 86.84  ? 124 GLN C N   1 
ATOM   3715  C CA  . GLN C  1 124 ? 1.307    -7.649  -18.555  1.00 85.72  ? 124 GLN C CA  1 
ATOM   3716  C C   . GLN C  1 124 ? -0.197   -7.822  -18.834  1.00 84.92  ? 124 GLN C C   1 
ATOM   3717  O O   . GLN C  1 124 ? -0.688   -7.317  -19.856  1.00 85.43  ? 124 GLN C O   1 
ATOM   3718  C CB  . GLN C  1 124 ? 1.578    -6.700  -17.385  1.00 86.09  ? 124 GLN C CB  1 
ATOM   3719  C CG  . GLN C  1 124 ? 1.357    -5.237  -17.679  1.00 87.01  ? 124 GLN C CG  1 
ATOM   3720  C CD  . GLN C  1 124 ? 1.571    -4.383  -16.463  1.00 87.40  ? 124 GLN C CD  1 
ATOM   3721  O OE1 . GLN C  1 124 ? 2.280    -3.391  -16.511  1.00 88.86  ? 124 GLN C OE1 1 
ATOM   3722  N NE2 . GLN C  1 124 ? 0.943    -4.757  -15.364  1.00 86.29  ? 124 GLN C NE2 1 
ATOM   3723  N N   . PRO C  1 125 ? -0.922   -8.570  -17.958  1.00 83.98  ? 125 PRO C N   1 
ATOM   3724  C CA  . PRO C  1 125 ? -2.357   -8.758  -18.179  1.00 83.56  ? 125 PRO C CA  1 
ATOM   3725  C C   . PRO C  1 125 ? -3.143   -7.482  -17.913  1.00 83.78  ? 125 PRO C C   1 
ATOM   3726  O O   . PRO C  1 125 ? -2.723   -6.643  -17.126  1.00 83.92  ? 125 PRO C O   1 
ATOM   3727  C CB  . PRO C  1 125 ? -2.742   -9.829  -17.169  1.00 82.88  ? 125 PRO C CB  1 
ATOM   3728  C CG  . PRO C  1 125 ? -1.694   -9.769  -16.120  1.00 82.94  ? 125 PRO C CG  1 
ATOM   3729  C CD  . PRO C  1 125 ? -0.438   -9.286  -16.765  1.00 83.67  ? 125 PRO C CD  1 
ATOM   3730  N N   . LEU C  1 126 ? -4.281   -7.357  -18.591  1.00 84.06  ? 126 LEU C N   1 
ATOM   3731  C CA  . LEU C  1 126 ? -5.160   -6.203  -18.489  1.00 84.61  ? 126 LEU C CA  1 
ATOM   3732  C C   . LEU C  1 126 ? -6.433   -6.641  -17.793  1.00 84.10  ? 126 LEU C C   1 
ATOM   3733  O O   . LEU C  1 126 ? -6.819   -7.793  -17.902  1.00 83.78  ? 126 LEU C O   1 
ATOM   3734  C CB  . LEU C  1 126 ? -5.490   -5.701  -19.882  1.00 85.90  ? 126 LEU C CB  1 
ATOM   3735  C CG  . LEU C  1 126 ? -4.310   -5.366  -20.804  1.00 86.74  ? 126 LEU C CG  1 
ATOM   3736  C CD1 . LEU C  1 126 ? -4.660   -5.593  -22.274  1.00 87.76  ? 126 LEU C CD1 1 
ATOM   3737  C CD2 . LEU C  1 126 ? -3.821   -3.947  -20.575  1.00 87.80  ? 126 LEU C CD2 1 
ATOM   3738  N N   . GLY C  1 127 ? -7.083   -5.735  -17.076  1.00 84.22  ? 127 GLY C N   1 
ATOM   3739  C CA  . GLY C  1 127 ? -8.341   -6.051  -16.427  1.00 83.99  ? 127 GLY C CA  1 
ATOM   3740  C C   . GLY C  1 127 ? -9.051   -4.790  -16.042  1.00 84.59  ? 127 GLY C C   1 
ATOM   3741  O O   . GLY C  1 127 ? -8.770   -3.715  -16.584  1.00 85.54  ? 127 GLY C O   1 
ATOM   3742  N N   . GLY C  1 128 ? -9.958   -4.915  -15.086  1.00 84.24  ? 128 GLY C N   1 
ATOM   3743  C CA  . GLY C  1 128 ? -10.762  -3.770  -14.643  1.00 84.87  ? 128 GLY C CA  1 
ATOM   3744  C C   . GLY C  1 128 ? -11.429  -4.021  -13.300  1.00 84.16  ? 128 GLY C C   1 
ATOM   3745  O O   . GLY C  1 128 ? -11.590  -5.168  -12.872  1.00 83.55  ? 128 GLY C O   1 
ATOM   3746  N N   . ALA C  1 129 ? -11.810  -2.943  -12.627  1.00 84.43  ? 129 ALA C N   1 
ATOM   3747  C CA  . ALA C  1 129 ? -12.536  -3.039  -11.362  1.00 83.93  ? 129 ALA C CA  1 
ATOM   3748  C C   . ALA C  1 129 ? -13.451  -1.842  -11.255  1.00 84.98  ? 129 ALA C C   1 
ATOM   3749  O O   . ALA C  1 129 ? -13.053  -0.727  -11.555  1.00 85.66  ? 129 ALA C O   1 
ATOM   3750  C CB  . ALA C  1 129 ? -11.577  -3.071  -10.193  1.00 82.81  ? 129 ALA C CB  1 
ATOM   3751  N N   . GLN C  1 130 ? -14.685  -2.086  -10.853  1.00 85.39  ? 130 GLN C N   1 
ATOM   3752  C CA  . GLN C  1 130 ? -15.636  -1.028  -10.652  1.00 86.53  ? 130 GLN C CA  1 
ATOM   3753  C C   . GLN C  1 130 ? -16.245  -1.248  -9.267   1.00 85.86  ? 130 GLN C C   1 
ATOM   3754  O O   . GLN C  1 130 ? -16.403  -2.388  -8.820   1.00 85.23  ? 130 GLN C O   1 
ATOM   3755  C CB  . GLN C  1 130 ? -16.696  -1.155  -11.729  1.00 88.30  ? 130 GLN C CB  1 
ATOM   3756  C CG  . GLN C  1 130 ? -17.472  0.116   -12.004  1.00 90.17  ? 130 GLN C CG  1 
ATOM   3757  C CD  . GLN C  1 130 ? -16.585  1.255   -12.503  1.00 90.73  ? 130 GLN C CD  1 
ATOM   3758  O OE1 . GLN C  1 130 ? -15.508  1.034   -13.131  1.00 90.21  ? 130 GLN C OE1 1 
ATOM   3759  N NE2 . GLN C  1 130 ? -17.036  2.504   -12.227  1.00 92.04  ? 130 GLN C NE2 1 
ATOM   3760  N N   . GLY C  1 131 ? -16.566  -0.179  -8.556   1.00 86.15  ? 131 GLY C N   1 
ATOM   3761  C CA  . GLY C  1 131 ? -17.352  -0.335  -7.338   1.00 85.85  ? 131 GLY C CA  1 
ATOM   3762  C C   . GLY C  1 131 ? -16.696  0.225   -6.114   1.00 84.78  ? 131 GLY C C   1 
ATOM   3763  O O   . GLY C  1 131 ? -15.948  1.184   -6.186   1.00 84.83  ? 131 GLY C O   1 
ATOM   3764  N N   . GLN C  1 132 ? -17.003  -0.378  -4.978   1.00 84.09  ? 132 GLN C N   1 
ATOM   3765  C CA  . GLN C  1 132 ? -16.500  0.058   -3.692   1.00 83.24  ? 132 GLN C CA  1 
ATOM   3766  C C   . GLN C  1 132 ? -15.010  -0.187  -3.561   1.00 82.29  ? 132 GLN C C   1 
ATOM   3767  O O   . GLN C  1 132 ? -14.479  -1.101  -4.169   1.00 82.00  ? 132 GLN C O   1 
ATOM   3768  C CB  . GLN C  1 132 ? -17.187  -0.731  -2.603   1.00 83.00  ? 132 GLN C CB  1 
ATOM   3769  C CG  . GLN C  1 132 ? -18.638  -0.401  -2.435   1.00 84.08  ? 132 GLN C CG  1 
ATOM   3770  C CD  . GLN C  1 132 ? -19.241  -1.069  -1.231   1.00 84.00  ? 132 GLN C CD  1 
ATOM   3771  O OE1 . GLN C  1 132 ? -19.319  -2.283  -1.151   1.00 84.05  ? 132 GLN C OE1 1 
ATOM   3772  N NE2 . GLN C  1 132 ? -19.690  -0.271  -0.297   1.00 84.09  ? 132 GLN C NE2 1 
ATOM   3773  N N   . ALA C  1 133 ? -14.352  0.627   -2.737   1.00 82.01  ? 133 ALA C N   1 
ATOM   3774  C CA  . ALA C  1 133 ? -12.927  0.471   -2.414   1.00 81.47  ? 133 ALA C CA  1 
ATOM   3775  C C   . ALA C  1 133 ? -12.503  -0.974  -2.091   1.00 80.87  ? 133 ALA C C   1 
ATOM   3776  O O   . ALA C  1 133 ? -11.560  -1.495  -2.669   1.00 80.74  ? 133 ALA C O   1 
ATOM   3777  C CB  . ALA C  1 133 ? -12.551  1.408   -1.288   1.00 81.51  ? 133 ALA C CB  1 
ATOM   3778  N N   . THR C  1 134 ? -13.240  -1.616  -1.193   1.00 80.75  ? 134 THR C N   1 
ATOM   3779  C CA  . THR C  1 134 ? -13.055  -3.023  -0.836   1.00 80.65  ? 134 THR C CA  1 
ATOM   3780  C C   . THR C  1 134 ? -13.084  -3.895  -2.074   1.00 80.79  ? 134 THR C C   1 
ATOM   3781  O O   . THR C  1 134 ? -12.216  -4.743  -2.215   1.00 80.71  ? 134 THR C O   1 
ATOM   3782  C CB  . THR C  1 134 ? -14.163  -3.469  0.135    1.00 80.96  ? 134 THR C CB  1 
ATOM   3783  O OG1 . THR C  1 134 ? -14.008  -2.761  1.356    1.00 80.83  ? 134 THR C OG1 1 
ATOM   3784  C CG2 . THR C  1 134 ? -14.110  -4.950  0.449    1.00 81.35  ? 134 THR C CG2 1 
ATOM   3785  N N   . GLU C  1 135 ? -14.075  -3.680  -2.955   1.00 81.21  ? 135 GLU C N   1 
ATOM   3786  C CA  . GLU C  1 135 ? -14.206  -4.444  -4.205   1.00 81.55  ? 135 GLU C CA  1 
ATOM   3787  C C   . GLU C  1 135 ? -13.049  -4.218  -5.179   1.00 81.25  ? 135 GLU C C   1 
ATOM   3788  O O   . GLU C  1 135 ? -12.560  -5.149  -5.791   1.00 81.22  ? 135 GLU C O   1 
ATOM   3789  C CB  . GLU C  1 135 ? -15.517  -4.124  -4.896   1.00 82.44  ? 135 GLU C CB  1 
ATOM   3790  C CG  . GLU C  1 135 ? -16.726  -4.650  -4.165   1.00 83.11  ? 135 GLU C CG  1 
ATOM   3791  C CD  . GLU C  1 135 ? -18.057  -4.163  -4.747   1.00 84.36  ? 135 GLU C CD  1 
ATOM   3792  O OE1 . GLU C  1 135 ? -18.146  -2.999  -5.250   1.00 84.64  ? 135 GLU C OE1 1 
ATOM   3793  O OE2 . GLU C  1 135 ? -19.038  -4.953  -4.691   1.00 85.40  ? 135 GLU C OE2 1 
ATOM   3794  N N   . ILE C  1 136 ? -12.620  -2.983  -5.315   1.00 81.25  ? 136 ILE C N   1 
ATOM   3795  C CA  . ILE C  1 136 ? -11.505  -2.685  -6.159   1.00 81.26  ? 136 ILE C CA  1 
ATOM   3796  C C   . ILE C  1 136 ? -10.244  -3.373  -5.643   1.00 80.79  ? 136 ILE C C   1 
ATOM   3797  O O   . ILE C  1 136 ? -9.480   -3.961  -6.427   1.00 80.79  ? 136 ILE C O   1 
ATOM   3798  C CB  . ILE C  1 136 ? -11.315  -1.171  -6.273   1.00 81.77  ? 136 ILE C CB  1 
ATOM   3799  C CG1 . ILE C  1 136 ? -12.457  -0.607  -7.116   1.00 82.69  ? 136 ILE C CG1 1 
ATOM   3800  C CG2 . ILE C  1 136 ? -9.975   -0.835  -6.899   1.00 82.02  ? 136 ILE C CG2 1 
ATOM   3801  C CD1 . ILE C  1 136 ? -12.635  0.885   -6.995   1.00 83.56  ? 136 ILE C CD1 1 
ATOM   3802  N N   . GLU C  1 137 ? -10.043  -3.324  -4.326   1.00 80.59  ? 137 GLU C N   1 
ATOM   3803  C CA  . GLU C  1 137 ? -8.919   -4.008  -3.691   1.00 80.56  ? 137 GLU C CA  1 
ATOM   3804  C C   . GLU C  1 137 ? -8.887   -5.509  -4.006   1.00 80.60  ? 137 GLU C C   1 
ATOM   3805  O O   . GLU C  1 137 ? -7.850   -6.068  -4.361   1.00 80.78  ? 137 GLU C O   1 
ATOM   3806  C CB  . GLU C  1 137 ? -8.975   -3.801  -2.185   1.00 80.61  ? 137 GLU C CB  1 
ATOM   3807  C CG  . GLU C  1 137 ? -7.711   -4.190  -1.441   1.00 81.04  ? 137 GLU C CG  1 
ATOM   3808  C CD  . GLU C  1 137 ? -7.902   -4.109  0.055    1.00 81.30  ? 137 GLU C CD  1 
ATOM   3809  O OE1 . GLU C  1 137 ? -9.068   -4.195  0.518    1.00 81.05  ? 137 GLU C OE1 1 
ATOM   3810  O OE2 . GLU C  1 137 ? -6.883   -3.961  0.765    1.00 81.94  ? 137 GLU C OE2 1 
ATOM   3811  N N   . ILE C  1 138 ? -10.029  -6.155  -3.890   1.00 80.68  ? 138 ILE C N   1 
ATOM   3812  C CA  . ILE C  1 138 ? -10.120  -7.561  -4.216   1.00 81.05  ? 138 ILE C CA  1 
ATOM   3813  C C   . ILE C  1 138 ? -9.683   -7.843  -5.660   1.00 81.00  ? 138 ILE C C   1 
ATOM   3814  O O   . ILE C  1 138 ? -8.866   -8.767  -5.914   1.00 81.24  ? 138 ILE C O   1 
ATOM   3815  C CB  . ILE C  1 138 ? -11.525  -8.103  -3.898   1.00 81.52  ? 138 ILE C CB  1 
ATOM   3816  C CG1 . ILE C  1 138 ? -11.680  -8.234  -2.373   1.00 81.81  ? 138 ILE C CG1 1 
ATOM   3817  C CG2 . ILE C  1 138 ? -11.742  -9.459  -4.555   1.00 82.20  ? 138 ILE C CG2 1 
ATOM   3818  C CD1 . ILE C  1 138 ? -13.094  -8.166  -1.858   1.00 82.24  ? 138 ILE C CD1 1 
ATOM   3819  N N   . ALA C  1 139 ? -10.196  -7.027  -6.588   1.00 80.90  ? 139 ALA C N   1 
ATOM   3820  C CA  . ALA C  1 139 ? -9.857   -7.151  -8.005   1.00 81.00  ? 139 ALA C CA  1 
ATOM   3821  C C   . ALA C  1 139 ? -8.367   -6.895  -8.269   1.00 80.85  ? 139 ALA C C   1 
ATOM   3822  O O   . ALA C  1 139 ? -7.721   -7.633  -9.027   1.00 80.96  ? 139 ALA C O   1 
ATOM   3823  C CB  . ALA C  1 139 ? -10.695  -6.232  -8.821   1.00 81.32  ? 139 ALA C CB  1 
ATOM   3824  N N   . ALA C  1 140 ? -7.828   -5.856  -7.629   1.00 80.79  ? 140 ALA C N   1 
ATOM   3825  C CA  . ALA C  1 140 ? -6.431   -5.507  -7.771   1.00 81.03  ? 140 ALA C CA  1 
ATOM   3826  C C   . ALA C  1 140 ? -5.510   -6.661  -7.294   1.00 81.21  ? 140 ALA C C   1 
ATOM   3827  O O   . ALA C  1 140 ? -4.563   -7.058  -8.006   1.00 81.51  ? 140 ALA C O   1 
ATOM   3828  C CB  . ALA C  1 140 ? -6.154   -4.232  -7.013   1.00 81.26  ? 140 ALA C CB  1 
ATOM   3829  N N   . ASN C  1 141 ? -5.810   -7.209  -6.108   1.00 81.25  ? 141 ASN C N   1 
ATOM   3830  C CA  . ASN C  1 141 ? -5.071   -8.365  -5.567   1.00 81.85  ? 141 ASN C CA  1 
ATOM   3831  C C   . ASN C  1 141 ? -5.097   -9.553  -6.537   1.00 81.99  ? 141 ASN C C   1 
ATOM   3832  O O   . ASN C  1 141 ? -4.060   -10.180 -6.791   1.00 82.56  ? 141 ASN C O   1 
ATOM   3833  C CB  . ASN C  1 141 ? -5.622   -8.773  -4.199   1.00 82.15  ? 141 ASN C CB  1 
ATOM   3834  C CG  . ASN C  1 141 ? -5.287   -7.770  -3.115   1.00 82.29  ? 141 ASN C CG  1 
ATOM   3835  O OD1 . ASN C  1 141 ? -4.343   -6.997  -3.231   1.00 82.54  ? 141 ASN C OD1 1 
ATOM   3836  N ND2 . ASN C  1 141 ? -6.060   -7.786  -2.043   1.00 82.33  ? 141 ASN C ND2 1 
ATOM   3837  N N   . HIS C  1 142 ? -6.282   -9.818  -7.101   1.00 81.66  ? 142 HIS C N   1 
ATOM   3838  C CA  . HIS C  1 142 ? -6.460   -10.942 -7.983   1.00 81.97  ? 142 HIS C CA  1 
ATOM   3839  C C   . HIS C  1 142 ? -5.646   -10.790 -9.223   1.00 81.83  ? 142 HIS C C   1 
ATOM   3840  O O   . HIS C  1 142 ? -5.066   -11.750 -9.695   1.00 82.26  ? 142 HIS C O   1 
ATOM   3841  C CB  . HIS C  1 142 ? -7.925   -11.125 -8.335   1.00 81.98  ? 142 HIS C CB  1 
ATOM   3842  C CG  . HIS C  1 142 ? -8.174   -12.286 -9.259   1.00 82.54  ? 142 HIS C CG  1 
ATOM   3843  N ND1 . HIS C  1 142 ? -8.742   -12.140 -10.471  1.00 82.52  ? 142 HIS C ND1 1 
ATOM   3844  C CD2 . HIS C  1 142 ? -7.871   -13.656 -9.122   1.00 83.42  ? 142 HIS C CD2 1 
ATOM   3845  C CE1 . HIS C  1 142 ? -8.831   -13.347 -11.083  1.00 83.23  ? 142 HIS C CE1 1 
ATOM   3846  N NE2 . HIS C  1 142 ? -8.289   -14.275 -10.261  1.00 83.79  ? 142 HIS C NE2 1 
ATOM   3847  N N   . ILE C  1 143 ? -5.587   -9.585  -9.780   1.00 81.44  ? 143 ILE C N   1 
ATOM   3848  C CA  . ILE C  1 143 ? -4.875   -9.417  -11.057  1.00 81.54  ? 143 ILE C CA  1 
ATOM   3849  C C   . ILE C  1 143 ? -3.352   -9.399  -10.842  1.00 81.97  ? 143 ILE C C   1 
ATOM   3850  O O   . ILE C  1 143 ? -2.584   -9.896  -11.672  1.00 82.29  ? 143 ILE C O   1 
ATOM   3851  C CB  . ILE C  1 143 ? -5.378   -8.236  -11.908  1.00 81.47  ? 143 ILE C CB  1 
ATOM   3852  C CG1 . ILE C  1 143 ? -4.857   -8.387  -13.328  1.00 81.78  ? 143 ILE C CG1 1 
ATOM   3853  C CG2 . ILE C  1 143 ? -4.941   -6.903  -11.319  1.00 81.59  ? 143 ILE C CG2 1 
ATOM   3854  C CD1 . ILE C  1 143 ? -5.368   -7.349  -14.307  1.00 82.17  ? 143 ILE C CD1 1 
ATOM   3855  N N   . LEU C  1 144 ? -2.916   -8.852  -9.713   1.00 82.18  ? 144 LEU C N   1 
ATOM   3856  C CA  . LEU C  1 144 ? -1.515   -8.934  -9.354   1.00 83.01  ? 144 LEU C CA  1 
ATOM   3857  C C   . LEU C  1 144 ? -1.126   -10.377 -9.163   1.00 83.55  ? 144 LEU C C   1 
ATOM   3858  O O   . LEU C  1 144 ? -0.062   -10.774 -9.639   1.00 84.27  ? 144 LEU C O   1 
ATOM   3859  C CB  . LEU C  1 144 ? -1.192   -8.093  -8.108   1.00 83.42  ? 144 LEU C CB  1 
ATOM   3860  C CG  . LEU C  1 144 ? -1.294   -6.556  -8.339   1.00 83.36  ? 144 LEU C CG  1 
ATOM   3861  C CD1 . LEU C  1 144 ? -1.354   -5.749  -7.043   1.00 83.61  ? 144 LEU C CD1 1 
ATOM   3862  C CD2 . LEU C  1 144 ? -0.205   -6.006  -9.266   1.00 84.21  ? 144 LEU C CD2 1 
ATOM   3863  N N   . LYS C  1 145 ? -1.986   -11.164 -8.500   1.00 83.47  ? 145 LYS C N   1 
ATOM   3864  C CA  . LYS C  1 145 ? -1.676   -12.564 -8.245   1.00 84.39  ? 145 LYS C CA  1 
ATOM   3865  C C   . LYS C  1 145 ? -1.591   -13.331 -9.553   1.00 84.36  ? 145 LYS C C   1 
ATOM   3866  O O   . LYS C  1 145 ? -0.723   -14.183 -9.742   1.00 85.29  ? 145 LYS C O   1 
ATOM   3867  C CB  . LYS C  1 145 ? -2.681   -13.200 -7.295   1.00 84.63  ? 145 LYS C CB  1 
ATOM   3868  C CG  . LYS C  1 145 ? -2.070   -14.375 -6.568   1.00 86.22  ? 145 LYS C CG  1 
ATOM   3869  C CD  . LYS C  1 145 ? -2.952   -14.940 -5.481   1.00 86.90  ? 145 LYS C CD  1 
ATOM   3870  C CE  . LYS C  1 145 ? -2.262   -16.176 -4.899   1.00 88.95  ? 145 LYS C CE  1 
ATOM   3871  N NZ  . LYS C  1 145 ? -3.155   -16.941 -3.977   1.00 90.08  ? 145 LYS C NZ  1 
ATOM   3872  N N   . THR C  1 146 ? -2.482   -12.993 -10.470  1.00 83.46  ? 146 THR C N   1 
ATOM   3873  C CA  . THR C  1 146 ? -2.478   -13.594 -11.788  1.00 83.44  ? 146 THR C CA  1 
ATOM   3874  C C   . THR C  1 146 ? -1.156   -13.270 -12.527  1.00 83.69  ? 146 THR C C   1 
ATOM   3875  O O   . THR C  1 146 ? -0.567   -14.139 -13.177  1.00 84.21  ? 146 THR C O   1 
ATOM   3876  C CB  . THR C  1 146 ? -3.745   -13.183 -12.584  1.00 82.77  ? 146 THR C CB  1 
ATOM   3877  O OG1 . THR C  1 146 ? -4.900   -13.693 -11.913  1.00 82.94  ? 146 THR C OG1 1 
ATOM   3878  C CG2 . THR C  1 146 ? -3.728   -13.761 -13.989  1.00 82.92  ? 146 THR C CG2 1 
ATOM   3879  N N   . ARG C  1 147 ? -0.684   -12.032 -12.418  1.00 83.53  ? 147 ARG C N   1 
ATOM   3880  C CA  . ARG C  1 147 ? 0.579    -11.691 -13.038  1.00 84.13  ? 147 ARG C CA  1 
ATOM   3881  C C   . ARG C  1 147 ? 1.759    -12.523 -12.486  1.00 85.32  ? 147 ARG C C   1 
ATOM   3882  O O   . ARG C  1 147 ? 2.597    -12.992 -13.246  1.00 85.94  ? 147 ARG C O   1 
ATOM   3883  C CB  . ARG C  1 147 ? 0.877    -10.208 -12.924  1.00 84.21  ? 147 ARG C CB  1 
ATOM   3884  C CG  . ARG C  1 147 ? 1.939    -9.764  -13.923  1.00 84.96  ? 147 ARG C CG  1 
ATOM   3885  C CD  . ARG C  1 147 ? 2.384    -8.337  -13.731  1.00 85.61  ? 147 ARG C CD  1 
ATOM   3886  N NE  . ARG C  1 147 ? 3.365    -7.974  -14.742  1.00 86.63  ? 147 ARG C NE  1 
ATOM   3887  C CZ  . ARG C  1 147 ? 4.080    -6.842  -14.715  1.00 87.85  ? 147 ARG C CZ  1 
ATOM   3888  N NH1 . ARG C  1 147 ? 3.919    -5.973  -13.720  1.00 88.10  ? 147 ARG C NH1 1 
ATOM   3889  N NH2 . ARG C  1 147 ? 4.975    -6.578  -15.677  1.00 89.04  ? 147 ARG C NH2 1 
ATOM   3890  N N   . GLU C  1 148 ? 1.812    -12.708 -11.171  1.00 85.86  ? 148 GLU C N   1 
ATOM   3891  C CA  . GLU C  1 148 ? 2.813    -13.562 -10.559  1.00 87.39  ? 148 GLU C CA  1 
ATOM   3892  C C   . GLU C  1 148 ? 2.751    -14.956 -11.105  1.00 87.79  ? 148 GLU C C   1 
ATOM   3893  O O   . GLU C  1 148 ? 3.792    -15.542 -11.428  1.00 88.98  ? 148 GLU C O   1 
ATOM   3894  C CB  . GLU C  1 148 ? 2.634    -13.619 -9.056   1.00 88.03  ? 148 GLU C CB  1 
ATOM   3895  C CG  . GLU C  1 148 ? 3.281    -12.442 -8.352   1.00 88.55  ? 148 GLU C CG  1 
ATOM   3896  C CD  . GLU C  1 148 ? 2.989    -12.417 -6.864   1.00 89.11  ? 148 GLU C CD  1 
ATOM   3897  O OE1 . GLU C  1 148 ? 3.095    -11.303 -6.295   1.00 89.09  ? 148 GLU C OE1 1 
ATOM   3898  O OE2 . GLU C  1 148 ? 2.647    -13.495 -6.269   1.00 89.76  ? 148 GLU C OE2 1 
ATOM   3899  N N   . LYS C  1 149 ? 1.540    -15.483 -11.204  1.00 87.04  ? 149 LYS C N   1 
ATOM   3900  C CA  . LYS C  1 149 ? 1.340    -16.816 -11.739  1.00 87.58  ? 149 LYS C CA  1 
ATOM   3901  C C   . LYS C  1 149 ? 1.871    -16.906 -13.162  1.00 87.34  ? 149 LYS C C   1 
ATOM   3902  O O   . LYS C  1 149 ? 2.585    -17.843 -13.493  1.00 88.42  ? 149 LYS C O   1 
ATOM   3903  C CB  . LYS C  1 149 ? -0.129   -17.232 -11.663  1.00 87.04  ? 149 LYS C CB  1 
ATOM   3904  C CG  . LYS C  1 149 ? -0.424   -18.571 -12.309  1.00 87.81  ? 149 LYS C CG  1 
ATOM   3905  C CD  . LYS C  1 149 ? -1.671   -19.180 -11.704  1.00 88.24  ? 149 LYS C CD  1 
ATOM   3906  C CE  . LYS C  1 149 ? -2.854   -19.118 -12.640  1.00 87.43  ? 149 LYS C CE  1 
ATOM   3907  N NZ  . LYS C  1 149 ? -4.018   -19.681 -11.909  1.00 88.23  ? 149 LYS C NZ  1 
ATOM   3908  N N   . LEU C  1 150 ? 1.558    -15.916 -13.984  1.00 86.15  ? 150 LEU C N   1 
ATOM   3909  C CA  . LEU C  1 150 ? 1.987    -15.926 -15.384  1.00 86.00  ? 150 LEU C CA  1 
ATOM   3910  C C   . LEU C  1 150 ? 3.497    -15.795 -15.528  1.00 87.02  ? 150 LEU C C   1 
ATOM   3911  O O   . LEU C  1 150 ? 4.116    -16.549 -16.306  1.00 87.64  ? 150 LEU C O   1 
ATOM   3912  C CB  . LEU C  1 150 ? 1.296    -14.824 -16.192  1.00 84.91  ? 150 LEU C CB  1 
ATOM   3913  C CG  . LEU C  1 150 ? -0.178   -15.042 -16.562  1.00 84.22  ? 150 LEU C CG  1 
ATOM   3914  C CD1 . LEU C  1 150 ? -0.807   -13.724 -16.995  1.00 83.55  ? 150 LEU C CD1 1 
ATOM   3915  C CD2 . LEU C  1 150 ? -0.330   -16.070 -17.668  1.00 84.51  ? 150 LEU C CD2 1 
ATOM   3916  N N   . ASN C  1 151 ? 4.085    -14.842 -14.798  1.00 87.39  ? 151 ASN C N   1 
ATOM   3917  C CA  . ASN C  1 151 ? 5.537    -14.663 -14.780  1.00 88.81  ? 151 ASN C CA  1 
ATOM   3918  C C   . ASN C  1 151 ? 6.285    -15.909 -14.305  1.00 90.38  ? 151 ASN C C   1 
ATOM   3919  O O   . ASN C  1 151 ? 7.279    -16.318 -14.933  1.00 91.46  ? 151 ASN C O   1 
ATOM   3920  C CB  . ASN C  1 151 ? 5.922    -13.448 -13.937  1.00 89.24  ? 151 ASN C CB  1 
ATOM   3921  C CG  . ASN C  1 151 ? 5.501    -12.135 -14.586  1.00 88.33  ? 151 ASN C CG  1 
ATOM   3922  O OD1 . ASN C  1 151 ? 4.900    -12.121 -15.671  1.00 87.41  ? 151 ASN C OD1 1 
ATOM   3923  N ND2 . ASN C  1 151 ? 5.823    -11.017 -13.930  1.00 88.88  ? 151 ASN C ND2 1 
ATOM   3924  N N   . ARG C  1 152 ? 5.795    -16.516 -13.218  1.00 90.72  ? 152 ARG C N   1 
ATOM   3925  C CA  . ARG C  1 152 ? 6.405    -17.718 -12.668  1.00 92.61  ? 152 ARG C CA  1 
ATOM   3926  C C   . ARG C  1 152 ? 6.471    -18.798 -13.732  1.00 92.80  ? 152 ARG C C   1 
ATOM   3927  O O   . ARG C  1 152 ? 7.521    -19.382 -13.939  1.00 94.41  ? 152 ARG C O   1 
ATOM   3928  C CB  . ARG C  1 152 ? 5.641    -18.201 -11.435  1.00 92.98  ? 152 ARG C CB  1 
ATOM   3929  C CG  . ARG C  1 152 ? 6.248    -19.417 -10.772  1.00 95.40  ? 152 ARG C CG  1 
ATOM   3930  C CD  . ARG C  1 152 ? 5.416    -19.929 -9.615   1.00 96.00  ? 152 ARG C CD  1 
ATOM   3931  N NE  . ARG C  1 152 ? 4.266    -20.694 -10.083  1.00 95.22  ? 152 ARG C NE  1 
ATOM   3932  C CZ  . ARG C  1 152 ? 2.983    -20.322 -9.922   1.00 93.67  ? 152 ARG C CZ  1 
ATOM   3933  N NH1 . ARG C  1 152 ? 1.999    -21.095 -10.409  1.00 93.43  ? 152 ARG C NH1 1 
ATOM   3934  N NH2 . ARG C  1 152 ? 2.662    -19.192 -9.270   1.00 92.59  ? 152 ARG C NH2 1 
ATOM   3935  N N   . ILE C  1 153 ? 5.359    -19.046 -14.418  1.00 91.35  ? 153 ILE C N   1 
ATOM   3936  C CA  . ILE C  1 153 ? 5.308    -20.146 -15.380  1.00 91.67  ? 153 ILE C CA  1 
ATOM   3937  C C   . ILE C  1 153 ? 6.138    -19.816 -16.598  1.00 91.50  ? 153 ILE C C   1 
ATOM   3938  O O   . ILE C  1 153 ? 6.816    -20.673 -17.167  1.00 92.58  ? 153 ILE C O   1 
ATOM   3939  C CB  . ILE C  1 153 ? 3.877    -20.531 -15.769  1.00 90.57  ? 153 ILE C CB  1 
ATOM   3940  C CG1 . ILE C  1 153 ? 3.182    -21.141 -14.557  1.00 91.38  ? 153 ILE C CG1 1 
ATOM   3941  C CG2 . ILE C  1 153 ? 3.884    -21.534 -16.905  1.00 90.95  ? 153 ILE C CG2 1 
ATOM   3942  C CD1 . ILE C  1 153 ? 1.703    -21.350 -14.741  1.00 90.55  ? 153 ILE C CD1 1 
ATOM   3943  N N   . LEU C  1 154 ? 6.111    -18.551 -16.970  1.00 90.37  ? 154 LEU C N   1 
ATOM   3944  C CA  . LEU C  1 154 ? 6.919    -18.096 -18.078  1.00 90.46  ? 154 LEU C CA  1 
ATOM   3945  C C   . LEU C  1 154 ? 8.425    -18.252 -17.785  1.00 92.41  ? 154 LEU C C   1 
ATOM   3946  O O   . LEU C  1 154 ? 9.212    -18.684 -18.653  1.00 93.20  ? 154 LEU C O   1 
ATOM   3947  C CB  . LEU C  1 154 ? 6.575    -16.658 -18.394  1.00 89.34  ? 154 LEU C CB  1 
ATOM   3948  C CG  . LEU C  1 154 ? 6.817    -16.284 -19.846  1.00 89.09  ? 154 LEU C CG  1 
ATOM   3949  C CD1 . LEU C  1 154 ? 6.070    -17.235 -20.776  1.00 88.46  ? 154 LEU C CD1 1 
ATOM   3950  C CD2 . LEU C  1 154 ? 6.365    -14.844 -20.064  1.00 88.36  ? 154 LEU C CD2 1 
ATOM   3951  N N   . SER C  1 155 ? 8.802    -17.902 -16.557  1.00 93.35  ? 155 SER C N   1 
ATOM   3952  C CA  . SER C  1 155 ? 10.174   -18.049 -16.071  1.00 95.66  ? 155 SER C CA  1 
ATOM   3953  C C   . SER C  1 155 ? 10.684   -19.491 -16.257  1.00 97.20  ? 155 SER C C   1 
ATOM   3954  O O   . SER C  1 155 ? 11.772   -19.702 -16.791  1.00 98.66  ? 155 SER C O   1 
ATOM   3955  C CB  . SER C  1 155 ? 10.235   -17.620 -14.604  1.00 96.51  ? 155 SER C CB  1 
ATOM   3956  O OG  . SER C  1 155 ? 11.533   -17.712 -14.094  1.00 99.08  ? 155 SER C OG  1 
ATOM   3957  N N   . GLU C  1 156 ? 9.869    -20.463 -15.849  1.00 97.63  ? 156 GLU C N   1 
ATOM   3958  C CA  . GLU C  1 156 ? 10.175   -21.887 -15.989  1.00 99.78  ? 156 GLU C CA  1 
ATOM   3959  C C   . GLU C  1 156 ? 10.367   -22.359 -17.422  1.00 99.42  ? 156 GLU C C   1 
ATOM   3960  O O   . GLU C  1 156 ? 11.144   -23.269 -17.667  1.00 101.36 ? 156 GLU C O   1 
ATOM   3961  C CB  . GLU C  1 156 ? 9.061    -22.725 -15.377  1.00 101.00 ? 156 GLU C CB  1 
ATOM   3962  C CG  . GLU C  1 156 ? 8.934    -22.569 -13.871  1.00 102.42 ? 156 GLU C CG  1 
ATOM   3963  C CD  . GLU C  1 156 ? 7.608    -23.077 -13.322  1.00 103.48 ? 156 GLU C CD  1 
ATOM   3964  O OE1 . GLU C  1 156 ? 6.782    -23.629 -14.110  1.00 103.27 ? 156 GLU C OE1 1 
ATOM   3965  O OE2 . GLU C  1 156 ? 7.397    -22.920 -12.091  1.00 104.91 ? 156 GLU C OE2 1 
ATOM   3966  N N   . ARG C  1 157 ? 9.655    -21.750 -18.361  1.00 97.32  ? 157 ARG C N   1 
ATOM   3967  C CA  . ARG C  1 157 ? 9.657    -22.230 -19.738  1.00 97.25  ? 157 ARG C CA  1 
ATOM   3968  C C   . ARG C  1 157 ? 10.637   -21.511 -20.657  1.00 96.62  ? 157 ARG C C   1 
ATOM   3969  O O   . ARG C  1 157 ? 10.977   -22.035 -21.728  1.00 97.37  ? 157 ARG C O   1 
ATOM   3970  C CB  . ARG C  1 157 ? 8.257    -22.163 -20.310  1.00 96.09  ? 157 ARG C CB  1 
ATOM   3971  C CG  . ARG C  1 157 ? 7.301    -22.904 -19.420  1.00 97.31  ? 157 ARG C CG  1 
ATOM   3972  C CD  . ARG C  1 157 ? 6.063    -23.348 -20.169  1.00 97.42  ? 157 ARG C CD  1 
ATOM   3973  N NE  . ARG C  1 157 ? 5.683    -24.706 -19.771  1.00 99.91  ? 157 ARG C NE  1 
ATOM   3974  C CZ  . ARG C  1 157 ? 6.103    -25.811 -20.387  1.00 101.59 ? 157 ARG C CZ  1 
ATOM   3975  N NH1 . ARG C  1 157 ? 6.930    -25.730 -21.440  1.00 101.08 ? 157 ARG C NH1 1 
ATOM   3976  N NH2 . ARG C  1 157 ? 5.687    -26.997 -19.949  1.00 104.14 ? 157 ARG C NH2 1 
ATOM   3977  N N   . THR C  1 158 ? 11.076   -20.320 -20.243  1.00 95.61  ? 158 THR C N   1 
ATOM   3978  C CA  . THR C  1 158 ? 12.034   -19.546 -21.011  1.00 95.47  ? 158 THR C CA  1 
ATOM   3979  C C   . THR C  1 158 ? 13.407   -19.628 -20.392  1.00 97.45  ? 158 THR C C   1 
ATOM   3980  O O   . THR C  1 158 ? 14.396   -19.436 -21.085  1.00 98.51  ? 158 THR C O   1 
ATOM   3981  C CB  . THR C  1 158 ? 11.669   -18.054 -21.044  1.00 93.50  ? 158 THR C CB  1 
ATOM   3982  O OG1 . THR C  1 158 ? 11.559   -17.578 -19.697  1.00 93.29  ? 158 THR C OG1 1 
ATOM   3983  C CG2 . THR C  1 158 ? 10.364   -17.807 -21.814  1.00 91.90  ? 158 THR C CG2 1 
ATOM   3984  N N   . GLY C  1 159 ? 13.457   -19.884 -19.086  1.00 98.31  ? 159 GLY C N   1 
ATOM   3985  C CA  . GLY C  1 159 ? 14.702   -19.944 -18.346  1.00 100.60 ? 159 GLY C CA  1 
ATOM   3986  C C   . GLY C  1 159 ? 15.160   -18.565 -17.919  1.00 99.98  ? 159 GLY C C   1 
ATOM   3987  O O   . GLY C  1 159 ? 16.262   -18.415 -17.367  1.00 102.08 ? 159 GLY C O   1 
ATOM   3988  N N   . GLN C  1 160 ? 14.335   -17.550 -18.182  1.00 97.48  ? 160 GLN C N   1 
ATOM   3989  C CA  . GLN C  1 160 ? 14.626   -16.192 -17.709  1.00 96.95  ? 160 GLN C CA  1 
ATOM   3990  C C   . GLN C  1 160 ? 14.152   -16.039 -16.273  1.00 97.02  ? 160 GLN C C   1 
ATOM   3991  O O   . GLN C  1 160 ? 13.234   -16.727 -15.859  1.00 96.67  ? 160 GLN C O   1 
ATOM   3992  C CB  . GLN C  1 160 ? 13.922   -15.173 -18.577  1.00 94.70  ? 160 GLN C CB  1 
ATOM   3993  C CG  . GLN C  1 160 ? 14.168   -15.350 -20.056  1.00 94.72  ? 160 GLN C CG  1 
ATOM   3994  C CD  . GLN C  1 160 ? 15.455   -14.706 -20.504  1.00 96.33  ? 160 GLN C CD  1 
ATOM   3995  O OE1 . GLN C  1 160 ? 16.240   -14.186 -19.690  1.00 97.61  ? 160 GLN C OE1 1 
ATOM   3996  N NE2 . GLN C  1 160 ? 15.695   -14.748 -21.811  1.00 96.71  ? 160 GLN C NE2 1 
ATOM   3997  N N   . SER C  1 161 ? 14.778   -15.148 -15.508  1.00 97.84  ? 161 SER C N   1 
ATOM   3998  C CA  . SER C  1 161 ? 14.356   -14.909 -14.118  1.00 98.24  ? 161 SER C CA  1 
ATOM   3999  C C   . SER C  1 161 ? 13.005   -14.172 -14.048  1.00 95.92  ? 161 SER C C   1 
ATOM   4000  O O   . SER C  1 161 ? 12.642   -13.388 -14.951  1.00 94.15  ? 161 SER C O   1 
ATOM   4001  C CB  . SER C  1 161 ? 15.441   -14.163 -13.321  1.00 100.22 ? 161 SER C CB  1 
ATOM   4002  O OG  . SER C  1 161 ? 15.606   -12.820 -13.739  1.00 99.24  ? 161 SER C OG  1 
ATOM   4003  N N   . ILE C  1 162 ? 12.273   -14.441 -12.969  1.00 96.39  ? 162 ILE C N   1 
ATOM   4004  C CA  . ILE C  1 162 ? 11.038   -13.719 -12.656  1.00 95.00  ? 162 ILE C CA  1 
ATOM   4005  C C   . ILE C  1 162 ? 11.213   -12.185 -12.750  1.00 94.15  ? 162 ILE C C   1 
ATOM   4006  O O   . ILE C  1 162 ? 10.332   -11.487 -13.310  1.00 92.48  ? 162 ILE C O   1 
ATOM   4007  C CB  . ILE C  1 162 ? 10.494   -14.154 -11.273  1.00 96.62  ? 162 ILE C CB  1 
ATOM   4008  C CG1 . ILE C  1 162 ? 9.761    -15.486 -11.397  1.00 97.04  ? 162 ILE C CG1 1 
ATOM   4009  C CG2 . ILE C  1 162 ? 9.554    -13.125 -10.667  1.00 96.08  ? 162 ILE C CG2 1 
ATOM   4010  C CD1 . ILE C  1 162 ? 9.669    -16.256 -10.091  1.00 99.67  ? 162 ILE C CD1 1 
ATOM   4011  N N   . GLU C  1 163 ? 12.341   -11.677 -12.224  1.00 95.66  ? 163 GLU C N   1 
ATOM   4012  C CA  . GLU C  1 163 ? 12.624   -10.224 -12.201  1.00 95.47  ? 163 GLU C CA  1 
ATOM   4013  C C   . GLU C  1 163 ? 12.733   -9.639  -13.597  1.00 94.03  ? 163 GLU C C   1 
ATOM   4014  O O   . GLU C  1 163 ? 12.206   -8.540  -13.856  1.00 93.04  ? 163 GLU C O   1 
ATOM   4015  C CB  . GLU C  1 163 ? 13.901   -9.889  -11.425  1.00 97.92  ? 163 GLU C CB  1 
ATOM   4016  C CG  . GLU C  1 163 ? 13.803   -10.116 -9.927   1.00 99.80  ? 163 GLU C CG  1 
ATOM   4017  C CD  . GLU C  1 163 ? 13.762   -11.601 -9.552   1.00 100.91 ? 163 GLU C CD  1 
ATOM   4018  O OE1 . GLU C  1 163 ? 14.431   -12.438 -10.211  1.00 101.35 ? 163 GLU C OE1 1 
ATOM   4019  O OE2 . GLU C  1 163 ? 13.044   -11.932 -8.590   1.00 101.67 ? 163 GLU C OE2 1 
ATOM   4020  N N   . LYS C  1 164 ? 13.426   -10.364 -14.480  1.00 94.29  ? 164 LYS C N   1 
ATOM   4021  C CA  . LYS C  1 164 ? 13.590   -9.929  -15.858  1.00 93.41  ? 164 LYS C CA  1 
ATOM   4022  C C   . LYS C  1 164 ? 12.252   -9.915  -16.625  1.00 91.26  ? 164 LYS C C   1 
ATOM   4023  O O   . LYS C  1 164 ? 11.983   -8.955  -17.374  1.00 90.51  ? 164 LYS C O   1 
ATOM   4024  C CB  . LYS C  1 164 ? 14.629   -10.766 -16.595  1.00 94.68  ? 164 LYS C CB  1 
ATOM   4025  C CG  . LYS C  1 164 ? 14.827   -10.285 -18.022  1.00 94.25  ? 164 LYS C CG  1 
ATOM   4026  C CD  . LYS C  1 164 ? 15.898   -11.083 -18.739  1.00 96.02  ? 164 LYS C CD  1 
ATOM   4027  C CE  . LYS C  1 164 ? 15.777   -10.936 -20.245  1.00 95.51  ? 164 LYS C CE  1 
ATOM   4028  N NZ  . LYS C  1 164 ? 15.956   -9.524  -20.656  1.00 95.71  ? 164 LYS C NZ  1 
ATOM   4029  N N   . ILE C  1 165 ? 11.440   -10.974 -16.437  1.00 90.72  ? 165 ILE C N   1 
ATOM   4030  C CA  . ILE C  1 165 ? 10.104   -11.069 -17.019  1.00 89.22  ? 165 ILE C CA  1 
ATOM   4031  C C   . ILE C  1 165 ? 9.260    -9.864  -16.586  1.00 88.63  ? 165 ILE C C   1 
ATOM   4032  O O   . ILE C  1 165 ? 8.678    -9.164  -17.426  1.00 87.79  ? 165 ILE C O   1 
ATOM   4033  C CB  . ILE C  1 165 ? 9.374    -12.363 -16.600  1.00 89.41  ? 165 ILE C CB  1 
ATOM   4034  C CG1 . ILE C  1 165 ? 10.208   -13.613 -16.909  1.00 90.43  ? 165 ILE C CG1 1 
ATOM   4035  C CG2 . ILE C  1 165 ? 7.997    -12.440 -17.253  1.00 88.34  ? 165 ILE C CG2 1 
ATOM   4036  C CD1 . ILE C  1 165 ? 10.311   -14.000 -18.371  1.00 89.95  ? 165 ILE C CD1 1 
ATOM   4037  N N   . GLN C  1 166 ? 9.215    -9.616  -15.277  1.00 89.44  ? 166 GLN C N   1 
ATOM   4038  C CA  . GLN C  1 166 ? 8.479    -8.490  -14.726  1.00 89.37  ? 166 GLN C CA  1 
ATOM   4039  C C   . GLN C  1 166 ? 8.844    -7.182  -15.422  1.00 89.09  ? 166 GLN C C   1 
ATOM   4040  O O   . GLN C  1 166 ? 7.963    -6.461  -15.869  1.00 88.52  ? 166 GLN C O   1 
ATOM   4041  C CB  . GLN C  1 166 ? 8.716    -8.382  -13.227  1.00 90.81  ? 166 GLN C CB  1 
ATOM   4042  C CG  . GLN C  1 166 ? 7.998    -7.199  -12.582  1.00 91.16  ? 166 GLN C CG  1 
ATOM   4043  C CD  . GLN C  1 166 ? 6.575    -7.516  -12.165  1.00 91.27  ? 166 GLN C CD  1 
ATOM   4044  O OE1 . GLN C  1 166 ? 5.999    -8.546  -12.542  1.00 90.88  ? 166 GLN C OE1 1 
ATOM   4045  N NE2 . GLN C  1 166 ? 5.994    -6.622  -11.381  1.00 92.20  ? 166 GLN C NE2 1 
ATOM   4046  N N   . LYS C  1 167 ? 10.133   -6.893  -15.535  1.00 89.91  ? 167 LYS C N   1 
ATOM   4047  C CA  . LYS C  1 167 ? 10.595   -5.673  -16.189  1.00 90.20  ? 167 LYS C CA  1 
ATOM   4048  C C   . LYS C  1 167 ? 10.254   -5.667  -17.682  1.00 89.28  ? 167 LYS C C   1 
ATOM   4049  O O   . LYS C  1 167 ? 9.756    -4.664  -18.202  1.00 89.17  ? 167 LYS C O   1 
ATOM   4050  C CB  . LYS C  1 167 ? 12.094   -5.448  -15.957  1.00 91.89  ? 167 LYS C CB  1 
ATOM   4051  C CG  . LYS C  1 167 ? 12.638   -4.235  -16.695  1.00 92.70  ? 167 LYS C CG  1 
ATOM   4052  C CD  . LYS C  1 167 ? 14.090   -3.948  -16.318  1.00 94.98  ? 167 LYS C CD  1 
ATOM   4053  C CE  . LYS C  1 167 ? 14.185   -3.231  -14.969  1.00 96.20  ? 167 LYS C CE  1 
ATOM   4054  N NZ  . LYS C  1 167 ? 15.496   -3.447  -14.293  1.00 98.60  ? 167 LYS C NZ  1 
ATOM   4055  N N   . ASP C  1 168 ? 10.493   -6.788  -18.359  1.00 88.94  ? 168 ASP C N   1 
ATOM   4056  C CA  . ASP C  1 168 ? 10.279   -6.893  -19.817  1.00 88.47  ? 168 ASP C CA  1 
ATOM   4057  C C   . ASP C  1 168 ? 8.817    -6.803  -20.251  1.00 87.43  ? 168 ASP C C   1 
ATOM   4058  O O   . ASP C  1 168 ? 8.527    -6.481  -21.422  1.00 87.41  ? 168 ASP C O   1 
ATOM   4059  C CB  . ASP C  1 168 ? 10.927   -8.163  -20.389  1.00 88.75  ? 168 ASP C CB  1 
ATOM   4060  C CG  . ASP C  1 168 ? 12.449   -8.071  -20.442  1.00 90.43  ? 168 ASP C CG  1 
ATOM   4061  O OD1 . ASP C  1 168 ? 12.989   -6.962  -20.206  1.00 91.36  ? 168 ASP C OD1 1 
ATOM   4062  O OD2 . ASP C  1 168 ? 13.103   -9.103  -20.728  1.00 91.16  ? 168 ASP C OD2 1 
ATOM   4063  N N   . THR C  1 169 ? 7.901    -7.089  -19.326  1.00 87.00  ? 169 THR C N   1 
ATOM   4064  C CA  . THR C  1 169 ? 6.478    -7.100  -19.661  1.00 86.54  ? 169 THR C CA  1 
ATOM   4065  C C   . THR C  1 169 ? 5.722    -5.879  -19.117  1.00 86.92  ? 169 THR C C   1 
ATOM   4066  O O   . THR C  1 169 ? 4.486    -5.807  -19.243  1.00 87.03  ? 169 THR C O   1 
ATOM   4067  C CB  . THR C  1 169 ? 5.783    -8.414  -19.230  1.00 86.35  ? 169 THR C CB  1 
ATOM   4068  O OG1 . THR C  1 169 ? 5.881    -8.573  -17.811  1.00 86.83  ? 169 THR C OG1 1 
ATOM   4069  C CG2 . THR C  1 169 ? 6.401    -9.600  -19.926  1.00 86.24  ? 169 THR C CG2 1 
ATOM   4070  N N   . ASP C  1 170 ? 6.454    -4.920  -18.544  1.00 87.50  ? 170 ASP C N   1 
ATOM   4071  C CA  . ASP C  1 170 ? 5.837    -3.715  -18.004  1.00 88.21  ? 170 ASP C CA  1 
ATOM   4072  C C   . ASP C  1 170 ? 4.995    -2.970  -19.065  1.00 88.48  ? 170 ASP C C   1 
ATOM   4073  O O   . ASP C  1 170 ? 3.878    -2.495  -18.788  1.00 89.09  ? 170 ASP C O   1 
ATOM   4074  C CB  . ASP C  1 170 ? 6.888    -2.792  -17.413  1.00 89.10  ? 170 ASP C CB  1 
ATOM   4075  C CG  . ASP C  1 170 ? 6.277    -1.649  -16.633  1.00 90.12  ? 170 ASP C CG  1 
ATOM   4076  O OD1 . ASP C  1 170 ? 6.484    -0.468  -17.015  1.00 91.01  ? 170 ASP C OD1 1 
ATOM   4077  O OD2 . ASP C  1 170 ? 5.583    -1.935  -15.634  1.00 90.36  ? 170 ASP C OD2 1 
ATOM   4078  N N   . ARG C  1 171 ? 5.540    -2.865  -20.275  1.00 88.46  ? 171 ARG C N   1 
ATOM   4079  C CA  . ARG C  1 171 ? 4.819    -2.298  -21.406  1.00 89.05  ? 171 ARG C CA  1 
ATOM   4080  C C   . ARG C  1 171 ? 4.880    -3.319  -22.524  1.00 88.51  ? 171 ARG C C   1 
ATOM   4081  O O   . ARG C  1 171 ? 5.532    -4.352  -22.393  1.00 87.76  ? 171 ARG C O   1 
ATOM   4082  C CB  . ARG C  1 171 ? 5.466    -1.004  -21.887  1.00 90.29  ? 171 ARG C CB  1 
ATOM   4083  C CG  . ARG C  1 171 ? 5.739    0.020   -20.805  1.00 91.11  ? 171 ARG C CG  1 
ATOM   4084  C CD  . ARG C  1 171 ? 4.650    1.056   -20.756  1.00 92.32  ? 171 ARG C CD  1 
ATOM   4085  N NE  . ARG C  1 171 ? 4.958    2.110   -19.794  1.00 93.46  ? 171 ARG C NE  1 
ATOM   4086  C CZ  . ARG C  1 171 ? 4.088    3.038   -19.423  1.00 94.82  ? 171 ARG C CZ  1 
ATOM   4087  N NH1 . ARG C  1 171 ? 2.864    3.033   -19.949  1.00 95.28  ? 171 ARG C NH1 1 
ATOM   4088  N NH2 . ARG C  1 171 ? 4.432    3.955   -18.530  1.00 96.05  ? 171 ARG C NH2 1 
ATOM   4089  N N   . ASP C  1 172 ? 4.199    -3.033  -23.630  1.00 89.23  ? 172 ASP C N   1 
ATOM   4090  C CA  . ASP C  1 172 ? 4.251    -3.883  -24.818  1.00 89.18  ? 172 ASP C CA  1 
ATOM   4091  C C   . ASP C  1 172 ? 5.690    -4.103  -25.283  1.00 89.23  ? 172 ASP C C   1 
ATOM   4092  O O   . ASP C  1 172 ? 6.455    -3.163  -25.499  1.00 90.22  ? 172 ASP C O   1 
ATOM   4093  C CB  . ASP C  1 172 ? 3.447    -3.258  -25.950  1.00 90.59  ? 172 ASP C CB  1 
ATOM   4094  C CG  . ASP C  1 172 ? 1.967    -3.310  -25.710  1.00 91.03  ? 172 ASP C CG  1 
ATOM   4095  O OD1 . ASP C  1 172 ? 1.557    -3.878  -24.664  1.00 90.22  ? 172 ASP C OD1 1 
ATOM   4096  O OD2 . ASP C  1 172 ? 1.225    -2.781  -26.580  1.00 92.58  ? 172 ASP C OD2 1 
ATOM   4097  N N   . ASN C  1 173 ? 6.045    -5.362  -25.442  1.00 88.56  ? 173 ASN C N   1 
ATOM   4098  C CA  . ASN C  1 173 ? 7.370    -5.716  -25.870  1.00 89.00  ? 173 ASN C CA  1 
ATOM   4099  C C   . ASN C  1 173 ? 7.301    -6.596  -27.120  1.00 89.48  ? 173 ASN C C   1 
ATOM   4100  O O   . ASN C  1 173 ? 6.947    -7.788  -27.072  1.00 88.83  ? 173 ASN C O   1 
ATOM   4101  C CB  . ASN C  1 173 ? 8.050    -6.435  -24.729  1.00 88.25  ? 173 ASN C CB  1 
ATOM   4102  C CG  . ASN C  1 173 ? 9.518    -6.537  -24.915  1.00 89.22  ? 173 ASN C CG  1 
ATOM   4103  O OD1 . ASN C  1 173 ? 10.070   -6.083  -25.915  1.00 90.53  ? 173 ASN C OD1 1 
ATOM   4104  N ND2 . ASN C  1 173 ? 10.174   -7.134  -23.943  1.00 89.03  ? 173 ASN C ND2 1 
ATOM   4105  N N   . PHE C  1 174 ? 7.619    -5.988  -28.252  1.00 90.96  ? 174 PHE C N   1 
ATOM   4106  C CA  . PHE C  1 174 ? 7.607    -6.694  -29.531  1.00 91.93  ? 174 PHE C CA  1 
ATOM   4107  C C   . PHE C  1 174 ? 8.942    -7.373  -29.832  1.00 92.72  ? 174 PHE C C   1 
ATOM   4108  O O   . PHE C  1 174 ? 10.036   -6.767  -29.693  1.00 93.73  ? 174 PHE C O   1 
ATOM   4109  C CB  . PHE C  1 174 ? 7.241    -5.748  -30.661  1.00 93.72  ? 174 PHE C CB  1 
ATOM   4110  C CG  . PHE C  1 174 ? 5.816    -5.275  -30.612  1.00 93.57  ? 174 PHE C CG  1 
ATOM   4111  C CD1 . PHE C  1 174 ? 4.792    -6.049  -31.150  1.00 93.69  ? 174 PHE C CD1 1 
ATOM   4112  C CD2 . PHE C  1 174 ? 5.489    -4.048  -30.022  1.00 93.73  ? 174 PHE C CD2 1 
ATOM   4113  C CE1 . PHE C  1 174 ? 3.479    -5.610  -31.113  1.00 94.11  ? 174 PHE C CE1 1 
ATOM   4114  C CE2 . PHE C  1 174 ? 4.170    -3.607  -29.989  1.00 94.09  ? 174 PHE C CE2 1 
ATOM   4115  C CZ  . PHE C  1 174 ? 3.168    -4.392  -30.535  1.00 94.35  ? 174 PHE C CZ  1 
ATOM   4116  N N   . LEU C  1 175 ? 8.842    -8.641  -30.233  1.00 92.63  ? 175 LEU C N   1 
ATOM   4117  C CA  . LEU C  1 175 ? 9.999    -9.499  -30.459  1.00 93.58  ? 175 LEU C CA  1 
ATOM   4118  C C   . LEU C  1 175 ? 9.973    -10.068 -31.880  1.00 95.28  ? 175 LEU C C   1 
ATOM   4119  O O   . LEU C  1 175 ? 8.912    -10.425 -32.393  1.00 95.07  ? 175 LEU C O   1 
ATOM   4120  C CB  . LEU C  1 175 ? 9.975    -10.621 -29.427  1.00 92.21  ? 175 LEU C CB  1 
ATOM   4121  C CG  . LEU C  1 175 ? 10.725   -10.478 -28.095  1.00 91.62  ? 175 LEU C CG  1 
ATOM   4122  C CD1 . LEU C  1 175 ? 10.714   -9.080  -27.508  1.00 91.29  ? 175 LEU C CD1 1 
ATOM   4123  C CD2 . LEU C  1 175 ? 10.138   -11.454 -27.096  1.00 90.25  ? 175 LEU C CD2 1 
ATOM   4124  N N   . THR C  1 176 ? 11.128   -10.127 -32.532  1.00 97.36  ? 176 THR C N   1 
ATOM   4125  C CA  . THR C  1 176 ? 11.221   -10.834 -33.809  1.00 99.31  ? 176 THR C CA  1 
ATOM   4126  C C   . THR C  1 176 ? 11.333   -12.329 -33.509  1.00 98.84  ? 176 THR C C   1 
ATOM   4127  O O   . THR C  1 176 ? 11.561   -12.727 -32.354  1.00 97.42  ? 176 THR C O   1 
ATOM   4128  C CB  . THR C  1 176 ? 12.441   -10.397 -34.651  1.00 102.35 ? 176 THR C CB  1 
ATOM   4129  O OG1 . THR C  1 176 ? 13.655   -10.738 -33.964  1.00 102.88 ? 176 THR C OG1 1 
ATOM   4130  C CG2 . THR C  1 176 ? 12.428   -8.913  -34.914  1.00 103.29 ? 176 THR C CG2 1 
ATOM   4131  N N   . ALA C  1 177 ? 11.184   -13.162 -34.533  1.00 100.35 ? 177 ALA C N   1 
ATOM   4132  C CA  . ALA C  1 177 ? 11.349   -14.597 -34.343  1.00 100.47 ? 177 ALA C CA  1 
ATOM   4133  C C   . ALA C  1 177 ? 12.706   -14.898 -33.697  1.00 101.27 ? 177 ALA C C   1 
ATOM   4134  O O   . ALA C  1 177 ? 12.773   -15.642 -32.718  1.00 100.19 ? 177 ALA C O   1 
ATOM   4135  C CB  . ALA C  1 177 ? 11.180   -15.348 -35.659  1.00 102.69 ? 177 ALA C CB  1 
ATOM   4136  N N   . GLU C  1 178 ? 13.774   -14.297 -34.219  1.00 103.53 ? 178 GLU C N   1 
ATOM   4137  C CA  . GLU C  1 178 ? 15.100   -14.525 -33.661  1.00 104.96 ? 178 GLU C CA  1 
ATOM   4138  C C   . GLU C  1 178 ? 15.139   -14.117 -32.202  1.00 102.79 ? 178 GLU C C   1 
ATOM   4139  O O   . GLU C  1 178 ? 15.650   -14.866 -31.369  1.00 102.85 ? 178 GLU C O   1 
ATOM   4140  C CB  . GLU C  1 178 ? 16.195   -13.799 -34.442  1.00 108.19 ? 178 GLU C CB  1 
ATOM   4141  C CG  . GLU C  1 178 ? 16.554   -14.458 -35.768  1.00 111.37 ? 178 GLU C CG  1 
ATOM   4142  C CD  . GLU C  1 178 ? 17.100   -15.894 -35.640  1.00 112.70 ? 178 GLU C CD  1 
ATOM   4143  O OE1 . GLU C  1 178 ? 17.672   -16.272 -34.573  1.00 112.28 ? 178 GLU C OE1 1 
ATOM   4144  O OE2 . GLU C  1 178 ? 16.972   -16.660 -36.636  1.00 114.55 ? 178 GLU C OE2 1 
ATOM   4145  N N   . GLU C  1 179 ? 14.576   -12.948 -31.892  1.00 101.17 ? 179 GLU C N   1 
ATOM   4146  C CA  . GLU C  1 179 ? 14.618   -12.419 -30.525  1.00 99.44  ? 179 GLU C CA  1 
ATOM   4147  C C   . GLU C  1 179 ? 13.845   -13.315 -29.579  1.00 97.24  ? 179 GLU C C   1 
ATOM   4148  O O   . GLU C  1 179 ? 14.241   -13.487 -28.417  1.00 96.78  ? 179 GLU C O   1 
ATOM   4149  C CB  . GLU C  1 179 ? 14.080   -10.995 -30.478  1.00 98.48  ? 179 GLU C CB  1 
ATOM   4150  C CG  . GLU C  1 179 ? 15.042   -9.958  -31.052  1.00 101.00 ? 179 GLU C CG  1 
ATOM   4151  C CD  . GLU C  1 179 ? 14.382   -8.617  -31.345  1.00 100.64 ? 179 GLU C CD  1 
ATOM   4152  O OE1 . GLU C  1 179 ? 13.120   -8.525  -31.334  1.00 98.68  ? 179 GLU C OE1 1 
ATOM   4153  O OE2 . GLU C  1 179 ? 15.140   -7.651  -31.606  1.00 102.75 ? 179 GLU C OE2 1 
ATOM   4154  N N   . ALA C  1 180 ? 12.765   -13.901 -30.106  1.00 96.37  ? 180 ALA C N   1 
ATOM   4155  C CA  . ALA C  1 180 ? 11.915   -14.818 -29.360  1.00 94.81  ? 180 ALA C CA  1 
ATOM   4156  C C   . ALA C  1 180 ? 12.668   -16.091 -28.989  1.00 96.02  ? 180 ALA C C   1 
ATOM   4157  O O   . ALA C  1 180 ? 12.490   -16.628 -27.879  1.00 95.20  ? 180 ALA C O   1 
ATOM   4158  C CB  . ALA C  1 180 ? 10.672   -15.150 -30.159  1.00 94.38  ? 180 ALA C CB  1 
ATOM   4159  N N   . LYS C  1 181 ? 13.495   -16.569 -29.920  1.00 98.34  ? 181 LYS C N   1 
ATOM   4160  C CA  . LYS C  1 181 ? 14.348   -17.747 -29.688  1.00 100.20 ? 181 LYS C CA  1 
ATOM   4161  C C   . LYS C  1 181 ? 15.388   -17.442 -28.635  1.00 100.83 ? 181 LYS C C   1 
ATOM   4162  O O   . LYS C  1 181 ? 15.571   -18.210 -27.702  1.00 101.03 ? 181 LYS C O   1 
ATOM   4163  C CB  . LYS C  1 181 ? 15.041   -18.174 -30.976  1.00 103.03 ? 181 LYS C CB  1 
ATOM   4164  C CG  . LYS C  1 181 ? 16.029   -19.309 -30.801  1.00 105.58 ? 181 LYS C CG  1 
ATOM   4165  C CD  . LYS C  1 181 ? 16.758   -19.587 -32.106  1.00 108.80 ? 181 LYS C CD  1 
ATOM   4166  C CE  . LYS C  1 181 ? 17.971   -20.467 -31.898  1.00 112.01 ? 181 LYS C CE  1 
ATOM   4167  N NZ  . LYS C  1 181 ? 18.704   -20.453 -33.178  1.00 115.40 ? 181 LYS C NZ  1 
ATOM   4168  N N   . GLU C  1 182 ? 16.048   -16.302 -28.802  1.00 101.50 ? 182 GLU C N   1 
ATOM   4169  C CA  . GLU C  1 182 ? 17.033   -15.783 -27.851  1.00 102.39 ? 182 GLU C CA  1 
ATOM   4170  C C   . GLU C  1 182 ? 16.447   -15.625 -26.452  1.00 100.12 ? 182 GLU C C   1 
ATOM   4171  O O   . GLU C  1 182 ? 17.156   -15.797 -25.461  1.00 101.12 ? 182 GLU C O   1 
ATOM   4172  C CB  . GLU C  1 182 ? 17.558   -14.424 -28.336  1.00 103.34 ? 182 GLU C CB  1 
ATOM   4173  C CG  . GLU C  1 182 ? 18.694   -13.835 -27.523  1.00 105.05 ? 182 GLU C CG  1 
ATOM   4174  C CD  . GLU C  1 182 ? 19.992   -14.563 -27.780  1.00 108.79 ? 182 GLU C CD  1 
ATOM   4175  O OE1 . GLU C  1 182 ? 20.859   -14.682 -26.861  1.00 110.45 ? 182 GLU C OE1 1 
ATOM   4176  O OE2 . GLU C  1 182 ? 20.151   -15.042 -28.925  1.00 110.45 ? 182 GLU C OE2 1 
ATOM   4177  N N   . TYR C  1 183 ? 15.161   -15.284 -26.384  1.00 97.50  ? 183 TYR C N   1 
ATOM   4178  C CA  . TYR C  1 183 ? 14.470   -15.111 -25.115  1.00 95.58  ? 183 TYR C CA  1 
ATOM   4179  C C   . TYR C  1 183 ? 14.135   -16.456 -24.449  1.00 95.62  ? 183 TYR C C   1 
ATOM   4180  O O   . TYR C  1 183 ? 13.994   -16.541 -23.234  1.00 95.18  ? 183 TYR C O   1 
ATOM   4181  C CB  . TYR C  1 183 ? 13.191   -14.289 -25.330  1.00 93.36  ? 183 TYR C CB  1 
ATOM   4182  C CG  . TYR C  1 183 ? 12.787   -13.503 -24.107  1.00 92.01  ? 183 TYR C CG  1 
ATOM   4183  C CD1 . TYR C  1 183 ? 13.279   -12.207 -23.877  1.00 92.22  ? 183 TYR C CD1 1 
ATOM   4184  C CD2 . TYR C  1 183 ? 11.927   -14.056 -23.159  1.00 90.94  ? 183 TYR C CD2 1 
ATOM   4185  C CE1 . TYR C  1 183 ? 12.914   -11.491 -22.747  1.00 91.27  ? 183 TYR C CE1 1 
ATOM   4186  C CE2 . TYR C  1 183 ? 11.549   -13.339 -22.027  1.00 90.07  ? 183 TYR C CE2 1 
ATOM   4187  C CZ  . TYR C  1 183 ? 12.041   -12.065 -21.830  1.00 90.19  ? 183 TYR C CZ  1 
ATOM   4188  O OH  . TYR C  1 183 ? 11.678   -11.374 -20.706  1.00 89.62  ? 183 TYR C OH  1 
ATOM   4189  N N   . GLY C  1 184 ? 14.001   -17.496 -25.266  1.00 96.48  ? 184 GLY C N   1 
ATOM   4190  C CA  . GLY C  1 184 ? 13.565   -18.795 -24.793  1.00 96.80  ? 184 GLY C CA  1 
ATOM   4191  C C   . GLY C  1 184 ? 12.068   -19.051 -24.943  1.00 95.12  ? 184 GLY C C   1 
ATOM   4192  O O   . GLY C  1 184 ? 11.532   -20.005 -24.372  1.00 95.37  ? 184 GLY C O   1 
ATOM   4193  N N   . LEU C  1 185 ? 11.378   -18.214 -25.708  1.00 93.84  ? 185 LEU C N   1 
ATOM   4194  C CA  . LEU C  1 185 ? 9.952    -18.478 -25.954  1.00 92.83  ? 185 LEU C CA  1 
ATOM   4195  C C   . LEU C  1 185 ? 9.758    -19.632 -26.938  1.00 94.22  ? 185 LEU C C   1 
ATOM   4196  O O   . LEU C  1 185 ? 8.837    -20.446 -26.801  1.00 94.36  ? 185 LEU C O   1 
ATOM   4197  C CB  . LEU C  1 185 ? 9.225    -17.219 -26.441  1.00 91.47  ? 185 LEU C CB  1 
ATOM   4198  C CG  . LEU C  1 185 ? 9.139    -16.102 -25.403  1.00 90.17  ? 185 LEU C CG  1 
ATOM   4199  C CD1 . LEU C  1 185 ? 9.033    -14.760 -26.085  1.00 89.67  ? 185 LEU C CD1 1 
ATOM   4200  C CD2 . LEU C  1 185 ? 8.002    -16.321 -24.424  1.00 89.36  ? 185 LEU C CD2 1 
ATOM   4201  N N   . ILE C  1 186 ? 10.643   -19.673 -27.928  1.00 95.61  ? 186 ILE C N   1 
ATOM   4202  C CA  . ILE C  1 186 ? 10.681   -20.739 -28.906  1.00 97.43  ? 186 ILE C CA  1 
ATOM   4203  C C   . ILE C  1 186 ? 12.061   -21.373 -28.902  1.00 99.64  ? 186 ILE C C   1 
ATOM   4204  O O   . ILE C  1 186 ? 13.020   -20.816 -28.338  1.00 99.85  ? 186 ILE C O   1 
ATOM   4205  C CB  . ILE C  1 186 ? 10.342   -20.230 -30.325  1.00 97.78  ? 186 ILE C CB  1 
ATOM   4206  C CG1 . ILE C  1 186 ? 11.227   -19.041 -30.708  1.00 97.96  ? 186 ILE C CG1 1 
ATOM   4207  C CG2 . ILE C  1 186 ? 8.871    -19.858 -30.406  1.00 96.32  ? 186 ILE C CG2 1 
ATOM   4208  C CD1 . ILE C  1 186 ? 11.209   -18.696 -32.187  1.00 99.33  ? 186 ILE C CD1 1 
ATOM   4209  N N   . ASP C  1 187 ? 12.159   -22.529 -29.555  1.00 101.66 ? 187 ASP C N   1 
ATOM   4210  C CA  . ASP C  1 187 ? 13.413   -23.258 -29.681  1.00 104.40 ? 187 ASP C CA  1 
ATOM   4211  C C   . ASP C  1 187 ? 14.091   -22.987 -31.020  1.00 106.30 ? 187 ASP C C   1 
ATOM   4212  O O   . ASP C  1 187 ? 15.310   -22.804 -31.085  1.00 108.21 ? 187 ASP C O   1 
ATOM   4213  C CB  . ASP C  1 187 ? 13.159   -24.751 -29.490  1.00 106.02 ? 187 ASP C CB  1 
ATOM   4214  C CG  . ASP C  1 187 ? 12.436   -25.055 -28.186  1.00 104.66 ? 187 ASP C CG  1 
ATOM   4215  O OD1 . ASP C  1 187 ? 13.037   -24.829 -27.116  1.00 104.56 ? 187 ASP C OD1 1 
ATOM   4216  O OD2 . ASP C  1 187 ? 11.265   -25.519 -28.224  1.00 104.07 ? 187 ASP C OD2 1 
ATOM   4217  N N   . GLU C  1 188 ? 13.298   -22.938 -32.078  1.00 106.15 ? 188 GLU C N   1 
ATOM   4218  C CA  . GLU C  1 188 ? 13.832   -22.870 -33.418  1.00 108.51 ? 188 GLU C CA  1 
ATOM   4219  C C   . GLU C  1 188 ? 12.999   -21.928 -34.262  1.00 107.34 ? 188 GLU C C   1 
ATOM   4220  O O   . GLU C  1 188 ? 11.777   -21.884 -34.109  1.00 105.45 ? 188 GLU C O   1 
ATOM   4221  C CB  . GLU C  1 188 ? 13.810   -24.282 -34.033  1.00 111.09 ? 188 GLU C CB  1 
ATOM   4222  C CG  . GLU C  1 188 ? 14.769   -24.501 -35.192  1.00 114.64 ? 188 GLU C CG  1 
ATOM   4223  C CD  . GLU C  1 188 ? 16.175   -24.040 -34.841  1.00 116.15 ? 188 GLU C CD  1 
ATOM   4224  O OE1 . GLU C  1 188 ? 16.952   -24.859 -34.292  1.00 118.06 ? 188 GLU C OE1 1 
ATOM   4225  O OE2 . GLU C  1 188 ? 16.496   -22.850 -35.101  1.00 115.74 ? 188 GLU C OE2 1 
ATOM   4226  N N   . VAL C  1 189 ? 13.638   -21.170 -35.148  1.00 108.85 ? 189 VAL C N   1 
ATOM   4227  C CA  . VAL C  1 189 ? 12.874   -20.495 -36.202  1.00 108.82 ? 189 VAL C CA  1 
ATOM   4228  C C   . VAL C  1 189 ? 12.983   -21.305 -37.497  1.00 112.02 ? 189 VAL C C   1 
ATOM   4229  O O   . VAL C  1 189 ? 14.073   -21.489 -38.028  1.00 114.90 ? 189 VAL C O   1 
ATOM   4230  C CB  . VAL C  1 189 ? 13.202   -18.973 -36.369  1.00 108.40 ? 189 VAL C CB  1 
ATOM   4231  C CG1 . VAL C  1 189 ? 14.013   -18.442 -35.189  1.00 107.30 ? 189 VAL C CG1 1 
ATOM   4232  C CG2 . VAL C  1 189 ? 13.885   -18.655 -37.692  1.00 111.74 ? 189 VAL C CG2 1 
ATOM   4233  N N   . MET C  1 190 ? 11.853   -21.817 -37.974  1.00 111.86 ? 190 MET C N   1 
ATOM   4234  C CA  . MET C  1 190 ? 11.825   -22.674 -39.158  1.00 115.02 ? 190 MET C CA  1 
ATOM   4235  C C   . MET C  1 190 ? 12.234   -21.944 -40.435  1.00 117.55 ? 190 MET C C   1 
ATOM   4236  O O   . MET C  1 190 ? 11.430   -21.218 -41.036  1.00 117.23 ? 190 MET C O   1 
ATOM   4237  C CB  . MET C  1 190 ? 10.440   -23.279 -39.368  1.00 114.50 ? 190 MET C CB  1 
ATOM   4238  C CG  . MET C  1 190 ? 9.786    -23.847 -38.126  1.00 112.12 ? 190 MET C CG  1 
ATOM   4239  S SD  . MET C  1 190 ? 8.778    -25.296 -38.523  1.00 113.91 ? 190 MET C SD  1 
ATOM   4240  C CE  . MET C  1 190 ? 7.438    -24.593 -39.488  1.00 114.02 ? 190 MET C CE  1 
ATOM   4241  N N   . VAL C  1 191 ? 13.480   -22.160 -40.849  1.00 120.52 ? 191 VAL C N   1 
ATOM   4242  C CA  . VAL C  1 191 ? 14.012   -21.576 -42.073  1.00 123.76 ? 191 VAL C CA  1 
ATOM   4243  C C   . VAL C  1 191 ? 13.322   -22.210 -43.308  1.00 126.30 ? 191 VAL C C   1 
ATOM   4244  O O   . VAL C  1 191 ? 13.051   -23.427 -43.322  1.00 127.08 ? 191 VAL C O   1 
ATOM   4245  C CB  . VAL C  1 191 ? 15.571   -21.664 -42.099  1.00 126.76 ? 191 VAL C CB  1 
ATOM   4246  C CG1 . VAL C  1 191 ? 16.052   -23.103 -42.302  1.00 129.57 ? 191 VAL C CG1 1 
ATOM   4247  C CG2 . VAL C  1 191 ? 16.177   -20.711 -43.131  1.00 129.88 ? 191 VAL C CG2 1 
ATOM   4248  N N   . PRO C  1 192 ? 12.993   -21.375 -44.325  1.00 127.81 ? 192 PRO C N   1 
ATOM   4249  C CA  . PRO C  1 192 ? 12.307   -21.874 -45.511  1.00 130.51 ? 192 PRO C CA  1 
ATOM   4250  C C   . PRO C  1 192 ? 12.998   -23.078 -46.113  1.00 134.32 ? 192 PRO C C   1 
ATOM   4251  O O   . PRO C  1 192 ? 14.219   -23.080 -46.301  1.00 136.90 ? 192 PRO C O   1 
ATOM   4252  C CB  . PRO C  1 192 ? 12.370   -20.696 -46.488  1.00 132.64 ? 192 PRO C CB  1 
ATOM   4253  C CG  . PRO C  1 192 ? 12.434   -19.494 -45.626  1.00 129.45 ? 192 PRO C CG  1 
ATOM   4254  C CD  . PRO C  1 192 ? 13.123   -19.902 -44.350  1.00 127.07 ? 192 PRO C CD  1 
ATOM   4255  N N   . GLU C  1 193 ? 12.189   -24.084 -46.411  1.00 134.97 ? 193 GLU C N   1 
ATOM   4256  C CA  . GLU C  1 193 ? 12.653   -25.332 -46.979  1.00 138.69 ? 193 GLU C CA  1 
ATOM   4257  C C   . GLU C  1 193 ? 12.691   -25.276 -48.515  1.00 143.41 ? 193 GLU C C   1 
ATOM   4258  O O   . GLU C  1 193 ? 13.760   -25.179 -49.115  1.00 146.97 ? 193 GLU C O   1 
ATOM   4259  C CB  . GLU C  1 193 ? 11.724   -26.436 -46.489  1.00 137.29 ? 193 GLU C CB  1 
ATOM   4260  C CG  . GLU C  1 193 ? 12.087   -27.837 -46.925  1.00 140.96 ? 193 GLU C CG  1 
ATOM   4261  C CD  . GLU C  1 193 ? 11.051   -28.846 -46.455  1.00 139.80 ? 193 GLU C CD  1 
ATOM   4262  O OE1 . GLU C  1 193 ? 11.425   -30.035 -46.288  1.00 141.74 ? 193 GLU C OE1 1 
ATOM   4263  O OE2 . GLU C  1 193 ? 9.869    -28.453 -46.256  1.00 137.35 ? 193 GLU C OE2 1 
ATOM   4264  N N   . ILE D  1 4   ? -17.485  -26.515 -33.138  1.00 96.44  ? 4   ILE D N   1 
ATOM   4265  C CA  . ILE D  1 4   ? -17.313  -26.067 -34.556  1.00 99.53  ? 4   ILE D CA  1 
ATOM   4266  C C   . ILE D  1 4   ? -16.832  -27.189 -35.499  1.00 101.19 ? 4   ILE D C   1 
ATOM   4267  O O   . ILE D  1 4   ? -17.524  -27.490 -36.461  1.00 104.38 ? 4   ILE D O   1 
ATOM   4268  C CB  . ILE D  1 4   ? -16.567  -24.687 -34.694  1.00 100.10 ? 4   ILE D CB  1 
ATOM   4269  C CG1 . ILE D  1 4   ? -16.462  -24.198 -36.162  1.00 103.97 ? 4   ILE D CG1 1 
ATOM   4270  C CG2 . ILE D  1 4   ? -15.235  -24.648 -33.939  1.00 98.03  ? 4   ILE D CG2 1 
ATOM   4271  C CD1 . ILE D  1 4   ? -16.139  -22.713 -36.303  1.00 105.39 ? 4   ILE D CD1 1 
ATOM   4272  N N   . PRO D  1 5   ? -15.695  -27.857 -35.217  1.00 99.84  ? 5   PRO D N   1 
ATOM   4273  C CA  . PRO D  1 5   ? -15.237  -28.865 -36.194  1.00 102.31 ? 5   PRO D CA  1 
ATOM   4274  C C   . PRO D  1 5   ? -15.898  -30.268 -36.181  1.00 103.03 ? 5   PRO D C   1 
ATOM   4275  O O   . PRO D  1 5   ? -16.468  -30.699 -35.174  1.00 100.82 ? 5   PRO D O   1 
ATOM   4276  C CB  . PRO D  1 5   ? -13.737  -28.995 -35.891  1.00 101.43 ? 5   PRO D CB  1 
ATOM   4277  C CG  . PRO D  1 5   ? -13.525  -28.447 -34.541  1.00 98.32  ? 5   PRO D CG  1 
ATOM   4278  C CD  . PRO D  1 5   ? -14.813  -27.840 -34.040  1.00 97.09  ? 5   PRO D CD  1 
ATOM   4279  N N   . THR D  1 6   ? -15.767  -30.976 -37.304  1.00 106.72 ? 6   THR D N   1 
ATOM   4280  C CA  . THR D  1 6   ? -16.476  -32.230 -37.570  1.00 108.98 ? 6   THR D CA  1 
ATOM   4281  C C   . THR D  1 6   ? -15.563  -33.466 -37.535  1.00 109.68 ? 6   THR D C   1 
ATOM   4282  O O   . THR D  1 6   ? -14.418  -33.403 -37.946  1.00 110.63 ? 6   THR D O   1 
ATOM   4283  C CB  . THR D  1 6   ? -17.193  -32.159 -38.942  1.00 114.36 ? 6   THR D CB  1 
ATOM   4284  O OG1 . THR D  1 6   ? -18.061  -31.027 -38.967  1.00 114.52 ? 6   THR D OG1 1 
ATOM   4285  C CG2 . THR D  1 6   ? -18.032  -33.395 -39.221  1.00 117.65 ? 6   THR D CG2 1 
ATOM   4286  N N   . VAL D  1 7   ? -16.089  -34.585 -37.043  1.00 109.76 ? 7   VAL D N   1 
ATOM   4287  C CA  . VAL D  1 7   ? -15.355  -35.868 -36.992  1.00 111.29 ? 7   VAL D CA  1 
ATOM   4288  C C   . VAL D  1 7   ? -16.132  -36.999 -37.715  1.00 115.94 ? 7   VAL D C   1 
ATOM   4289  O O   . VAL D  1 7   ? -17.375  -37.052 -37.674  1.00 116.68 ? 7   VAL D O   1 
ATOM   4290  C CB  . VAL D  1 7   ? -15.012  -36.283 -35.532  1.00 107.68 ? 7   VAL D CB  1 
ATOM   4291  C CG1 . VAL D  1 7   ? -14.206  -37.547 -35.488  1.00 109.99 ? 7   VAL D CG1 1 
ATOM   4292  C CG2 . VAL D  1 7   ? -14.221  -35.197 -34.831  1.00 104.27 ? 7   VAL D CG2 1 
ATOM   4293  N N   . ILE D  1 8   ? -15.386  -37.888 -38.377  1.00 119.76 ? 8   ILE D N   1 
ATOM   4294  C CA  . ILE D  1 8   ? -15.946  -39.044 -39.109  1.00 125.30 ? 8   ILE D CA  1 
ATOM   4295  C C   . ILE D  1 8   ? -15.844  -40.413 -38.399  1.00 125.90 ? 8   ILE D C   1 
ATOM   4296  O O   . ILE D  1 8   ? -14.908  -40.660 -37.635  1.00 123.61 ? 8   ILE D O   1 
ATOM   4297  C CB  . ILE D  1 8   ? -15.257  -39.227 -40.478  1.00 130.98 ? 8   ILE D CB  1 
ATOM   4298  C CG1 . ILE D  1 8   ? -13.742  -38.983 -40.341  1.00 129.43 ? 8   ILE D CG1 1 
ATOM   4299  C CG2 . ILE D  1 8   ? -15.936  -38.371 -41.548  1.00 134.11 ? 8   ILE D CG2 1 
ATOM   4300  C CD1 . ILE D  1 8   ? -12.907  -40.247 -40.187  1.00 132.09 ? 8   ILE D CD1 1 
ATOM   4301  N N   . GLU D  1 9   ? -16.792  -41.307 -38.698  1.00 129.91 ? 9   GLU D N   1 
ATOM   4302  C CA  . GLU D  1 9   ? -16.837  -42.639 -38.109  1.00 131.47 ? 9   GLU D CA  1 
ATOM   4303  C C   . GLU D  1 9   ? -17.654  -43.555 -38.994  1.00 138.39 ? 9   GLU D C   1 
ATOM   4304  O O   . GLU D  1 9   ? -17.102  -44.403 -39.691  1.00 143.72 ? 9   GLU D O   1 
ATOM   4305  C CB  . GLU D  1 9   ? -17.461  -42.589 -36.714  1.00 126.58 ? 9   GLU D CB  1 
ATOM   4306  C CG  . GLU D  1 9   ? -16.771  -43.491 -35.702  1.00 125.66 ? 9   GLU D CG  1 
ATOM   4307  C CD  . GLU D  1 9   ? -16.442  -42.752 -34.406  1.00 119.59 ? 9   GLU D CD  1 
ATOM   4308  O OE1 . GLU D  1 9   ? -17.109  -43.038 -33.381  1.00 117.83 ? 9   GLU D OE1 1 
ATOM   4309  O OE2 . GLU D  1 9   ? -15.530  -41.875 -34.414  1.00 117.15 ? 9   GLU D OE2 1 
ATOM   4310  N N   . ARG D  1 16  ? -20.399  -42.012 -40.351  1.00 143.27 ? 16  ARG D N   1 
ATOM   4311  C CA  . ARG D  1 16  ? -21.301  -41.026 -39.733  1.00 139.27 ? 16  ARG D CA  1 
ATOM   4312  C C   . ARG D  1 16  ? -20.558  -39.788 -39.201  1.00 132.45 ? 16  ARG D C   1 
ATOM   4313  O O   . ARG D  1 16  ? -19.416  -39.881 -38.763  1.00 129.07 ? 16  ARG D O   1 
ATOM   4314  C CB  . ARG D  1 16  ? -22.160  -41.687 -38.639  1.00 137.69 ? 16  ARG D CB  1 
ATOM   4315  C CG  . ARG D  1 16  ? -23.050  -42.833 -39.152  1.00 145.12 ? 16  ARG D CG  1 
ATOM   4316  C CD  . ARG D  1 16  ? -24.325  -42.362 -39.865  1.00 150.36 ? 16  ARG D CD  1 
ATOM   4317  N NE  . ARG D  1 16  ? -25.248  -43.458 -40.235  1.00 158.00 ? 16  ARG D NE  1 
ATOM   4318  C CZ  . ARG D  1 16  ? -26.489  -43.286 -40.708  1.00 163.85 ? 16  ARG D CZ  1 
ATOM   4319  N NH1 . ARG D  1 16  ? -27.234  -44.328 -41.012  1.00 171.23 ? 16  ARG D NH1 1 
ATOM   4320  N NH2 . ARG D  1 16  ? -26.995  -42.071 -40.884  1.00 163.08 ? 16  ARG D NH2 1 
ATOM   4321  N N   . ALA D  1 17  ? -21.213  -38.634 -39.246  1.00 131.23 ? 17  ALA D N   1 
ATOM   4322  C CA  . ALA D  1 17  ? -20.553  -37.364 -38.928  1.00 126.13 ? 17  ALA D CA  1 
ATOM   4323  C C   . ALA D  1 17  ? -20.970  -36.743 -37.583  1.00 120.25 ? 17  ALA D C   1 
ATOM   4324  O O   . ALA D  1 17  ? -22.158  -36.620 -37.297  1.00 121.12 ? 17  ALA D O   1 
ATOM   4325  C CB  . ALA D  1 17  ? -20.787  -36.372 -40.057  1.00 129.76 ? 17  ALA D CB  1 
ATOM   4326  N N   . TYR D  1 18  ? -19.990  -36.343 -36.771  1.00 115.06 ? 18  TYR D N   1 
ATOM   4327  C CA  . TYR D  1 18  ? -20.246  -35.638 -35.497  1.00 110.05 ? 18  TYR D CA  1 
ATOM   4328  C C   . TYR D  1 18  ? -19.609  -34.256 -35.445  1.00 107.27 ? 18  TYR D C   1 
ATOM   4329  O O   . TYR D  1 18  ? -18.574  -34.046 -36.069  1.00 107.81 ? 18  TYR D O   1 
ATOM   4330  C CB  . TYR D  1 18  ? -19.576  -36.353 -34.343  1.00 106.87 ? 18  TYR D CB  1 
ATOM   4331  C CG  . TYR D  1 18  ? -20.012  -37.745 -34.108  1.00 109.02 ? 18  TYR D CG  1 
ATOM   4332  C CD1 . TYR D  1 18  ? -21.175  -38.028 -33.385  1.00 108.93 ? 18  TYR D CD1 1 
ATOM   4333  C CD2 . TYR D  1 18  ? -19.251  -38.794 -34.575  1.00 111.63 ? 18  TYR D CD2 1 
ATOM   4334  C CE1 . TYR D  1 18  ? -21.566  -39.334 -33.155  1.00 111.36 ? 18  TYR D CE1 1 
ATOM   4335  C CE2 . TYR D  1 18  ? -19.639  -40.093 -34.361  1.00 114.20 ? 18  TYR D CE2 1 
ATOM   4336  C CZ  . TYR D  1 18  ? -20.795  -40.346 -33.651  1.00 113.97 ? 18  TYR D CZ  1 
ATOM   4337  O OH  . TYR D  1 18  ? -21.182  -41.625 -33.431  1.00 116.90 ? 18  TYR D OH  1 
ATOM   4338  N N   . ASP D  1 19  ? -20.170  -33.340 -34.651  1.00 104.65 ? 19  ASP D N   1 
ATOM   4339  C CA  . ASP D  1 19  ? -19.388  -32.190 -34.221  1.00 101.56 ? 19  ASP D CA  1 
ATOM   4340  C C   . ASP D  1 19  ? -18.545  -32.649 -33.045  1.00 98.30  ? 19  ASP D C   1 
ATOM   4341  O O   . ASP D  1 19  ? -18.901  -33.606 -32.363  1.00 97.96  ? 19  ASP D O   1 
ATOM   4342  C CB  . ASP D  1 19  ? -20.280  -31.018 -33.836  1.00 100.93 ? 19  ASP D CB  1 
ATOM   4343  C CG  . ASP D  1 19  ? -21.078  -31.278 -32.598  1.00 99.12  ? 19  ASP D CG  1 
ATOM   4344  O OD1 . ASP D  1 19  ? -20.531  -31.049 -31.502  1.00 96.03  ? 19  ASP D OD1 1 
ATOM   4345  O OD2 . ASP D  1 19  ? -22.254  -31.698 -32.738  1.00 101.47 ? 19  ASP D OD2 1 
ATOM   4346  N N   . ILE D  1 20  ? -17.442  -31.958 -32.799  1.00 96.60  ? 20  ILE D N   1 
ATOM   4347  C CA  . ILE D  1 20  ? -16.478  -32.400 -31.807  1.00 94.84  ? 20  ILE D CA  1 
ATOM   4348  C C   . ILE D  1 20  ? -17.070  -32.704 -30.427  1.00 93.10  ? 20  ILE D C   1 
ATOM   4349  O O   . ILE D  1 20  ? -16.623  -33.642 -29.773  1.00 93.11  ? 20  ILE D O   1 
ATOM   4350  C CB  . ILE D  1 20  ? -15.251  -31.466 -31.726  1.00 94.12  ? 20  ILE D CB  1 
ATOM   4351  C CG1 . ILE D  1 20  ? -14.102  -32.142 -30.962  1.00 94.03  ? 20  ILE D CG1 1 
ATOM   4352  C CG2 . ILE D  1 20  ? -15.605  -30.136 -31.095  1.00 92.56  ? 20  ILE D CG2 1 
ATOM   4353  C CD1 . ILE D  1 20  ? -13.313  -33.138 -31.782  1.00 96.46  ? 20  ILE D CD1 1 
ATOM   4354  N N   . TYR D  1 21  ? -18.079  -31.947 -29.998  1.00 92.26  ? 21  TYR D N   1 
ATOM   4355  C CA  . TYR D  1 21  ? -18.681  -32.170 -28.682  1.00 91.14  ? 21  TYR D CA  1 
ATOM   4356  C C   . TYR D  1 21  ? -19.504  -33.439 -28.644  1.00 92.36  ? 21  TYR D C   1 
ATOM   4357  O O   . TYR D  1 21  ? -19.482  -34.169 -27.655  1.00 92.06  ? 21  TYR D O   1 
ATOM   4358  C CB  . TYR D  1 21  ? -19.514  -30.982 -28.244  1.00 90.60  ? 21  TYR D CB  1 
ATOM   4359  C CG  . TYR D  1 21  ? -18.750  -29.679 -28.239  1.00 89.98  ? 21  TYR D CG  1 
ATOM   4360  C CD1 . TYR D  1 21  ? -17.711  -29.459 -27.319  1.00 89.21  ? 21  TYR D CD1 1 
ATOM   4361  C CD2 . TYR D  1 21  ? -19.056  -28.660 -29.157  1.00 90.97  ? 21  TYR D CD2 1 
ATOM   4362  C CE1 . TYR D  1 21  ? -17.002  -28.265 -27.318  1.00 89.33  ? 21  TYR D CE1 1 
ATOM   4363  C CE2 . TYR D  1 21  ? -18.351  -27.474 -29.161  1.00 90.87  ? 21  TYR D CE2 1 
ATOM   4364  C CZ  . TYR D  1 21  ? -17.331  -27.287 -28.241  1.00 89.98  ? 21  TYR D CZ  1 
ATOM   4365  O OH  . TYR D  1 21  ? -16.630  -26.121 -28.240  1.00 90.52  ? 21  TYR D OH  1 
ATOM   4366  N N   . SER D  1 22  ? -20.195  -33.720 -29.739  1.00 94.44  ? 22  SER D N   1 
ATOM   4367  C CA  . SER D  1 22  ? -20.977  -34.931 -29.863  1.00 96.54  ? 22  SER D CA  1 
ATOM   4368  C C   . SER D  1 22  ? -20.103  -36.170 -29.840  1.00 97.28  ? 22  SER D C   1 
ATOM   4369  O O   . SER D  1 22  ? -20.466  -37.177 -29.255  1.00 98.14  ? 22  SER D O   1 
ATOM   4370  C CB  . SER D  1 22  ? -21.762  -34.885 -31.156  1.00 99.76  ? 22  SER D CB  1 
ATOM   4371  O OG  . SER D  1 22  ? -22.567  -33.749 -31.153  1.00 99.79  ? 22  SER D OG  1 
ATOM   4372  N N   . ARG D  1 23  ? -18.956  -36.068 -30.497  1.00 97.46  ? 23  ARG D N   1 
ATOM   4373  C CA  . ARG D  1 23  ? -17.962  -37.123 -30.529  1.00 98.74  ? 23  ARG D CA  1 
ATOM   4374  C C   . ARG D  1 23  ? -17.507  -37.434 -29.119  1.00 97.31  ? 23  ARG D C   1 
ATOM   4375  O O   . ARG D  1 23  ? -17.461  -38.588 -28.739  1.00 98.95  ? 23  ARG D O   1 
ATOM   4376  C CB  . ARG D  1 23  ? -16.791  -36.739 -31.436  1.00 99.44  ? 23  ARG D CB  1 
ATOM   4377  C CG  . ARG D  1 23  ? -15.656  -37.753 -31.518  1.00 101.47 ? 23  ARG D CG  1 
ATOM   4378  C CD  . ARG D  1 23  ? -16.124  -39.134 -31.965  1.00 104.90 ? 23  ARG D CD  1 
ATOM   4379  N NE  . ARG D  1 23  ? -15.102  -40.150 -31.736  1.00 107.07 ? 23  ARG D NE  1 
ATOM   4380  C CZ  . ARG D  1 23  ? -14.880  -40.745 -30.572  1.00 106.80 ? 23  ARG D CZ  1 
ATOM   4381  N NH1 . ARG D  1 23  ? -15.591  -40.450 -29.500  1.00 104.32 ? 23  ARG D NH1 1 
ATOM   4382  N NH2 . ARG D  1 23  ? -13.933  -41.648 -30.473  1.00 109.70 ? 23  ARG D NH2 1 
ATOM   4383  N N   . LEU D  1 24  ? -17.232  -36.404 -28.332  1.00 94.96  ? 24  LEU D N   1 
ATOM   4384  C CA  . LEU D  1 24  ? -16.853  -36.584 -26.938  1.00 94.45  ? 24  LEU D CA  1 
ATOM   4385  C C   . LEU D  1 24  ? -17.995  -37.078 -26.081  1.00 94.56  ? 24  LEU D C   1 
ATOM   4386  O O   . LEU D  1 24  ? -17.769  -37.686 -25.043  1.00 95.42  ? 24  LEU D O   1 
ATOM   4387  C CB  . LEU D  1 24  ? -16.305  -35.290 -26.354  1.00 92.84  ? 24  LEU D CB  1 
ATOM   4388  C CG  . LEU D  1 24  ? -14.792  -35.118 -26.258  1.00 93.76  ? 24  LEU D CG  1 
ATOM   4389  C CD1 . LEU D  1 24  ? -14.059  -35.532 -27.521  1.00 95.14  ? 24  LEU D CD1 1 
ATOM   4390  C CD2 . LEU D  1 24  ? -14.490  -33.664 -25.950  1.00 92.57  ? 24  LEU D CD2 1 
ATOM   4391  N N   . LEU D  1 25  ? -19.225  -36.798 -26.497  1.00 94.31  ? 25  LEU D N   1 
ATOM   4392  C CA  . LEU D  1 25  ? -20.376  -37.237 -25.730  1.00 94.90  ? 25  LEU D CA  1 
ATOM   4393  C C   . LEU D  1 25  ? -20.516  -38.762 -25.831  1.00 97.45  ? 25  LEU D C   1 
ATOM   4394  O O   . LEU D  1 25  ? -20.962  -39.442 -24.885  1.00 98.47  ? 25  LEU D O   1 
ATOM   4395  C CB  . LEU D  1 25  ? -21.628  -36.542 -26.220  1.00 94.93  ? 25  LEU D CB  1 
ATOM   4396  C CG  . LEU D  1 25  ? -22.888  -36.914 -25.471  1.00 96.08  ? 25  LEU D CG  1 
ATOM   4397  C CD1 . LEU D  1 25  ? -22.759  -36.545 -24.007  1.00 94.98  ? 25  LEU D CD1 1 
ATOM   4398  C CD2 . LEU D  1 25  ? -24.084  -36.244 -26.127  1.00 97.15  ? 25  LEU D CD2 1 
ATOM   4399  N N   . LYS D  1 26  ? -20.115  -39.282 -26.990  1.00 99.01  ? 26  LYS D N   1 
ATOM   4400  C CA  . LYS D  1 26  ? -20.055  -40.706 -27.251  1.00 102.13 ? 26  LYS D CA  1 
ATOM   4401  C C   . LYS D  1 26  ? -19.176  -41.426 -26.228  1.00 102.83 ? 26  LYS D C   1 
ATOM   4402  O O   . LYS D  1 26  ? -19.442  -42.576 -25.925  1.00 105.46 ? 26  LYS D O   1 
ATOM   4403  C CB  . LYS D  1 26  ? -19.507  -40.936 -28.647  1.00 104.00 ? 26  LYS D CB  1 
ATOM   4404  C CG  . LYS D  1 26  ? -19.997  -42.198 -29.311  1.00 108.22 ? 26  LYS D CG  1 
ATOM   4405  C CD  . LYS D  1 26  ? -19.316  -42.341 -30.656  1.00 110.59 ? 26  LYS D CD  1 
ATOM   4406  C CE  . LYS D  1 26  ? -19.743  -43.595 -31.393  1.00 115.80 ? 26  LYS D CE  1 
ATOM   4407  N NZ  . LYS D  1 26  ? -19.142  -44.790 -30.775  1.00 117.83 ? 26  LYS D NZ  1 
ATOM   4408  N N   . ASP D  1 27  ? -18.151  -40.742 -25.707  1.00 101.18 ? 27  ASP D N   1 
ATOM   4409  C CA  . ASP D  1 27  ? -17.296  -41.246 -24.615  1.00 102.58 ? 27  ASP D CA  1 
ATOM   4410  C C   . ASP D  1 27  ? -17.734  -40.789 -23.236  1.00 101.67 ? 27  ASP D C   1 
ATOM   4411  O O   . ASP D  1 27  ? -16.917  -40.787 -22.315  1.00 102.87 ? 27  ASP D O   1 
ATOM   4412  C CB  . ASP D  1 27  ? -15.844  -40.815 -24.807  1.00 102.72 ? 27  ASP D CB  1 
ATOM   4413  C CG  . ASP D  1 27  ? -15.224  -41.403 -26.049  1.00 104.67 ? 27  ASP D CG  1 
ATOM   4414  O OD1 . ASP D  1 27  ? -14.044  -41.083 -26.346  1.00 105.28 ? 27  ASP D OD1 1 
ATOM   4415  O OD2 . ASP D  1 27  ? -15.909  -42.193 -26.738  1.00 106.22 ? 27  ASP D OD2 1 
ATOM   4416  N N   . ARG D  1 28  ? -19.004  -40.388 -23.105  1.00 100.29 ? 28  ARG D N   1 
ATOM   4417  C CA  . ARG D  1 28  ? -19.587  -39.937 -21.828  1.00 99.93  ? 28  ARG D CA  1 
ATOM   4418  C C   . ARG D  1 28  ? -18.952  -38.639 -21.260  1.00 98.36  ? 28  ARG D C   1 
ATOM   4419  O O   . ARG D  1 28  ? -18.958  -38.394 -20.043  1.00 99.37  ? 28  ARG D O   1 
ATOM   4420  C CB  . ARG D  1 28  ? -19.585  -41.088 -20.801  1.00 103.08 ? 28  ARG D CB  1 
ATOM   4421  C CG  . ARG D  1 28  ? -20.270  -42.344 -21.305  1.00 105.23 ? 28  ARG D CG  1 
ATOM   4422  C CD  . ARG D  1 28  ? -20.236  -43.462 -20.286  1.00 108.82 ? 28  ARG D CD  1 
ATOM   4423  N NE  . ARG D  1 28  ? -21.139  -43.267 -19.169  1.00 109.32 ? 28  ARG D NE  1 
ATOM   4424  C CZ  . ARG D  1 28  ? -22.456  -43.404 -19.244  1.00 109.51 ? 28  ARG D CZ  1 
ATOM   4425  N NH1 . ARG D  1 28  ? -23.035  -43.718 -20.392  1.00 109.43 ? 28  ARG D NH1 1 
ATOM   4426  N NH2 . ARG D  1 28  ? -23.204  -43.208 -18.172  1.00 110.45 ? 28  ARG D NH2 1 
ATOM   4427  N N   . ILE D  1 29  ? -18.415  -37.814 -22.155  1.00 96.52  ? 29  ILE D N   1 
ATOM   4428  C CA  . ILE D  1 29  ? -17.872  -36.523 -21.766  1.00 95.39  ? 29  ILE D CA  1 
ATOM   4429  C C   . ILE D  1 29  ? -18.845  -35.367 -22.080  1.00 93.34  ? 29  ILE D C   1 
ATOM   4430  O O   . ILE D  1 29  ? -19.393  -35.252 -23.186  1.00 92.38  ? 29  ILE D O   1 
ATOM   4431  C CB  . ILE D  1 29  ? -16.490  -36.277 -22.391  1.00 95.53  ? 29  ILE D CB  1 
ATOM   4432  C CG1 . ILE D  1 29  ? -15.453  -37.275 -21.826  1.00 98.62  ? 29  ILE D CG1 1 
ATOM   4433  C CG2 . ILE D  1 29  ? -16.044  -34.842 -22.144  1.00 94.61  ? 29  ILE D CG2 1 
ATOM   4434  C CD1 . ILE D  1 29  ? -14.178  -37.350 -22.645  1.00 99.57  ? 29  ILE D CD1 1 
ATOM   4435  N N   . ILE D  1 30  ? -19.095  -34.526 -21.084  1.00 81.30  ? 30  ILE D N   1 
ATOM   4436  C CA  . ILE D  1 30  ? -19.871  -33.312 -21.300  1.00 79.82  ? 30  ILE D CA  1 
ATOM   4437  C C   . ILE D  1 30  ? -19.007  -32.064 -21.072  1.00 79.77  ? 30  ILE D C   1 
ATOM   4438  O O   . ILE D  1 30  ? -18.348  -31.934 -20.033  1.00 79.94  ? 30  ILE D O   1 
ATOM   4439  C CB  . ILE D  1 30  ? -21.106  -33.263 -20.381  1.00 78.39  ? 30  ILE D CB  1 
ATOM   4440  C CG1 . ILE D  1 30  ? -22.035  -34.447 -20.671  1.00 78.59  ? 30  ILE D CG1 1 
ATOM   4441  C CG2 . ILE D  1 30  ? -21.837  -31.945 -20.560  1.00 77.07  ? 30  ILE D CG2 1 
ATOM   4442  C CD1 . ILE D  1 30  ? -23.079  -34.647 -19.602  1.00 77.70  ? 30  ILE D CD1 1 
ATOM   4443  N N   . MET D  1 31  ? -18.998  -31.157 -22.045  1.00 79.76  ? 31  MET D N   1 
ATOM   4444  C CA  . MET D  1 31  ? -18.319  -29.857 -21.884  1.00 79.79  ? 31  MET D CA  1 
ATOM   4445  C C   . MET D  1 31  ? -19.269  -28.754 -21.414  1.00 78.25  ? 31  MET D C   1 
ATOM   4446  O O   . MET D  1 31  ? -20.311  -28.521 -22.024  1.00 77.58  ? 31  MET D O   1 
ATOM   4447  C CB  . MET D  1 31  ? -17.621  -29.438 -23.166  1.00 81.12  ? 31  MET D CB  1 
ATOM   4448  C CG  . MET D  1 31  ? -16.739  -30.540 -23.745  1.00 82.85  ? 31  MET D CG  1 
ATOM   4449  S SD  . MET D  1 31  ? -15.330  -31.002 -22.669  1.00 84.00  ? 31  MET D SD  1 
ATOM   4450  C CE  . MET D  1 31  ? -14.356  -29.486 -22.642  1.00 84.59  ? 31  MET D CE  1 
ATOM   4451  N N   . LEU D  1 32  ? -18.938  -28.132 -20.291  1.00 77.85  ? 32  LEU D N   1 
ATOM   4452  C CA  . LEU D  1 32  ? -19.600  -26.907 -19.875  1.00 76.78  ? 32  LEU D CA  1 
ATOM   4453  C C   . LEU D  1 32  ? -18.614  -25.742 -20.059  1.00 77.62  ? 32  LEU D C   1 
ATOM   4454  O O   . LEU D  1 32  ? -17.655  -25.590 -19.282  1.00 78.21  ? 32  LEU D O   1 
ATOM   4455  C CB  . LEU D  1 32  ? -20.083  -27.022 -18.430  1.00 75.85  ? 32  LEU D CB  1 
ATOM   4456  C CG  . LEU D  1 32  ? -20.695  -25.757 -17.804  1.00 74.93  ? 32  LEU D CG  1 
ATOM   4457  C CD1 . LEU D  1 32  ? -21.764  -25.145 -18.698  1.00 74.31  ? 32  LEU D CD1 1 
ATOM   4458  C CD2 . LEU D  1 32  ? -21.268  -26.005 -16.414  1.00 74.21  ? 32  LEU D CD2 1 
ATOM   4459  N N   . GLY D  1 33  ? -18.814  -24.959 -21.113  1.00 77.92  ? 33  GLY D N   1 
ATOM   4460  C CA  . GLY D  1 33  ? -17.800  -24.005 -21.515  1.00 79.18  ? 33  GLY D CA  1 
ATOM   4461  C C   . GLY D  1 33  ? -18.317  -22.591 -21.497  1.00 78.82  ? 33  GLY D C   1 
ATOM   4462  O O   . GLY D  1 33  ? -17.688  -21.684 -21.996  1.00 79.98  ? 33  GLY D O   1 
ATOM   4463  N N   . SER D  1 34  ? -19.470  -22.386 -20.900  1.00 77.39  ? 34  SER D N   1 
ATOM   4464  C CA  . SER D  1 34  ? -20.126  -21.089 -21.032  1.00 77.19  ? 34  SER D CA  1 
ATOM   4465  C C   . SER D  1 34  ? -20.843  -20.664 -19.733  1.00 75.96  ? 34  SER D C   1 
ATOM   4466  O O   . SER D  1 34  ? -20.896  -21.439 -18.773  1.00 75.26  ? 34  SER D O   1 
ATOM   4467  C CB  . SER D  1 34  ? -21.124  -21.167 -22.195  1.00 77.11  ? 34  SER D CB  1 
ATOM   4468  O OG  . SER D  1 34  ? -22.225  -22.004 -21.834  1.00 75.80  ? 34  SER D OG  1 
ATOM   4469  N N   . GLN D  1 35  ? -21.405  -19.455 -19.703  1.00 75.91  ? 35  GLN D N   1 
ATOM   4470  C CA  . GLN D  1 35  ? -22.262  -19.093 -18.578  1.00 74.85  ? 35  GLN D CA  1 
ATOM   4471  C C   . GLN D  1 35  ? -23.477  -20.018 -18.524  1.00 73.69  ? 35  GLN D C   1 
ATOM   4472  O O   . GLN D  1 35  ? -23.858  -20.611 -19.546  1.00 73.75  ? 35  GLN D O   1 
ATOM   4473  C CB  . GLN D  1 35  ? -22.688  -17.620 -18.628  1.00 75.23  ? 35  GLN D CB  1 
ATOM   4474  C CG  . GLN D  1 35  ? -23.895  -17.294 -19.538  1.00 75.11  ? 35  GLN D CG  1 
ATOM   4475  C CD  . GLN D  1 35  ? -23.789  -17.867 -20.984  1.00 75.76  ? 35  GLN D CD  1 
ATOM   4476  O OE1 . GLN D  1 35  ? -22.774  -17.629 -21.707  1.00 77.05  ? 35  GLN D OE1 1 
ATOM   4477  N NE2 . GLN D  1 35  ? -24.825  -18.637 -21.410  1.00 75.05  ? 35  GLN D NE2 1 
ATOM   4478  N N   . ILE D  1 36  ? -24.073  -20.141 -17.340  1.00 72.84  ? 36  ILE D N   1 
ATOM   4479  C CA  . ILE D  1 36  ? -25.147  -21.115 -17.116  1.00 71.95  ? 36  ILE D CA  1 
ATOM   4480  C C   . ILE D  1 36  ? -26.462  -20.410 -17.180  1.00 71.52  ? 36  ILE D C   1 
ATOM   4481  O O   . ILE D  1 36  ? -26.719  -19.533 -16.349  1.00 71.45  ? 36  ILE D O   1 
ATOM   4482  C CB  . ILE D  1 36  ? -25.037  -21.749 -15.714  1.00 71.57  ? 36  ILE D CB  1 
ATOM   4483  C CG1 . ILE D  1 36  ? -23.773  -22.584 -15.608  1.00 72.17  ? 36  ILE D CG1 1 
ATOM   4484  C CG2 . ILE D  1 36  ? -26.245  -22.614 -15.408  1.00 70.88  ? 36  ILE D CG2 1 
ATOM   4485  C CD1 . ILE D  1 36  ? -23.323  -22.784 -14.185  1.00 72.31  ? 36  ILE D CD1 1 
ATOM   4486  N N   . ASP D  1 37  ? -27.293  -20.770 -18.149  1.00 71.43  ? 37  ASP D N   1 
ATOM   4487  C CA  . ASP D  1 37  ? -28.648  -20.205 -18.235  1.00 71.18  ? 37  ASP D CA  1 
ATOM   4488  C C   . ASP D  1 37  ? -29.576  -21.333 -18.619  1.00 70.79  ? 37  ASP D C   1 
ATOM   4489  O O   . ASP D  1 37  ? -29.138  -22.456 -18.820  1.00 70.76  ? 37  ASP D O   1 
ATOM   4490  C CB  . ASP D  1 37  ? -28.735  -19.063 -19.252  1.00 72.00  ? 37  ASP D CB  1 
ATOM   4491  C CG  . ASP D  1 37  ? -28.337  -19.506 -20.652  1.00 72.68  ? 37  ASP D CG  1 
ATOM   4492  O OD1 . ASP D  1 37  ? -27.703  -18.701 -21.364  1.00 73.69  ? 37  ASP D OD1 1 
ATOM   4493  O OD2 . ASP D  1 37  ? -28.640  -20.672 -21.041  1.00 72.39  ? 37  ASP D OD2 1 
ATOM   4494  N N   . ASP D  1 38  ? -30.852  -21.014 -18.778  1.00 70.71  ? 38  ASP D N   1 
ATOM   4495  C CA  . ASP D  1 38  ? -31.869  -22.025 -19.051  1.00 70.48  ? 38  ASP D CA  1 
ATOM   4496  C C   . ASP D  1 38  ? -31.617  -22.902 -20.266  1.00 70.89  ? 38  ASP D C   1 
ATOM   4497  O O   . ASP D  1 38  ? -31.944  -24.069 -20.223  1.00 70.72  ? 38  ASP D O   1 
ATOM   4498  C CB  . ASP D  1 38  ? -33.260  -21.392 -19.131  1.00 70.62  ? 38  ASP D CB  1 
ATOM   4499  C CG  . ASP D  1 38  ? -33.877  -21.111 -17.728  1.00 70.23  ? 38  ASP D CG  1 
ATOM   4500  O OD1 . ASP D  1 38  ? -35.114  -20.852 -17.643  1.00 70.40  ? 38  ASP D OD1 1 
ATOM   4501  O OD2 . ASP D  1 38  ? -33.126  -21.161 -16.699  1.00 69.91  ? 38  ASP D OD2 1 
ATOM   4502  N N   . ASN D  1 39  ? -31.045  -22.349 -21.332  1.00 71.60  ? 39  ASN D N   1 
ATOM   4503  C CA  . ASN D  1 39  ? -30.617  -23.153 -22.474  1.00 72.21  ? 39  ASN D CA  1 
ATOM   4504  C C   . ASN D  1 39  ? -29.505  -24.106 -22.157  1.00 72.13  ? 39  ASN D C   1 
ATOM   4505  O O   . ASN D  1 39  ? -29.612  -25.296 -22.462  1.00 72.24  ? 39  ASN D O   1 
ATOM   4506  C CB  . ASN D  1 39  ? -30.116  -22.282 -23.587  1.00 73.27  ? 39  ASN D CB  1 
ATOM   4507  C CG  . ASN D  1 39  ? -31.207  -21.842 -24.447  1.00 73.88  ? 39  ASN D CG  1 
ATOM   4508  O OD1 . ASN D  1 39  ? -32.379  -22.037 -24.119  1.00 73.44  ? 39  ASN D OD1 1 
ATOM   4509  N ND2 . ASN D  1 39  ? -30.861  -21.244 -25.564  1.00 75.11  ? 39  ASN D ND2 1 
ATOM   4510  N N   . VAL D  1 40  ? -28.430  -23.569 -21.579  1.00 72.14  ? 40  VAL D N   1 
ATOM   4511  C CA  . VAL D  1 40  ? -27.283  -24.368 -21.226  1.00 72.29  ? 40  VAL D CA  1 
ATOM   4512  C C   . VAL D  1 40  ? -27.723  -25.497 -20.284  1.00 71.67  ? 40  VAL D C   1 
ATOM   4513  O O   . VAL D  1 40  ? -27.379  -26.673 -20.504  1.00 72.02  ? 40  VAL D O   1 
ATOM   4514  C CB  . VAL D  1 40  ? -26.163  -23.500 -20.619  1.00 72.50  ? 40  VAL D CB  1 
ATOM   4515  C CG1 . VAL D  1 40  ? -25.075  -24.368 -20.020  1.00 72.70  ? 40  VAL D CG1 1 
ATOM   4516  C CG2 . VAL D  1 40  ? -25.587  -22.591 -21.682  1.00 73.51  ? 40  VAL D CG2 1 
ATOM   4517  N N   . ALA D  1 41  ? -28.536  -25.150 -19.288  1.00 70.98  ? 41  ALA D N   1 
ATOM   4518  C CA  . ALA D  1 41  ? -29.004  -26.140 -18.343  1.00 70.65  ? 41  ALA D CA  1 
ATOM   4519  C C   . ALA D  1 41  ? -29.828  -27.188 -19.052  1.00 70.84  ? 41  ALA D C   1 
ATOM   4520  O O   . ALA D  1 41  ? -29.634  -28.379 -18.861  1.00 71.14  ? 41  ALA D O   1 
ATOM   4521  C CB  . ALA D  1 41  ? -29.800  -25.494 -17.232  1.00 70.12  ? 41  ALA D CB  1 
ATOM   4522  N N   . ASN D  1 42  ? -30.722  -26.750 -19.900  1.00 70.88  ? 42  ASN D N   1 
ATOM   4523  C CA  . ASN D  1 42  ? -31.566  -27.674 -20.602  1.00 71.21  ? 42  ASN D CA  1 
ATOM   4524  C C   . ASN D  1 42  ? -30.792  -28.678 -21.451  1.00 71.93  ? 42  ASN D C   1 
ATOM   4525  O O   . ASN D  1 42  ? -31.209  -29.818 -21.599  1.00 72.30  ? 42  ASN D O   1 
ATOM   4526  C CB  . ASN D  1 42  ? -32.526  -26.882 -21.492  1.00 71.40  ? 42  ASN D CB  1 
ATOM   4527  C CG  . ASN D  1 42  ? -33.758  -27.666 -21.846  1.00 71.69  ? 42  ASN D CG  1 
ATOM   4528  O OD1 . ASN D  1 42  ? -34.135  -27.733 -23.015  1.00 72.35  ? 42  ASN D OD1 1 
ATOM   4529  N ND2 . ASN D  1 42  ? -34.381  -28.307 -20.834  1.00 71.42  ? 42  ASN D ND2 1 
ATOM   4530  N N   . SER D  1 43  ? -29.674  -28.235 -22.020  1.00 72.32  ? 43  SER D N   1 
ATOM   4531  C CA  . SER D  1 43  ? -28.772  -29.082 -22.770  1.00 73.19  ? 43  SER D CA  1 
ATOM   4532  C C   . SER D  1 43  ? -27.995  -30.028 -21.841  1.00 73.28  ? 43  SER D C   1 
ATOM   4533  O O   . SER D  1 43  ? -27.938  -31.230 -22.070  1.00 73.92  ? 43  SER D O   1 
ATOM   4534  C CB  . SER D  1 43  ? -27.811  -28.211 -23.555  1.00 73.78  ? 43  SER D CB  1 
ATOM   4535  O OG  . SER D  1 43  ? -27.085  -28.965 -24.503  1.00 74.88  ? 43  SER D OG  1 
ATOM   4536  N N   . ILE D  1 44  ? -27.409  -29.503 -20.781  1.00 72.84  ? 44  ILE D N   1 
ATOM   4537  C CA  . ILE D  1 44  ? -26.589  -30.341 -19.916  1.00 73.20  ? 44  ILE D CA  1 
ATOM   4538  C C   . ILE D  1 44  ? -27.462  -31.432 -19.309  1.00 73.20  ? 44  ILE D C   1 
ATOM   4539  O O   . ILE D  1 44  ? -27.077  -32.605 -19.297  1.00 74.02  ? 44  ILE D O   1 
ATOM   4540  C CB  . ILE D  1 44  ? -25.906  -29.563 -18.772  1.00 72.85  ? 44  ILE D CB  1 
ATOM   4541  C CG1 . ILE D  1 44  ? -24.976  -28.449 -19.268  1.00 73.07  ? 44  ILE D CG1 1 
ATOM   4542  C CG2 . ILE D  1 44  ? -25.145  -30.498 -17.863  1.00 73.46  ? 44  ILE D CG2 1 
ATOM   4543  C CD1 . ILE D  1 44  ? -23.771  -28.869 -20.079  1.00 74.19  ? 44  ILE D CD1 1 
ATOM   4544  N N   . VAL D  1 45  ? -28.636  -31.044 -18.814  1.00 72.48  ? 45  VAL D N   1 
ATOM   4545  C CA  . VAL D  1 45  ? -29.620  -32.000 -18.269  1.00 72.65  ? 45  VAL D CA  1 
ATOM   4546  C C   . VAL D  1 45  ? -29.967  -33.094 -19.298  1.00 73.44  ? 45  VAL D C   1 
ATOM   4547  O O   . VAL D  1 45  ? -29.870  -34.288 -19.036  1.00 74.26  ? 45  VAL D O   1 
ATOM   4548  C CB  . VAL D  1 45  ? -30.898  -31.301 -17.781  1.00 71.95  ? 45  VAL D CB  1 
ATOM   4549  C CG1 . VAL D  1 45  ? -31.974  -32.317 -17.511  1.00 72.41  ? 45  VAL D CG1 1 
ATOM   4550  C CG2 . VAL D  1 45  ? -30.621  -30.525 -16.506  1.00 71.48  ? 45  VAL D CG2 1 
ATOM   4551  N N   . SER D  1 46  ? -30.330  -32.691 -20.492  1.00 73.42  ? 46  SER D N   1 
ATOM   4552  C CA  . SER D  1 46  ? -30.580  -33.667 -21.529  1.00 74.34  ? 46  SER D CA  1 
ATOM   4553  C C   . SER D  1 46  ? -29.420  -34.632 -21.764  1.00 75.35  ? 46  SER D C   1 
ATOM   4554  O O   . SER D  1 46  ? -29.628  -35.815 -21.961  1.00 76.29  ? 46  SER D O   1 
ATOM   4555  C CB  . SER D  1 46  ? -30.945  -32.957 -22.817  1.00 74.38  ? 46  SER D CB  1 
ATOM   4556  O OG  . SER D  1 46  ? -32.175  -32.313 -22.606  1.00 73.77  ? 46  SER D OG  1 
ATOM   4557  N N   . GLN D  1 47  ? -28.199  -34.118 -21.763  1.00 75.36  ? 47  GLN D N   1 
ATOM   4558  C CA  . GLN D  1 47  ? -27.053  -34.971 -21.968  1.00 76.50  ? 47  GLN D CA  1 
ATOM   4559  C C   . GLN D  1 47  ? -26.910  -36.011 -20.839  1.00 77.01  ? 47  GLN D C   1 
ATOM   4560  O O   . GLN D  1 47  ? -26.699  -37.188 -21.100  1.00 78.24  ? 47  GLN D O   1 
ATOM   4561  C CB  . GLN D  1 47  ? -25.799  -34.122 -22.107  1.00 76.53  ? 47  GLN D CB  1 
ATOM   4562  C CG  . GLN D  1 47  ? -25.629  -33.547 -23.492  1.00 76.92  ? 47  GLN D CG  1 
ATOM   4563  C CD  . GLN D  1 47  ? -24.579  -32.465 -23.530  1.00 76.90  ? 47  GLN D CD  1 
ATOM   4564  O OE1 . GLN D  1 47  ? -23.384  -32.739 -23.626  1.00 77.87  ? 47  GLN D OE1 1 
ATOM   4565  N NE2 . GLN D  1 47  ? -25.028  -31.207 -23.446  1.00 75.98  ? 47  GLN D NE2 1 
ATOM   4566  N N   . LEU D  1 48  ? -27.042  -35.557 -19.594  1.00 76.27  ? 48  LEU D N   1 
ATOM   4567  C CA  . LEU D  1 48  ? -27.033  -36.431 -18.434  1.00 76.89  ? 48  LEU D CA  1 
ATOM   4568  C C   . LEU D  1 48  ? -28.110  -37.495 -18.538  1.00 77.53  ? 48  LEU D C   1 
ATOM   4569  O O   . LEU D  1 48  ? -27.781  -38.664 -18.382  1.00 78.87  ? 48  LEU D O   1 
ATOM   4570  C CB  . LEU D  1 48  ? -27.204  -35.648 -17.144  1.00 76.04  ? 48  LEU D CB  1 
ATOM   4571  C CG  . LEU D  1 48  ? -26.072  -34.688 -16.787  1.00 75.70  ? 48  LEU D CG  1 
ATOM   4572  C CD1 . LEU D  1 48  ? -26.479  -33.788 -15.635  1.00 74.83  ? 48  LEU D CD1 1 
ATOM   4573  C CD2 . LEU D  1 48  ? -24.800  -35.436 -16.434  1.00 76.99  ? 48  LEU D CD2 1 
ATOM   4574  N N   . LEU D  1 49  ? -29.365  -37.134 -18.823  1.00 76.82  ? 49  LEU D N   1 
ATOM   4575  C CA  . LEU D  1 49  ? -30.423  -38.136 -18.932  1.00 77.60  ? 49  LEU D CA  1 
ATOM   4576  C C   . LEU D  1 49  ? -30.132  -39.143 -20.025  1.00 78.87  ? 49  LEU D C   1 
ATOM   4577  O O   . LEU D  1 49  ? -30.357  -40.342 -19.842  1.00 80.18  ? 49  LEU D O   1 
ATOM   4578  C CB  . LEU D  1 49  ? -31.789  -37.504 -19.168  1.00 76.78  ? 49  LEU D CB  1 
ATOM   4579  C CG  . LEU D  1 49  ? -32.425  -36.713 -18.026  1.00 75.90  ? 49  LEU D CG  1 
ATOM   4580  C CD1 . LEU D  1 49  ? -33.773  -36.158 -18.457  1.00 75.39  ? 49  LEU D CD1 1 
ATOM   4581  C CD2 . LEU D  1 49  ? -32.581  -37.527 -16.763  1.00 76.75  ? 49  LEU D CD2 1 
ATOM   4582  N N   . PHE D  1 50  ? -29.630  -38.665 -21.155  1.00 78.69  ? 50  PHE D N   1 
ATOM   4583  C CA  . PHE D  1 50  ? -29.320  -39.530 -22.269  1.00 80.02  ? 50  PHE D CA  1 
ATOM   4584  C C   . PHE D  1 50  ? -28.203  -40.483 -21.883  1.00 81.34  ? 50  PHE D C   1 
ATOM   4585  O O   . PHE D  1 50  ? -28.283  -41.683 -22.165  1.00 82.85  ? 50  PHE D O   1 
ATOM   4586  C CB  . PHE D  1 50  ? -28.892  -38.717 -23.463  1.00 79.74  ? 50  PHE D CB  1 
ATOM   4587  C CG  . PHE D  1 50  ? -28.171  -39.502 -24.505  1.00 81.28  ? 50  PHE D CG  1 
ATOM   4588  C CD1 . PHE D  1 50  ? -28.864  -40.316 -25.378  1.00 82.37  ? 50  PHE D CD1 1 
ATOM   4589  C CD2 . PHE D  1 50  ? -26.801  -39.403 -24.635  1.00 81.81  ? 50  PHE D CD2 1 
ATOM   4590  C CE1 . PHE D  1 50  ? -28.199  -41.026 -26.356  1.00 83.97  ? 50  PHE D CE1 1 
ATOM   4591  C CE2 . PHE D  1 50  ? -26.130  -40.114 -25.605  1.00 83.43  ? 50  PHE D CE2 1 
ATOM   4592  C CZ  . PHE D  1 50  ? -26.828  -40.929 -26.464  1.00 84.51  ? 50  PHE D CZ  1 
ATOM   4593  N N   . LEU D  1 51  ? -27.159  -39.967 -21.243  1.00 80.98  ? 51  LEU D N   1 
ATOM   4594  C CA  . LEU D  1 51  ? -26.034  -40.812 -20.902  1.00 82.42  ? 51  LEU D CA  1 
ATOM   4595  C C   . LEU D  1 51  ? -26.412  -41.939 -19.934  1.00 83.53  ? 51  LEU D C   1 
ATOM   4596  O O   . LEU D  1 51  ? -25.845  -43.050 -20.000  1.00 85.33  ? 51  LEU D O   1 
ATOM   4597  C CB  . LEU D  1 51  ? -24.892  -39.992 -20.326  1.00 81.94  ? 51  LEU D CB  1 
ATOM   4598  C CG  . LEU D  1 51  ? -24.016  -39.277 -21.336  1.00 81.88  ? 51  LEU D CG  1 
ATOM   4599  C CD1 . LEU D  1 51  ? -22.862  -38.663 -20.574  1.00 81.79  ? 51  LEU D CD1 1 
ATOM   4600  C CD2 . LEU D  1 51  ? -23.502  -40.168 -22.450  1.00 83.57  ? 51  LEU D CD2 1 
ATOM   4601  N N   . GLN D  1 52  ? -27.359  -41.642 -19.042  1.00 82.67  ? 52  GLN D N   1 
ATOM   4602  C CA  . GLN D  1 52  ? -27.881  -42.629 -18.124  1.00 83.83  ? 52  GLN D CA  1 
ATOM   4603  C C   . GLN D  1 52  ? -28.654  -43.686 -18.862  1.00 85.06  ? 52  GLN D C   1 
ATOM   4604  O O   . GLN D  1 52  ? -28.426  -44.863 -18.642  1.00 86.94  ? 52  GLN D O   1 
ATOM   4605  C CB  . GLN D  1 52  ? -28.793  -41.998 -17.104  1.00 82.75  ? 52  GLN D CB  1 
ATOM   4606  C CG  . GLN D  1 52  ? -29.213  -42.992 -16.047  1.00 84.25  ? 52  GLN D CG  1 
ATOM   4607  C CD  . GLN D  1 52  ? -30.233  -42.434 -15.105  1.00 83.46  ? 52  GLN D CD  1 
ATOM   4608  O OE1 . GLN D  1 52  ? -31.165  -41.748 -15.536  1.00 82.21  ? 52  GLN D OE1 1 
ATOM   4609  N NE2 . GLN D  1 52  ? -30.075  -42.726 -13.815  1.00 84.39  ? 52  GLN D NE2 1 
ATOM   4610  N N   . ALA D  1 53  ? -29.566  -43.283 -19.734  1.00 84.23  ? 53  ALA D N   1 
ATOM   4611  C CA  . ALA D  1 53  ? -30.322  -44.241 -20.525  1.00 85.50  ? 53  ALA D CA  1 
ATOM   4612  C C   . ALA D  1 53  ? -29.414  -45.182 -21.358  1.00 87.24  ? 53  ALA D C   1 
ATOM   4613  O O   . ALA D  1 53  ? -29.786  -46.312 -21.678  1.00 88.97  ? 53  ALA D O   1 
ATOM   4614  C CB  . ALA D  1 53  ? -31.330  -43.514 -21.413  1.00 84.37  ? 53  ALA D CB  1 
ATOM   4615  N N   . GLN D  1 54  ? -28.223  -44.720 -21.700  1.00 86.97  ? 54  GLN D N   1 
ATOM   4616  C CA  . GLN D  1 54  ? -27.265  -45.530 -22.449  1.00 88.73  ? 54  GLN D CA  1 
ATOM   4617  C C   . GLN D  1 54  ? -26.644  -46.640 -21.605  1.00 90.63  ? 54  GLN D C   1 
ATOM   4618  O O   . GLN D  1 54  ? -26.456  -47.763 -22.055  1.00 92.69  ? 54  GLN D O   1 
ATOM   4619  C CB  . GLN D  1 54  ? -26.152  -44.631 -22.994  1.00 88.03  ? 54  GLN D CB  1 
ATOM   4620  C CG  . GLN D  1 54  ? -26.644  -43.680 -24.066  1.00 86.80  ? 54  GLN D CG  1 
ATOM   4621  C CD  . GLN D  1 54  ? -26.704  -44.345 -25.421  1.00 88.30  ? 54  GLN D CD  1 
ATOM   4622  O OE1 . GLN D  1 54  ? -25.680  -44.446 -26.103  1.00 89.32  ? 54  GLN D OE1 1 
ATOM   4623  N NE2 . GLN D  1 54  ? -27.899  -44.806 -25.823  1.00 88.63  ? 54  GLN D NE2 1 
ATOM   4624  N N   . ASP D  1 55  ? -26.310  -46.288 -20.376  1.00 90.09  ? 55  ASP D N   1 
ATOM   4625  C CA  . ASP D  1 55  ? -25.547  -47.137 -19.482  1.00 91.90  ? 55  ASP D CA  1 
ATOM   4626  C C   . ASP D  1 55  ? -25.616  -46.471 -18.114  1.00 90.82  ? 55  ASP D C   1 
ATOM   4627  O O   . ASP D  1 55  ? -25.064  -45.386 -17.926  1.00 89.33  ? 55  ASP D O   1 
ATOM   4628  C CB  . ASP D  1 55  ? -24.074  -47.247 -19.940  1.00 92.94  ? 55  ASP D CB  1 
ATOM   4629  C CG  . ASP D  1 55  ? -23.270  -48.224 -19.080  1.00 95.24  ? 55  ASP D CG  1 
ATOM   4630  O OD1 . ASP D  1 55  ? -23.305  -48.068 -17.831  1.00 95.07  ? 55  ASP D OD1 1 
ATOM   4631  O OD2 . ASP D  1 55  ? -22.623  -49.162 -19.638  1.00 97.41  ? 55  ASP D OD2 1 
ATOM   4632  N N   . SER D  1 56  ? -26.277  -47.114 -17.158  1.00 91.78  ? 56  SER D N   1 
ATOM   4633  C CA  . SER D  1 56  ? -26.441  -46.498 -15.857  1.00 90.96  ? 56  SER D CA  1 
ATOM   4634  C C   . SER D  1 56  ? -25.313  -46.806 -14.869  1.00 92.39  ? 56  SER D C   1 
ATOM   4635  O O   . SER D  1 56  ? -25.359  -46.356 -13.726  1.00 92.05  ? 56  SER D O   1 
ATOM   4636  C CB  . SER D  1 56  ? -27.814  -46.841 -15.277  1.00 91.21  ? 56  SER D CB  1 
ATOM   4637  O OG  . SER D  1 56  ? -28.073  -48.238 -15.360  1.00 93.66  ? 56  SER D OG  1 
ATOM   4638  N N   . GLU D  1 57  ? -24.300  -47.543 -15.314  1.00 94.14  ? 57  GLU D N   1 
ATOM   4639  C CA  . GLU D  1 57  ? -23.172  -47.886 -14.465  1.00 95.82  ? 57  GLU D CA  1 
ATOM   4640  C C   . GLU D  1 57  ? -21.966  -46.989 -14.758  1.00 94.89  ? 57  GLU D C   1 
ATOM   4641  O O   . GLU D  1 57  ? -21.388  -46.398 -13.842  1.00 94.63  ? 57  GLU D O   1 
ATOM   4642  C CB  . GLU D  1 57  ? -22.754  -49.338 -14.686  1.00 98.83  ? 57  GLU D CB  1 
ATOM   4643  C CG  . GLU D  1 57  ? -23.837  -50.242 -15.240  1.00 99.72  ? 57  GLU D CG  1 
ATOM   4644  C CD  . GLU D  1 57  ? -24.593  -50.983 -14.141  1.00 101.33 ? 57  GLU D CD  1 
ATOM   4645  O OE1 . GLU D  1 57  ? -25.603  -50.379 -13.659  1.00 99.77  ? 57  GLU D OE1 1 
ATOM   4646  O OE2 . GLU D  1 57  ? -24.182  -52.136 -13.766  1.00 104.29 ? 57  GLU D OE2 1 
ATOM   4647  N N   . LYS D  1 58  ? -21.576  -46.898 -16.032  1.00 94.60  ? 58  LYS D N   1 
ATOM   4648  C CA  . LYS D  1 58  ? -20.310  -46.275 -16.391  1.00 94.45  ? 58  LYS D CA  1 
ATOM   4649  C C   . LYS D  1 58  ? -20.398  -44.818 -16.058  1.00 92.00  ? 58  LYS D C   1 
ATOM   4650  O O   . LYS D  1 58  ? -21.366  -44.149 -16.438  1.00 90.05  ? 58  LYS D O   1 
ATOM   4651  C CB  . LYS D  1 58  ? -19.971  -46.500 -17.862  1.00 94.88  ? 58  LYS D CB  1 
ATOM   4652  C CG  . LYS D  1 58  ? -19.124  -47.750 -18.072  1.00 97.85  ? 58  LYS D CG  1 
ATOM   4653  C CD  . LYS D  1 58  ? -18.573  -47.853 -19.483  1.00 98.49  ? 58  LYS D CD  1 
ATOM   4654  C CE  . LYS D  1 58  ? -19.664  -48.241 -20.472  1.00 98.16  ? 58  LYS D CE  1 
ATOM   4655  N NZ  . LYS D  1 58  ? -19.087  -48.798 -21.722  1.00 99.85  ? 58  LYS D NZ  1 
ATOM   4656  N N   . ASP D  1 59  ? -19.424  -44.311 -15.313  1.00 92.22  ? 59  ASP D N   1 
ATOM   4657  C CA  . ASP D  1 59  ? -19.604  -42.939 -14.869  1.00 90.04  ? 59  ASP D CA  1 
ATOM   4658  C C   . ASP D  1 59  ? -19.287  -41.864 -15.948  1.00 88.52  ? 59  ASP D C   1 
ATOM   4659  O O   . ASP D  1 59  ? -18.784  -42.198 -17.026  1.00 89.32  ? 59  ASP D O   1 
ATOM   4660  C CB  . ASP D  1 59  ? -19.040  -42.690 -13.463  1.00 90.65  ? 59  ASP D CB  1 
ATOM   4661  C CG  . ASP D  1 59  ? -17.587  -43.016 -13.340  1.00 92.62  ? 59  ASP D CG  1 
ATOM   4662  O OD1 . ASP D  1 59  ? -16.866  -42.835 -14.353  1.00 92.74  ? 59  ASP D OD1 1 
ATOM   4663  O OD2 . ASP D  1 59  ? -17.172  -43.401 -12.218  1.00 94.15  ? 59  ASP D OD2 1 
ATOM   4664  N N   . ILE D  1 60  ? -19.670  -40.611 -15.663  1.00 86.51  ? 60  ILE D N   1 
ATOM   4665  C CA  . ILE D  1 60  ? -19.728  -39.510 -16.627  1.00 84.94  ? 60  ILE D CA  1 
ATOM   4666  C C   . ILE D  1 60  ? -18.687  -38.422 -16.300  1.00 84.65  ? 60  ILE D C   1 
ATOM   4667  O O   . ILE D  1 60  ? -18.421  -38.144 -15.127  1.00 84.73  ? 60  ILE D O   1 
ATOM   4668  C CB  . ILE D  1 60  ? -21.133  -38.881 -16.600  1.00 83.01  ? 60  ILE D CB  1 
ATOM   4669  C CG1 . ILE D  1 60  ? -22.149  -39.863 -17.178  1.00 83.37  ? 60  ILE D CG1 1 
ATOM   4670  C CG2 . ILE D  1 60  ? -21.156  -37.553 -17.357  1.00 81.50  ? 60  ILE D CG2 1 
ATOM   4671  C CD1 . ILE D  1 60  ? -23.579  -39.574 -16.783  1.00 82.06  ? 60  ILE D CD1 1 
ATOM   4672  N N   . TYR D  1 61  ? -18.114  -37.805 -17.331  1.00 84.50  ? 61  TYR D N   1 
ATOM   4673  C CA  . TYR D  1 61  ? -17.138  -36.750 -17.126  1.00 84.42  ? 61  TYR D CA  1 
ATOM   4674  C C   . TYR D  1 61  ? -17.656  -35.349 -17.493  1.00 82.58  ? 61  TYR D C   1 
ATOM   4675  O O   . TYR D  1 61  ? -17.950  -35.069 -18.666  1.00 82.19  ? 61  TYR D O   1 
ATOM   4676  C CB  . TYR D  1 61  ? -15.883  -37.089 -17.910  1.00 86.19  ? 61  TYR D CB  1 
ATOM   4677  C CG  . TYR D  1 61  ? -15.362  -38.444 -17.556  1.00 88.22  ? 61  TYR D CG  1 
ATOM   4678  C CD1 . TYR D  1 61  ? -15.838  -39.566 -18.204  1.00 89.00  ? 61  TYR D CD1 1 
ATOM   4679  C CD2 . TYR D  1 61  ? -14.407  -38.608 -16.549  1.00 89.57  ? 61  TYR D CD2 1 
ATOM   4680  C CE1 . TYR D  1 61  ? -15.366  -40.819 -17.882  1.00 91.10  ? 61  TYR D CE1 1 
ATOM   4681  C CE2 . TYR D  1 61  ? -13.930  -39.861 -16.210  1.00 91.71  ? 61  TYR D CE2 1 
ATOM   4682  C CZ  . TYR D  1 61  ? -14.422  -40.973 -16.879  1.00 92.48  ? 61  TYR D CZ  1 
ATOM   4683  O OH  . TYR D  1 61  ? -13.976  -42.264 -16.559  1.00 94.85  ? 61  TYR D OH  1 
ATOM   4684  N N   . LEU D  1 62  ? -17.763  -34.479 -16.489  1.00 81.67  ? 62  LEU D N   1 
ATOM   4685  C CA  . LEU D  1 62  ? -18.240  -33.106 -16.705  1.00 80.13  ? 62  LEU D CA  1 
ATOM   4686  C C   . LEU D  1 62  ? -17.120  -32.082 -16.554  1.00 80.56  ? 62  LEU D C   1 
ATOM   4687  O O   . LEU D  1 62  ? -16.721  -31.745 -15.446  1.00 80.72  ? 62  LEU D O   1 
ATOM   4688  C CB  . LEU D  1 62  ? -19.402  -32.767 -15.749  1.00 78.77  ? 62  LEU D CB  1 
ATOM   4689  C CG  . LEU D  1 62  ? -20.065  -31.394 -15.845  1.00 77.27  ? 62  LEU D CG  1 
ATOM   4690  C CD1 . LEU D  1 62  ? -20.643  -31.199 -17.233  1.00 76.77  ? 62  LEU D CD1 1 
ATOM   4691  C CD2 . LEU D  1 62  ? -21.128  -31.230 -14.772  1.00 76.33  ? 62  LEU D CD2 1 
ATOM   4692  N N   . TYR D  1 63  ? -16.603  -31.601 -17.674  1.00 80.95  ? 63  TYR D N   1 
ATOM   4693  C CA  . TYR D  1 63  ? -15.592  -30.562 -17.631  1.00 81.51  ? 63  TYR D CA  1 
ATOM   4694  C C   . TYR D  1 63  ? -16.281  -29.213 -17.449  1.00 80.06  ? 63  TYR D C   1 
ATOM   4695  O O   . TYR D  1 63  ? -17.295  -28.933 -18.102  1.00 79.00  ? 63  TYR D O   1 
ATOM   4696  C CB  . TYR D  1 63  ? -14.771  -30.557 -18.920  1.00 82.80  ? 63  TYR D CB  1 
ATOM   4697  C CG  . TYR D  1 63  ? -13.781  -31.690 -19.011  1.00 84.68  ? 63  TYR D CG  1 
ATOM   4698  C CD1 . TYR D  1 63  ? -14.162  -32.950 -19.516  1.00 85.13  ? 63  TYR D CD1 1 
ATOM   4699  C CD2 . TYR D  1 63  ? -12.456  -31.510 -18.603  1.00 86.23  ? 63  TYR D CD2 1 
ATOM   4700  C CE1 . TYR D  1 63  ? -13.259  -33.992 -19.601  1.00 87.07  ? 63  TYR D CE1 1 
ATOM   4701  C CE2 . TYR D  1 63  ? -11.540  -32.555 -18.686  1.00 88.19  ? 63  TYR D CE2 1 
ATOM   4702  C CZ  . TYR D  1 63  ? -11.950  -33.784 -19.187  1.00 88.59  ? 63  TYR D CZ  1 
ATOM   4703  O OH  . TYR D  1 63  ? -11.033  -34.799 -19.260  1.00 90.73  ? 63  TYR D OH  1 
ATOM   4704  N N   . ILE D  1 64  ? -15.724  -28.382 -16.575  1.00 80.20  ? 64  ILE D N   1 
ATOM   4705  C CA  . ILE D  1 64  ? -16.348  -27.119 -16.213  1.00 79.04  ? 64  ILE D CA  1 
ATOM   4706  C C   . ILE D  1 64  ? -15.388  -25.942 -16.379  1.00 79.88  ? 64  ILE D C   1 
ATOM   4707  O O   . ILE D  1 64  ? -14.345  -25.848 -15.720  1.00 81.00  ? 64  ILE D O   1 
ATOM   4708  C CB  . ILE D  1 64  ? -16.853  -27.142 -14.755  1.00 78.37  ? 64  ILE D CB  1 
ATOM   4709  C CG1 . ILE D  1 64  ? -17.847  -28.279 -14.535  1.00 77.75  ? 64  ILE D CG1 1 
ATOM   4710  C CG2 . ILE D  1 64  ? -17.416  -25.777 -14.374  1.00 77.42  ? 64  ILE D CG2 1 
ATOM   4711  C CD1 . ILE D  1 64  ? -18.265  -28.455 -13.101  1.00 77.53  ? 64  ILE D CD1 1 
ATOM   4712  N N   . ASN D  1 65  ? -15.741  -25.054 -17.288  1.00 79.55  ? 65  ASN D N   1 
ATOM   4713  C CA  . ASN D  1 65  ? -15.073  -23.771 -17.432  1.00 80.30  ? 65  ASN D CA  1 
ATOM   4714  C C   . ASN D  1 65  ? -16.174  -22.723 -17.596  1.00 79.13  ? 65  ASN D C   1 
ATOM   4715  O O   . ASN D  1 65  ? -16.673  -22.480 -18.714  1.00 79.04  ? 65  ASN D O   1 
ATOM   4716  C CB  . ASN D  1 65  ? -14.140  -23.777 -18.637  1.00 81.88  ? 65  ASN D CB  1 
ATOM   4717  C CG  . ASN D  1 65  ? -13.398  -22.475 -18.795  1.00 82.99  ? 65  ASN D CG  1 
ATOM   4718  O OD1 . ASN D  1 65  ? -13.222  -21.736 -17.828  1.00 82.91  ? 65  ASN D OD1 1 
ATOM   4719  N ND2 . ASN D  1 65  ? -12.964  -22.182 -20.014  1.00 84.22  ? 65  ASN D ND2 1 
ATOM   4720  N N   . SER D  1 66  ? -16.582  -22.128 -16.475  1.00 78.40  ? 66  SER D N   1 
ATOM   4721  C CA  . SER D  1 66  ? -17.795  -21.330 -16.452  1.00 77.25  ? 66  SER D CA  1 
ATOM   4722  C C   . SER D  1 66  ? -17.708  -20.199 -15.458  1.00 77.32  ? 66  SER D C   1 
ATOM   4723  O O   . SER D  1 66  ? -17.303  -20.423 -14.319  1.00 77.49  ? 66  SER D O   1 
ATOM   4724  C CB  . SER D  1 66  ? -18.988  -22.211 -16.081  1.00 75.90  ? 66  SER D CB  1 
ATOM   4725  O OG  . SER D  1 66  ? -20.143  -21.419 -15.869  1.00 74.94  ? 66  SER D OG  1 
ATOM   4726  N N   . PRO D  1 67  ? -18.126  -18.989 -15.864  1.00 77.36  ? 67  PRO D N   1 
ATOM   4727  C CA  . PRO D  1 67  ? -18.185  -17.873 -14.916  1.00 77.49  ? 67  PRO D CA  1 
ATOM   4728  C C   . PRO D  1 67  ? -19.404  -17.939 -13.985  1.00 76.19  ? 67  PRO D C   1 
ATOM   4729  O O   . PRO D  1 67  ? -19.517  -17.069 -13.117  1.00 76.35  ? 67  PRO D O   1 
ATOM   4730  C CB  . PRO D  1 67  ? -18.273  -16.636 -15.818  1.00 78.21  ? 67  PRO D CB  1 
ATOM   4731  C CG  . PRO D  1 67  ? -18.927  -17.133 -17.064  1.00 77.78  ? 67  PRO D CG  1 
ATOM   4732  C CD  . PRO D  1 67  ? -18.568  -18.600 -17.217  1.00 77.52  ? 67  PRO D CD  1 
ATOM   4733  N N   . GLY D  1 68  ? -20.302  -18.915 -14.175  1.00 75.11  ? 68  GLY D N   1 
ATOM   4734  C CA  . GLY D  1 68  ? -21.508  -19.002 -13.376  1.00 74.09  ? 68  GLY D CA  1 
ATOM   4735  C C   . GLY D  1 68  ? -22.764  -18.621 -14.115  1.00 73.40  ? 68  GLY D C   1 
ATOM   4736  O O   . GLY D  1 68  ? -22.841  -18.751 -15.340  1.00 73.50  ? 68  GLY D O   1 
ATOM   4737  N N   . GLY D  1 69  ? -23.779  -18.159 -13.396  1.00 72.88  ? 69  GLY D N   1 
ATOM   4738  C CA  . GLY D  1 69  ? -25.015  -17.740 -14.059  1.00 72.44  ? 69  GLY D CA  1 
ATOM   4739  C C   . GLY D  1 69  ? -26.245  -17.966 -13.202  1.00 71.73  ? 69  GLY D C   1 
ATOM   4740  O O   . GLY D  1 69  ? -26.187  -17.866 -11.997  1.00 71.80  ? 69  GLY D O   1 
ATOM   4741  N N   . SER D  1 70  ? -27.362  -18.297 -13.829  1.00 71.22  ? 70  SER D N   1 
ATOM   4742  C CA  . SER D  1 70  ? -28.619  -18.431 -13.152  1.00 70.77  ? 70  SER D CA  1 
ATOM   4743  C C   . SER D  1 70  ? -28.560  -19.501 -12.073  1.00 70.52  ? 70  SER D C   1 
ATOM   4744  O O   . SER D  1 70  ? -28.099  -20.628 -12.300  1.00 70.40  ? 70  SER D O   1 
ATOM   4745  C CB  . SER D  1 70  ? -29.675  -18.796 -14.173  1.00 70.46  ? 70  SER D CB  1 
ATOM   4746  O OG  . SER D  1 70  ? -30.798  -19.333 -13.531  1.00 70.10  ? 70  SER D OG  1 
ATOM   4747  N N   . VAL D  1 71  ? -29.033  -19.151 -10.890  1.00 70.66  ? 71  VAL D N   1 
ATOM   4748  C CA  . VAL D  1 71  ? -29.009  -20.069 -9.754   1.00 70.75  ? 71  VAL D CA  1 
ATOM   4749  C C   . VAL D  1 71  ? -30.004  -21.204 -9.988   1.00 70.38  ? 71  VAL D C   1 
ATOM   4750  O O   . VAL D  1 71  ? -29.669  -22.377 -9.755   1.00 70.48  ? 71  VAL D O   1 
ATOM   4751  C CB  . VAL D  1 71  ? -29.286  -19.331 -8.422   1.00 71.27  ? 71  VAL D CB  1 
ATOM   4752  C CG1 . VAL D  1 71  ? -29.568  -20.300 -7.296   1.00 71.58  ? 71  VAL D CG1 1 
ATOM   4753  C CG2 . VAL D  1 71  ? -28.112  -18.441 -8.031   1.00 71.87  ? 71  VAL D CG2 1 
ATOM   4754  N N   . THR D  1 72  ? -31.211  -20.885 -10.474  1.00 70.14  ? 72  THR D N   1 
ATOM   4755  C CA  . THR D  1 72  ? -32.176  -21.944 -10.722  1.00 69.96  ? 72  THR D CA  1 
ATOM   4756  C C   . THR D  1 72  ? -31.750  -22.845 -11.864  1.00 69.71  ? 72  THR D C   1 
ATOM   4757  O O   . THR D  1 72  ? -31.969  -24.054 -11.820  1.00 69.78  ? 72  THR D O   1 
ATOM   4758  C CB  . THR D  1 72  ? -33.582  -21.446 -10.994  1.00 69.98  ? 72  THR D CB  1 
ATOM   4759  O OG1 . THR D  1 72  ? -33.588  -20.665 -12.183  1.00 69.85  ? 72  THR D OG1 1 
ATOM   4760  C CG2 . THR D  1 72  ? -34.104  -20.666 -9.824   1.00 70.44  ? 72  THR D CG2 1 
ATOM   4761  N N   . ALA D  1 73  ? -31.127  -22.275 -12.886  1.00 69.61  ? 73  ALA D N   1 
ATOM   4762  C CA  . ALA D  1 73  ? -30.624  -23.108 -13.967  1.00 69.58  ? 73  ALA D CA  1 
ATOM   4763  C C   . ALA D  1 73  ? -29.564  -24.045 -13.422  1.00 69.81  ? 73  ALA D C   1 
ATOM   4764  O O   . ALA D  1 73  ? -29.547  -25.234 -13.769  1.00 69.94  ? 73  ALA D O   1 
ATOM   4765  C CB  . ALA D  1 73  ? -30.103  -22.275 -15.137  1.00 69.73  ? 73  ALA D CB  1 
ATOM   4766  N N   . GLY D  1 74  ? -28.693  -23.511 -12.557  1.00 70.07  ? 74  GLY D N   1 
ATOM   4767  C CA  . GLY D  1 74  ? -27.675  -24.304 -11.892  1.00 70.54  ? 74  GLY D CA  1 
ATOM   4768  C C   . GLY D  1 74  ? -28.284  -25.445 -11.128  1.00 70.75  ? 74  GLY D C   1 
ATOM   4769  O O   . GLY D  1 74  ? -27.764  -26.568 -11.180  1.00 71.20  ? 74  GLY D O   1 
ATOM   4770  N N   . PHE D  1 75  ? -29.395  -25.174 -10.441  1.00 70.64  ? 75  PHE D N   1 
ATOM   4771  C CA  . PHE D  1 75  ? -30.030  -26.212 -9.649   1.00 71.12  ? 75  PHE D CA  1 
ATOM   4772  C C   . PHE D  1 75  ? -30.649  -27.288 -10.502  1.00 71.07  ? 75  PHE D C   1 
ATOM   4773  O O   . PHE D  1 75  ? -30.675  -28.451 -10.121  1.00 71.72  ? 75  PHE D O   1 
ATOM   4774  C CB  . PHE D  1 75  ? -31.020  -25.665 -8.632   1.00 71.30  ? 75  PHE D CB  1 
ATOM   4775  C CG  . PHE D  1 75  ? -30.381  -25.284 -7.312   1.00 71.97  ? 75  PHE D CG  1 
ATOM   4776  C CD1 . PHE D  1 75  ? -30.445  -23.977 -6.839   1.00 71.92  ? 75  PHE D CD1 1 
ATOM   4777  C CD2 . PHE D  1 75  ? -29.700  -26.229 -6.550   1.00 72.86  ? 75  PHE D CD2 1 
ATOM   4778  C CE1 . PHE D  1 75  ? -29.859  -23.619 -5.641   1.00 72.70  ? 75  PHE D CE1 1 
ATOM   4779  C CE2 . PHE D  1 75  ? -29.122  -25.877 -5.346   1.00 73.68  ? 75  PHE D CE2 1 
ATOM   4780  C CZ  . PHE D  1 75  ? -29.208  -24.565 -4.895   1.00 73.57  ? 75  PHE D CZ  1 
ATOM   4781  N N   . ALA D  1 76  ? -31.105  -26.937 -11.684  1.00 70.50  ? 76  ALA D N   1 
ATOM   4782  C CA  . ALA D  1 76  ? -31.606  -27.959 -12.582  1.00 70.61  ? 76  ALA D CA  1 
ATOM   4783  C C   . ALA D  1 76  ? -30.493  -28.939 -12.866  1.00 71.07  ? 76  ALA D C   1 
ATOM   4784  O O   . ALA D  1 76  ? -30.739  -30.140 -12.880  1.00 71.65  ? 76  ALA D O   1 
ATOM   4785  C CB  . ALA D  1 76  ? -32.132  -27.349 -13.878  1.00 70.13  ? 76  ALA D CB  1 
ATOM   4786  N N   . ILE D  1 77  ? -29.277  -28.439 -13.078  1.00 71.03  ? 77  ILE D N   1 
ATOM   4787  C CA  . ILE D  1 77  ? -28.138  -29.318 -13.340  1.00 71.68  ? 77  ILE D CA  1 
ATOM   4788  C C   . ILE D  1 77  ? -27.780  -30.071 -12.075  1.00 72.49  ? 77  ILE D C   1 
ATOM   4789  O O   . ILE D  1 77  ? -27.671  -31.296 -12.090  1.00 73.27  ? 77  ILE D O   1 
ATOM   4790  C CB  . ILE D  1 77  ? -26.919  -28.559 -13.914  1.00 71.67  ? 77  ILE D CB  1 
ATOM   4791  C CG1 . ILE D  1 77  ? -27.285  -27.892 -15.258  1.00 71.20  ? 77  ILE D CG1 1 
ATOM   4792  C CG2 . ILE D  1 77  ? -25.698  -29.473 -14.033  1.00 72.59  ? 77  ILE D CG2 1 
ATOM   4793  C CD1 . ILE D  1 77  ? -26.202  -27.034 -15.858  1.00 71.39  ? 77  ILE D CD1 1 
ATOM   4794  N N   . TYR D  1 78  ? -27.654  -29.350 -10.974  1.00 72.49  ? 78  TYR D N   1 
ATOM   4795  C CA  . TYR D  1 78  ? -27.292  -29.961 -9.698   1.00 73.50  ? 78  TYR D CA  1 
ATOM   4796  C C   . TYR D  1 78  ? -28.194  -31.131 -9.355   1.00 74.16  ? 78  TYR D C   1 
ATOM   4797  O O   . TYR D  1 78  ? -27.720  -32.267 -9.144   1.00 75.27  ? 78  TYR D O   1 
ATOM   4798  C CB  . TYR D  1 78  ? -27.334  -28.934 -8.562   1.00 73.47  ? 78  TYR D CB  1 
ATOM   4799  C CG  . TYR D  1 78  ? -27.074  -29.543 -7.201   1.00 74.75  ? 78  TYR D CG  1 
ATOM   4800  C CD1 . TYR D  1 78  ? -25.775  -29.582 -6.660   1.00 75.64  ? 78  TYR D CD1 1 
ATOM   4801  C CD2 . TYR D  1 78  ? -28.109  -30.090 -6.448   1.00 75.32  ? 78  TYR D CD2 1 
ATOM   4802  C CE1 . TYR D  1 78  ? -25.534  -30.138 -5.412   1.00 77.06  ? 78  TYR D CE1 1 
ATOM   4803  C CE2 . TYR D  1 78  ? -27.872  -30.657 -5.205   1.00 76.77  ? 78  TYR D CE2 1 
ATOM   4804  C CZ  . TYR D  1 78  ? -26.590  -30.670 -4.695   1.00 77.63  ? 78  TYR D CZ  1 
ATOM   4805  O OH  . TYR D  1 78  ? -26.341  -31.227 -3.466   1.00 79.32  ? 78  TYR D OH  1 
ATOM   4806  N N   . ASP D  1 79  ? -29.492  -30.856 -9.290   1.00 73.70  ? 79  ASP D N   1 
ATOM   4807  C CA  . ASP D  1 79  ? -30.438  -31.897 -8.976   1.00 74.48  ? 79  ASP D CA  1 
ATOM   4808  C C   . ASP D  1 79  ? -30.377  -33.080 -9.960   1.00 74.89  ? 79  ASP D C   1 
ATOM   4809  O O   . ASP D  1 79  ? -30.420  -34.242 -9.543   1.00 76.14  ? 79  ASP D O   1 
ATOM   4810  C CB  . ASP D  1 79  ? -31.845  -31.334 -8.868   1.00 74.01  ? 79  ASP D CB  1 
ATOM   4811  C CG  . ASP D  1 79  ? -32.145  -30.778 -7.492   1.00 74.49  ? 79  ASP D CG  1 
ATOM   4812  O OD1 . ASP D  1 79  ? -33.305  -30.332 -7.287   1.00 74.37  ? 79  ASP D OD1 1 
ATOM   4813  O OD2 . ASP D  1 79  ? -31.239  -30.796 -6.612   1.00 75.17  ? 79  ASP D OD2 1 
ATOM   4814  N N   . THR D  1 80  ? -30.251  -32.810 -11.248  1.00 74.07  ? 80  THR D N   1 
ATOM   4815  C CA  . THR D  1 80  ? -30.136  -33.923 -12.192  1.00 74.63  ? 80  THR D CA  1 
ATOM   4816  C C   . THR D  1 80  ? -28.884  -34.809 -11.923  1.00 75.79  ? 80  THR D C   1 
ATOM   4817  O O   . THR D  1 80  ? -28.983  -36.047 -11.961  1.00 76.96  ? 80  THR D O   1 
ATOM   4818  C CB  . THR D  1 80  ? -30.179  -33.435 -13.654  1.00 73.76  ? 80  THR D CB  1 
ATOM   4819  O OG1 . THR D  1 80  ? -31.413  -32.784 -13.884  1.00 73.05  ? 80  THR D OG1 1 
ATOM   4820  C CG2 . THR D  1 80  ? -30.114  -34.565 -14.620  1.00 74.50  ? 80  THR D CG2 1 
ATOM   4821  N N   . ILE D  1 81  ? -27.731  -34.181 -11.645  1.00 75.66  ? 81  ILE D N   1 
ATOM   4822  C CA  . ILE D  1 81  ? -26.530  -34.944 -11.278  1.00 76.96  ? 81  ILE D CA  1 
ATOM   4823  C C   . ILE D  1 81  ? -26.855  -35.860 -10.112  1.00 78.34  ? 81  ILE D C   1 
ATOM   4824  O O   . ILE D  1 81  ? -26.662  -37.057 -10.217  1.00 79.67  ? 81  ILE D O   1 
ATOM   4825  C CB  . ILE D  1 81  ? -25.345  -34.048 -10.930  1.00 76.81  ? 81  ILE D CB  1 
ATOM   4826  C CG1 . ILE D  1 81  ? -24.876  -33.284 -12.180  1.00 75.90  ? 81  ILE D CG1 1 
ATOM   4827  C CG2 . ILE D  1 81  ? -24.223  -34.863 -10.277  1.00 78.47  ? 81  ILE D CG2 1 
ATOM   4828  C CD1 . ILE D  1 81  ? -23.891  -32.167 -11.904  1.00 75.66  ? 81  ILE D CD1 1 
ATOM   4829  N N   . GLN D  1 82  ? -27.407  -35.325 -9.021   1.00 78.24  ? 82  GLN D N   1 
ATOM   4830  C CA  . GLN D  1 82  ? -27.725  -36.168 -7.857   1.00 79.84  ? 82  GLN D CA  1 
ATOM   4831  C C   . GLN D  1 82  ? -28.776  -37.220 -8.169   1.00 80.53  ? 82  GLN D C   1 
ATOM   4832  O O   . GLN D  1 82  ? -28.824  -38.276 -7.533   1.00 82.33  ? 82  GLN D O   1 
ATOM   4833  C CB  . GLN D  1 82  ? -28.171  -35.356 -6.639   1.00 79.78  ? 82  GLN D CB  1 
ATOM   4834  C CG  . GLN D  1 82  ? -27.274  -34.182 -6.240   1.00 79.16  ? 82  GLN D CG  1 
ATOM   4835  C CD  . GLN D  1 82  ? -25.795  -34.412 -6.510   1.00 79.73  ? 82  GLN D CD  1 
ATOM   4836  O OE1 . GLN D  1 82  ? -25.054  -33.474 -6.796   1.00 78.93  ? 82  GLN D OE1 1 
ATOM   4837  N NE2 . GLN D  1 82  ? -25.358  -35.659 -6.428   1.00 81.32  ? 82  GLN D NE2 1 
ATOM   4838  N N   . HIS D  1 83  ? -29.615  -36.961 -9.159   1.00 79.35  ? 83  HIS D N   1 
ATOM   4839  C CA  . HIS D  1 83  ? -30.744  -37.861 -9.398   1.00 80.08  ? 83  HIS D CA  1 
ATOM   4840  C C   . HIS D  1 83  ? -30.437  -39.066 -10.247  1.00 81.07  ? 83  HIS D C   1 
ATOM   4841  O O   . HIS D  1 83  ? -31.117  -40.077 -10.139  1.00 82.40  ? 83  HIS D O   1 
ATOM   4842  C CB  . HIS D  1 83  ? -31.879  -37.112 -10.028  1.00 78.70  ? 83  HIS D CB  1 
ATOM   4843  C CG  . HIS D  1 83  ? -33.068  -37.973 -10.324  1.00 79.52  ? 83  HIS D CG  1 
ATOM   4844  N ND1 . HIS D  1 83  ? -33.392  -38.350 -11.594  1.00 79.26  ? 83  HIS D ND1 1 
ATOM   4845  C CD2 . HIS D  1 83  ? -34.028  -38.533 -9.473   1.00 80.83  ? 83  HIS D CD2 1 
ATOM   4846  C CE1 . HIS D  1 83  ? -34.504  -39.098 -11.556  1.00 80.30  ? 83  HIS D CE1 1 
ATOM   4847  N NE2 . HIS D  1 83  ? -34.891  -39.215 -10.249  1.00 81.28  ? 83  HIS D NE2 1 
ATOM   4848  N N   . ILE D  1 84  ? -29.427  -38.971 -11.106  1.00 80.63  ? 84  ILE D N   1 
ATOM   4849  C CA  . ILE D  1 84  ? -29.090  -40.078 -11.966  1.00 81.69  ? 84  ILE D CA  1 
ATOM   4850  C C   . ILE D  1 84  ? -28.170  -41.064 -11.258  1.00 83.69  ? 84  ILE D C   1 
ATOM   4851  O O   . ILE D  1 84  ? -27.543  -40.722 -10.258  1.00 84.01  ? 84  ILE D O   1 
ATOM   4852  C CB  . ILE D  1 84  ? -28.474  -39.618 -13.300  1.00 80.67  ? 84  ILE D CB  1 
ATOM   4853  C CG1 . ILE D  1 84  ? -27.219  -38.784 -13.080  1.00 80.13  ? 84  ILE D CG1 1 
ATOM   4854  C CG2 . ILE D  1 84  ? -29.490  -38.855 -14.109  1.00 79.18  ? 84  ILE D CG2 1 
ATOM   4855  C CD1 . ILE D  1 84  ? -26.321  -38.696 -14.293  1.00 79.99  ? 84  ILE D CD1 1 
ATOM   4856  N N   . LYS D  1 85  ? -28.103  -42.289 -11.788  1.00 85.21  ? 85  LYS D N   1 
ATOM   4857  C CA  . LYS D  1 85  ? -27.347  -43.370 -11.172  1.00 87.51  ? 85  LYS D CA  1 
ATOM   4858  C C   . LYS D  1 85  ? -25.838  -43.223 -11.328  1.00 87.80  ? 85  LYS D C   1 
ATOM   4859  O O   . LYS D  1 85  ? -25.116  -43.344 -10.340  1.00 88.97  ? 85  LYS D O   1 
ATOM   4860  C CB  . LYS D  1 85  ? -27.815  -44.730 -11.696  1.00 89.27  ? 85  LYS D CB  1 
ATOM   4861  C CG  . LYS D  1 85  ? -29.240  -45.085 -11.281  1.00 89.73  ? 85  LYS D CG  1 
ATOM   4862  C CD  . LYS D  1 85  ? -29.600  -46.504 -11.688  1.00 91.91  ? 85  LYS D CD  1 
ATOM   4863  C CE  . LYS D  1 85  ? -30.531  -47.143 -10.666  1.00 93.65  ? 85  LYS D CE  1 
ATOM   4864  N NZ  . LYS D  1 85  ? -30.135  -48.560 -10.414  1.00 96.68  ? 85  LYS D NZ  1 
ATOM   4865  N N   . PRO D  1 86  ? -25.352  -42.952 -12.561  1.00 86.94  ? 86  PRO D N   1 
ATOM   4866  C CA  . PRO D  1 86  ? -23.889  -42.877 -12.728  1.00 87.55  ? 86  PRO D CA  1 
ATOM   4867  C C   . PRO D  1 86  ? -23.254  -41.776 -11.889  1.00 86.69  ? 86  PRO D C   1 
ATOM   4868  O O   . PRO D  1 86  ? -23.863  -40.730 -11.680  1.00 84.92  ? 86  PRO D O   1 
ATOM   4869  C CB  . PRO D  1 86  ? -23.719  -42.550 -14.210  1.00 86.55  ? 86  PRO D CB  1 
ATOM   4870  C CG  . PRO D  1 86  ? -25.003  -42.971 -14.857  1.00 86.22  ? 86  PRO D CG  1 
ATOM   4871  C CD  . PRO D  1 86  ? -26.073  -42.757 -13.834  1.00 85.73  ? 86  PRO D CD  1 
ATOM   4872  N N   . ASP D  1 87  ? -22.045  -42.025 -11.400  1.00 88.14  ? 87  ASP D N   1 
ATOM   4873  C CA  . ASP D  1 87  ? -21.250  -41.000 -10.763  1.00 87.58  ? 87  ASP D CA  1 
ATOM   4874  C C   . ASP D  1 87  ? -20.904  -39.973 -11.807  1.00 85.87  ? 87  ASP D C   1 
ATOM   4875  O O   . ASP D  1 87  ? -20.646  -40.318 -12.965  1.00 86.04  ? 87  ASP D O   1 
ATOM   4876  C CB  . ASP D  1 87  ? -19.951  -41.573 -10.226  1.00 89.79  ? 87  ASP D CB  1 
ATOM   4877  C CG  . ASP D  1 87  ? -20.126  -42.264 -8.919   1.00 91.59  ? 87  ASP D CG  1 
ATOM   4878  O OD1 . ASP D  1 87  ? -19.171  -42.967 -8.486   1.00 93.88  ? 87  ASP D OD1 1 
ATOM   4879  O OD2 . ASP D  1 87  ? -21.223  -42.106 -8.337   1.00 90.92  ? 87  ASP D OD2 1 
ATOM   4880  N N   . VAL D  1 88  ? -20.899  -38.701 -11.418  1.00 84.41  ? 88  VAL D N   1 
ATOM   4881  C CA  . VAL D  1 88  ? -20.508  -37.661 -12.351  1.00 83.07  ? 88  VAL D CA  1 
ATOM   4882  C C   . VAL D  1 88  ? -19.232  -37.059 -11.827  1.00 83.69  ? 88  VAL D C   1 
ATOM   4883  O O   . VAL D  1 88  ? -19.224  -36.425 -10.793  1.00 83.45  ? 88  VAL D O   1 
ATOM   4884  C CB  . VAL D  1 88  ? -21.605  -36.593 -12.535  1.00 80.96  ? 88  VAL D CB  1 
ATOM   4885  C CG1 . VAL D  1 88  ? -21.081  -35.461 -13.385  1.00 79.95  ? 88  VAL D CG1 1 
ATOM   4886  C CG2 . VAL D  1 88  ? -22.841  -37.211 -13.163  1.00 80.55  ? 88  VAL D CG2 1 
ATOM   4887  N N   . GLN D  1 89  ? -18.143  -37.294 -12.537  1.00 84.70  ? 89  GLN D N   1 
ATOM   4888  C CA  . GLN D  1 89  ? -16.880  -36.635 -12.230  1.00 85.37  ? 89  GLN D CA  1 
ATOM   4889  C C   . GLN D  1 89  ? -16.918  -35.186 -12.725  1.00 83.68  ? 89  GLN D C   1 
ATOM   4890  O O   . GLN D  1 89  ? -17.412  -34.905 -13.837  1.00 82.64  ? 89  GLN D O   1 
ATOM   4891  C CB  . GLN D  1 89  ? -15.716  -37.372 -12.886  1.00 87.24  ? 89  GLN D CB  1 
ATOM   4892  C CG  . GLN D  1 89  ? -15.732  -38.869 -12.664  1.00 89.08  ? 89  GLN D CG  1 
ATOM   4893  C CD  . GLN D  1 89  ? -14.356  -39.509 -12.767  1.00 91.49  ? 89  GLN D CD  1 
ATOM   4894  O OE1 . GLN D  1 89  ? -13.333  -38.817 -12.775  1.00 91.90  ? 89  GLN D OE1 1 
ATOM   4895  N NE2 . GLN D  1 89  ? -14.326  -40.845 -12.842  1.00 93.30  ? 89  GLN D NE2 1 
ATOM   4896  N N   . THR D  1 90  ? -16.416  -34.272 -11.898  1.00 83.62  ? 90  THR D N   1 
ATOM   4897  C CA  . THR D  1 90  ? -16.293  -32.877 -12.289  1.00 82.45  ? 90  THR D CA  1 
ATOM   4898  C C   . THR D  1 90  ? -14.813  -32.509 -12.360  1.00 83.83  ? 90  THR D C   1 
ATOM   4899  O O   . THR D  1 90  ? -14.026  -32.806 -11.462  1.00 85.28  ? 90  THR D O   1 
ATOM   4900  C CB  . THR D  1 90  ? -17.067  -31.940 -11.349  1.00 81.19  ? 90  THR D CB  1 
ATOM   4901  O OG1 . THR D  1 90  ? -16.697  -32.196 -10.001  1.00 82.29  ? 90  THR D OG1 1 
ATOM   4902  C CG2 . THR D  1 90  ? -18.574  -32.139 -11.490  1.00 79.81  ? 90  THR D CG2 1 
ATOM   4903  N N   . ILE D  1 91  ? -14.431  -31.895 -13.468  1.00 83.61  ? 91  ILE D N   1 
ATOM   4904  C CA  . ILE D  1 91  ? -13.062  -31.475 -13.694  1.00 85.03  ? 91  ILE D CA  1 
ATOM   4905  C C   . ILE D  1 91  ? -13.062  -29.993 -14.095  1.00 84.09  ? 91  ILE D C   1 
ATOM   4906  O O   . ILE D  1 91  ? -13.630  -29.596 -15.133  1.00 83.13  ? 91  ILE D O   1 
ATOM   4907  C CB  . ILE D  1 91  ? -12.463  -32.279 -14.827  1.00 86.29  ? 91  ILE D CB  1 
ATOM   4908  C CG1 . ILE D  1 91  ? -12.653  -33.769 -14.552  1.00 87.19  ? 91  ILE D CG1 1 
ATOM   4909  C CG2 . ILE D  1 91  ? -11.012  -31.871 -15.040  1.00 88.04  ? 91  ILE D CG2 1 
ATOM   4910  C CD1 . ILE D  1 91  ? -13.098  -34.581 -15.754  1.00 87.21  ? 91  ILE D CD1 1 
ATOM   4911  N N   . CYS D  1 92  ? -12.438  -29.164 -13.274  1.00 84.56  ? 92  CYS D N   1 
ATOM   4912  C CA  . CYS D  1 92  ? -12.436  -27.756 -13.559  1.00 83.92  ? 92  CYS D CA  1 
ATOM   4913  C C   . CYS D  1 92  ? -11.225  -27.414 -14.406  1.00 85.46  ? 92  CYS D C   1 
ATOM   4914  O O   . CYS D  1 92  ? -10.097  -27.701 -14.012  1.00 87.22  ? 92  CYS D O   1 
ATOM   4915  C CB  . CYS D  1 92  ? -12.411  -26.967 -12.263  1.00 83.79  ? 92  CYS D CB  1 
ATOM   4916  S SG  . CYS D  1 92  ? -12.013  -25.247 -12.550  1.00 83.81  ? 92  CYS D SG  1 
ATOM   4917  N N   . ILE D  1 93  ? -11.459  -26.825 -15.575  1.00 85.03  ? 93  ILE D N   1 
ATOM   4918  C CA  . ILE D  1 93  ? -10.376  -26.272 -16.404  1.00 86.62  ? 93  ILE D CA  1 
ATOM   4919  C C   . ILE D  1 93  ? -10.607  -24.776 -16.587  1.00 86.07  ? 93  ILE D C   1 
ATOM   4920  O O   . ILE D  1 93  ? -11.738  -24.336 -16.757  1.00 84.45  ? 93  ILE D O   1 
ATOM   4921  C CB  . ILE D  1 93  ? -10.311  -26.928 -17.794  1.00 87.22  ? 93  ILE D CB  1 
ATOM   4922  C CG1 . ILE D  1 93  ? -11.652  -26.787 -18.511  1.00 85.46  ? 93  ILE D CG1 1 
ATOM   4923  C CG2 . ILE D  1 93  ? -9.938   -28.396 -17.675  1.00 88.20  ? 93  ILE D CG2 1 
ATOM   4924  C CD1 . ILE D  1 93  ? -11.666  -27.364 -19.912  1.00 86.14  ? 93  ILE D CD1 1 
ATOM   4925  N N   . GLY D  1 94  ? -9.557   -23.976 -16.560  1.00 87.60  ? 94  GLY D N   1 
ATOM   4926  C CA  . GLY D  1 94  ? -9.731   -22.539 -16.694  1.00 87.39  ? 94  GLY D CA  1 
ATOM   4927  C C   . GLY D  1 94  ? -10.234  -21.892 -15.421  1.00 86.35  ? 94  GLY D C   1 
ATOM   4928  O O   . GLY D  1 94  ? -9.432   -21.475 -14.589  1.00 87.45  ? 94  GLY D O   1 
ATOM   4929  N N   . MET D  1 95  ? -11.562  -21.816 -15.274  1.00 84.40  ? 95  MET D N   1 
ATOM   4930  C CA  . MET D  1 95  ? -12.216  -21.071 -14.186  1.00 83.41  ? 95  MET D CA  1 
ATOM   4931  C C   . MET D  1 95  ? -13.559  -21.700 -13.872  1.00 81.54  ? 95  MET D C   1 
ATOM   4932  O O   . MET D  1 95  ? -14.315  -22.018 -14.779  1.00 80.68  ? 95  MET D O   1 
ATOM   4933  C CB  . MET D  1 95  ? -12.424  -19.586 -14.599  1.00 83.48  ? 95  MET D CB  1 
ATOM   4934  C CG  . MET D  1 95  ? -13.306  -18.708 -13.687  1.00 82.44  ? 95  MET D CG  1 
ATOM   4935  S SD  . MET D  1 95  ? -12.564  -18.414 -12.030  1.00 83.38  ? 95  MET D SD  1 
ATOM   4936  C CE  . MET D  1 95  ? -11.603  -16.900 -12.238  1.00 85.23  ? 95  MET D CE  1 
ATOM   4937  N N   . ALA D  1 96  ? -13.856  -21.866 -12.592  1.00 81.12  ? 96  ALA D N   1 
ATOM   4938  C CA  . ALA D  1 96  ? -15.190  -22.220 -12.151  1.00 79.54  ? 96  ALA D CA  1 
ATOM   4939  C C   . ALA D  1 96  ? -15.575  -21.205 -11.088  1.00 79.26  ? 96  ALA D C   1 
ATOM   4940  O O   . ALA D  1 96  ? -15.078  -21.235 -9.957   1.00 80.02  ? 96  ALA D O   1 
ATOM   4941  C CB  . ALA D  1 96  ? -15.251  -23.644 -11.614  1.00 79.59  ? 96  ALA D CB  1 
ATOM   4942  N N   . ALA D  1 97  ? -16.455  -20.287 -11.473  1.00 78.36  ? 97  ALA D N   1 
ATOM   4943  C CA  . ALA D  1 97  ? -16.899  -19.220 -10.577  1.00 78.20  ? 97  ALA D CA  1 
ATOM   4944  C C   . ALA D  1 97  ? -18.370  -19.332 -10.230  1.00 76.80  ? 97  ALA D C   1 
ATOM   4945  O O   . ALA D  1 97  ? -19.149  -19.836 -11.024  1.00 75.88  ? 97  ALA D O   1 
ATOM   4946  C CB  . ALA D  1 97  ? -16.618  -17.873 -11.195  1.00 78.79  ? 97  ALA D CB  1 
ATOM   4947  N N   . ALA D  1 98  ? -18.739  -18.863 -9.037   1.00 76.84  ? 98  ALA D N   1 
ATOM   4948  C CA  . ALA D  1 98  ? -20.151  -18.753 -8.641   1.00 75.79  ? 98  ALA D CA  1 
ATOM   4949  C C   . ALA D  1 98  ? -20.835  -20.074 -8.868   1.00 74.96  ? 98  ALA D C   1 
ATOM   4950  O O   . ALA D  1 98  ? -20.300  -21.101 -8.453   1.00 75.43  ? 98  ALA D O   1 
ATOM   4951  C CB  . ALA D  1 98  ? -20.853  -17.641 -9.410   1.00 75.34  ? 98  ALA D CB  1 
ATOM   4952  N N   . MET D  1 99  ? -21.978  -20.072 -9.543   1.00 73.94  ? 99  MET D N   1 
ATOM   4953  C CA  . MET D  1 99  ? -22.723  -21.309 -9.732   1.00 73.29  ? 99  MET D CA  1 
ATOM   4954  C C   . MET D  1 99  ? -21.851  -22.378 -10.393  1.00 73.68  ? 99  MET D C   1 
ATOM   4955  O O   . MET D  1 99  ? -22.042  -23.602 -10.184  1.00 73.69  ? 99  MET D O   1 
ATOM   4956  C CB  . MET D  1 99  ? -24.002  -21.094 -10.531  1.00 72.34  ? 99  MET D CB  1 
ATOM   4957  C CG  . MET D  1 99  ? -25.083  -22.137 -10.291  1.00 71.80  ? 99  MET D CG  1 
ATOM   4958  S SD  . MET D  1 99  ? -25.736  -22.495 -8.592   1.00 72.09  ? 99  MET D SD  1 
ATOM   4959  C CE  . MET D  1 99  ? -25.408  -20.936 -7.742   1.00 72.59  ? 99  MET D CE  1 
ATOM   4960  N N   . GLY D  1 100 ? -20.882  -21.929 -11.182  1.00 74.22  ? 100 GLY D N   1 
ATOM   4961  C CA  . GLY D  1 100 ? -19.899  -22.830 -11.732  1.00 74.92  ? 100 GLY D CA  1 
ATOM   4962  C C   . GLY D  1 100 ? -19.182  -23.630 -10.651  1.00 75.80  ? 100 GLY D C   1 
ATOM   4963  O O   . GLY D  1 100 ? -19.144  -24.857 -10.715  1.00 76.02  ? 100 GLY D O   1 
ATOM   4964  N N   . SER D  1 101 ? -18.618  -22.950 -9.651   1.00 76.50  ? 101 SER D N   1 
ATOM   4965  C CA  . SER D  1 101 ? -17.880  -23.631 -8.594   1.00 77.64  ? 101 SER D CA  1 
ATOM   4966  C C   . SER D  1 101 ? -18.850  -24.457 -7.749   1.00 77.28  ? 101 SER D C   1 
ATOM   4967  O O   . SER D  1 101 ? -18.471  -25.522 -7.246   1.00 78.18  ? 101 SER D O   1 
ATOM   4968  C CB  . SER D  1 101 ? -17.130  -22.638 -7.735   1.00 78.60  ? 101 SER D CB  1 
ATOM   4969  O OG  . SER D  1 101 ? -18.054  -21.865 -6.981   1.00 78.00  ? 101 SER D OG  1 
ATOM   4970  N N   . PHE D  1 102 ? -20.103  -23.996 -7.623   1.00 76.19  ? 102 PHE D N   1 
ATOM   4971  C CA  . PHE D  1 102 ? -21.124  -24.802 -6.947   1.00 75.95  ? 102 PHE D CA  1 
ATOM   4972  C C   . PHE D  1 102 ? -21.262  -26.169 -7.620   1.00 75.92  ? 102 PHE D C   1 
ATOM   4973  O O   . PHE D  1 102 ? -21.313  -27.190 -6.943   1.00 76.69  ? 102 PHE D O   1 
ATOM   4974  C CB  . PHE D  1 102 ? -22.445  -24.094 -6.974   1.00 74.86  ? 102 PHE D CB  1 
ATOM   4975  C CG  . PHE D  1 102 ? -23.504  -24.738 -6.150   1.00 74.87  ? 102 PHE D CG  1 
ATOM   4976  C CD1 . PHE D  1 102 ? -23.563  -24.517 -4.792   1.00 75.71  ? 102 PHE D CD1 1 
ATOM   4977  C CD2 . PHE D  1 102 ? -24.490  -25.519 -6.743   1.00 74.21  ? 102 PHE D CD2 1 
ATOM   4978  C CE1 . PHE D  1 102 ? -24.568  -25.094 -4.022   1.00 75.97  ? 102 PHE D CE1 1 
ATOM   4979  C CE2 . PHE D  1 102 ? -25.488  -26.109 -5.973   1.00 74.45  ? 102 PHE D CE2 1 
ATOM   4980  C CZ  . PHE D  1 102 ? -25.533  -25.892 -4.611   1.00 75.36  ? 102 PHE D CZ  1 
ATOM   4981  N N   . LEU D  1 103 ? -21.299  -26.192 -8.946   1.00 75.26  ? 103 LEU D N   1 
ATOM   4982  C CA  . LEU D  1 103 ? -21.457  -27.438 -9.651   1.00 75.33  ? 103 LEU D CA  1 
ATOM   4983  C C   . LEU D  1 103 ? -20.194  -28.263 -9.575   1.00 76.71  ? 103 LEU D C   1 
ATOM   4984  O O   . LEU D  1 103 ? -20.271  -29.504 -9.505   1.00 77.34  ? 103 LEU D O   1 
ATOM   4985  C CB  . LEU D  1 103 ? -21.848  -27.203 -11.102  1.00 74.45  ? 103 LEU D CB  1 
ATOM   4986  C CG  . LEU D  1 103 ? -23.243  -26.603 -11.378  1.00 73.25  ? 103 LEU D CG  1 
ATOM   4987  C CD1 . LEU D  1 103 ? -23.450  -26.405 -12.876  1.00 72.76  ? 103 LEU D CD1 1 
ATOM   4988  C CD2 . LEU D  1 103 ? -24.351  -27.470 -10.805  1.00 73.09  ? 103 LEU D CD2 1 
ATOM   4989  N N   . LEU D  1 104 ? -19.037  -27.599 -9.570   1.00 77.38  ? 104 LEU D N   1 
ATOM   4990  C CA  . LEU D  1 104 ? -17.768  -28.317 -9.433   1.00 78.95  ? 104 LEU D CA  1 
ATOM   4991  C C   . LEU D  1 104 ? -17.754  -29.182 -8.137   1.00 80.06  ? 104 LEU D C   1 
ATOM   4992  O O   . LEU D  1 104 ? -17.377  -30.357 -8.143   1.00 81.18  ? 104 LEU D O   1 
ATOM   4993  C CB  . LEU D  1 104 ? -16.609  -27.330 -9.434   1.00 79.67  ? 104 LEU D CB  1 
ATOM   4994  C CG  . LEU D  1 104 ? -15.210  -27.885 -9.210   1.00 81.54  ? 104 LEU D CG  1 
ATOM   4995  C CD1 . LEU D  1 104 ? -14.863  -28.820 -10.343  1.00 81.98  ? 104 LEU D CD1 1 
ATOM   4996  C CD2 . LEU D  1 104 ? -14.210  -26.749 -9.107   1.00 82.26  ? 104 LEU D CD2 1 
ATOM   4997  N N   . ALA D  1 105 ? -18.207  -28.566 -7.049   1.00 79.90  ? 105 ALA D N   1 
ATOM   4998  C CA  . ALA D  1 105 ? -18.326  -29.196 -5.753   1.00 81.04  ? 105 ALA D CA  1 
ATOM   4999  C C   . ALA D  1 105 ? -19.418  -30.267 -5.718   1.00 80.83  ? 105 ALA D C   1 
ATOM   5000  O O   . ALA D  1 105 ? -19.445  -31.080 -4.777   1.00 82.18  ? 105 ALA D O   1 
ATOM   5001  C CB  . ALA D  1 105 ? -18.603  -28.131 -4.704   1.00 80.94  ? 105 ALA D CB  1 
ATOM   5002  N N   . ALA D  1 106 ? -20.300  -30.278 -6.729   1.00 79.39  ? 106 ALA D N   1 
ATOM   5003  C CA  . ALA D  1 106 ? -21.434  -31.190 -6.741   1.00 79.19  ? 106 ALA D CA  1 
ATOM   5004  C C   . ALA D  1 106 ? -21.136  -32.554 -7.387   1.00 80.07  ? 106 ALA D C   1 
ATOM   5005  O O   . ALA D  1 106 ? -22.005  -33.438 -7.406   1.00 80.23  ? 106 ALA D O   1 
ATOM   5006  C CB  . ALA D  1 106 ? -22.617  -30.542 -7.413   1.00 77.46  ? 106 ALA D CB  1 
ATOM   5007  N N   . GLY D  1 107 ? -19.926  -32.729 -7.917   1.00 80.82  ? 107 GLY D N   1 
ATOM   5008  C CA  . GLY D  1 107 ? -19.551  -34.003 -8.474   1.00 81.95  ? 107 GLY D CA  1 
ATOM   5009  C C   . GLY D  1 107 ? -19.488  -35.061 -7.386   1.00 83.79  ? 107 GLY D C   1 
ATOM   5010  O O   . GLY D  1 107 ? -19.405  -34.731 -6.202   1.00 84.41  ? 107 GLY D O   1 
ATOM   5011  N N   . ALA D  1 108 ? -19.539  -36.330 -7.806   1.00 84.84  ? 108 ALA D N   1 
ATOM   5012  C CA  . ALA D  1 108 ? -19.375  -37.498 -6.920   1.00 87.04  ? 108 ALA D CA  1 
ATOM   5013  C C   . ALA D  1 108 ? -18.125  -37.374 -6.066   1.00 88.73  ? 108 ALA D C   1 
ATOM   5014  O O   . ALA D  1 108 ? -17.039  -37.088 -6.590   1.00 89.00  ? 108 ALA D O   1 
ATOM   5015  C CB  . ALA D  1 108 ? -19.339  -38.796 -7.721   1.00 88.12  ? 108 ALA D CB  1 
ATOM   5016  N N   . LYS D  1 109 ? -18.297  -37.576 -4.757   1.00 90.03  ? 109 LYS D N   1 
ATOM   5017  C CA  . LYS D  1 109 ? -17.192  -37.434 -3.796   1.00 91.87  ? 109 LYS D CA  1 
ATOM   5018  C C   . LYS D  1 109 ? -16.021  -38.347 -4.142   1.00 93.95  ? 109 LYS D C   1 
ATOM   5019  O O   . LYS D  1 109 ? -16.199  -39.511 -4.502   1.00 95.03  ? 109 LYS D O   1 
ATOM   5020  C CB  . LYS D  1 109 ? -17.648  -37.686 -2.351   1.00 93.34  ? 109 LYS D CB  1 
ATOM   5021  C CG  . LYS D  1 109 ? -18.662  -36.653 -1.845   1.00 91.64  ? 109 LYS D CG  1 
ATOM   5022  C CD  . LYS D  1 109 ? -19.146  -36.995 -0.422   1.00 93.44  ? 109 LYS D CD  1 
ATOM   5023  C CE  . LYS D  1 109 ? -20.344  -36.144 0.010    1.00 91.93  ? 109 LYS D CE  1 
ATOM   5024  N NZ  . LYS D  1 109 ? -20.043  -34.678 0.002    1.00 90.36  ? 109 LYS D NZ  1 
ATOM   5025  N N   . GLY D  1 110 ? -14.826  -37.775 -4.046   1.00 94.60  ? 110 GLY D N   1 
ATOM   5026  C CA  . GLY D  1 110 ? -13.611  -38.435 -4.470   1.00 96.53  ? 110 GLY D CA  1 
ATOM   5027  C C   . GLY D  1 110 ? -13.304  -38.284 -5.948   1.00 95.34  ? 110 GLY D C   1 
ATOM   5028  O O   . GLY D  1 110 ? -12.210  -38.662 -6.396   1.00 96.90  ? 110 GLY D O   1 
ATOM   5029  N N   . LYS D  1 111 ? -14.260  -37.751 -6.711   1.00 92.83  ? 111 LYS D N   1 
ATOM   5030  C CA  . LYS D  1 111 ? -14.077  -37.581 -8.156   1.00 91.77  ? 111 LYS D CA  1 
ATOM   5031  C C   . LYS D  1 111 ? -14.304  -36.139 -8.633   1.00 89.48  ? 111 LYS D C   1 
ATOM   5032  O O   . LYS D  1 111 ? -14.818  -35.903 -9.732   1.00 87.98  ? 111 LYS D O   1 
ATOM   5033  C CB  . LYS D  1 111 ? -14.953  -38.569 -8.933   1.00 91.46  ? 111 LYS D CB  1 
ATOM   5034  C CG  . LYS D  1 111 ? -14.802  -40.019 -8.497   1.00 93.90  ? 111 LYS D CG  1 
ATOM   5035  C CD  . LYS D  1 111 ? -15.335  -40.976 -9.545   1.00 93.95  ? 111 LYS D CD  1 
ATOM   5036  C CE  . LYS D  1 111 ? -15.529  -42.350 -8.955   1.00 96.23  ? 111 LYS D CE  1 
ATOM   5037  N NZ  . LYS D  1 111 ? -16.708  -42.991 -9.580   1.00 95.52  ? 111 LYS D NZ  1 
ATOM   5038  N N   . ARG D  1 112 ? -13.907  -35.182 -7.801   1.00 89.45  ? 112 ARG D N   1 
ATOM   5039  C CA  . ARG D  1 112 ? -13.983  -33.763 -8.139   1.00 87.72  ? 112 ARG D CA  1 
ATOM   5040  C C   . ARG D  1 112 ? -12.562  -33.230 -8.259   1.00 88.97  ? 112 ARG D C   1 
ATOM   5041  O O   . ARG D  1 112 ? -11.805  -33.210 -7.291   1.00 90.56  ? 112 ARG D O   1 
ATOM   5042  C CB  . ARG D  1 112 ? -14.757  -33.001 -7.081   1.00 86.77  ? 112 ARG D CB  1 
ATOM   5043  C CG  . ARG D  1 112 ? -16.167  -33.525 -6.913   1.00 85.79  ? 112 ARG D CG  1 
ATOM   5044  C CD  . ARG D  1 112 ? -16.810  -32.912 -5.693   1.00 85.46  ? 112 ARG D CD  1 
ATOM   5045  N NE  . ARG D  1 112 ? -15.910  -32.985 -4.553   1.00 87.43  ? 112 ARG D NE  1 
ATOM   5046  C CZ  . ARG D  1 112 ? -16.229  -32.607 -3.316   1.00 87.89  ? 112 ARG D CZ  1 
ATOM   5047  N NH1 . ARG D  1 112 ? -17.444  -32.129 -3.049   1.00 86.48  ? 112 ARG D NH1 1 
ATOM   5048  N NH2 . ARG D  1 112 ? -15.333  -32.713 -2.336   1.00 89.95  ? 112 ARG D NH2 1 
ATOM   5049  N N   . PHE D  1 113 ? -12.209  -32.814 -9.468   1.00 88.43  ? 113 PHE D N   1 
ATOM   5050  C CA  . PHE D  1 113 ? -10.835  -32.454 -9.815   1.00 89.89  ? 113 PHE D CA  1 
ATOM   5051  C C   . PHE D  1 113 ? -10.718  -31.029 -10.354  1.00 88.77  ? 113 PHE D C   1 
ATOM   5052  O O   . PHE D  1 113 ? -11.711  -30.437 -10.806  1.00 86.81  ? 113 PHE D O   1 
ATOM   5053  C CB  . PHE D  1 113 ? -10.316  -33.397 -10.910  1.00 91.02  ? 113 PHE D CB  1 
ATOM   5054  C CG  . PHE D  1 113 ? -10.447  -34.871 -10.592  1.00 92.32  ? 113 PHE D CG  1 
ATOM   5055  C CD1 . PHE D  1 113 ? -11.530  -35.607 -11.086  1.00 91.30  ? 113 PHE D CD1 1 
ATOM   5056  C CD2 . PHE D  1 113 ? -9.471   -35.535 -9.830   1.00 94.81  ? 113 PHE D CD2 1 
ATOM   5057  C CE1 . PHE D  1 113 ? -11.649  -36.963 -10.817  1.00 92.72  ? 113 PHE D CE1 1 
ATOM   5058  C CE2 . PHE D  1 113 ? -9.590   -36.889 -9.555   1.00 96.27  ? 113 PHE D CE2 1 
ATOM   5059  C CZ  . PHE D  1 113 ? -10.675  -37.602 -10.053  1.00 95.23  ? 113 PHE D CZ  1 
ATOM   5060  N N   . ALA D  1 114 ? -9.502   -30.491 -10.335  1.00 90.22  ? 114 ALA D N   1 
ATOM   5061  C CA  . ALA D  1 114 ? -9.180   -29.243 -11.030  1.00 89.75  ? 114 ALA D CA  1 
ATOM   5062  C C   . ALA D  1 114 ? -7.790   -29.368 -11.621  1.00 91.90  ? 114 ALA D C   1 
ATOM   5063  O O   . ALA D  1 114 ? -6.927   -29.984 -11.010  1.00 93.86  ? 114 ALA D O   1 
ATOM   5064  C CB  . ALA D  1 114 ? -9.233   -28.066 -10.074  1.00 89.34  ? 114 ALA D CB  1 
ATOM   5065  N N   . LEU D  1 115 ? -7.552   -28.795 -12.794  1.00 91.81  ? 115 LEU D N   1 
ATOM   5066  C CA  . LEU D  1 115 ? -6.186   -28.778 -13.314  1.00 94.10  ? 115 LEU D CA  1 
ATOM   5067  C C   . LEU D  1 115 ? -5.300   -27.782 -12.533  1.00 95.31  ? 115 LEU D C   1 
ATOM   5068  O O   . LEU D  1 115 ? -5.821   -26.899 -11.861  1.00 94.11  ? 115 LEU D O   1 
ATOM   5069  C CB  . LEU D  1 115 ? -6.173   -28.534 -14.815  1.00 94.01  ? 115 LEU D CB  1 
ATOM   5070  C CG  . LEU D  1 115 ? -6.897   -29.606 -15.639  1.00 93.31  ? 115 LEU D CG  1 
ATOM   5071  C CD1 . LEU D  1 115 ? -6.402   -29.605 -17.082  1.00 94.40  ? 115 LEU D CD1 1 
ATOM   5072  C CD2 . LEU D  1 115 ? -6.699   -30.981 -15.023  1.00 94.37  ? 115 LEU D CD2 1 
ATOM   5073  N N   . PRO D  1 116 ? -3.963   -27.933 -12.588  1.00 97.86  ? 116 PRO D N   1 
ATOM   5074  C CA  . PRO D  1 116 ? -3.124   -27.186 -11.647  1.00 99.29  ? 116 PRO D CA  1 
ATOM   5075  C C   . PRO D  1 116 ? -3.340   -25.667 -11.667  1.00 98.36  ? 116 PRO D C   1 
ATOM   5076  O O   . PRO D  1 116 ? -3.284   -25.020 -10.622  1.00 98.46  ? 116 PRO D O   1 
ATOM   5077  C CB  . PRO D  1 116 ? -1.694   -27.519 -12.080  1.00 102.24 ? 116 PRO D CB  1 
ATOM   5078  C CG  . PRO D  1 116 ? -1.791   -28.698 -12.963  1.00 102.49 ? 116 PRO D CG  1 
ATOM   5079  C CD  . PRO D  1 116 ? -3.169   -28.751 -13.523  1.00 99.71  ? 116 PRO D CD  1 
ATOM   5080  N N   . ASN D  1 117 ? -3.581   -25.091 -12.835  1.00 97.67  ? 117 ASN D N   1 
ATOM   5081  C CA  . ASN D  1 117 ? -3.704   -23.649 -12.906  1.00 97.22  ? 117 ASN D CA  1 
ATOM   5082  C C   . ASN D  1 117 ? -5.102   -23.120 -13.030  1.00 94.56  ? 117 ASN D C   1 
ATOM   5083  O O   . ASN D  1 117 ? -5.270   -21.920 -13.195  1.00 94.26  ? 117 ASN D O   1 
ATOM   5084  C CB  . ASN D  1 117 ? -2.861   -23.105 -14.035  1.00 98.91  ? 117 ASN D CB  1 
ATOM   5085  C CG  . ASN D  1 117 ? -1.413   -23.355 -13.818  1.00 101.84 ? 117 ASN D CG  1 
ATOM   5086  O OD1 . ASN D  1 117 ? -0.804   -24.058 -14.592  1.00 103.27 ? 117 ASN D OD1 1 
ATOM   5087  N ND2 . ASN D  1 117 ? -0.855   -22.791 -12.758  1.00 102.90 ? 117 ASN D ND2 1 
ATOM   5088  N N   . ALA D  1 118 ? -6.094   -24.007 -12.965  1.00 92.85  ? 118 ALA D N   1 
ATOM   5089  C CA  . ALA D  1 118 ? -7.498   -23.611 -12.895  1.00 90.40  ? 118 ALA D CA  1 
ATOM   5090  C C   . ALA D  1 118 ? -7.782   -22.768 -11.637  1.00 89.93  ? 118 ALA D C   1 
ATOM   5091  O O   . ALA D  1 118 ? -7.129   -22.903 -10.617  1.00 91.15  ? 118 ALA D O   1 
ATOM   5092  C CB  . ALA D  1 118 ? -8.380   -24.837 -12.934  1.00 89.12  ? 118 ALA D CB  1 
ATOM   5093  N N   . GLU D  1 119 ? -8.744   -21.873 -11.738  1.00 93.05  ? 119 GLU D N   1 
ATOM   5094  C CA  . GLU D  1 119 ? -9.147   -21.013 -10.633  1.00 91.11  ? 119 GLU D CA  1 
ATOM   5095  C C   . GLU D  1 119 ? -10.571  -21.286 -10.217  1.00 88.30  ? 119 GLU D C   1 
ATOM   5096  O O   . GLU D  1 119 ? -11.433  -21.611 -11.049  1.00 88.17  ? 119 GLU D O   1 
ATOM   5097  C CB  . GLU D  1 119 ? -9.064   -19.538 -11.048  1.00 92.67  ? 119 GLU D CB  1 
ATOM   5098  C CG  . GLU D  1 119 ? -7.701   -18.926 -10.753  1.00 95.11  ? 119 GLU D CG  1 
ATOM   5099  C CD  . GLU D  1 119 ? -7.523   -17.555 -11.378  1.00 97.70  ? 119 GLU D CD  1 
ATOM   5100  O OE1 . GLU D  1 119 ? -6.323   -17.148 -11.514  1.00 100.78 ? 119 GLU D OE1 1 
ATOM   5101  O OE2 . GLU D  1 119 ? -8.566   -16.900 -11.727  1.00 96.95  ? 119 GLU D OE2 1 
ATOM   5102  N N   . VAL D  1 120 ? -10.825  -21.121 -8.931   1.00 86.45  ? 120 VAL D N   1 
ATOM   5103  C CA  . VAL D  1 120 ? -12.170  -21.259 -8.424   1.00 84.04  ? 120 VAL D CA  1 
ATOM   5104  C C   . VAL D  1 120 ? -12.520  -19.966 -7.720   1.00 83.29  ? 120 VAL D C   1 
ATOM   5105  O O   . VAL D  1 120 ? -11.646  -19.353 -7.070   1.00 84.32  ? 120 VAL D O   1 
ATOM   5106  C CB  . VAL D  1 120 ? -12.266  -22.451 -7.460   1.00 82.95  ? 120 VAL D CB  1 
ATOM   5107  C CG1 . VAL D  1 120 ? -13.617  -22.503 -6.768   1.00 80.85  ? 120 VAL D CG1 1 
ATOM   5108  C CG2 . VAL D  1 120 ? -12.024  -23.732 -8.218   1.00 83.98  ? 120 VAL D CG2 1 
ATOM   5109  N N   . MET D  1 121 ? -13.771  -19.531 -7.865   1.00 81.87  ? 121 MET D N   1 
ATOM   5110  C CA  . MET D  1 121 ? -14.206  -18.338 -7.167   1.00 81.21  ? 121 MET D CA  1 
ATOM   5111  C C   . MET D  1 121 ? -15.572  -18.567 -6.588   1.00 78.92  ? 121 MET D C   1 
ATOM   5112  O O   . MET D  1 121 ? -16.464  -19.094 -7.270   1.00 78.19  ? 121 MET D O   1 
ATOM   5113  C CB  . MET D  1 121 ? -14.162  -17.098 -8.071   1.00 82.75  ? 121 MET D CB  1 
ATOM   5114  C CG  . MET D  1 121 ? -14.503  -15.792 -7.359   1.00 82.61  ? 121 MET D CG  1 
ATOM   5115  S SD  . MET D  1 121 ? -16.270  -15.359 -7.424   1.00 80.43  ? 121 MET D SD  1 
ATOM   5116  C CE  . MET D  1 121 ? -16.335  -14.516 -9.022   1.00 82.61  ? 121 MET D CE  1 
ATOM   5117  N N   . ILE D  1 122 ? -15.725  -18.192 -5.322   1.00 78.21  ? 122 ILE D N   1 
ATOM   5118  C CA  . ILE D  1 122 ? -17.025  -18.295 -4.656   1.00 76.38  ? 122 ILE D CA  1 
ATOM   5119  C C   . ILE D  1 122 ? -17.456  -16.896 -4.200   1.00 76.29  ? 122 ILE D C   1 
ATOM   5120  O O   . ILE D  1 122 ? -16.599  -16.030 -3.889   1.00 77.82  ? 122 ILE D O   1 
ATOM   5121  C CB  . ILE D  1 122 ? -17.011  -19.315 -3.487   1.00 75.99  ? 122 ILE D CB  1 
ATOM   5122  C CG1 . ILE D  1 122 ? -15.932  -18.922 -2.502   1.00 77.37  ? 122 ILE D CG1 1 
ATOM   5123  C CG2 . ILE D  1 122 ? -16.788  -20.730 -4.008   1.00 76.22  ? 122 ILE D CG2 1 
ATOM   5124  C CD1 . ILE D  1 122 ? -16.015  -19.614 -1.171   1.00 77.51  ? 122 ILE D CD1 1 
ATOM   5125  N N   . HIS D  1 123 ? -18.769  -16.669 -4.193   1.00 74.84  ? 123 HIS D N   1 
ATOM   5126  C CA  . HIS D  1 123 ? -19.358  -15.403 -3.684   1.00 74.69  ? 123 HIS D CA  1 
ATOM   5127  C C   . HIS D  1 123 ? -20.854  -15.526 -3.557   1.00 72.95  ? 123 HIS D C   1 
ATOM   5128  O O   . HIS D  1 123 ? -21.451  -16.527 -4.029   1.00 72.09  ? 123 HIS D O   1 
ATOM   5129  C CB  . HIS D  1 123 ? -18.936  -14.177 -4.523   1.00 76.17  ? 123 HIS D CB  1 
ATOM   5130  C CG  . HIS D  1 123 ? -19.611  -14.073 -5.877   1.00 75.95  ? 123 HIS D CG  1 
ATOM   5131  N ND1 . HIS D  1 123 ? -20.000  -15.156 -6.602   1.00 75.23  ? 123 HIS D ND1 1 
ATOM   5132  C CD2 . HIS D  1 123 ? -19.938  -12.956 -6.646   1.00 76.92  ? 123 HIS D CD2 1 
ATOM   5133  C CE1 . HIS D  1 123 ? -20.586  -14.748 -7.751   1.00 75.72  ? 123 HIS D CE1 1 
ATOM   5134  N NE2 . HIS D  1 123 ? -20.540  -13.409 -7.785   1.00 76.71  ? 123 HIS D NE2 1 
ATOM   5135  N N   . GLN D  1 124 ? -21.480  -14.540 -2.916   1.00 72.75  ? 124 GLN D N   1 
ATOM   5136  C CA  . GLN D  1 124 ? -22.946  -14.589 -2.724   1.00 71.26  ? 124 GLN D CA  1 
ATOM   5137  C C   . GLN D  1 124 ? -23.721  -14.356 -4.029   1.00 70.73  ? 124 GLN D C   1 
ATOM   5138  O O   . GLN D  1 124 ? -23.169  -13.804 -5.001   1.00 71.79  ? 124 GLN D O   1 
ATOM   5139  C CB  . GLN D  1 124 ? -23.427  -13.668 -1.600   1.00 71.42  ? 124 GLN D CB  1 
ATOM   5140  C CG  . GLN D  1 124 ? -23.003  -12.228 -1.742   1.00 72.75  ? 124 GLN D CG  1 
ATOM   5141  C CD  . GLN D  1 124 ? -23.530  -11.363 -0.628   1.00 73.24  ? 124 GLN D CD  1 
ATOM   5142  O OE1 . GLN D  1 124 ? -22.780  -10.663 0.066    1.00 75.14  ? 124 GLN D OE1 1 
ATOM   5143  N NE2 . GLN D  1 124 ? -24.825  -11.407 -0.441   1.00 71.90  ? 124 GLN D NE2 1 
ATOM   5144  N N   . PRO D  1 125 ? -24.977  -14.814 -4.071   1.00 69.55  ? 125 PRO D N   1 
ATOM   5145  C CA  . PRO D  1 125 ? -25.776  -14.598 -5.271   1.00 69.42  ? 125 PRO D CA  1 
ATOM   5146  C C   . PRO D  1 125 ? -26.123  -13.128 -5.473   1.00 69.74  ? 125 PRO D C   1 
ATOM   5147  O O   . PRO D  1 125 ? -26.188  -12.356 -4.515   1.00 69.68  ? 125 PRO D O   1 
ATOM   5148  C CB  . PRO D  1 125 ? -27.050  -15.438 -5.034   1.00 68.41  ? 125 PRO D CB  1 
ATOM   5149  C CG  . PRO D  1 125 ? -27.101  -15.697 -3.579   1.00 68.00  ? 125 PRO D CG  1 
ATOM   5150  C CD  . PRO D  1 125 ? -25.690  -15.576 -3.033   1.00 68.80  ? 125 PRO D CD  1 
ATOM   5151  N N   . LEU D  1 126 ? -26.316  -12.765 -6.733   1.00 70.54  ? 126 LEU D N   1 
ATOM   5152  C CA  . LEU D  1 126 ? -26.686  -11.426 -7.120   1.00 71.29  ? 126 LEU D CA  1 
ATOM   5153  C C   . LEU D  1 126 ? -28.138  -11.435 -7.597   1.00 70.57  ? 126 LEU D C   1 
ATOM   5154  O O   . LEU D  1 126 ? -28.632  -12.476 -8.086   1.00 70.24  ? 126 LEU D O   1 
ATOM   5155  C CB  . LEU D  1 126 ? -25.779  -10.966 -8.246   1.00 73.48  ? 126 LEU D CB  1 
ATOM   5156  C CG  . LEU D  1 126 ? -24.285  -11.007 -7.950   1.00 74.64  ? 126 LEU D CG  1 
ATOM   5157  C CD1 . LEU D  1 126 ? -23.495  -11.256 -9.225   1.00 76.66  ? 126 LEU D CD1 1 
ATOM   5158  C CD2 . LEU D  1 126 ? -23.821  -9.729  -7.261   1.00 75.79  ? 126 LEU D CD2 1 
ATOM   5159  N N   . GLY D  1 127 ? -28.822  -10.295 -7.455   1.00 70.64  ? 127 GLY D N   1 
ATOM   5160  C CA  . GLY D  1 127 ? -30.175  -10.163 -7.958   1.00 70.26  ? 127 GLY D CA  1 
ATOM   5161  C C   . GLY D  1 127 ? -30.603  -8.732  -8.054   1.00 71.06  ? 127 GLY D C   1 
ATOM   5162  O O   . GLY D  1 127 ? -29.781  -7.820  -8.059   1.00 72.50  ? 127 GLY D O   1 
ATOM   5163  N N   . GLY D  1 128 ? -31.913  -8.536  -8.106   1.00 70.40  ? 128 GLY D N   1 
ATOM   5164  C CA  . GLY D  1 128 ? -32.473  -7.194  -8.267   1.00 71.29  ? 128 GLY D CA  1 
ATOM   5165  C C   . GLY D  1 128 ? -33.927  -7.190  -7.830   1.00 69.96  ? 128 GLY D C   1 
ATOM   5166  O O   . GLY D  1 128 ? -34.565  -8.241  -7.786   1.00 68.89  ? 128 GLY D O   1 
ATOM   5167  N N   . ALA D  1 129 ? -34.445  -6.009  -7.501   1.00 70.34  ? 129 ALA D N   1 
ATOM   5168  C CA  . ALA D  1 129 ? -35.851  -5.843  -7.163   1.00 69.43  ? 129 ALA D CA  1 
ATOM   5169  C C   . ALA D  1 129 ? -36.235  -4.434  -7.496   1.00 70.85  ? 129 ALA D C   1 
ATOM   5170  O O   . ALA D  1 129 ? -35.508  -3.499  -7.154   1.00 72.03  ? 129 ALA D O   1 
ATOM   5171  C CB  . ALA D  1 129 ? -36.058  -6.082  -5.688   1.00 68.02  ? 129 ALA D CB  1 
ATOM   5172  N N   . GLN D  1 130 ? -37.373  -4.288  -8.170   1.00 71.12  ? 130 GLN D N   1 
ATOM   5173  C CA  . GLN D  1 130 ? -37.867  -2.979  -8.604   1.00 72.76  ? 130 GLN D CA  1 
ATOM   5174  C C   . GLN D  1 130 ? -39.338  -2.884  -8.180   1.00 71.70  ? 130 GLN D C   1 
ATOM   5175  O O   . GLN D  1 130 ? -40.100  -3.851  -8.311   1.00 70.68  ? 130 GLN D O   1 
ATOM   5176  C CB  . GLN D  1 130 ? -37.727  -2.894  -10.113  1.00 74.96  ? 130 GLN D CB  1 
ATOM   5177  C CG  . GLN D  1 130 ? -37.739  -1.491  -10.697  1.00 77.63  ? 130 GLN D CG  1 
ATOM   5178  C CD  . GLN D  1 130 ? -36.546  -0.653  -10.219  1.00 78.95  ? 130 GLN D CD  1 
ATOM   5179  O OE1 . GLN D  1 130 ? -35.463  -1.210  -9.910   1.00 78.48  ? 130 GLN D OE1 1 
ATOM   5180  N NE2 . GLN D  1 130 ? -36.736  0.699   -10.141  1.00 80.93  ? 130 GLN D NE2 1 
ATOM   5181  N N   . GLY D  1 131 ? -39.759  -1.756  -7.652   1.00 72.21  ? 131 GLY D N   1 
ATOM   5182  C CA  . GLY D  1 131 ? -41.173  -1.578  -7.464   1.00 71.66  ? 131 GLY D CA  1 
ATOM   5183  C C   . GLY D  1 131 ? -41.549  -1.092  -6.093   1.00 70.90  ? 131 GLY D C   1 
ATOM   5184  O O   . GLY D  1 131 ? -40.795  -0.350  -5.456   1.00 71.69  ? 131 GLY D O   1 
ATOM   5185  N N   . GLN D  1 132 ? -42.750  -1.478  -5.657   1.00 69.82  ? 132 GLN D N   1 
ATOM   5186  C CA  . GLN D  1 132 ? -43.288  -1.137  -4.342   1.00 69.35  ? 132 GLN D CA  1 
ATOM   5187  C C   . GLN D  1 132 ? -42.473  -1.779  -3.242   1.00 68.58  ? 132 GLN D C   1 
ATOM   5188  O O   . GLN D  1 132 ? -41.870  -2.855  -3.438   1.00 67.77  ? 132 GLN D O   1 
ATOM   5189  C CB  . GLN D  1 132 ? -44.718  -1.633  -4.232   1.00 68.63  ? 132 GLN D CB  1 
ATOM   5190  C CG  . GLN D  1 132 ? -45.665  -0.936  -5.171   1.00 69.63  ? 132 GLN D CG  1 
ATOM   5191  C CD  . GLN D  1 132 ? -47.091  -1.317  -4.917   1.00 69.23  ? 132 GLN D CD  1 
ATOM   5192  O OE1 . GLN D  1 132 ? -47.471  -2.468  -5.065   1.00 68.63  ? 132 GLN D OE1 1 
ATOM   5193  N NE2 . GLN D  1 132 ? -47.882  -0.357  -4.514   1.00 69.85  ? 132 GLN D NE2 1 
ATOM   5194  N N   . ALA D  1 133 ? -42.486  -1.114  -2.076   1.00 69.17  ? 133 ALA D N   1 
ATOM   5195  C CA  . ALA D  1 133 ? -41.820  -1.628  -0.844   1.00 69.04  ? 133 ALA D CA  1 
ATOM   5196  C C   . ALA D  1 133 ? -42.148  -3.104  -0.551   1.00 67.70  ? 133 ALA D C   1 
ATOM   5197  O O   . ALA D  1 133 ? -41.253  -3.898  -0.293   1.00 67.38  ? 133 ALA D O   1 
ATOM   5198  C CB  . ALA D  1 133 ? -42.157  -0.751  0.339    1.00 70.35  ? 133 ALA D CB  1 
ATOM   5199  N N   . THR D  1 134 ? -43.428  -3.453  -0.622   1.00 67.25  ? 134 THR D N   1 
ATOM   5200  C CA  . THR D  1 134 ? -43.898  -4.811  -0.473   1.00 66.57  ? 134 THR D CA  1 
ATOM   5201  C C   . THR D  1 134 ? -43.231  -5.776  -1.445   1.00 65.91  ? 134 THR D C   1 
ATOM   5202  O O   . THR D  1 134 ? -42.802  -6.880  -1.049   1.00 65.67  ? 134 THR D O   1 
ATOM   5203  C CB  . THR D  1 134 ? -45.399  -4.792  -0.669   1.00 66.70  ? 134 THR D CB  1 
ATOM   5204  O OG1 . THR D  1 134 ? -45.918  -4.181  0.491    1.00 67.49  ? 134 THR D OG1 1 
ATOM   5205  C CG2 . THR D  1 134 ? -46.007  -6.172  -0.740   1.00 66.56  ? 134 THR D CG2 1 
ATOM   5206  N N   . GLU D  1 135 ? -43.152  -5.359  -2.714   1.00 65.99  ? 135 GLU D N   1 
ATOM   5207  C CA  . GLU D  1 135 ? -42.511  -6.161  -3.758   1.00 65.84  ? 135 GLU D CA  1 
ATOM   5208  C C   . GLU D  1 135 ? -41.039  -6.371  -3.484   1.00 65.69  ? 135 GLU D C   1 
ATOM   5209  O O   . GLU D  1 135 ? -40.565  -7.467  -3.603   1.00 65.36  ? 135 GLU D O   1 
ATOM   5210  C CB  . GLU D  1 135 ? -42.737  -5.554  -5.131   1.00 66.62  ? 135 GLU D CB  1 
ATOM   5211  C CG  . GLU D  1 135 ? -44.149  -5.762  -5.602   1.00 66.98  ? 135 GLU D CG  1 
ATOM   5212  C CD  . GLU D  1 135 ? -44.492  -4.959  -6.849   1.00 68.24  ? 135 GLU D CD  1 
ATOM   5213  O OE1 . GLU D  1 135 ? -43.880  -3.873  -7.073   1.00 68.91  ? 135 GLU D OE1 1 
ATOM   5214  O OE2 . GLU D  1 135 ? -45.399  -5.417  -7.612   1.00 69.01  ? 135 GLU D OE2 1 
ATOM   5215  N N   . ILE D  1 136 ? -40.342  -5.320  -3.103   1.00 66.23  ? 136 ILE D N   1 
ATOM   5216  C CA  . ILE D  1 136 ? -38.922  -5.395  -2.781   1.00 66.48  ? 136 ILE D CA  1 
ATOM   5217  C C   . ILE D  1 136 ? -38.647  -6.334  -1.590   1.00 66.04  ? 136 ILE D C   1 
ATOM   5218  O O   . ILE D  1 136 ? -37.717  -7.156  -1.607   1.00 65.84  ? 136 ILE D O   1 
ATOM   5219  C CB  . ILE D  1 136 ? -38.348  -3.995  -2.513   1.00 67.80  ? 136 ILE D CB  1 
ATOM   5220  C CG1 . ILE D  1 136 ? -38.334  -3.217  -3.812   1.00 68.76  ? 136 ILE D CG1 1 
ATOM   5221  C CG2 . ILE D  1 136 ? -36.940  -4.078  -1.928   1.00 68.44  ? 136 ILE D CG2 1 
ATOM   5222  C CD1 . ILE D  1 136 ? -38.190  -1.725  -3.647   1.00 70.54  ? 136 ILE D CD1 1 
ATOM   5223  N N   . GLU D  1 137 ? -39.475  -6.225  -0.573   1.00 66.18  ? 137 GLU D N   1 
ATOM   5224  C CA  . GLU D  1 137 ? -39.405  -7.143  0.519    1.00 66.30  ? 137 GLU D CA  1 
ATOM   5225  C C   . GLU D  1 137 ? -39.553  -8.631  0.103    1.00 65.67  ? 137 GLU D C   1 
ATOM   5226  O O   . GLU D  1 137 ? -38.796  -9.467  0.512    1.00 65.82  ? 137 GLU D O   1 
ATOM   5227  C CB  . GLU D  1 137 ? -40.452  -6.757  1.534    1.00 67.01  ? 137 GLU D CB  1 
ATOM   5228  C CG  . GLU D  1 137 ? -40.328  -7.503  2.842    1.00 67.97  ? 137 GLU D CG  1 
ATOM   5229  C CD  . GLU D  1 137 ? -41.531  -7.288  3.743    1.00 69.00  ? 137 GLU D CD  1 
ATOM   5230  O OE1 . GLU D  1 137 ? -42.651  -7.001  3.215    1.00 68.51  ? 137 GLU D OE1 1 
ATOM   5231  O OE2 . GLU D  1 137 ? -41.339  -7.440  4.984    1.00 70.60  ? 137 GLU D OE2 1 
ATOM   5232  N N   . ILE D  1 138 ? -40.527  -8.957  -0.719   1.00 65.31  ? 138 ILE D N   1 
ATOM   5233  C CA  . ILE D  1 138 ? -40.651  -10.298 -1.236   1.00 65.26  ? 138 ILE D CA  1 
ATOM   5234  C C   . ILE D  1 138 ? -39.375  -10.742 -1.960   1.00 65.01  ? 138 ILE D C   1 
ATOM   5235  O O   . ILE D  1 138 ? -38.904  -11.859 -1.752   1.00 65.21  ? 138 ILE D O   1 
ATOM   5236  C CB  . ILE D  1 138 ? -41.897  -10.444 -2.105   1.00 65.44  ? 138 ILE D CB  1 
ATOM   5237  C CG1 . ILE D  1 138 ? -43.120  -10.444 -1.226   1.00 66.00  ? 138 ILE D CG1 1 
ATOM   5238  C CG2 . ILE D  1 138 ? -41.879  -11.733 -2.857   1.00 65.90  ? 138 ILE D CG2 1 
ATOM   5239  C CD1 . ILE D  1 138 ? -44.347  -9.875  -1.901   1.00 66.20  ? 138 ILE D CD1 1 
ATOM   5240  N N   . ALA D  1 139 ? -38.794  -9.870  -2.777   1.00 64.90  ? 139 ALA D N   1 
ATOM   5241  C CA  . ALA D  1 139 ? -37.620  -10.233 -3.549   1.00 65.00  ? 139 ALA D CA  1 
ATOM   5242  C C   . ALA D  1 139 ? -36.423  -10.450 -2.617   1.00 65.02  ? 139 ALA D C   1 
ATOM   5243  O O   . ALA D  1 139 ? -35.635  -11.378 -2.790   1.00 65.07  ? 139 ALA D O   1 
ATOM   5244  C CB  . ALA D  1 139 ? -37.328  -9.157  -4.555   1.00 65.48  ? 139 ALA D CB  1 
ATOM   5245  N N   . ALA D  1 140 ? -36.309  -9.582  -1.622   1.00 65.28  ? 140 ALA D N   1 
ATOM   5246  C CA  . ALA D  1 140 ? -35.220  -9.629  -0.700   1.00 65.81  ? 140 ALA D CA  1 
ATOM   5247  C C   . ALA D  1 140 ? -35.253  -10.919 0.109    1.00 65.91  ? 140 ALA D C   1 
ATOM   5248  O O   . ALA D  1 140 ? -34.195  -11.563 0.379    1.00 66.25  ? 140 ALA D O   1 
ATOM   5249  C CB  . ALA D  1 140 ? -35.290  -8.434  0.217    1.00 66.68  ? 140 ALA D CB  1 
ATOM   5250  N N   . ASN D  1 141 ? -36.459  -11.294 0.524    1.00 65.94  ? 141 ASN D N   1 
ATOM   5251  C CA  . ASN D  1 141 ? -36.644  -12.529 1.288    1.00 66.62  ? 141 ASN D CA  1 
ATOM   5252  C C   . ASN D  1 141 ? -36.266  -13.720 0.429    1.00 66.38  ? 141 ASN D C   1 
ATOM   5253  O O   . ASN D  1 141 ? -35.580  -14.622 0.882    1.00 67.02  ? 141 ASN D O   1 
ATOM   5254  C CB  . ASN D  1 141 ? -38.085  -12.662 1.780    1.00 67.14  ? 141 ASN D CB  1 
ATOM   5255  C CG  . ASN D  1 141 ? -38.387  -11.724 2.939    1.00 68.01  ? 141 ASN D CG  1 
ATOM   5256  O OD1 . ASN D  1 141 ? -37.452  -11.208 3.586    1.00 68.65  ? 141 ASN D OD1 1 
ATOM   5257  N ND2 . ASN D  1 141 ? -39.692  -11.488 3.207    1.00 68.40  ? 141 ASN D ND2 1 
ATOM   5258  N N   . HIS D  1 142 ? -36.684  -13.698 -0.826   1.00 65.80  ? 142 HIS D N   1 
ATOM   5259  C CA  . HIS D  1 142 ? -36.381  -14.791 -1.719   1.00 66.03  ? 142 HIS D CA  1 
ATOM   5260  C C   . HIS D  1 142 ? -34.900  -14.969 -1.946   1.00 65.94  ? 142 HIS D C   1 
ATOM   5261  O O   . HIS D  1 142 ? -34.405  -16.096 -1.912   1.00 66.51  ? 142 HIS D O   1 
ATOM   5262  C CB  . HIS D  1 142 ? -37.114  -14.638 -3.034   1.00 65.99  ? 142 HIS D CB  1 
ATOM   5263  C CG  . HIS D  1 142 ? -36.860  -15.753 -3.993   1.00 66.79  ? 142 HIS D CG  1 
ATOM   5264  N ND1 . HIS D  1 142 ? -36.267  -15.558 -5.194   1.00 66.96  ? 142 HIS D ND1 1 
ATOM   5265  C CD2 . HIS D  1 142 ? -37.123  -17.118 -3.895   1.00 67.96  ? 142 HIS D CD2 1 
ATOM   5266  C CE1 . HIS D  1 142 ? -36.171  -16.733 -5.848   1.00 68.12  ? 142 HIS D CE1 1 
ATOM   5267  N NE2 . HIS D  1 142 ? -36.702  -17.694 -5.055   1.00 68.73  ? 142 HIS D NE2 1 
ATOM   5268  N N   . ILE D  1 143 ? -34.178  -13.884 -2.182   1.00 65.54  ? 143 ILE D N   1 
ATOM   5269  C CA  . ILE D  1 143 ? -32.778  -14.027 -2.448   1.00 65.75  ? 143 ILE D CA  1 
ATOM   5270  C C   . ILE D  1 143 ? -32.020  -14.443 -1.166   1.00 66.23  ? 143 ILE D C   1 
ATOM   5271  O O   . ILE D  1 143 ? -31.085  -15.250 -1.235   1.00 66.60  ? 143 ILE D O   1 
ATOM   5272  C CB  . ILE D  1 143 ? -32.164  -12.814 -3.162   1.00 65.84  ? 143 ILE D CB  1 
ATOM   5273  C CG1 . ILE D  1 143 ? -30.820  -13.207 -3.747   1.00 66.37  ? 143 ILE D CG1 1 
ATOM   5274  C CG2 . ILE D  1 143 ? -31.995  -11.614 -2.229   1.00 66.09  ? 143 ILE D CG2 1 
ATOM   5275  C CD1 . ILE D  1 143 ? -30.178  -12.145 -4.611   1.00 67.10  ? 143 ILE D CD1 1 
ATOM   5276  N N   . LEU D  1 144 ? -32.421  -13.930 -0.002   1.00 66.55  ? 144 LEU D N   1 
ATOM   5277  C CA  . LEU D  1 144 ? -31.802  -14.371 1.246    1.00 67.60  ? 144 LEU D CA  1 
ATOM   5278  C C   . LEU D  1 144 ? -32.018  -15.874 1.480    1.00 68.18  ? 144 LEU D C   1 
ATOM   5279  O O   . LEU D  1 144 ? -31.110  -16.602 1.918    1.00 69.02  ? 144 LEU D O   1 
ATOM   5280  C CB  . LEU D  1 144 ? -32.299  -13.554 2.428    1.00 68.42  ? 144 LEU D CB  1 
ATOM   5281  C CG  . LEU D  1 144 ? -31.835  -12.100 2.438    1.00 68.65  ? 144 LEU D CG  1 
ATOM   5282  C CD1 . LEU D  1 144 ? -32.659  -11.295 3.426    1.00 69.55  ? 144 LEU D CD1 1 
ATOM   5283  C CD2 . LEU D  1 144 ? -30.351  -11.944 2.741    1.00 69.73  ? 144 LEU D CD2 1 
ATOM   5284  N N   . LYS D  1 145 ? -33.203  -16.349 1.141    1.00 68.04  ? 145 LYS D N   1 
ATOM   5285  C CA  . LYS D  1 145 ? -33.549  -17.747 1.321    1.00 69.14  ? 145 LYS D CA  1 
ATOM   5286  C C   . LYS D  1 145 ? -32.721  -18.585 0.397    1.00 69.07  ? 145 LYS D C   1 
ATOM   5287  O O   . LYS D  1 145 ? -32.266  -19.655 0.774    1.00 70.25  ? 145 LYS D O   1 
ATOM   5288  C CB  . LYS D  1 145 ? -35.038  -17.987 1.106    1.00 69.44  ? 145 LYS D CB  1 
ATOM   5289  C CG  . LYS D  1 145 ? -35.479  -19.168 1.886    1.00 71.43  ? 145 LYS D CG  1 
ATOM   5290  C CD  . LYS D  1 145 ? -36.976  -19.337 1.977    1.00 72.35  ? 145 LYS D CD  1 
ATOM   5291  C CE  . LYS D  1 145 ? -37.256  -20.707 2.642    1.00 75.04  ? 145 LYS D CE  1 
ATOM   5292  N NZ  . LYS D  1 145 ? -38.666  -21.201 2.454    1.00 76.58  ? 145 LYS D NZ  1 
ATOM   5293  N N   . THR D  1 146 ? -32.497  -18.077 -0.807   1.00 68.03  ? 146 THR D N   1 
ATOM   5294  C CA  . THR D  1 146 ? -31.659  -18.762 -1.808   1.00 68.22  ? 146 THR D CA  1 
ATOM   5295  C C   . THR D  1 146 ? -30.205  -18.856 -1.307   1.00 68.44  ? 146 THR D C   1 
ATOM   5296  O O   . THR D  1 146 ? -29.525  -19.873 -1.516   1.00 69.20  ? 146 THR D O   1 
ATOM   5297  C CB  . THR D  1 146 ? -31.759  -18.116 -3.213   1.00 67.63  ? 146 THR D CB  1 
ATOM   5298  O OG1 . THR D  1 146 ? -33.086  -18.343 -3.738   1.00 67.96  ? 146 THR D OG1 1 
ATOM   5299  C CG2 . THR D  1 146 ? -30.818  -18.760 -4.154   1.00 68.24  ? 146 THR D CG2 1 
ATOM   5300  N N   . ARG D  1 147 ? -29.728  -17.807 -0.631   1.00 68.11  ? 147 ARG D N   1 
ATOM   5301  C CA  . ARG D  1 147 ? -28.386  -17.834 -0.124   1.00 68.70  ? 147 ARG D CA  1 
ATOM   5302  C C   . ARG D  1 147 ? -28.229  -18.910 0.951    1.00 70.01  ? 147 ARG D C   1 
ATOM   5303  O O   . ARG D  1 147 ? -27.208  -19.599 0.985    1.00 70.72  ? 147 ARG D O   1 
ATOM   5304  C CB  . ARG D  1 147 ? -27.949  -16.486 0.424    1.00 68.75  ? 147 ARG D CB  1 
ATOM   5305  C CG  . ARG D  1 147 ? -26.428  -16.424 0.567    1.00 69.58  ? 147 ARG D CG  1 
ATOM   5306  C CD  . ARG D  1 147 ? -25.936  -15.170 1.250    1.00 70.41  ? 147 ARG D CD  1 
ATOM   5307  N NE  . ARG D  1 147 ? -24.468  -15.192 1.354    1.00 71.58  ? 147 ARG D NE  1 
ATOM   5308  C CZ  . ARG D  1 147 ? -23.732  -14.315 2.056    1.00 73.13  ? 147 ARG D CZ  1 
ATOM   5309  N NH1 . ARG D  1 147 ? -24.302  -13.336 2.733    1.00 73.73  ? 147 ARG D NH1 1 
ATOM   5310  N NH2 . ARG D  1 147 ? -22.418  -14.414 2.085    1.00 74.39  ? 147 ARG D NH2 1 
ATOM   5311  N N   . GLU D  1 148 ? -29.225  -19.037 1.832    1.00 70.64  ? 148 GLU D N   1 
ATOM   5312  C CA  . GLU D  1 148 ? -29.201  -20.076 2.841    1.00 72.47  ? 148 GLU D CA  1 
ATOM   5313  C C   . GLU D  1 148 ? -29.178  -21.447 2.181    1.00 73.05  ? 148 GLU D C   1 
ATOM   5314  O O   . GLU D  1 148 ? -28.451  -22.333 2.589    1.00 74.43  ? 148 GLU D O   1 
ATOM   5315  C CB  . GLU D  1 148 ? -30.427  -19.982 3.720    1.00 73.39  ? 148 GLU D CB  1 
ATOM   5316  C CG  . GLU D  1 148 ? -30.277  -18.956 4.816    1.00 74.08  ? 148 GLU D CG  1 
ATOM   5317  C CD  . GLU D  1 148 ? -31.577  -18.754 5.602    1.00 75.10  ? 148 GLU D CD  1 
ATOM   5318  O OE1 . GLU D  1 148 ? -31.675  -17.693 6.308    1.00 75.52  ? 148 GLU D OE1 1 
ATOM   5319  O OE2 . GLU D  1 148 ? -32.503  -19.637 5.500    1.00 75.80  ? 148 GLU D OE2 1 
ATOM   5320  N N   . LYS D  1 149 ? -29.978  -21.616 1.143    1.00 72.33  ? 149 LYS D N   1 
ATOM   5321  C CA  . LYS D  1 149 ? -30.037  -22.896 0.474    1.00 73.39  ? 149 LYS D CA  1 
ATOM   5322  C C   . LYS D  1 149 ? -28.686  -23.250 -0.115   1.00 73.29  ? 149 LYS D C   1 
ATOM   5323  O O   . LYS D  1 149 ? -28.216  -24.376 0.006    1.00 74.80  ? 149 LYS D O   1 
ATOM   5324  C CB  . LYS D  1 149 ? -31.133  -22.890 -0.597   1.00 73.02  ? 149 LYS D CB  1 
ATOM   5325  C CG  . LYS D  1 149 ? -31.190  -24.166 -1.428   1.00 74.60  ? 149 LYS D CG  1 
ATOM   5326  C CD  . LYS D  1 149 ? -32.570  -24.375 -2.036   1.00 75.39  ? 149 LYS D CD  1 
ATOM   5327  C CE  . LYS D  1 149 ? -32.679  -23.930 -3.480   1.00 74.65  ? 149 LYS D CE  1 
ATOM   5328  N NZ  . LYS D  1 149 ? -34.103  -24.051 -3.902   1.00 75.69  ? 149 LYS D NZ  1 
ATOM   5329  N N   . LEU D  1 150 ? -28.068  -22.282 -0.754   1.00 71.81  ? 150 LEU D N   1 
ATOM   5330  C CA  . LEU D  1 150 ? -26.776  -22.487 -1.366   1.00 71.86  ? 150 LEU D CA  1 
ATOM   5331  C C   . LEU D  1 150 ? -25.723  -22.799 -0.321   1.00 72.77  ? 150 LEU D C   1 
ATOM   5332  O O   . LEU D  1 150 ? -24.978  -23.777 -0.448   1.00 73.84  ? 150 LEU D O   1 
ATOM   5333  C CB  . LEU D  1 150 ? -26.357  -21.256 -2.187   1.00 70.60  ? 150 LEU D CB  1 
ATOM   5334  C CG  . LEU D  1 150 ? -27.033  -21.064 -3.550   1.00 70.27  ? 150 LEU D CG  1 
ATOM   5335  C CD1 . LEU D  1 150 ? -26.817  -19.669 -4.098   1.00 69.42  ? 150 LEU D CD1 1 
ATOM   5336  C CD2 . LEU D  1 150 ? -26.534  -22.088 -4.565   1.00 71.43  ? 150 LEU D CD2 1 
ATOM   5337  N N   . ASN D  1 151 ? -25.659  -21.975 0.720    1.00 72.68  ? 151 ASN D N   1 
ATOM   5338  C CA  . ASN D  1 151 ? -24.703  -22.166 1.803    1.00 74.03  ? 151 ASN D CA  1 
ATOM   5339  C C   . ASN D  1 151 ? -24.872  -23.496 2.479    1.00 75.93  ? 151 ASN D C   1 
ATOM   5340  O O   . ASN D  1 151 ? -23.878  -24.163 2.739    1.00 77.15  ? 151 ASN D O   1 
ATOM   5341  C CB  . ASN D  1 151 ? -24.798  -21.022 2.814    1.00 74.19  ? 151 ASN D CB  1 
ATOM   5342  C CG  . ASN D  1 151 ? -24.221  -19.717 2.279    1.00 73.14  ? 151 ASN D CG  1 
ATOM   5343  O OD1 . ASN D  1 151 ? -23.757  -19.650 1.147    1.00 72.30  ? 151 ASN D OD1 1 
ATOM   5344  N ND2 . ASN D  1 151 ? -24.248  -18.674 3.096    1.00 73.66  ? 151 ASN D ND2 1 
ATOM   5345  N N   . ARG D  1 152 ? -26.119  -23.877 2.749    1.00 76.48  ? 152 ARG D N   1 
ATOM   5346  C CA  . ARG D  1 152 ? -26.429  -25.176 3.327    1.00 78.85  ? 152 ARG D CA  1 
ATOM   5347  C C   . ARG D  1 152 ? -25.833  -26.329 2.518    1.00 79.56  ? 152 ARG D C   1 
ATOM   5348  O O   . ARG D  1 152 ? -25.056  -27.166 3.041    1.00 81.42  ? 152 ARG D O   1 
ATOM   5349  C CB  . ARG D  1 152 ? -27.929  -25.385 3.466    1.00 79.48  ? 152 ARG D CB  1 
ATOM   5350  C CG  . ARG D  1 152 ? -28.304  -26.634 4.221    1.00 82.64  ? 152 ARG D CG  1 
ATOM   5351  C CD  . ARG D  1 152 ? -29.798  -26.737 4.387    1.00 83.58  ? 152 ARG D CD  1 
ATOM   5352  N NE  . ARG D  1 152 ? -30.420  -27.304 3.199    1.00 83.37  ? 152 ARG D NE  1 
ATOM   5353  C CZ  . ARG D  1 152 ? -31.281  -26.658 2.424    1.00 81.66  ? 152 ARG D CZ  1 
ATOM   5354  N NH1 . ARG D  1 152 ? -31.761  -27.293 1.355    1.00 82.19  ? 152 ARG D NH1 1 
ATOM   5355  N NH2 . ARG D  1 152 ? -31.635  -25.384 2.703    1.00 79.75  ? 152 ARG D NH2 1 
ATOM   5356  N N   . ILE D  1 153 ? -26.203  -26.385 1.248    1.00 78.43  ? 153 ILE D N   1 
ATOM   5357  C CA  . ILE D  1 153 ? -25.742  -27.481 0.387    1.00 79.48  ? 153 ILE D CA  1 
ATOM   5358  C C   . ILE D  1 153 ? -24.222  -27.461 0.227    1.00 79.20  ? 153 ILE D C   1 
ATOM   5359  O O   . ILE D  1 153 ? -23.581  -28.518 0.152    1.00 80.85  ? 153 ILE D O   1 
ATOM   5360  C CB  . ILE D  1 153 ? -26.469  -27.475 -0.979   1.00 78.83  ? 153 ILE D CB  1 
ATOM   5361  C CG1 . ILE D  1 153 ? -27.937  -27.733 -0.756   1.00 79.81  ? 153 ILE D CG1 1 
ATOM   5362  C CG2 . ILE D  1 153 ? -25.896  -28.519 -1.924   1.00 80.24  ? 153 ILE D CG2 1 
ATOM   5363  C CD1 . ILE D  1 153 ? -28.724  -27.609 -2.030   1.00 79.45  ? 153 ILE D CD1 1 
ATOM   5364  N N   . LEU D  1 154 ? -23.661  -26.261 0.189    1.00 77.43  ? 154 LEU D N   1 
ATOM   5365  C CA  . LEU D  1 154 ? -22.200  -26.110 0.092    1.00 77.41  ? 154 LEU D CA  1 
ATOM   5366  C C   . LEU D  1 154 ? -21.489  -26.632 1.326    1.00 79.19  ? 154 LEU D C   1 
ATOM   5367  O O   . LEU D  1 154 ? -20.505  -27.324 1.219    1.00 80.26  ? 154 LEU D O   1 
ATOM   5368  C CB  . LEU D  1 154 ? -21.818  -24.650 -0.152   1.00 75.73  ? 154 LEU D CB  1 
ATOM   5369  C CG  . LEU D  1 154 ? -20.558  -24.431 -0.974   1.00 75.62  ? 154 LEU D CG  1 
ATOM   5370  C CD1 . LEU D  1 154 ? -20.561  -25.222 -2.274   1.00 75.94  ? 154 LEU D CD1 1 
ATOM   5371  C CD2 . LEU D  1 154 ? -20.484  -22.949 -1.267   1.00 74.41  ? 154 LEU D CD2 1 
ATOM   5372  N N   . SER D  1 155 ? -22.041  -26.306 2.486    1.00 79.81  ? 155 SER D N   1 
ATOM   5373  C CA  . SER D  1 155 ? -21.598  -26.827 3.755    1.00 82.17  ? 155 SER D CA  1 
ATOM   5374  C C   . SER D  1 155 ? -21.469  -28.352 3.735    1.00 84.34  ? 155 SER D C   1 
ATOM   5375  O O   . SER D  1 155 ? -20.435  -28.894 4.105    1.00 85.88  ? 155 SER D O   1 
ATOM   5376  C CB  . SER D  1 155 ? -22.557  -26.376 4.853    1.00 82.98  ? 155 SER D CB  1 
ATOM   5377  O OG  . SER D  1 155 ? -22.081  -26.789 6.122    1.00 85.79  ? 155 SER D OG  1 
ATOM   5378  N N   . GLU D  1 156 ? -22.511  -29.025 3.262    1.00 84.72  ? 156 GLU D N   1 
ATOM   5379  C CA  . GLU D  1 156 ? -22.577  -30.483 3.167    1.00 87.24  ? 156 GLU D CA  1 
ATOM   5380  C C   . GLU D  1 156 ? -21.524  -31.098 2.284    1.00 87.32  ? 156 GLU D C   1 
ATOM   5381  O O   . GLU D  1 156 ? -21.083  -32.213 2.528    1.00 89.80  ? 156 GLU D O   1 
ATOM   5382  C CB  . GLU D  1 156 ? -23.935  -30.939 2.640    1.00 87.74  ? 156 GLU D CB  1 
ATOM   5383  C CG  . GLU D  1 156 ? -25.086  -30.712 3.613    1.00 88.78  ? 156 GLU D CG  1 
ATOM   5384  C CD  . GLU D  1 156 ? -26.462  -30.713 2.936    1.00 88.42  ? 156 GLU D CD  1 
ATOM   5385  O OE1 . GLU D  1 156 ? -26.538  -31.002 1.710    1.00 87.77  ? 156 GLU D OE1 1 
ATOM   5386  O OE2 . GLU D  1 156 ? -27.477  -30.409 3.623    1.00 89.06  ? 156 GLU D OE2 1 
ATOM   5387  N N   . ARG D  1 157 ? -21.114  -30.393 1.250    1.00 84.96  ? 157 ARG D N   1 
ATOM   5388  C CA  . ARG D  1 157 ? -20.234  -31.000 0.258    1.00 85.30  ? 157 ARG D CA  1 
ATOM   5389  C C   . ARG D  1 157 ? -18.776  -30.661 0.448    1.00 85.02  ? 157 ARG D C   1 
ATOM   5390  O O   . ARG D  1 157 ? -17.931  -31.302 -0.151   1.00 85.86  ? 157 ARG D O   1 
ATOM   5391  C CB  . ARG D  1 157 ? -20.696  -30.587 -1.136   1.00 83.73  ? 157 ARG D CB  1 
ATOM   5392  C CG  . ARG D  1 157 ? -22.145  -30.917 -1.344   1.00 84.31  ? 157 ARG D CG  1 
ATOM   5393  C CD  . ARG D  1 157 ? -22.458  -31.034 -2.807   1.00 84.22  ? 157 ARG D CD  1 
ATOM   5394  N NE  . ARG D  1 157 ? -23.269  -32.214 -3.040   1.00 86.84  ? 157 ARG D NE  1 
ATOM   5395  C CZ  . ARG D  1 157 ? -22.771  -33.433 -3.261   1.00 89.45  ? 157 ARG D CZ  1 
ATOM   5396  N NH1 . ARG D  1 157 ? -21.446  -33.632 -3.296   1.00 89.52  ? 157 ARG D NH1 1 
ATOM   5397  N NH2 . ARG D  1 157 ? -23.607  -34.452 -3.466   1.00 92.29  ? 157 ARG D NH2 1 
ATOM   5398  N N   . THR D  1 158 ? -18.503  -29.624 1.241    1.00 84.09  ? 158 THR D N   1 
ATOM   5399  C CA  . THR D  1 158 ? -17.144  -29.175 1.500    1.00 84.18  ? 158 THR D CA  1 
ATOM   5400  C C   . THR D  1 158 ? -16.728  -29.567 2.906    1.00 86.45  ? 158 THR D C   1 
ATOM   5401  O O   . THR D  1 158 ? -15.544  -29.701 3.183    1.00 87.56  ? 158 THR D O   1 
ATOM   5402  C CB  . THR D  1 158 ? -17.012  -27.653 1.420    1.00 82.29  ? 158 THR D CB  1 
ATOM   5403  O OG1 . THR D  1 158 ? -17.920  -27.048 2.354    1.00 82.10  ? 158 THR D OG1 1 
ATOM   5404  C CG2 . THR D  1 158 ? -17.258  -27.151 0.003    1.00 80.48  ? 158 THR D CG2 1 
ATOM   5405  N N   . GLY D  1 159 ? -17.709  -29.728 3.793    1.00 87.45  ? 159 GLY D N   1 
ATOM   5406  C CA  . GLY D  1 159 ? -17.428  -30.022 5.194    1.00 90.16  ? 159 GLY D CA  1 
ATOM   5407  C C   . GLY D  1 159 ? -17.160  -28.794 6.048    1.00 90.04  ? 159 GLY D C   1 
ATOM   5408  O O   . GLY D  1 159 ? -16.926  -28.923 7.246    1.00 92.67  ? 159 GLY D O   1 
ATOM   5409  N N   . GLN D  1 160 ? -17.188  -27.605 5.440    1.00 87.49  ? 160 GLN D N   1 
ATOM   5410  C CA  . GLN D  1 160 ? -17.065  -26.339 6.172    1.00 87.56  ? 160 GLN D CA  1 
ATOM   5411  C C   . GLN D  1 160 ? -18.399  -25.948 6.807    1.00 87.58  ? 160 GLN D C   1 
ATOM   5412  O O   . GLN D  1 160 ? -19.474  -26.289 6.292    1.00 86.38  ? 160 GLN D O   1 
ATOM   5413  C CB  . GLN D  1 160 ? -16.627  -25.232 5.221    1.00 85.25  ? 160 GLN D CB  1 
ATOM   5414  C CG  . GLN D  1 160 ? -15.440  -25.605 4.369    1.00 85.11  ? 160 GLN D CG  1 
ATOM   5415  C CD  . GLN D  1 160 ? -14.123  -25.454 5.117    1.00 87.37  ? 160 GLN D CD  1 
ATOM   5416  O OE1 . GLN D  1 160 ? -14.074  -25.012 6.273    1.00 89.22  ? 160 GLN D OE1 1 
ATOM   5417  N NE2 . GLN D  1 160 ? -13.040  -25.814 4.451    1.00 87.58  ? 160 GLN D NE2 1 
ATOM   5418  N N   . SER D  1 161 ? -18.350  -25.202 7.902    1.00 89.19  ? 161 SER D N   1 
ATOM   5419  C CA  . SER D  1 161 ? -19.591  -24.767 8.530    1.00 89.47  ? 161 SER D CA  1 
ATOM   5420  C C   . SER D  1 161 ? -20.331  -23.692 7.723    1.00 86.35  ? 161 SER D C   1 
ATOM   5421  O O   . SER D  1 161 ? -19.743  -22.896 6.993    1.00 84.66  ? 161 SER D O   1 
ATOM   5422  C CB  . SER D  1 161 ? -19.326  -24.252 9.934    1.00 92.60  ? 161 SER D CB  1 
ATOM   5423  O OG  . SER D  1 161 ? -18.755  -22.960 9.884    1.00 91.99  ? 161 SER D OG  1 
ATOM   5424  N N   . ILE D  1 162 ? -21.640  -23.680 7.891    1.00 86.01  ? 162 ILE D N   1 
ATOM   5425  C CA  . ILE D  1 162 ? -22.501  -22.621 7.334    1.00 83.56  ? 162 ILE D CA  1 
ATOM   5426  C C   . ILE D  1 162 ? -21.973  -21.199 7.649    1.00 83.58  ? 162 ILE D C   1 
ATOM   5427  O O   . ILE D  1 162 ? -21.932  -20.330 6.744    1.00 81.38  ? 162 ILE D O   1 
ATOM   5428  C CB  . ILE D  1 162 ? -23.933  -22.817 7.828    1.00 84.16  ? 162 ILE D CB  1 
ATOM   5429  C CG1 . ILE D  1 162 ? -24.628  -23.880 6.990    1.00 83.30  ? 162 ILE D CG1 1 
ATOM   5430  C CG2 . ILE D  1 162 ? -24.695  -21.533 7.834    1.00 82.82  ? 162 ILE D CG2 1 
ATOM   5431  C CD1 . ILE D  1 162 ? -25.752  -24.587 7.751    1.00 85.53  ? 162 ILE D CD1 1 
ATOM   5432  N N   . GLU D  1 163 ? -21.536  -20.977 8.898    1.00 86.53  ? 163 GLU D N   1 
ATOM   5433  C CA  . GLU D  1 163 ? -21.054  -19.656 9.310    1.00 87.40  ? 163 GLU D CA  1 
ATOM   5434  C C   . GLU D  1 163 ? -19.805  -19.261 8.547    1.00 86.63  ? 163 GLU D C   1 
ATOM   5435  O O   . GLU D  1 163 ? -19.686  -18.095 8.153    1.00 85.86  ? 163 GLU D O   1 
ATOM   5436  C CB  . GLU D  1 163 ? -20.759  -19.581 10.798   1.00 91.45  ? 163 GLU D CB  1 
ATOM   5437  C CG  . GLU D  1 163 ? -21.963  -19.695 11.716   1.00 93.10  ? 163 GLU D CG  1 
ATOM   5438  C CD  . GLU D  1 163 ? -22.598  -21.110 11.743   1.00 93.38  ? 163 GLU D CD  1 
ATOM   5439  O OE1 . GLU D  1 163 ? -21.881  -22.174 11.701   1.00 94.34  ? 163 GLU D OE1 1 
ATOM   5440  O OE2 . GLU D  1 163 ? -23.856  -21.157 11.814   1.00 92.93  ? 163 GLU D OE2 1 
ATOM   5441  N N   . LYS D  1 164 ? -18.878  -20.213 8.357    1.00 87.19  ? 164 LYS D N   1 
ATOM   5442  C CA  . LYS D  1 164 ? -17.648  -19.951 7.594    1.00 86.73  ? 164 LYS D CA  1 
ATOM   5443  C C   . LYS D  1 164 ? -17.982  -19.591 6.123    1.00 83.48  ? 164 LYS D C   1 
ATOM   5444  O O   . LYS D  1 164 ? -17.415  -18.625 5.577    1.00 83.22  ? 164 LYS D O   1 
ATOM   5445  C CB  . LYS D  1 164 ? -16.663  -21.119 7.666    1.00 88.03  ? 164 LYS D CB  1 
ATOM   5446  C CG  . LYS D  1 164 ? -15.365  -20.845 6.935    1.00 87.95  ? 164 LYS D CG  1 
ATOM   5447  C CD  . LYS D  1 164 ? -14.275  -21.889 7.210    1.00 89.85  ? 164 LYS D CD  1 
ATOM   5448  C CE  . LYS D  1 164 ? -13.223  -21.902 6.108    1.00 89.00  ? 164 LYS D CE  1 
ATOM   5449  N NZ  . LYS D  1 164 ? -12.505  -20.603 6.052    1.00 89.98  ? 164 LYS D NZ  1 
ATOM   5450  N N   . ILE D  1 165 ? -18.899  -20.349 5.504    1.00 88.20  ? 165 ILE D N   1 
ATOM   5451  C CA  . ILE D  1 165 ? -19.281  -20.136 4.108    1.00 84.47  ? 165 ILE D CA  1 
ATOM   5452  C C   . ILE D  1 165 ? -19.883  -18.726 3.968    1.00 82.67  ? 165 ILE D C   1 
ATOM   5453  O O   . ILE D  1 165 ? -19.505  -17.946 3.085    1.00 80.48  ? 165 ILE D O   1 
ATOM   5454  C CB  . ILE D  1 165 ? -20.330  -21.174 3.648    1.00 84.84  ? 165 ILE D CB  1 
ATOM   5455  C CG1 . ILE D  1 165 ? -19.839  -22.616 3.857    1.00 87.35  ? 165 ILE D CG1 1 
ATOM   5456  C CG2 . ILE D  1 165 ? -20.769  -20.926 2.214    1.00 82.09  ? 165 ILE D CG2 1 
ATOM   5457  C CD1 . ILE D  1 165 ? -18.860  -23.115 2.831    1.00 85.85  ? 165 ILE D CD1 1 
ATOM   5458  N N   . GLN D  1 166 ? -20.816  -18.405 4.860    1.00 84.20  ? 166 GLN D N   1 
ATOM   5459  C CA  . GLN D  1 166 ? -21.393  -17.097 4.911    1.00 83.23  ? 166 GLN D CA  1 
ATOM   5460  C C   . GLN D  1 166 ? -20.310  -16.026 4.870    1.00 82.54  ? 166 GLN D C   1 
ATOM   5461  O O   . GLN D  1 166 ? -20.363  -15.135 4.007    1.00 80.60  ? 166 GLN D O   1 
ATOM   5462  C CB  . GLN D  1 166 ? -22.262  -16.945 6.153    1.00 85.93  ? 166 GLN D CB  1 
ATOM   5463  C CG  . GLN D  1 166 ? -22.929  -15.581 6.276    1.00 85.32  ? 166 GLN D CG  1 
ATOM   5464  C CD  . GLN D  1 166 ? -24.201  -15.412 5.449    1.00 84.18  ? 166 GLN D CD  1 
ATOM   5465  O OE1 . GLN D  1 166 ? -24.562  -16.251 4.607    1.00 83.64  ? 166 GLN D OE1 1 
ATOM   5466  N NE2 . GLN D  1 166 ? -24.897  -14.322 5.702    1.00 84.49  ? 166 GLN D NE2 1 
ATOM   5467  N N   . LYS D  1 167 ? -19.326  -16.109 5.774    1.00 84.94  ? 167 LYS D N   1 
ATOM   5468  C CA  . LYS D  1 167 ? -18.260  -15.093 5.857    1.00 85.52  ? 167 LYS D CA  1 
ATOM   5469  C C   . LYS D  1 167 ? -17.359  -15.084 4.617    1.00 83.54  ? 167 LYS D C   1 
ATOM   5470  O O   . LYS D  1 167 ? -16.999  -14.017 4.111    1.00 82.92  ? 167 LYS D O   1 
ATOM   5471  C CB  . LYS D  1 167 ? -17.433  -15.262 7.142    1.00 89.84  ? 167 LYS D CB  1 
ATOM   5472  C CG  . LYS D  1 167 ? -16.195  -14.363 7.235    1.00 91.64  ? 167 LYS D CG  1 
ATOM   5473  C CD  . LYS D  1 167 ? -15.526  -14.462 8.599    1.00 97.16  ? 167 LYS D CD  1 
ATOM   5474  C CE  . LYS D  1 167 ? -16.364  -13.738 9.667    1.00 99.29  ? 167 LYS D CE  1 
ATOM   5475  N NZ  . LYS D  1 167 ? -16.105  -14.238 11.061   1.00 105.30 ? 167 LYS D NZ  1 
ATOM   5476  N N   . ASP D  1 168 ? -17.013  -16.270 4.123    1.00 83.06  ? 168 ASP D N   1 
ATOM   5477  C CA  . ASP D  1 168 ? -16.073  -16.395 3.022    1.00 81.88  ? 168 ASP D CA  1 
ATOM   5478  C C   . ASP D  1 168 ? -16.665  -15.973 1.697    1.00 79.11  ? 168 ASP D C   1 
ATOM   5479  O O   . ASP D  1 168 ? -15.911  -15.690 0.752    1.00 78.64  ? 168 ASP D O   1 
ATOM   5480  C CB  . ASP D  1 168 ? -15.566  -17.825 2.903    1.00 82.60  ? 168 ASP D CB  1 
ATOM   5481  C CG  . ASP D  1 168 ? -14.562  -18.182 3.981    1.00 86.42  ? 168 ASP D CG  1 
ATOM   5482  O OD1 . ASP D  1 168 ? -14.143  -17.261 4.733    1.00 88.61  ? 168 ASP D OD1 1 
ATOM   5483  O OD2 . ASP D  1 168 ? -14.194  -19.378 4.069    1.00 87.87  ? 168 ASP D OD2 1 
ATOM   5484  N N   . THR D  1 169 ? -18.002  -15.950 1.603    1.00 78.06  ? 169 THR D N   1 
ATOM   5485  C CA  . THR D  1 169 ? -18.671  -15.562 0.359    1.00 76.54  ? 169 THR D CA  1 
ATOM   5486  C C   . THR D  1 169 ? -19.289  -14.144 0.371    1.00 76.63  ? 169 THR D C   1 
ATOM   5487  O O   . THR D  1 169 ? -19.989  -13.733 -0.578   1.00 76.29  ? 169 THR D O   1 
ATOM   5488  C CB  . THR D  1 169 ? -19.740  -16.586 -0.028   1.00 76.25  ? 169 THR D CB  1 
ATOM   5489  O OG1 . THR D  1 169 ? -20.702  -16.676 1.031    1.00 77.26  ? 169 THR D OG1 1 
ATOM   5490  C CG2 . THR D  1 169 ? -19.108  -17.930 -0.262   1.00 76.43  ? 169 THR D CG2 1 
ATOM   5491  N N   . ASP D  1 170 ? -19.017  -13.397 1.439    1.00 77.75  ? 170 ASP D N   1 
ATOM   5492  C CA  . ASP D  1 170 ? -19.476  -12.015 1.535    1.00 78.29  ? 170 ASP D CA  1 
ATOM   5493  C C   . ASP D  1 170 ? -19.044  -11.159 0.325    1.00 78.36  ? 170 ASP D C   1 
ATOM   5494  O O   . ASP D  1 170 ? -19.861  -10.380 -0.215   1.00 78.66  ? 170 ASP D O   1 
ATOM   5495  C CB  . ASP D  1 170 ? -19.016  -11.363 2.830    1.00 80.20  ? 170 ASP D CB  1 
ATOM   5496  C CG  . ASP D  1 170 ? -19.682  -10.033 3.064    1.00 81.01  ? 170 ASP D CG  1 
ATOM   5497  O OD1 . ASP D  1 170 ? -18.945  -9.025  3.064    1.00 82.49  ? 170 ASP D OD1 1 
ATOM   5498  O OD2 . ASP D  1 170 ? -20.942  -9.990  3.220    1.00 80.65  ? 170 ASP D OD2 1 
ATOM   5499  N N   . ARG D  1 171 ? -17.780  -11.297 -0.085   1.00 78.81  ? 171 ARG D N   1 
ATOM   5500  C CA  . ARG D  1 171 ? -17.291  -10.664 -1.284   1.00 79.58  ? 171 ARG D CA  1 
ATOM   5501  C C   . ARG D  1 171 ? -16.728  -11.740 -2.210   1.00 78.83  ? 171 ARG D C   1 
ATOM   5502  O O   . ARG D  1 171 ? -16.759  -12.925 -1.872   1.00 77.67  ? 171 ARG D O   1 
ATOM   5503  C CB  . ARG D  1 171 ? -16.227  -9.653  -0.916   1.00 81.94  ? 171 ARG D CB  1 
ATOM   5504  C CG  . ARG D  1 171 ? -16.662  -8.646  0.136    1.00 83.18  ? 171 ARG D CG  1 
ATOM   5505  C CD  . ARG D  1 171 ? -17.163  -7.370  -0.487   1.00 84.55  ? 171 ARG D CD  1 
ATOM   5506  N NE  . ARG D  1 171 ? -17.426  -6.386  0.538    1.00 86.18  ? 171 ARG D NE  1 
ATOM   5507  C CZ  . ARG D  1 171 ? -17.944  -5.206  0.281    1.00 87.85  ? 171 ARG D CZ  1 
ATOM   5508  N NH1 . ARG D  1 171 ? -18.226  -4.886  -0.974   1.00 88.46  ? 171 ARG D NH1 1 
ATOM   5509  N NH2 . ARG D  1 171 ? -18.175  -4.359  1.271    1.00 89.51  ? 171 ARG D NH2 1 
ATOM   5510  N N   . ASP D  1 172 ? -16.257  -11.343 -3.392   1.00 80.00  ? 172 ASP D N   1 
ATOM   5511  C CA  . ASP D  1 172 ? -15.544  -12.254 -4.288   1.00 79.93  ? 172 ASP D CA  1 
ATOM   5512  C C   . ASP D  1 172 ? -14.315  -12.863 -3.614   1.00 80.19  ? 172 ASP D C   1 
ATOM   5513  O O   . ASP D  1 172 ? -13.454  -12.155 -3.076   1.00 82.12  ? 172 ASP D O   1 
ATOM   5514  C CB  . ASP D  1 172 ? -15.067  -11.519 -5.533   1.00 82.30  ? 172 ASP D CB  1 
ATOM   5515  C CG  . ASP D  1 172 ? -16.197  -11.197 -6.500   1.00 83.10  ? 172 ASP D CG  1 
ATOM   5516  O OD1 . ASP D  1 172 ? -17.367  -11.616 -6.259   1.00 81.68  ? 172 ASP D OD1 1 
ATOM   5517  O OD2 . ASP D  1 172 ? -15.906  -10.524 -7.519   1.00 85.96  ? 172 ASP D OD2 1 
ATOM   5518  N N   . ASN D  1 173 ? -14.258  -14.188 -3.664   1.00 78.94  ? 173 ASN D N   1 
ATOM   5519  C CA  . ASN D  1 173 ? -13.216  -14.959 -3.021   1.00 79.63  ? 173 ASN D CA  1 
ATOM   5520  C C   . ASN D  1 173 ? -12.529  -15.872 -4.008   1.00 79.82  ? 173 ASN D C   1 
ATOM   5521  O O   . ASN D  1 173 ? -13.026  -16.938 -4.335   1.00 78.55  ? 173 ASN D O   1 
ATOM   5522  C CB  . ASN D  1 173 ? -13.818  -15.792 -1.907   1.00 78.74  ? 173 ASN D CB  1 
ATOM   5523  C CG  . ASN D  1 173 ? -12.788  -16.316 -0.971   1.00 80.69  ? 173 ASN D CG  1 
ATOM   5524  O OD1 . ASN D  1 173 ? -11.579  -16.083 -1.135   1.00 82.74  ? 173 ASN D OD1 1 
ATOM   5525  N ND2 . ASN D  1 173 ? -13.246  -17.028 0.028    1.00 80.91  ? 173 ASN D ND2 1 
ATOM   5526  N N   . PHE D  1 174 ? -11.373  -15.442 -4.477   1.00 81.96  ? 174 PHE D N   1 
ATOM   5527  C CA  . PHE D  1 174 ? -10.612  -16.220 -5.426   1.00 82.71  ? 174 PHE D CA  1 
ATOM   5528  C C   . PHE D  1 174 ? -9.720   -17.261 -4.751   1.00 83.57  ? 174 PHE D C   1 
ATOM   5529  O O   . PHE D  1 174 ? -8.989   -16.971 -3.774   1.00 85.63  ? 174 PHE D O   1 
ATOM   5530  C CB  . PHE D  1 174 ? -9.786   -15.299 -6.313   1.00 85.45  ? 174 PHE D CB  1 
ATOM   5531  C CG  . PHE D  1 174 ? -10.614  -14.463 -7.223   1.00 85.57  ? 174 PHE D CG  1 
ATOM   5532  C CD1 . PHE D  1 174 ? -11.121  -14.998 -8.411   1.00 85.33  ? 174 PHE D CD1 1 
ATOM   5533  C CD2 . PHE D  1 174 ? -10.915  -13.149 -6.894   1.00 86.63  ? 174 PHE D CD2 1 
ATOM   5534  C CE1 . PHE D  1 174 ? -11.893  -14.226 -9.258   1.00 86.55  ? 174 PHE D CE1 1 
ATOM   5535  C CE2 . PHE D  1 174 ? -11.695  -12.369 -7.744   1.00 87.54  ? 174 PHE D CE2 1 
ATOM   5536  C CZ  . PHE D  1 174 ? -12.183  -12.906 -8.924   1.00 87.68  ? 174 PHE D CZ  1 
ATOM   5537  N N   . LEU D  1 175 ? -9.786   -18.476 -5.297   1.00 82.69  ? 175 LEU D N   1 
ATOM   5538  C CA  . LEU D  1 175 ? -9.071   -19.612 -4.757   1.00 83.77  ? 175 LEU D CA  1 
ATOM   5539  C C   . LEU D  1 175 ? -8.209   -20.249 -5.837   1.00 85.04  ? 175 LEU D C   1 
ATOM   5540  O O   . LEU D  1 175 ? -8.631   -20.322 -6.996   1.00 84.19  ? 175 LEU D O   1 
ATOM   5541  C CB  . LEU D  1 175 ? -10.095  -20.609 -4.227   1.00 82.01  ? 175 LEU D CB  1 
ATOM   5542  C CG  . LEU D  1 175 ? -10.566  -20.597 -2.762   1.00 82.27  ? 175 LEU D CG  1 
ATOM   5543  C CD1 . LEU D  1 175 ? -10.671  -19.199 -2.168   1.00 82.57  ? 175 LEU D CD1 1 
ATOM   5544  C CD2 . LEU D  1 175 ? -11.908  -21.320 -2.674   1.00 80.49  ? 175 LEU D CD2 1 
ATOM   5545  N N   . THR D  1 176 ? -7.005   -20.676 -5.473   1.00 87.73  ? 176 THR D N   1 
ATOM   5546  C CA  . THR D  1 176 ? -6.190   -21.498 -6.370   1.00 89.19  ? 176 THR D CA  1 
ATOM   5547  C C   . THR D  1 176 ? -6.734   -22.940 -6.347   1.00 87.85  ? 176 THR D C   1 
ATOM   5548  O O   . THR D  1 176 ? -7.587   -23.280 -5.506   1.00 86.48  ? 176 THR D O   1 
ATOM   5549  C CB  . THR D  1 176 ? -4.696   -21.514 -5.964   1.00 93.34  ? 176 THR D CB  1 
ATOM   5550  O OG1 . THR D  1 176 ? -4.539   -22.167 -4.691   1.00 94.69  ? 176 THR D OG1 1 
ATOM   5551  C CG2 . THR D  1 176 ? -4.123   -20.106 -5.904   1.00 95.67  ? 176 THR D CG2 1 
ATOM   5552  N N   . ALA D  1 177 ? -6.249   -23.787 -7.253   1.00 88.79  ? 177 ALA D N   1 
ATOM   5553  C CA  . ALA D  1 177 ? -6.620   -25.197 -7.212   1.00 88.45  ? 177 ALA D CA  1 
ATOM   5554  C C   . ALA D  1 177 ? -6.297   -25.852 -5.845   1.00 90.24  ? 177 ALA D C   1 
ATOM   5555  O O   . ALA D  1 177 ? -7.150   -26.550 -5.276   1.00 89.48  ? 177 ALA D O   1 
ATOM   5556  C CB  . ALA D  1 177 ? -5.963   -25.951 -8.361   1.00 89.96  ? 177 ALA D CB  1 
ATOM   5557  N N   . GLU D  1 178 ? -5.089   -25.599 -5.324   1.00 93.44  ? 178 GLU D N   1 
ATOM   5558  C CA  . GLU D  1 178 ? -4.698   -26.137 -4.033   1.00 96.45  ? 178 GLU D CA  1 
ATOM   5559  C C   . GLU D  1 178 ? -5.645   -25.645 -2.962   1.00 95.21  ? 178 GLU D C   1 
ATOM   5560  O O   . GLU D  1 178 ? -6.167   -26.453 -2.189   1.00 96.00  ? 178 GLU D O   1 
ATOM   5561  C CB  . GLU D  1 178 ? -3.260   -25.774 -3.661   1.00 101.06 ? 178 GLU D CB  1 
ATOM   5562  C CG  . GLU D  1 178 ? -2.193   -26.577 -4.383   1.00 103.84 ? 178 GLU D CG  1 
ATOM   5563  C CD  . GLU D  1 178 ? -2.217   -28.069 -4.067   1.00 105.52 ? 178 GLU D CD  1 
ATOM   5564  O OE1 . GLU D  1 178 ? -2.723   -28.473 -2.986   1.00 106.46 ? 178 GLU D OE1 1 
ATOM   5565  O OE2 . GLU D  1 178 ? -1.698   -28.852 -4.905   1.00 106.51 ? 178 GLU D OE2 1 
ATOM   5566  N N   . GLU D  1 179 ? -5.888   -24.330 -2.929   1.00 93.72  ? 179 GLU D N   1 
ATOM   5567  C CA  . GLU D  1 179 ? -6.779   -23.732 -1.926   1.00 92.71  ? 179 GLU D CA  1 
ATOM   5568  C C   . GLU D  1 179 ? -8.187   -24.320 -1.993   1.00 89.67  ? 179 GLU D C   1 
ATOM   5569  O O   . GLU D  1 179 ? -8.838   -24.509 -0.961   1.00 90.29  ? 179 GLU D O   1 
ATOM   5570  C CB  . GLU D  1 179 ? -6.823   -22.218 -2.083   1.00 91.66  ? 179 GLU D CB  1 
ATOM   5571  C CG  . GLU D  1 179 ? -5.538   -21.514 -1.679   1.00 95.84  ? 179 GLU D CG  1 
ATOM   5572  C CD  . GLU D  1 179 ? -5.510   -20.035 -2.073   1.00 95.34  ? 179 GLU D CD  1 
ATOM   5573  O OE1 . GLU D  1 179 ? -6.324   -19.593 -2.930   1.00 91.86  ? 179 GLU D OE1 1 
ATOM   5574  O OE2 . GLU D  1 179 ? -4.651   -19.308 -1.524   1.00 99.24  ? 179 GLU D OE2 1 
ATOM   5575  N N   . ALA D  1 180 ? -8.625   -24.628 -3.209   1.00 87.24  ? 180 ALA D N   1 
ATOM   5576  C CA  . ALA D  1 180 ? -9.940   -25.197 -3.437   1.00 85.18  ? 180 ALA D CA  1 
ATOM   5577  C C   . ALA D  1 180 ? -10.045  -26.583 -2.830   1.00 87.33  ? 180 ALA D C   1 
ATOM   5578  O O   . ALA D  1 180 ? -11.073  -26.944 -2.237   1.00 87.28  ? 180 ALA D O   1 
ATOM   5579  C CB  . ALA D  1 180 ? -10.225  -25.253 -4.925   1.00 83.49  ? 180 ALA D CB  1 
ATOM   5580  N N   . LYS D  1 181 ? -8.965   -27.348 -2.989   1.00 89.80  ? 181 LYS D N   1 
ATOM   5581  C CA  . LYS D  1 181 ? -8.857   -28.677 -2.400   1.00 92.92  ? 181 LYS D CA  1 
ATOM   5582  C C   . LYS D  1 181 ? -8.884   -28.594 -0.886   1.00 95.78  ? 181 LYS D C   1 
ATOM   5583  O O   . LYS D  1 181 ? -9.585   -29.358 -0.221   1.00 97.53  ? 181 LYS D O   1 
ATOM   5584  C CB  . LYS D  1 181 ? -7.587   -29.376 -2.871   1.00 95.50  ? 181 LYS D CB  1 
ATOM   5585  C CG  . LYS D  1 181 ? -7.410   -30.774 -2.305   1.00 99.44  ? 181 LYS D CG  1 
ATOM   5586  C CD  . LYS D  1 181 ? -6.046   -31.336 -2.666   1.00 102.58 ? 181 LYS D CD  1 
ATOM   5587  C CE  . LYS D  1 181 ? -5.654   -32.462 -1.734   1.00 107.98 ? 181 LYS D CE  1 
ATOM   5588  N NZ  . LYS D  1 181 ? -4.260   -32.756 -2.103   1.00 111.11 ? 181 LYS D NZ  1 
ATOM   5589  N N   . GLU D  1 182 ? -8.121   -27.641 -0.364   1.00 96.94  ? 182 GLU D N   1 
ATOM   5590  C CA  . GLU D  1 182 ? -8.058   -27.359 1.073    1.00 100.38 ? 182 GLU D CA  1 
ATOM   5591  C C   . GLU D  1 182 ? -9.423   -26.975 1.615    1.00 98.36  ? 182 GLU D C   1 
ATOM   5592  O O   . GLU D  1 182 ? -9.737   -27.229 2.769    1.00 101.61 ? 182 GLU D O   1 
ATOM   5593  C CB  . GLU D  1 182 ? -7.053   -26.232 1.343    1.00 101.97 ? 182 GLU D CB  1 
ATOM   5594  C CG  . GLU D  1 182 ? -6.737   -25.992 2.808    1.00 107.08 ? 182 GLU D CG  1 
ATOM   5595  C CD  . GLU D  1 182 ? -5.925   -27.154 3.428    1.00 113.36 ? 182 GLU D CD  1 
ATOM   5596  O OE1 . GLU D  1 182 ? -6.115   -27.458 4.638    1.00 117.97 ? 182 GLU D OE1 1 
ATOM   5597  O OE2 . GLU D  1 182 ? -5.080   -27.794 2.721    1.00 114.42 ? 182 GLU D OE2 1 
ATOM   5598  N N   . TYR D  1 183 ? -10.226  -26.356 0.758    1.00 93.63  ? 183 TYR D N   1 
ATOM   5599  C CA  . TYR D  1 183 ? -11.529  -25.874 1.154    1.00 91.73  ? 183 TYR D CA  1 
ATOM   5600  C C   . TYR D  1 183 ? -12.539  -27.003 1.127    1.00 92.19  ? 183 TYR D C   1 
ATOM   5601  O O   . TYR D  1 183 ? -13.536  -26.958 1.833    1.00 92.78  ? 183 TYR D O   1 
ATOM   5602  C CB  . TYR D  1 183 ? -11.968  -24.737 0.241    1.00 87.50  ? 183 TYR D CB  1 
ATOM   5603  C CG  . TYR D  1 183 ? -12.932  -23.792 0.899    1.00 86.40  ? 183 TYR D CG  1 
ATOM   5604  C CD1 . TYR D  1 183 ? -12.479  -22.681 1.607    1.00 87.32  ? 183 TYR D CD1 1 
ATOM   5605  C CD2 . TYR D  1 183 ? -14.327  -23.996 0.806    1.00 84.99  ? 183 TYR D CD2 1 
ATOM   5606  C CE1 . TYR D  1 183 ? -13.378  -21.792 2.193    1.00 86.47  ? 183 TYR D CE1 1 
ATOM   5607  C CE2 . TYR D  1 183 ? -15.236  -23.110 1.394    1.00 84.25  ? 183 TYR D CE2 1 
ATOM   5608  C CZ  . TYR D  1 183 ? -14.750  -22.012 2.084    1.00 84.82  ? 183 TYR D CZ  1 
ATOM   5609  O OH  . TYR D  1 183 ? -15.604  -21.134 2.676    1.00 84.37  ? 183 TYR D OH  1 
ATOM   5610  N N   . GLY D  1 184 ? -12.281  -28.009 0.305    1.00 92.44  ? 184 GLY D N   1 
ATOM   5611  C CA  . GLY D  1 184 ? -13.194  -29.129 0.184    1.00 93.59  ? 184 GLY D CA  1 
ATOM   5612  C C   . GLY D  1 184 ? -14.141  -29.014 -0.984   1.00 90.43  ? 184 GLY D C   1 
ATOM   5613  O O   . GLY D  1 184 ? -15.137  -29.744 -1.056   1.00 91.62  ? 184 GLY D O   1 
ATOM   5614  N N   . LEU D  1 185 ? -13.844  -28.082 -1.891   1.00 87.25  ? 185 LEU D N   1 
ATOM   5615  C CA  . LEU D  1 185 ? -14.608  -27.938 -3.130   1.00 85.18  ? 185 LEU D CA  1 
ATOM   5616  C C   . LEU D  1 185 ? -14.221  -29.036 -4.128   1.00 86.35  ? 185 LEU D C   1 
ATOM   5617  O O   . LEU D  1 185 ? -15.058  -29.569 -4.850   1.00 86.88  ? 185 LEU D O   1 
ATOM   5618  C CB  . LEU D  1 185 ? -14.398  -26.557 -3.738   1.00 82.45  ? 185 LEU D CB  1 
ATOM   5619  C CG  . LEU D  1 185 ? -14.967  -25.388 -2.934   1.00 81.28  ? 185 LEU D CG  1 
ATOM   5620  C CD1 . LEU D  1 185 ? -14.233  -24.118 -3.301   1.00 79.80  ? 185 LEU D CD1 1 
ATOM   5621  C CD2 . LEU D  1 185 ? -16.466  -25.221 -3.125   1.00 80.76  ? 185 LEU D CD2 1 
ATOM   5622  N N   . ILE D  1 186 ? -12.943  -29.379 -4.160   1.00 87.36  ? 186 ILE D N   1 
ATOM   5623  C CA  . ILE D  1 186 ? -12.482  -30.480 -4.978   1.00 88.96  ? 186 ILE D CA  1 
ATOM   5624  C C   . ILE D  1 186 ? -11.752  -31.476 -4.094   1.00 92.35  ? 186 ILE D C   1 
ATOM   5625  O O   . ILE D  1 186 ? -11.408  -31.157 -2.955   1.00 93.51  ? 186 ILE D O   1 
ATOM   5626  C CB  . ILE D  1 186 ? -11.533  -29.999 -6.088   1.00 87.77  ? 186 ILE D CB  1 
ATOM   5627  C CG1 . ILE D  1 186 ? -10.406  -29.129 -5.490   1.00 87.61  ? 186 ILE D CG1 1 
ATOM   5628  C CG2 . ILE D  1 186 ? -12.322  -29.295 -7.179   1.00 85.86  ? 186 ILE D CG2 1 
ATOM   5629  C CD1 . ILE D  1 186 ? -9.242   -28.838 -6.415   1.00 87.86  ? 186 ILE D CD1 1 
ATOM   5630  N N   . ASP D  1 187 ? -11.511  -32.668 -4.630   1.00 94.58  ? 187 ASP D N   1 
ATOM   5631  C CA  . ASP D  1 187 ? -10.796  -33.698 -3.919   1.00 98.57  ? 187 ASP D CA  1 
ATOM   5632  C C   . ASP D  1 187 ? -9.319   -33.725 -4.311   1.00 99.38  ? 187 ASP D C   1 
ATOM   5633  O O   . ASP D  1 187 ? -8.454   -33.850 -3.458   1.00 102.22 ? 187 ASP D O   1 
ATOM   5634  C CB  . ASP D  1 187 ? -11.457  -35.044 -4.185   1.00 101.42 ? 187 ASP D CB  1 
ATOM   5635  C CG  . ASP D  1 187 ? -12.937  -35.043 -3.860   1.00 101.46 ? 187 ASP D CG  1 
ATOM   5636  O OD1 . ASP D  1 187 ? -13.279  -34.890 -2.682   1.00 102.86 ? 187 ASP D OD1 1 
ATOM   5637  O OD2 . ASP D  1 187 ? -13.764  -35.217 -4.776   1.00 100.80 ? 187 ASP D OD2 1 
ATOM   5638  N N   . GLU D  1 188 ? -9.035   -33.581 -5.596   1.00 321.39 ? 188 GLU D N   1 
ATOM   5639  C CA  . GLU D  1 188 ? -7.686   -33.761 -6.084   1.00 322.49 ? 188 GLU D CA  1 
ATOM   5640  C C   . GLU D  1 188 ? -7.355   -32.694 -7.100   1.00 323.05 ? 188 GLU D C   1 
ATOM   5641  O O   . GLU D  1 188 ? -8.224   -32.285 -7.853   1.00 322.83 ? 188 GLU D O   1 
ATOM   5642  C CB  . GLU D  1 188 ? -7.584   -35.139 -6.737   1.00 324.53 ? 188 GLU D CB  1 
ATOM   5643  C CG  . GLU D  1 188 ? -6.174   -35.674 -6.863   1.00 326.70 ? 188 GLU D CG  1 
ATOM   5644  C CD  . GLU D  1 188 ? -5.434   -35.610 -5.549   1.00 325.85 ? 188 GLU D CD  1 
ATOM   5645  O OE1 . GLU D  1 188 ? -5.553   -36.564 -4.750   1.00 325.37 ? 188 GLU D OE1 1 
ATOM   5646  O OE2 . GLU D  1 188 ? -4.746   -34.592 -5.318   1.00 326.28 ? 188 GLU D OE2 1 
ATOM   5647  N N   . VAL D  1 189 ? -6.111   -32.231 -7.128   1.00 324.45 ? 189 VAL D N   1 
ATOM   5648  C CA  . VAL D  1 189 ? -5.677   -31.439 -8.276   1.00 326.15 ? 189 VAL D CA  1 
ATOM   5649  C C   . VAL D  1 189 ? -4.838   -32.330 -9.191   1.00 330.15 ? 189 VAL D C   1 
ATOM   5650  O O   . VAL D  1 189 ? -3.800   -32.848 -8.784   1.00 332.44 ? 189 VAL D O   1 
ATOM   5651  C CB  . VAL D  1 189 ? -4.989   -30.095 -7.902   1.00 326.54 ? 189 VAL D CB  1 
ATOM   5652  C CG1 . VAL D  1 189 ? -5.225   -29.746 -6.440   1.00 324.93 ? 189 VAL D CG1 1 
ATOM   5653  C CG2 . VAL D  1 189 ? -3.502   -30.094 -8.222   1.00 330.96 ? 189 VAL D CG2 1 
ATOM   5654  N N   . MET D  1 190 ? -5.320   -32.531 -10.414  1.00 331.90 ? 190 MET D N   1 
ATOM   5655  C CA  . MET D  1 190 ? -4.690   -33.450 -11.359  1.00 337.07 ? 190 MET D CA  1 
ATOM   5656  C C   . MET D  1 190 ? -3.322   -32.952 -11.793  1.00 341.44 ? 190 MET D C   1 
ATOM   5657  O O   . MET D  1 190 ? -3.215   -32.069 -12.640  1.00 343.21 ? 190 MET D O   1 
ATOM   5658  C CB  . MET D  1 190 ? -5.557   -33.662 -12.604  1.00 339.41 ? 190 MET D CB  1 
ATOM   5659  C CG  . MET D  1 190 ? -7.020   -33.951 -12.342  1.00 336.59 ? 190 MET D CG  1 
ATOM   5660  S SD  . MET D  1 190 ? -7.749   -35.072 -13.557  1.00 342.51 ? 190 MET D SD  1 
ATOM   5661  C CE  . MET D  1 190 ? -7.710   -34.116 -15.065  1.00 346.36 ? 190 MET D CE  1 
ATOM   5662  N N   . VAL D  1 191 ? -2.279   -33.530 -11.212  1.00 343.87 ? 191 VAL D N   1 
ATOM   5663  C CA  . VAL D  1 191 ? -0.908   -33.192 -11.572  1.00 349.85 ? 191 VAL D CA  1 
ATOM   5664  C C   . VAL D  1 191 ? -0.595   -33.706 -12.992  1.00 356.78 ? 191 VAL D C   1 
ATOM   5665  O O   . VAL D  1 191 ? -1.053   -34.786 -13.371  1.00 358.07 ? 191 VAL D O   1 
ATOM   5666  C CB  . VAL D  1 191 ? 0.079    -33.705 -10.492  1.00 351.41 ? 191 VAL D CB  1 
ATOM   5667  C CG1 . VAL D  1 191 ? 0.187    -35.224 -10.505  1.00 353.48 ? 191 VAL D CG1 1 
ATOM   5668  C CG2 . VAL D  1 191 ? 1.447    -33.055 -10.624  1.00 357.94 ? 191 VAL D CG2 1 
ATOM   5669  N N   . PRO D  1 192 ? 0.143    -32.912 -13.795  1.00 362.09 ? 192 PRO D N   1 
ATOM   5670  C CA  . PRO D  1 192 ? 0.446    -33.295 -15.170  1.00 370.03 ? 192 PRO D CA  1 
ATOM   5671  C C   . PRO D  1 192 ? 1.037    -34.684 -15.270  1.00 376.04 ? 192 PRO D C   1 
ATOM   5672  O O   . PRO D  1 192 ? 1.945    -35.038 -14.523  1.00 377.91 ? 192 PRO D O   1 
ATOM   5673  C CB  . PRO D  1 192 ? 1.485    -32.267 -15.604  1.00 375.74 ? 192 PRO D CB  1 
ATOM   5674  C CG  . PRO D  1 192 ? 1.194    -31.068 -14.786  1.00 368.88 ? 192 PRO D CG  1 
ATOM   5675  C CD  . PRO D  1 192 ? 0.614    -31.549 -13.490  1.00 361.48 ? 192 PRO D CD  1 
ATOM   5676  N N   . GLU D  1 193 ? 0.504    -35.454 -16.205  1.00 379.77 ? 193 GLU D N   1 
ATOM   5677  C CA  . GLU D  1 193 ? 0.910    -36.823 -16.425  1.00 386.20 ? 193 GLU D CA  1 
ATOM   5678  C C   . GLU D  1 193 ? 2.063    -36.886 -17.424  1.00 398.32 ? 193 GLU D C   1 
ATOM   5679  O O   . GLU D  1 193 ? 3.206    -37.147 -17.053  1.00 403.28 ? 193 GLU D O   1 
ATOM   5680  C CB  . GLU D  1 193 ? -0.293   -37.594 -16.945  1.00 385.66 ? 193 GLU D CB  1 
ATOM   5681  C CG  . GLU D  1 193 ? -0.074   -39.071 -17.194  1.00 392.40 ? 193 GLU D CG  1 
ATOM   5682  C CD  . GLU D  1 193 ? -1.305   -39.727 -17.784  1.00 393.35 ? 193 GLU D CD  1 
ATOM   5683  O OE1 . GLU D  1 193 ? -1.483   -40.945 -17.583  1.00 395.45 ? 193 GLU D OE1 1 
ATOM   5684  O OE2 . GLU D  1 193 ? -2.101   -39.024 -18.443  1.00 392.54 ? 193 GLU D OE2 1 
ATOM   5685  N N   . ILE E  1 4   ? -28.331  -28.502 -28.857  1.00 90.39  ? 4   ILE E N   1 
ATOM   5686  C CA  . ILE E  1 4   ? -26.986  -28.315 -29.502  1.00 91.12  ? 4   ILE E CA  1 
ATOM   5687  C C   . ILE E  1 4   ? -26.304  -29.659 -29.912  1.00 90.25  ? 4   ILE E C   1 
ATOM   5688  O O   . ILE E  1 4   ? -26.158  -29.880 -31.091  1.00 90.04  ? 4   ILE E O   1 
ATOM   5689  C CB  . ILE E  1 4   ? -26.077  -27.199 -28.804  1.00 93.08  ? 4   ILE E CB  1 
ATOM   5690  C CG1 . ILE E  1 4   ? -24.792  -26.882 -29.604  1.00 94.08  ? 4   ILE E CG1 1 
ATOM   5691  C CG2 . ILE E  1 4   ? -25.802  -27.460 -27.312  1.00 93.75  ? 4   ILE E CG2 1 
ATOM   5692  C CD1 . ILE E  1 4   ? -24.107  -25.575 -29.227  1.00 96.62  ? 4   ILE E CD1 1 
ATOM   5693  N N   . PRO E  1 5   ? -25.953  -30.576 -28.979  1.00 90.10  ? 5   PRO E N   1 
ATOM   5694  C CA  . PRO E  1 5   ? -25.146  -31.725 -29.455  1.00 89.71  ? 5   PRO E CA  1 
ATOM   5695  C C   . PRO E  1 5   ? -25.923  -32.872 -30.132  1.00 88.89  ? 5   PRO E C   1 
ATOM   5696  O O   . PRO E  1 5   ? -27.140  -32.992 -29.968  1.00 88.55  ? 5   PRO E O   1 
ATOM   5697  C CB  . PRO E  1 5   ? -24.455  -32.241 -28.188  1.00 90.49  ? 5   PRO E CB  1 
ATOM   5698  C CG  . PRO E  1 5   ? -25.256  -31.705 -27.058  1.00 91.09  ? 5   PRO E CG  1 
ATOM   5699  C CD  . PRO E  1 5   ? -26.314  -30.758 -27.568  1.00 90.56  ? 5   PRO E CD  1 
ATOM   5700  N N   . THR E  1 6   ? -25.193  -33.700 -30.884  1.00 88.86  ? 6   THR E N   1 
ATOM   5701  C CA  . THR E  1 6   ? -25.760  -34.704 -31.795  1.00 88.73  ? 6   THR E CA  1 
ATOM   5702  C C   . THR E  1 6   ? -25.543  -36.153 -31.297  1.00 89.15  ? 6   THR E C   1 
ATOM   5703  O O   . THR E  1 6   ? -24.489  -36.488 -30.730  1.00 89.50  ? 6   THR E O   1 
ATOM   5704  C CB  . THR E  1 6   ? -25.122  -34.553 -33.195  1.00 89.02  ? 6   THR E CB  1 
ATOM   5705  O OG1 . THR E  1 6   ? -25.325  -33.231 -33.682  1.00 89.26  ? 6   THR E OG1 1 
ATOM   5706  C CG2 . THR E  1 6   ? -25.705  -35.492 -34.188  1.00 89.50  ? 6   THR E CG2 1 
ATOM   5707  N N   . VAL E  1 7   ? -26.536  -37.012 -31.510  1.00 89.52  ? 7   VAL E N   1 
ATOM   5708  C CA  . VAL E  1 7   ? -26.397  -38.430 -31.178  1.00 90.57  ? 7   VAL E CA  1 
ATOM   5709  C C   . VAL E  1 7   ? -26.586  -39.354 -32.397  1.00 91.48  ? 7   VAL E C   1 
ATOM   5710  O O   . VAL E  1 7   ? -27.421  -39.091 -33.242  1.00 91.56  ? 7   VAL E O   1 
ATOM   5711  C CB  . VAL E  1 7   ? -27.360  -38.826 -30.049  1.00 91.18  ? 7   VAL E CB  1 
ATOM   5712  C CG1 . VAL E  1 7   ? -27.143  -40.263 -29.620  1.00 92.93  ? 7   VAL E CG1 1 
ATOM   5713  C CG2 . VAL E  1 7   ? -27.147  -37.913 -28.860  1.00 90.79  ? 7   VAL E CG2 1 
ATOM   5714  N N   . ILE E  1 8   ? -25.799  -40.429 -32.475  1.00 92.52  ? 8   ILE E N   1 
ATOM   5715  C CA  . ILE E  1 8   ? -25.888  -41.456 -33.547  1.00 94.04  ? 8   ILE E CA  1 
ATOM   5716  C C   . ILE E  1 8   ? -26.715  -42.715 -33.214  1.00 96.12  ? 8   ILE E C   1 
ATOM   5717  O O   . ILE E  1 8   ? -26.715  -43.194 -32.064  1.00 96.79  ? 8   ILE E O   1 
ATOM   5718  C CB  . ILE E  1 8   ? -24.478  -41.995 -33.925  1.00 94.44  ? 8   ILE E CB  1 
ATOM   5719  C CG1 . ILE E  1 8   ? -23.578  -42.194 -32.652  1.00 94.32  ? 8   ILE E CG1 1 
ATOM   5720  C CG2 . ILE E  1 8   ? -23.862  -41.139 -35.039  1.00 93.56  ? 8   ILE E CG2 1 
ATOM   5721  C CD1 . ILE E  1 8   ? -23.465  -43.636 -32.143  1.00 96.52  ? 8   ILE E CD1 1 
ATOM   5722  N N   . GLU E  1 9   ? -27.365  -43.276 -34.236  1.00 97.70  ? 9   GLU E N   1 
ATOM   5723  C CA  . GLU E  1 9   ? -28.110  -44.525 -34.086  1.00 100.39 ? 9   GLU E CA  1 
ATOM   5724  C C   . GLU E  1 9   ? -28.206  -45.327 -35.370  1.00 102.84 ? 9   GLU E C   1 
ATOM   5725  O O   . GLU E  1 9   ? -27.613  -46.392 -35.472  1.00 104.88 ? 9   GLU E O   1 
ATOM   5726  C CB  . GLU E  1 9   ? -29.494  -44.211 -33.562  1.00 100.31 ? 9   GLU E CB  1 
ATOM   5727  C CG  . GLU E  1 9   ? -29.977  -45.189 -32.516  1.00 102.37 ? 9   GLU E CG  1 
ATOM   5728  C CD  . GLU E  1 9   ? -30.559  -44.482 -31.304  1.00 100.94 ? 9   GLU E CD  1 
ATOM   5729  O OE1 . GLU E  1 9   ? -31.810  -44.503 -31.159  1.00 101.63 ? 9   GLU E OE1 1 
ATOM   5730  O OE2 . GLU E  1 9   ? -29.775  -43.906 -30.496  1.00 99.40  ? 9   GLU E OE2 1 
ATOM   5731  N N   . ARG E  1 16  ? -28.493  -43.231 -38.126  1.00 101.55 ? 16  ARG E N   1 
ATOM   5732  C CA  . ARG E  1 16  ? -29.221  -41.945 -38.138  1.00 99.95  ? 16  ARG E CA  1 
ATOM   5733  C C   . ARG E  1 16  ? -28.823  -40.929 -37.037  1.00 96.93  ? 16  ARG E C   1 
ATOM   5734  O O   . ARG E  1 16  ? -28.422  -41.314 -35.913  1.00 96.18  ? 16  ARG E O   1 
ATOM   5735  C CB  . ARG E  1 16  ? -30.716  -42.192 -38.142  1.00 101.39 ? 16  ARG E CB  1 
ATOM   5736  C CG  . ARG E  1 16  ? -31.150  -43.073 -39.313  1.00 105.00 ? 16  ARG E CG  1 
ATOM   5737  C CD  . ARG E  1 16  ? -31.224  -42.343 -40.672  1.00 106.11 ? 16  ARG E CD  1 
ATOM   5738  N NE  . ARG E  1 16  ? -31.738  -43.155 -41.788  1.00 110.21 ? 16  ARG E NE  1 
ATOM   5739  C CZ  . ARG E  1 16  ? -32.035  -42.664 -42.986  1.00 112.25 ? 16  ARG E CZ  1 
ATOM   5740  N NH1 . ARG E  1 16  ? -32.495  -43.470 -43.929  1.00 116.50 ? 16  ARG E NH1 1 
ATOM   5741  N NH2 . ARG E  1 16  ? -31.884  -41.360 -43.233  1.00 110.56 ? 16  ARG E NH2 1 
ATOM   5742  N N   . ALA E  1 17  ? -28.920  -39.639 -37.388  1.00 95.78  ? 17  ALA E N   1 
ATOM   5743  C CA  . ALA E  1 17  ? -28.465  -38.552 -36.515  1.00 93.53  ? 17  ALA E CA  1 
ATOM   5744  C C   . ALA E  1 17  ? -29.612  -37.787 -35.839  1.00 92.63  ? 17  ALA E C   1 
ATOM   5745  O O   . ALA E  1 17  ? -30.583  -37.426 -36.491  1.00 93.36  ? 17  ALA E O   1 
ATOM   5746  C CB  . ALA E  1 17  ? -27.542  -37.608 -37.274  1.00 93.25  ? 17  ALA E CB  1 
ATOM   5747  N N   . TYR E  1 18  ? -29.498  -37.577 -34.522  1.00 91.34  ? 18  TYR E N   1 
ATOM   5748  C CA  . TYR E  1 18  ? -30.410  -36.715 -33.764  1.00 90.41  ? 18  TYR E CA  1 
ATOM   5749  C C   . TYR E  1 18  ? -29.697  -35.598 -33.049  1.00 89.25  ? 18  TYR E C   1 
ATOM   5750  O O   . TYR E  1 18  ? -28.490  -35.726 -32.729  1.00 89.09  ? 18  TYR E O   1 
ATOM   5751  C CB  . TYR E  1 18  ? -31.038  -37.471 -32.630  1.00 90.57  ? 18  TYR E CB  1 
ATOM   5752  C CG  . TYR E  1 18  ? -31.799  -38.661 -33.032  1.00 92.19  ? 18  TYR E CG  1 
ATOM   5753  C CD1 . TYR E  1 18  ? -33.126  -38.565 -33.421  1.00 92.76  ? 18  TYR E CD1 1 
ATOM   5754  C CD2 . TYR E  1 18  ? -31.205  -39.900 -32.992  1.00 93.52  ? 18  TYR E CD2 1 
ATOM   5755  C CE1 . TYR E  1 18  ? -33.840  -39.675 -33.769  1.00 94.78  ? 18  TYR E CE1 1 
ATOM   5756  C CE2 . TYR E  1 18  ? -31.902  -41.025 -33.366  1.00 95.65  ? 18  TYR E CE2 1 
ATOM   5757  C CZ  . TYR E  1 18  ? -33.215  -40.902 -33.748  1.00 96.34  ? 18  TYR E CZ  1 
ATOM   5758  O OH  . TYR E  1 18  ? -33.892  -42.043 -34.092  1.00 98.97  ? 18  TYR E OH  1 
ATOM   5759  N N   . ASP E  1 19  ? -30.448  -34.534 -32.735  1.00 88.72  ? 19  ASP E N   1 
ATOM   5760  C CA  . ASP E  1 19  ? -29.986  -33.613 -31.705  1.00 88.14  ? 19  ASP E CA  1 
ATOM   5761  C C   . ASP E  1 19  ? -30.467  -34.175 -30.373  1.00 88.04  ? 19  ASP E C   1 
ATOM   5762  O O   . ASP E  1 19  ? -31.443  -34.920 -30.325  1.00 88.28  ? 19  ASP E O   1 
ATOM   5763  C CB  . ASP E  1 19  ? -30.507  -32.208 -31.933  1.00 88.11  ? 19  ASP E CB  1 
ATOM   5764  C CG  . ASP E  1 19  ? -31.999  -32.110 -31.750  1.00 87.91  ? 19  ASP E CG  1 
ATOM   5765  O OD1 . ASP E  1 19  ? -32.469  -31.947 -30.604  1.00 87.52  ? 19  ASP E OD1 1 
ATOM   5766  O OD2 . ASP E  1 19  ? -32.716  -32.199 -32.758  1.00 88.38  ? 19  ASP E OD2 1 
ATOM   5767  N N   . ILE E  1 20  ? -29.778  -33.819 -29.298  1.00 88.14  ? 20  ILE E N   1 
ATOM   5768  C CA  . ILE E  1 20  ? -30.041  -34.423 -28.014  1.00 88.67  ? 20  ILE E CA  1 
ATOM   5769  C C   . ILE E  1 20  ? -31.531  -34.464 -27.650  1.00 88.56  ? 20  ILE E C   1 
ATOM   5770  O O   . ILE E  1 20  ? -32.003  -35.478 -27.150  1.00 89.30  ? 20  ILE E O   1 
ATOM   5771  C CB  . ILE E  1 20  ? -29.131  -33.848 -26.909  1.00 89.36  ? 20  ILE E CB  1 
ATOM   5772  C CG1 . ILE E  1 20  ? -29.141  -34.755 -25.683  1.00 90.63  ? 20  ILE E CG1 1 
ATOM   5773  C CG2 . ILE E  1 20  ? -29.529  -32.435 -26.532  1.00 89.33  ? 20  ILE E CG2 1 
ATOM   5774  C CD1 . ILE E  1 20  ? -28.305  -35.992 -25.830  1.00 91.38  ? 20  ILE E CD1 1 
ATOM   5775  N N   . TYR E  1 21  ? -32.275  -33.400 -27.943  1.00 87.92  ? 21  TYR E N   1 
ATOM   5776  C CA  . TYR E  1 21  ? -33.687  -33.314 -27.547  1.00 87.76  ? 21  TYR E CA  1 
ATOM   5777  C C   . TYR E  1 21  ? -34.527  -34.320 -28.295  1.00 87.95  ? 21  TYR E C   1 
ATOM   5778  O O   . TYR E  1 21  ? -35.427  -34.911 -27.749  1.00 88.41  ? 21  TYR E O   1 
ATOM   5779  C CB  . TYR E  1 21  ? -34.247  -31.891 -27.692  1.00 87.27  ? 21  TYR E CB  1 
ATOM   5780  C CG  . TYR E  1 21  ? -33.457  -30.854 -26.911  1.00 87.74  ? 21  TYR E CG  1 
ATOM   5781  C CD1 . TYR E  1 21  ? -33.479  -30.827 -25.524  1.00 88.49  ? 21  TYR E CD1 1 
ATOM   5782  C CD2 . TYR E  1 21  ? -32.680  -29.895 -27.564  1.00 87.99  ? 21  TYR E CD2 1 
ATOM   5783  C CE1 . TYR E  1 21  ? -32.754  -29.883 -24.819  1.00 89.53  ? 21  TYR E CE1 1 
ATOM   5784  C CE2 . TYR E  1 21  ? -31.948  -28.951 -26.858  1.00 88.99  ? 21  TYR E CE2 1 
ATOM   5785  C CZ  . TYR E  1 21  ? -31.988  -28.951 -25.493  1.00 89.79  ? 21  TYR E CZ  1 
ATOM   5786  O OH  . TYR E  1 21  ? -31.261  -28.016 -24.793  1.00 91.36  ? 21  TYR E OH  1 
ATOM   5787  N N   . SER E  1 22  ? -34.204  -34.521 -29.551  1.00 88.01  ? 22  SER E N   1 
ATOM   5788  C CA  . SER E  1 22  ? -34.908  -35.480 -30.388  1.00 88.82  ? 22  SER E CA  1 
ATOM   5789  C C   . SER E  1 22  ? -34.626  -36.906 -29.969  1.00 89.99  ? 22  SER E C   1 
ATOM   5790  O O   . SER E  1 22  ? -35.489  -37.776 -30.039  1.00 91.16  ? 22  SER E O   1 
ATOM   5791  C CB  . SER E  1 22  ? -34.424  -35.347 -31.808  1.00 89.15  ? 22  SER E CB  1 
ATOM   5792  O OG  . SER E  1 22  ? -34.526  -34.013 -32.191  1.00 88.59  ? 22  SER E OG  1 
ATOM   5793  N N   . ARG E  1 23  ? -33.384  -37.152 -29.574  1.00 90.05  ? 23  ARG E N   1 
ATOM   5794  C CA  . ARG E  1 23  ? -33.022  -38.425 -29.021  1.00 91.49  ? 23  ARG E CA  1 
ATOM   5795  C C   . ARG E  1 23  ? -33.871  -38.739 -27.804  1.00 92.33  ? 23  ARG E C   1 
ATOM   5796  O O   . ARG E  1 23  ? -34.359  -39.828 -27.685  1.00 94.06  ? 23  ARG E O   1 
ATOM   5797  C CB  . ARG E  1 23  ? -31.536  -38.456 -28.686  1.00 91.43  ? 23  ARG E CB  1 
ATOM   5798  C CG  . ARG E  1 23  ? -31.075  -39.745 -28.028  1.00 93.30  ? 23  ARG E CG  1 
ATOM   5799  C CD  . ARG E  1 23  ? -31.400  -40.963 -28.879  1.00 94.86  ? 23  ARG E CD  1 
ATOM   5800  N NE  . ARG E  1 23  ? -31.181  -42.211 -28.143  1.00 97.27  ? 23  ARG E NE  1 
ATOM   5801  C CZ  . ARG E  1 23  ? -32.036  -42.735 -27.266  1.00 98.97  ? 23  ARG E CZ  1 
ATOM   5802  N NH1 . ARG E  1 23  ? -33.187  -42.150 -26.985  1.00 98.27  ? 23  ARG E NH1 1 
ATOM   5803  N NH2 . ARG E  1 23  ? -31.739  -43.857 -26.665  1.00 101.67 ? 23  ARG E NH2 1 
ATOM   5804  N N   . LEU E  1 24  ? -34.047  -37.782 -26.908  1.00 91.50  ? 24  LEU E N   1 
ATOM   5805  C CA  . LEU E  1 24  ? -34.893  -37.958 -25.733  1.00 92.43  ? 24  LEU E CA  1 
ATOM   5806  C C   . LEU E  1 24  ? -36.376  -38.060 -26.081  1.00 92.43  ? 24  LEU E C   1 
ATOM   5807  O O   . LEU E  1 24  ? -37.138  -38.682 -25.366  1.00 93.85  ? 24  LEU E O   1 
ATOM   5808  C CB  . LEU E  1 24  ? -34.677  -36.805 -24.760  1.00 91.80  ? 24  LEU E CB  1 
ATOM   5809  C CG  . LEU E  1 24  ? -33.800  -37.028 -23.550  1.00 93.36  ? 24  LEU E CG  1 
ATOM   5810  C CD1 . LEU E  1 24  ? -32.533  -37.774 -23.893  1.00 94.03  ? 24  LEU E CD1 1 
ATOM   5811  C CD2 . LEU E  1 24  ? -33.471  -35.683 -22.954  1.00 92.81  ? 24  LEU E CD2 1 
ATOM   5812  N N   . LEU E  1 25  ? -36.787  -37.431 -27.174  1.00 91.17  ? 25  LEU E N   1 
ATOM   5813  C CA  . LEU E  1 25  ? -38.176  -37.467 -27.595  1.00 91.34  ? 25  LEU E CA  1 
ATOM   5814  C C   . LEU E  1 25  ? -38.545  -38.879 -28.020  1.00 93.48  ? 25  LEU E C   1 
ATOM   5815  O O   . LEU E  1 25  ? -39.667  -39.325 -27.841  1.00 94.61  ? 25  LEU E O   1 
ATOM   5816  C CB  . LEU E  1 25  ? -38.437  -36.454 -28.710  1.00 90.07  ? 25  LEU E CB  1 
ATOM   5817  C CG  . LEU E  1 25  ? -39.867  -36.406 -29.218  1.00 90.42  ? 25  LEU E CG  1 
ATOM   5818  C CD1 . LEU E  1 25  ? -40.808  -35.968 -28.131  1.00 89.93  ? 25  LEU E CD1 1 
ATOM   5819  C CD2 . LEU E  1 25  ? -39.964  -35.480 -30.401  1.00 89.83  ? 25  LEU E CD2 1 
ATOM   5820  N N   . LYS E  1 26  ? -37.572  -39.586 -28.572  1.00 94.32  ? 26  LYS E N   1 
ATOM   5821  C CA  . LYS E  1 26  ? -37.703  -40.999 -28.928  1.00 96.95  ? 26  LYS E CA  1 
ATOM   5822  C C   . LYS E  1 26  ? -38.115  -41.854 -27.721  1.00 99.01  ? 26  LYS E C   1 
ATOM   5823  O O   . LYS E  1 26  ? -38.785  -42.864 -27.887  1.00 101.58 ? 26  LYS E O   1 
ATOM   5824  C CB  . LYS E  1 26  ? -36.378  -41.488 -29.492  1.00 97.36  ? 26  LYS E CB  1 
ATOM   5825  C CG  . LYS E  1 26  ? -36.479  -42.534 -30.567  1.00 99.71  ? 26  LYS E CG  1 
ATOM   5826  C CD  . LYS E  1 26  ? -35.069  -42.974 -30.950  1.00 99.98  ? 26  LYS E CD  1 
ATOM   5827  C CE  . LYS E  1 26  ? -35.054  -44.144 -31.922  1.00 102.91 ? 26  LYS E CE  1 
ATOM   5828  N NZ  . LYS E  1 26  ? -35.467  -45.394 -31.238  1.00 106.08 ? 26  LYS E NZ  1 
ATOM   5829  N N   . ASP E  1 27  ? -37.721  -41.433 -26.516  1.00 98.36  ? 27  ASP E N   1 
ATOM   5830  C CA  . ASP E  1 27  ? -38.099  -42.099 -25.261  1.00 100.62 ? 27  ASP E CA  1 
ATOM   5831  C C   . ASP E  1 27  ? -39.291  -41.453 -24.588  1.00 100.01 ? 27  ASP E C   1 
ATOM   5832  O O   . ASP E  1 27  ? -39.495  -41.658 -23.395  1.00 101.51 ? 27  ASP E O   1 
ATOM   5833  C CB  . ASP E  1 27  ? -36.942  -42.085 -24.273  1.00 101.05 ? 27  ASP E CB  1 
ATOM   5834  C CG  . ASP E  1 27  ? -35.744  -42.935 -24.736  1.00 102.25 ? 27  ASP E CG  1 
ATOM   5835  O OD1 . ASP E  1 27  ? -34.698  -42.898 -24.061  1.00 102.60 ? 27  ASP E OD1 1 
ATOM   5836  O OD2 . ASP E  1 27  ? -35.821  -43.652 -25.762  1.00 103.13 ? 27  ASP E OD2 1 
ATOM   5837  N N   . ARG E  1 28  ? -40.053  -40.666 -25.355  1.00 98.06  ? 28  ARG E N   1 
ATOM   5838  C CA  . ARG E  1 28  ? -41.233  -39.959 -24.876  1.00 97.22  ? 28  ARG E CA  1 
ATOM   5839  C C   . ARG E  1 28  ? -40.956  -38.864 -23.838  1.00 95.73  ? 28  ARG E C   1 
ATOM   5840  O O   . ARG E  1 28  ? -41.821  -38.530 -23.043  1.00 95.87  ? 28  ARG E O   1 
ATOM   5841  C CB  . ARG E  1 28  ? -42.269  -40.961 -24.379  1.00 99.97  ? 28  ARG E CB  1 
ATOM   5842  C CG  . ARG E  1 28  ? -42.645  -41.994 -25.422  1.00 102.03 ? 28  ARG E CG  1 
ATOM   5843  C CD  . ARG E  1 28  ? -43.678  -42.958 -24.889  1.00 105.25 ? 28  ARG E CD  1 
ATOM   5844  N NE  . ARG E  1 28  ? -45.030  -42.423 -24.818  1.00 104.55 ? 28  ARG E NE  1 
ATOM   5845  C CZ  . ARG E  1 28  ? -45.813  -42.198 -25.868  1.00 104.08 ? 28  ARG E CZ  1 
ATOM   5846  N NH1 . ARG E  1 28  ? -45.374  -42.413 -27.090  1.00 104.29 ? 28  ARG E NH1 1 
ATOM   5847  N NH2 . ARG E  1 28  ? -47.036  -41.734 -25.702  1.00 103.60 ? 28  ARG E NH2 1 
ATOM   5848  N N   . ILE E  1 29  ? -39.760  -38.288 -23.881  1.00 94.54  ? 29  ILE E N   1 
ATOM   5849  C CA  . ILE E  1 29  ? -39.393  -37.165 -23.015  1.00 93.54  ? 29  ILE E CA  1 
ATOM   5850  C C   . ILE E  1 29  ? -39.443  -35.812 -23.734  1.00 91.15  ? 29  ILE E C   1 
ATOM   5851  O O   . ILE E  1 29  ? -38.851  -35.633 -24.793  1.00 90.23  ? 29  ILE E O   1 
ATOM   5852  C CB  . ILE E  1 29  ? -37.997  -37.355 -22.397  1.00 94.53  ? 29  ILE E CB  1 
ATOM   5853  C CG1 . ILE E  1 29  ? -37.977  -38.587 -21.488  1.00 97.52  ? 29  ILE E CG1 1 
ATOM   5854  C CG2 . ILE E  1 29  ? -37.571  -36.087 -21.667  1.00 93.83  ? 29  ILE E CG2 1 
ATOM   5855  C CD1 . ILE E  1 29  ? -36.598  -39.011 -21.030  1.00 98.99  ? 29  ILE E CD1 1 
ATOM   5856  N N   . ILE E  1 30  ? -40.168  -34.865 -23.149  1.00 69.86  ? 30  ILE E N   1 
ATOM   5857  C CA  . ILE E  1 30  ? -40.201  -33.484 -23.657  1.00 68.18  ? 30  ILE E CA  1 
ATOM   5858  C C   . ILE E  1 30  ? -39.521  -32.495 -22.692  1.00 68.00  ? 30  ILE E C   1 
ATOM   5859  O O   . ILE E  1 30  ? -39.831  -32.480 -21.477  1.00 67.94  ? 30  ILE E O   1 
ATOM   5860  C CB  . ILE E  1 30  ? -41.628  -33.009 -23.941  1.00 66.36  ? 30  ILE E CB  1 
ATOM   5861  C CG1 . ILE E  1 30  ? -42.284  -33.957 -24.948  1.00 66.87  ? 30  ILE E CG1 1 
ATOM   5862  C CG2 . ILE E  1 30  ? -41.594  -31.560 -24.425  1.00 65.11  ? 30  ILE E CG2 1 
ATOM   5863  C CD1 . ILE E  1 30  ? -43.761  -33.759 -25.130  1.00 65.67  ? 30  ILE E CD1 1 
ATOM   5864  N N   . MET E  1 31  ? -38.592  -31.695 -23.217  1.00 68.30  ? 31  MET E N   1 
ATOM   5865  C CA  . MET E  1 31  ? -37.946  -30.693 -22.395  1.00 68.43  ? 31  MET E CA  1 
ATOM   5866  C C   . MET E  1 31  ? -38.590  -29.327 -22.584  1.00 66.77  ? 31  MET E C   1 
ATOM   5867  O O   . MET E  1 31  ? -38.691  -28.844 -23.703  1.00 66.39  ? 31  MET E O   1 
ATOM   5868  C CB  . MET E  1 31  ? -36.475  -30.631 -22.720  1.00 70.35  ? 31  MET E CB  1 
ATOM   5869  C CG  . MET E  1 31  ? -35.801  -31.976 -22.567  1.00 72.38  ? 31  MET E CG  1 
ATOM   5870  S SD  . MET E  1 31  ? -35.967  -32.677 -20.894  1.00 73.22  ? 31  MET E SD  1 
ATOM   5871  C CE  . MET E  1 31  ? -34.772  -31.692 -19.974  1.00 74.57  ? 31  MET E CE  1 
ATOM   5872  N N   . LEU E  1 32  ? -39.055  -28.717 -21.500  1.00 66.10  ? 32  LEU E N   1 
ATOM   5873  C CA  . LEU E  1 32  ? -39.462  -27.322 -21.541  1.00 65.10  ? 32  LEU E CA  1 
ATOM   5874  C C   . LEU E  1 32  ? -38.428  -26.566 -20.737  1.00 66.33  ? 32  LEU E C   1 
ATOM   5875  O O   . LEU E  1 32  ? -38.378  -26.663 -19.528  1.00 66.84  ? 32  LEU E O   1 
ATOM   5876  C CB  . LEU E  1 32  ? -40.862  -27.147 -20.965  1.00 63.71  ? 32  LEU E CB  1 
ATOM   5877  C CG  . LEU E  1 32  ? -41.371  -25.727 -20.758  1.00 63.01  ? 32  LEU E CG  1 
ATOM   5878  C CD1 . LEU E  1 32  ? -41.276  -24.916 -22.039  1.00 62.85  ? 32  LEU E CD1 1 
ATOM   5879  C CD2 . LEU E  1 32  ? -42.794  -25.786 -20.223  1.00 61.98  ? 32  LEU E CD2 1 
ATOM   5880  N N   . GLY E  1 33  ? -37.570  -25.845 -21.415  1.00 67.20  ? 33  GLY E N   1 
ATOM   5881  C CA  . GLY E  1 33  ? -36.458  -25.184 -20.731  1.00 68.89  ? 33  GLY E CA  1 
ATOM   5882  C C   . GLY E  1 33  ? -36.361  -23.691 -20.990  1.00 69.14  ? 33  GLY E C   1 
ATOM   5883  O O   . GLY E  1 33  ? -35.286  -23.128 -20.918  1.00 70.97  ? 33  GLY E O   1 
ATOM   5884  N N   . SER E  1 34  ? -37.497  -23.057 -21.279  1.00 67.61  ? 34  SER E N   1 
ATOM   5885  C CA  . SER E  1 34  ? -37.534  -21.659 -21.715  1.00 68.05  ? 34  SER E CA  1 
ATOM   5886  C C   . SER E  1 34  ? -38.847  -20.987 -21.327  1.00 66.69  ? 34  SER E C   1 
ATOM   5887  O O   . SER E  1 34  ? -39.752  -21.635 -20.814  1.00 65.36  ? 34  SER E O   1 
ATOM   5888  C CB  . SER E  1 34  ? -37.378  -21.572 -23.237  1.00 68.38  ? 34  SER E CB  1 
ATOM   5889  O OG  . SER E  1 34  ? -38.565  -22.016 -23.849  1.00 66.67  ? 34  SER E OG  1 
ATOM   5890  N N   . GLN E  1 35  ? -38.943  -19.681 -21.593  1.00 67.39  ? 35  GLN E N   1 
ATOM   5891  C CA  . GLN E  1 35  ? -40.187  -18.971 -21.375  1.00 66.48  ? 35  GLN E CA  1 
ATOM   5892  C C   . GLN E  1 35  ? -41.252  -19.546 -22.350  1.00 64.93  ? 35  GLN E C   1 
ATOM   5893  O O   . GLN E  1 35  ? -40.913  -20.161 -23.339  1.00 64.95  ? 35  GLN E O   1 
ATOM   5894  C CB  . GLN E  1 35  ? -39.991  -17.457 -21.466  1.00 68.07  ? 35  GLN E CB  1 
ATOM   5895  C CG  . GLN E  1 35  ? -40.008  -16.904 -22.878  1.00 68.77  ? 35  GLN E CG  1 
ATOM   5896  C CD  . GLN E  1 35  ? -39.065  -17.664 -23.844  1.00 69.31  ? 35  GLN E CD  1 
ATOM   5897  O OE1 . GLN E  1 35  ? -37.894  -17.983 -23.483  1.00 70.43  ? 35  GLN E OE1 1 
ATOM   5898  N NE2 . GLN E  1 35  ? -39.565  -17.980 -25.068  1.00 68.83  ? 35  GLN E NE2 1 
ATOM   5899  N N   . ILE E  1 36  ? -42.523  -19.405 -22.032  1.00 63.86  ? 36  ILE E N   1 
ATOM   5900  C CA  . ILE E  1 36  ? -43.569  -19.966 -22.839  1.00 62.71  ? 36  ILE E CA  1 
ATOM   5901  C C   . ILE E  1 36  ? -44.134  -18.865 -23.742  1.00 63.32  ? 36  ILE E C   1 
ATOM   5902  O O   . ILE E  1 36  ? -44.642  -17.847 -23.249  1.00 63.79  ? 36  ILE E O   1 
ATOM   5903  C CB  . ILE E  1 36  ? -44.672  -20.532 -21.926  1.00 61.59  ? 36  ILE E CB  1 
ATOM   5904  C CG1 . ILE E  1 36  ? -44.093  -21.662 -21.072  1.00 61.45  ? 36  ILE E CG1 1 
ATOM   5905  C CG2 . ILE E  1 36  ? -45.879  -21.041 -22.715  1.00 60.71  ? 36  ILE E CG2 1 
ATOM   5906  C CD1 . ILE E  1 36  ? -44.856  -21.885 -19.809  1.00 61.20  ? 36  ILE E CD1 1 
ATOM   5907  N N   . ASP E  1 37  ? -44.013  -19.038 -25.056  1.00 63.68  ? 37  ASP E N   1 
ATOM   5908  C CA  . ASP E  1 37  ? -44.656  -18.141 -26.005  1.00 64.54  ? 37  ASP E CA  1 
ATOM   5909  C C   . ASP E  1 37  ? -45.231  -18.989 -27.151  1.00 64.11  ? 37  ASP E C   1 
ATOM   5910  O O   . ASP E  1 37  ? -45.142  -20.211 -27.136  1.00 63.17  ? 37  ASP E O   1 
ATOM   5911  C CB  . ASP E  1 37  ? -43.650  -17.125 -26.522  1.00 66.59  ? 37  ASP E CB  1 
ATOM   5912  C CG  . ASP E  1 37  ? -42.478  -17.777 -27.271  1.00 67.32  ? 37  ASP E CG  1 
ATOM   5913  O OD1 . ASP E  1 37  ? -41.364  -17.226 -27.181  1.00 68.90  ? 37  ASP E OD1 1 
ATOM   5914  O OD2 . ASP E  1 37  ? -42.662  -18.835 -27.957  1.00 66.61  ? 37  ASP E OD2 1 
ATOM   5915  N N   . ASP E  1 38  ? -45.751  -18.342 -28.179  1.00 65.21  ? 38  ASP E N   1 
ATOM   5916  C CA  . ASP E  1 38  ? -46.425  -19.057 -29.230  1.00 65.14  ? 38  ASP E CA  1 
ATOM   5917  C C   . ASP E  1 38  ? -45.582  -20.130 -29.934  1.00 65.29  ? 38  ASP E C   1 
ATOM   5918  O O   . ASP E  1 38  ? -46.118  -21.182 -30.314  1.00 64.66  ? 38  ASP E O   1 
ATOM   5919  C CB  . ASP E  1 38  ? -47.043  -18.089 -30.216  1.00 66.84  ? 38  ASP E CB  1 
ATOM   5920  C CG  . ASP E  1 38  ? -48.379  -17.508 -29.728  1.00 66.59  ? 38  ASP E CG  1 
ATOM   5921  O OD1 . ASP E  1 38  ? -49.041  -16.770 -30.514  1.00 68.18  ? 38  ASP E OD1 1 
ATOM   5922  O OD2 . ASP E  1 38  ? -48.788  -17.795 -28.560  1.00 65.11  ? 38  ASP E OD2 1 
ATOM   5923  N N   . ASN E  1 39  ? -44.280  -19.876 -30.092  1.00 66.40  ? 39  ASN E N   1 
ATOM   5924  C CA  . ASN E  1 39  ? -43.398  -20.850 -30.700  1.00 66.90  ? 39  ASN E CA  1 
ATOM   5925  C C   . ASN E  1 39  ? -43.207  -22.028 -29.796  1.00 65.37  ? 39  ASN E C   1 
ATOM   5926  O O   . ASN E  1 39  ? -43.306  -23.192 -30.221  1.00 65.14  ? 39  ASN E O   1 
ATOM   5927  C CB  . ASN E  1 39  ? -42.028  -20.277 -30.964  1.00 68.76  ? 39  ASN E CB  1 
ATOM   5928  C CG  . ASN E  1 39  ? -41.984  -19.550 -32.236  1.00 70.98  ? 39  ASN E CG  1 
ATOM   5929  O OD1 . ASN E  1 39  ? -43.021  -19.423 -32.937  1.00 71.15  ? 39  ASN E OD1 1 
ATOM   5930  N ND2 . ASN E  1 39  ? -40.819  -19.014 -32.563  1.00 73.09  ? 39  ASN E ND2 1 
ATOM   5931  N N   . VAL E  1 40  ? -42.908  -21.734 -28.543  1.00 64.68  ? 40  VAL E N   1 
ATOM   5932  C CA  . VAL E  1 40  ? -42.629  -22.787 -27.641  1.00 63.74  ? 40  VAL E CA  1 
ATOM   5933  C C   . VAL E  1 40  ? -43.849  -23.656 -27.490  1.00 62.43  ? 40  VAL E C   1 
ATOM   5934  O O   . VAL E  1 40  ? -43.737  -24.870 -27.659  1.00 62.36  ? 40  VAL E O   1 
ATOM   5935  C CB  . VAL E  1 40  ? -42.116  -22.255 -26.320  1.00 63.63  ? 40  VAL E CB  1 
ATOM   5936  C CG1 . VAL E  1 40  ? -42.062  -23.371 -25.305  1.00 62.82  ? 40  VAL E CG1 1 
ATOM   5937  C CG2 . VAL E  1 40  ? -40.725  -21.700 -26.521  1.00 65.34  ? 40  VAL E CG2 1 
ATOM   5938  N N   . ALA E  1 41  ? -45.003  -23.041 -27.262  1.00 61.80  ? 41  ALA E N   1 
ATOM   5939  C CA  . ALA E  1 41  ? -46.267  -23.762 -27.277  1.00 61.00  ? 41  ALA E CA  1 
ATOM   5940  C C   . ALA E  1 41  ? -46.460  -24.600 -28.536  1.00 61.58  ? 41  ALA E C   1 
ATOM   5941  O O   . ALA E  1 41  ? -46.766  -25.800 -28.490  1.00 61.34  ? 41  ALA E O   1 
ATOM   5942  C CB  . ALA E  1 41  ? -47.414  -22.826 -27.104  1.00 60.81  ? 41  ALA E CB  1 
ATOM   5943  N N   . ASN E  1 42  ? -46.202  -24.000 -29.672  1.00 62.72  ? 42  ASN E N   1 
ATOM   5944  C CA  . ASN E  1 42  ? -46.437  -24.713 -30.920  1.00 63.64  ? 42  ASN E CA  1 
ATOM   5945  C C   . ASN E  1 42  ? -45.614  -25.979 -31.036  1.00 63.95  ? 42  ASN E C   1 
ATOM   5946  O O   . ASN E  1 42  ? -46.077  -27.002 -31.520  1.00 64.27  ? 42  ASN E O   1 
ATOM   5947  C CB  . ASN E  1 42  ? -46.203  -23.786 -32.101  1.00 65.29  ? 42  ASN E CB  1 
ATOM   5948  C CG  . ASN E  1 42  ? -46.935  -24.242 -33.343  1.00 66.44  ? 42  ASN E CG  1 
ATOM   5949  O OD1 . ASN E  1 42  ? -46.361  -24.242 -34.436  1.00 68.18  ? 42  ASN E OD1 1 
ATOM   5950  N ND2 . ASN E  1 42  ? -48.206  -24.640 -33.189  1.00 65.81  ? 42  ASN E ND2 1 
ATOM   5951  N N   . SER E  1 43  ? -44.382  -25.881 -30.565  1.00 64.13  ? 43  SER E N   1 
ATOM   5952  C CA  . SER E  1 43  ? -43.441  -26.980 -30.510  1.00 64.71  ? 43  SER E CA  1 
ATOM   5953  C C   . SER E  1 43  ? -43.839  -28.053 -29.496  1.00 63.75  ? 43  SER E C   1 
ATOM   5954  O O   . SER E  1 43  ? -43.828  -29.243 -29.830  1.00 64.41  ? 43  SER E O   1 
ATOM   5955  C CB  . SER E  1 43  ? -42.117  -26.415 -30.085  1.00 65.31  ? 43  SER E CB  1 
ATOM   5956  O OG  . SER E  1 43  ? -41.134  -27.382 -30.152  1.00 66.32  ? 43  SER E OG  1 
ATOM   5957  N N   . ILE E  1 44  ? -44.187  -27.636 -28.267  1.00 62.57  ? 44  ILE E N   1 
ATOM   5958  C CA  . ILE E  1 44  ? -44.607  -28.578 -27.235  1.00 62.04  ? 44  ILE E CA  1 
ATOM   5959  C C   . ILE E  1 44  ? -45.861  -29.308 -27.688  1.00 61.98  ? 44  ILE E C   1 
ATOM   5960  O O   . ILE E  1 44  ? -45.865  -30.546 -27.716  1.00 62.67  ? 44  ILE E O   1 
ATOM   5961  C CB  . ILE E  1 44  ? -44.865  -27.927 -25.857  1.00 61.12  ? 44  ILE E CB  1 
ATOM   5962  C CG1 . ILE E  1 44  ? -43.663  -27.162 -25.309  1.00 61.46  ? 44  ILE E CG1 1 
ATOM   5963  C CG2 . ILE E  1 44  ? -45.258  -28.979 -24.832  1.00 61.09  ? 44  ILE E CG2 1 
ATOM   5964  C CD1 . ILE E  1 44  ? -42.442  -27.986 -25.050  1.00 62.50  ? 44  ILE E CD1 1 
ATOM   5965  N N   . VAL E  1 45  ? -46.900  -28.565 -28.069  1.00 61.53  ? 45  VAL E N   1 
ATOM   5966  C CA  . VAL E  1 45  ? -48.119  -29.183 -28.599  1.00 61.85  ? 45  VAL E CA  1 
ATOM   5967  C C   . VAL E  1 45  ? -47.797  -30.237 -29.664  1.00 63.17  ? 45  VAL E C   1 
ATOM   5968  O O   . VAL E  1 45  ? -48.225  -31.384 -29.570  1.00 63.77  ? 45  VAL E O   1 
ATOM   5969  C CB  . VAL E  1 45  ? -49.115  -28.132 -29.142  1.00 61.73  ? 45  VAL E CB  1 
ATOM   5970  C CG1 . VAL E  1 45  ? -50.244  -28.764 -29.947  1.00 62.60  ? 45  VAL E CG1 1 
ATOM   5971  C CG2 . VAL E  1 45  ? -49.694  -27.331 -27.992  1.00 60.76  ? 45  VAL E CG2 1 
ATOM   5972  N N   . SER E  1 46  ? -47.018  -29.851 -30.653  1.00 63.94  ? 46  SER E N   1 
ATOM   5973  C CA  . SER E  1 46  ? -46.682  -30.767 -31.705  1.00 65.51  ? 46  SER E CA  1 
ATOM   5974  C C   . SER E  1 46  ? -45.997  -32.023 -31.191  1.00 66.08  ? 46  SER E C   1 
ATOM   5975  O O   . SER E  1 46  ? -46.250  -33.129 -31.713  1.00 67.39  ? 46  SER E O   1 
ATOM   5976  C CB  . SER E  1 46  ? -45.782  -30.093 -32.709  1.00 66.54  ? 46  SER E CB  1 
ATOM   5977  O OG  . SER E  1 46  ? -46.540  -29.127 -33.373  1.00 66.66  ? 46  SER E OG  1 
ATOM   5978  N N   . GLN E  1 47  ? -45.148  -31.877 -30.179  1.00 65.47  ? 47  GLN E N   1 
ATOM   5979  C CA  . GLN E  1 47  ? -44.481  -33.042 -29.634  1.00 66.36  ? 47  GLN E CA  1 
ATOM   5980  C C   . GLN E  1 47  ? -45.480  -33.976 -28.969  1.00 66.39  ? 47  GLN E C   1 
ATOM   5981  O O   . GLN E  1 47  ? -45.436  -35.192 -29.181  1.00 67.90  ? 47  GLN E O   1 
ATOM   5982  C CB  . GLN E  1 47  ? -43.391  -32.660 -28.657  1.00 66.05  ? 47  GLN E CB  1 
ATOM   5983  C CG  . GLN E  1 47  ? -42.106  -32.255 -29.337  1.00 67.07  ? 47  GLN E CG  1 
ATOM   5984  C CD  . GLN E  1 47  ? -41.184  -31.476 -28.424  1.00 66.71  ? 47  GLN E CD  1 
ATOM   5985  O OE1 . GLN E  1 47  ? -40.475  -32.053 -27.618  1.00 67.40  ? 47  GLN E OE1 1 
ATOM   5986  N NE2 . GLN E  1 47  ? -41.188  -30.145 -28.558  1.00 65.97  ? 47  GLN E NE2 1 
ATOM   5987  N N   . LEU E  1 48  ? -46.390  -33.399 -28.193  1.00 65.05  ? 48  LEU E N   1 
ATOM   5988  C CA  . LEU E  1 48  ? -47.492  -34.149 -27.624  1.00 65.32  ? 48  LEU E CA  1 
ATOM   5989  C C   . LEU E  1 48  ? -48.350  -34.877 -28.694  1.00 66.56  ? 48  LEU E C   1 
ATOM   5990  O O   . LEU E  1 48  ? -48.579  -36.082 -28.584  1.00 68.03  ? 48  LEU E O   1 
ATOM   5991  C CB  . LEU E  1 48  ? -48.341  -33.235 -26.744  1.00 63.91  ? 48  LEU E CB  1 
ATOM   5992  C CG  . LEU E  1 48  ? -47.652  -32.659 -25.498  1.00 63.12  ? 48  LEU E CG  1 
ATOM   5993  C CD1 . LEU E  1 48  ? -48.481  -31.567 -24.912  1.00 61.95  ? 48  LEU E CD1 1 
ATOM   5994  C CD2 . LEU E  1 48  ? -47.392  -33.704 -24.422  1.00 64.15  ? 48  LEU E CD2 1 
ATOM   5995  N N   . LEU E  1 49  ? -48.799  -34.195 -29.738  1.00 66.38  ? 49  LEU E N   1 
ATOM   5996  C CA  . LEU E  1 49  ? -49.609  -34.878 -30.725  1.00 67.89  ? 49  LEU E CA  1 
ATOM   5997  C C   . LEU E  1 49  ? -48.830  -36.019 -31.385  1.00 69.80  ? 49  LEU E C   1 
ATOM   5998  O O   . LEU E  1 49  ? -49.367  -37.128 -31.663  1.00 71.56  ? 49  LEU E O   1 
ATOM   5999  C CB  . LEU E  1 49  ? -50.143  -33.917 -31.775  1.00 67.78  ? 49  LEU E CB  1 
ATOM   6000  C CG  . LEU E  1 49  ? -51.139  -32.887 -31.241  1.00 66.48  ? 49  LEU E CG  1 
ATOM   6001  C CD1 . LEU E  1 49  ? -51.525  -31.932 -32.353  1.00 66.85  ? 49  LEU E CD1 1 
ATOM   6002  C CD2 . LEU E  1 49  ? -52.349  -33.579 -30.667  1.00 67.02  ? 49  LEU E CD2 1 
ATOM   6003  N N   . PHE E  1 50  ? -47.555  -35.759 -31.615  1.00 69.78  ? 50  PHE E N   1 
ATOM   6004  C CA  . PHE E  1 50  ? -46.733  -36.758 -32.241  1.00 71.82  ? 50  PHE E CA  1 
ATOM   6005  C C   . PHE E  1 50  ? -46.640  -37.984 -31.359  1.00 72.85  ? 50  PHE E C   1 
ATOM   6006  O O   . PHE E  1 50  ? -46.835  -39.106 -31.828  1.00 74.99  ? 50  PHE E O   1 
ATOM   6007  C CB  . PHE E  1 50  ? -45.350  -36.197 -32.530  1.00 71.82  ? 50  PHE E CB  1 
ATOM   6008  C CG  . PHE E  1 50  ? -44.321  -37.227 -32.869  1.00 74.00  ? 50  PHE E CG  1 
ATOM   6009  C CD1 . PHE E  1 50  ? -44.286  -37.837 -34.111  1.00 76.23  ? 50  PHE E CD1 1 
ATOM   6010  C CD2 . PHE E  1 50  ? -43.356  -37.567 -31.945  1.00 74.16  ? 50  PHE E CD2 1 
ATOM   6011  C CE1 . PHE E  1 50  ? -43.317  -38.795 -34.385  1.00 78.54  ? 50  PHE E CE1 1 
ATOM   6012  C CE2 . PHE E  1 50  ? -42.384  -38.518 -32.221  1.00 76.50  ? 50  PHE E CE2 1 
ATOM   6013  C CZ  . PHE E  1 50  ? -42.367  -39.129 -33.437  1.00 78.67  ? 50  PHE E CZ  1 
ATOM   6014  N N   . LEU E  1 51  ? -46.363  -37.764 -30.082  1.00 71.66  ? 51  LEU E N   1 
ATOM   6015  C CA  . LEU E  1 51  ? -46.146  -38.860 -29.153  1.00 72.96  ? 51  LEU E CA  1 
ATOM   6016  C C   . LEU E  1 51  ? -47.385  -39.725 -29.010  1.00 74.14  ? 51  LEU E C   1 
ATOM   6017  O O   . LEU E  1 51  ? -47.299  -40.978 -28.883  1.00 76.48  ? 51  LEU E O   1 
ATOM   6018  C CB  . LEU E  1 51  ? -45.693  -38.348 -27.806  1.00 71.67  ? 51  LEU E CB  1 
ATOM   6019  C CG  . LEU E  1 51  ? -44.220  -37.962 -27.731  1.00 71.65  ? 51  LEU E CG  1 
ATOM   6020  C CD1 . LEU E  1 51  ? -43.885  -37.682 -26.281  1.00 71.01  ? 51  LEU E CD1 1 
ATOM   6021  C CD2 . LEU E  1 51  ? -43.281  -39.015 -28.297  1.00 74.14  ? 51  LEU E CD2 1 
ATOM   6022  N N   . GLN E  1 52  ? -48.541  -39.066 -29.061  1.00 72.89  ? 52  GLN E N   1 
ATOM   6023  C CA  . GLN E  1 52  ? -49.788  -39.788 -29.030  1.00 74.24  ? 52  GLN E CA  1 
ATOM   6024  C C   . GLN E  1 52  ? -49.954  -40.686 -30.229  1.00 76.60  ? 52  GLN E C   1 
ATOM   6025  O O   . GLN E  1 52  ? -50.281  -41.842 -30.074  1.00 78.90  ? 52  GLN E O   1 
ATOM   6026  C CB  . GLN E  1 52  ? -50.947  -38.823 -28.965  1.00 72.70  ? 52  GLN E CB  1 
ATOM   6027  C CG  . GLN E  1 52  ? -52.258  -39.543 -28.709  1.00 74.30  ? 52  GLN E CG  1 
ATOM   6028  C CD  . GLN E  1 52  ? -53.437  -38.598 -28.685  1.00 73.16  ? 52  GLN E CD  1 
ATOM   6029  O OE1 . GLN E  1 52  ? -53.525  -37.701 -29.510  1.00 72.14  ? 52  GLN E OE1 1 
ATOM   6030  N NE2 . GLN E  1 52  ? -54.360  -38.808 -27.751  1.00 73.72  ? 52  GLN E NE2 1 
ATOM   6031  N N   . ALA E  1 53  ? -49.725  -40.148 -31.416  1.00 76.35  ? 53  ALA E N   1 
ATOM   6032  C CA  . ALA E  1 53  ? -49.850  -40.900 -32.664  1.00 78.82  ? 53  ALA E CA  1 
ATOM   6033  C C   . ALA E  1 53  ? -48.941  -42.130 -32.692  1.00 81.21  ? 53  ALA E C   1 
ATOM   6034  O O   . ALA E  1 53  ? -49.247  -43.133 -33.347  1.00 83.97  ? 53  ALA E O   1 
ATOM   6035  C CB  . ALA E  1 53  ? -49.582  -39.998 -33.858  1.00 78.29  ? 53  ALA E CB  1 
ATOM   6036  N N   . GLN E  1 54  ? -47.836  -42.047 -31.958  1.00 80.45  ? 54  GLN E N   1 
ATOM   6037  C CA  . GLN E  1 54  ? -46.864  -43.135 -31.872  1.00 82.84  ? 54  GLN E CA  1 
ATOM   6038  C C   . GLN E  1 54  ? -47.357  -44.282 -31.005  1.00 84.80  ? 54  GLN E C   1 
ATOM   6039  O O   . GLN E  1 54  ? -47.178  -45.465 -31.346  1.00 87.94  ? 54  GLN E O   1 
ATOM   6040  C CB  . GLN E  1 54  ? -45.550  -42.637 -31.270  1.00 81.67  ? 54  GLN E CB  1 
ATOM   6041  C CG  . GLN E  1 54  ? -44.799  -41.666 -32.145  1.00 80.62  ? 54  GLN E CG  1 
ATOM   6042  C CD  . GLN E  1 54  ? -44.003  -42.371 -33.210  1.00 83.37  ? 54  GLN E CD  1 
ATOM   6043  O OE1 . GLN E  1 54  ? -42.864  -42.793 -32.956  1.00 84.67  ? 54  GLN E OE1 1 
ATOM   6044  N NE2 . GLN E  1 54  ? -44.583  -42.509 -34.421  1.00 84.60  ? 54  GLN E NE2 1 
ATOM   6045  N N   . ASP E  1 55  ? -47.955  -43.921 -29.873  1.00 83.26  ? 55  ASP E N   1 
ATOM   6046  C CA  . ASP E  1 55  ? -48.417  -44.864 -28.878  1.00 85.13  ? 55  ASP E CA  1 
ATOM   6047  C C   . ASP E  1 55  ? -49.337  -44.084 -27.947  1.00 82.99  ? 55  ASP E C   1 
ATOM   6048  O O   . ASP E  1 55  ? -48.898  -43.143 -27.310  1.00 80.58  ? 55  ASP E O   1 
ATOM   6049  C CB  . ASP E  1 55  ? -47.206  -45.446 -28.118  1.00 86.46  ? 55  ASP E CB  1 
ATOM   6050  C CG  . ASP E  1 55  ? -47.596  -46.576 -27.154  1.00 89.29  ? 55  ASP E CG  1 
ATOM   6051  O OD1 . ASP E  1 55  ? -48.507  -46.315 -26.340  1.00 88.51  ? 55  ASP E OD1 1 
ATOM   6052  O OD2 . ASP E  1 55  ? -47.010  -47.707 -27.198  1.00 92.55  ? 55  ASP E OD2 1 
ATOM   6053  N N   . SER E  1 56  ? -50.608  -44.434 -27.878  1.00 84.07  ? 56  SER E N   1 
ATOM   6054  C CA  . SER E  1 56  ? -51.513  -43.696 -27.029  1.00 82.38  ? 56  SER E CA  1 
ATOM   6055  C C   . SER E  1 56  ? -51.668  -44.265 -25.622  1.00 83.79  ? 56  SER E C   1 
ATOM   6056  O O   . SER E  1 56  ? -52.502  -43.792 -24.858  1.00 83.04  ? 56  SER E O   1 
ATOM   6057  C CB  . SER E  1 56  ? -52.874  -43.520 -27.700  1.00 82.67  ? 56  SER E CB  1 
ATOM   6058  O OG  . SER E  1 56  ? -53.397  -44.761 -28.135  1.00 86.11  ? 56  SER E OG  1 
ATOM   6059  N N   . GLU E  1 57  ? -50.864  -45.265 -25.281  1.00 86.13  ? 57  GLU E N   1 
ATOM   6060  C CA  . GLU E  1 57  ? -50.917  -45.917 -23.949  1.00 88.19  ? 57  GLU E CA  1 
ATOM   6061  C C   . GLU E  1 57  ? -49.758  -45.437 -23.095  1.00 86.89  ? 57  GLU E C   1 
ATOM   6062  O O   . GLU E  1 57  ? -49.975  -44.990 -21.981  1.00 86.24  ? 57  GLU E O   1 
ATOM   6063  C CB  . GLU E  1 57  ? -50.818  -47.447 -24.011  1.00 92.53  ? 57  GLU E CB  1 
ATOM   6064  C CG  . GLU E  1 57  ? -51.287  -48.090 -25.302  1.00 94.29  ? 57  GLU E CG  1 
ATOM   6065  C CD  . GLU E  1 57  ? -52.760  -48.489 -25.235  1.00 96.19  ? 57  GLU E CD  1 
ATOM   6066  O OE1 . GLU E  1 57  ? -53.601  -47.551 -25.476  1.00 93.79  ? 57  GLU E OE1 1 
ATOM   6067  O OE2 . GLU E  1 57  ? -53.054  -49.715 -24.937  1.00 100.31 ? 57  GLU E OE2 1 
ATOM   6068  N N   . LYS E  1 58  ? -48.530  -45.548 -23.623  1.00 86.87  ? 58  LYS E N   1 
ATOM   6069  C CA  . LYS E  1 58  ? -47.309  -45.321 -22.843  1.00 86.59  ? 58  LYS E CA  1 
ATOM   6070  C C   . LYS E  1 58  ? -47.256  -43.858 -22.460  1.00 82.97  ? 58  LYS E C   1 
ATOM   6071  O O   . LYS E  1 58  ? -47.463  -42.975 -23.290  1.00 80.49  ? 58  LYS E O   1 
ATOM   6072  C CB  . LYS E  1 58  ? -46.050  -45.761 -23.601  1.00 87.71  ? 58  LYS E CB  1 
ATOM   6073  C CG  . LYS E  1 58  ? -45.703  -47.214 -23.360  1.00 91.97  ? 58  LYS E CG  1 
ATOM   6074  C CD  . LYS E  1 58  ? -44.333  -47.600 -23.890  1.00 93.39  ? 58  LYS E CD  1 
ATOM   6075  C CE  . LYS E  1 58  ? -44.379  -47.750 -25.397  1.00 93.46  ? 58  LYS E CE  1 
ATOM   6076  N NZ  . LYS E  1 58  ? -43.260  -48.608 -25.838  1.00 96.50  ? 58  LYS E NZ  1 
ATOM   6077  N N   . ASP E  1 59  ? -47.025  -43.583 -21.193  1.00 82.96  ? 59  ASP E N   1 
ATOM   6078  C CA  . ASP E  1 59  ? -47.147  -42.203 -20.814  1.00 79.86  ? 59  ASP E CA  1 
ATOM   6079  C C   . ASP E  1 59  ? -45.905  -41.348 -21.121  1.00 78.02  ? 59  ASP E C   1 
ATOM   6080  O O   . ASP E  1 59  ? -44.870  -41.875 -21.566  1.00 79.31  ? 59  ASP E O   1 
ATOM   6081  C CB  . ASP E  1 59  ? -47.813  -41.997 -19.435  1.00 80.26  ? 59  ASP E CB  1 
ATOM   6082  C CG  . ASP E  1 59  ? -47.084  -42.647 -18.323  1.00 82.83  ? 59  ASP E CG  1 
ATOM   6083  O OD1 . ASP E  1 59  ? -45.842  -42.728 -18.503  1.00 83.12  ? 59  ASP E OD1 1 
ATOM   6084  O OD2 . ASP E  1 59  ? -47.743  -43.030 -17.299  1.00 84.73  ? 59  ASP E OD2 1 
ATOM   6085  N N   . ILE E  1 60  ? -46.077  -40.026 -20.972  1.00 75.28  ? 60  ILE E N   1 
ATOM   6086  C CA  . ILE E  1 60  ? -45.158  -39.020 -21.478  1.00 73.38  ? 60  ILE E CA  1 
ATOM   6087  C C   . ILE E  1 60  ? -44.487  -38.288 -20.324  1.00 72.93  ? 60  ILE E C   1 
ATOM   6088  O O   . ILE E  1 60  ? -45.112  -38.058 -19.294  1.00 72.91  ? 60  ILE E O   1 
ATOM   6089  C CB  . ILE E  1 60  ? -45.915  -38.038 -22.377  1.00 71.00  ? 60  ILE E CB  1 
ATOM   6090  C CG1 . ILE E  1 60  ? -46.315  -38.742 -23.674  1.00 71.80  ? 60  ILE E CG1 1 
ATOM   6091  C CG2 . ILE E  1 60  ? -45.062  -36.817 -22.720  1.00 69.21  ? 60  ILE E CG2 1 
ATOM   6092  C CD1 . ILE E  1 60  ? -47.370  -38.015 -24.483  1.00 70.21  ? 60  ILE E CD1 1 
ATOM   6093  N N   . TYR E  1 61  ? -43.219  -37.933 -20.499  1.00 72.89  ? 61  TYR E N   1 
ATOM   6094  C CA  . TYR E  1 61  ? -42.490  -37.199 -19.487  1.00 72.75  ? 61  TYR E CA  1 
ATOM   6095  C C   . TYR E  1 61  ? -42.173  -35.746 -19.900  1.00 70.48  ? 61  TYR E C   1 
ATOM   6096  O O   . TYR E  1 61  ? -41.371  -35.496 -20.837  1.00 70.28  ? 61  TYR E O   1 
ATOM   6097  C CB  . TYR E  1 61  ? -41.208  -37.938 -19.133  1.00 75.24  ? 61  TYR E CB  1 
ATOM   6098  C CG  . TYR E  1 61  ? -41.473  -39.351 -18.717  1.00 77.94  ? 61  TYR E CG  1 
ATOM   6099  C CD1 . TYR E  1 61  ? -41.475  -40.383 -19.660  1.00 79.29  ? 61  TYR E CD1 1 
ATOM   6100  C CD2 . TYR E  1 61  ? -41.755  -39.678 -17.387  1.00 79.54  ? 61  TYR E CD2 1 
ATOM   6101  C CE1 . TYR E  1 61  ? -41.743  -41.693 -19.306  1.00 82.16  ? 61  TYR E CE1 1 
ATOM   6102  C CE2 . TYR E  1 61  ? -42.016  -40.993 -17.026  1.00 82.48  ? 61  TYR E CE2 1 
ATOM   6103  C CZ  . TYR E  1 61  ? -42.011  -41.997 -17.992  1.00 83.78  ? 61  TYR E CZ  1 
ATOM   6104  O OH  . TYR E  1 61  ? -42.257  -43.326 -17.626  1.00 87.16  ? 61  TYR E OH  1 
ATOM   6105  N N   . LEU E  1 62  ? -42.799  -34.802 -19.180  1.00 69.15  ? 62  LEU E N   1 
ATOM   6106  C CA  . LEU E  1 62  ? -42.606  -33.382 -19.418  1.00 67.37  ? 62  LEU E CA  1 
ATOM   6107  C C   . LEU E  1 62  ? -41.771  -32.734 -18.318  1.00 68.01  ? 62  LEU E C   1 
ATOM   6108  O O   . LEU E  1 62  ? -42.286  -32.466 -17.219  1.00 68.17  ? 62  LEU E O   1 
ATOM   6109  C CB  . LEU E  1 62  ? -43.953  -32.667 -19.590  1.00 65.61  ? 62  LEU E CB  1 
ATOM   6110  C CG  . LEU E  1 62  ? -43.880  -31.179 -19.938  1.00 64.04  ? 62  LEU E CG  1 
ATOM   6111  C CD1 . LEU E  1 62  ? -43.093  -30.928 -21.221  1.00 63.83  ? 62  LEU E CD1 1 
ATOM   6112  C CD2 . LEU E  1 62  ? -45.284  -30.606 -20.027  1.00 62.81  ? 62  LEU E CD2 1 
ATOM   6113  N N   . TYR E  1 63  ? -40.488  -32.493 -18.606  1.00 68.70  ? 63  TYR E N   1 
ATOM   6114  C CA  . TYR E  1 63  ? -39.630  -31.762 -17.658  1.00 69.53  ? 63  TYR E CA  1 
ATOM   6115  C C   . TYR E  1 63  ? -39.852  -30.268 -17.821  1.00 67.90  ? 63  TYR E C   1 
ATOM   6116  O O   . TYR E  1 63  ? -39.971  -29.771 -18.942  1.00 66.70  ? 63  TYR E O   1 
ATOM   6117  C CB  . TYR E  1 63  ? -38.174  -32.089 -17.876  1.00 71.35  ? 63  TYR E CB  1 
ATOM   6118  C CG  . TYR E  1 63  ? -37.789  -33.453 -17.406  1.00 73.67  ? 63  TYR E CG  1 
ATOM   6119  C CD1 . TYR E  1 63  ? -37.921  -34.567 -18.250  1.00 74.20  ? 63  TYR E CD1 1 
ATOM   6120  C CD2 . TYR E  1 63  ? -37.251  -33.642 -16.126  1.00 75.76  ? 63  TYR E CD2 1 
ATOM   6121  C CE1 . TYR E  1 63  ? -37.538  -35.837 -17.825  1.00 76.77  ? 63  TYR E CE1 1 
ATOM   6122  C CE2 . TYR E  1 63  ? -36.867  -34.901 -15.688  1.00 78.36  ? 63  TYR E CE2 1 
ATOM   6123  C CZ  . TYR E  1 63  ? -37.012  -35.995 -16.538  1.00 78.87  ? 63  TYR E CZ  1 
ATOM   6124  O OH  . TYR E  1 63  ? -36.642  -37.252 -16.135  1.00 81.79  ? 63  TYR E OH  1 
ATOM   6125  N N   . ILE E  1 64  ? -39.938  -29.555 -16.709  1.00 68.17  ? 64  ILE E N   1 
ATOM   6126  C CA  . ILE E  1 64  ? -40.321  -28.151 -16.748  1.00 66.91  ? 64  ILE E CA  1 
ATOM   6127  C C   . ILE E  1 64  ? -39.337  -27.300 -15.958  1.00 68.26  ? 64  ILE E C   1 
ATOM   6128  O O   . ILE E  1 64  ? -39.180  -27.471 -14.722  1.00 69.71  ? 64  ILE E O   1 
ATOM   6129  C CB  . ILE E  1 64  ? -41.732  -27.936 -16.175  1.00 65.97  ? 64  ILE E CB  1 
ATOM   6130  C CG1 . ILE E  1 64  ? -42.784  -28.680 -17.011  1.00 64.84  ? 64  ILE E CG1 1 
ATOM   6131  C CG2 . ILE E  1 64  ? -42.055  -26.441 -16.081  1.00 65.19  ? 64  ILE E CG2 1 
ATOM   6132  C CD1 . ILE E  1 64  ? -44.171  -28.607 -16.430  1.00 64.38  ? 64  ILE E CD1 1 
ATOM   6133  N N   . ASN E  1 65  ? -38.640  -26.423 -16.687  1.00 68.18  ? 65  ASN E N   1 
ATOM   6134  C CA  . ASN E  1 65  ? -37.787  -25.394 -16.105  1.00 69.53  ? 65  ASN E CA  1 
ATOM   6135  C C   . ASN E  1 65  ? -38.106  -24.138 -16.877  1.00 68.47  ? 65  ASN E C   1 
ATOM   6136  O O   . ASN E  1 65  ? -37.519  -23.888 -17.935  1.00 68.59  ? 65  ASN E O   1 
ATOM   6137  C CB  . ASN E  1 65  ? -36.319  -25.729 -16.228  1.00 71.54  ? 65  ASN E CB  1 
ATOM   6138  C CG  . ASN E  1 65  ? -35.456  -24.695 -15.584  1.00 73.31  ? 65  ASN E CG  1 
ATOM   6139  O OD1 . ASN E  1 65  ? -35.931  -23.929 -14.765  1.00 73.33  ? 65  ASN E OD1 1 
ATOM   6140  N ND2 . ASN E  1 65  ? -34.188  -24.651 -15.954  1.00 75.11  ? 65  ASN E ND2 1 
ATOM   6141  N N   . SER E  1 66  ? -39.061  -23.363 -16.361  1.00 67.73  ? 66  SER E N   1 
ATOM   6142  C CA  . SER E  1 66  ? -39.599  -22.231 -17.081  1.00 66.83  ? 66  SER E CA  1 
ATOM   6143  C C   . SER E  1 66  ? -39.969  -21.071 -16.161  1.00 67.47  ? 66  SER E C   1 
ATOM   6144  O O   . SER E  1 66  ? -40.568  -21.313 -15.104  1.00 67.59  ? 66  SER E O   1 
ATOM   6145  C CB  . SER E  1 66  ? -40.846  -22.678 -17.829  1.00 64.93  ? 66  SER E CB  1 
ATOM   6146  O OG  . SER E  1 66  ? -41.533  -21.568 -18.392  1.00 64.33  ? 66  SER E OG  1 
ATOM   6147  N N   . PRO E  1 67  ? -39.632  -19.807 -16.558  1.00 68.22  ? 67  PRO E N   1 
ATOM   6148  C CA  . PRO E  1 67  ? -40.088  -18.635 -15.790  1.00 69.02  ? 67  PRO E CA  1 
ATOM   6149  C C   . PRO E  1 67  ? -41.548  -18.256 -16.127  1.00 67.56  ? 67  PRO E C   1 
ATOM   6150  O O   . PRO E  1 67  ? -42.105  -17.350 -15.516  1.00 68.24  ? 67  PRO E O   1 
ATOM   6151  C CB  . PRO E  1 67  ? -39.119  -17.542 -16.208  1.00 70.75  ? 67  PRO E CB  1 
ATOM   6152  C CG  . PRO E  1 67  ? -38.659  -17.930 -17.564  1.00 70.20  ? 67  PRO E CG  1 
ATOM   6153  C CD  . PRO E  1 67  ? -38.763  -19.425 -17.691  1.00 68.84  ? 67  PRO E CD  1 
ATOM   6154  N N   . GLY E  1 68  ? -42.164  -18.933 -17.081  1.00 65.89  ? 68  GLY E N   1 
ATOM   6155  C CA  . GLY E  1 68  ? -43.541  -18.606 -17.436  1.00 64.84  ? 68  GLY E CA  1 
ATOM   6156  C C   . GLY E  1 68  ? -43.619  -17.932 -18.807  1.00 64.72  ? 68  GLY E C   1 
ATOM   6157  O O   . GLY E  1 68  ? -42.724  -18.130 -19.641  1.00 64.99  ? 68  GLY E O   1 
ATOM   6158  N N   . GLY E  1 69  ? -44.667  -17.125 -19.036  1.00 64.68  ? 69  GLY E N   1 
ATOM   6159  C CA  . GLY E  1 69  ? -44.838  -16.413 -20.286  1.00 65.04  ? 69  GLY E CA  1 
ATOM   6160  C C   . GLY E  1 69  ? -46.299  -16.301 -20.623  1.00 64.37  ? 69  GLY E C   1 
ATOM   6161  O O   . GLY E  1 69  ? -47.133  -16.202 -19.758  1.00 64.29  ? 69  GLY E O   1 
ATOM   6162  N N   . SER E  1 70  ? -46.618  -16.328 -21.903  1.00 64.19  ? 70  SER E N   1 
ATOM   6163  C CA  . SER E  1 70  ? -47.967  -16.089 -22.389  1.00 64.08  ? 70  SER E CA  1 
ATOM   6164  C C   . SER E  1 70  ? -49.023  -17.042 -21.772  1.00 62.82  ? 70  SER E C   1 
ATOM   6165  O O   . SER E  1 70  ? -48.871  -18.272 -21.759  1.00 61.70  ? 70  SER E O   1 
ATOM   6166  C CB  . SER E  1 70  ? -47.929  -16.133 -23.912  1.00 64.38  ? 70  SER E CB  1 
ATOM   6167  O OG  . SER E  1 70  ? -49.207  -16.267 -24.463  1.00 64.19  ? 70  SER E OG  1 
ATOM   6168  N N   . VAL E  1 71  ? -50.084  -16.456 -21.231  1.00 63.36  ? 71  VAL E N   1 
ATOM   6169  C CA  . VAL E  1 71  ? -51.192  -17.231 -20.687  1.00 62.70  ? 71  VAL E CA  1 
ATOM   6170  C C   . VAL E  1 71  ? -51.913  -18.023 -21.763  1.00 62.06  ? 71  VAL E C   1 
ATOM   6171  O O   . VAL E  1 71  ? -52.223  -19.191 -21.540  1.00 61.24  ? 71  VAL E O   1 
ATOM   6172  C CB  . VAL E  1 71  ? -52.163  -16.348 -19.904  1.00 63.87  ? 71  VAL E CB  1 
ATOM   6173  C CG1 . VAL E  1 71  ? -53.452  -17.076 -19.594  1.00 63.64  ? 71  VAL E CG1 1 
ATOM   6174  C CG2 . VAL E  1 71  ? -51.499  -15.893 -18.616  1.00 64.56  ? 71  VAL E CG2 1 
ATOM   6175  N N   . THR E  1 72  ? -52.143  -17.457 -22.940  1.00 62.72  ? 72  THR E N   1 
ATOM   6176  C CA  . THR E  1 72  ? -52.830  -18.231 -23.969  1.00 62.43  ? 72  THR E CA  1 
ATOM   6177  C C   . THR E  1 72  ? -51.918  -19.327 -24.533  1.00 61.48  ? 72  THR E C   1 
ATOM   6178  O O   . THR E  1 72  ? -52.353  -20.436 -24.830  1.00 60.95  ? 72  THR E O   1 
ATOM   6179  C CB  . THR E  1 72  ? -53.429  -17.386 -25.098  1.00 63.83  ? 72  THR E CB  1 
ATOM   6180  O OG1 . THR E  1 72  ? -52.387  -16.681 -25.771  1.00 64.56  ? 72  THR E OG1 1 
ATOM   6181  C CG2 . THR E  1 72  ? -54.428  -16.418 -24.561  1.00 65.05  ? 72  THR E CG2 1 
ATOM   6182  N N   . ALA E  1 73  ? -50.635  -19.039 -24.635  1.00 61.54  ? 73  ALA E N   1 
ATOM   6183  C CA  . ALA E  1 73  ? -49.714  -20.061 -25.086  1.00 60.93  ? 73  ALA E CA  1 
ATOM   6184  C C   . ALA E  1 73  ? -49.678  -21.209 -24.085  1.00 59.96  ? 73  ALA E C   1 
ATOM   6185  O O   . ALA E  1 73  ? -49.609  -22.389 -24.457  1.00 59.55  ? 73  ALA E O   1 
ATOM   6186  C CB  . ALA E  1 73  ? -48.324  -19.493 -25.297  1.00 61.56  ? 73  ALA E CB  1 
ATOM   6187  N N   . GLY E  1 74  ? -49.739  -20.858 -22.815  1.00 61.17  ? 74  GLY E N   1 
ATOM   6188  C CA  . GLY E  1 74  ? -49.806  -21.839 -21.784  1.00 61.06  ? 74  GLY E CA  1 
ATOM   6189  C C   . GLY E  1 74  ? -51.015  -22.713 -21.945  1.00 61.34  ? 74  GLY E C   1 
ATOM   6190  O O   . GLY E  1 74  ? -50.933  -23.951 -21.754  1.00 61.68  ? 74  GLY E O   1 
ATOM   6191  N N   . PHE E  1 75  ? -52.142  -22.088 -22.296  1.00 61.37  ? 75  PHE E N   1 
ATOM   6192  C CA  . PHE E  1 75  ? -53.365  -22.832 -22.326  1.00 61.85  ? 75  PHE E CA  1 
ATOM   6193  C C   . PHE E  1 75  ? -53.376  -23.781 -23.498  1.00 62.64  ? 75  PHE E C   1 
ATOM   6194  O O   . PHE E  1 75  ? -53.954  -24.875 -23.422  1.00 63.26  ? 75  PHE E O   1 
ATOM   6195  C CB  . PHE E  1 75  ? -54.564  -21.932 -22.287  1.00 61.80  ? 75  PHE E CB  1 
ATOM   6196  C CG  . PHE E  1 75  ? -55.090  -21.683 -20.904  1.00 61.51  ? 75  PHE E CG  1 
ATOM   6197  C CD1 . PHE E  1 75  ? -55.159  -20.386 -20.411  1.00 60.96  ? 75  PHE E CD1 1 
ATOM   6198  C CD2 . PHE E  1 75  ? -55.555  -22.726 -20.104  1.00 61.99  ? 75  PHE E CD2 1 
ATOM   6199  C CE1 . PHE E  1 75  ? -55.676  -20.119 -19.154  1.00 60.88  ? 75  PHE E CE1 1 
ATOM   6200  C CE2 . PHE E  1 75  ? -56.076  -22.470 -18.833  1.00 61.98  ? 75  PHE E CE2 1 
ATOM   6201  C CZ  . PHE E  1 75  ? -56.132  -21.160 -18.361  1.00 61.43  ? 75  PHE E CZ  1 
ATOM   6202  N N   . ALA E  1 76  ? -52.684  -23.414 -24.557  1.00 62.81  ? 76  ALA E N   1 
ATOM   6203  C CA  . ALA E  1 76  ? -52.614  -24.330 -25.674  1.00 63.75  ? 76  ALA E CA  1 
ATOM   6204  C C   . ALA E  1 76  ? -51.980  -25.626 -25.186  1.00 63.85  ? 76  ALA E C   1 
ATOM   6205  O O   . ALA E  1 76  ? -52.437  -26.719 -25.546  1.00 64.67  ? 76  ALA E O   1 
ATOM   6206  C CB  . ALA E  1 76  ? -51.844  -23.738 -26.858  1.00 64.13  ? 76  ALA E CB  1 
ATOM   6207  N N   . ILE E  1 77  ? -50.927  -25.501 -24.382  1.00 63.18  ? 77  ILE E N   1 
ATOM   6208  C CA  . ILE E  1 77  ? -50.248  -26.654 -23.869  1.00 63.31  ? 77  ILE E CA  1 
ATOM   6209  C C   . ILE E  1 77  ? -51.156  -27.367 -22.889  1.00 63.44  ? 77  ILE E C   1 
ATOM   6210  O O   . ILE E  1 77  ? -51.350  -28.585 -23.006  1.00 64.14  ? 77  ILE E O   1 
ATOM   6211  C CB  . ILE E  1 77  ? -48.913  -26.301 -23.206  1.00 62.78  ? 77  ILE E CB  1 
ATOM   6212  C CG1 . ILE E  1 77  ? -47.959  -25.708 -24.242  1.00 62.98  ? 77  ILE E CG1 1 
ATOM   6213  C CG2 . ILE E  1 77  ? -48.299  -27.544 -22.561  1.00 63.00  ? 77  ILE E CG2 1 
ATOM   6214  C CD1 . ILE E  1 77  ? -46.647  -25.261 -23.647  1.00 62.71  ? 77  ILE E CD1 1 
ATOM   6215  N N   . TYR E  1 78  ? -51.728  -26.619 -21.941  1.00 62.95  ? 78  TYR E N   1 
ATOM   6216  C CA  . TYR E  1 78  ? -52.588  -27.202 -20.938  1.00 63.28  ? 78  TYR E CA  1 
ATOM   6217  C C   . TYR E  1 78  ? -53.722  -28.012 -21.578  1.00 64.27  ? 78  TYR E C   1 
ATOM   6218  O O   . TYR E  1 78  ? -53.898  -29.198 -21.276  1.00 65.03  ? 78  TYR E O   1 
ATOM   6219  C CB  . TYR E  1 78  ? -53.157  -26.138 -20.045  1.00 62.80  ? 78  TYR E CB  1 
ATOM   6220  C CG  . TYR E  1 78  ? -54.191  -26.680 -19.075  1.00 63.42  ? 78  TYR E CG  1 
ATOM   6221  C CD1 . TYR E  1 78  ? -53.843  -27.018 -17.770  1.00 63.54  ? 78  TYR E CD1 1 
ATOM   6222  C CD2 . TYR E  1 78  ? -55.528  -26.869 -19.466  1.00 64.14  ? 78  TYR E CD2 1 
ATOM   6223  C CE1 . TYR E  1 78  ? -54.780  -27.505 -16.887  1.00 64.36  ? 78  TYR E CE1 1 
ATOM   6224  C CE2 . TYR E  1 78  ? -56.464  -27.373 -18.585  1.00 64.96  ? 78  TYR E CE2 1 
ATOM   6225  C CZ  . TYR E  1 78  ? -56.084  -27.677 -17.307  1.00 65.07  ? 78  TYR E CZ  1 
ATOM   6226  O OH  . TYR E  1 78  ? -57.039  -28.201 -16.466  1.00 66.16  ? 78  TYR E OH  1 
ATOM   6227  N N   . ASP E  1 79  ? -54.482  -27.395 -22.462  1.00 64.48  ? 79  ASP E N   1 
ATOM   6228  C CA  . ASP E  1 79  ? -55.551  -28.127 -23.095  1.00 65.67  ? 79  ASP E CA  1 
ATOM   6229  C C   . ASP E  1 79  ? -55.094  -29.376 -23.869  1.00 66.55  ? 79  ASP E C   1 
ATOM   6230  O O   . ASP E  1 79  ? -55.792  -30.400 -23.866  1.00 67.69  ? 79  ASP E O   1 
ATOM   6231  C CB  . ASP E  1 79  ? -56.395  -27.195 -23.986  1.00 65.91  ? 79  ASP E CB  1 
ATOM   6232  C CG  . ASP E  1 79  ? -57.442  -26.401 -23.187  1.00 65.70  ? 79  ASP E CG  1 
ATOM   6233  O OD1 . ASP E  1 79  ? -58.096  -25.561 -23.795  1.00 65.82  ? 79  ASP E OD1 1 
ATOM   6234  O OD2 . ASP E  1 79  ? -57.640  -26.591 -21.964  1.00 65.55  ? 79  ASP E OD2 1 
ATOM   6235  N N   . THR E  1 80  ? -53.943  -29.273 -24.530  1.00 66.17  ? 80  THR E N   1 
ATOM   6236  C CA  . THR E  1 80  ? -53.405  -30.390 -25.282  1.00 67.00  ? 80  THR E CA  1 
ATOM   6237  C C   . THR E  1 80  ? -53.037  -31.559 -24.353  1.00 67.15  ? 80  THR E C   1 
ATOM   6238  O O   . THR E  1 80  ? -53.360  -32.720 -24.648  1.00 68.29  ? 80  THR E O   1 
ATOM   6239  C CB  . THR E  1 80  ? -52.206  -29.976 -26.163  1.00 66.70  ? 80  THR E CB  1 
ATOM   6240  O OG1 . THR E  1 80  ? -52.654  -28.975 -27.080  1.00 66.90  ? 80  THR E OG1 1 
ATOM   6241  C CG2 . THR E  1 80  ? -51.684  -31.147 -26.955  1.00 67.71  ? 80  THR E CG2 1 
ATOM   6242  N N   . ILE E  1 81  ? -52.374  -31.267 -23.238  1.00 66.20  ? 81  ILE E N   1 
ATOM   6243  C CA  . ILE E  1 81  ? -52.164  -32.301 -22.251  1.00 66.51  ? 81  ILE E CA  1 
ATOM   6244  C C   . ILE E  1 81  ? -53.481  -33.002 -21.886  1.00 67.63  ? 81  ILE E C   1 
ATOM   6245  O O   . ILE E  1 81  ? -53.575  -34.217 -22.033  1.00 68.69  ? 81  ILE E O   1 
ATOM   6246  C CB  . ILE E  1 81  ? -51.441  -31.779 -21.001  1.00 65.59  ? 81  ILE E CB  1 
ATOM   6247  C CG1 . ILE E  1 81  ? -50.027  -31.280 -21.397  1.00 64.86  ? 81  ILE E CG1 1 
ATOM   6248  C CG2 . ILE E  1 81  ? -51.419  -32.845 -19.905  1.00 66.21  ? 81  ILE E CG2 1 
ATOM   6249  C CD1 . ILE E  1 81  ? -49.320  -30.449 -20.349  1.00 64.07  ? 81  ILE E CD1 1 
ATOM   6250  N N   . GLN E  1 82  ? -54.497  -32.259 -21.459  1.00 67.57  ? 82  GLN E N   1 
ATOM   6251  C CA  . GLN E  1 82  ? -55.782  -32.874 -21.089  1.00 68.86  ? 82  GLN E CA  1 
ATOM   6252  C C   . GLN E  1 82  ? -56.453  -33.616 -22.222  1.00 70.25  ? 82  GLN E C   1 
ATOM   6253  O O   . GLN E  1 82  ? -57.127  -34.591 -21.998  1.00 71.65  ? 82  GLN E O   1 
ATOM   6254  C CB  . GLN E  1 82  ? -56.781  -31.885 -20.502  1.00 68.67  ? 82  GLN E CB  1 
ATOM   6255  C CG  . GLN E  1 82  ? -56.260  -30.980 -19.406  1.00 67.48  ? 82  GLN E CG  1 
ATOM   6256  C CD  . GLN E  1 82  ? -55.213  -31.630 -18.523  1.00 67.32  ? 82  GLN E CD  1 
ATOM   6257  O OE1 . GLN E  1 82  ? -54.334  -30.951 -18.018  1.00 66.32  ? 82  GLN E OE1 1 
ATOM   6258  N NE2 . GLN E  1 82  ? -55.298  -32.937 -18.337  1.00 68.46  ? 82  GLN E NE2 1 
ATOM   6259  N N   . HIS E  1 83  ? -56.251  -33.181 -23.446  1.00 70.09  ? 83  HIS E N   1 
ATOM   6260  C CA  . HIS E  1 83  ? -56.949  -33.776 -24.576  1.00 71.64  ? 83  HIS E CA  1 
ATOM   6261  C C   . HIS E  1 83  ? -56.383  -35.091 -25.056  1.00 72.61  ? 83  HIS E C   1 
ATOM   6262  O O   . HIS E  1 83  ? -57.100  -35.917 -25.606  1.00 74.32  ? 83  HIS E O   1 
ATOM   6263  C CB  . HIS E  1 83  ? -56.979  -32.783 -25.706  1.00 71.37  ? 83  HIS E CB  1 
ATOM   6264  C CG  . HIS E  1 83  ? -57.671  -33.281 -26.905  1.00 73.13  ? 83  HIS E CG  1 
ATOM   6265  N ND1 . HIS E  1 83  ? -56.986  -33.691 -28.030  1.00 73.72  ? 83  HIS E ND1 1 
ATOM   6266  C CD2 . HIS E  1 83  ? -59.048  -33.478 -27.158  1.00 74.75  ? 83  HIS E CD2 1 
ATOM   6267  C CE1 . HIS E  1 83  ? -57.890  -34.106 -28.972  1.00 75.65  ? 83  HIS E CE1 1 
ATOM   6268  N NE2 . HIS E  1 83  ? -59.158  -33.964 -28.437  1.00 76.29  ? 83  HIS E NE2 1 
ATOM   6269  N N   . ILE E  1 84  ? -55.091  -35.316 -24.886  1.00 71.69  ? 84  ILE E N   1 
ATOM   6270  C CA  . ILE E  1 84  ? -54.489  -36.544 -25.390  1.00 72.61  ? 84  ILE E CA  1 
ATOM   6271  C C   . ILE E  1 84  ? -54.677  -37.717 -24.413  1.00 73.42  ? 84  ILE E C   1 
ATOM   6272  O O   . ILE E  1 84  ? -54.960  -37.511 -23.231  1.00 73.00  ? 84  ILE E O   1 
ATOM   6273  C CB  . ILE E  1 84  ? -53.009  -36.359 -25.790  1.00 71.60  ? 84  ILE E CB  1 
ATOM   6274  C CG1 . ILE E  1 84  ? -52.181  -35.853 -24.615  1.00 70.06  ? 84  ILE E CG1 1 
ATOM   6275  C CG2 . ILE E  1 84  ? -52.903  -35.410 -26.944  1.00 71.41  ? 84  ILE E CG2 1 
ATOM   6276  C CD1 . ILE E  1 84  ? -50.738  -36.232 -24.697  1.00 69.62  ? 84  ILE E CD1 1 
ATOM   6277  N N   . LYS E  1 85  ? -54.523  -38.938 -24.924  1.00 74.74  ? 85  LYS E N   1 
ATOM   6278  C CA  . LYS E  1 85  ? -54.842  -40.135 -24.179  1.00 75.96  ? 85  LYS E CA  1 
ATOM   6279  C C   . LYS E  1 85  ? -53.773  -40.425 -23.169  1.00 74.99  ? 85  LYS E C   1 
ATOM   6280  O O   . LYS E  1 85  ? -54.109  -40.600 -22.018  1.00 75.17  ? 85  LYS E O   1 
ATOM   6281  C CB  . LYS E  1 85  ? -55.077  -41.315 -25.104  1.00 77.89  ? 85  LYS E CB  1 
ATOM   6282  C CG  . LYS E  1 85  ? -56.337  -41.174 -25.946  1.00 79.42  ? 85  LYS E CG  1 
ATOM   6283  C CD  . LYS E  1 85  ? -56.556  -42.391 -26.825  1.00 81.61  ? 85  LYS E CD  1 
ATOM   6284  C CE  . LYS E  1 85  ? -58.013  -42.866 -26.788  1.00 83.87  ? 85  LYS E CE  1 
ATOM   6285  N NZ  . LYS E  1 85  ? -58.231  -44.260 -26.269  1.00 85.66  ? 85  LYS E NZ  1 
ATOM   6286  N N   . PRO E  1 86  ? -52.482  -40.427 -23.568  1.00 74.08  ? 86  PRO E N   1 
ATOM   6287  C CA  . PRO E  1 86  ? -51.449  -40.768 -22.582  1.00 73.39  ? 86  PRO E CA  1 
ATOM   6288  C C   . PRO E  1 86  ? -51.419  -39.825 -21.390  1.00 72.21  ? 86  PRO E C   1 
ATOM   6289  O O   . PRO E  1 86  ? -51.727  -38.650 -21.524  1.00 71.31  ? 86  PRO E O   1 
ATOM   6290  C CB  . PRO E  1 86  ? -50.141  -40.658 -23.370  1.00 72.64  ? 86  PRO E CB  1 
ATOM   6291  C CG  . PRO E  1 86  ? -50.558  -40.774 -24.798  1.00 73.55  ? 86  PRO E CG  1 
ATOM   6292  C CD  . PRO E  1 86  ? -51.902  -40.132 -24.888  1.00 73.88  ? 86  PRO E CD  1 
ATOM   6293  N N   . ASP E  1 87  ? -51.065  -40.362 -20.227  1.00 72.39  ? 87  ASP E N   1 
ATOM   6294  C CA  . ASP E  1 87  ? -50.774  -39.557 -19.046  1.00 71.44  ? 87  ASP E CA  1 
ATOM   6295  C C   . ASP E  1 87  ? -49.538  -38.743 -19.337  1.00 70.00  ? 87  ASP E C   1 
ATOM   6296  O O   . ASP E  1 87  ? -48.609  -39.226 -19.974  1.00 69.98  ? 87  ASP E O   1 
ATOM   6297  C CB  . ASP E  1 87  ? -50.535  -40.424 -17.794  1.00 72.28  ? 87  ASP E CB  1 
ATOM   6298  C CG  . ASP E  1 87  ? -51.830  -41.004 -17.204  1.00 73.85  ? 87  ASP E CG  1 
ATOM   6299  O OD1 . ASP E  1 87  ? -51.733  -41.854 -16.269  1.00 74.93  ? 87  ASP E OD1 1 
ATOM   6300  O OD2 . ASP E  1 87  ? -52.941  -40.609 -17.669  1.00 74.17  ? 87  ASP E OD2 1 
ATOM   6301  N N   . VAL E  1 88  ? -49.529  -37.497 -18.883  1.00 68.96  ? 88  VAL E N   1 
ATOM   6302  C CA  . VAL E  1 88  ? -48.325  -36.710 -18.989  1.00 67.85  ? 88  VAL E CA  1 
ATOM   6303  C C   . VAL E  1 88  ? -47.803  -36.483 -17.597  1.00 67.67  ? 88  VAL E C   1 
ATOM   6304  O O   . VAL E  1 88  ? -48.451  -35.828 -16.810  1.00 67.56  ? 88  VAL E O   1 
ATOM   6305  C CB  . VAL E  1 88  ? -48.584  -35.378 -19.721  1.00 66.94  ? 88  VAL E CB  1 
ATOM   6306  C CG1 . VAL E  1 88  ? -47.343  -34.494 -19.708  1.00 66.01  ? 88  VAL E CG1 1 
ATOM   6307  C CG2 . VAL E  1 88  ? -49.051  -35.654 -21.160  1.00 67.41  ? 88  VAL E CG2 1 
ATOM   6308  N N   . GLN E  1 89  ? -46.649  -37.059 -17.278  1.00 67.84  ? 89  GLN E N   1 
ATOM   6309  C CA  . GLN E  1 89  ? -45.990  -36.752 -15.997  1.00 67.82  ? 89  GLN E CA  1 
ATOM   6310  C C   . GLN E  1 89  ? -45.308  -35.418 -16.139  1.00 66.80  ? 89  GLN E C   1 
ATOM   6311  O O   . GLN E  1 89  ? -44.764  -35.105 -17.221  1.00 66.29  ? 89  GLN E O   1 
ATOM   6312  C CB  . GLN E  1 89  ? -44.951  -37.798 -15.645  1.00 68.50  ? 89  GLN E CB  1 
ATOM   6313  C CG  . GLN E  1 89  ? -45.485  -39.204 -15.775  1.00 69.59  ? 89  GLN E CG  1 
ATOM   6314  C CD  . GLN E  1 89  ? -44.712  -40.248 -14.957  1.00 70.56  ? 89  GLN E CD  1 
ATOM   6315  O OE1 . GLN E  1 89  ? -43.870  -39.928 -14.084  1.00 70.57  ? 89  GLN E OE1 1 
ATOM   6316  N NE2 . GLN E  1 89  ? -45.006  -41.515 -15.234  1.00 71.55  ? 89  GLN E NE2 1 
ATOM   6317  N N   . THR E  1 90  ? -45.341  -34.620 -15.086  1.00 66.69  ? 90  THR E N   1 
ATOM   6318  C CA  . THR E  1 90  ? -44.617  -33.362 -15.098  1.00 65.96  ? 90  THR E CA  1 
ATOM   6319  C C   . THR E  1 90  ? -43.569  -33.433 -14.014  1.00 66.53  ? 90  THR E C   1 
ATOM   6320  O O   . THR E  1 90  ? -43.823  -33.930 -12.896  1.00 67.37  ? 90  THR E O   1 
ATOM   6321  C CB  . THR E  1 90  ? -45.542  -32.156 -14.928  1.00 65.40  ? 90  THR E CB  1 
ATOM   6322  O OG1 . THR E  1 90  ? -46.359  -32.348 -13.777  1.00 66.05  ? 90  THR E OG1 1 
ATOM   6323  C CG2 . THR E  1 90  ? -46.427  -32.020 -16.113  1.00 64.95  ? 90  THR E CG2 1 
ATOM   6324  N N   . ILE E  1 91  ? -42.374  -32.968 -14.360  1.00 66.30  ? 91  ILE E N   1 
ATOM   6325  C CA  . ILE E  1 91  ? -41.227  -32.983 -13.426  1.00 67.03  ? 91  ILE E CA  1 
ATOM   6326  C C   . ILE E  1 91  ? -40.589  -31.585 -13.429  1.00 66.70  ? 91  ILE E C   1 
ATOM   6327  O O   . ILE E  1 91  ? -40.041  -31.136 -14.442  1.00 66.26  ? 91  ILE E O   1 
ATOM   6328  C CB  . ILE E  1 91  ? -40.166  -34.006 -13.866  1.00 67.50  ? 91  ILE E CB  1 
ATOM   6329  C CG1 . ILE E  1 91  ? -40.805  -35.371 -14.054  1.00 67.85  ? 91  ILE E CG1 1 
ATOM   6330  C CG2 . ILE E  1 91  ? -39.016  -34.060 -12.866  1.00 68.46  ? 91  ILE E CG2 1 
ATOM   6331  C CD1 . ILE E  1 91  ? -40.354  -36.126 -15.290  1.00 67.75  ? 91  ILE E CD1 1 
ATOM   6332  N N   . CYS E  1 92  ? -40.643  -30.903 -12.306  1.00 67.13  ? 92  CYS E N   1 
ATOM   6333  C CA  . CYS E  1 92  ? -40.047  -29.615 -12.238  1.00 67.06  ? 92  CYS E CA  1 
ATOM   6334  C C   . CYS E  1 92  ? -38.599  -29.696 -11.857  1.00 68.04  ? 92  CYS E C   1 
ATOM   6335  O O   . CYS E  1 92  ? -38.270  -30.196 -10.786  1.00 69.10  ? 92  CYS E O   1 
ATOM   6336  C CB  . CYS E  1 92  ? -40.776  -28.784 -11.210  1.00 67.24  ? 92  CYS E CB  1 
ATOM   6337  S SG  . CYS E  1 92  ? -39.954  -27.221 -10.916  1.00 67.55  ? 92  CYS E SG  1 
ATOM   6338  N N   . ILE E  1 93  ? -37.725  -29.189 -12.722  1.00 67.91  ? 93  ILE E N   1 
ATOM   6339  C CA  . ILE E  1 93  ? -36.280  -29.027 -12.376  1.00 69.06  ? 93  ILE E CA  1 
ATOM   6340  C C   . ILE E  1 93  ? -35.932  -27.554 -12.420  1.00 69.21  ? 93  ILE E C   1 
ATOM   6341  O O   . ILE E  1 93  ? -36.447  -26.839 -13.272  1.00 68.30  ? 93  ILE E O   1 
ATOM   6342  C CB  . ILE E  1 93  ? -35.349  -29.768 -13.356  1.00 69.23  ? 93  ILE E CB  1 
ATOM   6343  C CG1 . ILE E  1 93  ? -35.611  -29.347 -14.793  1.00 68.30  ? 93  ILE E CG1 1 
ATOM   6344  C CG2 . ILE E  1 93  ? -35.587  -31.260 -13.282  1.00 69.28  ? 93  ILE E CG2 1 
ATOM   6345  C CD1 . ILE E  1 93  ? -34.649  -29.972 -15.785  1.00 68.69  ? 93  ILE E CD1 1 
ATOM   6346  N N   . GLY E  1 94  ? -35.086  -27.087 -11.511  1.00 70.51  ? 94  GLY E N   1 
ATOM   6347  C CA  . GLY E  1 94  ? -34.714  -25.654 -11.471  1.00 70.94  ? 94  GLY E CA  1 
ATOM   6348  C C   . GLY E  1 94  ? -35.814  -24.784 -10.882  1.00 70.43  ? 94  GLY E C   1 
ATOM   6349  O O   . GLY E  1 94  ? -35.863  -24.613 -9.668   1.00 71.37  ? 94  GLY E O   1 
ATOM   6350  N N   . MET E  1 95  ? -36.705  -24.271 -11.737  1.00 69.10  ? 95  MET E N   1 
ATOM   6351  C CA  . MET E  1 95  ? -37.772  -23.340 -11.353  1.00 68.54  ? 95  MET E CA  1 
ATOM   6352  C C   . MET E  1 95  ? -38.990  -23.492 -12.271  1.00 67.01  ? 95  MET E C   1 
ATOM   6353  O O   . MET E  1 95  ? -38.834  -23.667 -13.493  1.00 66.43  ? 95  MET E O   1 
ATOM   6354  C CB  . MET E  1 95  ? -37.245  -21.906 -11.429  1.00 69.09  ? 95  MET E CB  1 
ATOM   6355  C CG  . MET E  1 95  ? -38.277  -20.773 -11.459  1.00 68.34  ? 95  MET E CG  1 
ATOM   6356  S SD  . MET E  1 95  ? -39.116  -20.471 -9.867   1.00 68.86  ? 95  MET E SD  1 
ATOM   6357  C CE  . MET E  1 95  ? -37.985  -19.330 -9.053   1.00 70.72  ? 95  MET E CE  1 
ATOM   6358  N N   . ALA E  1 96  ? -40.192  -23.447 -11.697  1.00 66.55  ? 96  ALA E N   1 
ATOM   6359  C CA  . ALA E  1 96  ? -41.422  -23.449 -12.475  1.00 65.33  ? 96  ALA E CA  1 
ATOM   6360  C C   . ALA E  1 96  ? -42.247  -22.311 -11.922  1.00 65.16  ? 96  ALA E C   1 
ATOM   6361  O O   . ALA E  1 96  ? -42.882  -22.437 -10.849  1.00 65.56  ? 96  ALA E O   1 
ATOM   6362  C CB  . ALA E  1 96  ? -42.174  -24.765 -12.358  1.00 65.12  ? 96  ALA E CB  1 
ATOM   6363  N N   . ALA E  1 97  ? -42.235  -21.192 -12.641  1.00 64.73  ? 97  ALA E N   1 
ATOM   6364  C CA  . ALA E  1 97  ? -42.898  -19.993 -12.176  1.00 64.64  ? 97  ALA E CA  1 
ATOM   6365  C C   . ALA E  1 97  ? -44.082  -19.628 -13.045  1.00 63.52  ? 97  ALA E C   1 
ATOM   6366  O O   . ALA E  1 97  ? -44.099  -19.949 -14.221  1.00 62.97  ? 97  ALA E O   1 
ATOM   6367  C CB  . ALA E  1 97  ? -41.906  -18.862 -12.105  1.00 65.39  ? 97  ALA E CB  1 
ATOM   6368  N N   . ALA E  1 98  ? -45.069  -18.953 -12.457  1.00 63.36  ? 98  ALA E N   1 
ATOM   6369  C CA  . ALA E  1 98  ? -46.225  -18.416 -13.195  1.00 62.47  ? 98  ALA E CA  1 
ATOM   6370  C C   . ALA E  1 98  ? -46.852  -19.524 -14.058  1.00 61.89  ? 98  ALA E C   1 
ATOM   6371  O O   . ALA E  1 98  ? -47.140  -20.609 -13.548  1.00 62.13  ? 98  ALA E O   1 
ATOM   6372  C CB  . ALA E  1 98  ? -45.822  -17.214 -14.017  1.00 62.30  ? 98  ALA E CB  1 
ATOM   6373  N N   . MET E  1 99  ? -47.016  -19.288 -15.354  1.00 61.35  ? 99  MET E N   1 
ATOM   6374  C CA  . MET E  1 99  ? -47.655  -20.270 -16.233  1.00 61.02  ? 99  MET E CA  1 
ATOM   6375  C C   . MET E  1 99  ? -46.850  -21.592 -16.241  1.00 61.39  ? 99  MET E C   1 
ATOM   6376  O O   . MET E  1 99  ? -47.404  -22.674 -16.456  1.00 61.41  ? 99  MET E O   1 
ATOM   6377  C CB  . MET E  1 99  ? -47.852  -19.703 -17.626  1.00 60.68  ? 99  MET E CB  1 
ATOM   6378  C CG  . MET E  1 99  ? -48.840  -20.455 -18.480  1.00 60.52  ? 99  MET E CG  1 
ATOM   6379  S SD  . MET E  1 99  ? -50.589  -20.417 -17.967  1.00 60.37  ? 99  MET E SD  1 
ATOM   6380  C CE  . MET E  1 99  ? -50.563  -18.932 -16.928  1.00 60.21  ? 99  MET E CE  1 
ATOM   6381  N N   . GLY E  1 100 ? -45.559  -21.499 -15.934  1.00 61.85  ? 100 GLY E N   1 
ATOM   6382  C CA  . GLY E  1 100 ? -44.716  -22.663 -15.700  1.00 62.33  ? 100 GLY E CA  1 
ATOM   6383  C C   . GLY E  1 100 ? -45.240  -23.550 -14.582  1.00 62.66  ? 100 GLY E C   1 
ATOM   6384  O O   . GLY E  1 100 ? -45.385  -24.768 -14.768  1.00 62.79  ? 100 GLY E O   1 
ATOM   6385  N N   . SER E  1 101 ? -45.533  -22.960 -13.420  1.00 62.99  ? 101 SER E N   1 
ATOM   6386  C CA  . SER E  1 101 ? -46.085  -23.719 -12.317  1.00 63.58  ? 101 SER E CA  1 
ATOM   6387  C C   . SER E  1 101 ? -47.530  -24.174 -12.603  1.00 63.25  ? 101 SER E C   1 
ATOM   6388  O O   . SER E  1 101 ? -47.951  -25.261 -12.150  1.00 63.81  ? 101 SER E O   1 
ATOM   6389  C CB  . SER E  1 101 ? -46.014  -22.900 -11.043  1.00 64.25  ? 101 SER E CB  1 
ATOM   6390  O OG  . SER E  1 101 ? -47.038  -21.921 -11.024  1.00 63.82  ? 101 SER E OG  1 
ATOM   6391  N N   . PHE E  1 102 ? -48.274  -23.372 -13.378  1.00 62.54  ? 102 PHE E N   1 
ATOM   6392  C CA  . PHE E  1 102 ? -49.591  -23.801 -13.838  1.00 62.37  ? 102 PHE E CA  1 
ATOM   6393  C C   . PHE E  1 102 ? -49.497  -25.125 -14.598  1.00 62.51  ? 102 PHE E C   1 
ATOM   6394  O O   . PHE E  1 102 ? -50.269  -26.055 -14.335  1.00 63.05  ? 102 PHE E O   1 
ATOM   6395  C CB  . PHE E  1 102 ? -50.225  -22.752 -14.719  1.00 61.68  ? 102 PHE E CB  1 
ATOM   6396  C CG  . PHE E  1 102 ? -51.666  -22.999 -15.023  1.00 61.73  ? 102 PHE E CG  1 
ATOM   6397  C CD1 . PHE E  1 102 ? -52.642  -22.698 -14.118  1.00 62.09  ? 102 PHE E CD1 1 
ATOM   6398  C CD2 . PHE E  1 102 ? -52.043  -23.532 -16.249  1.00 61.63  ? 102 PHE E CD2 1 
ATOM   6399  C CE1 . PHE E  1 102 ? -53.975  -22.942 -14.416  1.00 62.34  ? 102 PHE E CE1 1 
ATOM   6400  C CE2 . PHE E  1 102 ? -53.372  -23.764 -16.566  1.00 61.93  ? 102 PHE E CE2 1 
ATOM   6401  C CZ  . PHE E  1 102 ? -54.344  -23.460 -15.647  1.00 62.27  ? 102 PHE E CZ  1 
ATOM   6402  N N   . LEU E  1 103 ? -48.527  -25.229 -15.501  1.00 62.23  ? 103 LEU E N   1 
ATOM   6403  C CA  . LEU E  1 103 ? -48.352  -26.447 -16.265  1.00 62.45  ? 103 LEU E CA  1 
ATOM   6404  C C   . LEU E  1 103 ? -47.880  -27.613 -15.430  1.00 63.15  ? 103 LEU E C   1 
ATOM   6405  O O   . LEU E  1 103 ? -48.365  -28.751 -15.638  1.00 63.60  ? 103 LEU E O   1 
ATOM   6406  C CB  . LEU E  1 103 ? -47.452  -26.261 -17.475  1.00 62.17  ? 103 LEU E CB  1 
ATOM   6407  C CG  . LEU E  1 103 ? -48.027  -25.314 -18.563  1.00 61.73  ? 103 LEU E CG  1 
ATOM   6408  C CD1 . LEU E  1 103 ? -46.973  -25.031 -19.610  1.00 61.74  ? 103 LEU E CD1 1 
ATOM   6409  C CD2 . LEU E  1 103 ? -49.297  -25.807 -19.212  1.00 61.89  ? 103 LEU E CD2 1 
ATOM   6410  N N   . LEU E  1 104 ? -46.973  -27.347 -14.488  1.00 63.42  ? 104 LEU E N   1 
ATOM   6411  C CA  . LEU E  1 104 ? -46.507  -28.364 -13.555  1.00 64.27  ? 104 LEU E CA  1 
ATOM   6412  C C   . LEU E  1 104 ? -47.671  -29.005 -12.892  1.00 64.88  ? 104 LEU E C   1 
ATOM   6413  O O   . LEU E  1 104 ? -47.690  -30.201 -12.799  1.00 65.52  ? 104 LEU E O   1 
ATOM   6414  C CB  . LEU E  1 104 ? -45.648  -27.735 -12.468  1.00 64.71  ? 104 LEU E CB  1 
ATOM   6415  C CG  . LEU E  1 104 ? -45.036  -28.643 -11.402  1.00 65.82  ? 104 LEU E CG  1 
ATOM   6416  C CD1 . LEU E  1 104 ? -44.195  -29.770 -12.007  1.00 65.97  ? 104 LEU E CD1 1 
ATOM   6417  C CD2 . LEU E  1 104 ? -44.209  -27.819 -10.450  1.00 66.39  ? 104 LEU E CD2 1 
ATOM   6418  N N   . ALA E  1 105 ? -48.642  -28.205 -12.442  1.00 64.82  ? 105 ALA E N   1 
ATOM   6419  C CA  . ALA E  1 105 ? -49.828  -28.714 -11.718  1.00 65.67  ? 105 ALA E CA  1 
ATOM   6420  C C   . ALA E  1 105 ? -50.825  -29.393 -12.653  1.00 65.68  ? 105 ALA E C   1 
ATOM   6421  O O   . ALA E  1 105 ? -51.805  -30.033 -12.204  1.00 66.64  ? 105 ALA E O   1 
ATOM   6422  C CB  . ALA E  1 105 ? -50.515  -27.601 -10.945  1.00 65.73  ? 105 ALA E CB  1 
ATOM   6423  N N   . ALA E  1 106 ? -50.585  -29.261 -13.954  1.00 64.88  ? 106 ALA E N   1 
ATOM   6424  C CA  . ALA E  1 106 ? -51.500  -29.830 -14.936  1.00 65.06  ? 106 ALA E CA  1 
ATOM   6425  C C   . ALA E  1 106 ? -51.159  -31.283 -15.350  1.00 65.72  ? 106 ALA E C   1 
ATOM   6426  O O   . ALA E  1 106 ? -51.895  -31.921 -16.137  1.00 66.20  ? 106 ALA E O   1 
ATOM   6427  C CB  . ALA E  1 106 ? -51.569  -28.931 -16.146  1.00 64.16  ? 106 ALA E CB  1 
ATOM   6428  N N   . GLY E  1 107 ? -50.054  -31.813 -14.832  1.00 65.91  ? 107 GLY E N   1 
ATOM   6429  C CA  . GLY E  1 107 ? -49.711  -33.182 -15.102  1.00 66.61  ? 107 GLY E CA  1 
ATOM   6430  C C   . GLY E  1 107 ? -50.750  -34.146 -14.539  1.00 67.91  ? 107 GLY E C   1 
ATOM   6431  O O   . GLY E  1 107 ? -51.549  -33.765 -13.663  1.00 68.37  ? 107 GLY E O   1 
ATOM   6432  N N   . ALA E  1 108 ? -50.751  -35.378 -15.050  1.00 68.67  ? 108 ALA E N   1 
ATOM   6433  C CA  . ALA E  1 108 ? -51.621  -36.448 -14.550  1.00 70.21  ? 108 ALA E CA  1 
ATOM   6434  C C   . ALA E  1 108 ? -51.507  -36.593 -13.036  1.00 71.04  ? 108 ALA E C   1 
ATOM   6435  O O   . ALA E  1 108 ? -50.397  -36.661 -12.485  1.00 70.86  ? 108 ALA E O   1 
ATOM   6436  C CB  . ALA E  1 108 ? -51.283  -37.770 -15.233  1.00 70.92  ? 108 ALA E CB  1 
ATOM   6437  N N   . LYS E  1 109 ? -52.649  -36.614 -12.362  1.00 72.12  ? 109 LYS E N   1 
ATOM   6438  C CA  . LYS E  1 109 ? -52.663  -36.752 -10.900  1.00 73.26  ? 109 LYS E CA  1 
ATOM   6439  C C   . LYS E  1 109 ? -51.935  -38.003 -10.394  1.00 74.40  ? 109 LYS E C   1 
ATOM   6440  O O   . LYS E  1 109 ? -52.099  -39.106 -10.946  1.00 75.16  ? 109 LYS E O   1 
ATOM   6441  C CB  . LYS E  1 109 ? -54.094  -36.715 -10.359  1.00 74.59  ? 109 LYS E CB  1 
ATOM   6442  C CG  . LYS E  1 109 ? -54.779  -35.349 -10.552  1.00 73.60  ? 109 LYS E CG  1 
ATOM   6443  C CD  . LYS E  1 109 ? -56.223  -35.433 -10.046  1.00 75.17  ? 109 LYS E CD  1 
ATOM   6444  C CE  . LYS E  1 109 ? -57.088  -34.254 -10.488  1.00 74.35  ? 109 LYS E CE  1 
ATOM   6445  N NZ  . LYS E  1 109 ? -56.490  -32.945 -10.061  1.00 72.96  ? 109 LYS E NZ  1 
ATOM   6446  N N   . GLY E  1 110 ? -51.119  -37.807 -9.351   1.00 74.63  ? 110 GLY E N   1 
ATOM   6447  C CA  . GLY E  1 110 ? -50.195  -38.823 -8.855   1.00 75.55  ? 110 GLY E CA  1 
ATOM   6448  C C   . GLY E  1 110 ? -48.858  -38.829 -9.581   1.00 74.26  ? 110 GLY E C   1 
ATOM   6449  O O   . GLY E  1 110 ? -47.918  -39.483 -9.104   1.00 74.89  ? 110 GLY E O   1 
ATOM   6450  N N   . LYS E  1 111 ? -48.751  -38.121 -10.717  1.00 72.64  ? 111 LYS E N   1 
ATOM   6451  C CA  . LYS E  1 111 ? -47.492  -38.111 -11.493  1.00 71.59  ? 111 LYS E CA  1 
ATOM   6452  C C   . LYS E  1 111 ? -46.912  -36.714 -11.749  1.00 70.16  ? 111 LYS E C   1 
ATOM   6453  O O   . LYS E  1 111 ? -46.416  -36.424 -12.816  1.00 69.15  ? 111 LYS E O   1 
ATOM   6454  C CB  . LYS E  1 111 ? -47.665  -38.866 -12.807  1.00 71.41  ? 111 LYS E CB  1 
ATOM   6455  C CG  . LYS E  1 111 ? -48.352  -40.203 -12.648  1.00 72.97  ? 111 LYS E CG  1 
ATOM   6456  C CD  . LYS E  1 111 ? -48.115  -41.119 -13.830  1.00 73.03  ? 111 LYS E CD  1 
ATOM   6457  C CE  . LYS E  1 111 ? -49.075  -42.288 -13.804  1.00 74.69  ? 111 LYS E CE  1 
ATOM   6458  N NZ  . LYS E  1 111 ? -49.425  -42.638 -15.192  1.00 74.60  ? 111 LYS E NZ  1 
ATOM   6459  N N   . ARG E  1 112 ? -46.995  -35.851 -10.750  1.00 70.28  ? 112 ARG E N   1 
ATOM   6460  C CA  . ARG E  1 112 ? -46.490  -34.492 -10.804  1.00 69.22  ? 112 ARG E CA  1 
ATOM   6461  C C   . ARG E  1 112 ? -45.382  -34.423 -9.778   1.00 69.91  ? 112 ARG E C   1 
ATOM   6462  O O   . ARG E  1 112 ? -45.614  -34.552 -8.563   1.00 71.11  ? 112 ARG E O   1 
ATOM   6463  C CB  . ARG E  1 112 ? -47.601  -33.503 -10.469  1.00 69.02  ? 112 ARG E CB  1 
ATOM   6464  C CG  . ARG E  1 112 ? -48.667  -33.468 -11.537  1.00 68.42  ? 112 ARG E CG  1 
ATOM   6465  C CD  . ARG E  1 112 ? -49.883  -32.678 -11.118  1.00 68.51  ? 112 ARG E CD  1 
ATOM   6466  N NE  . ARG E  1 112 ? -50.244  -32.968 -9.740   1.00 69.91  ? 112 ARG E NE  1 
ATOM   6467  C CZ  . ARG E  1 112 ? -51.246  -32.397 -9.078   1.00 70.42  ? 112 ARG E CZ  1 
ATOM   6468  N NH1 . ARG E  1 112 ? -52.046  -31.504 -9.669   1.00 69.57  ? 112 ARG E NH1 1 
ATOM   6469  N NH2 . ARG E  1 112 ? -51.455  -32.754 -7.820   1.00 71.97  ? 112 ARG E NH2 1 
ATOM   6470  N N   . PHE E  1 113 ? -44.163  -34.240 -10.265  1.00 69.38  ? 113 PHE E N   1 
ATOM   6471  C CA  . PHE E  1 113 ? -42.987  -34.303 -9.383   1.00 70.25  ? 113 PHE E CA  1 
ATOM   6472  C C   . PHE E  1 113 ? -42.205  -32.991 -9.349   1.00 69.75  ? 113 PHE E C   1 
ATOM   6473  O O   . PHE E  1 113 ? -42.377  -32.148 -10.214  1.00 68.60  ? 113 PHE E O   1 
ATOM   6474  C CB  . PHE E  1 113 ? -42.042  -35.452 -9.816   1.00 70.59  ? 113 PHE E CB  1 
ATOM   6475  C CG  . PHE E  1 113 ? -42.722  -36.783 -9.950   1.00 71.19  ? 113 PHE E CG  1 
ATOM   6476  C CD1 . PHE E  1 113 ? -43.255  -37.183 -11.169  1.00 70.45  ? 113 PHE E CD1 1 
ATOM   6477  C CD2 . PHE E  1 113 ? -42.849  -37.640 -8.858   1.00 72.72  ? 113 PHE E CD2 1 
ATOM   6478  C CE1 . PHE E  1 113 ? -43.921  -38.415 -11.280  1.00 71.23  ? 113 PHE E CE1 1 
ATOM   6479  C CE2 . PHE E  1 113 ? -43.502  -38.862 -8.963   1.00 73.49  ? 113 PHE E CE2 1 
ATOM   6480  C CZ  . PHE E  1 113 ? -44.039  -39.246 -10.169  1.00 72.74  ? 113 PHE E CZ  1 
ATOM   6481  N N   . ALA E  1 114 ? -41.351  -32.836 -8.345   1.00 70.83  ? 114 ALA E N   1 
ATOM   6482  C CA  . ALA E  1 114 ? -40.316  -31.815 -8.366   1.00 70.74  ? 114 ALA E CA  1 
ATOM   6483  C C   . ALA E  1 114 ? -39.047  -32.403 -7.769   1.00 72.05  ? 114 ALA E C   1 
ATOM   6484  O O   . ALA E  1 114 ? -39.119  -33.207 -6.855   1.00 73.30  ? 114 ALA E O   1 
ATOM   6485  C CB  . ALA E  1 114 ? -40.756  -30.593 -7.588   1.00 70.95  ? 114 ALA E CB  1 
ATOM   6486  N N   . LEU E  1 115 ? -37.889  -32.017 -8.293   1.00 71.95  ? 115 LEU E N   1 
ATOM   6487  C CA  . LEU E  1 115 ? -36.626  -32.416 -7.668   1.00 73.40  ? 115 LEU E CA  1 
ATOM   6488  C C   . LEU E  1 115 ? -36.384  -31.599 -6.372   1.00 74.80  ? 115 LEU E C   1 
ATOM   6489  O O   . LEU E  1 115 ? -36.977  -30.527 -6.211   1.00 74.38  ? 115 LEU E O   1 
ATOM   6490  C CB  . LEU E  1 115 ? -35.478  -32.278 -8.662   1.00 73.09  ? 115 LEU E CB  1 
ATOM   6491  C CG  . LEU E  1 115 ? -35.595  -33.176 -9.898   1.00 72.07  ? 115 LEU E CG  1 
ATOM   6492  C CD1 . LEU E  1 115 ? -34.223  -33.354 -10.510  1.00 72.52  ? 115 LEU E CD1 1 
ATOM   6493  C CD2 . LEU E  1 115 ? -36.142  -34.546 -9.540   1.00 72.45  ? 115 LEU E CD2 1 
ATOM   6494  N N   . PRO E  1 116 ? -35.548  -32.112 -5.441   1.00 76.58  ? 116 PRO E N   1 
ATOM   6495  C CA  . PRO E  1 116 ? -35.540  -31.562 -4.078   1.00 78.26  ? 116 PRO E CA  1 
ATOM   6496  C C   . PRO E  1 116 ? -35.281  -30.064 -3.994   1.00 78.31  ? 116 PRO E C   1 
ATOM   6497  O O   . PRO E  1 116 ? -35.838  -29.369 -3.137   1.00 79.00  ? 116 PRO E O   1 
ATOM   6498  C CB  . PRO E  1 116 ? -34.414  -32.337 -3.370   1.00 80.23  ? 116 PRO E CB  1 
ATOM   6499  C CG  . PRO E  1 116 ? -34.185  -33.551 -4.184   1.00 79.51  ? 116 PRO E CG  1 
ATOM   6500  C CD  . PRO E  1 116 ? -34.646  -33.269 -5.583   1.00 77.29  ? 116 PRO E CD  1 
ATOM   6501  N N   . ASN E  1 117 ? -34.447  -29.560 -4.874   1.00 77.75  ? 117 ASN E N   1 
ATOM   6502  C CA  . ASN E  1 117 ? -34.099  -28.160 -4.767   1.00 78.12  ? 117 ASN E CA  1 
ATOM   6503  C C   . ASN E  1 117 ? -34.767  -27.234 -5.765   1.00 76.26  ? 117 ASN E C   1 
ATOM   6504  O O   . ASN E  1 117 ? -34.436  -26.060 -5.802   1.00 76.55  ? 117 ASN E O   1 
ATOM   6505  C CB  . ASN E  1 117 ? -32.581  -27.989 -4.807   1.00 79.53  ? 117 ASN E CB  1 
ATOM   6506  C CG  . ASN E  1 117 ? -31.904  -28.595 -3.604   1.00 81.82  ? 117 ASN E CG  1 
ATOM   6507  O OD1 . ASN E  1 117 ? -31.120  -29.499 -3.770   1.00 82.39  ? 117 ASN E OD1 1 
ATOM   6508  N ND2 . ASN E  1 117 ? -32.206  -28.097 -2.396   1.00 83.29  ? 117 ASN E ND2 1 
ATOM   6509  N N   . ALA E  1 118 ? -35.692  -27.779 -6.556   1.00 74.56  ? 118 ALA E N   1 
ATOM   6510  C CA  . ALA E  1 118 ? -36.486  -27.033 -7.494   1.00 72.87  ? 118 ALA E CA  1 
ATOM   6511  C C   . ALA E  1 118 ? -37.392  -26.079 -6.763   1.00 72.92  ? 118 ALA E C   1 
ATOM   6512  O O   . ALA E  1 118 ? -37.796  -26.367 -5.636   1.00 73.94  ? 118 ALA E O   1 
ATOM   6513  C CB  . ALA E  1 118 ? -37.314  -27.988 -8.313   1.00 71.51  ? 118 ALA E CB  1 
ATOM   6514  N N   . GLU E  1 119 ? -37.688  -24.945 -7.407   1.00 71.98  ? 119 GLU E N   1 
ATOM   6515  C CA  . GLU E  1 119 ? -38.527  -23.878 -6.848   1.00 71.94  ? 119 GLU E CA  1 
ATOM   6516  C C   . GLU E  1 119 ? -39.795  -23.710 -7.645   1.00 70.20  ? 119 GLU E C   1 
ATOM   6517  O O   . GLU E  1 119 ? -39.849  -23.973 -8.824   1.00 69.04  ? 119 GLU E O   1 
ATOM   6518  C CB  . GLU E  1 119 ? -37.779  -22.547 -6.813   1.00 72.63  ? 119 GLU E CB  1 
ATOM   6519  C CG  . GLU E  1 119 ? -37.032  -22.318 -5.508   1.00 74.80  ? 119 GLU E CG  1 
ATOM   6520  C CD  . GLU E  1 119 ? -36.113  -21.100 -5.555   1.00 75.80  ? 119 GLU E CD  1 
ATOM   6521  O OE1 . GLU E  1 119 ? -35.138  -21.029 -4.720   1.00 77.86  ? 119 GLU E OE1 1 
ATOM   6522  O OE2 . GLU E  1 119 ? -36.358  -20.216 -6.455   1.00 74.70  ? 119 GLU E OE2 1 
ATOM   6523  N N   . VAL E  1 120 ? -40.835  -23.271 -6.987   1.00 70.20  ? 120 VAL E N   1 
ATOM   6524  C CA  . VAL E  1 120 ? -42.072  -23.037 -7.661   1.00 68.77  ? 120 VAL E CA  1 
ATOM   6525  C C   . VAL E  1 120 ? -42.508  -21.660 -7.192   1.00 68.92  ? 120 VAL E C   1 
ATOM   6526  O O   . VAL E  1 120 ? -42.305  -21.289 -6.024   1.00 70.30  ? 120 VAL E O   1 
ATOM   6527  C CB  . VAL E  1 120 ? -43.128  -24.081 -7.278   1.00 68.76  ? 120 VAL E CB  1 
ATOM   6528  C CG1 . VAL E  1 120 ? -44.473  -23.678 -7.851   1.00 67.57  ? 120 VAL E CG1 1 
ATOM   6529  C CG2 . VAL E  1 120 ? -42.727  -25.450 -7.786   1.00 68.64  ? 120 VAL E CG2 1 
ATOM   6530  N N   . MET E  1 121 ? -43.108  -20.894 -8.093   1.00 67.67  ? 121 MET E N   1 
ATOM   6531  C CA  . MET E  1 121 ? -43.590  -19.589 -7.725   1.00 67.75  ? 121 MET E CA  1 
ATOM   6532  C C   . MET E  1 121 ? -44.910  -19.401 -8.424   1.00 66.41  ? 121 MET E C   1 
ATOM   6533  O O   . MET E  1 121 ? -45.052  -19.698 -9.605   1.00 65.33  ? 121 MET E O   1 
ATOM   6534  C CB  . MET E  1 121 ? -42.551  -18.504 -8.081   1.00 68.09  ? 121 MET E CB  1 
ATOM   6535  C CG  . MET E  1 121 ? -42.927  -17.050 -7.743   1.00 68.32  ? 121 MET E CG  1 
ATOM   6536  S SD  . MET E  1 121 ? -43.943  -16.279 -9.053   1.00 66.55  ? 121 MET E SD  1 
ATOM   6537  C CE  . MET E  1 121 ? -42.608  -15.552 -10.038  1.00 66.81  ? 121 MET E CE  1 
ATOM   6538  N N   . ILE E  1 122 ? -45.882  -18.921 -7.667   1.00 66.66  ? 122 ILE E N   1 
ATOM   6539  C CA  . ILE E  1 122 ? -47.200  -18.587 -8.215   1.00 65.61  ? 122 ILE E CA  1 
ATOM   6540  C C   . ILE E  1 122 ? -47.486  -17.089 -8.005   1.00 65.63  ? 122 ILE E C   1 
ATOM   6541  O O   . ILE E  1 122 ? -47.035  -16.495 -7.000   1.00 66.79  ? 122 ILE E O   1 
ATOM   6542  C CB  . ILE E  1 122 ? -48.296  -19.468 -7.608   1.00 65.95  ? 122 ILE E CB  1 
ATOM   6543  C CG1 . ILE E  1 122 ? -48.346  -19.298 -6.098   1.00 67.48  ? 122 ILE E CG1 1 
ATOM   6544  C CG2 . ILE E  1 122 ? -48.090  -20.933 -7.993   1.00 65.88  ? 122 ILE E CG2 1 
ATOM   6545  C CD1 . ILE E  1 122 ? -49.551  -19.951 -5.481   1.00 68.05  ? 122 ILE E CD1 1 
ATOM   6546  N N   . HIS E  1 123 ? -48.170  -16.475 -8.975   1.00 64.50  ? 123 HIS E N   1 
ATOM   6547  C CA  . HIS E  1 123 ? -48.613  -15.084 -8.841   1.00 64.45  ? 123 HIS E CA  1 
ATOM   6548  C C   . HIS E  1 123 ? -49.695  -14.774 -9.826   1.00 63.30  ? 123 HIS E C   1 
ATOM   6549  O O   . HIS E  1 123 ? -50.022  -15.609 -10.649  1.00 62.63  ? 123 HIS E O   1 
ATOM   6550  C CB  . HIS E  1 123 ? -47.423  -14.105 -8.890   1.00 64.98  ? 123 HIS E CB  1 
ATOM   6551  C CG  . HIS E  1 123 ? -46.811  -13.899 -10.274  1.00 64.23  ? 123 HIS E CG  1 
ATOM   6552  N ND1 . HIS E  1 123 ? -46.790  -14.853 -11.215  1.00 63.49  ? 123 HIS E ND1 1 
ATOM   6553  C CD2 . HIS E  1 123 ? -46.174  -12.800 -10.836  1.00 64.38  ? 123 HIS E CD2 1 
ATOM   6554  C CE1 . HIS E  1 123 ? -46.205  -14.374 -12.340  1.00 63.18  ? 123 HIS E CE1 1 
ATOM   6555  N NE2 . HIS E  1 123 ? -45.836  -13.133 -12.112  1.00 63.73  ? 123 HIS E NE2 1 
ATOM   6556  N N   . GLN E  1 124 ? -50.286  -13.593 -9.756   1.00 63.18  ? 124 GLN E N   1 
ATOM   6557  C CA  . GLN E  1 124 ? -51.358  -13.237 -10.707  1.00 62.21  ? 124 GLN E CA  1 
ATOM   6558  C C   . GLN E  1 124 ? -50.805  -12.952 -12.120  1.00 61.51  ? 124 GLN E C   1 
ATOM   6559  O O   . GLN E  1 124 ? -49.581  -12.816 -12.291  1.00 61.83  ? 124 GLN E O   1 
ATOM   6560  C CB  . GLN E  1 124 ? -52.255  -12.110 -10.164  1.00 62.39  ? 124 GLN E CB  1 
ATOM   6561  C CG  . GLN E  1 124 ? -51.547  -10.867 -9.740   1.00 62.95  ? 124 GLN E CG  1 
ATOM   6562  C CD  . GLN E  1 124 ? -52.513  -9.799  -9.280   1.00 63.11  ? 124 GLN E CD  1 
ATOM   6563  O OE1 . GLN E  1 124 ? -52.357  -9.232  -8.181   1.00 64.12  ? 124 GLN E OE1 1 
ATOM   6564  N NE2 . GLN E  1 124 ? -53.506  -9.498  -10.112  1.00 62.26  ? 124 GLN E NE2 1 
ATOM   6565  N N   . PRO E  1 125 ? -51.686  -12.924 -13.136  1.00 60.77  ? 125 PRO E N   1 
ATOM   6566  C CA  . PRO E  1 125 ? -51.218  -12.600 -14.485  1.00 60.36  ? 125 PRO E CA  1 
ATOM   6567  C C   . PRO E  1 125 ? -50.974  -11.124 -14.670  1.00 60.50  ? 125 PRO E C   1 
ATOM   6568  O O   . PRO E  1 125 ? -51.589  -10.282 -14.005  1.00 60.63  ? 125 PRO E O   1 
ATOM   6569  C CB  . PRO E  1 125 ? -52.356  -13.060 -15.393  1.00 59.83  ? 125 PRO E CB  1 
ATOM   6570  C CG  . PRO E  1 125 ? -53.562  -13.166 -14.524  1.00 59.92  ? 125 PRO E CG  1 
ATOM   6571  C CD  . PRO E  1 125 ? -53.090  -13.348 -13.103  1.00 60.54  ? 125 PRO E CD  1 
ATOM   6572  N N   . LEU E  1 126 ? -50.050  -10.839 -15.583  1.00 60.63  ? 126 LEU E N   1 
ATOM   6573  C CA  . LEU E  1 126 ? -49.595  -9.475  -15.909  1.00 61.03  ? 126 LEU E CA  1 
ATOM   6574  C C   . LEU E  1 126 ? -50.152  -9.075  -17.267  1.00 60.67  ? 126 LEU E C   1 
ATOM   6575  O O   . LEU E  1 126 ? -50.355  -9.907  -18.104  1.00 60.36  ? 126 LEU E O   1 
ATOM   6576  C CB  . LEU E  1 126 ? -48.059  -9.414  -15.934  1.00 61.85  ? 126 LEU E CB  1 
ATOM   6577  C CG  . LEU E  1 126 ? -47.364  -9.842  -14.628  1.00 62.49  ? 126 LEU E CG  1 
ATOM   6578  C CD1 . LEU E  1 126 ? -45.922  -10.293 -14.882  1.00 63.21  ? 126 LEU E CD1 1 
ATOM   6579  C CD2 . LEU E  1 126 ? -47.374  -8.750  -13.559  1.00 63.21  ? 126 LEU E CD2 1 
ATOM   6580  N N   . GLY E  1 127 ? -50.394  -7.796  -17.487  1.00 60.87  ? 127 GLY E N   1 
ATOM   6581  C CA  . GLY E  1 127 ? -50.840  -7.332  -18.790  1.00 60.80  ? 127 GLY E CA  1 
ATOM   6582  C C   . GLY E  1 127 ? -50.677  -5.835  -18.935  1.00 61.37  ? 127 GLY E C   1 
ATOM   6583  O O   . GLY E  1 127 ? -49.877  -5.207  -18.254  1.00 62.01  ? 127 GLY E O   1 
ATOM   6584  N N   . GLY E  1 128 ? -51.457  -5.244  -19.811  1.00 61.29  ? 128 GLY E N   1 
ATOM   6585  C CA  . GLY E  1 128 ? -51.301  -3.820  -20.089  1.00 61.96  ? 128 GLY E CA  1 
ATOM   6586  C C   . GLY E  1 128 ? -52.483  -3.349  -20.923  1.00 61.74  ? 128 GLY E C   1 
ATOM   6587  O O   . GLY E  1 128 ? -53.217  -4.147  -21.513  1.00 61.30  ? 128 GLY E O   1 
ATOM   6588  N N   . ALA E  1 129 ? -52.717  -2.052  -20.958  1.00 62.17  ? 129 ALA E N   1 
ATOM   6589  C CA  . ALA E  1 129 ? -53.809  -1.511  -21.790  1.00 62.15  ? 129 ALA E CA  1 
ATOM   6590  C C   . ALA E  1 129 ? -53.480  -0.076  -22.047  1.00 63.06  ? 129 ALA E C   1 
ATOM   6591  O O   . ALA E  1 129 ? -53.114  0.661   -21.126  1.00 63.32  ? 129 ALA E O   1 
ATOM   6592  C CB  . ALA E  1 129 ? -55.156  -1.602  -21.071  1.00 61.34  ? 129 ALA E CB  1 
ATOM   6593  N N   . GLN E  1 130 ? -53.591  0.310   -23.303  1.00 63.75  ? 130 GLN E N   1 
ATOM   6594  C CA  . GLN E  1 130 ? -53.287  1.657   -23.726  1.00 64.86  ? 130 GLN E CA  1 
ATOM   6595  C C   . GLN E  1 130 ? -54.497  2.205   -24.512  1.00 64.96  ? 130 GLN E C   1 
ATOM   6596  O O   . GLN E  1 130 ? -55.208  1.443   -25.201  1.00 64.65  ? 130 GLN E O   1 
ATOM   6597  C CB  . GLN E  1 130 ? -52.060  1.578   -24.602  1.00 66.08  ? 130 GLN E CB  1 
ATOM   6598  C CG  . GLN E  1 130 ? -51.262  2.866   -24.717  1.00 67.55  ? 130 GLN E CG  1 
ATOM   6599  C CD  . GLN E  1 130 ? -50.751  3.379   -23.361  1.00 67.55  ? 130 GLN E CD  1 
ATOM   6600  O OE1 . GLN E  1 130 ? -50.494  2.596   -22.396  1.00 66.76  ? 130 GLN E OE1 1 
ATOM   6601  N NE2 . GLN E  1 130 ? -50.621  4.702   -23.263  1.00 68.60  ? 130 GLN E NE2 1 
ATOM   6602  N N   . GLY E  1 131 ? -54.786  3.494   -24.398  1.00 65.48  ? 131 GLY E N   1 
ATOM   6603  C CA  . GLY E  1 131 ? -55.841  4.052   -25.208  1.00 65.79  ? 131 GLY E CA  1 
ATOM   6604  C C   . GLY E  1 131 ? -57.010  4.633   -24.486  1.00 65.12  ? 131 GLY E C   1 
ATOM   6605  O O   . GLY E  1 131 ? -56.883  5.180   -23.401  1.00 64.86  ? 131 GLY E O   1 
ATOM   6606  N N   . GLN E  1 132 ? -58.165  4.535   -25.114  1.00 65.02  ? 132 GLN E N   1 
ATOM   6607  C CA  . GLN E  1 132 ? -59.369  5.179   -24.610  1.00 64.63  ? 132 GLN E CA  1 
ATOM   6608  C C   . GLN E  1 132 ? -59.918  4.497   -23.390  1.00 63.43  ? 132 GLN E C   1 
ATOM   6609  O O   . GLN E  1 132 ? -59.707  3.325   -23.205  1.00 62.87  ? 132 GLN E O   1 
ATOM   6610  C CB  . GLN E  1 132 ? -60.439  5.172   -25.673  1.00 65.09  ? 132 GLN E CB  1 
ATOM   6611  C CG  . GLN E  1 132 ? -60.160  6.059   -26.871  1.00 66.55  ? 132 GLN E CG  1 
ATOM   6612  C CD  . GLN E  1 132 ? -61.324  6.097   -27.840  1.00 67.17  ? 132 GLN E CD  1 
ATOM   6613  O OE1 . GLN E  1 132 ? -61.743  5.076   -28.329  1.00 67.09  ? 132 GLN E OE1 1 
ATOM   6614  N NE2 . GLN E  1 132 ? -61.852  7.283   -28.114  1.00 67.93  ? 132 GLN E NE2 1 
ATOM   6615  N N   . ALA E  1 133 ? -60.652  5.242   -22.565  1.00 63.20  ? 133 ALA E N   1 
ATOM   6616  C CA  . ALA E  1 133 ? -61.287  4.699   -21.351  1.00 62.33  ? 133 ALA E CA  1 
ATOM   6617  C C   . ALA E  1 133 ? -62.059  3.420   -21.640  1.00 61.87  ? 133 ALA E C   1 
ATOM   6618  O O   . ALA E  1 133 ? -61.894  2.426   -20.987  1.00 61.33  ? 133 ALA E O   1 
ATOM   6619  C CB  . ALA E  1 133 ? -62.147  5.754   -20.663  1.00 62.42  ? 133 ALA E CB  1 
ATOM   6620  N N   . THR E  1 134 ? -62.860  3.433   -22.661  1.00 62.28  ? 134 THR E N   1 
ATOM   6621  C CA  . THR E  1 134 ? -63.564  2.236   -23.117  1.00 62.18  ? 134 THR E CA  1 
ATOM   6622  C C   . THR E  1 134 ? -62.669  1.038   -23.489  1.00 62.02  ? 134 THR E C   1 
ATOM   6623  O O   . THR E  1 134 ? -62.943  -0.107  -23.097  1.00 61.60  ? 134 THR E O   1 
ATOM   6624  C CB  . THR E  1 134 ? -64.433  2.632   -24.303  1.00 63.04  ? 134 THR E CB  1 
ATOM   6625  O OG1 . THR E  1 134 ? -65.415  3.507   -23.783  1.00 63.08  ? 134 THR E OG1 1 
ATOM   6626  C CG2 . THR E  1 134 ? -65.100  1.436   -24.995  1.00 63.34  ? 134 THR E CG2 1 
ATOM   6627  N N   . GLU E  1 135 ? -61.621  1.289   -24.261  1.00 62.51  ? 135 GLU E N   1 
ATOM   6628  C CA  . GLU E  1 135 ? -60.598  0.270   -24.500  1.00 62.40  ? 135 GLU E CA  1 
ATOM   6629  C C   . GLU E  1 135 ? -59.905  -0.282  -23.258  1.00 61.60  ? 135 GLU E C   1 
ATOM   6630  O O   . GLU E  1 135 ? -59.676  -1.457  -23.209  1.00 61.29  ? 135 GLU E O   1 
ATOM   6631  C CB  . GLU E  1 135 ? -59.531  0.791   -25.438  1.00 63.28  ? 135 GLU E CB  1 
ATOM   6632  C CG  . GLU E  1 135 ? -60.056  1.060   -26.830  1.00 64.36  ? 135 GLU E CG  1 
ATOM   6633  C CD  . GLU E  1 135 ? -59.096  1.878   -27.739  1.00 65.60  ? 135 GLU E CD  1 
ATOM   6634  O OE1 . GLU E  1 135 ? -58.413  2.885   -27.333  1.00 65.84  ? 135 GLU E OE1 1 
ATOM   6635  O OE2 . GLU E  1 135 ? -59.077  1.548   -28.947  1.00 66.62  ? 135 GLU E OE2 1 
ATOM   6636  N N   . ILE E  1 136 ? -59.556  0.560   -22.300  1.00 61.45  ? 136 ILE E N   1 
ATOM   6637  C CA  . ILE E  1 136 ? -58.901  0.106   -21.088  1.00 60.96  ? 136 ILE E CA  1 
ATOM   6638  C C   . ILE E  1 136 ? -59.865  -0.803  -20.296  1.00 60.36  ? 136 ILE E C   1 
ATOM   6639  O O   . ILE E  1 136 ? -59.473  -1.855  -19.749  1.00 60.03  ? 136 ILE E O   1 
ATOM   6640  C CB  . ILE E  1 136 ? -58.327  1.306   -20.251  1.00 61.26  ? 136 ILE E CB  1 
ATOM   6641  C CG1 . ILE E  1 136 ? -57.160  1.933   -21.011  1.00 62.07  ? 136 ILE E CG1 1 
ATOM   6642  C CG2 . ILE E  1 136 ? -57.910  0.870   -18.839  1.00 60.95  ? 136 ILE E CG2 1 
ATOM   6643  C CD1 . ILE E  1 136 ? -56.893  3.365   -20.656  1.00 62.74  ? 136 ILE E CD1 1 
ATOM   6644  N N   . GLU E  1 137 ? -61.119  -0.406  -20.277  1.00 60.40  ? 137 GLU E N   1 
ATOM   6645  C CA  . GLU E  1 137 ? -62.123  -1.153  -19.569  1.00 60.15  ? 137 GLU E CA  1 
ATOM   6646  C C   . GLU E  1 137 ? -62.231  -2.572  -20.128  1.00 60.09  ? 137 GLU E C   1 
ATOM   6647  O O   . GLU E  1 137 ? -62.213  -3.551  -19.393  1.00 59.87  ? 137 GLU E O   1 
ATOM   6648  C CB  . GLU E  1 137 ? -63.463  -0.425  -19.627  1.00 60.42  ? 137 GLU E CB  1 
ATOM   6649  C CG  . GLU E  1 137 ? -64.561  -1.145  -18.876  1.00 60.43  ? 137 GLU E CG  1 
ATOM   6650  C CD  . GLU E  1 137 ? -65.944  -0.499  -19.046  1.00 60.88  ? 137 GLU E CD  1 
ATOM   6651  O OE1 . GLU E  1 137 ? -66.236  0.073   -20.144  1.00 61.23  ? 137 GLU E OE1 1 
ATOM   6652  O OE2 . GLU E  1 137 ? -66.757  -0.573  -18.076  1.00 61.05  ? 137 GLU E OE2 1 
ATOM   6653  N N   . ILE E  1 138 ? -62.311  -2.675  -21.443  1.00 60.47  ? 138 ILE E N   1 
ATOM   6654  C CA  . ILE E  1 138 ? -62.328  -3.969  -22.106  1.00 60.62  ? 138 ILE E CA  1 
ATOM   6655  C C   . ILE E  1 138 ? -61.121  -4.826  -21.706  1.00 60.22  ? 138 ILE E C   1 
ATOM   6656  O O   . ILE E  1 138 ? -61.298  -5.973  -21.314  1.00 60.08  ? 138 ILE E O   1 
ATOM   6657  C CB  . ILE E  1 138 ? -62.475  -3.816  -23.635  1.00 61.36  ? 138 ILE E CB  1 
ATOM   6658  C CG1 . ILE E  1 138 ? -63.909  -3.388  -23.953  1.00 61.90  ? 138 ILE E CG1 1 
ATOM   6659  C CG2 . ILE E  1 138 ? -62.196  -5.118  -24.345  1.00 61.64  ? 138 ILE E CG2 1 
ATOM   6660  C CD1 . ILE E  1 138 ? -64.094  -2.602  -25.235  1.00 62.78  ? 138 ILE E CD1 1 
ATOM   6661  N N   . ALA E  1 139 ? -59.913  -4.265  -21.760  1.00 60.17  ? 139 ALA E N   1 
ATOM   6662  C CA  . ALA E  1 139 ? -58.707  -4.965  -21.355  1.00 59.93  ? 139 ALA E CA  1 
ATOM   6663  C C   . ALA E  1 139 ? -58.738  -5.408  -19.874  1.00 59.51  ? 139 ALA E C   1 
ATOM   6664  O O   . ALA E  1 139 ? -58.398  -6.533  -19.535  1.00 59.35  ? 139 ALA E O   1 
ATOM   6665  C CB  . ALA E  1 139 ? -57.497  -4.107  -21.633  1.00 60.24  ? 139 ALA E CB  1 
ATOM   6666  N N   . ALA E  1 140 ? -59.189  -4.514  -19.007  1.00 59.48  ? 140 ALA E N   1 
ATOM   6667  C CA  . ALA E  1 140 ? -59.277  -4.806  -17.617  1.00 59.38  ? 140 ALA E CA  1 
ATOM   6668  C C   . ALA E  1 140 ? -60.207  -5.987  -17.381  1.00 59.37  ? 140 ALA E C   1 
ATOM   6669  O O   . ALA E  1 140 ? -59.893  -6.898  -16.615  1.00 59.38  ? 140 ALA E O   1 
ATOM   6670  C CB  . ALA E  1 140 ? -59.732  -3.583  -16.878  1.00 59.55  ? 140 ALA E CB  1 
ATOM   6671  N N   . ASN E  1 141 ? -61.334  -5.992  -18.075  1.00 59.53  ? 141 ASN E N   1 
ATOM   6672  C CA  . ASN E  1 141 ? -62.327  -7.025  -17.870  1.00 59.82  ? 141 ASN E CA  1 
ATOM   6673  C C   . ASN E  1 141 ? -61.811  -8.372  -18.312  1.00 59.81  ? 141 ASN E C   1 
ATOM   6674  O O   . ASN E  1 141 ? -62.022  -9.399  -17.646  1.00 60.02  ? 141 ASN E O   1 
ATOM   6675  C CB  . ASN E  1 141 ? -63.619  -6.697  -18.588  1.00 60.23  ? 141 ASN E CB  1 
ATOM   6676  C CG  . ASN E  1 141 ? -64.418  -5.593  -17.902  1.00 60.38  ? 141 ASN E CG  1 
ATOM   6677  O OD1 . ASN E  1 141 ? -64.202  -5.275  -16.708  1.00 60.30  ? 141 ASN E OD1 1 
ATOM   6678  N ND2 . ASN E  1 141 ? -65.360  -4.990  -18.644  1.00 60.74  ? 141 ASN E ND2 1 
ATOM   6679  N N   . HIS E  1 142 ? -61.095  -8.350  -19.430  1.00 59.71  ? 142 HIS E N   1 
ATOM   6680  C CA  . HIS E  1 142 ? -60.504  -9.535  -19.951  1.00 59.76  ? 142 HIS E CA  1 
ATOM   6681  C C   . HIS E  1 142 ? -59.425  -10.090 -19.057  1.00 59.46  ? 142 HIS E C   1 
ATOM   6682  O O   . HIS E  1 142 ? -59.364  -11.289 -18.856  1.00 59.58  ? 142 HIS E O   1 
ATOM   6683  C CB  . HIS E  1 142 ? -59.961  -9.269  -21.329  1.00 59.93  ? 142 HIS E CB  1 
ATOM   6684  C CG  . HIS E  1 142 ? -59.321  -10.480 -21.959  1.00 60.11  ? 142 HIS E CG  1 
ATOM   6685  N ND1 . HIS E  1 142 ? -58.003  -10.523 -22.315  1.00 60.01  ? 142 HIS E ND1 1 
ATOM   6686  C CD2 . HIS E  1 142 ? -59.856  -11.735 -22.258  1.00 60.51  ? 142 HIS E CD2 1 
ATOM   6687  C CE1 . HIS E  1 142 ? -57.730  -11.721 -22.868  1.00 60.28  ? 142 HIS E CE1 1 
ATOM   6688  N NE2 . HIS E  1 142 ? -58.857  -12.471 -22.831  1.00 60.58  ? 142 HIS E NE2 1 
ATOM   6689  N N   . ILE E  1 143 ? -58.564  -9.250  -18.493  1.00 59.22  ? 143 ILE E N   1 
ATOM   6690  C CA  . ILE E  1 143 ? -57.501  -9.817  -17.699  1.00 59.14  ? 143 ILE E CA  1 
ATOM   6691  C C   . ILE E  1 143 ? -58.083  -10.339 -16.389  1.00 59.34  ? 143 ILE E C   1 
ATOM   6692  O O   . ILE E  1 143 ? -57.596  -11.349 -15.864  1.00 59.46  ? 143 ILE E O   1 
ATOM   6693  C CB  . ILE E  1 143 ? -56.272  -8.895  -17.512  1.00 59.15  ? 143 ILE E CB  1 
ATOM   6694  C CG1 . ILE E  1 143 ? -55.098  -9.716  -17.002  1.00 59.24  ? 143 ILE E CG1 1 
ATOM   6695  C CG2 . ILE E  1 143 ? -56.561  -7.804  -16.506  1.00 59.28  ? 143 ILE E CG2 1 
ATOM   6696  C CD1 . ILE E  1 143 ? -53.774  -8.994  -16.999  1.00 59.51  ? 143 ILE E CD1 1 
ATOM   6697  N N   . LEU E  1 144 ? -59.137  -9.681  -15.891  1.00 59.51  ? 144 LEU E N   1 
ATOM   6698  C CA  . LEU E  1 144 ? -59.775  -10.147 -14.646  1.00 59.97  ? 144 LEU E CA  1 
ATOM   6699  C C   . LEU E  1 144 ? -60.478  -11.490 -14.877  1.00 60.32  ? 144 LEU E C   1 
ATOM   6700  O O   . LEU E  1 144 ? -60.446  -12.406 -14.030  1.00 60.79  ? 144 LEU E O   1 
ATOM   6701  C CB  . LEU E  1 144 ? -60.726  -9.109  -14.039  1.00 60.24  ? 144 LEU E CB  1 
ATOM   6702  C CG  . LEU E  1 144 ? -60.063  -7.874  -13.444  1.00 60.21  ? 144 LEU E CG  1 
ATOM   6703  C CD1 . LEU E  1 144 ? -61.100  -6.782  -13.280  1.00 60.39  ? 144 LEU E CD1 1 
ATOM   6704  C CD2 . LEU E  1 144 ? -59.313  -8.135  -12.152  1.00 60.70  ? 144 LEU E CD2 1 
ATOM   6705  N N   . LYS E  1 145 ? -61.063  -11.617 -16.058  1.00 60.28  ? 145 LYS E N   1 
ATOM   6706  C CA  . LYS E  1 145 ? -61.705  -12.865 -16.427  1.00 60.80  ? 145 LYS E CA  1 
ATOM   6707  C C   . LYS E  1 145 ? -60.698  -13.986 -16.610  1.00 60.68  ? 145 LYS E C   1 
ATOM   6708  O O   . LYS E  1 145 ? -60.947  -15.121 -16.200  1.00 61.23  ? 145 LYS E O   1 
ATOM   6709  C CB  . LYS E  1 145 ? -62.526  -12.699 -17.675  1.00 61.02  ? 145 LYS E CB  1 
ATOM   6710  C CG  . LYS E  1 145 ? -63.707  -13.597 -17.624  1.00 61.97  ? 145 LYS E CG  1 
ATOM   6711  C CD  . LYS E  1 145 ? -64.703  -13.352 -18.747  1.00 62.51  ? 145 LYS E CD  1 
ATOM   6712  C CE  . LYS E  1 145 ? -65.747  -14.503 -18.746  1.00 63.76  ? 145 LYS E CE  1 
ATOM   6713  N NZ  . LYS E  1 145 ? -66.595  -14.571 -19.978  1.00 64.61  ? 145 LYS E NZ  1 
ATOM   6714  N N   . THR E  1 146 ? -59.545  -13.662 -17.178  1.00 60.11  ? 146 THR E N   1 
ATOM   6715  C CA  . THR E  1 146 ? -58.445  -14.630 -17.272  1.00 60.02  ? 146 THR E CA  1 
ATOM   6716  C C   . THR E  1 146 ? -57.948  -15.080 -15.907  1.00 60.20  ? 146 THR E C   1 
ATOM   6717  O O   . THR E  1 146 ? -57.643  -16.251 -15.723  1.00 60.48  ? 146 THR E O   1 
ATOM   6718  C CB  . THR E  1 146 ? -57.291  -14.092 -18.148  1.00 59.58  ? 146 THR E CB  1 
ATOM   6719  O OG1 . THR E  1 146 ? -57.784  -13.915 -19.470  1.00 59.72  ? 146 THR E OG1 1 
ATOM   6720  C CG2 . THR E  1 146 ? -56.170  -15.046 -18.267  1.00 59.57  ? 146 THR E CG2 1 
ATOM   6721  N N   . ARG E  1 147 ? -57.894  -14.165 -14.940  1.00 60.20  ? 147 ARG E N   1 
ATOM   6722  C CA  . ARG E  1 147 ? -57.472  -14.538 -13.593  1.00 60.67  ? 147 ARG E CA  1 
ATOM   6723  C C   . ARG E  1 147 ? -58.453  -15.535 -12.976  1.00 61.45  ? 147 ARG E C   1 
ATOM   6724  O O   . ARG E  1 147 ? -58.015  -16.529 -12.419  1.00 61.91  ? 147 ARG E O   1 
ATOM   6725  C CB  . ARG E  1 147 ? -57.233  -13.321 -12.682  1.00 60.78  ? 147 ARG E CB  1 
ATOM   6726  C CG  . ARG E  1 147 ? -56.409  -13.711 -11.465  1.00 61.40  ? 147 ARG E CG  1 
ATOM   6727  C CD  . ARG E  1 147 ? -56.335  -12.617 -10.451  1.00 61.87  ? 147 ARG E CD  1 
ATOM   6728  N NE  . ARG E  1 147 ? -55.524  -13.033 -9.329   1.00 62.71  ? 147 ARG E NE  1 
ATOM   6729  C CZ  . ARG E  1 147 ? -55.424  -12.349 -8.196   1.00 63.57  ? 147 ARG E CZ  1 
ATOM   6730  N NH1 . ARG E  1 147 ? -56.104  -11.197 -8.103   1.00 63.53  ? 147 ARG E NH1 1 
ATOM   6731  N NH2 . ARG E  1 147 ? -54.638  -12.816 -7.186   1.00 64.57  ? 147 ARG E NH2 1 
ATOM   6732  N N   . GLU E  1 148 ? -59.762  -15.276 -13.111  1.00 77.07  ? 148 GLU E N   1 
ATOM   6733  C CA  . GLU E  1 148 ? -60.777  -16.167 -12.596  1.00 78.47  ? 148 GLU E CA  1 
ATOM   6734  C C   . GLU E  1 148 ? -60.596  -17.552 -13.174  1.00 76.33  ? 148 GLU E C   1 
ATOM   6735  O O   . GLU E  1 148 ? -60.579  -18.543 -12.439  1.00 75.55  ? 148 GLU E O   1 
ATOM   6736  C CB  . GLU E  1 148 ? -62.134  -15.644 -12.924  1.00 83.14  ? 148 GLU E CB  1 
ATOM   6737  C CG  . GLU E  1 148 ? -62.619  -14.654 -11.903  1.00 86.86  ? 148 GLU E CG  1 
ATOM   6738  C CD  . GLU E  1 148 ? -63.953  -14.040 -12.300  1.00 92.89  ? 148 GLU E CD  1 
ATOM   6739  O OE1 . GLU E  1 148 ? -64.284  -12.963 -11.749  1.00 97.15  ? 148 GLU E OE1 1 
ATOM   6740  O OE2 . GLU E  1 148 ? -64.674  -14.613 -13.170  1.00 94.30  ? 148 GLU E OE2 1 
ATOM   6741  N N   . LYS E  1 149 ? -60.423  -17.607 -14.491  1.00 75.94  ? 149 LYS E N   1 
ATOM   6742  C CA  . LYS E  1 149 ? -60.216  -18.847 -15.183  1.00 74.98  ? 149 LYS E CA  1 
ATOM   6743  C C   . LYS E  1 149 ? -58.998  -19.575 -14.624  1.00 72.09  ? 149 LYS E C   1 
ATOM   6744  O O   . LYS E  1 149 ? -59.068  -20.767 -14.366  1.00 72.26  ? 149 LYS E O   1 
ATOM   6745  C CB  . LYS E  1 149 ? -60.102  -18.610 -16.689  1.00 75.55  ? 149 LYS E CB  1 
ATOM   6746  C CG  . LYS E  1 149 ? -59.804  -19.874 -17.488  1.00 75.46  ? 149 LYS E CG  1 
ATOM   6747  C CD  . LYS E  1 149 ? -60.175  -19.770 -18.945  1.00 77.75  ? 149 LYS E CD  1 
ATOM   6748  C CE  . LYS E  1 149 ? -58.992  -19.474 -19.869  1.00 76.09  ? 149 LYS E CE  1 
ATOM   6749  N NZ  . LYS E  1 149 ? -59.458  -19.209 -21.257  1.00 78.84  ? 149 LYS E NZ  1 
ATOM   6750  N N   . LEU E  1 150 ? -57.896  -18.868 -14.416  1.00 70.27  ? 150 LEU E N   1 
ATOM   6751  C CA  . LEU E  1 150 ? -56.677  -19.517 -13.914  1.00 68.60  ? 150 LEU E CA  1 
ATOM   6752  C C   . LEU E  1 150 ? -56.873  -20.042 -12.511  1.00 68.81  ? 150 LEU E C   1 
ATOM   6753  O O   . LEU E  1 150 ? -56.585  -21.209 -12.240  1.00 68.85  ? 150 LEU E O   1 
ATOM   6754  C CB  . LEU E  1 150 ? -55.468  -18.588 -13.950  1.00 67.61  ? 150 LEU E CB  1 
ATOM   6755  C CG  . LEU E  1 150 ? -54.841  -18.364 -15.318  1.00 67.36  ? 150 LEU E CG  1 
ATOM   6756  C CD1 . LEU E  1 150 ? -54.030  -17.090 -15.342  1.00 67.24  ? 150 LEU E CD1 1 
ATOM   6757  C CD2 . LEU E  1 150 ? -54.007  -19.537 -15.794  1.00 67.43  ? 150 LEU E CD2 1 
ATOM   6758  N N   . ASN E  1 151 ? -57.392  -19.187 -11.634  1.00 69.64  ? 151 ASN E N   1 
ATOM   6759  C CA  . ASN E  1 151 ? -57.689  -19.582 -10.288  1.00 70.38  ? 151 ASN E CA  1 
ATOM   6760  C C   . ASN E  1 151 ? -58.660  -20.771 -10.175  1.00 71.51  ? 151 ASN E C   1 
ATOM   6761  O O   . ASN E  1 151 ? -58.447  -21.670 -9.368   1.00 71.56  ? 151 ASN E O   1 
ATOM   6762  C CB  . ASN E  1 151 ? -58.223  -18.394 -9.515   1.00 72.22  ? 151 ASN E CB  1 
ATOM   6763  C CG  . ASN E  1 151 ? -57.171  -17.359 -9.256   1.00 71.97  ? 151 ASN E CG  1 
ATOM   6764  O OD1 . ASN E  1 151 ? -56.039  -17.493 -9.681   1.00 70.37  ? 151 ASN E OD1 1 
ATOM   6765  N ND2 . ASN E  1 151 ? -57.541  -16.306 -8.560   1.00 74.43  ? 151 ASN E ND2 1 
ATOM   6766  N N   . ARG E  1 152 ? -59.717  -20.773 -10.973  1.00 73.06  ? 152 ARG E N   1 
ATOM   6767  C CA  . ARG E  1 152 ? -60.666  -21.873 -10.965  1.00 75.01  ? 152 ARG E CA  1 
ATOM   6768  C C   . ARG E  1 152 ? -59.985  -23.214 -11.279  1.00 74.26  ? 152 ARG E C   1 
ATOM   6769  O O   . ARG E  1 152 ? -60.179  -24.215 -10.574  1.00 75.31  ? 152 ARG E O   1 
ATOM   6770  C CB  . ARG E  1 152 ? -61.796  -21.603 -11.961  1.00 77.66  ? 152 ARG E CB  1 
ATOM   6771  C CG  . ARG E  1 152 ? -62.932  -22.616 -11.942  1.00 80.95  ? 152 ARG E CG  1 
ATOM   6772  C CD  . ARG E  1 152 ? -63.965  -22.377 -13.040  1.00 84.48  ? 152 ARG E CD  1 
ATOM   6773  N NE  . ARG E  1 152 ? -63.523  -22.784 -14.389  1.00 84.05  ? 152 ARG E NE  1 
ATOM   6774  C CZ  . ARG E  1 152 ? -63.300  -21.936 -15.411  1.00 83.76  ? 152 ARG E CZ  1 
ATOM   6775  N NH1 . ARG E  1 152 ? -62.879  -22.429 -16.584  1.00 83.82  ? 152 ARG E NH1 1 
ATOM   6776  N NH2 . ARG E  1 152 ? -63.480  -20.597 -15.276  1.00 84.01  ? 152 ARG E NH2 1 
ATOM   6777  N N   . ILE E  1 153 ? -59.184  -23.234 -12.338  1.00 73.15  ? 153 ILE E N   1 
ATOM   6778  C CA  . ILE E  1 153 ? -58.542  -24.474 -12.761  1.00 73.71  ? 153 ILE E CA  1 
ATOM   6779  C C   . ILE E  1 153 ? -57.508  -24.874 -11.719  1.00 72.84  ? 153 ILE E C   1 
ATOM   6780  O O   . ILE E  1 153 ? -57.347  -26.044 -11.405  1.00 74.46  ? 153 ILE E O   1 
ATOM   6781  C CB  . ILE E  1 153 ? -57.960  -24.397 -14.206  1.00 73.69  ? 153 ILE E CB  1 
ATOM   6782  C CG1 . ILE E  1 153 ? -59.085  -24.282 -15.216  1.00 75.76  ? 153 ILE E CG1 1 
ATOM   6783  C CG2 . ILE E  1 153 ? -57.155  -25.619 -14.561  1.00 75.24  ? 153 ILE E CG2 1 
ATOM   6784  C CD1 . ILE E  1 153 ? -58.610  -24.013 -16.617  1.00 75.99  ? 153 ILE E CD1 1 
ATOM   6785  N N   . LEU E  1 154 ? -56.837  -23.901 -11.153  1.00 71.07  ? 154 LEU E N   1 
ATOM   6786  C CA  . LEU E  1 154 ? -55.818  -24.202 -10.177  1.00 71.04  ? 154 LEU E CA  1 
ATOM   6787  C C   . LEU E  1 154 ? -56.415  -24.784 -8.907   1.00 72.18  ? 154 LEU E C   1 
ATOM   6788  O O   . LEU E  1 154 ? -55.861  -25.712 -8.315   1.00 73.49  ? 154 LEU E O   1 
ATOM   6789  C CB  . LEU E  1 154 ? -55.011  -22.947 -9.865   1.00 69.74  ? 154 LEU E CB  1 
ATOM   6790  C CG  . LEU E  1 154 ? -53.581  -23.203 -9.391   1.00 70.52  ? 154 LEU E CG  1 
ATOM   6791  C CD1 . LEU E  1 154 ? -52.772  -24.011 -10.381  1.00 71.66  ? 154 LEU E CD1 1 
ATOM   6792  C CD2 . LEU E  1 154 ? -52.917  -21.873 -9.151   1.00 69.95  ? 154 LEU E CD2 1 
ATOM   6793  N N   . SER E  1 155 ? -57.544  -24.218 -8.485   1.00 72.33  ? 155 SER E N   1 
ATOM   6794  C CA  . SER E  1 155 ? -58.377  -24.750 -7.409   1.00 73.97  ? 155 SER E CA  1 
ATOM   6795  C C   . SER E  1 155 ? -58.684  -26.223 -7.613   1.00 75.83  ? 155 SER E C   1 
ATOM   6796  O O   . SER E  1 155 ? -58.521  -27.009 -6.707   1.00 77.12  ? 155 SER E O   1 
ATOM   6797  C CB  . SER E  1 155 ? -59.684  -23.960 -7.350   1.00 75.00  ? 155 SER E CB  1 
ATOM   6798  O OG  . SER E  1 155 ? -60.520  -24.397 -6.315   1.00 77.13  ? 155 SER E OG  1 
ATOM   6799  N N   . GLU E  1 156 ? -59.117  -26.600 -8.810   1.00 76.62  ? 156 GLU E N   1 
ATOM   6800  C CA  . GLU E  1 156 ? -59.447  -27.982 -9.108   1.00 79.39  ? 156 GLU E CA  1 
ATOM   6801  C C   . GLU E  1 156 ? -58.284  -28.929 -9.018   1.00 80.34  ? 156 GLU E C   1 
ATOM   6802  O O   . GLU E  1 156 ? -58.479  -30.121 -8.774   1.00 83.35  ? 156 GLU E O   1 
ATOM   6803  C CB  . GLU E  1 156 ? -60.033  -28.112 -10.497  1.00 80.78  ? 156 GLU E CB  1 
ATOM   6804  C CG  . GLU E  1 156 ? -61.389  -27.447 -10.651  1.00 81.80  ? 156 GLU E CG  1 
ATOM   6805  C CD  . GLU E  1 156 ? -61.767  -27.193 -12.114  1.00 82.92  ? 156 GLU E CD  1 
ATOM   6806  O OE1 . GLU E  1 156 ? -60.929  -27.488 -13.059  1.00 82.54  ? 156 GLU E OE1 1 
ATOM   6807  O OE2 . GLU E  1 156 ? -62.927  -26.684 -12.295  1.00 84.91  ? 156 GLU E OE2 1 
ATOM   6808  N N   . ARG E  1 157 ? -57.078  -28.431 -9.220   1.00 78.67  ? 157 ARG E N   1 
ATOM   6809  C CA  . ARG E  1 157 ? -55.950  -29.325 -9.384   1.00 80.81  ? 157 ARG E CA  1 
ATOM   6810  C C   . ARG E  1 157 ? -55.079  -29.398 -8.174   1.00 81.23  ? 157 ARG E C   1 
ATOM   6811  O O   . ARG E  1 157 ? -54.242  -30.291 -8.072   1.00 84.30  ? 157 ARG E O   1 
ATOM   6812  C CB  . ARG E  1 157 ? -55.116  -28.911 -10.588  1.00 80.23  ? 157 ARG E CB  1 
ATOM   6813  C CG  . ARG E  1 157 ? -55.928  -28.868 -11.856  1.00 80.50  ? 157 ARG E CG  1 
ATOM   6814  C CD  . ARG E  1 157 ? -55.028  -29.081 -13.024  1.00 82.03  ? 157 ARG E CD  1 
ATOM   6815  N NE  . ARG E  1 157 ? -55.661  -29.966 -13.984  1.00 85.46  ? 157 ARG E NE  1 
ATOM   6816  C CZ  . ARG E  1 157 ? -55.473  -31.284 -14.020  1.00 90.10  ? 157 ARG E CZ  1 
ATOM   6817  N NH1 . ARG E  1 157 ? -54.671  -31.891 -13.133  1.00 91.83  ? 157 ARG E NH1 1 
ATOM   6818  N NH2 . ARG E  1 157 ? -56.095  -31.997 -14.947  1.00 93.83  ? 157 ARG E NH2 1 
ATOM   6819  N N   . THR E  1 158 ? -55.262  -28.442 -7.272   1.00 78.99  ? 158 THR E N   1 
ATOM   6820  C CA  . THR E  1 158 ? -54.524  -28.408 -6.018   1.00 79.85  ? 158 THR E CA  1 
ATOM   6821  C C   . THR E  1 158 ? -55.408  -28.806 -4.870   1.00 80.86  ? 158 THR E C   1 
ATOM   6822  O O   . THR E  1 158 ? -54.908  -29.225 -3.854   1.00 82.82  ? 158 THR E O   1 
ATOM   6823  C CB  . THR E  1 158 ? -53.988  -27.003 -5.701   1.00 77.69  ? 158 THR E CB  1 
ATOM   6824  O OG1 . THR E  1 158 ? -55.073  -26.073 -5.691   1.00 75.59  ? 158 THR E OG1 1 
ATOM   6825  C CG2 . THR E  1 158 ? -52.941  -26.585 -6.727   1.00 77.23  ? 158 THR E CG2 1 
ATOM   6826  N N   . GLY E  1 159 ? -56.716  -28.665 -5.039   1.00 80.13  ? 159 GLY E N   1 
ATOM   6827  C CA  . GLY E  1 159 ? -57.664  -28.853 -3.964   1.00 81.32  ? 159 GLY E CA  1 
ATOM   6828  C C   . GLY E  1 159 ? -57.832  -27.675 -3.015   1.00 80.24  ? 159 GLY E C   1 
ATOM   6829  O O   . GLY E  1 159 ? -58.618  -27.782 -2.081   1.00 81.75  ? 159 GLY E O   1 
ATOM   6830  N N   . GLN E  1 160 ? -57.113  -26.567 -3.242   1.00 78.35  ? 160 GLN E N   1 
ATOM   6831  C CA  . GLN E  1 160 ? -57.278  -25.337 -2.471   1.00 78.15  ? 160 GLN E CA  1 
ATOM   6832  C C   . GLN E  1 160 ? -58.456  -24.544 -2.971   1.00 77.73  ? 160 GLN E C   1 
ATOM   6833  O O   . GLN E  1 160 ? -58.785  -24.616 -4.118   1.00 76.76  ? 160 GLN E O   1 
ATOM   6834  C CB  . GLN E  1 160 ? -56.051  -24.448 -2.572   1.00 77.24  ? 160 GLN E CB  1 
ATOM   6835  C CG  . GLN E  1 160 ? -54.735  -25.149 -2.300   1.00 78.48  ? 160 GLN E CG  1 
ATOM   6836  C CD  . GLN E  1 160 ? -54.424  -25.328 -0.827   1.00 81.15  ? 160 GLN E CD  1 
ATOM   6837  O OE1 . GLN E  1 160 ? -55.150  -24.859 0.059    1.00 82.00  ? 160 GLN E OE1 1 
ATOM   6838  N NE2 . GLN E  1 160 ? -53.337  -26.027 -0.555   1.00 83.28  ? 160 GLN E NE2 1 
ATOM   6839  N N   . SER E  1 161 ? -59.093  -23.767 -2.111   1.00 79.29  ? 161 SER E N   1 
ATOM   6840  C CA  . SER E  1 161 ? -60.235  -22.975 -2.537   1.00 80.23  ? 161 SER E CA  1 
ATOM   6841  C C   . SER E  1 161 ? -59.797  -21.788 -3.413   1.00 78.73  ? 161 SER E C   1 
ATOM   6842  O O   . SER E  1 161 ? -58.683  -21.281 -3.287   1.00 77.66  ? 161 SER E O   1 
ATOM   6843  C CB  . SER E  1 161 ? -61.003  -22.477 -1.332   1.00 83.51  ? 161 SER E CB  1 
ATOM   6844  O OG  . SER E  1 161 ? -60.271  -21.461 -0.695   1.00 84.05  ? 161 SER E OG  1 
ATOM   6845  N N   . ILE E  1 162 ? -60.691  -21.364 -4.298   1.00 79.33  ? 162 ILE E N   1 
ATOM   6846  C CA  . ILE E  1 162 ? -60.544  -20.146 -5.085   1.00 78.96  ? 162 ILE E CA  1 
ATOM   6847  C C   . ILE E  1 162 ? -60.125  -18.916 -4.221   1.00 80.59  ? 162 ILE E C   1 
ATOM   6848  O O   . ILE E  1 162 ? -59.250  -18.153 -4.619   1.00 79.45  ? 162 ILE E O   1 
ATOM   6849  C CB  . ILE E  1 162 ? -61.851  -19.886 -5.871   1.00 81.22  ? 162 ILE E CB  1 
ATOM   6850  C CG1 . ILE E  1 162 ? -61.948  -20.787 -7.073   1.00 79.69  ? 162 ILE E CG1 1 
ATOM   6851  C CG2 . ILE E  1 162 ? -61.963  -18.457 -6.344   1.00 82.65  ? 162 ILE E CG2 1 
ATOM   6852  C CD1 . ILE E  1 162 ? -63.373  -21.012 -7.535   1.00 83.14  ? 162 ILE E CD1 1 
ATOM   6853  N N   . GLU E  1 163 ? -60.738  -18.727 -3.047   1.00 83.91  ? 163 GLU E N   1 
ATOM   6854  C CA  . GLU E  1 163 ? -60.433  -17.578 -2.184   1.00 86.74  ? 163 GLU E CA  1 
ATOM   6855  C C   . GLU E  1 163 ? -59.004  -17.618 -1.715   1.00 85.08  ? 163 GLU E C   1 
ATOM   6856  O O   . GLU E  1 163 ? -58.368  -16.575 -1.627   1.00 86.35  ? 163 GLU E O   1 
ATOM   6857  C CB  . GLU E  1 163 ? -61.333  -17.487 -0.945   1.00 91.37  ? 163 GLU E CB  1 
ATOM   6858  C CG  . GLU E  1 163 ? -62.821  -17.233 -1.212   1.00 95.18  ? 163 GLU E CG  1 
ATOM   6859  C CD  . GLU E  1 163 ? -63.545  -18.394 -2.003   1.00 93.42  ? 163 GLU E CD  1 
ATOM   6860  O OE1 . GLU E  1 163 ? -63.340  -19.620 -1.706   1.00 91.25  ? 163 GLU E OE1 1 
ATOM   6861  O OE2 . GLU E  1 163 ? -64.348  -18.088 -2.939   1.00 94.99  ? 163 GLU E OE2 1 
ATOM   6862  N N   . LYS E  1 164 ? -58.506  -18.816 -1.400   1.00 83.13  ? 164 LYS E N   1 
ATOM   6863  C CA  . LYS E  1 164 ? -57.125  -18.970 -0.933   1.00 82.55  ? 164 LYS E CA  1 
ATOM   6864  C C   . LYS E  1 164 ? -56.126  -18.701 -2.049   1.00 79.98  ? 164 LYS E C   1 
ATOM   6865  O O   . LYS E  1 164 ? -55.147  -17.978 -1.833   1.00 81.06  ? 164 LYS E O   1 
ATOM   6866  C CB  . LYS E  1 164 ? -56.859  -20.340 -0.294   1.00 82.23  ? 164 LYS E CB  1 
ATOM   6867  C CG  . LYS E  1 164 ? -55.442  -20.492 0.247    1.00 82.95  ? 164 LYS E CG  1 
ATOM   6868  C CD  . LYS E  1 164 ? -55.248  -21.771 1.008    1.00 83.88  ? 164 LYS E CD  1 
ATOM   6869  C CE  . LYS E  1 164 ? -53.809  -22.186 1.007    1.00 84.42  ? 164 LYS E CE  1 
ATOM   6870  N NZ  . LYS E  1 164 ? -52.994  -21.229 1.774    1.00 87.38  ? 164 LYS E NZ  1 
ATOM   6871  N N   . ILE E  1 165 ? -56.383  -19.267 -3.226   1.00 75.07  ? 165 ILE E N   1 
ATOM   6872  C CA  . ILE E  1 165 ? -55.592  -18.999 -4.427   1.00 72.11  ? 165 ILE E CA  1 
ATOM   6873  C C   . ILE E  1 165 ? -55.502  -17.483 -4.708   1.00 71.07  ? 165 ILE E C   1 
ATOM   6874  O O   . ILE E  1 165 ? -54.383  -16.918 -4.917   1.00 68.68  ? 165 ILE E O   1 
ATOM   6875  C CB  . ILE E  1 165 ? -56.181  -19.680 -5.683   1.00 73.20  ? 165 ILE E CB  1 
ATOM   6876  C CG1 . ILE E  1 165 ? -56.429  -21.192 -5.481   1.00 75.11  ? 165 ILE E CG1 1 
ATOM   6877  C CG2 . ILE E  1 165 ? -55.273  -19.439 -6.863   1.00 70.87  ? 165 ILE E CG2 1 
ATOM   6878  C CD1 . ILE E  1 165 ? -55.192  -22.064 -5.452   1.00 73.15  ? 165 ILE E CD1 1 
ATOM   6879  N N   . GLN E  1 166 ? -56.672  -16.836 -4.685   1.00 73.42  ? 166 GLN E N   1 
ATOM   6880  C CA  . GLN E  1 166 ? -56.771  -15.404 -4.889   1.00 73.28  ? 166 GLN E CA  1 
ATOM   6881  C C   . GLN E  1 166 ? -55.855  -14.638 -3.963   1.00 72.05  ? 166 GLN E C   1 
ATOM   6882  O O   . GLN E  1 166 ? -55.106  -13.798 -4.402   1.00 70.44  ? 166 GLN E O   1 
ATOM   6883  C CB  . GLN E  1 166 ? -58.217  -14.915 -4.748   1.00 76.81  ? 166 GLN E CB  1 
ATOM   6884  C CG  . GLN E  1 166 ? -58.362  -13.406 -4.925   1.00 77.18  ? 166 GLN E CG  1 
ATOM   6885  C CD  . GLN E  1 166 ? -58.409  -12.927 -6.372   1.00 76.82  ? 166 GLN E CD  1 
ATOM   6886  O OE1 . GLN E  1 166 ? -58.116  -13.660 -7.315   1.00 75.91  ? 166 GLN E OE1 1 
ATOM   6887  N NE2 . GLN E  1 166 ? -58.798  -11.683 -6.545   1.00 78.18  ? 166 GLN E NE2 1 
ATOM   6888  N N   . LYS E  1 167 ? -55.909  -14.958 -2.684   1.00 73.51  ? 167 LYS E N   1 
ATOM   6889  C CA  . LYS E  1 167 ? -55.064  -14.333 -1.706   1.00 73.40  ? 167 LYS E CA  1 
ATOM   6890  C C   . LYS E  1 167 ? -53.587  -14.688 -1.922   1.00 70.62  ? 167 LYS E C   1 
ATOM   6891  O O   . LYS E  1 167 ? -52.720  -13.808 -1.879   1.00 69.82  ? 167 LYS E O   1 
ATOM   6892  C CB  . LYS E  1 167 ? -55.541  -14.674 -0.288   1.00 76.71  ? 167 LYS E CB  1 
ATOM   6893  C CG  . LYS E  1 167 ? -54.644  -14.106 0.801    1.00 77.61  ? 167 LYS E CG  1 
ATOM   6894  C CD  . LYS E  1 167 ? -55.265  -14.258 2.179    1.00 82.07  ? 167 LYS E CD  1 
ATOM   6895  C CE  . LYS E  1 167 ? -56.364  -13.196 2.392    1.00 85.09  ? 167 LYS E CE  1 
ATOM   6896  N NZ  . LYS E  1 167 ? -57.344  -13.610 3.453    1.00 90.10  ? 167 LYS E NZ  1 
ATOM   6897  N N   . ASP E  1 168 ? -53.303  -15.956 -2.183   1.00 69.65  ? 168 ASP E N   1 
ATOM   6898  C CA  . ASP E  1 168 ? -51.917  -16.413 -2.211   1.00 67.82  ? 168 ASP E CA  1 
ATOM   6899  C C   . ASP E  1 168 ? -51.184  -15.953 -3.445   1.00 65.55  ? 168 ASP E C   1 
ATOM   6900  O O   . ASP E  1 168 ? -49.945  -15.971 -3.468   1.00 64.53  ? 168 ASP E O   1 
ATOM   6901  C CB  . ASP E  1 168 ? -51.801  -17.947 -2.108   1.00 67.96  ? 168 ASP E CB  1 
ATOM   6902  C CG  . ASP E  1 168 ? -52.101  -18.484 -0.695   1.00 70.75  ? 168 ASP E CG  1 
ATOM   6903  O OD1 . ASP E  1 168 ? -52.164  -17.680 0.282    1.00 72.60  ? 168 ASP E OD1 1 
ATOM   6904  O OD2 . ASP E  1 168 ? -52.273  -19.734 -0.559   1.00 71.69  ? 168 ASP E OD2 1 
ATOM   6905  N N   . THR E  1 169 ? -51.921  -15.582 -4.491   1.00 65.40  ? 169 THR E N   1 
ATOM   6906  C CA  . THR E  1 169 ? -51.263  -15.104 -5.730   1.00 64.08  ? 169 THR E CA  1 
ATOM   6907  C C   . THR E  1 169 ? -51.295  -13.571 -5.928   1.00 64.55  ? 169 THR E C   1 
ATOM   6908  O O   . THR E  1 169 ? -50.891  -13.078 -6.964   1.00 64.22  ? 169 THR E O   1 
ATOM   6909  C CB  . THR E  1 169 ? -51.864  -15.797 -6.937   1.00 64.33  ? 169 THR E CB  1 
ATOM   6910  O OG1 . THR E  1 169 ? -53.283  -15.544 -6.940   1.00 66.18  ? 169 THR E OG1 1 
ATOM   6911  C CG2 . THR E  1 169 ? -51.624  -17.249 -6.831   1.00 64.12  ? 169 THR E CG2 1 
ATOM   6912  N N   . ASP E  1 170 ? -51.764  -12.831 -4.928   1.00 65.88  ? 170 ASP E N   1 
ATOM   6913  C CA  . ASP E  1 170 ? -51.779  -11.371 -5.000   1.00 66.83  ? 170 ASP E CA  1 
ATOM   6914  C C   . ASP E  1 170 ? -50.410  -10.744 -5.332   1.00 66.16  ? 170 ASP E C   1 
ATOM   6915  O O   . ASP E  1 170 ? -50.323  -9.831  -6.157   1.00 66.64  ? 170 ASP E O   1 
ATOM   6916  C CB  . ASP E  1 170 ? -52.347  -10.789 -3.719   1.00 68.95  ? 170 ASP E CB  1 
ATOM   6917  C CG  . ASP E  1 170 ? -52.627  -9.314  -3.840   1.00 70.55  ? 170 ASP E CG  1 
ATOM   6918  O OD1 . ASP E  1 170 ? -51.962  -8.512  -3.107   1.00 71.73  ? 170 ASP E OD1 1 
ATOM   6919  O OD2 . ASP E  1 170 ? -53.508  -8.963  -4.679   1.00 71.14  ? 170 ASP E OD2 1 
ATOM   6920  N N   . ARG E  1 171 ? -49.365  -11.270 -4.692   1.00 65.66  ? 171 ARG E N   1 
ATOM   6921  C CA  . ARG E  1 171 ? -48.000  -10.902 -4.986   1.00 65.57  ? 171 ARG E CA  1 
ATOM   6922  C C   . ARG E  1 171 ? -47.251  -12.155 -5.335   1.00 64.21  ? 171 ARG E C   1 
ATOM   6923  O O   . ARG E  1 171 ? -47.801  -13.239 -5.265   1.00 63.41  ? 171 ARG E O   1 
ATOM   6924  C CB  . ARG E  1 171 ? -47.336  -10.231 -3.782   1.00 67.46  ? 171 ARG E CB  1 
ATOM   6925  C CG  . ARG E  1 171 ? -48.081  -9.039  -3.177   1.00 69.57  ? 171 ARG E CG  1 
ATOM   6926  C CD  . ARG E  1 171 ? -47.644  -7.752  -3.783   1.00 70.77  ? 171 ARG E CD  1 
ATOM   6927  N NE  . ARG E  1 171 ? -48.380  -6.661  -3.206   1.00 73.10  ? 171 ARG E NE  1 
ATOM   6928  C CZ  . ARG E  1 171 ? -48.264  -5.396  -3.611   1.00 74.88  ? 171 ARG E CZ  1 
ATOM   6929  N NH1 . ARG E  1 171 ? -47.414  -5.060  -4.593   1.00 74.75  ? 171 ARG E NH1 1 
ATOM   6930  N NH2 . ARG E  1 171 ? -48.995  -4.457  -3.031   1.00 77.36  ? 171 ARG E NH2 1 
ATOM   6931  N N   . ASP E  1 172 ? -45.980  -12.015 -5.704   1.00 64.47  ? 172 ASP E N   1 
ATOM   6932  C CA  . ASP E  1 172 ? -45.134  -13.168 -5.951   1.00 63.78  ? 172 ASP E CA  1 
ATOM   6933  C C   . ASP E  1 172 ? -45.076  -14.041 -4.716   1.00 63.93  ? 172 ASP E C   1 
ATOM   6934  O O   . ASP E  1 172 ? -44.816  -13.584 -3.620   1.00 65.45  ? 172 ASP E O   1 
ATOM   6935  C CB  . ASP E  1 172 ? -43.728  -12.724 -6.320   1.00 65.06  ? 172 ASP E CB  1 
ATOM   6936  C CG  . ASP E  1 172 ? -43.623  -12.190 -7.736   1.00 65.46  ? 172 ASP E CG  1 
ATOM   6937  O OD1 . ASP E  1 172 ? -44.651  -12.173 -8.452   1.00 64.76  ? 172 ASP E OD1 1 
ATOM   6938  O OD2 . ASP E  1 172 ? -42.479  -11.803 -8.115   1.00 67.15  ? 172 ASP E OD2 1 
ATOM   6939  N N   . ASN E  1 173 ? -45.305  -15.318 -4.924   1.00 62.94  ? 173 ASN E N   1 
ATOM   6940  C CA  . ASN E  1 173 ? -45.264  -16.284 -3.851   1.00 63.50  ? 173 ASN E CA  1 
ATOM   6941  C C   . ASN E  1 173 ? -44.301  -17.424 -4.169   1.00 63.39  ? 173 ASN E C   1 
ATOM   6942  O O   . ASN E  1 173 ? -44.590  -18.265 -5.010   1.00 62.50  ? 173 ASN E O   1 
ATOM   6943  C CB  . ASN E  1 173 ? -46.682  -16.814 -3.651   1.00 63.22  ? 173 ASN E CB  1 
ATOM   6944  C CG  . ASN E  1 173 ? -46.852  -17.565 -2.378   1.00 64.67  ? 173 ASN E CG  1 
ATOM   6945  O OD1 . ASN E  1 173 ? -45.905  -17.776 -1.583   1.00 65.98  ? 173 ASN E OD1 1 
ATOM   6946  N ND2 . ASN E  1 173 ? -48.062  -18.006 -2.180   1.00 65.13  ? 173 ASN E ND2 1 
ATOM   6947  N N   . PHE E  1 174 ? -43.161  -17.429 -3.503   1.00 64.89  ? 174 PHE E N   1 
ATOM   6948  C CA  . PHE E  1 174 ? -42.161  -18.449 -3.707   1.00 65.44  ? 174 PHE E CA  1 
ATOM   6949  C C   . PHE E  1 174 ? -42.330  -19.631 -2.771   1.00 66.32  ? 174 PHE E C   1 
ATOM   6950  O O   . PHE E  1 174 ? -42.468  -19.467 -1.558   1.00 67.98  ? 174 PHE E O   1 
ATOM   6951  C CB  . PHE E  1 174 ? -40.773  -17.866 -3.529   1.00 67.45  ? 174 PHE E CB  1 
ATOM   6952  C CG  . PHE E  1 174 ? -40.373  -16.924 -4.610   1.00 67.33  ? 174 PHE E CG  1 
ATOM   6953  C CD1 . PHE E  1 174 ? -39.899  -17.399 -5.829   1.00 67.11  ? 174 PHE E CD1 1 
ATOM   6954  C CD2 . PHE E  1 174 ? -40.440  -15.547 -4.397   1.00 68.14  ? 174 PHE E CD2 1 
ATOM   6955  C CE1 . PHE E  1 174 ? -39.529  -16.519 -6.818   1.00 67.79  ? 174 PHE E CE1 1 
ATOM   6956  C CE2 . PHE E  1 174 ? -40.046  -14.665 -5.376   1.00 68.67  ? 174 PHE E CE2 1 
ATOM   6957  C CZ  . PHE E  1 174 ? -39.598  -15.150 -6.583   1.00 68.54  ? 174 PHE E CZ  1 
ATOM   6958  N N   . LEU E  1 175 ? -42.288  -20.818 -3.363   1.00 65.83  ? 175 LEU E N   1 
ATOM   6959  C CA  . LEU E  1 175 ? -42.543  -22.074 -2.696   1.00 66.84  ? 175 LEU E CA  1 
ATOM   6960  C C   . LEU E  1 175 ? -41.351  -23.039 -2.842   1.00 68.24  ? 175 LEU E C   1 
ATOM   6961  O O   . LEU E  1 175 ? -40.741  -23.133 -3.936   1.00 67.78  ? 175 LEU E O   1 
ATOM   6962  C CB  . LEU E  1 175 ? -43.791  -22.658 -3.336   1.00 65.57  ? 175 LEU E CB  1 
ATOM   6963  C CG  . LEU E  1 175 ? -45.138  -22.398 -2.682   1.00 65.72  ? 175 LEU E CG  1 
ATOM   6964  C CD1 . LEU E  1 175 ? -45.316  -21.021 -2.110   1.00 65.77  ? 175 LEU E CD1 1 
ATOM   6965  C CD2 . LEU E  1 175 ? -46.264  -22.655 -3.672   1.00 64.74  ? 175 LEU E CD2 1 
ATOM   6966  N N   . THR E  1 176 ? -40.998  -23.749 -1.769   1.00 70.53  ? 176 THR E N   1 
ATOM   6967  C CA  . THR E  1 176 ? -40.005  -24.825 -1.910   1.00 72.24  ? 176 THR E CA  1 
ATOM   6968  C C   . THR E  1 176 ? -40.702  -26.068 -2.478   1.00 71.69  ? 176 THR E C   1 
ATOM   6969  O O   . THR E  1 176 ? -41.930  -26.123 -2.521   1.00 70.56  ? 176 THR E O   1 
ATOM   6970  C CB  . THR E  1 176 ? -39.354  -25.217 -0.576   1.00 75.69  ? 176 THR E CB  1 
ATOM   6971  O OG1 . THR E  1 176 ? -40.351  -25.810 0.265    1.00 76.56  ? 176 THR E OG1 1 
ATOM   6972  C CG2 . THR E  1 176 ? -38.720  -24.027 0.125    1.00 77.30  ? 176 THR E CG2 1 
ATOM   6973  N N   . ALA E  1 177 ? -39.933  -27.067 -2.909   1.00 73.07  ? 177 ALA E N   1 
ATOM   6974  C CA  . ALA E  1 177 ? -40.535  -28.329 -3.384   1.00 73.43  ? 177 ALA E CA  1 
ATOM   6975  C C   . ALA E  1 177 ? -41.516  -28.929 -2.351   1.00 74.60  ? 177 ALA E C   1 
ATOM   6976  O O   . ALA E  1 177 ? -42.627  -29.366 -2.720   1.00 74.13  ? 177 ALA E O   1 
ATOM   6977  C CB  . ALA E  1 177 ? -39.459  -29.339 -3.778   1.00 75.65  ? 177 ALA E CB  1 
ATOM   6978  N N   . GLU E  1 178 ? -41.115  -28.932 -1.072   1.00 76.84  ? 178 GLU E N   1 
ATOM   6979  C CA  . GLU E  1 178 ? -41.974  -29.471 -0.032   1.00 78.89  ? 178 GLU E CA  1 
ATOM   6980  C C   . GLU E  1 178 ? -43.241  -28.657 0.065    1.00 77.21  ? 178 GLU E C   1 
ATOM   6981  O O   . GLU E  1 178 ? -44.342  -29.235 0.138    1.00 77.97  ? 178 GLU E O   1 
ATOM   6982  C CB  . GLU E  1 178 ? -41.281  -29.544 1.319    1.00 82.44  ? 178 GLU E CB  1 
ATOM   6983  C CG  . GLU E  1 178 ? -40.284  -30.671 1.425    1.00 85.35  ? 178 GLU E CG  1 
ATOM   6984  C CD  . GLU E  1 178 ? -40.890  -32.093 1.381    1.00 87.19  ? 178 GLU E CD  1 
ATOM   6985  O OE1 . GLU E  1 178 ? -42.095  -32.337 1.746    1.00 87.75  ? 178 GLU E OE1 1 
ATOM   6986  O OE2 . GLU E  1 178 ? -40.112  -33.012 0.996    1.00 88.75  ? 178 GLU E OE2 1 
ATOM   6987  N N   . GLU E  1 179 ? -43.085  -27.326 0.029    1.00 75.40  ? 179 GLU E N   1 
ATOM   6988  C CA  . GLU E  1 179 ? -44.224  -26.416 0.190    1.00 74.22  ? 179 GLU E CA  1 
ATOM   6989  C C   . GLU E  1 179 ? -45.219  -26.553 -0.956   1.00 72.10  ? 179 GLU E C   1 
ATOM   6990  O O   . GLU E  1 179 ? -46.444  -26.489 -0.758   1.00 72.52  ? 179 GLU E O   1 
ATOM   6991  C CB  . GLU E  1 179 ? -43.742  -24.996 0.325    1.00 73.21  ? 179 GLU E CB  1 
ATOM   6992  C CG  . GLU E  1 179 ? -43.177  -24.648 1.686    1.00 76.36  ? 179 GLU E CG  1 
ATOM   6993  C CD  . GLU E  1 179 ? -42.440  -23.312 1.692    1.00 75.98  ? 179 GLU E CD  1 
ATOM   6994  O OE1 . GLU E  1 179 ? -42.054  -22.778 0.604    1.00 73.42  ? 179 GLU E OE1 1 
ATOM   6995  O OE2 . GLU E  1 179 ? -42.230  -22.787 2.800    1.00 78.90  ? 179 GLU E OE2 1 
ATOM   6996  N N   . ALA E  1 180 ? -44.654  -26.792 -2.132   1.00 70.62  ? 180 ALA E N   1 
ATOM   6997  C CA  . ALA E  1 180 ? -45.397  -27.050 -3.342   1.00 69.51  ? 180 ALA E CA  1 
ATOM   6998  C C   . ALA E  1 180 ? -46.245  -28.305 -3.223   1.00 71.64  ? 180 ALA E C   1 
ATOM   6999  O O   . ALA E  1 180 ? -47.392  -28.321 -3.693   1.00 71.76  ? 180 ALA E O   1 
ATOM   7000  C CB  . ALA E  1 180 ? -44.443  -27.166 -4.510   1.00 68.71  ? 180 ALA E CB  1 
ATOM   7001  N N   . LYS E  1 181 ? -45.682  -29.344 -2.602   1.00 73.87  ? 181 LYS E N   1 
ATOM   7002  C CA  . LYS E  1 181 ? -46.396  -30.602 -2.410   1.00 76.64  ? 181 LYS E CA  1 
ATOM   7003  C C   . LYS E  1 181 ? -47.528  -30.428 -1.414   1.00 78.32  ? 181 LYS E C   1 
ATOM   7004  O O   . LYS E  1 181 ? -48.640  -30.921 -1.615   1.00 79.96  ? 181 LYS E O   1 
ATOM   7005  C CB  . LYS E  1 181 ? -45.448  -31.697 -1.939   1.00 79.08  ? 181 LYS E CB  1 
ATOM   7006  C CG  . LYS E  1 181 ? -46.130  -33.008 -1.579   1.00 82.69  ? 181 LYS E CG  1 
ATOM   7007  C CD  . LYS E  1 181 ? -45.133  -33.958 -0.979   1.00 85.42  ? 181 LYS E CD  1 
ATOM   7008  C CE  . LYS E  1 181 ? -45.853  -35.032 -0.213   1.00 89.67  ? 181 LYS E CE  1 
ATOM   7009  N NZ  . LYS E  1 181 ? -44.821  -35.763 0.540    1.00 92.60  ? 181 LYS E NZ  1 
ATOM   7010  N N   . GLU E  1 182 ? -47.225  -29.714 -0.342   1.00 78.57  ? 182 GLU E N   1 
ATOM   7011  C CA  . GLU E  1 182 ? -48.201  -29.371 0.681    1.00 80.66  ? 182 GLU E CA  1 
ATOM   7012  C C   . GLU E  1 182 ? -49.340  -28.544 0.077    1.00 79.03  ? 182 GLU E C   1 
ATOM   7013  O O   . GLU E  1 182 ? -50.470  -28.675 0.484    1.00 81.39  ? 182 GLU E O   1 
ATOM   7014  C CB  . GLU E  1 182 ? -47.495  -28.588 1.782    1.00 81.36  ? 182 GLU E CB  1 
ATOM   7015  C CG  . GLU E  1 182 ? -48.355  -28.242 2.962    1.00 84.50  ? 182 GLU E CG  1 
ATOM   7016  C CD  . GLU E  1 182 ? -48.618  -29.463 3.816    1.00 89.26  ? 182 GLU E CD  1 
ATOM   7017  O OE1 . GLU E  1 182 ? -49.736  -29.566 4.417    1.00 92.43  ? 182 GLU E OE1 1 
ATOM   7018  O OE2 . GLU E  1 182 ? -47.696  -30.339 3.903    1.00 90.39  ? 182 GLU E OE2 1 
ATOM   7019  N N   . TYR E  1 183 ? -49.026  -27.694 -0.899   1.00 75.56  ? 183 TYR E N   1 
ATOM   7020  C CA  . TYR E  1 183 ? -50.023  -26.863 -1.542   1.00 74.29  ? 183 TYR E CA  1 
ATOM   7021  C C   . TYR E  1 183 ? -50.906  -27.633 -2.519   1.00 75.32  ? 183 TYR E C   1 
ATOM   7022  O O   . TYR E  1 183 ? -52.028  -27.229 -2.785   1.00 76.03  ? 183 TYR E O   1 
ATOM   7023  C CB  . TYR E  1 183 ? -49.343  -25.742 -2.276   1.00 70.99  ? 183 TYR E CB  1 
ATOM   7024  C CG  . TYR E  1 183 ? -50.201  -24.515 -2.428   1.00 70.16  ? 183 TYR E CG  1 
ATOM   7025  C CD1 . TYR E  1 183 ? -50.185  -23.525 -1.464   1.00 70.44  ? 183 TYR E CD1 1 
ATOM   7026  C CD2 . TYR E  1 183 ? -51.016  -24.320 -3.572   1.00 69.65  ? 183 TYR E CD2 1 
ATOM   7027  C CE1 . TYR E  1 183 ? -50.970  -22.385 -1.603   1.00 70.04  ? 183 TYR E CE1 1 
ATOM   7028  C CE2 . TYR E  1 183 ? -51.796  -23.188 -3.725   1.00 69.30  ? 183 TYR E CE2 1 
ATOM   7029  C CZ  . TYR E  1 183 ? -51.775  -22.233 -2.731   1.00 69.40  ? 183 TYR E CZ  1 
ATOM   7030  O OH  . TYR E  1 183 ? -52.539  -21.100 -2.842   1.00 69.44  ? 183 TYR E OH  1 
ATOM   7031  N N   . GLY E  1 184 ? -50.399  -28.739 -3.053   1.00 75.98  ? 184 GLY E N   1 
ATOM   7032  C CA  . GLY E  1 184 ? -51.140  -29.564 -3.987   1.00 77.80  ? 184 GLY E CA  1 
ATOM   7033  C C   . GLY E  1 184 ? -50.752  -29.283 -5.422   1.00 75.92  ? 184 GLY E C   1 
ATOM   7034  O O   . GLY E  1 184 ? -51.445  -29.705 -6.340   1.00 77.68  ? 184 GLY E O   1 
ATOM   7035  N N   . LEU E  1 185 ? -49.656  -28.566 -5.633   1.00 73.08  ? 185 LEU E N   1 
ATOM   7036  C CA  . LEU E  1 185 ? -49.182  -28.318 -6.992   1.00 72.01  ? 185 LEU E CA  1 
ATOM   7037  C C   . LEU E  1 185 ? -48.468  -29.530 -7.577   1.00 73.66  ? 185 LEU E C   1 
ATOM   7038  O O   . LEU E  1 185 ? -48.470  -29.733 -8.784   1.00 74.64  ? 185 LEU E O   1 
ATOM   7039  C CB  . LEU E  1 185 ? -48.257  -27.106 -7.030   1.00 69.17  ? 185 LEU E CB  1 
ATOM   7040  C CG  . LEU E  1 185 ? -48.910  -25.770 -6.705   1.00 67.77  ? 185 LEU E CG  1 
ATOM   7041  C CD1 . LEU E  1 185 ? -47.839  -24.830 -6.260   1.00 65.85  ? 185 LEU E CD1 1 
ATOM   7042  C CD2 . LEU E  1 185 ? -49.684  -25.205 -7.889   1.00 67.96  ? 185 LEU E CD2 1 
ATOM   7043  N N   . ILE E  1 186 ? -47.818  -30.296 -6.713   1.00 74.44  ? 186 ILE E N   1 
ATOM   7044  C CA  . ILE E  1 186 ? -47.158  -31.531 -7.080   1.00 76.56  ? 186 ILE E CA  1 
ATOM   7045  C C   . ILE E  1 186 ? -47.620  -32.620 -6.117   1.00 79.35  ? 186 ILE E C   1 
ATOM   7046  O O   . ILE E  1 186 ? -48.199  -32.332 -5.073   1.00 79.47  ? 186 ILE E O   1 
ATOM   7047  C CB  . ILE E  1 186 ? -45.616  -31.416 -7.060   1.00 75.48  ? 186 ILE E CB  1 
ATOM   7048  C CG1 . ILE E  1 186 ? -45.101  -30.845 -5.720   1.00 74.25  ? 186 ILE E CG1 1 
ATOM   7049  C CG2 . ILE E  1 186 ? -45.135  -30.578 -8.218   1.00 74.01  ? 186 ILE E CG2 1 
ATOM   7050  C CD1 . ILE E  1 186 ? -43.612  -31.017 -5.452   1.00 74.63  ? 186 ILE E CD1 1 
ATOM   7051  N N   . ASP E  1 187 ? -47.358  -33.876 -6.469   1.00 82.18  ? 187 ASP E N   1 
ATOM   7052  C CA  . ASP E  1 187 ? -47.718  -35.032 -5.629   1.00 85.63  ? 187 ASP E CA  1 
ATOM   7053  C C   . ASP E  1 187 ? -46.547  -35.528 -4.810   1.00 86.24  ? 187 ASP E C   1 
ATOM   7054  O O   . ASP E  1 187 ? -46.709  -35.841 -3.654   1.00 87.93  ? 187 ASP E O   1 
ATOM   7055  C CB  . ASP E  1 187 ? -48.269  -36.142 -6.496   1.00 89.31  ? 187 ASP E CB  1 
ATOM   7056  C CG  . ASP E  1 187 ? -49.388  -35.657 -7.389   1.00 89.53  ? 187 ASP E CG  1 
ATOM   7057  O OD1 . ASP E  1 187 ? -50.442  -35.265 -6.865   1.00 89.88  ? 187 ASP E OD1 1 
ATOM   7058  O OD2 . ASP E  1 187 ? -49.210  -35.632 -8.622   1.00 89.85  ? 187 ASP E OD2 1 
ATOM   7059  N N   . GLU E  1 188 ? -45.362  -35.539 -5.403   1.00 85.35  ? 188 GLU E N   1 
ATOM   7060  C CA  . GLU E  1 188 ? -44.184  -36.115 -4.784   1.00 86.75  ? 188 GLU E CA  1 
ATOM   7061  C C   . GLU E  1 188 ? -42.948  -35.249 -5.026   1.00 84.31  ? 188 GLU E C   1 
ATOM   7062  O O   . GLU E  1 188 ? -42.811  -34.643 -6.097   1.00 82.53  ? 188 GLU E O   1 
ATOM   7063  C CB  . GLU E  1 188 ? -43.964  -37.513 -5.380   1.00 90.44  ? 188 GLU E CB  1 
ATOM   7064  C CG  . GLU E  1 188 ? -43.118  -38.454 -4.536   1.00 93.48  ? 188 GLU E CG  1 
ATOM   7065  C CD  . GLU E  1 188 ? -43.552  -38.468 -3.058   1.00 94.64  ? 188 GLU E CD  1 
ATOM   7066  O OE1 . GLU E  1 188 ? -44.410  -39.344 -2.694   1.00 97.96  ? 188 GLU E OE1 1 
ATOM   7067  O OE2 . GLU E  1 188 ? -43.042  -37.592 -2.274   1.00 92.86  ? 188 GLU E OE2 1 
ATOM   7068  N N   . VAL E  1 189 ? -42.041  -35.180 -4.053   1.00 84.90  ? 189 VAL E N   1 
ATOM   7069  C CA  . VAL E  1 189 ? -40.715  -34.643 -4.374   1.00 84.06  ? 189 VAL E CA  1 
ATOM   7070  C C   . VAL E  1 189 ? -39.744  -35.804 -4.508   1.00 87.52  ? 189 VAL E C   1 
ATOM   7071  O O   . VAL E  1 189 ? -39.552  -36.553 -3.570   1.00 90.26  ? 189 VAL E O   1 
ATOM   7072  C CB  . VAL E  1 189 ? -40.234  -33.501 -3.439   1.00 82.61  ? 189 VAL E CB  1 
ATOM   7073  C CG1 . VAL E  1 189 ? -41.352  -33.024 -2.546   1.00 81.74  ? 189 VAL E CG1 1 
ATOM   7074  C CG2 . VAL E  1 189 ? -39.030  -33.875 -2.623   1.00 85.45  ? 189 VAL E CG2 1 
ATOM   7075  N N   . MET E  1 190 ? -39.173  -35.962 -5.700   1.00 87.93  ? 190 MET E N   1 
ATOM   7076  C CA  . MET E  1 190 ? -38.292  -37.092 -6.022   1.00 91.69  ? 190 MET E CA  1 
ATOM   7077  C C   . MET E  1 190 ? -37.003  -37.043 -5.227   1.00 93.41  ? 190 MET E C   1 
ATOM   7078  O O   . MET E  1 190 ? -36.083  -36.306 -5.546   1.00 92.90  ? 190 MET E O   1 
ATOM   7079  C CB  . MET E  1 190 ? -37.952  -37.149 -7.513   1.00 92.34  ? 190 MET E CB  1 
ATOM   7080  C CG  . MET E  1 190 ? -39.119  -36.937 -8.459   1.00 90.96  ? 190 MET E CG  1 
ATOM   7081  S SD  . MET E  1 190 ? -38.997  -37.833 -10.030  1.00 94.82  ? 190 MET E SD  1 
ATOM   7082  C CE  . MET E  1 190 ? -37.529  -37.155 -10.817  1.00 95.42  ? 190 MET E CE  1 
ATOM   7083  N N   . VAL E  1 191 ? -36.943  -37.842 -4.185   1.00 96.15  ? 191 VAL E N   1 
ATOM   7084  C CA  . VAL E  1 191 ? -35.745  -37.931 -3.368   1.00 98.92  ? 191 VAL E CA  1 
ATOM   7085  C C   . VAL E  1 191 ? -34.611  -38.612 -4.172   1.00 102.12 ? 191 VAL E C   1 
ATOM   7086  O O   . VAL E  1 191 ? -34.872  -39.535 -4.954   1.00 103.74 ? 191 VAL E O   1 
ATOM   7087  C CB  . VAL E  1 191 ? -36.065  -38.646 -2.006   1.00 101.83 ? 191 VAL E CB  1 
ATOM   7088  C CG1 . VAL E  1 191 ? -36.365  -40.130 -2.204   1.00 105.35 ? 191 VAL E CG1 1 
ATOM   7089  C CG2 . VAL E  1 191 ? -34.966  -38.438 -0.949   1.00 104.76 ? 191 VAL E CG2 1 
ATOM   7090  N N   . PRO E  1 192 ? -33.359  -38.126 -4.000   1.00 103.59 ? 192 PRO E N   1 
ATOM   7091  C CA  . PRO E  1 192 ? -32.229  -38.678 -4.753   1.00 107.19 ? 192 PRO E CA  1 
ATOM   7092  C C   . PRO E  1 192 ? -32.111  -40.175 -4.617   1.00 111.62 ? 192 PRO E C   1 
ATOM   7093  O O   . PRO E  1 192 ? -32.128  -40.721 -3.498   1.00 113.96 ? 192 PRO E O   1 
ATOM   7094  C CB  . PRO E  1 192 ? -31.007  -38.009 -4.117   1.00 109.15 ? 192 PRO E CB  1 
ATOM   7095  C CG  . PRO E  1 192 ? -31.515  -36.738 -3.523   1.00 105.26 ? 192 PRO E CG  1 
ATOM   7096  C CD  . PRO E  1 192 ? -32.964  -36.950 -3.185   1.00 102.36 ? 192 PRO E CD  1 
ATOM   7097  N N   . GLU E  1 193 ? -31.972  -40.827 -5.759   1.00 113.38 ? 193 GLU E N   1 
ATOM   7098  C CA  . GLU E  1 193 ? -31.870  -42.283 -5.814   1.00 118.06 ? 193 GLU E CA  1 
ATOM   7099  C C   . GLU E  1 193 ? -30.427  -42.811 -5.605   1.00 123.46 ? 193 GLU E C   1 
ATOM   7100  O O   . GLU E  1 193 ? -30.090  -43.397 -4.570   1.00 126.69 ? 193 GLU E O   1 
ATOM   7101  C CB  . GLU E  1 193 ? -32.420  -42.733 -7.165   1.00 118.24 ? 193 GLU E CB  1 
ATOM   7102  C CG  . GLU E  1 193 ? -32.469  -44.236 -7.381   1.00 123.29 ? 193 GLU E CG  1 
ATOM   7103  C CD  . GLU E  1 193 ? -32.942  -44.570 -8.786   1.00 124.21 ? 193 GLU E CD  1 
ATOM   7104  O OE1 . GLU E  1 193 ? -33.455  -45.712 -8.960   1.00 127.58 ? 193 GLU E OE1 1 
ATOM   7105  O OE2 . GLU E  1 193 ? -32.798  -43.695 -9.698   1.00 122.18 ? 193 GLU E OE2 1 
ATOM   7106  N N   . ILE F  1 4   ? -38.311  -27.001 -33.881  1.00 156.50 ? 4   ILE F N   1 
ATOM   7107  C CA  . ILE F  1 4   ? -36.938  -27.196 -33.354  1.00 157.14 ? 4   ILE F CA  1 
ATOM   7108  C C   . ILE F  1 4   ? -36.487  -28.685 -33.339  1.00 155.28 ? 4   ILE F C   1 
ATOM   7109  O O   . ILE F  1 4   ? -35.532  -28.997 -34.026  1.00 155.36 ? 4   ILE F O   1 
ATOM   7110  C CB  . ILE F  1 4   ? -36.637  -26.309 -32.076  1.00 161.25 ? 4   ILE F CB  1 
ATOM   7111  C CG1 . ILE F  1 4   ? -35.184  -26.434 -31.568  1.00 164.17 ? 4   ILE F CG1 1 
ATOM   7112  C CG2 . ILE F  1 4   ? -37.667  -26.480 -30.956  1.00 161.40 ? 4   ILE F CG2 1 
ATOM   7113  C CD1 . ILE F  1 4   ? -34.756  -25.333 -30.605  1.00 170.48 ? 4   ILE F CD1 1 
ATOM   7114  N N   . PRO F  1 5   ? -37.184  -29.614 -32.632  1.00 154.43 ? 5   PRO F N   1 
ATOM   7115  C CA  . PRO F  1 5   ? -36.556  -30.930 -32.516  1.00 154.96 ? 5   PRO F CA  1 
ATOM   7116  C C   . PRO F  1 5   ? -36.768  -31.848 -33.735  1.00 154.12 ? 5   PRO F C   1 
ATOM   7117  O O   . PRO F  1 5   ? -37.662  -31.629 -34.535  1.00 152.93 ? 5   PRO F O   1 
ATOM   7118  C CB  . PRO F  1 5   ? -37.181  -31.514 -31.235  1.00 155.44 ? 5   PRO F CB  1 
ATOM   7119  C CG  . PRO F  1 5   ? -38.371  -30.681 -30.938  1.00 154.18 ? 5   PRO F CG  1 
ATOM   7120  C CD  . PRO F  1 5   ? -38.506  -29.621 -31.997  1.00 153.83 ? 5   PRO F CD  1 
ATOM   7121  N N   . THR F  1 6   ? -35.934  -32.878 -33.831  1.00 156.30 ? 6   THR F N   1 
ATOM   7122  C CA  . THR F  1 6   ? -35.850  -33.837 -34.955  1.00 157.56 ? 6   THR F CA  1 
ATOM   7123  C C   . THR F  1 6   ? -36.407  -35.268 -34.666  1.00 160.51 ? 6   THR F C   1 
ATOM   7124  O O   . THR F  1 6   ? -36.254  -35.807 -33.569  1.00 162.59 ? 6   THR F O   1 
ATOM   7125  C CB  . THR F  1 6   ? -34.372  -33.950 -35.382  1.00 159.96 ? 6   THR F CB  1 
ATOM   7126  O OG1 . THR F  1 6   ? -33.901  -32.636 -35.694  1.00 157.94 ? 6   THR F OG1 1 
ATOM   7127  C CG2 . THR F  1 6   ? -34.179  -34.876 -36.569  1.00 162.23 ? 6   THR F CG2 1 
ATOM   7128  N N   . VAL F  1 7   ? -37.048  -35.873 -35.660  1.00 161.86 ? 7   VAL F N   1 
ATOM   7129  C CA  . VAL F  1 7   ? -37.593  -37.226 -35.528  1.00 166.39 ? 7   VAL F CA  1 
ATOM   7130  C C   . VAL F  1 7   ? -36.981  -38.143 -36.606  1.00 171.63 ? 7   VAL F C   1 
ATOM   7131  O O   . VAL F  1 7   ? -36.676  -37.679 -37.705  1.00 170.57 ? 7   VAL F O   1 
ATOM   7132  C CB  . VAL F  1 7   ? -39.145  -37.230 -35.621  1.00 165.97 ? 7   VAL F CB  1 
ATOM   7133  C CG1 . VAL F  1 7   ? -39.702  -38.637 -35.442  1.00 171.87 ? 7   VAL F CG1 1 
ATOM   7134  C CG2 . VAL F  1 7   ? -39.744  -36.298 -34.584  1.00 161.62 ? 7   VAL F CG2 1 
ATOM   7135  N N   . ILE F  1 8   ? -36.803  -39.430 -36.281  1.00 178.11 ? 8   ILE F N   1 
ATOM   7136  C CA  . ILE F  1 8   ? -36.258  -40.446 -37.213  1.00 185.46 ? 8   ILE F CA  1 
ATOM   7137  C C   . ILE F  1 8   ? -37.308  -41.375 -37.817  1.00 191.43 ? 8   ILE F C   1 
ATOM   7138  O O   . ILE F  1 8   ? -38.341  -41.638 -37.193  1.00 191.83 ? 8   ILE F O   1 
ATOM   7139  C CB  . ILE F  1 8   ? -35.233  -41.384 -36.532  1.00 192.42 ? 8   ILE F CB  1 
ATOM   7140  C CG1 . ILE F  1 8   ? -35.684  -41.720 -35.094  1.00 193.01 ? 8   ILE F CG1 1 
ATOM   7141  C CG2 . ILE F  1 8   ? -33.819  -40.815 -36.643  1.00 191.52 ? 8   ILE F CG2 1 
ATOM   7142  C CD1 . ILE F  1 8   ? -36.347  -43.071 -34.910  1.00 201.27 ? 8   ILE F CD1 1 
ATOM   7143  N N   . GLU F  1 9   ? -37.005  -41.903 -39.009  1.00 197.19 ? 9   GLU F N   1 
ATOM   7144  C CA  . GLU F  1 9   ? -37.866  -42.867 -39.703  1.00 205.72 ? 9   GLU F CA  1 
ATOM   7145  C C   . GLU F  1 9   ? -37.085  -43.678 -40.728  1.00 214.59 ? 9   GLU F C   1 
ATOM   7146  O O   . GLU F  1 9   ? -36.836  -44.863 -40.527  1.00 224.56 ? 9   GLU F O   1 
ATOM   7147  C CB  . GLU F  1 9   ? -39.030  -42.146 -40.381  1.00 202.49 ? 9   GLU F CB  1 
ATOM   7148  C CG  . GLU F  1 9   ? -40.367  -42.860 -40.247  1.00 208.98 ? 9   GLU F CG  1 
ATOM   7149  C CD  . GLU F  1 9   ? -41.470  -41.924 -39.776  1.00 202.41 ? 9   GLU F CD  1 
ATOM   7150  O OE1 . GLU F  1 9   ? -42.361  -41.614 -40.592  1.00 204.85 ? 9   GLU F OE1 1 
ATOM   7151  O OE2 . GLU F  1 9   ? -41.438  -41.481 -38.600  1.00 195.86 ? 9   GLU F OE2 1 
ATOM   7152  N N   . ARG F  1 16  ? -34.812  -41.745 -42.340  1.00 202.80 ? 16  ARG F N   1 
ATOM   7153  C CA  . ARG F  1 16  ? -34.841  -40.372 -42.815  1.00 193.65 ? 16  ARG F CA  1 
ATOM   7154  C C   . ARG F  1 16  ? -35.183  -39.417 -41.663  1.00 185.38 ? 16  ARG F C   1 
ATOM   7155  O O   . ARG F  1 16  ? -35.889  -39.806 -40.724  1.00 186.20 ? 16  ARG F O   1 
ATOM   7156  C CB  . ARG F  1 16  ? -35.825  -40.249 -43.979  1.00 195.44 ? 16  ARG F CB  1 
ATOM   7157  C CG  . ARG F  1 16  ? -35.447  -41.073 -45.208  1.00 204.14 ? 16  ARG F CG  1 
ATOM   7158  C CD  . ARG F  1 16  ? -34.385  -40.388 -46.060  1.00 200.49 ? 16  ARG F CD  1 
ATOM   7159  N NE  . ARG F  1 16  ? -34.054  -41.117 -47.283  1.00 208.92 ? 16  ARG F NE  1 
ATOM   7160  C CZ  . ARG F  1 16  ? -33.270  -40.653 -48.250  1.00 207.28 ? 16  ARG F CZ  1 
ATOM   7161  N NH1 . ARG F  1 16  ? -33.031  -41.393 -49.311  1.00 215.99 ? 16  ARG F NH1 1 
ATOM   7162  N NH2 . ARG F  1 16  ? -32.724  -39.454 -48.174  1.00 197.82 ? 16  ARG F NH2 1 
ATOM   7163  N N   . ALA F  1 17  ? -34.669  -38.182 -41.732  1.00 214.43 ? 17  ALA F N   1 
ATOM   7164  C CA  . ALA F  1 17  ? -34.802  -37.187 -40.641  1.00 186.56 ? 17  ALA F CA  1 
ATOM   7165  C C   . ALA F  1 17  ? -35.836  -36.021 -40.883  1.00 164.99 ? 17  ALA F C   1 
ATOM   7166  O O   . ALA F  1 17  ? -35.821  -35.394 -41.946  1.00 174.02 ? 17  ALA F O   1 
ATOM   7167  C CB  . ALA F  1 17  ? -33.423  -36.638 -40.303  1.00 201.58 ? 17  ALA F CB  1 
ATOM   7168  N N   . TYR F  1 18  ? -36.725  -35.744 -39.917  1.00 141.87 ? 18  TYR F N   1 
ATOM   7169  C CA  . TYR F  1 18  ? -37.670  -34.628 -40.015  1.00 125.89 ? 18  TYR F CA  1 
ATOM   7170  C C   . TYR F  1 18  ? -37.490  -33.635 -38.860  1.00 115.13 ? 18  TYR F C   1 
ATOM   7171  O O   . TYR F  1 18  ? -37.040  -33.972 -37.793  1.00 117.04 ? 18  TYR F O   1 
ATOM   7172  C CB  . TYR F  1 18  ? -39.103  -35.138 -39.872  1.00 117.87 ? 18  TYR F CB  1 
ATOM   7173  C CG  . TYR F  1 18  ? -39.580  -36.114 -40.856  1.00 135.32 ? 18  TYR F CG  1 
ATOM   7174  C CD1 . TYR F  1 18  ? -40.072  -35.701 -42.078  1.00 146.74 ? 18  TYR F CD1 1 
ATOM   7175  C CD2 . TYR F  1 18  ? -39.615  -37.447 -40.534  1.00 146.15 ? 18  TYR F CD2 1 
ATOM   7176  C CE1 . TYR F  1 18  ? -40.528  -36.623 -43.008  1.00 173.56 ? 18  TYR F CE1 1 
ATOM   7177  C CE2 . TYR F  1 18  ? -40.054  -38.395 -41.447  1.00 171.80 ? 18  TYR F CE2 1 
ATOM   7178  C CZ  . TYR F  1 18  ? -40.508  -37.979 -42.686  1.00 187.40 ? 18  TYR F CZ  1 
ATOM   7179  O OH  . TYR F  1 18  ? -40.948  -38.928 -43.568  1.00 222.44 ? 18  TYR F OH  1 
ATOM   7180  N N   . ASP F  1 19  ? -37.912  -32.410 -39.034  1.00 108.73 ? 19  ASP F N   1 
ATOM   7181  C CA  . ASP F  1 19  ? -38.271  -31.627 -37.857  1.00 101.95 ? 19  ASP F CA  1 
ATOM   7182  C C   . ASP F  1 19  ? -39.724  -31.970 -37.439  1.00 90.67  ? 19  ASP F C   1 
ATOM   7183  O O   . ASP F  1 19  ? -40.533  -32.497 -38.243  1.00 89.02  ? 19  ASP F O   1 
ATOM   7184  C CB  . ASP F  1 19  ? -38.138  -30.127 -38.127  1.00 105.97 ? 19  ASP F CB  1 
ATOM   7185  C CG  . ASP F  1 19  ? -39.201  -29.604 -39.098  1.00 98.19  ? 19  ASP F CG  1 
ATOM   7186  O OD1 . ASP F  1 19  ? -40.252  -29.148 -38.654  1.00 91.46  ? 19  ASP F OD1 1 
ATOM   7187  O OD2 . ASP F  1 19  ? -38.997  -29.669 -40.321  1.00 104.12 ? 19  ASP F OD2 1 
ATOM   7188  N N   . ILE F  1 20  ? -40.069  -31.629 -36.207  1.00 90.86  ? 20  ILE F N   1 
ATOM   7189  C CA  . ILE F  1 20  ? -41.319  -32.078 -35.633  1.00 88.36  ? 20  ILE F CA  1 
ATOM   7190  C C   . ILE F  1 20  ? -42.504  -31.689 -36.459  1.00 85.38  ? 20  ILE F C   1 
ATOM   7191  O O   . ILE F  1 20  ? -43.409  -32.479 -36.601  1.00 88.80  ? 20  ILE F O   1 
ATOM   7192  C CB  . ILE F  1 20  ? -41.491  -31.670 -34.139  1.00 97.77  ? 20  ILE F CB  1 
ATOM   7193  C CG1 . ILE F  1 20  ? -42.567  -32.521 -33.438  1.00 102.37 ? 20  ILE F CG1 1 
ATOM   7194  C CG2 . ILE F  1 20  ? -41.746  -30.174 -33.968  1.00 103.96 ? 20  ILE F CG2 1 
ATOM   7195  C CD1 . ILE F  1 20  ? -42.163  -33.945 -33.137  1.00 104.62 ? 20  ILE F CD1 1 
ATOM   7196  N N   . TYR F  1 21  ? -42.487  -30.506 -37.044  1.00 84.29  ? 21  TYR F N   1 
ATOM   7197  C CA  . TYR F  1 21  ? -43.631  -30.031 -37.848  1.00 86.05  ? 21  TYR F CA  1 
ATOM   7198  C C   . TYR F  1 21  ? -43.804  -30.852 -39.122  1.00 90.14  ? 21  TYR F C   1 
ATOM   7199  O O   . TYR F  1 21  ? -44.903  -31.185 -39.529  1.00 99.83  ? 21  TYR F O   1 
ATOM   7200  C CB  . TYR F  1 21  ? -43.522  -28.533 -38.139  1.00 87.55  ? 21  TYR F CB  1 
ATOM   7201  C CG  . TYR F  1 21  ? -43.384  -27.714 -36.892  1.00 93.76  ? 21  TYR F CG  1 
ATOM   7202  C CD1 . TYR F  1 21  ? -44.449  -27.546 -36.035  1.00 102.37 ? 21  TYR F CD1 1 
ATOM   7203  C CD2 . TYR F  1 21  ? -42.175  -27.131 -36.551  1.00 99.68  ? 21  TYR F CD2 1 
ATOM   7204  C CE1 . TYR F  1 21  ? -44.316  -26.816 -34.864  1.00 116.98 ? 21  TYR F CE1 1 
ATOM   7205  C CE2 . TYR F  1 21  ? -42.026  -26.396 -35.391  1.00 115.50 ? 21  TYR F CE2 1 
ATOM   7206  C CZ  . TYR F  1 21  ? -43.101  -26.241 -34.545  1.00 124.26 ? 21  TYR F CZ  1 
ATOM   7207  O OH  . TYR F  1 21  ? -42.961  -25.528 -33.382  1.00 148.38 ? 21  TYR F OH  1 
ATOM   7208  N N   . SER F  1 22  ? -42.685  -31.207 -39.726  1.00 90.37  ? 22  SER F N   1 
ATOM   7209  C CA  . SER F  1 22  ? -42.682  -31.978 -40.934  1.00 102.66 ? 22  SER F CA  1 
ATOM   7210  C C   . SER F  1 22  ? -43.215  -33.367 -40.667  1.00 111.08 ? 22  SER F C   1 
ATOM   7211  O O   . SER F  1 22  ? -43.932  -33.944 -41.501  1.00 129.91 ? 22  SER F O   1 
ATOM   7212  C CB  . SER F  1 22  ? -41.255  -32.091 -41.424  1.00 107.07 ? 22  SER F CB  1 
ATOM   7213  O OG  . SER F  1 22  ? -40.705  -30.821 -41.611  1.00 104.90 ? 22  SER F OG  1 
ATOM   7214  N N   . ARG F  1 23  ? -42.828  -33.904 -39.513  1.00 103.24 ? 23  ARG F N   1 
ATOM   7215  C CA  . ARG F  1 23  ? -43.287  -35.191 -39.083  1.00 112.76 ? 23  ARG F CA  1 
ATOM   7216  C C   . ARG F  1 23  ? -44.811  -35.209 -38.987  1.00 123.83 ? 23  ARG F C   1 
ATOM   7217  O O   . ARG F  1 23  ? -45.466  -36.128 -39.462  1.00 145.44 ? 23  ARG F O   1 
ATOM   7218  C CB  . ARG F  1 23  ? -42.619  -35.574 -37.767  1.00 104.63 ? 23  ARG F CB  1 
ATOM   7219  C CG  . ARG F  1 23  ? -43.071  -36.922 -37.216  1.00 116.72 ? 23  ARG F CG  1 
ATOM   7220  C CD  . ARG F  1 23  ? -42.915  -38.096 -38.205  1.00 135.85 ? 23  ARG F CD  1 
ATOM   7221  N NE  . ARG F  1 23  ? -43.630  -39.313 -37.798  1.00 154.83 ? 23  ARG F NE  1 
ATOM   7222  C CZ  . ARG F  1 23  ? -44.936  -39.522 -37.980  1.00 173.42 ? 23  ARG F CZ  1 
ATOM   7223  N NH1 . ARG F  1 23  ? -45.691  -38.600 -38.567  1.00 174.17 ? 23  ARG F NH1 1 
ATOM   7224  N NH2 . ARG F  1 23  ? -45.495  -40.666 -37.578  1.00 196.71 ? 23  ARG F NH2 1 
ATOM   7225  N N   . LEU F  1 24  ? -45.372  -34.176 -38.388  1.00 70.74  ? 24  LEU F N   1 
ATOM   7226  C CA  . LEU F  1 24  ? -46.810  -34.011 -38.332  1.00 69.64  ? 24  LEU F CA  1 
ATOM   7227  C C   . LEU F  1 24  ? -47.477  -33.765 -39.684  1.00 68.35  ? 24  LEU F C   1 
ATOM   7228  O O   . LEU F  1 24  ? -48.623  -34.090 -39.903  1.00 68.43  ? 24  LEU F O   1 
ATOM   7229  C CB  . LEU F  1 24  ? -47.154  -32.874 -37.361  1.00 68.40  ? 24  LEU F CB  1 
ATOM   7230  C CG  . LEU F  1 24  ? -47.578  -33.206 -35.930  1.00 69.83  ? 24  LEU F CG  1 
ATOM   7231  C CD1 . LEU F  1 24  ? -46.751  -34.318 -35.278  1.00 72.49  ? 24  LEU F CD1 1 
ATOM   7232  C CD2 . LEU F  1 24  ? -47.585  -31.961 -35.083  1.00 68.98  ? 24  LEU F CD2 1 
ATOM   7233  N N   . LEU F  1 25  ? -46.760  -33.147 -40.592  1.00 67.49  ? 25  LEU F N   1 
ATOM   7234  C CA  . LEU F  1 25  ? -47.315  -32.825 -41.880  1.00 66.59  ? 25  LEU F CA  1 
ATOM   7235  C C   . LEU F  1 25  ? -47.506  -34.135 -42.668  1.00 68.51  ? 25  LEU F C   1 
ATOM   7236  O O   . LEU F  1 25  ? -48.400  -34.262 -43.513  1.00 68.53  ? 25  LEU F O   1 
ATOM   7237  C CB  . LEU F  1 25  ? -46.387  -31.845 -42.593  1.00 65.79  ? 25  LEU F CB  1 
ATOM   7238  C CG  . LEU F  1 25  ? -46.784  -31.436 -43.996  1.00 65.28  ? 25  LEU F CG  1 
ATOM   7239  C CD1 . LEU F  1 25  ? -48.113  -30.699 -43.985  1.00 63.80  ? 25  LEU F CD1 1 
ATOM   7240  C CD2 . LEU F  1 25  ? -45.675  -30.650 -44.677  1.00 65.34  ? 25  LEU F CD2 1 
ATOM   7241  N N   . LYS F  1 26  ? -46.658  -35.110 -42.381  1.00 70.53  ? 26  LYS F N   1 
ATOM   7242  C CA  . LYS F  1 26  ? -46.788  -36.440 -42.937  1.00 73.00  ? 26  LYS F CA  1 
ATOM   7243  C C   . LYS F  1 26  ? -48.151  -37.036 -42.596  1.00 73.66  ? 26  LYS F C   1 
ATOM   7244  O O   . LYS F  1 26  ? -48.669  -37.842 -43.376  1.00 75.39  ? 26  LYS F O   1 
ATOM   7245  C CB  . LYS F  1 26  ? -45.705  -37.321 -42.364  1.00 75.34  ? 26  LYS F CB  1 
ATOM   7246  C CG  . LYS F  1 26  ? -45.331  -38.481 -43.220  1.00 78.23  ? 26  LYS F CG  1 
ATOM   7247  C CD  . LYS F  1 26  ? -44.203  -39.260 -42.546  1.00 80.80  ? 26  LYS F CD  1 
ATOM   7248  C CE  . LYS F  1 26  ? -43.666  -40.388 -43.439  1.00 84.20  ? 26  LYS F CE  1 
ATOM   7249  N NZ  . LYS F  1 26  ? -44.653  -41.501 -43.523  1.00 86.32  ? 26  LYS F NZ  1 
ATOM   7250  N N   . ASP F  1 27  ? -48.719  -36.641 -41.445  1.00 72.73  ? 27  ASP F N   1 
ATOM   7251  C CA  . ASP F  1 27  ? -50.061  -37.054 -41.018  1.00 73.55  ? 27  ASP F CA  1 
ATOM   7252  C C   . ASP F  1 27  ? -51.122  -36.038 -41.363  1.00 71.57  ? 27  ASP F C   1 
ATOM   7253  O O   . ASP F  1 27  ? -52.181  -36.047 -40.765  1.00 71.99  ? 27  ASP F O   1 
ATOM   7254  C CB  . ASP F  1 27  ? -50.126  -37.326 -39.524  1.00 74.53  ? 27  ASP F CB  1 
ATOM   7255  C CG  . ASP F  1 27  ? -49.195  -38.450 -39.085  1.00 77.19  ? 27  ASP F CG  1 
ATOM   7256  O OD1 . ASP F  1 27  ? -49.106  -38.663 -37.852  1.00 78.32  ? 27  ASP F OD1 1 
ATOM   7257  O OD2 . ASP F  1 27  ? -48.544  -39.127 -39.941  1.00 78.54  ? 27  ASP F OD2 1 
ATOM   7258  N N   . ARG F  1 28  ? -50.845  -35.165 -42.321  1.00 69.82  ? 28  ARG F N   1 
ATOM   7259  C CA  . ARG F  1 28  ? -51.813  -34.176 -42.788  1.00 68.29  ? 28  ARG F CA  1 
ATOM   7260  C C   . ARG F  1 28  ? -52.169  -33.103 -41.738  1.00 66.68  ? 28  ARG F C   1 
ATOM   7261  O O   . ARG F  1 28  ? -53.203  -32.455 -41.808  1.00 66.12  ? 28  ARG F O   1 
ATOM   7262  C CB  . ARG F  1 28  ? -53.053  -34.867 -43.353  1.00 70.04  ? 28  ARG F CB  1 
ATOM   7263  C CG  . ARG F  1 28  ? -52.723  -35.891 -44.440  1.00 72.09  ? 28  ARG F CG  1 
ATOM   7264  C CD  . ARG F  1 28  ? -53.966  -36.498 -45.070  1.00 74.23  ? 28  ARG F CD  1 
ATOM   7265  N NE  . ARG F  1 28  ? -54.738  -35.586 -45.904  1.00 73.29  ? 28  ARG F NE  1 
ATOM   7266  C CZ  . ARG F  1 28  ? -54.403  -35.244 -47.135  1.00 73.12  ? 28  ARG F CZ  1 
ATOM   7267  N NH1 . ARG F  1 28  ? -53.289  -35.690 -47.702  1.00 73.76  ? 28  ARG F NH1 1 
ATOM   7268  N NH2 . ARG F  1 28  ? -55.190  -34.438 -47.804  1.00 72.69  ? 28  ARG F NH2 1 
ATOM   7269  N N   . ILE F  1 29  ? -51.268  -32.885 -40.793  1.00 66.27  ? 29  ILE F N   1 
ATOM   7270  C CA  . ILE F  1 29  ? -51.431  -31.824 -39.785  1.00 65.13  ? 29  ILE F CA  1 
ATOM   7271  C C   . ILE F  1 29  ? -50.578  -30.585 -40.081  1.00 63.43  ? 29  ILE F C   1 
ATOM   7272  O O   . ILE F  1 29  ? -49.357  -30.670 -40.243  1.00 63.54  ? 29  ILE F O   1 
ATOM   7273  C CB  . ILE F  1 29  ? -51.097  -32.338 -38.361  1.00 66.43  ? 29  ILE F CB  1 
ATOM   7274  C CG1 . ILE F  1 29  ? -52.100  -33.472 -37.949  1.00 68.59  ? 29  ILE F CG1 1 
ATOM   7275  C CG2 . ILE F  1 29  ? -51.097  -31.175 -37.383  1.00 65.58  ? 29  ILE F CG2 1 
ATOM   7276  C CD1 . ILE F  1 29  ? -51.723  -34.258 -36.715  1.00 70.63  ? 29  ILE F CD1 1 
ATOM   7277  N N   . ILE F  1 30  ? -51.237  -29.432 -40.154  1.00 62.28  ? 30  ILE F N   1 
ATOM   7278  C CA  . ILE F  1 30  ? -50.565  -28.137 -40.239  1.00 61.14  ? 30  ILE F CA  1 
ATOM   7279  C C   . ILE F  1 30  ? -50.678  -27.300 -38.935  1.00 61.14  ? 30  ILE F C   1 
ATOM   7280  O O   . ILE F  1 30  ? -51.772  -27.081 -38.399  1.00 61.42  ? 30  ILE F O   1 
ATOM   7281  C CB  . ILE F  1 30  ? -51.116  -27.320 -41.397  1.00 60.33  ? 30  ILE F CB  1 
ATOM   7282  C CG1 . ILE F  1 30  ? -50.965  -28.085 -42.687  1.00 60.75  ? 30  ILE F CG1 1 
ATOM   7283  C CG2 . ILE F  1 30  ? -50.405  -25.982 -41.492  1.00 59.64  ? 30  ILE F CG2 1 
ATOM   7284  C CD1 . ILE F  1 30  ? -51.806  -27.528 -43.814  1.00 60.56  ? 30  ILE F CD1 1 
ATOM   7285  N N   . MET F  1 31  ? -49.544  -26.827 -38.440  1.00 61.25  ? 31  MET F N   1 
ATOM   7286  C CA  . MET F  1 31  ? -49.530  -25.980 -37.256  1.00 61.69  ? 31  MET F CA  1 
ATOM   7287  C C   . MET F  1 31  ? -49.448  -24.485 -37.561  1.00 61.12  ? 31  MET F C   1 
ATOM   7288  O O   . MET F  1 31  ? -48.544  -24.044 -38.221  1.00 60.90  ? 31  MET F O   1 
ATOM   7289  C CB  . MET F  1 31  ? -48.375  -26.371 -36.357  1.00 62.89  ? 31  MET F CB  1 
ATOM   7290  C CG  . MET F  1 31  ? -48.347  -27.846 -36.032  1.00 63.94  ? 31  MET F CG  1 
ATOM   7291  S SD  . MET F  1 31  ? -49.852  -28.466 -35.232  1.00 64.83  ? 31  MET F SD  1 
ATOM   7292  C CE  . MET F  1 31  ? -49.770  -27.603 -33.637  1.00 66.12  ? 31  MET F CE  1 
ATOM   7293  N N   . LEU F  1 32  ? -50.416  -23.706 -37.116  1.00 61.26  ? 32  LEU F N   1 
ATOM   7294  C CA  . LEU F  1 32  ? -50.338  -22.275 -37.297  1.00 61.25  ? 32  LEU F CA  1 
ATOM   7295  C C   . LEU F  1 32  ? -50.156  -21.731 -35.908  1.00 62.64  ? 32  LEU F C   1 
ATOM   7296  O O   . LEU F  1 32  ? -51.111  -21.652 -35.119  1.00 63.43  ? 32  LEU F O   1 
ATOM   7297  C CB  . LEU F  1 32  ? -51.578  -21.710 -37.986  1.00 60.85  ? 32  LEU F CB  1 
ATOM   7298  C CG  . LEU F  1 32  ? -51.765  -20.191 -37.937  1.00 61.49  ? 32  LEU F CG  1 
ATOM   7299  C CD1 . LEU F  1 32  ? -50.550  -19.484 -38.475  1.00 61.56  ? 32  LEU F CD1 1 
ATOM   7300  C CD2 . LEU F  1 32  ? -52.999  -19.763 -38.723  1.00 61.40  ? 32  LEU F CD2 1 
ATOM   7301  N N   . GLY F  1 33  ? -48.912  -21.405 -35.590  1.00 63.37  ? 33  GLY F N   1 
ATOM   7302  C CA  . GLY F  1 33  ? -48.574  -20.965 -34.242  1.00 65.19  ? 33  GLY F CA  1 
ATOM   7303  C C   . GLY F  1 33  ? -48.015  -19.547 -34.133  1.00 66.38  ? 33  GLY F C   1 
ATOM   7304  O O   . GLY F  1 33  ? -47.331  -19.223 -33.180  1.00 68.25  ? 33  GLY F O   1 
ATOM   7305  N N   . SER F  1 34  ? -48.301  -18.686 -35.099  1.00 65.75  ? 34  SER F N   1 
ATOM   7306  C CA  . SER F  1 34  ? -47.690  -17.368 -35.118  1.00 67.25  ? 34  SER F CA  1 
ATOM   7307  C C   . SER F  1 34  ? -48.653  -16.349 -35.734  1.00 67.19  ? 34  SER F C   1 
ATOM   7308  O O   . SER F  1 34  ? -49.748  -16.705 -36.114  1.00 66.00  ? 34  SER F O   1 
ATOM   7309  C CB  . SER F  1 34  ? -46.374  -17.420 -35.893  1.00 67.31  ? 34  SER F CB  1 
ATOM   7310  O OG  . SER F  1 34  ? -46.610  -17.573 -37.255  1.00 65.75  ? 34  SER F OG  1 
ATOM   7311  N N   . GLN F  1 35  ? -48.242  -15.091 -35.806  1.00 68.91  ? 35  GLN F N   1 
ATOM   7312  C CA  . GLN F  1 35  ? -49.012  -14.089 -36.485  1.00 69.29  ? 35  GLN F CA  1 
ATOM   7313  C C   . GLN F  1 35  ? -48.980  -14.437 -37.955  1.00 67.57  ? 35  GLN F C   1 
ATOM   7314  O O   . GLN F  1 35  ? -48.104  -15.180 -38.392  1.00 66.69  ? 35  GLN F O   1 
ATOM   7315  C CB  . GLN F  1 35  ? -48.485  -12.675 -36.233  1.00 72.07  ? 35  GLN F CB  1 
ATOM   7316  C CG  . GLN F  1 35  ? -47.229  -12.239 -37.003  1.00 72.95  ? 35  GLN F CG  1 
ATOM   7317  C CD  . GLN F  1 35  ? -46.100  -13.320 -37.049  1.00 71.99  ? 35  GLN F CD  1 
ATOM   7318  O OE1 . GLN F  1 35  ? -45.664  -13.895 -35.995  1.00 72.44  ? 35  GLN F OE1 1 
ATOM   7319  N NE2 . GLN F  1 35  ? -45.637  -13.623 -38.278  1.00 71.01  ? 35  GLN F NE2 1 
ATOM   7320  N N   . ILE F  1 36  ? -49.959  -13.921 -38.697  1.00 67.45  ? 36  ILE F N   1 
ATOM   7321  C CA  . ILE F  1 36  ? -50.139  -14.240 -40.089  1.00 66.20  ? 36  ILE F CA  1 
ATOM   7322  C C   . ILE F  1 36  ? -49.550  -13.135 -40.920  1.00 67.78  ? 36  ILE F C   1 
ATOM   7323  O O   . ILE F  1 36  ? -50.001  -11.991 -40.843  1.00 69.58  ? 36  ILE F O   1 
ATOM   7324  C CB  . ILE F  1 36  ? -51.642  -14.376 -40.428  1.00 65.63  ? 36  ILE F CB  1 
ATOM   7325  C CG1 . ILE F  1 36  ? -52.243  -15.604 -39.719  1.00 64.35  ? 36  ILE F CG1 1 
ATOM   7326  C CG2 . ILE F  1 36  ? -51.875  -14.463 -41.933  1.00 65.09  ? 36  ILE F CG2 1 
ATOM   7327  C CD1 . ILE F  1 36  ? -53.754  -15.565 -39.641  1.00 64.73  ? 36  ILE F CD1 1 
ATOM   7328  N N   . ASP F  1 37  ? -48.519  -13.470 -41.692  1.00 67.55  ? 37  ASP F N   1 
ATOM   7329  C CA  . ASP F  1 37  ? -47.977  -12.537 -42.692  1.00 69.30  ? 37  ASP F CA  1 
ATOM   7330  C C   . ASP F  1 37  ? -47.692  -13.296 -43.964  1.00 68.30  ? 37  ASP F C   1 
ATOM   7331  O O   . ASP F  1 37  ? -47.890  -14.494 -44.020  1.00 66.38  ? 37  ASP F O   1 
ATOM   7332  C CB  . ASP F  1 37  ? -46.711  -11.843 -42.205  1.00 71.56  ? 37  ASP F CB  1 
ATOM   7333  C CG  . ASP F  1 37  ? -45.624  -12.814 -41.880  1.00 70.90  ? 37  ASP F CG  1 
ATOM   7334  O OD1 . ASP F  1 37  ? -44.867  -12.520 -40.954  1.00 72.44  ? 37  ASP F OD1 1 
ATOM   7335  O OD2 . ASP F  1 37  ? -45.527  -13.880 -42.528  1.00 69.20  ? 37  ASP F OD2 1 
ATOM   7336  N N   . ASP F  1 38  ? -47.183  -12.596 -44.963  1.00 70.06  ? 38  ASP F N   1 
ATOM   7337  C CA  . ASP F  1 38  ? -46.949  -13.153 -46.252  1.00 69.82  ? 38  ASP F CA  1 
ATOM   7338  C C   . ASP F  1 38  ? -46.089  -14.415 -46.193  1.00 68.64  ? 38  ASP F C   1 
ATOM   7339  O O   . ASP F  1 38  ? -46.395  -15.381 -46.884  1.00 67.41  ? 38  ASP F O   1 
ATOM   7340  C CB  . ASP F  1 38  ? -46.373  -12.100 -47.190  1.00 72.64  ? 38  ASP F CB  1 
ATOM   7341  C CG  . ASP F  1 38  ? -47.463  -11.171 -47.788  1.00 73.79  ? 38  ASP F CG  1 
ATOM   7342  O OD1 . ASP F  1 38  ? -47.143  -10.391 -48.747  1.00 76.32  ? 38  ASP F OD1 1 
ATOM   7343  O OD2 . ASP F  1 38  ? -48.636  -11.220 -47.326  1.00 72.58  ? 38  ASP F OD2 1 
ATOM   7344  N N   . ASN F  1 39  ? -45.048  -14.462 -45.381  1.00 69.30  ? 39  ASN F N   1 
ATOM   7345  C CA  . ASN F  1 39  ? -44.281  -15.713 -45.282  1.00 68.46  ? 39  ASN F CA  1 
ATOM   7346  C C   . ASN F  1 39  ? -45.106  -16.853 -44.714  1.00 65.99  ? 39  ASN F C   1 
ATOM   7347  O O   . ASN F  1 39  ? -45.126  -17.963 -45.261  1.00 65.05  ? 39  ASN F O   1 
ATOM   7348  C CB  . ASN F  1 39  ? -43.081  -15.577 -44.386  1.00 69.93  ? 39  ASN F CB  1 
ATOM   7349  C CG  . ASN F  1 39  ? -41.932  -14.894 -45.052  1.00 72.79  ? 39  ASN F CG  1 
ATOM   7350  O OD1 . ASN F  1 39  ? -41.972  -14.505 -46.210  1.00 73.79  ? 39  ASN F OD1 1 
ATOM   7351  N ND2 . ASN F  1 39  ? -40.878  -14.734 -44.310  1.00 74.58  ? 39  ASN F ND2 1 
ATOM   7352  N N   . VAL F  1 40  ? -45.766  -16.595 -43.594  1.00 65.38  ? 40  VAL F N   1 
ATOM   7353  C CA  . VAL F  1 40  ? -46.574  -17.608 -42.990  1.00 63.56  ? 40  VAL F CA  1 
ATOM   7354  C C   . VAL F  1 40  ? -47.620  -18.069 -43.963  1.00 62.49  ? 40  VAL F C   1 
ATOM   7355  O O   . VAL F  1 40  ? -47.703  -19.278 -44.211  1.00 61.56  ? 40  VAL F O   1 
ATOM   7356  C CB  . VAL F  1 40  ? -47.169  -17.133 -41.666  1.00 63.66  ? 40  VAL F CB  1 
ATOM   7357  C CG1 . VAL F  1 40  ? -48.187  -18.111 -41.136  1.00 62.21  ? 40  VAL F CG1 1 
ATOM   7358  C CG2 . VAL F  1 40  ? -46.054  -16.960 -40.639  1.00 64.98  ? 40  VAL F CG2 1 
ATOM   7359  N N   . ALA F  1 41  ? -48.386  -17.147 -44.542  1.00 63.00  ? 41  ALA F N   1 
ATOM   7360  C CA  . ALA F  1 41  ? -49.408  -17.535 -45.546  1.00 62.49  ? 41  ALA F CA  1 
ATOM   7361  C C   . ALA F  1 41  ? -48.791  -18.368 -46.657  1.00 62.57  ? 41  ALA F C   1 
ATOM   7362  O O   . ALA F  1 41  ? -49.299  -19.438 -46.988  1.00 61.81  ? 41  ALA F O   1 
ATOM   7363  C CB  . ALA F  1 41  ? -50.115  -16.330 -46.123  1.00 63.69  ? 41  ALA F CB  1 
ATOM   7364  N N   . ASN F  1 42  ? -47.676  -17.903 -47.200  1.00 63.91  ? 42  ASN F N   1 
ATOM   7365  C CA  . ASN F  1 42  ? -46.995  -18.613 -48.282  1.00 64.59  ? 42  ASN F CA  1 
ATOM   7366  C C   . ASN F  1 42  ? -46.616  -20.065 -47.919  1.00 63.66  ? 42  ASN F C   1 
ATOM   7367  O O   . ASN F  1 42  ? -46.722  -20.960 -48.735  1.00 63.83  ? 42  ASN F O   1 
ATOM   7368  C CB  . ASN F  1 42  ? -45.760  -17.831 -48.713  1.00 66.67  ? 42  ASN F CB  1 
ATOM   7369  C CG  . ASN F  1 42  ? -45.326  -18.177 -50.133  1.00 68.19  ? 42  ASN F CG  1 
ATOM   7370  O OD1 . ASN F  1 42  ? -44.118  -18.534 -50.410  1.00 69.57  ? 42  ASN F OD1 1 
ATOM   7371  N ND2 . ASN F  1 42  ? -46.318  -18.130 -51.073  1.00 68.34  ? 42  ASN F ND2 1 
ATOM   7372  N N   . SER F  1 43  ? -46.224  -20.299 -46.674  1.00 63.02  ? 43  SER F N   1 
ATOM   7373  C CA  . SER F  1 43  ? -45.922  -21.624 -46.178  1.00 62.44  ? 43  SER F CA  1 
ATOM   7374  C C   . SER F  1 43  ? -47.181  -22.476 -45.982  1.00 61.17  ? 43  SER F C   1 
ATOM   7375  O O   . SER F  1 43  ? -47.230  -23.606 -46.469  1.00 61.30  ? 43  SER F O   1 
ATOM   7376  C CB  . SER F  1 43  ? -45.193  -21.461 -44.870  1.00 62.61  ? 43  SER F CB  1 
ATOM   7377  O OG  . SER F  1 43  ? -44.726  -22.687 -44.428  1.00 62.61  ? 43  SER F OG  1 
ATOM   7378  N N   . ILE F  1 44  ? -48.202  -21.940 -45.290  1.00 60.39  ? 44  ILE F N   1 
ATOM   7379  C CA  . ILE F  1 44  ? -49.464  -22.634 -45.074  1.00 59.69  ? 44  ILE F CA  1 
ATOM   7380  C C   . ILE F  1 44  ? -50.100  -22.977 -46.420  1.00 60.11  ? 44  ILE F C   1 
ATOM   7381  O O   . ILE F  1 44  ? -50.489  -24.129 -46.642  1.00 60.23  ? 44  ILE F O   1 
ATOM   7382  C CB  . ILE F  1 44  ? -50.468  -21.781 -44.285  1.00 59.40  ? 44  ILE F CB  1 
ATOM   7383  C CG1 . ILE F  1 44  ? -49.907  -21.320 -42.942  1.00 59.46  ? 44  ILE F CG1 1 
ATOM   7384  C CG2 . ILE F  1 44  ? -51.795  -22.504 -44.062  1.00 59.19  ? 44  ILE F CG2 1 
ATOM   7385  C CD1 . ILE F  1 44  ? -49.678  -22.450 -41.982  1.00 59.27  ? 44  ILE F CD1 1 
ATOM   7386  N N   . VAL F  1 45  ? -50.194  -22.009 -47.323  1.00 60.75  ? 45  VAL F N   1 
ATOM   7387  C CA  . VAL F  1 45  ? -50.736  -22.289 -48.652  1.00 61.64  ? 45  VAL F CA  1 
ATOM   7388  C C   . VAL F  1 45  ? -50.000  -23.466 -49.300  1.00 62.29  ? 45  VAL F C   1 
ATOM   7389  O O   . VAL F  1 45  ? -50.634  -24.445 -49.724  1.00 62.74  ? 45  VAL F O   1 
ATOM   7390  C CB  . VAL F  1 45  ? -50.707  -21.046 -49.585  1.00 62.78  ? 45  VAL F CB  1 
ATOM   7391  C CG1 . VAL F  1 45  ? -50.988  -21.420 -51.037  1.00 64.22  ? 45  VAL F CG1 1 
ATOM   7392  C CG2 . VAL F  1 45  ? -51.705  -20.008 -49.102  1.00 62.66  ? 45  VAL F CG2 1 
ATOM   7393  N N   . SER F  1 46  ? -48.671  -23.370 -49.354  1.00 62.77  ? 46  SER F N   1 
ATOM   7394  C CA  . SER F  1 46  ? -47.852  -24.442 -49.905  1.00 63.82  ? 46  SER F CA  1 
ATOM   7395  C C   . SER F  1 46  ? -48.111  -25.797 -49.274  1.00 63.41  ? 46  SER F C   1 
ATOM   7396  O O   . SER F  1 46  ? -48.156  -26.824 -49.982  1.00 64.60  ? 46  SER F O   1 
ATOM   7397  C CB  . SER F  1 46  ? -46.387  -24.095 -49.776  1.00 64.61  ? 46  SER F CB  1 
ATOM   7398  O OG  . SER F  1 46  ? -46.077  -23.102 -50.754  1.00 65.95  ? 46  SER F OG  1 
ATOM   7399  N N   . GLN F  1 47  ? -48.290  -25.808 -47.949  1.00 62.16  ? 47  GLN F N   1 
ATOM   7400  C CA  . GLN F  1 47  ? -48.597  -27.059 -47.273  1.00 62.12  ? 47  GLN F CA  1 
ATOM   7401  C C   . GLN F  1 47  ? -49.916  -27.594 -47.744  1.00 62.45  ? 47  GLN F C   1 
ATOM   7402  O O   . GLN F  1 47  ? -50.004  -28.766 -48.002  1.00 63.54  ? 47  GLN F O   1 
ATOM   7403  C CB  . GLN F  1 47  ? -48.578  -26.885 -45.778  1.00 61.15  ? 47  GLN F CB  1 
ATOM   7404  C CG  . GLN F  1 47  ? -47.158  -26.901 -45.239  1.00 61.60  ? 47  GLN F CG  1 
ATOM   7405  C CD  . GLN F  1 47  ? -47.075  -26.378 -43.838  1.00 60.97  ? 47  GLN F CD  1 
ATOM   7406  O OE1 . GLN F  1 47  ? -47.377  -27.102 -42.881  1.00 61.01  ? 47  GLN F OE1 1 
ATOM   7407  N NE2 . GLN F  1 47  ? -46.697  -25.086 -43.697  1.00 60.78  ? 47  GLN F NE2 1 
ATOM   7408  N N   . LEU F  1 48  ? -50.918  -26.727 -47.919  1.00 61.97  ? 48  LEU F N   1 
ATOM   7409  C CA  . LEU F  1 48  ? -52.233  -27.147 -48.342  1.00 62.69  ? 48  LEU F CA  1 
ATOM   7410  C C   . LEU F  1 48  ? -52.171  -27.743 -49.718  1.00 64.38  ? 48  LEU F C   1 
ATOM   7411  O O   . LEU F  1 48  ? -52.681  -28.857 -49.930  1.00 65.65  ? 48  LEU F O   1 
ATOM   7412  C CB  . LEU F  1 48  ? -53.222  -25.992 -48.297  1.00 62.27  ? 48  LEU F CB  1 
ATOM   7413  C CG  . LEU F  1 48  ? -53.667  -25.529 -46.894  1.00 61.24  ? 48  LEU F CG  1 
ATOM   7414  C CD1 . LEU F  1 48  ? -54.373  -24.195 -46.993  1.00 61.21  ? 48  LEU F CD1 1 
ATOM   7415  C CD2 . LEU F  1 48  ? -54.538  -26.550 -46.195  1.00 61.78  ? 48  LEU F CD2 1 
ATOM   7416  N N   . LEU F  1 49  ? -51.520  -27.053 -50.656  1.00 64.85  ? 49  LEU F N   1 
ATOM   7417  C CA  . LEU F  1 49  ? -51.398  -27.565 -52.041  1.00 66.95  ? 49  LEU F CA  1 
ATOM   7418  C C   . LEU F  1 49  ? -50.691  -28.917 -52.099  1.00 68.13  ? 49  LEU F C   1 
ATOM   7419  O O   . LEU F  1 49  ? -51.088  -29.814 -52.849  1.00 70.10  ? 49  LEU F O   1 
ATOM   7420  C CB  . LEU F  1 49  ? -50.690  -26.574 -52.945  1.00 67.63  ? 49  LEU F CB  1 
ATOM   7421  C CG  . LEU F  1 49  ? -51.470  -25.308 -53.298  1.00 67.55  ? 49  LEU F CG  1 
ATOM   7422  C CD1 . LEU F  1 49  ? -50.635  -24.393 -54.181  1.00 68.74  ? 49  LEU F CD1 1 
ATOM   7423  C CD2 . LEU F  1 49  ? -52.810  -25.623 -53.930  1.00 68.86  ? 49  LEU F CD2 1 
ATOM   7424  N N   . PHE F  1 50  ? -49.648  -29.080 -51.296  1.00 67.32  ? 50  PHE F N   1 
ATOM   7425  C CA  . PHE F  1 50  ? -48.911  -30.318 -51.288  1.00 68.74  ? 50  PHE F CA  1 
ATOM   7426  C C   . PHE F  1 50  ? -49.786  -31.437 -50.786  1.00 69.26  ? 50  PHE F C   1 
ATOM   7427  O O   . PHE F  1 50  ? -49.821  -32.531 -51.392  1.00 71.53  ? 50  PHE F O   1 
ATOM   7428  C CB  . PHE F  1 50  ? -47.717  -30.179 -50.380  1.00 67.93  ? 50  PHE F CB  1 
ATOM   7429  C CG  . PHE F  1 50  ? -47.106  -31.483 -49.957  1.00 69.26  ? 50  PHE F CG  1 
ATOM   7430  C CD1 . PHE F  1 50  ? -46.297  -32.214 -50.841  1.00 71.76  ? 50  PHE F CD1 1 
ATOM   7431  C CD2 . PHE F  1 50  ? -47.320  -31.970 -48.671  1.00 68.45  ? 50  PHE F CD2 1 
ATOM   7432  C CE1 . PHE F  1 50  ? -45.734  -33.411 -50.462  1.00 73.41  ? 50  PHE F CE1 1 
ATOM   7433  C CE2 . PHE F  1 50  ? -46.756  -33.171 -48.283  1.00 70.09  ? 50  PHE F CE2 1 
ATOM   7434  C CZ  . PHE F  1 50  ? -45.967  -33.892 -49.184  1.00 72.57  ? 50  PHE F CZ  1 
ATOM   7435  N N   . LEU F  1 51  ? -50.488  -31.169 -49.681  1.00 67.60  ? 51  LEU F N   1 
ATOM   7436  C CA  . LEU F  1 51  ? -51.330  -32.180 -49.060  1.00 68.36  ? 51  LEU F CA  1 
ATOM   7437  C C   . LEU F  1 51  ? -52.431  -32.689 -50.018  1.00 70.35  ? 51  LEU F C   1 
ATOM   7438  O O   . LEU F  1 51  ? -52.784  -33.893 -50.035  1.00 72.43  ? 51  LEU F O   1 
ATOM   7439  C CB  . LEU F  1 51  ? -51.913  -31.670 -47.765  1.00 66.63  ? 51  LEU F CB  1 
ATOM   7440  C CG  . LEU F  1 51  ? -50.981  -31.693 -46.563  1.00 65.69  ? 51  LEU F CG  1 
ATOM   7441  C CD1 . LEU F  1 51  ? -51.784  -31.315 -45.319  1.00 64.68  ? 51  LEU F CD1 1 
ATOM   7442  C CD2 . LEU F  1 51  ? -50.276  -33.022 -46.364  1.00 67.42  ? 51  LEU F CD2 1 
ATOM   7443  N N   . GLN F  1 52  ? -52.942  -31.788 -50.842  1.00 70.17  ? 52  GLN F N   1 
ATOM   7444  C CA  . GLN F  1 52  ? -53.945  -32.167 -51.801  1.00 72.40  ? 52  GLN F CA  1 
ATOM   7445  C C   . GLN F  1 52  ? -53.355  -33.047 -52.873  1.00 75.00  ? 52  GLN F C   1 
ATOM   7446  O O   . GLN F  1 52  ? -53.929  -34.081 -53.207  1.00 77.55  ? 52  GLN F O   1 
ATOM   7447  C CB  . GLN F  1 52  ? -54.543  -30.942 -52.446  1.00 71.95  ? 52  GLN F CB  1 
ATOM   7448  C CG  . GLN F  1 52  ? -55.664  -31.296 -53.380  1.00 74.60  ? 52  GLN F CG  1 
ATOM   7449  C CD  . GLN F  1 52  ? -56.130  -30.114 -54.160  1.00 74.72  ? 52  GLN F CD  1 
ATOM   7450  O OE1 . GLN F  1 52  ? -55.307  -29.292 -54.628  1.00 73.97  ? 52  GLN F OE1 1 
ATOM   7451  N NE2 . GLN F  1 52  ? -57.442  -30.019 -54.342  1.00 76.14  ? 52  GLN F NE2 1 
ATOM   7452  N N   . ALA F  1 53  ? -52.212  -32.635 -53.415  1.00 74.80  ? 53  ALA F N   1 
ATOM   7453  C CA  . ALA F  1 53  ? -51.530  -33.398 -54.441  1.00 77.59  ? 53  ALA F CA  1 
ATOM   7454  C C   . ALA F  1 53  ? -51.218  -34.815 -53.944  1.00 79.16  ? 53  ALA F C   1 
ATOM   7455  O O   . ALA F  1 53  ? -51.108  -35.732 -54.756  1.00 82.33  ? 53  ALA F O   1 
ATOM   7456  C CB  . ALA F  1 53  ? -50.262  -32.686 -54.868  1.00 77.17  ? 53  ALA F CB  1 
ATOM   7457  N N   . GLN F  1 54  ? -51.093  -34.996 -52.623  1.00 77.37  ? 54  GLN F N   1 
ATOM   7458  C CA  . GLN F  1 54  ? -50.755  -36.303 -52.036  1.00 79.04  ? 54  GLN F CA  1 
ATOM   7459  C C   . GLN F  1 54  ? -51.959  -37.205 -52.016  1.00 81.17  ? 54  GLN F C   1 
ATOM   7460  O O   . GLN F  1 54  ? -51.864  -38.407 -52.308  1.00 84.35  ? 54  GLN F O   1 
ATOM   7461  C CB  . GLN F  1 54  ? -50.289  -36.135 -50.608  1.00 76.78  ? 54  GLN F CB  1 
ATOM   7462  C CG  . GLN F  1 54  ? -48.941  -35.462 -50.508  1.00 75.46  ? 54  GLN F CG  1 
ATOM   7463  C CD  . GLN F  1 54  ? -47.833  -36.468 -50.742  1.00 78.04  ? 54  GLN F CD  1 
ATOM   7464  O OE1 . GLN F  1 54  ? -47.474  -37.190 -49.799  1.00 78.56  ? 54  GLN F OE1 1 
ATOM   7465  N NE2 . GLN F  1 54  ? -47.277  -36.527 -51.975  1.00 80.06  ? 54  GLN F NE2 1 
ATOM   7466  N N   . ASP F  1 55  ? -53.107  -36.617 -51.685  1.00 79.86  ? 55  ASP F N   1 
ATOM   7467  C CA  . ASP F  1 55  ? -54.356  -37.358 -51.533  1.00 82.01  ? 55  ASP F CA  1 
ATOM   7468  C C   . ASP F  1 55  ? -55.454  -36.300 -51.473  1.00 80.43  ? 55  ASP F C   1 
ATOM   7469  O O   . ASP F  1 55  ? -55.487  -35.482 -50.553  1.00 77.62  ? 55  ASP F O   1 
ATOM   7470  C CB  . ASP F  1 55  ? -54.295  -38.183 -50.232  1.00 82.27  ? 55  ASP F CB  1 
ATOM   7471  C CG  . ASP F  1 55  ? -55.528  -39.042 -50.014  1.00 85.12  ? 55  ASP F CG  1 
ATOM   7472  O OD1 . ASP F  1 55  ? -56.670  -38.552 -50.211  1.00 85.24  ? 55  ASP F OD1 1 
ATOM   7473  O OD2 . ASP F  1 55  ? -55.354  -40.224 -49.633  1.00 87.67  ? 55  ASP F OD2 1 
ATOM   7474  N N   . SER F  1 56  ? -56.351  -36.285 -52.434  1.00 82.54  ? 56  SER F N   1 
ATOM   7475  C CA  . SER F  1 56  ? -57.362  -35.245 -52.417  1.00 81.42  ? 56  SER F CA  1 
ATOM   7476  C C   . SER F  1 56  ? -58.638  -35.609 -51.658  1.00 82.67  ? 56  SER F C   1 
ATOM   7477  O O   . SER F  1 56  ? -59.598  -34.838 -51.676  1.00 82.48  ? 56  SER F O   1 
ATOM   7478  C CB  . SER F  1 56  ? -57.702  -34.842 -53.836  1.00 83.20  ? 56  SER F CB  1 
ATOM   7479  O OG  . SER F  1 56  ? -57.920  -36.013 -54.613  1.00 87.17  ? 56  SER F OG  1 
ATOM   7480  N N   . GLU F  1 57  ? -58.653  -36.774 -51.003  1.00 84.37  ? 57  GLU F N   1 
ATOM   7481  C CA  . GLU F  1 57  ? -59.836  -37.258 -50.255  1.00 86.32  ? 57  GLU F CA  1 
ATOM   7482  C C   . GLU F  1 57  ? -59.644  -37.041 -48.754  1.00 83.99  ? 57  GLU F C   1 
ATOM   7483  O O   . GLU F  1 57  ? -60.455  -36.388 -48.101  1.00 83.25  ? 57  GLU F O   1 
ATOM   7484  C CB  . GLU F  1 57  ? -60.127  -38.763 -50.477  1.00 90.74  ? 57  GLU F CB  1 
ATOM   7485  C CG  . GLU F  1 57  ? -59.598  -39.372 -51.758  1.00 93.11  ? 57  GLU F CG  1 
ATOM   7486  C CD  . GLU F  1 57  ? -60.620  -39.321 -52.877  1.00 96.24  ? 57  GLU F CD  1 
ATOM   7487  O OE1 . GLU F  1 57  ? -60.690  -38.240 -53.536  1.00 94.57  ? 57  GLU F OE1 1 
ATOM   7488  O OE2 . GLU F  1 57  ? -61.339  -40.355 -53.090  1.00 100.69 ? 57  GLU F OE2 1 
ATOM   7489  N N   . LYS F  1 58  ? -58.571  -37.615 -48.212  1.00 83.30  ? 58  LYS F N   1 
ATOM   7490  C CA  . LYS F  1 58  ? -58.308  -37.581 -46.782  1.00 81.81  ? 58  LYS F CA  1 
ATOM   7491  C C   . LYS F  1 58  ? -58.215  -36.151 -46.282  1.00 78.20  ? 58  LYS F C   1 
ATOM   7492  O O   . LYS F  1 58  ? -57.463  -35.308 -46.810  1.00 75.85  ? 58  LYS F O   1 
ATOM   7493  C CB  . LYS F  1 58  ? -57.039  -38.348 -46.436  1.00 81.86  ? 58  LYS F CB  1 
ATOM   7494  C CG  . LYS F  1 58  ? -57.305  -39.809 -46.244  1.00 85.80  ? 58  LYS F CG  1 
ATOM   7495  C CD  . LYS F  1 58  ? -56.134  -40.556 -45.633  1.00 86.18  ? 58  LYS F CD  1 
ATOM   7496  C CE  . LYS F  1 58  ? -55.098  -40.903 -46.699  1.00 86.77  ? 58  LYS F CE  1 
ATOM   7497  N NZ  . LYS F  1 58  ? -54.272  -42.068 -46.272  1.00 89.19  ? 58  LYS F NZ  1 
ATOM   7498  N N   . ASP F  1 59  ? -58.988  -35.844 -45.264  1.00 78.12  ? 59  ASP F N   1 
ATOM   7499  C CA  . ASP F  1 59  ? -59.010  -34.467 -44.897  1.00 75.30  ? 59  ASP F CA  1 
ATOM   7500  C C   . ASP F  1 59  ? -57.805  -34.033 -44.080  1.00 72.70  ? 59  ASP F C   1 
ATOM   7501  O O   . ASP F  1 59  ? -56.955  -34.849 -43.769  1.00 73.15  ? 59  ASP F O   1 
ATOM   7502  C CB  . ASP F  1 59  ? -60.401  -33.998 -44.418  1.00 76.41  ? 59  ASP F CB  1 
ATOM   7503  C CG  . ASP F  1 59  ? -60.975  -34.811 -43.278  1.00 78.69  ? 59  ASP F CG  1 
ATOM   7504  O OD1 . ASP F  1 59  ? -60.175  -35.249 -42.440  1.00 78.17  ? 59  ASP F OD1 1 
ATOM   7505  O OD2 . ASP F  1 59  ? -62.214  -34.922 -43.181  1.00 81.17  ? 59  ASP F OD2 1 
ATOM   7506  N N   . ILE F  1 60  ? -57.720  -32.727 -43.830  1.00 70.37  ? 60  ILE F N   1 
ATOM   7507  C CA  . ILE F  1 60  ? -56.515  -32.046 -43.326  1.00 67.96  ? 60  ILE F CA  1 
ATOM   7508  C C   . ILE F  1 60  ? -56.799  -31.368 -42.008  1.00 67.29  ? 60  ILE F C   1 
ATOM   7509  O O   . ILE F  1 60  ? -57.883  -30.839 -41.807  1.00 67.82  ? 60  ILE F O   1 
ATOM   7510  C CB  . ILE F  1 60  ? -56.090  -30.953 -44.327  1.00 66.27  ? 60  ILE F CB  1 
ATOM   7511  C CG1 . ILE F  1 60  ? -55.525  -31.584 -45.581  1.00 67.05  ? 60  ILE F CG1 1 
ATOM   7512  C CG2 . ILE F  1 60  ? -55.047  -30.059 -43.703  1.00 64.23  ? 60  ILE F CG2 1 
ATOM   7513  C CD1 . ILE F  1 60  ? -55.471  -30.664 -46.742  1.00 66.42  ? 60  ILE F CD1 1 
ATOM   7514  N N   . TYR F  1 61  ? -55.826  -31.357 -41.121  1.00 66.48  ? 61  TYR F N   1 
ATOM   7515  C CA  . TYR F  1 61  ? -56.009  -30.755 -39.788  1.00 66.29  ? 61  TYR F CA  1 
ATOM   7516  C C   . TYR F  1 61  ? -55.151  -29.501 -39.611  1.00 64.27  ? 61  TYR F C   1 
ATOM   7517  O O   . TYR F  1 61  ? -53.924  -29.539 -39.706  1.00 63.47  ? 61  TYR F O   1 
ATOM   7518  C CB  . TYR F  1 61  ? -55.714  -31.768 -38.682  1.00 67.86  ? 61  TYR F CB  1 
ATOM   7519  C CG  . TYR F  1 61  ? -56.496  -33.047 -38.831  1.00 70.39  ? 61  TYR F CG  1 
ATOM   7520  C CD1 . TYR F  1 61  ? -56.011  -34.097 -39.632  1.00 71.27  ? 61  TYR F CD1 1 
ATOM   7521  C CD2 . TYR F  1 61  ? -57.736  -33.203 -38.207  1.00 72.40  ? 61  TYR F CD2 1 
ATOM   7522  C CE1 . TYR F  1 61  ? -56.730  -35.262 -39.806  1.00 74.06  ? 61  TYR F CE1 1 
ATOM   7523  C CE2 . TYR F  1 61  ? -58.461  -34.370 -38.378  1.00 75.22  ? 61  TYR F CE2 1 
ATOM   7524  C CZ  . TYR F  1 61  ? -57.943  -35.399 -39.180  1.00 76.04  ? 61  TYR F CZ  1 
ATOM   7525  O OH  . TYR F  1 61  ? -58.631  -36.576 -39.344  1.00 79.31  ? 61  TYR F OH  1 
ATOM   7526  N N   . LEU F  1 62  ? -55.821  -28.382 -39.375  1.00 63.88  ? 62  LEU F N   1 
ATOM   7527  C CA  . LEU F  1 62  ? -55.177  -27.073 -39.201  1.00 62.50  ? 62  LEU F CA  1 
ATOM   7528  C C   . LEU F  1 62  ? -55.395  -26.562 -37.764  1.00 63.24  ? 62  LEU F C   1 
ATOM   7529  O O   . LEU F  1 62  ? -56.471  -26.102 -37.399  1.00 64.18  ? 62  LEU F O   1 
ATOM   7530  C CB  . LEU F  1 62  ? -55.761  -26.074 -40.199  1.00 61.95  ? 62  LEU F CB  1 
ATOM   7531  C CG  . LEU F  1 62  ? -55.157  -24.680 -40.165  1.00 61.00  ? 62  LEU F CG  1 
ATOM   7532  C CD1 . LEU F  1 62  ? -53.649  -24.739 -40.440  1.00 60.09  ? 62  LEU F CD1 1 
ATOM   7533  C CD2 . LEU F  1 62  ? -55.895  -23.768 -41.136  1.00 61.05  ? 62  LEU F CD2 1 
ATOM   7534  N N   . TYR F  1 63  ? -54.362  -26.689 -36.948  1.00 63.25  ? 63  TYR F N   1 
ATOM   7535  C CA  . TYR F  1 63  ? -54.371  -26.184 -35.580  1.00 64.27  ? 63  TYR F CA  1 
ATOM   7536  C C   . TYR F  1 63  ? -54.030  -24.695 -35.617  1.00 63.55  ? 63  TYR F C   1 
ATOM   7537  O O   . TYR F  1 63  ? -53.117  -24.245 -36.350  1.00 62.35  ? 63  TYR F O   1 
ATOM   7538  C CB  . TYR F  1 63  ? -53.341  -26.927 -34.725  1.00 65.04  ? 63  TYR F CB  1 
ATOM   7539  C CG  . TYR F  1 63  ? -53.785  -28.304 -34.309  1.00 66.65  ? 63  TYR F CG  1 
ATOM   7540  C CD1 . TYR F  1 63  ? -53.535  -29.406 -35.105  1.00 66.55  ? 63  TYR F CD1 1 
ATOM   7541  C CD2 . TYR F  1 63  ? -54.459  -28.499 -33.119  1.00 68.74  ? 63  TYR F CD2 1 
ATOM   7542  C CE1 . TYR F  1 63  ? -53.941  -30.663 -34.736  1.00 68.49  ? 63  TYR F CE1 1 
ATOM   7543  C CE2 . TYR F  1 63  ? -54.875  -29.752 -32.742  1.00 70.69  ? 63  TYR F CE2 1 
ATOM   7544  C CZ  . TYR F  1 63  ? -54.617  -30.828 -33.548  1.00 70.56  ? 63  TYR F CZ  1 
ATOM   7545  O OH  . TYR F  1 63  ? -55.045  -32.059 -33.101  1.00 73.04  ? 63  TYR F OH  1 
ATOM   7546  N N   . ILE F  1 64  ? -54.767  -23.924 -34.842  1.00 60.86  ? 64  ILE F N   1 
ATOM   7547  C CA  . ILE F  1 64  ? -54.631  -22.497 -34.947  1.00 60.66  ? 64  ILE F CA  1 
ATOM   7548  C C   . ILE F  1 64  ? -54.433  -21.889 -33.586  1.00 60.71  ? 64  ILE F C   1 
ATOM   7549  O O   . ILE F  1 64  ? -55.286  -21.989 -32.734  1.00 60.96  ? 64  ILE F O   1 
ATOM   7550  C CB  . ILE F  1 64  ? -55.867  -21.834 -35.585  1.00 60.74  ? 64  ILE F CB  1 
ATOM   7551  C CG1 . ILE F  1 64  ? -56.115  -22.335 -37.011  1.00 60.93  ? 64  ILE F CG1 1 
ATOM   7552  C CG2 . ILE F  1 64  ? -55.682  -20.317 -35.583  1.00 60.56  ? 64  ILE F CG2 1 
ATOM   7553  C CD1 . ILE F  1 64  ? -57.451  -21.880 -37.568  1.00 61.26  ? 64  ILE F CD1 1 
ATOM   7554  N N   . ASN F  1 65  ? -53.278  -21.276 -33.391  1.00 60.68  ? 65  ASN F N   1 
ATOM   7555  C CA  . ASN F  1 65  ? -52.997  -20.459 -32.227  1.00 60.94  ? 65  ASN F CA  1 
ATOM   7556  C C   . ASN F  1 65  ? -52.322  -19.190 -32.720  1.00 60.91  ? 65  ASN F C   1 
ATOM   7557  O O   . ASN F  1 65  ? -51.104  -19.144 -32.903  1.00 61.06  ? 65  ASN F O   1 
ATOM   7558  C CB  . ASN F  1 65  ? -52.111  -21.214 -31.247  1.00 61.29  ? 65  ASN F CB  1 
ATOM   7559  C CG  . ASN F  1 65  ? -51.730  -20.377 -30.067  1.00 61.82  ? 65  ASN F CG  1 
ATOM   7560  O OD1 . ASN F  1 65  ? -52.450  -19.478 -29.696  1.00 61.97  ? 65  ASN F OD1 1 
ATOM   7561  N ND2 . ASN F  1 65  ? -50.592  -20.666 -29.471  1.00 62.27  ? 65  ASN F ND2 1 
ATOM   7562  N N   . SER F  1 66  ? -53.118  -18.163 -32.962  1.00 60.83  ? 66  SER F N   1 
ATOM   7563  C CA  . SER F  1 66  ? -52.631  -17.012 -33.700  1.00 60.77  ? 66  SER F CA  1 
ATOM   7564  C C   . SER F  1 66  ? -53.274  -15.704 -33.272  1.00 60.96  ? 66  SER F C   1 
ATOM   7565  O O   . SER F  1 66  ? -54.488  -15.632 -33.123  1.00 60.97  ? 66  SER F O   1 
ATOM   7566  C CB  . SER F  1 66  ? -52.869  -17.214 -35.206  1.00 60.45  ? 66  SER F CB  1 
ATOM   7567  O OG  . SER F  1 66  ? -52.668  -16.017 -35.923  1.00 60.44  ? 66  SER F OG  1 
ATOM   7568  N N   . PRO F  1 67  ? -52.477  -14.640 -33.142  1.00 61.24  ? 67  PRO F N   1 
ATOM   7569  C CA  . PRO F  1 67  ? -53.050  -13.337 -32.818  1.00 61.51  ? 67  PRO F CA  1 
ATOM   7570  C C   . PRO F  1 67  ? -53.610  -12.587 -34.028  1.00 61.18  ? 67  PRO F C   1 
ATOM   7571  O O   . PRO F  1 67  ? -54.164  -11.481 -33.881  1.00 61.41  ? 67  PRO F O   1 
ATOM   7572  C CB  . PRO F  1 67  ? -51.876  -12.587 -32.212  1.00 62.12  ? 67  PRO F CB  1 
ATOM   7573  C CG  . PRO F  1 67  ? -50.719  -13.171 -32.887  1.00 62.01  ? 67  PRO F CG  1 
ATOM   7574  C CD  . PRO F  1 67  ? -51.013  -14.601 -33.162  1.00 61.54  ? 67  PRO F CD  1 
ATOM   7575  N N   . GLY F  1 68  ? -53.481  -13.165 -35.212  1.00 60.78  ? 68  GLY F N   1 
ATOM   7576  C CA  . GLY F  1 68  ? -54.007  -12.530 -36.411  1.00 60.60  ? 68  GLY F CA  1 
ATOM   7577  C C   . GLY F  1 68  ? -52.854  -12.002 -37.244  1.00 60.68  ? 68  GLY F C   1 
ATOM   7578  O O   . GLY F  1 68  ? -51.746  -12.564 -37.224  1.00 60.80  ? 68  GLY F O   1 
ATOM   7579  N N   . GLY F  1 69  ? -53.106  -10.928 -37.996  1.00 60.73  ? 69  GLY F N   1 
ATOM   7580  C CA  . GLY F  1 69  ? -52.085  -10.361 -38.871  1.00 60.94  ? 69  GLY F CA  1 
ATOM   7581  C C   . GLY F  1 69  ? -52.688  -9.813  -40.129  1.00 60.91  ? 69  GLY F C   1 
ATOM   7582  O O   . GLY F  1 69  ? -53.786  -9.296  -40.109  1.00 60.83  ? 69  GLY F O   1 
ATOM   7583  N N   . SER F  1 70  ? -51.967  -9.941  -41.230  1.00 61.12  ? 70  SER F N   1 
ATOM   7584  C CA  . SER F  1 70  ? -52.346  -9.352  -42.501  1.00 61.30  ? 70  SER F CA  1 
ATOM   7585  C C   . SER F  1 70  ? -53.635  -9.912  -43.098  1.00 61.19  ? 70  SER F C   1 
ATOM   7586  O O   . SER F  1 70  ? -53.797  -11.113 -43.298  1.00 61.17  ? 70  SER F O   1 
ATOM   7587  C CB  . SER F  1 70  ? -51.199  -9.498  -43.474  1.00 61.78  ? 70  SER F CB  1 
ATOM   7588  O OG  . SER F  1 70  ? -51.642  -9.345  -44.789  1.00 62.07  ? 70  SER F OG  1 
ATOM   7589  N N   . VAL F  1 71  ? -54.579  -9.027  -43.382  1.00 61.25  ? 71  VAL F N   1 
ATOM   7590  C CA  . VAL F  1 71  ? -55.850  -9.437  -43.962  1.00 61.40  ? 71  VAL F CA  1 
ATOM   7591  C C   . VAL F  1 71  ? -55.676  -10.070 -45.328  1.00 61.86  ? 71  VAL F C   1 
ATOM   7592  O O   . VAL F  1 71  ? -56.298  -11.097 -45.637  1.00 62.07  ? 71  VAL F O   1 
ATOM   7593  C CB  . VAL F  1 71  ? -56.795  -8.259  -44.077  1.00 61.57  ? 71  VAL F CB  1 
ATOM   7594  C CG1 . VAL F  1 71  ? -58.009  -8.616  -44.916  1.00 62.03  ? 71  VAL F CG1 1 
ATOM   7595  C CG2 . VAL F  1 71  ? -57.170  -7.813  -42.669  1.00 61.34  ? 71  VAL F CG2 1 
ATOM   7596  N N   . THR F  1 72  ? -54.819  -9.506  -46.162  1.00 62.19  ? 72  THR F N   1 
ATOM   7597  C CA  . THR F  1 72  ? -54.625  -10.185 -47.441  1.00 62.84  ? 72  THR F CA  1 
ATOM   7598  C C   . THR F  1 72  ? -53.901  -11.543 -47.272  1.00 62.85  ? 72  THR F C   1 
ATOM   7599  O O   . THR F  1 72  ? -54.254  -12.533 -47.924  1.00 63.31  ? 72  THR F O   1 
ATOM   7600  C CB  . THR F  1 72  ? -53.954  -9.327  -48.518  1.00 63.44  ? 72  THR F CB  1 
ATOM   7601  O OG1 . THR F  1 72  ? -52.669  -8.962  -48.057  1.00 63.33  ? 72  THR F OG1 1 
ATOM   7602  C CG2 . THR F  1 72  ? -54.755  -8.111  -48.831  1.00 63.55  ? 72  THR F CG2 1 
ATOM   7603  N N   . ALA F  1 73  ? -52.923  -11.609 -46.375  1.00 62.47  ? 73  ALA F N   1 
ATOM   7604  C CA  . ALA F  1 73  ? -52.276  -12.886 -46.159  1.00 62.52  ? 73  ALA F CA  1 
ATOM   7605  C C   . ALA F  1 73  ? -53.273  -13.928 -45.637  1.00 62.22  ? 73  ALA F C   1 
ATOM   7606  O O   . ALA F  1 73  ? -53.203  -15.112 -45.965  1.00 62.53  ? 73  ALA F O   1 
ATOM   7607  C CB  . ALA F  1 73  ? -51.117  -12.748 -45.206  1.00 62.30  ? 73  ALA F CB  1 
ATOM   7608  N N   . GLY F  1 74  ? -54.193  -13.488 -44.803  1.00 61.75  ? 74  GLY F N   1 
ATOM   7609  C CA  . GLY F  1 74  ? -55.230  -14.347 -44.344  1.00 61.66  ? 74  GLY F CA  1 
ATOM   7610  C C   . GLY F  1 74  ? -56.108  -14.810 -45.485  1.00 62.34  ? 74  GLY F C   1 
ATOM   7611  O O   . GLY F  1 74  ? -56.504  -15.985 -45.538  1.00 62.63  ? 74  GLY F O   1 
ATOM   7612  N N   . PHE F  1 75  ? -56.420  -13.922 -46.425  1.00 62.76  ? 75  PHE F N   1 
ATOM   7613  C CA  . PHE F  1 75  ? -57.275  -14.362 -47.504  1.00 63.65  ? 75  PHE F CA  1 
ATOM   7614  C C   . PHE F  1 75  ? -56.581  -15.382 -48.404  1.00 64.33  ? 75  PHE F C   1 
ATOM   7615  O O   . PHE F  1 75  ? -57.239  -16.225 -49.031  1.00 65.15  ? 75  PHE F O   1 
ATOM   7616  C CB  . PHE F  1 75  ? -57.832  -13.194 -48.294  1.00 64.08  ? 75  PHE F CB  1 
ATOM   7617  C CG  . PHE F  1 75  ? -59.096  -12.646 -47.718  1.00 64.00  ? 75  PHE F CG  1 
ATOM   7618  C CD1 . PHE F  1 75  ? -59.168  -11.340 -47.256  1.00 63.56  ? 75  PHE F CD1 1 
ATOM   7619  C CD2 . PHE F  1 75  ? -60.215  -13.454 -47.627  1.00 64.53  ? 75  PHE F CD2 1 
ATOM   7620  C CE1 . PHE F  1 75  ? -60.342  -10.848 -46.712  1.00 63.65  ? 75  PHE F CE1 1 
ATOM   7621  C CE2 . PHE F  1 75  ? -61.399  -12.975 -47.070  1.00 64.66  ? 75  PHE F CE2 1 
ATOM   7622  C CZ  . PHE F  1 75  ? -61.465  -11.659 -46.620  1.00 64.23  ? 75  PHE F CZ  1 
ATOM   7623  N N   . ALA F  1 76  ? -55.252  -15.333 -48.474  1.00 64.18  ? 76  ALA F N   1 
ATOM   7624  C CA  . ALA F  1 76  ? -54.578  -16.255 -49.346  1.00 65.01  ? 76  ALA F CA  1 
ATOM   7625  C C   . ALA F  1 76  ? -54.840  -17.605 -48.752  1.00 64.91  ? 76  ALA F C   1 
ATOM   7626  O O   . ALA F  1 76  ? -55.125  -18.561 -49.484  1.00 65.83  ? 76  ALA F O   1 
ATOM   7627  C CB  . ALA F  1 76  ? -53.099  -15.971 -49.437  1.00 65.03  ? 76  ALA F CB  1 
ATOM   7628  N N   . ILE F  1 77  ? -54.766  -17.694 -47.428  1.00 63.94  ? 77  ILE F N   1 
ATOM   7629  C CA  . ILE F  1 77  ? -55.017  -18.960 -46.732  1.00 63.81  ? 77  ILE F CA  1 
ATOM   7630  C C   . ILE F  1 77  ? -56.482  -19.334 -46.902  1.00 64.28  ? 77  ILE F C   1 
ATOM   7631  O O   . ILE F  1 77  ? -56.794  -20.442 -47.331  1.00 65.02  ? 77  ILE F O   1 
ATOM   7632  C CB  . ILE F  1 77  ? -54.639  -18.925 -45.244  1.00 62.83  ? 77  ILE F CB  1 
ATOM   7633  C CG1 . ILE F  1 77  ? -53.154  -18.703 -45.097  1.00 62.67  ? 77  ILE F CG1 1 
ATOM   7634  C CG2 . ILE F  1 77  ? -54.973  -20.234 -44.596  1.00 62.81  ? 77  ILE F CG2 1 
ATOM   7635  C CD1 . ILE F  1 77  ? -52.673  -18.571 -43.690  1.00 61.95  ? 77  ILE F CD1 1 
ATOM   7636  N N   . TYR F  1 78  ? -57.380  -18.404 -46.597  1.00 64.03  ? 78  TYR F N   1 
ATOM   7637  C CA  . TYR F  1 78  ? -58.814  -18.657 -46.712  1.00 64.65  ? 78  TYR F CA  1 
ATOM   7638  C C   . TYR F  1 78  ? -59.178  -19.218 -48.098  1.00 66.00  ? 78  TYR F C   1 
ATOM   7639  O O   . TYR F  1 78  ? -59.743  -20.284 -48.210  1.00 66.74  ? 78  TYR F O   1 
ATOM   7640  C CB  . TYR F  1 78  ? -59.617  -17.390 -46.387  1.00 64.41  ? 78  TYR F CB  1 
ATOM   7641  C CG  . TYR F  1 78  ? -61.088  -17.565 -46.599  1.00 65.31  ? 78  TYR F CG  1 
ATOM   7642  C CD1 . TYR F  1 78  ? -61.919  -17.906 -45.538  1.00 65.23  ? 78  TYR F CD1 1 
ATOM   7643  C CD2 . TYR F  1 78  ? -61.658  -17.422 -47.876  1.00 66.48  ? 78  TYR F CD2 1 
ATOM   7644  C CE1 . TYR F  1 78  ? -63.273  -18.066 -45.719  1.00 66.29  ? 78  TYR F CE1 1 
ATOM   7645  C CE2 . TYR F  1 78  ? -63.016  -17.583 -48.065  1.00 67.55  ? 78  TYR F CE2 1 
ATOM   7646  C CZ  . TYR F  1 78  ? -63.822  -17.911 -46.989  1.00 67.46  ? 78  TYR F CZ  1 
ATOM   7647  O OH  . TYR F  1 78  ? -65.176  -18.116 -47.185  1.00 68.77  ? 78  TYR F OH  1 
ATOM   7648  N N   . ASP F  1 79  ? -58.819  -18.504 -49.147  1.00 66.46  ? 79  ASP F N   1 
ATOM   7649  C CA  . ASP F  1 79  ? -59.191  -18.908 -50.471  1.00 67.94  ? 79  ASP F CA  1 
ATOM   7650  C C   . ASP F  1 79  ? -58.586  -20.255 -50.833  1.00 68.60  ? 79  ASP F C   1 
ATOM   7651  O O   . ASP F  1 79  ? -59.212  -21.042 -51.524  1.00 69.93  ? 79  ASP F O   1 
ATOM   7652  C CB  . ASP F  1 79  ? -58.839  -17.846 -51.505  1.00 68.38  ? 79  ASP F CB  1 
ATOM   7653  C CG  . ASP F  1 79  ? -59.927  -16.759 -51.655  1.00 68.58  ? 79  ASP F CG  1 
ATOM   7654  O OD1 . ASP F  1 79  ? -59.749  -15.825 -52.477  1.00 68.98  ? 79  ASP F OD1 1 
ATOM   7655  O OD2 . ASP F  1 79  ? -60.958  -16.814 -50.944  1.00 68.43  ? 79  ASP F OD2 1 
ATOM   7656  N N   . THR F  1 80  ? -57.391  -20.553 -50.358  1.00 67.84  ? 80  THR F N   1 
ATOM   7657  C CA  . THR F  1 80  ? -56.768  -21.837 -50.683  1.00 68.54  ? 80  THR F CA  1 
ATOM   7658  C C   . THR F  1 80  ? -57.510  -22.967 -49.986  1.00 68.59  ? 80  THR F C   1 
ATOM   7659  O O   . THR F  1 80  ? -57.748  -24.017 -50.594  1.00 69.82  ? 80  THR F O   1 
ATOM   7660  C CB  . THR F  1 80  ? -55.290  -21.866 -50.308  1.00 67.85  ? 80  THR F CB  1 
ATOM   7661  O OG1 . THR F  1 80  ? -54.647  -20.820 -50.993  1.00 68.01  ? 80  THR F OG1 1 
ATOM   7662  C CG2 . THR F  1 80  ? -54.649  -23.159 -50.719  1.00 68.75  ? 80  THR F CG2 1 
ATOM   7663  N N   . ILE F  1 81  ? -57.876  -22.765 -48.720  1.00 67.43  ? 81  ILE F N   1 
ATOM   7664  C CA  . ILE F  1 81  ? -58.754  -23.726 -48.018  1.00 67.60  ? 81  ILE F CA  1 
ATOM   7665  C C   . ILE F  1 81  ? -60.041  -24.039 -48.825  1.00 69.11  ? 81  ILE F C   1 
ATOM   7666  O O   . ILE F  1 81  ? -60.353  -25.195 -49.047  1.00 70.11  ? 81  ILE F O   1 
ATOM   7667  C CB  . ILE F  1 81  ? -59.129  -23.272 -46.588  1.00 66.39  ? 81  ILE F CB  1 
ATOM   7668  C CG1 . ILE F  1 81  ? -57.884  -23.286 -45.685  1.00 65.21  ? 81  ILE F CG1 1 
ATOM   7669  C CG2 . ILE F  1 81  ? -60.216  -24.174 -46.047  1.00 66.92  ? 81  ILE F CG2 1 
ATOM   7670  C CD1 . ILE F  1 81  ? -58.047  -22.580 -44.366  1.00 64.14  ? 81  ILE F CD1 1 
ATOM   7671  N N   . GLN F  1 82  ? -60.742  -23.011 -49.296  1.00 69.44  ? 82  GLN F N   1 
ATOM   7672  C CA  . GLN F  1 82  ? -61.964  -23.209 -50.035  1.00 71.03  ? 82  GLN F CA  1 
ATOM   7673  C C   . GLN F  1 82  ? -61.702  -23.849 -51.376  1.00 72.63  ? 82  GLN F C   1 
ATOM   7674  O O   . GLN F  1 82  ? -62.560  -24.537 -51.917  1.00 74.26  ? 82  GLN F O   1 
ATOM   7675  C CB  . GLN F  1 82  ? -62.740  -21.909 -50.218  1.00 71.08  ? 82  GLN F CB  1 
ATOM   7676  C CG  . GLN F  1 82  ? -63.064  -21.136 -48.946  1.00 69.75  ? 82  GLN F CG  1 
ATOM   7677  C CD  . GLN F  1 82  ? -63.250  -22.000 -47.685  1.00 69.20  ? 82  GLN F CD  1 
ATOM   7678  O OE1 . GLN F  1 82  ? -62.853  -21.592 -46.582  1.00 67.87  ? 82  GLN F OE1 1 
ATOM   7679  N NE2 . GLN F  1 82  ? -63.829  -23.191 -47.833  1.00 70.36  ? 82  GLN F NE2 1 
ATOM   7680  N N   . HIS F  1 83  ? -60.515  -23.636 -51.925  1.00 72.39  ? 83  HIS F N   1 
ATOM   7681  C CA  . HIS F  1 83  ? -60.243  -24.071 -53.303  1.00 74.13  ? 83  HIS F CA  1 
ATOM   7682  C C   . HIS F  1 83  ? -59.864  -25.510 -53.423  1.00 74.97  ? 83  HIS F C   1 
ATOM   7683  O O   . HIS F  1 83  ? -60.106  -26.111 -54.447  1.00 76.86  ? 83  HIS F O   1 
ATOM   7684  C CB  . HIS F  1 83  ? -59.178  -23.200 -53.929  1.00 73.85  ? 83  HIS F CB  1 
ATOM   7685  C CG  . HIS F  1 83  ? -58.810  -23.592 -55.325  1.00 75.75  ? 83  HIS F CG  1 
ATOM   7686  N ND1 . HIS F  1 83  ? -57.687  -24.273 -55.611  1.00 76.10  ? 83  HIS F ND1 1 
ATOM   7687  C CD2 . HIS F  1 83  ? -59.455  -23.369 -56.538  1.00 77.62  ? 83  HIS F CD2 1 
ATOM   7688  C CE1 . HIS F  1 83  ? -57.610  -24.494 -56.935  1.00 78.13  ? 83  HIS F CE1 1 
ATOM   7689  N NE2 . HIS F  1 83  ? -58.700  -23.950 -57.503  1.00 79.08  ? 83  HIS F NE2 1 
ATOM   7690  N N   . ILE F  1 84  ? -59.267  -26.085 -52.386  1.00 73.72  ? 84  ILE F N   1 
ATOM   7691  C CA  . ILE F  1 84  ? -58.811  -27.462 -52.467  1.00 74.48  ? 84  ILE F CA  1 
ATOM   7692  C C   . ILE F  1 84  ? -59.918  -28.443 -52.147  1.00 75.34  ? 84  ILE F C   1 
ATOM   7693  O O   . ILE F  1 84  ? -60.873  -28.093 -51.513  1.00 74.90  ? 84  ILE F O   1 
ATOM   7694  C CB  . ILE F  1 84  ? -57.577  -27.724 -51.597  1.00 73.03  ? 84  ILE F CB  1 
ATOM   7695  C CG1 . ILE F  1 84  ? -57.838  -27.408 -50.125  1.00 71.25  ? 84  ILE F CG1 1 
ATOM   7696  C CG2 . ILE F  1 84  ? -56.394  -26.950 -52.147  1.00 72.79  ? 84  ILE F CG2 1 
ATOM   7697  C CD1 . ILE F  1 84  ? -56.849  -28.072 -49.181  1.00 70.26  ? 84  ILE F CD1 1 
ATOM   7698  N N   . LYS F  1 85  ? -59.784  -29.682 -52.595  1.00 76.72  ? 85  LYS F N   1 
ATOM   7699  C CA  . LYS F  1 85  ? -60.814  -30.723 -52.416  1.00 77.92  ? 85  LYS F CA  1 
ATOM   7700  C C   . LYS F  1 85  ? -60.951  -31.232 -50.985  1.00 76.56  ? 85  LYS F C   1 
ATOM   7701  O O   . LYS F  1 85  ? -62.054  -31.240 -50.458  1.00 76.73  ? 85  LYS F O   1 
ATOM   7702  C CB  . LYS F  1 85  ? -60.609  -31.902 -53.378  1.00 80.03  ? 85  LYS F CB  1 
ATOM   7703  C CG  . LYS F  1 85  ? -60.718  -31.502 -54.848  1.00 81.92  ? 85  LYS F CG  1 
ATOM   7704  C CD  . LYS F  1 85  ? -60.482  -32.707 -55.754  1.00 84.21  ? 85  LYS F CD  1 
ATOM   7705  C CE  . LYS F  1 85  ? -61.368  -32.635 -56.992  1.00 86.80  ? 85  LYS F CE  1 
ATOM   7706  N NZ  . LYS F  1 85  ? -62.101  -33.913 -57.274  1.00 89.06  ? 85  LYS F NZ  1 
ATOM   7707  N N   . PRO F  1 86  ? -59.842  -31.627 -50.336  1.00 75.35  ? 86  PRO F N   1 
ATOM   7708  C CA  . PRO F  1 86  ? -59.997  -32.114 -48.965  1.00 74.20  ? 86  PRO F CA  1 
ATOM   7709  C C   . PRO F  1 86  ? -60.665  -31.132 -47.981  1.00 72.88  ? 86  PRO F C   1 
ATOM   7710  O O   . PRO F  1 86  ? -60.473  -29.932 -48.067  1.00 72.04  ? 86  PRO F O   1 
ATOM   7711  C CB  . PRO F  1 86  ? -58.542  -32.375 -48.503  1.00 73.05  ? 86  PRO F CB  1 
ATOM   7712  C CG  . PRO F  1 86  ? -57.731  -32.446 -49.746  1.00 74.11  ? 86  PRO F CG  1 
ATOM   7713  C CD  . PRO F  1 86  ? -58.417  -31.530 -50.717  1.00 74.94  ? 86  PRO F CD  1 
ATOM   7714  N N   . ASP F  1 87  ? -61.444  -31.657 -47.050  1.00 72.84  ? 87  ASP F N   1 
ATOM   7715  C CA  . ASP F  1 87  ? -61.984  -30.878 -45.986  1.00 71.72  ? 87  ASP F CA  1 
ATOM   7716  C C   . ASP F  1 87  ? -60.813  -30.470 -45.114  1.00 69.88  ? 87  ASP F C   1 
ATOM   7717  O O   . ASP F  1 87  ? -59.880  -31.274 -44.889  1.00 69.60  ? 87  ASP F O   1 
ATOM   7718  C CB  . ASP F  1 87  ? -62.949  -31.736 -45.176  1.00 72.34  ? 87  ASP F CB  1 
ATOM   7719  C CG  . ASP F  1 87  ? -64.322  -31.808 -45.789  1.00 74.15  ? 87  ASP F CG  1 
ATOM   7720  O OD1 . ASP F  1 87  ? -65.186  -32.507 -45.202  1.00 74.96  ? 87  ASP F OD1 1 
ATOM   7721  O OD2 . ASP F  1 87  ? -64.552  -31.150 -46.837  1.00 74.89  ? 87  ASP F OD2 1 
ATOM   7722  N N   . VAL F  1 88  ? -60.841  -29.224 -44.624  1.00 68.78  ? 88  VAL F N   1 
ATOM   7723  C CA  . VAL F  1 88  ? -59.824  -28.772 -43.690  1.00 67.23  ? 88  VAL F CA  1 
ATOM   7724  C C   . VAL F  1 88  ? -60.485  -28.562 -42.343  1.00 66.65  ? 88  VAL F C   1 
ATOM   7725  O O   . VAL F  1 88  ? -61.320  -27.672 -42.174  1.00 66.65  ? 88  VAL F O   1 
ATOM   7726  C CB  . VAL F  1 88  ? -59.164  -27.502 -44.185  1.00 66.58  ? 88  VAL F CB  1 
ATOM   7727  C CG1 . VAL F  1 88  ? -58.193  -27.016 -43.165  1.00 65.23  ? 88  VAL F CG1 1 
ATOM   7728  C CG2 . VAL F  1 88  ? -58.427  -27.774 -45.474  1.00 67.32  ? 88  VAL F CG2 1 
ATOM   7729  N N   . GLN F  1 89  ? -60.159  -29.419 -41.385  1.00 66.32  ? 89  GLN F N   1 
ATOM   7730  C CA  . GLN F  1 89  ? -60.622  -29.212 -40.017  1.00 65.82  ? 89  GLN F CA  1 
ATOM   7731  C C   . GLN F  1 89  ? -59.823  -28.093 -39.385  1.00 64.59  ? 89  GLN F C   1 
ATOM   7732  O O   . GLN F  1 89  ? -58.592  -28.041 -39.541  1.00 64.01  ? 89  GLN F O   1 
ATOM   7733  C CB  . GLN F  1 89  ? -60.426  -30.469 -39.203  1.00 65.93  ? 89  GLN F CB  1 
ATOM   7734  C CG  . GLN F  1 89  ? -60.967  -31.689 -39.905  1.00 67.22  ? 89  GLN F CG  1 
ATOM   7735  C CD  . GLN F  1 89  ? -61.459  -32.818 -38.980  1.00 67.73  ? 89  GLN F CD  1 
ATOM   7736  O OE1 . GLN F  1 89  ? -61.584  -32.659 -37.753  1.00 67.22  ? 89  GLN F OE1 1 
ATOM   7737  N NE2 . GLN F  1 89  ? -61.734  -33.976 -39.576  1.00 68.89  ? 89  GLN F NE2 1 
ATOM   7738  N N   . THR F  1 90  ? -60.479  -27.192 -38.676  1.00 64.36  ? 90  THR F N   1 
ATOM   7739  C CA  . THR F  1 90  ? -59.728  -26.190 -37.949  1.00 63.38  ? 90  THR F CA  1 
ATOM   7740  C C   . THR F  1 90  ? -59.916  -26.451 -36.460  1.00 63.26  ? 90  THR F C   1 
ATOM   7741  O O   . THR F  1 90  ? -61.036  -26.696 -36.008  1.00 63.92  ? 90  THR F O   1 
ATOM   7742  C CB  . THR F  1 90  ? -60.163  -24.761 -38.323  1.00 63.25  ? 90  THR F CB  1 
ATOM   7743  O OG1 . THR F  1 90  ? -61.573  -24.655 -38.171  1.00 64.02  ? 90  THR F OG1 1 
ATOM   7744  C CG2 . THR F  1 90  ? -59.826  -24.441 -39.732  1.00 63.38  ? 90  THR F CG2 1 
ATOM   7745  N N   . ILE F  1 91  ? -58.824  -26.417 -35.702  1.00 62.61  ? 91  ILE F N   1 
ATOM   7746  C CA  . ILE F  1 91  ? -58.844  -26.629 -34.239  1.00 62.59  ? 91  ILE F CA  1 
ATOM   7747  C C   . ILE F  1 91  ? -58.139  -25.460 -33.535  1.00 62.05  ? 91  ILE F C   1 
ATOM   7748  O O   . ILE F  1 91  ? -56.946  -25.255 -33.680  1.00 61.59  ? 91  ILE F O   1 
ATOM   7749  C CB  . ILE F  1 91  ? -58.144  -27.963 -33.879  1.00 62.64  ? 91  ILE F CB  1 
ATOM   7750  C CG1 . ILE F  1 91  ? -58.722  -29.107 -34.713  1.00 63.28  ? 91  ILE F CG1 1 
ATOM   7751  C CG2 . ILE F  1 91  ? -58.224  -28.254 -32.400  1.00 62.80  ? 91  ILE F CG2 1 
ATOM   7752  C CD1 . ILE F  1 91  ? -57.676  -29.987 -35.361  1.00 63.20  ? 91  ILE F CD1 1 
ATOM   7753  N N   . CYS F  1 92  ? -58.883  -24.700 -32.764  1.00 62.30  ? 92  CYS F N   1 
ATOM   7754  C CA  . CYS F  1 92  ? -58.286  -23.629 -32.018  1.00 62.02  ? 92  CYS F CA  1 
ATOM   7755  C C   . CYS F  1 92  ? -57.660  -24.046 -30.697  1.00 62.17  ? 92  CYS F C   1 
ATOM   7756  O O   . CYS F  1 92  ? -58.348  -24.510 -29.817  1.00 62.74  ? 92  CYS F O   1 
ATOM   7757  C CB  . CYS F  1 92  ? -59.313  -22.557 -31.753  1.00 62.39  ? 92  CYS F CB  1 
ATOM   7758  S SG  . CYS F  1 92  ? -58.531  -21.274 -30.770  1.00 62.28  ? 92  CYS F SG  1 
ATOM   7759  N N   . ILE F  1 93  ? -56.352  -23.885 -30.557  1.00 61.83  ? 93  ILE F N   1 
ATOM   7760  C CA  . ILE F  1 93  ? -55.674  -24.077 -29.257  1.00 62.15  ? 93  ILE F CA  1 
ATOM   7761  C C   . ILE F  1 93  ? -55.088  -22.739 -28.794  1.00 62.23  ? 93  ILE F C   1 
ATOM   7762  O O   . ILE F  1 93  ? -54.576  -21.978 -29.609  1.00 61.83  ? 93  ILE F O   1 
ATOM   7763  C CB  . ILE F  1 93  ? -54.571  -25.131 -29.300  1.00 62.02  ? 93  ILE F CB  1 
ATOM   7764  C CG1 . ILE F  1 93  ? -53.518  -24.741 -30.312  1.00 61.58  ? 93  ILE F CG1 1 
ATOM   7765  C CG2 . ILE F  1 93  ? -55.185  -26.442 -29.703  1.00 62.09  ? 93  ILE F CG2 1 
ATOM   7766  C CD1 . ILE F  1 93  ? -52.354  -25.676 -30.433  1.00 61.62  ? 93  ILE F CD1 1 
ATOM   7767  N N   . GLY F  1 94  ? -55.179  -22.436 -27.500  1.00 62.89  ? 94  GLY F N   1 
ATOM   7768  C CA  . GLY F  1 94  ? -54.695  -21.167 -27.009  1.00 63.20  ? 94  GLY F CA  1 
ATOM   7769  C C   . GLY F  1 94  ? -55.546  -19.948 -27.321  1.00 63.22  ? 94  GLY F C   1 
ATOM   7770  O O   . GLY F  1 94  ? -56.373  -19.538 -26.506  1.00 63.92  ? 94  GLY F O   1 
ATOM   7771  N N   . MET F  1 95  ? -55.316  -19.334 -28.481  1.00 62.60  ? 95  MET F N   1 
ATOM   7772  C CA  . MET F  1 95  ? -56.028  -18.112 -28.883  1.00 62.60  ? 95  MET F CA  1 
ATOM   7773  C C   . MET F  1 95  ? -56.120  -18.041 -30.393  1.00 61.89  ? 95  MET F C   1 
ATOM   7774  O O   . MET F  1 95  ? -55.158  -18.312 -31.087  1.00 61.46  ? 95  MET F O   1 
ATOM   7775  C CB  . MET F  1 95  ? -55.307  -16.879 -28.354  1.00 63.01  ? 95  MET F CB  1 
ATOM   7776  C CG  . MET F  1 95  ? -55.638  -15.514 -28.993  1.00 62.90  ? 95  MET F CG  1 
ATOM   7777  S SD  . MET F  1 95  ? -57.251  -14.742 -28.470  1.00 63.61  ? 95  MET F SD  1 
ATOM   7778  C CE  . MET F  1 95  ? -57.018  -14.179 -26.742  1.00 64.91  ? 95  MET F CE  1 
ATOM   7779  N N   . ALA F  1 96  ? -57.293  -17.705 -30.896  1.00 61.93  ? 96  ALA F N   1 
ATOM   7780  C CA  . ALA F  1 96  ? -57.469  -17.371 -32.286  1.00 61.49  ? 96  ALA F CA  1 
ATOM   7781  C C   . ALA F  1 96  ? -58.106  -16.001 -32.345  1.00 61.73  ? 96  ALA F C   1 
ATOM   7782  O O   . ALA F  1 96  ? -59.308  -15.859 -32.095  1.00 62.22  ? 96  ALA F O   1 
ATOM   7783  C CB  . ALA F  1 96  ? -58.385  -18.375 -32.946  1.00 61.53  ? 96  ALA F CB  1 
ATOM   7784  N N   . ALA F  1 97  ? -57.319  -14.989 -32.689  1.00 61.51  ? 97  ALA F N   1 
ATOM   7785  C CA  . ALA F  1 97  ? -57.808  -13.612 -32.665  1.00 61.80  ? 97  ALA F CA  1 
ATOM   7786  C C   . ALA F  1 97  ? -57.805  -12.992 -34.044  1.00 61.42  ? 97  ALA F C   1 
ATOM   7787  O O   . ALA F  1 97  ? -56.955  -13.338 -34.859  1.00 60.98  ? 97  ALA F O   1 
ATOM   7788  C CB  . ALA F  1 97  ? -56.966  -12.801 -31.722  1.00 62.16  ? 97  ALA F CB  1 
ATOM   7789  N N   . ALA F  1 98  ? -58.737  -12.065 -34.305  1.00 61.71  ? 98  ALA F N   1 
ATOM   7790  C CA  . ALA F  1 98  ? -58.735  -11.255 -35.560  1.00 61.48  ? 98  ALA F CA  1 
ATOM   7791  C C   . ALA F  1 98  ? -58.701  -12.190 -36.759  1.00 61.16  ? 98  ALA F C   1 
ATOM   7792  O O   . ALA F  1 98  ? -59.481  -13.136 -36.807  1.00 61.35  ? 98  ALA F O   1 
ATOM   7793  C CB  . ALA F  1 98  ? -57.567  -10.292 -35.587  1.00 61.35  ? 98  ALA F CB  1 
ATOM   7794  N N   . MET F  1 99  ? -57.784  -11.988 -37.691  1.00 60.84  ? 99  MET F N   1 
ATOM   7795  C CA  . MET F  1 99  ? -57.736  -12.862 -38.854  1.00 60.76  ? 99  MET F CA  1 
ATOM   7796  C C   . MET F  1 99  ? -57.556  -14.344 -38.467  1.00 60.68  ? 99  MET F C   1 
ATOM   7797  O O   . MET F  1 99  ? -57.956  -15.229 -39.194  1.00 60.85  ? 99  MET F O   1 
ATOM   7798  C CB  . MET F  1 99  ? -56.673  -12.387 -39.832  1.00 60.62  ? 99  MET F CB  1 
ATOM   7799  C CG  . MET F  1 99  ? -56.834  -12.919 -41.252  1.00 60.83  ? 99  MET F CG  1 
ATOM   7800  S SD  . MET F  1 99  ? -58.302  -12.411 -42.241  1.00 61.35  ? 99  MET F SD  1 
ATOM   7801  C CE  . MET F  1 99  ? -58.773  -10.915 -41.355  1.00 61.30  ? 99  MET F CE  1 
ATOM   7802  N N   . GLY F  1 100 ? -56.974  -14.609 -37.312  1.00 60.56  ? 100 GLY F N   1 
ATOM   7803  C CA  . GLY F  1 100 ? -56.909  -15.949 -36.784  1.00 60.55  ? 100 GLY F CA  1 
ATOM   7804  C C   . GLY F  1 100 ? -58.280  -16.573 -36.538  1.00 60.93  ? 100 GLY F C   1 
ATOM   7805  O O   . GLY F  1 100 ? -58.502  -17.742 -36.842  1.00 61.04  ? 100 GLY F O   1 
ATOM   7806  N N   . SER F  1 101 ? -59.204  -15.819 -35.986  1.00 61.27  ? 101 SER F N   1 
ATOM   7807  C CA  . SER F  1 101 ? -60.501  -16.380 -35.707  1.00 61.86  ? 101 SER F CA  1 
ATOM   7808  C C   . SER F  1 101 ? -61.294  -16.460 -36.994  1.00 62.18  ? 101 SER F C   1 
ATOM   7809  O O   . SER F  1 101 ? -62.190  -17.280 -37.122  1.00 62.76  ? 101 SER F O   1 
ATOM   7810  C CB  . SER F  1 101 ? -61.247  -15.535 -34.686  1.00 62.37  ? 101 SER F CB  1 
ATOM   7811  O OG  . SER F  1 101 ? -61.668  -14.304 -35.286  1.00 62.50  ? 101 SER F OG  1 
ATOM   7812  N N   . PHE F  1 102 ? -60.960  -15.590 -37.943  1.00 61.95  ? 102 PHE F N   1 
ATOM   7813  C CA  . PHE F  1 102 ? -61.548  -15.651 -39.272  1.00 62.36  ? 102 PHE F CA  1 
ATOM   7814  C C   . PHE F  1 102 ? -61.255  -16.992 -39.929  1.00 62.46  ? 102 PHE F C   1 
ATOM   7815  O O   . PHE F  1 102 ? -62.159  -17.623 -40.461  1.00 63.20  ? 102 PHE F O   1 
ATOM   7816  C CB  . PHE F  1 102 ? -61.023  -14.535 -40.158  1.00 62.11  ? 102 PHE F CB  1 
ATOM   7817  C CG  . PHE F  1 102 ? -61.748  -14.405 -41.487  1.00 62.75  ? 102 PHE F CG  1 
ATOM   7818  C CD1 . PHE F  1 102 ? -62.965  -13.753 -41.577  1.00 63.42  ? 102 PHE F CD1 1 
ATOM   7819  C CD2 . PHE F  1 102 ? -61.160  -14.897 -42.665  1.00 62.83  ? 102 PHE F CD2 1 
ATOM   7820  C CE1 . PHE F  1 102 ? -63.572  -13.602 -42.799  1.00 64.14  ? 102 PHE F CE1 1 
ATOM   7821  C CE2 . PHE F  1 102 ? -61.779  -14.748 -43.883  1.00 63.59  ? 102 PHE F CE2 1 
ATOM   7822  C CZ  . PHE F  1 102 ? -62.984  -14.103 -43.946  1.00 64.24  ? 102 PHE F CZ  1 
ATOM   7823  N N   . LEU F  1 103 ? -59.997  -17.410 -39.922  1.00 61.89  ? 103 LEU F N   1 
ATOM   7824  C CA  . LEU F  1 103 ? -59.611  -18.690 -40.474  1.00 62.05  ? 103 LEU F CA  1 
ATOM   7825  C C   . LEU F  1 103 ? -60.220  -19.843 -39.683  1.00 62.36  ? 103 LEU F C   1 
ATOM   7826  O O   . LEU F  1 103 ? -60.610  -20.834 -40.253  1.00 62.93  ? 103 LEU F O   1 
ATOM   7827  C CB  . LEU F  1 103 ? -58.079  -18.823 -40.473  1.00 61.49  ? 103 LEU F CB  1 
ATOM   7828  C CG  . LEU F  1 103 ? -57.332  -17.885 -41.422  1.00 61.39  ? 103 LEU F CG  1 
ATOM   7829  C CD1 . LEU F  1 103 ? -55.848  -18.091 -41.333  1.00 61.09  ? 103 LEU F CD1 1 
ATOM   7830  C CD2 . LEU F  1 103 ? -57.777  -18.005 -42.861  1.00 62.05  ? 103 LEU F CD2 1 
ATOM   7831  N N   . LEU F  1 104 ? -60.281  -19.713 -38.361  1.00 62.12  ? 104 LEU F N   1 
ATOM   7832  C CA  . LEU F  1 104 ? -60.950  -20.710 -37.540  1.00 62.55  ? 104 LEU F CA  1 
ATOM   7833  C C   . LEU F  1 104 ? -62.351  -20.983 -38.109  1.00 63.53  ? 104 LEU F C   1 
ATOM   7834  O O   . LEU F  1 104 ? -62.738  -22.141 -38.281  1.00 64.11  ? 104 LEU F O   1 
ATOM   7835  C CB  . LEU F  1 104 ? -61.043  -20.277 -36.079  1.00 62.45  ? 104 LEU F CB  1 
ATOM   7836  C CG  . LEU F  1 104 ? -61.715  -21.258 -35.141  1.00 63.01  ? 104 LEU F CG  1 
ATOM   7837  C CD1 . LEU F  1 104 ? -60.995  -22.579 -35.078  1.00 62.81  ? 104 LEU F CD1 1 
ATOM   7838  C CD2 . LEU F  1 104 ? -61.794  -20.651 -33.769  1.00 63.11  ? 104 LEU F CD2 1 
ATOM   7839  N N   . ALA F  1 105 ? -63.080  -19.922 -38.424  1.00 63.85  ? 105 ALA F N   1 
ATOM   7840  C CA  . ALA F  1 105 ? -64.435  -20.035 -38.875  1.00 64.99  ? 105 ALA F CA  1 
ATOM   7841  C C   . ALA F  1 105 ? -64.514  -20.558 -40.279  1.00 65.52  ? 105 ALA F C   1 
ATOM   7842  O O   . ALA F  1 105 ? -65.569  -20.873 -40.749  1.00 66.68  ? 105 ALA F O   1 
ATOM   7843  C CB  . ALA F  1 105 ? -65.114  -18.688 -38.792  1.00 65.24  ? 105 ALA F CB  1 
ATOM   7844  N N   . ALA F  1 106 ? -63.388  -20.650 -40.949  1.00 64.88  ? 106 ALA F N   1 
ATOM   7845  C CA  . ALA F  1 106 ? -63.358  -20.983 -42.374  1.00 65.52  ? 106 ALA F CA  1 
ATOM   7846  C C   . ALA F  1 106 ? -63.106  -22.468 -42.635  1.00 65.96  ? 106 ALA F C   1 
ATOM   7847  O O   . ALA F  1 106 ? -63.026  -22.891 -43.775  1.00 66.68  ? 106 ALA F O   1 
ATOM   7848  C CB  . ALA F  1 106 ? -62.302  -20.144 -43.077  1.00 64.84  ? 106 ALA F CB  1 
ATOM   7849  N N   . GLY F  1 107 ? -62.954  -23.245 -41.576  1.00 65.64  ? 107 GLY F N   1 
ATOM   7850  C CA  . GLY F  1 107 ? -62.861  -24.680 -41.704  1.00 66.18  ? 107 GLY F CA  1 
ATOM   7851  C C   . GLY F  1 107 ? -64.163  -25.289 -42.207  1.00 67.73  ? 107 GLY F C   1 
ATOM   7852  O O   . GLY F  1 107 ? -65.263  -24.632 -42.178  1.00 68.40  ? 107 GLY F O   1 
ATOM   7853  N N   . ALA F  1 108 ? -64.039  -26.525 -42.697  1.00 68.47  ? 108 ALA F N   1 
ATOM   7854  C CA  . ALA F  1 108 ? -65.190  -27.267 -43.203  1.00 70.20  ? 108 ALA F CA  1 
ATOM   7855  C C   . ALA F  1 108 ? -66.284  -27.343 -42.161  1.00 70.69  ? 108 ALA F C   1 
ATOM   7856  O O   . ALA F  1 108 ? -66.026  -27.659 -40.982  1.00 69.96  ? 108 ALA F O   1 
ATOM   7857  C CB  . ALA F  1 108 ? -64.791  -28.673 -43.616  1.00 70.87  ? 108 ALA F CB  1 
ATOM   7858  N N   . LYS F  1 109 ? -67.511  -27.068 -42.599  1.00 72.13  ? 109 LYS F N   1 
ATOM   7859  C CA  . LYS F  1 109 ? -68.658  -27.034 -41.694  1.00 72.93  ? 109 LYS F CA  1 
ATOM   7860  C C   . LYS F  1 109 ? -68.858  -28.367 -40.972  1.00 73.52  ? 109 LYS F C   1 
ATOM   7861  O O   . LYS F  1 109 ? -68.793  -29.414 -41.594  1.00 74.37  ? 109 LYS F O   1 
ATOM   7862  C CB  . LYS F  1 109 ? -69.909  -26.615 -42.466  1.00 74.70  ? 109 LYS F CB  1 
ATOM   7863  C CG  . LYS F  1 109 ? -69.944  -25.121 -42.822  1.00 74.16  ? 109 LYS F CG  1 
ATOM   7864  C CD  . LYS F  1 109 ? -71.241  -24.765 -43.580  1.00 76.15  ? 109 LYS F CD  1 
ATOM   7865  C CE  . LYS F  1 109 ? -71.188  -23.450 -44.396  1.00 75.90  ? 109 LYS F CE  1 
ATOM   7866  N NZ  . LYS F  1 109 ? -70.888  -22.310 -43.462  1.00 74.38  ? 109 LYS F NZ  1 
ATOM   7867  N N   . GLY F  1 110 ? -69.078  -28.309 -39.658  1.00 73.14  ? 110 GLY F N   1 
ATOM   7868  C CA  . GLY F  1 110 ? -69.136  -29.478 -38.804  1.00 73.48  ? 110 GLY F CA  1 
ATOM   7869  C C   . GLY F  1 110 ? -67.768  -29.912 -38.319  1.00 71.87  ? 110 GLY F C   1 
ATOM   7870  O O   . GLY F  1 110 ? -67.655  -30.807 -37.491  1.00 71.92  ? 110 GLY F O   1 
ATOM   7871  N N   . LYS F  1 111 ? -66.709  -29.308 -38.837  1.00 70.56  ? 111 LYS F N   1 
ATOM   7872  C CA  . LYS F  1 111 ? -65.351  -29.721 -38.427  1.00 69.21  ? 111 LYS F CA  1 
ATOM   7873  C C   . LYS F  1 111 ? -64.452  -28.569 -37.944  1.00 67.66  ? 111 LYS F C   1 
ATOM   7874  O O   . LYS F  1 111 ? -63.242  -28.583 -38.165  1.00 66.70  ? 111 LYS F O   1 
ATOM   7875  C CB  . LYS F  1 111 ? -64.650  -30.519 -39.530  1.00 69.40  ? 111 LYS F CB  1 
ATOM   7876  C CG  . LYS F  1 111 ? -65.454  -31.725 -40.016  1.00 71.10  ? 111 LYS F CG  1 
ATOM   7877  C CD  . LYS F  1 111 ? -64.621  -32.704 -40.809  1.00 71.30  ? 111 LYS F CD  1 
ATOM   7878  C CE  . LYS F  1 111 ? -65.522  -33.583 -41.657  1.00 73.30  ? 111 LYS F CE  1 
ATOM   7879  N NZ  . LYS F  1 111 ? -64.869  -33.912 -42.953  1.00 73.79  ? 111 LYS F NZ  1 
ATOM   7880  N N   . ARG F  1 112 ? -65.067  -27.593 -37.271  1.00 67.63  ? 112 ARG F N   1 
ATOM   7881  C CA  . ARG F  1 112 ? -64.393  -26.455 -36.679  1.00 66.46  ? 112 ARG F CA  1 
ATOM   7882  C C   . ARG F  1 112 ? -64.478  -26.602 -35.158  1.00 66.39  ? 112 ARG F C   1 
ATOM   7883  O O   . ARG F  1 112 ? -65.561  -26.581 -34.573  1.00 67.34  ? 112 ARG F O   1 
ATOM   7884  C CB  . ARG F  1 112 ? -65.067  -25.164 -37.151  1.00 66.69  ? 112 ARG F CB  1 
ATOM   7885  C CG  . ARG F  1 112 ? -64.978  -24.934 -38.641  1.00 66.87  ? 112 ARG F CG  1 
ATOM   7886  C CD  . ARG F  1 112 ? -65.811  -23.758 -39.058  1.00 67.34  ? 112 ARG F CD  1 
ATOM   7887  N NE  . ARG F  1 112 ? -67.144  -23.864 -38.487  1.00 68.56  ? 112 ARG F NE  1 
ATOM   7888  C CZ  . ARG F  1 112 ? -68.165  -23.043 -38.752  1.00 69.45  ? 112 ARG F CZ  1 
ATOM   7889  N NH1 . ARG F  1 112 ? -68.032  -22.031 -39.593  1.00 69.17  ? 112 ARG F NH1 1 
ATOM   7890  N NH2 . ARG F  1 112 ? -69.333  -23.237 -38.169  1.00 70.74  ? 112 ARG F NH2 1 
ATOM   7891  N N   . PHE F  1 113 ? -63.326  -26.785 -34.523  1.00 65.45  ? 113 PHE F N   1 
ATOM   7892  C CA  . PHE F  1 113 ? -63.270  -27.091 -33.099  1.00 65.51  ? 113 PHE F CA  1 
ATOM   7893  C C   . PHE F  1 113 ? -62.518  -26.046 -32.307  1.00 64.74  ? 113 PHE F C   1 
ATOM   7894  O O   . PHE F  1 113 ? -61.766  -25.267 -32.857  1.00 63.97  ? 113 PHE F O   1 
ATOM   7895  C CB  . PHE F  1 113 ? -62.607  -28.453 -32.887  1.00 65.41  ? 113 PHE F CB  1 
ATOM   7896  C CG  . PHE F  1 113 ? -63.228  -29.561 -33.684  1.00 66.28  ? 113 PHE F CG  1 
ATOM   7897  C CD1 . PHE F  1 113 ? -62.745  -29.880 -34.945  1.00 66.12  ? 113 PHE F CD1 1 
ATOM   7898  C CD2 . PHE F  1 113 ? -64.315  -30.275 -33.189  1.00 67.46  ? 113 PHE F CD2 1 
ATOM   7899  C CE1 . PHE F  1 113 ? -63.333  -30.883 -35.693  1.00 67.14  ? 113 PHE F CE1 1 
ATOM   7900  C CE2 . PHE F  1 113 ? -64.904  -31.281 -33.930  1.00 68.47  ? 113 PHE F CE2 1 
ATOM   7901  C CZ  . PHE F  1 113 ? -64.411  -31.583 -35.183  1.00 68.32  ? 113 PHE F CZ  1 
ATOM   7902  N N   . ALA F  1 114 ? -62.720  -26.044 -30.998  1.00 65.11  ? 114 ALA F N   1 
ATOM   7903  C CA  . ALA F  1 114 ? -61.845  -25.305 -30.047  1.00 64.61  ? 114 ALA F CA  1 
ATOM   7904  C C   . ALA F  1 114 ? -61.653  -26.146 -28.785  1.00 65.04  ? 114 ALA F C   1 
ATOM   7905  O O   . ALA F  1 114 ? -62.574  -26.808 -28.359  1.00 65.94  ? 114 ALA F O   1 
ATOM   7906  C CB  . ALA F  1 114 ? -62.457  -23.968 -29.683  1.00 64.95  ? 114 ALA F CB  1 
ATOM   7907  N N   . LEU F  1 115 ? -60.466  -26.134 -28.194  1.00 64.54  ? 115 LEU F N   1 
ATOM   7908  C CA  . LEU F  1 115 ? -60.269  -26.851 -26.930  1.00 65.08  ? 115 LEU F CA  1 
ATOM   7909  C C   . LEU F  1 115 ? -60.892  -26.024 -25.792  1.00 65.96  ? 115 LEU F C   1 
ATOM   7910  O O   . LEU F  1 115 ? -61.158  -24.842 -25.959  1.00 65.94  ? 115 LEU F O   1 
ATOM   7911  C CB  . LEU F  1 115 ? -58.797  -27.155 -26.694  1.00 64.49  ? 115 LEU F CB  1 
ATOM   7912  C CG  . LEU F  1 115 ? -58.099  -28.033 -27.753  1.00 63.83  ? 115 LEU F CG  1 
ATOM   7913  C CD1 . LEU F  1 115 ? -56.871  -28.731 -27.159  1.00 63.73  ? 115 LEU F CD1 1 
ATOM   7914  C CD2 . LEU F  1 115 ? -59.075  -29.076 -28.238  1.00 64.27  ? 115 LEU F CD2 1 
ATOM   7915  N N   . PRO F  1 116 ? -61.158  -26.640 -24.633  1.00 66.87  ? 116 PRO F N   1 
ATOM   7916  C CA  . PRO F  1 116 ? -62.090  -26.011 -23.691  1.00 68.07  ? 116 PRO F CA  1 
ATOM   7917  C C   . PRO F  1 116 ? -61.659  -24.630 -23.219  1.00 68.11  ? 116 PRO F C   1 
ATOM   7918  O O   . PRO F  1 116 ? -62.475  -23.782 -22.933  1.00 68.88  ? 116 PRO F O   1 
ATOM   7919  C CB  . PRO F  1 116 ? -62.111  -26.970 -22.513  1.00 69.00  ? 116 PRO F CB  1 
ATOM   7920  C CG  . PRO F  1 116 ? -61.613  -28.257 -23.042  1.00 68.36  ? 116 PRO F CG  1 
ATOM   7921  C CD  . PRO F  1 116 ? -60.684  -27.940 -24.154  1.00 67.00  ? 116 PRO F CD  1 
ATOM   7922  N N   . ASN F  1 117 ? -60.370  -24.413 -23.118  1.00 67.44  ? 117 ASN F N   1 
ATOM   7923  C CA  . ASN F  1 117 ? -59.902  -23.175 -22.544  1.00 67.74  ? 117 ASN F CA  1 
ATOM   7924  C C   . ASN F  1 117 ? -59.336  -22.227 -23.596  1.00 66.69  ? 117 ASN F C   1 
ATOM   7925  O O   . ASN F  1 117 ? -58.774  -21.204 -23.276  1.00 66.84  ? 117 ASN F O   1 
ATOM   7926  C CB  . ASN F  1 117 ? -58.891  -23.436 -21.425  1.00 68.27  ? 117 ASN F CB  1 
ATOM   7927  C CG  . ASN F  1 117 ? -59.514  -24.106 -20.213  1.00 69.63  ? 117 ASN F CG  1 
ATOM   7928  O OD1 . ASN F  1 117 ? -59.105  -25.194 -19.825  1.00 69.73  ? 117 ASN F OD1 1 
ATOM   7929  N ND2 . ASN F  1 117 ? -60.481  -23.455 -19.597  1.00 70.81  ? 117 ASN F ND2 1 
ATOM   7930  N N   . ALA F  1 118 ? -59.471  -22.567 -24.854  1.00 65.77  ? 118 ALA F N   1 
ATOM   7931  C CA  . ALA F  1 118 ? -59.003  -21.688 -25.880  1.00 64.91  ? 118 ALA F CA  1 
ATOM   7932  C C   . ALA F  1 118 ? -59.904  -20.453 -25.936  1.00 65.35  ? 118 ALA F C   1 
ATOM   7933  O O   . ALA F  1 118 ? -61.028  -20.476 -25.460  1.00 66.24  ? 118 ALA F O   1 
ATOM   7934  C CB  . ALA F  1 118 ? -58.960  -22.421 -27.206  1.00 64.06  ? 118 ALA F CB  1 
ATOM   7935  N N   . GLU F  1 119 ? -59.373  -19.364 -26.469  1.00 64.85  ? 119 GLU F N   1 
ATOM   7936  C CA  . GLU F  1 119 ? -60.080  -18.101 -26.545  1.00 65.25  ? 119 GLU F CA  1 
ATOM   7937  C C   . GLU F  1 119 ? -60.177  -17.650 -27.970  1.00 64.42  ? 119 GLU F C   1 
ATOM   7938  O O   . GLU F  1 119 ? -59.272  -17.860 -28.777  1.00 63.55  ? 119 GLU F O   1 
ATOM   7939  C CB  . GLU F  1 119 ? -59.328  -17.022 -25.777  1.00 65.66  ? 119 GLU F CB  1 
ATOM   7940  C CG  . GLU F  1 119 ? -59.804  -16.886 -24.323  1.00 67.06  ? 119 GLU F CG  1 
ATOM   7941  C CD  . GLU F  1 119 ? -58.921  -15.961 -23.475  1.00 67.73  ? 119 GLU F CD  1 
ATOM   7942  O OE1 . GLU F  1 119 ? -59.092  -16.039 -22.242  1.00 68.98  ? 119 GLU F OE1 1 
ATOM   7943  O OE2 . GLU F  1 119 ? -58.061  -15.170 -24.016  1.00 67.18  ? 119 GLU F OE2 1 
ATOM   7944  N N   . VAL F  1 120 ? -61.288  -17.025 -28.284  1.00 64.84  ? 120 VAL F N   1 
ATOM   7945  C CA  . VAL F  1 120 ? -61.460  -16.460 -29.598  1.00 64.25  ? 120 VAL F CA  1 
ATOM   7946  C C   . VAL F  1 120 ? -61.759  -14.974 -29.439  1.00 64.66  ? 120 VAL F C   1 
ATOM   7947  O O   . VAL F  1 120 ? -62.526  -14.569 -28.513  1.00 65.71  ? 120 VAL F O   1 
ATOM   7948  C CB  . VAL F  1 120 ? -62.621  -17.133 -30.313  1.00 64.54  ? 120 VAL F CB  1 
ATOM   7949  C CG1 . VAL F  1 120 ? -62.903  -16.451 -31.641  1.00 64.19  ? 120 VAL F CG1 1 
ATOM   7950  C CG2 . VAL F  1 120 ? -62.317  -18.585 -30.511  1.00 64.22  ? 120 VAL F CG2 1 
ATOM   7951  N N   . MET F  1 121 ? -61.145  -14.163 -30.305  1.00 63.99  ? 121 MET F N   1 
ATOM   7952  C CA  . MET F  1 121 ? -61.402  -12.714 -30.283  1.00 64.36  ? 121 MET F CA  1 
ATOM   7953  C C   . MET F  1 121 ? -61.738  -12.222 -31.661  1.00 63.91  ? 121 MET F C   1 
ATOM   7954  O O   . MET F  1 121 ? -61.048  -12.534 -32.628  1.00 63.10  ? 121 MET F O   1 
ATOM   7955  C CB  . MET F  1 121 ? -60.225  -11.935 -29.649  1.00 64.36  ? 121 MET F CB  1 
ATOM   7956  C CG  . MET F  1 121 ? -60.484  -10.461 -29.363  1.00 65.01  ? 121 MET F CG  1 
ATOM   7957  S SD  . MET F  1 121 ? -59.945  -9.391  -30.705  1.00 64.25  ? 121 MET F SD  1 
ATOM   7958  C CE  . MET F  1 121 ? -58.192  -9.238  -30.329  1.00 64.03  ? 121 MET F CE  1 
ATOM   7959  N N   . ILE F  1 122 ? -62.799  -11.453 -31.767  1.00 64.56  ? 122 ILE F N   1 
ATOM   7960  C CA  . ILE F  1 122 ? -63.109  -10.797 -33.062  1.00 64.28  ? 122 ILE F CA  1 
ATOM   7961  C C   . ILE F  1 122 ? -63.086  -9.253  -32.914  1.00 64.60  ? 122 ILE F C   1 
ATOM   7962  O O   . ILE F  1 122 ? -63.372  -8.721  -31.844  1.00 65.40  ? 122 ILE F O   1 
ATOM   7963  C CB  . ILE F  1 122 ? -64.445  -11.309 -33.650  1.00 64.87  ? 122 ILE F CB  1 
ATOM   7964  C CG1 . ILE F  1 122 ? -65.575  -11.063 -32.650  1.00 66.13  ? 122 ILE F CG1 1 
ATOM   7965  C CG2 . ILE F  1 122 ? -64.355  -12.789 -33.966  1.00 64.58  ? 122 ILE F CG2 1 
ATOM   7966  C CD1 . ILE F  1 122 ? -66.954  -11.255 -33.221  1.00 67.05  ? 122 ILE F CD1 1 
ATOM   7967  N N   . HIS F  1 123 ? -62.718  -8.549  -33.969  1.00 64.09  ? 123 HIS F N   1 
ATOM   7968  C CA  . HIS F  1 123 ? -62.720  -7.091  -33.958  1.00 64.41  ? 123 HIS F CA  1 
ATOM   7969  C C   . HIS F  1 123 ? -62.485  -6.584  -35.340  1.00 63.88  ? 123 HIS F C   1 
ATOM   7970  O O   . HIS F  1 123 ? -62.174  -7.368  -36.221  1.00 63.29  ? 123 HIS F O   1 
ATOM   7971  C CB  . HIS F  1 123 ? -61.719  -6.523  -32.932  1.00 64.54  ? 123 HIS F CB  1 
ATOM   7972  C CG  . HIS F  1 123 ? -60.273  -6.537  -33.395  1.00 63.73  ? 123 HIS F CG  1 
ATOM   7973  N ND1 . HIS F  1 123 ? -59.757  -7.544  -34.100  1.00 62.97  ? 123 HIS F ND1 1 
ATOM   7974  C CD2 . HIS F  1 123 ? -59.243  -5.627  -33.225  1.00 63.78  ? 123 HIS F CD2 1 
ATOM   7975  C CE1 . HIS F  1 123 ? -58.466  -7.298  -34.393  1.00 62.57  ? 123 HIS F CE1 1 
ATOM   7976  N NE2 . HIS F  1 123 ? -58.148  -6.140  -33.859  1.00 63.07  ? 123 HIS F NE2 1 
ATOM   7977  N N   . GLN F  1 124 ? -62.658  -5.287  -35.568  1.00 64.20  ? 124 GLN F N   1 
ATOM   7978  C CA  . GLN F  1 124 ? -62.549  -4.738  -36.935  1.00 63.85  ? 124 GLN F CA  1 
ATOM   7979  C C   . GLN F  1 124 ? -61.068  -4.652  -37.375  1.00 63.09  ? 124 GLN F C   1 
ATOM   7980  O O   . GLN F  1 124 ? -60.143  -4.677  -36.517  1.00 62.99  ? 124 GLN F O   1 
ATOM   7981  C CB  . GLN F  1 124 ? -63.296  -3.402  -37.083  1.00 64.53  ? 124 GLN F CB  1 
ATOM   7982  C CG  . GLN F  1 124 ? -62.852  -2.325  -36.132  1.00 64.93  ? 124 GLN F CG  1 
ATOM   7983  C CD  . GLN F  1 124 ? -63.553  -1.002  -36.340  1.00 65.65  ? 124 GLN F CD  1 
ATOM   7984  O OE1 . GLN F  1 124 ? -64.199  -0.448  -35.433  1.00 66.59  ? 124 GLN F OE1 1 
ATOM   7985  N NE2 . GLN F  1 124 ? -63.407  -0.469  -37.523  1.00 65.33  ? 124 GLN F NE2 1 
ATOM   7986  N N   . PRO F  1 125 ? -60.830  -4.576  -38.699  1.00 62.76  ? 125 PRO F N   1 
ATOM   7987  C CA  . PRO F  1 125 ? -59.457  -4.487  -39.179  1.00 62.26  ? 125 PRO F CA  1 
ATOM   7988  C C   . PRO F  1 125 ? -58.807  -3.136  -38.832  1.00 62.51  ? 125 PRO F C   1 
ATOM   7989  O O   . PRO F  1 125 ? -59.488  -2.114  -38.691  1.00 62.99  ? 125 PRO F O   1 
ATOM   7990  C CB  . PRO F  1 125 ? -59.591  -4.682  -40.719  1.00 62.15  ? 125 PRO F CB  1 
ATOM   7991  C CG  . PRO F  1 125 ? -61.004  -4.380  -41.060  1.00 62.68  ? 125 PRO F CG  1 
ATOM   7992  C CD  . PRO F  1 125 ? -61.834  -4.530  -39.801  1.00 63.05  ? 125 PRO F CD  1 
ATOM   7993  N N   . LEU F  1 126 ? -57.484  -3.156  -38.724  1.00 62.31  ? 126 LEU F N   1 
ATOM   7994  C CA  . LEU F  1 126 ? -56.698  -1.986  -38.426  1.00 62.69  ? 126 LEU F CA  1 
ATOM   7995  C C   . LEU F  1 126 ? -55.888  -1.598  -39.658  1.00 62.57  ? 126 LEU F C   1 
ATOM   7996  O O   . LEU F  1 126 ? -55.585  -2.448  -40.472  1.00 62.21  ? 126 LEU F O   1 
ATOM   7997  C CB  . LEU F  1 126 ? -55.754  -2.328  -37.287  1.00 62.87  ? 126 LEU F CB  1 
ATOM   7998  C CG  . LEU F  1 126 ? -56.432  -2.874  -36.012  1.00 63.11  ? 126 LEU F CG  1 
ATOM   7999  C CD1 . LEU F  1 126 ? -55.527  -3.854  -35.280  1.00 63.04  ? 126 LEU F CD1 1 
ATOM   8000  C CD2 . LEU F  1 126 ? -56.865  -1.706  -35.110  1.00 63.97  ? 126 LEU F CD2 1 
ATOM   8001  N N   . GLY F  1 127 ? -55.536  -0.319  -39.799  1.00 63.01  ? 127 GLY F N   1 
ATOM   8002  C CA  . GLY F  1 127 ? -54.691  0.119   -40.889  1.00 63.09  ? 127 GLY F CA  1 
ATOM   8003  C C   . GLY F  1 127 ? -54.185  1.512   -40.624  1.00 63.76  ? 127 GLY F C   1 
ATOM   8004  O O   . GLY F  1 127 ? -54.218  2.001   -39.516  1.00 64.20  ? 127 GLY F O   1 
ATOM   8005  N N   . GLY F  1 128 ? -53.724  2.173   -41.667  1.00 63.98  ? 128 GLY F N   1 
ATOM   8006  C CA  . GLY F  1 128 ? -53.134  3.511   -41.565  1.00 64.73  ? 128 GLY F CA  1 
ATOM   8007  C C   . GLY F  1 128 ? -53.112  4.183   -42.931  1.00 64.90  ? 128 GLY F C   1 
ATOM   8008  O O   . GLY F  1 128 ? -53.233  3.535   -43.966  1.00 64.56  ? 128 GLY F O   1 
ATOM   8009  N N   . ALA F  1 129 ? -52.973  5.499   -42.941  1.00 65.56  ? 129 ALA F N   1 
ATOM   8010  C CA  . ALA F  1 129 ? -52.924  6.267   -44.182  1.00 65.87  ? 129 ALA F CA  1 
ATOM   8011  C C   . ALA F  1 129 ? -52.160  7.504   -43.827  1.00 66.79  ? 129 ALA F C   1 
ATOM   8012  O O   . ALA F  1 129 ? -52.362  8.108   -42.783  1.00 67.17  ? 129 ALA F O   1 
ATOM   8013  C CB  . ALA F  1 129 ? -54.335  6.630   -44.675  1.00 65.65  ? 129 ALA F CB  1 
ATOM   8014  N N   . GLN F  1 130 ? -51.266  7.878   -44.713  1.00 67.32  ? 130 GLN F N   1 
ATOM   8015  C CA  . GLN F  1 130 ? -50.466  9.073   -44.548  1.00 68.40  ? 130 GLN F CA  1 
ATOM   8016  C C   . GLN F  1 130 ? -50.453  9.821   -45.854  1.00 68.79  ? 130 GLN F C   1 
ATOM   8017  O O   . GLN F  1 130 ? -50.429  9.204   -46.901  1.00 68.51  ? 130 GLN F O   1 
ATOM   8018  C CB  . GLN F  1 130 ? -49.050  8.627   -44.221  1.00 68.99  ? 130 GLN F CB  1 
ATOM   8019  C CG  . GLN F  1 130 ? -48.218  9.710   -43.557  1.00 70.30  ? 130 GLN F CG  1 
ATOM   8020  C CD  . GLN F  1 130 ? -48.751  10.067  -42.150  1.00 70.45  ? 130 GLN F CD  1 
ATOM   8021  O OE1 . GLN F  1 130 ? -49.356  9.195   -41.428  1.00 69.66  ? 130 GLN F OE1 1 
ATOM   8022  N NE2 . GLN F  1 130 ? -48.545  11.350  -41.739  1.00 71.60  ? 130 GLN F NE2 1 
ATOM   8023  N N   . GLY F  1 131 ? -50.460  11.143  -45.827  1.00 69.56  ? 131 GLY F N   1 
ATOM   8024  C CA  . GLY F  1 131 ? -50.274  11.899  -47.073  1.00 70.14  ? 131 GLY F CA  1 
ATOM   8025  C C   . GLY F  1 131 ? -51.381  12.858  -47.335  1.00 70.13  ? 131 GLY F C   1 
ATOM   8026  O O   . GLY F  1 131 ? -51.939  13.429  -46.389  1.00 70.21  ? 131 GLY F O   1 
ATOM   8027  N N   . GLN F  1 132 ? -51.708  13.038  -48.620  1.00 70.18  ? 132 GLN F N   1 
ATOM   8028  C CA  . GLN F  1 132 ? -52.723  14.023  -49.070  1.00 70.36  ? 132 GLN F CA  1 
ATOM   8029  C C   . GLN F  1 132 ? -54.142  13.578  -48.750  1.00 69.55  ? 132 GLN F C   1 
ATOM   8030  O O   . GLN F  1 132 ? -54.416  12.375  -48.707  1.00 68.80  ? 132 GLN F O   1 
ATOM   8031  C CB  . GLN F  1 132 ? -52.600  14.234  -50.563  1.00 70.81  ? 132 GLN F CB  1 
ATOM   8032  C CG  . GLN F  1 132 ? -51.289  14.847  -51.005  1.00 71.89  ? 132 GLN F CG  1 
ATOM   8033  C CD  . GLN F  1 132 ? -51.279  15.191  -52.485  1.00 72.53  ? 132 GLN F CD  1 
ATOM   8034  O OE1 . GLN F  1 132 ? -51.363  14.314  -53.320  1.00 72.33  ? 132 GLN F OE1 1 
ATOM   8035  N NE2 . GLN F  1 132 ? -51.155  16.457  -52.805  1.00 73.44  ? 132 GLN F NE2 1 
ATOM   8036  N N   . ALA F  1 133 ? -55.025  14.550  -48.543  1.00 69.85  ? 133 ALA F N   1 
ATOM   8037  C CA  . ALA F  1 133 ? -56.463  14.309  -48.363  1.00 69.41  ? 133 ALA F CA  1 
ATOM   8038  C C   . ALA F  1 133 ? -57.035  13.245  -49.299  1.00 68.89  ? 133 ALA F C   1 
ATOM   8039  O O   . ALA F  1 133 ? -57.672  12.311  -48.846  1.00 68.31  ? 133 ALA F O   1 
ATOM   8040  C CB  . ALA F  1 133 ? -57.249  15.620  -48.476  1.00 70.09  ? 133 ALA F CB  1 
ATOM   8041  N N   . THR F  1 134 ? -56.779  13.404  -50.595  1.00 69.28  ? 134 THR F N   1 
ATOM   8042  C CA  . THR F  1 134 ? -57.130  12.462  -51.645  1.00 69.12  ? 134 THR F CA  1 
ATOM   8043  C C   . THR F  1 134 ? -56.621  11.064  -51.360  1.00 68.46  ? 134 THR F C   1 
ATOM   8044  O O   . THR F  1 134 ? -57.391  10.119  -51.492  1.00 68.09  ? 134 THR F O   1 
ATOM   8045  C CB  . THR F  1 134 ? -56.540  12.955  -52.972  1.00 69.91  ? 134 THR F CB  1 
ATOM   8046  O OG1 . THR F  1 134 ? -57.236  14.136  -53.337  1.00 70.53  ? 134 THR F OG1 1 
ATOM   8047  C CG2 . THR F  1 134 ? -56.676  11.920  -54.110  1.00 70.02  ? 134 THR F CG2 1 
ATOM   8048  N N   . GLU F  1 135 ? -55.344  10.951  -50.980  1.00 68.45  ? 135 GLU F N   1 
ATOM   8049  C CA  . GLU F  1 135 ? -54.720  9.670   -50.622  1.00 67.91  ? 135 GLU F CA  1 
ATOM   8050  C C   . GLU F  1 135 ? -55.293  8.987   -49.396  1.00 67.14  ? 135 GLU F C   1 
ATOM   8051  O O   . GLU F  1 135 ? -55.472  7.763   -49.380  1.00 66.61  ? 135 GLU F O   1 
ATOM   8052  C CB  . GLU F  1 135 ? -53.234  9.864   -50.378  1.00 68.32  ? 135 GLU F CB  1 
ATOM   8053  C CG  . GLU F  1 135 ? -52.486  10.021  -51.669  1.00 69.11  ? 135 GLU F CG  1 
ATOM   8054  C CD  . GLU F  1 135 ? -51.100  10.493  -51.455  1.00 69.85  ? 135 GLU F CD  1 
ATOM   8055  O OE1 . GLU F  1 135 ? -50.804  11.111  -50.395  1.00 69.95  ? 135 GLU F OE1 1 
ATOM   8056  O OE2 . GLU F  1 135 ? -50.303  10.243  -52.383  1.00 70.53  ? 135 GLU F OE2 1 
ATOM   8057  N N   . ILE F  1 136 ? -55.552  9.777   -48.363  1.00 67.21  ? 136 ILE F N   1 
ATOM   8058  C CA  . ILE F  1 136 ? -56.248  9.291   -47.179  1.00 66.72  ? 136 ILE F CA  1 
ATOM   8059  C C   . ILE F  1 136 ? -57.622  8.743   -47.535  1.00 66.45  ? 136 ILE F C   1 
ATOM   8060  O O   . ILE F  1 136 ? -57.976  7.673   -47.081  1.00 65.95  ? 136 ILE F O   1 
ATOM   8061  C CB  . ILE F  1 136 ? -56.282  10.377  -46.074  1.00 67.17  ? 136 ILE F CB  1 
ATOM   8062  C CG1 . ILE F  1 136 ? -54.863  10.557  -45.516  1.00 67.51  ? 136 ILE F CG1 1 
ATOM   8063  C CG2 . ILE F  1 136 ? -57.203  10.011  -44.926  1.00 66.93  ? 136 ILE F CG2 1 
ATOM   8064  C CD1 . ILE F  1 136 ? -54.654  11.886  -44.840  1.00 68.37  ? 136 ILE F CD1 1 
ATOM   8065  N N   . GLU F  1 137 ? -58.366  9.467   -48.377  1.00 66.93  ? 137 GLU F N   1 
ATOM   8066  C CA  . GLU F  1 137 ? -59.679  9.059   -48.781  1.00 66.99  ? 137 GLU F CA  1 
ATOM   8067  C C   . GLU F  1 137 ? -59.636  7.700   -49.467  1.00 66.68  ? 137 GLU F C   1 
ATOM   8068  O O   . GLU F  1 137 ? -60.412  6.807   -49.148  1.00 66.45  ? 137 GLU F O   1 
ATOM   8069  C CB  . GLU F  1 137 ? -60.307  10.120  -49.673  1.00 67.74  ? 137 GLU F CB  1 
ATOM   8070  C CG  . GLU F  1 137 ? -61.752  9.871   -49.996  1.00 68.10  ? 137 GLU F CG  1 
ATOM   8071  C CD  . GLU F  1 137 ? -62.221  10.785  -51.072  1.00 68.93  ? 137 GLU F CD  1 
ATOM   8072  O OE1 . GLU F  1 137 ? -61.374  11.183  -51.882  1.00 69.13  ? 137 GLU F OE1 1 
ATOM   8073  O OE2 . GLU F  1 137 ? -63.443  11.105  -51.130  1.00 69.53  ? 137 GLU F OE2 1 
ATOM   8074  N N   . ILE F  1 138 ? -58.701  7.529   -50.378  1.00 66.80  ? 138 ILE F N   1 
ATOM   8075  C CA  . ILE F  1 138 ? -58.511  6.241   -51.041  1.00 66.67  ? 138 ILE F CA  1 
ATOM   8076  C C   . ILE F  1 138 ? -58.249  5.112   -50.036  1.00 65.91  ? 138 ILE F C   1 
ATOM   8077  O O   . ILE F  1 138 ? -58.818  4.048   -50.147  1.00 65.76  ? 138 ILE F O   1 
ATOM   8078  C CB  . ILE F  1 138 ? -57.415  6.320   -52.113  1.00 67.13  ? 138 ILE F CB  1 
ATOM   8079  C CG1 . ILE F  1 138 ? -57.951  7.074   -53.319  1.00 68.01  ? 138 ILE F CG1 1 
ATOM   8080  C CG2 . ILE F  1 138 ? -57.025  4.932   -52.539  1.00 67.02  ? 138 ILE F CG2 1 
ATOM   8081  C CD1 . ILE F  1 138 ? -56.912  7.850   -54.067  1.00 68.65  ? 138 ILE F CD1 1 
ATOM   8082  N N   . ALA F  1 139 ? -57.416  5.356   -49.040  1.00 65.57  ? 139 ALA F N   1 
ATOM   8083  C CA  . ALA F  1 139 ? -57.133  4.361   -48.038  1.00 64.96  ? 139 ALA F CA  1 
ATOM   8084  C C   . ALA F  1 139 ? -58.316  4.052   -47.100  1.00 64.70  ? 139 ALA F C   1 
ATOM   8085  O O   . ALA F  1 139 ? -58.555  2.931   -46.708  1.00 64.31  ? 139 ALA F O   1 
ATOM   8086  C CB  . ALA F  1 139 ? -55.927  4.807   -47.237  1.00 64.94  ? 139 ALA F CB  1 
ATOM   8087  N N   . ALA F  1 140 ? -59.023  5.083   -46.704  1.00 65.04  ? 140 ALA F N   1 
ATOM   8088  C CA  . ALA F  1 140 ? -60.211  4.923   -45.935  1.00 65.10  ? 140 ALA F CA  1 
ATOM   8089  C C   . ALA F  1 140 ? -61.250  4.093   -46.686  1.00 65.26  ? 140 ALA F C   1 
ATOM   8090  O O   . ALA F  1 140 ? -61.813  3.169   -46.110  1.00 65.10  ? 140 ALA F O   1 
ATOM   8091  C CB  . ALA F  1 140 ? -60.764  6.276   -45.548  1.00 65.67  ? 140 ALA F CB  1 
ATOM   8092  N N   . ASN F  1 141 ? -61.496  4.393   -47.962  1.00 65.73  ? 141 ASN F N   1 
ATOM   8093  C CA  . ASN F  1 141 ? -62.468  3.641   -48.722  1.00 66.16  ? 141 ASN F CA  1 
ATOM   8094  C C   . ASN F  1 141 ? -62.061  2.186   -48.782  1.00 65.73  ? 141 ASN F C   1 
ATOM   8095  O O   . ASN F  1 141 ? -62.882  1.298   -48.655  1.00 65.90  ? 141 ASN F O   1 
ATOM   8096  C CB  . ASN F  1 141 ? -62.632  4.208   -50.125  1.00 66.90  ? 141 ASN F CB  1 
ATOM   8097  C CG  . ASN F  1 141 ? -63.405  5.514   -50.155  1.00 67.53  ? 141 ASN F CG  1 
ATOM   8098  O OD1 . ASN F  1 141 ? -64.175  5.799   -49.262  1.00 67.65  ? 141 ASN F OD1 1 
ATOM   8099  N ND2 . ASN F  1 141 ? -63.196  6.315   -51.193  1.00 68.06  ? 141 ASN F ND2 1 
ATOM   8100  N N   . HIS F  1 142 ? -60.780  1.948   -48.943  1.00 65.28  ? 142 HIS F N   1 
ATOM   8101  C CA  . HIS F  1 142 ? -60.296  0.613   -49.092  1.00 64.98  ? 142 HIS F CA  1 
ATOM   8102  C C   . HIS F  1 142 ? -60.507  -0.187  -47.861  1.00 64.43  ? 142 HIS F C   1 
ATOM   8103  O O   . HIS F  1 142 ? -60.934  -1.320  -47.940  1.00 64.46  ? 142 HIS F O   1 
ATOM   8104  C CB  . HIS F  1 142 ? -58.813  0.599   -49.472  1.00 64.79  ? 142 HIS F CB  1 
ATOM   8105  C CG  . HIS F  1 142 ? -58.259  -0.794  -49.657  1.00 64.59  ? 142 HIS F CG  1 
ATOM   8106  N ND1 . HIS F  1 142 ? -57.199  -1.248  -48.960  1.00 64.07  ? 142 HIS F ND1 1 
ATOM   8107  C CD2 . HIS F  1 142 ? -58.689  -1.857  -50.470  1.00 65.01  ? 142 HIS F CD2 1 
ATOM   8108  C CE1 . HIS F  1 142 ? -56.927  -2.515  -49.315  1.00 64.08  ? 142 HIS F CE1 1 
ATOM   8109  N NE2 . HIS F  1 142 ? -57.846  -2.893  -50.242  1.00 64.66  ? 142 HIS F NE2 1 
ATOM   8110  N N   . ILE F  1 143 ? -60.187  0.365   -46.694  1.00 64.05  ? 143 ILE F N   1 
ATOM   8111  C CA  . ILE F  1 143 ? -60.286  -0.407  -45.487  1.00 63.64  ? 143 ILE F CA  1 
ATOM   8112  C C   . ILE F  1 143 ? -61.752  -0.623  -45.145  1.00 64.05  ? 143 ILE F C   1 
ATOM   8113  O O   . ILE F  1 143 ? -62.109  -1.682  -44.606  1.00 63.92  ? 143 ILE F O   1 
ATOM   8114  C CB  . ILE F  1 143 ? -59.475  0.183   -44.322  1.00 63.36  ? 143 ILE F CB  1 
ATOM   8115  C CG1 . ILE F  1 143 ? -59.324  -0.850  -43.206  1.00 62.97  ? 143 ILE F CG1 1 
ATOM   8116  C CG2 . ILE F  1 143 ? -60.111  1.433   -43.748  1.00 63.80  ? 143 ILE F CG2 1 
ATOM   8117  C CD1 . ILE F  1 143 ? -58.342  -0.457  -42.104  1.00 62.86  ? 143 ILE F CD1 1 
ATOM   8118  N N   . LEU F  1 144 ? -62.618  0.336   -45.480  1.00 64.67  ? 144 LEU F N   1 
ATOM   8119  C CA  . LEU F  1 144 ? -64.014  0.163   -45.202  1.00 65.31  ? 144 LEU F CA  1 
ATOM   8120  C C   . LEU F  1 144 ? -64.554  -0.951  -46.070  1.00 65.67  ? 144 LEU F C   1 
ATOM   8121  O O   . LEU F  1 144 ? -65.344  -1.775  -45.632  1.00 65.98  ? 144 LEU F O   1 
ATOM   8122  C CB  . LEU F  1 144 ? -64.769  1.471   -45.400  1.00 66.04  ? 144 LEU F CB  1 
ATOM   8123  C CG  . LEU F  1 144 ? -64.552  2.538   -44.320  1.00 66.02  ? 144 LEU F CG  1 
ATOM   8124  C CD1 . LEU F  1 144 ? -65.055  3.890   -44.804  1.00 66.72  ? 144 LEU F CD1 1 
ATOM   8125  C CD2 . LEU F  1 144 ? -65.144  2.202   -42.959  1.00 66.24  ? 144 LEU F CD2 1 
ATOM   8126  N N   . LYS F  1 145 ? -64.104  -0.998  -47.307  1.00 65.77  ? 145 LYS F N   1 
ATOM   8127  C CA  . LYS F  1 145 ? -64.541  -2.046  -48.236  1.00 66.33  ? 145 LYS F CA  1 
ATOM   8128  C C   . LYS F  1 145 ? -64.095  -3.414  -47.755  1.00 65.79  ? 145 LYS F C   1 
ATOM   8129  O O   . LYS F  1 145 ? -64.876  -4.380  -47.834  1.00 66.33  ? 145 LYS F O   1 
ATOM   8130  C CB  . LYS F  1 145 ? -64.054  -1.781  -49.652  1.00 66.72  ? 145 LYS F CB  1 
ATOM   8131  C CG  . LYS F  1 145 ? -65.043  -2.324  -50.631  1.00 67.91  ? 145 LYS F CG  1 
ATOM   8132  C CD  . LYS F  1 145 ? -64.704  -2.037  -52.096  1.00 68.64  ? 145 LYS F CD  1 
ATOM   8133  C CE  . LYS F  1 145 ? -65.690  -2.790  -53.013  1.00 70.05  ? 145 LYS F CE  1 
ATOM   8134  N NZ  . LYS F  1 145 ? -65.334  -2.736  -54.459  1.00 70.98  ? 145 LYS F NZ  1 
ATOM   8135  N N   . THR F  1 146 ? -62.861  -3.473  -47.241  1.00 64.86  ? 146 THR F N   1 
ATOM   8136  C CA  . THR F  1 146 ? -62.305  -4.674  -46.666  1.00 64.30  ? 146 THR F CA  1 
ATOM   8137  C C   . THR F  1 146 ? -63.127  -5.127  -45.459  1.00 64.30  ? 146 THR F C   1 
ATOM   8138  O O   . THR F  1 146 ? -63.351  -6.310  -45.270  1.00 64.34  ? 146 THR F O   1 
ATOM   8139  C CB  . THR F  1 146 ? -60.815  -4.500  -46.296  1.00 63.51  ? 146 THR F CB  1 
ATOM   8140  O OG1 . THR F  1 146 ? -60.074  -4.292  -47.493  1.00 63.73  ? 146 THR F OG1 1 
ATOM   8141  C CG2 . THR F  1 146 ? -60.267  -5.737  -45.666  1.00 63.02  ? 146 THR F CG2 1 
ATOM   8142  N N   . ARG F  1 147 ? -63.593  -4.192  -44.653  1.00 64.39  ? 147 ARG F N   1 
ATOM   8143  C CA  . ARG F  1 147 ? -64.426  -4.577  -43.533  1.00 64.65  ? 147 ARG F CA  1 
ATOM   8144  C C   . ARG F  1 147 ? -65.764  -5.198  -44.000  1.00 65.65  ? 147 ARG F C   1 
ATOM   8145  O O   . ARG F  1 147 ? -66.233  -6.173  -43.418  1.00 65.86  ? 147 ARG F O   1 
ATOM   8146  C CB  . ARG F  1 147 ? -64.656  -3.401  -42.572  1.00 64.80  ? 147 ARG F CB  1 
ATOM   8147  C CG  . ARG F  1 147 ? -65.255  -3.872  -41.270  1.00 65.08  ? 147 ARG F CG  1 
ATOM   8148  C CD  . ARG F  1 147 ? -65.709  -2.772  -40.342  1.00 65.61  ? 147 ARG F CD  1 
ATOM   8149  N NE  . ARG F  1 147 ? -66.128  -3.339  -39.064  1.00 65.96  ? 147 ARG F NE  1 
ATOM   8150  C CZ  . ARG F  1 147 ? -66.737  -2.657  -38.107  1.00 66.76  ? 147 ARG F CZ  1 
ATOM   8151  N NH1 . ARG F  1 147 ? -67.011  -1.363  -38.284  1.00 67.24  ? 147 ARG F NH1 1 
ATOM   8152  N NH2 . ARG F  1 147 ? -67.079  -3.269  -36.971  1.00 67.19  ? 147 ARG F NH2 1 
ATOM   8153  N N   . GLU F  1 148 ? -66.366  -4.626  -45.038  1.00 66.39  ? 148 GLU F N   1 
ATOM   8154  C CA  . GLU F  1 148 ? -67.593  -5.173  -45.559  1.00 67.59  ? 148 GLU F CA  1 
ATOM   8155  C C   . GLU F  1 148 ? -67.394  -6.590  -46.051  1.00 67.64  ? 148 GLU F C   1 
ATOM   8156  O O   . GLU F  1 148 ? -68.242  -7.446  -45.787  1.00 68.39  ? 148 GLU F O   1 
ATOM   8157  C CB  . GLU F  1 148 ? -68.097  -4.337  -46.697  1.00 68.45  ? 148 GLU F CB  1 
ATOM   8158  C CG  . GLU F  1 148 ? -68.942  -3.176  -46.263  1.00 69.09  ? 148 GLU F CG  1 
ATOM   8159  C CD  . GLU F  1 148 ? -69.213  -2.255  -47.439  1.00 69.80  ? 148 GLU F CD  1 
ATOM   8160  O OE1 . GLU F  1 148 ? -69.567  -1.064  -47.186  1.00 70.09  ? 148 GLU F OE1 1 
ATOM   8161  O OE2 . GLU F  1 148 ? -69.056  -2.709  -48.639  1.00 70.18  ? 148 GLU F OE2 1 
ATOM   8162  N N   . LYS F  1 149 ? -66.282  -6.804  -46.764  1.00 66.99  ? 149 LYS F N   1 
ATOM   8163  C CA  . LYS F  1 149 ? -65.900  -8.093  -47.272  1.00 67.04  ? 149 LYS F CA  1 
ATOM   8164  C C   . LYS F  1 149 ? -65.769  -9.062  -46.126  1.00 66.49  ? 149 LYS F C   1 
ATOM   8165  O O   . LYS F  1 149 ? -66.340  -10.140 -46.177  1.00 67.13  ? 149 LYS F O   1 
ATOM   8166  C CB  . LYS F  1 149 ? -64.590  -8.010  -48.072  1.00 66.46  ? 149 LYS F CB  1 
ATOM   8167  C CG  . LYS F  1 149 ? -64.152  -9.368  -48.623  1.00 66.66  ? 149 LYS F CG  1 
ATOM   8168  C CD  . LYS F  1 149 ? -63.282  -9.245  -49.854  1.00 66.88  ? 149 LYS F CD  1 
ATOM   8169  C CE  . LYS F  1 149 ? -61.798  -9.428  -49.561  1.00 65.86  ? 149 LYS F CE  1 
ATOM   8170  N NZ  . LYS F  1 149 ? -60.977  -9.197  -50.776  1.00 66.30  ? 149 LYS F NZ  1 
ATOM   8171  N N   . LEU F  1 150 ? -65.043  -8.691  -45.084  1.00 65.47  ? 150 LEU F N   1 
ATOM   8172  C CA  . LEU F  1 150 ? -64.855  -9.592  -43.960  1.00 65.01  ? 150 LEU F CA  1 
ATOM   8173  C C   . LEU F  1 150 ? -66.195  -9.925  -43.317  1.00 65.90  ? 150 LEU F C   1 
ATOM   8174  O O   . LEU F  1 150 ? -66.519  -11.100 -43.116  1.00 66.23  ? 150 LEU F O   1 
ATOM   8175  C CB  . LEU F  1 150 ? -63.872  -9.027  -42.945  1.00 64.03  ? 150 LEU F CB  1 
ATOM   8176  C CG  . LEU F  1 150 ? -62.392  -9.038  -43.348  1.00 63.23  ? 150 LEU F CG  1 
ATOM   8177  C CD1 . LEU F  1 150 ? -61.567  -8.050  -42.555  1.00 62.65  ? 150 LEU F CD1 1 
ATOM   8178  C CD2 . LEU F  1 150 ? -61.792  -10.426 -43.227  1.00 62.92  ? 150 LEU F CD2 1 
ATOM   8179  N N   . ASN F  1 151 ? -66.992  -8.908  -43.022  1.00 66.45  ? 151 ASN F N   1 
ATOM   8180  C CA  . ASN F  1 151 ? -68.236  -9.132  -42.338  1.00 67.48  ? 151 ASN F CA  1 
ATOM   8181  C C   . ASN F  1 151 ? -69.178  -10.004 -43.162  1.00 68.71  ? 151 ASN F C   1 
ATOM   8182  O O   . ASN F  1 151 ? -69.878  -10.853 -42.626  1.00 69.43  ? 151 ASN F O   1 
ATOM   8183  C CB  . ASN F  1 151 ? -68.905  -7.811  -42.006  1.00 68.04  ? 151 ASN F CB  1 
ATOM   8184  C CG  . ASN F  1 151 ? -68.191  -7.026  -40.931  1.00 67.23  ? 151 ASN F CG  1 
ATOM   8185  O OD1 . ASN F  1 151 ? -67.135  -7.436  -40.389  1.00 66.22  ? 151 ASN F OD1 1 
ATOM   8186  N ND2 . ASN F  1 151 ? -68.762  -5.875  -40.604  1.00 67.83  ? 151 ASN F ND2 1 
ATOM   8187  N N   . ARG F  1 152 ? -69.194  -9.801  -44.469  1.00 69.11  ? 152 ARG F N   1 
ATOM   8188  C CA  . ARG F  1 152 ? -70.064  -10.563 -45.325  1.00 70.53  ? 152 ARG F CA  1 
ATOM   8189  C C   . ARG F  1 152 ? -69.728  -12.028 -45.235  1.00 70.39  ? 152 ARG F C   1 
ATOM   8190  O O   . ARG F  1 152 ? -70.612  -12.844 -45.030  1.00 71.52  ? 152 ARG F O   1 
ATOM   8191  C CB  . ARG F  1 152 ? -69.949  -10.086 -46.765  1.00 71.00  ? 152 ARG F CB  1 
ATOM   8192  C CG  . ARG F  1 152 ? -70.868  -10.759 -47.754  1.00 72.77  ? 152 ARG F CG  1 
ATOM   8193  C CD  . ARG F  1 152 ? -70.589  -10.227 -49.159  1.00 73.21  ? 152 ARG F CD  1 
ATOM   8194  N NE  . ARG F  1 152 ? -69.421  -10.874 -49.779  1.00 72.49  ? 152 ARG F NE  1 
ATOM   8195  C CZ  . ARG F  1 152 ? -68.334  -10.220 -50.184  1.00 71.47  ? 152 ARG F CZ  1 
ATOM   8196  N NH1 . ARG F  1 152 ? -67.319  -10.928 -50.739  1.00 71.09  ? 152 ARG F NH1 1 
ATOM   8197  N NH2 . ARG F  1 152 ? -68.272  -8.868  -50.032  1.00 70.98  ? 152 ARG F NH2 1 
ATOM   8198  N N   . ILE F  1 153 ? -68.457  -12.367 -45.379  1.00 69.15  ? 153 ILE F N   1 
ATOM   8199  C CA  . ILE F  1 153 ? -68.062  -13.768 -45.403  1.00 69.07  ? 153 ILE F CA  1 
ATOM   8200  C C   . ILE F  1 153 ? -68.277  -14.377 -44.013  1.00 68.80  ? 153 ILE F C   1 
ATOM   8201  O O   . ILE F  1 153 ? -68.631  -15.543 -43.876  1.00 69.41  ? 153 ILE F O   1 
ATOM   8202  C CB  . ILE F  1 153 ? -66.607  -13.915 -45.860  1.00 67.93  ? 153 ILE F CB  1 
ATOM   8203  C CG1 . ILE F  1 153 ? -66.490  -13.518 -47.312  1.00 68.57  ? 153 ILE F CG1 1 
ATOM   8204  C CG2 . ILE F  1 153 ? -66.083  -15.324 -45.616  1.00 67.69  ? 153 ILE F CG2 1 
ATOM   8205  C CD1 . ILE F  1 153 ? -65.079  -13.518 -47.843  1.00 67.70  ? 153 ILE F CD1 1 
ATOM   8206  N N   . LEU F  1 154 ? -68.061  -13.579 -42.979  1.00 73.24  ? 154 LEU F N   1 
ATOM   8207  C CA  . LEU F  1 154 ? -68.234  -14.050 -41.624  1.00 71.52  ? 154 LEU F CA  1 
ATOM   8208  C C   . LEU F  1 154 ? -69.710  -14.329 -41.355  1.00 72.68  ? 154 LEU F C   1 
ATOM   8209  O O   . LEU F  1 154 ? -70.060  -15.307 -40.710  1.00 72.79  ? 154 LEU F O   1 
ATOM   8210  C CB  . LEU F  1 154 ? -67.670  -13.029 -40.646  1.00 69.33  ? 154 LEU F CB  1 
ATOM   8211  C CG  . LEU F  1 154 ? -67.181  -13.582 -39.318  1.00 67.60  ? 154 LEU F CG  1 
ATOM   8212  C CD1 . LEU F  1 154 ? -66.115  -14.633 -39.482  1.00 67.66  ? 154 LEU F CD1 1 
ATOM   8213  C CD2 . LEU F  1 154 ? -66.610  -12.451 -38.470  1.00 66.03  ? 154 LEU F CD2 1 
ATOM   8214  N N   . SER F  1 155 ? -70.571  -13.463 -41.859  1.00 73.95  ? 155 SER F N   1 
ATOM   8215  C CA  . SER F  1 155 ? -71.993  -13.652 -41.764  1.00 75.84  ? 155 SER F CA  1 
ATOM   8216  C C   . SER F  1 155 ? -72.373  -15.016 -42.352  1.00 78.01  ? 155 SER F C   1 
ATOM   8217  O O   . SER F  1 155 ? -73.103  -15.781 -41.740  1.00 78.86  ? 155 SER F O   1 
ATOM   8218  C CB  . SER F  1 155 ? -72.692  -12.526 -42.507  1.00 77.49  ? 155 SER F CB  1 
ATOM   8219  O OG  . SER F  1 155 ? -74.089  -12.708 -42.527  1.00 80.00  ? 155 SER F OG  1 
ATOM   8220  N N   . GLU F  1 156 ? -71.853  -15.334 -43.529  1.00 79.30  ? 156 GLU F N   1 
ATOM   8221  C CA  . GLU F  1 156 ? -72.137  -16.597 -44.193  1.00 81.89  ? 156 GLU F CA  1 
ATOM   8222  C C   . GLU F  1 156 ? -71.709  -17.840 -43.417  1.00 81.11  ? 156 GLU F C   1 
ATOM   8223  O O   . GLU F  1 156 ? -72.328  -18.876 -43.532  1.00 83.36  ? 156 GLU F O   1 
ATOM   8224  C CB  . GLU F  1 156 ? -71.436  -16.631 -45.537  1.00 83.51  ? 156 GLU F CB  1 
ATOM   8225  C CG  . GLU F  1 156 ? -72.006  -15.672 -46.567  1.00 85.54  ? 156 GLU F CG  1 
ATOM   8226  C CD  . GLU F  1 156 ? -71.061  -15.429 -47.755  1.00 86.77  ? 156 GLU F CD  1 
ATOM   8227  O OE1 . GLU F  1 156 ? -70.018  -16.133 -47.840  1.00 86.48  ? 156 GLU F OE1 1 
ATOM   8228  O OE2 . GLU F  1 156 ? -71.346  -14.531 -48.600  1.00 88.39  ? 156 GLU F OE2 1 
ATOM   8229  N N   . ARG F  1 157 ? -70.641  -17.753 -42.644  1.00 78.32  ? 157 ARG F N   1 
ATOM   8230  C CA  . ARG F  1 157 ? -70.077  -18.931 -41.994  1.00 77.86  ? 157 ARG F CA  1 
ATOM   8231  C C   . ARG F  1 157 ? -70.513  -19.119 -40.550  1.00 76.48  ? 157 ARG F C   1 
ATOM   8232  O O   . ARG F  1 157 ? -70.376  -20.208 -40.015  1.00 76.87  ? 157 ARG F O   1 
ATOM   8233  C CB  . ARG F  1 157 ? -68.563  -18.866 -42.070  1.00 76.39  ? 157 ARG F CB  1 
ATOM   8234  C CG  . ARG F  1 157 ? -68.088  -18.638 -43.472  1.00 78.19  ? 157 ARG F CG  1 
ATOM   8235  C CD  . ARG F  1 157 ? -66.688  -19.140 -43.634  1.00 78.22  ? 157 ARG F CD  1 
ATOM   8236  N NE  . ARG F  1 157 ? -66.595  -19.865 -44.887  1.00 81.62  ? 157 ARG F NE  1 
ATOM   8237  C CZ  . ARG F  1 157 ? -66.779  -21.175 -44.997  1.00 83.77  ? 157 ARG F CZ  1 
ATOM   8238  N NH1 . ARG F  1 157 ? -67.053  -21.932 -43.907  1.00 82.77  ? 157 ARG F NH1 1 
ATOM   8239  N NH2 . ARG F  1 157 ? -66.658  -21.726 -46.198  1.00 87.28  ? 157 ARG F NH2 1 
ATOM   8240  N N   . THR F  1 158 ? -71.012  -18.055 -39.925  1.00 75.22  ? 158 THR F N   1 
ATOM   8241  C CA  . THR F  1 158 ? -71.555  -18.114 -38.574  1.00 74.55  ? 158 THR F CA  1 
ATOM   8242  C C   . THR F  1 158 ? -73.086  -18.198 -38.575  1.00 77.15  ? 158 THR F C   1 
ATOM   8243  O O   . THR F  1 158 ? -73.690  -18.708 -37.629  1.00 77.91  ? 158 THR F O   1 
ATOM   8244  C CB  . THR F  1 158 ? -71.189  -16.856 -37.782  1.00 72.19  ? 158 THR F CB  1 
ATOM   8245  O OG1 . THR F  1 158 ? -71.689  -15.710 -38.483  1.00 72.77  ? 158 THR F OG1 1 
ATOM   8246  C CG2 . THR F  1 158 ? -69.662  -16.744 -37.592  1.00 69.94  ? 158 THR F CG2 1 
ATOM   8247  N N   . GLY F  1 159 ? -73.715  -17.680 -39.626  1.00 78.90  ? 159 GLY F N   1 
ATOM   8248  C CA  . GLY F  1 159 ? -75.150  -17.558 -39.665  1.00 81.72  ? 159 GLY F CA  1 
ATOM   8249  C C   . GLY F  1 159 ? -75.669  -16.313 -38.985  1.00 81.16  ? 159 GLY F C   1 
ATOM   8250  O O   . GLY F  1 159 ? -76.872  -16.151 -38.891  1.00 83.80  ? 159 GLY F O   1 
ATOM   8251  N N   . GLN F  1 160 ? -74.787  -15.440 -38.503  1.00 78.22  ? 160 GLN F N   1 
ATOM   8252  C CA  . GLN F  1 160 ? -75.200  -14.193 -37.870  1.00 77.96  ? 160 GLN F CA  1 
ATOM   8253  C C   . GLN F  1 160 ? -75.423  -13.134 -38.931  1.00 78.86  ? 160 GLN F C   1 
ATOM   8254  O O   . GLN F  1 160 ? -74.821  -13.207 -39.981  1.00 78.57  ? 160 GLN F O   1 
ATOM   8255  C CB  . GLN F  1 160 ? -74.116  -13.713 -36.905  1.00 74.88  ? 160 GLN F CB  1 
ATOM   8256  C CG  . GLN F  1 160 ? -73.713  -14.739 -35.850  1.00 73.94  ? 160 GLN F CG  1 
ATOM   8257  C CD  . GLN F  1 160 ? -74.707  -14.857 -34.704  1.00 75.64  ? 160 GLN F CD  1 
ATOM   8258  O OE1 . GLN F  1 160 ? -75.726  -14.146 -34.646  1.00 77.66  ? 160 GLN F OE1 1 
ATOM   8259  N NE2 . GLN F  1 160 ? -74.421  -15.773 -33.789  1.00 75.27  ? 160 GLN F NE2 1 
ATOM   8260  N N   . SER F  1 161 ? -76.272  -12.144 -38.674  1.00 80.32  ? 161 SER F N   1 
ATOM   8261  C CA  . SER F  1 161 ? -76.506  -11.092 -39.661  1.00 81.50  ? 161 SER F CA  1 
ATOM   8262  C C   . SER F  1 161 ? -75.329  -10.138 -39.750  1.00 78.87  ? 161 SER F C   1 
ATOM   8263  O O   . SER F  1 161 ? -74.671  -9.883  -38.756  1.00 76.70  ? 161 SER F O   1 
ATOM   8264  C CB  . SER F  1 161 ? -77.779  -10.315 -39.329  1.00 84.37  ? 161 SER F CB  1 
ATOM   8265  O OG  . SER F  1 161 ? -77.609  -9.484  -38.191  1.00 83.23  ? 161 SER F OG  1 
ATOM   8266  N N   . ILE F  1 162 ? -75.102  -9.600  -40.944  1.00 79.56  ? 162 ILE F N   1 
ATOM   8267  C CA  . ILE F  1 162 ? -74.131  -8.523  -41.184  1.00 78.02  ? 162 ILE F CA  1 
ATOM   8268  C C   . ILE F  1 162 ? -74.175  -7.401  -40.116  1.00 77.35  ? 162 ILE F C   1 
ATOM   8269  O O   . ILE F  1 162 ? -73.117  -6.982  -39.591  1.00 75.13  ? 162 ILE F O   1 
ATOM   8270  C CB  . ILE F  1 162 ? -74.288  -7.993  -42.626  1.00 80.11  ? 162 ILE F CB  1 
ATOM   8271  C CG1 . ILE F  1 162 ? -73.599  -8.957  -43.589  1.00 80.05  ? 162 ILE F CG1 1 
ATOM   8272  C CG2 . ILE F  1 162 ? -73.717  -6.603  -42.783  1.00 79.69  ? 162 ILE F CG2 1 
ATOM   8273  C CD1 . ILE F  1 162 ? -74.062  -8.832  -45.021  1.00 83.11  ? 162 ILE F CD1 1 
ATOM   8274  N N   . GLU F  1 163 ? -75.390  -6.960  -39.777  1.00 79.71  ? 163 GLU F N   1 
ATOM   8275  C CA  . GLU F  1 163 ? -75.596  -5.890  -38.796  1.00 80.00  ? 163 GLU F CA  1 
ATOM   8276  C C   . GLU F  1 163 ? -75.054  -6.224  -37.429  1.00 77.90  ? 163 GLU F C   1 
ATOM   8277  O O   . GLU F  1 163 ? -74.390  -5.376  -36.796  1.00 76.80  ? 163 GLU F O   1 
ATOM   8278  C CB  . GLU F  1 163 ? -77.064  -5.518  -38.661  1.00 83.59  ? 163 GLU F CB  1 
ATOM   8279  C CG  . GLU F  1 163 ? -77.599  -4.801  -39.884  1.00 86.16  ? 163 GLU F CG  1 
ATOM   8280  C CD  . GLU F  1 163 ? -77.852  -5.738  -41.090  1.00 87.21  ? 163 GLU F CD  1 
ATOM   8281  O OE1 . GLU F  1 163 ? -78.149  -6.972  -40.906  1.00 87.27  ? 163 GLU F OE1 1 
ATOM   8282  O OE2 . GLU F  1 163 ? -77.773  -5.212  -42.247  1.00 88.42  ? 163 GLU F OE2 1 
ATOM   8283  N N   . LYS F  1 164 ? -75.356  -7.447  -36.982  1.00 77.77  ? 164 LYS F N   1 
ATOM   8284  C CA  . LYS F  1 164 ? -74.851  -7.931  -35.704  1.00 76.07  ? 164 LYS F CA  1 
ATOM   8285  C C   . LYS F  1 164 ? -73.300  -8.049  -35.680  1.00 72.89  ? 164 LYS F C   1 
ATOM   8286  O O   . LYS F  1 164 ? -72.662  -7.659  -34.688  1.00 71.69  ? 164 LYS F O   1 
ATOM   8287  C CB  . LYS F  1 164 ? -75.523  -9.254  -35.315  1.00 77.06  ? 164 LYS F CB  1 
ATOM   8288  C CG  . LYS F  1 164 ? -75.046  -9.771  -33.965  1.00 75.72  ? 164 LYS F CG  1 
ATOM   8289  C CD  . LYS F  1 164 ? -75.692  -11.074 -33.575  1.00 77.04  ? 164 LYS F CD  1 
ATOM   8290  C CE  . LYS F  1 164 ? -74.876  -11.776 -32.510  1.00 75.22  ? 164 LYS F CE  1 
ATOM   8291  N NZ  . LYS F  1 164 ? -74.878  -11.072 -31.201  1.00 75.60  ? 164 LYS F NZ  1 
ATOM   8292  N N   . ILE F  1 165 ? -72.712  -8.580  -36.760  1.00 72.03  ? 165 ILE F N   1 
ATOM   8293  C CA  . ILE F  1 165 ? -71.266  -8.663  -36.885  1.00 69.75  ? 165 ILE F CA  1 
ATOM   8294  C C   . ILE F  1 165 ? -70.637  -7.268  -36.753  1.00 69.32  ? 165 ILE F C   1 
ATOM   8295  O O   . ILE F  1 165 ? -69.700  -7.077  -35.966  1.00 67.89  ? 165 ILE F O   1 
ATOM   8296  C CB  . ILE F  1 165 ? -70.811  -9.275  -38.231  1.00 69.81  ? 165 ILE F CB  1 
ATOM   8297  C CG1 . ILE F  1 165 ? -71.467  -10.623 -38.497  1.00 70.82  ? 165 ILE F CG1 1 
ATOM   8298  C CG2 . ILE F  1 165 ? -69.288  -9.419  -38.269  1.00 67.97  ? 165 ILE F CG2 1 
ATOM   8299  C CD1 . ILE F  1 165 ? -70.880  -11.769 -37.701  1.00 69.45  ? 165 ILE F CD1 1 
ATOM   8300  N N   . GLN F  1 166 ? -71.156  -6.317  -37.532  1.00 70.94  ? 166 GLN F N   1 
ATOM   8301  C CA  . GLN F  1 166 ? -70.694  -4.946  -37.505  1.00 71.18  ? 166 GLN F CA  1 
ATOM   8302  C C   . GLN F  1 166 ? -70.706  -4.389  -36.084  1.00 71.05  ? 166 GLN F C   1 
ATOM   8303  O O   . GLN F  1 166 ? -69.746  -3.757  -35.659  1.00 70.26  ? 166 GLN F O   1 
ATOM   8304  C CB  . GLN F  1 166 ? -71.536  -4.065  -38.431  1.00 73.57  ? 166 GLN F CB  1 
ATOM   8305  C CG  . GLN F  1 166 ? -71.143  -2.584  -38.392  1.00 74.34  ? 166 GLN F CG  1 
ATOM   8306  C CD  . GLN F  1 166 ? -70.037  -2.181  -39.373  1.00 73.99  ? 166 GLN F CD  1 
ATOM   8307  O OE1 . GLN F  1 166 ? -69.337  -3.006  -39.959  1.00 72.90  ? 166 GLN F OE1 1 
ATOM   8308  N NE2 . GLN F  1 166 ? -69.885  -0.899  -39.560  1.00 75.38  ? 166 GLN F NE2 1 
ATOM   8309  N N   . LYS F  1 167 ? -71.780  -4.649  -35.344  1.00 72.26  ? 167 LYS F N   1 
ATOM   8310  C CA  . LYS F  1 167 ? -71.890  -4.161  -33.976  1.00 72.79  ? 167 LYS F CA  1 
ATOM   8311  C C   . LYS F  1 167 ? -70.932  -4.867  -33.043  1.00 70.75  ? 167 LYS F C   1 
ATOM   8312  O O   . LYS F  1 167 ? -70.272  -4.215  -32.240  1.00 70.56  ? 167 LYS F O   1 
ATOM   8313  C CB  . LYS F  1 167 ? -73.331  -4.228  -33.438  1.00 75.36  ? 167 LYS F CB  1 
ATOM   8314  C CG  . LYS F  1 167 ? -73.441  -3.819  -31.955  1.00 76.40  ? 167 LYS F CG  1 
ATOM   8315  C CD  . LYS F  1 167 ? -74.893  -3.653  -31.488  1.00 79.87  ? 167 LYS F CD  1 
ATOM   8316  C CE  . LYS F  1 167 ? -75.517  -2.383  -32.100  1.00 82.43  ? 167 LYS F CE  1 
ATOM   8317  N NZ  . LYS F  1 167 ? -77.015  -2.441  -32.245  1.00 86.04  ? 167 LYS F NZ  1 
ATOM   8318  N N   . ASP F  1 168 ? -70.848  -6.190  -33.179  1.00 69.57  ? 168 ASP F N   1 
ATOM   8319  C CA  . ASP F  1 168 ? -70.036  -7.021  -32.296  1.00 67.99  ? 168 ASP F CA  1 
ATOM   8320  C C   . ASP F  1 168 ? -68.554  -6.894  -32.506  1.00 66.24  ? 168 ASP F C   1 
ATOM   8321  O O   . ASP F  1 168 ? -67.805  -7.243  -31.634  1.00 65.41  ? 168 ASP F O   1 
ATOM   8322  C CB  . ASP F  1 168 ? -70.424  -8.479  -32.416  1.00 67.75  ? 168 ASP F CB  1 
ATOM   8323  C CG  . ASP F  1 168 ? -71.759  -8.802  -31.736  1.00 69.83  ? 168 ASP F CG  1 
ATOM   8324  O OD1 . ASP F  1 168 ? -72.322  -7.920  -31.029  1.00 71.47  ? 168 ASP F OD1 1 
ATOM   8325  O OD2 . ASP F  1 168 ? -72.229  -9.967  -31.904  1.00 70.22  ? 168 ASP F OD2 1 
ATOM   8326  N N   . THR F  1 169 ? -68.130  -6.387  -33.648  1.00 66.11  ? 169 THR F N   1 
ATOM   8327  C CA  . THR F  1 169 ? -66.709  -6.188  -33.906  1.00 65.08  ? 169 THR F CA  1 
ATOM   8328  C C   . THR F  1 169 ? -66.197  -4.713  -33.789  1.00 65.90  ? 169 THR F C   1 
ATOM   8329  O O   . THR F  1 169 ? -65.037  -4.424  -34.109  1.00 65.63  ? 169 THR F O   1 
ATOM   8330  C CB  . THR F  1 169 ? -66.340  -6.775  -35.289  1.00 64.80  ? 169 THR F CB  1 
ATOM   8331  O OG1 . THR F  1 169 ? -67.088  -6.104  -36.311  1.00 66.11  ? 169 THR F OG1 1 
ATOM   8332  C CG2 . THR F  1 169 ? -66.640  -8.233  -35.328  1.00 64.29  ? 169 THR F CG2 1 
ATOM   8333  N N   . ASP F  1 170 ? -67.062  -3.797  -33.343  1.00 67.34  ? 170 ASP F N   1 
ATOM   8334  C CA  . ASP F  1 170 ? -66.697  -2.389  -33.224  1.00 68.62  ? 170 ASP F CA  1 
ATOM   8335  C C   . ASP F  1 170 ? -65.467  -2.207  -32.326  1.00 68.22  ? 170 ASP F C   1 
ATOM   8336  O O   . ASP F  1 170 ? -64.585  -1.388  -32.620  1.00 68.86  ? 170 ASP F O   1 
ATOM   8337  C CB  . ASP F  1 170 ? -67.870  -1.575  -32.707  1.00 70.65  ? 170 ASP F CB  1 
ATOM   8338  C CG  . ASP F  1 170 ? -67.606  -0.098  -32.708  1.00 72.46  ? 170 ASP F CG  1 
ATOM   8339  O OD1 . ASP F  1 170 ? -67.668  0.504   -31.638  1.00 73.79  ? 170 ASP F OD1 1 
ATOM   8340  O OD2 . ASP F  1 170 ? -67.349  0.488   -33.766  1.00 72.95  ? 170 ASP F OD2 1 
ATOM   8341  N N   . ARG F  1 171 ? -65.420  -2.966  -31.233  1.00 67.57  ? 171 ARG F N   1 
ATOM   8342  C CA  . ARG F  1 171 ? -64.286  -2.959  -30.330  1.00 67.45  ? 171 ARG F CA  1 
ATOM   8343  C C   . ARG F  1 171 ? -63.811  -4.405  -30.150  1.00 65.79  ? 171 ARG F C   1 
ATOM   8344  O O   . ARG F  1 171 ? -64.424  -5.327  -30.700  1.00 64.89  ? 171 ARG F O   1 
ATOM   8345  C CB  . ARG F  1 171 ? -64.688  -2.370  -28.987  1.00 69.07  ? 171 ARG F CB  1 
ATOM   8346  C CG  . ARG F  1 171 ? -65.303  -0.984  -29.034  1.00 71.26  ? 171 ARG F CG  1 
ATOM   8347  C CD  . ARG F  1 171 ? -64.237  0.059   -28.827  1.00 72.55  ? 171 ARG F CD  1 
ATOM   8348  N NE  . ARG F  1 171 ? -64.849  1.368   -28.793  1.00 75.04  ? 171 ARG F NE  1 
ATOM   8349  C CZ  . ARG F  1 171 ? -64.174  2.506   -28.791  1.00 76.87  ? 171 ARG F CZ  1 
ATOM   8350  N NH1 . ARG F  1 171 ? -62.848  2.469   -28.840  1.00 76.48  ? 171 ARG F NH1 1 
ATOM   8351  N NH2 . ARG F  1 171 ? -64.823  3.661   -28.747  1.00 79.46  ? 171 ARG F NH2 1 
ATOM   8352  N N   . ASP F  1 172 ? -62.733  -4.627  -29.408  1.00 65.72  ? 172 ASP F N   1 
ATOM   8353  C CA  . ASP F  1 172 ? -62.293  -5.990  -29.171  1.00 64.55  ? 172 ASP F CA  1 
ATOM   8354  C C   . ASP F  1 172 ? -63.391  -6.767  -28.456  1.00 64.42  ? 172 ASP F C   1 
ATOM   8355  O O   . ASP F  1 172 ? -63.942  -6.282  -27.473  1.00 65.64  ? 172 ASP F O   1 
ATOM   8356  C CB  . ASP F  1 172 ? -61.039  -5.995  -28.313  1.00 65.13  ? 172 ASP F CB  1 
ATOM   8357  C CG  . ASP F  1 172 ? -59.794  -5.611  -29.087  1.00 65.51  ? 172 ASP F CG  1 
ATOM   8358  O OD1 . ASP F  1 172 ? -59.876  -5.484  -30.335  1.00 65.15  ? 172 ASP F OD1 1 
ATOM   8359  O OD2 . ASP F  1 172 ? -58.721  -5.460  -28.450  1.00 66.54  ? 172 ASP F OD2 1 
ATOM   8360  N N   . ASN F  1 173 ? -63.703  -7.967  -28.953  1.00 63.41  ? 173 ASN F N   1 
ATOM   8361  C CA  . ASN F  1 173 ? -64.727  -8.797  -28.377  1.00 63.63  ? 173 ASN F CA  1 
ATOM   8362  C C   . ASN F  1 173 ? -64.162  -10.145 -28.047  1.00 63.00  ? 173 ASN F C   1 
ATOM   8363  O O   . ASN F  1 173 ? -63.846  -10.903 -28.919  1.00 62.22  ? 173 ASN F O   1 
ATOM   8364  C CB  . ASN F  1 173 ? -65.861  -8.931  -29.376  1.00 63.69  ? 173 ASN F CB  1 
ATOM   8365  C CG  . ASN F  1 173 ? -67.119  -9.513  -28.774  1.00 64.73  ? 173 ASN F CG  1 
ATOM   8366  O OD1 . ASN F  1 173 ? -67.165  -9.894  -27.594  1.00 65.39  ? 173 ASN F OD1 1 
ATOM   8367  N ND2 . ASN F  1 173 ? -68.167  -9.591  -29.590  1.00 65.32  ? 173 ASN F ND2 1 
ATOM   8368  N N   . PHE F  1 174 ? -64.016  -10.441 -26.780  1.00 63.68  ? 174 PHE F N   1 
ATOM   8369  C CA  . PHE F  1 174 ? -63.441  -11.715 -26.348  1.00 63.46  ? 174 PHE F CA  1 
ATOM   8370  C C   . PHE F  1 174 ? -64.514  -12.741 -26.057  1.00 63.98  ? 174 PHE F C   1 
ATOM   8371  O O   . PHE F  1 174 ? -65.484  -12.464 -25.381  1.00 65.19  ? 174 PHE F O   1 
ATOM   8372  C CB  . PHE F  1 174 ? -62.554  -11.520 -25.118  1.00 64.36  ? 174 PHE F CB  1 
ATOM   8373  C CG  . PHE F  1 174 ? -61.298  -10.749 -25.405  1.00 64.28  ? 174 PHE F CG  1 
ATOM   8374  C CD1 . PHE F  1 174 ? -60.183  -11.394 -25.948  1.00 63.84  ? 174 PHE F CD1 1 
ATOM   8375  C CD2 . PHE F  1 174 ? -61.211  -9.388  -25.146  1.00 65.14  ? 174 PHE F CD2 1 
ATOM   8376  C CE1 . PHE F  1 174 ? -58.991  -10.702 -26.209  1.00 64.36  ? 174 PHE F CE1 1 
ATOM   8377  C CE2 . PHE F  1 174 ? -60.027  -8.698  -25.411  1.00 65.53  ? 174 PHE F CE2 1 
ATOM   8378  C CZ  . PHE F  1 174 ? -58.917  -9.347  -25.949  1.00 65.18  ? 174 PHE F CZ  1 
ATOM   8379  N N   . LEU F  1 175 ? -64.325  -13.943 -26.579  1.00 63.49  ? 175 LEU F N   1 
ATOM   8380  C CA  . LEU F  1 175 ? -65.300  -15.012 -26.499  1.00 64.24  ? 175 LEU F CA  1 
ATOM   8381  C C   . LEU F  1 175 ? -64.666  -16.243 -25.919  1.00 64.63  ? 175 LEU F C   1 
ATOM   8382  O O   . LEU F  1 175 ? -63.525  -16.587 -26.259  1.00 64.03  ? 175 LEU F O   1 
ATOM   8383  C CB  . LEU F  1 175 ? -65.746  -15.318 -27.904  1.00 63.76  ? 175 LEU F CB  1 
ATOM   8384  C CG  . LEU F  1 175 ? -66.998  -14.649 -28.483  1.00 64.31  ? 175 LEU F CG  1 
ATOM   8385  C CD1 . LEU F  1 175 ? -67.125  -13.214 -28.077  1.00 64.45  ? 175 LEU F CD1 1 
ATOM   8386  C CD2 . LEU F  1 175 ? -66.906  -14.701 -29.983  1.00 63.70  ? 175 LEU F CD2 1 
ATOM   8387  N N   . THR F  1 176 ? -65.376  -16.918 -25.029  1.00 66.06  ? 176 THR F N   1 
ATOM   8388  C CA  . THR F  1 176 ? -64.948  -18.253 -24.572  1.00 66.84  ? 176 THR F CA  1 
ATOM   8389  C C   . THR F  1 176 ? -65.208  -19.294 -25.666  1.00 66.80  ? 176 THR F C   1 
ATOM   8390  O O   . THR F  1 176 ? -65.929  -19.007 -26.643  1.00 66.46  ? 176 THR F O   1 
ATOM   8391  C CB  . THR F  1 176 ? -65.668  -18.687 -23.300  1.00 68.89  ? 176 THR F CB  1 
ATOM   8392  O OG1 . THR F  1 176 ? -67.052  -18.865 -23.579  1.00 69.98  ? 176 THR F OG1 1 
ATOM   8393  C CG2 . THR F  1 176 ? -65.478  -17.677 -22.209  1.00 69.52  ? 176 THR F CG2 1 
ATOM   8394  N N   . ALA F  1 177 ? -64.628  -20.487 -25.525  1.00 67.50  ? 177 ALA F N   1 
ATOM   8395  C CA  . ALA F  1 177 ? -64.930  -21.577 -26.470  1.00 68.13  ? 177 ALA F CA  1 
ATOM   8396  C C   . ALA F  1 177 ? -66.459  -21.787 -26.630  1.00 69.39  ? 177 ALA F C   1 
ATOM   8397  O O   . ALA F  1 177 ? -66.961  -21.834 -27.757  1.00 69.37  ? 177 ALA F O   1 
ATOM   8398  C CB  . ALA F  1 177 ? -64.244  -22.870 -26.060  1.00 69.41  ? 177 ALA F CB  1 
ATOM   8399  N N   . GLU F  1 178 ? -67.187  -21.887 -25.508  1.00 70.90  ? 178 GLU F N   1 
ATOM   8400  C CA  . GLU F  1 178 ? -68.635  -22.052 -25.558  1.00 72.74  ? 178 GLU F CA  1 
ATOM   8401  C C   . GLU F  1 178 ? -69.289  -20.895 -26.285  1.00 71.93  ? 178 GLU F C   1 
ATOM   8402  O O   . GLU F  1 178 ? -70.176  -21.105 -27.105  1.00 72.92  ? 178 GLU F O   1 
ATOM   8403  C CB  . GLU F  1 178 ? -69.240  -22.180 -24.164  1.00 74.91  ? 178 GLU F CB  1 
ATOM   8404  C CG  . GLU F  1 178 ? -69.018  -23.523 -23.472  1.00 76.81  ? 178 GLU F CG  1 
ATOM   8405  C CD  . GLU F  1 178 ? -69.603  -24.745 -24.237  1.00 78.52  ? 178 GLU F CD  1 
ATOM   8406  O OE1 . GLU F  1 178 ? -70.627  -24.615 -25.034  1.00 79.30  ? 178 GLU F OE1 1 
ATOM   8407  O OE2 . GLU F  1 178 ? -69.019  -25.866 -24.008  1.00 79.49  ? 178 GLU F OE2 1 
ATOM   8408  N N   . GLU F  1 179 ? -68.848  -19.673 -25.993  1.00 70.47  ? 179 GLU F N   1 
ATOM   8409  C CA  . GLU F  1 179 ? -69.463  -18.495 -26.592  1.00 70.01  ? 179 GLU F CA  1 
ATOM   8410  C C   . GLU F  1 179 ? -69.223  -18.479 -28.100  1.00 68.77  ? 179 GLU F C   1 
ATOM   8411  O O   . GLU F  1 179 ? -70.121  -18.064 -28.876  1.00 69.41  ? 179 GLU F O   1 
ATOM   8412  C CB  . GLU F  1 179 ? -68.926  -17.212 -25.957  1.00 69.02  ? 179 GLU F CB  1 
ATOM   8413  C CG  . GLU F  1 179 ? -69.477  -16.953 -24.597  1.00 70.96  ? 179 GLU F CG  1 
ATOM   8414  C CD  . GLU F  1 179 ? -68.763  -15.843 -23.869  1.00 70.38  ? 179 GLU F CD  1 
ATOM   8415  O OE1 . GLU F  1 179 ? -67.602  -15.459 -24.204  1.00 68.47  ? 179 GLU F OE1 1 
ATOM   8416  O OE2 . GLU F  1 179 ? -69.377  -15.373 -22.882  1.00 72.40  ? 179 GLU F OE2 1 
ATOM   8417  N N   . ALA F  1 180 ? -68.017  -18.917 -28.485  1.00 67.45  ? 180 ALA F N   1 
ATOM   8418  C CA  . ALA F  1 180 ? -67.635  -19.048 -29.899  1.00 66.76  ? 180 ALA F CA  1 
ATOM   8419  C C   . ALA F  1 180 ? -68.550  -20.037 -30.668  1.00 68.55  ? 180 ALA F C   1 
ATOM   8420  O O   . ALA F  1 180 ? -68.921  -19.784 -31.827  1.00 68.79  ? 180 ALA F O   1 
ATOM   8421  C CB  . ALA F  1 180 ? -66.167  -19.452 -30.036  1.00 65.82  ? 180 ALA F CB  1 
ATOM   8422  N N   . LYS F  1 181 ? -68.888  -21.156 -30.024  1.00 70.15  ? 181 LYS F N   1 
ATOM   8423  C CA  . LYS F  1 181 ? -69.779  -22.149 -30.582  1.00 72.43  ? 181 LYS F CA  1 
ATOM   8424  C C   . LYS F  1 181 ? -71.200  -21.581 -30.729  1.00 73.90  ? 181 LYS F C   1 
ATOM   8425  O O   . LYS F  1 181 ? -71.853  -21.758 -31.744  1.00 75.23  ? 181 LYS F O   1 
ATOM   8426  C CB  . LYS F  1 181 ? -69.776  -23.399 -29.705  1.00 74.12  ? 181 LYS F CB  1 
ATOM   8427  C CG  . LYS F  1 181 ? -70.729  -24.474 -30.190  1.00 77.04  ? 181 LYS F CG  1 
ATOM   8428  C CD  . LYS F  1 181 ? -70.849  -25.586 -29.192  1.00 79.09  ? 181 LYS F CD  1 
ATOM   8429  C CE  . LYS F  1 181 ? -72.135  -26.334 -29.392  1.00 82.56  ? 181 LYS F CE  1 
ATOM   8430  N NZ  . LYS F  1 181 ? -72.267  -27.288 -28.274  1.00 84.76  ? 181 LYS F NZ  1 
ATOM   8431  N N   . GLU F  1 182 ? -71.646  -20.892 -29.688  1.00 74.06  ? 182 GLU F N   1 
ATOM   8432  C CA  . GLU F  1 182 ? -72.910  -20.198 -29.666  1.00 75.73  ? 182 GLU F CA  1 
ATOM   8433  C C   . GLU F  1 182 ? -72.970  -19.159 -30.769  1.00 74.64  ? 182 GLU F C   1 
ATOM   8434  O O   . GLU F  1 182 ? -74.017  -18.914 -31.338  1.00 76.51  ? 182 GLU F O   1 
ATOM   8435  C CB  . GLU F  1 182 ? -73.110  -19.540 -28.298  1.00 76.10  ? 182 GLU F CB  1 
ATOM   8436  C CG  . GLU F  1 182 ? -74.481  -18.920 -28.129  1.00 78.69  ? 182 GLU F CG  1 
ATOM   8437  C CD  . GLU F  1 182 ? -75.553  -19.998 -28.038  1.00 82.24  ? 182 GLU F CD  1 
ATOM   8438  O OE1 . GLU F  1 182 ? -76.732  -19.788 -28.483  1.00 84.87  ? 182 GLU F OE1 1 
ATOM   8439  O OE2 . GLU F  1 182 ? -75.223  -21.091 -27.487  1.00 82.82  ? 182 GLU F OE2 1 
ATOM   8440  N N   . TYR F  1 183 ? -71.849  -18.529 -31.062  1.00 71.99  ? 183 TYR F N   1 
ATOM   8441  C CA  . TYR F  1 183 ? -71.824  -17.505 -32.067  1.00 71.14  ? 183 TYR F CA  1 
ATOM   8442  C C   . TYR F  1 183 ? -71.843  -18.123 -33.466  1.00 71.82  ? 183 TYR F C   1 
ATOM   8443  O O   . TYR F  1 183 ? -72.241  -17.455 -34.411  1.00 72.26  ? 183 TYR F O   1 
ATOM   8444  C CB  . TYR F  1 183 ? -70.583  -16.652 -31.888  1.00 68.61  ? 183 TYR F CB  1 
ATOM   8445  C CG  . TYR F  1 183 ? -70.723  -15.253 -32.437  1.00 68.14  ? 183 TYR F CG  1 
ATOM   8446  C CD1 . TYR F  1 183 ? -71.265  -14.230 -31.652  1.00 68.66  ? 183 TYR F CD1 1 
ATOM   8447  C CD2 . TYR F  1 183 ? -70.279  -14.942 -33.741  1.00 67.55  ? 183 TYR F CD2 1 
ATOM   8448  C CE1 . TYR F  1 183 ? -71.402  -12.944 -32.148  1.00 68.58  ? 183 TYR F CE1 1 
ATOM   8449  C CE2 . TYR F  1 183 ? -70.403  -13.656 -34.259  1.00 67.42  ? 183 TYR F CE2 1 
ATOM   8450  C CZ  . TYR F  1 183 ? -70.972  -12.663 -33.459  1.00 67.89  ? 183 TYR F CZ  1 
ATOM   8451  O OH  . TYR F  1 183 ? -71.090  -11.386 -33.973  1.00 68.08  ? 183 TYR F OH  1 
ATOM   8452  N N   . GLY F  1 184 ? -71.414  -19.379 -33.603  1.00 72.26  ? 184 GLY F N   1 
ATOM   8453  C CA  . GLY F  1 184 ? -71.294  -20.025 -34.900  1.00 73.27  ? 184 GLY F CA  1 
ATOM   8454  C C   . GLY F  1 184 ? -69.903  -19.968 -35.509  1.00 71.59  ? 184 GLY F C   1 
ATOM   8455  O O   . GLY F  1 184 ? -69.743  -20.233 -36.697  1.00 72.56  ? 184 GLY F O   1 
ATOM   8456  N N   . LEU F  1 185 ? -68.888  -19.591 -34.729  1.00 69.52  ? 185 LEU F N   1 
ATOM   8457  C CA  . LEU F  1 185 ? -67.525  -19.532 -35.273  1.00 68.45  ? 185 LEU F CA  1 
ATOM   8458  C C   . LEU F  1 185 ? -66.902  -20.929 -35.298  1.00 69.52  ? 185 LEU F C   1 
ATOM   8459  O O   . LEU F  1 185 ? -66.045  -21.226 -36.137  1.00 69.99  ? 185 LEU F O   1 
ATOM   8460  C CB  . LEU F  1 185 ? -66.639  -18.620 -34.444  1.00 66.40  ? 185 LEU F CB  1 
ATOM   8461  C CG  . LEU F  1 185 ? -66.931  -17.147 -34.497  1.00 65.48  ? 185 LEU F CG  1 
ATOM   8462  C CD1 . LEU F  1 185 ? -66.408  -16.499 -33.204  1.00 64.18  ? 185 LEU F CD1 1 
ATOM   8463  C CD2 . LEU F  1 185 ? -66.295  -16.574 -35.759  1.00 65.40  ? 185 LEU F CD2 1 
ATOM   8464  N N   . ILE F  1 186 ? -67.326  -21.745 -34.328  1.00 70.23  ? 186 ILE F N   1 
ATOM   8465  C CA  . ILE F  1 186 ? -66.983  -23.161 -34.241  1.00 71.82  ? 186 ILE F CA  1 
ATOM   8466  C C   . ILE F  1 186 ? -68.247  -24.044 -34.128  1.00 74.21  ? 186 ILE F C   1 
ATOM   8467  O O   . ILE F  1 186 ? -69.336  -23.582 -33.848  1.00 74.58  ? 186 ILE F O   1 
ATOM   8468  C CB  . ILE F  1 186 ? -65.996  -23.462 -33.086  1.00 70.93  ? 186 ILE F CB  1 
ATOM   8469  C CG1 . ILE F  1 186 ? -66.537  -22.960 -31.763  1.00 70.12  ? 186 ILE F CG1 1 
ATOM   8470  C CG2 . ILE F  1 186 ? -64.646  -22.840 -33.367  1.00 69.52  ? 186 ILE F CG2 1 
ATOM   8471  C CD1 . ILE F  1 186 ? -65.846  -23.524 -30.539  1.00 70.19  ? 186 ILE F CD1 1 
ATOM   8472  N N   . ASP F  1 187 ? -68.075  -25.328 -34.348  1.00 76.28  ? 187 ASP F N   1 
ATOM   8473  C CA  . ASP F  1 187 ? -69.170  -26.235 -34.278  1.00 79.04  ? 187 ASP F CA  1 
ATOM   8474  C C   . ASP F  1 187 ? -69.191  -26.968 -32.949  1.00 79.70  ? 187 ASP F C   1 
ATOM   8475  O O   . ASP F  1 187 ? -70.247  -27.173 -32.373  1.00 81.26  ? 187 ASP F O   1 
ATOM   8476  C CB  . ASP F  1 187 ? -69.078  -27.228 -35.431  1.00 81.70  ? 187 ASP F CB  1 
ATOM   8477  C CG  . ASP F  1 187 ? -68.982  -26.549 -36.778  1.00 81.52  ? 187 ASP F CG  1 
ATOM   8478  O OD1 . ASP F  1 187 ? -69.932  -25.870 -37.196  1.00 81.78  ? 187 ASP F OD1 1 
ATOM   8479  O OD2 . ASP F  1 187 ? -67.936  -26.695 -37.416  1.00 81.47  ? 187 ASP F OD2 1 
ATOM   8480  N N   . GLU F  1 188 ? -68.016  -27.342 -32.459  1.00 78.86  ? 188 GLU F N   1 
ATOM   8481  C CA  . GLU F  1 188 ? -67.895  -28.183 -31.293  1.00 79.96  ? 188 GLU F CA  1 
ATOM   8482  C C   . GLU F  1 188 ? -66.744  -27.730 -30.411  1.00 77.79  ? 188 GLU F C   1 
ATOM   8483  O O   . GLU F  1 188 ? -65.697  -27.369 -30.925  1.00 76.44  ? 188 GLU F O   1 
ATOM   8484  C CB  . GLU F  1 188 ? -67.653  -29.619 -31.760  1.00 82.88  ? 188 GLU F CB  1 
ATOM   8485  C CG  . GLU F  1 188 ? -67.979  -30.675 -30.721  1.00 85.24  ? 188 GLU F CG  1 
ATOM   8486  C CD  . GLU F  1 188 ? -69.389  -30.468 -30.135  1.00 86.36  ? 188 GLU F CD  1 
ATOM   8487  O OE1 . GLU F  1 188 ? -70.397  -31.026 -30.735  1.00 89.20  ? 188 GLU F OE1 1 
ATOM   8488  O OE2 . GLU F  1 188 ? -69.477  -29.723 -29.080  1.00 84.80  ? 188 GLU F OE2 1 
ATOM   8489  N N   . VAL F  1 189 ? -66.921  -27.757 -29.090  1.00 77.91  ? 189 VAL F N   1 
ATOM   8490  C CA  . VAL F  1 189 ? -65.757  -27.654 -28.224  1.00 76.83  ? 189 VAL F CA  1 
ATOM   8491  C C   . VAL F  1 189 ? -65.330  -29.040 -27.755  1.00 79.27  ? 189 VAL F C   1 
ATOM   8492  O O   . VAL F  1 189 ? -66.086  -29.732 -27.087  1.00 81.38  ? 189 VAL F O   1 
ATOM   8493  C CB  . VAL F  1 189 ? -65.896  -26.622 -27.077  1.00 75.38  ? 189 VAL F CB  1 
ATOM   8494  C CG1 . VAL F  1 189 ? -67.113  -25.777 -27.255  1.00 75.01  ? 189 VAL F CG1 1 
ATOM   8495  C CG2 . VAL F  1 189 ? -65.875  -27.259 -25.710  1.00 77.04  ? 189 VAL F CG2 1 
ATOM   8496  N N   . MET F  1 190 ? -64.125  -29.441 -28.150  1.00 79.39  ? 190 MET F N   1 
ATOM   8497  C CA  . MET F  1 190 ? -63.585  -30.778 -27.846  1.00 82.06  ? 190 MET F CA  1 
ATOM   8498  C C   . MET F  1 190 ? -63.335  -31.002 -26.368  1.00 82.70  ? 190 MET F C   1 
ATOM   8499  O O   . MET F  1 190 ? -62.304  -30.635 -25.838  1.00 81.81  ? 190 MET F O   1 
ATOM   8500  C CB  . MET F  1 190 ? -62.285  -31.082 -28.609  1.00 82.50  ? 190 MET F CB  1 
ATOM   8501  C CG  . MET F  1 190 ? -62.217  -30.533 -30.012  1.00 81.54  ? 190 MET F CG  1 
ATOM   8502  S SD  . MET F  1 190 ? -61.164  -31.559 -31.056  1.00 84.43  ? 190 MET F SD  1 
ATOM   8503  C CE  . MET F  1 190 ? -59.529  -31.532 -30.316  1.00 84.56  ? 190 MET F CE  1 
ATOM   8504  N N   . VAL F  1 191 ? -64.292  -31.650 -25.732  1.00 84.76  ? 191 VAL F N   1 
ATOM   8505  C CA  . VAL F  1 191 ? -64.219  -32.013 -24.329  1.00 86.19  ? 191 VAL F CA  1 
ATOM   8506  C C   . VAL F  1 191 ? -63.128  -33.095 -24.120  1.00 88.35  ? 191 VAL F C   1 
ATOM   8507  O O   . VAL F  1 191 ? -62.963  -33.987 -24.952  1.00 90.13  ? 191 VAL F O   1 
ATOM   8508  C CB  . VAL F  1 191 ? -65.618  -32.454 -23.828  1.00 88.47  ? 191 VAL F CB  1 
ATOM   8509  C CG1 . VAL F  1 191 ? -66.019  -33.820 -24.380  1.00 91.78  ? 191 VAL F CG1 1 
ATOM   8510  C CG2 . VAL F  1 191 ? -65.700  -32.439 -22.317  1.00 89.67  ? 191 VAL F CG2 1 
ATOM   8511  N N   . PRO F  1 192 ? -62.348  -32.979 -23.020  1.00 88.51  ? 192 PRO F N   1 
ATOM   8512  C CA  . PRO F  1 192 ? -61.253  -33.907 -22.727  1.00 90.80  ? 192 PRO F CA  1 
ATOM   8513  C C   . PRO F  1 192 ? -61.670  -35.358 -22.756  1.00 94.53  ? 192 PRO F C   1 
ATOM   8514  O O   . PRO F  1 192 ? -62.707  -35.746 -22.219  1.00 96.17  ? 192 PRO F O   1 
ATOM   8515  C CB  . PRO F  1 192 ? -60.801  -33.519 -21.320  1.00 90.94  ? 192 PRO F CB  1 
ATOM   8516  C CG  . PRO F  1 192 ? -61.175  -32.102 -21.182  1.00 87.83  ? 192 PRO F CG  1 
ATOM   8517  C CD  . PRO F  1 192 ? -62.330  -31.821 -22.105  1.00 86.57  ? 192 PRO F CD  1 
ATOM   8518  N N   . GLU F  1 193 ? -60.815  -36.126 -23.414  1.00 96.20  ? 193 GLU F N   1 
ATOM   8519  C CA  . GLU F  1 193 ? -61.037  -37.528 -23.700  1.00 100.06 ? 193 GLU F CA  1 
ATOM   8520  C C   . GLU F  1 193 ? -60.343  -38.348 -22.601  1.00 103.09 ? 193 GLU F C   1 
ATOM   8521  O O   . GLU F  1 193 ? -60.983  -38.895 -21.681  1.00 105.29 ? 193 GLU F O   1 
ATOM   8522  C CB  . GLU F  1 193 ? -60.466  -37.874 -25.086  1.00 100.72 ? 193 GLU F CB  1 
ATOM   8523  C CG  . GLU F  1 193 ? -60.723  -39.296 -25.535  1.00 105.05 ? 193 GLU F CG  1 
ATOM   8524  C CD  . GLU F  1 193 ? -60.039  -39.615 -26.843  1.00 106.24 ? 193 GLU F CD  1 
ATOM   8525  O OE1 . GLU F  1 193 ? -60.442  -40.619 -27.470  1.00 109.63 ? 193 GLU F OE1 1 
ATOM   8526  O OE2 . GLU F  1 193 ? -59.098  -38.868 -27.237  1.00 104.22 ? 193 GLU F OE2 1 
ATOM   8527  N N   . ILE G  1 4   ? -40.149  -23.370 -45.113  1.00 74.95  ? 4   ILE G N   1 
ATOM   8528  C CA  . ILE G  1 4   ? -39.736  -23.863 -43.786  1.00 76.98  ? 4   ILE G CA  1 
ATOM   8529  C C   . ILE G  1 4   ? -39.820  -25.392 -43.610  1.00 78.02  ? 4   ILE G C   1 
ATOM   8530  O O   . ILE G  1 4   ? -38.782  -25.993 -43.364  1.00 79.22  ? 4   ILE G O   1 
ATOM   8531  C CB  . ILE G  1 4   ? -40.284  -22.978 -42.585  1.00 78.22  ? 4   ILE G CB  1 
ATOM   8532  C CG1 . ILE G  1 4   ? -39.761  -23.451 -41.184  1.00 80.70  ? 4   ILE G CG1 1 
ATOM   8533  C CG2 . ILE G  1 4   ? -41.810  -22.753 -42.612  1.00 77.90  ? 4   ILE G CG2 1 
ATOM   8534  C CD1 . ILE G  1 4   ? -39.956  -22.423 -40.076  1.00 82.32  ? 4   ILE G CD1 1 
ATOM   8535  N N   . PRO G  1 5   ? -40.994  -26.049 -43.751  1.00 77.94  ? 5   PRO G N   1 
ATOM   8536  C CA  . PRO G  1 5   ? -41.018  -27.518 -43.503  1.00 79.45  ? 5   PRO G CA  1 
ATOM   8537  C C   . PRO G  1 5   ? -40.483  -28.438 -44.625  1.00 79.21  ? 5   PRO G C   1 
ATOM   8538  O O   . PRO G  1 5   ? -40.418  -28.051 -45.783  1.00 77.59  ? 5   PRO G O   1 
ATOM   8539  C CB  . PRO G  1 5   ? -42.493  -27.822 -43.249  1.00 79.82  ? 5   PRO G CB  1 
ATOM   8540  C CG  . PRO G  1 5   ? -43.256  -26.654 -43.737  1.00 78.21  ? 5   PRO G CG  1 
ATOM   8541  C CD  . PRO G  1 5   ? -42.311  -25.568 -44.175  1.00 76.90  ? 5   PRO G CD  1 
ATOM   8542  N N   . THR G  1 6   ? -40.137  -29.665 -44.254  1.00 81.21  ? 6   THR G N   1 
ATOM   8543  C CA  . THR G  1 6   ? -39.437  -30.652 -45.091  1.00 82.01  ? 6   THR G CA  1 
ATOM   8544  C C   . THR G  1 6   ? -40.360  -31.824 -45.507  1.00 82.96  ? 6   THR G C   1 
ATOM   8545  O O   . THR G  1 6   ? -41.194  -32.265 -44.731  1.00 84.09  ? 6   THR G O   1 
ATOM   8546  C CB  . THR G  1 6   ? -38.209  -31.183 -44.307  1.00 84.37  ? 6   THR G CB  1 
ATOM   8547  O OG1 . THR G  1 6   ? -37.371  -30.085 -44.000  1.00 83.74  ? 6   THR G OG1 1 
ATOM   8548  C CG2 . THR G  1 6   ? -37.402  -32.176 -45.088  1.00 85.82  ? 6   THR G CG2 1 
ATOM   8549  N N   . VAL G  1 7   ? -40.199  -32.320 -46.732  1.00 82.82  ? 7   VAL G N   1 
ATOM   8550  C CA  . VAL G  1 7   ? -40.918  -33.501 -47.228  1.00 84.29  ? 7   VAL G CA  1 
ATOM   8551  C C   . VAL G  1 7   ? -39.951  -34.611 -47.693  1.00 86.65  ? 7   VAL G C   1 
ATOM   8552  O O   . VAL G  1 7   ? -38.886  -34.310 -48.243  1.00 86.36  ? 7   VAL G O   1 
ATOM   8553  C CB  . VAL G  1 7   ? -41.808  -33.090 -48.387  1.00 82.50  ? 7   VAL G CB  1 
ATOM   8554  C CG1 . VAL G  1 7   ? -42.614  -34.265 -48.870  1.00 84.33  ? 7   VAL G CG1 1 
ATOM   8555  C CG2 . VAL G  1 7   ? -42.705  -31.938 -47.975  1.00 80.55  ? 7   VAL G CG2 1 
ATOM   8556  N N   . ILE G  1 8   ? -40.320  -35.884 -47.470  1.00 89.35  ? 8   ILE G N   1 
ATOM   8557  C CA  . ILE G  1 8   ? -39.516  -37.063 -47.885  1.00 92.38  ? 8   ILE G CA  1 
ATOM   8558  C C   . ILE G  1 8   ? -40.023  -37.779 -49.118  1.00 93.33  ? 8   ILE G C   1 
ATOM   8559  O O   . ILE G  1 8   ? -41.218  -37.739 -49.412  1.00 92.49  ? 8   ILE G O   1 
ATOM   8560  C CB  . ILE G  1 8   ? -39.558  -38.136 -46.836  1.00 95.61  ? 8   ILE G CB  1 
ATOM   8561  C CG1 . ILE G  1 8   ? -40.989  -38.209 -46.288  1.00 95.29  ? 8   ILE G CG1 1 
ATOM   8562  C CG2 . ILE G  1 8   ? -38.500  -37.864 -45.780  1.00 96.39  ? 8   ILE G CG2 1 
ATOM   8563  C CD1 . ILE G  1 8   ? -41.868  -39.372 -46.778  1.00 97.65  ? 8   ILE G CD1 1 
ATOM   8564  N N   . GLU G  1 9   ? -39.116  -38.484 -49.796  1.00 95.60  ? 9   GLU G N   1 
ATOM   8565  C CA  . GLU G  1 9   ? -39.423  -39.174 -51.042  1.00 97.07  ? 9   GLU G CA  1 
ATOM   8566  C C   . GLU G  1 9   ? -38.368  -40.225 -51.228  1.00 100.99 ? 9   GLU G C   1 
ATOM   8567  O O   . GLU G  1 9   ? -38.629  -41.393 -50.976  1.00 104.41 ? 9   GLU G O   1 
ATOM   8568  C CB  . GLU G  1 9   ? -39.432  -38.192 -52.241  1.00 94.25  ? 9   GLU G CB  1 
ATOM   8569  C CG  . GLU G  1 9   ? -40.489  -38.494 -53.306  1.00 94.48  ? 9   GLU G CG  1 
ATOM   8570  C CD  . GLU G  1 9   ? -41.319  -37.269 -53.626  1.00 90.80  ? 9   GLU G CD  1 
ATOM   8571  O OE1 . GLU G  1 9   ? -41.155  -36.692 -54.746  1.00 89.55  ? 9   GLU G OE1 1 
ATOM   8572  O OE2 . GLU G  1 9   ? -42.099  -36.866 -52.718  1.00 89.43  ? 9   GLU G OE2 1 
ATOM   8573  N N   . ARG G  1 16  ? -35.138  -39.073 -50.348  1.00 101.16 ? 16  ARG G N   1 
ATOM   8574  C CA  . ARG G  1 16  ? -34.550  -37.777 -50.611  1.00 98.21  ? 16  ARG G CA  1 
ATOM   8575  C C   . ARG G  1 16  ? -35.402  -36.681 -49.955  1.00 94.39  ? 16  ARG G C   1 
ATOM   8576  O O   . ARG G  1 16  ? -36.622  -36.805 -49.888  1.00 93.37  ? 16  ARG G O   1 
ATOM   8577  C CB  . ARG G  1 16  ? -34.367  -37.545 -52.132  1.00 97.62  ? 16  ARG G CB  1 
ATOM   8578  C CG  . ARG G  1 16  ? -33.348  -38.478 -52.826  1.00 101.73 ? 16  ARG G CG  1 
ATOM   8579  C CD  . ARG G  1 16  ? -31.857  -38.204 -52.486  1.00 103.29 ? 16  ARG G CD  1 
ATOM   8580  N NE  . ARG G  1 16  ? -30.909  -39.064 -53.247  1.00 107.60 ? 16  ARG G NE  1 
ATOM   8581  C CZ  . ARG G  1 16  ? -29.579  -38.868 -53.313  1.00 109.55 ? 16  ARG G CZ  1 
ATOM   8582  N NH1 . ARG G  1 16  ? -28.811  -39.689 -54.036  1.00 113.85 ? 16  ARG G NH1 1 
ATOM   8583  N NH2 . ARG G  1 16  ? -29.013  -37.841 -52.655  1.00 107.55 ? 16  ARG G NH2 1 
ATOM   8584  N N   . ALA G  1 17  ? -34.751  -35.622 -49.453  1.00 92.74  ? 17  ALA G N   1 
ATOM   8585  C CA  . ALA G  1 17  ? -35.424  -34.535 -48.670  1.00 89.78  ? 17  ALA G CA  1 
ATOM   8586  C C   . ALA G  1 17  ? -35.587  -33.173 -49.401  1.00 86.35  ? 17  ALA G C   1 
ATOM   8587  O O   . ALA G  1 17  ? -34.631  -32.627 -49.969  1.00 86.09  ? 17  ALA G O   1 
ATOM   8588  C CB  . ALA G  1 17  ? -34.733  -34.330 -47.322  1.00 90.94  ? 17  ALA G CB  1 
ATOM   8589  N N   . TYR G  1 18  ? -36.802  -32.635 -49.387  1.00 84.07  ? 18  TYR G N   1 
ATOM   8590  C CA  . TYR G  1 18  ? -37.085  -31.306 -49.941  1.00 81.11  ? 18  TYR G CA  1 
ATOM   8591  C C   . TYR G  1 18  ? -37.634  -30.339 -48.898  1.00 79.63  ? 18  TYR G C   1 
ATOM   8592  O O   . TYR G  1 18  ? -38.306  -30.739 -47.970  1.00 80.39  ? 18  TYR G O   1 
ATOM   8593  C CB  . TYR G  1 18  ? -38.200  -31.368 -50.970  1.00 79.93  ? 18  TYR G CB  1 
ATOM   8594  C CG  . TYR G  1 18  ? -37.964  -32.256 -52.142  1.00 81.42  ? 18  TYR G CG  1 
ATOM   8595  C CD1 . TYR G  1 18  ? -37.267  -31.800 -53.274  1.00 80.91  ? 18  TYR G CD1 1 
ATOM   8596  C CD2 . TYR G  1 18  ? -38.473  -33.555 -52.142  1.00 83.67  ? 18  TYR G CD2 1 
ATOM   8597  C CE1 . TYR G  1 18  ? -37.066  -32.639 -54.367  1.00 82.72  ? 18  TYR G CE1 1 
ATOM   8598  C CE2 . TYR G  1 18  ? -38.280  -34.405 -53.217  1.00 85.57  ? 18  TYR G CE2 1 
ATOM   8599  C CZ  . TYR G  1 18  ? -37.586  -33.949 -54.324  1.00 85.11  ? 18  TYR G CZ  1 
ATOM   8600  O OH  . TYR G  1 18  ? -37.438  -34.826 -55.371  1.00 87.44  ? 18  TYR G OH  1 
ATOM   8601  N N   . ASP G  1 19  ? -37.418  -29.045 -49.089  1.00 77.76  ? 19  ASP G N   1 
ATOM   8602  C CA  . ASP G  1 19  ? -38.268  -28.082 -48.412  1.00 76.38  ? 19  ASP G CA  1 
ATOM   8603  C C   . ASP G  1 19  ? -39.557  -27.980 -49.206  1.00 75.02  ? 19  ASP G C   1 
ATOM   8604  O O   . ASP G  1 19  ? -39.587  -28.247 -50.410  1.00 74.64  ? 19  ASP G O   1 
ATOM   8605  C CB  . ASP G  1 19  ? -37.576  -26.736 -48.327  1.00 75.38  ? 19  ASP G CB  1 
ATOM   8606  C CG  . ASP G  1 19  ? -37.452  -26.045 -49.675  1.00 73.80  ? 19  ASP G CG  1 
ATOM   8607  O OD1 . ASP G  1 19  ? -38.398  -25.366 -50.103  1.00 72.31  ? 19  ASP G OD1 1 
ATOM   8608  O OD2 . ASP G  1 19  ? -36.383  -26.167 -50.323  1.00 74.32  ? 19  ASP G OD2 1 
ATOM   8609  N N   . ILE G  1 20  ? -40.621  -27.551 -48.560  1.00 74.57  ? 20  ILE G N   1 
ATOM   8610  C CA  . ILE G  1 20  ? -41.919  -27.554 -49.202  1.00 73.86  ? 20  ILE G CA  1 
ATOM   8611  C C   . ILE G  1 20  ? -41.946  -26.917 -50.600  1.00 72.35  ? 20  ILE G C   1 
ATOM   8612  O O   . ILE G  1 20  ? -42.595  -27.447 -51.526  1.00 72.45  ? 20  ILE G O   1 
ATOM   8613  C CB  . ILE G  1 20  ? -43.022  -27.014 -48.257  1.00 73.93  ? 20  ILE G CB  1 
ATOM   8614  C CG1 . ILE G  1 20  ? -44.431  -27.378 -48.765  1.00 74.07  ? 20  ILE G CG1 1 
ATOM   8615  C CG2 . ILE G  1 20  ? -42.879  -25.504 -48.048  1.00 72.82  ? 20  ILE G CG2 1 
ATOM   8616  C CD1 . ILE G  1 20  ? -44.803  -28.822 -48.574  1.00 75.85  ? 20  ILE G CD1 1 
ATOM   8617  N N   . TYR G  1 21  ? -41.217  -25.808 -50.776  1.00 71.29  ? 21  TYR G N   1 
ATOM   8618  C CA  . TYR G  1 21  ? -41.261  -25.082 -52.052  1.00 70.03  ? 21  TYR G CA  1 
ATOM   8619  C C   . TYR G  1 21  ? -40.656  -25.915 -53.162  1.00 70.52  ? 21  TYR G C   1 
ATOM   8620  O O   . TYR G  1 21  ? -41.222  -25.967 -54.268  1.00 70.19  ? 21  TYR G O   1 
ATOM   8621  C CB  . TYR G  1 21  ? -40.618  -23.704 -51.962  1.00 69.17  ? 21  TYR G CB  1 
ATOM   8622  C CG  . TYR G  1 21  ? -41.265  -22.841 -50.936  1.00 69.15  ? 21  TYR G CG  1 
ATOM   8623  C CD1 . TYR G  1 21  ? -42.591  -22.385 -51.098  1.00 68.83  ? 21  TYR G CD1 1 
ATOM   8624  C CD2 . TYR G  1 21  ? -40.575  -22.475 -49.780  1.00 69.88  ? 21  TYR G CD2 1 
ATOM   8625  C CE1 . TYR G  1 21  ? -43.209  -21.595 -50.103  1.00 69.34  ? 21  TYR G CE1 1 
ATOM   8626  C CE2 . TYR G  1 21  ? -41.162  -21.679 -48.808  1.00 70.33  ? 21  TYR G CE2 1 
ATOM   8627  C CZ  . TYR G  1 21  ? -42.484  -21.257 -48.963  1.00 70.10  ? 21  TYR G CZ  1 
ATOM   8628  O OH  . TYR G  1 21  ? -43.104  -20.473 -48.006  1.00 71.01  ? 21  TYR G OH  1 
ATOM   8629  N N   . SER G  1 22  ? -39.553  -26.597 -52.833  1.00 71.70  ? 22  SER G N   1 
ATOM   8630  C CA  . SER G  1 22  ? -38.825  -27.424 -53.773  1.00 72.80  ? 22  SER G CA  1 
ATOM   8631  C C   . SER G  1 22  ? -39.681  -28.575 -54.196  1.00 73.88  ? 22  SER G C   1 
ATOM   8632  O O   . SER G  1 22  ? -39.629  -29.001 -55.349  1.00 74.50  ? 22  SER G O   1 
ATOM   8633  C CB  . SER G  1 22  ? -37.583  -27.975 -53.102  1.00 74.43  ? 22  SER G CB  1 
ATOM   8634  O OG  . SER G  1 22  ? -36.715  -26.939 -52.713  1.00 73.85  ? 22  SER G OG  1 
ATOM   8635  N N   . ARG G  1 23  ? -40.467  -29.075 -53.242  1.00 74.44  ? 23  ARG G N   1 
ATOM   8636  C CA  . ARG G  1 23  ? -41.346  -30.197 -53.474  1.00 75.86  ? 23  ARG G CA  1 
ATOM   8637  C C   . ARG G  1 23  ? -42.363  -29.777 -54.500  1.00 74.93  ? 23  ARG G C   1 
ATOM   8638  O O   . ARG G  1 23  ? -42.642  -30.532 -55.429  1.00 76.16  ? 23  ARG G O   1 
ATOM   8639  C CB  . ARG G  1 23  ? -41.993  -30.665 -52.172  1.00 76.71  ? 23  ARG G CB  1 
ATOM   8640  C CG  . ARG G  1 23  ? -43.011  -31.804 -52.332  1.00 78.47  ? 23  ARG G CG  1 
ATOM   8641  C CD  . ARG G  1 23  ? -42.477  -33.057 -53.056  1.00 80.77  ? 23  ARG G CD  1 
ATOM   8642  N NE  . ARG G  1 23  ? -43.562  -33.955 -53.456  1.00 82.47  ? 23  ARG G NE  1 
ATOM   8643  C CZ  . ARG G  1 23  ? -44.292  -33.813 -54.556  1.00 82.23  ? 23  ARG G CZ  1 
ATOM   8644  N NH1 . ARG G  1 23  ? -44.051  -32.812 -55.401  1.00 80.30  ? 23  ARG G NH1 1 
ATOM   8645  N NH2 . ARG G  1 23  ? -45.253  -34.687 -54.820  1.00 84.24  ? 23  ARG G NH2 1 
ATOM   8646  N N   . LEU G  1 24  ? -42.858  -28.557 -54.369  1.00 73.12  ? 24  LEU G N   1 
ATOM   8647  C CA  . LEU G  1 24  ? -43.830  -28.053 -55.312  1.00 72.48  ? 24  LEU G CA  1 
ATOM   8648  C C   . LEU G  1 24  ? -43.214  -27.740 -56.660  1.00 72.11  ? 24  LEU G C   1 
ATOM   8649  O O   . LEU G  1 24  ? -43.884  -27.749 -57.699  1.00 72.39  ? 24  LEU G O   1 
ATOM   8650  C CB  . LEU G  1 24  ? -44.522  -26.816 -54.738  1.00 71.15  ? 24  LEU G CB  1 
ATOM   8651  C CG  . LEU G  1 24  ? -45.938  -26.956 -54.163  1.00 71.84  ? 24  LEU G CG  1 
ATOM   8652  C CD1 . LEU G  1 24  ? -46.123  -28.197 -53.297  1.00 73.47  ? 24  LEU G CD1 1 
ATOM   8653  C CD2 . LEU G  1 24  ? -46.241  -25.695 -53.367  1.00 70.93  ? 24  LEU G CD2 1 
ATOM   8654  N N   . LEU G  1 25  ? -41.932  -27.435 -56.636  1.00 71.75  ? 25  LEU G N   1 
ATOM   8655  C CA  . LEU G  1 25  ? -41.236  -27.072 -57.851  1.00 71.60  ? 25  LEU G CA  1 
ATOM   8656  C C   . LEU G  1 25  ? -41.143  -28.279 -58.779  1.00 73.60  ? 25  LEU G C   1 
ATOM   8657  O O   . LEU G  1 25  ? -41.225  -28.160 -60.017  1.00 73.95  ? 25  LEU G O   1 
ATOM   8658  C CB  . LEU G  1 25  ? -39.850  -26.514 -57.539  1.00 71.21  ? 25  LEU G CB  1 
ATOM   8659  C CG  . LEU G  1 25  ? -39.052  -26.046 -58.767  1.00 71.26  ? 25  LEU G CG  1 
ATOM   8660  C CD1 . LEU G  1 25  ? -39.739  -24.899 -59.516  1.00 69.91  ? 25  LEU G CD1 1 
ATOM   8661  C CD2 . LEU G  1 25  ? -37.623  -25.710 -58.392  1.00 71.53  ? 25  LEU G CD2 1 
ATOM   8662  N N   . LYS G  1 26  ? -40.981  -29.439 -58.155  1.00 75.24  ? 26  LYS G N   1 
ATOM   8663  C CA  . LYS G  1 26  ? -41.048  -30.719 -58.810  1.00 77.72  ? 26  LYS G CA  1 
ATOM   8664  C C   . LYS G  1 26  ? -42.335  -30.859 -59.620  1.00 78.12  ? 26  LYS G C   1 
ATOM   8665  O O   . LYS G  1 26  ? -42.316  -31.515 -60.636  1.00 80.01  ? 26  LYS G O   1 
ATOM   8666  C CB  . LYS G  1 26  ? -40.967  -31.811 -57.759  1.00 79.40  ? 26  LYS G CB  1 
ATOM   8667  C CG  . LYS G  1 26  ? -40.300  -33.089 -58.206  1.00 82.51  ? 26  LYS G CG  1 
ATOM   8668  C CD  . LYS G  1 26  ? -40.338  -34.091 -57.067  1.00 84.26  ? 26  LYS G CD  1 
ATOM   8669  C CE  . LYS G  1 26  ? -39.741  -35.407 -57.477  1.00 87.90  ? 26  LYS G CE  1 
ATOM   8670  N NZ  . LYS G  1 26  ? -40.653  -36.149 -58.403  1.00 89.81  ? 26  LYS G NZ  1 
ATOM   8671  N N   . ASP G  1 27  ? -43.435  -30.250 -59.192  1.00 76.75  ? 27  ASP G N   1 
ATOM   8672  C CA  . ASP G  1 27  ? -44.693  -30.269 -59.941  1.00 77.32  ? 27  ASP G CA  1 
ATOM   8673  C C   . ASP G  1 27  ? -44.880  -29.056 -60.826  1.00 75.87  ? 27  ASP G C   1 
ATOM   8674  O O   . ASP G  1 27  ? -45.992  -28.751 -61.233  1.00 76.02  ? 27  ASP G O   1 
ATOM   8675  C CB  . ASP G  1 27  ? -45.869  -30.351 -58.987  1.00 77.29  ? 27  ASP G CB  1 
ATOM   8676  C CG  . ASP G  1 27  ? -45.901  -31.658 -58.219  1.00 79.27  ? 27  ASP G CG  1 
ATOM   8677  O OD1 . ASP G  1 27  ? -46.763  -31.780 -57.315  1.00 79.47  ? 27  ASP G OD1 1 
ATOM   8678  O OD2 . ASP G  1 27  ? -45.081  -32.579 -58.513  1.00 80.98  ? 27  ASP G OD2 1 
ATOM   8679  N N   . ARG G  1 28  ? -43.785  -28.361 -61.119  1.00 74.77  ? 28  ARG G N   1 
ATOM   8680  C CA  . ARG G  1 28  ? -43.797  -27.164 -61.956  1.00 73.58  ? 28  ARG G CA  1 
ATOM   8681  C C   . ARG G  1 28  ? -44.544  -25.973 -61.354  1.00 71.84  ? 28  ARG G C   1 
ATOM   8682  O O   . ARG G  1 28  ? -44.983  -25.083 -62.072  1.00 71.42  ? 28  ARG G O   1 
ATOM   8683  C CB  . ARG G  1 28  ? -44.303  -27.491 -63.362  1.00 75.21  ? 28  ARG G CB  1 
ATOM   8684  C CG  . ARG G  1 28  ? -43.524  -28.616 -64.039  1.00 77.45  ? 28  ARG G CG  1 
ATOM   8685  C CD  . ARG G  1 28  ? -44.050  -28.932 -65.425  1.00 79.47  ? 28  ARG G CD  1 
ATOM   8686  N NE  . ARG G  1 28  ? -43.663  -27.935 -66.421  1.00 78.88  ? 28  ARG G NE  1 
ATOM   8687  C CZ  . ARG G  1 28  ? -42.439  -27.806 -66.928  1.00 79.22  ? 28  ARG G CZ  1 
ATOM   8688  N NH1 . ARG G  1 28  ? -41.445  -28.577 -66.513  1.00 80.14  ? 28  ARG G NH1 1 
ATOM   8689  N NH2 . ARG G  1 28  ? -42.208  -26.887 -67.844  1.00 78.90  ? 28  ARG G NH2 1 
ATOM   8690  N N   . ILE G  1 29  ? -44.650  -25.951 -60.028  1.00 71.16  ? 29  ILE G N   1 
ATOM   8691  C CA  . ILE G  1 29  ? -45.231  -24.805 -59.313  1.00 69.90  ? 29  ILE G CA  1 
ATOM   8692  C C   . ILE G  1 29  ? -44.182  -23.871 -58.680  1.00 68.56  ? 29  ILE G C   1 
ATOM   8693  O O   . ILE G  1 29  ? -43.326  -24.303 -57.925  1.00 68.59  ? 29  ILE G O   1 
ATOM   8694  C CB  . ILE G  1 29  ? -46.188  -25.283 -58.223  1.00 70.47  ? 29  ILE G CB  1 
ATOM   8695  C CG1 . ILE G  1 29  ? -47.353  -26.061 -58.842  1.00 72.08  ? 29  ILE G CG1 1 
ATOM   8696  C CG2 . ILE G  1 29  ? -46.661  -24.103 -57.391  1.00 69.59  ? 29  ILE G CG2 1 
ATOM   8697  C CD1 . ILE G  1 29  ? -48.165  -26.844 -57.827  1.00 73.19  ? 29  ILE G CD1 1 
ATOM   8698  N N   . ILE G  1 30  ? -44.264  -22.588 -58.999  1.00 67.75  ? 30  ILE G N   1 
ATOM   8699  C CA  . ILE G  1 30  ? -43.386  -21.570 -58.395  1.00 66.84  ? 30  ILE G CA  1 
ATOM   8700  C C   . ILE G  1 30  ? -44.180  -20.625 -57.538  1.00 66.63  ? 30  ILE G C   1 
ATOM   8701  O O   . ILE G  1 30  ? -45.203  -20.077 -58.015  1.00 66.93  ? 30  ILE G O   1 
ATOM   8702  C CB  . ILE G  1 30  ? -42.692  -20.720 -59.457  1.00 66.52  ? 30  ILE G CB  1 
ATOM   8703  C CG1 . ILE G  1 30  ? -41.803  -21.590 -60.322  1.00 67.12  ? 30  ILE G CG1 1 
ATOM   8704  C CG2 . ILE G  1 30  ? -41.883  -19.611 -58.804  1.00 65.96  ? 30  ILE G CG2 1 
ATOM   8705  C CD1 . ILE G  1 30  ? -41.322  -20.909 -61.569  1.00 67.23  ? 30  ILE G CD1 1 
ATOM   8706  N N   . MET G  1 31  ? -43.726  -20.446 -56.291  1.00 66.51  ? 31  MET G N   1 
ATOM   8707  C CA  . MET G  1 31  ? -44.386  -19.511 -55.351  1.00 66.76  ? 31  MET G CA  1 
ATOM   8708  C C   . MET G  1 31  ? -43.730  -18.126 -55.326  1.00 66.55  ? 31  MET G C   1 
ATOM   8709  O O   . MET G  1 31  ? -42.521  -18.005 -55.109  1.00 66.32  ? 31  MET G O   1 
ATOM   8710  C CB  . MET G  1 31  ? -44.481  -20.089 -53.941  1.00 67.29  ? 31  MET G CB  1 
ATOM   8711  C CG  . MET G  1 31  ? -45.161  -21.470 -53.904  1.00 67.86  ? 31  MET G CG  1 
ATOM   8712  S SD  . MET G  1 31  ? -46.946  -21.517 -54.428  1.00 68.72  ? 31  MET G SD  1 
ATOM   8713  C CE  . MET G  1 31  ? -47.667  -20.596 -53.047  1.00 69.60  ? 31  MET G CE  1 
ATOM   8714  N N   . LEU G  1 32  ? -44.498  -17.086 -55.614  1.00 66.97  ? 32  LEU G N   1 
ATOM   8715  C CA  . LEU G  1 32  ? -43.979  -15.755 -55.427  1.00 67.28  ? 32  LEU G CA  1 
ATOM   8716  C C   . LEU G  1 32  ? -44.731  -15.125 -54.274  1.00 68.47  ? 32  LEU G C   1 
ATOM   8717  O O   . LEU G  1 32  ? -45.892  -14.733 -54.423  1.00 69.36  ? 32  LEU G O   1 
ATOM   8718  C CB  . LEU G  1 32  ? -44.128  -14.938 -56.702  1.00 67.36  ? 32  LEU G CB  1 
ATOM   8719  C CG  . LEU G  1 32  ? -43.831  -13.428 -56.567  1.00 68.23  ? 32  LEU G CG  1 
ATOM   8720  C CD1 . LEU G  1 32  ? -42.419  -13.169 -56.015  1.00 68.10  ? 32  LEU G CD1 1 
ATOM   8721  C CD2 . LEU G  1 32  ? -44.007  -12.699 -57.887  1.00 68.55  ? 32  LEU G CD2 1 
ATOM   8722  N N   . GLY G  1 33  ? -44.095  -15.055 -53.117  1.00 68.85  ? 33  GLY G N   1 
ATOM   8723  C CA  . GLY G  1 33  ? -44.824  -14.742 -51.888  1.00 70.28  ? 33  GLY G CA  1 
ATOM   8724  C C   . GLY G  1 33  ? -44.308  -13.516 -51.192  1.00 71.58  ? 33  GLY G C   1 
ATOM   8725  O O   . GLY G  1 33  ? -44.639  -13.278 -50.037  1.00 73.06  ? 33  GLY G O   1 
ATOM   8726  N N   . SER G  1 34  ? -43.507  -12.733 -51.897  1.00 71.35  ? 34  SER G N   1 
ATOM   8727  C CA  . SER G  1 34  ? -42.770  -11.653 -51.265  1.00 72.76  ? 34  SER G CA  1 
ATOM   8728  C C   . SER G  1 34  ? -42.666  -10.457 -52.190  1.00 73.34  ? 34  SER G C   1 
ATOM   8729  O O   . SER G  1 34  ? -43.143  -10.529 -53.325  1.00 72.52  ? 34  SER G O   1 
ATOM   8730  C CB  . SER G  1 34  ? -41.385  -12.158 -50.835  1.00 72.27  ? 34  SER G CB  1 
ATOM   8731  O OG  . SER G  1 34  ? -40.613  -12.531 -51.947  1.00 70.83  ? 34  SER G OG  1 
ATOM   8732  N N   . GLN G  1 35  ? -42.062  -9.368  -51.703  1.00 75.06  ? 35  GLN G N   1 
ATOM   8733  C CA  . GLN G  1 35  ? -41.782  -8.210  -52.544  1.00 75.93  ? 35  GLN G CA  1 
ATOM   8734  C C   . GLN G  1 35  ? -40.750  -8.640  -53.577  1.00 74.18  ? 35  GLN G C   1 
ATOM   8735  O O   . GLN G  1 35  ? -39.997  -9.577  -53.342  1.00 73.01  ? 35  GLN G O   1 
ATOM   8736  C CB  . GLN G  1 35  ? -41.319  -6.973  -51.748  1.00 78.63  ? 35  GLN G CB  1 
ATOM   8737  C CG  . GLN G  1 35  ? -39.842  -6.946  -51.341  1.00 78.86  ? 35  GLN G CG  1 
ATOM   8738  C CD  . GLN G  1 35  ? -39.353  -8.283  -50.678  1.00 77.36  ? 35  GLN G CD  1 
ATOM   8739  O OE1 . GLN G  1 35  ? -39.995  -8.791  -49.693  1.00 77.71  ? 35  GLN G OE1 1 
ATOM   8740  N NE2 . GLN G  1 35  ? -38.221  -8.881  -51.212  1.00 76.03  ? 35  GLN G NE2 1 
ATOM   8741  N N   . ILE G  1 36  ? -40.746  -7.969  -54.727  1.00 74.34  ? 36  ILE G N   1 
ATOM   8742  C CA  . ILE G  1 36  ? -39.905  -8.333  -55.848  1.00 73.02  ? 36  ILE G CA  1 
ATOM   8743  C C   . ILE G  1 36  ? -38.683  -7.453  -55.783  1.00 74.36  ? 36  ILE G C   1 
ATOM   8744  O O   . ILE G  1 36  ? -38.768  -6.223  -55.883  1.00 76.26  ? 36  ILE G O   1 
ATOM   8745  C CB  . ILE G  1 36  ? -40.642  -8.073  -57.169  1.00 72.83  ? 36  ILE G CB  1 
ATOM   8746  C CG1 . ILE G  1 36  ? -41.895  -8.948  -57.271  1.00 71.88  ? 36  ILE G CG1 1 
ATOM   8747  C CG2 . ILE G  1 36  ? -39.738  -8.310  -58.364  1.00 71.99  ? 36  ILE G CG2 1 
ATOM   8748  C CD1 . ILE G  1 36  ? -42.954  -8.354  -58.171  1.00 72.78  ? 36  ILE G CD1 1 
ATOM   8749  N N   . ASP G  1 37  ? -37.540  -8.089  -55.576  1.00 73.76  ? 37  ASP G N   1 
ATOM   8750  C CA  . ASP G  1 37  ? -36.244  -7.410  -55.720  1.00 75.08  ? 37  ASP G CA  1 
ATOM   8751  C C   . ASP G  1 37  ? -35.307  -8.293  -56.542  1.00 73.87  ? 37  ASP G C   1 
ATOM   8752  O O   . ASP G  1 37  ? -35.716  -9.355  -57.047  1.00 72.14  ? 37  ASP G O   1 
ATOM   8753  C CB  . ASP G  1 37  ? -35.621  -7.091  -54.364  1.00 76.76  ? 37  ASP G CB  1 
ATOM   8754  C CG  . ASP G  1 37  ? -35.386  -8.332  -53.531  1.00 75.72  ? 37  ASP G CG  1 
ATOM   8755  O OD1 . ASP G  1 37  ? -35.535  -8.275  -52.284  1.00 76.81  ? 37  ASP G OD1 1 
ATOM   8756  O OD2 . ASP G  1 37  ? -35.076  -9.387  -54.119  1.00 74.10  ? 37  ASP G OD2 1 
ATOM   8757  N N   . ASP G  1 38  ? -34.048  -7.879  -56.645  1.00 75.15  ? 38  ASP G N   1 
ATOM   8758  C CA  . ASP G  1 38  ? -33.090  -8.589  -57.473  1.00 74.66  ? 38  ASP G CA  1 
ATOM   8759  C C   . ASP G  1 38  ? -32.867  -10.049 -57.073  1.00 73.45  ? 38  ASP G C   1 
ATOM   8760  O O   . ASP G  1 38  ? -32.714  -10.888 -57.939  1.00 72.57  ? 38  ASP G O   1 
ATOM   8761  C CB  . ASP G  1 38  ? -31.774  -7.822  -57.552  1.00 76.77  ? 38  ASP G CB  1 
ATOM   8762  C CG  . ASP G  1 38  ? -31.794  -6.696  -58.628  1.00 77.83  ? 38  ASP G CG  1 
ATOM   8763  O OD1 . ASP G  1 38  ? -30.703  -6.141  -58.945  1.00 79.64  ? 38  ASP G OD1 1 
ATOM   8764  O OD2 . ASP G  1 38  ? -32.876  -6.366  -59.174  1.00 77.15  ? 38  ASP G OD2 1 
ATOM   8765  N N   . ASN G  1 39  ? -32.851  -10.369 -55.785  1.00 73.73  ? 39  ASN G N   1 
ATOM   8766  C CA  . ASN G  1 39  ? -32.775  -11.769 -55.379  1.00 72.80  ? 39  ASN G CA  1 
ATOM   8767  C C   . ASN G  1 39  ? -33.994  -12.543 -55.811  1.00 70.95  ? 39  ASN G C   1 
ATOM   8768  O O   . ASN G  1 39  ? -33.892  -13.642 -56.369  1.00 70.17  ? 39  ASN G O   1 
ATOM   8769  C CB  . ASN G  1 39  ? -32.666  -11.919 -53.886  1.00 73.67  ? 39  ASN G CB  1 
ATOM   8770  C CG  . ASN G  1 39  ? -31.270  -11.702 -53.406  1.00 75.68  ? 39  ASN G CG  1 
ATOM   8771  O OD1 . ASN G  1 39  ? -30.384  -11.328 -54.181  1.00 76.53  ? 39  ASN G OD1 1 
ATOM   8772  N ND2 . ASN G  1 39  ? -31.047  -11.917 -52.125  1.00 76.78  ? 39  ASN G ND2 1 
ATOM   8773  N N   . VAL G  1 40  ? -35.167  -11.993 -55.531  1.00 70.61  ? 40  VAL G N   1 
ATOM   8774  C CA  . VAL G  1 40  ? -36.358  -12.739 -55.786  1.00 69.24  ? 40  VAL G CA  1 
ATOM   8775  C C   . VAL G  1 40  ? -36.383  -13.010 -57.291  1.00 68.53  ? 40  VAL G C   1 
ATOM   8776  O O   . VAL G  1 40  ? -36.519  -14.168 -57.721  1.00 67.75  ? 40  VAL G O   1 
ATOM   8777  C CB  . VAL G  1 40  ? -37.604  -12.023 -55.244  1.00 69.51  ? 40  VAL G CB  1 
ATOM   8778  C CG1 . VAL G  1 40  ? -38.856  -12.663 -55.779  1.00 68.42  ? 40  VAL G CG1 1 
ATOM   8779  C CG2 . VAL G  1 40  ? -37.611  -12.073 -53.725  1.00 70.36  ? 40  VAL G CG2 1 
ATOM   8780  N N   . ALA G  1 41  ? -36.183  -11.966 -58.085  1.00 69.15  ? 41  ALA G N   1 
ATOM   8781  C CA  . ALA G  1 41  ? -36.187  -12.118 -59.529  1.00 68.85  ? 41  ALA G CA  1 
ATOM   8782  C C   . ALA G  1 41  ? -35.183  -13.159 -59.951  1.00 68.84  ? 41  ALA G C   1 
ATOM   8783  O O   . ALA G  1 41  ? -35.500  -14.057 -60.694  1.00 68.31  ? 41  ALA G O   1 
ATOM   8784  C CB  . ALA G  1 41  ? -35.879  -10.814 -60.204  1.00 69.96  ? 41  ALA G CB  1 
ATOM   8785  N N   . ASN G  1 42  ? -33.961  -13.063 -59.461  1.00 69.81  ? 42  ASN G N   1 
ATOM   8786  C CA  . ASN G  1 42  ? -32.944  -14.031 -59.787  1.00 70.35  ? 42  ASN G CA  1 
ATOM   8787  C C   . ASN G  1 42  ? -33.368  -15.483 -59.496  1.00 69.60  ? 42  ASN G C   1 
ATOM   8788  O O   . ASN G  1 42  ? -33.119  -16.382 -60.262  1.00 69.88  ? 42  ASN G O   1 
ATOM   8789  C CB  . ASN G  1 42  ? -31.688  -13.686 -59.052  1.00 71.82  ? 42  ASN G CB  1 
ATOM   8790  C CG  . ASN G  1 42  ? -30.469  -14.211 -59.741  1.00 73.15  ? 42  ASN G CG  1 
ATOM   8791  O OD1 . ASN G  1 42  ? -29.641  -14.854 -59.095  1.00 74.18  ? 42  ASN G OD1 1 
ATOM   8792  N ND2 . ASN G  1 42  ? -30.336  -13.956 -61.075  1.00 73.51  ? 42  ASN G ND2 1 
ATOM   8793  N N   . SER G  1 43  ? -34.071  -15.706 -58.407  1.00 68.93  ? 43  SER G N   1 
ATOM   8794  C CA  . SER G  1 43  ? -34.539  -17.027 -58.078  1.00 68.47  ? 43  SER G CA  1 
ATOM   8795  C C   . SER G  1 43  ? -35.693  -17.459 -58.992  1.00 67.60  ? 43  SER G C   1 
ATOM   8796  O O   . SER G  1 43  ? -35.695  -18.582 -59.487  1.00 67.84  ? 43  SER G O   1 
ATOM   8797  C CB  . SER G  1 43  ? -34.994  -16.997 -56.623  1.00 68.29  ? 43  SER G CB  1 
ATOM   8798  O OG  . SER G  1 43  ? -35.316  -18.280 -56.135  1.00 68.20  ? 43  SER G OG  1 
ATOM   8799  N N   . ILE G  1 44  ? -36.685  -16.584 -59.185  1.00 66.97  ? 44  ILE G N   1 
ATOM   8800  C CA  . ILE G  1 44  ? -37.843  -16.904 -60.007  1.00 66.48  ? 44  ILE G CA  1 
ATOM   8801  C C   . ILE G  1 44  ? -37.313  -17.224 -61.387  1.00 67.04  ? 44  ILE G C   1 
ATOM   8802  O O   . ILE G  1 44  ? -37.616  -18.287 -61.913  1.00 67.27  ? 44  ILE G O   1 
ATOM   8803  C CB  . ILE G  1 44  ? -38.878  -15.746 -60.089  1.00 66.28  ? 44  ILE G CB  1 
ATOM   8804  C CG1 . ILE G  1 44  ? -39.464  -15.362 -58.715  1.00 66.19  ? 44  ILE G CG1 1 
ATOM   8805  C CG2 . ILE G  1 44  ? -40.000  -16.065 -61.060  1.00 66.21  ? 44  ILE G CG2 1 
ATOM   8806  C CD1 . ILE G  1 44  ? -40.209  -16.462 -57.992  1.00 65.87  ? 44  ILE G CD1 1 
ATOM   8807  N N   . VAL G  1 45  ? -36.505  -16.334 -61.977  1.00 67.62  ? 45  VAL G N   1 
ATOM   8808  C CA  . VAL G  1 45  ? -35.922  -16.551 -63.318  1.00 68.53  ? 45  VAL G CA  1 
ATOM   8809  C C   . VAL G  1 45  ? -35.245  -17.927 -63.417  1.00 69.32  ? 45  VAL G C   1 
ATOM   8810  O O   . VAL G  1 45  ? -35.598  -18.730 -64.271  1.00 69.86  ? 45  VAL G O   1 
ATOM   8811  C CB  . VAL G  1 45  ? -34.931  -15.413 -63.701  1.00 69.38  ? 45  VAL G CB  1 
ATOM   8812  C CG1 . VAL G  1 45  ? -34.078  -15.782 -64.913  1.00 70.75  ? 45  VAL G CG1 1 
ATOM   8813  C CG2 . VAL G  1 45  ? -35.676  -14.111 -63.979  1.00 69.18  ? 45  VAL G CG2 1 
ATOM   8814  N N   . SER G  1 46  ? -34.292  -18.201 -62.531  1.00 69.77  ? 46  SER G N   1 
ATOM   8815  C CA  . SER G  1 46  ? -33.675  -19.516 -62.458  1.00 70.89  ? 46  SER G CA  1 
ATOM   8816  C C   . SER G  1 46  ? -34.680  -20.667 -62.422  1.00 70.61  ? 46  SER G C   1 
ATOM   8817  O O   . SER G  1 46  ? -34.528  -21.650 -63.132  1.00 71.89  ? 46  SER G O   1 
ATOM   8818  C CB  . SER G  1 46  ? -32.782  -19.621 -61.239  1.00 71.40  ? 46  SER G CB  1 
ATOM   8819  O OG  . SER G  1 46  ? -31.641  -18.814 -61.382  1.00 72.42  ? 46  SER G OG  1 
ATOM   8820  N N   . GLN G  1 47  ? -35.708  -20.564 -61.588  1.00 69.29  ? 47  GLN G N   1 
ATOM   8821  C CA  . GLN G  1 47  ? -36.740  -21.598 -61.573  1.00 69.24  ? 47  GLN G CA  1 
ATOM   8822  C C   . GLN G  1 47  ? -37.374  -21.791 -62.947  1.00 69.73  ? 47  GLN G C   1 
ATOM   8823  O O   . GLN G  1 47  ? -37.522  -22.919 -63.399  1.00 70.93  ? 47  GLN G O   1 
ATOM   8824  C CB  . GLN G  1 47  ? -37.795  -21.320 -60.495  1.00 68.01  ? 47  GLN G CB  1 
ATOM   8825  C CG  . GLN G  1 47  ? -37.309  -21.656 -59.086  1.00 68.12  ? 47  GLN G CG  1 
ATOM   8826  C CD  . GLN G  1 47  ? -38.196  -21.069 -58.019  1.00 67.17  ? 47  GLN G CD  1 
ATOM   8827  O OE1 . GLN G  1 47  ? -39.269  -21.558 -57.765  1.00 67.00  ? 47  GLN G OE1 1 
ATOM   8828  N NE2 . GLN G  1 47  ? -37.740  -20.001 -57.388  1.00 66.91  ? 47  GLN G NE2 1 
ATOM   8829  N N   . LEU G  1 48  ? -37.713  -20.686 -63.605  1.00 69.17  ? 48  LEU G N   1 
ATOM   8830  C CA  . LEU G  1 48  ? -38.295  -20.724 -64.937  1.00 69.89  ? 48  LEU G CA  1 
ATOM   8831  C C   . LEU G  1 48  ? -37.355  -21.420 -65.925  1.00 71.71  ? 48  LEU G C   1 
ATOM   8832  O O   . LEU G  1 48  ? -37.770  -22.374 -66.598  1.00 73.00  ? 48  LEU G O   1 
ATOM   8833  C CB  . LEU G  1 48  ? -38.682  -19.326 -65.426  1.00 69.31  ? 48  LEU G CB  1 
ATOM   8834  C CG  . LEU G  1 48  ? -39.884  -18.656 -64.716  1.00 68.20  ? 48  LEU G CG  1 
ATOM   8835  C CD1 . LEU G  1 48  ? -40.005  -17.195 -65.100  1.00 68.10  ? 48  LEU G CD1 1 
ATOM   8836  C CD2 . LEU G  1 48  ? -41.183  -19.355 -65.057  1.00 68.60  ? 48  LEU G CD2 1 
ATOM   8837  N N   . LEU G  1 49  ? -36.092  -20.990 -65.993  1.00 72.23  ? 49  LEU G N   1 
ATOM   8838  C CA  . LEU G  1 49  ? -35.128  -21.624 -66.901  1.00 74.41  ? 49  LEU G CA  1 
ATOM   8839  C C   . LEU G  1 49  ? -34.969  -23.096 -66.597  1.00 75.77  ? 49  LEU G C   1 
ATOM   8840  O O   . LEU G  1 49  ? -34.916  -23.931 -67.512  1.00 77.84  ? 49  LEU G O   1 
ATOM   8841  C CB  . LEU G  1 49  ? -33.765  -20.979 -66.843  1.00 75.05  ? 49  LEU G CB  1 
ATOM   8842  C CG  . LEU G  1 49  ? -33.696  -19.561 -67.375  1.00 74.54  ? 49  LEU G CG  1 
ATOM   8843  C CD1 . LEU G  1 49  ? -32.256  -19.025 -67.261  1.00 75.64  ? 49  LEU G CD1 1 
ATOM   8844  C CD2 . LEU G  1 49  ? -34.244  -19.449 -68.795  1.00 75.46  ? 49  LEU G CD2 1 
ATOM   8845  N N   . PHE G  1 50  ? -34.904  -23.445 -65.318  1.00 74.99  ? 50  PHE G N   1 
ATOM   8846  C CA  . PHE G  1 50  ? -34.772  -24.849 -64.941  1.00 76.53  ? 50  PHE G CA  1 
ATOM   8847  C C   . PHE G  1 50  ? -35.966  -25.671 -65.398  1.00 77.03  ? 50  PHE G C   1 
ATOM   8848  O O   . PHE G  1 50  ? -35.794  -26.763 -65.923  1.00 79.40  ? 50  PHE G O   1 
ATOM   8849  C CB  . PHE G  1 50  ? -34.608  -24.980 -63.440  1.00 75.62  ? 50  PHE G CB  1 
ATOM   8850  C CG  . PHE G  1 50  ? -34.858  -26.352 -62.935  1.00 76.92  ? 50  PHE G CG  1 
ATOM   8851  C CD1 . PHE G  1 50  ? -33.890  -27.332 -63.062  1.00 79.62  ? 50  PHE G CD1 1 
ATOM   8852  C CD2 . PHE G  1 50  ? -36.079  -26.679 -62.341  1.00 75.85  ? 50  PHE G CD2 1 
ATOM   8853  C CE1 . PHE G  1 50  ? -34.126  -28.626 -62.596  1.00 81.23  ? 50  PHE G CE1 1 
ATOM   8854  C CE2 . PHE G  1 50  ? -36.326  -27.984 -61.877  1.00 77.38  ? 50  PHE G CE2 1 
ATOM   8855  C CZ  . PHE G  1 50  ? -35.342  -28.960 -62.006  1.00 80.09  ? 50  PHE G CZ  1 
ATOM   8856  N N   . LEU G  1 51  ? -37.173  -25.137 -65.186  1.00 75.17  ? 51  LEU G N   1 
ATOM   8857  C CA  . LEU G  1 51  ? -38.403  -25.848 -65.552  1.00 75.78  ? 51  LEU G CA  1 
ATOM   8858  C C   . LEU G  1 51  ? -38.514  -26.108 -67.069  1.00 77.76  ? 51  LEU G C   1 
ATOM   8859  O O   . LEU G  1 51  ? -39.001  -27.171 -67.526  1.00 79.77  ? 51  LEU G O   1 
ATOM   8860  C CB  . LEU G  1 51  ? -39.637  -25.136 -65.006  1.00 73.75  ? 51  LEU G CB  1 
ATOM   8861  C CG  . LEU G  1 51  ? -39.927  -25.330 -63.513  1.00 72.61  ? 51  LEU G CG  1 
ATOM   8862  C CD1 . LEU G  1 51  ? -41.263  -24.642 -63.197  1.00 71.27  ? 51  LEU G CD1 1 
ATOM   8863  C CD2 . LEU G  1 51  ? -39.896  -26.795 -63.075  1.00 74.26  ? 51  LEU G CD2 1 
ATOM   8864  N N   . GLN G  1 52  ? -38.034  -25.152 -67.847  1.00 77.56  ? 52  GLN G N   1 
ATOM   8865  C CA  . GLN G  1 52  ? -38.036  -25.310 -69.287  1.00 79.68  ? 52  GLN G CA  1 
ATOM   8866  C C   . GLN G  1 52  ? -37.070  -26.390 -69.743  1.00 82.63  ? 52  GLN G C   1 
ATOM   8867  O O   . GLN G  1 52  ? -37.443  -27.239 -70.549  1.00 85.07  ? 52  GLN G O   1 
ATOM   8868  C CB  . GLN G  1 52  ? -37.665  -24.013 -69.950  1.00 79.01  ? 52  GLN G CB  1 
ATOM   8869  C CG  . GLN G  1 52  ? -37.690  -24.133 -71.446  1.00 81.40  ? 52  GLN G CG  1 
ATOM   8870  C CD  . GLN G  1 52  ? -37.158  -22.900 -72.110  1.00 81.16  ? 52  GLN G CD  1 
ATOM   8871  O OE1 . GLN G  1 52  ? -36.100  -22.401 -71.741  1.00 80.69  ? 52  GLN G OE1 1 
ATOM   8872  N NE2 . GLN G  1 52  ? -37.885  -22.404 -73.098  1.00 81.80  ? 52  GLN G NE2 1 
ATOM   8873  N N   . ALA G  1 53  ? -35.833  -26.343 -69.236  1.00 82.79  ? 53  ALA G N   1 
ATOM   8874  C CA  . ALA G  1 53  ? -34.833  -27.385 -69.482  1.00 85.92  ? 53  ALA G CA  1 
ATOM   8875  C C   . ALA G  1 53  ? -35.348  -28.783 -69.129  1.00 87.59  ? 53  ALA G C   1 
ATOM   8876  O O   . ALA G  1 53  ? -34.930  -29.753 -69.727  1.00 90.97  ? 53  ALA G O   1 
ATOM   8877  C CB  . ALA G  1 53  ? -33.566  -27.092 -68.709  1.00 85.68  ? 53  ALA G CB  1 
ATOM   8878  N N   . GLN G  1 54  ? -36.266  -28.879 -68.172  1.00 85.56  ? 54  GLN G N   1 
ATOM   8879  C CA  . GLN G  1 54  ? -36.841  -30.153 -67.765  1.00 87.15  ? 54  GLN G CA  1 
ATOM   8880  C C   . GLN G  1 54  ? -37.841  -30.694 -68.768  1.00 89.01  ? 54  GLN G C   1 
ATOM   8881  O O   . GLN G  1 54  ? -37.864  -31.886 -69.059  1.00 92.20  ? 54  GLN G O   1 
ATOM   8882  C CB  . GLN G  1 54  ? -37.544  -29.994 -66.432  1.00 84.53  ? 54  GLN G CB  1 
ATOM   8883  C CG  . GLN G  1 54  ? -36.594  -29.785 -65.270  1.00 83.50  ? 54  GLN G CG  1 
ATOM   8884  C CD  . GLN G  1 54  ? -36.000  -31.098 -64.785  1.00 86.28  ? 54  GLN G CD  1 
ATOM   8885  O OE1 . GLN G  1 54  ? -36.601  -31.763 -63.937  1.00 86.31  ? 54  GLN G OE1 1 
ATOM   8886  N NE2 . GLN G  1 54  ? -34.812  -31.473 -65.304  1.00 88.94  ? 54  GLN G NE2 1 
ATOM   8887  N N   . ASP G  1 55  ? -38.678  -29.799 -69.272  1.00 87.31  ? 55  ASP G N   1 
ATOM   8888  C CA  . ASP G  1 55  ? -39.745  -30.138 -70.179  1.00 88.93  ? 55  ASP G CA  1 
ATOM   8889  C C   . ASP G  1 55  ? -40.202  -28.803 -70.728  1.00 86.91  ? 55  ASP G C   1 
ATOM   8890  O O   . ASP G  1 55  ? -40.592  -27.928 -69.965  1.00 83.92  ? 55  ASP G O   1 
ATOM   8891  C CB  . ASP G  1 55  ? -40.879  -30.817 -69.415  1.00 88.76  ? 55  ASP G CB  1 
ATOM   8892  C CG  . ASP G  1 55  ? -42.010  -31.277 -70.324  1.00 91.02  ? 55  ASP G CG  1 
ATOM   8893  O OD1 . ASP G  1 55  ? -42.458  -30.468 -71.163  1.00 90.62  ? 55  ASP G OD1 1 
ATOM   8894  O OD2 . ASP G  1 55  ? -42.458  -32.453 -70.201  1.00 93.50  ? 55  ASP G OD2 1 
ATOM   8895  N N   . SER G  1 56  ? -40.125  -28.618 -72.037  1.00 88.82  ? 56  SER G N   1 
ATOM   8896  C CA  . SER G  1 56  ? -40.507  -27.337 -72.637  1.00 87.36  ? 56  SER G CA  1 
ATOM   8897  C C   . SER G  1 56  ? -41.969  -27.299 -73.119  1.00 87.93  ? 56  SER G C   1 
ATOM   8898  O O   . SER G  1 56  ? -42.411  -26.307 -73.706  1.00 87.32  ? 56  SER G O   1 
ATOM   8899  C CB  . SER G  1 56  ? -39.534  -26.939 -73.768  1.00 89.06  ? 56  SER G CB  1 
ATOM   8900  O OG  . SER G  1 56  ? -39.318  -27.997 -74.672  1.00 92.95  ? 56  SER G OG  1 
ATOM   8901  N N   . GLU G  1 57  ? -42.719  -28.365 -72.850  1.00 97.27  ? 57  GLU G N   1 
ATOM   8902  C CA  . GLU G  1 57  ? -44.114  -28.460 -73.288  1.00 97.76  ? 57  GLU G CA  1 
ATOM   8903  C C   . GLU G  1 57  ? -45.031  -28.205 -72.115  1.00 95.36  ? 57  GLU G C   1 
ATOM   8904  O O   . GLU G  1 57  ? -45.904  -27.361 -72.200  1.00 93.83  ? 57  GLU G O   1 
ATOM   8905  C CB  . GLU G  1 57  ? -44.473  -29.850 -73.864  1.00 101.31 ? 57  GLU G CB  1 
ATOM   8906  C CG  . GLU G  1 57  ? -43.335  -30.672 -74.418  1.00 104.18 ? 57  GLU G CG  1 
ATOM   8907  C CD  . GLU G  1 57  ? -43.170  -30.443 -75.894  1.00 106.23 ? 57  GLU G CD  1 
ATOM   8908  O OE1 . GLU G  1 57  ? -42.489  -29.448 -76.269  1.00 104.99 ? 57  GLU G OE1 1 
ATOM   8909  O OE2 . GLU G  1 57  ? -43.730  -31.266 -76.667  1.00 109.21 ? 57  GLU G OE2 1 
ATOM   8910  N N   . LYS G  1 58  ? -44.847  -28.955 -71.031  1.00 95.26  ? 58  LYS G N   1 
ATOM   8911  C CA  . LYS G  1 58  ? -45.775  -28.925 -69.908  1.00 93.51  ? 58  LYS G CA  1 
ATOM   8912  C C   . LYS G  1 58  ? -45.766  -27.545 -69.274  1.00 90.22  ? 58  LYS G C   1 
ATOM   8913  O O   . LYS G  1 58  ? -44.707  -26.976 -68.976  1.00 89.05  ? 58  LYS G O   1 
ATOM   8914  C CB  . LYS G  1 58  ? -45.447  -30.017 -68.894  1.00 94.31  ? 58  LYS G CB  1 
ATOM   8915  C CG  . LYS G  1 58  ? -46.142  -31.326 -69.210  1.00 97.18  ? 58  LYS G CG  1 
ATOM   8916  C CD  . LYS G  1 58  ? -45.986  -32.330 -68.091  1.00 97.81  ? 58  LYS G CD  1 
ATOM   8917  C CE  . LYS G  1 58  ? -44.601  -32.953 -68.105  1.00 99.46  ? 58  LYS G CE  1 
ATOM   8918  N NZ  . LYS G  1 58  ? -44.631  -34.245 -67.385  1.00 101.36 ? 58  LYS G NZ  1 
ATOM   8919  N N   . ASP G  1 59  ? -46.938  -26.968 -69.104  1.00 88.90  ? 59  ASP G N   1 
ATOM   8920  C CA  . ASP G  1 59  ? -46.900  -25.617 -68.655  1.00 86.19  ? 59  ASP G CA  1 
ATOM   8921  C C   . ASP G  1 59  ? -46.632  -25.456 -67.158  1.00 84.26  ? 59  ASP G C   1 
ATOM   8922  O O   . ASP G  1 59  ? -46.531  -26.461 -66.441  1.00 85.05  ? 59  ASP G O   1 
ATOM   8923  C CB  . ASP G  1 59  ? -48.022  -24.745 -69.267  1.00 85.56  ? 59  ASP G CB  1 
ATOM   8924  C CG  . ASP G  1 59  ? -49.412  -25.262 -68.998  1.00 86.06  ? 59  ASP G CG  1 
ATOM   8925  O OD1 . ASP G  1 59  ? -49.561  -25.905 -67.950  1.00 85.80  ? 59  ASP G OD1 1 
ATOM   8926  O OD2 . ASP G  1 59  ? -50.352  -24.983 -69.799  1.00 86.71  ? 59  ASP G OD2 1 
ATOM   8927  N N   . ILE G  1 60  ? -46.440  -24.196 -66.747  1.00 81.99  ? 60  ILE G N   1 
ATOM   8928  C CA  . ILE G  1 60  ? -45.880  -23.808 -65.444  1.00 80.21  ? 60  ILE G CA  1 
ATOM   8929  C C   . ILE G  1 60  ? -46.882  -22.999 -64.635  1.00 78.34  ? 60  ILE G C   1 
ATOM   8930  O O   . ILE G  1 60  ? -47.620  -22.181 -65.192  1.00 77.82  ? 60  ILE G O   1 
ATOM   8931  C CB  . ILE G  1 60  ? -44.590  -22.974 -65.627  1.00 79.42  ? 60  ILE G CB  1 
ATOM   8932  C CG1 . ILE G  1 60  ? -43.471  -23.867 -66.184  1.00 81.37  ? 60  ILE G CG1 1 
ATOM   8933  C CG2 . ILE G  1 60  ? -44.139  -22.336 -64.317  1.00 77.50  ? 60  ILE G CG2 1 
ATOM   8934  C CD1 . ILE G  1 60  ? -42.304  -23.142 -66.811  1.00 81.25  ? 60  ILE G CD1 1 
ATOM   8935  N N   . TYR G  1 61  ? -46.903  -23.221 -63.320  1.00 77.51  ? 61  TYR G N   1 
ATOM   8936  C CA  . TYR G  1 61  ? -47.821  -22.498 -62.440  1.00 75.94  ? 61  TYR G CA  1 
ATOM   8937  C C   . TYR G  1 61  ? -47.057  -21.525 -61.561  1.00 74.23  ? 61  TYR G C   1 
ATOM   8938  O O   . TYR G  1 61  ? -46.206  -21.921 -60.771  1.00 74.19  ? 61  TYR G O   1 
ATOM   8939  C CB  . TYR G  1 61  ? -48.649  -23.485 -61.632  1.00 76.56  ? 61  TYR G CB  1 
ATOM   8940  C CG  . TYR G  1 61  ? -49.342  -24.505 -62.518  1.00 78.54  ? 61  TYR G CG  1 
ATOM   8941  C CD1 . TYR G  1 61  ? -48.695  -25.690 -62.886  1.00 80.44  ? 61  TYR G CD1 1 
ATOM   8942  C CD2 . TYR G  1 61  ? -50.641  -24.278 -63.007  1.00 78.75  ? 61  TYR G CD2 1 
ATOM   8943  C CE1 . TYR G  1 61  ? -49.329  -26.633 -63.684  1.00 82.52  ? 61  TYR G CE1 1 
ATOM   8944  C CE2 . TYR G  1 61  ? -51.284  -25.206 -63.815  1.00 80.75  ? 61  TYR G CE2 1 
ATOM   8945  C CZ  . TYR G  1 61  ? -50.630  -26.393 -64.156  1.00 82.67  ? 61  TYR G CZ  1 
ATOM   8946  O OH  . TYR G  1 61  ? -51.261  -27.346 -64.958  1.00 84.96  ? 61  TYR G OH  1 
ATOM   8947  N N   . LEU G  1 62  ? -47.348  -20.245 -61.739  1.00 73.01  ? 62  LEU G N   1 
ATOM   8948  C CA  . LEU G  1 62  ? -46.823  -19.176 -60.887  1.00 71.48  ? 62  LEU G CA  1 
ATOM   8949  C C   . LEU G  1 62  ? -47.908  -18.546 -59.987  1.00 70.49  ? 62  LEU G C   1 
ATOM   8950  O O   . LEU G  1 62  ? -48.777  -17.780 -60.450  1.00 70.20  ? 62  LEU G O   1 
ATOM   8951  C CB  . LEU G  1 62  ? -46.192  -18.103 -61.769  1.00 71.08  ? 62  LEU G CB  1 
ATOM   8952  C CG  . LEU G  1 62  ? -45.560  -16.895 -61.096  1.00 69.76  ? 62  LEU G CG  1 
ATOM   8953  C CD1 . LEU G  1 62  ? -44.370  -17.380 -60.296  1.00 69.78  ? 62  LEU G CD1 1 
ATOM   8954  C CD2 . LEU G  1 62  ? -45.120  -15.862 -62.107  1.00 69.60  ? 62  LEU G CD2 1 
ATOM   8955  N N   . TYR G  1 63  ? -47.868  -18.900 -58.705  1.00 70.18  ? 63  TYR G N   1 
ATOM   8956  C CA  . TYR G  1 63  ? -48.753  -18.302 -57.713  1.00 69.38  ? 63  TYR G CA  1 
ATOM   8957  C C   . TYR G  1 63  ? -48.156  -16.979 -57.288  1.00 68.28  ? 63  TYR G C   1 
ATOM   8958  O O   . TYR G  1 63  ? -46.946  -16.903 -57.063  1.00 68.10  ? 63  TYR G O   1 
ATOM   8959  C CB  . TYR G  1 63  ? -48.896  -19.225 -56.503  1.00 69.70  ? 63  TYR G CB  1 
ATOM   8960  C CG  . TYR G  1 63  ? -49.822  -20.382 -56.757  1.00 70.83  ? 63  TYR G CG  1 
ATOM   8961  C CD1 . TYR G  1 63  ? -49.336  -21.564 -57.355  1.00 72.10  ? 63  TYR G CD1 1 
ATOM   8962  C CD2 . TYR G  1 63  ? -51.182  -20.306 -56.446  1.00 70.87  ? 63  TYR G CD2 1 
ATOM   8963  C CE1 . TYR G  1 63  ? -50.169  -22.640 -57.618  1.00 73.39  ? 63  TYR G CE1 1 
ATOM   8964  C CE2 . TYR G  1 63  ? -52.025  -21.380 -56.704  1.00 72.06  ? 63  TYR G CE2 1 
ATOM   8965  C CZ  . TYR G  1 63  ? -51.511  -22.539 -57.283  1.00 73.32  ? 63  TYR G CZ  1 
ATOM   8966  O OH  . TYR G  1 63  ? -52.331  -23.616 -57.523  1.00 74.73  ? 63  TYR G OH  1 
ATOM   8967  N N   . ILE G  1 64  ? -48.988  -15.949 -57.180  1.00 67.74  ? 64  ILE G N   1 
ATOM   8968  C CA  . ILE G  1 64  ? -48.494  -14.609 -56.903  1.00 66.94  ? 64  ILE G CA  1 
ATOM   8969  C C   . ILE G  1 64  ? -49.267  -13.989 -55.739  1.00 66.59  ? 64  ILE G C   1 
ATOM   8970  O O   . ILE G  1 64  ? -50.490  -13.795 -55.810  1.00 66.78  ? 64  ILE G O   1 
ATOM   8971  C CB  . ILE G  1 64  ? -48.644  -13.675 -58.114  1.00 66.90  ? 64  ILE G CB  1 
ATOM   8972  C CG1 . ILE G  1 64  ? -47.876  -14.177 -59.338  1.00 67.43  ? 64  ILE G CG1 1 
ATOM   8973  C CG2 . ILE G  1 64  ? -48.237  -12.263 -57.744  1.00 66.28  ? 64  ILE G CG2 1 
ATOM   8974  C CD1 . ILE G  1 64  ? -48.156  -13.408 -60.622  1.00 67.65  ? 64  ILE G CD1 1 
ATOM   8975  N N   . ASN G  1 65  ? -48.536  -13.723 -54.659  1.00 66.26  ? 65  ASN G N   1 
ATOM   8976  C CA  . ASN G  1 65  ? -48.997  -12.938 -53.541  1.00 66.07  ? 65  ASN G CA  1 
ATOM   8977  C C   . ASN G  1 65  ? -47.859  -11.968 -53.252  1.00 65.72  ? 65  ASN G C   1 
ATOM   8978  O O   . ASN G  1 65  ? -46.922  -12.290 -52.541  1.00 65.73  ? 65  ASN G O   1 
ATOM   8979  C CB  . ASN G  1 65  ? -49.304  -13.836 -52.352  1.00 66.39  ? 65  ASN G CB  1 
ATOM   8980  C CG  . ASN G  1 65  ? -49.825  -13.071 -51.146  1.00 66.44  ? 65  ASN G CG  1 
ATOM   8981  O OD1 . ASN G  1 65  ? -50.320  -11.963 -51.274  1.00 66.37  ? 65  ASN G OD1 1 
ATOM   8982  N ND2 . ASN G  1 65  ? -49.719  -13.676 -49.970  1.00 66.75  ? 65  ASN G ND2 1 
ATOM   8983  N N   . SER G  1 66  ? -47.927  -10.788 -53.860  1.00 65.56  ? 66  SER G N   1 
ATOM   8984  C CA  . SER G  1 66  ? -46.843  -9.857  -53.772  1.00 65.38  ? 66  SER G CA  1 
ATOM   8985  C C   . SER G  1 66  ? -47.298  -8.405  -53.743  1.00 65.50  ? 66  SER G C   1 
ATOM   8986  O O   . SER G  1 66  ? -48.197  -8.051  -54.498  1.00 65.64  ? 66  SER G O   1 
ATOM   8987  C CB  . SER G  1 66  ? -45.902  -10.079 -54.938  1.00 65.29  ? 66  SER G CB  1 
ATOM   8988  O OG  . SER G  1 66  ? -44.833  -9.121  -54.933  1.00 65.20  ? 66  SER G OG  1 
ATOM   8989  N N   . PRO G  1 67  ? -46.648  -7.559  -52.895  1.00 65.63  ? 67  PRO G N   1 
ATOM   8990  C CA  . PRO G  1 67  ? -46.939  -6.116  -52.886  1.00 66.00  ? 67  PRO G CA  1 
ATOM   8991  C C   . PRO G  1 67  ? -46.238  -5.354  -54.014  1.00 65.96  ? 67  PRO G C   1 
ATOM   8992  O O   . PRO G  1 67  ? -46.465  -4.157  -54.205  1.00 66.40  ? 67  PRO G O   1 
ATOM   8993  C CB  . PRO G  1 67  ? -46.399  -5.665  -51.543  1.00 66.38  ? 67  PRO G CB  1 
ATOM   8994  C CG  . PRO G  1 67  ? -45.306  -6.644  -51.221  1.00 66.06  ? 67  PRO G CG  1 
ATOM   8995  C CD  . PRO G  1 67  ? -45.668  -7.949  -51.852  1.00 65.66  ? 67  PRO G CD  1 
ATOM   8996  N N   . GLY G  1 68  ? -45.402  -6.035  -54.777  1.00 65.59  ? 68  GLY G N   1 
ATOM   8997  C CA  . GLY G  1 68  ? -44.700  -5.383  -55.858  1.00 65.65  ? 68  GLY G CA  1 
ATOM   8998  C C   . GLY G  1 68  ? -43.227  -5.201  -55.528  1.00 65.66  ? 68  GLY G C   1 
ATOM   8999  O O   . GLY G  1 68  ? -42.633  -6.003  -54.808  1.00 65.53  ? 68  GLY G O   1 
ATOM   9000  N N   . GLY G  1 69  ? -42.612  -4.153  -56.058  1.00 65.95  ? 69  GLY G N   1 
ATOM   9001  C CA  . GLY G  1 69  ? -41.181  -3.971  -55.853  1.00 66.09  ? 69  GLY G CA  1 
ATOM   9002  C C   . GLY G  1 69  ? -40.495  -3.415  -57.081  1.00 66.31  ? 69  GLY G C   1 
ATOM   9003  O O   . GLY G  1 69  ? -41.109  -2.705  -57.877  1.00 66.53  ? 69  GLY G O   1 
ATOM   9004  N N   . SER G  1 70  ? -39.222  -3.750  -57.232  1.00 66.37  ? 70  SER G N   1 
ATOM   9005  C CA  . SER G  1 70  ? -38.372  -3.184  -58.263  1.00 66.74  ? 70  SER G CA  1 
ATOM   9006  C C   . SER G  1 70  ? -38.917  -3.391  -59.694  1.00 66.76  ? 70  SER G C   1 
ATOM   9007  O O   . SER G  1 70  ? -39.227  -4.523  -60.106  1.00 66.54  ? 70  SER G O   1 
ATOM   9008  C CB  . SER G  1 70  ? -36.964  -3.753  -58.088  1.00 66.90  ? 70  SER G CB  1 
ATOM   9009  O OG  . SER G  1 70  ? -36.171  -3.566  -59.239  1.00 67.30  ? 70  SER G OG  1 
ATOM   9010  N N   . VAL G  1 71  ? -39.054  -2.298  -60.434  1.00 67.20  ? 71  VAL G N   1 
ATOM   9011  C CA  . VAL G  1 71  ? -39.564  -2.388  -61.792  1.00 67.43  ? 71  VAL G CA  1 
ATOM   9012  C C   . VAL G  1 71  ? -38.625  -3.228  -62.687  1.00 67.63  ? 71  VAL G C   1 
ATOM   9013  O O   . VAL G  1 71  ? -39.066  -4.131  -63.434  1.00 67.68  ? 71  VAL G O   1 
ATOM   9014  C CB  . VAL G  1 71  ? -39.838  -0.999  -62.409  1.00 68.08  ? 71  VAL G CB  1 
ATOM   9015  C CG1 . VAL G  1 71  ? -40.107  -1.113  -63.888  1.00 68.52  ? 71  VAL G CG1 1 
ATOM   9016  C CG2 . VAL G  1 71  ? -41.047  -0.357  -61.756  1.00 68.13  ? 71  VAL G CG2 1 
ATOM   9017  N N   . THR G  1 72  ? -37.330  -2.967  -62.615  1.00 67.92  ? 72  THR G N   1 
ATOM   9018  C CA  . THR G  1 72  ? -36.420  -3.740  -63.438  1.00 68.33  ? 72  THR G CA  1 
ATOM   9019  C C   . THR G  1 72  ? -36.400  -5.199  -63.018  1.00 68.04  ? 72  THR G C   1 
ATOM   9020  O O   . THR G  1 72  ? -36.353  -6.084  -63.885  1.00 68.46  ? 72  THR G O   1 
ATOM   9021  C CB  . THR G  1 72  ? -34.999  -3.152  -63.524  1.00 68.89  ? 72  THR G CB  1 
ATOM   9022  O OG1 . THR G  1 72  ? -34.354  -3.211  -62.247  1.00 68.66  ? 72  THR G OG1 1 
ATOM   9023  C CG2 . THR G  1 72  ? -35.057  -1.735  -64.057  1.00 69.38  ? 72  THR G CG2 1 
ATOM   9024  N N   . ALA G  1 73  ? -36.451  -5.462  -61.713  1.00 67.54  ? 73  ALA G N   1 
ATOM   9025  C CA  . ALA G  1 73  ? -36.488  -6.850  -61.240  1.00 67.40  ? 73  ALA G CA  1 
ATOM   9026  C C   . ALA G  1 73  ? -37.760  -7.559  -61.777  1.00 67.27  ? 73  ALA G C   1 
ATOM   9027  O O   . ALA G  1 73  ? -37.733  -8.739  -62.195  1.00 67.64  ? 73  ALA G O   1 
ATOM   9028  C CB  . ALA G  1 73  ? -36.418  -6.915  -59.722  1.00 67.00  ? 73  ALA G CB  1 
ATOM   9029  N N   . GLY G  1 74  ? -38.859  -6.807  -61.791  1.00 66.95  ? 74  GLY G N   1 
ATOM   9030  C CA  . GLY G  1 74  ? -40.085  -7.258  -62.412  1.00 66.99  ? 74  GLY G CA  1 
ATOM   9031  C C   . GLY G  1 74  ? -39.882  -7.613  -63.866  1.00 67.74  ? 74  GLY G C   1 
ATOM   9032  O O   . GLY G  1 74  ? -40.332  -8.673  -64.336  1.00 68.11  ? 74  GLY G O   1 
ATOM   9033  N N   . PHE G  1 75  ? -39.195  -6.738  -64.591  1.00 68.15  ? 75  PHE G N   1 
ATOM   9034  C CA  . PHE G  1 75  ? -38.992  -6.988  -66.017  1.00 69.05  ? 75  PHE G CA  1 
ATOM   9035  C C   . PHE G  1 75  ? -38.099  -8.187  -66.330  1.00 69.70  ? 75  PHE G C   1 
ATOM   9036  O O   . PHE G  1 75  ? -38.268  -8.850  -67.368  1.00 70.58  ? 75  PHE G O   1 
ATOM   9037  C CB  . PHE G  1 75  ? -38.513  -5.761  -66.734  1.00 69.49  ? 75  PHE G CB  1 
ATOM   9038  C CG  . PHE G  1 75  ? -39.616  -4.872  -67.195  1.00 69.58  ? 75  PHE G CG  1 
ATOM   9039  C CD1 . PHE G  1 75  ? -39.685  -3.544  -66.765  1.00 69.39  ? 75  PHE G CD1 1 
ATOM   9040  C CD2 . PHE G  1 75  ? -40.588  -5.339  -68.078  1.00 70.09  ? 75  PHE G CD2 1 
ATOM   9041  C CE1 . PHE G  1 75  ? -40.719  -2.710  -67.206  1.00 69.70  ? 75  PHE G CE1 1 
ATOM   9042  C CE2 . PHE G  1 75  ? -41.622  -4.510  -68.516  1.00 70.35  ? 75  PHE G CE2 1 
ATOM   9043  C CZ  . PHE G  1 75  ? -41.690  -3.196  -68.076  1.00 70.16  ? 75  PHE G CZ  1 
ATOM   9044  N N   . ALA G  1 76  ? -37.170  -8.497  -65.430  1.00 69.45  ? 76  ALA G N   1 
ATOM   9045  C CA  . ALA G  1 76  ? -36.388  -9.718  -65.606  1.00 70.22  ? 76  ALA G CA  1 
ATOM   9046  C C   . ALA G  1 76  ? -37.331  -10.933 -65.592  1.00 70.40  ? 76  ALA G C   1 
ATOM   9047  O O   . ALA G  1 76  ? -37.229  -11.827 -66.432  1.00 71.49  ? 76  ALA G O   1 
ATOM   9048  C CB  . ALA G  1 76  ? -35.337  -9.839  -64.535  1.00 70.00  ? 76  ALA G CB  1 
ATOM   9049  N N   . ILE G  1 77  ? -38.272  -10.947 -64.649  1.00 69.50  ? 77  ILE G N   1 
ATOM   9050  C CA  . ILE G  1 77  ? -39.263  -12.001 -64.599  1.00 69.69  ? 77  ILE G CA  1 
ATOM   9051  C C   . ILE G  1 77  ? -40.178  -11.961 -65.833  1.00 70.30  ? 77  ILE G C   1 
ATOM   9052  O O   . ILE G  1 77  ? -40.340  -12.969 -66.520  1.00 71.35  ? 77  ILE G O   1 
ATOM   9053  C CB  . ILE G  1 77  ? -40.082  -11.936 -63.302  1.00 68.68  ? 77  ILE G CB  1 
ATOM   9054  C CG1 . ILE G  1 77  ? -39.159  -12.150 -62.091  1.00 68.36  ? 77  ILE G CG1 1 
ATOM   9055  C CG2 . ILE G  1 77  ? -41.175  -12.981 -63.349  1.00 69.01  ? 77  ILE G CG2 1 
ATOM   9056  C CD1 . ILE G  1 77  ? -39.850  -12.044 -60.748  1.00 67.54  ? 77  ILE G CD1 1 
ATOM   9057  N N   . TYR G  1 78  ? -40.750  -10.797 -66.126  1.00 69.87  ? 78  TYR G N   1 
ATOM   9058  C CA  . TYR G  1 78  ? -41.646  -10.653 -67.248  1.00 70.53  ? 78  TYR G CA  1 
ATOM   9059  C C   . TYR G  1 78  ? -41.012  -11.170 -68.520  1.00 71.91  ? 78  TYR G C   1 
ATOM   9060  O O   . TYR G  1 78  ? -41.601  -12.025 -69.229  1.00 72.92  ? 78  TYR G O   1 
ATOM   9061  C CB  . TYR G  1 78  ? -42.022  -9.204  -67.441  1.00 70.12  ? 78  TYR G CB  1 
ATOM   9062  C CG  . TYR G  1 78  ? -42.864  -8.973  -68.654  1.00 70.99  ? 78  TYR G CG  1 
ATOM   9063  C CD1 . TYR G  1 78  ? -44.245  -8.959  -68.571  1.00 70.91  ? 78  TYR G CD1 1 
ATOM   9064  C CD2 . TYR G  1 78  ? -42.275  -8.759  -69.907  1.00 72.06  ? 78  TYR G CD2 1 
ATOM   9065  C CE1 . TYR G  1 78  ? -45.029  -8.745  -69.689  1.00 71.87  ? 78  TYR G CE1 1 
ATOM   9066  C CE2 . TYR G  1 78  ? -43.054  -8.551  -71.048  1.00 73.05  ? 78  TYR G CE2 1 
ATOM   9067  C CZ  . TYR G  1 78  ? -44.432  -8.546  -70.922  1.00 72.95  ? 78  TYR G CZ  1 
ATOM   9068  O OH  . TYR G  1 78  ? -45.226  -8.358  -72.005  1.00 74.05  ? 78  TYR G OH  1 
ATOM   9069  N N   . ASP G  1 79  ? -39.823  -10.657 -68.839  1.00 72.15  ? 79  ASP G N   1 
ATOM   9070  C CA  . ASP G  1 79  ? -39.184  -11.053 -70.082  1.00 73.65  ? 79  ASP G CA  1 
ATOM   9071  C C   . ASP G  1 79  ? -38.854  -12.551 -70.125  1.00 74.67  ? 79  ASP G C   1 
ATOM   9072  O O   . ASP G  1 79  ? -38.951  -13.194 -71.194  1.00 76.20  ? 79  ASP G O   1 
ATOM   9073  C CB  . ASP G  1 79  ? -37.960  -10.213 -70.365  1.00 73.80  ? 79  ASP G CB  1 
ATOM   9074  C CG  . ASP G  1 79  ? -38.292  -8.924  -71.076  1.00 73.83  ? 79  ASP G CG  1 
ATOM   9075  O OD1 . ASP G  1 79  ? -37.364  -8.114  -71.353  1.00 74.05  ? 79  ASP G OD1 1 
ATOM   9076  O OD2 . ASP G  1 79  ? -39.492  -8.712  -71.349  1.00 73.77  ? 79  ASP G OD2 1 
ATOM   9077  N N   . THR G  1 80  ? -38.486  -13.119 -68.978  1.00 74.04  ? 80  THR G N   1 
ATOM   9078  C CA  . THR G  1 80  ? -38.192  -14.540 -68.942  1.00 75.15  ? 80  THR G CA  1 
ATOM   9079  C C   . THR G  1 80  ? -39.450  -15.359 -69.164  1.00 75.67  ? 80  THR G C   1 
ATOM   9080  O O   . THR G  1 80  ? -39.405  -16.367 -69.875  1.00 77.32  ? 80  THR G O   1 
ATOM   9081  C CB  . THR G  1 80  ? -37.556  -14.942 -67.644  1.00 74.49  ? 80  THR G CB  1 
ATOM   9082  O OG1 . THR G  1 80  ? -36.337  -14.221 -67.532  1.00 74.30  ? 80  THR G OG1 1 
ATOM   9083  C CG2 . THR G  1 80  ? -37.256  -16.412 -67.653  1.00 75.90  ? 80  THR G CG2 1 
ATOM   9084  N N   . ILE G  1 81  ? -40.570  -14.931 -68.580  1.00 74.46  ? 81  ILE G N   1 
ATOM   9085  C CA  . ILE G  1 81  ? -41.850  -15.576 -68.865  1.00 75.02  ? 81  ILE G CA  1 
ATOM   9086  C C   . ILE G  1 81  ? -42.113  -15.611 -70.370  1.00 76.56  ? 81  ILE G C   1 
ATOM   9087  O O   . ILE G  1 81  ? -42.393  -16.683 -70.927  1.00 78.11  ? 81  ILE G O   1 
ATOM   9088  C CB  . ILE G  1 81  ? -43.027  -14.918 -68.125  1.00 73.62  ? 81  ILE G CB  1 
ATOM   9089  C CG1 . ILE G  1 81  ? -42.884  -15.184 -66.623  1.00 72.50  ? 81  ILE G CG1 1 
ATOM   9090  C CG2 . ILE G  1 81  ? -44.347  -15.461 -68.651  1.00 74.44  ? 81  ILE G CG2 1 
ATOM   9091  C CD1 . ILE G  1 81  ? -43.882  -14.444 -65.771  1.00 71.20  ? 81  ILE G CD1 1 
ATOM   9092  N N   . GLN G  1 82  ? -41.987  -14.460 -71.037  1.00 76.36  ? 82  GLN G N   1 
ATOM   9093  C CA  . GLN G  1 82  ? -42.297  -14.391 -72.474  1.00 77.91  ? 82  GLN G CA  1 
ATOM   9094  C C   . GLN G  1 82  ? -41.292  -15.168 -73.320  1.00 79.76  ? 82  GLN G C   1 
ATOM   9095  O O   . GLN G  1 82  ? -41.597  -15.604 -74.424  1.00 81.54  ? 82  GLN G O   1 
ATOM   9096  C CB  . GLN G  1 82  ? -42.377  -12.944 -72.968  1.00 77.40  ? 82  GLN G CB  1 
ATOM   9097  C CG  . GLN G  1 82  ? -43.309  -11.995 -72.200  1.00 75.83  ? 82  GLN G CG  1 
ATOM   9098  C CD  . GLN G  1 82  ? -44.563  -12.673 -71.658  1.00 75.61  ? 82  GLN G CD  1 
ATOM   9099  O OE1 . GLN G  1 82  ? -45.051  -12.339 -70.567  1.00 74.24  ? 82  GLN G OE1 1 
ATOM   9100  N NE2 . GLN G  1 82  ? -45.057  -13.662 -72.382  1.00 77.10  ? 82  GLN G NE2 1 
ATOM   9101  N N   . HIS G  1 83  ? -40.089  -15.347 -72.786  1.00 79.51  ? 83  HIS G N   1 
ATOM   9102  C CA  . HIS G  1 83  ? -39.005  -15.927 -73.570  1.00 81.34  ? 83  HIS G CA  1 
ATOM   9103  C C   . HIS G  1 83  ? -38.995  -17.422 -73.601  1.00 82.95  ? 83  HIS G C   1 
ATOM   9104  O O   . HIS G  1 83  ? -38.501  -18.015 -74.551  1.00 85.08  ? 83  HIS G O   1 
ATOM   9105  C CB  . HIS G  1 83  ? -37.665  -15.412 -73.069  1.00 80.64  ? 83  HIS G CB  1 
ATOM   9106  C CG  . HIS G  1 83  ? -36.491  -15.967 -73.814  1.00 82.59  ? 83  HIS G CG  1 
ATOM   9107  N ND1 . HIS G  1 83  ? -35.719  -16.957 -73.304  1.00 83.33  ? 83  HIS G ND1 1 
ATOM   9108  C CD2 . HIS G  1 83  ? -35.975  -15.659 -75.073  1.00 84.16  ? 83  HIS G CD2 1 
ATOM   9109  C CE1 . HIS G  1 83  ? -34.746  -17.276 -74.198  1.00 85.34  ? 83  HIS G CE1 1 
ATOM   9110  N NE2 . HIS G  1 83  ? -34.909  -16.480 -75.283  1.00 85.83  ? 83  HIS G NE2 1 
ATOM   9111  N N   . ILE G  1 84  ? -39.519  -18.054 -72.567  1.00 82.17  ? 84  ILE G N   1 
ATOM   9112  C CA  . ILE G  1 84  ? -39.499  -19.495 -72.510  1.00 83.81  ? 84  ILE G CA  1 
ATOM   9113  C C   . ILE G  1 84  ? -40.677  -20.100 -73.255  1.00 85.21  ? 84  ILE G C   1 
ATOM   9114  O O   . ILE G  1 84  ? -41.664  -19.425 -73.497  1.00 84.45  ? 84  ILE G O   1 
ATOM   9115  C CB  . ILE G  1 84  ? -39.459  -20.016 -71.064  1.00 82.67  ? 84  ILE G CB  1 
ATOM   9116  C CG1 . ILE G  1 84  ? -40.688  -19.531 -70.282  1.00 80.78  ? 84  ILE G CG1 1 
ATOM   9117  C CG2 . ILE G  1 84  ? -38.104  -19.704 -70.442  1.00 82.04  ? 84  ILE G CG2 1 
ATOM   9118  C CD1 . ILE G  1 84  ? -40.976  -20.375 -69.063  1.00 80.35  ? 84  ILE G CD1 1 
ATOM   9119  N N   . LYS G  1 85  ? -40.553  -21.380 -73.602  1.00 87.44  ? 85  LYS G N   1 
ATOM   9120  C CA  . LYS G  1 85  ? -41.563  -22.093 -74.397  1.00 89.32  ? 85  LYS G CA  1 
ATOM   9121  C C   . LYS G  1 85  ? -42.836  -22.421 -73.622  1.00 88.39  ? 85  LYS G C   1 
ATOM   9122  O O   . LYS G  1 85  ? -43.919  -22.061 -74.059  1.00 88.32  ? 85  LYS G O   1 
ATOM   9123  C CB  . LYS G  1 85  ? -40.986  -23.356 -75.046  1.00 92.37  ? 85  LYS G CB  1 
ATOM   9124  C CG  . LYS G  1 85  ? -39.905  -23.068 -76.073  1.00 93.85  ? 85  LYS G CG  1 
ATOM   9125  C CD  . LYS G  1 85  ? -39.430  -24.331 -76.743  1.00 97.19  ? 85  LYS G CD  1 
ATOM   9126  C CE  . LYS G  1 85  ? -39.068  -24.040 -78.194  1.00 99.28  ? 85  LYS G CE  1 
ATOM   9127  N NZ  . LYS G  1 85  ? -39.578  -25.103 -79.107  1.00 102.58 ? 85  LYS G NZ  1 
ATOM   9128  N N   . PRO G  1 86  ? -42.719  -23.080 -72.456  1.00 87.76  ? 86  PRO G N   1 
ATOM   9129  C CA  . PRO G  1 86  ? -43.952  -23.400 -71.743  1.00 87.04  ? 86  PRO G CA  1 
ATOM   9130  C C   . PRO G  1 86  ? -44.853  -22.196 -71.461  1.00 84.83  ? 86  PRO G C   1 
ATOM   9131  O O   . PRO G  1 86  ? -44.374  -21.085 -71.263  1.00 83.17  ? 86  PRO G O   1 
ATOM   9132  C CB  . PRO G  1 86  ? -43.451  -23.995 -70.419  1.00 86.31  ? 86  PRO G CB  1 
ATOM   9133  C CG  . PRO G  1 86  ? -42.034  -24.414 -70.683  1.00 87.62  ? 86  PRO G CG  1 
ATOM   9134  C CD  . PRO G  1 86  ? -41.519  -23.416 -71.662  1.00 87.50  ? 86  PRO G CD  1 
ATOM   9135  N N   . ASP G  1 87  ? -46.159  -22.429 -71.464  1.00 85.06  ? 87  ASP G N   1 
ATOM   9136  C CA  . ASP G  1 87  ? -47.106  -21.440 -70.961  1.00 83.09  ? 87  ASP G CA  1 
ATOM   9137  C C   . ASP G  1 87  ? -46.878  -21.253 -69.474  1.00 81.08  ? 87  ASP G C   1 
ATOM   9138  O O   . ASP G  1 87  ? -46.634  -22.230 -68.767  1.00 81.51  ? 87  ASP G O   1 
ATOM   9139  C CB  . ASP G  1 87  ? -48.553  -21.884 -71.200  1.00 84.02  ? 87  ASP G CB  1 
ATOM   9140  C CG  . ASP G  1 87  ? -49.001  -21.668 -72.633  1.00 85.67  ? 87  ASP G CG  1 
ATOM   9141  O OD1 . ASP G  1 87  ? -50.136  -22.095 -73.000  1.00 86.87  ? 87  ASP G OD1 1 
ATOM   9142  O OD2 . ASP G  1 87  ? -48.200  -21.057 -73.393  1.00 85.86  ? 87  ASP G OD2 1 
ATOM   9143  N N   . VAL G  1 88  ? -46.943  -20.011 -68.993  1.00 79.08  ? 88  VAL G N   1 
ATOM   9144  C CA  . VAL G  1 88  ? -46.897  -19.791 -67.557  1.00 77.34  ? 88  VAL G CA  1 
ATOM   9145  C C   . VAL G  1 88  ? -48.250  -19.299 -67.074  1.00 76.41  ? 88  VAL G C   1 
ATOM   9146  O O   . VAL G  1 88  ? -48.645  -18.205 -67.429  1.00 75.74  ? 88  VAL G O   1 
ATOM   9147  C CB  . VAL G  1 88  ? -45.774  -18.804 -67.192  1.00 75.96  ? 88  VAL G CB  1 
ATOM   9148  C CG1 . VAL G  1 88  ? -45.781  -18.478 -65.713  1.00 74.30  ? 88  VAL G CG1 1 
ATOM   9149  C CG2 . VAL G  1 88  ? -44.425  -19.374 -67.607  1.00 77.05  ? 88  VAL G CG2 1 
ATOM   9150  N N   . GLN G  1 89  ? -48.955  -20.116 -66.287  1.00 76.57  ? 89  GLN G N   1 
ATOM   9151  C CA  . GLN G  1 89  ? -50.219  -19.708 -65.691  1.00 75.78  ? 89  GLN G CA  1 
ATOM   9152  C C   . GLN G  1 89  ? -49.895  -18.851 -64.514  1.00 73.92  ? 89  GLN G C   1 
ATOM   9153  O O   . GLN G  1 89  ? -48.975  -19.159 -63.760  1.00 73.49  ? 89  GLN G O   1 
ATOM   9154  C CB  . GLN G  1 89  ? -51.038  -20.899 -65.224  1.00 76.73  ? 89  GLN G CB  1 
ATOM   9155  C CG  . GLN G  1 89  ? -51.182  -21.941 -66.310  1.00 78.92  ? 89  GLN G CG  1 
ATOM   9156  C CD  . GLN G  1 89  ? -52.379  -22.862 -66.133  1.00 80.09  ? 89  GLN G CD  1 
ATOM   9157  O OE1 . GLN G  1 89  ? -53.280  -22.578 -65.330  1.00 79.21  ? 89  GLN G OE1 1 
ATOM   9158  N NE2 . GLN G  1 89  ? -52.402  -23.971 -66.889  1.00 82.27  ? 89  GLN G NE2 1 
ATOM   9159  N N   . THR G  1 90  ? -50.631  -17.766 -64.357  1.00 73.01  ? 90  THR G N   1 
ATOM   9160  C CA  . THR G  1 90  ? -50.488  -16.960 -63.171  1.00 71.51  ? 90  THR G CA  1 
ATOM   9161  C C   . THR G  1 90  ? -51.763  -17.043 -62.338  1.00 71.32  ? 90  THR G C   1 
ATOM   9162  O O   . THR G  1 90  ? -52.871  -16.908 -62.855  1.00 71.89  ? 90  THR G O   1 
ATOM   9163  C CB  . THR G  1 90  ? -50.128  -15.505 -63.515  1.00 70.69  ? 90  THR G CB  1 
ATOM   9164  O OG1 . THR G  1 90  ? -51.052  -14.971 -64.458  1.00 71.25  ? 90  THR G OG1 1 
ATOM   9165  C CG2 . THR G  1 90  ? -48.758  -15.447 -64.102  1.00 70.82  ? 90  THR G CG2 1 
ATOM   9166  N N   . ILE G  1 91  ? -51.593  -17.286 -61.043  1.00 70.68  ? 91  ILE G N   1 
ATOM   9167  C CA  . ILE G  1 91  ? -52.715  -17.365 -60.107  1.00 70.54  ? 91  ILE G CA  1 
ATOM   9168  C C   . ILE G  1 91  ? -52.484  -16.412 -58.933  1.00 69.36  ? 91  ILE G C   1 
ATOM   9169  O O   . ILE G  1 91  ? -51.558  -16.577 -58.158  1.00 68.90  ? 91  ILE G O   1 
ATOM   9170  C CB  . ILE G  1 91  ? -52.862  -18.792 -59.582  1.00 71.34  ? 91  ILE G CB  1 
ATOM   9171  C CG1 . ILE G  1 91  ? -52.974  -19.774 -60.756  1.00 72.80  ? 91  ILE G CG1 1 
ATOM   9172  C CG2 . ILE G  1 91  ? -54.038  -18.921 -58.608  1.00 71.35  ? 91  ILE G CG2 1 
ATOM   9173  C CD1 . ILE G  1 91  ? -52.098  -21.000 -60.575  1.00 73.59  ? 91  ILE G CD1 1 
ATOM   9174  N N   . CYS G  1 92  ? -53.333  -15.405 -58.810  1.00 69.06  ? 92  CYS G N   1 
ATOM   9175  C CA  . CYS G  1 92  ? -53.237  -14.465 -57.702  1.00 68.25  ? 92  CYS G CA  1 
ATOM   9176  C C   . CYS G  1 92  ? -53.969  -14.951 -56.462  1.00 68.38  ? 92  CYS G C   1 
ATOM   9177  O O   . CYS G  1 92  ? -55.173  -15.105 -56.467  1.00 68.93  ? 92  CYS G O   1 
ATOM   9178  C CB  . CYS G  1 92  ? -53.830  -13.119 -58.110  1.00 68.16  ? 92  CYS G CB  1 
ATOM   9179  S SG  . CYS G  1 92  ? -53.812  -11.909 -56.760  1.00 67.57  ? 92  CYS G SG  1 
ATOM   9180  N N   . ILE G  1 93  ? -53.226  -15.163 -55.398  1.00 67.99  ? 93  ILE G N   1 
ATOM   9181  C CA  . ILE G  1 93  ? -53.782  -15.435 -54.087  1.00 68.12  ? 93  ILE G CA  1 
ATOM   9182  C C   . ILE G  1 93  ? -53.406  -14.314 -53.121  1.00 67.57  ? 93  ILE G C   1 
ATOM   9183  O O   . ILE G  1 93  ? -52.277  -13.872 -53.102  1.00 67.08  ? 93  ILE G O   1 
ATOM   9184  C CB  . ILE G  1 93  ? -53.238  -16.750 -53.528  1.00 68.45  ? 93  ILE G CB  1 
ATOM   9185  C CG1 . ILE G  1 93  ? -51.702  -16.709 -53.396  1.00 67.99  ? 93  ILE G CG1 1 
ATOM   9186  C CG2 . ILE G  1 93  ? -53.682  -17.905 -54.408  1.00 69.30  ? 93  ILE G CG2 1 
ATOM   9187  C CD1 . ILE G  1 93  ? -51.121  -17.941 -52.724  1.00 68.48  ? 93  ILE G CD1 1 
ATOM   9188  N N   . GLY G  1 94  ? -54.329  -13.856 -52.302  1.00 67.83  ? 94  GLY G N   1 
ATOM   9189  C CA  . GLY G  1 94  ? -54.013  -12.733 -51.428  1.00 67.61  ? 94  GLY G CA  1 
ATOM   9190  C C   . GLY G  1 94  ? -54.098  -11.367 -52.100  1.00 67.48  ? 94  GLY G C   1 
ATOM   9191  O O   . GLY G  1 94  ? -55.168  -10.738 -52.178  1.00 67.96  ? 94  GLY G O   1 
ATOM   9192  N N   . MET G  1 95  ? -52.955  -10.894 -52.564  1.00 66.96  ? 95  MET G N   1 
ATOM   9193  C CA  . MET G  1 95  ? -52.843  -9.559  -53.142  1.00 66.93  ? 95  MET G CA  1 
ATOM   9194  C C   . MET G  1 95  ? -51.814  -9.602  -54.273  1.00 66.49  ? 95  MET G C   1 
ATOM   9195  O O   . MET G  1 95  ? -50.765  -10.239 -54.149  1.00 66.14  ? 95  MET G O   1 
ATOM   9196  C CB  . MET G  1 95  ? -52.381  -8.563  -52.063  1.00 67.03  ? 95  MET G CB  1 
ATOM   9197  C CG  . MET G  1 95  ? -51.989  -7.136  -52.521  1.00 67.14  ? 95  MET G CG  1 
ATOM   9198  S SD  . MET G  1 95  ? -53.413  -6.134  -53.272  1.00 67.94  ? 95  MET G SD  1 
ATOM   9199  C CE  . MET G  1 95  ? -54.129  -5.300  -51.803  1.00 68.93  ? 95  MET G CE  1 
ATOM   9200  N N   . ALA G  1 96  ? -52.114  -8.940  -55.378  1.00 66.65  ? 96  ALA G N   1 
ATOM   9201  C CA  . ALA G  1 96  ? -51.104  -8.681  -56.378  1.00 66.38  ? 96  ALA G CA  1 
ATOM   9202  C C   . ALA G  1 96  ? -51.095  -7.206  -56.655  1.00 66.60  ? 96  ALA G C   1 
ATOM   9203  O O   . ALA G  1 96  ? -52.011  -6.670  -57.275  1.00 67.11  ? 96  ALA G O   1 
ATOM   9204  C CB  . ALA G  1 96  ? -51.375  -9.467  -57.638  1.00 66.62  ? 96  ALA G CB  1 
ATOM   9205  N N   . ALA G  1 97  ? -50.069  -6.522  -56.181  1.00 66.38  ? 97  ALA G N   1 
ATOM   9206  C CA  . ALA G  1 97  ? -50.063  -5.055  -56.252  1.00 66.80  ? 97  ALA G CA  1 
ATOM   9207  C C   . ALA G  1 97  ? -48.917  -4.552  -57.075  1.00 66.66  ? 97  ALA G C   1 
ATOM   9208  O O   . ALA G  1 97  ? -47.876  -5.199  -57.097  1.00 66.19  ? 97  ALA G O   1 
ATOM   9209  C CB  . ALA G  1 97  ? -50.013  -4.456  -54.849  1.00 67.07  ? 97  ALA G CB  1 
ATOM   9210  N N   . ALA G  1 98  ? -49.101  -3.420  -57.752  1.00 67.20  ? 98  ALA G N   1 
ATOM   9211  C CA  . ALA G  1 98  ? -48.007  -2.784  -58.501  1.00 67.24  ? 98  ALA G CA  1 
ATOM   9212  C C   . ALA G  1 98  ? -47.336  -3.773  -59.449  1.00 66.81  ? 98  ALA G C   1 
ATOM   9213  O O   . ALA G  1 98  ? -48.027  -4.480  -60.166  1.00 66.90  ? 98  ALA G O   1 
ATOM   9214  C CB  . ALA G  1 98  ? -46.991  -2.192  -57.543  1.00 67.22  ? 98  ALA G CB  1 
ATOM   9215  N N   . MET G  1 99  ? -46.013  -3.867  -59.422  1.00 66.53  ? 99  MET G N   1 
ATOM   9216  C CA  . MET G  1 99  ? -45.324  -4.802  -60.295  1.00 66.36  ? 99  MET G CA  1 
ATOM   9217  C C   . MET G  1 99  ? -45.851  -6.239  -60.159  1.00 66.13  ? 99  MET G C   1 
ATOM   9218  O O   . MET G  1 99  ? -45.769  -7.013  -61.112  1.00 66.35  ? 99  MET G O   1 
ATOM   9219  C CB  . MET G  1 99  ? -43.808  -4.755  -60.078  1.00 66.20  ? 99  MET G CB  1 
ATOM   9220  C CG  . MET G  1 99  ? -42.985  -5.335  -61.243  1.00 66.39  ? 99  MET G CG  1 
ATOM   9221  S SD  . MET G  1 99  ? -43.107  -4.522  -62.893  1.00 67.11  ? 99  MET G SD  1 
ATOM   9222  C CE  . MET G  1 99  ? -43.534  -2.871  -62.300  1.00 67.31  ? 99  MET G CE  1 
ATOM   9223  N N   . GLY G  1 100 ? -46.399  -6.571  -58.985  1.00 65.88  ? 100 GLY G N   1 
ATOM   9224  C CA  . GLY G  1 100 ? -47.055  -7.827  -58.747  1.00 65.82  ? 100 GLY G CA  1 
ATOM   9225  C C   . GLY G  1 100 ? -48.251  -8.030  -59.655  1.00 66.26  ? 100 GLY G C   1 
ATOM   9226  O O   . GLY G  1 100 ? -48.394  -9.114  -60.256  1.00 66.50  ? 100 GLY G O   1 
ATOM   9227  N N   . SER G  1 101 ? -49.104  -7.014  -59.793  1.00 66.57  ? 101 SER G N   1 
ATOM   9228  C CA  . SER G  1 101 ? -50.246  -7.165  -60.683  1.00 67.15  ? 101 SER G CA  1 
ATOM   9229  C C   . SER G  1 101 ? -49.802  -7.118  -62.139  1.00 67.56  ? 101 SER G C   1 
ATOM   9230  O O   . SER G  1 101 ? -50.482  -7.675  -63.025  1.00 68.15  ? 101 SER G O   1 
ATOM   9231  C CB  . SER G  1 101 ? -51.279  -6.103  -60.423  1.00 67.59  ? 101 SER G CB  1 
ATOM   9232  O OG  . SER G  1 101 ? -50.817  -4.889  -60.967  1.00 67.86  ? 101 SER G OG  1 
ATOM   9233  N N   . PHE G  1 102 ? -48.656  -6.472  -62.383  1.00 67.40  ? 102 PHE G N   1 
ATOM   9234  C CA  . PHE G  1 102 ? -48.091  -6.439  -63.720  1.00 67.88  ? 102 PHE G CA  1 
ATOM   9235  C C   . PHE G  1 102 ? -47.814  -7.866  -64.138  1.00 68.03  ? 102 PHE G C   1 
ATOM   9236  O O   . PHE G  1 102 ? -48.239  -8.296  -65.209  1.00 68.79  ? 102 PHE G O   1 
ATOM   9237  C CB  . PHE G  1 102 ? -46.831  -5.591  -63.770  1.00 67.72  ? 102 PHE G CB  1 
ATOM   9238  C CG  . PHE G  1 102 ? -46.308  -5.350  -65.170  1.00 68.39  ? 102 PHE G CG  1 
ATOM   9239  C CD1 . PHE G  1 102 ? -46.919  -4.434  -66.044  1.00 69.14  ? 102 PHE G CD1 1 
ATOM   9240  C CD2 . PHE G  1 102 ? -45.203  -6.041  -65.617  1.00 68.46  ? 102 PHE G CD2 1 
ATOM   9241  C CE1 . PHE G  1 102 ? -46.427  -4.234  -67.323  1.00 69.89  ? 102 PHE G CE1 1 
ATOM   9242  C CE2 . PHE G  1 102 ? -44.717  -5.844  -66.904  1.00 69.25  ? 102 PHE G CE2 1 
ATOM   9243  C CZ  . PHE G  1 102 ? -45.327  -4.944  -67.753  1.00 69.94  ? 102 PHE G CZ  1 
ATOM   9244  N N   . LEU G  1 103 ? -47.160  -8.616  -63.263  1.00 67.51  ? 103 LEU G N   1 
ATOM   9245  C CA  . LEU G  1 103 ? -46.766  -9.983  -63.583  1.00 67.85  ? 103 LEU G CA  1 
ATOM   9246  C C   . LEU G  1 103 ? -47.978  -10.882 -63.670  1.00 68.31  ? 103 LEU G C   1 
ATOM   9247  O O   . LEU G  1 103 ? -48.008  -11.791 -64.482  1.00 69.11  ? 103 LEU G O   1 
ATOM   9248  C CB  . LEU G  1 103 ? -45.764  -10.536 -62.577  1.00 67.36  ? 103 LEU G CB  1 
ATOM   9249  C CG  . LEU G  1 103 ? -44.400  -9.849  -62.491  1.00 67.10  ? 103 LEU G CG  1 
ATOM   9250  C CD1 . LEU G  1 103 ? -43.616  -10.504 -61.381  1.00 66.76  ? 103 LEU G CD1 1 
ATOM   9251  C CD2 . LEU G  1 103 ? -43.655  -9.923  -63.814  1.00 67.81  ? 103 LEU G CD2 1 
ATOM   9252  N N   . LEU G  1 104 ? -48.993  -10.609 -62.856  1.00 67.98  ? 104 LEU G N   1 
ATOM   9253  C CA  . LEU G  1 104 ? -50.234  -11.356 -62.941  1.00 68.52  ? 104 LEU G CA  1 
ATOM   9254  C C   . LEU G  1 104 ? -50.756  -11.308 -64.375  1.00 69.51  ? 104 LEU G C   1 
ATOM   9255  O O   . LEU G  1 104 ? -51.143  -12.329 -64.946  1.00 70.36  ? 104 LEU G O   1 
ATOM   9256  C CB  . LEU G  1 104 ? -51.271  -10.785 -61.985  1.00 68.19  ? 104 LEU G CB  1 
ATOM   9257  C CG  . LEU G  1 104 ? -52.648  -11.455 -61.959  1.00 68.80  ? 104 LEU G CG  1 
ATOM   9258  C CD1 . LEU G  1 104 ? -52.586  -12.949 -61.650  1.00 69.06  ? 104 LEU G CD1 1 
ATOM   9259  C CD2 . LEU G  1 104 ? -53.534  -10.741 -60.952  1.00 68.56  ? 104 LEU G CD2 1 
ATOM   9260  N N   . ALA G  1 105 ? -50.730  -10.105 -64.944  1.00 69.57  ? 105 ALA G N   1 
ATOM   9261  C CA  . ALA G  1 105 ? -51.307  -9.841  -66.261  1.00 70.62  ? 105 ALA G CA  1 
ATOM   9262  C C   . ALA G  1 105 ? -50.421  -10.421 -67.337  1.00 71.31  ? 105 ALA G C   1 
ATOM   9263  O O   . ALA G  1 105 ? -50.809  -10.488 -68.488  1.00 72.42  ? 105 ALA G O   1 
ATOM   9264  C CB  . ALA G  1 105 ? -51.505  -8.341  -66.473  1.00 70.62  ? 105 ALA G CB  1 
ATOM   9265  N N   . ALA G  1 106 ? -49.233  -10.871 -66.941  1.00 70.81  ? 106 ALA G N   1 
ATOM   9266  C CA  . ALA G  1 106 ? -48.210  -11.342 -67.895  1.00 71.56  ? 106 ALA G CA  1 
ATOM   9267  C C   . ALA G  1 106 ? -48.244  -12.858 -68.177  1.00 72.51  ? 106 ALA G C   1 
ATOM   9268  O O   . ALA G  1 106 ? -47.478  -13.377 -68.996  1.00 73.46  ? 106 ALA G O   1 
ATOM   9269  C CB  . ALA G  1 106 ? -46.823  -10.918 -67.434  1.00 70.79  ? 106 ALA G CB  1 
ATOM   9270  N N   . GLY G  1 107 ? -49.137  -13.562 -67.504  1.00 72.45  ? 107 GLY G N   1 
ATOM   9271  C CA  . GLY G  1 107 ? -49.299  -14.981 -67.716  1.00 73.54  ? 107 GLY G CA  1 
ATOM   9272  C C   . GLY G  1 107 ? -49.881  -15.217 -69.084  1.00 75.14  ? 107 GLY G C   1 
ATOM   9273  O O   . GLY G  1 107 ? -50.404  -14.289 -69.711  1.00 75.28  ? 107 GLY G O   1 
ATOM   9274  N N   . ALA G  1 108 ? -49.758  -16.460 -69.550  1.00 76.55  ? 108 ALA G N   1 
ATOM   9275  C CA  . ALA G  1 108 ? -50.305  -16.891 -70.828  1.00 78.44  ? 108 ALA G CA  1 
ATOM   9276  C C   . ALA G  1 108 ? -51.796  -16.567 -70.955  1.00 78.69  ? 108 ALA G C   1 
ATOM   9277  O O   . ALA G  1 108 ? -52.574  -16.838 -70.034  1.00 78.11  ? 108 ALA G O   1 
ATOM   9278  C CB  . ALA G  1 108 ? -50.055  -18.374 -71.023  1.00 80.00  ? 108 ALA G CB  1 
ATOM   9279  N N   . LYS G  1 109 ? -52.185  -15.976 -72.082  1.00 79.68  ? 109 LYS G N   1 
ATOM   9280  C CA  . LYS G  1 109 ? -53.573  -15.557 -72.263  1.00 80.07  ? 109 LYS G CA  1 
ATOM   9281  C C   . LYS G  1 109 ? -54.549  -16.734 -72.136  1.00 81.24  ? 109 LYS G C   1 
ATOM   9282  O O   . LYS G  1 109 ? -54.294  -17.802 -72.671  1.00 82.74  ? 109 LYS G O   1 
ATOM   9283  C CB  . LYS G  1 109 ? -53.760  -14.826 -73.585  1.00 81.28  ? 109 LYS G CB  1 
ATOM   9284  C CG  . LYS G  1 109 ? -53.104  -13.441 -73.608  1.00 80.13  ? 109 LYS G CG  1 
ATOM   9285  C CD  . LYS G  1 109 ? -53.264  -12.806 -75.000  1.00 81.63  ? 109 LYS G CD  1 
ATOM   9286  C CE  . LYS G  1 109 ? -52.345  -11.596 -75.268  1.00 80.95  ? 109 LYS G CE  1 
ATOM   9287  N NZ  . LYS G  1 109 ? -52.517  -10.462 -74.303  1.00 79.25  ? 109 LYS G NZ  1 
ATOM   9288  N N   . GLY G  1 110 ? -55.637  -16.526 -71.396  1.00 80.65  ? 110 GLY G N   1 
ATOM   9289  C CA  . GLY G  1 110 ? -56.577  -17.575 -71.072  1.00 81.58  ? 110 GLY G CA  1 
ATOM   9290  C C   . GLY G  1 110 ? -56.199  -18.372 -69.838  1.00 80.64  ? 110 GLY G C   1 
ATOM   9291  O O   . GLY G  1 110 ? -56.996  -19.192 -69.375  1.00 81.25  ? 110 GLY G O   1 
ATOM   9292  N N   . LYS G  1 111 ? -54.993  -18.147 -69.309  1.00 79.31  ? 111 LYS G N   1 
ATOM   9293  C CA  . LYS G  1 111 ? -54.521  -18.845 -68.111  1.00 78.47  ? 111 LYS G CA  1 
ATOM   9294  C C   . LYS G  1 111 ? -54.014  -17.885 -66.987  1.00 76.33  ? 111 LYS G C   1 
ATOM   9295  O O   . LYS G  1 111 ? -53.029  -18.174 -66.264  1.00 75.57  ? 111 LYS G O   1 
ATOM   9296  C CB  . LYS G  1 111 ? -53.444  -19.870 -68.468  1.00 79.45  ? 111 LYS G CB  1 
ATOM   9297  C CG  . LYS G  1 111 ? -53.827  -20.766 -69.611  1.00 81.80  ? 111 LYS G CG  1 
ATOM   9298  C CD  . LYS G  1 111 ? -52.918  -21.973 -69.705  1.00 83.03  ? 111 LYS G CD  1 
ATOM   9299  C CE  . LYS G  1 111 ? -53.205  -22.774 -70.963  1.00 85.68  ? 111 LYS G CE  1 
ATOM   9300  N NZ  . LYS G  1 111 ? -51.912  -23.389 -71.340  1.00 86.67  ? 111 LYS G NZ  1 
ATOM   9301  N N   . ARG G  1 112 ? -54.702  -16.755 -66.837  1.00 75.60  ? 112 ARG G N   1 
ATOM   9302  C CA  . ARG G  1 112 ? -54.443  -15.821 -65.751  1.00 73.91  ? 112 ARG G CA  1 
ATOM   9303  C C   . ARG G  1 112 ? -55.634  -15.817 -64.785  1.00 73.66  ? 112 ARG G C   1 
ATOM   9304  O O   . ARG G  1 112 ? -56.747  -15.414 -65.131  1.00 74.26  ? 112 ARG G O   1 
ATOM   9305  C CB  . ARG G  1 112 ? -54.158  -14.442 -66.309  1.00 73.46  ? 112 ARG G CB  1 
ATOM   9306  C CG  . ARG G  1 112 ? -52.951  -14.412 -67.240  1.00 73.77  ? 112 ARG G CG  1 
ATOM   9307  C CD  . ARG G  1 112 ? -52.844  -13.094 -67.984  1.00 73.71  ? 112 ARG G CD  1 
ATOM   9308  N NE  . ARG G  1 112 ? -54.136  -12.756 -68.540  1.00 74.60  ? 112 ARG G NE  1 
ATOM   9309  C CZ  . ARG G  1 112 ? -54.386  -11.673 -69.263  1.00 74.96  ? 112 ARG G CZ  1 
ATOM   9310  N NH1 . ARG G  1 112 ? -53.406  -10.815 -69.542  1.00 74.48  ? 112 ARG G NH1 1 
ATOM   9311  N NH2 . ARG G  1 112 ? -55.628  -11.465 -69.730  1.00 75.97  ? 112 ARG G NH2 1 
ATOM   9312  N N   . PHE G  1 113 ? -55.394  -16.297 -63.572  1.00 72.95  ? 113 PHE G N   1 
ATOM   9313  C CA  . PHE G  1 113 ? -56.455  -16.493 -62.599  1.00 72.91  ? 113 PHE G CA  1 
ATOM   9314  C C   . PHE G  1 113 ? -56.302  -15.646 -61.329  1.00 71.61  ? 113 PHE G C   1 
ATOM   9315  O O   . PHE G  1 113 ? -55.230  -15.159 -61.021  1.00 70.70  ? 113 PHE G O   1 
ATOM   9316  C CB  . PHE G  1 113 ? -56.533  -17.974 -62.216  1.00 73.66  ? 113 PHE G CB  1 
ATOM   9317  C CG  . PHE G  1 113 ? -56.602  -18.900 -63.386  1.00 75.20  ? 113 PHE G CG  1 
ATOM   9318  C CD1 . PHE G  1 113 ? -55.448  -19.466 -63.909  1.00 75.56  ? 113 PHE G CD1 1 
ATOM   9319  C CD2 . PHE G  1 113 ? -57.829  -19.209 -63.987  1.00 76.52  ? 113 PHE G CD2 1 
ATOM   9320  C CE1 . PHE G  1 113 ? -55.516  -20.324 -64.999  1.00 77.27  ? 113 PHE G CE1 1 
ATOM   9321  C CE2 . PHE G  1 113 ? -57.898  -20.054 -65.081  1.00 78.20  ? 113 PHE G CE2 1 
ATOM   9322  C CZ  . PHE G  1 113 ? -56.741  -20.617 -65.583  1.00 78.61  ? 113 PHE G CZ  1 
ATOM   9323  N N   . ALA G  1 114 ? -57.391  -15.477 -60.594  1.00 71.71  ? 114 ALA G N   1 
ATOM   9324  C CA  . ALA G  1 114 ? -57.317  -14.996 -59.220  1.00 70.83  ? 114 ALA G CA  1 
ATOM   9325  C C   . ALA G  1 114 ? -58.308  -15.758 -58.364  1.00 71.37  ? 114 ALA G C   1 
ATOM   9326  O O   . ALA G  1 114 ? -59.380  -16.113 -58.828  1.00 72.35  ? 114 ALA G O   1 
ATOM   9327  C CB  . ALA G  1 114 ? -57.601  -13.517 -59.162  1.00 70.47  ? 114 ALA G CB  1 
ATOM   9328  N N   . LEU G  1 115 ? -57.969  -16.030 -57.120  1.00 70.87  ? 115 LEU G N   1 
ATOM   9329  C CA  . LEU G  1 115 ? -58.975  -16.620 -56.235  1.00 71.46  ? 115 LEU G CA  1 
ATOM   9330  C C   . LEU G  1 115 ? -60.079  -15.600 -55.844  1.00 71.66  ? 115 LEU G C   1 
ATOM   9331  O O   . LEU G  1 115 ? -59.854  -14.394 -55.916  1.00 71.17  ? 115 LEU G O   1 
ATOM   9332  C CB  . LEU G  1 115 ? -58.286  -17.254 -55.043  1.00 71.09  ? 115 LEU G CB  1 
ATOM   9333  C CG  . LEU G  1 115 ? -57.296  -18.373 -55.437  1.00 71.26  ? 115 LEU G CG  1 
ATOM   9334  C CD1 . LEU G  1 115 ? -57.013  -19.304 -54.269  1.00 71.45  ? 115 LEU G CD1 1 
ATOM   9335  C CD2 . LEU G  1 115 ? -57.863  -19.180 -56.573  1.00 72.37  ? 115 LEU G CD2 1 
ATOM   9336  N N   . PRO G  1 116 ? -61.275  -16.060 -55.458  1.00 72.56  ? 116 PRO G N   1 
ATOM   9337  C CA  . PRO G  1 116 ? -62.404  -15.118 -55.307  1.00 73.08  ? 116 PRO G CA  1 
ATOM   9338  C C   . PRO G  1 116 ? -62.143  -13.878 -54.445  1.00 72.50  ? 116 PRO G C   1 
ATOM   9339  O O   . PRO G  1 116 ? -62.612  -12.808 -54.770  1.00 72.78  ? 116 PRO G O   1 
ATOM   9340  C CB  . PRO G  1 116 ? -63.495  -15.958 -54.646  1.00 74.07  ? 116 PRO G CB  1 
ATOM   9341  C CG  . PRO G  1 116 ? -63.091  -17.365 -54.820  1.00 74.29  ? 116 PRO G CG  1 
ATOM   9342  C CD  . PRO G  1 116 ? -61.613  -17.419 -55.018  1.00 73.26  ? 116 PRO G CD  1 
ATOM   9343  N N   . ASN G  1 117 ? -61.400  -14.034 -53.351  1.00 71.89  ? 117 ASN G N   1 
ATOM   9344  C CA  . ASN G  1 117 ? -61.162  -12.943 -52.442  1.00 71.60  ? 117 ASN G CA  1 
ATOM   9345  C C   . ASN G  1 117 ? -59.812  -12.250 -52.560  1.00 70.61  ? 117 ASN G C   1 
ATOM   9346  O O   . ASN G  1 117 ? -59.515  -11.352 -51.753  1.00 70.51  ? 117 ASN G O   1 
ATOM   9347  C CB  . ASN G  1 117 ? -61.430  -13.391 -51.010  1.00 71.95  ? 117 ASN G CB  1 
ATOM   9348  C CG  . ASN G  1 117 ? -62.893  -13.772 -50.793  1.00 73.13  ? 117 ASN G CG  1 
ATOM   9349  O OD1 . ASN G  1 117 ? -63.195  -14.925 -50.508  1.00 73.53  ? 117 ASN G OD1 1 
ATOM   9350  N ND2 . ASN G  1 117 ? -63.807  -12.809 -50.939  1.00 73.85  ? 117 ASN G ND2 1 
ATOM   9351  N N   . ALA G  1 118 ? -59.021  -12.637 -53.563  1.00 70.09  ? 118 ALA G N   1 
ATOM   9352  C CA  . ALA G  1 118 ? -57.740  -11.996 -53.832  1.00 69.26  ? 118 ALA G CA  1 
ATOM   9353  C C   . ALA G  1 118 ? -57.953  -10.554 -54.297  1.00 69.40  ? 118 ALA G C   1 
ATOM   9354  O O   . ALA G  1 118 ? -59.004  -10.206 -54.826  1.00 70.12  ? 118 ALA G O   1 
ATOM   9355  C CB  . ALA G  1 118 ? -56.967  -12.791 -54.845  1.00 68.95  ? 118 ALA G CB  1 
ATOM   9356  N N   . GLU G  1 119 ? -56.975  -9.706  -54.063  1.00 68.88  ? 119 GLU G N   1 
ATOM   9357  C CA  . GLU G  1 119 ? -57.100  -8.327  -54.427  1.00 69.18  ? 119 GLU G CA  1 
ATOM   9358  C C   . GLU G  1 119 ? -56.024  -7.966  -55.417  1.00 68.63  ? 119 GLU G C   1 
ATOM   9359  O O   . GLU G  1 119 ? -54.928  -8.524  -55.376  1.00 67.94  ? 119 GLU G O   1 
ATOM   9360  C CB  . GLU G  1 119 ? -56.932  -7.460  -53.193  1.00 69.39  ? 119 GLU G CB  1 
ATOM   9361  C CG  . GLU G  1 119 ? -58.258  -7.116  -52.522  1.00 70.45  ? 119 GLU G CG  1 
ATOM   9362  C CD  . GLU G  1 119 ? -58.108  -6.359  -51.191  1.00 70.94  ? 119 GLU G CD  1 
ATOM   9363  O OE1 . GLU G  1 119 ? -59.106  -6.321  -50.392  1.00 71.89  ? 119 GLU G OE1 1 
ATOM   9364  O OE2 . GLU G  1 119 ? -56.991  -5.804  -50.942  1.00 70.54  ? 119 GLU G OE2 1 
ATOM   9365  N N   . VAL G  1 120 ? -56.328  -7.025  -56.300  1.00 69.08  ? 120 VAL G N   1 
ATOM   9366  C CA  . VAL G  1 120 ? -55.349  -6.512  -57.242  1.00 68.74  ? 120 VAL G CA  1 
ATOM   9367  C C   . VAL G  1 120 ? -55.308  -4.989  -57.094  1.00 69.23  ? 120 VAL G C   1 
ATOM   9368  O O   . VAL G  1 120 ? -56.356  -4.346  -56.807  1.00 70.13  ? 120 VAL G O   1 
ATOM   9369  C CB  . VAL G  1 120 ? -55.740  -6.885  -58.663  1.00 69.10  ? 120 VAL G CB  1 
ATOM   9370  C CG1 . VAL G  1 120 ? -54.769  -6.269  -59.651  1.00 68.94  ? 120 VAL G CG1 1 
ATOM   9371  C CG2 . VAL G  1 120 ? -55.738  -8.387  -58.809  1.00 68.87  ? 120 VAL G CG2 1 
ATOM   9372  N N   . MET G  1 121 ? -54.118  -4.404  -57.233  1.00 68.83  ? 121 MET G N   1 
ATOM   9373  C CA  . MET G  1 121 ? -53.987  -2.963  -57.134  1.00 69.46  ? 121 MET G CA  1 
ATOM   9374  C C   . MET G  1 121 ? -52.996  -2.552  -58.161  1.00 69.23  ? 121 MET G C   1 
ATOM   9375  O O   . MET G  1 121 ? -51.947  -3.190  -58.319  1.00 68.42  ? 121 MET G O   1 
ATOM   9376  C CB  . MET G  1 121 ? -53.533  -2.555  -55.740  1.00 69.47  ? 121 MET G CB  1 
ATOM   9377  C CG  . MET G  1 121 ? -53.449  -1.063  -55.505  1.00 70.43  ? 121 MET G CG  1 
ATOM   9378  S SD  . MET G  1 121 ? -51.784  -0.413  -55.848  1.00 70.04  ? 121 MET G SD  1 
ATOM   9379  C CE  . MET G  1 121 ? -51.028  -0.559  -54.221  1.00 69.84  ? 121 MET G CE  1 
ATOM   9380  N N   . ILE G  1 122 ? -53.349  -1.507  -58.893  1.00 70.09  ? 122 ILE G N   1 
ATOM   9381  C CA  . ILE G  1 122 ? -52.451  -0.925  -59.906  1.00 70.13  ? 122 ILE G CA  1 
ATOM   9382  C C   . ILE G  1 122 ? -52.237  0.532   -59.549  1.00 70.98  ? 122 ILE G C   1 
ATOM   9383  O O   . ILE G  1 122 ? -53.137  1.167   -59.010  1.00 71.92  ? 122 ILE G O   1 
ATOM   9384  C CB  . ILE G  1 122 ? -53.019  -1.054  -61.342  1.00 70.65  ? 122 ILE G CB  1 
ATOM   9385  C CG1 . ILE G  1 122 ? -54.388  -0.372  -61.437  1.00 71.88  ? 122 ILE G CG1 1 
ATOM   9386  C CG2 . ILE G  1 122 ? -53.124  -2.521  -61.732  1.00 70.02  ? 122 ILE G CG2 1 
ATOM   9387  C CD1 . ILE G  1 122 ? -54.999  -0.378  -62.804  1.00 72.66  ? 122 ILE G CD1 1 
ATOM   9388  N N   . HIS G  1 123 ? -51.039  1.033   -59.823  1.00 70.82  ? 123 HIS G N   1 
ATOM   9389  C CA  . HIS G  1 123 ? -50.704  2.460   -59.655  1.00 71.83  ? 123 HIS G CA  1 
ATOM   9390  C C   . HIS G  1 123 ? -49.422  2.803   -60.394  1.00 71.64  ? 123 HIS G C   1 
ATOM   9391  O O   . HIS G  1 123 ? -48.718  1.885   -60.865  1.00 70.67  ? 123 HIS G O   1 
ATOM   9392  C CB  . HIS G  1 123 ? -50.653  2.865   -58.168  1.00 72.13  ? 123 HIS G CB  1 
ATOM   9393  C CG  . HIS G  1 123 ? -49.452  2.328   -57.396  1.00 71.16  ? 123 HIS G CG  1 
ATOM   9394  N ND1 . HIS G  1 123 ? -48.763  1.236   -57.766  1.00 69.96  ? 123 HIS G ND1 1 
ATOM   9395  C CD2 . HIS G  1 123 ? -48.831  2.794   -56.232  1.00 71.47  ? 123 HIS G CD2 1 
ATOM   9396  C CE1 . HIS G  1 123 ? -47.751  1.016   -56.886  1.00 69.50  ? 123 HIS G CE1 1 
ATOM   9397  N NE2 . HIS G  1 123 ? -47.799  1.959   -55.955  1.00 70.40  ? 123 HIS G NE2 1 
ATOM   9398  N N   . GLN G  1 124 ? -49.097  4.095   -60.509  1.00 72.71  ? 124 GLN G N   1 
ATOM   9399  C CA  . GLN G  1 124 ? -47.872  4.482   -61.173  1.00 72.70  ? 124 GLN G CA  1 
ATOM   9400  C C   . GLN G  1 124 ? -46.607  4.050   -60.423  1.00 71.79  ? 124 GLN G C   1 
ATOM   9401  O O   . GLN G  1 124 ? -46.668  3.699   -59.235  1.00 71.42  ? 124 GLN G O   1 
ATOM   9402  C CB  . GLN G  1 124 ? -47.872  5.958   -61.521  1.00 74.26  ? 124 GLN G CB  1 
ATOM   9403  C CG  . GLN G  1 124 ? -48.159  6.926   -60.407  1.00 75.38  ? 124 GLN G CG  1 
ATOM   9404  C CD  . GLN G  1 124 ? -48.083  8.364   -60.868  1.00 77.14  ? 124 GLN G CD  1 
ATOM   9405  O OE1 . GLN G  1 124 ? -48.996  9.134   -60.680  1.00 78.56  ? 124 GLN G OE1 1 
ATOM   9406  N NE2 . GLN G  1 124 ? -46.995  8.721   -61.484  1.00 77.20  ? 124 GLN G NE2 1 
ATOM   9407  N N   . PRO G  1 125 ? -45.460  4.005   -61.133  1.00 71.53  ? 125 PRO G N   1 
ATOM   9408  C CA  . PRO G  1 125 ? -44.208  3.673   -60.440  1.00 70.90  ? 125 PRO G CA  1 
ATOM   9409  C C   . PRO G  1 125 ? -43.717  4.813   -59.560  1.00 71.83  ? 125 PRO G C   1 
ATOM   9410  O O   . PRO G  1 125 ? -44.021  5.992   -59.812  1.00 73.09  ? 125 PRO G O   1 
ATOM   9411  C CB  . PRO G  1 125 ? -43.230  3.413   -61.581  1.00 70.68  ? 125 PRO G CB  1 
ATOM   9412  C CG  . PRO G  1 125 ? -43.811  4.100   -62.765  1.00 71.57  ? 125 PRO G CG  1 
ATOM   9413  C CD  . PRO G  1 125 ? -45.290  4.116   -62.595  1.00 71.84  ? 125 PRO G CD  1 
ATOM   9414  N N   . LEU G  1 126 ? -42.967  4.435   -58.531  1.00 71.38  ? 126 LEU G N   1 
ATOM   9415  C CA  . LEU G  1 126 ? -42.384  5.380   -57.570  1.00 72.35  ? 126 LEU G CA  1 
ATOM   9416  C C   . LEU G  1 126 ? -40.867  5.425   -57.694  1.00 72.28  ? 126 LEU G C   1 
ATOM   9417  O O   . LEU G  1 126 ? -40.245  4.448   -58.075  1.00 71.27  ? 126 LEU G O   1 
ATOM   9418  C CB  . LEU G  1 126 ? -42.754  4.942   -56.148  1.00 72.17  ? 126 LEU G CB  1 
ATOM   9419  C CG  . LEU G  1 126 ? -44.232  4.641   -55.859  1.00 72.13  ? 126 LEU G CG  1 
ATOM   9420  C CD1 . LEU G  1 126 ? -44.309  3.596   -54.759  1.00 71.35  ? 126 LEU G CD1 1 
ATOM   9421  C CD2 . LEU G  1 126 ? -44.912  5.917   -55.420  1.00 73.78  ? 126 LEU G CD2 1 
ATOM   9422  N N   . GLY G  1 127 ? -40.254  6.552   -57.360  1.00 73.52  ? 127 GLY G N   1 
ATOM   9423  C CA  . GLY G  1 127 ? -38.795  6.621   -57.414  1.00 73.61  ? 127 GLY G CA  1 
ATOM   9424  C C   . GLY G  1 127 ? -38.332  7.834   -56.690  1.00 75.18  ? 127 GLY G C   1 
ATOM   9425  O O   . GLY G  1 127 ? -39.067  8.374   -55.883  1.00 76.03  ? 127 GLY G O   1 
ATOM   9426  N N   . GLY G  1 128 ? -37.115  8.275   -56.986  1.00 75.74  ? 128 GLY G N   1 
ATOM   9427  C CA  . GLY G  1 128 ? -36.513  9.411   -56.281  1.00 77.44  ? 128 GLY G CA  1 
ATOM   9428  C C   . GLY G  1 128 ? -35.362  9.958   -57.079  1.00 78.10  ? 128 GLY G C   1 
ATOM   9429  O O   . GLY G  1 128 ? -34.851  9.267   -57.956  1.00 77.10  ? 128 GLY G O   1 
ATOM   9430  N N   . ALA G  1 129 ? -34.982  11.207  -56.809  1.00 79.95  ? 129 ALA G N   1 
ATOM   9431  C CA  . ALA G  1 129 ? -33.863  11.860  -57.474  1.00 80.91  ? 129 ALA G CA  1 
ATOM   9432  C C   . ALA G  1 129 ? -33.271  12.833  -56.507  1.00 82.80  ? 129 ALA G C   1 
ATOM   9433  O O   . ALA G  1 129 ? -33.985  13.605  -55.878  1.00 84.11  ? 129 ALA G O   1 
ATOM   9434  C CB  . ALA G  1 129 ? -34.326  12.584  -58.716  1.00 81.57  ? 129 ALA G CB  1 
ATOM   9435  N N   . GLN G  1 130 ? -31.961  12.790  -56.368  1.00 74.52  ? 130 GLN G N   1 
ATOM   9436  C CA  . GLN G  1 130 ? -31.271  13.715  -55.480  1.00 75.93  ? 130 GLN G CA  1 
ATOM   9437  C C   . GLN G  1 130 ? -30.149  14.390  -56.289  1.00 76.11  ? 130 GLN G C   1 
ATOM   9438  O O   . GLN G  1 130 ? -29.564  13.751  -57.191  1.00 75.70  ? 130 GLN G O   1 
ATOM   9439  C CB  . GLN G  1 130 ? -30.706  12.932  -54.284  1.00 77.44  ? 130 GLN G CB  1 
ATOM   9440  C CG  . GLN G  1 130 ? -30.431  13.746  -53.019  1.00 79.30  ? 130 GLN G CG  1 
ATOM   9441  C CD  . GLN G  1 130 ? -31.687  14.402  -52.403  1.00 79.52  ? 130 GLN G CD  1 
ATOM   9442  O OE1 . GLN G  1 130 ? -32.828  13.873  -52.496  1.00 78.66  ? 130 GLN G OE1 1 
ATOM   9443  N NE2 . GLN G  1 130 ? -31.480  15.575  -51.763  1.00 80.96  ? 130 GLN G NE2 1 
ATOM   9444  N N   . GLY G  1 131 ? -29.853  15.663  -56.004  1.00 76.99  ? 131 GLY G N   1 
ATOM   9445  C CA  . GLY G  1 131 ? -28.668  16.291  -56.603  1.00 77.61  ? 131 GLY G CA  1 
ATOM   9446  C C   . GLY G  1 131 ? -28.948  17.492  -57.476  1.00 77.48  ? 131 GLY G C   1 
ATOM   9447  O O   . GLY G  1 131 ? -29.899  18.248  -57.232  1.00 77.60  ? 131 GLY G O   1 
ATOM   9448  N N   . GLN G  1 132 ? -28.106  17.670  -58.489  1.00 77.65  ? 132 GLN G N   1 
ATOM   9449  C CA  . GLN G  1 132 ? -28.176  18.822  -59.371  1.00 78.10  ? 132 GLN G CA  1 
ATOM   9450  C C   . GLN G  1 132 ? -29.430  18.823  -60.206  1.00 77.16  ? 132 GLN G C   1 
ATOM   9451  O O   . GLN G  1 132 ? -29.966  17.762  -60.512  1.00 75.95  ? 132 GLN G O   1 
ATOM   9452  C CB  . GLN G  1 132 ? -26.972  18.836  -60.297  1.00 78.76  ? 132 GLN G CB  1 
ATOM   9453  C CG  . GLN G  1 132 ? -25.692  19.211  -59.600  1.00 80.21  ? 132 GLN G CG  1 
ATOM   9454  C CD  . GLN G  1 132 ? -24.499  19.312  -60.539  1.00 81.20  ? 132 GLN G CD  1 
ATOM   9455  O OE1 . GLN G  1 132 ? -24.121  18.341  -61.171  1.00 80.92  ? 132 GLN G OE1 1 
ATOM   9456  N NE2 . GLN G  1 132 ? -23.880  20.482  -60.598  1.00 82.68  ? 132 GLN G NE2 1 
ATOM   9457  N N   . ALA G  1 133 ? -29.885  20.016  -60.584  1.00 78.02  ? 133 ALA G N   1 
ATOM   9458  C CA  . ALA G  1 133 ? -31.012  20.197  -61.514  1.00 77.75  ? 133 ALA G CA  1 
ATOM   9459  C C   . ALA G  1 133 ? -30.932  19.273  -62.756  1.00 76.95  ? 133 ALA G C   1 
ATOM   9460  O O   . ALA G  1 133 ? -31.920  18.619  -63.095  1.00 76.00  ? 133 ALA G O   1 
ATOM   9461  C CB  . ALA G  1 133 ? -31.119  21.651  -61.939  1.00 79.54  ? 133 ALA G CB  1 
ATOM   9462  N N   . THR G  1 134 ? -29.764  19.234  -63.403  1.00 77.62  ? 134 THR G N   1 
ATOM   9463  C CA  . THR G  1 134 ? -29.477  18.347  -64.521  1.00 77.39  ? 134 THR G CA  1 
ATOM   9464  C C   . THR G  1 134 ? -29.724  16.873  -64.175  1.00 75.93  ? 134 THR G C   1 
ATOM   9465  O O   . THR G  1 134 ? -30.372  16.146  -64.974  1.00 75.40  ? 134 THR G O   1 
ATOM   9466  C CB  . THR G  1 134 ? -28.031  18.568  -64.953  1.00 78.72  ? 134 THR G CB  1 
ATOM   9467  O OG1 . THR G  1 134 ? -27.960  19.876  -65.507  1.00 80.32  ? 134 THR G OG1 1 
ATOM   9468  C CG2 . THR G  1 134 ? -27.577  17.534  -65.980  1.00 78.87  ? 134 THR G CG2 1 
ATOM   9469  N N   . GLU G  1 135 ? -29.229  16.460  -62.994  1.00 75.61  ? 135 GLU G N   1 
ATOM   9470  C CA  . GLU G  1 135 ? -29.375  15.097  -62.499  1.00 74.71  ? 135 GLU G CA  1 
ATOM   9471  C C   . GLU G  1 135 ? -30.821  14.727  -62.232  1.00 73.55  ? 135 GLU G C   1 
ATOM   9472  O O   . GLU G  1 135 ? -31.249  13.652  -62.569  1.00 72.88  ? 135 GLU G O   1 
ATOM   9473  C CB  . GLU G  1 135 ? -28.531  14.872  -61.250  1.00 75.24  ? 135 GLU G CB  1 
ATOM   9474  C CG  . GLU G  1 135 ? -27.048  14.784  -61.551  1.00 76.50  ? 135 GLU G CG  1 
ATOM   9475  C CD  . GLU G  1 135 ? -26.150  14.832  -60.292  1.00 77.54  ? 135 GLU G CD  1 
ATOM   9476  O OE1 . GLU G  1 135 ? -26.520  15.489  -59.272  1.00 77.64  ? 135 GLU G OE1 1 
ATOM   9477  O OE2 . GLU G  1 135 ? -25.032  14.234  -60.329  1.00 78.65  ? 135 GLU G OE2 1 
ATOM   9478  N N   . ILE G  1 136 ? -31.565  15.629  -61.629  1.00 73.58  ? 136 ILE G N   1 
ATOM   9479  C CA  . ILE G  1 136 ? -32.979  15.408  -61.384  1.00 72.81  ? 136 ILE G CA  1 
ATOM   9480  C C   . ILE G  1 136 ? -33.769  15.267  -62.678  1.00 72.48  ? 136 ILE G C   1 
ATOM   9481  O O   . ILE G  1 136 ? -34.612  14.416  -62.811  1.00 71.69  ? 136 ILE G O   1 
ATOM   9482  C CB  . ILE G  1 136 ? -33.542  16.529  -60.515  1.00 73.49  ? 136 ILE G CB  1 
ATOM   9483  C CG1 . ILE G  1 136 ? -32.934  16.431  -59.116  1.00 73.98  ? 136 ILE G CG1 1 
ATOM   9484  C CG2 . ILE G  1 136 ? -35.064  16.485  -60.457  1.00 73.11  ? 136 ILE G CG2 1 
ATOM   9485  C CD1 . ILE G  1 136 ? -33.044  17.719  -58.342  1.00 75.29  ? 136 ILE G CD1 1 
ATOM   9486  N N   . GLU G  1 137 ? -33.459  16.098  -63.649  1.00 73.40  ? 137 GLU G N   1 
ATOM   9487  C CA  . GLU G  1 137 ? -34.071  16.009  -64.959  1.00 73.66  ? 137 GLU G CA  1 
ATOM   9488  C C   . GLU G  1 137 ? -33.843  14.641  -65.627  1.00 73.10  ? 137 GLU G C   1 
ATOM   9489  O O   . GLU G  1 137 ? -34.778  14.060  -66.182  1.00 72.75  ? 137 GLU G O   1 
ATOM   9490  C CB  . GLU G  1 137 ? -33.535  17.108  -65.841  1.00 75.28  ? 137 GLU G CB  1 
ATOM   9491  C CG  . GLU G  1 137 ? -34.217  17.187  -67.179  1.00 76.19  ? 137 GLU G CG  1 
ATOM   9492  C CD  . GLU G  1 137 ? -33.599  18.242  -68.056  1.00 78.25  ? 137 GLU G CD  1 
ATOM   9493  O OE1 . GLU G  1 137 ? -32.340  18.455  -68.018  1.00 78.80  ? 137 GLU G OE1 1 
ATOM   9494  O OE2 . GLU G  1 137 ? -34.388  18.863  -68.787  1.00 79.62  ? 137 GLU G OE2 1 
ATOM   9495  N N   . ILE G  1 138 ? -32.614  14.129  -65.568  1.00 73.30  ? 138 ILE G N   1 
ATOM   9496  C CA  . ILE G  1 138 ? -32.324  12.811  -66.127  1.00 73.20  ? 138 ILE G CA  1 
ATOM   9497  C C   . ILE G  1 138 ? -33.185  11.744  -65.470  1.00 72.02  ? 138 ILE G C   1 
ATOM   9498  O O   . ILE G  1 138 ? -33.793  10.949  -66.169  1.00 71.89  ? 138 ILE G O   1 
ATOM   9499  C CB  . ILE G  1 138 ? -30.827  12.487  -66.071  1.00 74.05  ? 138 ILE G CB  1 
ATOM   9500  C CG1 . ILE G  1 138 ? -30.117  13.290  -67.141  1.00 75.55  ? 138 ILE G CG1 1 
ATOM   9501  C CG2 . ILE G  1 138 ? -30.569  11.010  -66.312  1.00 74.18  ? 138 ILE G CG2 1 
ATOM   9502  C CD1 . ILE G  1 138 ? -28.698  13.623  -66.760  1.00 76.51  ? 138 ILE G CD1 1 
ATOM   9503  N N   . ALA G  1 139 ? -33.271  11.774  -64.145  1.00 71.45  ? 139 ALA G N   1 
ATOM   9504  C CA  . ALA G  1 139 ? -34.062  10.815  -63.372  1.00 70.67  ? 139 ALA G CA  1 
ATOM   9505  C C   . ALA G  1 139 ? -35.573  10.945  -63.660  1.00 70.06  ? 139 ALA G C   1 
ATOM   9506  O O   . ALA G  1 139 ? -36.278  9.959   -63.772  1.00 69.64  ? 139 ALA G O   1 
ATOM   9507  C CB  . ALA G  1 139 ? -33.780  10.974  -61.886  1.00 70.75  ? 139 ALA G CB  1 
ATOM   9508  N N   . ALA G  1 140 ? -36.054  12.172  -63.780  1.00 70.32  ? 140 ALA G N   1 
ATOM   9509  C CA  . ALA G  1 140 ? -37.442  12.415  -64.076  1.00 70.21  ? 140 ALA G CA  1 
ATOM   9510  C C   . ALA G  1 140 ? -37.795  11.841  -65.431  1.00 70.40  ? 140 ALA G C   1 
ATOM   9511  O O   . ALA G  1 140 ? -38.820  11.175  -65.550  1.00 70.03  ? 140 ALA G O   1 
ATOM   9512  C CB  . ALA G  1 140 ? -37.755  13.902  -64.030  1.00 71.06  ? 140 ALA G CB  1 
ATOM   9513  N N   . ASN G  1 141 ? -36.945  12.087  -66.438  1.00 71.25  ? 141 ASN G N   1 
ATOM   9514  C CA  . ASN G  1 141 ? -37.142  11.565  -67.781  1.00 71.96  ? 141 ASN G CA  1 
ATOM   9515  C C   . ASN G  1 141 ? -37.156  10.049  -67.772  1.00 71.40  ? 141 ASN G C   1 
ATOM   9516  O O   . ASN G  1 141 ? -37.996  9.429   -68.413  1.00 71.56  ? 141 ASN G O   1 
ATOM   9517  C CB  . ASN G  1 141 ? -36.055  12.065  -68.712  1.00 73.32  ? 141 ASN G CB  1 
ATOM   9518  C CG  . ASN G  1 141 ? -36.211  13.531  -69.073  1.00 74.50  ? 141 ASN G CG  1 
ATOM   9519  O OD1 . ASN G  1 141 ? -37.279  14.093  -68.949  1.00 74.61  ? 141 ASN G OD1 1 
ATOM   9520  N ND2 . ASN G  1 141 ? -35.136  14.152  -69.520  1.00 75.69  ? 141 ASN G ND2 1 
ATOM   9521  N N   . HIS G  1 142 ? -36.250  9.452   -67.013  1.00 71.03  ? 142 HIS G N   1 
ATOM   9522  C CA  . HIS G  1 142 ? -36.155  8.009   -66.951  1.00 70.96  ? 142 HIS G CA  1 
ATOM   9523  C C   . HIS G  1 142 ? -37.383  7.378   -66.357  1.00 70.11  ? 142 HIS G C   1 
ATOM   9524  O O   . HIS G  1 142 ? -37.851  6.353   -66.843  1.00 70.34  ? 142 HIS G O   1 
ATOM   9525  C CB  . HIS G  1 142 ? -34.905  7.581   -66.191  1.00 71.23  ? 142 HIS G CB  1 
ATOM   9526  C CG  . HIS G  1 142 ? -34.762  6.096   -66.088  1.00 71.67  ? 142 HIS G CG  1 
ATOM   9527  N ND1 . HIS G  1 142 ? -34.737  5.446   -64.911  1.00 71.49  ? 142 HIS G ND1 1 
ATOM   9528  C CD2 . HIS G  1 142 ? -34.696  5.112   -67.081  1.00 72.68  ? 142 HIS G CD2 1 
ATOM   9529  C CE1 . HIS G  1 142 ? -34.626  4.117   -65.125  1.00 72.37  ? 142 HIS G CE1 1 
ATOM   9530  N NE2 . HIS G  1 142 ? -34.607  3.910   -66.451  1.00 73.06  ? 142 HIS G NE2 1 
ATOM   9531  N N   . ILE G  1 143 ? -37.925  7.978   -65.303  1.00 69.39  ? 143 ILE G N   1 
ATOM   9532  C CA  . ILE G  1 143 ? -39.071  7.390   -64.657  1.00 68.85  ? 143 ILE G CA  1 
ATOM   9533  C C   . ILE G  1 143 ? -40.338  7.621   -65.493  1.00 68.92  ? 143 ILE G C   1 
ATOM   9534  O O   . ILE G  1 143 ? -41.222  6.780   -65.515  1.00 68.80  ? 143 ILE G O   1 
ATOM   9535  C CB  . ILE G  1 143 ? -39.226  7.821   -63.184  1.00 68.54  ? 143 ILE G CB  1 
ATOM   9536  C CG1 . ILE G  1 143 ? -40.215  6.920   -62.470  1.00 68.37  ? 143 ILE G CG1 1 
ATOM   9537  C CG2 . ILE G  1 143 ? -39.762  9.220   -63.077  1.00 68.59  ? 143 ILE G CG2 1 
ATOM   9538  C CD1 . ILE G  1 143 ? -40.280  7.168   -60.985  1.00 68.57  ? 143 ILE G CD1 1 
ATOM   9539  N N   . LEU G  1 144 ? -40.416  8.725   -66.216  1.00 69.43  ? 144 LEU G N   1 
ATOM   9540  C CA  . LEU G  1 144 ? -41.577  8.958   -67.050  1.00 69.98  ? 144 LEU G CA  1 
ATOM   9541  C C   . LEU G  1 144 ? -41.540  7.979   -68.185  1.00 70.57  ? 144 LEU G C   1 
ATOM   9542  O O   . LEU G  1 144 ? -42.609  7.461   -68.607  1.00 70.85  ? 144 LEU G O   1 
ATOM   9543  C CB  . LEU G  1 144 ? -41.607  10.385  -67.576  1.00 70.96  ? 144 LEU G CB  1 
ATOM   9544  C CG  . LEU G  1 144 ? -41.917  11.426  -66.502  1.00 70.84  ? 144 LEU G CG  1 
ATOM   9545  C CD1 . LEU G  1 144 ? -41.522  12.827  -66.943  1.00 72.06  ? 144 LEU G CD1 1 
ATOM   9546  C CD2 . LEU G  1 144 ? -43.374  11.347  -66.020  1.00 70.85  ? 144 LEU G CD2 1 
ATOM   9547  N N   . LYS G  1 145 ? -40.320  7.701   -68.679  1.00 71.04  ? 145 LYS G N   1 
ATOM   9548  C CA  . LYS G  1 145 ? -40.181  6.770   -69.814  1.00 72.09  ? 145 LYS G CA  1 
ATOM   9549  C C   . LYS G  1 145 ? -40.568  5.344   -69.380  1.00 71.64  ? 145 LYS G C   1 
ATOM   9550  O O   . LYS G  1 145 ? -41.262  4.646   -70.103  1.00 72.34  ? 145 LYS G O   1 
ATOM   9551  C CB  . LYS G  1 145 ? -38.790  6.829   -70.432  1.00 73.11  ? 145 LYS G CB  1 
ATOM   9552  C CG  . LYS G  1 145 ? -38.821  6.430   -71.900  1.00 74.96  ? 145 LYS G CG  1 
ATOM   9553  C CD  . LYS G  1 145 ? -37.445  6.462   -72.552  1.00 76.40  ? 145 LYS G CD  1 
ATOM   9554  C CE  . LYS G  1 145 ? -37.555  5.914   -73.960  1.00 78.61  ? 145 LYS G CE  1 
ATOM   9555  N NZ  . LYS G  1 145 ? -36.230  5.865   -74.633  1.00 80.46  ? 145 LYS G NZ  1 
ATOM   9556  N N   . THR G  1 146 ? -40.142  4.963   -68.170  1.00 70.76  ? 146 THR G N   1 
ATOM   9557  C CA  . THR G  1 146 ? -40.501  3.705   -67.574  1.00 70.60  ? 146 THR G CA  1 
ATOM   9558  C C   . THR G  1 146 ? -42.028  3.603   -67.447  1.00 70.20  ? 146 THR G C   1 
ATOM   9559  O O   . THR G  1 146 ? -42.604  2.529   -67.681  1.00 70.65  ? 146 THR G O   1 
ATOM   9560  C CB  . THR G  1 146 ? -39.758  3.492   -66.245  1.00 70.19  ? 146 THR G CB  1 
ATOM   9561  O OG1 . THR G  1 146 ? -38.369  3.370   -66.526  1.00 70.98  ? 146 THR G OG1 1 
ATOM   9562  C CG2 . THR G  1 146 ? -40.155  2.221   -65.598  1.00 70.45  ? 146 THR G CG2 1 
ATOM   9563  N N   . ARG G  1 147 ? -42.697  4.705   -67.119  1.00 69.66  ? 147 ARG G N   1 
ATOM   9564  C CA  . ARG G  1 147 ? -44.147  4.656   -66.976  1.00 69.58  ? 147 ARG G CA  1 
ATOM   9565  C C   . ARG G  1 147 ? -44.818  4.404   -68.320  1.00 70.58  ? 147 ARG G C   1 
ATOM   9566  O O   . ARG G  1 147 ? -45.759  3.630   -68.390  1.00 70.83  ? 147 ARG G O   1 
ATOM   9567  C CB  . ARG G  1 147 ? -44.707  5.899   -66.303  1.00 69.27  ? 147 ARG G CB  1 
ATOM   9568  C CG  . ARG G  1 147 ? -46.138  5.673   -65.872  1.00 69.37  ? 147 ARG G CG  1 
ATOM   9569  C CD  . ARG G  1 147 ? -46.839  6.894   -65.307  1.00 69.61  ? 147 ARG G CD  1 
ATOM   9570  N NE  . ARG G  1 147 ? -48.206  6.595   -64.863  1.00 70.00  ? 147 ARG G NE  1 
ATOM   9571  C CZ  . ARG G  1 147 ? -49.113  7.521   -64.565  1.00 70.77  ? 147 ARG G CZ  1 
ATOM   9572  N NH1 . ARG G  1 147 ? -48.822  8.813   -64.655  1.00 71.28  ? 147 ARG G NH1 1 
ATOM   9573  N NH2 . ARG G  1 147 ? -50.316  7.163   -64.166  1.00 71.33  ? 147 ARG G NH2 1 
ATOM   9574  N N   . GLU G  1 148 ? -44.324  5.031   -69.382  1.00 71.43  ? 148 GLU G N   1 
ATOM   9575  C CA  . GLU G  1 148 ? -44.837  4.740   -70.716  1.00 72.89  ? 148 GLU G CA  1 
ATOM   9576  C C   . GLU G  1 148 ? -44.677  3.274   -71.084  1.00 73.42  ? 148 GLU G C   1 
ATOM   9577  O O   . GLU G  1 148 ? -45.592  2.666   -71.591  1.00 74.20  ? 148 GLU G O   1 
ATOM   9578  C CB  . GLU G  1 148 ? -44.135  5.595   -71.757  1.00 74.14  ? 148 GLU G CB  1 
ATOM   9579  C CG  . GLU G  1 148 ? -44.684  7.005   -71.877  1.00 74.68  ? 148 GLU G CG  1 
ATOM   9580  C CD  . GLU G  1 148 ? -43.819  7.896   -72.792  1.00 76.14  ? 148 GLU G CD  1 
ATOM   9581  O OE1 . GLU G  1 148 ? -43.894  9.145   -72.586  1.00 76.43  ? 148 GLU G OE1 1 
ATOM   9582  O OE2 . GLU G  1 148 ? -43.065  7.382   -73.709  1.00 77.31  ? 148 GLU G OE2 1 
ATOM   9583  N N   . LYS G  1 149 ? -43.506  2.718   -70.803  1.00 73.25  ? 149 LYS G N   1 
ATOM   9584  C CA  . LYS G  1 149 ? -43.196  1.350   -71.118  1.00 74.18  ? 149 LYS G CA  1 
ATOM   9585  C C   . LYS G  1 149 ? -44.178  0.455   -70.392  1.00 73.70  ? 149 LYS G C   1 
ATOM   9586  O O   . LYS G  1 149 ? -44.738  -0.470  -70.987  1.00 74.81  ? 149 LYS G O   1 
ATOM   9587  C CB  . LYS G  1 149 ? -41.761  1.019   -70.722  1.00 74.27  ? 149 LYS G CB  1 
ATOM   9588  C CG  . LYS G  1 149 ? -41.392  -0.439  -70.939  1.00 75.64  ? 149 LYS G CG  1 
ATOM   9589  C CD  . LYS G  1 149 ? -39.900  -0.623  -71.123  1.00 76.72  ? 149 LYS G CD  1 
ATOM   9590  C CE  . LYS G  1 149 ? -39.190  -1.102  -69.860  1.00 76.29  ? 149 LYS G CE  1 
ATOM   9591  N NZ  . LYS G  1 149 ? -37.710  -1.171  -70.068  1.00 77.59  ? 149 LYS G NZ  1 
ATOM   9592  N N   . LEU G  1 150 ? -44.420  0.728   -69.112  1.00 72.33  ? 150 LEU G N   1 
ATOM   9593  C CA  . LEU G  1 150 ? -45.350  -0.098  -68.341  1.00 72.13  ? 150 LEU G CA  1 
ATOM   9594  C C   . LEU G  1 150 ? -46.762  0.002   -68.913  1.00 72.52  ? 150 LEU G C   1 
ATOM   9595  O O   . LEU G  1 150 ? -47.421  -1.020  -69.189  1.00 73.37  ? 150 LEU G O   1 
ATOM   9596  C CB  . LEU G  1 150 ? -45.344  0.263   -66.853  1.00 71.03  ? 150 LEU G CB  1 
ATOM   9597  C CG  . LEU G  1 150 ? -44.109  -0.214  -66.077  1.00 71.12  ? 150 LEU G CG  1 
ATOM   9598  C CD1 . LEU G  1 150 ? -43.929  0.561   -64.777  1.00 70.26  ? 150 LEU G CD1 1 
ATOM   9599  C CD2 . LEU G  1 150 ? -44.126  -1.704  -65.817  1.00 72.24  ? 150 LEU G CD2 1 
ATOM   9600  N N   . ASN G  1 151 ? -47.211  1.229   -69.117  1.00 72.21  ? 151 ASN G N   1 
ATOM   9601  C CA  . ASN G  1 151 ? -48.537  1.468   -69.623  1.00 72.90  ? 151 ASN G CA  1 
ATOM   9602  C C   . ASN G  1 151 ? -48.784  0.821   -70.971  1.00 74.51  ? 151 ASN G C   1 
ATOM   9603  O O   . ASN G  1 151 ? -49.848  0.249   -71.192  1.00 75.26  ? 151 ASN G O   1 
ATOM   9604  C CB  . ASN G  1 151 ? -48.800  2.958   -69.690  1.00 72.84  ? 151 ASN G CB  1 
ATOM   9605  C CG  . ASN G  1 151 ? -49.059  3.557   -68.319  1.00 71.76  ? 151 ASN G CG  1 
ATOM   9606  O OD1 . ASN G  1 151 ? -49.010  2.862   -67.300  1.00 71.07  ? 151 ASN G OD1 1 
ATOM   9607  N ND2 . ASN G  1 151 ? -49.347  4.847   -68.281  1.00 72.00  ? 151 ASN G ND2 1 
ATOM   9608  N N   . ARG G  1 152 ? -47.788  0.907   -71.857  1.00 75.29  ? 152 ARG G N   1 
ATOM   9609  C CA  . ARG G  1 152 ? -47.866  0.332   -73.204  1.00 77.31  ? 152 ARG G CA  1 
ATOM   9610  C C   . ARG G  1 152 ? -48.029  -1.178  -73.100  1.00 77.85  ? 152 ARG G C   1 
ATOM   9611  O O   . ARG G  1 152 ? -48.931  -1.742  -73.707  1.00 79.16  ? 152 ARG G O   1 
ATOM   9612  C CB  . ARG G  1 152 ? -46.615  0.694   -74.021  1.00 78.25  ? 152 ARG G CB  1 
ATOM   9613  C CG  . ARG G  1 152 ? -46.617  0.179   -75.443  1.00 80.81  ? 152 ARG G CG  1 
ATOM   9614  C CD  . ARG G  1 152 ? -45.279  0.370   -76.155  1.00 82.03  ? 152 ARG G CD  1 
ATOM   9615  N NE  . ARG G  1 152 ? -44.243  -0.604  -75.766  1.00 81.92  ? 152 ARG G NE  1 
ATOM   9616  C CZ  . ARG G  1 152 ? -43.102  -0.286  -75.130  1.00 80.86  ? 152 ARG G CZ  1 
ATOM   9617  N NH1 . ARG G  1 152 ? -42.237  -1.269  -74.849  1.00 81.35  ? 152 ARG G NH1 1 
ATOM   9618  N NH2 . ARG G  1 152 ? -42.804  1.003   -74.782  1.00 79.64  ? 152 ARG G NH2 1 
ATOM   9619  N N   . ILE G  1 153 ? -47.174  -1.842  -72.323  1.00 77.15  ? 153 ILE G N   1 
ATOM   9620  C CA  . ILE G  1 153 ? -47.258  -3.306  -72.229  1.00 78.14  ? 153 ILE G CA  1 
ATOM   9621  C C   . ILE G  1 153 ? -48.556  -3.767  -71.545  1.00 77.73  ? 153 ILE G C   1 
ATOM   9622  O O   . ILE G  1 153 ? -49.144  -4.785  -71.916  1.00 79.10  ? 153 ILE G O   1 
ATOM   9623  C CB  . ILE G  1 153 ? -46.036  -3.898  -71.530  1.00 77.99  ? 153 ILE G CB  1 
ATOM   9624  C CG1 . ILE G  1 153 ? -44.813  -3.619  -72.358  1.00 78.96  ? 153 ILE G CG1 1 
ATOM   9625  C CG2 . ILE G  1 153 ? -46.217  -5.395  -71.304  1.00 79.32  ? 153 ILE G CG2 1 
ATOM   9626  C CD1 . ILE G  1 153 ? -43.535  -4.058  -71.692  1.00 79.05  ? 153 ILE G CD1 1 
ATOM   9627  N N   . LEU G  1 154 ? -48.997  -2.992  -70.568  1.00 76.12  ? 154 LEU G N   1 
ATOM   9628  C CA  . LEU G  1 154 ? -50.241  -3.269  -69.904  1.00 75.92  ? 154 LEU G CA  1 
ATOM   9629  C C   . LEU G  1 154 ? -51.434  -3.138  -70.873  1.00 77.09  ? 154 LEU G C   1 
ATOM   9630  O O   . LEU G  1 154 ? -52.345  -3.948  -70.892  1.00 77.98  ? 154 LEU G O   1 
ATOM   9631  C CB  . LEU G  1 154 ? -50.382  -2.337  -68.700  1.00 74.35  ? 154 LEU G CB  1 
ATOM   9632  C CG  . LEU G  1 154 ? -51.210  -2.877  -67.539  1.00 74.24  ? 154 LEU G CG  1 
ATOM   9633  C CD1 . LEU G  1 154 ? -50.736  -4.242  -67.035  1.00 74.95  ? 154 LEU G CD1 1 
ATOM   9634  C CD2 . LEU G  1 154 ? -51.165  -1.870  -66.415  1.00 73.07  ? 154 LEU G CD2 1 
ATOM   9635  N N   . SER G  1 155 ? -51.404  -2.115  -71.697  1.00 77.38  ? 155 SER G N   1 
ATOM   9636  C CA  . SER G  1 155 ? -52.446  -1.873  -72.657  1.00 78.90  ? 155 SER G CA  1 
ATOM   9637  C C   . SER G  1 155 ? -52.622  -3.098  -73.530  1.00 80.77  ? 155 SER G C   1 
ATOM   9638  O O   . SER G  1 155 ? -53.767  -3.519  -73.814  1.00 81.95  ? 155 SER G O   1 
ATOM   9639  C CB  . SER G  1 155 ? -52.060  -0.676  -73.525  1.00 79.50  ? 155 SER G CB  1 
ATOM   9640  O OG  . SER G  1 155 ? -53.112  -0.295  -74.368  1.00 81.28  ? 155 SER G OG  1 
ATOM   9641  N N   . GLU G  1 156 ? -51.486  -3.664  -73.958  1.00 81.31  ? 156 GLU G N   1 
ATOM   9642  C CA  . GLU G  1 156 ? -51.447  -4.834  -74.850  1.00 83.53  ? 156 GLU G CA  1 
ATOM   9643  C C   . GLU G  1 156 ? -52.069  -6.048  -74.224  1.00 83.77  ? 156 GLU G C   1 
ATOM   9644  O O   . GLU G  1 156 ? -52.660  -6.847  -74.924  1.00 85.75  ? 156 GLU G O   1 
ATOM   9645  C CB  . GLU G  1 156 ? -50.009  -5.178  -75.209  1.00 84.15  ? 156 GLU G CB  1 
ATOM   9646  C CG  . GLU G  1 156 ? -49.354  -4.124  -76.084  1.00 84.70  ? 156 GLU G CG  1 
ATOM   9647  C CD  . GLU G  1 156 ? -47.828  -4.251  -76.178  1.00 84.93  ? 156 GLU G CD  1 
ATOM   9648  O OE1 . GLU G  1 156 ? -47.270  -5.174  -75.515  1.00 84.69  ? 156 GLU G OE1 1 
ATOM   9649  O OE2 . GLU G  1 156 ? -47.193  -3.426  -76.921  1.00 85.67  ? 156 GLU G OE2 1 
ATOM   9650  N N   . ARG G  1 157 ? -51.934  -6.191  -72.911  1.00 82.06  ? 157 ARG G N   1 
ATOM   9651  C CA  . ARG G  1 157 ? -52.310  -7.431  -72.262  1.00 82.66  ? 157 ARG G CA  1 
ATOM   9652  C C   . ARG G  1 157 ? -53.689  -7.407  -71.643  1.00 82.31  ? 157 ARG G C   1 
ATOM   9653  O O   . ARG G  1 157 ? -54.237  -8.453  -71.342  1.00 83.35  ? 157 ARG G O   1 
ATOM   9654  C CB  . ARG G  1 157 ? -51.272  -7.796  -71.223  1.00 81.81  ? 157 ARG G CB  1 
ATOM   9655  C CG  . ARG G  1 157 ? -49.891  -7.816  -71.788  1.00 82.37  ? 157 ARG G CG  1 
ATOM   9656  C CD  . ARG G  1 157 ? -48.976  -8.675  -70.964  1.00 82.78  ? 157 ARG G CD  1 
ATOM   9657  N NE  . ARG G  1 157 ? -48.162  -9.526  -71.815  1.00 85.08  ? 157 ARG G NE  1 
ATOM   9658  C CZ  . ARG G  1 157 ? -48.534  -10.741 -72.227  1.00 87.43  ? 157 ARG G CZ  1 
ATOM   9659  N NH1 . ARG G  1 157 ? -49.711  -11.278 -71.841  1.00 87.66  ? 157 ARG G NH1 1 
ATOM   9660  N NH2 . ARG G  1 157 ? -47.711  -11.423 -73.011  1.00 89.80  ? 157 ARG G NH2 1 
ATOM   9661  N N   . THR G  1 158 ? -54.229  -6.212  -71.437  1.00 81.12  ? 158 THR G N   1 
ATOM   9662  C CA  . THR G  1 158 ? -55.551  -6.035  -70.881  1.00 81.06  ? 158 THR G CA  1 
ATOM   9663  C C   . THR G  1 158 ? -56.514  -5.649  -71.967  1.00 82.49  ? 158 THR G C   1 
ATOM   9664  O O   . THR G  1 158 ? -57.699  -5.837  -71.806  1.00 83.27  ? 158 THR G O   1 
ATOM   9665  C CB  . THR G  1 158 ? -55.588  -4.905  -69.845  1.00 79.28  ? 158 THR G CB  1 
ATOM   9666  O OG1 . THR G  1 158 ? -55.147  -3.674  -70.449  1.00 78.77  ? 158 THR G OG1 1 
ATOM   9667  C CG2 . THR G  1 158 ? -54.727  -5.256  -68.653  1.00 78.17  ? 158 THR G CG2 1 
ATOM   9668  N N   . GLY G  1 159 ? -56.014  -5.075  -73.054  1.00 83.11  ? 159 GLY G N   1 
ATOM   9669  C CA  . GLY G  1 159 ? -56.873  -4.536  -74.096  1.00 84.83  ? 159 GLY G CA  1 
ATOM   9670  C C   . GLY G  1 159 ? -57.415  -3.136  -73.835  1.00 84.28  ? 159 GLY G C   1 
ATOM   9671  O O   . GLY G  1 159 ? -58.217  -2.627  -74.620  1.00 86.05  ? 159 GLY G O   1 
ATOM   9672  N N   . GLN G  1 160 ? -56.985  -2.507  -72.737  1.00 82.20  ? 160 GLN G N   1 
ATOM   9673  C CA  . GLN G  1 160 ? -57.403  -1.134  -72.393  1.00 81.85  ? 160 GLN G CA  1 
ATOM   9674  C C   . GLN G  1 160 ? -56.476  -0.130  -73.055  1.00 81.83  ? 160 GLN G C   1 
ATOM   9675  O O   . GLN G  1 160 ? -55.287  -0.410  -73.238  1.00 81.10  ? 160 GLN G O   1 
ATOM   9676  C CB  . GLN G  1 160 ? -57.350  -0.920  -70.881  1.00 80.01  ? 160 GLN G CB  1 
ATOM   9677  C CG  . GLN G  1 160 ? -58.133  -1.929  -70.060  1.00 80.11  ? 160 GLN G CG  1 
ATOM   9678  C CD  . GLN G  1 160 ? -59.640  -1.693  -70.072  1.00 81.65  ? 160 GLN G CD  1 
ATOM   9679  O OE1 . GLN G  1 160 ? -60.140  -0.720  -70.630  1.00 82.73  ? 160 GLN G OE1 1 
ATOM   9680  N NE2 . GLN G  1 160 ? -60.369  -2.594  -69.440  1.00 82.06  ? 160 GLN G NE2 1 
ATOM   9681  N N   . SER G  1 161 ? -56.991  1.048   -73.404  1.00 82.91  ? 161 SER G N   1 
ATOM   9682  C CA  . SER G  1 161 ? -56.147  2.042   -74.064  1.00 83.29  ? 161 SER G CA  1 
ATOM   9683  C C   . SER G  1 161 ? -55.119  2.627   -73.114  1.00 81.03  ? 161 SER G C   1 
ATOM   9684  O O   . SER G  1 161 ? -55.358  2.780   -71.915  1.00 79.65  ? 161 SER G O   1 
ATOM   9685  C CB  . SER G  1 161 ? -56.978  3.153   -74.678  1.00 85.54  ? 161 SER G CB  1 
ATOM   9686  O OG  . SER G  1 161 ? -57.534  3.982   -73.695  1.00 84.99  ? 161 SER G OG  1 
ATOM   9687  N N   . ILE G  1 162 ? -53.977  2.970   -73.671  1.00 80.96  ? 162 ILE G N   1 
ATOM   9688  C CA  . ILE G  1 162 ? -52.946  3.674   -72.963  1.00 79.27  ? 162 ILE G CA  1 
ATOM   9689  C C   . ILE G  1 162 ? -53.500  4.853   -72.144  1.00 79.02  ? 162 ILE G C   1 
ATOM   9690  O O   . ILE G  1 162 ? -53.128  5.011   -70.976  1.00 77.29  ? 162 ILE G O   1 
ATOM   9691  C CB  . ILE G  1 162 ? -51.886  4.147   -73.967  1.00 80.18  ? 162 ILE G CB  1 
ATOM   9692  C CG1 . ILE G  1 162 ? -50.953  2.999   -74.309  1.00 79.88  ? 162 ILE G CG1 1 
ATOM   9693  C CG2 . ILE G  1 162 ? -51.063  5.283   -73.403  1.00 79.13  ? 162 ILE G CG2 1 
ATOM   9694  C CD1 . ILE G  1 162 ? -50.209  3.221   -75.608  1.00 81.78  ? 162 ILE G CD1 1 
ATOM   9695  N N   . GLU G  1 163 ? -54.380  5.671   -72.738  1.00 81.10  ? 163 GLU G N   1 
ATOM   9696  C CA  . GLU G  1 163 ? -54.973  6.839   -72.044  1.00 81.53  ? 163 GLU G CA  1 
ATOM   9697  C C   . GLU G  1 163 ? -55.736  6.434   -70.790  1.00 80.49  ? 163 GLU G C   1 
ATOM   9698  O O   . GLU G  1 163 ? -55.617  7.112   -69.774  1.00 79.75  ? 163 GLU G O   1 
ATOM   9699  C CB  . GLU G  1 163 ? -55.923  7.647   -72.939  1.00 84.60  ? 163 GLU G CB  1 
ATOM   9700  C CG  . GLU G  1 163 ? -55.263  8.408   -74.075  1.00 86.36  ? 163 GLU G CG  1 
ATOM   9701  C CD  . GLU G  1 163 ? -54.757  7.495   -75.213  1.00 86.95  ? 163 GLU G CD  1 
ATOM   9702  O OE1 . GLU G  1 163 ? -55.399  6.444   -75.548  1.00 87.40  ? 163 GLU G OE1 1 
ATOM   9703  O OE2 . GLU G  1 163 ? -53.686  7.835   -75.785  1.00 87.20  ? 163 GLU G OE2 1 
ATOM   9704  N N   . LYS G  1 164 ? -56.519  5.347   -70.881  1.00 80.76  ? 164 LYS G N   1 
ATOM   9705  C CA  . LYS G  1 164 ? -57.315  4.851   -69.747  1.00 80.19  ? 164 LYS G CA  1 
ATOM   9706  C C   . LYS G  1 164 ? -56.417  4.343   -68.614  1.00 77.86  ? 164 LYS G C   1 
ATOM   9707  O O   . LYS G  1 164 ? -56.689  4.647   -67.434  1.00 77.46  ? 164 LYS G O   1 
ATOM   9708  C CB  . LYS G  1 164 ? -58.299  3.764   -70.162  1.00 81.22  ? 164 LYS G CB  1 
ATOM   9709  C CG  . LYS G  1 164 ? -59.163  3.299   -69.008  1.00 81.01  ? 164 LYS G CG  1 
ATOM   9710  C CD  . LYS G  1 164 ? -60.213  2.290   -69.425  1.00 82.33  ? 164 LYS G CD  1 
ATOM   9711  C CE  . LYS G  1 164 ? -60.704  1.478   -68.240  1.00 81.76  ? 164 LYS G CE  1 
ATOM   9712  N NZ  . LYS G  1 164 ? -61.374  2.299   -67.204  1.00 82.34  ? 164 LYS G NZ  1 
ATOM   9713  N N   . ILE G  1 165 ? -55.362  3.587   -68.984  1.00 76.77  ? 165 ILE G N   1 
ATOM   9714  C CA  . ILE G  1 165 ? -54.357  3.090   -68.022  1.00 74.96  ? 165 ILE G CA  1 
ATOM   9715  C C   . ILE G  1 165 ? -53.711  4.279   -67.276  1.00 74.20  ? 165 ILE G C   1 
ATOM   9716  O O   . ILE G  1 165 ? -53.622  4.293   -66.032  1.00 73.48  ? 165 ILE G O   1 
ATOM   9717  C CB  . ILE G  1 165 ? -53.248  2.272   -68.706  1.00 74.47  ? 165 ILE G CB  1 
ATOM   9718  C CG1 . ILE G  1 165 ? -53.821  1.138   -69.561  1.00 75.60  ? 165 ILE G CG1 1 
ATOM   9719  C CG2 . ILE G  1 165 ? -52.224  1.774   -67.693  1.00 73.05  ? 165 ILE G CG2 1 
ATOM   9720  C CD1 . ILE G  1 165 ? -54.292  -0.071  -68.816  1.00 75.46  ? 165 ILE G CD1 1 
ATOM   9721  N N   . GLN G  1 166 ? -53.269  5.273   -68.045  1.00 74.70  ? 166 GLN G N   1 
ATOM   9722  C CA  . GLN G  1 166 ? -52.678  6.479   -67.473  1.00 74.34  ? 166 GLN G CA  1 
ATOM   9723  C C   . GLN G  1 166 ? -53.590  7.118   -66.402  1.00 74.92  ? 166 GLN G C   1 
ATOM   9724  O O   . GLN G  1 166 ? -53.141  7.446   -65.324  1.00 74.20  ? 166 GLN G O   1 
ATOM   9725  C CB  . GLN G  1 166 ? -52.362  7.491   -68.573  1.00 75.51  ? 166 GLN G CB  1 
ATOM   9726  C CG  . GLN G  1 166 ? -51.765  8.778   -68.040  1.00 75.46  ? 166 GLN G CG  1 
ATOM   9727  C CD  . GLN G  1 166 ? -50.248  8.725   -67.838  1.00 73.98  ? 166 GLN G CD  1 
ATOM   9728  O OE1 . GLN G  1 166 ? -49.611  7.655   -67.861  1.00 72.87  ? 166 GLN G OE1 1 
ATOM   9729  N NE2 . GLN G  1 166 ? -49.663  9.895   -67.639  1.00 74.26  ? 166 GLN G NE2 1 
ATOM   9730  N N   . LYS G  1 167 ? -54.866  7.294   -66.707  1.00 84.20  ? 167 LYS G N   1 
ATOM   9731  C CA  . LYS G  1 167 ? -55.793  7.892   -65.776  1.00 84.03  ? 167 LYS G CA  1 
ATOM   9732  C C   . LYS G  1 167 ? -56.035  6.983   -64.563  1.00 80.50  ? 167 LYS G C   1 
ATOM   9733  O O   . LYS G  1 167 ? -56.052  7.472   -63.423  1.00 79.18  ? 167 LYS G O   1 
ATOM   9734  C CB  . LYS G  1 167 ? -57.115  8.224   -66.474  1.00 87.97  ? 167 LYS G CB  1 
ATOM   9735  C CG  . LYS G  1 167 ? -58.206  8.722   -65.533  1.00 88.59  ? 167 LYS G CG  1 
ATOM   9736  C CD  . LYS G  1 167 ? -59.413  9.288   -66.270  1.00 93.81  ? 167 LYS G CD  1 
ATOM   9737  C CE  . LYS G  1 167 ? -59.089  10.658  -66.876  1.00 97.35  ? 167 LYS G CE  1 
ATOM   9738  N NZ  . LYS G  1 167 ? -59.860  10.975  -68.101  1.00 103.10 ? 167 LYS G NZ  1 
ATOM   9739  N N   . ASP G  1 168 ? -56.203  5.678   -64.812  1.00 79.41  ? 168 ASP G N   1 
ATOM   9740  C CA  . ASP G  1 168 ? -56.551  4.713   -63.782  1.00 76.75  ? 168 ASP G CA  1 
ATOM   9741  C C   . ASP G  1 168 ? -55.411  4.444   -62.823  1.00 73.77  ? 168 ASP G C   1 
ATOM   9742  O O   . ASP G  1 168 ? -55.653  4.011   -61.689  1.00 71.95  ? 168 ASP G O   1 
ATOM   9743  C CB  . ASP G  1 168 ? -57.046  3.386   -64.379  1.00 76.96  ? 168 ASP G CB  1 
ATOM   9744  C CG  . ASP G  1 168 ? -58.451  3.492   -65.006  1.00 80.27  ? 168 ASP G CG  1 
ATOM   9745  O OD1 . ASP G  1 168 ? -59.138  4.532   -64.811  1.00 82.32  ? 168 ASP G OD1 1 
ATOM   9746  O OD2 . ASP G  1 168 ? -58.869  2.525   -65.697  1.00 81.36  ? 168 ASP G OD2 1 
ATOM   9747  N N   . THR G  1 169 ? -54.176  4.695   -63.238  1.00 73.84  ? 169 THR G N   1 
ATOM   9748  C CA  . THR G  1 169 ? -53.034  4.442   -62.346  1.00 71.90  ? 169 THR G CA  1 
ATOM   9749  C C   . THR G  1 169 ? -52.445  5.704   -61.697  1.00 72.18  ? 169 THR G C   1 
ATOM   9750  O O   . THR G  1 169 ? -51.392  5.651   -61.071  1.00 71.47  ? 169 THR G O   1 
ATOM   9751  C CB  . THR G  1 169 ? -51.929  3.630   -63.058  1.00 72.19  ? 169 THR G CB  1 
ATOM   9752  O OG1 . THR G  1 169 ? -51.488  4.335   -64.215  1.00 74.60  ? 169 THR G OG1 1 
ATOM   9753  C CG2 . THR G  1 169 ? -52.450  2.327   -63.473  1.00 71.90  ? 169 THR G CG2 1 
ATOM   9754  N N   . ASP G  1 170 ? -53.131  6.832   -61.856  1.00 73.78  ? 170 ASP G N   1 
ATOM   9755  C CA  . ASP G  1 170 ? -52.656  8.091   -61.290  1.00 74.53  ? 170 ASP G CA  1 
ATOM   9756  C C   . ASP G  1 170 ? -52.480  8.030   -59.770  1.00 72.85  ? 170 ASP G C   1 
ATOM   9757  O O   . ASP G  1 170 ? -51.502  8.537   -59.223  1.00 73.00  ? 170 ASP G O   1 
ATOM   9758  C CB  . ASP G  1 170 ? -53.572  9.246   -61.660  1.00 77.04  ? 170 ASP G CB  1 
ATOM   9759  C CG  . ASP G  1 170 ? -52.992  10.596  -61.245  1.00 78.36  ? 170 ASP G CG  1 
ATOM   9760  O OD1 . ASP G  1 170 ? -53.631  11.252  -60.406  1.00 78.92  ? 170 ASP G OD1 1 
ATOM   9761  O OD2 . ASP G  1 170 ? -51.896  11.015  -61.722  1.00 79.23  ? 170 ASP G OD2 1 
ATOM   9762  N N   . ARG G  1 171 ? -53.446  7.412   -59.096  1.00 71.78  ? 171 ARG G N   1 
ATOM   9763  C CA  . ARG G  1 171 ? -53.367  7.110   -57.678  1.00 70.51  ? 171 ARG G CA  1 
ATOM   9764  C C   . ARG G  1 171 ? -53.561  5.611   -57.483  1.00 68.83  ? 171 ARG G C   1 
ATOM   9765  O O   . ARG G  1 171 ? -53.679  4.858   -58.433  1.00 68.62  ? 171 ARG G O   1 
ATOM   9766  C CB  . ARG G  1 171 ? -54.440  7.865   -56.928  1.00 71.62  ? 171 ARG G CB  1 
ATOM   9767  C CG  . ARG G  1 171 ? -54.478  9.347   -57.226  1.00 73.90  ? 171 ARG G CG  1 
ATOM   9768  C CD  . ARG G  1 171 ? -53.691  10.108  -56.206  1.00 74.27  ? 171 ARG G CD  1 
ATOM   9769  N NE  . ARG G  1 171 ? -53.847  11.535  -56.408  1.00 76.80  ? 171 ARG G NE  1 
ATOM   9770  C CZ  . ARG G  1 171 ? -53.171  12.460  -55.741  1.00 77.94  ? 171 ARG G CZ  1 
ATOM   9771  N NH1 . ARG G  1 171 ? -52.271  12.104  -54.831  1.00 76.92  ? 171 ARG G NH1 1 
ATOM   9772  N NH2 . ARG G  1 171 ? -53.378  13.735  -55.990  1.00 80.57  ? 171 ARG G NH2 1 
ATOM   9773  N N   . ASP G  1 172 ? -53.564  5.154   -56.249  1.00 68.02  ? 172 ASP G N   1 
ATOM   9774  C CA  . ASP G  1 172 ? -53.745  3.741   -55.963  1.00 66.83  ? 172 ASP G CA  1 
ATOM   9775  C C   . ASP G  1 172 ? -55.141  3.350   -56.399  1.00 67.04  ? 172 ASP G C   1 
ATOM   9776  O O   . ASP G  1 172 ? -56.146  3.994   -56.062  1.00 68.16  ? 172 ASP G O   1 
ATOM   9777  C CB  . ASP G  1 172 ? -53.599  3.461   -54.458  1.00 66.69  ? 172 ASP G CB  1 
ATOM   9778  C CG  . ASP G  1 172 ? -52.136  3.464   -53.975  1.00 67.05  ? 172 ASP G CG  1 
ATOM   9779  O OD1 . ASP G  1 172 ? -51.200  3.597   -54.836  1.00 67.31  ? 172 ASP G OD1 1 
ATOM   9780  O OD2 . ASP G  1 172 ? -51.934  3.308   -52.728  1.00 67.62  ? 172 ASP G OD2 1 
ATOM   9781  N N   . ASN G  1 173 ? -55.208  2.260   -57.148  1.00 66.49  ? 173 ASN G N   1 
ATOM   9782  C CA  . ASN G  1 173 ? -56.469  1.776   -57.632  1.00 67.16  ? 173 ASN G CA  1 
ATOM   9783  C C   . ASN G  1 173 ? -56.658  0.326   -57.255  1.00 66.28  ? 173 ASN G C   1 
ATOM   9784  O O   . ASN G  1 173 ? -56.004  -0.564  -57.808  1.00 65.73  ? 173 ASN G O   1 
ATOM   9785  C CB  . ASN G  1 173 ? -56.496  1.944   -59.128  1.00 68.24  ? 173 ASN G CB  1 
ATOM   9786  C CG  . ASN G  1 173 ? -57.867  1.740   -59.694  1.00 69.96  ? 173 ASN G CG  1 
ATOM   9787  O OD1 . ASN G  1 173 ? -58.837  1.538   -58.951  1.00 70.42  ? 173 ASN G OD1 1 
ATOM   9788  N ND2 . ASN G  1 173 ? -57.963  1.785   -61.016  1.00 71.52  ? 173 ASN G ND2 1 
ATOM   9789  N N   . PHE G  1 174 ? -57.553  0.112   -56.293  1.00 66.61  ? 174 PHE G N   1 
ATOM   9790  C CA  . PHE G  1 174 ? -57.831  -1.212  -55.752  1.00 66.21  ? 174 PHE G CA  1 
ATOM   9791  C C   . PHE G  1 174 ? -58.960  -1.872  -56.505  1.00 67.30  ? 174 PHE G C   1 
ATOM   9792  O O   . PHE G  1 174 ? -59.998  -1.273  -56.752  1.00 69.00  ? 174 PHE G O   1 
ATOM   9793  C CB  . PHE G  1 174 ? -58.158  -1.125  -54.270  1.00 66.59  ? 174 PHE G CB  1 
ATOM   9794  C CG  . PHE G  1 174 ? -56.981  -0.789  -53.413  1.00 66.00  ? 174 PHE G CG  1 
ATOM   9795  C CD1 . PHE G  1 174 ? -56.075  -1.774  -53.029  1.00 65.51  ? 174 PHE G CD1 1 
ATOM   9796  C CD2 . PHE G  1 174 ? -56.770  0.498   -52.980  1.00 66.55  ? 174 PHE G CD2 1 
ATOM   9797  C CE1 . PHE G  1 174 ? -54.975  -1.463  -52.236  1.00 65.80  ? 174 PHE G CE1 1 
ATOM   9798  C CE2 . PHE G  1 174 ? -55.674  0.804   -52.175  1.00 66.57  ? 174 PHE G CE2 1 
ATOM   9799  C CZ  . PHE G  1 174 ? -54.778  -0.166  -51.804  1.00 66.32  ? 174 PHE G CZ  1 
ATOM   9800  N N   . LEU G  1 175 ? -58.736  -3.121  -56.874  1.00 66.85  ? 175 LEU G N   1 
ATOM   9801  C CA  . LEU G  1 175 ? -59.650  -3.870  -57.706  1.00 68.14  ? 175 LEU G CA  1 
ATOM   9802  C C   . LEU G  1 175 ? -60.053  -5.186  -57.034  1.00 68.28  ? 175 LEU G C   1 
ATOM   9803  O O   . LEU G  1 175 ? -59.200  -5.887  -56.448  1.00 67.21  ? 175 LEU G O   1 
ATOM   9804  C CB  . LEU G  1 175 ? -58.939  -4.123  -59.033  1.00 68.10  ? 175 LEU G CB  1 
ATOM   9805  C CG  . LEU G  1 175 ? -59.185  -3.186  -60.224  1.00 69.58  ? 175 LEU G CG  1 
ATOM   9806  C CD1 . LEU G  1 175 ? -59.251  -1.711  -59.909  1.00 69.84  ? 175 LEU G CD1 1 
ATOM   9807  C CD2 . LEU G  1 175 ? -58.101  -3.398  -61.242  1.00 69.42  ? 175 LEU G CD2 1 
ATOM   9808  N N   . THR G  1 176 ? -61.332  -5.536  -57.081  1.00 70.13  ? 176 THR G N   1 
ATOM   9809  C CA  . THR G  1 176 ? -61.699  -6.893  -56.680  1.00 70.66  ? 176 THR G CA  1 
ATOM   9810  C C   . THR G  1 176 ? -61.290  -7.894  -57.771  1.00 70.72  ? 176 THR G C   1 
ATOM   9811  O O   . THR G  1 176 ? -60.931  -7.500  -58.870  1.00 70.78  ? 176 THR G O   1 
ATOM   9812  C CB  . THR G  1 176 ? -63.200  -7.045  -56.377  1.00 73.23  ? 176 THR G CB  1 
ATOM   9813  O OG1 . THR G  1 176 ? -63.963  -6.898  -57.586  1.00 75.34  ? 176 THR G OG1 1 
ATOM   9814  C CG2 . THR G  1 176 ? -63.636  -6.060  -55.375  1.00 73.87  ? 176 THR G CG2 1 
ATOM   9815  N N   . ALA G  1 177 ? -61.342  -9.184  -57.476  1.00 71.13  ? 177 ALA G N   1 
ATOM   9816  C CA  . ALA G  1 177 ? -61.072  -10.187 -58.517  1.00 71.85  ? 177 ALA G CA  1 
ATOM   9817  C C   . ALA G  1 177 ? -62.007  -10.015 -59.737  1.00 74.01  ? 177 ALA G C   1 
ATOM   9818  O O   . ALA G  1 177 ? -61.542  -10.048 -60.873  1.00 74.45  ? 177 ALA G O   1 
ATOM   9819  C CB  . ALA G  1 177 ? -61.162  -11.602 -57.954  1.00 72.62  ? 177 ALA G CB  1 
ATOM   9820  N N   . GLU G  1 178 ? -63.308  -9.821  -59.509  1.00 75.99  ? 178 GLU G N   1 
ATOM   9821  C CA  . GLU G  1 178 ? -64.220  -9.612  -60.615  1.00 78.91  ? 178 GLU G CA  1 
ATOM   9822  C C   . GLU G  1 178 ? -63.807  -8.380  -61.384  1.00 78.66  ? 178 GLU G C   1 
ATOM   9823  O O   . GLU G  1 178 ? -63.737  -8.424  -62.596  1.00 80.22  ? 178 GLU G O   1 
ATOM   9824  C CB  . GLU G  1 178 ? -65.673  -9.474  -60.167  1.00 81.82  ? 178 GLU G CB  1 
ATOM   9825  C CG  . GLU G  1 178 ? -66.346  -10.770 -59.732  1.00 83.46  ? 178 GLU G CG  1 
ATOM   9826  C CD  . GLU G  1 178 ? -66.541  -11.812 -60.853  1.00 85.64  ? 178 GLU G CD  1 
ATOM   9827  O OE1 . GLU G  1 178 ? -66.644  -11.464 -62.077  1.00 87.42  ? 178 GLU G OE1 1 
ATOM   9828  O OE2 . GLU G  1 178 ? -66.618  -13.022 -60.507  1.00 86.07  ? 178 GLU G OE2 1 
ATOM   9829  N N   . GLU G  1 179 ? -63.518  -7.285  -60.678  1.00 77.06  ? 179 GLU G N   1 
ATOM   9830  C CA  . GLU G  1 179 ? -63.099  -6.034  -61.328  1.00 77.01  ? 179 GLU G CA  1 
ATOM   9831  C C   . GLU G  1 179 ? -61.803  -6.161  -62.174  1.00 75.58  ? 179 GLU G C   1 
ATOM   9832  O O   . GLU G  1 179 ? -61.665  -5.534  -63.243  1.00 77.01  ? 179 GLU G O   1 
ATOM   9833  C CB  . GLU G  1 179 ? -62.926  -4.941  -60.286  1.00 75.57  ? 179 GLU G CB  1 
ATOM   9834  C CG  . GLU G  1 179 ? -64.240  -4.431  -59.716  1.00 78.13  ? 179 GLU G CG  1 
ATOM   9835  C CD  . GLU G  1 179 ? -64.043  -3.486  -58.534  1.00 76.94  ? 179 GLU G CD  1 
ATOM   9836  O OE1 . GLU G  1 179 ? -62.944  -3.480  -57.884  1.00 73.95  ? 179 GLU G OE1 1 
ATOM   9837  O OE2 . GLU G  1 179 ? -65.010  -2.751  -58.249  1.00 79.60  ? 179 GLU G OE2 1 
ATOM   9838  N N   . ALA G  1 180 ? -60.867  -6.971  -61.675  1.00 73.40  ? 180 ALA G N   1 
ATOM   9839  C CA  . ALA G  1 180 ? -59.642  -7.314  -62.369  1.00 72.73  ? 180 ALA G CA  1 
ATOM   9840  C C   . ALA G  1 180 ? -59.907  -8.078  -63.652  1.00 75.19  ? 180 ALA G C   1 
ATOM   9841  O O   . ALA G  1 180 ? -59.231  -7.832  -64.656  1.00 76.03  ? 180 ALA G O   1 
ATOM   9842  C CB  . ALA G  1 180 ? -58.768  -8.144  -61.473  1.00 70.95  ? 180 ALA G CB  1 
ATOM   9843  N N   . LYS G  1 181 ? -60.868  -9.010  -63.630  1.00 76.78  ? 181 LYS G N   1 
ATOM   9844  C CA  . LYS G  1 181 ? -61.264  -9.749  -64.832  1.00 79.79  ? 181 LYS G CA  1 
ATOM   9845  C C   . LYS G  1 181 ? -61.893  -8.803  -65.821  1.00 82.48  ? 181 LYS G C   1 
ATOM   9846  O O   . LYS G  1 181 ? -61.549  -8.825  -66.979  1.00 84.44  ? 181 LYS G O   1 
ATOM   9847  C CB  . LYS G  1 181 ? -62.243  -10.876 -64.493  1.00 81.30  ? 181 LYS G CB  1 
ATOM   9848  C CG  . LYS G  1 181 ? -62.802  -11.612 -65.694  1.00 85.04  ? 181 LYS G CG  1 
ATOM   9849  C CD  . LYS G  1 181 ? -63.807  -12.655 -65.253  1.00 86.74  ? 181 LYS G CD  1 
ATOM   9850  C CE  . LYS G  1 181 ? -64.669  -13.110 -66.410  1.00 91.34  ? 181 LYS G CE  1 
ATOM   9851  N NZ  . LYS G  1 181 ? -65.791  -13.864 -65.810  1.00 93.21  ? 181 LYS G NZ  1 
ATOM   9852  N N   . GLU G  1 182 ? -62.795  -7.958  -65.347  1.00 83.08  ? 182 GLU G N   1 
ATOM   9853  C CA  . GLU G  1 182 ? -63.461  -6.968  -66.173  1.00 86.30  ? 182 GLU G CA  1 
ATOM   9854  C C   . GLU G  1 182 ? -62.436  -6.035  -66.821  1.00 85.62  ? 182 GLU G C   1 
ATOM   9855  O O   . GLU G  1 182 ? -62.646  -5.562  -67.932  1.00 88.91  ? 182 GLU G O   1 
ATOM   9856  C CB  . GLU G  1 182 ? -64.457  -6.170  -65.324  1.00 87.01  ? 182 GLU G CB  1 
ATOM   9857  C CG  . GLU G  1 182 ? -65.279  -5.149  -66.082  1.00 91.27  ? 182 GLU G CG  1 
ATOM   9858  C CD  . GLU G  1 182 ? -66.322  -5.826  -66.928  1.00 96.16  ? 182 GLU G CD  1 
ATOM   9859  O OE1 . GLU G  1 182 ? -66.673  -5.269  -68.001  1.00 100.35 ? 182 GLU G OE1 1 
ATOM   9860  O OE2 . GLU G  1 182 ? -66.787  -6.936  -66.529  1.00 96.27  ? 182 GLU G OE2 1 
ATOM   9861  N N   . TYR G  1 183 ? -61.331  -5.782  -66.123  1.00 81.87  ? 183 TYR G N   1 
ATOM   9862  C CA  . TYR G  1 183 ? -60.318  -4.860  -66.588  1.00 81.28  ? 183 TYR G CA  1 
ATOM   9863  C C   . TYR G  1 183 ? -59.443  -5.511  -67.627  1.00 82.31  ? 183 TYR G C   1 
ATOM   9864  O O   . TYR G  1 183 ? -58.869  -4.827  -68.464  1.00 83.68  ? 183 TYR G O   1 
ATOM   9865  C CB  . TYR G  1 183 ? -59.452  -4.408  -65.420  1.00 77.53  ? 183 TYR G CB  1 
ATOM   9866  C CG  . TYR G  1 183 ? -58.808  -3.067  -65.642  1.00 77.41  ? 183 TYR G CG  1 
ATOM   9867  C CD1 . TYR G  1 183 ? -59.487  -1.879  -65.320  1.00 78.21  ? 183 TYR G CD1 1 
ATOM   9868  C CD2 . TYR G  1 183 ? -57.525  -2.974  -66.176  1.00 77.05  ? 183 TYR G CD2 1 
ATOM   9869  C CE1 . TYR G  1 183 ? -58.909  -0.629  -65.557  1.00 78.51  ? 183 TYR G CE1 1 
ATOM   9870  C CE2 . TYR G  1 183 ? -56.929  -1.725  -66.413  1.00 77.36  ? 183 TYR G CE2 1 
ATOM   9871  C CZ  . TYR G  1 183 ? -57.618  -0.552  -66.109  1.00 77.99  ? 183 TYR G CZ  1 
ATOM   9872  O OH  . TYR G  1 183 ? -57.034  0.671   -66.337  1.00 78.58  ? 183 TYR G OH  1 
ATOM   9873  N N   . GLY G  1 184 ? -59.338  -6.835  -67.575  1.00 82.09  ? 184 GLY G N   1 
ATOM   9874  C CA  . GLY G  1 184 ? -58.502  -7.583  -68.496  1.00 83.52  ? 184 GLY G CA  1 
ATOM   9875  C C   . GLY G  1 184 ? -57.169  -7.976  -67.895  1.00 81.00  ? 184 GLY G C   1 
ATOM   9876  O O   . GLY G  1 184 ? -56.270  -8.411  -68.601  1.00 82.40  ? 184 GLY G O   1 
ATOM   9877  N N   . LEU G  1 185 ? -57.016  -7.813  -66.584  1.00 77.88  ? 185 LEU G N   1 
ATOM   9878  C CA  . LEU G  1 185 ? -55.766  -8.213  -65.928  1.00 76.19  ? 185 LEU G CA  1 
ATOM   9879  C C   . LEU G  1 185 ? -55.699  -9.723  -65.745  1.00 76.79  ? 185 LEU G C   1 
ATOM   9880  O O   . LEU G  1 185 ? -54.613  -10.329 -65.793  1.00 77.39  ? 185 LEU G O   1 
ATOM   9881  C CB  . LEU G  1 185 ? -55.608  -7.519  -64.581  1.00 73.34  ? 185 LEU G CB  1 
ATOM   9882  C CG  . LEU G  1 185 ? -55.387  -6.018  -64.580  1.00 72.71  ? 185 LEU G CG  1 
ATOM   9883  C CD1 . LEU G  1 185 ? -55.792  -5.457  -63.245  1.00 70.57  ? 185 LEU G CD1 1 
ATOM   9884  C CD2 . LEU G  1 185 ? -53.951  -5.678  -64.855  1.00 72.96  ? 185 LEU G CD2 1 
ATOM   9885  N N   . ILE G  1 186 ? -56.867  -10.307 -65.498  1.00 77.08  ? 186 ILE G N   1 
ATOM   9886  C CA  . ILE G  1 186 ? -57.036  -11.755 -65.447  1.00 78.27  ? 186 ILE G CA  1 
ATOM   9887  C C   . ILE G  1 186 ? -58.101  -12.227 -66.456  1.00 81.21  ? 186 ILE G C   1 
ATOM   9888  O O   . ILE G  1 186 ? -58.849  -11.426 -67.028  1.00 82.33  ? 186 ILE G O   1 
ATOM   9889  C CB  . ILE G  1 186 ? -57.372  -12.242 -64.018  1.00 76.43  ? 186 ILE G CB  1 
ATOM   9890  C CG1 . ILE G  1 186 ? -58.587  -11.507 -63.459  1.00 75.56  ? 186 ILE G CG1 1 
ATOM   9891  C CG2 . ILE G  1 186 ? -56.173  -12.102 -63.103  1.00 74.70  ? 186 ILE G CG2 1 
ATOM   9892  C CD1 . ILE G  1 186 ? -59.136  -12.118 -62.189  1.00 74.75  ? 186 ILE G CD1 1 
ATOM   9893  N N   . ASP G  1 187 ? -58.154  -13.534 -66.671  1.00 82.99  ? 187 ASP G N   1 
ATOM   9894  C CA  . ASP G  1 187 ? -59.134  -14.156 -67.549  1.00 86.28  ? 187 ASP G CA  1 
ATOM   9895  C C   . ASP G  1 187 ? -60.288  -14.753 -66.762  1.00 86.27  ? 187 ASP G C   1 
ATOM   9896  O O   . ASP G  1 187 ? -61.430  -14.589 -67.133  1.00 88.30  ? 187 ASP G O   1 
ATOM   9897  C CB  . ASP G  1 187 ? -58.461  -15.234 -68.387  1.00 89.03  ? 187 ASP G CB  1 
ATOM   9898  C CG  . ASP G  1 187 ? -57.259  -14.716 -69.144  1.00 89.68  ? 187 ASP G CG  1 
ATOM   9899  O OD1 . ASP G  1 187 ? -57.422  -13.879 -70.036  1.00 91.10  ? 187 ASP G OD1 1 
ATOM   9900  O OD2 . ASP G  1 187 ? -56.137  -15.144 -68.862  1.00 89.33  ? 187 ASP G OD2 1 
ATOM   9901  N N   . GLU G  1 188 ? -59.989  -15.408 -65.650  1.00 136.12 ? 188 GLU G N   1 
ATOM   9902  C CA  . GLU G  1 188 ? -61.003  -16.124 -64.907  1.00 131.75 ? 188 GLU G CA  1 
ATOM   9903  C C   . GLU G  1 188 ? -60.818  -15.902 -63.429  1.00 120.13 ? 188 GLU G C   1 
ATOM   9904  O O   . GLU G  1 188 ? -59.693  -15.768 -62.986  1.00 116.14 ? 188 GLU G O   1 
ATOM   9905  C CB  . GLU G  1 188 ? -60.871  -17.617 -65.235  1.00 136.11 ? 188 GLU G CB  1 
ATOM   9906  C CG  . GLU G  1 188 ? -62.113  -18.459 -64.970  1.00 138.19 ? 188 GLU G CG  1 
ATOM   9907  C CD  . GLU G  1 188 ? -63.356  -17.826 -65.566  1.00 146.89 ? 188 GLU G CD  1 
ATOM   9908  O OE1 . GLU G  1 188 ? -63.653  -18.095 -66.757  1.00 162.00 ? 188 GLU G OE1 1 
ATOM   9909  O OE2 . GLU G  1 188 ? -64.016  -17.037 -64.837  1.00 141.27 ? 188 GLU G OE2 1 
ATOM   9910  N N   . VAL G  1 189 ? -61.900  -15.851 -62.660  1.00 117.31 ? 189 VAL G N   1 
ATOM   9911  C CA  . VAL G  1 189 ? -61.759  -15.979 -61.200  1.00 109.37 ? 189 VAL G CA  1 
ATOM   9912  C C   . VAL G  1 189 ? -62.151  -17.395 -60.800  1.00 107.86 ? 189 VAL G C   1 
ATOM   9913  O O   . VAL G  1 189 ? -63.275  -17.825 -61.079  1.00 111.78 ? 189 VAL G O   1 
ATOM   9914  C CB  . VAL G  1 189 ? -62.460  -14.857 -60.367  1.00 109.23 ? 189 VAL G CB  1 
ATOM   9915  C CG1 . VAL G  1 189 ? -62.891  -13.702 -61.245  1.00 116.37 ? 189 VAL G CG1 1 
ATOM   9916  C CG2 . VAL G  1 189 ? -63.631  -15.354 -59.548  1.00 108.65 ? 189 VAL G CG2 1 
ATOM   9917  N N   . MET G  1 190 ? -61.207  -18.133 -60.204  1.00 104.67 ? 190 MET G N   1 
ATOM   9918  C CA  . MET G  1 190 ? -61.405  -19.556 -59.877  1.00 105.49 ? 190 MET G CA  1 
ATOM   9919  C C   . MET G  1 190 ? -62.421  -19.726 -58.770  1.00 103.11 ? 190 MET G C   1 
ATOM   9920  O O   . MET G  1 190 ? -62.113  -19.491 -57.622  1.00 100.25 ? 190 MET G O   1 
ATOM   9921  C CB  . MET G  1 190 ? -60.105  -20.238 -59.451  1.00 105.46 ? 190 MET G CB  1 
ATOM   9922  C CG  . MET G  1 190 ? -58.897  -19.948 -60.318  1.00 108.69 ? 190 MET G CG  1 
ATOM   9923  S SD  . MET G  1 190 ? -57.752  -21.338 -60.447  1.00 115.74 ? 190 MET G SD  1 
ATOM   9924  C CE  . MET G  1 190 ? -57.076  -21.454 -58.807  1.00 113.25 ? 190 MET G CE  1 
ATOM   9925  N N   . VAL G  1 191 ? -63.632  -20.127 -59.126  1.00 106.85 ? 191 VAL G N   1 
ATOM   9926  C CA  . VAL G  1 191 ? -64.710  -20.344 -58.166  1.00 106.69 ? 191 VAL G CA  1 
ATOM   9927  C C   . VAL G  1 191 ? -64.397  -21.620 -57.370  1.00 106.66 ? 191 VAL G C   1 
ATOM   9928  O O   . VAL G  1 191 ? -63.810  -22.554 -57.910  1.00 109.81 ? 191 VAL G O   1 
ATOM   9929  C CB  . VAL G  1 191 ? -66.102  -20.376 -58.885  1.00 113.72 ? 191 VAL G CB  1 
ATOM   9930  C CG1 . VAL G  1 191 ? -66.274  -21.614 -59.763  1.00 121.47 ? 191 VAL G CG1 1 
ATOM   9931  C CG2 . VAL G  1 191 ? -67.261  -20.233 -57.898  1.00 114.82 ? 191 VAL G CG2 1 
ATOM   9932  N N   . PRO G  1 192 ? -64.728  -21.630 -56.064  1.00 105.45 ? 192 PRO G N   1 
ATOM   9933  C CA  . PRO G  1 192 ? -64.384  -22.767 -55.215  1.00 107.47 ? 192 PRO G CA  1 
ATOM   9934  C C   . PRO G  1 192 ? -64.926  -24.070 -55.767  1.00 113.13 ? 192 PRO G C   1 
ATOM   9935  O O   . PRO G  1 192 ? -66.089  -24.154 -56.167  1.00 116.62 ? 192 PRO G O   1 
ATOM   9936  C CB  . PRO G  1 192 ? -65.042  -22.430 -53.867  1.00 108.61 ? 192 PRO G CB  1 
ATOM   9937  C CG  . PRO G  1 192 ? -65.105  -20.953 -53.832  1.00 106.55 ? 192 PRO G CG  1 
ATOM   9938  C CD  . PRO G  1 192 ? -65.219  -20.487 -55.265  1.00 104.64 ? 192 PRO G CD  1 
ATOM   9939  N N   . GLU G  1 193 ? -64.068  -25.076 -55.782  1.00 116.62 ? 193 GLU G N   1 
ATOM   9940  C CA  . GLU G  1 193 ? -64.415  -26.387 -56.292  1.00 125.30 ? 193 GLU G CA  1 
ATOM   9941  C C   . GLU G  1 193 ? -65.028  -27.276 -55.200  1.00 129.76 ? 193 GLU G C   1 
ATOM   9942  O O   . GLU G  1 193 ? -66.233  -27.539 -55.196  1.00 133.52 ? 193 GLU G O   1 
ATOM   9943  C CB  . GLU G  1 193 ? -63.148  -27.014 -56.848  1.00 130.00 ? 193 GLU G CB  1 
ATOM   9944  C CG  . GLU G  1 193 ? -63.310  -28.380 -57.478  1.00 142.79 ? 193 GLU G CG  1 
ATOM   9945  C CD  . GLU G  1 193 ? -61.971  -28.936 -57.920  1.00 149.66 ? 193 GLU G CD  1 
ATOM   9946  O OE1 . GLU G  1 193 ? -61.946  -29.747 -58.871  1.00 162.23 ? 193 GLU G OE1 1 
ATOM   9947  O OE2 . GLU G  1 193 ? -60.936  -28.555 -57.326  1.00 145.08 ? 193 GLU G OE2 1 
ATOM   9948  N N   . ILE H  1 4   ? -43.377  31.600  -16.906  1.00 93.87  ? 4   ILE H N   1 
ATOM   9949  C CA  . ILE H  1 4   ? -43.094  32.201  -18.243  1.00 95.93  ? 4   ILE H CA  1 
ATOM   9950  C C   . ILE H  1 4   ? -43.375  33.717  -18.304  1.00 96.21  ? 4   ILE H C   1 
ATOM   9951  O O   . ILE H  1 4   ? -42.435  34.444  -18.521  1.00 97.67  ? 4   ILE H O   1 
ATOM   9952  C CB  . ILE H  1 4   ? -43.611  31.308  -19.442  1.00 97.14  ? 4   ILE H CB  1 
ATOM   9953  C CG1 . ILE H  1 4   ? -43.261  31.895  -20.831  1.00 99.43  ? 4   ILE H CG1 1 
ATOM   9954  C CG2 . ILE H  1 4   ? -45.093  30.917  -19.318  1.00 96.13  ? 4   ILE H CG2 1 
ATOM   9955  C CD1 . ILE H  1 4   ? -43.305  30.877  -21.969  1.00 101.40 ? 4   ILE H CD1 1 
ATOM   9956  N N   . PRO H  1 5   ? -44.624  34.204  -18.065  1.00 95.28  ? 5   PRO H N   1 
ATOM   9957  C CA  . PRO H  1 5   ? -44.857  35.638  -18.361  1.00 96.30  ? 5   PRO H CA  1 
ATOM   9958  C C   . PRO H  1 5   ? -44.419  36.622  -17.263  1.00 96.32  ? 5   PRO H C   1 
ATOM   9959  O O   . PRO H  1 5   ? -44.285  36.243  -16.105  1.00 95.04  ? 5   PRO H O   1 
ATOM   9960  C CB  . PRO H  1 5   ? -46.371  35.725  -18.589  1.00 96.01  ? 5   PRO H CB  1 
ATOM   9961  C CG  . PRO H  1 5   ? -46.948  34.507  -17.978  1.00 94.61  ? 5   PRO H CG  1 
ATOM   9962  C CD  . PRO H  1 5   ? -45.839  33.587  -17.518  1.00 93.90  ? 5   PRO H CD  1 
ATOM   9963  N N   . THR H  1 6   ? -44.213  37.876  -17.654  1.00 98.06  ? 6   THR H N   1 
ATOM   9964  C CA  . THR H  1 6   ? -43.646  38.969  -16.826  1.00 99.23  ? 6   THR H CA  1 
ATOM   9965  C C   . THR H  1 6   ? -44.674  40.038  -16.323  1.00 99.75  ? 6   THR H C   1 
ATOM   9966  O O   . THR H  1 6   ? -45.614  40.435  -17.041  1.00 100.26 ? 6   THR H O   1 
ATOM   9967  C CB  . THR H  1 6   ? -42.522  39.665  -17.635  1.00 101.84 ? 6   THR H CB  1 
ATOM   9968  O OG1 . THR H  1 6   ? -41.571  38.665  -18.009  1.00 101.90 ? 6   THR H OG1 1 
ATOM   9969  C CG2 . THR H  1 6   ? -41.835  40.803  -16.881  1.00 103.92 ? 6   THR H CG2 1 
ATOM   9970  N N   . VAL H  1 7   ? -44.485  40.516  -15.097  1.00 100.05 ? 7   VAL H N   1 
ATOM   9971  C CA  . VAL H  1 7   ? -45.353  41.561  -14.532  1.00 101.29 ? 7   VAL H CA  1 
ATOM   9972  C C   . VAL H  1 7   ? -44.541  42.797  -14.101  1.00 104.16 ? 7   VAL H C   1 
ATOM   9973  O O   . VAL H  1 7   ? -43.419  42.653  -13.600  1.00 104.58 ? 7   VAL H O   1 
ATOM   9974  C CB  . VAL H  1 7   ? -46.145  41.035  -13.327  1.00 99.67  ? 7   VAL H CB  1 
ATOM   9975  C CG1 . VAL H  1 7   ? -47.059  42.110  -12.784  1.00 101.62 ? 7   VAL H CG1 1 
ATOM   9976  C CG2 . VAL H  1 7   ? -46.938  39.800  -13.711  1.00 97.44  ? 7   VAL H CG2 1 
ATOM   9977  N N   . ILE H  1 8   ? -45.114  43.992  -14.299  1.00 106.56 ? 8   ILE H N   1 
ATOM   9978  C CA  . ILE H  1 8   ? -44.469  45.270  -13.930  1.00 110.10 ? 8   ILE H CA  1 
ATOM   9979  C C   . ILE H  1 8   ? -44.917  45.874  -12.607  1.00 111.54 ? 8   ILE H C   1 
ATOM   9980  O O   . ILE H  1 8   ? -46.079  45.708  -12.204  1.00 110.64 ? 8   ILE H O   1 
ATOM   9981  C CB  . ILE H  1 8   ? -44.745  46.368  -14.975  1.00 112.78 ? 8   ILE H CB  1 
ATOM   9982  C CG1 . ILE H  1 8   ? -46.206  46.283  -15.500  1.00 111.78 ? 8   ILE H CG1 1 
ATOM   9983  C CG2 . ILE H  1 8   ? -43.673  46.342  -16.060  1.00 113.58 ? 8   ILE H CG2 1 
ATOM   9984  C CD1 . ILE H  1 8   ? -47.161  47.323  -14.927  1.00 114.38 ? 8   ILE H CD1 1 
ATOM   9985  N N   . GLU H  1 9   ? -44.008  46.613  -11.966  1.00 114.40 ? 9   GLU H N   1 
ATOM   9986  C CA  . GLU H  1 9   ? -44.318  47.317  -10.717  1.00 116.71 ? 9   GLU H CA  1 
ATOM   9987  C C   . GLU H  1 9   ? -43.398  48.502  -10.468  1.00 121.44 ? 9   GLU H C   1 
ATOM   9988  O O   . GLU H  1 9   ? -43.824  49.649  -10.542  1.00 125.04 ? 9   GLU H O   1 
ATOM   9989  C CB  . GLU H  1 9   ? -44.234  46.351  -9.548   1.00 114.16 ? 9   GLU H CB  1 
ATOM   9990  C CG  . GLU H  1 9   ? -45.314  46.543  -8.503   1.00 114.65 ? 9   GLU H CG  1 
ATOM   9991  C CD  . GLU H  1 9   ? -45.988  45.240  -8.141   1.00 110.54 ? 9   GLU H CD  1 
ATOM   9992  O OE1 . GLU H  1 9   ? -45.748  44.766  -7.004   1.00 109.65 ? 9   GLU H OE1 1 
ATOM   9993  O OE2 . GLU H  1 9   ? -46.734  44.687  -8.996   1.00 108.49 ? 9   GLU H OE2 1 
ATOM   9994  N N   . ARG H  1 16  ? -40.201  47.872  -11.559  1.00 122.87 ? 16  ARG H N   1 
ATOM   9995  C CA  . ARG H  1 16  ? -39.446  46.616  -11.450  1.00 120.13 ? 16  ARG H CA  1 
ATOM   9996  C C   . ARG H  1 16  ? -40.184  45.407  -12.049  1.00 115.29 ? 16  ARG H C   1 
ATOM   9997  O O   . ARG H  1 16  ? -41.434  45.344  -12.018  1.00 113.35 ? 16  ARG H O   1 
ATOM   9998  C CB  . ARG H  1 16  ? -39.071  46.344  -9.994   1.00 120.19 ? 16  ARG H CB  1 
ATOM   9999  C CG  . ARG H  1 16  ? -38.216  47.442  -9.368   1.00 125.54 ? 16  ARG H CG  1 
ATOM   10000 C CD  . ARG H  1 16  ? -36.747  47.378  -9.798   1.00 128.27 ? 16  ARG H CD  1 
ATOM   10001 N NE  . ARG H  1 16  ? -35.877  48.362  -9.133   1.00 133.96 ? 16  ARG H NE  1 
ATOM   10002 C CZ  . ARG H  1 16  ? -34.546  48.390  -9.224   1.00 137.46 ? 16  ARG H CZ  1 
ATOM   10003 N NH1 . ARG H  1 16  ? -33.856  49.327  -8.587   1.00 143.12 ? 16  ARG H NH1 1 
ATOM   10004 N NH2 . ARG H  1 16  ? -33.896  47.488  -9.943   1.00 135.89 ? 16  ARG H NH2 1 
ATOM   10005 N N   . ALA H  1 17  ? -39.405  44.458  -12.582  1.00 113.96 ? 17  ALA H N   1 
ATOM   10006 C CA  . ALA H  1 17  ? -39.948  43.325  -13.359  1.00 110.32 ? 17  ALA H CA  1 
ATOM   10007 C C   . ALA H  1 17  ? -39.937  41.953  -12.626  1.00 106.97 ? 17  ALA H C   1 
ATOM   10008 O O   . ALA H  1 17  ? -38.933  41.548  -12.067  1.00 107.56 ? 17  ALA H O   1 
ATOM   10009 C CB  . ALA H  1 17  ? -39.259  43.242  -14.736  1.00 111.65 ? 17  ALA H CB  1 
ATOM   10010 N N   . TYR H  1 18  ? -41.062  41.245  -12.627  1.00 103.83 ? 18  TYR H N   1 
ATOM   10011 C CA  . TYR H  1 18  ? -41.094  39.897  -12.107  1.00 100.90 ? 18  TYR H CA  1 
ATOM   10012 C C   . TYR H  1 18  ? -41.529  38.907  -13.165  1.00 99.05  ? 18  TYR H C   1 
ATOM   10013 O O   . TYR H  1 18  ? -42.180  39.281  -14.130  1.00 99.44  ? 18  TYR H O   1 
ATOM   10014 C CB  . TYR H  1 18  ? -42.151  39.788  -11.026  1.00 99.13  ? 18  TYR H CB  1 
ATOM   10015 C CG  . TYR H  1 18  ? -42.008  40.710  -9.879   1.00 100.96 ? 18  TYR H CG  1 
ATOM   10016 C CD1 . TYR H  1 18  ? -41.223  40.367  -8.789   1.00 100.90 ? 18  TYR H CD1 1 
ATOM   10017 C CD2 . TYR H  1 18  ? -42.706  41.917  -9.854   1.00 103.07 ? 18  TYR H CD2 1 
ATOM   10018 C CE1 . TYR H  1 18  ? -41.100  41.221  -7.704   1.00 103.01 ? 18  TYR H CE1 1 
ATOM   10019 C CE2 . TYR H  1 18  ? -42.587  42.799  -8.787   1.00 105.43 ? 18  TYR H CE2 1 
ATOM   10020 C CZ  . TYR H  1 18  ? -41.788  42.455  -7.717   1.00 105.42 ? 18  TYR H CZ  1 
ATOM   10021 O OH  . TYR H  1 18  ? -41.716  43.368  -6.688   1.00 108.24 ? 18  TYR H OH  1 
ATOM   10022 N N   . ASP H  1 19  ? -41.232  37.631  -12.949  1.00 97.27  ? 19  ASP H N   1 
ATOM   10023 C CA  . ASP H  1 19  ? -42.010  36.562  -13.582  1.00 95.34  ? 19  ASP H CA  1 
ATOM   10024 C C   . ASP H  1 19  ? -43.238  36.274  -12.719  1.00 93.29  ? 19  ASP H C   1 
ATOM   10025 O O   . ASP H  1 19  ? -43.227  36.556  -11.522  1.00 92.96  ? 19  ASP H O   1 
ATOM   10026 C CB  . ASP H  1 19  ? -41.169  35.306  -13.745  1.00 94.96  ? 19  ASP H CB  1 
ATOM   10027 C CG  . ASP H  1 19  ? -40.842  34.643  -12.419  1.00 93.56  ? 19  ASP H CG  1 
ATOM   10028 O OD1 . ASP H  1 19  ? -41.666  33.855  -11.931  1.00 91.45  ? 19  ASP H OD1 1 
ATOM   10029 O OD2 . ASP H  1 19  ? -39.752  34.893  -11.868  1.00 94.86  ? 19  ASP H OD2 1 
ATOM   10030 N N   . ILE H  1 20  ? -44.279  35.699  -13.312  1.00 92.34  ? 20  ILE H N   1 
ATOM   10031 C CA  . ILE H  1 20  ? -45.554  35.549  -12.626  1.00 91.21  ? 20  ILE H CA  1 
ATOM   10032 C C   . ILE H  1 20  ? -45.432  34.903  -11.237  1.00 89.66  ? 20  ILE H C   1 
ATOM   10033 O O   . ILE H  1 20  ? -46.078  35.334  -10.295  1.00 89.55  ? 20  ILE H O   1 
ATOM   10034 C CB  . ILE H  1 20  ? -46.620  34.899  -13.533  1.00 91.01  ? 20  ILE H CB  1 
ATOM   10035 C CG1 . ILE H  1 20  ? -48.012  35.079  -12.950  1.00 90.94  ? 20  ILE H CG1 1 
ATOM   10036 C CG2 . ILE H  1 20  ? -46.332  33.431  -13.774  1.00 90.07  ? 20  ILE H CG2 1 
ATOM   10037 C CD1 . ILE H  1 20  ? -48.565  36.452  -13.177  1.00 92.69  ? 20  ILE H CD1 1 
ATOM   10038 N N   . TYR H  1 21  ? -44.574  33.897  -11.097  1.00 88.79  ? 21  TYR H N   1 
ATOM   10039 C CA  . TYR H  1 21  ? -44.431  33.175  -9.818   1.00 87.28  ? 21  TYR H CA  1 
ATOM   10040 C C   . TYR H  1 21  ? -43.825  34.042  -8.720   1.00 87.81  ? 21  TYR H C   1 
ATOM   10041 O O   . TYR H  1 21  ? -44.199  33.945  -7.565   1.00 86.93  ? 21  TYR H O   1 
ATOM   10042 C CB  . TYR H  1 21  ? -43.637  31.871  -9.991   1.00 86.66  ? 21  TYR H CB  1 
ATOM   10043 C CG  . TYR H  1 21  ? -44.208  30.965  -11.052  1.00 86.74  ? 21  TYR H CG  1 
ATOM   10044 C CD1 . TYR H  1 21  ? -45.442  30.362  -10.880  1.00 85.96  ? 21  TYR H CD1 1 
ATOM   10045 C CD2 . TYR H  1 21  ? -43.529  30.728  -12.238  1.00 88.14  ? 21  TYR H CD2 1 
ATOM   10046 C CE1 . TYR H  1 21  ? -45.974  29.541  -11.858  1.00 86.64  ? 21  TYR H CE1 1 
ATOM   10047 C CE2 . TYR H  1 21  ? -44.063  29.920  -13.214  1.00 88.69  ? 21  TYR H CE2 1 
ATOM   10048 C CZ  . TYR H  1 21  ? -45.278  29.336  -13.013  1.00 87.97  ? 21  TYR H CZ  1 
ATOM   10049 O OH  . TYR H  1 21  ? -45.801  28.553  -13.984  1.00 89.08  ? 21  TYR H OH  1 
ATOM   10050 N N   . SER H  1 22  ? -42.897  34.904  -9.106   1.00 89.66  ? 22  SER H N   1 
ATOM   10051 C CA  . SER H  1 22  ? -42.250  35.838  -8.205   1.00 91.09  ? 22  SER H CA  1 
ATOM   10052 C C   . SER H  1 22  ? -43.208  36.889  -7.726   1.00 91.93  ? 22  SER H C   1 
ATOM   10053 O O   . SER H  1 22  ? -43.167  37.302  -6.579   1.00 92.45  ? 22  SER H O   1 
ATOM   10054 C CB  . SER H  1 22  ? -41.131  36.523  -8.938   1.00 93.58  ? 22  SER H CB  1 
ATOM   10055 O OG  . SER H  1 22  ? -40.286  35.538  -9.446   1.00 93.34  ? 22  SER H OG  1 
ATOM   10056 N N   . ARG H  1 23  ? -44.059  37.334  -8.635   1.00 92.47  ? 23  ARG H N   1 
ATOM   10057 C CA  . ARG H  1 23  ? -45.088  38.299  -8.322   1.00 93.73  ? 23  ARG H CA  1 
ATOM   10058 C C   . ARG H  1 23  ? -46.016  37.712  -7.275   1.00 92.32  ? 23  ARG H C   1 
ATOM   10059 O O   . ARG H  1 23  ? -46.388  38.405  -6.342   1.00 93.61  ? 23  ARG H O   1 
ATOM   10060 C CB  . ARG H  1 23  ? -45.840  38.707  -9.588   1.00 94.54  ? 23  ARG H CB  1 
ATOM   10061 C CG  . ARG H  1 23  ? -47.023  39.612  -9.357   1.00 96.17  ? 23  ARG H CG  1 
ATOM   10062 C CD  . ARG H  1 23  ? -46.610  40.908  -8.675   1.00 98.92  ? 23  ARG H CD  1 
ATOM   10063 N NE  . ARG H  1 23  ? -47.760  41.686  -8.200   1.00 100.88 ? 23  ARG H NE  1 
ATOM   10064 C CZ  . ARG H  1 23  ? -48.451  41.416  -7.095   1.00 100.67 ? 23  ARG H CZ  1 
ATOM   10065 N NH1 . ARG H  1 23  ? -48.139  40.382  -6.320   1.00 98.26  ? 23  ARG H NH1 1 
ATOM   10066 N NH2 . ARG H  1 23  ? -49.470  42.187  -6.768   1.00 103.19 ? 23  ARG H NH2 1 
ATOM   10067 N N   . LEU H  1 24  ? -46.366  36.435  -7.414   1.00 90.10  ? 24  LEU H N   1 
ATOM   10068 C CA  . LEU H  1 24  ? -47.205  35.782  -6.451   1.00 88.96  ? 24  LEU H CA  1 
ATOM   10069 C C   . LEU H  1 24  ? -46.458  35.506  -5.153   1.00 88.17  ? 24  LEU H C   1 
ATOM   10070 O O   . LEU H  1 24  ? -47.034  35.456  -4.090   1.00 88.08  ? 24  LEU H O   1 
ATOM   10071 C CB  . LEU H  1 24  ? -47.758  34.502  -7.045   1.00 87.40  ? 24  LEU H CB  1 
ATOM   10072 C CG  . LEU H  1 24  ? -49.202  34.436  -7.514   1.00 88.20  ? 24  LEU H CG  1 
ATOM   10073 C CD1 . LEU H  1 24  ? -49.579  35.636  -8.340   1.00 90.27  ? 24  LEU H CD1 1 
ATOM   10074 C CD2 . LEU H  1 24  ? -49.390  33.171  -8.324   1.00 87.22  ? 24  LEU H CD2 1 
ATOM   10075 N N   . LEU H  1 25  ? -45.161  35.318  -5.230   1.00 87.89  ? 25  LEU H N   1 
ATOM   10076 C CA  . LEU H  1 25  ? -44.392  35.088  -4.035   1.00 87.47  ? 25  LEU H CA  1 
ATOM   10077 C C   . LEU H  1 25  ? -44.423  36.319  -3.150   1.00 89.67  ? 25  LEU H C   1 
ATOM   10078 O O   . LEU H  1 25  ? -44.385  36.222  -1.934   1.00 89.53  ? 25  LEU H O   1 
ATOM   10079 C CB  . LEU H  1 25  ? -42.960  34.733  -4.392   1.00 87.56  ? 25  LEU H CB  1 
ATOM   10080 C CG  . LEU H  1 25  ? -42.018  34.379  -3.245   1.00 87.34  ? 25  LEU H CG  1 
ATOM   10081 C CD1 . LEU H  1 25  ? -42.546  33.211  -2.421   1.00 84.88  ? 25  LEU H CD1 1 
ATOM   10082 C CD2 . LEU H  1 25  ? -40.620  34.096  -3.758   1.00 88.26  ? 25  LEU H CD2 1 
ATOM   10083 N N   . LYS H  1 26  ? -44.504  37.482  -3.772   1.00 92.02  ? 26  LYS H N   1 
ATOM   10084 C CA  . LYS H  1 26  ? -44.634  38.747  -3.064   1.00 94.92  ? 26  LYS H CA  1 
ATOM   10085 C C   . LYS H  1 26  ? -45.849  38.742  -2.159   1.00 94.97  ? 26  LYS H C   1 
ATOM   10086 O O   . LYS H  1 26  ? -45.843  39.400  -1.143   1.00 96.98  ? 26  LYS H O   1 
ATOM   10087 C CB  . LYS H  1 26  ? -44.757  39.879  -4.071   1.00 97.43  ? 26  LYS H CB  1 
ATOM   10088 C CG  . LYS H  1 26  ? -44.165  41.199  -3.642   1.00 101.21 ? 26  LYS H CG  1 
ATOM   10089 C CD  . LYS H  1 26  ? -44.399  42.212  -4.742   1.00 103.54 ? 26  LYS H CD  1 
ATOM   10090 C CE  . LYS H  1 26  ? -43.911  43.597  -4.353   1.00 108.02 ? 26  LYS H CE  1 
ATOM   10091 N NZ  . LYS H  1 26  ? -44.790  44.231  -3.343   1.00 110.19 ? 26  LYS H NZ  1 
ATOM   10092 N N   . ASP H  1 27  ? -46.889  38.002  -2.537   1.00 93.25  ? 27  ASP H N   1 
ATOM   10093 C CA  . ASP H  1 27  ? -48.112  37.843  -1.733   1.00 93.55  ? 27  ASP H CA  1 
ATOM   10094 C C   . ASP H  1 27  ? -48.112  36.582  -0.892   1.00 91.00  ? 27  ASP H C   1 
ATOM   10095 O O   . ASP H  1 27  ? -49.162  36.116  -0.480   1.00 90.82  ? 27  ASP H O   1 
ATOM   10096 C CB  . ASP H  1 27  ? -49.353  37.805  -2.613   1.00 93.99  ? 27  ASP H CB  1 
ATOM   10097 C CG  . ASP H  1 27  ? -49.599  39.103  -3.341   1.00 96.89  ? 27  ASP H CG  1 
ATOM   10098 O OD1 . ASP H  1 27  ? -50.568  39.146  -4.125   1.00 97.56  ? 27  ASP H OD1 1 
ATOM   10099 O OD2 . ASP H  1 27  ? -48.844  40.088  -3.147   1.00 98.84  ? 27  ASP H OD2 1 
ATOM   10100 N N   . ARG H  1 28  ? -46.928  36.040  -0.648   1.00 89.40  ? 28  ARG H N   1 
ATOM   10101 C CA  . ARG H  1 28  ? -46.750  34.854  0.187    1.00 87.08  ? 28  ARG H CA  1 
ATOM   10102 C C   . ARG H  1 28  ? -47.373  33.574  -0.409   1.00 84.92  ? 28  ARG H C   1 
ATOM   10103 O O   . ARG H  1 28  ? -47.677  32.629  0.300    1.00 83.53  ? 28  ARG H O   1 
ATOM   10104 C CB  . ARG H  1 28  ? -47.223  35.125  1.622    1.00 88.13  ? 28  ARG H CB  1 
ATOM   10105 C CG  . ARG H  1 28  ? -46.556  36.33