data_3VOQ
# 
_entry.id   3VOQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3VOQ         
RCSB  RCSB095310   
WWPDB D_1000095310 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3ULB 'Structure of a yeast homologue in an orthorhombic crystal form' unspecified 
PDB 3ULC 'Structure of a yeast homologue in a trigonal crystal form'      unspecified 
# 
_pdbx_database_status.entry_id                        3VOQ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, D.'      1 
'Matsuura, Y.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structures of the pleckstrin homology domain of Saccharomyces cerevisiae Avo1 and its human orthologue Sin1, an essential subunit of TOR complex 2
;
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            68 
_citation.page_first                386 
_citation.page_last                 392 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22505404 
_citation.pdbx_database_id_DOI      10.1107/S1744309112007178 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, D.'      1 
primary 'Matsuura, Y.' 2 
# 
_cell.length_a           79.293 
_cell.length_b           79.293 
_cell.length_c           123.599 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3VOQ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         3VOQ 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                96 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Target of rapamycin complex 2 subunit MAPKAP1' 14114.072 2   ? ? 'C-terminal PH domain, UNP residues 372-493' ? 
2 water   nat water                                           18.015    125 ? ? ?                                            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;TORC2 subunit MAPKAP1, Mitogen-activated protein kinase 2-associated protein 1, Stress-activated map kinase-interacting protein 1, SAPK-interacting protein 1, mSIN1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSP
SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSP
SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   THR n 
1 6   VAL n 
1 7   GLN n 
1 8   ASP n 
1 9   MET n 
1 10  LEU n 
1 11  SER n 
1 12  SER n 
1 13  HIS n 
1 14  HIS n 
1 15  TYR n 
1 16  LYS n 
1 17  SER n 
1 18  PHE n 
1 19  LYS n 
1 20  VAL n 
1 21  SER n 
1 22  MET n 
1 23  ILE n 
1 24  HIS n 
1 25  ARG n 
1 26  LEU n 
1 27  ARG n 
1 28  PHE n 
1 29  THR n 
1 30  THR n 
1 31  ASP n 
1 32  VAL n 
1 33  GLN n 
1 34  LEU n 
1 35  GLY n 
1 36  ILE n 
1 37  SER n 
1 38  GLY n 
1 39  ASP n 
1 40  LYS n 
1 41  VAL n 
1 42  GLU n 
1 43  ILE n 
1 44  ASP n 
1 45  PRO n 
1 46  VAL n 
1 47  THR n 
1 48  ASN n 
1 49  GLN n 
1 50  LYS n 
1 51  ALA n 
1 52  SER n 
1 53  THR n 
1 54  LYS n 
1 55  PHE n 
1 56  TRP n 
1 57  ILE n 
1 58  LYS n 
1 59  GLN n 
1 60  LYS n 
1 61  PRO n 
1 62  ILE n 
1 63  SER n 
1 64  ILE n 
1 65  ASP n 
1 66  SER n 
1 67  ASP n 
1 68  LEU n 
1 69  LEU n 
1 70  CYS n 
1 71  ALA n 
1 72  CYS n 
1 73  ASP n 
1 74  LEU n 
1 75  ALA n 
1 76  GLU n 
1 77  GLU n 
1 78  LYS n 
1 79  SER n 
1 80  PRO n 
1 81  SER n 
1 82  HIS n 
1 83  ALA n 
1 84  ILE n 
1 85  PHE n 
1 86  LYS n 
1 87  LEU n 
1 88  THR n 
1 89  TYR n 
1 90  LEU n 
1 91  SER n 
1 92  ASN n 
1 93  HIS n 
1 94  ASP n 
1 95  TYR n 
1 96  LYS n 
1 97  HIS n 
1 98  LEU n 
1 99  TYR n 
1 100 PHE n 
1 101 GLU n 
1 102 SER n 
1 103 ASP n 
1 104 ALA n 
1 105 ALA n 
1 106 THR n 
1 107 VAL n 
1 108 ASN n 
1 109 GLU n 
1 110 ILE n 
1 111 VAL n 
1 112 LEU n 
1 113 LYS n 
1 114 VAL n 
1 115 ASN n 
1 116 TYR n 
1 117 ILE n 
1 118 LEU n 
1 119 GLU n 
1 120 SER n 
1 121 ARG n 
1 122 ALA n 
1 123 SER n 
1 124 THR n 
1 125 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SIN1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus(DE3)RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET30a-TEV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SIN1_HUMAN 
_struct_ref.pdbx_db_accession          Q9BPZ7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHA
IFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTA
;
_struct_ref.pdbx_align_begin           372 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3VOQ A 4 ? 125 ? Q9BPZ7 372 ? 493 ? 372 493 
2 1 3VOQ B 4 ? 125 ? Q9BPZ7 372 ? 493 ? 372 493 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3VOQ GLY A 1 ? UNP Q9BPZ7 ? ? 'EXPRESSION TAG' 369 1 
1 3VOQ ALA A 2 ? UNP Q9BPZ7 ? ? 'EXPRESSION TAG' 370 2 
1 3VOQ MET A 3 ? UNP Q9BPZ7 ? ? 'EXPRESSION TAG' 371 3 
2 3VOQ GLY B 1 ? UNP Q9BPZ7 ? ? 'EXPRESSION TAG' 369 4 
2 3VOQ ALA B 2 ? UNP Q9BPZ7 ? ? 'EXPRESSION TAG' 370 5 
2 3VOQ MET B 3 ? UNP Q9BPZ7 ? ? 'EXPRESSION TAG' 371 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3VOQ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.44 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   64.26 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.1M Bis-Tris, 1.26M ammonium sulfate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2010-02-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
# 
_reflns.entry_id                     3VOQ 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.00 
_reflns.d_resolution_low             41.53 
_reflns.number_all                   27409 
_reflns.number_obs                   27409 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.105 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.00 
_reflns_shell.d_res_low                   2.11 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.Rmerge_I_obs                0.911 
_reflns_shell.meanI_over_sigI_obs         2.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_redundancy             8.4 
_reflns_shell.number_unique_all           3907 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3VOQ 
_refine.ls_d_res_high                            2.0000 
_refine.ls_d_res_low                             41.53 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.9500 
_refine.ls_number_reflns_obs                     27346 
_refine.ls_number_reflns_all                     27409 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          0.1950 
_refine.ls_R_factor_obs                          0.1950 
_refine.ls_R_factor_R_work                       0.1934 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2239 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  1370 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               34.6473 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.4200 
_refine.aniso_B[2][2]                            -0.4200 
_refine.aniso_B[3][3]                            0.8500 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9540 
_refine.correlation_coeff_Fo_to_Fc_free          0.9440 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1280 
_refine.pdbx_overall_ESU_R_Free                  0.1240 
_refine.overall_SU_ML                            0.0840 
_refine.overall_SU_B                             2.9810 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 3ULB' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                100.290 
_refine.B_iso_min                                14.680 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1805 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             125 
_refine_hist.number_atoms_total               1930 
_refine_hist.d_res_high                       2.0000 
_refine_hist.d_res_low                        41.53 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       1840 0.027  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2488 2.461  1.952  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 225  6.793  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 80   40.354 24.500 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 324  17.636 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 6    23.928 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         290  0.199  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1347 0.013  0.021  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0000 
_refine_ls_shell.d_res_low                        2.0520 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.9400 
_refine_ls_shell.number_reflns_R_work             1707 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2820 
_refine_ls_shell.R_factor_R_free                  0.3040 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             82 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1789 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3VOQ 
_struct.title                     'Crystal structure of the pleckstrin homology domain of human Sin1, a TORC2 subunit' 
_struct.pdbx_descriptor           'Target of rapamycin complex 2 subunit MAPKAP1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3VOQ 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'PH domain, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 1   ? SER A 11  ? GLY A 369 SER A 379 1 ? 11 
HELX_P HELX_P2 2 ASP A 103 ? SER A 120 ? ASP A 471 SER A 488 1 ? 18 
HELX_P HELX_P3 3 ALA B 2   ? HIS B 14  ? ALA B 370 HIS B 382 1 ? 13 
HELX_P HELX_P4 4 ASP B 103 ? SER B 120 ? ASP B 471 SER B 488 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 62 ? ASP A 65  ? ILE A 430 ASP A 433 
A 2 LYS A 40 ? PRO A 45  ? LYS A 408 PRO A 413 
A 3 PHE A 28 ? ILE A 36  ? PHE A 396 ILE A 404 
A 4 LYS A 16 ? HIS A 24  ? LYS A 384 HIS A 392 
A 5 ASP A 94 ? SER A 102 ? ASP A 462 SER A 470 
A 6 ALA A 83 ? SER A 91  ? ALA A 451 SER A 459 
A 7 LEU A 69 ? GLU A 77  ? LEU A 437 GLU A 445 
B 1 ILE B 62 ? ASP B 65  ? ILE B 430 ASP B 433 
B 2 LYS B 40 ? PRO B 45  ? LYS B 408 PRO B 413 
B 3 PHE B 28 ? ILE B 36  ? PHE B 396 ILE B 404 
B 4 LYS B 16 ? ARG B 25  ? LYS B 384 ARG B 393 
B 5 ASP B 94 ? SER B 102 ? ASP B 462 SER B 470 
B 6 HIS B 82 ? SER B 91  ? HIS B 450 SER B 459 
B 7 LEU B 69 ? SER B 79  ? LEU B 437 SER B 447 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 64 ? O ILE A 432 N VAL A 41  ? N VAL A 409 
A 2 3 O ASP A 44 ? O ASP A 412 N GLN A 33  ? N GLN A 401 
A 3 4 O PHE A 28 ? O PHE A 396 N HIS A 24  ? N HIS A 392 
A 4 5 N SER A 21 ? N SER A 389 O GLU A 101 ? O GLU A 469 
A 5 6 O LYS A 96 ? O LYS A 464 N TYR A 89  ? N TYR A 457 
A 6 7 O ILE A 84 ? O ILE A 452 N ALA A 75  ? N ALA A 443 
B 1 2 O ILE B 64 ? O ILE B 432 N VAL B 41  ? N VAL B 409 
B 2 3 O ASP B 44 ? O ASP B 412 N GLN B 33  ? N GLN B 401 
B 3 4 O PHE B 28 ? O PHE B 396 N ARG B 25  ? N ARG B 393 
B 4 5 N SER B 21 ? N SER B 389 O GLU B 101 ? O GLU B 469 
B 5 6 O LEU B 98 ? O LEU B 466 N LEU B 87  ? N LEU B 455 
B 6 7 O ILE B 84 ? O ILE B 452 N ALA B 75  ? N ALA B 443 
# 
_atom_sites.entry_id                    3VOQ 
_atom_sites.fract_transf_matrix[1][1]   0.012611 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012611 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008091 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? -9.800  -5.917  -7.929  1.00 37.42  ? 369 GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? -10.938 -5.593  -7.082  1.00 30.53  ? 369 GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? -11.239 -6.807  -6.233  1.00 33.48  ? 369 GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? -10.323 -7.661  -5.976  1.00 30.46  ? 369 GLY A O   1 
ATOM   5    N N   . ALA A 1 2   ? -12.483 -6.888  -5.755  1.00 28.46  ? 370 ALA A N   1 
ATOM   6    C CA  . ALA A 1 2   ? -12.810 -7.920  -4.750  1.00 28.98  ? 370 ALA A CA  1 
ATOM   7    C C   . ALA A 1 2   ? -12.509 -9.334  -5.321  1.00 28.17  ? 370 ALA A C   1 
ATOM   8    O O   . ALA A 1 2   ? -11.921 -10.182 -4.616  1.00 23.92  ? 370 ALA A O   1 
ATOM   9    C CB  . ALA A 1 2   ? -14.248 -7.837  -4.244  1.00 27.15  ? 370 ALA A CB  1 
ATOM   10   N N   . MET A 1 3   ? -12.867 -9.593  -6.566  1.00 27.98  ? 371 MET A N   1 
ATOM   11   C CA  . MET A 1 3   ? -12.827 -11.019 -7.028  1.00 28.02  ? 371 MET A CA  1 
ATOM   12   C C   . MET A 1 3   ? -11.368 -11.434 -7.300  1.00 29.80  ? 371 MET A C   1 
ATOM   13   O O   . MET A 1 3   ? -10.996 -12.575 -7.079  1.00 27.59  ? 371 MET A O   1 
ATOM   14   C CB  . MET A 1 3   ? -13.781 -11.274 -8.229  1.00 32.62  ? 371 MET A CB  1 
ATOM   15   C CG  . MET A 1 3   ? -15.321 -11.231 -7.856  1.00 29.44  ? 371 MET A CG  1 
ATOM   16   S SD  . MET A 1 3   ? -15.795 -12.109 -6.244  1.00 35.75  ? 371 MET A SD  1 
ATOM   17   C CE  . MET A 1 3   ? -15.318 -13.858 -6.561  1.00 35.84  ? 371 MET A CE  1 
ATOM   18   N N   . ALA A 1 4   ? -10.533 -10.508 -7.758  1.00 26.58  ? 372 ALA A N   1 
ATOM   19   C CA  . ALA A 1 4   ? -9.081  -10.811 -7.885  1.00 27.98  ? 372 ALA A CA  1 
ATOM   20   C C   . ALA A 1 4   ? -8.455  -11.060 -6.531  1.00 26.09  ? 372 ALA A C   1 
ATOM   21   O O   . ALA A 1 4   ? -7.568  -11.898 -6.419  1.00 23.95  ? 372 ALA A O   1 
ATOM   22   C CB  . ALA A 1 4   ? -8.310  -9.630  -8.571  1.00 27.27  ? 372 ALA A CB  1 
ATOM   23   N N   . THR A 1 5   ? -8.905  -10.333 -5.488  1.00 21.94  ? 373 THR A N   1 
ATOM   24   C CA  . THR A 1 5   ? -8.430  -10.481 -4.128  1.00 20.78  ? 373 THR A CA  1 
ATOM   25   C C   . THR A 1 5   ? -8.888  -11.817 -3.603  1.00 22.05  ? 373 THR A C   1 
ATOM   26   O O   . THR A 1 5   ? -8.070  -12.544 -3.003  1.00 21.53  ? 373 THR A O   1 
ATOM   27   C CB  . THR A 1 5   ? -8.974  -9.358  -3.218  1.00 24.34  ? 373 THR A CB  1 
ATOM   28   O OG1 . THR A 1 5   ? -8.396  -8.126  -3.639  1.00 25.66  ? 373 THR A OG1 1 
ATOM   29   C CG2 . THR A 1 5   ? -8.598  -9.540  -1.805  1.00 25.49  ? 373 THR A CG2 1 
ATOM   30   N N   . VAL A 1 6   ? -10.133 -12.213 -3.905  1.00 21.07  ? 374 VAL A N   1 
ATOM   31   C CA  . VAL A 1 6   ? -10.565 -13.573 -3.499  1.00 22.35  ? 374 VAL A CA  1 
ATOM   32   C C   . VAL A 1 6   ? -9.766  -14.671 -4.283  1.00 20.86  ? 374 VAL A C   1 
ATOM   33   O O   . VAL A 1 6   ? -9.365  -15.650 -3.707  1.00 19.65  ? 374 VAL A O   1 
ATOM   34   C CB  . VAL A 1 6   ? -12.063 -13.773 -3.846  1.00 22.15  ? 374 VAL A CB  1 
ATOM   35   C CG1 . VAL A 1 6   ? -12.502 -15.247 -3.642  1.00 17.26  ? 374 VAL A CG1 1 
ATOM   36   C CG2 . VAL A 1 6   ? -12.882 -12.826 -2.898  1.00 19.69  ? 374 VAL A CG2 1 
ATOM   37   N N   . GLN A 1 7   ? -9.514  -14.467 -5.574  1.00 22.81  ? 375 GLN A N   1 
ATOM   38   C CA  . GLN A 1 7   ? -8.660  -15.429 -6.331  1.00 22.67  ? 375 GLN A CA  1 
ATOM   39   C C   . GLN A 1 7   ? -7.286  -15.567 -5.657  1.00 22.33  ? 375 GLN A C   1 
ATOM   40   O O   . GLN A 1 7   ? -6.747  -16.672 -5.506  1.00 20.60  ? 375 GLN A O   1 
ATOM   41   C CB  . GLN A 1 7   ? -8.399  -15.018 -7.838  1.00 25.13  ? 375 GLN A CB  1 
ATOM   42   C CG  . GLN A 1 7   ? -7.593  -16.141 -8.591  1.00 25.63  ? 375 GLN A CG  1 
ATOM   43   C CD  . GLN A 1 7   ? -8.365  -17.503 -8.586  1.00 33.13  ? 375 GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 7   ? -9.410  -17.566 -9.186  1.00 32.50  ? 375 GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 7   ? -7.911  -18.561 -7.826  1.00 29.11  ? 375 GLN A NE2 1 
ATOM   46   N N   . ASP A 1 8   ? -6.707  -14.455 -5.250  1.00 23.23  ? 376 ASP A N   1 
ATOM   47   C CA  . ASP A 1 8   ? -5.402  -14.531 -4.562  1.00 23.49  ? 376 ASP A CA  1 
ATOM   48   C C   . ASP A 1 8   ? -5.485  -15.304 -3.203  1.00 22.01  ? 376 ASP A C   1 
ATOM   49   O O   . ASP A 1 8   ? -4.500  -15.886 -2.794  1.00 23.75  ? 376 ASP A O   1 
ATOM   50   C CB  . ASP A 1 8   ? -4.969  -13.162 -4.098  1.00 30.34  ? 376 ASP A CB  1 
ATOM   51   C CG  . ASP A 1 8   ? -4.068  -12.529 -5.002  1.00 51.50  ? 376 ASP A CG  1 
ATOM   52   O OD1 . ASP A 1 8   ? -3.078  -12.015 -4.454  1.00 82.63  ? 376 ASP A OD1 1 
ATOM   53   O OD2 . ASP A 1 8   ? -4.305  -12.549 -6.225  1.00 41.18  ? 376 ASP A OD2 1 
ATOM   54   N N   . MET A 1 9   ? -6.565  -15.133 -2.460  1.00 17.75  ? 377 MET A N   1 
ATOM   55   C CA  . MET A 1 9   ? -6.739  -15.933 -1.232  1.00 19.77  ? 377 MET A CA  1 
ATOM   56   C C   . MET A 1 9   ? -6.853  -17.407 -1.606  1.00 17.61  ? 377 MET A C   1 
ATOM   57   O O   . MET A 1 9   ? -6.285  -18.271 -0.967  1.00 21.49  ? 377 MET A O   1 
ATOM   58   C CB  . MET A 1 9   ? -8.022  -15.429 -0.471  1.00 18.79  ? 377 MET A CB  1 
ATOM   59   C CG  . MET A 1 9   ? -7.825  -13.997 0.090   1.00 20.87  ? 377 MET A CG  1 
ATOM   60   S SD  . MET A 1 9   ? -9.448  -13.630 0.841   1.00 28.56  ? 377 MET A SD  1 
ATOM   61   C CE  . MET A 1 9   ? -9.171  -11.878 1.022   1.00 36.44  ? 377 MET A CE  1 
ATOM   62   N N   . LEU A 1 10  ? -7.665  -17.717 -2.604  1.00 18.36  ? 378 LEU A N   1 
ATOM   63   C CA  . LEU A 1 10  ? -7.849  -19.126 -2.979  1.00 18.93  ? 378 LEU A CA  1 
ATOM   64   C C   . LEU A 1 10  ? -6.553  -19.837 -3.372  1.00 18.61  ? 378 LEU A C   1 
ATOM   65   O O   . LEU A 1 10  ? -6.357  -21.055 -3.085  1.00 19.79  ? 378 LEU A O   1 
ATOM   66   C CB  . LEU A 1 10  ? -8.859  -19.242 -4.148  1.00 17.30  ? 378 LEU A CB  1 
ATOM   67   C CG  . LEU A 1 10  ? -10.330 -19.081 -3.658  1.00 17.15  ? 378 LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 10  ? -11.291 -18.710 -4.868  1.00 17.57  ? 378 LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 10  ? -10.884 -20.322 -2.908  1.00 17.07  ? 378 LEU A CD2 1 
ATOM   70   N N   . SER A 1 11  ? -5.660  -19.088 -4.035  1.00 18.07  ? 379 SER A N   1 
ATOM   71   C CA  . SER A 1 11  ? -4.422  -19.612 -4.626  1.00 18.40  ? 379 SER A CA  1 
ATOM   72   C C   . SER A 1 11  ? -3.271  -19.369 -3.620  1.00 17.00  ? 379 SER A C   1 
ATOM   73   O O   . SER A 1 11  ? -2.137  -19.584 -3.955  1.00 19.33  ? 379 SER A O   1 
ATOM   74   C CB  . SER A 1 11  ? -4.095  -18.795 -5.931  1.00 21.14  ? 379 SER A CB  1 
ATOM   75   O OG  . SER A 1 11  ? -5.054  -19.311 -6.868  1.00 26.91  ? 379 SER A OG  1 
ATOM   76   N N   . SER A 1 12  ? -3.558  -18.946 -2.408  1.00 18.31  ? 380 SER A N   1 
ATOM   77   C CA  . SER A 1 12  ? -2.470  -18.513 -1.508  1.00 17.19  ? 380 SER A CA  1 
ATOM   78   C C   . SER A 1 12  ? -1.520  -19.603 -1.084  1.00 22.65  ? 380 SER A C   1 
ATOM   79   O O   . SER A 1 12  ? -0.335  -19.334 -0.784  1.00 19.50  ? 380 SER A O   1 
ATOM   80   C CB  . SER A 1 12  ? -3.027  -17.817 -0.312  1.00 14.68  ? 380 SER A CB  1 
ATOM   81   O OG  . SER A 1 12  ? -3.916  -18.582 0.542   1.00 21.86  ? 380 SER A OG  1 
ATOM   82   N N   . HIS A 1 13  ? -2.039  -20.843 -1.017  1.00 20.30  ? 381 HIS A N   1 
ATOM   83   C CA  . HIS A 1 13  ? -1.223  -21.929 -0.646  1.00 19.17  ? 381 HIS A CA  1 
ATOM   84   C C   . HIS A 1 13  ? -0.581  -22.625 -1.821  1.00 17.53  ? 381 HIS A C   1 
ATOM   85   O O   . HIS A 1 13  ? 0.233   -23.548 -1.617  1.00 18.91  ? 381 HIS A O   1 
ATOM   86   C CB  . HIS A 1 13  ? -2.017  -22.955 0.239   1.00 17.06  ? 381 HIS A CB  1 
ATOM   87   C CG  . HIS A 1 13  ? -2.375  -22.443 1.590   1.00 17.18  ? 381 HIS A CG  1 
ATOM   88   N ND1 . HIS A 1 13  ? -2.988  -21.295 1.784   1.00 18.34  ? 381 HIS A ND1 1 
ATOM   89   C CD2 . HIS A 1 13  ? -2.315  -23.058 2.815   1.00 16.74  ? 381 HIS A CD2 1 
ATOM   90   C CE1 . HIS A 1 13  ? -3.218  -21.132 3.041   1.00 16.00  ? 381 HIS A CE1 1 
ATOM   91   N NE2 . HIS A 1 13  ? -2.819  -22.206 3.676   1.00 19.67  ? 381 HIS A NE2 1 
ATOM   92   N N   . HIS A 1 14  ? -0.838  -22.206 -3.047  1.00 17.82  ? 382 HIS A N   1 
ATOM   93   C CA  . HIS A 1 14  ? -0.270  -22.890 -4.206  1.00 19.38  ? 382 HIS A CA  1 
ATOM   94   C C   . HIS A 1 14  ? 1.205   -22.483 -4.243  1.00 24.45  ? 382 HIS A C   1 
ATOM   95   O O   . HIS A 1 14  ? 1.584   -21.370 -3.788  1.00 21.57  ? 382 HIS A O   1 
ATOM   96   C CB  . HIS A 1 14  ? -0.808  -22.268 -5.505  1.00 23.34  ? 382 HIS A CB  1 
ATOM   97   C CG  . HIS A 1 14  ? -2.203  -22.717 -5.877  1.00 20.11  ? 382 HIS A CG  1 
ATOM   98   N ND1 . HIS A 1 14  ? -3.157  -22.986 -4.945  1.00 21.05  ? 382 HIS A ND1 1 
ATOM   99   C CD2 . HIS A 1 14  ? -2.833  -22.817 -7.155  1.00 25.13  ? 382 HIS A CD2 1 
ATOM   100  C CE1 . HIS A 1 14  ? -4.324  -23.362 -5.586  1.00 21.48  ? 382 HIS A CE1 1 
ATOM   101  N NE2 . HIS A 1 14  ? -4.132  -23.224 -6.932  1.00 23.62  ? 382 HIS A NE2 1 
ATOM   102  N N   . TYR A 1 15  ? 2.018   -23.332 -4.849  1.00 22.66  ? 383 TYR A N   1 
ATOM   103  C CA  . TYR A 1 15  ? 3.437   -23.008 -5.078  1.00 24.08  ? 383 TYR A CA  1 
ATOM   104  C C   . TYR A 1 15  ? 3.619   -21.810 -5.973  1.00 25.52  ? 383 TYR A C   1 
ATOM   105  O O   . TYR A 1 15  ? 2.995   -21.721 -7.019  1.00 20.57  ? 383 TYR A O   1 
ATOM   106  C CB  . TYR A 1 15  ? 4.189   -24.217 -5.660  1.00 24.26  ? 383 TYR A CB  1 
ATOM   107  C CG  . TYR A 1 15  ? 5.677   -23.892 -5.864  1.00 26.91  ? 383 TYR A CG  1 
ATOM   108  C CD1 . TYR A 1 15  ? 6.139   -23.485 -7.128  1.00 29.51  ? 383 TYR A CD1 1 
ATOM   109  C CD2 . TYR A 1 15  ? 6.623   -23.968 -4.804  1.00 28.07  ? 383 TYR A CD2 1 
ATOM   110  C CE1 . TYR A 1 15  ? 7.475   -23.169 -7.341  1.00 32.06  ? 383 TYR A CE1 1 
ATOM   111  C CE2 . TYR A 1 15  ? 7.994   -23.656 -5.031  1.00 30.26  ? 383 TYR A CE2 1 
ATOM   112  C CZ  . TYR A 1 15  ? 8.395   -23.266 -6.306  1.00 35.55  ? 383 TYR A CZ  1 
ATOM   113  O OH  . TYR A 1 15  ? 9.712   -22.937 -6.644  1.00 35.74  ? 383 TYR A OH  1 
ATOM   114  N N   . LYS A 1 16  ? 4.475   -20.862 -5.590  1.00 23.97  ? 384 LYS A N   1 
ATOM   115  C CA  . LYS A 1 16  ? 4.894   -19.844 -6.496  1.00 25.24  ? 384 LYS A CA  1 
ATOM   116  C C   . LYS A 1 16  ? 6.361   -19.428 -6.149  1.00 29.85  ? 384 LYS A C   1 
ATOM   117  O O   . LYS A 1 16  ? 6.749   -19.303 -4.991  1.00 24.96  ? 384 LYS A O   1 
ATOM   118  C CB  . LYS A 1 16  ? 3.991   -18.627 -6.406  1.00 24.71  ? 384 LYS A CB  1 
ATOM   119  C CG  . LYS A 1 16  ? 4.363   -17.544 -7.496  1.00 27.32  ? 384 LYS A CG  1 
ATOM   120  C CD  . LYS A 1 16  ? 3.270   -16.456 -7.713  1.00 28.65  ? 384 LYS A CD  1 
ATOM   121  C CE  . LYS A 1 16  ? 3.737   -15.384 -8.778  1.00 32.82  ? 384 LYS A CE  1 
ATOM   122  N NZ  . LYS A 1 16  ? 2.847   -14.173 -8.736  1.00 28.48  ? 384 LYS A NZ  1 
ATOM   123  N N   . SER A 1 17  ? 7.183   -19.202 -7.165  1.00 31.01  ? 385 SER A N   1 
ATOM   124  C CA  . SER A 1 17  ? 8.587   -18.805 -6.857  1.00 36.03  ? 385 SER A CA  1 
ATOM   125  C C   . SER A 1 17  ? 8.810   -17.388 -7.236  1.00 36.55  ? 385 SER A C   1 
ATOM   126  O O   . SER A 1 17  ? 8.162   -16.874 -8.149  1.00 34.48  ? 385 SER A O   1 
ATOM   127  C CB  . SER A 1 17  ? 9.582   -19.700 -7.600  1.00 39.62  ? 385 SER A CB  1 
ATOM   128  O OG  . SER A 1 17  ? 9.398   -19.434 -8.946  1.00 42.38  ? 385 SER A OG  1 
ATOM   129  N N   . PHE A 1 18  ? 9.671   -16.701 -6.500  1.00 30.79  ? 386 PHE A N   1 
ATOM   130  C CA  . PHE A 1 18  ? 9.920   -15.310 -6.759  1.00 29.93  ? 386 PHE A CA  1 
ATOM   131  C C   . PHE A 1 18  ? 11.478  -15.113 -6.868  1.00 34.82  ? 386 PHE A C   1 
ATOM   132  O O   . PHE A 1 18  ? 12.242  -15.684 -6.075  1.00 30.53  ? 386 PHE A O   1 
ATOM   133  C CB  . PHE A 1 18  ? 9.432   -14.481 -5.585  1.00 27.09  ? 386 PHE A CB  1 
ATOM   134  C CG  . PHE A 1 18  ? 7.987   -14.676 -5.258  1.00 27.45  ? 386 PHE A CG  1 
ATOM   135  C CD1 . PHE A 1 18  ? 7.039   -13.769 -5.794  1.00 25.92  ? 386 PHE A CD1 1 
ATOM   136  C CD2 . PHE A 1 18  ? 7.524   -15.823 -4.506  1.00 23.26  ? 386 PHE A CD2 1 
ATOM   137  C CE1 . PHE A 1 18  ? 5.668   -13.936 -5.539  1.00 30.75  ? 386 PHE A CE1 1 
ATOM   138  C CE2 . PHE A 1 18  ? 6.150   -16.011 -4.271  1.00 25.84  ? 386 PHE A CE2 1 
ATOM   139  C CZ  . PHE A 1 18  ? 5.215   -15.035 -4.791  1.00 24.88  ? 386 PHE A CZ  1 
ATOM   140  N N   . LYS A 1 19  ? 11.937  -14.286 -7.801  1.00 33.86  ? 387 LYS A N   1 
ATOM   141  C CA  . LYS A 1 19  ? 13.405  -13.919 -7.905  1.00 35.20  ? 387 LYS A CA  1 
ATOM   142  C C   . LYS A 1 19  ? 13.600  -12.721 -7.072  1.00 31.82  ? 387 LYS A C   1 
ATOM   143  O O   . LYS A 1 19  ? 13.087  -11.647 -7.401  1.00 33.67  ? 387 LYS A O   1 
ATOM   144  C CB  . LYS A 1 19  ? 13.758  -13.542 -9.343  1.00 40.55  ? 387 LYS A CB  1 
ATOM   145  C CG  . LYS A 1 19  ? 13.399  -14.600 -10.369 1.00 49.86  ? 387 LYS A CG  1 
ATOM   146  C CD  . LYS A 1 19  ? 14.045  -15.919 -10.014 1.00 53.92  ? 387 LYS A CD  1 
ATOM   147  C CE  . LYS A 1 19  ? 14.076  -16.904 -11.178 1.00 66.07  ? 387 LYS A CE  1 
ATOM   148  N NZ  . LYS A 1 19  ? 14.664  -18.148 -10.578 1.00 67.31  ? 387 LYS A NZ  1 
ATOM   149  N N   . VAL A 1 20  ? 14.326  -12.848 -5.965  1.00 32.18  ? 388 VAL A N   1 
ATOM   150  C CA  . VAL A 1 20  ? 14.503  -11.712 -5.040  1.00 28.85  ? 388 VAL A CA  1 
ATOM   151  C C   . VAL A 1 20  ? 16.021  -11.751 -4.585  1.00 27.60  ? 388 VAL A C   1 
ATOM   152  O O   . VAL A 1 20  ? 16.713  -12.713 -4.795  1.00 31.09  ? 388 VAL A O   1 
ATOM   153  C CB  . VAL A 1 20  ? 13.556  -11.773 -3.786  1.00 28.92  ? 388 VAL A CB  1 
ATOM   154  C CG1 . VAL A 1 20  ? 12.074  -11.817 -4.233  1.00 28.64  ? 388 VAL A CG1 1 
ATOM   155  C CG2 . VAL A 1 20  ? 13.850  -12.997 -2.875  1.00 25.69  ? 388 VAL A CG2 1 
ATOM   156  N N   . SER A 1 21  ? 16.455  -10.706 -3.910  1.00 29.02  ? 389 SER A N   1 
ATOM   157  C CA  . SER A 1 21  ? 17.777  -10.619 -3.262  1.00 36.99  ? 389 SER A CA  1 
ATOM   158  C C   . SER A 1 21  ? 17.596  -10.999 -1.833  1.00 29.29  ? 389 SER A C   1 
ATOM   159  O O   . SER A 1 21  ? 16.796  -10.401 -1.169  1.00 35.42  ? 389 SER A O   1 
ATOM   160  C CB  . SER A 1 21  ? 18.172  -9.128  -3.217  1.00 31.60  ? 389 SER A CB  1 
ATOM   161  O OG  . SER A 1 21  ? 18.343  -8.760  -4.570  1.00 34.15  ? 389 SER A OG  1 
ATOM   162  N N   . MET A 1 22  ? 18.390  -11.946 -1.373  1.00 32.38  ? 390 MET A N   1 
ATOM   163  C CA  . MET A 1 22  ? 18.592  -12.205 0.038   1.00 26.34  ? 390 MET A CA  1 
ATOM   164  C C   . MET A 1 22  ? 19.709  -11.279 0.614   1.00 32.39  ? 390 MET A C   1 
ATOM   165  O O   . MET A 1 22  ? 20.813  -11.192 0.023   1.00 33.09  ? 390 MET A O   1 
ATOM   166  C CB  . MET A 1 22  ? 19.007  -13.666 0.166   1.00 26.70  ? 390 MET A CB  1 
ATOM   167  C CG  . MET A 1 22  ? 18.982  -14.130 1.627   1.00 30.54  ? 390 MET A CG  1 
ATOM   168  S SD  . MET A 1 22  ? 19.338  -15.910 1.880   1.00 39.54  ? 390 MET A SD  1 
ATOM   169  C CE  . MET A 1 22  ? 20.104  -15.783 3.503   1.00 45.27  ? 390 MET A CE  1 
ATOM   170  N N   . ILE A 1 23  ? 19.440  -10.601 1.726   1.00 28.96  ? 391 ILE A N   1 
ATOM   171  C CA  . ILE A 1 23  ? 20.392  -9.718  2.352   1.00 29.55  ? 391 ILE A CA  1 
ATOM   172  C C   . ILE A 1 23  ? 21.238  -10.576 3.339   1.00 38.18  ? 391 ILE A C   1 
ATOM   173  O O   . ILE A 1 23  ? 20.650  -11.359 4.133   1.00 32.39  ? 391 ILE A O   1 
ATOM   174  C CB  . ILE A 1 23  ? 19.661  -8.620  3.035   1.00 31.06  ? 391 ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 23  ? 18.699  -7.965  2.002   1.00 27.76  ? 391 ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 23  ? 20.652  -7.606  3.663   1.00 36.18  ? 391 ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 23  ? 17.813  -6.952  2.672   1.00 30.84  ? 391 ILE A CD1 1 
ATOM   178  N N   . HIS A 1 24  ? 22.598  -10.546 3.237   1.00 29.68  ? 392 HIS A N   1 
ATOM   179  C CA  . HIS A 1 24  ? 23.489  -11.297 4.202   1.00 30.68  ? 392 HIS A CA  1 
ATOM   180  C C   . HIS A 1 24  ? 24.130  -10.393 5.182   1.00 33.81  ? 392 HIS A C   1 
ATOM   181  O O   . HIS A 1 24  ? 24.707  -9.326  4.810   1.00 35.95  ? 392 HIS A O   1 
ATOM   182  C CB  . HIS A 1 24  ? 24.517  -12.109 3.472   1.00 32.87  ? 392 HIS A CB  1 
ATOM   183  C CG  . HIS A 1 24  ? 23.953  -12.998 2.443   1.00 37.99  ? 392 HIS A CG  1 
ATOM   184  N ND1 . HIS A 1 24  ? 23.684  -14.307 2.687   1.00 40.32  ? 392 HIS A ND1 1 
ATOM   185  C CD2 . HIS A 1 24  ? 23.603  -12.767 1.111   1.00 35.68  ? 392 HIS A CD2 1 
ATOM   186  C CE1 . HIS A 1 24  ? 23.187  -14.889 1.559   1.00 37.91  ? 392 HIS A CE1 1 
ATOM   187  N NE2 . HIS A 1 24  ? 23.134  -13.955 0.601   1.00 40.49  ? 392 HIS A NE2 1 
ATOM   188  N N   . ARG A 1 25  ? 24.049  -10.757 6.455   1.00 32.73  ? 393 ARG A N   1 
ATOM   189  C CA  . ARG A 1 25  ? 24.567  -9.904  7.547   1.00 37.45  ? 393 ARG A CA  1 
ATOM   190  C C   . ARG A 1 25  ? 24.255  -8.440  7.455   1.00 42.44  ? 393 ARG A C   1 
ATOM   191  O O   . ARG A 1 25  ? 25.121  -7.619  7.787   1.00 41.36  ? 393 ARG A O   1 
ATOM   192  C CB  . ARG A 1 25  ? 26.094  -10.013 7.631   1.00 45.59  ? 393 ARG A CB  1 
ATOM   193  C CG  . ARG A 1 25  ? 26.470  -11.301 8.329   1.00 52.83  ? 393 ARG A CG  1 
ATOM   194  C CD  . ARG A 1 25  ? 26.967  -12.194 7.243   1.00 61.17  ? 393 ARG A CD  1 
ATOM   195  N NE  . ARG A 1 25  ? 26.846  -13.585 7.635   1.00 82.55  ? 393 ARG A NE  1 
ATOM   196  C CZ  . ARG A 1 25  ? 27.465  -14.144 8.670   1.00 83.11  ? 393 ARG A CZ  1 
ATOM   197  N NH1 . ARG A 1 25  ? 28.288  -13.441 9.462   1.00 96.47  ? 393 ARG A NH1 1 
ATOM   198  N NH2 . ARG A 1 25  ? 27.268  -15.426 8.891   1.00 80.06  ? 393 ARG A NH2 1 
ATOM   199  N N   . LEU A 1 26  ? 23.065  -8.092  6.962   1.00 40.61  ? 394 LEU A N   1 
ATOM   200  C CA  . LEU A 1 26  ? 22.659  -6.704  6.843   1.00 42.64  ? 394 LEU A CA  1 
ATOM   201  C C   . LEU A 1 26  ? 23.664  -5.840  6.068   1.00 41.22  ? 394 LEU A C   1 
ATOM   202  O O   . LEU A 1 26  ? 23.744  -4.623  6.293   1.00 41.64  ? 394 LEU A O   1 
ATOM   203  C CB  . LEU A 1 26  ? 22.459  -6.079  8.209   1.00 45.98  ? 394 LEU A CB  1 
ATOM   204  C CG  . LEU A 1 26  ? 21.429  -6.860  9.053   1.00 56.26  ? 394 LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 26  ? 21.438  -6.377  10.510  1.00 49.40  ? 394 LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 26  ? 20.056  -6.769  8.355   1.00 52.29  ? 394 LEU A CD2 1 
ATOM   207  N N   . ARG A 1 27  ? 24.392  -6.481  5.164   1.00 37.52  ? 395 ARG A N   1 
ATOM   208  C CA  . ARG A 1 27  ? 25.437  -5.826  4.401   1.00 41.12  ? 395 ARG A CA  1 
ATOM   209  C C   . ARG A 1 27  ? 25.351  -6.001  2.918   1.00 40.66  ? 395 ARG A C   1 
ATOM   210  O O   . ARG A 1 27  ? 25.393  -5.023  2.205   1.00 48.94  ? 395 ARG A O   1 
ATOM   211  C CB  . ARG A 1 27  ? 26.785  -6.291  4.874   1.00 39.92  ? 395 ARG A CB  1 
ATOM   212  C CG  . ARG A 1 27  ? 27.159  -5.288  5.873   1.00 40.30  ? 395 ARG A CG  1 
ATOM   213  C CD  . ARG A 1 27  ? 27.873  -6.022  6.869   1.00 43.01  ? 395 ARG A CD  1 
ATOM   214  N NE  . ARG A 1 27  ? 28.403  -5.004  7.701   1.00 46.30  ? 395 ARG A NE  1 
ATOM   215  C CZ  . ARG A 1 27  ? 28.451  -5.172  8.985   1.00 53.74  ? 395 ARG A CZ  1 
ATOM   216  N NH1 . ARG A 1 27  ? 27.937  -6.304  9.461   1.00 54.91  ? 395 ARG A NH1 1 
ATOM   217  N NH2 . ARG A 1 27  ? 28.994  -4.237  9.748   1.00 62.30  ? 395 ARG A NH2 1 
ATOM   218  N N   . PHE A 1 28  ? 25.229  -7.223  2.414   1.00 42.76  ? 396 PHE A N   1 
ATOM   219  C CA  . PHE A 1 28  ? 25.181  -7.315  0.980   1.00 36.21  ? 396 PHE A CA  1 
ATOM   220  C C   . PHE A 1 28  ? 24.098  -8.270  0.475   1.00 43.74  ? 396 PHE A C   1 
ATOM   221  O O   . PHE A 1 28  ? 23.592  -9.089  1.260   1.00 34.20  ? 396 PHE A O   1 
ATOM   222  C CB  . PHE A 1 28  ? 26.570  -7.728  0.490   1.00 35.18  ? 396 PHE A CB  1 
ATOM   223  C CG  . PHE A 1 28  ? 27.003  -9.056  0.967   1.00 28.87  ? 396 PHE A CG  1 
ATOM   224  C CD1 . PHE A 1 28  ? 27.509  -9.239  2.268   1.00 30.77  ? 396 PHE A CD1 1 
ATOM   225  C CD2 . PHE A 1 28  ? 26.864  -10.156 0.131   1.00 31.08  ? 396 PHE A CD2 1 
ATOM   226  C CE1 . PHE A 1 28  ? 27.843  -10.534 2.731   1.00 27.29  ? 396 PHE A CE1 1 
ATOM   227  C CE2 . PHE A 1 28  ? 27.202  -11.425 0.547   1.00 27.74  ? 396 PHE A CE2 1 
ATOM   228  C CZ  . PHE A 1 28  ? 27.676  -11.602 1.882   1.00 28.14  ? 396 PHE A CZ  1 
ATOM   229  N N   . THR A 1 29  ? 23.802  -8.279  -0.828  1.00 33.54  ? 397 THR A N   1 
ATOM   230  C CA  . THR A 1 29  ? 22.783  -9.252  -1.266  1.00 41.21  ? 397 THR A CA  1 
ATOM   231  C C   . THR A 1 29  ? 23.350  -10.248 -2.204  1.00 43.49  ? 397 THR A C   1 
ATOM   232  O O   . THR A 1 29  ? 24.378  -9.967  -2.825  1.00 40.02  ? 397 THR A O   1 
ATOM   233  C CB  . THR A 1 29  ? 21.717  -8.520  -2.048  1.00 38.43  ? 397 THR A CB  1 
ATOM   234  O OG1 . THR A 1 29  ? 22.336  -8.058  -3.237  1.00 43.82  ? 397 THR A OG1 1 
ATOM   235  C CG2 . THR A 1 29  ? 21.216  -7.331  -1.236  1.00 39.66  ? 397 THR A CG2 1 
ATOM   236  N N   . THR A 1 30  ? 22.712  -11.424 -2.293  1.00 40.43  ? 398 THR A N   1 
ATOM   237  C CA  . THR A 1 30  ? 22.915  -12.390 -3.375  1.00 35.77  ? 398 THR A CA  1 
ATOM   238  C C   . THR A 1 30  ? 21.525  -12.695 -3.988  1.00 44.75  ? 398 THR A C   1 
ATOM   239  O O   . THR A 1 30  ? 20.479  -12.428 -3.393  1.00 37.13  ? 398 THR A O   1 
ATOM   240  C CB  . THR A 1 30  ? 23.543  -13.736 -2.937  1.00 43.22  ? 398 THR A CB  1 
ATOM   241  O OG1 . THR A 1 30  ? 22.780  -14.337 -1.870  1.00 41.63  ? 398 THR A OG1 1 
ATOM   242  C CG2 . THR A 1 30  ? 25.053  -13.604 -2.473  1.00 41.22  ? 398 THR A CG2 1 
ATOM   243  N N   . ASP A 1 31  ? 21.507  -13.273 -5.168  1.00 44.37  ? 399 ASP A N   1 
ATOM   244  C CA  . ASP A 1 31  ? 20.215  -13.519 -5.827  1.00 45.65  ? 399 ASP A CA  1 
ATOM   245  C C   . ASP A 1 31  ? 19.759  -14.900 -5.536  1.00 41.29  ? 399 ASP A C   1 
ATOM   246  O O   . ASP A 1 31  ? 20.533  -15.813 -5.607  1.00 36.94  ? 399 ASP A O   1 
ATOM   247  C CB  . ASP A 1 31  ? 20.300  -13.382 -7.337  1.00 44.26  ? 399 ASP A CB  1 
ATOM   248  C CG  . ASP A 1 31  ? 20.513  -11.989 -7.748  1.00 46.96  ? 399 ASP A CG  1 
ATOM   249  O OD1 . ASP A 1 31  ? 20.079  -11.026 -7.079  1.00 48.29  ? 399 ASP A OD1 1 
ATOM   250  O OD2 . ASP A 1 31  ? 21.164  -11.855 -8.771  1.00 57.31  ? 399 ASP A OD2 1 
ATOM   251  N N   . VAL A 1 32  ? 18.474  -15.056 -5.157  1.00 40.75  ? 400 VAL A N   1 
ATOM   252  C CA  . VAL A 1 32  ? 17.951  -16.400 -4.829  1.00 33.83  ? 400 VAL A CA  1 
ATOM   253  C C   . VAL A 1 32  ? 16.619  -16.612 -5.588  1.00 33.29  ? 400 VAL A C   1 
ATOM   254  O O   . VAL A 1 32  ? 15.984  -15.670 -6.054  1.00 35.42  ? 400 VAL A O   1 
ATOM   255  C CB  . VAL A 1 32  ? 17.749  -16.552 -3.306  1.00 33.52  ? 400 VAL A CB  1 
ATOM   256  C CG1 . VAL A 1 32  ? 19.082  -16.255 -2.563  1.00 29.46  ? 400 VAL A CG1 1 
ATOM   257  C CG2 . VAL A 1 32  ? 16.737  -15.530 -2.778  1.00 23.77  ? 400 VAL A CG2 1 
ATOM   258  N N   . GLN A 1 33  ? 16.197  -17.850 -5.663  1.00 34.72  ? 401 GLN A N   1 
ATOM   259  C CA  . GLN A 1 33  ? 14.820  -18.101 -5.972  1.00 38.56  ? 401 GLN A CA  1 
ATOM   260  C C   . GLN A 1 33  ? 14.147  -18.516 -4.620  1.00 32.11  ? 401 GLN A C   1 
ATOM   261  O O   . GLN A 1 33  ? 14.625  -19.434 -3.905  1.00 33.74  ? 401 GLN A O   1 
ATOM   262  C CB  . GLN A 1 33  ? 14.746  -19.195 -7.008  1.00 38.74  ? 401 GLN A CB  1 
ATOM   263  C CG  . GLN A 1 33  ? 13.340  -19.768 -7.056  1.00 53.72  ? 401 GLN A CG  1 
ATOM   264  C CD  . GLN A 1 33  ? 13.191  -20.852 -8.086  1.00 64.96  ? 401 GLN A CD  1 
ATOM   265  O OE1 . GLN A 1 33  ? 13.228  -20.573 -9.287  1.00 70.33  ? 401 GLN A OE1 1 
ATOM   266  N NE2 . GLN A 1 33  ? 13.051  -22.103 -7.626  1.00 54.10  ? 401 GLN A NE2 1 
ATOM   267  N N   . LEU A 1 34  ? 13.085  -17.798 -4.265  1.00 33.56  ? 402 LEU A N   1 
ATOM   268  C CA  . LEU A 1 34  ? 12.326  -18.049 -3.013  1.00 27.21  ? 402 LEU A CA  1 
ATOM   269  C C   . LEU A 1 34  ? 10.995  -18.752 -3.500  1.00 27.21  ? 402 LEU A C   1 
ATOM   270  O O   . LEU A 1 34  ? 10.185  -18.124 -4.239  1.00 26.86  ? 402 LEU A O   1 
ATOM   271  C CB  . LEU A 1 34  ? 12.063  -16.692 -2.438  1.00 23.52  ? 402 LEU A CB  1 
ATOM   272  C CG  . LEU A 1 34  ? 11.153  -16.668 -1.224  1.00 26.88  ? 402 LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 34  ? 11.700  -17.500 -0.055  1.00 27.34  ? 402 LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 34  ? 11.003  -15.208 -0.810  1.00 28.10  ? 402 LEU A CD2 1 
ATOM   275  N N   . GLY A 1 35  ? 10.879  -20.023 -3.213  1.00 26.02  ? 403 GLY A N   1 
ATOM   276  C CA  . GLY A 1 35  ? 9.715   -20.842 -3.622  1.00 26.82  ? 403 GLY A CA  1 
ATOM   277  C C   . GLY A 1 35  ? 8.845   -20.893 -2.340  1.00 29.81  ? 403 GLY A C   1 
ATOM   278  O O   . GLY A 1 35  ? 9.353   -21.231 -1.248  1.00 27.88  ? 403 GLY A O   1 
ATOM   279  N N   . ILE A 1 36  ? 7.569   -20.531 -2.455  1.00 19.98  ? 404 ILE A N   1 
ATOM   280  C CA  . ILE A 1 36  ? 6.660   -20.525 -1.264  1.00 18.28  ? 404 ILE A CA  1 
ATOM   281  C C   . ILE A 1 36  ? 5.395   -21.346 -1.628  1.00 20.61  ? 404 ILE A C   1 
ATOM   282  O O   . ILE A 1 36  ? 4.798   -21.070 -2.693  1.00 19.63  ? 404 ILE A O   1 
ATOM   283  C CB  . ILE A 1 36  ? 6.150   -19.084 -1.009  1.00 20.15  ? 404 ILE A CB  1 
ATOM   284  C CG1 . ILE A 1 36  ? 7.426   -18.152 -0.825  1.00 20.62  ? 404 ILE A CG1 1 
ATOM   285  C CG2 . ILE A 1 36  ? 5.216   -19.001 0.237   1.00 17.37  ? 404 ILE A CG2 1 
ATOM   286  C CD1 . ILE A 1 36  ? 7.180   -16.715 -0.330  1.00 19.89  ? 404 ILE A CD1 1 
ATOM   287  N N   . SER A 1 37  ? 4.981   -22.284 -0.780  1.00 20.97  ? 405 SER A N   1 
ATOM   288  C CA  . SER A 1 37  ? 3.633   -22.859 -0.948  1.00 21.14  ? 405 SER A CA  1 
ATOM   289  C C   . SER A 1 37  ? 3.176   -23.130 0.452   1.00 21.18  ? 405 SER A C   1 
ATOM   290  O O   . SER A 1 37  ? 3.947   -22.897 1.447   1.00 19.72  ? 405 SER A O   1 
ATOM   291  C CB  . SER A 1 37  ? 3.794   -24.181 -1.741  1.00 24.98  ? 405 SER A CB  1 
ATOM   292  O OG  . SER A 1 37  ? 4.400   -25.092 -0.871  1.00 23.59  ? 405 SER A OG  1 
ATOM   293  N N   . GLY A 1 38  ? 1.937   -23.637 0.629   1.00 19.15  ? 406 GLY A N   1 
ATOM   294  C CA  . GLY A 1 38  ? 1.492   -24.026 1.986   1.00 16.53  ? 406 GLY A CA  1 
ATOM   295  C C   . GLY A 1 38  ? 2.315   -25.159 2.626   1.00 20.49  ? 406 GLY A C   1 
ATOM   296  O O   . GLY A 1 38  ? 2.157   -25.434 3.838   1.00 24.57  ? 406 GLY A O   1 
ATOM   297  N N   . ASP A 1 39  ? 3.069   -25.901 1.836   1.00 18.93  ? 407 ASP A N   1 
ATOM   298  C CA  . ASP A 1 39  ? 3.958   -27.019 2.380   1.00 24.85  ? 407 ASP A CA  1 
ATOM   299  C C   . ASP A 1 39  ? 5.278   -26.471 2.947   1.00 23.18  ? 407 ASP A C   1 
ATOM   300  O O   . ASP A 1 39  ? 5.750   -26.951 3.942   1.00 23.52  ? 407 ASP A O   1 
ATOM   301  C CB  . ASP A 1 39  ? 4.487   -27.919 1.266   1.00 24.73  ? 407 ASP A CB  1 
ATOM   302  C CG  . ASP A 1 39  ? 3.455   -28.761 0.634   1.00 35.36  ? 407 ASP A CG  1 
ATOM   303  O OD1 . ASP A 1 39  ? 2.472   -29.114 1.330   1.00 41.28  ? 407 ASP A OD1 1 
ATOM   304  O OD2 . ASP A 1 39  ? 3.628   -29.081 -0.598  1.00 36.00  ? 407 ASP A OD2 1 
ATOM   305  N N   . LYS A 1 40  ? 5.907   -25.491 2.297   1.00 22.52  ? 408 LYS A N   1 
ATOM   306  C CA  . LYS A 1 40  ? 7.255   -25.107 2.717   1.00 24.73  ? 408 LYS A CA  1 
ATOM   307  C C   . LYS A 1 40  ? 7.740   -23.882 1.988   1.00 25.57  ? 408 LYS A C   1 
ATOM   308  O O   . LYS A 1 40  ? 7.143   -23.491 0.947   1.00 23.82  ? 408 LYS A O   1 
ATOM   309  C CB  . LYS A 1 40  ? 8.258   -26.234 2.380   1.00 30.86  ? 408 LYS A CB  1 
ATOM   310  C CG  . LYS A 1 40  ? 8.345   -26.556 0.911   1.00 37.09  ? 408 LYS A CG  1 
ATOM   311  C CD  . LYS A 1 40  ? 9.167   -27.820 0.623   1.00 48.10  ? 408 LYS A CD  1 
ATOM   312  C CE  . LYS A 1 40  ? 9.517   -28.526 1.925   1.00 54.12  ? 408 LYS A CE  1 
ATOM   313  N NZ  . LYS A 1 40  ? 9.569   -30.015 1.831   1.00 69.05  ? 408 LYS A NZ  1 
ATOM   314  N N   . VAL A 1 41  ? 8.817   -23.275 2.543   1.00 22.80  ? 409 VAL A N   1 
ATOM   315  C CA  . VAL A 1 41  ? 9.454   -22.132 1.979   1.00 21.58  ? 409 VAL A CA  1 
ATOM   316  C C   . VAL A 1 41  ? 10.897  -22.621 1.551   1.00 25.92  ? 409 VAL A C   1 
ATOM   317  O O   . VAL A 1 41  ? 11.633  -23.162 2.404   1.00 25.04  ? 409 VAL A O   1 
ATOM   318  C CB  . VAL A 1 41  ? 9.490   -20.897 2.908   1.00 20.77  ? 409 VAL A CB  1 
ATOM   319  C CG1 . VAL A 1 41  ? 10.387  -19.855 2.257   1.00 23.23  ? 409 VAL A CG1 1 
ATOM   320  C CG2 . VAL A 1 41  ? 8.077   -20.228 3.027   1.00 24.49  ? 409 VAL A CG2 1 
ATOM   321  N N   . GLU A 1 42  ? 11.278  -22.483 0.278   1.00 23.68  ? 410 GLU A N   1 
ATOM   322  C CA  . GLU A 1 42  ? 12.671  -22.808 -0.126  1.00 28.59  ? 410 GLU A CA  1 
ATOM   323  C C   . GLU A 1 42  ? 13.418  -21.645 -0.648  1.00 31.03  ? 410 GLU A C   1 
ATOM   324  O O   . GLU A 1 42  ? 12.833  -20.802 -1.337  1.00 27.37  ? 410 GLU A O   1 
ATOM   325  C CB  . GLU A 1 42  ? 12.653  -23.841 -1.254  1.00 30.76  ? 410 GLU A CB  1 
ATOM   326  C CG  . GLU A 1 42  ? 12.075  -25.108 -0.709  1.00 36.05  ? 410 GLU A CG  1 
ATOM   327  C CD  . GLU A 1 42  ? 11.425  -25.926 -1.803  1.00 44.68  ? 410 GLU A CD  1 
ATOM   328  O OE1 . GLU A 1 42  ? 10.688  -25.344 -2.658  1.00 51.61  ? 410 GLU A OE1 1 
ATOM   329  O OE2 . GLU A 1 42  ? 11.680  -27.152 -1.833  1.00 48.39  ? 410 GLU A OE2 1 
ATOM   330  N N   . ILE A 1 43  ? 14.716  -21.561 -0.300  1.00 31.10  ? 411 ILE A N   1 
ATOM   331  C CA  . ILE A 1 43  ? 15.618  -20.509 -0.817  1.00 31.39  ? 411 ILE A CA  1 
ATOM   332  C C   . ILE A 1 43  ? 16.770  -21.258 -1.492  1.00 34.65  ? 411 ILE A C   1 
ATOM   333  O O   . ILE A 1 43  ? 17.418  -22.149 -0.849  1.00 34.05  ? 411 ILE A O   1 
ATOM   334  C CB  . ILE A 1 43  ? 16.190  -19.626 0.318   1.00 30.90  ? 411 ILE A CB  1 
ATOM   335  C CG1 . ILE A 1 43  ? 15.083  -18.888 1.015   1.00 28.96  ? 411 ILE A CG1 1 
ATOM   336  C CG2 . ILE A 1 43  ? 17.079  -18.523 -0.281  1.00 28.62  ? 411 ILE A CG2 1 
ATOM   337  C CD1 . ILE A 1 43  ? 14.508  -19.496 2.251   1.00 29.31  ? 411 ILE A CD1 1 
ATOM   338  N N   . ASP A 1 44  ? 16.915  -21.017 -2.787  1.00 37.40  ? 412 ASP A N   1 
ATOM   339  C CA  . ASP A 1 44  ? 17.951  -21.617 -3.597  1.00 38.99  ? 412 ASP A CA  1 
ATOM   340  C C   . ASP A 1 44  ? 18.703  -20.464 -4.236  1.00 41.31  ? 412 ASP A C   1 
ATOM   341  O O   . ASP A 1 44  ? 18.095  -19.562 -4.814  1.00 41.74  ? 412 ASP A O   1 
ATOM   342  C CB  . ASP A 1 44  ? 17.373  -22.564 -4.653  1.00 44.62  ? 412 ASP A CB  1 
ATOM   343  C CG  . ASP A 1 44  ? 16.863  -23.852 -4.038  1.00 51.21  ? 412 ASP A CG  1 
ATOM   344  O OD1 . ASP A 1 44  ? 17.641  -24.808 -3.798  1.00 57.73  ? 412 ASP A OD1 1 
ATOM   345  O OD2 . ASP A 1 44  ? 15.673  -23.921 -3.748  1.00 47.95  ? 412 ASP A OD2 1 
ATOM   346  N N   . PRO A 1 45  ? 20.031  -20.449 -4.048  1.00 46.04  ? 413 PRO A N   1 
ATOM   347  C CA  . PRO A 1 45  ? 20.877  -19.459 -4.658  1.00 45.43  ? 413 PRO A CA  1 
ATOM   348  C C   . PRO A 1 45  ? 20.760  -19.570 -6.169  1.00 40.82  ? 413 PRO A C   1 
ATOM   349  O O   . PRO A 1 45  ? 20.823  -20.679 -6.697  1.00 47.26  ? 413 PRO A O   1 
ATOM   350  C CB  . PRO A 1 45  ? 22.295  -19.879 -4.199  1.00 51.47  ? 413 PRO A CB  1 
ATOM   351  C CG  . PRO A 1 45  ? 22.180  -21.323 -3.829  1.00 54.24  ? 413 PRO A CG  1 
ATOM   352  C CD  . PRO A 1 45  ? 20.798  -21.435 -3.245  1.00 51.09  ? 413 PRO A CD  1 
ATOM   353  N N   . VAL A 1 46  ? 20.590  -18.464 -6.874  1.00 46.74  ? 414 VAL A N   1 
ATOM   354  C CA  . VAL A 1 46  ? 20.494  -18.533 -8.337  1.00 55.24  ? 414 VAL A CA  1 
ATOM   355  C C   . VAL A 1 46  ? 21.834  -18.841 -9.102  1.00 62.75  ? 414 VAL A C   1 
ATOM   356  O O   . VAL A 1 46  ? 22.935  -18.379 -8.724  1.00 57.16  ? 414 VAL A O   1 
ATOM   357  C CB  . VAL A 1 46  ? 19.748  -17.318 -8.878  1.00 59.40  ? 414 VAL A CB  1 
ATOM   358  C CG1 . VAL A 1 46  ? 20.719  -16.330 -9.523  1.00 62.84  ? 414 VAL A CG1 1 
ATOM   359  C CG2 . VAL A 1 46  ? 18.670  -17.818 -9.827  1.00 70.39  ? 414 VAL A CG2 1 
ATOM   360  N N   . THR A 1 53  ? 36.561  -18.366 -6.649  1.00 85.87  ? 421 THR A N   1 
ATOM   361  C CA  . THR A 1 53  ? 35.632  -19.490 -6.579  1.00 91.89  ? 421 THR A CA  1 
ATOM   362  C C   . THR A 1 53  ? 36.342  -20.701 -5.899  1.00 88.52  ? 421 THR A C   1 
ATOM   363  O O   . THR A 1 53  ? 35.753  -21.777 -5.778  1.00 100.29 ? 421 THR A O   1 
ATOM   364  C CB  . THR A 1 53  ? 34.971  -19.818 -7.973  1.00 97.89  ? 421 THR A CB  1 
ATOM   365  O OG1 . THR A 1 53  ? 35.884  -19.442 -9.011  1.00 99.40  ? 421 THR A OG1 1 
ATOM   366  C CG2 . THR A 1 53  ? 33.599  -19.047 -8.226  1.00 81.87  ? 421 THR A CG2 1 
ATOM   367  N N   . LYS A 1 54  ? 37.589  -20.511 -5.437  1.00 83.56  ? 422 LYS A N   1 
ATOM   368  C CA  . LYS A 1 54  ? 38.210  -21.428 -4.434  1.00 68.14  ? 422 LYS A CA  1 
ATOM   369  C C   . LYS A 1 54  ? 38.310  -20.827 -2.965  1.00 65.55  ? 422 LYS A C   1 
ATOM   370  O O   . LYS A 1 54  ? 38.419  -21.560 -1.946  1.00 59.44  ? 422 LYS A O   1 
ATOM   371  C CB  . LYS A 1 54  ? 39.554  -21.989 -4.940  1.00 72.16  ? 422 LYS A CB  1 
ATOM   372  C CG  . LYS A 1 54  ? 40.740  -21.053 -4.869  1.00 66.01  ? 422 LYS A CG  1 
ATOM   373  C CD  . LYS A 1 54  ? 41.964  -21.801 -4.350  1.00 66.49  ? 422 LYS A CD  1 
ATOM   374  C CE  . LYS A 1 54  ? 41.781  -22.251 -2.896  1.00 72.88  ? 422 LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 54  ? 42.994  -22.871 -2.267  1.00 74.36  ? 422 LYS A NZ  1 
ATOM   376  N N   . PHE A 1 55  ? 38.251  -19.495 -2.849  1.00 39.79  ? 423 PHE A N   1 
ATOM   377  C CA  . PHE A 1 55  ? 38.008  -18.882 -1.502  1.00 46.04  ? 423 PHE A CA  1 
ATOM   378  C C   . PHE A 1 55  ? 36.592  -18.339 -1.418  1.00 46.43  ? 423 PHE A C   1 
ATOM   379  O O   . PHE A 1 55  ? 36.379  -17.306 -0.843  1.00 45.94  ? 423 PHE A O   1 
ATOM   380  C CB  . PHE A 1 55  ? 39.007  -17.764 -1.164  1.00 34.51  ? 423 PHE A CB  1 
ATOM   381  C CG  . PHE A 1 55  ? 40.427  -18.263 -1.158  1.00 34.18  ? 423 PHE A CG  1 
ATOM   382  C CD1 . PHE A 1 55  ? 41.311  -17.892 -2.162  1.00 39.07  ? 423 PHE A CD1 1 
ATOM   383  C CD2 . PHE A 1 55  ? 40.854  -19.149 -0.164  1.00 32.27  ? 423 PHE A CD2 1 
ATOM   384  C CE1 . PHE A 1 55  ? 42.637  -18.380 -2.147  1.00 36.58  ? 423 PHE A CE1 1 
ATOM   385  C CE2 . PHE A 1 55  ? 42.161  -19.632 -0.133  1.00 38.62  ? 423 PHE A CE2 1 
ATOM   386  C CZ  . PHE A 1 55  ? 43.045  -19.234 -1.142  1.00 38.30  ? 423 PHE A CZ  1 
ATOM   387  N N   . TRP A 1 56  ? 35.642  -19.068 -1.997  1.00 49.32  ? 424 TRP A N   1 
ATOM   388  C CA  . TRP A 1 56  ? 34.252  -18.588 -2.141  1.00 50.94  ? 424 TRP A CA  1 
ATOM   389  C C   . TRP A 1 56  ? 33.406  -19.083 -0.972  1.00 58.60  ? 424 TRP A C   1 
ATOM   390  O O   . TRP A 1 56  ? 33.344  -20.304 -0.730  1.00 57.41  ? 424 TRP A O   1 
ATOM   391  C CB  . TRP A 1 56  ? 33.694  -18.975 -3.521  1.00 57.42  ? 424 TRP A CB  1 
ATOM   392  C CG  . TRP A 1 56  ? 32.381  -18.293 -3.806  1.00 75.59  ? 424 TRP A CG  1 
ATOM   393  C CD1 . TRP A 1 56  ? 32.140  -16.924 -4.030  1.00 79.56  ? 424 TRP A CD1 1 
ATOM   394  C CD2 . TRP A 1 56  ? 31.056  -18.919 -3.811  1.00 84.76  ? 424 TRP A CD2 1 
ATOM   395  N NE1 . TRP A 1 56  ? 30.796  -16.675 -4.175  1.00 79.12  ? 424 TRP A NE1 1 
ATOM   396  C CE2 . TRP A 1 56  ? 30.086  -17.828 -4.058  1.00 78.20  ? 424 TRP A CE2 1 
ATOM   397  C CE3 . TRP A 1 56  ? 30.585  -20.233 -3.626  1.00 87.49  ? 424 TRP A CE3 1 
ATOM   398  C CZ2 . TRP A 1 56  ? 28.725  -18.067 -4.121  1.00 80.16  ? 424 TRP A CZ2 1 
ATOM   399  C CZ3 . TRP A 1 56  ? 29.206  -20.460 -3.692  1.00 85.17  ? 424 TRP A CZ3 1 
ATOM   400  C CH2 . TRP A 1 56  ? 28.302  -19.404 -3.934  1.00 82.04  ? 424 TRP A CH2 1 
ATOM   401  N N   . ILE A 1 57  ? 32.791  -18.150 -0.214  1.00 53.55  ? 425 ILE A N   1 
ATOM   402  C CA  . ILE A 1 57  ? 31.764  -18.460 0.820   1.00 53.10  ? 425 ILE A CA  1 
ATOM   403  C C   . ILE A 1 57  ? 30.514  -19.147 0.153   1.00 52.12  ? 425 ILE A C   1 
ATOM   404  O O   . ILE A 1 57  ? 29.747  -18.450 -0.512  1.00 55.69  ? 425 ILE A O   1 
ATOM   405  C CB  . ILE A 1 57  ? 31.303  -17.168 1.587   1.00 45.31  ? 425 ILE A CB  1 
ATOM   406  C CG1 . ILE A 1 57  ? 32.388  -16.632 2.539   1.00 45.87  ? 425 ILE A CG1 1 
ATOM   407  C CG2 . ILE A 1 57  ? 30.040  -17.457 2.398   1.00 50.17  ? 425 ILE A CG2 1 
ATOM   408  C CD1 . ILE A 1 57  ? 32.178  -15.215 3.013   1.00 38.15  ? 425 ILE A CD1 1 
ATOM   409  N N   . LYS A 1 58  ? 30.355  -20.477 0.290   1.00 56.04  ? 426 LYS A N   1 
ATOM   410  C CA  . LYS A 1 58  ? 29.272  -21.251 -0.362  1.00 62.28  ? 426 LYS A CA  1 
ATOM   411  C C   . LYS A 1 58  ? 27.868  -20.851 0.224   1.00 61.25  ? 426 LYS A C   1 
ATOM   412  O O   . LYS A 1 58  ? 27.755  -20.612 1.431   1.00 50.82  ? 426 LYS A O   1 
ATOM   413  C CB  . LYS A 1 58  ? 29.540  -22.758 -0.226  1.00 62.52  ? 426 LYS A CB  1 
ATOM   414  N N   . GLN A 1 59  ? 26.826  -20.707 -0.609  1.00 62.04  ? 427 GLN A N   1 
ATOM   415  C CA  . GLN A 1 59  ? 25.443  -20.478 -0.053  1.00 57.18  ? 427 GLN A CA  1 
ATOM   416  C C   . GLN A 1 59  ? 24.625  -21.784 -0.074  1.00 48.08  ? 427 GLN A C   1 
ATOM   417  O O   . GLN A 1 59  ? 24.362  -22.337 -1.112  1.00 50.40  ? 427 GLN A O   1 
ATOM   418  C CB  . GLN A 1 59  ? 24.731  -19.308 -0.753  1.00 56.74  ? 427 GLN A CB  1 
ATOM   419  C CG  . GLN A 1 59  ? 25.496  -17.957 -0.637  1.00 70.09  ? 427 GLN A CG  1 
ATOM   420  C CD  . GLN A 1 59  ? 25.724  -17.462 0.814   1.00 74.43  ? 427 GLN A CD  1 
ATOM   421  O OE1 . GLN A 1 59  ? 25.100  -17.958 1.760   1.00 69.77  ? 427 GLN A OE1 1 
ATOM   422  N NE2 . GLN A 1 59  ? 26.616  -16.474 0.990   1.00 71.09  ? 427 GLN A NE2 1 
ATOM   423  N N   . LYS A 1 60  ? 24.311  -22.363 1.064   1.00 49.13  ? 428 LYS A N   1 
ATOM   424  C CA  . LYS A 1 60  ? 23.624  -23.674 1.004   1.00 47.84  ? 428 LYS A CA  1 
ATOM   425  C C   . LYS A 1 60  ? 22.056  -23.417 0.761   1.00 46.11  ? 428 LYS A C   1 
ATOM   426  O O   . LYS A 1 60  ? 21.519  -22.363 1.178   1.00 42.65  ? 428 LYS A O   1 
ATOM   427  C CB  . LYS A 1 60  ? 23.934  -24.483 2.264   1.00 49.04  ? 428 LYS A CB  1 
ATOM   428  N N   . PRO A 1 61  ? 21.375  -24.299 0.017   1.00 45.96  ? 429 PRO A N   1 
ATOM   429  C CA  . PRO A 1 61  ? 19.889  -24.162 -0.145  1.00 39.95  ? 429 PRO A CA  1 
ATOM   430  C C   . PRO A 1 61  ? 19.247  -24.252 1.220   1.00 40.95  ? 429 PRO A C   1 
ATOM   431  O O   . PRO A 1 61  ? 19.830  -24.860 2.101   1.00 37.35  ? 429 PRO A O   1 
ATOM   432  C CB  . PRO A 1 61  ? 19.539  -25.361 -0.997  1.00 44.60  ? 429 PRO A CB  1 
ATOM   433  C CG  . PRO A 1 61  ? 20.836  -25.598 -1.822  1.00 47.69  ? 429 PRO A CG  1 
ATOM   434  C CD  . PRO A 1 61  ? 21.900  -25.424 -0.782  1.00 45.41  ? 429 PRO A CD  1 
ATOM   435  N N   . ILE A 1 62  ? 18.121  -23.549 1.442   1.00 39.50  ? 430 ILE A N   1 
ATOM   436  C CA  . ILE A 1 62  ? 17.446  -23.581 2.744   1.00 33.61  ? 430 ILE A CA  1 
ATOM   437  C C   . ILE A 1 62  ? 16.045  -24.158 2.443   1.00 34.98  ? 430 ILE A C   1 
ATOM   438  O O   . ILE A 1 62  ? 15.386  -23.743 1.431   1.00 27.75  ? 430 ILE A O   1 
ATOM   439  C CB  . ILE A 1 62  ? 17.355  -22.179 3.328   1.00 37.37  ? 430 ILE A CB  1 
ATOM   440  C CG1 . ILE A 1 62  ? 18.703  -21.671 3.838   1.00 37.49  ? 430 ILE A CG1 1 
ATOM   441  C CG2 . ILE A 1 62  ? 16.360  -22.070 4.497   1.00 34.74  ? 430 ILE A CG2 1 
ATOM   442  C CD1 . ILE A 1 62  ? 18.633  -20.203 4.167   1.00 38.56  ? 430 ILE A CD1 1 
ATOM   443  N N   . SER A 1 63  ? 15.586  -25.094 3.288   1.00 29.91  ? 431 SER A N   1 
ATOM   444  C CA  . SER A 1 63  ? 14.218  -25.595 3.137   1.00 33.18  ? 431 SER A CA  1 
ATOM   445  C C   . SER A 1 63  ? 13.513  -25.452 4.455   1.00 31.95  ? 431 SER A C   1 
ATOM   446  O O   . SER A 1 63  ? 14.014  -25.926 5.473   1.00 32.08  ? 431 SER A O   1 
ATOM   447  C CB  . SER A 1 63  ? 14.195  -27.053 2.647   1.00 36.41  ? 431 SER A CB  1 
ATOM   448  O OG  . SER A 1 63  ? 12.871  -27.387 2.330   1.00 40.04  ? 431 SER A OG  1 
ATOM   449  N N   . ILE A 1 64  ? 12.373  -24.754 4.525   1.00 25.86  ? 432 ILE A N   1 
ATOM   450  C CA  . ILE A 1 64  ? 11.721  -24.579 5.840   1.00 22.70  ? 432 ILE A CA  1 
ATOM   451  C C   . ILE A 1 64  ? 10.272  -25.171 5.749   1.00 27.04  ? 432 ILE A C   1 
ATOM   452  O O   . ILE A 1 64  ? 9.486   -24.655 4.924   1.00 26.17  ? 432 ILE A O   1 
ATOM   453  C CB  . ILE A 1 64  ? 11.648  -23.065 6.168   1.00 21.79  ? 432 ILE A CB  1 
ATOM   454  C CG1 . ILE A 1 64  ? 13.088  -22.473 6.050   1.00 23.30  ? 432 ILE A CG1 1 
ATOM   455  C CG2 . ILE A 1 64  ? 10.946  -22.749 7.561   1.00 17.95  ? 432 ILE A CG2 1 
ATOM   456  C CD1 . ILE A 1 64  ? 12.997  -20.964 6.070   1.00 29.66  ? 432 ILE A CD1 1 
ATOM   457  N N   . ASP A 1 65  ? 9.900   -26.141 6.580   1.00 24.55  ? 433 ASP A N   1 
ATOM   458  C CA  . ASP A 1 65  ? 8.498   -26.618 6.683   1.00 28.35  ? 433 ASP A CA  1 
ATOM   459  C C   . ASP A 1 65  ? 7.619   -25.448 7.014   1.00 23.42  ? 433 ASP A C   1 
ATOM   460  O O   . ASP A 1 65  ? 7.953   -24.640 7.910   1.00 23.07  ? 433 ASP A O   1 
ATOM   461  C CB  . ASP A 1 65  ? 8.424   -27.694 7.819   1.00 30.14  ? 433 ASP A CB  1 
ATOM   462  C CG  . ASP A 1 65  ? 6.902   -28.176 8.228   1.00 44.78  ? 433 ASP A CG  1 
ATOM   463  O OD1 . ASP A 1 65  ? 5.769   -27.990 7.598   1.00 38.46  ? 433 ASP A OD1 1 
ATOM   464  O OD2 . ASP A 1 65  ? 6.810   -28.819 9.346   1.00 59.05  ? 433 ASP A OD2 1 
ATOM   465  N N   . SER A 1 66  ? 6.496   -25.267 6.311   1.00 20.35  ? 434 SER A N   1 
ATOM   466  C CA  . SER A 1 66  ? 5.661   -24.100 6.614   1.00 19.82  ? 434 SER A CA  1 
ATOM   467  C C   . SER A 1 66  ? 5.179   -24.092 8.035   1.00 19.76  ? 434 SER A C   1 
ATOM   468  O O   . SER A 1 66  ? 4.960   -23.002 8.597   1.00 19.75  ? 434 SER A O   1 
ATOM   469  C CB  . SER A 1 66  ? 4.462   -23.908 5.593   1.00 24.72  ? 434 SER A CB  1 
ATOM   470  O OG  . SER A 1 66  ? 3.659   -25.081 5.818   1.00 32.11  ? 434 SER A OG  1 
ATOM   471  N N   . ASP A 1 67  ? 5.064   -25.259 8.702   1.00 19.39  ? 435 ASP A N   1 
ATOM   472  C CA  . ASP A 1 67  ? 4.605   -25.204 10.117  1.00 21.19  ? 435 ASP A CA  1 
ATOM   473  C C   . ASP A 1 67  ? 5.753   -24.703 11.076  1.00 23.94  ? 435 ASP A C   1 
ATOM   474  O O   . ASP A 1 67  ? 5.470   -24.450 12.202  1.00 22.19  ? 435 ASP A O   1 
ATOM   475  C CB  . ASP A 1 67  ? 4.193   -26.598 10.657  1.00 23.89  ? 435 ASP A CB  1 
ATOM   476  C CG  . ASP A 1 67  ? 2.882   -27.117 10.002  1.00 28.29  ? 435 ASP A CG  1 
ATOM   477  O OD1 . ASP A 1 67  ? 2.147   -26.296 9.425   1.00 24.77  ? 435 ASP A OD1 1 
ATOM   478  O OD2 . ASP A 1 67  ? 2.604   -28.330 10.134  1.00 24.96  ? 435 ASP A OD2 1 
ATOM   479  N N   . LEU A 1 68  ? 6.958   -24.496 10.566  1.00 22.19  ? 436 LEU A N   1 
ATOM   480  C CA  . LEU A 1 68  ? 8.000   -23.840 11.464  1.00 24.20  ? 436 LEU A CA  1 
ATOM   481  C C   . LEU A 1 68  ? 8.098   -22.323 11.178  1.00 26.75  ? 436 LEU A C   1 
ATOM   482  O O   . LEU A 1 68  ? 8.884   -21.604 11.855  1.00 25.81  ? 436 LEU A O   1 
ATOM   483  C CB  . LEU A 1 68  ? 9.364   -24.447 11.186  1.00 21.98  ? 436 LEU A CB  1 
ATOM   484  C CG  . LEU A 1 68  ? 9.332   -25.961 11.521  1.00 29.25  ? 436 LEU A CG  1 
ATOM   485  C CD1 . LEU A 1 68  ? 10.584  -26.604 11.007  1.00 33.23  ? 436 LEU A CD1 1 
ATOM   486  C CD2 . LEU A 1 68  ? 9.172   -26.110 13.004  1.00 26.21  ? 436 LEU A CD2 1 
ATOM   487  N N   . LEU A 1 69  ? 7.298   -21.814 10.240  1.00 23.37  ? 437 LEU A N   1 
ATOM   488  C CA  . LEU A 1 69  ? 7.264   -20.350 10.026  1.00 25.14  ? 437 LEU A CA  1 
ATOM   489  C C   . LEU A 1 69  ? 6.575   -19.681 11.222  1.00 23.61  ? 437 LEU A C   1 
ATOM   490  O O   . LEU A 1 69  ? 5.504   -20.185 11.687  1.00 23.63  ? 437 LEU A O   1 
ATOM   491  C CB  . LEU A 1 69  ? 6.508   -19.986 8.712   1.00 23.03  ? 437 LEU A CB  1 
ATOM   492  C CG  . LEU A 1 69  ? 7.085   -20.615 7.448   1.00 24.73  ? 437 LEU A CG  1 
ATOM   493  C CD1 . LEU A 1 69  ? 6.111   -20.331 6.276   1.00 21.32  ? 437 LEU A CD1 1 
ATOM   494  C CD2 . LEU A 1 69  ? 8.555   -20.136 7.105   1.00 26.35  ? 437 LEU A CD2 1 
ATOM   495  N N   . CYS A 1 70  ? 7.060   -18.491 11.632  1.00 23.97  ? 438 CYS A N   1 
ATOM   496  C CA  . CYS A 1 70  ? 6.518   -17.738 12.749  1.00 22.24  ? 438 CYS A CA  1 
ATOM   497  C C   . CYS A 1 70  ? 5.976   -16.418 12.271  1.00 23.19  ? 438 CYS A C   1 
ATOM   498  O O   . CYS A 1 70  ? 4.931   -16.042 12.753  1.00 23.77  ? 438 CYS A O   1 
ATOM   499  C CB  . CYS A 1 70  ? 7.564   -17.437 13.919  1.00 22.21  ? 438 CYS A CB  1 
ATOM   500  S SG  . CYS A 1 70  ? 8.326   -19.012 14.351  1.00 37.05  ? 438 CYS A SG  1 
ATOM   501  N N   . ALA A 1 71  ? 6.632   -15.696 11.336  1.00 22.85  ? 439 ALA A N   1 
ATOM   502  C CA  . ALA A 1 71  ? 6.185   -14.319 11.041  1.00 21.64  ? 439 ALA A CA  1 
ATOM   503  C C   . ALA A 1 71  ? 6.789   -13.866 9.736   1.00 26.24  ? 439 ALA A C   1 
ATOM   504  O O   . ALA A 1 71  ? 7.838   -14.374 9.280   1.00 23.71  ? 439 ALA A O   1 
ATOM   505  C CB  . ALA A 1 71  ? 6.515   -13.285 12.216  1.00 24.63  ? 439 ALA A CB  1 
ATOM   506  N N   . CYS A 1 72  ? 6.079   -12.953 9.048   1.00 22.14  ? 440 CYS A N   1 
ATOM   507  C CA  . CYS A 1 72  ? 6.603   -12.415 7.799   1.00 21.78  ? 440 CYS A CA  1 
ATOM   508  C C   . CYS A 1 72  ? 6.156   -10.975 7.788   1.00 26.79  ? 440 CYS A C   1 
ATOM   509  O O   . CYS A 1 72  ? 4.922   -10.705 7.812   1.00 24.78  ? 440 CYS A O   1 
ATOM   510  C CB  . CYS A 1 72  ? 6.047   -13.095 6.535   1.00 16.28  ? 440 CYS A CB  1 
ATOM   511  S SG  . CYS A 1 72  ? 6.951   -12.601 5.081   1.00 24.60  ? 440 CYS A SG  1 
ATOM   512  N N   . ASP A 1 73  ? 7.133   -10.048 7.764   1.00 25.52  ? 441 ASP A N   1 
ATOM   513  C CA  . ASP A 1 73  ? 6.766   -8.611  8.068   1.00 27.49  ? 441 ASP A CA  1 
ATOM   514  C C   . ASP A 1 73  ? 7.515   -7.698  7.132   1.00 29.12  ? 441 ASP A C   1 
ATOM   515  O O   . ASP A 1 73  ? 8.671   -7.933  6.839   1.00 26.96  ? 441 ASP A O   1 
ATOM   516  C CB  . ASP A 1 73  ? 7.173   -8.226  9.480   1.00 34.82  ? 441 ASP A CB  1 
ATOM   517  C CG  . ASP A 1 73  ? 6.185   -8.706  10.499  1.00 47.77  ? 441 ASP A CG  1 
ATOM   518  O OD1 . ASP A 1 73  ? 6.521   -9.591  11.291  1.00 51.06  ? 441 ASP A OD1 1 
ATOM   519  O OD2 . ASP A 1 73  ? 5.032   -8.249  10.448  1.00 61.02  ? 441 ASP A OD2 1 
ATOM   520  N N   . LEU A 1 74  ? 6.845   -6.684  6.632   1.00 27.49  ? 442 LEU A N   1 
ATOM   521  C CA  . LEU A 1 74  ? 7.497   -5.699  5.804   1.00 36.09  ? 442 LEU A CA  1 
ATOM   522  C C   . LEU A 1 74  ? 8.514   -4.960  6.705   1.00 36.46  ? 442 LEU A C   1 
ATOM   523  O O   . LEU A 1 74  ? 8.176   -4.610  7.843   1.00 39.04  ? 442 LEU A O   1 
ATOM   524  C CB  . LEU A 1 74  ? 6.399   -4.757  5.289   1.00 42.10  ? 442 LEU A CB  1 
ATOM   525  C CG  . LEU A 1 74  ? 6.945   -3.497  4.629   1.00 45.69  ? 442 LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 74  ? 7.626   -3.871  3.317   1.00 37.97  ? 442 LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 74  ? 5.822   -2.486  4.448   1.00 38.51  ? 442 LEU A CD2 1 
ATOM   528  N N   . ALA A 1 75  ? 9.774   -4.877  6.323   1.00 38.58  ? 443 ALA A N   1 
ATOM   529  C CA  . ALA A 1 75  ? 10.739  -4.313  7.314   1.00 46.51  ? 443 ALA A CA  1 
ATOM   530  C C   . ALA A 1 75  ? 10.885  -2.805  7.047   1.00 54.38  ? 443 ALA A C   1 
ATOM   531  O O   . ALA A 1 75  ? 10.906  -1.990  7.969   1.00 62.76  ? 443 ALA A O   1 
ATOM   532  C CB  . ALA A 1 75  ? 12.085  -5.030  7.256   1.00 38.34  ? 443 ALA A CB  1 
ATOM   533  N N   . GLU A 1 76  ? 10.953  -2.449  5.774   1.00 50.37  ? 444 GLU A N   1 
ATOM   534  C CA  . GLU A 1 76  ? 10.747  -1.071  5.376   1.00 62.06  ? 444 GLU A CA  1 
ATOM   535  C C   . GLU A 1 76  ? 10.533  -1.038  3.874   1.00 63.20  ? 444 GLU A C   1 
ATOM   536  O O   . GLU A 1 76  ? 11.012  -1.934  3.134   1.00 60.94  ? 444 GLU A O   1 
ATOM   537  C CB  . GLU A 1 76  ? 11.962  -0.200  5.728   1.00 64.42  ? 444 GLU A CB  1 
ATOM   538  C CG  . GLU A 1 76  ? 12.832  0.067   4.519   1.00 75.87  ? 444 GLU A CG  1 
ATOM   539  C CD  . GLU A 1 76  ? 14.312  0.017   4.807   1.00 90.32  ? 444 GLU A CD  1 
ATOM   540  O OE1 . GLU A 1 76  ? 14.694  -0.281  5.979   1.00 79.72  ? 444 GLU A OE1 1 
ATOM   541  O OE2 . GLU A 1 76  ? 15.076  0.281   3.838   1.00 85.55  ? 444 GLU A OE2 1 
ATOM   542  N N   . GLU A 1 77  ? 9.835   0.016   3.434   1.00 66.89  ? 445 GLU A N   1 
ATOM   543  C CA  . GLU A 1 77  ? 9.607   0.290   2.032   1.00 62.29  ? 445 GLU A CA  1 
ATOM   544  C C   . GLU A 1 77  ? 10.258  1.638   1.707   1.00 72.71  ? 445 GLU A C   1 
ATOM   545  O O   . GLU A 1 77  ? 9.769   2.677   2.167   1.00 56.74  ? 445 GLU A O   1 
ATOM   546  C CB  . GLU A 1 77  ? 8.114   0.370   1.799   1.00 70.39  ? 445 GLU A CB  1 
ATOM   547  C CG  . GLU A 1 77  ? 7.645   0.058   0.385   1.00 71.75  ? 445 GLU A CG  1 
ATOM   548  C CD  . GLU A 1 77  ? 6.134   -0.073  0.363   1.00 77.87  ? 445 GLU A CD  1 
ATOM   549  O OE1 . GLU A 1 77  ? 5.491   0.477   1.286   1.00 87.42  ? 445 GLU A OE1 1 
ATOM   550  O OE2 . GLU A 1 77  ? 5.580   -0.716  -0.549  1.00 74.19  ? 445 GLU A OE2 1 
ATOM   551  N N   . LYS A 1 78  ? 11.369  1.586   0.958   1.00 75.68  ? 446 LYS A N   1 
ATOM   552  C CA  . LYS A 1 78  ? 12.184  2.753   0.558   1.00 79.38  ? 446 LYS A CA  1 
ATOM   553  C C   . LYS A 1 78  ? 11.501  3.554   -0.560  1.00 81.85  ? 446 LYS A C   1 
ATOM   554  O O   . LYS A 1 78  ? 11.129  4.720   -0.361  1.00 71.54  ? 446 LYS A O   1 
ATOM   555  C CB  . LYS A 1 78  ? 13.542  2.280   0.040   1.00 78.08  ? 446 LYS A CB  1 
ATOM   556  C CG  . LYS A 1 78  ? 14.764  2.649   0.861   1.00 75.65  ? 446 LYS A CG  1 
ATOM   557  C CD  . LYS A 1 78  ? 16.019  2.388   0.002   1.00 88.99  ? 446 LYS A CD  1 
ATOM   558  C CE  . LYS A 1 78  ? 16.012  3.083   -1.378  1.00 87.87  ? 446 LYS A CE  1 
ATOM   559  N NZ  . LYS A 1 78  ? 15.978  4.577   -1.230  1.00 74.77  ? 446 LYS A NZ  1 
ATOM   560  N N   . SER A 1 79  ? 11.379  2.913   -1.728  1.00 70.21  ? 447 SER A N   1 
ATOM   561  C CA  . SER A 1 79  ? 10.729  3.448   -2.915  1.00 68.89  ? 447 SER A CA  1 
ATOM   562  C C   . SER A 1 79  ? 9.768   2.365   -3.424  1.00 72.49  ? 447 SER A C   1 
ATOM   563  O O   . SER A 1 79  ? 9.649   1.296   -2.792  1.00 65.53  ? 447 SER A O   1 
ATOM   564  C CB  . SER A 1 79  ? 11.761  3.791   -4.000  1.00 65.40  ? 447 SER A CB  1 
ATOM   565  O OG  . SER A 1 79  ? 12.708  2.760   -4.222  1.00 64.92  ? 447 SER A OG  1 
ATOM   566  N N   . PRO A 1 80  ? 9.031   2.654   -4.519  1.00 70.54  ? 448 PRO A N   1 
ATOM   567  C CA  . PRO A 1 80  ? 8.447   1.557   -5.331  1.00 64.93  ? 448 PRO A CA  1 
ATOM   568  C C   . PRO A 1 80  ? 9.499   0.511   -5.790  1.00 58.74  ? 448 PRO A C   1 
ATOM   569  O O   . PRO A 1 80  ? 9.184   -0.632  -6.217  1.00 50.52  ? 448 PRO A O   1 
ATOM   570  C CB  . PRO A 1 80  ? 7.816   2.323   -6.519  1.00 67.83  ? 448 PRO A CB  1 
ATOM   571  C CG  . PRO A 1 80  ? 7.325   3.601   -5.858  1.00 67.16  ? 448 PRO A CG  1 
ATOM   572  C CD  . PRO A 1 80  ? 8.342   3.948   -4.775  1.00 63.38  ? 448 PRO A CD  1 
ATOM   573  N N   . SER A 1 81  ? 10.756  0.866   -5.647  1.00 56.36  ? 449 SER A N   1 
ATOM   574  C CA  . SER A 1 81  ? 11.797  0.070   -6.260  1.00 59.40  ? 449 SER A CA  1 
ATOM   575  C C   . SER A 1 81  ? 12.531  -0.864  -5.303  1.00 49.59  ? 449 SER A C   1 
ATOM   576  O O   . SER A 1 81  ? 13.153  -1.843  -5.751  1.00 47.77  ? 449 SER A O   1 
ATOM   577  C CB  . SER A 1 81  ? 12.812  1.027   -6.863  1.00 65.07  ? 449 SER A CB  1 
ATOM   578  O OG  . SER A 1 81  ? 13.499  0.353   -7.876  1.00 66.47  ? 449 SER A OG  1 
ATOM   579  N N   . HIS A 1 82  ? 12.530  -0.514  -4.013  1.00 51.79  ? 450 HIS A N   1 
ATOM   580  C CA  . HIS A 1 82  ? 13.262  -1.289  -2.979  1.00 59.21  ? 450 HIS A CA  1 
ATOM   581  C C   . HIS A 1 82  ? 12.381  -1.400  -1.796  1.00 58.96  ? 450 HIS A C   1 
ATOM   582  O O   . HIS A 1 82  ? 11.945  -0.374  -1.231  1.00 61.69  ? 450 HIS A O   1 
ATOM   583  C CB  . HIS A 1 82  ? 14.637  -0.689  -2.611  1.00 62.65  ? 450 HIS A CB  1 
ATOM   584  C CG  . HIS A 1 82  ? 15.582  -0.616  -3.797  1.00 79.75  ? 450 HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 82  ? 16.049  -1.730  -4.431  1.00 84.12  ? 450 HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 82  ? 16.106  0.482   -4.498  1.00 85.02  ? 450 HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 82  ? 16.842  -1.371  -5.471  1.00 78.36  ? 450 HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 82  ? 16.876  -0.018  -5.516  1.00 88.63  ? 450 HIS A NE2 1 
ATOM   589  N N   . ALA A 1 83  ? 12.000  -2.636  -1.456  1.00 44.59  ? 451 ALA A N   1 
ATOM   590  C CA  . ALA A 1 83  ? 11.405  -2.837  -0.126  1.00 37.06  ? 451 ALA A CA  1 
ATOM   591  C C   . ALA A 1 83  ? 12.080  -4.098  0.385   1.00 28.48  ? 451 ALA A C   1 
ATOM   592  O O   . ALA A 1 83  ? 12.555  -4.932  -0.413  1.00 31.80  ? 451 ALA A O   1 
ATOM   593  C CB  . ALA A 1 83  ? 9.869   -2.979  -0.185  1.00 34.73  ? 451 ALA A CB  1 
ATOM   594  N N   . ILE A 1 84  ? 12.051  -4.205  1.691   1.00 31.81  ? 452 ILE A N   1 
ATOM   595  C CA  . ILE A 1 84  ? 12.746  -5.300  2.430   1.00 33.62  ? 452 ILE A CA  1 
ATOM   596  C C   . ILE A 1 84  ? 11.691  -5.923  3.348   1.00 29.88  ? 452 ILE A C   1 
ATOM   597  O O   . ILE A 1 84  ? 10.934  -5.208  4.060   1.00 29.88  ? 452 ILE A O   1 
ATOM   598  C CB  . ILE A 1 84  ? 13.917  -4.757  3.328   1.00 33.72  ? 452 ILE A CB  1 
ATOM   599  C CG1 . ILE A 1 84  ? 14.940  -4.001  2.426   1.00 35.63  ? 452 ILE A CG1 1 
ATOM   600  C CG2 . ILE A 1 84  ? 14.643  -5.875  4.086   1.00 30.60  ? 452 ILE A CG2 1 
ATOM   601  C CD1 . ILE A 1 84  ? 16.016  -3.236  3.212   1.00 35.63  ? 452 ILE A CD1 1 
ATOM   602  N N   . PHE A 1 85  ? 11.703  -7.258  3.367   1.00 26.73  ? 453 PHE A N   1 
ATOM   603  C CA  . PHE A 1 85  ? 10.836  -7.941  4.343   1.00 22.78  ? 453 PHE A CA  1 
ATOM   604  C C   . PHE A 1 85  ? 11.682  -8.973  5.130   1.00 23.07  ? 453 PHE A C   1 
ATOM   605  O O   . PHE A 1 85  ? 12.779  -9.371  4.685   1.00 25.07  ? 453 PHE A O   1 
ATOM   606  C CB  . PHE A 1 85  ? 9.647   -8.603  3.567   1.00 20.94  ? 453 PHE A CB  1 
ATOM   607  C CG  . PHE A 1 85  ? 10.023  -9.714  2.693   1.00 22.62  ? 453 PHE A CG  1 
ATOM   608  C CD1 . PHE A 1 85  ? 10.389  -9.529  1.357   1.00 23.29  ? 453 PHE A CD1 1 
ATOM   609  C CD2 . PHE A 1 85  ? 9.919   -11.045 3.203   1.00 25.85  ? 453 PHE A CD2 1 
ATOM   610  C CE1 . PHE A 1 85  ? 10.614  -10.586 0.518   1.00 24.36  ? 453 PHE A CE1 1 
ATOM   611  C CE2 . PHE A 1 85  ? 10.213  -12.093 2.372   1.00 24.65  ? 453 PHE A CE2 1 
ATOM   612  C CZ  . PHE A 1 85  ? 10.582  -11.857 1.024   1.00 24.47  ? 453 PHE A CZ  1 
ATOM   613  N N   . LYS A 1 86  ? 11.136  -9.355  6.270   1.00 21.47  ? 454 LYS A N   1 
ATOM   614  C CA  . LYS A 1 86  ? 11.811  -10.182 7.174   1.00 22.52  ? 454 LYS A CA  1 
ATOM   615  C C   . LYS A 1 86  ? 10.968  -11.442 7.351   1.00 23.77  ? 454 LYS A C   1 
ATOM   616  O O   . LYS A 1 86  ? 9.805   -11.320 7.694   1.00 26.53  ? 454 LYS A O   1 
ATOM   617  C CB  . LYS A 1 86  ? 11.815  -9.455  8.503   1.00 20.98  ? 454 LYS A CB  1 
ATOM   618  C CG  . LYS A 1 86  ? 12.594  -10.266 9.561   1.00 27.15  ? 454 LYS A CG  1 
ATOM   619  C CD  . LYS A 1 86  ? 12.436  -9.466  10.826  1.00 31.76  ? 454 LYS A CD  1 
ATOM   620  C CE  . LYS A 1 86  ? 13.354  -10.011 11.868  1.00 37.77  ? 454 LYS A CE  1 
ATOM   621  N NZ  . LYS A 1 86  ? 13.083  -9.173  13.046  1.00 44.82  ? 454 LYS A NZ  1 
ATOM   622  N N   . LEU A 1 87  ? 11.582  -12.607 7.189   1.00 24.40  ? 455 LEU A N   1 
ATOM   623  C CA  . LEU A 1 87  ? 10.913  -13.862 7.535   1.00 21.84  ? 455 LEU A CA  1 
ATOM   624  C C   . LEU A 1 87  ? 11.507  -14.477 8.761   1.00 25.65  ? 455 LEU A C   1 
ATOM   625  O O   . LEU A 1 87  ? 12.728  -14.708 8.805   1.00 23.95  ? 455 LEU A O   1 
ATOM   626  C CB  . LEU A 1 87  ? 11.115  -14.802 6.327   1.00 24.56  ? 455 LEU A CB  1 
ATOM   627  C CG  . LEU A 1 87  ? 10.472  -16.215 6.391   1.00 27.64  ? 455 LEU A CG  1 
ATOM   628  C CD1 . LEU A 1 87  ? 8.919   -16.080 6.347   1.00 23.34  ? 455 LEU A CD1 1 
ATOM   629  C CD2 . LEU A 1 87  ? 10.941  -17.111 5.257   1.00 28.52  ? 455 LEU A CD2 1 
ATOM   630  N N   . THR A 1 88  ? 10.679  -14.801 9.744   1.00 22.72  ? 456 THR A N   1 
ATOM   631  C CA  . THR A 1 88  ? 11.118  -15.429 10.976  1.00 23.47  ? 456 THR A CA  1 
ATOM   632  C C   . THR A 1 88  ? 10.603  -16.858 11.036  1.00 27.71  ? 456 THR A C   1 
ATOM   633  O O   . THR A 1 88  ? 9.463   -17.160 10.579  1.00 20.92  ? 456 THR A O   1 
ATOM   634  C CB  . THR A 1 88  ? 10.579  -14.631 12.187  1.00 26.91  ? 456 THR A CB  1 
ATOM   635  O OG1 . THR A 1 88  ? 11.115  -13.343 12.096  1.00 28.37  ? 456 THR A OG1 1 
ATOM   636  C CG2 . THR A 1 88  ? 11.088  -15.203 13.498  1.00 24.63  ? 456 THR A CG2 1 
ATOM   637  N N   . TYR A 1 89  ? 11.454  -17.771 11.476  1.00 23.11  ? 457 TYR A N   1 
ATOM   638  C CA  . TYR A 1 89  ? 11.025  -19.210 11.559  1.00 22.74  ? 457 TYR A CA  1 
ATOM   639  C C   . TYR A 1 89  ? 11.794  -19.887 12.686  1.00 28.22  ? 457 TYR A C   1 
ATOM   640  O O   . TYR A 1 89  ? 12.807  -19.290 13.223  1.00 22.59  ? 457 TYR A O   1 
ATOM   641  C CB  . TYR A 1 89  ? 11.256  -19.904 10.275  1.00 22.61  ? 457 TYR A CB  1 
ATOM   642  C CG  . TYR A 1 89  ? 12.675  -20.045 9.804   1.00 25.63  ? 457 TYR A CG  1 
ATOM   643  C CD1 . TYR A 1 89  ? 13.330  -21.283 9.878   1.00 24.40  ? 457 TYR A CD1 1 
ATOM   644  C CD2 . TYR A 1 89  ? 13.362  -18.941 9.221   1.00 31.41  ? 457 TYR A CD2 1 
ATOM   645  C CE1 . TYR A 1 89  ? 14.649  -21.392 9.479   1.00 25.83  ? 457 TYR A CE1 1 
ATOM   646  C CE2 . TYR A 1 89  ? 14.661  -19.070 8.732   1.00 27.71  ? 457 TYR A CE2 1 
ATOM   647  C CZ  . TYR A 1 89  ? 15.266  -20.294 8.864   1.00 32.41  ? 457 TYR A CZ  1 
ATOM   648  O OH  . TYR A 1 89  ? 16.522  -20.435 8.377   1.00 34.01  ? 457 TYR A OH  1 
ATOM   649  N N   . LEU A 1 90  ? 11.388  -21.108 13.044  1.00 21.37  ? 458 LEU A N   1 
ATOM   650  C CA  . LEU A 1 90  ? 12.007  -21.833 14.134  1.00 21.43  ? 458 LEU A CA  1 
ATOM   651  C C   . LEU A 1 90  ? 12.883  -22.855 13.506  1.00 22.11  ? 458 LEU A C   1 
ATOM   652  O O   . LEU A 1 90  ? 12.492  -23.542 12.519  1.00 26.50  ? 458 LEU A O   1 
ATOM   653  C CB  . LEU A 1 90  ? 10.915  -22.427 14.952  1.00 24.93  ? 458 LEU A CB  1 
ATOM   654  C CG  . LEU A 1 90  ? 10.835  -22.677 16.395  1.00 35.86  ? 458 LEU A CG  1 
ATOM   655  C CD1 . LEU A 1 90  ? 11.667  -21.750 17.269  1.00 28.78  ? 458 LEU A CD1 1 
ATOM   656  C CD2 . LEU A 1 90  ? 9.329   -22.726 16.722  1.00 30.28  ? 458 LEU A CD2 1 
ATOM   657  N N   . SER A 1 91  ? 14.153  -22.900 13.929  1.00 21.80  ? 459 SER A N   1 
ATOM   658  C CA  . SER A 1 91  ? 15.057  -23.897 13.361  1.00 24.96  ? 459 SER A CA  1 
ATOM   659  C C   . SER A 1 91  ? 15.874  -24.494 14.545  1.00 26.23  ? 459 SER A C   1 
ATOM   660  O O   . SER A 1 91  ? 16.523  -23.747 15.251  1.00 24.25  ? 459 SER A O   1 
ATOM   661  C CB  . SER A 1 91  ? 16.036  -23.167 12.427  1.00 28.90  ? 459 SER A CB  1 
ATOM   662  O OG  . SER A 1 91  ? 16.963  -24.121 12.092  1.00 33.58  ? 459 SER A OG  1 
ATOM   663  N N   . ASN A 1 92  ? 15.776  -25.787 14.773  1.00 27.01  ? 460 ASN A N   1 
ATOM   664  C CA  . ASN A 1 92  ? 16.385  -26.437 15.911  1.00 29.74  ? 460 ASN A CA  1 
ATOM   665  C C   . ASN A 1 92  ? 16.275  -25.657 17.213  1.00 25.84  ? 460 ASN A C   1 
ATOM   666  O O   . ASN A 1 92  ? 17.298  -25.350 17.814  1.00 25.63  ? 460 ASN A O   1 
ATOM   667  C CB  . ASN A 1 92  ? 17.849  -26.718 15.563  1.00 34.54  ? 460 ASN A CB  1 
ATOM   668  C CG  . ASN A 1 92  ? 18.402  -27.834 16.433  1.00 56.78  ? 460 ASN A CG  1 
ATOM   669  O OD1 . ASN A 1 92  ? 17.666  -28.788 16.815  1.00 60.33  ? 460 ASN A OD1 1 
ATOM   670  N ND2 . ASN A 1 92  ? 19.687  -27.706 16.812  1.00 63.07  ? 460 ASN A ND2 1 
ATOM   671  N N   . HIS A 1 93  ? 15.074  -25.190 17.536  1.00 21.25  ? 461 HIS A N   1 
ATOM   672  C CA  . HIS A 1 93  ? 14.654  -24.596 18.818  1.00 21.98  ? 461 HIS A CA  1 
ATOM   673  C C   . HIS A 1 93  ? 15.020  -23.169 18.942  1.00 20.48  ? 461 HIS A C   1 
ATOM   674  O O   . HIS A 1 93  ? 14.872  -22.610 20.053  1.00 20.44  ? 461 HIS A O   1 
ATOM   675  C CB  . HIS A 1 93  ? 15.171  -25.385 20.096  1.00 27.05  ? 461 HIS A CB  1 
ATOM   676  C CG  . HIS A 1 93  ? 15.033  -26.888 19.959  1.00 29.76  ? 461 HIS A CG  1 
ATOM   677  N ND1 . HIS A 1 93  ? 13.913  -27.471 19.392  1.00 26.63  ? 461 HIS A ND1 1 
ATOM   678  C CD2 . HIS A 1 93  ? 15.905  -27.939 20.276  1.00 31.78  ? 461 HIS A CD2 1 
ATOM   679  C CE1 . HIS A 1 93  ? 14.113  -28.818 19.286  1.00 29.42  ? 461 HIS A CE1 1 
ATOM   680  N NE2 . HIS A 1 93  ? 15.279  -29.117 19.893  1.00 29.66  ? 461 HIS A NE2 1 
ATOM   681  N N   . ASP A 1 94  ? 15.563  -22.554 17.879  1.00 20.27  ? 462 ASP A N   1 
ATOM   682  C CA  . ASP A 1 94  ? 15.842  -21.078 17.998  1.00 22.57  ? 462 ASP A CA  1 
ATOM   683  C C   . ASP A 1 94  ? 15.051  -20.373 16.885  1.00 21.45  ? 462 ASP A C   1 
ATOM   684  O O   . ASP A 1 94  ? 14.948  -20.964 15.767  1.00 20.84  ? 462 ASP A O   1 
ATOM   685  C CB  . ASP A 1 94  ? 17.309  -20.878 17.603  1.00 26.04  ? 462 ASP A CB  1 
ATOM   686  C CG  . ASP A 1 94  ? 18.292  -21.441 18.682  1.00 31.76  ? 462 ASP A CG  1 
ATOM   687  O OD1 . ASP A 1 94  ? 18.178  -21.040 19.834  1.00 34.03  ? 462 ASP A OD1 1 
ATOM   688  O OD2 . ASP A 1 94  ? 19.239  -22.146 18.343  1.00 36.90  ? 462 ASP A OD2 1 
ATOM   689  N N   . TYR A 1 95  ? 14.696  -19.103 17.086  1.00 22.85  ? 463 TYR A N   1 
ATOM   690  C CA  . TYR A 1 95  ? 14.089  -18.263 16.039  1.00 23.77  ? 463 TYR A CA  1 
ATOM   691  C C   . TYR A 1 95  ? 15.214  -17.811 15.141  1.00 29.27  ? 463 TYR A C   1 
ATOM   692  O O   . TYR A 1 95  ? 16.199  -17.242 15.622  1.00 28.84  ? 463 TYR A O   1 
ATOM   693  C CB  . TYR A 1 95  ? 13.428  -17.052 16.637  1.00 24.80  ? 463 TYR A CB  1 
ATOM   694  C CG  . TYR A 1 95  ? 12.223  -17.422 17.423  1.00 27.00  ? 463 TYR A CG  1 
ATOM   695  C CD1 . TYR A 1 95  ? 12.111  -17.072 18.745  1.00 28.72  ? 463 TYR A CD1 1 
ATOM   696  C CD2 . TYR A 1 95  ? 11.150  -18.104 16.804  1.00 30.95  ? 463 TYR A CD2 1 
ATOM   697  C CE1 . TYR A 1 95  ? 11.034  -17.426 19.505  1.00 31.47  ? 463 TYR A CE1 1 
ATOM   698  C CE2 . TYR A 1 95  ? 10.054  -18.476 17.546  1.00 32.26  ? 463 TYR A CE2 1 
ATOM   699  C CZ  . TYR A 1 95  ? 9.992   -18.135 18.873  1.00 30.83  ? 463 TYR A CZ  1 
ATOM   700  O OH  . TYR A 1 95  ? 8.893   -18.530 19.580  1.00 35.02  ? 463 TYR A OH  1 
ATOM   701  N N   . LYS A 1 96  ? 15.091  -18.032 13.853  1.00 22.33  ? 464 LYS A N   1 
ATOM   702  C CA  . LYS A 1 96  ? 16.005  -17.474 12.916  1.00 27.34  ? 464 LYS A CA  1 
ATOM   703  C C   . LYS A 1 96  ? 15.296  -16.446 12.063  1.00 30.34  ? 464 LYS A C   1 
ATOM   704  O O   . LYS A 1 96  ? 14.048  -16.517 11.882  1.00 25.49  ? 464 LYS A O   1 
ATOM   705  C CB  . LYS A 1 96  ? 16.560  -18.562 12.048  1.00 27.67  ? 464 LYS A CB  1 
ATOM   706  C CG  . LYS A 1 96  ? 17.364  -19.567 12.882  1.00 37.89  ? 464 LYS A CG  1 
ATOM   707  C CD  . LYS A 1 96  ? 18.736  -19.821 12.275  1.00 51.29  ? 464 LYS A CD  1 
ATOM   708  C CE  . LYS A 1 96  ? 19.157  -21.278 12.545  1.00 63.87  ? 464 LYS A CE  1 
ATOM   709  N NZ  . LYS A 1 96  ? 20.114  -21.783 11.483  1.00 60.24  ? 464 LYS A NZ  1 
ATOM   710  N N   . HIS A 1 97  ? 16.048  -15.538 11.448  1.00 25.04  ? 465 HIS A N   1 
ATOM   711  C CA  . HIS A 1 97  ? 15.413  -14.367 10.719  1.00 28.31  ? 465 HIS A CA  1 
ATOM   712  C C   . HIS A 1 97  ? 16.135  -14.250 9.431   1.00 35.05  ? 465 HIS A C   1 
ATOM   713  O O   . HIS A 1 97  ? 17.361  -14.322 9.419   1.00 32.99  ? 465 HIS A O   1 
ATOM   714  C CB  . HIS A 1 97  ? 15.630  -13.060 11.504  1.00 31.31  ? 465 HIS A CB  1 
ATOM   715  C CG  . HIS A 1 97  ? 15.179  -13.147 12.896  1.00 32.11  ? 465 HIS A CG  1 
ATOM   716  N ND1 . HIS A 1 97  ? 13.869  -13.133 13.246  1.00 38.52  ? 465 HIS A ND1 1 
ATOM   717  C CD2 . HIS A 1 97  ? 15.895  -13.299 14.080  1.00 36.53  ? 465 HIS A CD2 1 
ATOM   718  C CE1 . HIS A 1 97  ? 13.743  -13.253 14.613  1.00 36.66  ? 465 HIS A CE1 1 
ATOM   719  N NE2 . HIS A 1 97  ? 14.985  -13.388 15.113  1.00 37.34  ? 465 HIS A NE2 1 
ATOM   720  N N   . LEU A 1 98  ? 15.440  -14.179 8.322   1.00 26.48  ? 466 LEU A N   1 
ATOM   721  C CA  . LEU A 1 98  ? 16.047  -13.929 7.009   1.00 26.98  ? 466 LEU A CA  1 
ATOM   722  C C   . LEU A 1 98  ? 15.463  -12.641 6.391   1.00 29.48  ? 466 LEU A C   1 
ATOM   723  O O   . LEU A 1 98  ? 14.255  -12.284 6.643   1.00 26.59  ? 466 LEU A O   1 
ATOM   724  C CB  . LEU A 1 98  ? 15.716  -15.060 6.111   1.00 26.33  ? 466 LEU A CB  1 
ATOM   725  C CG  . LEU A 1 98  ? 16.196  -16.466 6.425   1.00 28.48  ? 466 LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 98  ? 15.562  -17.376 5.443   1.00 32.10  ? 466 LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 98  ? 17.726  -16.602 6.328   1.00 31.14  ? 466 LEU A CD2 1 
ATOM   728  N N   . TYR A 1 99  ? 16.289  -11.924 5.621   1.00 30.69  ? 467 TYR A N   1 
ATOM   729  C CA  . TYR A 1 99  ? 15.892  -10.599 5.066   1.00 25.13  ? 467 TYR A CA  1 
ATOM   730  C C   . TYR A 1 99  ? 16.000  -10.691 3.595   1.00 28.94  ? 467 TYR A C   1 
ATOM   731  O O   . TYR A 1 99  ? 16.954  -11.292 3.084   1.00 29.30  ? 467 TYR A O   1 
ATOM   732  C CB  . TYR A 1 99  ? 16.751  -9.436  5.562   1.00 28.42  ? 467 TYR A CB  1 
ATOM   733  C CG  . TYR A 1 99  ? 16.563  -9.145  6.959   1.00 26.19  ? 467 TYR A CG  1 
ATOM   734  C CD1 . TYR A 1 99  ? 15.605  -8.249  7.362   1.00 29.00  ? 467 TYR A CD1 1 
ATOM   735  C CD2 . TYR A 1 99  ? 17.328  -9.813  7.933   1.00 34.32  ? 467 TYR A CD2 1 
ATOM   736  C CE1 . TYR A 1 99  ? 15.413  -7.972  8.703   1.00 32.86  ? 467 TYR A CE1 1 
ATOM   737  C CE2 . TYR A 1 99  ? 17.149  -9.562  9.283   1.00 36.57  ? 467 TYR A CE2 1 
ATOM   738  C CZ  . TYR A 1 99  ? 16.211  -8.658  9.663   1.00 38.72  ? 467 TYR A CZ  1 
ATOM   739  O OH  . TYR A 1 99  ? 16.034  -8.496  11.026  1.00 42.98  ? 467 TYR A OH  1 
ATOM   740  N N   . PHE A 1 100 ? 14.975  -10.151 2.882   1.00 26.68  ? 468 PHE A N   1 
ATOM   741  C CA  . PHE A 1 100 ? 15.003  -10.212 1.444   1.00 24.92  ? 468 PHE A CA  1 
ATOM   742  C C   . PHE A 1 100 ? 14.608  -8.800  0.918   1.00 23.96  ? 468 PHE A C   1 
ATOM   743  O O   . PHE A 1 100 ? 13.925  -8.053  1.605   1.00 26.94  ? 468 PHE A O   1 
ATOM   744  C CB  . PHE A 1 100 ? 14.050  -11.260 0.895   1.00 25.41  ? 468 PHE A CB  1 
ATOM   745  C CG  . PHE A 1 100 ? 14.330  -12.658 1.397   1.00 24.16  ? 468 PHE A CG  1 
ATOM   746  C CD1 . PHE A 1 100 ? 15.122  -13.518 0.666   1.00 25.16  ? 468 PHE A CD1 1 
ATOM   747  C CD2 . PHE A 1 100 ? 13.681  -13.127 2.546   1.00 26.93  ? 468 PHE A CD2 1 
ATOM   748  C CE1 . PHE A 1 100 ? 15.333  -14.828 1.104   1.00 27.87  ? 468 PHE A CE1 1 
ATOM   749  C CE2 . PHE A 1 100 ? 13.873  -14.434 2.996   1.00 24.55  ? 468 PHE A CE2 1 
ATOM   750  C CZ  . PHE A 1 100 ? 14.687  -15.291 2.283   1.00 23.02  ? 468 PHE A CZ  1 
ATOM   751  N N   . GLU A 1 101 ? 15.067  -8.436  -0.273  1.00 29.49  ? 469 GLU A N   1 
ATOM   752  C CA  . GLU A 1 101 ? 14.534  -7.168  -0.813  1.00 29.20  ? 469 GLU A CA  1 
ATOM   753  C C   . GLU A 1 101 ? 14.174  -7.396  -2.253  1.00 27.50  ? 469 GLU A C   1 
ATOM   754  O O   . GLU A 1 101 ? 14.732  -8.259  -2.891  1.00 26.35  ? 469 GLU A O   1 
ATOM   755  C CB  . GLU A 1 101 ? 15.526  -5.984  -0.691  1.00 41.32  ? 469 GLU A CB  1 
ATOM   756  C CG  . GLU A 1 101 ? 16.769  -6.122  -1.524  1.00 37.37  ? 469 GLU A CG  1 
ATOM   757  C CD  . GLU A 1 101 ? 17.518  -4.742  -1.730  1.00 53.69  ? 469 GLU A CD  1 
ATOM   758  O OE1 . GLU A 1 101 ? 17.184  -3.676  -1.125  1.00 51.43  ? 469 GLU A OE1 1 
ATOM   759  O OE2 . GLU A 1 101 ? 18.463  -4.738  -2.542  1.00 47.85  ? 469 GLU A OE2 1 
ATOM   760  N N   . SER A 1 102 ? 13.228  -6.597  -2.737  1.00 31.45  ? 470 SER A N   1 
ATOM   761  C CA  . SER A 1 102 ? 12.842  -6.666  -4.128  1.00 35.47  ? 470 SER A CA  1 
ATOM   762  C C   . SER A 1 102 ? 12.078  -5.350  -4.409  1.00 32.75  ? 470 SER A C   1 
ATOM   763  O O   . SER A 1 102 ? 11.984  -4.480  -3.558  1.00 33.39  ? 470 SER A O   1 
ATOM   764  C CB  . SER A 1 102 ? 11.894  -7.882  -4.356  1.00 36.57  ? 470 SER A CB  1 
ATOM   765  O OG  . SER A 1 102 ? 11.788  -8.161  -5.745  1.00 36.43  ? 470 SER A OG  1 
ATOM   766  N N   . ASP A 1 103 ? 11.417  -5.234  -5.542  1.00 37.54  ? 471 ASP A N   1 
ATOM   767  C CA  . ASP A 1 103 ? 10.484  -4.066  -5.687  1.00 37.10  ? 471 ASP A CA  1 
ATOM   768  C C   . ASP A 1 103 ? 9.310   -4.163  -4.707  1.00 41.31  ? 471 ASP A C   1 
ATOM   769  O O   . ASP A 1 103 ? 9.010   -5.271  -4.146  1.00 31.96  ? 471 ASP A O   1 
ATOM   770  C CB  . ASP A 1 103 ? 9.971   -3.965  -7.130  1.00 41.83  ? 471 ASP A CB  1 
ATOM   771  C CG  . ASP A 1 103 ? 9.100   -5.131  -7.498  1.00 37.25  ? 471 ASP A CG  1 
ATOM   772  O OD1 . ASP A 1 103 ? 7.850   -5.061  -7.294  1.00 44.24  ? 471 ASP A OD1 1 
ATOM   773  O OD2 . ASP A 1 103 ? 9.684   -6.132  -7.904  1.00 38.02  ? 471 ASP A OD2 1 
ATOM   774  N N   . ALA A 1 104 ? 8.650   -3.037  -4.450  1.00 34.08  ? 472 ALA A N   1 
ATOM   775  C CA  . ALA A 1 104 ? 7.618   -3.039  -3.456  1.00 37.70  ? 472 ALA A CA  1 
ATOM   776  C C   . ALA A 1 104 ? 6.438   -3.976  -3.793  1.00 41.55  ? 472 ALA A C   1 
ATOM   777  O O   . ALA A 1 104 ? 5.809   -4.476  -2.831  1.00 32.37  ? 472 ALA A O   1 
ATOM   778  C CB  . ALA A 1 104 ? 7.085   -1.637  -3.143  1.00 33.24  ? 472 ALA A CB  1 
ATOM   779  N N   . ALA A 1 105 ? 6.137   -4.142  -5.101  1.00 35.36  ? 473 ALA A N   1 
ATOM   780  C CA  . ALA A 1 105 ? 4.948   -4.933  -5.582  1.00 39.79  ? 473 ALA A CA  1 
ATOM   781  C C   . ALA A 1 105 ? 5.172   -6.454  -5.212  1.00 36.52  ? 473 ALA A C   1 
ATOM   782  O O   . ALA A 1 105 ? 4.296   -7.096  -4.636  1.00 36.50  ? 473 ALA A O   1 
ATOM   783  C CB  . ALA A 1 105 ? 4.792   -4.808  -7.130  1.00 31.09  ? 473 ALA A CB  1 
ATOM   784  N N   . THR A 1 106 ? 6.312   -6.991  -5.651  1.00 31.33  ? 474 THR A N   1 
ATOM   785  C CA  . THR A 1 106 ? 6.832   -8.319  -5.267  1.00 36.26  ? 474 THR A CA  1 
ATOM   786  C C   . THR A 1 106 ? 6.851   -8.576  -3.802  1.00 32.84  ? 474 THR A C   1 
ATOM   787  O O   . THR A 1 106 ? 6.296   -9.596  -3.342  1.00 28.66  ? 474 THR A O   1 
ATOM   788  C CB  . THR A 1 106 ? 8.162   -8.545  -5.852  1.00 36.43  ? 474 THR A CB  1 
ATOM   789  O OG1 . THR A 1 106 ? 7.990   -8.458  -7.236  1.00 38.70  ? 474 THR A OG1 1 
ATOM   790  C CG2 . THR A 1 106 ? 8.691   -9.922  -5.540  1.00 31.93  ? 474 THR A CG2 1 
ATOM   791  N N   . VAL A 1 107 ? 7.361   -7.624  -3.049  1.00 26.50  ? 475 VAL A N   1 
ATOM   792  C CA  . VAL A 1 107 ? 7.465   -7.754  -1.585  1.00 28.05  ? 475 VAL A CA  1 
ATOM   793  C C   . VAL A 1 107 ? 6.096   -7.779  -0.988  1.00 33.50  ? 475 VAL A C   1 
ATOM   794  O O   . VAL A 1 107 ? 5.794   -8.624  -0.104  1.00 28.92  ? 475 VAL A O   1 
ATOM   795  C CB  . VAL A 1 107 ? 8.294   -6.606  -0.914  1.00 27.92  ? 475 VAL A CB  1 
ATOM   796  C CG1 . VAL A 1 107 ? 8.120   -6.559  0.591   1.00 22.73  ? 475 VAL A CG1 1 
ATOM   797  C CG2 . VAL A 1 107 ? 9.787   -6.819  -1.195  1.00 28.11  ? 475 VAL A CG2 1 
ATOM   798  N N   . ASN A 1 108 ? 5.231   -6.850  -1.368  1.00 28.93  ? 476 ASN A N   1 
ATOM   799  C CA  . ASN A 1 108 ? 3.897   -6.897  -0.762  1.00 33.72  ? 476 ASN A CA  1 
ATOM   800  C C   . ASN A 1 108 ? 3.112   -8.215  -1.103  1.00 24.45  ? 476 ASN A C   1 
ATOM   801  O O   . ASN A 1 108 ? 2.349   -8.687  -0.277  1.00 25.62  ? 476 ASN A O   1 
ATOM   802  C CB  . ASN A 1 108 ? 3.001   -5.710  -1.149  1.00 36.19  ? 476 ASN A CB  1 
ATOM   803  C CG  . ASN A 1 108 ? 3.463   -4.371  -0.572  1.00 47.20  ? 476 ASN A CG  1 
ATOM   804  O OD1 . ASN A 1 108 ? 3.858   -4.200  0.621   1.00 43.13  ? 476 ASN A OD1 1 
ATOM   805  N ND2 . ASN A 1 108 ? 3.327   -3.367  -1.411  1.00 55.63  ? 476 ASN A ND2 1 
ATOM   806  N N   . GLU A 1 109 ? 3.283   -8.712  -2.298  1.00 26.14  ? 477 GLU A N   1 
ATOM   807  C CA  . GLU A 1 109 ? 2.706   -9.967  -2.697  1.00 27.68  ? 477 GLU A CA  1 
ATOM   808  C C   . GLU A 1 109 ? 3.233   -11.139 -1.799  1.00 25.25  ? 477 GLU A C   1 
ATOM   809  O O   . GLU A 1 109 ? 2.430   -11.962 -1.340  1.00 20.75  ? 477 GLU A O   1 
ATOM   810  C CB  . GLU A 1 109 ? 2.943   -10.289 -4.188  1.00 28.48  ? 477 GLU A CB  1 
ATOM   811  C CG  . GLU A 1 109 ? 2.261   -11.569 -4.662  1.00 30.40  ? 477 GLU A CG  1 
ATOM   812  C CD  . GLU A 1 109 ? 2.621   -11.961 -6.084  1.00 37.62  ? 477 GLU A CD  1 
ATOM   813  O OE1 . GLU A 1 109 ? 3.247   -11.129 -6.762  1.00 37.24  ? 477 GLU A OE1 1 
ATOM   814  O OE2 . GLU A 1 109 ? 2.341   -13.102 -6.520  1.00 37.91  ? 477 GLU A OE2 1 
ATOM   815  N N   . ILE A 1 110 ? 4.548   -11.212 -1.576  1.00 23.40  ? 478 ILE A N   1 
ATOM   816  C CA  . ILE A 1 110 ? 5.113   -12.309 -0.719  1.00 22.91  ? 478 ILE A CA  1 
ATOM   817  C C   . ILE A 1 110 ? 4.598   -12.166 0.674   1.00 20.21  ? 478 ILE A C   1 
ATOM   818  O O   . ILE A 1 110 ? 4.231   -13.174 1.333   1.00 20.93  ? 478 ILE A O   1 
ATOM   819  C CB  . ILE A 1 110 ? 6.670   -12.200 -0.771  1.00 23.21  ? 478 ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 110 ? 7.137   -12.564 -2.181  1.00 20.62  ? 478 ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 110 ? 7.316   -13.136 0.242   1.00 20.13  ? 478 ILE A CG2 1 
ATOM   822  C CD1 . ILE A 1 110 ? 8.592   -12.234 -2.587  1.00 19.01  ? 478 ILE A CD1 1 
ATOM   823  N N   . VAL A 1 111 ? 4.720   -10.939 1.251   1.00 15.95  ? 479 VAL A N   1 
ATOM   824  C CA  . VAL A 1 111 ? 4.325   -10.795 2.640   1.00 18.87  ? 479 VAL A CA  1 
ATOM   825  C C   . VAL A 1 111 ? 2.800   -11.250 2.780   1.00 18.62  ? 479 VAL A C   1 
ATOM   826  O O   . VAL A 1 111 ? 2.373   -11.839 3.789   1.00 20.31  ? 479 VAL A O   1 
ATOM   827  C CB  . VAL A 1 111 ? 4.509   -9.287  3.116   1.00 23.43  ? 479 VAL A CB  1 
ATOM   828  C CG1 . VAL A 1 111 ? 3.806   -9.076  4.441   1.00 22.48  ? 479 VAL A CG1 1 
ATOM   829  C CG2 . VAL A 1 111 ? 6.078   -8.954  3.206   1.00 24.83  ? 479 VAL A CG2 1 
ATOM   830  N N   . LEU A 1 112 ? 1.959   -10.774 1.874   1.00 19.33  ? 480 LEU A N   1 
ATOM   831  C CA  . LEU A 1 112 ? 0.533   -11.192 1.964   1.00 22.06  ? 480 LEU A CA  1 
ATOM   832  C C   . LEU A 1 112 ? 0.378   -12.724 1.871   1.00 16.10  ? 480 LEU A C   1 
ATOM   833  O O   . LEU A 1 112 ? -0.394  -13.349 2.606   1.00 20.08  ? 480 LEU A O   1 
ATOM   834  C CB  . LEU A 1 112 ? -0.178  -10.642 0.763   1.00 22.21  ? 480 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 112 ? -1.698  -10.517 0.901   1.00 28.76  ? 480 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 112 ? -2.163  -9.398  1.847   1.00 28.70  ? 480 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 112 ? -2.272  -10.190 -0.503  1.00 30.59  ? 480 LEU A CD2 1 
ATOM   838  N N   . LYS A 1 113 ? 1.078   -13.279 0.907   1.00 17.77  ? 481 LYS A N   1 
ATOM   839  C CA  . LYS A 1 113 ? 0.974   -14.753 0.676   1.00 19.00  ? 481 LYS A CA  1 
ATOM   840  C C   . LYS A 1 113 ? 1.424   -15.543 1.940   1.00 18.87  ? 481 LYS A C   1 
ATOM   841  O O   . LYS A 1 113 ? 0.716   -16.412 2.471   1.00 17.34  ? 481 LYS A O   1 
ATOM   842  C CB  . LYS A 1 113 ? 1.838   -15.148 -0.526  1.00 20.55  ? 481 LYS A CB  1 
ATOM   843  C CG  . LYS A 1 113 ? 1.888   -16.681 -0.838  1.00 17.78  ? 481 LYS A CG  1 
ATOM   844  C CD  . LYS A 1 113 ? 2.726   -16.982 -2.081  1.00 20.32  ? 481 LYS A CD  1 
ATOM   845  C CE  . LYS A 1 113 ? 2.668   -18.480 -2.466  1.00 19.77  ? 481 LYS A CE  1 
ATOM   846  N NZ  . LYS A 1 113 ? 1.272   -18.816 -2.981  1.00 19.60  ? 481 LYS A NZ  1 
ATOM   847  N N   . VAL A 1 114 ? 2.590   -15.175 2.503   1.00 19.51  ? 482 VAL A N   1 
ATOM   848  C CA  . VAL A 1 114 ? 3.045   -15.891 3.694   1.00 16.94  ? 482 VAL A CA  1 
ATOM   849  C C   . VAL A 1 114 ? 2.079   -15.713 4.850   1.00 19.04  ? 482 VAL A C   1 
ATOM   850  O O   . VAL A 1 114 ? 1.834   -16.648 5.619   1.00 18.00  ? 482 VAL A O   1 
ATOM   851  C CB  . VAL A 1 114 ? 4.518   -15.498 4.167   1.00 18.03  ? 482 VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 114 ? 4.858   -16.278 5.406   1.00 17.28  ? 482 VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 114 ? 5.500   -15.873 3.055   1.00 18.44  ? 482 VAL A CG2 1 
ATOM   854  N N   . ASN A 1 115 ? 1.541   -14.519 5.044   1.00 18.46  ? 483 ASN A N   1 
ATOM   855  C CA  . ASN A 1 115 ? 0.660   -14.357 6.160   1.00 20.17  ? 483 ASN A CA  1 
ATOM   856  C C   . ASN A 1 115 ? -0.703  -15.027 5.906   1.00 18.79  ? 483 ASN A C   1 
ATOM   857  O O   . ASN A 1 115 ? -1.311  -15.521 6.850   1.00 20.40  ? 483 ASN A O   1 
ATOM   858  C CB  . ASN A 1 115 ? 0.409   -12.834 6.403   1.00 20.82  ? 483 ASN A CB  1 
ATOM   859  C CG  . ASN A 1 115 ? 1.564   -12.241 7.244   1.00 23.64  ? 483 ASN A CG  1 
ATOM   860  O OD1 . ASN A 1 115 ? 1.647   -12.518 8.445   1.00 22.80  ? 483 ASN A OD1 1 
ATOM   861  N ND2 . ASN A 1 115 ? 2.516   -11.572 6.570   1.00 22.88  ? 483 ASN A ND2 1 
ATOM   862  N N   . TYR A 1 116 ? -1.097  -15.158 4.633   1.00 20.73  ? 484 TYR A N   1 
ATOM   863  C CA  . TYR A 1 116 ? -2.344  -16.012 4.391   1.00 20.50  ? 484 TYR A CA  1 
ATOM   864  C C   . TYR A 1 116 ? -2.071  -17.422 4.817   1.00 21.99  ? 484 TYR A C   1 
ATOM   865  O O   . TYR A 1 116 ? -2.953  -18.100 5.376   1.00 19.88  ? 484 TYR A O   1 
ATOM   866  C CB  . TYR A 1 116 ? -2.742  -16.009 2.904   1.00 19.82  ? 484 TYR A CB  1 
ATOM   867  C CG  . TYR A 1 116 ? -3.445  -14.778 2.385   1.00 21.04  ? 484 TYR A CG  1 
ATOM   868  C CD1 . TYR A 1 116 ? -4.168  -13.965 3.226   1.00 22.12  ? 484 TYR A CD1 1 
ATOM   869  C CD2 . TYR A 1 116 ? -3.323  -14.422 1.037   1.00 22.35  ? 484 TYR A CD2 1 
ATOM   870  C CE1 . TYR A 1 116 ? -4.858  -12.819 2.717   1.00 23.79  ? 484 TYR A CE1 1 
ATOM   871  C CE2 . TYR A 1 116 ? -3.947  -13.284 0.497   1.00 25.62  ? 484 TYR A CE2 1 
ATOM   872  C CZ  . TYR A 1 116 ? -4.745  -12.487 1.364   1.00 23.76  ? 484 TYR A CZ  1 
ATOM   873  O OH  . TYR A 1 116 ? -5.450  -11.376 0.882   1.00 26.90  ? 484 TYR A OH  1 
ATOM   874  N N   . ILE A 1 117 ? -0.852  -17.902 4.525   1.00 21.06  ? 485 ILE A N   1 
ATOM   875  C CA  . ILE A 1 117 ? -0.472  -19.285 4.936   1.00 18.61  ? 485 ILE A CA  1 
ATOM   876  C C   . ILE A 1 117 ? -0.451  -19.375 6.466   1.00 23.58  ? 485 ILE A C   1 
ATOM   877  O O   . ILE A 1 117 ? -1.049  -20.345 7.060   1.00 22.61  ? 485 ILE A O   1 
ATOM   878  C CB  . ILE A 1 117 ? 0.839   -19.754 4.276   1.00 17.60  ? 485 ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 117 ? 0.648   -19.837 2.791   1.00 18.98  ? 485 ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 117 ? 1.349   -21.102 4.864   1.00 20.10  ? 485 ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 117 ? 1.988   -19.995 2.009   1.00 16.22  ? 485 ILE A CD1 1 
ATOM   882  N N   . LEU A 1 118 ? 0.161   -18.375 7.159   1.00 19.44  ? 486 LEU A N   1 
ATOM   883  C CA  . LEU A 1 118 ? 0.156   -18.496 8.652   1.00 23.33  ? 486 LEU A CA  1 
ATOM   884  C C   . LEU A 1 118 ? -1.286  -18.421 9.241   1.00 25.61  ? 486 LEU A C   1 
ATOM   885  O O   . LEU A 1 118 ? -1.641  -19.138 10.163  1.00 26.75  ? 486 LEU A O   1 
ATOM   886  C CB  . LEU A 1 118 ? 0.943   -17.298 9.287   1.00 22.33  ? 486 LEU A CB  1 
ATOM   887  C CG  . LEU A 1 118 ? 2.457   -17.259 8.945   1.00 24.47  ? 486 LEU A CG  1 
ATOM   888  C CD1 . LEU A 1 118 ? 2.969   -15.875 9.470   1.00 22.58  ? 486 LEU A CD1 1 
ATOM   889  C CD2 . LEU A 1 118 ? 3.122   -18.500 9.509   1.00 23.36  ? 486 LEU A CD2 1 
ATOM   890  N N   . GLU A 1 119 ? -2.095  -17.550 8.668   1.00 24.40  ? 487 GLU A N   1 
ATOM   891  C CA  . GLU A 1 119 ? -3.451  -17.337 9.178   1.00 30.70  ? 487 GLU A CA  1 
ATOM   892  C C   . GLU A 1 119 ? -4.360  -18.587 9.000   1.00 29.55  ? 487 GLU A C   1 
ATOM   893  O O   . GLU A 1 119 ? -5.200  -18.820 9.830   1.00 30.02  ? 487 GLU A O   1 
ATOM   894  C CB  . GLU A 1 119 ? -4.057  -16.102 8.479   1.00 32.22  ? 487 GLU A CB  1 
ATOM   895  C CG  . GLU A 1 119 ? -5.534  -15.854 8.833   1.00 45.72  ? 487 GLU A CG  1 
ATOM   896  C CD  . GLU A 1 119 ? -6.244  -14.898 7.828   1.00 56.76  ? 487 GLU A CD  1 
ATOM   897  O OE1 . GLU A 1 119 ? -5.550  -14.594 6.765   1.00 43.00  ? 487 GLU A OE1 1 
ATOM   898  O OE2 . GLU A 1 119 ? -7.468  -14.480 8.107   1.00 43.95  ? 487 GLU A OE2 1 
ATOM   899  N N   . SER A 1 120 ? -4.121  -19.426 8.003   1.00 25.69  ? 488 SER A N   1 
ATOM   900  C CA  . SER A 1 120 ? -4.978  -20.551 7.738   1.00 29.21  ? 488 SER A CA  1 
ATOM   901  C C   . SER A 1 120 ? -4.822  -21.663 8.752   1.00 36.36  ? 488 SER A C   1 
ATOM   902  O O   . SER A 1 120 ? -5.608  -22.637 8.716   1.00 31.06  ? 488 SER A O   1 
ATOM   903  C CB  . SER A 1 120 ? -4.727  -21.102 6.329   1.00 28.87  ? 488 SER A CB  1 
ATOM   904  O OG  . SER A 1 120 ? -3.405  -21.772 6.274   1.00 31.64  ? 488 SER A OG  1 
ATOM   905  N N   . ARG A 1 121 ? -3.812  -21.610 9.635   1.00 30.83  ? 489 ARG A N   1 
ATOM   906  C CA  . ARG A 1 121 ? -3.739  -22.633 10.748  1.00 35.53  ? 489 ARG A CA  1 
ATOM   907  C C   . ARG A 1 121 ? -5.040  -22.506 11.646  1.00 31.88  ? 489 ARG A C   1 
ATOM   908  O O   . ARG A 1 121 ? -5.535  -21.458 11.922  1.00 33.52  ? 489 ARG A O   1 
ATOM   909  C CB  . ARG A 1 121 ? -2.475  -22.358 11.596  1.00 31.57  ? 489 ARG A CB  1 
ATOM   910  C CG  . ARG A 1 121 ? -1.175  -22.449 10.803  1.00 31.36  ? 489 ARG A CG  1 
ATOM   911  C CD  . ARG A 1 121 ? 0.012   -21.877 11.639  1.00 27.97  ? 489 ARG A CD  1 
ATOM   912  N NE  . ARG A 1 121 ? 1.245   -22.145 10.913  1.00 26.62  ? 489 ARG A NE  1 
ATOM   913  C CZ  . ARG A 1 121 ? 2.443   -21.672 11.290  1.00 28.66  ? 489 ARG A CZ  1 
ATOM   914  N NH1 . ARG A 1 121 ? 2.578   -20.919 12.363  1.00 24.30  ? 489 ARG A NH1 1 
ATOM   915  N NH2 . ARG A 1 121 ? 3.515   -21.961 10.603  1.00 31.73  ? 489 ARG A NH2 1 
ATOM   916  N N   . ALA A 1 122 ? -5.652  -23.525 12.129  1.00 43.24  ? 490 ALA A N   1 
ATOM   917  C CA  . ALA A 1 122 ? -7.079  -23.157 12.645  1.00 45.55  ? 490 ALA A CA  1 
ATOM   918  C C   . ALA A 1 122 ? -7.618  -24.362 13.422  1.00 50.52  ? 490 ALA A C   1 
ATOM   919  O O   . ALA A 1 122 ? -7.006  -25.490 13.324  1.00 48.36  ? 490 ALA A O   1 
ATOM   920  C CB  . ALA A 1 122 ? -8.055  -22.771 11.499  1.00 30.73  ? 490 ALA A CB  1 
ATOM   921  N N   . GLY B 1 1   ? 61.201  -23.198 -8.473  1.00 27.63  ? 369 GLY B N   1 
ATOM   922  C CA  . GLY B 1 1   ? 62.590  -23.324 -7.901  1.00 26.50  ? 369 GLY B CA  1 
ATOM   923  C C   . GLY B 1 1   ? 62.620  -22.263 -6.767  1.00 25.26  ? 369 GLY B C   1 
ATOM   924  O O   . GLY B 1 1   ? 61.604  -21.642 -6.485  1.00 25.97  ? 369 GLY B O   1 
ATOM   925  N N   . ALA B 1 2   ? 63.754  -22.193 -6.109  1.00 22.55  ? 370 ALA B N   1 
ATOM   926  C CA  . ALA B 1 2   ? 64.005  -21.411 -4.936  1.00 25.64  ? 370 ALA B CA  1 
ATOM   927  C C   . ALA B 1 2   ? 63.819  -19.905 -5.340  1.00 21.61  ? 370 ALA B C   1 
ATOM   928  O O   . ALA B 1 2   ? 63.195  -19.214 -4.569  1.00 22.49  ? 370 ALA B O   1 
ATOM   929  C CB  . ALA B 1 2   ? 65.447  -21.658 -4.408  1.00 19.62  ? 370 ALA B CB  1 
ATOM   930  N N   . MET B 1 3   ? 64.327  -19.431 -6.526  1.00 20.51  ? 371 MET B N   1 
ATOM   931  C CA  . MET B 1 3   ? 64.228  -17.978 -6.859  1.00 22.05  ? 371 MET B CA  1 
ATOM   932  C C   . MET B 1 3   ? 62.745  -17.581 -6.963  1.00 23.60  ? 371 MET B C   1 
ATOM   933  O O   . MET B 1 3   ? 62.269  -16.630 -6.327  1.00 24.05  ? 371 MET B O   1 
ATOM   934  C CB  . MET B 1 3   ? 64.937  -17.683 -8.194  1.00 22.07  ? 371 MET B CB  1 
ATOM   935  C CG  . MET B 1 3   ? 66.450  -17.802 -8.113  1.00 25.41  ? 371 MET B CG  1 
ATOM   936  S SD  . MET B 1 3   ? 67.043  -16.208 -7.349  1.00 31.18  ? 371 MET B SD  1 
ATOM   937  C CE  . MET B 1 3   ? 66.873  -15.060 -8.756  1.00 28.17  ? 371 MET B CE  1 
ATOM   938  N N   . ALA B 1 4   ? 61.973  -18.377 -7.697  1.00 19.73  ? 372 ALA B N   1 
ATOM   939  C CA  . ALA B 1 4   ? 60.547  -18.106 -7.909  1.00 21.82  ? 372 ALA B CA  1 
ATOM   940  C C   . ALA B 1 4   ? 59.813  -18.149 -6.561  1.00 20.95  ? 372 ALA B C   1 
ATOM   941  O O   . ALA B 1 4   ? 58.941  -17.313 -6.284  1.00 19.11  ? 372 ALA B O   1 
ATOM   942  C CB  . ALA B 1 4   ? 59.891  -19.165 -8.895  1.00 23.37  ? 372 ALA B CB  1 
ATOM   943  N N   . THR B 1 5   ? 60.165  -19.080 -5.696  1.00 20.65  ? 373 THR B N   1 
ATOM   944  C CA  . THR B 1 5   ? 59.400  -19.148 -4.439  1.00 22.34  ? 373 THR B CA  1 
ATOM   945  C C   . THR B 1 5   ? 59.722  -17.927 -3.541  1.00 21.69  ? 373 THR B C   1 
ATOM   946  O O   . THR B 1 5   ? 58.847  -17.359 -2.872  1.00 20.16  ? 373 THR B O   1 
ATOM   947  C CB  . THR B 1 5   ? 59.786  -20.448 -3.685  1.00 27.77  ? 373 THR B CB  1 
ATOM   948  O OG1 . THR B 1 5   ? 59.274  -21.568 -4.409  1.00 31.78  ? 373 THR B OG1 1 
ATOM   949  C CG2 . THR B 1 5   ? 59.254  -20.499 -2.193  1.00 24.61  ? 373 THR B CG2 1 
ATOM   950  N N   . VAL B 1 6   ? 60.985  -17.572 -3.516  1.00 19.73  ? 374 VAL B N   1 
ATOM   951  C CA  . VAL B 1 6   ? 61.398  -16.363 -2.738  1.00 18.65  ? 374 VAL B CA  1 
ATOM   952  C C   . VAL B 1 6   ? 60.732  -15.132 -3.318  1.00 18.05  ? 374 VAL B C   1 
ATOM   953  O O   . VAL B 1 6   ? 60.162  -14.321 -2.549  1.00 19.24  ? 374 VAL B O   1 
ATOM   954  C CB  . VAL B 1 6   ? 62.920  -16.189 -2.696  1.00 16.24  ? 374 VAL B CB  1 
ATOM   955  C CG1 . VAL B 1 6   ? 63.242  -14.884 -1.893  1.00 20.13  ? 374 VAL B CG1 1 
ATOM   956  C CG2 . VAL B 1 6   ? 63.548  -17.367 -1.932  1.00 17.95  ? 374 VAL B CG2 1 
ATOM   957  N N   . GLN B 1 7   ? 60.753  -14.981 -4.672  1.00 18.41  ? 375 GLN B N   1 
ATOM   958  C CA  . GLN B 1 7   ? 60.150  -13.822 -5.262  1.00 20.58  ? 375 GLN B CA  1 
ATOM   959  C C   . GLN B 1 7   ? 58.631  -13.753 -4.918  1.00 21.27  ? 375 GLN B C   1 
ATOM   960  O O   . GLN B 1 7   ? 58.067  -12.679 -4.691  1.00 19.71  ? 375 GLN B O   1 
ATOM   961  C CB  . GLN B 1 7   ? 60.303  -13.858 -6.784  1.00 23.36  ? 375 GLN B CB  1 
ATOM   962  C CG  . GLN B 1 7   ? 59.754  -12.597 -7.540  1.00 31.75  ? 375 GLN B CG  1 
ATOM   963  C CD  . GLN B 1 7   ? 60.106  -12.754 -9.050  1.00 47.90  ? 375 GLN B CD  1 
ATOM   964  O OE1 . GLN B 1 7   ? 60.076  -13.872 -9.564  1.00 53.52  ? 375 GLN B OE1 1 
ATOM   965  N NE2 . GLN B 1 7   ? 60.465  -11.688 -9.722  1.00 40.89  ? 375 GLN B NE2 1 
ATOM   966  N N   . ASP B 1 8   ? 57.955  -14.892 -4.949  1.00 22.08  ? 376 ASP B N   1 
ATOM   967  C CA  . ASP B 1 8   ? 56.508  -14.890 -4.592  1.00 22.02  ? 376 ASP B CA  1 
ATOM   968  C C   . ASP B 1 8   ? 56.255  -14.598 -3.142  1.00 19.45  ? 376 ASP B C   1 
ATOM   969  O O   . ASP B 1 8   ? 55.286  -13.926 -2.788  1.00 20.29  ? 376 ASP B O   1 
ATOM   970  C CB  . ASP B 1 8   ? 55.953  -16.296 -4.808  1.00 22.96  ? 376 ASP B CB  1 
ATOM   971  C CG  . ASP B 1 8   ? 55.707  -16.571 -6.244  1.00 31.23  ? 376 ASP B CG  1 
ATOM   972  O OD1 . ASP B 1 8   ? 55.580  -15.618 -7.015  1.00 35.24  ? 376 ASP B OD1 1 
ATOM   973  O OD2 . ASP B 1 8   ? 55.741  -17.732 -6.636  1.00 35.00  ? 376 ASP B OD2 1 
ATOM   974  N N   . MET B 1 9   ? 57.155  -15.067 -2.248  1.00 18.44  ? 377 MET B N   1 
ATOM   975  C CA  . MET B 1 9   ? 57.015  -14.648 -0.878  1.00 18.08  ? 377 MET B CA  1 
ATOM   976  C C   . MET B 1 9   ? 57.225  -13.149 -0.736  1.00 19.07  ? 377 MET B C   1 
ATOM   977  O O   . MET B 1 9   ? 56.604  -12.504 0.116   1.00 17.58  ? 377 MET B O   1 
ATOM   978  C CB  . MET B 1 9   ? 58.110  -15.404 -0.083  1.00 22.78  ? 377 MET B CB  1 
ATOM   979  C CG  . MET B 1 9   ? 57.831  -15.863 1.226   1.00 35.58  ? 377 MET B CG  1 
ATOM   980  S SD  . MET B 1 9   ? 56.248  -16.691 1.682   1.00 36.17  ? 377 MET B SD  1 
ATOM   981  C CE  . MET B 1 9   ? 56.284  -18.145 0.804   1.00 35.18  ? 377 MET B CE  1 
ATOM   982  N N   . LEU B 1 10  ? 58.213  -12.580 -1.435  1.00 20.52  ? 378 LEU B N   1 
ATOM   983  C CA  . LEU B 1 10  ? 58.451  -11.115 -1.223  1.00 18.35  ? 378 LEU B CA  1 
ATOM   984  C C   . LEU B 1 10  ? 57.186  -10.365 -1.676  1.00 20.15  ? 378 LEU B C   1 
ATOM   985  O O   . LEU B 1 10  ? 56.663  -9.429  -1.040  1.00 20.55  ? 378 LEU B O   1 
ATOM   986  C CB  . LEU B 1 10  ? 59.591  -10.641 -2.141  1.00 20.25  ? 378 LEU B CB  1 
ATOM   987  C CG  . LEU B 1 10  ? 60.937  -11.179 -1.552  1.00 23.22  ? 378 LEU B CG  1 
ATOM   988  C CD1 . LEU B 1 10  ? 62.073  -10.721 -2.411  1.00 24.93  ? 378 LEU B CD1 1 
ATOM   989  C CD2 . LEU B 1 10  ? 61.203  -10.785 -0.110  1.00 21.62  ? 378 LEU B CD2 1 
ATOM   990  N N   . SER B 1 11  ? 56.775  -10.760 -2.846  1.00 17.25  ? 379 SER B N   1 
ATOM   991  C CA  . SER B 1 11  ? 55.710  -10.104 -3.515  1.00 23.38  ? 379 SER B CA  1 
ATOM   992  C C   . SER B 1 11  ? 54.360  -10.186 -2.745  1.00 21.80  ? 379 SER B C   1 
ATOM   993  O O   . SER B 1 11  ? 53.644  -9.153  -2.569  1.00 22.65  ? 379 SER B O   1 
ATOM   994  C CB  . SER B 1 11  ? 55.734  -10.777 -4.865  1.00 27.26  ? 379 SER B CB  1 
ATOM   995  O OG  . SER B 1 11  ? 54.527  -10.720 -5.306  1.00 31.67  ? 379 SER B OG  1 
ATOM   996  N N   . SER B 1 12  ? 54.050  -11.314 -2.126  1.00 19.26  ? 380 SER B N   1 
ATOM   997  C CA  . SER B 1 12  ? 52.803  -11.446 -1.372  1.00 18.47  ? 380 SER B CA  1 
ATOM   998  C C   . SER B 1 12  ? 52.929  -10.723 -0.029  1.00 18.43  ? 380 SER B C   1 
ATOM   999  O O   . SER B 1 12  ? 51.953  -10.137 0.497   1.00 20.15  ? 380 SER B O   1 
ATOM   1000 C CB  . SER B 1 12  ? 52.450  -12.990 -1.256  1.00 19.90  ? 380 SER B CB  1 
ATOM   1001 O OG  . SER B 1 12  ? 53.439  -13.566 -0.377  1.00 22.02  ? 380 SER B OG  1 
ATOM   1002 N N   . HIS B 1 13  ? 54.106  -10.750 0.611   1.00 16.38  ? 381 HIS B N   1 
ATOM   1003 C CA  . HIS B 1 13  ? 54.226  -10.035 1.866   1.00 17.60  ? 381 HIS B CA  1 
ATOM   1004 C C   . HIS B 1 13  ? 54.593  -8.575  1.855   1.00 19.40  ? 381 HIS B C   1 
ATOM   1005 O O   . HIS B 1 13  ? 54.484  -7.926  2.932   1.00 19.61  ? 381 HIS B O   1 
ATOM   1006 C CB  . HIS B 1 13  ? 55.194  -10.772 2.783   1.00 18.53  ? 381 HIS B CB  1 
ATOM   1007 C CG  . HIS B 1 13  ? 54.662  -12.179 3.146   1.00 22.94  ? 381 HIS B CG  1 
ATOM   1008 N ND1 . HIS B 1 13  ? 54.276  -13.112 2.182   1.00 24.55  ? 381 HIS B ND1 1 
ATOM   1009 C CD2 . HIS B 1 13  ? 54.337  -12.761 4.414   1.00 20.73  ? 381 HIS B CD2 1 
ATOM   1010 C CE1 . HIS B 1 13  ? 53.781  -14.251 2.822   1.00 21.45  ? 381 HIS B CE1 1 
ATOM   1011 N NE2 . HIS B 1 13  ? 53.808  -14.036 4.137   1.00 21.27  ? 381 HIS B NE2 1 
ATOM   1012 N N   . HIS B 1 14  ? 55.018  -8.055  0.700   1.00 15.62  ? 382 HIS B N   1 
ATOM   1013 C CA  . HIS B 1 14  ? 55.322  -6.574  0.655   1.00 17.17  ? 382 HIS B CA  1 
ATOM   1014 C C   . HIS B 1 14  ? 53.987  -5.823  0.961   1.00 18.86  ? 382 HIS B C   1 
ATOM   1015 O O   . HIS B 1 14  ? 52.893  -6.242  0.510   1.00 21.77  ? 382 HIS B O   1 
ATOM   1016 C CB  . HIS B 1 14  ? 55.629  -6.198  -0.787  1.00 17.83  ? 382 HIS B CB  1 
ATOM   1017 C CG  . HIS B 1 14  ? 57.020  -6.467  -1.203  1.00 19.99  ? 382 HIS B CG  1 
ATOM   1018 N ND1 . HIS B 1 14  ? 57.400  -6.563  -2.510  1.00 18.79  ? 382 HIS B ND1 1 
ATOM   1019 C CD2 . HIS B 1 14  ? 58.191  -6.513  -0.430  1.00 19.33  ? 382 HIS B CD2 1 
ATOM   1020 C CE1 . HIS B 1 14  ? 58.754  -6.765  -2.560  1.00 20.60  ? 382 HIS B CE1 1 
ATOM   1021 N NE2 . HIS B 1 14  ? 59.234  -6.721  -1.280  1.00 21.79  ? 382 HIS B NE2 1 
ATOM   1022 N N   . TYR B 1 15  ? 54.094  -4.716  1.665   1.00 18.91  ? 383 TYR B N   1 
ATOM   1023 C CA  . TYR B 1 15  ? 52.964  -3.772  1.797   1.00 19.98  ? 383 TYR B CA  1 
ATOM   1024 C C   . TYR B 1 15  ? 52.407  -3.348  0.446   1.00 21.38  ? 383 TYR B C   1 
ATOM   1025 O O   . TYR B 1 15  ? 53.140  -3.004  -0.497  1.00 20.52  ? 383 TYR B O   1 
ATOM   1026 C CB  . TYR B 1 15  ? 53.489  -2.540  2.528   1.00 21.22  ? 383 TYR B CB  1 
ATOM   1027 C CG  . TYR B 1 15  ? 52.422  -1.465  2.585   1.00 18.69  ? 383 TYR B CG  1 
ATOM   1028 C CD1 . TYR B 1 15  ? 51.376  -1.515  3.502   1.00 18.16  ? 383 TYR B CD1 1 
ATOM   1029 C CD2 . TYR B 1 15  ? 52.446  -0.408  1.608   1.00 22.25  ? 383 TYR B CD2 1 
ATOM   1030 C CE1 . TYR B 1 15  ? 50.400  -0.491  3.519   1.00 23.65  ? 383 TYR B CE1 1 
ATOM   1031 C CE2 . TYR B 1 15  ? 51.503  0.592   1.642   1.00 23.93  ? 383 TYR B CE2 1 
ATOM   1032 C CZ  . TYR B 1 15  ? 50.510  0.572   2.626   1.00 23.32  ? 383 TYR B CZ  1 
ATOM   1033 O OH  . TYR B 1 15  ? 49.561  1.549   2.560   1.00 26.49  ? 383 TYR B OH  1 
ATOM   1034 N N   . LYS B 1 16  ? 51.084  -3.391  0.324   1.00 23.27  ? 384 LYS B N   1 
ATOM   1035 C CA  . LYS B 1 16  ? 50.379  -2.860  -0.859  1.00 21.10  ? 384 LYS B CA  1 
ATOM   1036 C C   . LYS B 1 16  ? 49.014  -2.333  -0.348  1.00 22.23  ? 384 LYS B C   1 
ATOM   1037 O O   . LYS B 1 16  ? 48.388  -2.989  0.528   1.00 20.52  ? 384 LYS B O   1 
ATOM   1038 C CB  . LYS B 1 16  ? 50.133  -3.936  -1.957  1.00 21.26  ? 384 LYS B CB  1 
ATOM   1039 C CG  . LYS B 1 16  ? 49.563  -3.320  -3.265  1.00 19.66  ? 384 LYS B CG  1 
ATOM   1040 C CD  . LYS B 1 16  ? 49.639  -4.247  -4.455  1.00 21.09  ? 384 LYS B CD  1 
ATOM   1041 C CE  . LYS B 1 16  ? 49.006  -3.580  -5.736  1.00 19.92  ? 384 LYS B CE  1 
ATOM   1042 N NZ  . LYS B 1 16  ? 49.361  -4.591  -6.824  1.00 18.23  ? 384 LYS B NZ  1 
ATOM   1043 N N   . SER B 1 17  ? 48.615  -1.139  -0.799  1.00 21.28  ? 385 SER B N   1 
ATOM   1044 C CA  . SER B 1 17  ? 47.275  -0.645  -0.490  1.00 22.22  ? 385 SER B CA  1 
ATOM   1045 C C   . SER B 1 17  ? 46.337  -0.599  -1.663  1.00 24.67  ? 385 SER B C   1 
ATOM   1046 O O   . SER B 1 17  ? 46.741  -0.583  -2.833  1.00 25.46  ? 385 SER B O   1 
ATOM   1047 C CB  . SER B 1 17  ? 47.246  0.750   0.186   1.00 26.98  ? 385 SER B CB  1 
ATOM   1048 O OG  . SER B 1 17  ? 47.617  1.636   -0.802  1.00 23.56  ? 385 SER B OG  1 
ATOM   1049 N N   . PHE B 1 18  ? 45.031  -0.558  -1.353  1.00 22.42  ? 386 PHE B N   1 
ATOM   1050 C CA  . PHE B 1 18  ? 44.033  -0.795  -2.366  1.00 22.23  ? 386 PHE B CA  1 
ATOM   1051 C C   . PHE B 1 18  ? 42.930  0.182   -1.989  1.00 23.40  ? 386 PHE B C   1 
ATOM   1052 O O   . PHE B 1 18  ? 42.545  0.312   -0.790  1.00 22.69  ? 386 PHE B O   1 
ATOM   1053 C CB  . PHE B 1 18  ? 43.456  -2.221  -2.310  1.00 23.97  ? 386 PHE B CB  1 
ATOM   1054 C CG  . PHE B 1 18  ? 44.483  -3.309  -2.569  1.00 20.64  ? 386 PHE B CG  1 
ATOM   1055 C CD1 . PHE B 1 18  ? 44.696  -3.814  -3.852  1.00 18.93  ? 386 PHE B CD1 1 
ATOM   1056 C CD2 . PHE B 1 18  ? 45.208  -3.836  -1.471  1.00 19.16  ? 386 PHE B CD2 1 
ATOM   1057 C CE1 . PHE B 1 18  ? 45.684  -4.852  -4.047  1.00 19.63  ? 386 PHE B CE1 1 
ATOM   1058 C CE2 . PHE B 1 18  ? 46.141  -4.838  -1.632  1.00 18.52  ? 386 PHE B CE2 1 
ATOM   1059 C CZ  . PHE B 1 18  ? 46.393  -5.345  -2.929  1.00 17.31  ? 386 PHE B CZ  1 
ATOM   1060 N N   . LYS B 1 19  ? 42.355  0.818   -3.006  1.00 27.62  ? 387 LYS B N   1 
ATOM   1061 C CA  . LYS B 1 19  ? 41.186  1.715   -2.748  1.00 30.47  ? 387 LYS B CA  1 
ATOM   1062 C C   . LYS B 1 19  ? 39.891  0.886   -2.857  1.00 29.37  ? 387 LYS B C   1 
ATOM   1063 O O   . LYS B 1 19  ? 39.593  0.388   -3.910  1.00 28.76  ? 387 LYS B O   1 
ATOM   1064 C CB  . LYS B 1 19  ? 41.242  2.840   -3.789  1.00 34.02  ? 387 LYS B CB  1 
ATOM   1065 C CG  . LYS B 1 19  ? 42.408  3.783   -3.444  1.00 42.83  ? 387 LYS B CG  1 
ATOM   1066 C CD  . LYS B 1 19  ? 42.835  4.708   -4.603  1.00 57.93  ? 387 LYS B CD  1 
ATOM   1067 C CE  . LYS B 1 19  ? 44.369  4.780   -4.709  1.00 67.00  ? 387 LYS B CE  1 
ATOM   1068 N NZ  . LYS B 1 19  ? 44.778  5.909   -5.582  1.00 69.30  ? 387 LYS B NZ  1 
ATOM   1069 N N   . VAL B 1 20  ? 39.153  0.680   -1.760  1.00 28.64  ? 388 VAL B N   1 
ATOM   1070 C CA  . VAL B 1 20  ? 37.971  -0.208  -1.860  1.00 29.56  ? 388 VAL B CA  1 
ATOM   1071 C C   . VAL B 1 20  ? 36.943  0.496   -1.069  1.00 28.47  ? 388 VAL B C   1 
ATOM   1072 O O   . VAL B 1 20  ? 37.251  1.479   -0.397  1.00 26.74  ? 388 VAL B O   1 
ATOM   1073 C CB  . VAL B 1 20  ? 38.184  -1.655  -1.229  1.00 27.03  ? 388 VAL B CB  1 
ATOM   1074 C CG1 . VAL B 1 20  ? 39.179  -2.472  -2.088  1.00 25.21  ? 388 VAL B CG1 1 
ATOM   1075 C CG2 . VAL B 1 20  ? 38.661  -1.516  0.200   1.00 25.43  ? 388 VAL B CG2 1 
ATOM   1076 N N   . SER B 1 21  ? 35.697  0.031   -1.130  1.00 28.97  ? 389 SER B N   1 
ATOM   1077 C CA  . SER B 1 21  ? 34.776  0.698   -0.238  1.00 33.58  ? 389 SER B CA  1 
ATOM   1078 C C   . SER B 1 21  ? 34.343  -0.263  0.825   1.00 27.30  ? 389 SER B C   1 
ATOM   1079 O O   . SER B 1 21  ? 34.087  -1.438  0.575   1.00 30.17  ? 389 SER B O   1 
ATOM   1080 C CB  . SER B 1 21  ? 33.647  1.339   -1.063  1.00 36.81  ? 389 SER B CB  1 
ATOM   1081 O OG  . SER B 1 21  ? 33.122  0.323   -1.768  1.00 45.32  ? 389 SER B OG  1 
ATOM   1082 N N   . MET B 1 22  ? 34.350  0.206   2.047   1.00 24.62  ? 390 MET B N   1 
ATOM   1083 C CA  . MET B 1 22  ? 34.022  -0.616  3.144   1.00 24.15  ? 390 MET B CA  1 
ATOM   1084 C C   . MET B 1 22  ? 32.489  -0.514  3.341   1.00 28.63  ? 390 MET B C   1 
ATOM   1085 O O   . MET B 1 22  ? 31.939  0.592   3.245   1.00 29.77  ? 390 MET B O   1 
ATOM   1086 C CB  . MET B 1 22  ? 34.622  -0.018  4.360   1.00 25.48  ? 390 MET B CB  1 
ATOM   1087 C CG  . MET B 1 22  ? 34.385  -0.822  5.645   1.00 30.04  ? 390 MET B CG  1 
ATOM   1088 S SD  . MET B 1 22  ? 35.572  -0.302  6.971   1.00 36.17  ? 390 MET B SD  1 
ATOM   1089 C CE  . MET B 1 22  ? 35.058  -1.255  8.362   1.00 40.71  ? 390 MET B CE  1 
ATOM   1090 N N   . ILE B 1 23  ? 31.863  -1.639  3.610   1.00 28.40  ? 391 ILE B N   1 
ATOM   1091 C CA  . ILE B 1 23  ? 30.389  -1.753  3.652   1.00 30.43  ? 391 ILE B CA  1 
ATOM   1092 C C   . ILE B 1 23  ? 29.977  -1.797  5.147   1.00 31.55  ? 391 ILE B C   1 
ATOM   1093 O O   . ILE B 1 23  ? 30.261  -2.758  5.867   1.00 31.39  ? 391 ILE B O   1 
ATOM   1094 C CB  . ILE B 1 23  ? 29.864  -3.022  2.957   1.00 24.72  ? 391 ILE B CB  1 
ATOM   1095 C CG1 . ILE B 1 23  ? 30.340  -3.122  1.520   1.00 27.65  ? 391 ILE B CG1 1 
ATOM   1096 C CG2 . ILE B 1 23  ? 28.270  -3.018  2.980   1.00 30.15  ? 391 ILE B CG2 1 
ATOM   1097 C CD1 . ILE B 1 23  ? 30.023  -4.562  1.021   1.00 27.93  ? 391 ILE B CD1 1 
ATOM   1098 N N   . HIS B 1 24  ? 29.353  -0.712  5.593   1.00 35.45  ? 392 HIS B N   1 
ATOM   1099 C CA  . HIS B 1 24  ? 28.838  -0.628  6.966   1.00 38.85  ? 392 HIS B CA  1 
ATOM   1100 C C   . HIS B 1 24  ? 27.456  -1.277  7.125   1.00 39.78  ? 392 HIS B C   1 
ATOM   1101 O O   . HIS B 1 24  ? 27.249  -2.009  8.056   1.00 46.85  ? 392 HIS B O   1 
ATOM   1102 C CB  . HIS B 1 24  ? 28.856  0.809   7.433   1.00 35.18  ? 392 HIS B CB  1 
ATOM   1103 C CG  . HIS B 1 24  ? 30.129  1.534   7.098   1.00 39.77  ? 392 HIS B CG  1 
ATOM   1104 N ND1 . HIS B 1 24  ? 31.243  1.405   7.813   1.00 38.28  ? 392 HIS B ND1 1 
ATOM   1105 C CD2 . HIS B 1 24  ? 30.425  2.430   6.062   1.00 42.30  ? 392 HIS B CD2 1 
ATOM   1106 C CE1 . HIS B 1 24  ? 32.200  2.171   7.283   1.00 43.39  ? 392 HIS B CE1 1 
ATOM   1107 N NE2 . HIS B 1 24  ? 31.695  2.804   6.208   1.00 40.97  ? 392 HIS B NE2 1 
ATOM   1108 N N   . ARG B 1 25  ? 26.534  -0.988  6.197   1.00 46.34  ? 393 ARG B N   1 
ATOM   1109 C CA  . ARG B 1 25  ? 25.180  -1.621  6.024   1.00 46.82  ? 393 ARG B CA  1 
ATOM   1110 C C   . ARG B 1 25  ? 24.821  -1.545  4.564   1.00 46.22  ? 393 ARG B C   1 
ATOM   1111 O O   . ARG B 1 25  ? 25.487  -0.862  3.746   1.00 41.54  ? 393 ARG B O   1 
ATOM   1112 C CB  . ARG B 1 25  ? 24.013  -1.043  6.913   1.00 45.09  ? 393 ARG B CB  1 
ATOM   1113 C CG  . ARG B 1 25  ? 24.433  0.212   7.592   1.00 50.25  ? 393 ARG B CG  1 
ATOM   1114 C CD  . ARG B 1 25  ? 23.366  1.006   8.297   1.00 71.62  ? 393 ARG B CD  1 
ATOM   1115 N NE  . ARG B 1 25  ? 23.638  0.947   9.736   1.00 87.86  ? 393 ARG B NE  1 
ATOM   1116 C CZ  . ARG B 1 25  ? 24.757  1.360   10.364  1.00 94.63  ? 393 ARG B CZ  1 
ATOM   1117 N NH1 . ARG B 1 25  ? 25.791  1.909   9.718   1.00 98.45  ? 393 ARG B NH1 1 
ATOM   1118 N NH2 . ARG B 1 25  ? 24.839  1.225   11.682  1.00 88.44  ? 393 ARG B NH2 1 
ATOM   1119 N N   . LEU B 1 26  ? 23.775  -2.291  4.238   1.00 43.94  ? 394 LEU B N   1 
ATOM   1120 C CA  . LEU B 1 26  ? 23.294  -2.444  2.909   1.00 50.24  ? 394 LEU B CA  1 
ATOM   1121 C C   . LEU B 1 26  ? 23.297  -1.067  2.264   1.00 47.06  ? 394 LEU B C   1 
ATOM   1122 O O   . LEU B 1 26  ? 22.724  -0.106  2.824   1.00 57.55  ? 394 LEU B O   1 
ATOM   1123 C CB  . LEU B 1 26  ? 21.867  -3.051  2.982   1.00 47.21  ? 394 LEU B CB  1 
ATOM   1124 C CG  . LEU B 1 26  ? 21.223  -3.455  1.685   1.00 44.83  ? 394 LEU B CG  1 
ATOM   1125 C CD1 . LEU B 1 26  ? 22.115  -4.332  0.809   1.00 43.66  ? 394 LEU B CD1 1 
ATOM   1126 C CD2 . LEU B 1 26  ? 19.913  -4.112  2.105   1.00 42.29  ? 394 LEU B CD2 1 
ATOM   1127 N N   . ARG B 1 27  ? 23.991  -0.929  1.139   1.00 55.95  ? 395 ARG B N   1 
ATOM   1128 C CA  . ARG B 1 27  ? 24.120  0.394   0.459   1.00 62.65  ? 395 ARG B CA  1 
ATOM   1129 C C   . ARG B 1 27  ? 24.614  1.605   1.297   1.00 62.07  ? 395 ARG B C   1 
ATOM   1130 O O   . ARG B 1 27  ? 24.304  2.751   0.937   1.00 59.07  ? 395 ARG B O   1 
ATOM   1131 C CB  . ARG B 1 27  ? 22.765  0.800   -0.124  1.00 71.76  ? 395 ARG B CB  1 
ATOM   1132 C CG  . ARG B 1 27  ? 22.162  -0.192  -1.064  1.00 70.26  ? 395 ARG B CG  1 
ATOM   1133 C CD  . ARG B 1 27  ? 20.927  0.447   -1.657  1.00 80.34  ? 395 ARG B CD  1 
ATOM   1134 N NE  . ARG B 1 27  ? 20.578  -0.343  -2.814  1.00 90.78  ? 395 ARG B NE  1 
ATOM   1135 C CZ  . ARG B 1 27  ? 19.984  -1.526  -2.745  1.00 87.29  ? 395 ARG B CZ  1 
ATOM   1136 N NH1 . ARG B 1 27  ? 19.652  -2.034  -1.562  1.00 68.10  ? 395 ARG B NH1 1 
ATOM   1137 N NH2 . ARG B 1 27  ? 19.708  -2.181  -3.870  1.00 95.21  ? 395 ARG B NH2 1 
ATOM   1138 N N   . PHE B 1 28  ? 25.286  1.379   2.432   1.00 51.95  ? 396 PHE B N   1 
ATOM   1139 C CA  . PHE B 1 28  ? 25.961  2.471   3.146   1.00 46.99  ? 396 PHE B CA  1 
ATOM   1140 C C   . PHE B 1 28  ? 27.439  2.097   3.217   1.00 42.48  ? 396 PHE B C   1 
ATOM   1141 O O   . PHE B 1 28  ? 27.796  1.199   3.946   1.00 34.99  ? 396 PHE B O   1 
ATOM   1142 C CB  . PHE B 1 28  ? 25.432  2.651   4.551   1.00 49.00  ? 396 PHE B CB  1 
ATOM   1143 C CG  . PHE B 1 28  ? 26.177  3.705   5.312   1.00 68.20  ? 396 PHE B CG  1 
ATOM   1144 C CD1 . PHE B 1 28  ? 26.780  4.783   4.630   1.00 79.26  ? 396 PHE B CD1 1 
ATOM   1145 C CD2 . PHE B 1 28  ? 26.297  3.642   6.706   1.00 82.04  ? 396 PHE B CD2 1 
ATOM   1146 C CE1 . PHE B 1 28  ? 27.491  5.760   5.323   1.00 85.82  ? 396 PHE B CE1 1 
ATOM   1147 C CE2 . PHE B 1 28  ? 27.014  4.622   7.409   1.00 90.67  ? 396 PHE B CE2 1 
ATOM   1148 C CZ  . PHE B 1 28  ? 27.606  5.681   6.716   1.00 93.10  ? 396 PHE B CZ  1 
ATOM   1149 N N   . THR B 1 29  ? 28.260  2.725   2.409   1.00 39.75  ? 397 THR B N   1 
ATOM   1150 C CA  . THR B 1 29  ? 29.636  2.356   2.309   1.00 40.94  ? 397 THR B CA  1 
ATOM   1151 C C   . THR B 1 29  ? 30.491  3.604   2.415   1.00 43.21  ? 397 THR B C   1 
ATOM   1152 O O   . THR B 1 29  ? 30.023  4.675   2.085   1.00 38.94  ? 397 THR B O   1 
ATOM   1153 C CB  . THR B 1 29  ? 29.896  1.716   0.951   1.00 43.94  ? 397 THR B CB  1 
ATOM   1154 O OG1 . THR B 1 29  ? 29.731  2.716   -0.040  1.00 44.17  ? 397 THR B OG1 1 
ATOM   1155 C CG2 . THR B 1 29  ? 28.951  0.540   0.646   1.00 36.26  ? 397 THR B CG2 1 
ATOM   1156 N N   . THR B 1 30  ? 31.741  3.490   2.890   1.00 40.73  ? 398 THR B N   1 
ATOM   1157 C CA  . THR B 1 30  ? 32.717  4.590   2.733   1.00 40.42  ? 398 THR B CA  1 
ATOM   1158 C C   . THR B 1 30  ? 33.965  4.141   1.953   1.00 42.13  ? 398 THR B C   1 
ATOM   1159 O O   . THR B 1 30  ? 34.332  2.951   1.952   1.00 37.31  ? 398 THR B O   1 
ATOM   1160 C CB  . THR B 1 30  ? 33.104  5.201   4.062   1.00 42.30  ? 398 THR B CB  1 
ATOM   1161 O OG1 . THR B 1 30  ? 33.643  4.175   4.869   1.00 45.34  ? 398 THR B OG1 1 
ATOM   1162 C CG2 . THR B 1 30  ? 31.830  5.730   4.810   1.00 40.58  ? 398 THR B CG2 1 
ATOM   1163 N N   . ASP B 1 31  ? 34.577  5.081   1.241   1.00 34.14  ? 399 ASP B N   1 
ATOM   1164 C CA  . ASP B 1 31  ? 35.792  4.796   0.509   1.00 36.48  ? 399 ASP B CA  1 
ATOM   1165 C C   . ASP B 1 31  ? 36.968  4.722   1.475   1.00 29.93  ? 399 ASP B C   1 
ATOM   1166 O O   . ASP B 1 31  ? 37.127  5.548   2.413   1.00 29.99  ? 399 ASP B O   1 
ATOM   1167 C CB  . ASP B 1 31  ? 36.065  5.849   -0.546  1.00 40.60  ? 399 ASP B CB  1 
ATOM   1168 C CG  . ASP B 1 31  ? 35.088  5.773   -1.695  1.00 49.88  ? 399 ASP B CG  1 
ATOM   1169 O OD1 . ASP B 1 31  ? 34.562  4.656   -1.982  1.00 51.21  ? 399 ASP B OD1 1 
ATOM   1170 O OD2 . ASP B 1 31  ? 34.897  6.842   -2.326  1.00 50.68  ? 399 ASP B OD2 1 
ATOM   1171 N N   . VAL B 1 32  ? 37.790  3.692   1.279   1.00 29.12  ? 400 VAL B N   1 
ATOM   1172 C CA  . VAL B 1 32  ? 38.923  3.536   2.242   1.00 25.56  ? 400 VAL B CA  1 
ATOM   1173 C C   . VAL B 1 32  ? 40.139  3.152   1.483   1.00 21.68  ? 400 VAL B C   1 
ATOM   1174 O O   . VAL B 1 32  ? 40.043  2.663   0.382   1.00 25.18  ? 400 VAL B O   1 
ATOM   1175 C CB  . VAL B 1 32  ? 38.685  2.449   3.346   1.00 24.37  ? 400 VAL B CB  1 
ATOM   1176 C CG1 . VAL B 1 32  ? 37.540  2.846   4.246   1.00 23.19  ? 400 VAL B CG1 1 
ATOM   1177 C CG2 . VAL B 1 32  ? 38.495  1.011   2.746   1.00 21.92  ? 400 VAL B CG2 1 
ATOM   1178 N N   . GLN B 1 33  ? 41.277  3.316   2.154   1.00 25.84  ? 401 GLN B N   1 
ATOM   1179 C CA  . GLN B 1 33  ? 42.532  2.727   1.705   1.00 27.02  ? 401 GLN B CA  1 
ATOM   1180 C C   . GLN B 1 33  ? 42.816  1.534   2.679   1.00 21.27  ? 401 GLN B C   1 
ATOM   1181 O O   . GLN B 1 33  ? 42.924  1.689   3.896   1.00 23.84  ? 401 GLN B O   1 
ATOM   1182 C CB  . GLN B 1 33  ? 43.685  3.729   1.799   1.00 28.64  ? 401 GLN B CB  1 
ATOM   1183 C CG  . GLN B 1 33  ? 44.992  3.101   1.369   1.00 40.75  ? 401 GLN B CG  1 
ATOM   1184 C CD  . GLN B 1 33  ? 46.236  3.989   1.674   1.00 50.82  ? 401 GLN B CD  1 
ATOM   1185 O OE1 . GLN B 1 33  ? 46.451  4.485   2.798   1.00 51.89  ? 401 GLN B OE1 1 
ATOM   1186 N NE2 . GLN B 1 33  ? 47.060  4.148   0.682   1.00 49.99  ? 401 GLN B NE2 1 
ATOM   1187 N N   . LEU B 1 34  ? 42.891  0.373   2.092   1.00 20.56  ? 402 LEU B N   1 
ATOM   1188 C CA  . LEU B 1 34  ? 43.116  -0.894  2.814   1.00 19.05  ? 402 LEU B CA  1 
ATOM   1189 C C   . LEU B 1 34  ? 44.591  -1.233  2.470   1.00 16.71  ? 402 LEU B C   1 
ATOM   1190 O O   . LEU B 1 34  ? 44.911  -1.618  1.321   1.00 19.54  ? 402 LEU B O   1 
ATOM   1191 C CB  . LEU B 1 34  ? 42.155  -1.966  2.190   1.00 20.76  ? 402 LEU B CB  1 
ATOM   1192 C CG  . LEU B 1 34  ? 42.469  -3.426  2.622   1.00 22.30  ? 402 LEU B CG  1 
ATOM   1193 C CD1 . LEU B 1 34  ? 42.287  -3.500  4.154   1.00 20.67  ? 402 LEU B CD1 1 
ATOM   1194 C CD2 . LEU B 1 34  ? 41.518  -4.355  1.894   1.00 19.62  ? 402 LEU B CD2 1 
ATOM   1195 N N   . GLY B 1 35  ? 45.412  -1.176  3.500   1.00 18.45  ? 403 GLY B N   1 
ATOM   1196 C CA  . GLY B 1 35  ? 46.855  -1.474  3.374   1.00 17.42  ? 403 GLY B CA  1 
ATOM   1197 C C   . GLY B 1 35  ? 47.134  -2.883  3.921   1.00 19.61  ? 403 GLY B C   1 
ATOM   1198 O O   . GLY B 1 35  ? 46.742  -3.191  5.021   1.00 21.20  ? 403 GLY B O   1 
ATOM   1199 N N   . ILE B 1 36  ? 47.716  -3.760  3.104   1.00 18.84  ? 404 ILE B N   1 
ATOM   1200 C CA  . ILE B 1 36  ? 47.991  -5.104  3.581   1.00 16.08  ? 404 ILE B CA  1 
ATOM   1201 C C   . ILE B 1 36  ? 49.483  -5.402  3.421   1.00 16.48  ? 404 ILE B C   1 
ATOM   1202 O O   . ILE B 1 36  ? 50.051  -5.178  2.329   1.00 16.94  ? 404 ILE B O   1 
ATOM   1203 C CB  . ILE B 1 36  ? 47.223  -6.094  2.658   1.00 15.87  ? 404 ILE B CB  1 
ATOM   1204 C CG1 . ILE B 1 36  ? 45.697  -5.741  2.684   1.00 22.22  ? 404 ILE B CG1 1 
ATOM   1205 C CG2 . ILE B 1 36  ? 47.486  -7.584  3.190   1.00 17.03  ? 404 ILE B CG2 1 
ATOM   1206 C CD1 . ILE B 1 36  ? 44.909  -6.525  1.661   1.00 22.44  ? 404 ILE B CD1 1 
ATOM   1207 N N   . SER B 1 37  ? 50.100  -5.938  4.481   1.00 17.24  ? 405 SER B N   1 
ATOM   1208 C CA  . SER B 1 37  ? 51.408  -6.572  4.366   1.00 17.89  ? 405 SER B CA  1 
ATOM   1209 C C   . SER B 1 37  ? 51.495  -7.861  5.209   1.00 19.34  ? 405 SER B C   1 
ATOM   1210 O O   . SER B 1 37  ? 50.529  -8.177  5.942   1.00 19.93  ? 405 SER B O   1 
ATOM   1211 C CB  . SER B 1 37  ? 52.522  -5.664  4.854   1.00 15.11  ? 405 SER B CB  1 
ATOM   1212 O OG  . SER B 1 37  ? 52.493  -5.525  6.248   1.00 16.97  ? 405 SER B OG  1 
ATOM   1213 N N   . GLY B 1 38  ? 52.675  -8.517  5.161   1.00 21.70  ? 406 GLY B N   1 
ATOM   1214 C CA  . GLY B 1 38  ? 52.960  -9.638  6.021   1.00 22.30  ? 406 GLY B CA  1 
ATOM   1215 C C   . GLY B 1 38  ? 52.829  -9.278  7.521   1.00 20.68  ? 406 GLY B C   1 
ATOM   1216 O O   . GLY B 1 38  ? 52.666  -10.171 8.383   1.00 20.05  ? 406 GLY B O   1 
ATOM   1217 N N   . ASP B 1 39  ? 52.993  -7.998  7.881   1.00 19.05  ? 407 ASP B N   1 
ATOM   1218 C CA  . ASP B 1 39  ? 52.949  -7.613  9.256   1.00 22.10  ? 407 ASP B CA  1 
ATOM   1219 C C   . ASP B 1 39  ? 51.603  -7.061  9.760   1.00 22.37  ? 407 ASP B C   1 
ATOM   1220 O O   . ASP B 1 39  ? 51.273  -7.259  10.933  1.00 22.45  ? 407 ASP B O   1 
ATOM   1221 C CB  . ASP B 1 39  ? 53.959  -6.455  9.474   1.00 22.55  ? 407 ASP B CB  1 
ATOM   1222 C CG  . ASP B 1 39  ? 55.381  -6.932  9.263   1.00 29.86  ? 407 ASP B CG  1 
ATOM   1223 O OD1 . ASP B 1 39  ? 55.715  -8.102  9.638   1.00 29.52  ? 407 ASP B OD1 1 
ATOM   1224 O OD2 . ASP B 1 39  ? 56.167  -6.129  8.753   1.00 29.60  ? 407 ASP B OD2 1 
ATOM   1225 N N   . LYS B 1 40  ? 50.852  -6.401  8.894   1.00 22.84  ? 408 LYS B N   1 
ATOM   1226 C CA  . LYS B 1 40  ? 49.631  -5.715  9.401   1.00 25.80  ? 408 LYS B CA  1 
ATOM   1227 C C   . LYS B 1 40  ? 48.620  -5.492  8.307   1.00 23.74  ? 408 LYS B C   1 
ATOM   1228 O O   . LYS B 1 40  ? 48.957  -5.341  7.136   1.00 22.68  ? 408 LYS B O   1 
ATOM   1229 C CB  . LYS B 1 40  ? 50.072  -4.288  9.834   1.00 24.70  ? 408 LYS B CB  1 
ATOM   1230 C CG  . LYS B 1 40  ? 50.005  -4.059  11.285  1.00 43.75  ? 408 LYS B CG  1 
ATOM   1231 C CD  . LYS B 1 40  ? 50.206  -2.563  11.510  1.00 42.50  ? 408 LYS B CD  1 
ATOM   1232 C CE  . LYS B 1 40  ? 51.580  -2.327  12.090  1.00 50.49  ? 408 LYS B CE  1 
ATOM   1233 N NZ  . LYS B 1 40  ? 51.939  -0.851  12.168  1.00 61.74  ? 408 LYS B NZ  1 
ATOM   1234 N N   . VAL B 1 41  ? 47.345  -5.369  8.689   1.00 21.35  ? 409 VAL B N   1 
ATOM   1235 C CA  . VAL B 1 41  ? 46.347  -4.893  7.762   1.00 20.62  ? 409 VAL B CA  1 
ATOM   1236 C C   . VAL B 1 41  ? 45.835  -3.542  8.389   1.00 23.27  ? 409 VAL B C   1 
ATOM   1237 O O   . VAL B 1 41  ? 45.572  -3.458  9.590   1.00 22.80  ? 409 VAL B O   1 
ATOM   1238 C CB  . VAL B 1 41  ? 45.188  -5.885  7.685   1.00 21.98  ? 409 VAL B CB  1 
ATOM   1239 C CG1 . VAL B 1 41  ? 43.993  -5.171  6.948   1.00 24.46  ? 409 VAL B CG1 1 
ATOM   1240 C CG2 . VAL B 1 41  ? 45.672  -7.094  6.934   1.00 23.79  ? 409 VAL B CG2 1 
ATOM   1241 N N   . GLU B 1 42  ? 45.763  -2.489  7.599   1.00 21.43  ? 410 GLU B N   1 
ATOM   1242 C CA  . GLU B 1 42  ? 45.315  -1.174  8.111   1.00 23.50  ? 410 GLU B CA  1 
ATOM   1243 C C   . GLU B 1 42  ? 44.188  -0.665  7.250   1.00 23.34  ? 410 GLU B C   1 
ATOM   1244 O O   . GLU B 1 42  ? 44.167  -0.934  6.053   1.00 21.31  ? 410 GLU B O   1 
ATOM   1245 C CB  . GLU B 1 42  ? 46.477  -0.160  7.979   1.00 24.86  ? 410 GLU B CB  1 
ATOM   1246 C CG  . GLU B 1 42  ? 47.527  -0.367  9.009   1.00 29.70  ? 410 GLU B CG  1 
ATOM   1247 C CD  . GLU B 1 42  ? 48.794  0.286   8.493   1.00 45.71  ? 410 GLU B CD  1 
ATOM   1248 O OE1 . GLU B 1 42  ? 49.403  1.049   9.219   1.00 48.21  ? 410 GLU B OE1 1 
ATOM   1249 O OE2 . GLU B 1 42  ? 49.127  0.128   7.292   1.00 45.53  ? 410 GLU B OE2 1 
ATOM   1250 N N   . ILE B 1 43  ? 43.244  0.043   7.845   1.00 24.58  ? 411 ILE B N   1 
ATOM   1251 C CA  . ILE B 1 43  ? 42.114  0.584   7.059   1.00 25.21  ? 411 ILE B CA  1 
ATOM   1252 C C   . ILE B 1 43  ? 42.025  2.067   7.409   1.00 25.30  ? 411 ILE B C   1 
ATOM   1253 O O   . ILE B 1 43  ? 41.979  2.406   8.550   1.00 27.03  ? 411 ILE B O   1 
ATOM   1254 C CB  . ILE B 1 43  ? 40.762  -0.127  7.407   1.00 26.86  ? 411 ILE B CB  1 
ATOM   1255 C CG1 . ILE B 1 43  ? 40.861  -1.593  7.001   1.00 30.88  ? 411 ILE B CG1 1 
ATOM   1256 C CG2 . ILE B 1 43  ? 39.634  0.565   6.629   1.00 31.35  ? 411 ILE B CG2 1 
ATOM   1257 C CD1 . ILE B 1 43  ? 40.148  -2.487  7.971   1.00 34.42  ? 411 ILE B CD1 1 
ATOM   1258 N N   . ASP B 1 44  ? 42.135  2.931   6.427   1.00 30.06  ? 412 ASP B N   1 
ATOM   1259 C CA  . ASP B 1 44  ? 42.101  4.380   6.702   1.00 35.86  ? 412 ASP B CA  1 
ATOM   1260 C C   . ASP B 1 44  ? 41.048  4.944   5.748   1.00 35.14  ? 412 ASP B C   1 
ATOM   1261 O O   . ASP B 1 44  ? 41.070  4.643   4.526   1.00 29.88  ? 412 ASP B O   1 
ATOM   1262 C CB  . ASP B 1 44  ? 43.457  5.044   6.428   1.00 33.88  ? 412 ASP B CB  1 
ATOM   1263 C CG  . ASP B 1 44  ? 44.501  4.638   7.459   1.00 46.93  ? 412 ASP B CG  1 
ATOM   1264 O OD1 . ASP B 1 44  ? 45.310  3.718   7.257   1.00 40.69  ? 412 ASP B OD1 1 
ATOM   1265 O OD2 . ASP B 1 44  ? 44.458  5.177   8.560   1.00 50.79  ? 412 ASP B OD2 1 
ATOM   1266 N N   . PRO B 1 45  ? 40.157  5.795   6.290   1.00 43.66  ? 413 PRO B N   1 
ATOM   1267 C CA  . PRO B 1 45  ? 39.235  6.657   5.444   1.00 46.46  ? 413 PRO B CA  1 
ATOM   1268 C C   . PRO B 1 45  ? 40.041  7.430   4.389   1.00 43.10  ? 413 PRO B C   1 
ATOM   1269 O O   . PRO B 1 45  ? 41.159  7.856   4.686   1.00 49.18  ? 413 PRO B O   1 
ATOM   1270 C CB  . PRO B 1 45  ? 38.590  7.607   6.471   1.00 52.76  ? 413 PRO B CB  1 
ATOM   1271 C CG  . PRO B 1 45  ? 39.472  7.523   7.702   1.00 64.05  ? 413 PRO B CG  1 
ATOM   1272 C CD  . PRO B 1 45  ? 40.100  6.140   7.724   1.00 47.68  ? 413 PRO B CD  1 
ATOM   1273 N N   . VAL B 1 46  ? 39.569  7.508   3.139   1.00 44.49  ? 414 VAL B N   1 
ATOM   1274 C CA  . VAL B 1 46  ? 40.284  8.306   2.113   1.00 47.93  ? 414 VAL B CA  1 
ATOM   1275 C C   . VAL B 1 46  ? 40.266  9.835   2.402   1.00 57.08  ? 414 VAL B C   1 
ATOM   1276 O O   . VAL B 1 46  ? 39.292  10.348  2.985   1.00 54.30  ? 414 VAL B O   1 
ATOM   1277 C CB  . VAL B 1 46  ? 39.721  8.092   0.716   1.00 47.41  ? 414 VAL B CB  1 
ATOM   1278 C CG1 . VAL B 1 46  ? 39.876  6.628   0.282   1.00 48.88  ? 414 VAL B CG1 1 
ATOM   1279 C CG2 . VAL B 1 46  ? 38.260  8.544   0.691   1.00 50.59  ? 414 VAL B CG2 1 
ATOM   1280 N N   . ILE B 1 57  ? 28.854  6.369   12.154  1.00 64.89  ? 425 ILE B N   1 
ATOM   1281 C CA  . ILE B 1 57  ? 29.744  5.240   11.877  1.00 85.87  ? 425 ILE B CA  1 
ATOM   1282 C C   . ILE B 1 57  ? 31.244  5.592   12.076  1.00 88.18  ? 425 ILE B C   1 
ATOM   1283 O O   . ILE B 1 57  ? 31.695  6.672   11.636  1.00 85.57  ? 425 ILE B O   1 
ATOM   1284 C CB  . ILE B 1 57  ? 29.448  4.632   10.465  1.00 95.75  ? 425 ILE B CB  1 
ATOM   1285 C CG1 . ILE B 1 57  ? 29.735  3.097   10.434  1.00 98.24  ? 425 ILE B CG1 1 
ATOM   1286 C CG2 . ILE B 1 57  ? 30.121  5.441   9.330   1.00 80.95  ? 425 ILE B CG2 1 
ATOM   1287 C CD1 . ILE B 1 57  ? 28.621  2.156   10.909  1.00 82.74  ? 425 ILE B CD1 1 
ATOM   1288 N N   . LYS B 1 58  ? 31.989  4.686   12.744  1.00 87.37  ? 426 LYS B N   1 
ATOM   1289 C CA  . LYS B 1 58  ? 33.427  4.890   13.132  1.00 93.75  ? 426 LYS B CA  1 
ATOM   1290 C C   . LYS B 1 58  ? 34.344  5.263   11.955  1.00 92.71  ? 426 LYS B C   1 
ATOM   1291 O O   . LYS B 1 58  ? 34.356  4.570   10.943  1.00 89.55  ? 426 LYS B O   1 
ATOM   1292 C CB  . LYS B 1 58  ? 33.998  3.665   13.883  1.00 73.46  ? 426 LYS B CB  1 
ATOM   1293 N N   . GLN B 1 59  ? 35.069  6.376   12.068  1.00 93.62  ? 427 GLN B N   1 
ATOM   1294 C CA  . GLN B 1 59  ? 36.030  6.773   11.018  1.00 93.22  ? 427 GLN B CA  1 
ATOM   1295 C C   . GLN B 1 59  ? 37.475  6.813   11.564  1.00 93.66  ? 427 GLN B C   1 
ATOM   1296 O O   . GLN B 1 59  ? 38.364  7.353   10.881  1.00 91.33  ? 427 GLN B O   1 
ATOM   1297 C CB  . GLN B 1 59  ? 35.669  8.111   10.287  1.00 90.36  ? 427 GLN B CB  1 
ATOM   1298 C CG  . GLN B 1 59  ? 34.184  8.449   10.134  1.00 82.72  ? 427 GLN B CG  1 
ATOM   1299 C CD  . GLN B 1 59  ? 33.743  8.595   8.672   1.00 87.59  ? 427 GLN B CD  1 
ATOM   1300 O OE1 . GLN B 1 59  ? 34.541  8.426   7.728   1.00 77.65  ? 427 GLN B OE1 1 
ATOM   1301 N NE2 . GLN B 1 59  ? 32.454  8.886   8.477   1.00 68.25  ? 427 GLN B NE2 1 
ATOM   1302 N N   . LYS B 1 60  ? 37.697  6.270   12.782  1.00 80.78  ? 428 LYS B N   1 
ATOM   1303 C CA  . LYS B 1 60  ? 39.061  6.101   13.333  1.00 70.88  ? 428 LYS B CA  1 
ATOM   1304 C C   . LYS B 1 60  ? 39.785  4.998   12.481  1.00 61.46  ? 428 LYS B C   1 
ATOM   1305 O O   . LYS B 1 60  ? 39.191  3.941   12.181  1.00 63.14  ? 428 LYS B O   1 
ATOM   1306 C CB  . LYS B 1 60  ? 39.050  5.783   14.852  1.00 65.11  ? 428 LYS B CB  1 
ATOM   1307 N N   . PRO B 1 61  ? 41.028  5.266   12.025  1.00 52.09  ? 429 PRO B N   1 
ATOM   1308 C CA  . PRO B 1 61  ? 41.813  4.159   11.374  1.00 46.87  ? 429 PRO B CA  1 
ATOM   1309 C C   . PRO B 1 61  ? 41.698  2.811   12.145  1.00 48.45  ? 429 PRO B C   1 
ATOM   1310 O O   . PRO B 1 61  ? 41.559  2.840   13.369  1.00 45.08  ? 429 PRO B O   1 
ATOM   1311 C CB  . PRO B 1 61  ? 43.269  4.699   11.370  1.00 42.93  ? 429 PRO B CB  1 
ATOM   1312 C CG  . PRO B 1 61  ? 43.198  6.123   11.910  1.00 53.32  ? 429 PRO B CG  1 
ATOM   1313 C CD  . PRO B 1 61  ? 41.749  6.560   11.991  1.00 47.40  ? 429 PRO B CD  1 
ATOM   1314 N N   . ILE B 1 62  ? 41.723  1.646   11.450  1.00 39.62  ? 430 ILE B N   1 
ATOM   1315 C CA  . ILE B 1 62  ? 41.761  0.324   12.113  1.00 32.45  ? 430 ILE B CA  1 
ATOM   1316 C C   . ILE B 1 62  ? 43.145  -0.323  11.824  1.00 31.06  ? 430 ILE B C   1 
ATOM   1317 O O   . ILE B 1 62  ? 43.669  -0.133  10.727  1.00 26.62  ? 430 ILE B O   1 
ATOM   1318 C CB  . ILE B 1 62  ? 40.651  -0.573  11.538  1.00 37.57  ? 430 ILE B CB  1 
ATOM   1319 C CG1 . ILE B 1 62  ? 39.241  0.018   11.868  1.00 35.41  ? 430 ILE B CG1 1 
ATOM   1320 C CG2 . ILE B 1 62  ? 40.903  -1.991  11.994  1.00 34.57  ? 430 ILE B CG2 1 
ATOM   1321 C CD1 . ILE B 1 62  ? 38.171  -0.346  10.832  1.00 42.00  ? 430 ILE B CD1 1 
ATOM   1322 N N   . SER B 1 63  ? 43.760  -1.011  12.781  1.00 28.11  ? 431 SER B N   1 
ATOM   1323 C CA  . SER B 1 63  ? 45.092  -1.568  12.525  1.00 27.56  ? 431 SER B CA  1 
ATOM   1324 C C   . SER B 1 63  ? 45.036  -2.950  13.128  1.00 30.93  ? 431 SER B C   1 
ATOM   1325 O O   . SER B 1 63  ? 44.576  -3.094  14.234  1.00 30.67  ? 431 SER B O   1 
ATOM   1326 C CB  . SER B 1 63  ? 46.133  -0.699  13.181  1.00 30.63  ? 431 SER B CB  1 
ATOM   1327 O OG  . SER B 1 63  ? 47.429  -1.231  13.030  1.00 35.03  ? 431 SER B OG  1 
ATOM   1328 N N   . ILE B 1 64  ? 45.341  -3.974  12.343  1.00 27.68  ? 432 ILE B N   1 
ATOM   1329 C CA  . ILE B 1 64  ? 45.197  -5.375  12.778  1.00 23.83  ? 432 ILE B CA  1 
ATOM   1330 C C   . ILE B 1 64  ? 46.561  -6.040  12.527  1.00 24.95  ? 432 ILE B C   1 
ATOM   1331 O O   . ILE B 1 64  ? 47.058  -6.087  11.370  1.00 20.02  ? 432 ILE B O   1 
ATOM   1332 C CB  . ILE B 1 64  ? 44.174  -6.129  11.912  1.00 21.95  ? 432 ILE B CB  1 
ATOM   1333 C CG1 . ILE B 1 64  ? 42.771  -5.404  11.934  1.00 23.16  ? 432 ILE B CG1 1 
ATOM   1334 C CG2 . ILE B 1 64  ? 44.068  -7.571  12.403  1.00 21.02  ? 432 ILE B CG2 1 
ATOM   1335 C CD1 . ILE B 1 64  ? 41.833  -5.752  10.785  1.00 21.81  ? 432 ILE B CD1 1 
ATOM   1336 N N   . ASP B 1 65  ? 47.124  -6.607  13.573  1.00 21.30  ? 433 ASP B N   1 
ATOM   1337 C CA  . ASP B 1 65  ? 48.339  -7.410  13.453  1.00 23.08  ? 433 ASP B CA  1 
ATOM   1338 C C   . ASP B 1 65  ? 48.057  -8.565  12.601  1.00 22.10  ? 433 ASP B C   1 
ATOM   1339 O O   . ASP B 1 65  ? 47.039  -9.263  12.760  1.00 21.74  ? 433 ASP B O   1 
ATOM   1340 C CB  . ASP B 1 65  ? 48.818  -7.856  14.798  1.00 29.86  ? 433 ASP B CB  1 
ATOM   1341 C CG  . ASP B 1 65  ? 49.615  -6.781  15.492  1.00 46.61  ? 433 ASP B CG  1 
ATOM   1342 O OD1 . ASP B 1 65  ? 49.600  -5.585  15.077  1.00 44.12  ? 433 ASP B OD1 1 
ATOM   1343 O OD2 . ASP B 1 65  ? 50.309  -7.129  16.443  1.00 63.60  ? 433 ASP B OD2 1 
ATOM   1344 N N   . SER B 1 66  ? 48.985  -8.868  11.693  1.00 19.77  ? 434 SER B N   1 
ATOM   1345 C CA  . SER B 1 66  ? 48.610  -9.908  10.746  1.00 18.16  ? 434 SER B CA  1 
ATOM   1346 C C   . SER B 1 66  ? 48.462  -11.254 11.456  1.00 15.74  ? 434 SER B C   1 
ATOM   1347 O O   . SER B 1 66  ? 47.756  -12.146 10.935  1.00 16.49  ? 434 SER B O   1 
ATOM   1348 C CB  . SER B 1 66  ? 49.694  -10.049 9.628   1.00 24.53  ? 434 SER B CB  1 
ATOM   1349 O OG  . SER B 1 66  ? 50.887  -10.502 10.360  1.00 26.74  ? 434 SER B OG  1 
ATOM   1350 N N   . ASP B 1 67  ? 49.174  -11.468 12.557  1.00 17.67  ? 435 ASP B N   1 
ATOM   1351 C CA  . ASP B 1 67  ? 48.974  -12.764 13.323  1.00 19.52  ? 435 ASP B CA  1 
ATOM   1352 C C   . ASP B 1 67  ? 47.511  -12.892 13.947  1.00 25.01  ? 435 ASP B C   1 
ATOM   1353 O O   . ASP B 1 67  ? 47.176  -13.944 14.396  1.00 21.47  ? 435 ASP B O   1 
ATOM   1354 C CB  . ASP B 1 67  ? 49.972  -12.874 14.432  1.00 20.66  ? 435 ASP B CB  1 
ATOM   1355 C CG  . ASP B 1 67  ? 51.377  -13.297 13.853  1.00 24.42  ? 435 ASP B CG  1 
ATOM   1356 O OD1 . ASP B 1 67  ? 51.420  -13.503 12.626  1.00 26.56  ? 435 ASP B OD1 1 
ATOM   1357 O OD2 . ASP B 1 67  ? 52.356  -13.386 14.570  1.00 25.50  ? 435 ASP B OD2 1 
ATOM   1358 N N   . LEU B 1 68  ? 46.688  -11.852 13.852  1.00 20.89  ? 436 LEU B N   1 
ATOM   1359 C CA  . LEU B 1 68  ? 45.260  -11.885 14.433  1.00 19.89  ? 436 LEU B CA  1 
ATOM   1360 C C   . LEU B 1 68  ? 44.306  -12.090 13.268  1.00 20.89  ? 436 LEU B C   1 
ATOM   1361 O O   . LEU B 1 68  ? 43.069  -12.299 13.462  1.00 23.72  ? 436 LEU B O   1 
ATOM   1362 C CB  . LEU B 1 68  ? 44.999  -10.546 15.157  1.00 22.19  ? 436 LEU B CB  1 
ATOM   1363 C CG  . LEU B 1 68  ? 45.776  -10.388 16.435  1.00 27.79  ? 436 LEU B CG  1 
ATOM   1364 C CD1 . LEU B 1 68  ? 45.567  -9.026  17.113  1.00 29.51  ? 436 LEU B CD1 1 
ATOM   1365 C CD2 . LEU B 1 68  ? 45.467  -11.585 17.335  1.00 29.05  ? 436 LEU B CD2 1 
ATOM   1366 N N   . LEU B 1 69  ? 44.832  -12.200 12.018  1.00 20.35  ? 437 LEU B N   1 
ATOM   1367 C CA  . LEU B 1 69  ? 43.962  -12.449 10.880  1.00 20.38  ? 437 LEU B CA  1 
ATOM   1368 C C   . LEU B 1 69  ? 43.520  -13.913 10.913  1.00 22.45  ? 437 LEU B C   1 
ATOM   1369 O O   . LEU B 1 69  ? 44.338  -14.822 11.288  1.00 21.94  ? 437 LEU B O   1 
ATOM   1370 C CB  . LEU B 1 69  ? 44.680  -12.205 9.549   1.00 23.21  ? 437 LEU B CB  1 
ATOM   1371 C CG  . LEU B 1 69  ? 45.014  -10.708 9.315   1.00 23.37  ? 437 LEU B CG  1 
ATOM   1372 C CD1 . LEU B 1 69  ? 45.899  -10.598 8.048   1.00 22.27  ? 437 LEU B CD1 1 
ATOM   1373 C CD2 . LEU B 1 69  ? 43.753  -9.829  9.242   1.00 22.39  ? 437 LEU B CD2 1 
ATOM   1374 N N   . CYS B 1 70  ? 42.300  -14.172 10.470  1.00 23.37  ? 438 CYS B N   1 
ATOM   1375 C CA  . CYS B 1 70  ? 41.809  -15.590 10.477  1.00 27.26  ? 438 CYS B CA  1 
ATOM   1376 C C   . CYS B 1 70  ? 41.468  -16.053 9.101   1.00 25.62  ? 438 CYS B C   1 
ATOM   1377 O O   . CYS B 1 70  ? 41.701  -17.168 8.823   1.00 26.82  ? 438 CYS B O   1 
ATOM   1378 C CB  . CYS B 1 70  ? 40.519  -15.807 11.404  1.00 29.33  ? 438 CYS B CB  1 
ATOM   1379 S SG  . CYS B 1 70  ? 40.887  -15.211 13.043  1.00 39.13  ? 438 CYS B SG  1 
ATOM   1380 N N   . ALA B 1 71  ? 40.822  -15.256 8.260   1.00 26.63  ? 439 ALA B N   1 
ATOM   1381 C CA  . ALA B 1 71  ? 40.313  -15.724 6.994   1.00 23.35  ? 439 ALA B CA  1 
ATOM   1382 C C   . ALA B 1 71  ? 40.016  -14.529 6.057   1.00 24.56  ? 439 ALA B C   1 
ATOM   1383 O O   . ALA B 1 71  ? 39.705  -13.438 6.482   1.00 26.89  ? 439 ALA B O   1 
ATOM   1384 C CB  . ALA B 1 71  ? 38.987  -16.586 7.146   1.00 30.95  ? 439 ALA B CB  1 
ATOM   1385 N N   . CYS B 1 72  ? 40.002  -14.799 4.786   1.00 20.86  ? 440 CYS B N   1 
ATOM   1386 C CA  . CYS B 1 72  ? 39.594  -13.801 3.840   1.00 25.40  ? 440 CYS B CA  1 
ATOM   1387 C C   . CYS B 1 72  ? 38.944  -14.540 2.650   1.00 23.68  ? 440 CYS B C   1 
ATOM   1388 O O   . CYS B 1 72  ? 39.563  -15.419 1.957   1.00 25.83  ? 440 CYS B O   1 
ATOM   1389 C CB  . CYS B 1 72  ? 40.840  -12.928 3.357   1.00 23.62  ? 440 CYS B CB  1 
ATOM   1390 S SG  . CYS B 1 72  ? 40.309  -11.562 2.307   1.00 26.44  ? 440 CYS B SG  1 
ATOM   1391 N N   . ASP B 1 73  ? 37.667  -14.237 2.438   1.00 26.78  ? 441 ASP B N   1 
ATOM   1392 C CA  . ASP B 1 73  ? 36.890  -14.986 1.434   1.00 27.27  ? 441 ASP B CA  1 
ATOM   1393 C C   . ASP B 1 73  ? 36.154  -14.100 0.556   1.00 25.42  ? 441 ASP B C   1 
ATOM   1394 O O   . ASP B 1 73  ? 35.766  -13.004 0.980   1.00 24.27  ? 441 ASP B O   1 
ATOM   1395 C CB  . ASP B 1 73  ? 35.874  -15.900 2.167   1.00 33.60  ? 441 ASP B CB  1 
ATOM   1396 C CG  . ASP B 1 73  ? 36.582  -17.037 2.777   1.00 41.58  ? 441 ASP B CG  1 
ATOM   1397 O OD1 . ASP B 1 73  ? 37.254  -17.787 2.011   1.00 57.22  ? 441 ASP B OD1 1 
ATOM   1398 O OD2 . ASP B 1 73  ? 36.600  -17.105 3.995   1.00 47.60  ? 441 ASP B OD2 1 
ATOM   1399 N N   . LEU B 1 74  ? 35.938  -14.562 -0.669  1.00 26.36  ? 442 LEU B N   1 
ATOM   1400 C CA  . LEU B 1 74  ? 35.022  -13.909 -1.620  1.00 30.10  ? 442 LEU B CA  1 
ATOM   1401 C C   . LEU B 1 74  ? 33.574  -14.202 -1.205  1.00 31.68  ? 442 LEU B C   1 
ATOM   1402 O O   . LEU B 1 74  ? 33.247  -15.347 -0.921  1.00 33.56  ? 442 LEU B O   1 
ATOM   1403 C CB  . LEU B 1 74  ? 35.256  -14.528 -3.008  1.00 33.32  ? 442 LEU B CB  1 
ATOM   1404 C CG  . LEU B 1 74  ? 34.385  -13.938 -4.111  1.00 31.98  ? 442 LEU B CG  1 
ATOM   1405 C CD1 . LEU B 1 74  ? 34.682  -12.448 -4.393  1.00 34.32  ? 442 LEU B CD1 1 
ATOM   1406 C CD2 . LEU B 1 74  ? 34.600  -14.837 -5.327  1.00 41.98  ? 442 LEU B CD2 1 
ATOM   1407 N N   . ALA B 1 75  ? 32.736  -13.187 -1.130  1.00 33.41  ? 443 ALA B N   1 
ATOM   1408 C CA  . ALA B 1 75  ? 31.397  -13.422 -0.558  1.00 33.81  ? 443 ALA B CA  1 
ATOM   1409 C C   . ALA B 1 75  ? 30.427  -13.390 -1.698  1.00 38.30  ? 443 ALA B C   1 
ATOM   1410 O O   . ALA B 1 75  ? 29.513  -14.160 -1.692  1.00 41.88  ? 443 ALA B O   1 
ATOM   1411 C CB  . ALA B 1 75  ? 31.001  -12.349 0.472   1.00 32.73  ? 443 ALA B CB  1 
ATOM   1412 N N   . GLU B 1 76  ? 30.582  -12.467 -2.644  1.00 37.17  ? 444 GLU B N   1 
ATOM   1413 C CA  . GLU B 1 76  ? 29.642  -12.324 -3.795  1.00 43.25  ? 444 GLU B CA  1 
ATOM   1414 C C   . GLU B 1 76  ? 30.475  -11.727 -4.939  1.00 39.30  ? 444 GLU B C   1 
ATOM   1415 O O   . GLU B 1 76  ? 31.117  -10.721 -4.782  1.00 37.03  ? 444 GLU B O   1 
ATOM   1416 C CB  . GLU B 1 76  ? 28.546  -11.280 -3.484  1.00 39.93  ? 444 GLU B CB  1 
ATOM   1417 C CG  . GLU B 1 76  ? 27.111  -11.451 -3.981  1.00 55.49  ? 444 GLU B CG  1 
ATOM   1418 C CD  . GLU B 1 76  ? 26.779  -12.307 -5.224  1.00 46.77  ? 444 GLU B CD  1 
ATOM   1419 O OE1 . GLU B 1 76  ? 26.051  -11.761 -6.060  1.00 67.47  ? 444 GLU B OE1 1 
ATOM   1420 O OE2 . GLU B 1 76  ? 27.122  -13.520 -5.336  1.00 51.26  ? 444 GLU B OE2 1 
ATOM   1421 N N   . GLU B 1 77  ? 30.462  -12.355 -6.090  1.00 42.02  ? 445 GLU B N   1 
ATOM   1422 C CA  . GLU B 1 77  ? 30.868  -11.656 -7.285  1.00 41.46  ? 445 GLU B CA  1 
ATOM   1423 C C   . GLU B 1 77  ? 29.673  -11.392 -8.183  1.00 46.80  ? 445 GLU B C   1 
ATOM   1424 O O   . GLU B 1 77  ? 29.162  -12.318 -8.783  1.00 47.16  ? 445 GLU B O   1 
ATOM   1425 C CB  . GLU B 1 77  ? 31.957  -12.435 -7.996  1.00 42.83  ? 445 GLU B CB  1 
ATOM   1426 C CG  . GLU B 1 77  ? 32.673  -11.468 -8.896  1.00 53.16  ? 445 GLU B CG  1 
ATOM   1427 C CD  . GLU B 1 77  ? 33.532  -12.148 -9.902  1.00 62.05  ? 445 GLU B CD  1 
ATOM   1428 O OE1 . GLU B 1 77  ? 33.194  -12.047 -11.098 1.00 71.62  ? 445 GLU B OE1 1 
ATOM   1429 O OE2 . GLU B 1 77  ? 34.524  -12.780 -9.497  1.00 52.69  ? 445 GLU B OE2 1 
ATOM   1430 N N   . LYS B 1 78  ? 29.234  -10.146 -8.254  1.00 44.31  ? 446 LYS B N   1 
ATOM   1431 C CA  . LYS B 1 78  ? 28.149  -9.723  -9.124  1.00 53.29  ? 446 LYS B CA  1 
ATOM   1432 C C   . LYS B 1 78  ? 28.496  -9.612  -10.585 1.00 54.50  ? 446 LYS B C   1 
ATOM   1433 O O   . LYS B 1 78  ? 27.902  -10.260 -11.404 1.00 59.19  ? 446 LYS B O   1 
ATOM   1434 C CB  . LYS B 1 78  ? 27.531  -8.422  -8.615  1.00 52.37  ? 446 LYS B CB  1 
ATOM   1435 C CG  . LYS B 1 78  ? 26.549  -8.793  -7.508  1.00 56.63  ? 446 LYS B CG  1 
ATOM   1436 C CD  . LYS B 1 78  ? 26.121  -7.644  -6.643  1.00 55.88  ? 446 LYS B CD  1 
ATOM   1437 C CE  . LYS B 1 78  ? 25.117  -8.197  -5.633  1.00 54.19  ? 446 LYS B CE  1 
ATOM   1438 N NZ  . LYS B 1 78  ? 25.643  -7.681  -4.344  1.00 65.25  ? 446 LYS B NZ  1 
ATOM   1439 N N   . SER B 1 79  ? 29.453  -8.775  -10.915 1.00 48.27  ? 447 SER B N   1 
ATOM   1440 C CA  . SER B 1 79  ? 29.909  -8.645  -12.271 1.00 49.59  ? 447 SER B CA  1 
ATOM   1441 C C   . SER B 1 79  ? 31.421  -8.401  -12.221 1.00 56.69  ? 447 SER B C   1 
ATOM   1442 O O   . SER B 1 79  ? 31.976  -8.216  -11.126 1.00 50.56  ? 447 SER B O   1 
ATOM   1443 C CB  . SER B 1 79  ? 29.212  -7.444  -12.837 1.00 43.56  ? 447 SER B CB  1 
ATOM   1444 O OG  . SER B 1 79  ? 29.629  -6.310  -12.134 1.00 47.31  ? 447 SER B OG  1 
ATOM   1445 N N   . PRO B 1 80  ? 32.097  -8.415  -13.385 1.00 55.27  ? 448 PRO B N   1 
ATOM   1446 C CA  . PRO B 1 80  ? 33.455  -7.894  -13.471 1.00 47.18  ? 448 PRO B CA  1 
ATOM   1447 C C   . PRO B 1 80  ? 33.718  -6.603  -12.715 1.00 47.61  ? 448 PRO B C   1 
ATOM   1448 O O   . PRO B 1 80  ? 34.816  -6.409  -12.206 1.00 45.49  ? 448 PRO B O   1 
ATOM   1449 C CB  . PRO B 1 80  ? 33.592  -7.633  -14.979 1.00 55.76  ? 448 PRO B CB  1 
ATOM   1450 C CG  . PRO B 1 80  ? 32.933  -8.855  -15.567 1.00 47.29  ? 448 PRO B CG  1 
ATOM   1451 C CD  . PRO B 1 80  ? 31.707  -9.059  -14.666 1.00 55.42  ? 448 PRO B CD  1 
ATOM   1452 N N   . SER B 1 81  ? 32.748  -5.720  -12.597 1.00 43.86  ? 449 SER B N   1 
ATOM   1453 C CA  . SER B 1 81  ? 33.003  -4.532  -11.827 1.00 39.87  ? 449 SER B CA  1 
ATOM   1454 C C   . SER B 1 81  ? 32.423  -4.476  -10.342 1.00 39.75  ? 449 SER B C   1 
ATOM   1455 O O   . SER B 1 81  ? 32.522  -3.459  -9.681  1.00 36.77  ? 449 SER B O   1 
ATOM   1456 C CB  . SER B 1 81  ? 32.528  -3.344  -12.603 1.00 46.86  ? 449 SER B CB  1 
ATOM   1457 O OG  . SER B 1 81  ? 31.158  -3.522  -12.757 1.00 57.88  ? 449 SER B OG  1 
ATOM   1458 N N   . HIS B 1 82  ? 31.888  -5.565  -9.804  1.00 41.43  ? 450 HIS B N   1 
ATOM   1459 C CA  . HIS B 1 82  ? 31.342  -5.510  -8.434  1.00 42.96  ? 450 HIS B CA  1 
ATOM   1460 C C   . HIS B 1 82  ? 31.551  -6.865  -7.778  1.00 41.27  ? 450 HIS B C   1 
ATOM   1461 O O   . HIS B 1 82  ? 30.955  -7.888  -8.199  1.00 34.16  ? 450 HIS B O   1 
ATOM   1462 C CB  . HIS B 1 82  ? 29.843  -5.087  -8.469  1.00 44.39  ? 450 HIS B CB  1 
ATOM   1463 C CG  . HIS B 1 82  ? 29.209  -4.870  -7.109  1.00 56.21  ? 450 HIS B CG  1 
ATOM   1464 N ND1 . HIS B 1 82  ? 28.006  -4.223  -6.952  1.00 64.59  ? 450 HIS B ND1 1 
ATOM   1465 C CD2 . HIS B 1 82  ? 29.621  -5.237  -5.822  1.00 58.03  ? 450 HIS B CD2 1 
ATOM   1466 C CE1 . HIS B 1 82  ? 27.673  -4.171  -5.625  1.00 52.87  ? 450 HIS B CE1 1 
ATOM   1467 N NE2 . HIS B 1 82  ? 28.663  -4.781  -4.932  1.00 62.02  ? 450 HIS B NE2 1 
ATOM   1468 N N   . ALA B 1 83  ? 32.436  -6.912  -6.771  1.00 30.58  ? 451 ALA B N   1 
ATOM   1469 C CA  . ALA B 1 83  ? 32.656  -8.136  -5.977  1.00 31.05  ? 451 ALA B CA  1 
ATOM   1470 C C   . ALA B 1 83  ? 32.812  -7.667  -4.527  1.00 27.31  ? 451 ALA B C   1 
ATOM   1471 O O   . ALA B 1 83  ? 33.170  -6.480  -4.248  1.00 30.46  ? 451 ALA B O   1 
ATOM   1472 C CB  . ALA B 1 83  ? 33.854  -8.988  -6.429  1.00 28.93  ? 451 ALA B CB  1 
ATOM   1473 N N   . ILE B 1 84  ? 32.473  -8.588  -3.593  1.00 29.15  ? 452 ILE B N   1 
ATOM   1474 C CA  . ILE B 1 84  ? 32.459  -8.312  -2.152  1.00 27.99  ? 452 ILE B CA  1 
ATOM   1475 C C   . ILE B 1 84  ? 33.249  -9.397  -1.535  1.00 24.69  ? 452 ILE B C   1 
ATOM   1476 O O   . ILE B 1 84  ? 33.086  -10.563 -1.916  1.00 27.46  ? 452 ILE B O   1 
ATOM   1477 C CB  . ILE B 1 84  ? 31.008  -8.302  -1.553  1.00 27.31  ? 452 ILE B CB  1 
ATOM   1478 C CG1 . ILE B 1 84  ? 30.285  -7.187  -2.343  1.00 32.95  ? 452 ILE B CG1 1 
ATOM   1479 C CG2 . ILE B 1 84  ? 31.099  -7.976  -0.078  1.00 26.71  ? 452 ILE B CG2 1 
ATOM   1480 C CD1 . ILE B 1 84  ? 28.782  -7.288  -2.409  1.00 39.91  ? 452 ILE B CD1 1 
ATOM   1481 N N   . PHE B 1 85  ? 34.100  -9.004  -0.568  1.00 24.86  ? 453 PHE B N   1 
ATOM   1482 C CA  . PHE B 1 85  ? 34.839  -9.970  0.182   1.00 22.92  ? 453 PHE B CA  1 
ATOM   1483 C C   . PHE B 1 85  ? 34.751  -9.665  1.655   1.00 21.45  ? 453 PHE B C   1 
ATOM   1484 O O   . PHE B 1 85  ? 34.464  -8.555  2.090   1.00 22.88  ? 453 PHE B O   1 
ATOM   1485 C CB  . PHE B 1 85  ? 36.331  -10.107 -0.347  1.00 22.37  ? 453 PHE B CB  1 
ATOM   1486 C CG  . PHE B 1 85  ? 37.214  -8.883  -0.042  1.00 20.49  ? 453 PHE B CG  1 
ATOM   1487 C CD1 . PHE B 1 85  ? 37.240  -7.758  -0.882  1.00 25.44  ? 453 PHE B CD1 1 
ATOM   1488 C CD2 . PHE B 1 85  ? 38.026  -8.870  1.083   1.00 22.33  ? 453 PHE B CD2 1 
ATOM   1489 C CE1 . PHE B 1 85  ? 38.085  -6.679  -0.591  1.00 23.52  ? 453 PHE B CE1 1 
ATOM   1490 C CE2 . PHE B 1 85  ? 38.893  -7.817  1.363   1.00 24.41  ? 453 PHE B CE2 1 
ATOM   1491 C CZ  . PHE B 1 85  ? 38.891  -6.707  0.551   1.00 20.68  ? 453 PHE B CZ  1 
ATOM   1492 N N   . LYS B 1 86  ? 35.067  -10.672 2.450   1.00 23.62  ? 454 LYS B N   1 
ATOM   1493 C CA  . LYS B 1 86  ? 34.910  -10.608 3.872   1.00 22.39  ? 454 LYS B CA  1 
ATOM   1494 C C   . LYS B 1 86  ? 36.210  -10.935 4.542   1.00 22.69  ? 454 LYS B C   1 
ATOM   1495 O O   . LYS B 1 86  ? 36.844  -11.962 4.255   1.00 24.93  ? 454 LYS B O   1 
ATOM   1496 C CB  . LYS B 1 86  ? 33.945  -11.760 4.263   1.00 24.54  ? 454 LYS B CB  1 
ATOM   1497 C CG  . LYS B 1 86  ? 33.562  -11.761 5.722   1.00 32.63  ? 454 LYS B CG  1 
ATOM   1498 C CD  . LYS B 1 86  ? 33.148  -13.186 5.956   1.00 38.99  ? 454 LYS B CD  1 
ATOM   1499 C CE  . LYS B 1 86  ? 31.855  -13.182 6.659   1.00 50.66  ? 454 LYS B CE  1 
ATOM   1500 N NZ  . LYS B 1 86  ? 32.065  -13.918 7.897   1.00 49.96  ? 454 LYS B NZ  1 
ATOM   1501 N N   . LEU B 1 87  ? 36.666  -10.049 5.404   1.00 24.06  ? 455 LEU B N   1 
ATOM   1502 C CA  . LEU B 1 87  ? 37.908  -10.361 6.130   1.00 23.43  ? 455 LEU B CA  1 
ATOM   1503 C C   . LEU B 1 87  ? 37.513  -10.635 7.576   1.00 21.91  ? 455 LEU B C   1 
ATOM   1504 O O   . LEU B 1 87  ? 36.842  -9.793  8.158   1.00 26.28  ? 455 LEU B O   1 
ATOM   1505 C CB  . LEU B 1 87  ? 38.781  -9.096  6.131   1.00 21.92  ? 455 LEU B CB  1 
ATOM   1506 C CG  . LEU B 1 87  ? 40.100  -9.077  6.923   1.00 27.01  ? 455 LEU B CG  1 
ATOM   1507 C CD1 . LEU B 1 87  ? 40.965  -10.064 6.150   1.00 24.48  ? 455 LEU B CD1 1 
ATOM   1508 C CD2 . LEU B 1 87  ? 40.675  -7.619  6.765   1.00 24.34  ? 455 LEU B CD2 1 
ATOM   1509 N N   . THR B 1 88  ? 38.075  -11.682 8.193   1.00 19.09  ? 456 THR B N   1 
ATOM   1510 C CA  . THR B 1 88  ? 37.829  -12.066 9.589   1.00 23.49  ? 456 THR B CA  1 
ATOM   1511 C C   . THR B 1 88  ? 39.098  -12.035 10.340  1.00 22.84  ? 456 THR B C   1 
ATOM   1512 O O   . THR B 1 88  ? 40.095  -12.553 9.868   1.00 21.77  ? 456 THR B O   1 
ATOM   1513 C CB  . THR B 1 88  ? 37.159  -13.510 9.649   1.00 24.78  ? 456 THR B CB  1 
ATOM   1514 O OG1 . THR B 1 88  ? 35.980  -13.477 8.823   1.00 28.17  ? 456 THR B OG1 1 
ATOM   1515 C CG2 . THR B 1 88  ? 36.849  -14.093 11.176  1.00 24.62  ? 456 THR B CG2 1 
ATOM   1516 N N   . TYR B 1 89  ? 39.046  -11.439 11.531  1.00 18.83  ? 457 TYR B N   1 
ATOM   1517 C CA  . TYR B 1 89  ? 40.151  -11.332 12.391  1.00 21.35  ? 457 TYR B CA  1 
ATOM   1518 C C   . TYR B 1 89  ? 39.732  -11.384 13.853  1.00 23.72  ? 457 TYR B C   1 
ATOM   1519 O O   . TYR B 1 89  ? 38.518  -11.224 14.123  1.00 22.49  ? 457 TYR B O   1 
ATOM   1520 C CB  . TYR B 1 89  ? 40.944  -10.031 12.088  1.00 20.14  ? 457 TYR B CB  1 
ATOM   1521 C CG  . TYR B 1 89  ? 40.209  -8.767  12.405  1.00 22.16  ? 457 TYR B CG  1 
ATOM   1522 C CD1 . TYR B 1 89  ? 39.165  -8.307  11.570  1.00 22.38  ? 457 TYR B CD1 1 
ATOM   1523 C CD2 . TYR B 1 89  ? 40.564  -8.044  13.496  1.00 20.90  ? 457 TYR B CD2 1 
ATOM   1524 C CE1 . TYR B 1 89  ? 38.509  -7.134  11.888  1.00 28.13  ? 457 TYR B CE1 1 
ATOM   1525 C CE2 . TYR B 1 89  ? 39.928  -6.892  13.849  1.00 26.03  ? 457 TYR B CE2 1 
ATOM   1526 C CZ  . TYR B 1 89  ? 38.911  -6.451  13.029  1.00 31.57  ? 457 TYR B CZ  1 
ATOM   1527 O OH  . TYR B 1 89  ? 38.364  -5.312  13.470  1.00 33.48  ? 457 TYR B OH  1 
ATOM   1528 N N   . LEU B 1 90  ? 40.683  -11.591 14.779  1.00 22.48  ? 458 LEU B N   1 
ATOM   1529 C CA  . LEU B 1 90  ? 40.449  -11.548 16.243  1.00 24.13  ? 458 LEU B CA  1 
ATOM   1530 C C   . LEU B 1 90  ? 40.670  -10.196 16.850  1.00 25.82  ? 458 LEU B C   1 
ATOM   1531 O O   . LEU B 1 90  ? 41.678  -9.494  16.566  1.00 22.31  ? 458 LEU B O   1 
ATOM   1532 C CB  . LEU B 1 90  ? 41.358  -12.533 16.978  1.00 28.35  ? 458 LEU B CB  1 
ATOM   1533 C CG  . LEU B 1 90  ? 40.785  -13.959 16.938  1.00 30.51  ? 458 LEU B CG  1 
ATOM   1534 C CD1 . LEU B 1 90  ? 41.819  -14.909 17.550  1.00 33.33  ? 458 LEU B CD1 1 
ATOM   1535 C CD2 . LEU B 1 90  ? 39.519  -14.068 17.825  1.00 29.29  ? 458 LEU B CD2 1 
ATOM   1536 N N   . SER B 1 91  ? 39.711  -9.752  17.685  1.00 24.36  ? 459 SER B N   1 
ATOM   1537 C CA  . SER B 1 91  ? 39.861  -8.435  18.294  1.00 24.60  ? 459 SER B CA  1 
ATOM   1538 C C   . SER B 1 91  ? 39.327  -8.578  19.698  1.00 28.64  ? 459 SER B C   1 
ATOM   1539 O O   . SER B 1 91  ? 38.125  -9.033  19.885  1.00 28.72  ? 459 SER B O   1 
ATOM   1540 C CB  . SER B 1 91  ? 39.000  -7.378  17.605  1.00 33.29  ? 459 SER B CB  1 
ATOM   1541 O OG  . SER B 1 91  ? 39.222  -6.120  18.311  1.00 35.05  ? 459 SER B OG  1 
ATOM   1542 N N   . ASN B 1 92  ? 40.231  -8.379  20.644  1.00 28.96  ? 460 ASN B N   1 
ATOM   1543 C CA  . ASN B 1 92  ? 39.933  -8.583  22.073  1.00 30.18  ? 460 ASN B CA  1 
ATOM   1544 C C   . ASN B 1 92  ? 39.078  -9.862  22.240  1.00 30.10  ? 460 ASN B C   1 
ATOM   1545 O O   . ASN B 1 92  ? 37.963  -9.861  22.810  1.00 25.64  ? 460 ASN B O   1 
ATOM   1546 C CB  . ASN B 1 92  ? 39.301  -7.287  22.713  1.00 32.60  ? 460 ASN B CB  1 
ATOM   1547 C CG  . ASN B 1 92  ? 39.350  -7.344  24.256  1.00 42.33  ? 460 ASN B CG  1 
ATOM   1548 O OD1 . ASN B 1 92  ? 40.294  -7.913  24.799  1.00 40.80  ? 460 ASN B OD1 1 
ATOM   1549 N ND2 . ASN B 1 92  ? 38.335  -6.803  24.955  1.00 38.25  ? 460 ASN B ND2 1 
ATOM   1550 N N   . HIS B 1 93  ? 39.575  -10.965 21.657  1.00 25.68  ? 461 HIS B N   1 
ATOM   1551 C CA  . HIS B 1 93  ? 38.988  -12.308 21.888  1.00 25.80  ? 461 HIS B CA  1 
ATOM   1552 C C   . HIS B 1 93  ? 37.737  -12.674 21.190  1.00 25.64  ? 461 HIS B C   1 
ATOM   1553 O O   . HIS B 1 93  ? 37.222  -13.742 21.499  1.00 27.69  ? 461 HIS B O   1 
ATOM   1554 C CB  . HIS B 1 93  ? 38.859  -12.667 23.385  1.00 28.57  ? 461 HIS B CB  1 
ATOM   1555 C CG  . HIS B 1 93  ? 39.999  -12.105 24.253  1.00 35.90  ? 461 HIS B CG  1 
ATOM   1556 N ND1 . HIS B 1 93  ? 41.303  -12.438 24.060  1.00 31.38  ? 461 HIS B ND1 1 
ATOM   1557 C CD2 . HIS B 1 93  ? 39.997  -11.138 25.308  1.00 34.95  ? 461 HIS B CD2 1 
ATOM   1558 C CE1 . HIS B 1 93  ? 42.110  -11.700 24.900  1.00 32.07  ? 461 HIS B CE1 1 
ATOM   1559 N NE2 . HIS B 1 93  ? 41.320  -10.935 25.674  1.00 38.11  ? 461 HIS B NE2 1 
ATOM   1560 N N   . ASP B 1 94  ? 37.197  -11.861 20.233  1.00 25.66  ? 462 ASP B N   1 
ATOM   1561 C CA  . ASP B 1 94  ? 36.017  -12.240 19.403  1.00 22.71  ? 462 ASP B CA  1 
ATOM   1562 C C   . ASP B 1 94  ? 36.406  -12.189 17.907  1.00 25.16  ? 462 ASP B C   1 
ATOM   1563 O O   . ASP B 1 94  ? 37.246  -11.320 17.531  1.00 23.32  ? 462 ASP B O   1 
ATOM   1564 C CB  . ASP B 1 94  ? 34.920  -11.167 19.455  1.00 30.73  ? 462 ASP B CB  1 
ATOM   1565 C CG  . ASP B 1 94  ? 34.217  -11.099 20.769  1.00 42.67  ? 462 ASP B CG  1 
ATOM   1566 O OD1 . ASP B 1 94  ? 33.889  -12.174 21.299  1.00 54.06  ? 462 ASP B OD1 1 
ATOM   1567 O OD2 . ASP B 1 94  ? 33.980  -9.982  21.255  1.00 49.47  ? 462 ASP B OD2 1 
ATOM   1568 N N   . TYR B 1 95  ? 35.747  -12.993 17.067  1.00 24.85  ? 463 TYR B N   1 
ATOM   1569 C CA  . TYR B 1 95  ? 35.901  -12.873 15.611  1.00 29.16  ? 463 TYR B CA  1 
ATOM   1570 C C   . TYR B 1 95  ? 35.131  -11.663 15.123  1.00 29.81  ? 463 TYR B C   1 
ATOM   1571 O O   . TYR B 1 95  ? 33.975  -11.587 15.416  1.00 30.12  ? 463 TYR B O   1 
ATOM   1572 C CB  . TYR B 1 95  ? 35.342  -14.069 14.841  1.00 29.84  ? 463 TYR B CB  1 
ATOM   1573 C CG  . TYR B 1 95  ? 36.074  -15.319 15.121  1.00 36.37  ? 463 TYR B CG  1 
ATOM   1574 C CD1 . TYR B 1 95  ? 37.468  -15.375 15.010  1.00 32.09  ? 463 TYR B CD1 1 
ATOM   1575 C CD2 . TYR B 1 95  ? 35.374  -16.461 15.543  1.00 39.90  ? 463 TYR B CD2 1 
ATOM   1576 C CE1 . TYR B 1 95  ? 38.150  -16.531 15.273  1.00 38.70  ? 463 TYR B CE1 1 
ATOM   1577 C CE2 . TYR B 1 95  ? 36.061  -17.617 15.840  1.00 40.84  ? 463 TYR B CE2 1 
ATOM   1578 C CZ  . TYR B 1 95  ? 37.437  -17.634 15.699  1.00 38.58  ? 463 TYR B CZ  1 
ATOM   1579 O OH  . TYR B 1 95  ? 38.108  -18.779 15.980  1.00 47.80  ? 463 TYR B OH  1 
ATOM   1580 N N   . LYS B 1 96  ? 35.735  -10.743 14.398  1.00 23.48  ? 464 LYS B N   1 
ATOM   1581 C CA  . LYS B 1 96  ? 35.035  -9.643  13.741  1.00 25.47  ? 464 LYS B CA  1 
ATOM   1582 C C   . LYS B 1 96  ? 35.140  -9.820  12.274  1.00 29.35  ? 464 LYS B C   1 
ATOM   1583 O O   . LYS B 1 96  ? 36.150  -10.376 11.793  1.00 26.13  ? 464 LYS B O   1 
ATOM   1584 C CB  . LYS B 1 96  ? 35.836  -8.364  13.877  1.00 30.94  ? 464 LYS B CB  1 
ATOM   1585 C CG  . LYS B 1 96  ? 36.455  -8.181  15.203  1.00 34.84  ? 464 LYS B CG  1 
ATOM   1586 C CD  . LYS B 1 96  ? 35.736  -7.128  15.948  1.00 40.22  ? 464 LYS B CD  1 
ATOM   1587 C CE  . LYS B 1 96  ? 34.747  -7.815  16.806  1.00 44.19  ? 464 LYS B CE  1 
ATOM   1588 N NZ  . LYS B 1 96  ? 34.846  -7.330  18.239  1.00 54.26  ? 464 LYS B NZ  1 
ATOM   1589 N N   . HIS B 1 97  ? 34.213  -9.194  11.540  1.00 24.91  ? 465 HIS B N   1 
ATOM   1590 C CA  . HIS B 1 97  ? 34.158  -9.365  10.070  1.00 22.94  ? 465 HIS B CA  1 
ATOM   1591 C C   . HIS B 1 97  ? 34.067  -8.005  9.473   1.00 25.97  ? 465 HIS B C   1 
ATOM   1592 O O   . HIS B 1 97  ? 33.270  -7.156  9.920   1.00 27.51  ? 465 HIS B O   1 
ATOM   1593 C CB  . HIS B 1 97  ? 32.980  -10.179 9.719   1.00 25.51  ? 465 HIS B CB  1 
ATOM   1594 C CG  . HIS B 1 97  ? 32.850  -11.426 10.549  1.00 30.73  ? 465 HIS B CG  1 
ATOM   1595 N ND1 . HIS B 1 97  ? 33.629  -12.547 10.337  1.00 30.36  ? 465 HIS B ND1 1 
ATOM   1596 C CD2 . HIS B 1 97  ? 31.968  -11.735 11.619  1.00 33.82  ? 465 HIS B CD2 1 
ATOM   1597 C CE1 . HIS B 1 97  ? 33.257  -13.519 11.218  1.00 32.84  ? 465 HIS B CE1 1 
ATOM   1598 N NE2 . HIS B 1 97  ? 32.250  -13.007 12.025  1.00 33.69  ? 465 HIS B NE2 1 
ATOM   1599 N N   . LEU B 1 98  ? 34.899  -7.751  8.475   1.00 24.69  ? 466 LEU B N   1 
ATOM   1600 C CA  . LEU B 1 98  ? 34.827  -6.509  7.731   1.00 27.10  ? 466 LEU B CA  1 
ATOM   1601 C C   . LEU B 1 98  ? 34.465  -6.928  6.319   1.00 24.61  ? 466 LEU B C   1 
ATOM   1602 O O   . LEU B 1 98  ? 34.990  -7.908  5.769   1.00 26.97  ? 466 LEU B O   1 
ATOM   1603 C CB  . LEU B 1 98  ? 36.170  -5.794  7.725   1.00 24.49  ? 466 LEU B CB  1 
ATOM   1604 C CG  . LEU B 1 98  ? 36.611  -5.311  9.097   1.00 32.62  ? 466 LEU B CG  1 
ATOM   1605 C CD1 . LEU B 1 98  ? 38.085  -4.877  9.148   1.00 30.62  ? 466 LEU B CD1 1 
ATOM   1606 C CD2 . LEU B 1 98  ? 35.694  -4.267  9.669   1.00 37.01  ? 466 LEU B CD2 1 
ATOM   1607 N N   . TYR B 1 99  ? 33.649  -6.127  5.679   1.00 23.01  ? 467 TYR B N   1 
ATOM   1608 C CA  . TYR B 1 99  ? 33.262  -6.427  4.299   1.00 23.97  ? 467 TYR B CA  1 
ATOM   1609 C C   . TYR B 1 99  ? 33.608  -5.238  3.459   1.00 23.42  ? 467 TYR B C   1 
ATOM   1610 O O   . TYR B 1 99  ? 33.343  -4.110  3.865   1.00 26.15  ? 467 TYR B O   1 
ATOM   1611 C CB  . TYR B 1 99  ? 31.685  -6.601  4.244   1.00 27.49  ? 467 TYR B CB  1 
ATOM   1612 C CG  . TYR B 1 99  ? 31.206  -7.725  5.184   1.00 28.60  ? 467 TYR B CG  1 
ATOM   1613 C CD1 . TYR B 1 99  ? 30.937  -8.962  4.698   1.00 30.70  ? 467 TYR B CD1 1 
ATOM   1614 C CD2 . TYR B 1 99  ? 31.014  -7.498  6.586   1.00 34.50  ? 467 TYR B CD2 1 
ATOM   1615 C CE1 . TYR B 1 99  ? 30.483  -9.981  5.519   1.00 32.20  ? 467 TYR B CE1 1 
ATOM   1616 C CE2 . TYR B 1 99  ? 30.530  -8.523  7.395   1.00 31.51  ? 467 TYR B CE2 1 
ATOM   1617 C CZ  . TYR B 1 99  ? 30.290  -9.760  6.831   1.00 36.24  ? 467 TYR B CZ  1 
ATOM   1618 O OH  . TYR B 1 99  ? 29.857  -10.845 7.608   1.00 46.33  ? 467 TYR B OH  1 
ATOM   1619 N N   . PHE B 1 100 ? 34.070  -5.508  2.228   1.00 25.89  ? 468 PHE B N   1 
ATOM   1620 C CA  . PHE B 1 100 ? 34.515  -4.421  1.369   1.00 25.64  ? 468 PHE B CA  1 
ATOM   1621 C C   . PHE B 1 100 ? 34.020  -4.769  -0.013  1.00 24.99  ? 468 PHE B C   1 
ATOM   1622 O O   . PHE B 1 100 ? 33.881  -5.955  -0.372  1.00 25.28  ? 468 PHE B O   1 
ATOM   1623 C CB  . PHE B 1 100 ? 36.073  -4.369  1.296   1.00 25.35  ? 468 PHE B CB  1 
ATOM   1624 C CG  . PHE B 1 100 ? 36.739  -4.196  2.644   1.00 25.62  ? 468 PHE B CG  1 
ATOM   1625 C CD1 . PHE B 1 100 ? 36.942  -2.918  3.191   1.00 24.96  ? 468 PHE B CD1 1 
ATOM   1626 C CD2 . PHE B 1 100 ? 37.108  -5.320  3.377   1.00 24.87  ? 468 PHE B CD2 1 
ATOM   1627 C CE1 . PHE B 1 100 ? 37.582  -2.769  4.407   1.00 25.47  ? 468 PHE B CE1 1 
ATOM   1628 C CE2 . PHE B 1 100 ? 37.746  -5.221  4.632   1.00 18.97  ? 468 PHE B CE2 1 
ATOM   1629 C CZ  . PHE B 1 100 ? 37.957  -3.958  5.179   1.00 22.22  ? 468 PHE B CZ  1 
ATOM   1630 N N   . GLU B 1 101 ? 33.897  -3.764  -0.860  1.00 26.65  ? 469 GLU B N   1 
ATOM   1631 C CA  . GLU B 1 101 ? 33.655  -4.154  -2.260  1.00 29.63  ? 469 GLU B CA  1 
ATOM   1632 C C   . GLU B 1 101 ? 34.489  -3.298  -3.155  1.00 25.41  ? 469 GLU B C   1 
ATOM   1633 O O   . GLU B 1 101 ? 34.871  -2.180  -2.785  1.00 27.93  ? 469 GLU B O   1 
ATOM   1634 C CB  . GLU B 1 101 ? 32.140  -3.969  -2.669  1.00 31.81  ? 469 GLU B CB  1 
ATOM   1635 C CG  . GLU B 1 101 ? 31.703  -2.598  -2.300  1.00 32.49  ? 469 GLU B CG  1 
ATOM   1636 C CD  . GLU B 1 101 ? 30.183  -2.321  -2.524  1.00 52.70  ? 469 GLU B CD  1 
ATOM   1637 O OE1 . GLU B 1 101 ? 29.801  -1.121  -2.675  1.00 52.49  ? 469 GLU B OE1 1 
ATOM   1638 O OE2 . GLU B 1 101 ? 29.381  -3.285  -2.522  1.00 46.03  ? 469 GLU B OE2 1 
ATOM   1639 N N   . SER B 1 102 ? 34.691  -3.824  -4.350  1.00 27.06  ? 470 SER B N   1 
ATOM   1640 C CA  . SER B 1 102 ? 35.479  -3.187  -5.350  1.00 28.44  ? 470 SER B CA  1 
ATOM   1641 C C   . SER B 1 102 ? 35.209  -3.881  -6.631  1.00 30.64  ? 470 SER B C   1 
ATOM   1642 O O   . SER B 1 102 ? 34.371  -4.810  -6.697  1.00 32.97  ? 470 SER B O   1 
ATOM   1643 C CB  . SER B 1 102 ? 37.015  -3.385  -5.064  1.00 29.13  ? 470 SER B CB  1 
ATOM   1644 O OG  . SER B 1 102 ? 37.710  -2.418  -5.882  1.00 30.90  ? 470 SER B OG  1 
ATOM   1645 N N   . ASP B 1 103 ? 36.029  -3.586  -7.645  1.00 30.31  ? 471 ASP B N   1 
ATOM   1646 C CA  . ASP B 1 103 ? 35.904  -4.324  -8.881  1.00 32.69  ? 471 ASP B CA  1 
ATOM   1647 C C   . ASP B 1 103 ? 36.454  -5.707  -8.680  1.00 31.48  ? 471 ASP B C   1 
ATOM   1648 O O   . ASP B 1 103 ? 37.264  -5.971  -7.741  1.00 28.92  ? 471 ASP B O   1 
ATOM   1649 C CB  . ASP B 1 103 ? 36.618  -3.604  -10.036 1.00 37.38  ? 471 ASP B CB  1 
ATOM   1650 C CG  . ASP B 1 103 ? 38.141  -3.681  -9.864  1.00 35.21  ? 471 ASP B CG  1 
ATOM   1651 O OD1 . ASP B 1 103 ? 38.673  -2.809  -9.169  1.00 37.93  ? 471 ASP B OD1 1 
ATOM   1652 O OD2 . ASP B 1 103 ? 38.722  -4.688  -10.265 1.00 39.73  ? 471 ASP B OD2 1 
ATOM   1653 N N   . ALA B 1 104 ? 36.039  -6.640  -9.547  1.00 31.69  ? 472 ALA B N   1 
ATOM   1654 C CA  . ALA B 1 104 ? 36.356  -8.038  -9.291  1.00 33.80  ? 472 ALA B CA  1 
ATOM   1655 C C   . ALA B 1 104 ? 37.867  -8.468  -9.350  1.00 33.97  ? 472 ALA B C   1 
ATOM   1656 O O   . ALA B 1 104 ? 38.309  -9.388  -8.627  1.00 28.64  ? 472 ALA B O   1 
ATOM   1657 C CB  . ALA B 1 104 ? 35.514  -8.910  -10.181 1.00 33.13  ? 472 ALA B CB  1 
ATOM   1658 N N   . ALA B 1 105 ? 38.662  -7.813  -10.198 1.00 31.22  ? 473 ALA B N   1 
ATOM   1659 C CA  . ALA B 1 105 ? 40.094  -8.131  -10.315 1.00 30.65  ? 473 ALA B CA  1 
ATOM   1660 C C   . ALA B 1 105 ? 40.804  -7.696  -8.983  1.00 25.38  ? 473 ALA B C   1 
ATOM   1661 O O   . ALA B 1 105 ? 41.639  -8.437  -8.427  1.00 29.59  ? 473 ALA B O   1 
ATOM   1662 C CB  . ALA B 1 105 ? 40.701  -7.357  -11.574 1.00 28.82  ? 473 ALA B CB  1 
ATOM   1663 N N   . THR B 1 106 ? 40.475  -6.489  -8.518  1.00 24.80  ? 474 THR B N   1 
ATOM   1664 C CA  . THR B 1 106 ? 41.010  -5.975  -7.255  1.00 29.46  ? 474 THR B CA  1 
ATOM   1665 C C   . THR B 1 106 ? 40.649  -6.926  -6.079  1.00 28.82  ? 474 THR B C   1 
ATOM   1666 O O   . THR B 1 106 ? 41.476  -7.239  -5.250  1.00 23.32  ? 474 THR B O   1 
ATOM   1667 C CB  . THR B 1 106 ? 40.471  -4.574  -6.985  1.00 26.97  ? 474 THR B CB  1 
ATOM   1668 O OG1 . THR B 1 106 ? 40.968  -3.718  -8.007  1.00 27.50  ? 474 THR B OG1 1 
ATOM   1669 C CG2 . THR B 1 106 ? 40.886  -3.966  -5.602  1.00 23.58  ? 474 THR B CG2 1 
ATOM   1670 N N   . VAL B 1 107 ? 39.381  -7.333  -6.003  1.00 28.28  ? 475 VAL B N   1 
ATOM   1671 C CA  . VAL B 1 107 ? 38.933  -8.204  -4.955  1.00 24.90  ? 475 VAL B CA  1 
ATOM   1672 C C   . VAL B 1 107 ? 39.689  -9.520  -4.971  1.00 23.59  ? 475 VAL B C   1 
ATOM   1673 O O   . VAL B 1 107 ? 40.201  -9.972  -3.940  1.00 24.11  ? 475 VAL B O   1 
ATOM   1674 C CB  . VAL B 1 107 ? 37.401  -8.478  -5.059  1.00 25.17  ? 475 VAL B CB  1 
ATOM   1675 C CG1 . VAL B 1 107 ? 37.086  -9.702  -4.160  1.00 22.50  ? 475 VAL B CG1 1 
ATOM   1676 C CG2 . VAL B 1 107 ? 36.680  -7.232  -4.569  1.00 22.68  ? 475 VAL B CG2 1 
ATOM   1677 N N   . ASN B 1 108 ? 39.779  -10.144 -6.153  1.00 24.78  ? 476 ASN B N   1 
ATOM   1678 C CA  . ASN B 1 108 ? 40.490  -11.394 -6.274  1.00 25.48  ? 476 ASN B CA  1 
ATOM   1679 C C   . ASN B 1 108 ? 41.980  -11.223 -5.910  1.00 23.63  ? 476 ASN B C   1 
ATOM   1680 O O   . ASN B 1 108 ? 42.564  -12.052 -5.273  1.00 21.08  ? 476 ASN B O   1 
ATOM   1681 C CB  . ASN B 1 108 ? 40.308  -11.866 -7.726  1.00 29.29  ? 476 ASN B CB  1 
ATOM   1682 C CG  . ASN B 1 108 ? 41.014  -13.139 -8.010  1.00 39.72  ? 476 ASN B CG  1 
ATOM   1683 O OD1 . ASN B 1 108 ? 42.098  -13.154 -8.582  1.00 48.55  ? 476 ASN B OD1 1 
ATOM   1684 N ND2 . ASN B 1 108 ? 40.455  -14.239 -7.541  1.00 45.18  ? 476 ASN B ND2 1 
ATOM   1685 N N   . GLU B 1 109 ? 42.594  -10.090 -6.274  1.00 23.10  ? 477 GLU B N   1 
ATOM   1686 C CA  . GLU B 1 109 ? 43.997  -9.906  -5.883  1.00 22.57  ? 477 GLU B CA  1 
ATOM   1687 C C   . GLU B 1 109 ? 44.123  -9.821  -4.359  1.00 19.84  ? 477 GLU B C   1 
ATOM   1688 O O   . GLU B 1 109 ? 45.024  -10.380 -3.783  1.00 20.41  ? 477 GLU B O   1 
ATOM   1689 C CB  . GLU B 1 109 ? 44.543  -8.577  -6.491  1.00 20.66  ? 477 GLU B CB  1 
ATOM   1690 C CG  . GLU B 1 109 ? 45.985  -8.316  -6.018  1.00 24.07  ? 477 GLU B CG  1 
ATOM   1691 C CD  . GLU B 1 109 ? 46.581  -7.007  -6.618  1.00 29.27  ? 477 GLU B CD  1 
ATOM   1692 O OE1 . GLU B 1 109 ? 45.877  -6.271  -7.312  1.00 31.65  ? 477 GLU B OE1 1 
ATOM   1693 O OE2 . GLU B 1 109 ? 47.692  -6.587  -6.288  1.00 29.42  ? 477 GLU B OE2 1 
ATOM   1694 N N   . ILE B 1 110 ? 43.225  -9.099  -3.704  1.00 20.41  ? 478 ILE B N   1 
ATOM   1695 C CA  . ILE B 1 110 ? 43.305  -8.936  -2.267  1.00 19.83  ? 478 ILE B CA  1 
ATOM   1696 C C   . ILE B 1 110 ? 43.087  -10.257 -1.531  1.00 20.06  ? 478 ILE B C   1 
ATOM   1697 O O   . ILE B 1 110 ? 43.850  -10.646 -0.609  1.00 19.24  ? 478 ILE B O   1 
ATOM   1698 C CB  . ILE B 1 110 ? 42.227  -7.937  -1.787  1.00 19.57  ? 478 ILE B CB  1 
ATOM   1699 C CG1 . ILE B 1 110 ? 42.550  -6.490  -2.236  1.00 19.85  ? 478 ILE B CG1 1 
ATOM   1700 C CG2 . ILE B 1 110 ? 42.149  -7.916  -0.246  1.00 19.38  ? 478 ILE B CG2 1 
ATOM   1701 C CD1 . ILE B 1 110 ? 41.472  -5.403  -2.047  1.00 20.34  ? 478 ILE B CD1 1 
ATOM   1702 N N   . VAL B 1 111 ? 42.043  -10.997 -1.965  1.00 20.29  ? 479 VAL B N   1 
ATOM   1703 C CA  . VAL B 1 111 ? 41.716  -12.303 -1.312  1.00 18.93  ? 479 VAL B CA  1 
ATOM   1704 C C   . VAL B 1 111 ? 42.947  -13.220 -1.499  1.00 17.08  ? 479 VAL B C   1 
ATOM   1705 O O   . VAL B 1 111 ? 43.410  -13.885 -0.562  1.00 19.78  ? 479 VAL B O   1 
ATOM   1706 C CB  . VAL B 1 111 ? 40.472  -12.952 -2.017  1.00 21.11  ? 479 VAL B CB  1 
ATOM   1707 C CG1 . VAL B 1 111 ? 40.250  -14.376 -1.487  1.00 21.43  ? 479 VAL B CG1 1 
ATOM   1708 C CG2 . VAL B 1 111 ? 39.259  -12.069 -1.690  1.00 20.63  ? 479 VAL B CG2 1 
ATOM   1709 N N   . LEU B 1 112 ? 43.529  -13.241 -2.670  1.00 20.67  ? 480 LEU B N   1 
ATOM   1710 C CA  . LEU B 1 112 ? 44.718  -14.179 -2.800  1.00 21.55  ? 480 LEU B CA  1 
ATOM   1711 C C   . LEU B 1 112 ? 45.906  -13.727 -1.936  1.00 21.98  ? 480 LEU B C   1 
ATOM   1712 O O   . LEU B 1 112 ? 46.628  -14.552 -1.328  1.00 21.10  ? 480 LEU B O   1 
ATOM   1713 C CB  . LEU B 1 112 ? 45.208  -14.194 -4.253  1.00 29.32  ? 480 LEU B CB  1 
ATOM   1714 C CG  . LEU B 1 112 ? 44.251  -14.801 -5.327  1.00 38.72  ? 480 LEU B CG  1 
ATOM   1715 C CD1 . LEU B 1 112 ? 44.924  -14.840 -6.743  1.00 35.39  ? 480 LEU B CD1 1 
ATOM   1716 C CD2 . LEU B 1 112 ? 43.794  -16.204 -4.903  1.00 41.59  ? 480 LEU B CD2 1 
ATOM   1717 N N   . LYS B 1 113 ? 46.150  -12.389 -1.920  1.00 19.39  ? 481 LYS B N   1 
ATOM   1718 C CA  . LYS B 1 113 ? 47.323  -11.863 -1.107  1.00 19.10  ? 481 LYS B CA  1 
ATOM   1719 C C   . LYS B 1 113 ? 47.133  -12.203 0.408   1.00 17.01  ? 481 LYS B C   1 
ATOM   1720 O O   . LYS B 1 113 ? 48.059  -12.678 1.062   1.00 16.56  ? 481 LYS B O   1 
ATOM   1721 C CB  . LYS B 1 113 ? 47.400  -10.302 -1.222  1.00 19.79  ? 481 LYS B CB  1 
ATOM   1722 C CG  . LYS B 1 113 ? 48.547  -9.657  -0.406  1.00 19.27  ? 481 LYS B CG  1 
ATOM   1723 C CD  . LYS B 1 113 ? 48.606  -8.088  -0.768  1.00 17.78  ? 481 LYS B CD  1 
ATOM   1724 C CE  . LYS B 1 113 ? 49.830  -7.458  0.031   1.00 17.67  ? 481 LYS B CE  1 
ATOM   1725 N NZ  . LYS B 1 113 ? 51.106  -7.961  -0.634  1.00 15.16  ? 481 LYS B NZ  1 
ATOM   1726 N N   . VAL B 1 114 ? 45.927  -11.928 0.979   1.00 17.13  ? 482 VAL B N   1 
ATOM   1727 C CA  . VAL B 1 114 ? 45.708  -12.262 2.362   1.00 17.72  ? 482 VAL B CA  1 
ATOM   1728 C C   . VAL B 1 114 ? 45.851  -13.824 2.586   1.00 16.76  ? 482 VAL B C   1 
ATOM   1729 O O   . VAL B 1 114 ? 46.495  -14.270 3.569   1.00 17.56  ? 482 VAL B O   1 
ATOM   1730 C CB  . VAL B 1 114 ? 44.260  -11.803 2.842   1.00 17.18  ? 482 VAL B CB  1 
ATOM   1731 C CG1 . VAL B 1 114 ? 44.026  -12.173 4.314   1.00 16.86  ? 482 VAL B CG1 1 
ATOM   1732 C CG2 . VAL B 1 114 ? 44.213  -10.256 2.744   1.00 20.15  ? 482 VAL B CG2 1 
ATOM   1733 N N   . ASN B 1 115 ? 45.273  -14.644 1.723   1.00 19.34  ? 483 ASN B N   1 
ATOM   1734 C CA  . ASN B 1 115 ? 45.438  -16.094 1.970   1.00 20.25  ? 483 ASN B CA  1 
ATOM   1735 C C   . ASN B 1 115 ? 46.866  -16.576 1.817   1.00 24.01  ? 483 ASN B C   1 
ATOM   1736 O O   . ASN B 1 115 ? 47.319  -17.529 2.474   1.00 23.20  ? 483 ASN B O   1 
ATOM   1737 C CB  . ASN B 1 115 ? 44.519  -16.837 1.045   1.00 19.87  ? 483 ASN B CB  1 
ATOM   1738 C CG  . ASN B 1 115 ? 43.082  -16.880 1.609   1.00 24.19  ? 483 ASN B CG  1 
ATOM   1739 O OD1 . ASN B 1 115 ? 42.870  -17.572 2.616   1.00 24.31  ? 483 ASN B OD1 1 
ATOM   1740 N ND2 . ASN B 1 115 ? 42.135  -16.090 1.045   1.00 22.81  ? 483 ASN B ND2 1 
ATOM   1741 N N   . TYR B 1 116 ? 47.597  -15.894 0.928   1.00 23.00  ? 484 TYR B N   1 
ATOM   1742 C CA  . TYR B 1 116 ? 48.979  -16.300 0.780   1.00 23.45  ? 484 TYR B CA  1 
ATOM   1743 C C   . TYR B 1 116 ? 49.696  -15.964 2.059   1.00 23.76  ? 484 TYR B C   1 
ATOM   1744 O O   . TYR B 1 116 ? 50.518  -16.709 2.502   1.00 24.68  ? 484 TYR B O   1 
ATOM   1745 C CB  . TYR B 1 116 ? 49.554  -15.526 -0.443  1.00 27.63  ? 484 TYR B CB  1 
ATOM   1746 C CG  . TYR B 1 116 ? 50.708  -16.158 -1.048  1.00 29.72  ? 484 TYR B CG  1 
ATOM   1747 C CD1 . TYR B 1 116 ? 50.644  -16.699 -2.366  1.00 44.17  ? 484 TYR B CD1 1 
ATOM   1748 C CD2 . TYR B 1 116 ? 51.901  -16.265 -0.322  1.00 33.59  ? 484 TYR B CD2 1 
ATOM   1749 C CE1 . TYR B 1 116 ? 51.796  -17.282 -2.963  1.00 37.98  ? 484 TYR B CE1 1 
ATOM   1750 C CE2 . TYR B 1 116 ? 53.058  -16.809 -0.871  1.00 40.96  ? 484 TYR B CE2 1 
ATOM   1751 C CZ  . TYR B 1 116 ? 53.008  -17.348 -2.157  1.00 45.76  ? 484 TYR B CZ  1 
ATOM   1752 O OH  . TYR B 1 116 ? 54.212  -17.903 -2.580  1.00 51.48  ? 484 TYR B OH  1 
ATOM   1753 N N   . ILE B 1 117 ? 49.391  -14.841 2.737   1.00 21.40  ? 485 ILE B N   1 
ATOM   1754 C CA  . ILE B 1 117 ? 50.021  -14.543 4.018   1.00 18.61  ? 485 ILE B CA  1 
ATOM   1755 C C   . ILE B 1 117 ? 49.526  -15.501 5.131   1.00 22.69  ? 485 ILE B C   1 
ATOM   1756 O O   . ILE B 1 117 ? 50.291  -15.894 5.979   1.00 22.18  ? 485 ILE B O   1 
ATOM   1757 C CB  . ILE B 1 117 ? 49.662  -13.044 4.478   1.00 20.54  ? 485 ILE B CB  1 
ATOM   1758 C CG1 . ILE B 1 117 ? 50.348  -12.063 3.490   1.00 21.40  ? 485 ILE B CG1 1 
ATOM   1759 C CG2 . ILE B 1 117 ? 50.019  -12.757 5.949   1.00 19.64  ? 485 ILE B CG2 1 
ATOM   1760 C CD1 . ILE B 1 117 ? 49.842  -10.598 3.644   1.00 17.45  ? 485 ILE B CD1 1 
ATOM   1761 N N   . LEU B 1 118 ? 48.218  -15.840 5.163   1.00 19.67  ? 486 LEU B N   1 
ATOM   1762 C CA  . LEU B 1 118 ? 47.759  -16.850 6.188   1.00 19.69  ? 486 LEU B CA  1 
ATOM   1763 C C   . LEU B 1 118 ? 48.499  -18.189 5.970   1.00 21.35  ? 486 LEU B C   1 
ATOM   1764 O O   . LEU B 1 118 ? 49.015  -18.732 6.897   1.00 20.58  ? 486 LEU B O   1 
ATOM   1765 C CB  . LEU B 1 118 ? 46.246  -17.122 5.970   1.00 19.68  ? 486 LEU B CB  1 
ATOM   1766 C CG  . LEU B 1 118 ? 45.416  -15.842 6.222   1.00 19.48  ? 486 LEU B CG  1 
ATOM   1767 C CD1 . LEU B 1 118 ? 43.901  -16.016 5.840   1.00 19.27  ? 486 LEU B CD1 1 
ATOM   1768 C CD2 . LEU B 1 118 ? 45.472  -15.560 7.678   1.00 19.43  ? 486 LEU B CD2 1 
ATOM   1769 N N   . GLU B 1 119 ? 48.563  -18.664 4.722   1.00 22.46  ? 487 GLU B N   1 
ATOM   1770 C CA  . GLU B 1 119 ? 49.243  -19.939 4.435   1.00 27.68  ? 487 GLU B CA  1 
ATOM   1771 C C   . GLU B 1 119 ? 50.731  -19.979 4.655   1.00 30.17  ? 487 GLU B C   1 
ATOM   1772 O O   . GLU B 1 119 ? 51.275  -21.071 4.890   1.00 28.27  ? 487 GLU B O   1 
ATOM   1773 C CB  . GLU B 1 119 ? 48.924  -20.391 3.028   1.00 29.44  ? 487 GLU B CB  1 
ATOM   1774 C CG  . GLU B 1 119 ? 47.457  -20.772 2.949   1.00 38.30  ? 487 GLU B CG  1 
ATOM   1775 C CD  . GLU B 1 119 ? 46.935  -20.813 1.505   1.00 49.47  ? 487 GLU B CD  1 
ATOM   1776 O OE1 . GLU B 1 119 ? 47.741  -20.668 0.565   1.00 56.15  ? 487 GLU B OE1 1 
ATOM   1777 O OE2 . GLU B 1 119 ? 45.701  -20.909 1.278   1.00 52.20  ? 487 GLU B OE2 1 
ATOM   1778 N N   . SER B 1 120 ? 51.395  -18.815 4.704   1.00 25.18  ? 488 SER B N   1 
ATOM   1779 C CA  . SER B 1 120 ? 52.824  -18.796 4.902   1.00 24.83  ? 488 SER B CA  1 
ATOM   1780 C C   . SER B 1 120 ? 53.209  -18.977 6.348   1.00 27.99  ? 488 SER B C   1 
ATOM   1781 O O   . SER B 1 120 ? 54.404  -19.112 6.692   1.00 26.34  ? 488 SER B O   1 
ATOM   1782 C CB  . SER B 1 120 ? 53.391  -17.414 4.352   1.00 28.03  ? 488 SER B CB  1 
ATOM   1783 O OG  . SER B 1 120 ? 53.139  -17.472 2.915   1.00 31.74  ? 488 SER B OG  1 
ATOM   1784 N N   . ARG B 1 121 ? 52.268  -18.883 7.275   1.00 24.33  ? 489 ARG B N   1 
ATOM   1785 C CA  . ARG B 1 121 ? 52.667  -19.107 8.665   1.00 22.40  ? 489 ARG B CA  1 
ATOM   1786 C C   . ARG B 1 121 ? 53.210  -20.557 8.907   1.00 23.85  ? 489 ARG B C   1 
ATOM   1787 O O   . ARG B 1 121 ? 54.080  -20.734 9.712   1.00 23.88  ? 489 ARG B O   1 
ATOM   1788 C CB  . ARG B 1 121 ? 51.451  -18.957 9.631   1.00 26.08  ? 489 ARG B CB  1 
ATOM   1789 C CG  . ARG B 1 121 ? 50.705  -17.605 9.470   1.00 24.58  ? 489 ARG B CG  1 
ATOM   1790 C CD  . ARG B 1 121 ? 49.301  -17.715 10.137  1.00 26.27  ? 489 ARG B CD  1 
ATOM   1791 N NE  . ARG B 1 121 ? 48.775  -16.335 10.343  1.00 27.42  ? 489 ARG B NE  1 
ATOM   1792 C CZ  . ARG B 1 121 ? 47.566  -16.062 10.854  1.00 26.64  ? 489 ARG B CZ  1 
ATOM   1793 N NH1 . ARG B 1 121 ? 46.704  -17.047 11.136  1.00 23.87  ? 489 ARG B NH1 1 
ATOM   1794 N NH2 . ARG B 1 121 ? 47.176  -14.817 11.008  1.00 25.49  ? 489 ARG B NH2 1 
ATOM   1795 N N   . ALA B 1 122 ? 52.673  -21.551 8.241   1.00 22.27  ? 490 ALA B N   1 
ATOM   1796 C CA  . ALA B 1 122 ? 53.113  -22.975 8.557   1.00 30.92  ? 490 ALA B CA  1 
ATOM   1797 C C   . ALA B 1 122 ? 54.594  -23.184 8.122   1.00 32.97  ? 490 ALA B C   1 
ATOM   1798 O O   . ALA B 1 122 ? 54.989  -22.573 7.133   1.00 33.69  ? 490 ALA B O   1 
ATOM   1799 C CB  . ALA B 1 122 ? 52.243  -23.934 7.751   1.00 26.27  ? 490 ALA B CB  1 
ATOM   1800 N N   . SER B 1 123 ? 55.369  -24.094 8.685   1.00 39.60  ? 491 SER B N   1 
ATOM   1801 C CA  . SER B 1 123 ? 56.753  -24.232 8.112   1.00 42.30  ? 491 SER B CA  1 
ATOM   1802 C C   . SER B 1 123 ? 56.802  -25.167 6.915   1.00 35.01  ? 491 SER B C   1 
ATOM   1803 O O   . SER B 1 123 ? 55.700  -25.788 6.703   1.00 32.40  ? 491 SER B O   1 
ATOM   1804 C CB  . SER B 1 123 ? 57.775  -24.546 9.178   1.00 49.42  ? 491 SER B CB  1 
ATOM   1805 O OG  . SER B 1 123 ? 57.628  -25.865 9.596   1.00 53.90  ? 491 SER B OG  1 
HETATM 1806 O O   . HOH C 2 .   ? -4.075  -22.431 -2.349  1.00 18.47  ? 501 HOH A O   1 
HETATM 1807 O O   . HOH C 2 .   ? 0.304   -28.692 2.406   1.00 19.66  ? 502 HOH A O   1 
HETATM 1808 O O   . HOH C 2 .   ? 1.752   -23.658 8.671   1.00 28.75  ? 503 HOH A O   1 
HETATM 1809 O O   . HOH C 2 .   ? 0.037   -12.912 -2.457  1.00 27.24  ? 504 HOH A O   1 
HETATM 1810 O O   . HOH C 2 .   ? 9.354   -11.722 10.539  1.00 34.32  ? 505 HOH A O   1 
HETATM 1811 O O   . HOH C 2 .   ? 1.384   -14.560 -4.740  1.00 30.09  ? 506 HOH A O   1 
HETATM 1812 O O   . HOH C 2 .   ? -3.358  -13.280 7.108   1.00 37.74  ? 507 HOH A O   1 
HETATM 1813 O O   . HOH C 2 .   ? -6.254  -17.180 1.988   1.00 29.19  ? 508 HOH A O   1 
HETATM 1814 O O   . HOH C 2 .   ? 13.706  -22.054 -4.381  1.00 36.47  ? 509 HOH A O   1 
HETATM 1815 O O   . HOH C 2 .   ? 18.681  -15.195 12.766  1.00 34.50  ? 510 HOH A O   1 
HETATM 1816 O O   . HOH C 2 .   ? 6.002   -20.054 -9.861  1.00 34.95  ? 511 HOH A O   1 
HETATM 1817 O O   . HOH C 2 .   ? 3.539   -12.375 10.316  1.00 27.47  ? 512 HOH A O   1 
HETATM 1818 O O   . HOH C 2 .   ? -5.896  -9.295  2.357   1.00 27.71  ? 513 HOH A O   1 
HETATM 1819 O O   . HOH C 2 .   ? -7.067  -21.330 -6.773  1.00 33.19  ? 514 HOH A O   1 
HETATM 1820 O O   . HOH C 2 .   ? 18.835  -12.932 5.469   1.00 30.81  ? 515 HOH A O   1 
HETATM 1821 O O   . HOH C 2 .   ? -11.573 -8.114  -9.245  1.00 37.42  ? 516 HOH A O   1 
HETATM 1822 O O   . HOH C 2 .   ? -8.256  -24.946 15.585  1.00 52.62  ? 517 HOH A O   1 
HETATM 1823 O O   . HOH C 2 .   ? 12.024  -27.303 8.101   1.00 36.16  ? 518 HOH A O   1 
HETATM 1824 O O   . HOH C 2 .   ? -5.370  -7.258  0.360   1.00 38.19  ? 519 HOH A O   1 
HETATM 1825 O O   . HOH C 2 .   ? 22.475  -16.568 -2.887  1.00 48.93  ? 520 HOH A O   1 
HETATM 1826 O O   . HOH C 2 .   ? -0.112  -24.673 5.111   1.00 39.94  ? 521 HOH A O   1 
HETATM 1827 O O   . HOH C 2 .   ? 9.939   -13.028 -9.233  1.00 38.74  ? 522 HOH A O   1 
HETATM 1828 O O   . HOH C 2 .   ? 6.234   -26.550 -2.034  1.00 37.62  ? 523 HOH A O   1 
HETATM 1829 O O   . HOH C 2 .   ? -2.304  -11.847 4.687   1.00 36.50  ? 524 HOH A O   1 
HETATM 1830 O O   . HOH C 2 .   ? 8.072   -24.208 -1.742  1.00 40.19  ? 525 HOH A O   1 
HETATM 1831 O O   . HOH C 2 .   ? -1.009  -10.735 -3.780  1.00 41.21  ? 526 HOH A O   1 
HETATM 1832 O O   . HOH C 2 .   ? 16.914  -13.871 -7.962  1.00 36.68  ? 527 HOH A O   1 
HETATM 1833 O O   . HOH C 2 .   ? 29.121  -13.773 5.337   1.00 41.09  ? 528 HOH A O   1 
HETATM 1834 O O   . HOH C 2 .   ? -1.528  -15.005 -2.050  1.00 33.78  ? 529 HOH A O   1 
HETATM 1835 O O   . HOH C 2 .   ? -5.684  -17.325 4.775   1.00 31.71  ? 530 HOH A O   1 
HETATM 1836 O O   . HOH C 2 .   ? -0.616  -23.368 7.132   1.00 37.83  ? 531 HOH A O   1 
HETATM 1837 O O   . HOH C 2 .   ? 0.689   -25.673 -6.155  1.00 46.21  ? 532 HOH A O   1 
HETATM 1838 O O   . HOH C 2 .   ? 1.523   -7.271  1.899   1.00 43.28  ? 533 HOH A O   1 
HETATM 1839 O O   . HOH C 2 .   ? -7.370  -7.188  -6.017  1.00 45.03  ? 534 HOH A O   1 
HETATM 1840 O O   . HOH C 2 .   ? 11.442  -23.364 -4.736  1.00 36.61  ? 535 HOH A O   1 
HETATM 1841 O O   . HOH C 2 .   ? 11.157  -17.705 -9.917  1.00 49.55  ? 536 HOH A O   1 
HETATM 1842 O O   . HOH C 2 .   ? 13.346  -24.968 10.172  1.00 46.26  ? 537 HOH A O   1 
HETATM 1843 O O   . HOH C 2 .   ? -5.577  -11.302 -1.515  1.00 40.48  ? 538 HOH A O   1 
HETATM 1844 O O   . HOH C 2 .   ? 1.879   -3.605  -4.228  1.00 48.60  ? 539 HOH A O   1 
HETATM 1845 O O   . HOH C 2 .   ? 3.046   -13.792 12.555  1.00 37.84  ? 540 HOH A O   1 
HETATM 1846 O O   . HOH C 2 .   ? 25.819  -19.857 -3.850  1.00 57.39  ? 541 HOH A O   1 
HETATM 1847 O O   . HOH C 2 .   ? 0.297   -17.004 -4.892  1.00 34.29  ? 542 HOH A O   1 
HETATM 1848 O O   . HOH C 2 .   ? 9.398   -29.185 6.097   1.00 49.65  ? 543 HOH A O   1 
HETATM 1849 O O   . HOH C 2 .   ? 0.144   -7.674  4.177   1.00 40.35  ? 544 HOH A O   1 
HETATM 1850 O O   . HOH C 2 .   ? -9.841  -4.364  -4.473  1.00 44.64  ? 545 HOH A O   1 
HETATM 1851 O O   . HOH C 2 .   ? 31.925  -3.215  9.671   1.00 47.74  ? 546 HOH A O   1 
HETATM 1852 O O   . HOH C 2 .   ? 18.172  -18.248 20.588  1.00 50.99  ? 547 HOH A O   1 
HETATM 1853 O O   . HOH C 2 .   ? 4.116   -6.362  7.356   1.00 38.62  ? 548 HOH A O   1 
HETATM 1854 O O   . HOH C 2 .   ? 2.001   -6.488  -4.994  1.00 41.02  ? 549 HOH A O   1 
HETATM 1855 O O   . HOH C 2 .   ? -0.125  -9.711  5.458   1.00 42.93  ? 550 HOH A O   1 
HETATM 1856 O O   . HOH C 2 .   ? 20.842  -9.942  6.676   1.00 37.05  ? 551 HOH A O   1 
HETATM 1857 O O   . HOH C 2 .   ? -4.550  -9.857  -3.243  1.00 44.11  ? 552 HOH A O   1 
HETATM 1858 O O   . HOH C 2 .   ? 17.717  -23.096 8.763   1.00 47.84  ? 553 HOH A O   1 
HETATM 1859 O O   . HOH C 2 .   ? 11.361  -28.467 4.493   1.00 62.68  ? 554 HOH A O   1 
HETATM 1860 O O   . HOH C 2 .   ? 17.368  -26.146 5.294   1.00 41.56  ? 555 HOH A O   1 
HETATM 1861 O O   . HOH C 2 .   ? -2.101  -16.188 -4.467  1.00 38.31  ? 556 HOH A O   1 
HETATM 1862 O O   . HOH C 2 .   ? -0.265  -18.519 -7.293  1.00 46.50  ? 557 HOH A O   1 
HETATM 1863 O O   . HOH C 2 .   ? 4.465   -30.237 9.906   1.00 54.69  ? 558 HOH A O   1 
HETATM 1864 O O   . HOH C 2 .   ? 2.354   -8.444  8.485   1.00 55.37  ? 559 HOH A O   1 
HETATM 1865 O O   . HOH C 2 .   ? 16.275  -4.174  8.137   1.00 59.36  ? 560 HOH A O   1 
HETATM 1866 O O   . HOH D 2 .   ? 65.952  -21.127 -8.600  1.00 22.40  ? 501 HOH B O   1 
HETATM 1867 O O   . HOH D 2 .   ? 62.963  -20.544 -9.380  1.00 24.36  ? 502 HOH B O   1 
HETATM 1868 O O   . HOH D 2 .   ? 53.009  -1.001  -2.434  1.00 23.62  ? 503 HOH B O   1 
HETATM 1869 O O   . HOH D 2 .   ? 36.605  -14.073 6.192   1.00 36.35  ? 504 HOH B O   1 
HETATM 1870 O O   . HOH D 2 .   ? 50.406  -14.062 10.237  1.00 23.35  ? 505 HOH B O   1 
HETATM 1871 O O   . HOH D 2 .   ? 58.698  -22.202 -7.169  1.00 30.82  ? 506 HOH B O   1 
HETATM 1872 O O   . HOH D 2 .   ? 47.872  1.405   4.897   1.00 32.99  ? 507 HOH B O   1 
HETATM 1873 O O   . HOH D 2 .   ? 52.377  -2.838  6.953   1.00 28.99  ? 508 HOH B O   1 
HETATM 1874 O O   . HOH D 2 .   ? 51.194  -9.884  13.975  1.00 34.82  ? 509 HOH B O   1 
HETATM 1875 O O   . HOH D 2 .   ? 49.671  -2.449  6.313   1.00 34.84  ? 510 HOH B O   1 
HETATM 1876 O O   . HOH D 2 .   ? 40.875  -17.585 4.323   1.00 26.12  ? 511 HOH B O   1 
HETATM 1877 O O   . HOH D 2 .   ? 42.980  -7.103  16.678  1.00 32.67  ? 512 HOH B O   1 
HETATM 1878 O O   . HOH D 2 .   ? 47.446  -11.074 -4.854  1.00 26.13  ? 513 HOH B O   1 
HETATM 1879 O O   . HOH D 2 .   ? 32.426  -3.997  7.182   1.00 32.42  ? 514 HOH B O   1 
HETATM 1880 O O   . HOH D 2 .   ? 38.037  -13.138 -6.887  1.00 44.33  ? 515 HOH B O   1 
HETATM 1881 O O   . HOH D 2 .   ? 45.980  -5.894  16.211  1.00 41.17  ? 516 HOH B O   1 
HETATM 1882 O O   . HOH D 2 .   ? 52.944  -12.945 8.182   1.00 32.84  ? 517 HOH B O   1 
HETATM 1883 O O   . HOH D 2 .   ? 29.205  -9.998  10.345  1.00 46.54  ? 518 HOH B O   1 
HETATM 1884 O O   . HOH D 2 .   ? 55.401  -21.970 11.460  1.00 30.61  ? 519 HOH B O   1 
HETATM 1885 O O   . HOH D 2 .   ? 53.048  -15.661 6.369   1.00 38.47  ? 520 HOH B O   1 
HETATM 1886 O O   . HOH D 2 .   ? 36.976  0.012   -5.383  1.00 37.59  ? 521 HOH B O   1 
HETATM 1887 O O   . HOH D 2 .   ? 36.938  -13.434 26.106  1.00 34.03  ? 522 HOH B O   1 
HETATM 1888 O O   . HOH D 2 .   ? 66.111  -23.354 -7.547  1.00 31.68  ? 523 HOH B O   1 
HETATM 1889 O O   . HOH D 2 .   ? 45.347  2.196   5.059   1.00 28.40  ? 524 HOH B O   1 
HETATM 1890 O O   . HOH D 2 .   ? 51.912  -5.576  -6.749  1.00 40.87  ? 525 HOH B O   1 
HETATM 1891 O O   . HOH D 2 .   ? 31.959  -8.278  13.216  1.00 39.74  ? 526 HOH B O   1 
HETATM 1892 O O   . HOH D 2 .   ? 43.139  -0.108  -5.834  1.00 30.56  ? 527 HOH B O   1 
HETATM 1893 O O   . HOH D 2 .   ? 51.030  -7.563  -3.218  1.00 36.46  ? 528 HOH B O   1 
HETATM 1894 O O   . HOH D 2 .   ? 42.498  -0.905  15.379  1.00 34.60  ? 529 HOH B O   1 
HETATM 1895 O O   . HOH D 2 .   ? 35.893  -7.968  21.059  1.00 36.42  ? 530 HOH B O   1 
HETATM 1896 O O   . HOH D 2 .   ? 56.332  -10.452 6.374   1.00 28.94  ? 531 HOH B O   1 
HETATM 1897 O O   . HOH D 2 .   ? 43.121  -10.200 -9.850  1.00 38.62  ? 532 HOH B O   1 
HETATM 1898 O O   . HOH D 2 .   ? 53.135  -8.043  13.027  1.00 37.99  ? 533 HOH B O   1 
HETATM 1899 O O   . HOH D 2 .   ? 56.203  -8.229  5.117   1.00 34.48  ? 534 HOH B O   1 
HETATM 1900 O O   . HOH D 2 .   ? 44.037  -19.873 3.031   1.00 32.64  ? 535 HOH B O   1 
HETATM 1901 O O   . HOH D 2 .   ? 54.127  -25.232 11.288  1.00 40.64  ? 536 HOH B O   1 
HETATM 1902 O O   . HOH D 2 .   ? 43.035  -7.441  19.980  1.00 44.95  ? 537 HOH B O   1 
HETATM 1903 O O   . HOH D 2 .   ? 37.005  2.788   13.595  1.00 70.31  ? 538 HOH B O   1 
HETATM 1904 O O   . HOH D 2 .   ? 48.911  -8.156  -4.471  1.00 39.82  ? 539 HOH B O   1 
HETATM 1905 O O   . HOH D 2 .   ? 60.247  -7.702  -5.485  1.00 41.98  ? 540 HOH B O   1 
HETATM 1906 O O   . HOH D 2 .   ? 55.735  -6.411  -4.554  1.00 32.34  ? 541 HOH B O   1 
HETATM 1907 O O   . HOH D 2 .   ? 33.284  -14.456 21.187  1.00 43.83  ? 542 HOH B O   1 
HETATM 1908 O O   . HOH D 2 .   ? 49.564  -21.479 7.440   1.00 38.20  ? 543 HOH B O   1 
HETATM 1909 O O   . HOH D 2 .   ? 47.169  -11.793 -7.476  1.00 38.61  ? 544 HOH B O   1 
HETATM 1910 O O   . HOH D 2 .   ? 53.816  -2.753  9.791   1.00 47.20  ? 545 HOH B O   1 
HETATM 1911 O O   . HOH D 2 .   ? 25.274  -6.297  -2.337  1.00 41.89  ? 546 HOH B O   1 
HETATM 1912 O O   . HOH D 2 .   ? 37.256  -6.893  -12.637 1.00 39.40  ? 547 HOH B O   1 
HETATM 1913 O O   . HOH D 2 .   ? 39.021  -3.945  15.277  1.00 43.07  ? 548 HOH B O   1 
HETATM 1914 O O   . HOH D 2 .   ? 49.920  -11.019 -3.532  1.00 38.32  ? 549 HOH B O   1 
HETATM 1915 O O   . HOH D 2 .   ? 58.806  -24.001 -3.338  1.00 43.76  ? 550 HOH B O   1 
HETATM 1916 O O   . HOH D 2 .   ? 52.690  -12.837 17.074  1.00 47.60  ? 551 HOH B O   1 
HETATM 1917 O O   . HOH D 2 .   ? 45.800  -3.682  -7.466  1.00 38.33  ? 552 HOH B O   1 
HETATM 1918 O O   . HOH D 2 .   ? 32.186  4.043   -0.882  1.00 52.28  ? 553 HOH B O   1 
HETATM 1919 O O   . HOH D 2 .   ? 36.481  2.753   -3.788  1.00 49.08  ? 554 HOH B O   1 
HETATM 1920 O O   . HOH D 2 .   ? 36.761  -14.891 23.639  1.00 38.72  ? 555 HOH B O   1 
HETATM 1921 O O   . HOH D 2 .   ? 53.796  -22.244 4.725   1.00 36.25  ? 556 HOH B O   1 
HETATM 1922 O O   . HOH D 2 .   ? 58.079  -9.453  8.566   1.00 47.78  ? 557 HOH B O   1 
HETATM 1923 O O   . HOH D 2 .   ? 56.134  -20.131 -5.528  1.00 48.67  ? 558 HOH B O   1 
HETATM 1924 O O   . HOH D 2 .   ? 53.512  -4.663  -2.987  1.00 41.71  ? 559 HOH B O   1 
HETATM 1925 O O   . HOH D 2 .   ? 53.605  -18.899 -5.120  1.00 41.47  ? 560 HOH B O   1 
HETATM 1926 O O   . HOH D 2 .   ? 32.442  -1.539  -6.417  1.00 52.10  ? 561 HOH B O   1 
HETATM 1927 O O   . HOH D 2 .   ? 38.275  -18.393 11.134  1.00 51.07  ? 562 HOH B O   1 
HETATM 1928 O O   . HOH D 2 .   ? 43.331  -18.815 10.386  1.00 46.68  ? 563 HOH B O   1 
HETATM 1929 O O   . HOH D 2 .   ? 41.493  -19.028 6.668   1.00 36.25  ? 564 HOH B O   1 
HETATM 1930 O O   . HOH D 2 .   ? 50.988  -20.323 -0.368  1.00 48.96  ? 565 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   369 369 GLY GLY A . n 
A 1 2   ALA 2   370 370 ALA ALA A . n 
A 1 3   MET 3   371 371 MET MET A . n 
A 1 4   ALA 4   372 372 ALA ALA A . n 
A 1 5   THR 5   373 373 THR THR A . n 
A 1 6   VAL 6   374 374 VAL VAL A . n 
A 1 7   GLN 7   375 375 GLN GLN A . n 
A 1 8   ASP 8   376 376 ASP ASP A . n 
A 1 9   MET 9   377 377 MET MET A . n 
A 1 10  LEU 10  378 378 LEU LEU A . n 
A 1 11  SER 11  379 379 SER SER A . n 
A 1 12  SER 12  380 380 SER SER A . n 
A 1 13  HIS 13  381 381 HIS HIS A . n 
A 1 14  HIS 14  382 382 HIS HIS A . n 
A 1 15  TYR 15  383 383 TYR TYR A . n 
A 1 16  LYS 16  384 384 LYS LYS A . n 
A 1 17  SER 17  385 385 SER SER A . n 
A 1 18  PHE 18  386 386 PHE PHE A . n 
A 1 19  LYS 19  387 387 LYS LYS A . n 
A 1 20  VAL 20  388 388 VAL VAL A . n 
A 1 21  SER 21  389 389 SER SER A . n 
A 1 22  MET 22  390 390 MET MET A . n 
A 1 23  ILE 23  391 391 ILE ILE A . n 
A 1 24  HIS 24  392 392 HIS HIS A . n 
A 1 25  ARG 25  393 393 ARG ARG A . n 
A 1 26  LEU 26  394 394 LEU LEU A . n 
A 1 27  ARG 27  395 395 ARG ARG A . n 
A 1 28  PHE 28  396 396 PHE PHE A . n 
A 1 29  THR 29  397 397 THR THR A . n 
A 1 30  THR 30  398 398 THR THR A . n 
A 1 31  ASP 31  399 399 ASP ASP A . n 
A 1 32  VAL 32  400 400 VAL VAL A . n 
A 1 33  GLN 33  401 401 GLN GLN A . n 
A 1 34  LEU 34  402 402 LEU LEU A . n 
A 1 35  GLY 35  403 403 GLY GLY A . n 
A 1 36  ILE 36  404 404 ILE ILE A . n 
A 1 37  SER 37  405 405 SER SER A . n 
A 1 38  GLY 38  406 406 GLY GLY A . n 
A 1 39  ASP 39  407 407 ASP ASP A . n 
A 1 40  LYS 40  408 408 LYS LYS A . n 
A 1 41  VAL 41  409 409 VAL VAL A . n 
A 1 42  GLU 42  410 410 GLU GLU A . n 
A 1 43  ILE 43  411 411 ILE ILE A . n 
A 1 44  ASP 44  412 412 ASP ASP A . n 
A 1 45  PRO 45  413 413 PRO PRO A . n 
A 1 46  VAL 46  414 414 VAL VAL A . n 
A 1 47  THR 47  415 ?   ?   ?   A . n 
A 1 48  ASN 48  416 ?   ?   ?   A . n 
A 1 49  GLN 49  417 ?   ?   ?   A . n 
A 1 50  LYS 50  418 ?   ?   ?   A . n 
A 1 51  ALA 51  419 ?   ?   ?   A . n 
A 1 52  SER 52  420 ?   ?   ?   A . n 
A 1 53  THR 53  421 421 THR THR A . n 
A 1 54  LYS 54  422 422 LYS LYS A . n 
A 1 55  PHE 55  423 423 PHE PHE A . n 
A 1 56  TRP 56  424 424 TRP TRP A . n 
A 1 57  ILE 57  425 425 ILE ILE A . n 
A 1 58  LYS 58  426 426 LYS LYS A . n 
A 1 59  GLN 59  427 427 GLN GLN A . n 
A 1 60  LYS 60  428 428 LYS LYS A . n 
A 1 61  PRO 61  429 429 PRO PRO A . n 
A 1 62  ILE 62  430 430 ILE ILE A . n 
A 1 63  SER 63  431 431 SER SER A . n 
A 1 64  ILE 64  432 432 ILE ILE A . n 
A 1 65  ASP 65  433 433 ASP ASP A . n 
A 1 66  SER 66  434 434 SER SER A . n 
A 1 67  ASP 67  435 435 ASP ASP A . n 
A 1 68  LEU 68  436 436 LEU LEU A . n 
A 1 69  LEU 69  437 437 LEU LEU A . n 
A 1 70  CYS 70  438 438 CYS CYS A . n 
A 1 71  ALA 71  439 439 ALA ALA A . n 
A 1 72  CYS 72  440 440 CYS CYS A . n 
A 1 73  ASP 73  441 441 ASP ASP A . n 
A 1 74  LEU 74  442 442 LEU LEU A . n 
A 1 75  ALA 75  443 443 ALA ALA A . n 
A 1 76  GLU 76  444 444 GLU GLU A . n 
A 1 77  GLU 77  445 445 GLU GLU A . n 
A 1 78  LYS 78  446 446 LYS LYS A . n 
A 1 79  SER 79  447 447 SER SER A . n 
A 1 80  PRO 80  448 448 PRO PRO A . n 
A 1 81  SER 81  449 449 SER SER A . n 
A 1 82  HIS 82  450 450 HIS HIS A . n 
A 1 83  ALA 83  451 451 ALA ALA A . n 
A 1 84  ILE 84  452 452 ILE ILE A . n 
A 1 85  PHE 85  453 453 PHE PHE A . n 
A 1 86  LYS 86  454 454 LYS LYS A . n 
A 1 87  LEU 87  455 455 LEU LEU A . n 
A 1 88  THR 88  456 456 THR THR A . n 
A 1 89  TYR 89  457 457 TYR TYR A . n 
A 1 90  LEU 90  458 458 LEU LEU A . n 
A 1 91  SER 91  459 459 SER SER A . n 
A 1 92  ASN 92  460 460 ASN ASN A . n 
A 1 93  HIS 93  461 461 HIS HIS A . n 
A 1 94  ASP 94  462 462 ASP ASP A . n 
A 1 95  TYR 95  463 463 TYR TYR A . n 
A 1 96  LYS 96  464 464 LYS LYS A . n 
A 1 97  HIS 97  465 465 HIS HIS A . n 
A 1 98  LEU 98  466 466 LEU LEU A . n 
A 1 99  TYR 99  467 467 TYR TYR A . n 
A 1 100 PHE 100 468 468 PHE PHE A . n 
A 1 101 GLU 101 469 469 GLU GLU A . n 
A 1 102 SER 102 470 470 SER SER A . n 
A 1 103 ASP 103 471 471 ASP ASP A . n 
A 1 104 ALA 104 472 472 ALA ALA A . n 
A 1 105 ALA 105 473 473 ALA ALA A . n 
A 1 106 THR 106 474 474 THR THR A . n 
A 1 107 VAL 107 475 475 VAL VAL A . n 
A 1 108 ASN 108 476 476 ASN ASN A . n 
A 1 109 GLU 109 477 477 GLU GLU A . n 
A 1 110 ILE 110 478 478 ILE ILE A . n 
A 1 111 VAL 111 479 479 VAL VAL A . n 
A 1 112 LEU 112 480 480 LEU LEU A . n 
A 1 113 LYS 113 481 481 LYS LYS A . n 
A 1 114 VAL 114 482 482 VAL VAL A . n 
A 1 115 ASN 115 483 483 ASN ASN A . n 
A 1 116 TYR 116 484 484 TYR TYR A . n 
A 1 117 ILE 117 485 485 ILE ILE A . n 
A 1 118 LEU 118 486 486 LEU LEU A . n 
A 1 119 GLU 119 487 487 GLU GLU A . n 
A 1 120 SER 120 488 488 SER SER A . n 
A 1 121 ARG 121 489 489 ARG ARG A . n 
A 1 122 ALA 122 490 490 ALA ALA A . n 
A 1 123 SER 123 491 ?   ?   ?   A . n 
A 1 124 THR 124 492 ?   ?   ?   A . n 
A 1 125 ALA 125 493 ?   ?   ?   A . n 
B 1 1   GLY 1   369 369 GLY GLY B . n 
B 1 2   ALA 2   370 370 ALA ALA B . n 
B 1 3   MET 3   371 371 MET MET B . n 
B 1 4   ALA 4   372 372 ALA ALA B . n 
B 1 5   THR 5   373 373 THR THR B . n 
B 1 6   VAL 6   374 374 VAL VAL B . n 
B 1 7   GLN 7   375 375 GLN GLN B . n 
B 1 8   ASP 8   376 376 ASP ASP B . n 
B 1 9   MET 9   377 377 MET MET B . n 
B 1 10  LEU 10  378 378 LEU LEU B . n 
B 1 11  SER 11  379 379 SER SER B . n 
B 1 12  SER 12  380 380 SER SER B . n 
B 1 13  HIS 13  381 381 HIS HIS B . n 
B 1 14  HIS 14  382 382 HIS HIS B . n 
B 1 15  TYR 15  383 383 TYR TYR B . n 
B 1 16  LYS 16  384 384 LYS LYS B . n 
B 1 17  SER 17  385 385 SER SER B . n 
B 1 18  PHE 18  386 386 PHE PHE B . n 
B 1 19  LYS 19  387 387 LYS LYS B . n 
B 1 20  VAL 20  388 388 VAL VAL B . n 
B 1 21  SER 21  389 389 SER SER B . n 
B 1 22  MET 22  390 390 MET MET B . n 
B 1 23  ILE 23  391 391 ILE ILE B . n 
B 1 24  HIS 24  392 392 HIS HIS B . n 
B 1 25  ARG 25  393 393 ARG ARG B . n 
B 1 26  LEU 26  394 394 LEU LEU B . n 
B 1 27  ARG 27  395 395 ARG ARG B . n 
B 1 28  PHE 28  396 396 PHE PHE B . n 
B 1 29  THR 29  397 397 THR THR B . n 
B 1 30  THR 30  398 398 THR THR B . n 
B 1 31  ASP 31  399 399 ASP ASP B . n 
B 1 32  VAL 32  400 400 VAL VAL B . n 
B 1 33  GLN 33  401 401 GLN GLN B . n 
B 1 34  LEU 34  402 402 LEU LEU B . n 
B 1 35  GLY 35  403 403 GLY GLY B . n 
B 1 36  ILE 36  404 404 ILE ILE B . n 
B 1 37  SER 37  405 405 SER SER B . n 
B 1 38  GLY 38  406 406 GLY GLY B . n 
B 1 39  ASP 39  407 407 ASP ASP B . n 
B 1 40  LYS 40  408 408 LYS LYS B . n 
B 1 41  VAL 41  409 409 VAL VAL B . n 
B 1 42  GLU 42  410 410 GLU GLU B . n 
B 1 43  ILE 43  411 411 ILE ILE B . n 
B 1 44  ASP 44  412 412 ASP ASP B . n 
B 1 45  PRO 45  413 413 PRO PRO B . n 
B 1 46  VAL 46  414 414 VAL VAL B . n 
B 1 47  THR 47  415 ?   ?   ?   B . n 
B 1 48  ASN 48  416 ?   ?   ?   B . n 
B 1 49  GLN 49  417 ?   ?   ?   B . n 
B 1 50  LYS 50  418 ?   ?   ?   B . n 
B 1 51  ALA 51  419 ?   ?   ?   B . n 
B 1 52  SER 52  420 ?   ?   ?   B . n 
B 1 53  THR 53  421 ?   ?   ?   B . n 
B 1 54  LYS 54  422 ?   ?   ?   B . n 
B 1 55  PHE 55  423 ?   ?   ?   B . n 
B 1 56  TRP 56  424 ?   ?   ?   B . n 
B 1 57  ILE 57  425 425 ILE ILE B . n 
B 1 58  LYS 58  426 426 LYS LYS B . n 
B 1 59  GLN 59  427 427 GLN GLN B . n 
B 1 60  LYS 60  428 428 LYS LYS B . n 
B 1 61  PRO 61  429 429 PRO PRO B . n 
B 1 62  ILE 62  430 430 ILE ILE B . n 
B 1 63  SER 63  431 431 SER SER B . n 
B 1 64  ILE 64  432 432 ILE ILE B . n 
B 1 65  ASP 65  433 433 ASP ASP B . n 
B 1 66  SER 66  434 434 SER SER B . n 
B 1 67  ASP 67  435 435 ASP ASP B . n 
B 1 68  LEU 68  436 436 LEU LEU B . n 
B 1 69  LEU 69  437 437 LEU LEU B . n 
B 1 70  CYS 70  438 438 CYS CYS B . n 
B 1 71  ALA 71  439 439 ALA ALA B . n 
B 1 72  CYS 72  440 440 CYS CYS B . n 
B 1 73  ASP 73  441 441 ASP ASP B . n 
B 1 74  LEU 74  442 442 LEU LEU B . n 
B 1 75  ALA 75  443 443 ALA ALA B . n 
B 1 76  GLU 76  444 444 GLU GLU B . n 
B 1 77  GLU 77  445 445 GLU GLU B . n 
B 1 78  LYS 78  446 446 LYS LYS B . n 
B 1 79  SER 79  447 447 SER SER B . n 
B 1 80  PRO 80  448 448 PRO PRO B . n 
B 1 81  SER 81  449 449 SER SER B . n 
B 1 82  HIS 82  450 450 HIS HIS B . n 
B 1 83  ALA 83  451 451 ALA ALA B . n 
B 1 84  ILE 84  452 452 ILE ILE B . n 
B 1 85  PHE 85  453 453 PHE PHE B . n 
B 1 86  LYS 86  454 454 LYS LYS B . n 
B 1 87  LEU 87  455 455 LEU LEU B . n 
B 1 88  THR 88  456 456 THR THR B . n 
B 1 89  TYR 89  457 457 TYR TYR B . n 
B 1 90  LEU 90  458 458 LEU LEU B . n 
B 1 91  SER 91  459 459 SER SER B . n 
B 1 92  ASN 92  460 460 ASN ASN B . n 
B 1 93  HIS 93  461 461 HIS HIS B . n 
B 1 94  ASP 94  462 462 ASP ASP B . n 
B 1 95  TYR 95  463 463 TYR TYR B . n 
B 1 96  LYS 96  464 464 LYS LYS B . n 
B 1 97  HIS 97  465 465 HIS HIS B . n 
B 1 98  LEU 98  466 466 LEU LEU B . n 
B 1 99  TYR 99  467 467 TYR TYR B . n 
B 1 100 PHE 100 468 468 PHE PHE B . n 
B 1 101 GLU 101 469 469 GLU GLU B . n 
B 1 102 SER 102 470 470 SER SER B . n 
B 1 103 ASP 103 471 471 ASP ASP B . n 
B 1 104 ALA 104 472 472 ALA ALA B . n 
B 1 105 ALA 105 473 473 ALA ALA B . n 
B 1 106 THR 106 474 474 THR THR B . n 
B 1 107 VAL 107 475 475 VAL VAL B . n 
B 1 108 ASN 108 476 476 ASN ASN B . n 
B 1 109 GLU 109 477 477 GLU GLU B . n 
B 1 110 ILE 110 478 478 ILE ILE B . n 
B 1 111 VAL 111 479 479 VAL VAL B . n 
B 1 112 LEU 112 480 480 LEU LEU B . n 
B 1 113 LYS 113 481 481 LYS LYS B . n 
B 1 114 VAL 114 482 482 VAL VAL B . n 
B 1 115 ASN 115 483 483 ASN ASN B . n 
B 1 116 TYR 116 484 484 TYR TYR B . n 
B 1 117 ILE 117 485 485 ILE ILE B . n 
B 1 118 LEU 118 486 486 LEU LEU B . n 
B 1 119 GLU 119 487 487 GLU GLU B . n 
B 1 120 SER 120 488 488 SER SER B . n 
B 1 121 ARG 121 489 489 ARG ARG B . n 
B 1 122 ALA 122 490 490 ALA ALA B . n 
B 1 123 SER 123 491 491 SER SER B . n 
B 1 124 THR 124 492 ?   ?   ?   B . n 
B 1 125 ALA 125 493 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1550  ? 
1 MORE         -7    ? 
1 'SSA (A^2)'  13130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-04-11 
2 'Structure model' 1 1 2013-08-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 REFMAC      5.6.0117 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
2 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 BSS         .        ?               ?       ?                    ?                        'data collection' ? ?          ? 
4 MOSFLM      .        ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
5 SCALA       .        ?               ?       ?                    ?                        'data scaling'    ? ?          ? 
6 MOLREP      .        ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A HIS 382 ? ? CD2 A HIS 382 ? ? 1.428 1.354 0.074  0.009 N 
2 1 CB A ASP 433 ? ? CG  A ASP 433 ? ? 1.648 1.513 0.135  0.021 N 
3 1 CD A GLU 487 ? ? OE2 A GLU 487 ? ? 1.323 1.252 0.071  0.011 N 
4 1 CB B SER 379 ? ? OG  B SER 379 ? ? 1.286 1.418 -0.132 0.013 N 
5 1 CG B HIS 381 ? ? CD2 B HIS 381 ? ? 1.433 1.354 0.079  0.009 N 
6 1 CG B HIS 461 ? ? CD2 B HIS 461 ? ? 1.431 1.354 0.077  0.009 N 
7 1 CG B HIS 465 ? ? CD2 B HIS 465 ? ? 1.421 1.354 0.067  0.009 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 395 ? ? CZ A ARG 395 ? ? NH1 A ARG 395 ? ? 116.76 120.30 -3.54 0.50 N 
2 1 CB A ASP 433 ? ? CG A ASP 433 ? ? OD1 A ASP 433 ? ? 129.64 118.30 11.34 0.90 N 
3 1 CA A LEU 458 ? ? CB A LEU 458 ? ? CG  A LEU 458 ? ? 130.46 115.30 15.16 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 395 ? ? -128.19 -51.44  
2 1 HIS A 461 ? ? 81.86   5.70    
3 1 SER A 470 ? ? -163.09 -168.97 
4 1 SER B 470 ? ? -166.29 -168.53 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 426 ? CG ? A LYS 58 CG 
2  1 Y 1 A LYS 426 ? CD ? A LYS 58 CD 
3  1 Y 1 A LYS 426 ? CE ? A LYS 58 CE 
4  1 Y 1 A LYS 426 ? NZ ? A LYS 58 NZ 
5  1 Y 1 A LYS 428 ? CG ? A LYS 60 CG 
6  1 Y 1 A LYS 428 ? CD ? A LYS 60 CD 
7  1 Y 1 A LYS 428 ? CE ? A LYS 60 CE 
8  1 Y 1 A LYS 428 ? NZ ? A LYS 60 NZ 
9  1 Y 1 B LYS 426 ? CG ? B LYS 58 CG 
10 1 Y 1 B LYS 426 ? CD ? B LYS 58 CD 
11 1 Y 1 B LYS 426 ? CE ? B LYS 58 CE 
12 1 Y 1 B LYS 426 ? NZ ? B LYS 58 NZ 
13 1 Y 1 B LYS 428 ? CG ? B LYS 60 CG 
14 1 Y 1 B LYS 428 ? CD ? B LYS 60 CD 
15 1 Y 1 B LYS 428 ? CE ? B LYS 60 CE 
16 1 Y 1 B LYS 428 ? NZ ? B LYS 60 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 415 ? A THR 47  
2  1 Y 1 A ASN 416 ? A ASN 48  
3  1 Y 1 A GLN 417 ? A GLN 49  
4  1 Y 1 A LYS 418 ? A LYS 50  
5  1 Y 1 A ALA 419 ? A ALA 51  
6  1 Y 1 A SER 420 ? A SER 52  
7  1 Y 1 A SER 491 ? A SER 123 
8  1 Y 1 A THR 492 ? A THR 124 
9  1 Y 1 A ALA 493 ? A ALA 125 
10 1 Y 1 B THR 415 ? B THR 47  
11 1 Y 1 B ASN 416 ? B ASN 48  
12 1 Y 1 B GLN 417 ? B GLN 49  
13 1 Y 1 B LYS 418 ? B LYS 50  
14 1 Y 1 B ALA 419 ? B ALA 51  
15 1 Y 1 B SER 420 ? B SER 52  
16 1 Y 1 B THR 421 ? B THR 53  
17 1 Y 1 B LYS 422 ? B LYS 54  
18 1 Y 1 B PHE 423 ? B PHE 55  
19 1 Y 1 B TRP 424 ? B TRP 56  
20 1 Y 1 B THR 492 ? B THR 124 
21 1 Y 1 B ALA 493 ? B ALA 125 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  501 1   HOH HOH A . 
C 2 HOH 2  502 3   HOH HOH A . 
C 2 HOH 3  503 6   HOH HOH A . 
C 2 HOH 4  504 7   HOH HOH A . 
C 2 HOH 5  505 10  HOH HOH A . 
C 2 HOH 6  506 11  HOH HOH A . 
C 2 HOH 7  507 12  HOH HOH A . 
C 2 HOH 8  508 14  HOH HOH A . 
C 2 HOH 9  509 16  HOH HOH A . 
C 2 HOH 10 510 18  HOH HOH A . 
C 2 HOH 11 511 23  HOH HOH A . 
C 2 HOH 12 512 29  HOH HOH A . 
C 2 HOH 13 513 31  HOH HOH A . 
C 2 HOH 14 514 34  HOH HOH A . 
C 2 HOH 15 515 36  HOH HOH A . 
C 2 HOH 16 516 38  HOH HOH A . 
C 2 HOH 17 517 40  HOH HOH A . 
C 2 HOH 18 518 43  HOH HOH A . 
C 2 HOH 19 519 44  HOH HOH A . 
C 2 HOH 20 520 45  HOH HOH A . 
C 2 HOH 21 521 46  HOH HOH A . 
C 2 HOH 22 522 49  HOH HOH A . 
C 2 HOH 23 523 52  HOH HOH A . 
C 2 HOH 24 524 53  HOH HOH A . 
C 2 HOH 25 525 54  HOH HOH A . 
C 2 HOH 26 526 56  HOH HOH A . 
C 2 HOH 27 527 57  HOH HOH A . 
C 2 HOH 28 528 58  HOH HOH A . 
C 2 HOH 29 529 60  HOH HOH A . 
C 2 HOH 30 530 63  HOH HOH A . 
C 2 HOH 31 531 64  HOH HOH A . 
C 2 HOH 32 532 68  HOH HOH A . 
C 2 HOH 33 533 69  HOH HOH A . 
C 2 HOH 34 534 70  HOH HOH A . 
C 2 HOH 35 535 71  HOH HOH A . 
C 2 HOH 36 536 73  HOH HOH A . 
C 2 HOH 37 537 74  HOH HOH A . 
C 2 HOH 38 538 76  HOH HOH A . 
C 2 HOH 39 539 77  HOH HOH A . 
C 2 HOH 40 540 80  HOH HOH A . 
C 2 HOH 41 541 86  HOH HOH A . 
C 2 HOH 42 542 88  HOH HOH A . 
C 2 HOH 43 543 89  HOH HOH A . 
C 2 HOH 44 544 91  HOH HOH A . 
C 2 HOH 45 545 93  HOH HOH A . 
C 2 HOH 46 546 95  HOH HOH A . 
C 2 HOH 47 547 97  HOH HOH A . 
C 2 HOH 48 548 99  HOH HOH A . 
C 2 HOH 49 549 101 HOH HOH A . 
C 2 HOH 50 550 102 HOH HOH A . 
C 2 HOH 51 551 104 HOH HOH A . 
C 2 HOH 52 552 105 HOH HOH A . 
C 2 HOH 53 553 106 HOH HOH A . 
C 2 HOH 54 554 107 HOH HOH A . 
C 2 HOH 55 555 115 HOH HOH A . 
C 2 HOH 56 556 120 HOH HOH A . 
C 2 HOH 57 557 121 HOH HOH A . 
C 2 HOH 58 558 122 HOH HOH A . 
C 2 HOH 59 559 123 HOH HOH A . 
C 2 HOH 60 560 124 HOH HOH A . 
D 2 HOH 1  501 2   HOH HOH B . 
D 2 HOH 2  502 4   HOH HOH B . 
D 2 HOH 3  503 5   HOH HOH B . 
D 2 HOH 4  504 8   HOH HOH B . 
D 2 HOH 5  505 9   HOH HOH B . 
D 2 HOH 6  506 13  HOH HOH B . 
D 2 HOH 7  507 15  HOH HOH B . 
D 2 HOH 8  508 17  HOH HOH B . 
D 2 HOH 9  509 19  HOH HOH B . 
D 2 HOH 10 510 20  HOH HOH B . 
D 2 HOH 11 511 21  HOH HOH B . 
D 2 HOH 12 512 22  HOH HOH B . 
D 2 HOH 13 513 24  HOH HOH B . 
D 2 HOH 14 514 25  HOH HOH B . 
D 2 HOH 15 515 26  HOH HOH B . 
D 2 HOH 16 516 27  HOH HOH B . 
D 2 HOH 17 517 28  HOH HOH B . 
D 2 HOH 18 518 32  HOH HOH B . 
D 2 HOH 19 519 33  HOH HOH B . 
D 2 HOH 20 520 35  HOH HOH B . 
D 2 HOH 21 521 37  HOH HOH B . 
D 2 HOH 22 522 39  HOH HOH B . 
D 2 HOH 23 523 41  HOH HOH B . 
D 2 HOH 24 524 42  HOH HOH B . 
D 2 HOH 25 525 47  HOH HOH B . 
D 2 HOH 26 526 48  HOH HOH B . 
D 2 HOH 27 527 50  HOH HOH B . 
D 2 HOH 28 528 51  HOH HOH B . 
D 2 HOH 29 529 55  HOH HOH B . 
D 2 HOH 30 530 59  HOH HOH B . 
D 2 HOH 31 531 61  HOH HOH B . 
D 2 HOH 32 532 62  HOH HOH B . 
D 2 HOH 33 533 65  HOH HOH B . 
D 2 HOH 34 534 66  HOH HOH B . 
D 2 HOH 35 535 67  HOH HOH B . 
D 2 HOH 36 536 72  HOH HOH B . 
D 2 HOH 37 537 75  HOH HOH B . 
D 2 HOH 38 538 78  HOH HOH B . 
D 2 HOH 39 539 79  HOH HOH B . 
D 2 HOH 40 540 81  HOH HOH B . 
D 2 HOH 41 541 82  HOH HOH B . 
D 2 HOH 42 542 84  HOH HOH B . 
D 2 HOH 43 543 85  HOH HOH B . 
D 2 HOH 44 544 87  HOH HOH B . 
D 2 HOH 45 545 90  HOH HOH B . 
D 2 HOH 46 546 92  HOH HOH B . 
D 2 HOH 47 547 94  HOH HOH B . 
D 2 HOH 48 548 96  HOH HOH B . 
D 2 HOH 49 549 98  HOH HOH B . 
D 2 HOH 50 550 100 HOH HOH B . 
D 2 HOH 51 551 103 HOH HOH B . 
D 2 HOH 52 552 108 HOH HOH B . 
D 2 HOH 53 553 109 HOH HOH B . 
D 2 HOH 54 554 110 HOH HOH B . 
D 2 HOH 55 555 112 HOH HOH B . 
D 2 HOH 56 556 113 HOH HOH B . 
D 2 HOH 57 557 114 HOH HOH B . 
D 2 HOH 58 558 116 HOH HOH B . 
D 2 HOH 59 559 118 HOH HOH B . 
D 2 HOH 60 560 119 HOH HOH B . 
D 2 HOH 61 561 125 HOH HOH B . 
D 2 HOH 62 562 126 HOH HOH B . 
D 2 HOH 63 563 127 HOH HOH B . 
D 2 HOH 64 564 128 HOH HOH B . 
D 2 HOH 65 565 129 HOH HOH B . 
#