data_3W3K
# 
_entry.id   3W3K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3W3K         
RCSB  RCSB095841   
WWPDB D_1000095841 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3W3G . unspecified 
PDB 3W3J . unspecified 
PDB 3W3L . unspecified 
PDB 3W3M . unspecified 
PDB 3W3N . unspecified 
# 
_pdbx_database_status.entry_id                        3W3K 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-12-22 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tanji, H.'   1 
'Ohto, U.'    2 
'Shimizu, T.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural reorganization of the Toll-like receptor 8 dimer induced by agonistic ligands' 
_citation.journal_abbrev            Science 
_citation.journal_volume            339 
_citation.page_first                1426 
_citation.page_last                 1429 
_citation.year                      2013 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23520111 
_citation.pdbx_database_id_DOI      10.1126/science.1229159 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tanji, H.'   1 ? 
primary 'Ohto, U.'    2 ? 
primary 'Shibata, T.' 3 ? 
primary 'Miyake, K.'  4 ? 
primary 'Shimizu, T.' 5 ? 
# 
_cell.length_a           72.410 
_cell.length_b           154.020 
_cell.length_c           86.860 
_cell.angle_alpha        90.000 
_cell.angle_beta         103.030 
_cell.angle_gamma        90.000 
_cell.entry_id           3W3K 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3W3K 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Toll-like receptor 8' 92835.367 2   ? ? 'UNP residues 27-827' ? 
2 branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   4   ? ? ?                     ? 
3 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1   
? ? ?                     ? 
4 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
5 non-polymer syn '2-propyl[1,3]thiazolo[4,5-c]quinolin-4-amine' 243.327   2   ? ? ?                     ? 
6 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   6   ? ? ?                     ? 
7 water       nat water 18.015    360 ? ? ?                     ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RSPWEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQH
QNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCY
FNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFN
APFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEIL
DLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEI
IYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFE
NLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQN
FTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNL
PASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLD
LSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTC
VSDVTEFLVPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RSPWEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQH
QNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCY
FNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFN
APFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEIL
DLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEI
IYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFE
NLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQN
FTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNL
PASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLD
LSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTC
VSDVTEFLVPR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   SER n 
1 3   PRO n 
1 4   TRP n 
1 5   GLU n 
1 6   GLU n 
1 7   ASN n 
1 8   PHE n 
1 9   SER n 
1 10  ARG n 
1 11  SER n 
1 12  TYR n 
1 13  PRO n 
1 14  CYS n 
1 15  ASP n 
1 16  GLU n 
1 17  LYS n 
1 18  LYS n 
1 19  GLN n 
1 20  ASN n 
1 21  ASP n 
1 22  SER n 
1 23  VAL n 
1 24  ILE n 
1 25  ALA n 
1 26  GLU n 
1 27  CYS n 
1 28  SER n 
1 29  ASN n 
1 30  ARG n 
1 31  ARG n 
1 32  LEU n 
1 33  GLN n 
1 34  GLU n 
1 35  VAL n 
1 36  PRO n 
1 37  GLN n 
1 38  THR n 
1 39  VAL n 
1 40  GLY n 
1 41  LYS n 
1 42  TYR n 
1 43  VAL n 
1 44  THR n 
1 45  GLU n 
1 46  LEU n 
1 47  ASP n 
1 48  LEU n 
1 49  SER n 
1 50  ASP n 
1 51  ASN n 
1 52  PHE n 
1 53  ILE n 
1 54  THR n 
1 55  HIS n 
1 56  ILE n 
1 57  THR n 
1 58  ASN n 
1 59  GLU n 
1 60  SER n 
1 61  PHE n 
1 62  GLN n 
1 63  GLY n 
1 64  LEU n 
1 65  GLN n 
1 66  ASN n 
1 67  LEU n 
1 68  THR n 
1 69  LYS n 
1 70  ILE n 
1 71  ASN n 
1 72  LEU n 
1 73  ASN n 
1 74  HIS n 
1 75  ASN n 
1 76  PRO n 
1 77  ASN n 
1 78  VAL n 
1 79  GLN n 
1 80  HIS n 
1 81  GLN n 
1 82  ASN n 
1 83  GLY n 
1 84  ASN n 
1 85  PRO n 
1 86  GLY n 
1 87  ILE n 
1 88  GLN n 
1 89  SER n 
1 90  ASN n 
1 91  GLY n 
1 92  LEU n 
1 93  ASN n 
1 94  ILE n 
1 95  THR n 
1 96  ASP n 
1 97  GLY n 
1 98  ALA n 
1 99  PHE n 
1 100 LEU n 
1 101 ASN n 
1 102 LEU n 
1 103 LYS n 
1 104 ASN n 
1 105 LEU n 
1 106 ARG n 
1 107 GLU n 
1 108 LEU n 
1 109 LEU n 
1 110 LEU n 
1 111 GLU n 
1 112 ASP n 
1 113 ASN n 
1 114 GLN n 
1 115 LEU n 
1 116 PRO n 
1 117 GLN n 
1 118 ILE n 
1 119 PRO n 
1 120 SER n 
1 121 GLY n 
1 122 LEU n 
1 123 PRO n 
1 124 GLU n 
1 125 SER n 
1 126 LEU n 
1 127 THR n 
1 128 GLU n 
1 129 LEU n 
1 130 SER n 
1 131 LEU n 
1 132 ILE n 
1 133 GLN n 
1 134 ASN n 
1 135 ASN n 
1 136 ILE n 
1 137 TYR n 
1 138 ASN n 
1 139 ILE n 
1 140 THR n 
1 141 LYS n 
1 142 GLU n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 ARG n 
1 147 LEU n 
1 148 ILE n 
1 149 ASN n 
1 150 LEU n 
1 151 LYS n 
1 152 ASN n 
1 153 LEU n 
1 154 TYR n 
1 155 LEU n 
1 156 ALA n 
1 157 TRP n 
1 158 ASN n 
1 159 CYS n 
1 160 TYR n 
1 161 PHE n 
1 162 ASN n 
1 163 LYS n 
1 164 VAL n 
1 165 CYS n 
1 166 GLU n 
1 167 LYS n 
1 168 THR n 
1 169 ASN n 
1 170 ILE n 
1 171 GLU n 
1 172 ASP n 
1 173 GLY n 
1 174 VAL n 
1 175 PHE n 
1 176 GLU n 
1 177 THR n 
1 178 LEU n 
1 179 THR n 
1 180 ASN n 
1 181 LEU n 
1 182 GLU n 
1 183 LEU n 
1 184 LEU n 
1 185 SER n 
1 186 LEU n 
1 187 SER n 
1 188 PHE n 
1 189 ASN n 
1 190 SER n 
1 191 LEU n 
1 192 SER n 
1 193 HIS n 
1 194 VAL n 
1 195 PRO n 
1 196 PRO n 
1 197 LYS n 
1 198 LEU n 
1 199 PRO n 
1 200 SER n 
1 201 SER n 
1 202 LEU n 
1 203 ARG n 
1 204 LYS n 
1 205 LEU n 
1 206 PHE n 
1 207 LEU n 
1 208 SER n 
1 209 ASN n 
1 210 THR n 
1 211 GLN n 
1 212 ILE n 
1 213 LYS n 
1 214 TYR n 
1 215 ILE n 
1 216 SER n 
1 217 GLU n 
1 218 GLU n 
1 219 ASP n 
1 220 PHE n 
1 221 LYS n 
1 222 GLY n 
1 223 LEU n 
1 224 ILE n 
1 225 ASN n 
1 226 LEU n 
1 227 THR n 
1 228 LEU n 
1 229 LEU n 
1 230 ASP n 
1 231 LEU n 
1 232 SER n 
1 233 GLY n 
1 234 ASN n 
1 235 CYS n 
1 236 PRO n 
1 237 ARG n 
1 238 CYS n 
1 239 PHE n 
1 240 ASN n 
1 241 ALA n 
1 242 PRO n 
1 243 PHE n 
1 244 PRO n 
1 245 CYS n 
1 246 VAL n 
1 247 PRO n 
1 248 CYS n 
1 249 ASP n 
1 250 GLY n 
1 251 GLY n 
1 252 ALA n 
1 253 SER n 
1 254 ILE n 
1 255 ASN n 
1 256 ILE n 
1 257 ASP n 
1 258 ARG n 
1 259 PHE n 
1 260 ALA n 
1 261 PHE n 
1 262 GLN n 
1 263 ASN n 
1 264 LEU n 
1 265 THR n 
1 266 GLN n 
1 267 LEU n 
1 268 ARG n 
1 269 TYR n 
1 270 LEU n 
1 271 ASN n 
1 272 LEU n 
1 273 SER n 
1 274 SER n 
1 275 THR n 
1 276 SER n 
1 277 LEU n 
1 278 ARG n 
1 279 LYS n 
1 280 ILE n 
1 281 ASN n 
1 282 ALA n 
1 283 ALA n 
1 284 TRP n 
1 285 PHE n 
1 286 LYS n 
1 287 ASN n 
1 288 MET n 
1 289 PRO n 
1 290 HIS n 
1 291 LEU n 
1 292 LYS n 
1 293 VAL n 
1 294 LEU n 
1 295 ASP n 
1 296 LEU n 
1 297 GLU n 
1 298 PHE n 
1 299 ASN n 
1 300 TYR n 
1 301 LEU n 
1 302 VAL n 
1 303 GLY n 
1 304 GLU n 
1 305 ILE n 
1 306 ALA n 
1 307 SER n 
1 308 GLY n 
1 309 ALA n 
1 310 PHE n 
1 311 LEU n 
1 312 THR n 
1 313 MET n 
1 314 LEU n 
1 315 PRO n 
1 316 ARG n 
1 317 LEU n 
1 318 GLU n 
1 319 ILE n 
1 320 LEU n 
1 321 ASP n 
1 322 LEU n 
1 323 SER n 
1 324 PHE n 
1 325 ASN n 
1 326 TYR n 
1 327 ILE n 
1 328 LYS n 
1 329 GLY n 
1 330 SER n 
1 331 TYR n 
1 332 PRO n 
1 333 GLN n 
1 334 HIS n 
1 335 ILE n 
1 336 ASN n 
1 337 ILE n 
1 338 SER n 
1 339 ARG n 
1 340 ASN n 
1 341 PHE n 
1 342 SER n 
1 343 LYS n 
1 344 LEU n 
1 345 LEU n 
1 346 SER n 
1 347 LEU n 
1 348 ARG n 
1 349 ALA n 
1 350 LEU n 
1 351 HIS n 
1 352 LEU n 
1 353 ARG n 
1 354 GLY n 
1 355 TYR n 
1 356 VAL n 
1 357 PHE n 
1 358 GLN n 
1 359 GLU n 
1 360 LEU n 
1 361 ARG n 
1 362 GLU n 
1 363 ASP n 
1 364 ASP n 
1 365 PHE n 
1 366 GLN n 
1 367 PRO n 
1 368 LEU n 
1 369 MET n 
1 370 GLN n 
1 371 LEU n 
1 372 PRO n 
1 373 ASN n 
1 374 LEU n 
1 375 SER n 
1 376 THR n 
1 377 ILE n 
1 378 ASN n 
1 379 LEU n 
1 380 GLY n 
1 381 ILE n 
1 382 ASN n 
1 383 PHE n 
1 384 ILE n 
1 385 LYS n 
1 386 GLN n 
1 387 ILE n 
1 388 ASP n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PHE n 
1 393 GLN n 
1 394 ASN n 
1 395 PHE n 
1 396 SER n 
1 397 ASN n 
1 398 LEU n 
1 399 GLU n 
1 400 ILE n 
1 401 ILE n 
1 402 TYR n 
1 403 LEU n 
1 404 SER n 
1 405 GLU n 
1 406 ASN n 
1 407 ARG n 
1 408 ILE n 
1 409 SER n 
1 410 PRO n 
1 411 LEU n 
1 412 VAL n 
1 413 LYS n 
1 414 ASP n 
1 415 THR n 
1 416 ARG n 
1 417 GLN n 
1 418 SER n 
1 419 TYR n 
1 420 ALA n 
1 421 ASN n 
1 422 SER n 
1 423 SER n 
1 424 SER n 
1 425 PHE n 
1 426 GLN n 
1 427 ARG n 
1 428 HIS n 
1 429 ILE n 
1 430 ARG n 
1 431 LYS n 
1 432 ARG n 
1 433 ARG n 
1 434 SER n 
1 435 THR n 
1 436 ASP n 
1 437 PHE n 
1 438 GLU n 
1 439 PHE n 
1 440 ASP n 
1 441 PRO n 
1 442 HIS n 
1 443 SER n 
1 444 ASN n 
1 445 PHE n 
1 446 TYR n 
1 447 HIS n 
1 448 PHE n 
1 449 THR n 
1 450 ARG n 
1 451 PRO n 
1 452 LEU n 
1 453 ILE n 
1 454 LYS n 
1 455 PRO n 
1 456 GLN n 
1 457 CYS n 
1 458 ALA n 
1 459 ALA n 
1 460 TYR n 
1 461 GLY n 
1 462 LYS n 
1 463 ALA n 
1 464 LEU n 
1 465 ASP n 
1 466 LEU n 
1 467 SER n 
1 468 LEU n 
1 469 ASN n 
1 470 SER n 
1 471 ILE n 
1 472 PHE n 
1 473 PHE n 
1 474 ILE n 
1 475 GLY n 
1 476 PRO n 
1 477 ASN n 
1 478 GLN n 
1 479 PHE n 
1 480 GLU n 
1 481 ASN n 
1 482 LEU n 
1 483 PRO n 
1 484 ASP n 
1 485 ILE n 
1 486 ALA n 
1 487 CYS n 
1 488 LEU n 
1 489 ASN n 
1 490 LEU n 
1 491 SER n 
1 492 ALA n 
1 493 ASN n 
1 494 SER n 
1 495 ASN n 
1 496 ALA n 
1 497 GLN n 
1 498 VAL n 
1 499 LEU n 
1 500 SER n 
1 501 GLY n 
1 502 THR n 
1 503 GLU n 
1 504 PHE n 
1 505 SER n 
1 506 ALA n 
1 507 ILE n 
1 508 PRO n 
1 509 HIS n 
1 510 VAL n 
1 511 LYS n 
1 512 TYR n 
1 513 LEU n 
1 514 ASP n 
1 515 LEU n 
1 516 THR n 
1 517 ASN n 
1 518 ASN n 
1 519 ARG n 
1 520 LEU n 
1 521 ASP n 
1 522 PHE n 
1 523 ASP n 
1 524 ASN n 
1 525 ALA n 
1 526 SER n 
1 527 ALA n 
1 528 LEU n 
1 529 THR n 
1 530 GLU n 
1 531 LEU n 
1 532 SER n 
1 533 ASP n 
1 534 LEU n 
1 535 GLU n 
1 536 VAL n 
1 537 LEU n 
1 538 ASP n 
1 539 LEU n 
1 540 SER n 
1 541 TYR n 
1 542 ASN n 
1 543 SER n 
1 544 HIS n 
1 545 TYR n 
1 546 PHE n 
1 547 ARG n 
1 548 ILE n 
1 549 ALA n 
1 550 GLY n 
1 551 VAL n 
1 552 THR n 
1 553 HIS n 
1 554 HIS n 
1 555 LEU n 
1 556 GLU n 
1 557 PHE n 
1 558 ILE n 
1 559 GLN n 
1 560 ASN n 
1 561 PHE n 
1 562 THR n 
1 563 ASN n 
1 564 LEU n 
1 565 LYS n 
1 566 VAL n 
1 567 LEU n 
1 568 ASN n 
1 569 LEU n 
1 570 SER n 
1 571 HIS n 
1 572 ASN n 
1 573 ASN n 
1 574 ILE n 
1 575 TYR n 
1 576 THR n 
1 577 LEU n 
1 578 THR n 
1 579 ASP n 
1 580 LYS n 
1 581 TYR n 
1 582 ASN n 
1 583 LEU n 
1 584 GLU n 
1 585 SER n 
1 586 LYS n 
1 587 SER n 
1 588 LEU n 
1 589 VAL n 
1 590 GLU n 
1 591 LEU n 
1 592 VAL n 
1 593 PHE n 
1 594 SER n 
1 595 GLY n 
1 596 ASN n 
1 597 ARG n 
1 598 LEU n 
1 599 ASP n 
1 600 ILE n 
1 601 LEU n 
1 602 TRP n 
1 603 ASN n 
1 604 ASP n 
1 605 ASP n 
1 606 ASP n 
1 607 ASN n 
1 608 ARG n 
1 609 TYR n 
1 610 ILE n 
1 611 SER n 
1 612 ILE n 
1 613 PHE n 
1 614 LYS n 
1 615 GLY n 
1 616 LEU n 
1 617 LYS n 
1 618 ASN n 
1 619 LEU n 
1 620 THR n 
1 621 ARG n 
1 622 LEU n 
1 623 ASP n 
1 624 LEU n 
1 625 SER n 
1 626 LEU n 
1 627 ASN n 
1 628 ARG n 
1 629 LEU n 
1 630 LYS n 
1 631 HIS n 
1 632 ILE n 
1 633 PRO n 
1 634 ASN n 
1 635 GLU n 
1 636 ALA n 
1 637 PHE n 
1 638 LEU n 
1 639 ASN n 
1 640 LEU n 
1 641 PRO n 
1 642 ALA n 
1 643 SER n 
1 644 LEU n 
1 645 THR n 
1 646 GLU n 
1 647 LEU n 
1 648 HIS n 
1 649 ILE n 
1 650 ASN n 
1 651 ASP n 
1 652 ASN n 
1 653 MET n 
1 654 LEU n 
1 655 LYS n 
1 656 PHE n 
1 657 PHE n 
1 658 ASN n 
1 659 TRP n 
1 660 THR n 
1 661 LEU n 
1 662 LEU n 
1 663 GLN n 
1 664 GLN n 
1 665 PHE n 
1 666 PRO n 
1 667 ARG n 
1 668 LEU n 
1 669 GLU n 
1 670 LEU n 
1 671 LEU n 
1 672 ASP n 
1 673 LEU n 
1 674 ARG n 
1 675 GLY n 
1 676 ASN n 
1 677 LYS n 
1 678 LEU n 
1 679 LEU n 
1 680 PHE n 
1 681 LEU n 
1 682 THR n 
1 683 ASP n 
1 684 SER n 
1 685 LEU n 
1 686 SER n 
1 687 ASP n 
1 688 PHE n 
1 689 THR n 
1 690 SER n 
1 691 SER n 
1 692 LEU n 
1 693 ARG n 
1 694 THR n 
1 695 LEU n 
1 696 LEU n 
1 697 LEU n 
1 698 SER n 
1 699 HIS n 
1 700 ASN n 
1 701 ARG n 
1 702 ILE n 
1 703 SER n 
1 704 HIS n 
1 705 LEU n 
1 706 PRO n 
1 707 SER n 
1 708 GLY n 
1 709 PHE n 
1 710 LEU n 
1 711 SER n 
1 712 GLU n 
1 713 VAL n 
1 714 SER n 
1 715 SER n 
1 716 LEU n 
1 717 LYS n 
1 718 HIS n 
1 719 LEU n 
1 720 ASP n 
1 721 LEU n 
1 722 SER n 
1 723 SER n 
1 724 ASN n 
1 725 LEU n 
1 726 LEU n 
1 727 LYS n 
1 728 THR n 
1 729 ILE n 
1 730 ASN n 
1 731 LYS n 
1 732 SER n 
1 733 ALA n 
1 734 LEU n 
1 735 GLU n 
1 736 THR n 
1 737 LYS n 
1 738 THR n 
1 739 THR n 
1 740 THR n 
1 741 LYS n 
1 742 LEU n 
1 743 SER n 
1 744 MET n 
1 745 LEU n 
1 746 GLU n 
1 747 LEU n 
1 748 HIS n 
1 749 GLY n 
1 750 ASN n 
1 751 PRO n 
1 752 PHE n 
1 753 GLU n 
1 754 CYS n 
1 755 THR n 
1 756 CYS n 
1 757 ASP n 
1 758 ILE n 
1 759 GLY n 
1 760 ASP n 
1 761 PHE n 
1 762 ARG n 
1 763 ARG n 
1 764 TRP n 
1 765 MET n 
1 766 ASP n 
1 767 GLU n 
1 768 HIS n 
1 769 LEU n 
1 770 ASN n 
1 771 VAL n 
1 772 LYS n 
1 773 ILE n 
1 774 PRO n 
1 775 ARG n 
1 776 LEU n 
1 777 VAL n 
1 778 ASP n 
1 779 VAL n 
1 780 ILE n 
1 781 CYS n 
1 782 ALA n 
1 783 SER n 
1 784 PRO n 
1 785 GLY n 
1 786 ASP n 
1 787 GLN n 
1 788 ARG n 
1 789 GLY n 
1 790 LYS n 
1 791 SER n 
1 792 ILE n 
1 793 VAL n 
1 794 SER n 
1 795 LEU n 
1 796 GLU n 
1 797 LEU n 
1 798 THR n 
1 799 THR n 
1 800 CYS n 
1 801 VAL n 
1 802 SER n 
1 803 ASP n 
1 804 VAL n 
1 805 THR n 
1 806 GLU n 
1 807 PHE n 
1 808 LEU n 
1 809 VAL n 
1 810 PRO n 
1 811 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TLR8, UNQ249/PRO286' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      Drosophila 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7215 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               S2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TLR8_HUMAN 
_struct_ref.pdbx_db_accession          Q9NR97 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGN
PGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKV
CEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFP
CVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSF
NYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEIIYLS
ENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFENLPD
IACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNL
KVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASL
TELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSN
LLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDV
T
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3W3K A 5 ? 805 ? Q9NR97 27 ? 827 ? 27 827 
2 1 3W3K B 5 ? 805 ? Q9NR97 27 ? 827 ? 27 827 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3W3K ARG A 1   ? UNP Q9NR97 ? ? 'expression tag' 23  1  
1 3W3K SER A 2   ? UNP Q9NR97 ? ? 'expression tag' 24  2  
1 3W3K PRO A 3   ? UNP Q9NR97 ? ? 'expression tag' 25  3  
1 3W3K TRP A 4   ? UNP Q9NR97 ? ? 'expression tag' 26  4  
1 3W3K GLU A 806 ? UNP Q9NR97 ? ? 'expression tag' 828 5  
1 3W3K PHE A 807 ? UNP Q9NR97 ? ? 'expression tag' 829 6  
1 3W3K LEU A 808 ? UNP Q9NR97 ? ? 'expression tag' 830 7  
1 3W3K VAL A 809 ? UNP Q9NR97 ? ? 'expression tag' 831 8  
1 3W3K PRO A 810 ? UNP Q9NR97 ? ? 'expression tag' 832 9  
1 3W3K ARG A 811 ? UNP Q9NR97 ? ? 'expression tag' 833 10 
2 3W3K ARG B 1   ? UNP Q9NR97 ? ? 'expression tag' 23  11 
2 3W3K SER B 2   ? UNP Q9NR97 ? ? 'expression tag' 24  12 
2 3W3K PRO B 3   ? UNP Q9NR97 ? ? 'expression tag' 25  13 
2 3W3K TRP B 4   ? UNP Q9NR97 ? ? 'expression tag' 26  14 
2 3W3K GLU B 806 ? UNP Q9NR97 ? ? 'expression tag' 828 15 
2 3W3K PHE B 807 ? UNP Q9NR97 ? ? 'expression tag' 829 16 
2 3W3K LEU B 808 ? UNP Q9NR97 ? ? 'expression tag' 830 17 
2 3W3K VAL B 809 ? UNP Q9NR97 ? ? 'expression tag' 831 18 
2 3W3K PRO B 810 ? UNP Q9NR97 ? ? 'expression tag' 832 19 
2 3W3K ARG B 811 ? UNP Q9NR97 ? ? 'expression tag' 833 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                        ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                       ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                     ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                ?               'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                           ?               'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                       ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                      ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                        ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                      ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                          ?               'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                     ?               'C6 H13 N O2'    131.173 
L07 non-polymer                   . '2-propyl[1,3]thiazolo[4,5-c]quinolin-4-amine' 'CL075, 3M-002' 'C13 H13 N3 S'   243.327 
LEU 'L-peptide linking'           y LEUCINE                                        ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                         ?               'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                          ?               'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                     ?               'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose       ?               'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                  ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                        ?               'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                         ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                      ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                     ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                       ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                         ?               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3W3K 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   51.60 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.1 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'14%(w/v) PEG3350, 0.2M potassium formate, 0.1M sodium citrate, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2012-07-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
# 
_reflns.entry_id                     3W3K 
_reflns.B_iso_Wilson_estimate        40.150 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.30 
_reflns.d_resolution_low             39.41 
_reflns.number_all                   ? 
_reflns.number_obs                   75250 
_reflns.percent_possible_obs         91.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.076 
_reflns.pdbx_netI_over_sigmaI        10.5 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3W3K 
_refine.ls_d_res_high                            2.3000 
_refine.ls_d_res_low                             37.0830 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    91.5500 
_refine.ls_number_reflns_obs                     75205 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2066 
_refine.ls_R_factor_R_work                       0.2046 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2444 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0300 
_refine.ls_number_reflns_R_free                  3782 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               55.7174 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.2900 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8133 
_refine.B_iso_max                                122.380 
_refine.B_iso_min                                20.840 
_refine.pdbx_overall_phase_error                 26.2700 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11983 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         429 
_refine_hist.number_atoms_solvent             360 
_refine_hist.number_atoms_total               12772 
_refine_hist.d_res_high                       2.3000 
_refine_hist.d_res_low                        37.0830 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           12707 0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          17261 1.377  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     2051  0.113  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      2162  0.007  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 4834  21.306 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.3000 2.3291  27 93.0000  2730 . 0.2567 0.2913 . 139 . 2869 . 'X-RAY DIFFRACTION' . 
2.3291 2.3598  27 95.0000  2745 . 0.2497 0.3174 . 144 . 2889 . 'X-RAY DIFFRACTION' . 
2.3598 2.3921  27 95.0000  2699 . 0.2441 0.3108 . 129 . 2828 . 'X-RAY DIFFRACTION' . 
2.3921 2.4262  27 96.0000  2777 . 0.2428 0.2924 . 144 . 2921 . 'X-RAY DIFFRACTION' . 
2.4262 2.4624  27 97.0000  2774 . 0.2351 0.2721 . 132 . 2906 . 'X-RAY DIFFRACTION' . 
2.4624 2.5009  27 97.0000  2828 . 0.2327 0.2908 . 153 . 2981 . 'X-RAY DIFFRACTION' . 
2.5009 2.5419  27 98.0000  2780 . 0.2320 0.2834 . 157 . 2937 . 'X-RAY DIFFRACTION' . 
2.5419 2.5857  27 98.0000  2843 . 0.2325 0.2562 . 155 . 2998 . 'X-RAY DIFFRACTION' . 
2.5857 2.6327  27 99.0000  2872 . 0.2347 0.2734 . 133 . 3005 . 'X-RAY DIFFRACTION' . 
2.6327 2.6834  27 99.0000  968  . 0.2294 0.3110 . 67  . 1035 . 'X-RAY DIFFRACTION' . 
2.6834 2.7381  27 100.0000 2507 . 0.2351 0.3057 . 127 . 2634 . 'X-RAY DIFFRACTION' . 
2.7381 2.7976  27 100.0000 2921 . 0.2203 0.2739 . 144 . 3065 . 'X-RAY DIFFRACTION' . 
2.7976 2.8627  27 100.0000 2853 . 0.2260 0.2666 . 147 . 3000 . 'X-RAY DIFFRACTION' . 
2.8627 2.9343  27 100.0000 2902 . 0.2309 0.3299 . 123 . 3025 . 'X-RAY DIFFRACTION' . 
2.9343 3.0136  27 100.0000 2920 . 0.2396 0.2620 . 141 . 3061 . 'X-RAY DIFFRACTION' . 
3.0136 3.1022  27 100.0000 2887 . 0.2332 0.2867 . 149 . 3036 . 'X-RAY DIFFRACTION' . 
3.1022 3.2023  27 100.0000 2894 . 0.2405 0.3154 . 142 . 3036 . 'X-RAY DIFFRACTION' . 
3.2023 3.3166  27 100.0000 2902 . 0.2323 0.2940 . 135 . 3037 . 'X-RAY DIFFRACTION' . 
3.3166 3.4493  27 100.0000 2181 . 0.2108 0.2716 . 123 . 2304 . 'X-RAY DIFFRACTION' . 
3.4493 3.6062  27 100.0000 2542 . 0.2080 0.2538 . 165 . 2707 . 'X-RAY DIFFRACTION' . 
3.6062 3.7962  27 62.0000  1766 . 0.1848 0.2170 . 97  . 1863 . 'X-RAY DIFFRACTION' . 
3.7962 4.0337  27 66.0000  1874 . 0.1706 0.2091 . 136 . 2010 . 'X-RAY DIFFRACTION' . 
4.0337 4.3447  27 100.0000 2890 . 0.1604 0.1680 . 154 . 3044 . 'X-RAY DIFFRACTION' . 
4.3447 4.7812  27 100.0000 2889 . 0.1595 0.2042 . 168 . 3057 . 'X-RAY DIFFRACTION' . 
4.7812 5.4711  27 100.0000 2906 . 0.1660 0.2222 . 153 . 3059 . 'X-RAY DIFFRACTION' . 
5.4711 6.8858  27 100.0000 2907 . 0.1915 0.2080 . 158 . 3065 . 'X-RAY DIFFRACTION' . 
6.8858 37.0879 27 91.0000  2666 . 0.2151 0.2324 . 167 . 2833 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3W3K 
_struct.title                     'Crystal structure of human TLR8 in complex with CL075' 
_struct.pdbx_descriptor           'Toll-like receptor 8' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3W3K 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;Leucine Rich Repeat, RNA, Glycosylation, RNA Recognition, ssRNA, Receptor, RNA Receptor, Innate Immunity, RNA Binding, Secreted, CL075, IMMUNE SYSTEM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 2 ? 
G N N 4 ? 
H N N 2 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
M N N 5 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 140 ? SER A 145 ? THR A 162 SER A 167 1 ? 6  
HELX_P HELX_P2  2  CYS A 248 ? ALA A 252 ? CYS A 270 ALA A 274 5 ? 5  
HELX_P HELX_P3  3  ASN A 281 ? LYS A 286 ? ASN A 303 LYS A 308 5 ? 6  
HELX_P HELX_P4  4  LEU A 301 ? SER A 307 ? LEU A 323 SER A 329 1 ? 7  
HELX_P HELX_P5  5  GLY A 308 ? LEU A 314 ? GLY A 330 LEU A 336 5 ? 7  
HELX_P HELX_P6  6  SER A 338 ? LEU A 344 ? SER A 360 LEU A 366 5 ? 7  
HELX_P HELX_P7  7  ARG A 361 ? MET A 369 ? ARG A 383 MET A 391 5 ? 9  
HELX_P HELX_P8  8  PHE A 389 ? PHE A 395 ? PHE A 411 PHE A 417 5 ? 7  
HELX_P HELX_P9  9  LYS A 454 ? ALA A 459 ? LYS A 476 ALA A 481 1 ? 6  
HELX_P HELX_P10 10 ASN A 542 ? ARG A 547 ? ASN A 564 ARG A 569 1 ? 6  
HELX_P HELX_P11 11 LEU A 555 ? PHE A 561 ? LEU A 577 PHE A 583 5 ? 7  
HELX_P HELX_P12 12 ARG A 597 ? TRP A 602 ? ARG A 619 TRP A 624 1 ? 6  
HELX_P HELX_P13 13 PRO A 633 ? ASN A 639 ? PRO A 655 ASN A 661 1 ? 7  
HELX_P HELX_P14 14 ASN A 658 ? PHE A 665 ? ASN A 680 PHE A 687 5 ? 8  
HELX_P HELX_P15 15 SER A 684 ? PHE A 688 ? SER A 706 PHE A 710 5 ? 5  
HELX_P HELX_P16 16 ASN A 730 ? GLU A 735 ? ASN A 752 GLU A 757 5 ? 6  
HELX_P HELX_P17 17 THR A 755 ? ASP A 757 ? THR A 777 ASP A 779 5 ? 3  
HELX_P HELX_P18 18 ILE A 758 ? HIS A 768 ? ILE A 780 HIS A 790 1 ? 11 
HELX_P HELX_P19 19 ARG A 775 ? VAL A 779 ? ARG A 797 VAL A 801 5 ? 5  
HELX_P HELX_P20 20 SER A 791 ? LEU A 795 ? SER A 813 LEU A 817 5 ? 5  
HELX_P HELX_P21 21 THR B 140 ? SER B 145 ? THR B 162 SER B 167 1 ? 6  
HELX_P HELX_P22 22 VAL B 174 ? LEU B 178 ? VAL B 196 LEU B 200 5 ? 5  
HELX_P HELX_P23 23 CYS B 248 ? ALA B 252 ? CYS B 270 ALA B 274 5 ? 5  
HELX_P HELX_P24 24 ASN B 281 ? LYS B 286 ? ASN B 303 LYS B 308 5 ? 6  
HELX_P HELX_P25 25 LEU B 301 ? SER B 307 ? LEU B 323 SER B 329 1 ? 7  
HELX_P HELX_P26 26 GLY B 308 ? LEU B 314 ? GLY B 330 LEU B 336 5 ? 7  
HELX_P HELX_P27 27 SER B 338 ? LEU B 344 ? SER B 360 LEU B 366 5 ? 7  
HELX_P HELX_P28 28 GLU B 362 ? MET B 369 ? GLU B 384 MET B 391 5 ? 8  
HELX_P HELX_P29 29 LYS B 390 ? PHE B 395 ? LYS B 412 PHE B 417 1 ? 6  
HELX_P HELX_P30 30 LYS B 454 ? ALA B 459 ? LYS B 476 ALA B 481 1 ? 6  
HELX_P HELX_P31 31 ASN B 542 ? ARG B 547 ? ASN B 564 ARG B 569 1 ? 6  
HELX_P HELX_P32 32 LEU B 555 ? PHE B 561 ? LEU B 577 PHE B 583 5 ? 7  
HELX_P HELX_P33 33 ARG B 597 ? TRP B 602 ? ARG B 619 TRP B 624 1 ? 6  
HELX_P HELX_P34 34 PRO B 633 ? ASN B 639 ? PRO B 655 ASN B 661 1 ? 7  
HELX_P HELX_P35 35 ASN B 658 ? PHE B 665 ? ASN B 680 PHE B 687 5 ? 8  
HELX_P HELX_P36 36 SER B 684 ? THR B 689 ? SER B 706 THR B 711 1 ? 6  
HELX_P HELX_P37 37 ASN B 730 ? GLU B 735 ? ASN B 752 GLU B 757 1 ? 6  
HELX_P HELX_P38 38 THR B 755 ? ASP B 757 ? THR B 777 ASP B 779 5 ? 3  
HELX_P HELX_P39 39 ILE B 758 ? HIS B 768 ? ILE B 780 HIS B 790 1 ? 11 
HELX_P HELX_P40 40 ARG B 775 ? VAL B 779 ? ARG B 797 VAL B 801 5 ? 5  
HELX_P HELX_P41 41 SER B 791 ? LEU B 795 ? SER B 813 LEU B 817 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 14  SG  ? ? ? 1_555 A CYS 27  SG ? ? A CYS 36  A CYS 49  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf2  disulf ?    ? A CYS 159 SG  ? ? ? 1_555 A CYS 165 SG ? ? A CYS 181 A CYS 187 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf3  disulf ?    ? A CYS 235 SG  ? ? ? 1_555 A CYS 248 SG ? ? A CYS 257 A CYS 270 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4  disulf ?    ? A CYS 238 SG  ? ? ? 1_555 A CYS 245 SG ? ? A CYS 260 A CYS 267 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf5  disulf ?    ? A CYS 457 SG  ? ? ? 1_555 A CYS 487 SG ? ? A CYS 479 A CYS 509 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf6  disulf ?    ? A CYS 754 SG  ? ? ? 1_555 A CYS 781 SG ? ? A CYS 776 A CYS 803 1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf7  disulf ?    ? B CYS 14  SG  ? ? ? 1_555 B CYS 27  SG ? ? B CYS 36  B CYS 49  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf8  disulf ?    ? B CYS 159 SG  ? ? ? 1_555 B CYS 165 SG ? ? B CYS 181 B CYS 187 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf9  disulf ?    ? B CYS 235 SG  ? ? ? 1_555 B CYS 248 SG ? ? B CYS 257 B CYS 270 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf10 disulf ?    ? B CYS 238 SG  ? ? ? 1_555 B CYS 245 SG ? ? B CYS 260 B CYS 267 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf11 disulf ?    ? B CYS 457 SG  ? ? ? 1_555 B CYS 487 SG ? ? B CYS 479 B CYS 509 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf12 disulf ?    ? B CYS 754 SG  ? ? ? 1_555 B CYS 781 SG ? ? B CYS 776 B CYS 803 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
covale1  covale one  ? A ASN 271 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 293 C NAG 1   1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale2  covale one  ? A ASN 489 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 511 D NAG 1   1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale3  covale one  ? A ASN 524 ND2 ? ? ? 1_555 J NAG .   C1 ? ? A ASN 546 A NAG 910 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale4  covale one  ? A ASN 568 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 590 E NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale5  covale one  ? A ASN 618 ND2 ? ? ? 1_555 L NAG .   C1 ? ? A ASN 640 A NAG 917 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale6  covale one  ? A ASN 658 ND2 ? ? ? 1_555 K NAG .   C1 ? ? A ASN 680 A NAG 916 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale7  covale one  ? B ASN 271 ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 293 F NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale8  covale one  ? B ASN 373 ND2 ? ? ? 1_555 O NAG .   C1 ? ? B ASN 395 B NAG 915 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale9  covale one  ? B ASN 489 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 511 G NAG 1   1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale10 covale one  ? B ASN 524 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 546 B NAG 909 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale11 covale one  ? B ASN 568 ND2 ? ? ? 1_555 H NAG .   C1 ? ? B ASN 590 H NAG 1   1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale12 covale one  ? B ASN 618 ND2 ? ? ? 1_555 P NAG .   C1 ? ? B ASN 640 B NAG 916 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale13 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale14 covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale15 covale both ? C BMA .   O3  ? ? ? 1_555 C MAN .   C1 ? ? C BMA 3   C MAN 4   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale16 covale both ? C BMA .   O6  ? ? ? 1_555 C MAN .   C1 ? ? C BMA 3   C MAN 5   1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale17 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale18 covale both ? D NAG .   O4  ? ? ? 1_555 D BMA .   C1 ? ? D NAG 2   D BMA 3   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale19 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale20 covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? E NAG 2   E BMA 3   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale21 covale both ? E BMA .   O3  ? ? ? 1_555 E MAN .   C1 ? ? E BMA 3   E MAN 4   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale22 covale both ? E BMA .   O6  ? ? ? 1_555 E MAN .   C1 ? ? E BMA 3   E MAN 5   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale23 covale both ? F NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
covale24 covale both ? F NAG .   O4  ? ? ? 1_555 F BMA .   C1 ? ? F NAG 2   F BMA 3   1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale25 covale both ? F BMA .   O3  ? ? ? 1_555 F MAN .   C1 ? ? F BMA 3   F MAN 4   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
covale26 covale both ? F BMA .   O6  ? ? ? 1_555 F MAN .   C1 ? ? F BMA 3   F MAN 5   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale27 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale28 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale29 covale both ? H NAG .   O4  ? ? ? 1_555 H BMA .   C1 ? ? H NAG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.438 ? ?               
covale30 covale both ? H BMA .   O3  ? ? ? 1_555 H MAN .   C1 ? ? H BMA 3   H MAN 4   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale31 covale both ? H BMA .   O6  ? ? ? 1_555 H MAN .   C1 ? ? H BMA 3   H MAN 5   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 12  A . ? TYR 34  A PRO 13  A ? PRO 35  A 1 -3.37  
2 ASN 75  A . ? ASN 97  A PRO 76  A ? PRO 98  A 1 -11.13 
3 SER 783 A . ? SER 805 A PRO 784 A ? PRO 806 A 1 -18.14 
4 TYR 12  B . ? TYR 34  B PRO 13  B ? PRO 35  B 1 -11.85 
5 ASN 75  B . ? ASN 97  B PRO 76  B ? PRO 98  B 1 2.00   
6 GLU 735 B . ? GLU 757 B THR 736 B ? THR 758 B 1 25.08  
7 SER 783 B . ? SER 805 B PRO 784 B ? PRO 806 B 1 -4.41  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 28 ? 
B ? 2  ? 
C ? 2  ? 
D ? 2  ? 
E ? 2  ? 
F ? 28 ? 
G ? 2  ? 
H ? 2  ? 
I ? 2  ? 
J ? 2  ? 
K ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
A 3  4  ? parallel      
A 4  5  ? parallel      
A 5  6  ? parallel      
A 6  7  ? parallel      
A 7  8  ? parallel      
A 8  9  ? parallel      
A 9  10 ? parallel      
A 10 11 ? parallel      
A 11 12 ? parallel      
A 12 13 ? parallel      
A 13 14 ? parallel      
A 14 15 ? parallel      
A 15 16 ? parallel      
A 16 17 ? parallel      
A 17 18 ? parallel      
A 18 19 ? parallel      
A 19 20 ? parallel      
A 20 21 ? parallel      
A 21 22 ? parallel      
A 22 23 ? parallel      
A 23 24 ? parallel      
A 24 25 ? parallel      
A 25 26 ? parallel      
A 26 27 ? parallel      
A 27 28 ? parallel      
B 1  2  ? parallel      
C 1  2  ? parallel      
D 1  2  ? parallel      
E 1  2  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? parallel      
F 3  4  ? parallel      
F 4  5  ? parallel      
F 5  6  ? parallel      
F 6  7  ? parallel      
F 7  8  ? parallel      
F 8  9  ? parallel      
F 9  10 ? parallel      
F 10 11 ? parallel      
F 11 12 ? parallel      
F 12 13 ? parallel      
F 13 14 ? parallel      
F 14 15 ? parallel      
F 15 16 ? parallel      
F 16 17 ? parallel      
F 17 18 ? parallel      
F 18 19 ? parallel      
F 19 20 ? parallel      
F 20 21 ? parallel      
F 21 22 ? parallel      
F 22 23 ? parallel      
F 23 24 ? parallel      
F 24 25 ? parallel      
F 25 26 ? parallel      
F 26 27 ? parallel      
F 27 28 ? parallel      
G 1  2  ? parallel      
H 1  2  ? parallel      
I 1  2  ? parallel      
J 1  2  ? parallel      
K 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ASP A 15  ? GLU A 16  ? ASP A 37  GLU A 38  
A 2  ILE A 24  ? GLU A 26  ? ILE A 46  GLU A 48  
A 3  GLU A 45  ? ASP A 47  ? GLU A 67  ASP A 69  
A 4  LYS A 69  ? ASN A 71  ? LYS A 91  ASN A 93  
A 5  GLU A 107 ? LEU A 109 ? GLU A 129 LEU A 131 
A 6  GLU A 128 ? SER A 130 ? GLU A 150 SER A 152 
A 7  ASN A 152 ? TYR A 154 ? ASN A 174 TYR A 176 
A 8  LEU A 183 ? SER A 185 ? LEU A 205 SER A 207 
A 9  LYS A 204 ? PHE A 206 ? LYS A 226 PHE A 228 
A 10 LEU A 228 ? ASP A 230 ? LEU A 250 ASP A 252 
A 11 TYR A 269 ? ASN A 271 ? TYR A 291 ASN A 293 
A 12 VAL A 293 ? ASP A 295 ? VAL A 315 ASP A 317 
A 13 ILE A 319 ? ASP A 321 ? ILE A 341 ASP A 343 
A 14 ALA A 349 ? HIS A 351 ? ALA A 371 HIS A 373 
A 15 THR A 376 ? ASN A 378 ? THR A 398 ASN A 400 
A 16 ILE A 400 ? TYR A 402 ? ILE A 422 TYR A 424 
A 17 ALA A 463 ? ASP A 465 ? ALA A 485 ASP A 487 
A 18 CYS A 487 ? ASN A 489 ? CYS A 509 ASN A 511 
A 19 TYR A 512 ? ASP A 514 ? TYR A 534 ASP A 536 
A 20 VAL A 536 ? ASP A 538 ? VAL A 558 ASP A 560 
A 21 VAL A 566 ? ASN A 568 ? VAL A 588 ASN A 590 
A 22 GLU A 590 ? VAL A 592 ? GLU A 612 VAL A 614 
A 23 ARG A 621 ? ASP A 623 ? ARG A 643 ASP A 645 
A 24 GLU A 646 ? HIS A 648 ? GLU A 668 HIS A 670 
A 25 LEU A 670 ? ASP A 672 ? LEU A 692 ASP A 694 
A 26 THR A 694 ? LEU A 696 ? THR A 716 LEU A 718 
A 27 HIS A 718 ? ASP A 720 ? HIS A 740 ASP A 742 
A 28 MET A 744 ? GLU A 746 ? MET A 766 GLU A 768 
B 1  HIS A 55  ? ILE A 56  ? HIS A 77  ILE A 78  
B 2  ASN A 93  ? ILE A 94  ? ASN A 115 ILE A 116 
C 1  ASN A 138 ? ILE A 139 ? ASN A 160 ILE A 161 
C 2  ASN A 169 ? ILE A 170 ? ASN A 191 ILE A 192 
D 1  TYR A 214 ? ILE A 215 ? TYR A 236 ILE A 237 
D 2  ASN A 255 ? ILE A 256 ? ASN A 277 ILE A 278 
E 1  GLU A 359 ? LEU A 360 ? GLU A 381 LEU A 382 
E 2  GLN A 386 ? ILE A 387 ? GLN A 408 ILE A 409 
F 1  ASP B 15  ? GLU B 16  ? ASP B 37  GLU B 38  
F 2  ILE B 24  ? GLU B 26  ? ILE B 46  GLU B 48  
F 3  GLU B 45  ? ASP B 47  ? GLU B 67  ASP B 69  
F 4  LYS B 69  ? ASN B 71  ? LYS B 91  ASN B 93  
F 5  GLU B 107 ? LEU B 109 ? GLU B 129 LEU B 131 
F 6  GLU B 128 ? SER B 130 ? GLU B 150 SER B 152 
F 7  ASN B 152 ? TYR B 154 ? ASN B 174 TYR B 176 
F 8  LEU B 183 ? SER B 185 ? LEU B 205 SER B 207 
F 9  LYS B 204 ? PHE B 206 ? LYS B 226 PHE B 228 
F 10 LEU B 228 ? ASP B 230 ? LEU B 250 ASP B 252 
F 11 TYR B 269 ? ASN B 271 ? TYR B 291 ASN B 293 
F 12 VAL B 293 ? ASP B 295 ? VAL B 315 ASP B 317 
F 13 ILE B 319 ? ASP B 321 ? ILE B 341 ASP B 343 
F 14 ALA B 349 ? HIS B 351 ? ALA B 371 HIS B 373 
F 15 THR B 376 ? ASN B 378 ? THR B 398 ASN B 400 
F 16 ILE B 400 ? TYR B 402 ? ILE B 422 TYR B 424 
F 17 ALA B 463 ? ASP B 465 ? ALA B 485 ASP B 487 
F 18 CYS B 487 ? ASN B 489 ? CYS B 509 ASN B 511 
F 19 TYR B 512 ? ASP B 514 ? TYR B 534 ASP B 536 
F 20 VAL B 536 ? ASP B 538 ? VAL B 558 ASP B 560 
F 21 VAL B 566 ? ASN B 568 ? VAL B 588 ASN B 590 
F 22 GLU B 590 ? VAL B 592 ? GLU B 612 VAL B 614 
F 23 ARG B 621 ? ASP B 623 ? ARG B 643 ASP B 645 
F 24 GLU B 646 ? HIS B 648 ? GLU B 668 HIS B 670 
F 25 LEU B 670 ? ASP B 672 ? LEU B 692 ASP B 694 
F 26 THR B 694 ? LEU B 696 ? THR B 716 LEU B 718 
F 27 HIS B 718 ? ASP B 720 ? HIS B 740 ASP B 742 
F 28 MET B 744 ? GLU B 746 ? MET B 766 GLU B 768 
G 1  HIS B 55  ? ILE B 56  ? HIS B 77  ILE B 78  
G 2  ASN B 93  ? ILE B 94  ? ASN B 115 ILE B 116 
H 1  ASN B 138 ? ILE B 139 ? ASN B 160 ILE B 161 
H 2  ASN B 169 ? ILE B 170 ? ASN B 191 ILE B 192 
I 1  TYR B 214 ? ILE B 215 ? TYR B 236 ILE B 237 
I 2  ASN B 255 ? ILE B 256 ? ASN B 277 ILE B 278 
J 1  GLU B 359 ? LEU B 360 ? GLU B 381 LEU B 382 
J 2  GLN B 386 ? ILE B 387 ? GLN B 408 ILE B 409 
K 1  PHE B 752 ? GLU B 753 ? PHE B 774 GLU B 775 
K 2  CYS B 781 ? SER B 783 ? CYS B 803 SER B 805 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N ASP A 15  ? N ASP A 37  O GLU A 26  ? O GLU A 48  
A 2  3  N ALA A 25  ? N ALA A 47  O GLU A 45  ? O GLU A 67  
A 3  4  N LEU A 46  ? N LEU A 68  O LYS A 69  ? O LYS A 91  
A 4  5  N ILE A 70  ? N ILE A 92  O GLU A 107 ? O GLU A 129 
A 5  6  N LEU A 108 ? N LEU A 130 O GLU A 128 ? O GLU A 150 
A 6  7  N LEU A 129 ? N LEU A 151 O TYR A 154 ? O TYR A 176 
A 7  8  N LEU A 153 ? N LEU A 175 O LEU A 183 ? O LEU A 205 
A 8  9  N LEU A 184 ? N LEU A 206 O PHE A 206 ? O PHE A 228 
A 9  10 N LEU A 205 ? N LEU A 227 O ASP A 230 ? O ASP A 252 
A 10 11 N LEU A 229 ? N LEU A 251 O ASN A 271 ? O ASN A 293 
A 11 12 N LEU A 270 ? N LEU A 292 O VAL A 293 ? O VAL A 315 
A 12 13 N LEU A 294 ? N LEU A 316 O ILE A 319 ? O ILE A 341 
A 13 14 N LEU A 320 ? N LEU A 342 O HIS A 351 ? O HIS A 373 
A 14 15 N LEU A 350 ? N LEU A 372 O ASN A 378 ? O ASN A 400 
A 15 16 N ILE A 377 ? N ILE A 399 O TYR A 402 ? O TYR A 424 
A 16 17 N ILE A 401 ? N ILE A 423 O ALA A 463 ? O ALA A 485 
A 17 18 N LEU A 464 ? N LEU A 486 O CYS A 487 ? O CYS A 509 
A 18 19 N LEU A 488 ? N LEU A 510 O ASP A 514 ? O ASP A 536 
A 19 20 N LEU A 513 ? N LEU A 535 O VAL A 536 ? O VAL A 558 
A 20 21 N LEU A 537 ? N LEU A 559 O VAL A 566 ? O VAL A 588 
A 21 22 N LEU A 567 ? N LEU A 589 O GLU A 590 ? O GLU A 612 
A 22 23 N LEU A 591 ? N LEU A 613 O ARG A 621 ? O ARG A 643 
A 23 24 N LEU A 622 ? N LEU A 644 O HIS A 648 ? O HIS A 670 
A 24 25 N LEU A 647 ? N LEU A 669 O ASP A 672 ? O ASP A 694 
A 25 26 N LEU A 671 ? N LEU A 693 O LEU A 696 ? O LEU A 718 
A 26 27 N LEU A 695 ? N LEU A 717 O ASP A 720 ? O ASP A 742 
A 27 28 N LEU A 719 ? N LEU A 741 O MET A 744 ? O MET A 766 
B 1  2  N ILE A 56  ? N ILE A 78  O ASN A 93  ? O ASN A 115 
C 1  2  N ILE A 139 ? N ILE A 161 O ASN A 169 ? O ASN A 191 
D 1  2  N ILE A 215 ? N ILE A 237 O ASN A 255 ? O ASN A 277 
E 1  2  N LEU A 360 ? N LEU A 382 O GLN A 386 ? O GLN A 408 
F 1  2  N ASP B 15  ? N ASP B 37  O GLU B 26  ? O GLU B 48  
F 2  3  N ALA B 25  ? N ALA B 47  O GLU B 45  ? O GLU B 67  
F 3  4  N LEU B 46  ? N LEU B 68  O ASN B 71  ? O ASN B 93  
F 4  5  N ILE B 70  ? N ILE B 92  O LEU B 109 ? O LEU B 131 
F 5  6  N LEU B 108 ? N LEU B 130 O GLU B 128 ? O GLU B 150 
F 6  7  N LEU B 129 ? N LEU B 151 O TYR B 154 ? O TYR B 176 
F 7  8  N LEU B 153 ? N LEU B 175 O SER B 185 ? O SER B 207 
F 8  9  N LEU B 184 ? N LEU B 206 O PHE B 206 ? O PHE B 228 
F 9  10 N LEU B 205 ? N LEU B 227 O ASP B 230 ? O ASP B 252 
F 10 11 N LEU B 229 ? N LEU B 251 O ASN B 271 ? O ASN B 293 
F 11 12 N LEU B 270 ? N LEU B 292 O ASP B 295 ? O ASP B 317 
F 12 13 N LEU B 294 ? N LEU B 316 O ASP B 321 ? O ASP B 343 
F 13 14 N LEU B 320 ? N LEU B 342 O HIS B 351 ? O HIS B 373 
F 14 15 N LEU B 350 ? N LEU B 372 O ASN B 378 ? O ASN B 400 
F 15 16 N ILE B 377 ? N ILE B 399 O TYR B 402 ? O TYR B 424 
F 16 17 N ILE B 401 ? N ILE B 423 O ALA B 463 ? O ALA B 485 
F 17 18 N LEU B 464 ? N LEU B 486 O CYS B 487 ? O CYS B 509 
F 18 19 N LEU B 488 ? N LEU B 510 O ASP B 514 ? O ASP B 536 
F 19 20 N LEU B 513 ? N LEU B 535 O VAL B 536 ? O VAL B 558 
F 20 21 N LEU B 537 ? N LEU B 559 O ASN B 568 ? O ASN B 590 
F 21 22 N LEU B 567 ? N LEU B 589 O GLU B 590 ? O GLU B 612 
F 22 23 N LEU B 591 ? N LEU B 613 O ARG B 621 ? O ARG B 643 
F 23 24 N LEU B 622 ? N LEU B 644 O HIS B 648 ? O HIS B 670 
F 24 25 N LEU B 647 ? N LEU B 669 O ASP B 672 ? O ASP B 694 
F 25 26 N LEU B 671 ? N LEU B 693 O THR B 694 ? O THR B 716 
F 26 27 N LEU B 695 ? N LEU B 717 O HIS B 718 ? O HIS B 740 
F 27 28 N LEU B 719 ? N LEU B 741 O MET B 744 ? O MET B 766 
G 1  2  N ILE B 56  ? N ILE B 78  O ASN B 93  ? O ASN B 115 
H 1  2  N ILE B 139 ? N ILE B 161 O ASN B 169 ? O ASN B 191 
I 1  2  N ILE B 215 ? N ILE B 237 O ASN B 255 ? O ASN B 277 
J 1  2  N LEU B 360 ? N LEU B 382 O GLN B 386 ? O GLN B 408 
K 1  2  N PHE B 752 ? N PHE B 774 O ALA B 782 ? O ALA B 804 
# 
_atom_sites.entry_id                    3W3K 
_atom_sites.fract_transf_matrix[1][1]   0.013810 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003196 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006493 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011817 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 9   ? -4.033  31.278  46.935  1.00 89.29  ? 31   SER A N   1 
ATOM   2     C CA  . SER A 1 9   ? -3.029  30.320  47.376  1.00 86.21  ? 31   SER A CA  1 
ATOM   3     C C   . SER A 1 9   ? -3.177  28.984  46.653  1.00 82.79  ? 31   SER A C   1 
ATOM   4     O O   . SER A 1 9   ? -4.227  28.357  46.707  1.00 84.78  ? 31   SER A O   1 
ATOM   5     C CB  . SER A 1 9   ? -3.131  30.106  48.889  1.00 86.34  ? 31   SER A CB  1 
ATOM   6     N N   . ARG A 1 10  ? -2.121  28.556  45.971  1.00 79.29  ? 32   ARG A N   1 
ATOM   7     C CA  . ARG A 1 10  ? -2.112  27.259  45.301  1.00 74.61  ? 32   ARG A CA  1 
ATOM   8     C C   . ARG A 1 10  ? -1.856  26.164  46.321  1.00 74.36  ? 32   ARG A C   1 
ATOM   9     O O   . ARG A 1 10  ? -1.313  26.431  47.394  1.00 76.73  ? 32   ARG A O   1 
ATOM   10    C CB  . ARG A 1 10  ? -1.036  27.221  44.225  1.00 70.28  ? 32   ARG A CB  1 
ATOM   11    C CG  . ARG A 1 10  ? -1.138  28.351  43.221  1.00 72.60  ? 32   ARG A CG  1 
ATOM   12    C CD  . ARG A 1 10  ? 0.238   28.901  42.852  1.00 72.18  ? 32   ARG A CD  1 
ATOM   13    N NE  . ARG A 1 10  ? 0.155   29.893  41.785  1.00 72.48  ? 32   ARG A NE  1 
ATOM   14    C CZ  . ARG A 1 10  ? 0.235   29.575  40.499  1.00 70.60  ? 32   ARG A CZ  1 
ATOM   15    N NH1 . ARG A 1 10  ? 0.390   28.302  40.160  1.00 66.56  ? 32   ARG A NH1 1 
ATOM   16    N NH2 . ARG A 1 10  ? 0.154   30.509  39.557  1.00 71.89  ? 32   ARG A NH2 1 
ATOM   17    N N   . SER A 1 11  ? -2.261  24.938  46.001  1.00 71.23  ? 33   SER A N   1 
ATOM   18    C CA  . SER A 1 11  ? -2.043  23.821  46.911  1.00 72.62  ? 33   SER A CA  1 
ATOM   19    C C   . SER A 1 11  ? -0.554  23.513  47.049  1.00 70.98  ? 33   SER A C   1 
ATOM   20    O O   . SER A 1 11  ? 0.227   23.731  46.122  1.00 71.07  ? 33   SER A O   1 
ATOM   21    C CB  . SER A 1 11  ? -2.822  22.578  46.461  1.00 74.20  ? 33   SER A CB  1 
ATOM   22    O OG  . SER A 1 11  ? -2.372  22.099  45.206  1.00 74.85  ? 33   SER A OG  1 
ATOM   23    N N   . TYR A 1 12  ? -0.181  22.973  48.202  1.00 69.97  ? 34   TYR A N   1 
ATOM   24    C CA  . TYR A 1 12  ? 1.208   22.696  48.523  1.00 70.47  ? 34   TYR A CA  1 
ATOM   25    C C   . TYR A 1 12  ? 1.237   21.952  49.847  1.00 70.98  ? 34   TYR A C   1 
ATOM   26    O O   . TYR A 1 12  ? 0.515   22.317  50.770  1.00 69.07  ? 34   TYR A O   1 
ATOM   27    C CB  . TYR A 1 12  ? 2.007   23.999  48.665  1.00 71.61  ? 34   TYR A CB  1 
ATOM   28    C CG  . TYR A 1 12  ? 3.471   23.751  48.924  1.00 73.22  ? 34   TYR A CG  1 
ATOM   29    C CD1 . TYR A 1 12  ? 3.962   23.627  50.222  1.00 75.17  ? 34   TYR A CD1 1 
ATOM   30    C CD2 . TYR A 1 12  ? 4.359   23.598  47.868  1.00 73.49  ? 34   TYR A CD2 1 
ATOM   31    C CE1 . TYR A 1 12  ? 5.301   23.374  50.458  1.00 75.92  ? 34   TYR A CE1 1 
ATOM   32    C CE2 . TYR A 1 12  ? 5.699   23.347  48.090  1.00 74.59  ? 34   TYR A CE2 1 
ATOM   33    C CZ  . TYR A 1 12  ? 6.166   23.234  49.385  1.00 76.67  ? 34   TYR A CZ  1 
ATOM   34    O OH  . TYR A 1 12  ? 7.501   22.983  49.599  1.00 77.83  ? 34   TYR A OH  1 
ATOM   35    N N   . PRO A 1 13  ? 2.091   20.917  49.956  1.00 70.97  ? 35   PRO A N   1 
ATOM   36    C CA  . PRO A 1 13  ? 2.974   20.351  48.926  1.00 67.61  ? 35   PRO A CA  1 
ATOM   37    C C   . PRO A 1 13  ? 2.257   19.542  47.844  1.00 67.79  ? 35   PRO A C   1 
ATOM   38    O O   . PRO A 1 13  ? 2.819   19.285  46.778  1.00 64.05  ? 35   PRO A O   1 
ATOM   39    C CB  . PRO A 1 13  ? 3.898   19.421  49.727  1.00 67.11  ? 35   PRO A CB  1 
ATOM   40    C CG  . PRO A 1 13  ? 3.664   19.743  51.169  1.00 69.07  ? 35   PRO A CG  1 
ATOM   41    C CD  . PRO A 1 13  ? 2.259   20.228  51.244  1.00 71.69  ? 35   PRO A CD  1 
ATOM   42    N N   . CYS A 1 14  ? 1.034   19.115  48.129  1.00 69.82  ? 36   CYS A N   1 
ATOM   43    C CA  . CYS A 1 14  ? 0.296   18.276  47.184  1.00 70.12  ? 36   CYS A CA  1 
ATOM   44    C C   . CYS A 1 14  ? -0.131  19.031  45.921  1.00 72.15  ? 36   CYS A C   1 
ATOM   45    O O   . CYS A 1 14  ? -0.217  20.261  45.912  1.00 72.62  ? 36   CYS A O   1 
ATOM   46    C CB  . CYS A 1 14  ? -0.945  17.688  47.850  1.00 69.55  ? 36   CYS A CB  1 
ATOM   47    S SG  . CYS A 1 14  ? -0.581  16.868  49.447  1.00 78.17  ? 36   CYS A SG  1 
ATOM   48    N N   . ASP A 1 15  ? -0.377  18.285  44.848  1.00 72.19  ? 37   ASP A N   1 
ATOM   49    C CA  . ASP A 1 15  ? -1.050  18.835  43.684  1.00 72.77  ? 37   ASP A CA  1 
ATOM   50    C C   . ASP A 1 15  ? -2.490  18.340  43.749  1.00 75.15  ? 37   ASP A C   1 
ATOM   51    O O   . ASP A 1 15  ? -2.753  17.160  43.524  1.00 73.48  ? 37   ASP A O   1 
ATOM   52    C CB  . ASP A 1 15  ? -0.376  18.366  42.390  1.00 72.61  ? 37   ASP A CB  1 
ATOM   53    C CG  . ASP A 1 15  ? 1.092   18.760  42.311  1.00 75.17  ? 37   ASP A CG  1 
ATOM   54    O OD1 . ASP A 1 15  ? 1.453   19.858  42.786  1.00 79.70  ? 37   ASP A OD1 1 
ATOM   55    O OD2 . ASP A 1 15  ? 1.885   17.975  41.750  1.00 74.71  ? 37   ASP A OD2 1 
ATOM   56    N N   . GLU A 1 16  ? -3.417  19.241  44.066  1.00 79.86  ? 38   GLU A N   1 
ATOM   57    C CA  . GLU A 1 16  ? -4.836  18.899  44.142  1.00 82.10  ? 38   GLU A CA  1 
ATOM   58    C C   . GLU A 1 16  ? -5.502  19.145  42.790  1.00 85.58  ? 38   GLU A C   1 
ATOM   59    O O   . GLU A 1 16  ? -5.278  20.181  42.161  1.00 86.34  ? 38   GLU A O   1 
ATOM   60    C CB  . GLU A 1 16  ? -5.532  19.698  45.256  1.00 80.30  ? 38   GLU A CB  1 
ATOM   61    C CG  . GLU A 1 16  ? -5.374  19.088  46.649  1.00 77.54  ? 38   GLU A CG  1 
ATOM   62    C CD  . GLU A 1 16  ? -5.454  20.106  47.783  1.00 78.60  ? 38   GLU A CD  1 
ATOM   63    O OE1 . GLU A 1 16  ? -6.156  21.131  47.645  1.00 78.43  ? 38   GLU A OE1 1 
ATOM   64    O OE2 . GLU A 1 16  ? -4.802  19.871  48.824  1.00 78.59  ? 38   GLU A OE2 1 
ATOM   65    N N   . LYS A 1 17  ? -6.305  18.185  42.338  1.00 86.93  ? 39   LYS A N   1 
ATOM   66    C CA  . LYS A 1 17  ? -6.972  18.307  41.046  1.00 89.36  ? 39   LYS A CA  1 
ATOM   67    C C   . LYS A 1 17  ? -8.311  17.577  41.024  1.00 91.21  ? 39   LYS A C   1 
ATOM   68    O O   . LYS A 1 17  ? -8.549  16.673  41.823  1.00 90.93  ? 39   LYS A O   1 
ATOM   69    C CB  . LYS A 1 17  ? -6.066  17.801  39.916  1.00 87.18  ? 39   LYS A CB  1 
ATOM   70    C CG  . LYS A 1 17  ? -6.190  16.314  39.601  1.00 85.63  ? 39   LYS A CG  1 
ATOM   71    C CD  . LYS A 1 17  ? -5.235  15.913  38.477  1.00 83.17  ? 39   LYS A CD  1 
ATOM   72    C CE  . LYS A 1 17  ? -5.386  14.448  38.090  1.00 81.86  ? 39   LYS A CE  1 
ATOM   73    N NZ  . LYS A 1 17  ? -4.320  14.004  37.132  1.00 79.91  ? 39   LYS A NZ  1 
ATOM   74    N N   . VAL A 1 23  ? -12.158 14.761  44.118  1.00 73.39  ? 45   VAL A N   1 
ATOM   75    C CA  . VAL A 1 23  ? -10.899 15.492  44.033  1.00 73.38  ? 45   VAL A CA  1 
ATOM   76    C C   . VAL A 1 23  ? -9.788  14.755  44.784  1.00 73.65  ? 45   VAL A C   1 
ATOM   77    O O   . VAL A 1 23  ? -9.954  14.370  45.943  1.00 73.65  ? 45   VAL A O   1 
ATOM   78    C CB  . VAL A 1 23  ? -11.054 16.956  44.527  1.00 76.34  ? 45   VAL A CB  1 
ATOM   79    C CG1 . VAL A 1 23  ? -11.736 17.000  45.871  1.00 77.01  ? 45   VAL A CG1 1 
ATOM   80    C CG2 . VAL A 1 23  ? -9.710  17.653  44.589  1.00 76.08  ? 45   VAL A CG2 1 
ATOM   81    N N   . ILE A 1 24  ? -8.671  14.524  44.099  1.00 74.58  ? 46   ILE A N   1 
ATOM   82    C CA  . ILE A 1 24  ? -7.545  13.802  44.682  1.00 75.75  ? 46   ILE A CA  1 
ATOM   83    C C   . ILE A 1 24  ? -6.329  14.703  44.859  1.00 77.99  ? 46   ILE A C   1 
ATOM   84    O O   . ILE A 1 24  ? -6.151  15.678  44.130  1.00 79.08  ? 46   ILE A O   1 
ATOM   85    C CB  . ILE A 1 24  ? -7.134  12.580  43.829  1.00 74.88  ? 46   ILE A CB  1 
ATOM   86    C CG1 . ILE A 1 24  ? -6.606  13.026  42.463  1.00 74.40  ? 46   ILE A CG1 1 
ATOM   87    C CG2 . ILE A 1 24  ? -8.296  11.625  43.667  1.00 76.29  ? 46   ILE A CG2 1 
ATOM   88    C CD1 . ILE A 1 24  ? -6.157  11.882  41.572  1.00 72.40  ? 46   ILE A CD1 1 
ATOM   89    N N   . ALA A 1 25  ? -5.502  14.369  45.845  1.00 76.99  ? 47   ALA A N   1 
ATOM   90    C CA  . ALA A 1 25  ? -4.235  15.050  46.067  1.00 72.18  ? 47   ALA A CA  1 
ATOM   91    C C   . ALA A 1 25  ? -3.083  14.125  45.705  1.00 69.51  ? 47   ALA A C   1 
ATOM   92    O O   . ALA A 1 25  ? -3.015  12.999  46.195  1.00 65.90  ? 47   ALA A O   1 
ATOM   93    C CB  . ALA A 1 25  ? -4.124  15.476  47.522  1.00 70.41  ? 47   ALA A CB  1 
ATOM   94    N N   . GLU A 1 26  ? -2.173  14.587  44.856  1.00 72.59  ? 48   GLU A N   1 
ATOM   95    C CA  . GLU A 1 26  ? -0.982  13.800  44.573  1.00 71.93  ? 48   GLU A CA  1 
ATOM   96    C C   . GLU A 1 26  ? 0.165   14.396  45.366  1.00 69.56  ? 48   GLU A C   1 
ATOM   97    O O   . GLU A 1 26  ? 0.711   15.435  45.007  1.00 68.26  ? 48   GLU A O   1 
ATOM   98    C CB  . GLU A 1 26  ? -0.674  13.837  43.074  1.00 73.50  ? 48   GLU A CB  1 
ATOM   99    C CG  . GLU A 1 26  ? -1.831  13.344  42.219  1.00 77.27  ? 48   GLU A CG  1 
ATOM   100   C CD  . GLU A 1 26  ? -1.808  13.908  40.820  1.00 81.21  ? 48   GLU A CD  1 
ATOM   101   O OE1 . GLU A 1 26  ? -0.936  14.756  40.539  1.00 84.15  ? 48   GLU A OE1 1 
ATOM   102   O OE2 . GLU A 1 26  ? -2.663  13.507  40.003  1.00 81.12  ? 48   GLU A OE2 1 
ATOM   103   N N   . CYS A 1 27  ? 0.510   13.724  46.454  1.00 69.69  ? 49   CYS A N   1 
ATOM   104   C CA  . CYS A 1 27  ? 1.614   14.124  47.299  1.00 72.69  ? 49   CYS A CA  1 
ATOM   105   C C   . CYS A 1 27  ? 2.862   13.277  47.122  1.00 71.55  ? 49   CYS A C   1 
ATOM   106   O O   . CYS A 1 27  ? 3.832   13.449  47.863  1.00 73.96  ? 49   CYS A O   1 
ATOM   107   C CB  . CYS A 1 27  ? 1.192   14.120  48.752  1.00 74.93  ? 49   CYS A CB  1 
ATOM   108   S SG  . CYS A 1 27  ? 1.139   15.803  49.451  1.00 74.80  ? 49   CYS A SG  1 
ATOM   109   N N   . SER A 1 28  ? 2.822   12.334  46.185  1.00 68.84  ? 50   SER A N   1 
ATOM   110   C CA  . SER A 1 28  ? 3.907   11.367  46.023  1.00 68.08  ? 50   SER A CA  1 
ATOM   111   C C   . SER A 1 28  ? 5.241   12.002  45.652  1.00 67.10  ? 50   SER A C   1 
ATOM   112   O O   . SER A 1 28  ? 5.287   13.043  44.998  1.00 66.43  ? 50   SER A O   1 
ATOM   113   C CB  . SER A 1 28  ? 3.548   10.329  44.960  1.00 67.52  ? 50   SER A CB  1 
ATOM   114   O OG  . SER A 1 28  ? 3.614   10.896  43.664  1.00 68.75  ? 50   SER A OG  1 
ATOM   115   N N   . ASN A 1 29  ? 6.324   11.351  46.068  1.00 67.67  ? 51   ASN A N   1 
ATOM   116   C CA  . ASN A 1 29  ? 7.672   11.697  45.616  1.00 69.64  ? 51   ASN A CA  1 
ATOM   117   C C   . ASN A 1 29  ? 8.096   13.139  45.942  1.00 70.65  ? 51   ASN A C   1 
ATOM   118   O O   . ASN A 1 29  ? 8.931   13.725  45.252  1.00 70.48  ? 51   ASN A O   1 
ATOM   119   C CB  . ASN A 1 29  ? 7.787   11.438  44.110  1.00 70.78  ? 51   ASN A CB  1 
ATOM   120   C CG  . ASN A 1 29  ? 9.206   11.183  43.668  1.00 72.10  ? 51   ASN A CG  1 
ATOM   121   O OD1 . ASN A 1 29  ? 9.979   10.530  44.367  1.00 71.63  ? 51   ASN A OD1 1 
ATOM   122   N ND2 . ASN A 1 29  ? 9.559   11.696  42.496  1.00 73.29  ? 51   ASN A ND2 1 
ATOM   123   N N   . ARG A 1 30  ? 7.492   13.713  46.978  1.00 72.20  ? 52   ARG A N   1 
ATOM   124   C CA  . ARG A 1 30  ? 7.760   15.100  47.367  1.00 72.53  ? 52   ARG A CA  1 
ATOM   125   C C   . ARG A 1 30  ? 8.764   15.293  48.513  1.00 71.78  ? 52   ARG A C   1 
ATOM   126   O O   . ARG A 1 30  ? 8.950   16.415  48.990  1.00 74.34  ? 52   ARG A O   1 
ATOM   127   C CB  . ARG A 1 30  ? 6.454   15.843  47.651  1.00 73.89  ? 52   ARG A CB  1 
ATOM   128   C CG  . ARG A 1 30  ? 5.812   16.378  46.394  1.00 74.20  ? 52   ARG A CG  1 
ATOM   129   C CD  . ARG A 1 30  ? 4.307   16.390  46.480  1.00 75.33  ? 52   ARG A CD  1 
ATOM   130   N NE  . ARG A 1 30  ? 3.720   16.786  45.207  1.00 76.64  ? 52   ARG A NE  1 
ATOM   131   C CZ  . ARG A 1 30  ? 3.453   15.943  44.217  1.00 76.86  ? 52   ARG A CZ  1 
ATOM   132   N NH1 . ARG A 1 30  ? 3.705   14.651  44.357  1.00 77.08  ? 52   ARG A NH1 1 
ATOM   133   N NH2 . ARG A 1 30  ? 2.918   16.389  43.091  1.00 77.64  ? 52   ARG A NH2 1 
ATOM   134   N N   . ARG A 1 31  ? 9.373   14.199  48.963  1.00 67.57  ? 53   ARG A N   1 
ATOM   135   C CA  . ARG A 1 31  ? 10.353  14.224  50.054  1.00 67.58  ? 53   ARG A CA  1 
ATOM   136   C C   . ARG A 1 31  ? 9.745   14.656  51.385  1.00 67.88  ? 53   ARG A C   1 
ATOM   137   O O   . ARG A 1 31  ? 10.435  15.201  52.245  1.00 68.77  ? 53   ARG A O   1 
ATOM   138   C CB  . ARG A 1 31  ? 11.547  15.123  49.708  1.00 67.01  ? 53   ARG A CB  1 
ATOM   139   C CG  . ARG A 1 31  ? 12.154  14.847  48.346  1.00 63.81  ? 53   ARG A CG  1 
ATOM   140   C CD  . ARG A 1 31  ? 13.311  15.779  48.075  1.00 63.07  ? 53   ARG A CD  1 
ATOM   141   N NE  . ARG A 1 31  ? 12.924  17.188  48.108  1.00 63.88  ? 53   ARG A NE  1 
ATOM   142   C CZ  . ARG A 1 31  ? 12.558  17.883  47.034  1.00 61.80  ? 53   ARG A CZ  1 
ATOM   143   N NH1 . ARG A 1 31  ? 12.516  17.293  45.847  1.00 61.18  ? 53   ARG A NH1 1 
ATOM   144   N NH2 . ARG A 1 31  ? 12.232  19.165  47.144  1.00 59.96  ? 53   ARG A NH2 1 
ATOM   145   N N   . LEU A 1 32  ? 8.452   14.416  51.548  1.00 68.32  ? 54   LEU A N   1 
ATOM   146   C CA  . LEU A 1 32  ? 7.757   14.785  52.777  1.00 70.48  ? 54   LEU A CA  1 
ATOM   147   C C   . LEU A 1 32  ? 8.299   13.985  53.957  1.00 72.19  ? 54   LEU A C   1 
ATOM   148   O O   . LEU A 1 32  ? 8.527   12.778  53.842  1.00 72.00  ? 54   LEU A O   1 
ATOM   149   C CB  . LEU A 1 32  ? 6.266   14.510  52.628  1.00 69.25  ? 54   LEU A CB  1 
ATOM   150   C CG  . LEU A 1 32  ? 5.370   15.575  52.002  1.00 69.56  ? 54   LEU A CG  1 
ATOM   151   C CD1 . LEU A 1 32  ? 6.176   16.621  51.263  1.00 68.85  ? 54   LEU A CD1 1 
ATOM   152   C CD2 . LEU A 1 32  ? 4.372   14.909  51.070  1.00 68.12  ? 54   LEU A CD2 1 
ATOM   153   N N   . GLN A 1 33  ? 8.516   14.649  55.085  1.00 74.35  ? 55   GLN A N   1 
ATOM   154   C CA  . GLN A 1 33  ? 8.989   13.960  56.280  1.00 78.66  ? 55   GLN A CA  1 
ATOM   155   C C   . GLN A 1 33  ? 7.816   13.413  57.102  1.00 80.79  ? 55   GLN A C   1 
ATOM   156   O O   . GLN A 1 33  ? 7.997   12.563  57.975  1.00 81.19  ? 55   GLN A O   1 
ATOM   157   C CB  . GLN A 1 33  ? 9.852   14.896  57.133  1.00 83.06  ? 55   GLN A CB  1 
ATOM   158   C CG  . GLN A 1 33  ? 11.084  14.230  57.718  1.00 85.42  ? 55   GLN A CG  1 
ATOM   159   C CD  . GLN A 1 33  ? 12.117  13.893  56.665  1.00 87.14  ? 55   GLN A CD  1 
ATOM   160   O OE1 . GLN A 1 33  ? 12.172  14.521  55.607  1.00 87.94  ? 55   GLN A OE1 1 
ATOM   161   N NE2 . GLN A 1 33  ? 12.943  12.894  56.948  1.00 87.89  ? 55   GLN A NE2 1 
ATOM   162   N N   . GLU A 1 34  ? 6.607   13.850  56.768  1.00 81.26  ? 56   GLU A N   1 
ATOM   163   C CA  . GLU A 1 34  ? 5.440   13.594  57.603  1.00 82.81  ? 56   GLU A CA  1 
ATOM   164   C C   . GLU A 1 34  ? 4.198   14.078  56.869  1.00 79.90  ? 56   GLU A C   1 
ATOM   165   O O   . GLU A 1 34  ? 4.298   14.838  55.906  1.00 79.51  ? 56   GLU A O   1 
ATOM   166   C CB  . GLU A 1 34  ? 5.570   14.330  58.951  1.00 88.73  ? 56   GLU A CB  1 
ATOM   167   C CG  . GLU A 1 34  ? 6.014   13.464  60.138  1.00 92.37  ? 56   GLU A CG  1 
ATOM   168   C CD  . GLU A 1 34  ? 6.260   14.283  61.409  1.00 95.86  ? 56   GLU A CD  1 
ATOM   169   O OE1 . GLU A 1 34  ? 5.625   15.355  61.550  1.00 97.72  ? 56   GLU A OE1 1 
ATOM   170   O OE2 . GLU A 1 34  ? 7.100   13.859  62.243  1.00 96.15  ? 56   GLU A OE2 1 
ATOM   171   N N   . VAL A 1 35  ? 3.032   13.617  57.316  1.00 78.43  ? 57   VAL A N   1 
ATOM   172   C CA  . VAL A 1 35  ? 1.761   13.969  56.687  1.00 77.97  ? 57   VAL A CA  1 
ATOM   173   C C   . VAL A 1 35  ? 1.489   15.468  56.784  1.00 77.01  ? 57   VAL A C   1 
ATOM   174   O O   . VAL A 1 35  ? 1.496   16.036  57.874  1.00 79.16  ? 57   VAL A O   1 
ATOM   175   C CB  . VAL A 1 35  ? 0.575   13.215  57.333  1.00 80.11  ? 57   VAL A CB  1 
ATOM   176   C CG1 . VAL A 1 35  ? -0.536  12.990  56.314  1.00 80.52  ? 57   VAL A CG1 1 
ATOM   177   C CG2 . VAL A 1 35  ? 1.033   11.889  57.923  1.00 79.63  ? 57   VAL A CG2 1 
ATOM   178   N N   . PRO A 1 36  ? 1.238   16.114  55.639  1.00 75.10  ? 58   PRO A N   1 
ATOM   179   C CA  . PRO A 1 36  ? 0.989   17.559  55.599  1.00 77.63  ? 58   PRO A CA  1 
ATOM   180   C C   . PRO A 1 36  ? -0.320  17.962  56.267  1.00 84.81  ? 58   PRO A C   1 
ATOM   181   O O   . PRO A 1 36  ? -1.283  17.199  56.224  1.00 87.40  ? 58   PRO A O   1 
ATOM   182   C CB  . PRO A 1 36  ? 0.889   17.851  54.104  1.00 75.34  ? 58   PRO A CB  1 
ATOM   183   C CG  . PRO A 1 36  ? 1.588   16.713  53.427  1.00 73.15  ? 58   PRO A CG  1 
ATOM   184   C CD  . PRO A 1 36  ? 1.341   15.527  54.291  1.00 73.22  ? 58   PRO A CD  1 
ATOM   185   N N   . GLN A 1 37  ? -0.344  19.143  56.880  1.00 87.65  ? 59   GLN A N   1 
ATOM   186   C CA  . GLN A 1 37  ? -1.563  19.695  57.470  1.00 90.57  ? 59   GLN A CA  1 
ATOM   187   C C   . GLN A 1 37  ? -2.265  20.584  56.447  1.00 89.72  ? 59   GLN A C   1 
ATOM   188   O O   . GLN A 1 37  ? -3.405  21.005  56.635  1.00 88.89  ? 59   GLN A O   1 
ATOM   189   C CB  . GLN A 1 37  ? -1.221  20.516  58.717  1.00 94.56  ? 59   GLN A CB  1 
ATOM   190   C CG  . GLN A 1 37  ? -0.152  19.885  59.602  1.00 95.65  ? 59   GLN A CG  1 
ATOM   191   C CD  . GLN A 1 37  ? -0.527  18.487  60.057  1.00 95.21  ? 59   GLN A CD  1 
ATOM   192   O OE1 . GLN A 1 37  ? -1.653  18.247  60.496  1.00 96.19  ? 59   GLN A OE1 1 
ATOM   193   N NE2 . GLN A 1 37  ? 0.412   17.554  59.944  1.00 93.07  ? 59   GLN A NE2 1 
ATOM   194   N N   . THR A 1 38  ? -1.572  20.828  55.342  1.00 90.88  ? 60   THR A N   1 
ATOM   195   C CA  . THR A 1 38  ? -1.978  21.823  54.360  1.00 91.99  ? 60   THR A CA  1 
ATOM   196   C C   . THR A 1 38  ? -2.904  21.256  53.280  1.00 90.94  ? 60   THR A C   1 
ATOM   197   O O   . THR A 1 38  ? -3.230  21.944  52.313  1.00 91.88  ? 60   THR A O   1 
ATOM   198   C CB  . THR A 1 38  ? -0.746  22.465  53.689  1.00 91.29  ? 60   THR A CB  1 
ATOM   199   O OG1 . THR A 1 38  ? -0.837  22.306  52.269  1.00 90.23  ? 60   THR A OG1 1 
ATOM   200   C CG2 . THR A 1 38  ? 0.534   21.807  54.176  1.00 88.82  ? 60   THR A CG2 1 
ATOM   201   N N   . VAL A 1 39  ? -3.310  20.000  53.436  1.00 87.97  ? 61   VAL A N   1 
ATOM   202   C CA  . VAL A 1 39  ? -4.214  19.355  52.482  1.00 85.82  ? 61   VAL A CA  1 
ATOM   203   C C   . VAL A 1 39  ? -5.646  19.902  52.572  1.00 86.36  ? 61   VAL A C   1 
ATOM   204   O O   . VAL A 1 39  ? -6.175  20.096  53.669  1.00 89.25  ? 61   VAL A O   1 
ATOM   205   C CB  . VAL A 1 39  ? -4.188  17.810  52.643  1.00 97.94  ? 61   VAL A CB  1 
ATOM   206   C CG1 . VAL A 1 39  ? -3.699  17.427  54.023  1.00 98.78  ? 61   VAL A CG1 1 
ATOM   207   C CG2 . VAL A 1 39  ? -5.555  17.192  52.352  1.00 97.23  ? 61   VAL A CG2 1 
ATOM   208   N N   . GLY A 1 40  ? -6.255  20.175  51.417  1.00 84.25  ? 62   GLY A N   1 
ATOM   209   C CA  . GLY A 1 40  ? -7.609  20.702  51.360  1.00 85.99  ? 62   GLY A CA  1 
ATOM   210   C C   . GLY A 1 40  ? -8.654  19.776  51.956  1.00 85.73  ? 62   GLY A C   1 
ATOM   211   O O   . GLY A 1 40  ? -8.506  18.555  51.932  1.00 83.50  ? 62   GLY A O   1 
ATOM   212   N N   . LYS A 1 41  ? -9.727  20.363  52.474  1.00 87.05  ? 63   LYS A N   1 
ATOM   213   C CA  . LYS A 1 41  ? -10.759 19.610  53.185  1.00 87.31  ? 63   LYS A CA  1 
ATOM   214   C C   . LYS A 1 41  ? -11.772 18.968  52.222  1.00 86.00  ? 63   LYS A C   1 
ATOM   215   O O   . LYS A 1 41  ? -12.528 18.076  52.600  1.00 89.24  ? 63   LYS A O   1 
ATOM   216   C CB  . LYS A 1 41  ? -11.426 20.511  54.243  1.00 89.44  ? 63   LYS A CB  1 
ATOM   217   C CG  . LYS A 1 41  ? -12.746 20.026  54.858  1.00 89.92  ? 63   LYS A CG  1 
ATOM   218   C CD  . LYS A 1 41  ? -12.626 18.692  55.591  1.00 86.96  ? 63   LYS A CD  1 
ATOM   219   C CE  . LYS A 1 41  ? -13.962 18.304  56.207  1.00 87.46  ? 63   LYS A CE  1 
ATOM   220   N NZ  . LYS A 1 41  ? -15.086 18.517  55.250  1.00 87.51  ? 63   LYS A NZ  1 
ATOM   221   N N   . TYR A 1 42  ? -11.767 19.387  50.964  1.00 80.63  ? 64   TYR A N   1 
ATOM   222   C CA  . TYR A 1 42  ? -12.598 18.709  49.979  1.00 76.63  ? 64   TYR A CA  1 
ATOM   223   C C   . TYR A 1 42  ? -11.922 17.429  49.476  1.00 75.41  ? 64   TYR A C   1 
ATOM   224   O O   . TYR A 1 42  ? -12.552 16.590  48.837  1.00 76.54  ? 64   TYR A O   1 
ATOM   225   C CB  . TYR A 1 42  ? -12.987 19.662  48.845  1.00 73.79  ? 64   TYR A CB  1 
ATOM   226   C CG  . TYR A 1 42  ? -14.181 20.520  49.203  1.00 72.26  ? 64   TYR A CG  1 
ATOM   227   C CD1 . TYR A 1 42  ? -15.284 19.959  49.831  1.00 68.55  ? 64   TYR A CD1 1 
ATOM   228   C CD2 . TYR A 1 42  ? -14.198 21.884  48.932  1.00 73.13  ? 64   TYR A CD2 1 
ATOM   229   C CE1 . TYR A 1 42  ? -16.359 20.718  50.169  1.00 69.62  ? 64   TYR A CE1 1 
ATOM   230   C CE2 . TYR A 1 42  ? -15.274 22.652  49.265  1.00 69.50  ? 64   TYR A CE2 1 
ATOM   231   C CZ  . TYR A 1 42  ? -16.357 22.061  49.888  1.00 70.45  ? 64   TYR A CZ  1 
ATOM   232   O OH  . TYR A 1 42  ? -17.460 22.808  50.239  1.00 72.64  ? 64   TYR A OH  1 
ATOM   233   N N   . VAL A 1 43  ? -10.650 17.266  49.825  1.00 73.19  ? 65   VAL A N   1 
ATOM   234   C CA  . VAL A 1 43  ? -9.861  16.129  49.370  1.00 72.33  ? 65   VAL A CA  1 
ATOM   235   C C   . VAL A 1 43  ? -10.434 14.775  49.783  1.00 74.96  ? 65   VAL A C   1 
ATOM   236   O O   . VAL A 1 43  ? -10.769 14.548  50.946  1.00 76.60  ? 65   VAL A O   1 
ATOM   237   C CB  . VAL A 1 43  ? -8.396  16.246  49.826  1.00 68.91  ? 65   VAL A CB  1 
ATOM   238   C CG1 . VAL A 1 43  ? -7.655  14.939  49.604  1.00 63.92  ? 65   VAL A CG1 1 
ATOM   239   C CG2 . VAL A 1 43  ? -7.713  17.384  49.085  1.00 69.51  ? 65   VAL A CG2 1 
ATOM   240   N N   . THR A 1 44  ? -10.541 13.887  48.802  1.00 76.25  ? 66   THR A N   1 
ATOM   241   C CA  . THR A 1 44  ? -11.092 12.556  48.988  1.00 79.19  ? 66   THR A CA  1 
ATOM   242   C C   . THR A 1 44  ? -9.957  11.534  49.101  1.00 77.90  ? 66   THR A C   1 
ATOM   243   O O   . THR A 1 44  ? -9.838  10.832  50.104  1.00 77.14  ? 66   THR A O   1 
ATOM   244   C CB  . THR A 1 44  ? -12.034 12.174  47.827  1.00 81.52  ? 66   THR A CB  1 
ATOM   245   O OG1 . THR A 1 44  ? -12.439 13.355  47.120  1.00 85.65  ? 66   THR A OG1 1 
ATOM   246   C CG2 . THR A 1 44  ? -13.260 11.469  48.357  1.00 81.48  ? 66   THR A CG2 1 
ATOM   247   N N   . GLU A 1 45  ? -9.147  11.445  48.049  1.00 77.37  ? 67   GLU A N   1 
ATOM   248   C CA  . GLU A 1 45  ? -8.037  10.496  47.980  1.00 78.22  ? 67   GLU A CA  1 
ATOM   249   C C   . GLU A 1 45  ? -6.663  11.162  48.109  1.00 76.03  ? 67   GLU A C   1 
ATOM   250   O O   . GLU A 1 45  ? -6.369  12.158  47.448  1.00 78.09  ? 67   GLU A O   1 
ATOM   251   C CB  . GLU A 1 45  ? -8.118  9.706   46.678  1.00 79.02  ? 67   GLU A CB  1 
ATOM   252   C CG  . GLU A 1 45  ? -9.451  9.013   46.505  1.00 83.82  ? 67   GLU A CG  1 
ATOM   253   C CD  . GLU A 1 45  ? -9.710  8.576   45.083  1.00 86.27  ? 67   GLU A CD  1 
ATOM   254   O OE1 . GLU A 1 45  ? -8.748  8.498   44.290  1.00 86.05  ? 67   GLU A OE1 1 
ATOM   255   O OE2 . GLU A 1 45  ? -10.887 8.314   44.759  1.00 88.42  ? 67   GLU A OE2 1 
ATOM   256   N N   . LEU A 1 46  ? -5.820  10.588  48.956  1.00 70.83  ? 68   LEU A N   1 
ATOM   257   C CA  . LEU A 1 46  ? -4.530  11.177  49.270  1.00 67.19  ? 68   LEU A CA  1 
ATOM   258   C C   . LEU A 1 46  ? -3.409  10.199  48.971  1.00 66.08  ? 68   LEU A C   1 
ATOM   259   O O   . LEU A 1 46  ? -3.347  9.125   49.570  1.00 67.45  ? 68   LEU A O   1 
ATOM   260   C CB  . LEU A 1 46  ? -4.498  11.558  50.747  1.00 65.84  ? 68   LEU A CB  1 
ATOM   261   C CG  . LEU A 1 46  ? -3.230  12.223  51.269  1.00 63.87  ? 68   LEU A CG  1 
ATOM   262   C CD1 . LEU A 1 46  ? -2.910  13.446  50.433  1.00 61.65  ? 68   LEU A CD1 1 
ATOM   263   C CD2 . LEU A 1 46  ? -3.411  12.590  52.740  1.00 65.17  ? 68   LEU A CD2 1 
ATOM   264   N N   . ASP A 1 47  ? -2.516  10.564  48.056  1.00 65.91  ? 69   ASP A N   1 
ATOM   265   C CA  . ASP A 1 47  ? -1.434  9.658   47.677  1.00 64.34  ? 69   ASP A CA  1 
ATOM   266   C C   . ASP A 1 47  ? -0.103  10.164  48.234  1.00 62.11  ? 69   ASP A C   1 
ATOM   267   O O   . ASP A 1 47  ? 0.506   11.092  47.702  1.00 60.85  ? 69   ASP A O   1 
ATOM   268   C CB  . ASP A 1 47  ? -1.372  9.561   46.150  1.00 63.71  ? 69   ASP A CB  1 
ATOM   269   C CG  . ASP A 1 47  ? -0.384  8.526   45.663  1.00 64.77  ? 69   ASP A CG  1 
ATOM   270   O OD1 . ASP A 1 47  ? 0.313   7.907   46.493  1.00 66.04  ? 69   ASP A OD1 1 
ATOM   271   O OD2 . ASP A 1 47  ? -0.277  8.357   44.432  1.00 66.71  ? 69   ASP A OD2 1 
ATOM   272   N N   . LEU A 1 48  ? 0.332   9.509   49.308  1.00 59.37  ? 70   LEU A N   1 
ATOM   273   C CA  . LEU A 1 48  ? 1.563   9.816   50.040  1.00 54.87  ? 70   LEU A CA  1 
ATOM   274   C C   . LEU A 1 48  ? 2.732   8.879   49.717  1.00 55.75  ? 70   LEU A C   1 
ATOM   275   O O   . LEU A 1 48  ? 3.747   8.868   50.422  1.00 53.71  ? 70   LEU A O   1 
ATOM   276   C CB  . LEU A 1 48  ? 1.299   9.900   51.541  1.00 51.55  ? 70   LEU A CB  1 
ATOM   277   C CG  . LEU A 1 48  ? 0.576   11.182  51.970  1.00 53.99  ? 70   LEU A CG  1 
ATOM   278   C CD1 . LEU A 1 48  ? 0.010   11.045  53.375  1.00 53.95  ? 70   LEU A CD1 1 
ATOM   279   C CD2 . LEU A 1 48  ? 1.500   12.399  51.876  1.00 53.04  ? 70   LEU A CD2 1 
ATOM   280   N N   . SER A 1 49  ? 2.552   8.041   48.703  1.00 56.27  ? 71   SER A N   1 
ATOM   281   C CA  . SER A 1 49  ? 3.565   7.071   48.316  1.00 57.83  ? 71   SER A CA  1 
ATOM   282   C C   . SER A 1 49  ? 4.927   7.711   48.043  1.00 61.54  ? 71   SER A C   1 
ATOM   283   O O   . SER A 1 49  ? 5.005   8.867   47.635  1.00 62.89  ? 71   SER A O   1 
ATOM   284   C CB  . SER A 1 49  ? 3.122   6.321   47.066  1.00 56.34  ? 71   SER A CB  1 
ATOM   285   O OG  . SER A 1 49  ? 3.535   7.010   45.900  1.00 55.82  ? 71   SER A OG  1 
ATOM   286   N N   . ASP A 1 50  ? 5.991   6.958   48.310  1.00 63.10  ? 72   ASP A N   1 
ATOM   287   C CA  . ASP A 1 50  ? 7.358   7.366   47.963  1.00 65.64  ? 72   ASP A CA  1 
ATOM   288   C C   . ASP A 1 50  ? 7.832   8.658   48.627  1.00 67.65  ? 72   ASP A C   1 
ATOM   289   O O   . ASP A 1 50  ? 8.484   9.488   47.991  1.00 68.38  ? 72   ASP A O   1 
ATOM   290   C CB  . ASP A 1 50  ? 7.530   7.458   46.447  1.00 65.20  ? 72   ASP A CB  1 
ATOM   291   C CG  . ASP A 1 50  ? 7.876   6.129   45.828  1.00 67.03  ? 72   ASP A CG  1 
ATOM   292   O OD1 . ASP A 1 50  ? 9.018   5.673   46.043  1.00 70.31  ? 72   ASP A OD1 1 
ATOM   293   O OD2 . ASP A 1 50  ? 7.020   5.547   45.126  1.00 65.92  ? 72   ASP A OD2 1 
ATOM   294   N N   . ASN A 1 51  ? 7.499   8.817   49.904  1.00 67.86  ? 73   ASN A N   1 
ATOM   295   C CA  . ASN A 1 51  ? 7.987   9.933   50.704  1.00 69.82  ? 73   ASN A CA  1 
ATOM   296   C C   . ASN A 1 51  ? 8.884   9.439   51.839  1.00 69.59  ? 73   ASN A C   1 
ATOM   297   O O   . ASN A 1 51  ? 9.221   8.258   51.905  1.00 69.87  ? 73   ASN A O   1 
ATOM   298   C CB  . ASN A 1 51  ? 6.819   10.754  51.252  1.00 74.43  ? 73   ASN A CB  1 
ATOM   299   C CG  . ASN A 1 51  ? 6.098   11.540  50.166  1.00 75.67  ? 73   ASN A CG  1 
ATOM   300   O OD1 . ASN A 1 51  ? 6.554   12.604  49.750  1.00 76.55  ? 73   ASN A OD1 1 
ATOM   301   N ND2 . ASN A 1 51  ? 4.969   11.019  49.706  1.00 74.87  ? 73   ASN A ND2 1 
ATOM   302   N N   . PHE A 1 52  ? 9.300   10.349  52.709  1.00 69.61  ? 74   PHE A N   1 
ATOM   303   C CA  . PHE A 1 52  ? 10.196  10.003  53.811  1.00 66.82  ? 74   PHE A CA  1 
ATOM   304   C C   . PHE A 1 52  ? 9.532   9.776   55.169  1.00 67.31  ? 74   PHE A C   1 
ATOM   305   O O   . PHE A 1 52  ? 10.219  9.671   56.181  1.00 67.76  ? 74   PHE A O   1 
ATOM   306   C CB  . PHE A 1 52  ? 11.375  10.974  53.877  1.00 66.09  ? 74   PHE A CB  1 
ATOM   307   C CG  . PHE A 1 52  ? 12.310  10.838  52.711  1.00 66.30  ? 74   PHE A CG  1 
ATOM   308   C CD1 . PHE A 1 52  ? 12.749  9.587   52.317  1.00 65.10  ? 74   PHE A CD1 1 
ATOM   309   C CD2 . PHE A 1 52  ? 12.717  11.944  51.985  1.00 67.72  ? 74   PHE A CD2 1 
ATOM   310   C CE1 . PHE A 1 52  ? 13.598  9.441   51.238  1.00 64.22  ? 74   PHE A CE1 1 
ATOM   311   C CE2 . PHE A 1 52  ? 13.568  11.803  50.901  1.00 65.72  ? 74   PHE A CE2 1 
ATOM   312   C CZ  . PHE A 1 52  ? 14.006  10.551  50.528  1.00 64.15  ? 74   PHE A CZ  1 
ATOM   313   N N   . ILE A 1 53  ? 8.203   9.748   55.196  1.00 67.66  ? 75   ILE A N   1 
ATOM   314   C CA  . ILE A 1 53  ? 7.473   9.644   56.460  1.00 71.16  ? 75   ILE A CA  1 
ATOM   315   C C   . ILE A 1 53  ? 7.718   8.314   57.195  1.00 71.46  ? 75   ILE A C   1 
ATOM   316   O O   . ILE A 1 53  ? 7.536   7.229   56.638  1.00 70.17  ? 75   ILE A O   1 
ATOM   317   C CB  . ILE A 1 53  ? 5.954   9.923   56.252  1.00 68.11  ? 75   ILE A CB  1 
ATOM   318   C CG1 . ILE A 1 53  ? 5.083   8.974   57.077  1.00 65.06  ? 75   ILE A CG1 1 
ATOM   319   C CG2 . ILE A 1 53  ? 5.595   9.832   54.785  1.00 69.34  ? 75   ILE A CG2 1 
ATOM   320   C CD1 . ILE A 1 53  ? 4.675   9.538   58.405  1.00 67.83  ? 75   ILE A CD1 1 
ATOM   321   N N   . THR A 1 54  ? 8.199   8.425   58.432  1.00 71.73  ? 76   THR A N   1 
ATOM   322   C CA  . THR A 1 54  ? 8.442   7.277   59.302  1.00 71.60  ? 76   THR A CA  1 
ATOM   323   C C   . THR A 1 54  ? 7.260   6.787   60.151  1.00 72.98  ? 76   THR A C   1 
ATOM   324   O O   . THR A 1 54  ? 7.055   5.584   60.300  1.00 73.27  ? 76   THR A O   1 
ATOM   325   C CB  . THR A 1 54  ? 9.662   7.515   60.211  1.00 72.83  ? 76   THR A CB  1 
ATOM   326   O OG1 . THR A 1 54  ? 9.431   8.666   61.031  1.00 75.46  ? 76   THR A OG1 1 
ATOM   327   C CG2 . THR A 1 54  ? 10.912  7.731   59.369  1.00 71.48  ? 76   THR A CG2 1 
ATOM   328   N N   . HIS A 1 55  ? 6.501   7.722   60.720  1.00 75.46  ? 77   HIS A N   1 
ATOM   329   C CA  . HIS A 1 55  ? 5.552   7.395   61.789  1.00 76.91  ? 77   HIS A CA  1 
ATOM   330   C C   . HIS A 1 55  ? 4.090   7.769   61.542  1.00 74.52  ? 77   HIS A C   1 
ATOM   331   O O   . HIS A 1 55  ? 3.764   8.926   61.287  1.00 75.01  ? 77   HIS A O   1 
ATOM   332   C CB  . HIS A 1 55  ? 5.999   8.046   63.100  1.00 82.01  ? 77   HIS A CB  1 
ATOM   333   C CG  . HIS A 1 55  ? 7.218   7.422   63.700  1.00 85.88  ? 77   HIS A CG  1 
ATOM   334   N ND1 . HIS A 1 55  ? 8.492   7.689   63.246  1.00 87.30  ? 77   HIS A ND1 1 
ATOM   335   C CD2 . HIS A 1 55  ? 7.358   6.546   64.723  1.00 88.66  ? 77   HIS A CD2 1 
ATOM   336   C CE1 . HIS A 1 55  ? 9.365   7.002   63.962  1.00 89.11  ? 77   HIS A CE1 1 
ATOM   337   N NE2 . HIS A 1 55  ? 8.702   6.301   64.865  1.00 90.61  ? 77   HIS A NE2 1 
ATOM   338   N N   . ILE A 1 56  ? 3.210   6.782   61.663  1.00 72.00  ? 78   ILE A N   1 
ATOM   339   C CA  . ILE A 1 56  ? 1.779   7.022   61.581  1.00 70.23  ? 78   ILE A CA  1 
ATOM   340   C C   . ILE A 1 56  ? 1.112   6.791   62.936  1.00 69.70  ? 78   ILE A C   1 
ATOM   341   O O   . ILE A 1 56  ? 1.222   5.718   63.528  1.00 69.41  ? 78   ILE A O   1 
ATOM   342   C CB  . ILE A 1 56  ? 1.106   6.133   60.522  1.00 67.30  ? 78   ILE A CB  1 
ATOM   343   C CG1 . ILE A 1 56  ? 1.698   6.409   59.140  1.00 67.04  ? 78   ILE A CG1 1 
ATOM   344   C CG2 . ILE A 1 56  ? -0.389  6.389   60.497  1.00 65.61  ? 78   ILE A CG2 1 
ATOM   345   C CD1 . ILE A 1 56  ? 1.384   7.795   58.616  1.00 69.01  ? 78   ILE A CD1 1 
ATOM   346   N N   . THR A 1 57  ? 0.405   7.809   63.408  1.00 69.63  ? 79   THR A N   1 
ATOM   347   C CA  . THR A 1 57  ? -0.262  7.769   64.702  1.00 71.50  ? 79   THR A CA  1 
ATOM   348   C C   . THR A 1 57  ? -1.711  8.214   64.531  1.00 73.42  ? 79   THR A C   1 
ATOM   349   O O   . THR A 1 57  ? -2.094  8.680   63.461  1.00 72.22  ? 79   THR A O   1 
ATOM   350   C CB  . THR A 1 57  ? 0.449   8.670   65.733  1.00 71.94  ? 79   THR A CB  1 
ATOM   351   O OG1 . THR A 1 57  ? -0.456  8.992   66.795  1.00 75.15  ? 79   THR A OG1 1 
ATOM   352   C CG2 . THR A 1 57  ? 0.921   9.956   65.079  1.00 70.30  ? 79   THR A CG2 1 
ATOM   353   N N   . ASN A 1 58  ? -2.525  8.044   65.568  1.00 78.22  ? 80   ASN A N   1 
ATOM   354   C CA  . ASN A 1 58  ? -3.939  8.404   65.470  1.00 80.82  ? 80   ASN A CA  1 
ATOM   355   C C   . ASN A 1 58  ? -4.200  9.884   65.152  1.00 83.24  ? 80   ASN A C   1 
ATOM   356   O O   . ASN A 1 58  ? -5.297  10.240  64.727  1.00 86.44  ? 80   ASN A O   1 
ATOM   357   C CB  . ASN A 1 58  ? -4.725  7.943   66.708  1.00 82.86  ? 80   ASN A CB  1 
ATOM   358   C CG  . ASN A 1 58  ? -4.313  8.669   67.980  1.00 85.16  ? 80   ASN A CG  1 
ATOM   359   O OD1 . ASN A 1 58  ? -3.280  9.337   68.022  1.00 87.56  ? 80   ASN A OD1 1 
ATOM   360   N ND2 . ASN A 1 58  ? -5.121  8.529   69.031  1.00 82.95  ? 80   ASN A ND2 1 
ATOM   361   N N   . GLU A 1 59  ? -3.193  10.735  65.351  1.00 82.36  ? 81   GLU A N   1 
ATOM   362   C CA  . GLU A 1 59  ? -3.313  12.162  65.035  1.00 83.07  ? 81   GLU A CA  1 
ATOM   363   C C   . GLU A 1 59  ? -2.752  12.524  63.658  1.00 80.42  ? 81   GLU A C   1 
ATOM   364   O O   . GLU A 1 59  ? -2.785  13.688  63.252  1.00 80.17  ? 81   GLU A O   1 
ATOM   365   C CB  . GLU A 1 59  ? -2.630  13.021  66.103  1.00 85.64  ? 81   GLU A CB  1 
ATOM   366   C CG  . GLU A 1 59  ? -3.267  12.949  67.471  1.00 90.33  ? 81   GLU A CG  1 
ATOM   367   C CD  . GLU A 1 59  ? -2.639  13.922  68.443  1.00 94.17  ? 81   GLU A CD  1 
ATOM   368   O OE1 . GLU A 1 59  ? -2.849  13.767  69.662  1.00 95.14  ? 81   GLU A OE1 1 
ATOM   369   O OE2 . GLU A 1 59  ? -1.935  14.845  67.982  1.00 96.49  ? 81   GLU A OE2 1 
ATOM   370   N N   . SER A 1 60  ? -2.232  11.529  62.948  1.00 78.18  ? 82   SER A N   1 
ATOM   371   C CA  . SER A 1 60  ? -1.623  11.766  61.643  1.00 76.85  ? 82   SER A CA  1 
ATOM   372   C C   . SER A 1 60  ? -2.635  12.346  60.660  1.00 77.70  ? 82   SER A C   1 
ATOM   373   O O   . SER A 1 60  ? -2.433  13.425  60.100  1.00 78.80  ? 82   SER A O   1 
ATOM   374   C CB  . SER A 1 60  ? -1.039  10.466  61.078  1.00 73.05  ? 82   SER A CB  1 
ATOM   375   O OG  . SER A 1 60  ? -0.133  9.866   61.991  1.00 71.50  ? 82   SER A OG  1 
ATOM   376   N N   . PHE A 1 61  ? -3.723  11.614  60.460  1.00 76.71  ? 83   PHE A N   1 
ATOM   377   C CA  . PHE A 1 61  ? -4.749  11.994  59.504  1.00 78.03  ? 83   PHE A CA  1 
ATOM   378   C C   . PHE A 1 61  ? -5.933  12.733  60.127  1.00 83.82  ? 83   PHE A C   1 
ATOM   379   O O   . PHE A 1 61  ? -6.922  12.996  59.449  1.00 85.78  ? 83   PHE A O   1 
ATOM   380   C CB  . PHE A 1 61  ? -5.212  10.771  58.717  1.00 74.63  ? 83   PHE A CB  1 
ATOM   381   C CG  . PHE A 1 61  ? -4.138  10.171  57.860  1.00 72.30  ? 83   PHE A CG  1 
ATOM   382   C CD1 . PHE A 1 61  ? -3.794  10.757  56.652  1.00 69.65  ? 83   PHE A CD1 1 
ATOM   383   C CD2 . PHE A 1 61  ? -3.466  9.029   58.261  1.00 71.37  ? 83   PHE A CD2 1 
ATOM   384   C CE1 . PHE A 1 61  ? -2.809  10.213  55.860  1.00 67.54  ? 83   PHE A CE1 1 
ATOM   385   C CE2 . PHE A 1 61  ? -2.475  8.481   57.468  1.00 69.67  ? 83   PHE A CE2 1 
ATOM   386   C CZ  . PHE A 1 61  ? -2.148  9.075   56.265  1.00 68.49  ? 83   PHE A CZ  1 
ATOM   387   N N   . GLN A 1 62  ? -5.822  13.058  61.413  1.00 88.39  ? 84   GLN A N   1 
ATOM   388   C CA  . GLN A 1 62  ? -6.936  13.596  62.205  1.00 92.75  ? 84   GLN A CA  1 
ATOM   389   C C   . GLN A 1 62  ? -7.745  14.710  61.542  1.00 93.97  ? 84   GLN A C   1 
ATOM   390   O O   . GLN A 1 62  ? -8.979  14.696  61.579  1.00 96.12  ? 84   GLN A O   1 
ATOM   391   C CB  . GLN A 1 62  ? -6.428  14.115  63.549  1.00 95.37  ? 84   GLN A CB  1 
ATOM   392   C CG  . GLN A 1 62  ? -7.501  14.838  64.356  1.00 97.14  ? 84   GLN A CG  1 
ATOM   393   C CD  . GLN A 1 62  ? -6.929  15.720  65.446  1.00 97.98  ? 84   GLN A CD  1 
ATOM   394   O OE1 . GLN A 1 62  ? -5.714  15.871  65.567  1.00 97.57  ? 84   GLN A OE1 1 
ATOM   395   N NE2 . GLN A 1 62  ? -7.807  16.310  66.246  1.00 99.27  ? 84   GLN A NE2 1 
ATOM   396   N N   . GLY A 1 63  ? -7.053  15.671  60.940  1.00 92.47  ? 85   GLY A N   1 
ATOM   397   C CA  . GLY A 1 63  ? -7.717  16.786  60.290  1.00 92.45  ? 85   GLY A CA  1 
ATOM   398   C C   . GLY A 1 63  ? -8.505  16.382  59.058  1.00 91.06  ? 85   GLY A C   1 
ATOM   399   O O   . GLY A 1 63  ? -9.276  17.178  58.523  1.00 91.13  ? 85   GLY A O   1 
ATOM   400   N N   . LEU A 1 64  ? -8.306  15.148  58.598  1.00 89.08  ? 86   LEU A N   1 
ATOM   401   C CA  . LEU A 1 64  ? -8.997  14.668  57.410  1.00 86.29  ? 86   LEU A CA  1 
ATOM   402   C C   . LEU A 1 64  ? -9.953  13.526  57.734  1.00 85.87  ? 86   LEU A C   1 
ATOM   403   O O   . LEU A 1 64  ? -9.532  12.378  57.863  1.00 87.15  ? 86   LEU A O   1 
ATOM   404   C CB  . LEU A 1 64  ? -7.945  14.157  56.433  1.00 81.04  ? 86   LEU A CB  1 
ATOM   405   C CG  . LEU A 1 64  ? -6.616  14.893  56.609  1.00 79.73  ? 86   LEU A CG  1 
ATOM   406   C CD1 . LEU A 1 64  ? -5.426  13.988  56.346  1.00 77.65  ? 86   LEU A CD1 1 
ATOM   407   C CD2 . LEU A 1 64  ? -6.581  16.108  55.703  1.00 79.55  ? 86   LEU A CD2 1 
ATOM   408   N N   . GLN A 1 65  ? -11.245 13.826  57.803  1.00 83.70  ? 87   GLN A N   1 
ATOM   409   C CA  . GLN A 1 65  ? -12.252 12.783  57.966  1.00 80.55  ? 87   GLN A CA  1 
ATOM   410   C C   . GLN A 1 65  ? -12.849 12.368  56.628  1.00 73.74  ? 87   GLN A C   1 
ATOM   411   O O   . GLN A 1 65  ? -13.533 11.353  56.533  1.00 70.03  ? 87   GLN A O   1 
ATOM   412   C CB  . GLN A 1 65  ? -13.359 13.239  58.925  1.00 85.48  ? 87   GLN A CB  1 
ATOM   413   C CG  . GLN A 1 65  ? -12.946 13.218  60.382  1.00 88.79  ? 87   GLN A CG  1 
ATOM   414   C CD  . GLN A 1 65  ? -12.445 11.853  60.816  1.00 90.80  ? 87   GLN A CD  1 
ATOM   415   O OE1 . GLN A 1 65  ? -11.290 11.702  61.217  1.00 91.90  ? 87   GLN A OE1 1 
ATOM   416   N NE2 . GLN A 1 65  ? -13.314 10.850  60.736  1.00 90.36  ? 87   GLN A NE2 1 
ATOM   417   N N   . ASN A 1 66  ? -12.561 13.152  55.594  1.00 73.61  ? 88   ASN A N   1 
ATOM   418   C CA  . ASN A 1 66  ? -13.168 12.960  54.286  1.00 75.56  ? 88   ASN A CA  1 
ATOM   419   C C   . ASN A 1 66  ? -12.422 11.900  53.511  1.00 74.78  ? 88   ASN A C   1 
ATOM   420   O O   . ASN A 1 66  ? -12.826 11.520  52.413  1.00 75.78  ? 88   ASN A O   1 
ATOM   421   C CB  . ASN A 1 66  ? -13.159 14.269  53.489  1.00 80.00  ? 88   ASN A CB  1 
ATOM   422   C CG  . ASN A 1 66  ? -13.948 15.378  54.166  1.00 87.66  ? 88   ASN A CG  1 
ATOM   423   O OD1 . ASN A 1 66  ? -14.299 15.284  55.342  1.00 88.80  ? 88   ASN A OD1 1 
ATOM   424   N ND2 . ASN A 1 66  ? -14.227 16.441  53.420  1.00 91.89  ? 88   ASN A ND2 1 
ATOM   425   N N   . LEU A 1 67  ? -11.325 11.420  54.084  1.00 72.99  ? 89   LEU A N   1 
ATOM   426   C CA  . LEU A 1 67  ? -10.468 10.506  53.355  1.00 71.51  ? 89   LEU A CA  1 
ATOM   427   C C   . LEU A 1 67  ? -11.142 9.164   53.131  1.00 70.58  ? 89   LEU A C   1 
ATOM   428   O O   . LEU A 1 67  ? -11.709 8.571   54.045  1.00 70.23  ? 89   LEU A O   1 
ATOM   429   C CB  . LEU A 1 67  ? -9.113  10.339  54.044  1.00 69.88  ? 89   LEU A CB  1 
ATOM   430   C CG  . LEU A 1 67  ? -8.175  11.539  53.913  1.00 69.02  ? 89   LEU A CG  1 
ATOM   431   C CD1 . LEU A 1 67  ? -6.820  11.205  54.499  1.00 67.01  ? 89   LEU A CD1 1 
ATOM   432   C CD2 . LEU A 1 67  ? -8.034  11.963  52.457  1.00 69.30  ? 89   LEU A CD2 1 
ATOM   433   N N   . THR A 1 68  ? -11.087 8.719   51.885  1.00 69.64  ? 90   THR A N   1 
ATOM   434   C CA  . THR A 1 68  ? -11.604 7.427   51.470  1.00 68.05  ? 90   THR A CA  1 
ATOM   435   C C   . THR A 1 68  ? -10.436 6.514   51.143  1.00 66.50  ? 90   THR A C   1 
ATOM   436   O O   . THR A 1 68  ? -10.360 5.394   51.638  1.00 68.00  ? 90   THR A O   1 
ATOM   437   C CB  . THR A 1 68  ? -12.564 7.530   50.277  1.00 67.13  ? 90   THR A CB  1 
ATOM   438   O OG1 . THR A 1 68  ? -12.027 8.435   49.307  1.00 66.97  ? 90   THR A OG1 1 
ATOM   439   C CG2 . THR A 1 68  ? -13.928 8.036   50.741  1.00 65.63  ? 90   THR A CG2 1 
ATOM   440   N N   . LYS A 1 69  ? -9.584  6.973   50.232  1.00 64.82  ? 91   LYS A N   1 
ATOM   441   C CA  . LYS A 1 69  ? -8.414  6.221   49.790  1.00 64.09  ? 91   LYS A CA  1 
ATOM   442   C C   . LYS A 1 69  ? -7.086  6.885   50.202  1.00 64.06  ? 91   LYS A C   1 
ATOM   443   O O   . LYS A 1 69  ? -6.859  8.063   49.924  1.00 65.98  ? 91   LYS A O   1 
ATOM   444   C CB  . LYS A 1 69  ? -8.494  6.045   48.271  1.00 65.36  ? 91   LYS A CB  1 
ATOM   445   C CG  . LYS A 1 69  ? -7.199  5.680   47.565  1.00 69.29  ? 91   LYS A CG  1 
ATOM   446   C CD  . LYS A 1 69  ? -7.458  5.545   46.068  1.00 70.05  ? 91   LYS A CD  1 
ATOM   447   C CE  . LYS A 1 69  ? -6.239  5.066   45.313  1.00 70.41  ? 91   LYS A CE  1 
ATOM   448   N NZ  . LYS A 1 69  ? -6.584  4.702   43.906  1.00 70.87  ? 91   LYS A NZ  1 
ATOM   449   N N   . ILE A 1 70  ? -6.219  6.122   50.866  1.00 60.65  ? 92   ILE A N   1 
ATOM   450   C CA  . ILE A 1 70  ? -4.897  6.601   51.269  1.00 57.54  ? 92   ILE A CA  1 
ATOM   451   C C   . ILE A 1 70  ? -3.803  5.672   50.753  1.00 56.52  ? 92   ILE A C   1 
ATOM   452   O O   . ILE A 1 70  ? -3.839  4.467   51.009  1.00 53.91  ? 92   ILE A O   1 
ATOM   453   C CB  . ILE A 1 70  ? -4.771  6.686   52.804  1.00 57.45  ? 92   ILE A CB  1 
ATOM   454   C CG1 . ILE A 1 70  ? -5.685  7.782   53.365  1.00 56.58  ? 92   ILE A CG1 1 
ATOM   455   C CG2 . ILE A 1 70  ? -3.325  6.932   53.206  1.00 55.61  ? 92   ILE A CG2 1 
ATOM   456   C CD1 . ILE A 1 70  ? -5.877  7.690   54.871  1.00 59.77  ? 92   ILE A CD1 1 
ATOM   457   N N   . ASN A 1 71  ? -2.826  6.234   50.040  1.00 57.19  ? 93   ASN A N   1 
ATOM   458   C CA  . ASN A 1 71  ? -1.682  5.459   49.564  1.00 55.68  ? 93   ASN A CA  1 
ATOM   459   C C   . ASN A 1 71  ? -0.404  5.857   50.306  1.00 57.86  ? 93   ASN A C   1 
ATOM   460   O O   . ASN A 1 71  ? 0.161   6.923   50.072  1.00 56.09  ? 93   ASN A O   1 
ATOM   461   C CB  . ASN A 1 71  ? -1.510  5.662   48.054  1.00 53.30  ? 93   ASN A CB  1 
ATOM   462   C CG  . ASN A 1 71  ? -0.363  4.864   47.474  1.00 53.98  ? 93   ASN A CG  1 
ATOM   463   O OD1 . ASN A 1 71  ? 0.460   4.307   48.196  1.00 55.00  ? 93   ASN A OD1 1 
ATOM   464   N ND2 . ASN A 1 71  ? -0.293  4.820   46.153  1.00 51.90  ? 93   ASN A ND2 1 
ATOM   465   N N   . LEU A 1 72  ? 0.035   4.979   51.201  1.00 60.23  ? 94   LEU A N   1 
ATOM   466   C CA  . LEU A 1 72  ? 1.296   5.118   51.929  1.00 59.05  ? 94   LEU A CA  1 
ATOM   467   C C   . LEU A 1 72  ? 2.453   4.305   51.347  1.00 59.32  ? 94   LEU A C   1 
ATOM   468   O O   . LEU A 1 72  ? 3.477   4.142   52.008  1.00 61.74  ? 94   LEU A O   1 
ATOM   469   C CB  . LEU A 1 72  ? 1.116   4.873   53.432  1.00 58.70  ? 94   LEU A CB  1 
ATOM   470   C CG  . LEU A 1 72  ? 0.523   6.086   54.154  1.00 59.85  ? 94   LEU A CG  1 
ATOM   471   C CD1 . LEU A 1 72  ? 0.145   5.781   55.591  1.00 61.47  ? 94   LEU A CD1 1 
ATOM   472   C CD2 . LEU A 1 72  ? 1.502   7.249   54.093  1.00 60.66  ? 94   LEU A CD2 1 
ATOM   473   N N   . ASN A 1 73  ? 2.267   3.752   50.150  1.00 58.67  ? 95   ASN A N   1 
ATOM   474   C CA  . ASN A 1 73  ? 3.254   2.843   49.569  1.00 57.73  ? 95   ASN A CA  1 
ATOM   475   C C   . ASN A 1 73  ? 4.684   3.367   49.644  1.00 61.23  ? 95   ASN A C   1 
ATOM   476   O O   . ASN A 1 73  ? 4.946   4.536   49.396  1.00 61.32  ? 95   ASN A O   1 
ATOM   477   C CB  . ASN A 1 73  ? 2.938   2.534   48.101  1.00 53.94  ? 95   ASN A CB  1 
ATOM   478   C CG  . ASN A 1 73  ? 1.735   1.616   47.926  1.00 50.61  ? 95   ASN A CG  1 
ATOM   479   O OD1 . ASN A 1 73  ? 1.213   1.037   48.893  1.00 47.22  ? 95   ASN A OD1 1 
ATOM   480   N ND2 . ASN A 1 73  ? 1.296   1.471   46.673  1.00 43.84  ? 95   ASN A ND2 1 
ATOM   481   N N   . HIS A 1 74  ? 5.595   2.470   50.009  1.00 65.54  ? 96   HIS A N   1 
ATOM   482   C CA  . HIS A 1 74  ? 7.025   2.749   50.092  1.00 67.51  ? 96   HIS A CA  1 
ATOM   483   C C   . HIS A 1 74  ? 7.383   3.963   50.952  1.00 70.79  ? 96   HIS A C   1 
ATOM   484   O O   . HIS A 1 74  ? 7.929   4.950   50.450  1.00 72.15  ? 96   HIS A O   1 
ATOM   485   C CB  . HIS A 1 74  ? 7.630   2.891   48.694  1.00 68.33  ? 96   HIS A CB  1 
ATOM   486   C CG  . HIS A 1 74  ? 9.110   2.634   48.645  1.00 71.66  ? 96   HIS A CG  1 
ATOM   487   N ND1 . HIS A 1 74  ? 9.867   2.848   47.525  1.00 72.17  ? 96   HIS A ND1 1 
ATOM   488   C CD2 . HIS A 1 74  ? 9.952   2.164   49.601  1.00 71.96  ? 96   HIS A CD2 1 
ATOM   489   C CE1 . HIS A 1 74  ? 11.135  2.541   47.788  1.00 70.39  ? 96   HIS A CE1 1 
ATOM   490   N NE2 . HIS A 1 74  ? 11.203  2.116   49.030  1.00 70.07  ? 96   HIS A NE2 1 
ATOM   491   N N   . ASN A 1 75  ? 7.089   3.888   52.247  1.00 70.36  ? 97   ASN A N   1 
ATOM   492   C CA  . ASN A 1 75  ? 7.621   4.883   53.164  1.00 72.33  ? 97   ASN A CA  1 
ATOM   493   C C   . ASN A 1 75  ? 8.399   4.242   54.299  1.00 75.39  ? 97   ASN A C   1 
ATOM   494   O O   . ASN A 1 75  ? 7.940   3.274   54.901  1.00 76.66  ? 97   ASN A O   1 
ATOM   495   C CB  . ASN A 1 75  ? 6.488   5.722   53.749  1.00 72.99  ? 97   ASN A CB  1 
ATOM   496   C CG  . ASN A 1 75  ? 6.015   6.801   52.806  1.00 71.86  ? 97   ASN A CG  1 
ATOM   497   O OD1 . ASN A 1 75  ? 6.755   7.721   52.496  1.00 74.43  ? 97   ASN A OD1 1 
ATOM   498   N ND2 . ASN A 1 75  ? 4.770   6.705   52.361  1.00 67.94  ? 97   ASN A ND2 1 
ATOM   499   N N   . PRO A 1 76  ? 9.574   4.801   54.622  1.00 77.41  ? 98   PRO A N   1 
ATOM   500   C CA  . PRO A 1 76  ? 10.303  5.822   53.863  1.00 78.29  ? 98   PRO A CA  1 
ATOM   501   C C   . PRO A 1 76  ? 10.947  5.213   52.623  1.00 78.09  ? 98   PRO A C   1 
ATOM   502   O O   . PRO A 1 76  ? 11.002  3.988   52.514  1.00 77.68  ? 98   PRO A O   1 
ATOM   503   C CB  . PRO A 1 76  ? 11.383  6.272   54.845  1.00 79.41  ? 98   PRO A CB  1 
ATOM   504   C CG  . PRO A 1 76  ? 11.638  5.076   55.679  1.00 79.15  ? 98   PRO A CG  1 
ATOM   505   C CD  . PRO A 1 76  ? 10.315  4.380   55.823  1.00 78.58  ? 98   PRO A CD  1 
ATOM   506   N N   . ASN A 1 77  ? 11.407  6.051   51.700  1.00 80.72  ? 99   ASN A N   1 
ATOM   507   C CA  . ASN A 1 77  ? 12.086  5.575   50.500  1.00 83.00  ? 99   ASN A CA  1 
ATOM   508   C C   . ASN A 1 77  ? 13.503  5.101   50.859  1.00 83.44  ? 99   ASN A C   1 
ATOM   509   O O   . ASN A 1 77  ? 14.302  5.869   51.391  1.00 85.83  ? 99   ASN A O   1 
ATOM   510   C CB  . ASN A 1 77  ? 12.108  6.714   49.471  1.00 85.63  ? 99   ASN A CB  1 
ATOM   511   C CG  . ASN A 1 77  ? 12.719  6.313   48.148  1.00 87.68  ? 99   ASN A CG  1 
ATOM   512   O OD1 . ASN A 1 77  ? 12.153  5.496   47.410  1.00 88.82  ? 99   ASN A OD1 1 
ATOM   513   N ND2 . ASN A 1 77  ? 13.868  6.920   47.814  1.00 88.11  ? 99   ASN A ND2 1 
ATOM   514   N N   . VAL A 1 78  ? 13.803  3.832   50.585  1.00 82.34  ? 100  VAL A N   1 
ATOM   515   C CA  . VAL A 1 78  ? 15.092  3.245   50.957  1.00 83.63  ? 100  VAL A CA  1 
ATOM   516   C C   . VAL A 1 78  ? 15.342  1.910   50.255  1.00 84.17  ? 100  VAL A C   1 
ATOM   517   O O   . VAL A 1 78  ? 16.285  1.188   50.589  1.00 85.25  ? 100  VAL A O   1 
ATOM   518   C CB  . VAL A 1 78  ? 15.207  3.029   52.485  1.00 84.46  ? 100  VAL A CB  1 
ATOM   519   N N   . GLY A 1 91  ? 11.991  1.516   58.477  1.00 64.75  ? 113  GLY A N   1 
ATOM   520   C CA  . GLY A 1 91  ? 10.677  0.923   58.306  1.00 64.43  ? 113  GLY A CA  1 
ATOM   521   C C   . GLY A 1 91  ? 9.575   1.899   58.673  1.00 66.44  ? 113  GLY A C   1 
ATOM   522   O O   . GLY A 1 91  ? 9.844   3.006   59.131  1.00 69.50  ? 113  GLY A O   1 
ATOM   523   N N   . LEU A 1 92  ? 8.329   1.490   58.474  1.00 65.57  ? 114  LEU A N   1 
ATOM   524   C CA  . LEU A 1 92  ? 7.192   2.349   58.774  1.00 64.06  ? 114  LEU A CA  1 
ATOM   525   C C   . LEU A 1 92  ? 6.550   1.926   60.085  1.00 63.23  ? 114  LEU A C   1 
ATOM   526   O O   . LEU A 1 92  ? 6.102   0.792   60.218  1.00 63.16  ? 114  LEU A O   1 
ATOM   527   C CB  . LEU A 1 92  ? 6.171   2.286   57.633  1.00 62.08  ? 114  LEU A CB  1 
ATOM   528   C CG  . LEU A 1 92  ? 5.029   3.304   57.643  1.00 61.32  ? 114  LEU A CG  1 
ATOM   529   C CD1 . LEU A 1 92  ? 5.566   4.716   57.517  1.00 61.89  ? 114  LEU A CD1 1 
ATOM   530   C CD2 . LEU A 1 92  ? 4.032   3.014   56.535  1.00 58.35  ? 114  LEU A CD2 1 
ATOM   531   N N   . ASN A 1 93  ? 6.513   2.830   61.059  1.00 63.31  ? 115  ASN A N   1 
ATOM   532   C CA  . ASN A 1 93  ? 5.893   2.517   62.340  1.00 65.95  ? 115  ASN A CA  1 
ATOM   533   C C   . ASN A 1 93  ? 4.447   3.006   62.435  1.00 67.23  ? 115  ASN A C   1 
ATOM   534   O O   . ASN A 1 93  ? 4.184   4.207   62.382  1.00 69.07  ? 115  ASN A O   1 
ATOM   535   C CB  . ASN A 1 93  ? 6.715   3.081   63.502  1.00 68.90  ? 115  ASN A CB  1 
ATOM   536   C CG  . ASN A 1 93  ? 6.281   2.522   64.840  1.00 74.87  ? 115  ASN A CG  1 
ATOM   537   O OD1 . ASN A 1 93  ? 5.276   2.948   65.413  1.00 78.05  ? 115  ASN A OD1 1 
ATOM   538   N ND2 . ASN A 1 93  ? 7.034   1.555   65.345  1.00 77.54  ? 115  ASN A ND2 1 
ATOM   539   N N   . ILE A 1 94  ? 3.519   2.065   62.587  1.00 64.18  ? 116  ILE A N   1 
ATOM   540   C CA  . ILE A 1 94  ? 2.099   2.383   62.683  1.00 61.14  ? 116  ILE A CA  1 
ATOM   541   C C   . ILE A 1 94  ? 1.524   1.946   64.027  1.00 61.72  ? 116  ILE A C   1 
ATOM   542   O O   . ILE A 1 94  ? 1.459   0.753   64.326  1.00 61.41  ? 116  ILE A O   1 
ATOM   543   C CB  . ILE A 1 94  ? 1.293   1.698   61.561  1.00 57.33  ? 116  ILE A CB  1 
ATOM   544   C CG1 . ILE A 1 94  ? 1.721   2.225   60.196  1.00 56.87  ? 116  ILE A CG1 1 
ATOM   545   C CG2 . ILE A 1 94  ? -0.195  1.920   61.767  1.00 57.64  ? 116  ILE A CG2 1 
ATOM   546   C CD1 . ILE A 1 94  ? 1.176   1.419   59.027  1.00 55.89  ? 116  ILE A CD1 1 
ATOM   547   N N   . THR A 1 95  ? 1.098   2.916   64.827  1.00 62.08  ? 117  THR A N   1 
ATOM   548   C CA  . THR A 1 95  ? 0.552   2.636   66.144  1.00 65.81  ? 117  THR A CA  1 
ATOM   549   C C   . THR A 1 95  ? -0.754  1.858   66.043  1.00 65.84  ? 117  THR A C   1 
ATOM   550   O O   . THR A 1 95  ? -1.439  1.906   65.021  1.00 61.94  ? 117  THR A O   1 
ATOM   551   C CB  . THR A 1 95  ? 0.274   3.937   66.919  1.00 67.27  ? 117  THR A CB  1 
ATOM   552   O OG1 . THR A 1 95  ? -0.703  4.708   66.211  1.00 67.57  ? 117  THR A OG1 1 
ATOM   553   C CG2 . THR A 1 95  ? 1.548   4.755   67.065  1.00 67.37  ? 117  THR A CG2 1 
ATOM   554   N N   . ASP A 1 96  ? -1.090  1.140   67.110  1.00 69.24  ? 118  ASP A N   1 
ATOM   555   C CA  . ASP A 1 96  ? -2.364  0.438   67.186  1.00 72.57  ? 118  ASP A CA  1 
ATOM   556   C C   . ASP A 1 96  ? -3.522  1.404   67.051  1.00 70.39  ? 118  ASP A C   1 
ATOM   557   O O   . ASP A 1 96  ? -3.635  2.363   67.818  1.00 69.93  ? 118  ASP A O   1 
ATOM   558   C CB  . ASP A 1 96  ? -2.499  -0.290  68.522  1.00 79.12  ? 118  ASP A CB  1 
ATOM   559   C CG  . ASP A 1 96  ? -1.785  -1.619  68.534  1.00 82.13  ? 118  ASP A CG  1 
ATOM   560   O OD1 . ASP A 1 96  ? -0.737  -1.742  67.859  1.00 78.23  ? 118  ASP A OD1 1 
ATOM   561   O OD2 . ASP A 1 96  ? -2.280  -2.543  69.217  1.00 86.05  ? 118  ASP A OD2 1 
ATOM   562   N N   . GLY A 1 97  ? -4.392  1.130   66.085  1.00 67.60  ? 119  GLY A N   1 
ATOM   563   C CA  . GLY A 1 97  ? -5.593  1.919   65.893  1.00 66.86  ? 119  GLY A CA  1 
ATOM   564   C C   . GLY A 1 97  ? -5.314  3.315   65.380  1.00 64.61  ? 119  GLY A C   1 
ATOM   565   O O   . GLY A 1 97  ? -6.125  4.217   65.553  1.00 67.55  ? 119  GLY A O   1 
ATOM   566   N N   . ALA A 1 98  ? -4.165  3.491   64.741  1.00 62.17  ? 120  ALA A N   1 
ATOM   567   C CA  . ALA A 1 98  ? -3.813  4.773   64.144  1.00 61.98  ? 120  ALA A CA  1 
ATOM   568   C C   . ALA A 1 98  ? -4.850  5.237   63.111  1.00 61.83  ? 120  ALA A C   1 
ATOM   569   O O   . ALA A 1 98  ? -5.165  6.420   63.036  1.00 56.83  ? 120  ALA A O   1 
ATOM   570   C CB  . ALA A 1 98  ? -2.426  4.700   63.515  1.00 54.59  ? 120  ALA A CB  1 
ATOM   571   N N   . PHE A 1 99  ? -5.377  4.299   62.325  1.00 60.89  ? 121  PHE A N   1 
ATOM   572   C CA  . PHE A 1 99  ? -6.331  4.620   61.266  1.00 61.43  ? 121  PHE A CA  1 
ATOM   573   C C   . PHE A 1 99  ? -7.779  4.489   61.743  1.00 67.79  ? 121  PHE A C   1 
ATOM   574   O O   . PHE A 1 99  ? -8.711  4.708   60.969  1.00 71.07  ? 121  PHE A O   1 
ATOM   575   C CB  . PHE A 1 99  ? -6.127  3.693   60.058  1.00 55.88  ? 121  PHE A CB  1 
ATOM   576   C CG  . PHE A 1 99  ? -4.838  3.915   59.315  1.00 52.44  ? 121  PHE A CG  1 
ATOM   577   C CD1 . PHE A 1 99  ? -4.719  4.955   58.399  1.00 50.87  ? 121  PHE A CD1 1 
ATOM   578   C CD2 . PHE A 1 99  ? -3.759  3.067   59.513  1.00 50.88  ? 121  PHE A CD2 1 
ATOM   579   C CE1 . PHE A 1 99  ? -3.550  5.155   57.711  1.00 59.16  ? 121  PHE A CE1 1 
ATOM   580   C CE2 . PHE A 1 99  ? -2.576  3.259   58.827  1.00 52.60  ? 121  PHE A CE2 1 
ATOM   581   C CZ  . PHE A 1 99  ? -2.469  4.306   57.922  1.00 55.58  ? 121  PHE A CZ  1 
ATOM   582   N N   . LEU A 1 100 ? -7.963  4.137   63.013  1.00 70.18  ? 122  LEU A N   1 
ATOM   583   C CA  . LEU A 1 100 ? -9.284  3.779   63.536  1.00 74.67  ? 122  LEU A CA  1 
ATOM   584   C C   . LEU A 1 100 ? -10.342 4.888   63.453  1.00 82.36  ? 122  LEU A C   1 
ATOM   585   O O   . LEU A 1 100 ? -11.492 4.634   63.081  1.00 85.65  ? 122  LEU A O   1 
ATOM   586   C CB  . LEU A 1 100 ? -9.166  3.263   64.972  1.00 74.34  ? 122  LEU A CB  1 
ATOM   587   C CG  . LEU A 1 100 ? -10.422 2.644   65.581  1.00 72.60  ? 122  LEU A CG  1 
ATOM   588   C CD1 . LEU A 1 100 ? -10.885 1.453   64.750  1.00 70.02  ? 122  LEU A CD1 1 
ATOM   589   C CD2 . LEU A 1 100 ? -10.148 2.227   67.013  1.00 71.72  ? 122  LEU A CD2 1 
ATOM   590   N N   . ASN A 1 101 ? -9.946  6.111   63.794  1.00 84.39  ? 123  ASN A N   1 
ATOM   591   C CA  . ASN A 1 101 ? -10.860 7.253   63.816  1.00 86.10  ? 123  ASN A CA  1 
ATOM   592   C C   . ASN A 1 101 ? -11.412 7.651   62.441  1.00 85.25  ? 123  ASN A C   1 
ATOM   593   O O   . ASN A 1 101 ? -12.252 8.540   62.345  1.00 86.62  ? 123  ASN A O   1 
ATOM   594   C CB  . ASN A 1 101 ? -10.199 8.461   64.490  1.00 88.60  ? 123  ASN A CB  1 
ATOM   595   C CG  . ASN A 1 101 ? -11.212 9.463   65.016  1.00 94.33  ? 123  ASN A CG  1 
ATOM   596   O OD1 . ASN A 1 101 ? -12.304 9.089   65.443  1.00 97.28  ? 123  ASN A OD1 1 
ATOM   597   N ND2 . ASN A 1 101 ? -10.858 10.743  64.983  1.00 96.07  ? 123  ASN A ND2 1 
ATOM   598   N N   . LEU A 1 102 ? -10.932 7.009   61.379  1.00 84.21  ? 124  LEU A N   1 
ATOM   599   C CA  . LEU A 1 102 ? -11.395 7.324   60.030  1.00 83.37  ? 124  LEU A CA  1 
ATOM   600   C C   . LEU A 1 102 ? -12.568 6.424   59.675  1.00 82.73  ? 124  LEU A C   1 
ATOM   601   O O   . LEU A 1 102 ? -12.399 5.228   59.429  1.00 82.81  ? 124  LEU A O   1 
ATOM   602   C CB  . LEU A 1 102 ? -10.270 7.088   59.017  1.00 81.08  ? 124  LEU A CB  1 
ATOM   603   C CG  . LEU A 1 102 ? -9.014  7.952   59.109  1.00 81.68  ? 124  LEU A CG  1 
ATOM   604   C CD1 . LEU A 1 102 ? -7.789  7.112   58.819  1.00 80.53  ? 124  LEU A CD1 1 
ATOM   605   C CD2 . LEU A 1 102 ? -9.094  9.119   58.136  1.00 81.96  ? 124  LEU A CD2 1 
ATOM   606   N N   . LYS A 1 103 ? -13.756 7.011   59.624  1.00 83.00  ? 125  LYS A N   1 
ATOM   607   C CA  . LYS A 1 103 ? -14.971 6.241   59.390  1.00 79.98  ? 125  LYS A CA  1 
ATOM   608   C C   . LYS A 1 103 ? -15.243 5.993   57.913  1.00 75.98  ? 125  LYS A C   1 
ATOM   609   O O   . LYS A 1 103 ? -15.990 5.081   57.562  1.00 75.81  ? 125  LYS A O   1 
ATOM   610   C CB  . LYS A 1 103 ? -16.165 6.927   60.047  1.00 79.48  ? 125  LYS A CB  1 
ATOM   611   C CG  . LYS A 1 103 ? -15.976 7.141   61.534  1.00 80.45  ? 125  LYS A CG  1 
ATOM   612   C CD  . LYS A 1 103 ? -15.530 5.854   62.205  1.00 79.46  ? 125  LYS A CD  1 
ATOM   613   C CE  . LYS A 1 103 ? -15.344 6.044   63.700  1.00 80.64  ? 125  LYS A CE  1 
ATOM   614   N NZ  . LYS A 1 103 ? -16.625 6.359   64.388  1.00 84.40  ? 125  LYS A NZ  1 
ATOM   615   N N   . ASN A 1 104 ? -14.658 6.831   57.060  1.00 71.79  ? 126  ASN A N   1 
ATOM   616   C CA  . ASN A 1 104 ? -14.840 6.729   55.613  1.00 67.15  ? 126  ASN A CA  1 
ATOM   617   C C   . ASN A 1 104 ? -13.719 6.050   54.838  1.00 59.64  ? 126  ASN A C   1 
ATOM   618   O O   . ASN A 1 104 ? -13.755 6.000   53.606  1.00 56.24  ? 126  ASN A O   1 
ATOM   619   C CB  . ASN A 1 104 ? -15.151 8.097   55.011  1.00 69.33  ? 126  ASN A CB  1 
ATOM   620   C CG  . ASN A 1 104 ? -16.502 8.621   55.450  1.00 72.25  ? 126  ASN A CG  1 
ATOM   621   O OD1 . ASN A 1 104 ? -16.607 9.340   56.443  1.00 70.78  ? 126  ASN A OD1 1 
ATOM   622   N ND2 . ASN A 1 104 ? -17.549 8.252   54.715  1.00 74.61  ? 126  ASN A ND2 1 
ATOM   623   N N   . LEU A 1 105 ? -12.711 5.549   55.541  1.00 58.07  ? 127  LEU A N   1 
ATOM   624   C CA  . LEU A 1 105 ? -11.571 4.967   54.841  1.00 56.55  ? 127  LEU A CA  1 
ATOM   625   C C   . LEU A 1 105 ? -11.980 3.661   54.156  1.00 53.24  ? 127  LEU A C   1 
ATOM   626   O O   . LEU A 1 105 ? -12.499 2.742   54.792  1.00 51.60  ? 127  LEU A O   1 
ATOM   627   C CB  . LEU A 1 105 ? -10.399 4.762   55.804  1.00 57.43  ? 127  LEU A CB  1 
ATOM   628   C CG  . LEU A 1 105 ? -9.024  4.410   55.235  1.00 56.51  ? 127  LEU A CG  1 
ATOM   629   C CD1 . LEU A 1 105 ? -8.590  5.406   54.178  1.00 54.37  ? 127  LEU A CD1 1 
ATOM   630   C CD2 . LEU A 1 105 ? -8.023  4.380   56.367  1.00 57.22  ? 127  LEU A CD2 1 
ATOM   631   N N   . ARG A 1 106 ? -11.760 3.593   52.850  1.00 51.59  ? 128  ARG A N   1 
ATOM   632   C CA  . ARG A 1 106 ? -12.119 2.411   52.078  1.00 52.19  ? 128  ARG A CA  1 
ATOM   633   C C   . ARG A 1 106 ? -10.868 1.683   51.641  1.00 56.00  ? 128  ARG A C   1 
ATOM   634   O O   . ARG A 1 106 ? -10.671 0.508   51.950  1.00 56.26  ? 128  ARG A O   1 
ATOM   635   C CB  . ARG A 1 106 ? -12.955 2.786   50.855  1.00 55.06  ? 128  ARG A CB  1 
ATOM   636   C CG  . ARG A 1 106 ? -14.237 3.533   51.180  1.00 61.27  ? 128  ARG A CG  1 
ATOM   637   C CD  . ARG A 1 106 ? -15.268 2.646   51.887  1.00 67.08  ? 128  ARG A CD  1 
ATOM   638   N NE  . ARG A 1 106 ? -16.512 3.381   52.144  1.00 73.36  ? 128  ARG A NE  1 
ATOM   639   C CZ  . ARG A 1 106 ? -17.671 2.819   52.483  1.00 76.74  ? 128  ARG A CZ  1 
ATOM   640   N NH1 . ARG A 1 106 ? -17.768 1.498   52.609  1.00 77.13  ? 128  ARG A NH1 1 
ATOM   641   N NH2 . ARG A 1 106 ? -18.739 3.580   52.691  1.00 79.17  ? 128  ARG A NH2 1 
ATOM   642   N N   . GLU A 1 107 ? -10.046 2.388   50.875  1.00 58.11  ? 129  GLU A N   1 
ATOM   643   C CA  . GLU A 1 107 ? -8.849  1.811   50.303  1.00 62.10  ? 129  GLU A CA  1 
ATOM   644   C C   . GLU A 1 107 ? -7.598  2.298   51.031  1.00 62.30  ? 129  GLU A C   1 
ATOM   645   O O   . GLU A 1 107 ? -7.340  3.498   51.126  1.00 64.39  ? 129  GLU A O   1 
ATOM   646   C CB  . GLU A 1 107 ? -8.768  2.161   48.822  1.00 64.88  ? 129  GLU A CB  1 
ATOM   647   C CG  . GLU A 1 107 ? -7.774  1.322   48.050  1.00 69.90  ? 129  GLU A CG  1 
ATOM   648   C CD  . GLU A 1 107 ? -7.677  1.743   46.599  1.00 72.62  ? 129  GLU A CD  1 
ATOM   649   O OE1 . GLU A 1 107 ? -8.617  2.409   46.105  1.00 76.34  ? 129  GLU A OE1 1 
ATOM   650   O OE2 . GLU A 1 107 ? -6.659  1.415   45.956  1.00 70.53  ? 129  GLU A OE2 1 
ATOM   651   N N   . LEU A 1 108 ? -6.826  1.354   51.550  1.00 57.90  ? 130  LEU A N   1 
ATOM   652   C CA  . LEU A 1 108 ? -5.589  1.681   52.232  1.00 54.78  ? 130  LEU A CA  1 
ATOM   653   C C   . LEU A 1 108 ? -4.457  0.867   51.627  1.00 53.27  ? 130  LEU A C   1 
ATOM   654   O O   . LEU A 1 108 ? -4.411  -0.353  51.771  1.00 53.12  ? 130  LEU A O   1 
ATOM   655   C CB  . LEU A 1 108 ? -5.722  1.374   53.724  1.00 53.11  ? 130  LEU A CB  1 
ATOM   656   C CG  . LEU A 1 108 ? -4.475  1.582   54.578  1.00 51.44  ? 130  LEU A CG  1 
ATOM   657   C CD1 . LEU A 1 108 ? -3.981  3.016   54.448  1.00 48.63  ? 130  LEU A CD1 1 
ATOM   658   C CD2 . LEU A 1 108 ? -4.770  1.238   56.028  1.00 54.39  ? 130  LEU A CD2 1 
ATOM   659   N N   . LEU A 1 109 ? -3.541  1.545   50.950  1.00 54.92  ? 131  LEU A N   1 
ATOM   660   C CA  . LEU A 1 109 ? -2.441  0.856   50.299  1.00 54.32  ? 131  LEU A CA  1 
ATOM   661   C C   . LEU A 1 109 ? -1.150  1.058   51.083  1.00 58.04  ? 131  LEU A C   1 
ATOM   662   O O   . LEU A 1 109 ? -0.557  2.140   51.046  1.00 59.09  ? 131  LEU A O   1 
ATOM   663   C CB  . LEU A 1 109 ? -2.253  1.397   48.881  1.00 51.88  ? 131  LEU A CB  1 
ATOM   664   C CG  . LEU A 1 109 ? -3.434  1.404   47.902  1.00 52.01  ? 131  LEU A CG  1 
ATOM   665   C CD1 . LEU A 1 109 ? -3.017  1.988   46.555  1.00 47.22  ? 131  LEU A CD1 1 
ATOM   666   C CD2 . LEU A 1 109 ? -3.997  0.007   47.713  1.00 52.09  ? 131  LEU A CD2 1 
ATOM   667   N N   . LEU A 1 110 ? -0.712  0.020   51.791  1.00 56.65  ? 132  LEU A N   1 
ATOM   668   C CA  . LEU A 1 110 ? 0.598   0.056   52.423  1.00 54.12  ? 132  LEU A CA  1 
ATOM   669   C C   . LEU A 1 110 ? 1.463   -1.055  51.830  1.00 51.51  ? 132  LEU A C   1 
ATOM   670   O O   . LEU A 1 110 ? 1.382   -2.203  52.261  1.00 53.32  ? 132  LEU A O   1 
ATOM   671   C CB  . LEU A 1 110 ? 0.439   -0.151  53.940  1.00 50.07  ? 132  LEU A CB  1 
ATOM   672   C CG  . LEU A 1 110 ? -0.659  0.632   54.664  1.00 49.67  ? 132  LEU A CG  1 
ATOM   673   C CD1 . LEU A 1 110 ? -1.131  -0.108  55.906  1.00 50.65  ? 132  LEU A CD1 1 
ATOM   674   C CD2 . LEU A 1 110 ? -0.177  2.012   55.055  1.00 51.77  ? 132  LEU A CD2 1 
ATOM   675   N N   . GLU A 1 111 ? 2.351   -0.702  50.910  1.00 49.19  ? 133  GLU A N   1 
ATOM   676   C CA  . GLU A 1 111 ? 3.232   -1.686  50.286  1.00 47.56  ? 133  GLU A CA  1 
ATOM   677   C C   . GLU A 1 111 ? 4.656   -1.244  50.535  1.00 48.91  ? 133  GLU A C   1 
ATOM   678   O O   . GLU A 1 111 ? 4.906   -0.059  50.764  1.00 50.26  ? 133  GLU A O   1 
ATOM   679   C CB  . GLU A 1 111 ? 2.975   -1.804  48.777  1.00 45.27  ? 133  GLU A CB  1 
ATOM   680   C CG  . GLU A 1 111 ? 1.543   -2.183  48.440  1.00 46.67  ? 133  GLU A CG  1 
ATOM   681   C CD  . GLU A 1 111 ? 1.281   -2.379  46.960  1.00 45.76  ? 133  GLU A CD  1 
ATOM   682   O OE1 . GLU A 1 111 ? 2.192   -2.174  46.128  1.00 44.37  ? 133  GLU A OE1 1 
ATOM   683   O OE2 . GLU A 1 111 ? 0.138   -2.742  46.626  1.00 47.67  ? 133  GLU A OE2 1 
ATOM   684   N N   . ASP A 1 112 ? 5.578   -2.201  50.514  1.00 51.00  ? 134  ASP A N   1 
ATOM   685   C CA  . ASP A 1 112 ? 7.003   -1.909  50.608  1.00 51.03  ? 134  ASP A CA  1 
ATOM   686   C C   . ASP A 1 112 ? 7.341   -1.089  51.852  1.00 51.89  ? 134  ASP A C   1 
ATOM   687   O O   . ASP A 1 112 ? 8.209   -0.226  51.811  1.00 54.77  ? 134  ASP A O   1 
ATOM   688   C CB  . ASP A 1 112 ? 7.452   -1.165  49.356  1.00 53.46  ? 134  ASP A CB  1 
ATOM   689   C CG  . ASP A 1 112 ? 8.890   -1.438  49.007  1.00 57.28  ? 134  ASP A CG  1 
ATOM   690   O OD1 . ASP A 1 112 ? 9.485   -2.361  49.611  1.00 56.58  ? 134  ASP A OD1 1 
ATOM   691   O OD2 . ASP A 1 112 ? 9.415   -0.734  48.120  1.00 59.56  ? 134  ASP A OD2 1 
ATOM   692   N N   . ASN A 1 113 ? 6.608   -1.325  52.933  1.00 50.90  ? 135  ASN A N   1 
ATOM   693   C CA  . ASN A 1 113 ? 6.794   -0.586  54.181  1.00 54.62  ? 135  ASN A CA  1 
ATOM   694   C C   . ASN A 1 113 ? 7.591   -1.317  55.266  1.00 55.31  ? 135  ASN A C   1 
ATOM   695   O O   . ASN A 1 113 ? 7.734   -0.816  56.388  1.00 57.41  ? 135  ASN A O   1 
ATOM   696   C CB  . ASN A 1 113 ? 5.444   -0.075  54.695  1.00 58.34  ? 135  ASN A CB  1 
ATOM   697   C CG  . ASN A 1 113 ? 4.825   0.955   53.757  1.00 61.74  ? 135  ASN A CG  1 
ATOM   698   O OD1 . ASN A 1 113 ? 5.525   1.801   53.196  1.00 60.62  ? 135  ASN A OD1 1 
ATOM   699   N ND2 . ASN A 1 113 ? 3.516   0.878   53.570  1.00 64.20  ? 135  ASN A ND2 1 
ATOM   700   N N   . GLN A 1 114 ? 8.077   -2.509  54.932  1.00 53.49  ? 136  GLN A N   1 
ATOM   701   C CA  . GLN A 1 114 ? 8.769   -3.378  55.883  1.00 55.72  ? 136  GLN A CA  1 
ATOM   702   C C   . GLN A 1 114 ? 7.960   -3.657  57.162  1.00 53.04  ? 136  GLN A C   1 
ATOM   703   O O   . GLN A 1 114 ? 8.523   -3.768  58.254  1.00 52.80  ? 136  GLN A O   1 
ATOM   704   C CB  . GLN A 1 114 ? 10.163  -2.833  56.203  1.00 59.61  ? 136  GLN A CB  1 
ATOM   705   C CG  . GLN A 1 114 ? 11.170  -2.986  55.055  1.00 61.57  ? 136  GLN A CG  1 
ATOM   706   C CD  . GLN A 1 114 ? 12.434  -2.192  55.306  1.00 66.86  ? 136  GLN A CD  1 
ATOM   707   O OE1 . GLN A 1 114 ? 12.376  -1.000  55.605  1.00 69.90  ? 136  GLN A OE1 1 
ATOM   708   N NE2 . GLN A 1 114 ? 13.583  -2.846  55.197  1.00 68.53  ? 136  GLN A NE2 1 
ATOM   709   N N   . LEU A 1 115 ? 6.643   -3.794  57.011  1.00 48.86  ? 137  LEU A N   1 
ATOM   710   C CA  . LEU A 1 115 ? 5.771   -4.043  58.150  1.00 50.34  ? 137  LEU A CA  1 
ATOM   711   C C   . LEU A 1 115 ? 5.971   -5.465  58.665  1.00 49.40  ? 137  LEU A C   1 
ATOM   712   O O   . LEU A 1 115 ? 5.886   -6.418  57.891  1.00 48.39  ? 137  LEU A O   1 
ATOM   713   C CB  . LEU A 1 115 ? 4.302   -3.811  57.771  1.00 49.69  ? 137  LEU A CB  1 
ATOM   714   C CG  . LEU A 1 115 ? 3.945   -2.452  57.158  1.00 47.85  ? 137  LEU A CG  1 
ATOM   715   C CD1 . LEU A 1 115 ? 2.627   -2.525  56.409  1.00 47.84  ? 137  LEU A CD1 1 
ATOM   716   C CD2 . LEU A 1 115 ? 3.882   -1.376  58.223  1.00 44.00  ? 137  LEU A CD2 1 
ATOM   717   N N   . PRO A 1 116 ? 6.264   -5.602  59.972  1.00 44.56  ? 138  PRO A N   1 
ATOM   718   C CA  . PRO A 1 116 ? 6.414   -6.861  60.715  1.00 46.01  ? 138  PRO A CA  1 
ATOM   719   C C   . PRO A 1 116 ? 5.082   -7.579  60.964  1.00 49.10  ? 138  PRO A C   1 
ATOM   720   O O   . PRO A 1 116 ? 5.071   -8.796  61.151  1.00 49.05  ? 138  PRO A O   1 
ATOM   721   C CB  . PRO A 1 116 ? 7.020   -6.410  62.050  1.00 47.10  ? 138  PRO A CB  1 
ATOM   722   C CG  . PRO A 1 116 ? 6.514   -5.024  62.231  1.00 44.98  ? 138  PRO A CG  1 
ATOM   723   C CD  . PRO A 1 116 ? 6.448   -4.427  60.841  1.00 43.69  ? 138  PRO A CD  1 
ATOM   724   N N   . GLN A 1 117 ? 3.987   -6.824  61.004  1.00 50.91  ? 139  GLN A N   1 
ATOM   725   C CA  . GLN A 1 117 ? 2.662   -7.376  61.277  1.00 57.41  ? 139  GLN A CA  1 
ATOM   726   C C   . GLN A 1 117 ? 1.596   -6.582  60.527  1.00 55.67  ? 139  GLN A C   1 
ATOM   727   O O   . GLN A 1 117 ? 1.791   -5.411  60.213  1.00 53.22  ? 139  GLN A O   1 
ATOM   728   C CB  . GLN A 1 117 ? 2.324   -7.305  62.777  1.00 61.66  ? 139  GLN A CB  1 
ATOM   729   C CG  . GLN A 1 117 ? 3.438   -7.697  63.750  1.00 68.34  ? 139  GLN A CG  1 
ATOM   730   C CD  . GLN A 1 117 ? 3.552   -9.201  63.969  1.00 72.27  ? 139  GLN A CD  1 
ATOM   731   O OE1 . GLN A 1 117 ? 2.576   -9.939  63.828  1.00 74.20  ? 139  GLN A OE1 1 
ATOM   732   N NE2 . GLN A 1 117 ? 4.751   -9.658  64.319  1.00 71.78  ? 139  GLN A NE2 1 
ATOM   733   N N   . ILE A 1 118 ? 0.464   -7.222  60.257  1.00 57.13  ? 140  ILE A N   1 
ATOM   734   C CA  . ILE A 1 118 ? -0.733  -6.508  59.838  1.00 53.12  ? 140  ILE A CA  1 
ATOM   735   C C   . ILE A 1 118 ? -1.097  -5.544  60.945  1.00 50.92  ? 140  ILE A C   1 
ATOM   736   O O   . ILE A 1 118 ? -1.356  -5.970  62.071  1.00 54.68  ? 140  ILE A O   1 
ATOM   737   C CB  . ILE A 1 118 ? -1.909  -7.459  59.633  1.00 52.74  ? 140  ILE A CB  1 
ATOM   738   C CG1 . ILE A 1 118 ? -1.555  -8.502  58.572  1.00 52.30  ? 140  ILE A CG1 1 
ATOM   739   C CG2 . ILE A 1 118 ? -3.158  -6.680  59.251  1.00 53.60  ? 140  ILE A CG2 1 
ATOM   740   C CD1 . ILE A 1 118 ? -2.671  -9.448  58.234  1.00 51.92  ? 140  ILE A CD1 1 
ATOM   741   N N   . PRO A 1 119 ? -1.116  -4.240  60.629  1.00 47.35  ? 141  PRO A N   1 
ATOM   742   C CA  . PRO A 1 119 ? -1.358  -3.179  61.611  1.00 49.42  ? 141  PRO A CA  1 
ATOM   743   C C   . PRO A 1 119 ? -2.615  -3.434  62.432  1.00 56.08  ? 141  PRO A C   1 
ATOM   744   O O   . PRO A 1 119 ? -3.642  -3.850  61.893  1.00 59.74  ? 141  PRO A O   1 
ATOM   745   C CB  . PRO A 1 119 ? -1.526  -1.936  60.740  1.00 49.56  ? 141  PRO A CB  1 
ATOM   746   C CG  . PRO A 1 119 ? -0.695  -2.230  59.538  1.00 48.66  ? 141  PRO A CG  1 
ATOM   747   C CD  . PRO A 1 119 ? -0.897  -3.696  59.278  1.00 47.26  ? 141  PRO A CD  1 
ATOM   748   N N   . SER A 1 120 ? -2.517  -3.204  63.735  1.00 56.13  ? 142  SER A N   1 
ATOM   749   C CA  . SER A 1 120 ? -3.609  -3.494  64.645  1.00 58.77  ? 142  SER A CA  1 
ATOM   750   C C   . SER A 1 120 ? -4.693  -2.434  64.579  1.00 59.26  ? 142  SER A C   1 
ATOM   751   O O   . SER A 1 120 ? -4.419  -1.263  64.317  1.00 58.16  ? 142  SER A O   1 
ATOM   752   C CB  . SER A 1 120 ? -3.092  -3.635  66.077  1.00 61.89  ? 142  SER A CB  1 
ATOM   753   O OG  . SER A 1 120 ? -2.566  -4.931  66.306  1.00 61.15  ? 142  SER A OG  1 
ATOM   754   N N   . GLY A 1 121 ? -5.926  -2.864  64.816  1.00 61.80  ? 143  GLY A N   1 
ATOM   755   C CA  . GLY A 1 121 ? -7.068  -1.969  64.826  1.00 63.21  ? 143  GLY A CA  1 
ATOM   756   C C   . GLY A 1 121 ? -7.245  -1.155  63.557  1.00 61.16  ? 143  GLY A C   1 
ATOM   757   O O   . GLY A 1 121 ? -7.359  0.065   63.617  1.00 61.83  ? 143  GLY A O   1 
ATOM   758   N N   . LEU A 1 122 ? -7.242  -1.820  62.407  1.00 51.93  ? 144  LEU A N   1 
ATOM   759   C CA  . LEU A 1 122 ? -7.599  -1.162  61.157  1.00 54.74  ? 144  LEU A CA  1 
ATOM   760   C C   . LEU A 1 122 ? -9.106  -0.862  61.162  1.00 59.19  ? 144  LEU A C   1 
ATOM   761   O O   . LEU A 1 122 ? -9.879  -1.553  61.841  1.00 58.17  ? 144  LEU A O   1 
ATOM   762   C CB  . LEU A 1 122 ? -7.215  -2.040  59.969  1.00 49.48  ? 144  LEU A CB  1 
ATOM   763   C CG  . LEU A 1 122 ? -5.737  -2.003  59.568  1.00 49.40  ? 144  LEU A CG  1 
ATOM   764   C CD1 . LEU A 1 122 ? -5.428  -3.051  58.516  1.00 46.63  ? 144  LEU A CD1 1 
ATOM   765   C CD2 . LEU A 1 122 ? -5.368  -0.626  59.058  1.00 48.31  ? 144  LEU A CD2 1 
ATOM   766   N N   . PRO A 1 123 ? -9.531  0.187   60.434  1.00 58.50  ? 145  PRO A N   1 
ATOM   767   C CA  . PRO A 1 123 ? -10.950 0.559   60.502  1.00 59.35  ? 145  PRO A CA  1 
ATOM   768   C C   . PRO A 1 123 ? -11.843 -0.429  59.760  1.00 60.73  ? 145  PRO A C   1 
ATOM   769   O O   . PRO A 1 123 ? -11.498 -0.893  58.670  1.00 57.31  ? 145  PRO A O   1 
ATOM   770   C CB  . PRO A 1 123 ? -10.984 1.927   59.819  1.00 56.36  ? 145  PRO A CB  1 
ATOM   771   C CG  . PRO A 1 123 ? -9.832  1.912   58.898  1.00 54.18  ? 145  PRO A CG  1 
ATOM   772   C CD  . PRO A 1 123 ? -8.759  1.108   59.585  1.00 55.21  ? 145  PRO A CD  1 
ATOM   773   N N   . GLU A 1 124 ? -12.999 -0.723  60.348  1.00 62.85  ? 146  GLU A N   1 
ATOM   774   C CA  . GLU A 1 124 ? -13.921 -1.720  59.806  1.00 63.10  ? 146  GLU A CA  1 
ATOM   775   C C   . GLU A 1 124 ? -14.560 -1.323  58.464  1.00 58.42  ? 146  GLU A C   1 
ATOM   776   O O   . GLU A 1 124 ? -15.128 -2.171  57.769  1.00 53.62  ? 146  GLU A O   1 
ATOM   777   C CB  . GLU A 1 124 ? -15.008 -2.052  60.833  1.00 67.39  ? 146  GLU A CB  1 
ATOM   778   C CG  . GLU A 1 124 ? -15.763 -0.844  61.335  1.00 73.65  ? 146  GLU A CG  1 
ATOM   779   C CD  . GLU A 1 124 ? -16.464 -1.112  62.644  1.00 80.86  ? 146  GLU A CD  1 
ATOM   780   O OE1 . GLU A 1 124 ? -16.655 -2.303  62.977  1.00 84.22  ? 146  GLU A OE1 1 
ATOM   781   O OE2 . GLU A 1 124 ? -16.817 -0.134  63.337  1.00 81.87  ? 146  GLU A OE2 1 
ATOM   782   N N   . SER A 1 125 ? -14.462 -0.046  58.105  1.00 57.90  ? 147  SER A N   1 
ATOM   783   C CA  . SER A 1 125 ? -14.975 0.432   56.824  1.00 59.50  ? 147  SER A CA  1 
ATOM   784   C C   . SER A 1 125 ? -14.165 -0.025  55.595  1.00 59.53  ? 147  SER A C   1 
ATOM   785   O O   . SER A 1 125 ? -14.627 0.140   54.468  1.00 61.32  ? 147  SER A O   1 
ATOM   786   C CB  . SER A 1 125 ? -15.099 1.961   56.832  1.00 61.21  ? 147  SER A CB  1 
ATOM   787   O OG  . SER A 1 125 ? -13.828 2.585   56.938  1.00 62.15  ? 147  SER A OG  1 
ATOM   788   N N   . LEU A 1 126 ? -12.980 -0.606  55.802  1.00 58.79  ? 148  LEU A N   1 
ATOM   789   C CA  . LEU A 1 126 ? -12.087 -0.922  54.674  1.00 61.37  ? 148  LEU A CA  1 
ATOM   790   C C   . LEU A 1 126 ? -12.656 -1.940  53.678  1.00 59.80  ? 148  LEU A C   1 
ATOM   791   O O   . LEU A 1 126 ? -13.072 -3.033  54.061  1.00 59.42  ? 148  LEU A O   1 
ATOM   792   C CB  . LEU A 1 126 ? -10.728 -1.429  55.176  1.00 62.17  ? 148  LEU A CB  1 
ATOM   793   C CG  . LEU A 1 126 ? -9.792  -0.435  55.857  1.00 60.48  ? 148  LEU A CG  1 
ATOM   794   C CD1 . LEU A 1 126 ? -8.655  -1.169  56.516  1.00 56.53  ? 148  LEU A CD1 1 
ATOM   795   C CD2 . LEU A 1 126 ? -9.269  0.568   54.857  1.00 59.64  ? 148  LEU A CD2 1 
ATOM   796   N N   . THR A 1 127 ? -12.731 -1.540  52.412  1.00 58.76  ? 149  THR A N   1 
ATOM   797   C CA  . THR A 1 127 ? -12.991 -2.451  51.293  1.00 56.70  ? 149  THR A CA  1 
ATOM   798   C C   . THR A 1 127 ? -11.756 -3.089  50.654  1.00 60.46  ? 149  THR A C   1 
ATOM   799   O O   . THR A 1 127 ? -11.780 -4.264  50.289  1.00 62.12  ? 149  THR A O   1 
ATOM   800   C CB  . THR A 1 127 ? -13.837 -1.779  50.212  1.00 54.93  ? 149  THR A CB  1 
ATOM   801   O OG1 . THR A 1 127 ? -13.204 -0.563  49.808  1.00 51.94  ? 149  THR A OG1 1 
ATOM   802   C CG2 . THR A 1 127 ? -15.219 -1.450  50.762  1.00 58.22  ? 149  THR A CG2 1 
ATOM   803   N N   . GLU A 1 128 ? -10.701 -2.294  50.473  1.00 62.52  ? 150  GLU A N   1 
ATOM   804   C CA  . GLU A 1 128 ? -9.481  -2.759  49.807  1.00 63.32  ? 150  GLU A CA  1 
ATOM   805   C C   . GLU A 1 128 ? -8.228  -2.500  50.635  1.00 59.62  ? 150  GLU A C   1 
ATOM   806   O O   . GLU A 1 128 ? -7.923  -1.363  50.991  1.00 58.38  ? 150  GLU A O   1 
ATOM   807   C CB  . GLU A 1 128 ? -9.313  -2.117  48.425  1.00 67.59  ? 150  GLU A CB  1 
ATOM   808   C CG  . GLU A 1 128 ? -10.417 -2.436  47.446  1.00 74.74  ? 150  GLU A CG  1 
ATOM   809   C CD  . GLU A 1 128 ? -11.564 -1.447  47.527  1.00 83.69  ? 150  GLU A CD  1 
ATOM   810   O OE1 . GLU A 1 128 ? -11.500 -0.515  48.359  1.00 86.26  ? 150  GLU A OE1 1 
ATOM   811   O OE2 . GLU A 1 128 ? -12.534 -1.599  46.756  1.00 87.31  ? 150  GLU A OE2 1 
ATOM   812   N N   . LEU A 1 129 ? -7.497  -3.566  50.928  1.00 55.13  ? 151  LEU A N   1 
ATOM   813   C CA  . LEU A 1 129 ? -6.294  -3.458  51.731  1.00 50.71  ? 151  LEU A CA  1 
ATOM   814   C C   . LEU A 1 129 ? -5.135  -4.084  50.984  1.00 46.77  ? 151  LEU A C   1 
ATOM   815   O O   . LEU A 1 129 ? -5.225  -5.225  50.524  1.00 47.41  ? 151  LEU A O   1 
ATOM   816   C CB  . LEU A 1 129 ? -6.495  -4.154  53.075  1.00 52.67  ? 151  LEU A CB  1 
ATOM   817   C CG  . LEU A 1 129 ? -5.289  -4.271  54.012  1.00 52.80  ? 151  LEU A CG  1 
ATOM   818   C CD1 . LEU A 1 129 ? -4.642  -2.917  54.248  1.00 53.01  ? 151  LEU A CD1 1 
ATOM   819   C CD2 . LEU A 1 129 ? -5.720  -4.884  55.336  1.00 52.67  ? 151  LEU A CD2 1 
ATOM   820   N N   . SER A 1 130 ? -4.049  -3.339  50.834  1.00 44.95  ? 152  SER A N   1 
ATOM   821   C CA  . SER A 1 130 ? -2.869  -3.914  50.203  1.00 43.15  ? 152  SER A CA  1 
ATOM   822   C C   . SER A 1 130 ? -1.683  -3.898  51.146  1.00 43.07  ? 152  SER A C   1 
ATOM   823   O O   . SER A 1 130 ? -1.191  -2.836  51.525  1.00 41.58  ? 152  SER A O   1 
ATOM   824   C CB  . SER A 1 130 ? -2.519  -3.197  48.908  1.00 41.67  ? 152  SER A CB  1 
ATOM   825   O OG  . SER A 1 130 ? -1.680  -4.022  48.118  1.00 42.50  ? 152  SER A OG  1 
ATOM   826   N N   . LEU A 1 131 ? -1.294  -5.096  51.568  1.00 44.03  ? 153  LEU A N   1 
ATOM   827   C CA  . LEU A 1 131 ? -0.108  -5.345  52.384  1.00 45.79  ? 153  LEU A CA  1 
ATOM   828   C C   . LEU A 1 131 ? 1.109   -5.885  51.611  1.00 48.98  ? 153  LEU A C   1 
ATOM   829   O O   . LEU A 1 131 ? 2.074   -6.366  52.220  1.00 47.66  ? 153  LEU A O   1 
ATOM   830   C CB  . LEU A 1 131 ? -0.460  -6.212  53.578  1.00 45.61  ? 153  LEU A CB  1 
ATOM   831   C CG  . LEU A 1 131 ? -1.480  -5.500  54.461  1.00 49.66  ? 153  LEU A CG  1 
ATOM   832   C CD1 . LEU A 1 131 ? -1.817  -6.351  55.657  1.00 53.94  ? 153  LEU A CD1 1 
ATOM   833   C CD2 . LEU A 1 131 ? -0.944  -4.141  54.903  1.00 51.72  ? 153  LEU A CD2 1 
ATOM   834   N N   . ILE A 1 132 ? 1.020   -5.869  50.280  1.00 48.82  ? 154  ILE A N   1 
ATOM   835   C CA  . ILE A 1 132 ? 2.030   -6.470  49.404  1.00 45.83  ? 154  ILE A CA  1 
ATOM   836   C C   . ILE A 1 132 ? 3.445   -6.057  49.788  1.00 45.86  ? 154  ILE A C   1 
ATOM   837   O O   . ILE A 1 132 ? 3.678   -4.914  50.170  1.00 46.97  ? 154  ILE A O   1 
ATOM   838   C CB  . ILE A 1 132 ? 1.798   -6.046  47.927  1.00 40.98  ? 154  ILE A CB  1 
ATOM   839   C CG1 . ILE A 1 132 ? 0.571   -6.732  47.336  1.00 40.66  ? 154  ILE A CG1 1 
ATOM   840   C CG2 . ILE A 1 132 ? 2.995   -6.361  47.048  1.00 39.38  ? 154  ILE A CG2 1 
ATOM   841   C CD1 . ILE A 1 132 ? 0.246   -6.225  45.939  1.00 35.91  ? 154  ILE A CD1 1 
ATOM   842   N N   . GLN A 1 133 ? 4.374   -7.010  49.717  1.00 46.73  ? 155  GLN A N   1 
ATOM   843   C CA  . GLN A 1 133 ? 5.804   -6.726  49.831  1.00 47.85  ? 155  GLN A CA  1 
ATOM   844   C C   . GLN A 1 133 ? 6.227   -6.175  51.186  1.00 48.33  ? 155  GLN A C   1 
ATOM   845   O O   . GLN A 1 133 ? 6.902   -5.150  51.273  1.00 47.76  ? 155  GLN A O   1 
ATOM   846   C CB  . GLN A 1 133 ? 6.260   -5.792  48.704  1.00 47.06  ? 155  GLN A CB  1 
ATOM   847   C CG  . GLN A 1 133 ? 6.832   -6.526  47.503  1.00 48.18  ? 155  GLN A CG  1 
ATOM   848   C CD  . GLN A 1 133 ? 8.225   -7.069  47.779  1.00 50.25  ? 155  GLN A CD  1 
ATOM   849   O OE1 . GLN A 1 133 ? 8.863   -6.695  48.764  1.00 50.95  ? 155  GLN A OE1 1 
ATOM   850   N NE2 . GLN A 1 133 ? 8.709   -7.940  46.901  1.00 49.53  ? 155  GLN A NE2 1 
ATOM   851   N N   . ASN A 1 134 ? 5.819   -6.875  52.237  1.00 47.67  ? 156  ASN A N   1 
ATOM   852   C CA  . ASN A 1 134 ? 6.227   -6.543  53.592  1.00 46.89  ? 156  ASN A CA  1 
ATOM   853   C C   . ASN A 1 134 ? 6.901   -7.720  54.292  1.00 45.49  ? 156  ASN A C   1 
ATOM   854   O O   . ASN A 1 134 ? 7.292   -8.698  53.663  1.00 44.17  ? 156  ASN A O   1 
ATOM   855   C CB  . ASN A 1 134 ? 5.042   -6.040  54.415  1.00 48.59  ? 156  ASN A CB  1 
ATOM   856   C CG  . ASN A 1 134 ? 4.613   -4.641  54.019  1.00 51.34  ? 156  ASN A CG  1 
ATOM   857   O OD1 . ASN A 1 134 ? 5.296   -3.662  54.323  1.00 55.15  ? 156  ASN A OD1 1 
ATOM   858   N ND2 . ASN A 1 134 ? 3.469   -4.537  53.351  1.00 46.90  ? 156  ASN A ND2 1 
ATOM   859   N N   . ASN A 1 135 ? 7.105   -7.562  55.590  1.00 47.43  ? 157  ASN A N   1 
ATOM   860   C CA  . ASN A 1 135 ? 7.633   -8.598  56.478  1.00 46.04  ? 157  ASN A CA  1 
ATOM   861   C C   . ASN A 1 135 ? 6.591   -9.395  57.288  1.00 47.98  ? 157  ASN A C   1 
ATOM   862   O O   . ASN A 1 135 ? 6.906   -9.982  58.327  1.00 43.42  ? 157  ASN A O   1 
ATOM   863   C CB  . ASN A 1 135 ? 8.786   -8.048  57.315  1.00 45.37  ? 157  ASN A CB  1 
ATOM   864   C CG  . ASN A 1 135 ? 9.869   -7.449  56.442  1.00 48.13  ? 157  ASN A CG  1 
ATOM   865   O OD1 . ASN A 1 135 ? 10.066  -7.882  55.298  1.00 48.57  ? 157  ASN A OD1 1 
ATOM   866   N ND2 . ASN A 1 135 ? 10.548  -6.429  56.948  1.00 47.72  ? 157  ASN A ND2 1 
ATOM   867   N N   . ILE A 1 136 ? 5.329   -9.310  56.882  1.00 50.99  ? 158  ILE A N   1 
ATOM   868   C CA  . ILE A 1 136 ? 4.270   -9.990  57.617  1.00 48.72  ? 158  ILE A CA  1 
ATOM   869   C C   . ILE A 1 136 ? 4.252   -11.487 57.313  1.00 51.89  ? 158  ILE A C   1 
ATOM   870   O O   . ILE A 1 136 ? 3.982   -11.908 56.191  1.00 51.21  ? 158  ILE A O   1 
ATOM   871   C CB  . ILE A 1 136 ? 2.916   -9.400  57.223  1.00 42.24  ? 158  ILE A CB  1 
ATOM   872   C CG1 . ILE A 1 136 ? 2.987   -7.874  57.308  1.00 41.88  ? 158  ILE A CG1 1 
ATOM   873   C CG2 . ILE A 1 136 ? 1.806   -9.965  58.106  1.00 43.61  ? 158  ILE A CG2 1 
ATOM   874   C CD1 . ILE A 1 136 ? 1.889   -7.152  56.557  1.00 43.65  ? 158  ILE A CD1 1 
ATOM   875   N N   . TYR A 1 137 ? 4.566   -12.274 58.339  1.00 56.77  ? 159  TYR A N   1 
ATOM   876   C CA  . TYR A 1 137 ? 4.540   -13.732 58.282  1.00 57.23  ? 159  TYR A CA  1 
ATOM   877   C C   . TYR A 1 137 ? 3.354   -14.355 59.019  1.00 61.14  ? 159  TYR A C   1 
ATOM   878   O O   . TYR A 1 137 ? 3.186   -15.574 59.031  1.00 62.28  ? 159  TYR A O   1 
ATOM   879   C CB  . TYR A 1 137 ? 5.878   -14.285 58.776  1.00 53.85  ? 159  TYR A CB  1 
ATOM   880   C CG  . TYR A 1 137 ? 7.048   -13.505 58.215  1.00 52.35  ? 159  TYR A CG  1 
ATOM   881   C CD1 . TYR A 1 137 ? 7.284   -13.463 56.848  1.00 48.97  ? 159  TYR A CD1 1 
ATOM   882   C CD2 . TYR A 1 137 ? 7.900   -12.790 59.048  1.00 54.54  ? 159  TYR A CD2 1 
ATOM   883   C CE1 . TYR A 1 137 ? 8.337   -12.738 56.325  1.00 48.05  ? 159  TYR A CE1 1 
ATOM   884   C CE2 . TYR A 1 137 ? 8.969   -12.064 58.532  1.00 50.71  ? 159  TYR A CE2 1 
ATOM   885   C CZ  . TYR A 1 137 ? 9.180   -12.041 57.172  1.00 49.22  ? 159  TYR A CZ  1 
ATOM   886   O OH  . TYR A 1 137 ? 10.237  -11.320 56.658  1.00 48.89  ? 159  TYR A OH  1 
ATOM   887   N N   . ASN A 1 138 ? 2.542   -13.511 59.642  1.00 63.24  ? 160  ASN A N   1 
ATOM   888   C CA  . ASN A 1 138 ? 1.478   -13.981 60.513  1.00 66.28  ? 160  ASN A CA  1 
ATOM   889   C C   . ASN A 1 138 ? 0.129   -13.364 60.140  1.00 61.32  ? 160  ASN A C   1 
ATOM   890   O O   . ASN A 1 138 ? -0.054  -12.158 60.259  1.00 61.15  ? 160  ASN A O   1 
ATOM   891   C CB  . ASN A 1 138 ? 1.836   -13.632 61.962  1.00 74.02  ? 160  ASN A CB  1 
ATOM   892   C CG  . ASN A 1 138 ? 1.400   -14.698 62.952  1.00 80.79  ? 160  ASN A CG  1 
ATOM   893   O OD1 . ASN A 1 138 ? 0.367   -15.345 62.779  1.00 82.25  ? 160  ASN A OD1 1 
ATOM   894   N ND2 . ASN A 1 138 ? 2.189   -14.879 64.007  1.00 83.83  ? 160  ASN A ND2 1 
ATOM   895   N N   . ILE A 1 139 ? -0.816  -14.185 59.694  1.00 58.08  ? 161  ILE A N   1 
ATOM   896   C CA  . ILE A 1 139 ? -2.146  -13.683 59.366  1.00 56.05  ? 161  ILE A CA  1 
ATOM   897   C C   . ILE A 1 139 ? -3.113  -14.051 60.479  1.00 57.03  ? 161  ILE A C   1 
ATOM   898   O O   . ILE A 1 139 ? -3.530  -15.203 60.577  1.00 58.65  ? 161  ILE A O   1 
ATOM   899   C CB  . ILE A 1 139 ? -2.677  -14.321 58.061  1.00 52.43  ? 161  ILE A CB  1 
ATOM   900   C CG1 . ILE A 1 139 ? -1.617  -14.303 56.945  1.00 49.78  ? 161  ILE A CG1 1 
ATOM   901   C CG2 . ILE A 1 139 ? -3.989  -13.663 57.643  1.00 50.65  ? 161  ILE A CG2 1 
ATOM   902   C CD1 . ILE A 1 139 ? -1.092  -12.927 56.585  1.00 50.19  ? 161  ILE A CD1 1 
ATOM   903   N N   . THR A 1 140 ? -3.522  -13.072 61.281  1.00 58.63  ? 162  THR A N   1 
ATOM   904   C CA  . THR A 1 140 ? -4.272  -13.367 62.507  1.00 59.33  ? 162  THR A CA  1 
ATOM   905   C C   . THR A 1 140 ? -5.669  -12.760 62.531  1.00 57.49  ? 162  THR A C   1 
ATOM   906   O O   . THR A 1 140 ? -5.964  -11.831 61.787  1.00 55.27  ? 162  THR A O   1 
ATOM   907   C CB  . THR A 1 140 ? -3.513  -12.898 63.765  1.00 63.01  ? 162  THR A CB  1 
ATOM   908   O OG1 . THR A 1 140 ? -3.363  -11.472 63.738  1.00 65.74  ? 162  THR A OG1 1 
ATOM   909   C CG2 . THR A 1 140 ? -2.137  -13.555 63.841  1.00 61.18  ? 162  THR A CG2 1 
ATOM   910   N N   . LYS A 1 141 ? -6.528  -13.305 63.388  1.00 61.13  ? 163  LYS A N   1 
ATOM   911   C CA  . LYS A 1 141 ? -7.895  -12.814 63.541  1.00 61.71  ? 163  LYS A CA  1 
ATOM   912   C C   . LYS A 1 141 ? -7.976  -11.373 64.039  1.00 60.00  ? 163  LYS A C   1 
ATOM   913   O O   . LYS A 1 141 ? -8.840  -10.623 63.601  1.00 59.28  ? 163  LYS A O   1 
ATOM   914   C CB  . LYS A 1 141 ? -8.706  -13.727 64.468  1.00 67.58  ? 163  LYS A CB  1 
ATOM   915   C CG  . LYS A 1 141 ? -8.909  -15.138 63.936  1.00 72.50  ? 163  LYS A CG  1 
ATOM   916   C CD  . LYS A 1 141 ? -10.078 -15.835 64.620  1.00 78.72  ? 163  LYS A CD  1 
ATOM   917   C CE  . LYS A 1 141 ? -9.903  -15.927 66.137  1.00 83.81  ? 163  LYS A CE  1 
ATOM   918   N NZ  . LYS A 1 141 ? -8.953  -16.998 66.569  1.00 85.72  ? 163  LYS A NZ  1 
ATOM   919   N N   . GLU A 1 142 ? -7.089  -10.980 64.948  1.00 62.36  ? 164  GLU A N   1 
ATOM   920   C CA  . GLU A 1 142 ? -7.160  -9.630  65.510  1.00 67.59  ? 164  GLU A CA  1 
ATOM   921   C C   . GLU A 1 142 ? -6.920  -8.522  64.477  1.00 66.95  ? 164  GLU A C   1 
ATOM   922   O O   . GLU A 1 142 ? -7.488  -7.434  64.580  1.00 67.97  ? 164  GLU A O   1 
ATOM   923   C CB  . GLU A 1 142 ? -6.198  -9.467  66.685  1.00 72.58  ? 164  GLU A CB  1 
ATOM   924   C CG  . GLU A 1 142 ? -6.742  -8.581  67.797  1.00 78.65  ? 164  GLU A CG  1 
ATOM   925   C CD  . GLU A 1 142 ? -7.264  -9.385  68.975  1.00 83.66  ? 164  GLU A CD  1 
ATOM   926   O OE1 . GLU A 1 142 ? -7.426  -10.615 68.835  1.00 83.65  ? 164  GLU A OE1 1 
ATOM   927   O OE2 . GLU A 1 142 ? -7.498  -8.790  70.047  1.00 88.28  ? 164  GLU A OE2 1 
ATOM   928   N N   . GLY A 1 143 ? -6.049  -8.782  63.508  1.00 65.17  ? 165  GLY A N   1 
ATOM   929   C CA  . GLY A 1 143 ? -5.843  -7.838  62.424  1.00 64.77  ? 165  GLY A CA  1 
ATOM   930   C C   . GLY A 1 143 ? -6.902  -7.869  61.333  1.00 65.44  ? 165  GLY A C   1 
ATOM   931   O O   . GLY A 1 143 ? -7.385  -6.826  60.892  1.00 66.03  ? 165  GLY A O   1 
ATOM   932   N N   . ILE A 1 144 ? -7.208  -9.073  60.856  1.00 65.73  ? 166  ILE A N   1 
ATOM   933   C CA  . ILE A 1 144 ? -8.125  -9.285  59.728  1.00 67.03  ? 166  ILE A CA  1 
ATOM   934   C C   . ILE A 1 144 ? -9.646  -9.438  59.976  1.00 68.63  ? 166  ILE A C   1 
ATOM   935   O O   . ILE A 1 144 ? -10.460 -8.875  59.244  1.00 67.78  ? 166  ILE A O   1 
ATOM   936   C CB  . ILE A 1 144 ? -7.584  -10.407 58.806  1.00 66.22  ? 166  ILE A CB  1 
ATOM   937   C CG1 . ILE A 1 144 ? -6.236  -9.974  58.238  1.00 65.87  ? 166  ILE A CG1 1 
ATOM   938   C CG2 . ILE A 1 144 ? -8.538  -10.713 57.677  1.00 67.83  ? 166  ILE A CG2 1 
ATOM   939   C CD1 . ILE A 1 144 ? -6.227  -8.543  57.719  1.00 64.76  ? 166  ILE A CD1 1 
ATOM   940   N N   . SER A 1 145 ? -10.029 -10.202 60.996  1.00 69.82  ? 167  SER A N   1 
ATOM   941   C CA  . SER A 1 145 ? -11.405 -10.698 61.063  1.00 72.16  ? 167  SER A CA  1 
ATOM   942   C C   . SER A 1 145 ? -12.442 -9.654  61.443  1.00 72.18  ? 167  SER A C   1 
ATOM   943   O O   . SER A 1 145 ? -13.642 -9.874  61.278  1.00 71.94  ? 167  SER A O   1 
ATOM   944   C CB  . SER A 1 145 ? -11.516 -11.921 61.972  1.00 77.16  ? 167  SER A CB  1 
ATOM   945   O OG  . SER A 1 145 ? -11.394 -13.107 61.205  1.00 78.44  ? 167  SER A OG  1 
ATOM   946   N N   . ARG A 1 146 ? -11.982 -8.515  61.944  1.00 71.80  ? 168  ARG A N   1 
ATOM   947   C CA  . ARG A 1 146 ? -12.898 -7.441  62.296  1.00 74.19  ? 168  ARG A CA  1 
ATOM   948   C C   . ARG A 1 146 ? -13.438 -6.723  61.068  1.00 71.37  ? 168  ARG A C   1 
ATOM   949   O O   . ARG A 1 146 ? -14.458 -6.042  61.159  1.00 70.47  ? 168  ARG A O   1 
ATOM   950   C CB  . ARG A 1 146 ? -12.216 -6.420  63.204  1.00 77.42  ? 168  ARG A CB  1 
ATOM   951   C CG  . ARG A 1 146 ? -12.691 -6.437  64.656  1.00 79.57  ? 168  ARG A CG  1 
ATOM   952   C CD  . ARG A 1 146 ? -11.826 -5.523  65.526  1.00 81.26  ? 168  ARG A CD  1 
ATOM   953   N NE  . ARG A 1 146 ? -11.665 -4.195  64.937  1.00 82.19  ? 168  ARG A NE  1 
ATOM   954   C CZ  . ARG A 1 146 ? -10.562 -3.780  64.318  1.00 83.42  ? 168  ARG A CZ  1 
ATOM   955   N NH1 . ARG A 1 146 ? -9.514  -4.588  64.207  1.00 82.58  ? 168  ARG A NH1 1 
ATOM   956   N NH2 . ARG A 1 146 ? -10.503 -2.559  63.806  1.00 84.39  ? 168  ARG A NH2 1 
ATOM   957   N N   . LEU A 1 147 ? -12.778 -6.884  59.920  1.00 69.13  ? 169  LEU A N   1 
ATOM   958   C CA  . LEU A 1 147 ? -13.127 -6.073  58.762  1.00 68.02  ? 169  LEU A CA  1 
ATOM   959   C C   . LEU A 1 147 ? -14.034 -6.873  57.846  1.00 68.57  ? 169  LEU A C   1 
ATOM   960   O O   . LEU A 1 147 ? -13.578 -7.640  57.005  1.00 70.20  ? 169  LEU A O   1 
ATOM   961   C CB  . LEU A 1 147 ? -11.853 -5.715  57.995  1.00 64.96  ? 169  LEU A CB  1 
ATOM   962   C CG  . LEU A 1 147 ? -10.592 -5.533  58.842  1.00 62.65  ? 169  LEU A CG  1 
ATOM   963   C CD1 . LEU A 1 147 ? -9.352  -5.380  57.965  1.00 60.28  ? 169  LEU A CD1 1 
ATOM   964   C CD2 . LEU A 1 147 ? -10.735 -4.345  59.773  1.00 61.81  ? 169  LEU A CD2 1 
ATOM   965   N N   . ILE A 1 148 ? -15.322 -6.584  57.946  1.00 70.51  ? 170  ILE A N   1 
ATOM   966   C CA  . ILE A 1 148 ? -16.358 -7.383  57.314  1.00 70.23  ? 170  ILE A CA  1 
ATOM   967   C C   . ILE A 1 148 ? -16.565 -6.902  55.891  1.00 65.92  ? 170  ILE A C   1 
ATOM   968   O O   . ILE A 1 148 ? -17.082 -7.624  55.042  1.00 63.79  ? 170  ILE A O   1 
ATOM   969   C CB  . ILE A 1 148 ? -17.683 -7.254  58.119  1.00 64.00  ? 170  ILE A CB  1 
ATOM   970   C CG1 . ILE A 1 148 ? -17.418 -7.509  59.601  1.00 62.62  ? 170  ILE A CG1 1 
ATOM   971   C CG2 . ILE A 1 148 ? -18.757 -8.202  57.594  1.00 68.04  ? 170  ILE A CG2 1 
ATOM   972   C CD1 . ILE A 1 148 ? -16.752 -8.856  59.885  1.00 61.05  ? 170  ILE A CD1 1 
ATOM   973   N N   . ASN A 1 149 ? -16.123 -5.678  55.639  1.00 65.99  ? 171  ASN A N   1 
ATOM   974   C CA  . ASN A 1 149 ? -16.367 -5.019  54.366  1.00 66.17  ? 171  ASN A CA  1 
ATOM   975   C C   . ASN A 1 149 ? -15.243 -5.220  53.357  1.00 62.73  ? 171  ASN A C   1 
ATOM   976   O O   . ASN A 1 149 ? -15.259 -4.619  52.288  1.00 64.95  ? 171  ASN A O   1 
ATOM   977   C CB  . ASN A 1 149 ? -16.639 -3.532  54.582  1.00 66.69  ? 171  ASN A CB  1 
ATOM   978   C CG  . ASN A 1 149 ? -17.753 -3.291  55.575  1.00 71.15  ? 171  ASN A CG  1 
ATOM   979   O OD1 . ASN A 1 149 ? -18.686 -4.088  55.679  1.00 73.99  ? 171  ASN A OD1 1 
ATOM   980   N ND2 . ASN A 1 149 ? -17.659 -2.199  56.322  1.00 72.14  ? 171  ASN A ND2 1 
ATOM   981   N N   . LEU A 1 150 ? -14.263 -6.051  53.698  1.00 59.25  ? 172  LEU A N   1 
ATOM   982   C CA  . LEU A 1 150 ? -13.153 -6.304  52.778  1.00 58.85  ? 172  LEU A CA  1 
ATOM   983   C C   . LEU A 1 150 ? -13.594 -6.951  51.472  1.00 58.39  ? 172  LEU A C   1 
ATOM   984   O O   . LEU A 1 150 ? -14.249 -7.996  51.470  1.00 57.82  ? 172  LEU A O   1 
ATOM   985   C CB  . LEU A 1 150 ? -12.079 -7.172  53.429  1.00 58.16  ? 172  LEU A CB  1 
ATOM   986   C CG  . LEU A 1 150 ? -10.934 -6.452  54.135  1.00 56.73  ? 172  LEU A CG  1 
ATOM   987   C CD1 . LEU A 1 150 ? -9.901  -7.479  54.552  1.00 52.78  ? 172  LEU A CD1 1 
ATOM   988   C CD2 . LEU A 1 150 ? -10.316 -5.379  53.237  1.00 54.87  ? 172  LEU A CD2 1 
ATOM   989   N N   . LYS A 1 151 ? -13.213 -6.318  50.368  1.00 59.75  ? 173  LYS A N   1 
ATOM   990   C CA  . LYS A 1 151 ? -13.492 -6.812  49.028  1.00 63.77  ? 173  LYS A CA  1 
ATOM   991   C C   . LYS A 1 151 ? -12.213 -7.411  48.446  1.00 59.45  ? 173  LYS A C   1 
ATOM   992   O O   . LYS A 1 151 ? -12.171 -8.595  48.119  1.00 60.09  ? 173  LYS A O   1 
ATOM   993   C CB  . LYS A 1 151 ? -14.037 -5.681  48.148  1.00 72.50  ? 173  LYS A CB  1 
ATOM   994   C CG  . LYS A 1 151 ? -14.468 -6.081  46.734  1.00 79.50  ? 173  LYS A CG  1 
ATOM   995   C CD  . LYS A 1 151 ? -15.316 -4.970  46.097  1.00 85.34  ? 173  LYS A CD  1 
ATOM   996   C CE  . LYS A 1 151 ? -15.272 -4.987  44.567  1.00 87.32  ? 173  LYS A CE  1 
ATOM   997   N NZ  . LYS A 1 151 ? -16.158 -6.017  43.951  1.00 89.40  ? 173  LYS A NZ  1 
ATOM   998   N N   . ASN A 1 152 ? -11.183 -6.581  48.301  1.00 53.75  ? 174  ASN A N   1 
ATOM   999   C CA  . ASN A 1 152 ? -9.876  -7.042  47.847  1.00 46.72  ? 174  ASN A CA  1 
ATOM   1000  C C   . ASN A 1 152 ? -8.832  -6.966  48.957  1.00 44.04  ? 174  ASN A C   1 
ATOM   1001  O O   . ASN A 1 152 ? -8.659  -5.922  49.590  1.00 46.80  ? 174  ASN A O   1 
ATOM   1002  C CB  . ASN A 1 152 ? -9.395  -6.235  46.641  1.00 49.17  ? 174  ASN A CB  1 
ATOM   1003  C CG  . ASN A 1 152 ? -10.459 -6.091  45.567  1.00 54.71  ? 174  ASN A CG  1 
ATOM   1004  O OD1 . ASN A 1 152 ? -11.357 -6.922  45.439  1.00 56.99  ? 174  ASN A OD1 1 
ATOM   1005  N ND2 . ASN A 1 152 ? -10.360 -5.028  44.787  1.00 57.50  ? 174  ASN A ND2 1 
ATOM   1006  N N   . LEU A 1 153 ? -8.150  -8.082  49.192  1.00 40.62  ? 175  LEU A N   1 
ATOM   1007  C CA  . LEU A 1 153 ? -7.118  -8.177  50.220  1.00 43.10  ? 175  LEU A CA  1 
ATOM   1008  C C   . LEU A 1 153 ? -5.860  -8.705  49.570  1.00 42.66  ? 175  LEU A C   1 
ATOM   1009  O O   . LEU A 1 153 ? -5.855  -9.830  49.075  1.00 41.61  ? 175  LEU A O   1 
ATOM   1010  C CB  . LEU A 1 153 ? -7.547  -9.135  51.331  1.00 42.49  ? 175  LEU A CB  1 
ATOM   1011  C CG  . LEU A 1 153 ? -6.488  -9.454  52.387  1.00 44.34  ? 175  LEU A CG  1 
ATOM   1012  C CD1 . LEU A 1 153 ? -6.001  -8.182  53.070  1.00 46.60  ? 175  LEU A CD1 1 
ATOM   1013  C CD2 . LEU A 1 153 ? -7.044  -10.442 53.411  1.00 44.84  ? 175  LEU A CD2 1 
ATOM   1014  N N   . TYR A 1 154 ? -4.805  -7.890  49.565  1.00 43.43  ? 176  TYR A N   1 
ATOM   1015  C CA  . TYR A 1 154 ? -3.558  -8.231  48.884  1.00 40.03  ? 176  TYR A CA  1 
ATOM   1016  C C   . TYR A 1 154 ? -2.434  -8.477  49.892  1.00 42.85  ? 176  TYR A C   1 
ATOM   1017  O O   . TYR A 1 154 ? -1.958  -7.538  50.535  1.00 41.28  ? 176  TYR A O   1 
ATOM   1018  C CB  . TYR A 1 154 ? -3.151  -7.090  47.945  1.00 38.79  ? 176  TYR A CB  1 
ATOM   1019  C CG  . TYR A 1 154 ? -4.174  -6.720  46.896  1.00 40.34  ? 176  TYR A CG  1 
ATOM   1020  C CD1 . TYR A 1 154 ? -4.205  -7.368  45.666  1.00 40.57  ? 176  TYR A CD1 1 
ATOM   1021  C CD2 . TYR A 1 154 ? -5.099  -5.701  47.128  1.00 42.06  ? 176  TYR A CD2 1 
ATOM   1022  C CE1 . TYR A 1 154 ? -5.136  -7.020  44.695  1.00 42.18  ? 176  TYR A CE1 1 
ATOM   1023  C CE2 . TYR A 1 154 ? -6.029  -5.347  46.166  1.00 43.02  ? 176  TYR A CE2 1 
ATOM   1024  C CZ  . TYR A 1 154 ? -6.043  -6.011  44.954  1.00 44.54  ? 176  TYR A CZ  1 
ATOM   1025  O OH  . TYR A 1 154 ? -6.969  -5.659  44.006  1.00 50.79  ? 176  TYR A OH  1 
ATOM   1026  N N   . LEU A 1 155 ? -2.066  -9.747  50.064  1.00 45.64  ? 177  LEU A N   1 
ATOM   1027  C CA  . LEU A 1 155 ? -0.965  -10.158 50.944  1.00 44.51  ? 177  LEU A CA  1 
ATOM   1028  C C   . LEU A 1 155 ? 0.358   -10.590 50.294  1.00 44.36  ? 177  LEU A C   1 
ATOM   1029  O O   . LEU A 1 155 ? 1.268   -11.061 50.986  1.00 45.01  ? 177  LEU A O   1 
ATOM   1030  C CB  . LEU A 1 155 ? -1.450  -11.182 51.971  1.00 46.17  ? 177  LEU A CB  1 
ATOM   1031  C CG  . LEU A 1 155 ? -2.360  -10.523 53.014  1.00 49.10  ? 177  LEU A CG  1 
ATOM   1032  C CD1 . LEU A 1 155 ? -3.147  -11.543 53.845  1.00 46.99  ? 177  LEU A CD1 1 
ATOM   1033  C CD2 . LEU A 1 155 ? -1.537  -9.611  53.915  1.00 50.97  ? 177  LEU A CD2 1 
ATOM   1034  N N   . ALA A 1 156 ? 0.460   -10.472 48.976  1.00 41.99  ? 178  ALA A N   1 
ATOM   1035  C CA  . ALA A 1 156 ? 1.553   -11.112 48.237  1.00 40.95  ? 178  ALA A CA  1 
ATOM   1036  C C   . ALA A 1 156 ? 2.982   -10.656 48.562  1.00 40.19  ? 178  ALA A C   1 
ATOM   1037  O O   . ALA A 1 156 ? 3.207   -9.584  49.124  1.00 40.71  ? 178  ALA A O   1 
ATOM   1038  C CB  . ALA A 1 156 ? 1.309   -11.034 46.720  1.00 38.24  ? 178  ALA A CB  1 
ATOM   1039  N N   . TRP A 1 157 ? 3.931   -11.524 48.224  1.00 36.77  ? 179  TRP A N   1 
ATOM   1040  C CA  . TRP A 1 157 ? 5.355   -11.187 48.196  1.00 38.73  ? 179  TRP A CA  1 
ATOM   1041  C C   . TRP A 1 157 ? 5.921   -10.800 49.553  1.00 43.27  ? 179  TRP A C   1 
ATOM   1042  O O   . TRP A 1 157 ? 6.793   -9.934  49.636  1.00 47.24  ? 179  TRP A O   1 
ATOM   1043  C CB  . TRP A 1 157 ? 5.636   -10.062 47.190  1.00 38.47  ? 179  TRP A CB  1 
ATOM   1044  C CG  . TRP A 1 157 ? 5.494   -10.435 45.731  1.00 34.22  ? 179  TRP A CG  1 
ATOM   1045  C CD1 . TRP A 1 157 ? 4.383   -10.285 44.943  1.00 35.25  ? 179  TRP A CD1 1 
ATOM   1046  C CD2 . TRP A 1 157 ? 6.508   -10.989 44.886  1.00 32.99  ? 179  TRP A CD2 1 
ATOM   1047  N NE1 . TRP A 1 157 ? 4.646   -10.718 43.661  1.00 32.91  ? 179  TRP A NE1 1 
ATOM   1048  C CE2 . TRP A 1 157 ? 5.941   -11.159 43.602  1.00 34.38  ? 179  TRP A CE2 1 
ATOM   1049  C CE3 . TRP A 1 157 ? 7.836   -11.374 45.094  1.00 32.98  ? 179  TRP A CE3 1 
ATOM   1050  C CZ2 . TRP A 1 157 ? 6.663   -11.688 42.531  1.00 35.89  ? 179  TRP A CZ2 1 
ATOM   1051  C CZ3 . TRP A 1 157 ? 8.550   -11.897 44.028  1.00 33.01  ? 179  TRP A CZ3 1 
ATOM   1052  C CH2 . TRP A 1 157 ? 7.964   -12.051 42.766  1.00 33.87  ? 179  TRP A CH2 1 
ATOM   1053  N N   . ASN A 1 158 ? 5.405   -11.399 50.621  1.00 43.55  ? 180  ASN A N   1 
ATOM   1054  C CA  . ASN A 1 158 ? 6.013   -11.210 51.932  1.00 43.35  ? 180  ASN A CA  1 
ATOM   1055  C C   . ASN A 1 158 ? 7.198   -12.131 52.242  1.00 44.37  ? 180  ASN A C   1 
ATOM   1056  O O   . ASN A 1 158 ? 8.175   -11.693 52.836  1.00 49.14  ? 180  ASN A O   1 
ATOM   1057  C CB  . ASN A 1 158 ? 4.968   -11.228 53.055  1.00 40.26  ? 180  ASN A CB  1 
ATOM   1058  C CG  . ASN A 1 158 ? 4.238   -9.911  53.182  1.00 45.29  ? 180  ASN A CG  1 
ATOM   1059  O OD1 . ASN A 1 158 ? 4.320   -9.239  54.208  1.00 47.45  ? 180  ASN A OD1 1 
ATOM   1060  N ND2 . ASN A 1 158 ? 3.519   -9.526  52.128  1.00 45.86  ? 180  ASN A ND2 1 
ATOM   1061  N N   . CYS A 1 159 ? 7.092   -13.410 51.890  1.00 41.87  ? 181  CYS A N   1 
ATOM   1062  C CA  . CYS A 1 159 ? 8.200   -14.348 52.093  1.00 42.10  ? 181  CYS A CA  1 
ATOM   1063  C C   . CYS A 1 159 ? 8.465   -15.177 50.831  1.00 41.11  ? 181  CYS A C   1 
ATOM   1064  O O   . CYS A 1 159 ? 7.672   -16.048 50.479  1.00 42.01  ? 181  CYS A O   1 
ATOM   1065  C CB  . CYS A 1 159 ? 7.895   -15.263 53.284  1.00 43.75  ? 181  CYS A CB  1 
ATOM   1066  S SG  . CYS A 1 159 ? 9.243   -16.386 53.752  1.00 56.76  ? 181  CYS A SG  1 
ATOM   1067  N N   . TYR A 1 160 ? 9.602   -14.943 50.185  1.00 38.65  ? 182  TYR A N   1 
ATOM   1068  C CA  . TYR A 1 160 ? 9.837   -15.481 48.847  1.00 41.03  ? 182  TYR A CA  1 
ATOM   1069  C C   . TYR A 1 160 ? 11.335  -15.553 48.540  1.00 44.19  ? 182  TYR A C   1 
ATOM   1070  O O   . TYR A 1 160 ? 12.135  -14.888 49.197  1.00 46.71  ? 182  TYR A O   1 
ATOM   1071  C CB  . TYR A 1 160 ? 9.138   -14.589 47.807  1.00 39.23  ? 182  TYR A CB  1 
ATOM   1072  C CG  . TYR A 1 160 ? 9.674   -13.173 47.807  1.00 38.70  ? 182  TYR A CG  1 
ATOM   1073  C CD1 . TYR A 1 160 ? 9.160   -12.205 48.671  1.00 38.57  ? 182  TYR A CD1 1 
ATOM   1074  C CD2 . TYR A 1 160 ? 10.722  -12.814 46.971  1.00 38.97  ? 182  TYR A CD2 1 
ATOM   1075  C CE1 . TYR A 1 160 ? 9.679   -10.910 48.685  1.00 39.53  ? 182  TYR A CE1 1 
ATOM   1076  C CE2 . TYR A 1 160 ? 11.242  -11.533 46.978  1.00 39.17  ? 182  TYR A CE2 1 
ATOM   1077  C CZ  . TYR A 1 160 ? 10.723  -10.585 47.833  1.00 38.50  ? 182  TYR A CZ  1 
ATOM   1078  O OH  . TYR A 1 160 ? 11.258  -9.313  47.820  1.00 36.38  ? 182  TYR A OH  1 
ATOM   1079  N N   . PHE A 1 161 ? 11.701  -16.345 47.531  1.00 43.84  ? 183  PHE A N   1 
ATOM   1080  C CA  . PHE A 1 161 ? 13.091  -16.459 47.064  1.00 39.36  ? 183  PHE A CA  1 
ATOM   1081  C C   . PHE A 1 161 ? 14.105  -16.719 48.189  1.00 40.58  ? 183  PHE A C   1 
ATOM   1082  O O   . PHE A 1 161 ? 13.886  -17.536 49.084  1.00 37.53  ? 183  PHE A O   1 
ATOM   1083  C CB  . PHE A 1 161 ? 13.520  -15.190 46.323  1.00 38.16  ? 183  PHE A CB  1 
ATOM   1084  C CG  . PHE A 1 161 ? 12.764  -14.925 45.053  1.00 38.02  ? 183  PHE A CG  1 
ATOM   1085  C CD1 . PHE A 1 161 ? 11.939  -15.888 44.493  1.00 37.46  ? 183  PHE A CD1 1 
ATOM   1086  C CD2 . PHE A 1 161 ? 12.895  -13.705 44.407  1.00 38.53  ? 183  PHE A CD2 1 
ATOM   1087  C CE1 . PHE A 1 161 ? 11.256  -15.630 43.325  1.00 38.39  ? 183  PHE A CE1 1 
ATOM   1088  C CE2 . PHE A 1 161 ? 12.212  -13.445 43.244  1.00 37.95  ? 183  PHE A CE2 1 
ATOM   1089  C CZ  . PHE A 1 161 ? 11.390  -14.410 42.702  1.00 38.13  ? 183  PHE A CZ  1 
ATOM   1090  N N   . ASN A 1 162 ? 15.217  -15.998 48.129  1.00 42.47  ? 184  ASN A N   1 
ATOM   1091  C CA  . ASN A 1 162 ? 16.258  -16.102 49.142  1.00 44.27  ? 184  ASN A CA  1 
ATOM   1092  C C   . ASN A 1 162 ? 16.120  -15.074 50.264  1.00 46.20  ? 184  ASN A C   1 
ATOM   1093  O O   . ASN A 1 162 ? 17.042  -14.894 51.049  1.00 48.03  ? 184  ASN A O   1 
ATOM   1094  C CB  . ASN A 1 162 ? 17.660  -16.061 48.522  1.00 43.65  ? 184  ASN A CB  1 
ATOM   1095  C CG  . ASN A 1 162 ? 17.966  -17.295 47.680  1.00 44.06  ? 184  ASN A CG  1 
ATOM   1096  O OD1 . ASN A 1 162 ? 18.643  -17.207 46.649  1.00 48.12  ? 184  ASN A OD1 1 
ATOM   1097  N ND2 . ASN A 1 162 ? 17.461  -18.449 48.109  1.00 40.77  ? 184  ASN A ND2 1 
ATOM   1098  N N   . LYS A 1 163 ? 15.001  -14.355 50.292  1.00 46.99  ? 185  LYS A N   1 
ATOM   1099  C CA  . LYS A 1 163 ? 14.721  -13.431 51.391  1.00 48.61  ? 185  LYS A CA  1 
ATOM   1100  C C   . LYS A 1 163 ? 14.825  -14.168 52.722  1.00 48.85  ? 185  LYS A C   1 
ATOM   1101  O O   . LYS A 1 163 ? 14.469  -15.341 52.810  1.00 47.45  ? 185  LYS A O   1 
ATOM   1102  C CB  . LYS A 1 163 ? 13.316  -12.836 51.252  1.00 46.64  ? 185  LYS A CB  1 
ATOM   1103  C CG  . LYS A 1 163 ? 12.999  -11.724 52.237  1.00 45.18  ? 185  LYS A CG  1 
ATOM   1104  C CD  . LYS A 1 163 ? 11.506  -11.379 52.261  1.00 43.63  ? 185  LYS A CD  1 
ATOM   1105  C CE  . LYS A 1 163 ? 11.237  -10.239 53.246  1.00 42.59  ? 185  LYS A CE  1 
ATOM   1106  N NZ  . LYS A 1 163 ? 9.795   -9.852  53.356  1.00 42.79  ? 185  LYS A NZ  1 
ATOM   1107  N N   . VAL A 1 164 ? 15.333  -13.497 53.752  1.00 49.55  ? 186  VAL A N   1 
ATOM   1108  C CA  . VAL A 1 164 ? 15.343  -14.111 55.067  1.00 50.48  ? 186  VAL A CA  1 
ATOM   1109  C C   . VAL A 1 164 ? 13.960  -13.836 55.602  1.00 52.04  ? 186  VAL A C   1 
ATOM   1110  O O   . VAL A 1 164 ? 13.588  -12.689 55.825  1.00 51.20  ? 186  VAL A O   1 
ATOM   1111  C CB  . VAL A 1 164 ? 16.379  -13.466 56.023  1.00 50.47  ? 186  VAL A CB  1 
ATOM   1112  C CG1 . VAL A 1 164 ? 16.312  -14.123 57.396  1.00 51.20  ? 186  VAL A CG1 1 
ATOM   1113  C CG2 . VAL A 1 164 ? 17.785  -13.567 55.454  1.00 48.81  ? 186  VAL A CG2 1 
ATOM   1114  N N   . CYS A 1 165 ? 13.189  -14.895 55.791  1.00 54.29  ? 187  CYS A N   1 
ATOM   1115  C CA  . CYS A 1 165 ? 11.792  -14.731 56.151  1.00 56.90  ? 187  CYS A CA  1 
ATOM   1116  C C   . CYS A 1 165 ? 11.205  -15.988 56.775  1.00 59.56  ? 187  CYS A C   1 
ATOM   1117  O O   . CYS A 1 165 ? 11.781  -17.070 56.682  1.00 55.17  ? 187  CYS A O   1 
ATOM   1118  C CB  . CYS A 1 165 ? 10.967  -14.273 54.943  1.00 53.45  ? 187  CYS A CB  1 
ATOM   1119  S SG  . CYS A 1 165 ? 10.997  -15.370 53.520  1.00 53.67  ? 187  CYS A SG  1 
ATOM   1120  N N   . GLU A 1 166 ? 10.050  -15.834 57.408  1.00 65.53  ? 188  GLU A N   1 
ATOM   1121  C CA  . GLU A 1 166 ? 9.418   -16.940 58.099  1.00 71.36  ? 188  GLU A CA  1 
ATOM   1122  C C   . GLU A 1 166 ? 8.264   -17.518 57.292  1.00 70.97  ? 188  GLU A C   1 
ATOM   1123  O O   . GLU A 1 166 ? 7.599   -16.799 56.546  1.00 71.70  ? 188  GLU A O   1 
ATOM   1124  C CB  . GLU A 1 166 ? 8.931   -16.496 59.478  1.00 76.94  ? 188  GLU A CB  1 
ATOM   1125  C CG  . GLU A 1 166 ? 8.762   -17.646 60.444  1.00 80.73  ? 188  GLU A CG  1 
ATOM   1126  C CD  . GLU A 1 166 ? 9.971   -18.560 60.445  1.00 82.72  ? 188  GLU A CD  1 
ATOM   1127  O OE1 . GLU A 1 166 ? 11.037  -18.123 60.932  1.00 83.68  ? 188  GLU A OE1 1 
ATOM   1128  O OE2 . GLU A 1 166 ? 9.859   -19.705 59.945  1.00 82.58  ? 188  GLU A OE2 1 
ATOM   1129  N N   . LYS A 1 167 ? 8.063   -18.827 57.429  1.00 68.99  ? 189  LYS A N   1 
ATOM   1130  C CA  . LYS A 1 167 ? 6.917   -19.524 56.851  1.00 64.35  ? 189  LYS A CA  1 
ATOM   1131  C C   . LYS A 1 167 ? 5.630   -18.858 57.333  1.00 60.28  ? 189  LYS A C   1 
ATOM   1132  O O   . LYS A 1 167 ? 5.552   -18.406 58.476  1.00 61.77  ? 189  LYS A O   1 
ATOM   1133  C CB  . LYS A 1 167 ? 6.952   -21.000 57.255  1.00 66.46  ? 189  LYS A CB  1 
ATOM   1134  C CG  . LYS A 1 167 ? 5.590   -21.604 57.558  1.00 70.81  ? 189  LYS A CG  1 
ATOM   1135  C CD  . LYS A 1 167 ? 4.941   -22.192 56.312  1.00 70.83  ? 189  LYS A CD  1 
ATOM   1136  C CE  . LYS A 1 167 ? 3.422   -22.274 56.452  1.00 69.90  ? 189  LYS A CE  1 
ATOM   1137  N NZ  . LYS A 1 167 ? 2.968   -22.932 57.715  1.00 71.06  ? 189  LYS A NZ  1 
ATOM   1138  N N   . THR A 1 168 ? 4.627   -18.776 56.464  1.00 54.47  ? 190  THR A N   1 
ATOM   1139  C CA  . THR A 1 168 ? 3.462   -17.964 56.778  1.00 52.88  ? 190  THR A CA  1 
ATOM   1140  C C   . THR A 1 168 ? 2.418   -18.725 57.591  1.00 55.26  ? 190  THR A C   1 
ATOM   1141  O O   . THR A 1 168 ? 1.829   -19.701 57.123  1.00 55.61  ? 190  THR A O   1 
ATOM   1142  C CB  . THR A 1 168 ? 2.813   -17.375 55.509  1.00 50.98  ? 190  THR A CB  1 
ATOM   1143  O OG1 . THR A 1 168 ? 3.829   -16.859 54.637  1.00 53.12  ? 190  THR A OG1 1 
ATOM   1144  C CG2 . THR A 1 168 ? 1.868   -16.254 55.882  1.00 49.89  ? 190  THR A CG2 1 
ATOM   1145  N N   . ASN A 1 169 ? 2.181   -18.247 58.807  1.00 54.45  ? 191  ASN A N   1 
ATOM   1146  C CA  . ASN A 1 169 ? 1.186   -18.840 59.691  1.00 53.69  ? 191  ASN A CA  1 
ATOM   1147  C C   . ASN A 1 169 ? -0.152  -18.170 59.451  1.00 51.04  ? 191  ASN A C   1 
ATOM   1148  O O   . ASN A 1 169 ? -0.310  -16.973 59.682  1.00 50.91  ? 191  ASN A O   1 
ATOM   1149  C CB  . ASN A 1 169 ? 1.602   -18.690 61.160  1.00 54.79  ? 191  ASN A CB  1 
ATOM   1150  C CG  . ASN A 1 169 ? 0.685   -19.450 62.117  1.00 60.06  ? 191  ASN A CG  1 
ATOM   1151  O OD1 . ASN A 1 169 ? -0.179  -20.221 61.699  1.00 61.88  ? 191  ASN A OD1 1 
ATOM   1152  N ND2 . ASN A 1 169 ? 0.888   -19.244 63.411  1.00 62.98  ? 191  ASN A ND2 1 
ATOM   1153  N N   . ILE A 1 170 ? -1.105  -18.949 58.959  1.00 50.99  ? 192  ILE A N   1 
ATOM   1154  C CA  . ILE A 1 170 ? -2.443  -18.449 58.713  1.00 51.92  ? 192  ILE A CA  1 
ATOM   1155  C C   . ILE A 1 170 ? -3.393  -19.092 59.707  1.00 52.38  ? 192  ILE A C   1 
ATOM   1156  O O   . ILE A 1 170 ? -3.661  -20.294 59.645  1.00 52.97  ? 192  ILE A O   1 
ATOM   1157  C CB  . ILE A 1 170 ? -2.900  -18.744 57.279  1.00 51.44  ? 192  ILE A CB  1 
ATOM   1158  C CG1 . ILE A 1 170 ? -2.057  -17.937 56.283  1.00 50.42  ? 192  ILE A CG1 1 
ATOM   1159  C CG2 . ILE A 1 170 ? -4.386  -18.441 57.125  1.00 49.66  ? 192  ILE A CG2 1 
ATOM   1160  C CD1 . ILE A 1 170 ? -2.390  -18.200 54.844  1.00 45.45  ? 192  ILE A CD1 1 
ATOM   1161  N N   . GLU A 1 171 ? -3.894  -18.276 60.626  1.00 51.70  ? 193  GLU A N   1 
ATOM   1162  C CA  . GLU A 1 171 ? -4.716  -18.761 61.723  1.00 52.09  ? 193  GLU A CA  1 
ATOM   1163  C C   . GLU A 1 171 ? -5.995  -19.386 61.178  1.00 54.25  ? 193  GLU A C   1 
ATOM   1164  O O   . GLU A 1 171 ? -6.609  -18.857 60.246  1.00 55.14  ? 193  GLU A O   1 
ATOM   1165  C CB  . GLU A 1 171 ? -5.025  -17.613 62.679  1.00 51.81  ? 193  GLU A CB  1 
ATOM   1166  C CG  . GLU A 1 171 ? -5.755  -18.010 63.943  1.00 55.99  ? 193  GLU A CG  1 
ATOM   1167  C CD  . GLU A 1 171 ? -5.908  -16.843 64.904  1.00 59.46  ? 193  GLU A CD  1 
ATOM   1168  O OE1 . GLU A 1 171 ? -5.203  -15.822 64.716  1.00 58.20  ? 193  GLU A OE1 1 
ATOM   1169  O OE2 . GLU A 1 171 ? -6.732  -16.945 65.844  1.00 61.03  ? 193  GLU A OE2 1 
ATOM   1170  N N   . ASP A 1 172 ? -6.376  -20.526 61.744  1.00 54.66  ? 194  ASP A N   1 
ATOM   1171  C CA  . ASP A 1 172 ? -7.556  -21.243 61.288  1.00 57.19  ? 194  ASP A CA  1 
ATOM   1172  C C   . ASP A 1 172 ? -8.801  -20.357 61.357  1.00 57.49  ? 194  ASP A C   1 
ATOM   1173  O O   . ASP A 1 172 ? -9.158  -19.836 62.420  1.00 54.93  ? 194  ASP A O   1 
ATOM   1174  C CB  . ASP A 1 172 ? -7.758  -22.507 62.131  1.00 60.78  ? 194  ASP A CB  1 
ATOM   1175  C CG  . ASP A 1 172 ? -8.938  -23.334 61.672  1.00 62.31  ? 194  ASP A CG  1 
ATOM   1176  O OD1 . ASP A 1 172 ? -8.831  -24.007 60.620  1.00 60.81  ? 194  ASP A OD1 1 
ATOM   1177  O OD2 . ASP A 1 172 ? -9.973  -23.313 62.366  1.00 64.90  ? 194  ASP A OD2 1 
ATOM   1178  N N   . GLY A 1 173 ? -9.454  -20.200 60.207  1.00 57.61  ? 195  GLY A N   1 
ATOM   1179  C CA  . GLY A 1 173 ? -10.671 -19.416 60.101  1.00 57.66  ? 195  GLY A CA  1 
ATOM   1180  C C   . GLY A 1 173 ? -10.541 -17.907 59.950  1.00 57.09  ? 195  GLY A C   1 
ATOM   1181  O O   . GLY A 1 173 ? -11.551 -17.213 60.030  1.00 58.78  ? 195  GLY A O   1 
ATOM   1182  N N   . VAL A 1 174 ? -9.330  -17.394 59.726  1.00 58.05  ? 196  VAL A N   1 
ATOM   1183  C CA  . VAL A 1 174 ? -9.134  -15.943 59.580  1.00 59.34  ? 196  VAL A CA  1 
ATOM   1184  C C   . VAL A 1 174 ? -10.038 -15.283 58.548  1.00 58.10  ? 196  VAL A C   1 
ATOM   1185  O O   . VAL A 1 174 ? -10.539 -14.190 58.780  1.00 63.20  ? 196  VAL A O   1 
ATOM   1186  C CB  . VAL A 1 174 ? -7.686  -15.560 59.190  1.00 58.31  ? 196  VAL A CB  1 
ATOM   1187  C CG1 . VAL A 1 174 ? -6.789  -15.529 60.399  1.00 60.30  ? 196  VAL A CG1 1 
ATOM   1188  C CG2 . VAL A 1 174 ? -7.150  -16.487 58.116  1.00 56.03  ? 196  VAL A CG2 1 
ATOM   1189  N N   . PHE A 1 175 ? -10.223 -15.932 57.404  1.00 55.13  ? 197  PHE A N   1 
ATOM   1190  C CA  . PHE A 1 175 ? -10.983 -15.335 56.301  1.00 56.27  ? 197  PHE A CA  1 
ATOM   1191  C C   . PHE A 1 175 ? -12.460 -15.703 56.358  1.00 56.25  ? 197  PHE A C   1 
ATOM   1192  O O   . PHE A 1 175 ? -13.268 -15.173 55.595  1.00 55.10  ? 197  PHE A O   1 
ATOM   1193  C CB  . PHE A 1 175 ? -10.405 -15.774 54.953  1.00 55.78  ? 197  PHE A CB  1 
ATOM   1194  C CG  . PHE A 1 175 ? -8.929  -15.528 54.816  1.00 56.39  ? 197  PHE A CG  1 
ATOM   1195  C CD1 . PHE A 1 175 ? -8.398  -14.265 55.027  1.00 57.46  ? 197  PHE A CD1 1 
ATOM   1196  C CD2 . PHE A 1 175 ? -8.072  -16.565 54.486  1.00 55.16  ? 197  PHE A CD2 1 
ATOM   1197  C CE1 . PHE A 1 175 ? -7.037  -14.038 54.903  1.00 55.65  ? 197  PHE A CE1 1 
ATOM   1198  C CE2 . PHE A 1 175 ? -6.710  -16.343 54.360  1.00 56.83  ? 197  PHE A CE2 1 
ATOM   1199  C CZ  . PHE A 1 175 ? -6.195  -15.078 54.571  1.00 57.09  ? 197  PHE A CZ  1 
ATOM   1200  N N   . GLU A 1 176 ? -12.802 -16.615 57.265  1.00 56.41  ? 198  GLU A N   1 
ATOM   1201  C CA  . GLU A 1 176 ? -14.138 -17.184 57.321  1.00 62.01  ? 198  GLU A CA  1 
ATOM   1202  C C   . GLU A 1 176 ? -15.181 -16.104 57.554  1.00 61.92  ? 198  GLU A C   1 
ATOM   1203  O O   . GLU A 1 176 ? -16.333 -16.238 57.142  1.00 62.32  ? 198  GLU A O   1 
ATOM   1204  C CB  . GLU A 1 176 ? -14.225 -18.236 58.428  1.00 68.28  ? 198  GLU A CB  1 
ATOM   1205  C CG  . GLU A 1 176 ? -15.370 -19.214 58.258  1.00 72.33  ? 198  GLU A CG  1 
ATOM   1206  C CD  . GLU A 1 176 ? -15.317 -20.347 59.261  1.00 75.98  ? 198  GLU A CD  1 
ATOM   1207  O OE1 . GLU A 1 176 ? -14.820 -20.122 60.386  1.00 77.96  ? 198  GLU A OE1 1 
ATOM   1208  O OE2 . GLU A 1 176 ? -15.768 -21.463 58.921  1.00 76.47  ? 198  GLU A OE2 1 
ATOM   1209  N N   . THR A 1 177 ? -14.760 -15.025 58.205  1.00 62.37  ? 199  THR A N   1 
ATOM   1210  C CA  . THR A 1 177 ? -15.672 -13.955 58.567  1.00 63.37  ? 199  THR A CA  1 
ATOM   1211  C C   . THR A 1 177 ? -15.772 -12.869 57.512  1.00 63.11  ? 199  THR A C   1 
ATOM   1212  O O   . THR A 1 177 ? -16.558 -11.937 57.672  1.00 50.83  ? 199  THR A O   1 
ATOM   1213  C CB  . THR A 1 177 ? -15.282 -13.301 59.907  1.00 65.15  ? 199  THR A CB  1 
ATOM   1214  O OG1 . THR A 1 177 ? -14.153 -12.437 59.721  1.00 62.00  ? 199  THR A OG1 1 
ATOM   1215  C CG2 . THR A 1 177 ? -14.950 -14.367 60.939  1.00 68.44  ? 199  THR A CG2 1 
ATOM   1216  N N   . LEU A 1 178 ? -15.009 -12.984 56.423  1.00 62.46  ? 200  LEU A N   1 
ATOM   1217  C CA  . LEU A 1 178 ? -15.109 -11.963 55.392  1.00 62.80  ? 200  LEU A CA  1 
ATOM   1218  C C   . LEU A 1 178 ? -16.040 -12.511 54.344  1.00 62.38  ? 200  LEU A C   1 
ATOM   1219  O O   . LEU A 1 178 ? -15.624 -13.228 53.440  1.00 62.21  ? 200  LEU A O   1 
ATOM   1220  C CB  . LEU A 1 178 ? -13.743 -11.730 54.743  1.00 63.50  ? 200  LEU A CB  1 
ATOM   1221  C CG  . LEU A 1 178 ? -12.552 -11.606 55.693  1.00 64.06  ? 200  LEU A CG  1 
ATOM   1222  C CD1 . LEU A 1 178 ? -11.265 -11.398 54.924  1.00 63.43  ? 200  LEU A CD1 1 
ATOM   1223  C CD2 . LEU A 1 178 ? -12.771 -10.483 56.701  1.00 66.98  ? 200  LEU A CD2 1 
ATOM   1224  N N   . THR A 1 179 ? -17.291 -12.076 54.416  1.00 63.94  ? 201  THR A N   1 
ATOM   1225  C CA  . THR A 1 179 ? -18.346 -12.657 53.606  1.00 62.67  ? 201  THR A CA  1 
ATOM   1226  C C   . THR A 1 179 ? -18.511 -11.868 52.319  1.00 60.05  ? 201  THR A C   1 
ATOM   1227  O O   . THR A 1 179 ? -19.212 -12.287 51.401  1.00 60.62  ? 201  THR A O   1 
ATOM   1228  C CB  . THR A 1 179 ? -19.666 -12.730 54.394  1.00 64.56  ? 201  THR A CB  1 
ATOM   1229  O OG1 . THR A 1 179 ? -19.981 -11.438 54.934  1.00 66.85  ? 201  THR A OG1 1 
ATOM   1230  C CG2 . THR A 1 179 ? -19.531 -13.724 55.535  1.00 62.45  ? 201  THR A CG2 1 
ATOM   1231  N N   . ASN A 1 180 ? -17.857 -10.714 52.270  1.00 58.69  ? 202  ASN A N   1 
ATOM   1232  C CA  . ASN A 1 180 ? -17.807 -9.905  51.062  1.00 59.09  ? 202  ASN A CA  1 
ATOM   1233  C C   . ASN A 1 180 ? -16.510 -10.029 50.263  1.00 59.84  ? 202  ASN A C   1 
ATOM   1234  O O   . ASN A 1 180 ? -16.345 -9.362  49.242  1.00 60.12  ? 202  ASN A O   1 
ATOM   1235  C CB  . ASN A 1 180 ? -18.125 -8.445  51.391  1.00 62.02  ? 202  ASN A CB  1 
ATOM   1236  C CG  . ASN A 1 180 ? -19.506 -8.284  52.027  1.00 66.08  ? 202  ASN A CG  1 
ATOM   1237  O OD1 . ASN A 1 180 ? -19.633 -7.861  53.177  1.00 66.27  ? 202  ASN A OD1 1 
ATOM   1238  N ND2 . ASN A 1 180 ? -20.543 -8.645  51.280  1.00 67.71  ? 202  ASN A ND2 1 
ATOM   1239  N N   . LEU A 1 181 ? -15.591 -10.880 50.716  1.00 56.34  ? 203  LEU A N   1 
ATOM   1240  C CA  . LEU A 1 181 ? -14.268 -10.909 50.117  1.00 52.23  ? 203  LEU A CA  1 
ATOM   1241  C C   . LEU A 1 181 ? -14.364 -11.556 48.742  1.00 52.34  ? 203  LEU A C   1 
ATOM   1242  O O   . LEU A 1 181 ? -14.797 -12.701 48.612  1.00 50.20  ? 203  LEU A O   1 
ATOM   1243  C CB  . LEU A 1 181 ? -13.294 -11.693 51.011  1.00 43.64  ? 203  LEU A CB  1 
ATOM   1244  C CG  . LEU A 1 181 ? -11.836 -11.782 50.548  1.00 42.37  ? 203  LEU A CG  1 
ATOM   1245  C CD1 . LEU A 1 181 ? -11.210 -10.398 50.462  1.00 41.94  ? 203  LEU A CD1 1 
ATOM   1246  C CD2 . LEU A 1 181 ? -11.019 -12.684 51.454  1.00 43.03  ? 203  LEU A CD2 1 
ATOM   1247  N N   . GLU A 1 182 ? -14.033 -10.779 47.710  1.00 53.65  ? 204  GLU A N   1 
ATOM   1248  C CA  . GLU A 1 182 ? -13.998 -11.279 46.340  1.00 52.67  ? 204  GLU A CA  1 
ATOM   1249  C C   . GLU A 1 182 ? -12.612 -11.572 45.762  1.00 46.67  ? 204  GLU A C   1 
ATOM   1250  O O   . GLU A 1 182 ? -12.494 -12.297 44.783  1.00 45.23  ? 204  GLU A O   1 
ATOM   1251  C CB  . GLU A 1 182 ? -14.751 -10.304 45.438  1.00 57.25  ? 204  GLU A CB  1 
ATOM   1252  C CG  . GLU A 1 182 ? -16.103 -9.930  46.020  1.00 61.13  ? 204  GLU A CG  1 
ATOM   1253  C CD  . GLU A 1 182 ? -16.877 -8.955  45.158  1.00 62.48  ? 204  GLU A CD  1 
ATOM   1254  O OE1 . GLU A 1 182 ? -16.376 -8.585  44.069  1.00 64.31  ? 204  GLU A OE1 1 
ATOM   1255  O OE2 . GLU A 1 182 ? -17.986 -8.562  45.581  1.00 62.31  ? 204  GLU A OE2 1 
ATOM   1256  N N   . LEU A 1 183 ? -11.567 -11.034 46.382  1.00 44.95  ? 205  LEU A N   1 
ATOM   1257  C CA  . LEU A 1 183 ? -10.204 -11.248 45.905  1.00 43.53  ? 205  LEU A CA  1 
ATOM   1258  C C   . LEU A 1 183 ? -9.226  -11.420 47.061  1.00 45.11  ? 205  LEU A C   1 
ATOM   1259  O O   . LEU A 1 183 ? -9.115  -10.560 47.939  1.00 43.31  ? 205  LEU A O   1 
ATOM   1260  C CB  . LEU A 1 183 ? -9.741  -10.104 44.983  1.00 41.32  ? 205  LEU A CB  1 
ATOM   1261  C CG  . LEU A 1 183 ? -8.442  -10.316 44.184  1.00 42.54  ? 205  LEU A CG  1 
ATOM   1262  C CD1 . LEU A 1 183 ? -8.380  -9.424  42.930  1.00 43.00  ? 205  LEU A CD1 1 
ATOM   1263  C CD2 . LEU A 1 183 ? -7.189  -10.076 45.025  1.00 41.88  ? 205  LEU A CD2 1 
ATOM   1264  N N   . LEU A 1 184 ? -8.487  -12.517 47.017  1.00 46.41  ? 206  LEU A N   1 
ATOM   1265  C CA  . LEU A 1 184 ? -7.483  -12.818 48.014  1.00 48.89  ? 206  LEU A CA  1 
ATOM   1266  C C   . LEU A 1 184 ? -6.217  -13.198 47.264  1.00 48.05  ? 206  LEU A C   1 
ATOM   1267  O O   . LEU A 1 184 ? -6.223  -14.132 46.466  1.00 48.95  ? 206  LEU A O   1 
ATOM   1268  C CB  . LEU A 1 184 ? -7.949  -13.982 48.884  1.00 48.99  ? 206  LEU A CB  1 
ATOM   1269  C CG  . LEU A 1 184 ? -7.037  -14.437 50.027  1.00 46.00  ? 206  LEU A CG  1 
ATOM   1270  C CD1 . LEU A 1 184 ? -6.890  -13.345 51.083  1.00 44.93  ? 206  LEU A CD1 1 
ATOM   1271  C CD2 . LEU A 1 184 ? -7.581  -15.718 50.642  1.00 40.92  ? 206  LEU A CD2 1 
ATOM   1272  N N   . SER A 1 185 ? -5.149  -12.440 47.477  1.00 46.05  ? 207  SER A N   1 
ATOM   1273  C CA  . SER A 1 185 ? -3.874  -12.733 46.846  1.00 43.62  ? 207  SER A CA  1 
ATOM   1274  C C   . SER A 1 185 ? -2.833  -13.072 47.899  1.00 44.54  ? 207  SER A C   1 
ATOM   1275  O O   . SER A 1 185 ? -2.397  -12.202 48.651  1.00 47.54  ? 207  SER A O   1 
ATOM   1276  C CB  . SER A 1 185 ? -3.419  -11.535 46.017  1.00 43.07  ? 207  SER A CB  1 
ATOM   1277  O OG  . SER A 1 185 ? -2.152  -11.768 45.440  1.00 43.20  ? 207  SER A OG  1 
ATOM   1278  N N   . LEU A 1 186 ? -2.486  -14.353 47.976  1.00 44.79  ? 208  LEU A N   1 
ATOM   1279  C CA  . LEU A 1 186 ? -1.467  -14.871 48.895  1.00 44.48  ? 208  LEU A CA  1 
ATOM   1280  C C   . LEU A 1 186 ? -0.112  -15.225 48.261  1.00 43.81  ? 208  LEU A C   1 
ATOM   1281  O O   . LEU A 1 186 ? 0.766   -15.790 48.918  1.00 42.03  ? 208  LEU A O   1 
ATOM   1282  C CB  . LEU A 1 186 ? -2.036  -16.037 49.707  1.00 42.68  ? 208  LEU A CB  1 
ATOM   1283  C CG  . LEU A 1 186 ? -3.285  -15.583 50.472  1.00 46.10  ? 208  LEU A CG  1 
ATOM   1284  C CD1 . LEU A 1 186 ? -4.000  -16.748 51.142  1.00 46.86  ? 208  LEU A CD1 1 
ATOM   1285  C CD2 . LEU A 1 186 ? -2.900  -14.525 51.497  1.00 45.80  ? 208  LEU A CD2 1 
ATOM   1286  N N   . SER A 1 187 ? 0.033   -14.930 46.977  1.00 44.09  ? 209  SER A N   1 
ATOM   1287  C CA  . SER A 1 187 ? 1.186   -15.384 46.205  1.00 41.04  ? 209  SER A CA  1 
ATOM   1288  C C   . SER A 1 187 ? 2.535   -14.960 46.772  1.00 39.75  ? 209  SER A C   1 
ATOM   1289  O O   . SER A 1 187 ? 2.642   -13.955 47.473  1.00 39.31  ? 209  SER A O   1 
ATOM   1290  C CB  . SER A 1 187 ? 1.059   -14.943 44.750  1.00 36.61  ? 209  SER A CB  1 
ATOM   1291  O OG  . SER A 1 187 ? -0.115  -15.490 44.185  1.00 35.64  ? 209  SER A OG  1 
ATOM   1292  N N   . PHE A 1 188 ? 3.551   -15.770 46.491  1.00 37.69  ? 210  PHE A N   1 
ATOM   1293  C CA  . PHE A 1 188 ? 4.918   -15.504 46.947  1.00 41.16  ? 210  PHE A CA  1 
ATOM   1294  C C   . PHE A 1 188 ? 4.990   -15.366 48.465  1.00 40.87  ? 210  PHE A C   1 
ATOM   1295  O O   . PHE A 1 188 ? 5.491   -14.381 49.009  1.00 39.80  ? 210  PHE A O   1 
ATOM   1296  C CB  . PHE A 1 188 ? 5.535   -14.302 46.204  1.00 42.12  ? 210  PHE A CB  1 
ATOM   1297  C CG  . PHE A 1 188 ? 5.727   -14.556 44.731  1.00 39.89  ? 210  PHE A CG  1 
ATOM   1298  C CD1 . PHE A 1 188 ? 4.712   -14.295 43.829  1.00 36.17  ? 210  PHE A CD1 1 
ATOM   1299  C CD2 . PHE A 1 188 ? 6.908   -15.101 44.260  1.00 39.31  ? 210  PHE A CD2 1 
ATOM   1300  C CE1 . PHE A 1 188 ? 4.882   -14.567 42.481  1.00 35.15  ? 210  PHE A CE1 1 
ATOM   1301  C CE2 . PHE A 1 188 ? 7.081   -15.369 42.926  1.00 34.97  ? 210  PHE A CE2 1 
ATOM   1302  C CZ  . PHE A 1 188 ? 6.069   -15.108 42.034  1.00 35.06  ? 210  PHE A CZ  1 
ATOM   1303  N N   . ASN A 1 189 ? 4.445   -16.376 49.128  1.00 41.62  ? 211  ASN A N   1 
ATOM   1304  C CA  . ASN A 1 189 ? 4.564   -16.568 50.563  1.00 42.55  ? 211  ASN A CA  1 
ATOM   1305  C C   . ASN A 1 189 ? 4.713   -18.069 50.720  1.00 42.70  ? 211  ASN A C   1 
ATOM   1306  O O   . ASN A 1 189 ? 4.373   -18.805 49.803  1.00 46.30  ? 211  ASN A O   1 
ATOM   1307  C CB  . ASN A 1 189 ? 3.301   -16.090 51.289  1.00 41.19  ? 211  ASN A CB  1 
ATOM   1308  C CG  . ASN A 1 189 ? 3.139   -14.574 51.263  1.00 42.10  ? 211  ASN A CG  1 
ATOM   1309  O OD1 . ASN A 1 189 ? 3.930   -13.848 51.866  1.00 42.25  ? 211  ASN A OD1 1 
ATOM   1310  N ND2 . ASN A 1 189 ? 2.094   -14.093 50.587  1.00 37.74  ? 211  ASN A ND2 1 
ATOM   1311  N N   . SER A 1 190 ? 5.184   -18.555 51.857  1.00 43.60  ? 212  SER A N   1 
ATOM   1312  C CA  . SER A 1 190 ? 5.259   -20.003 51.977  1.00 47.37  ? 212  SER A CA  1 
ATOM   1313  C C   . SER A 1 190 ? 4.056   -20.492 52.781  1.00 45.27  ? 212  SER A C   1 
ATOM   1314  O O   . SER A 1 190 ? 4.037   -20.398 53.999  1.00 42.92  ? 212  SER A O   1 
ATOM   1315  C CB  . SER A 1 190 ? 6.571   -20.398 52.659  1.00 50.13  ? 212  SER A CB  1 
ATOM   1316  O OG  . SER A 1 190 ? 6.655   -21.799 52.822  1.00 55.26  ? 212  SER A OG  1 
ATOM   1317  N N   . LEU A 1 191 ? 3.053   -21.000 52.066  1.00 46.78  ? 213  LEU A N   1 
ATOM   1318  C CA  . LEU A 1 191 ? 1.826   -21.534 52.665  1.00 52.25  ? 213  LEU A CA  1 
ATOM   1319  C C   . LEU A 1 191 ? 1.888   -23.016 53.031  1.00 55.14  ? 213  LEU A C   1 
ATOM   1320  O O   . LEU A 1 191 ? 1.387   -23.432 54.075  1.00 56.62  ? 213  LEU A O   1 
ATOM   1321  C CB  . LEU A 1 191 ? 0.610   -21.273 51.766  1.00 49.10  ? 213  LEU A CB  1 
ATOM   1322  C CG  . LEU A 1 191 ? 0.365   -19.825 51.321  1.00 48.74  ? 213  LEU A CG  1 
ATOM   1323  C CD1 . LEU A 1 191 ? -1.045  -19.657 50.731  1.00 45.33  ? 213  LEU A CD1 1 
ATOM   1324  C CD2 . LEU A 1 191 ? 0.592   -18.872 52.476  1.00 50.21  ? 213  LEU A CD2 1 
ATOM   1325  N N   . SER A 1 192 ? 2.461   -23.797 52.119  1.00 55.04  ? 214  SER A N   1 
ATOM   1326  C CA  . SER A 1 192 ? 2.516   -25.265 52.187  1.00 57.18  ? 214  SER A CA  1 
ATOM   1327  C C   . SER A 1 192 ? 1.167   -25.971 52.000  1.00 53.67  ? 214  SER A C   1 
ATOM   1328  O O   . SER A 1 192 ? 1.132   -27.149 51.673  1.00 51.09  ? 214  SER A O   1 
ATOM   1329  C CB  . SER A 1 192 ? 3.173   -25.739 53.492  1.00 58.89  ? 214  SER A CB  1 
ATOM   1330  O OG  . SER A 1 192 ? 4.546   -25.403 53.506  1.00 63.12  ? 214  SER A OG  1 
ATOM   1331  N N   . HIS A 1 193 ? 0.064   -25.255 52.173  1.00 55.71  ? 215  HIS A N   1 
ATOM   1332  C CA  . HIS A 1 193 ? -1.236  -25.762 51.742  1.00 59.27  ? 215  HIS A CA  1 
ATOM   1333  C C   . HIS A 1 193 ? -2.237  -24.624 51.640  1.00 54.77  ? 215  HIS A C   1 
ATOM   1334  O O   . HIS A 1 193 ? -2.040  -23.576 52.244  1.00 54.77  ? 215  HIS A O   1 
ATOM   1335  C CB  . HIS A 1 193 ? -1.749  -26.902 52.641  1.00 65.92  ? 215  HIS A CB  1 
ATOM   1336  C CG  . HIS A 1 193 ? -1.982  -26.508 54.065  1.00 71.90  ? 215  HIS A CG  1 
ATOM   1337  N ND1 . HIS A 1 193 ? -0.958  -26.370 54.979  1.00 74.85  ? 215  HIS A ND1 1 
ATOM   1338  C CD2 . HIS A 1 193 ? -3.126  -26.247 54.742  1.00 74.07  ? 215  HIS A CD2 1 
ATOM   1339  C CE1 . HIS A 1 193 ? -1.461  -26.029 56.152  1.00 76.85  ? 215  HIS A CE1 1 
ATOM   1340  N NE2 . HIS A 1 193 ? -2.776  -25.948 56.036  1.00 75.75  ? 215  HIS A NE2 1 
ATOM   1341  N N   . VAL A 1 194 ? -3.311  -24.819 50.887  1.00 52.55  ? 216  VAL A N   1 
ATOM   1342  C CA  . VAL A 1 194 ? -4.311  -23.767 50.800  1.00 52.12  ? 216  VAL A CA  1 
ATOM   1343  C C   . VAL A 1 194 ? -4.983  -23.614 52.166  1.00 52.64  ? 216  VAL A C   1 
ATOM   1344  O O   . VAL A 1 194 ? -5.192  -24.596 52.885  1.00 53.27  ? 216  VAL A O   1 
ATOM   1345  C CB  . VAL A 1 194 ? -5.347  -23.997 49.667  1.00 61.71  ? 216  VAL A CB  1 
ATOM   1346  C CG1 . VAL A 1 194 ? -4.742  -24.826 48.539  1.00 59.49  ? 216  VAL A CG1 1 
ATOM   1347  C CG2 . VAL A 1 194 ? -6.604  -24.647 50.195  1.00 63.75  ? 216  VAL A CG2 1 
ATOM   1348  N N   . PRO A 1 195 ? -5.254  -22.368 52.562  1.00 47.42  ? 217  PRO A N   1 
ATOM   1349  C CA  . PRO A 1 195 ? -5.946  -22.174 53.836  1.00 41.77  ? 217  PRO A CA  1 
ATOM   1350  C C   . PRO A 1 195 ? -7.353  -22.759 53.757  1.00 46.36  ? 217  PRO A C   1 
ATOM   1351  O O   . PRO A 1 195 ? -8.036  -22.586 52.745  1.00 44.02  ? 217  PRO A O   1 
ATOM   1352  C CB  . PRO A 1 195 ? -6.018  -20.651 53.973  1.00 41.03  ? 217  PRO A CB  1 
ATOM   1353  C CG  . PRO A 1 195 ? -4.926  -20.118 53.089  1.00 42.38  ? 217  PRO A CG  1 
ATOM   1354  C CD  . PRO A 1 195 ? -4.769  -21.106 51.969  1.00 41.91  ? 217  PRO A CD  1 
ATOM   1355  N N   . PRO A 1 196 ? -7.773  -23.487 54.801  1.00 48.93  ? 218  PRO A N   1 
ATOM   1356  C CA  . PRO A 1 196 ? -9.156  -23.963 54.840  1.00 49.57  ? 218  PRO A CA  1 
ATOM   1357  C C   . PRO A 1 196 ? -10.096 -22.826 55.214  1.00 53.47  ? 218  PRO A C   1 
ATOM   1358  O O   . PRO A 1 196 ? -9.632  -21.715 55.480  1.00 54.03  ? 218  PRO A O   1 
ATOM   1359  C CB  . PRO A 1 196 ? -9.132  -25.020 55.948  1.00 51.99  ? 218  PRO A CB  1 
ATOM   1360  C CG  . PRO A 1 196 ? -7.957  -24.661 56.807  1.00 51.65  ? 218  PRO A CG  1 
ATOM   1361  C CD  . PRO A 1 196 ? -6.941  -24.078 55.864  1.00 49.46  ? 218  PRO A CD  1 
ATOM   1362  N N   . LYS A 1 197 ? -11.395 -23.107 55.234  1.00 56.91  ? 219  LYS A N   1 
ATOM   1363  C CA  . LYS A 1 197 ? -12.406 -22.118 55.605  1.00 57.01  ? 219  LYS A CA  1 
ATOM   1364  C C   . LYS A 1 197 ? -12.292 -20.804 54.822  1.00 57.10  ? 219  LYS A C   1 
ATOM   1365  O O   . LYS A 1 197 ? -12.227 -19.725 55.409  1.00 59.24  ? 219  LYS A O   1 
ATOM   1366  C CB  . LYS A 1 197 ? -12.369 -21.868 57.114  1.00 58.94  ? 219  LYS A CB  1 
ATOM   1367  C CG  . LYS A 1 197 ? -12.648 -23.135 57.914  1.00 61.72  ? 219  LYS A CG  1 
ATOM   1368  C CD  . LYS A 1 197 ? -12.590 -22.926 59.416  1.00 62.73  ? 219  LYS A CD  1 
ATOM   1369  C CE  . LYS A 1 197 ? -12.607 -24.278 60.121  1.00 64.49  ? 219  LYS A CE  1 
ATOM   1370  N NZ  . LYS A 1 197 ? -12.656 -24.155 61.591  1.00 68.34  ? 219  LYS A NZ  1 
ATOM   1371  N N   . LEU A 1 198 ? -12.254 -20.903 53.496  1.00 52.97  ? 220  LEU A N   1 
ATOM   1372  C CA  . LEU A 1 198 ? -12.308 -19.716 52.649  1.00 48.24  ? 220  LEU A CA  1 
ATOM   1373  C C   . LEU A 1 198 ? -13.763 -19.357 52.367  1.00 49.14  ? 220  LEU A C   1 
ATOM   1374  O O   . LEU A 1 198 ? -14.607 -20.241 52.209  1.00 47.53  ? 220  LEU A O   1 
ATOM   1375  C CB  . LEU A 1 198 ? -11.529 -19.940 51.344  1.00 45.54  ? 220  LEU A CB  1 
ATOM   1376  C CG  . LEU A 1 198 ? -10.026 -20.186 51.535  1.00 41.41  ? 220  LEU A CG  1 
ATOM   1377  C CD1 . LEU A 1 198 ? -9.276  -20.216 50.205  1.00 40.15  ? 220  LEU A CD1 1 
ATOM   1378  C CD2 . LEU A 1 198 ? -9.434  -19.133 52.460  1.00 43.68  ? 220  LEU A CD2 1 
ATOM   1379  N N   . PRO A 1 199 ? -14.066 -18.052 52.327  1.00 49.27  ? 221  PRO A N   1 
ATOM   1380  C CA  . PRO A 1 199 ? -15.423 -17.556 52.062  1.00 49.05  ? 221  PRO A CA  1 
ATOM   1381  C C   . PRO A 1 199 ? -15.890 -17.858 50.641  1.00 45.14  ? 221  PRO A C   1 
ATOM   1382  O O   . PRO A 1 199 ? -15.082 -17.866 49.716  1.00 43.96  ? 221  PRO A O   1 
ATOM   1383  C CB  . PRO A 1 199 ? -15.277 -16.045 52.232  1.00 50.26  ? 221  PRO A CB  1 
ATOM   1384  C CG  . PRO A 1 199 ? -13.822 -15.775 51.971  1.00 48.86  ? 221  PRO A CG  1 
ATOM   1385  C CD  . PRO A 1 199 ? -13.110 -16.954 52.553  1.00 46.45  ? 221  PRO A CD  1 
ATOM   1386  N N   . SER A 1 200 ? -17.190 -18.076 50.472  1.00 46.18  ? 222  SER A N   1 
ATOM   1387  C CA  . SER A 1 200 ? -17.743 -18.513 49.192  1.00 50.05  ? 222  SER A CA  1 
ATOM   1388  C C   . SER A 1 200 ? -18.050 -17.347 48.273  1.00 49.55  ? 222  SER A C   1 
ATOM   1389  O O   . SER A 1 200 ? -18.574 -17.530 47.171  1.00 50.79  ? 222  SER A O   1 
ATOM   1390  C CB  . SER A 1 200 ? -19.001 -19.355 49.407  1.00 53.75  ? 222  SER A CB  1 
ATOM   1391  O OG  . SER A 1 200 ? -19.895 -18.725 50.308  1.00 57.41  ? 222  SER A OG  1 
ATOM   1392  N N   . SER A 1 201 ? -17.725 -16.148 48.736  1.00 49.32  ? 223  SER A N   1 
ATOM   1393  C CA  . SER A 1 201 ? -17.847 -14.943 47.930  1.00 47.44  ? 223  SER A CA  1 
ATOM   1394  C C   . SER A 1 201 ? -16.619 -14.758 47.027  1.00 46.68  ? 223  SER A C   1 
ATOM   1395  O O   . SER A 1 201 ? -16.596 -13.872 46.175  1.00 47.18  ? 223  SER A O   1 
ATOM   1396  C CB  . SER A 1 201 ? -18.005 -13.736 48.850  1.00 47.81  ? 223  SER A CB  1 
ATOM   1397  O OG  . SER A 1 201 ? -17.017 -13.765 49.872  1.00 49.93  ? 223  SER A OG  1 
ATOM   1398  N N   . LEU A 1 202 ? -15.607 -15.599 47.217  1.00 46.59  ? 224  LEU A N   1 
ATOM   1399  C CA  . LEU A 1 202 ? -14.375 -15.510 46.427  1.00 47.21  ? 224  LEU A CA  1 
ATOM   1400  C C   . LEU A 1 202 ? -14.566 -15.645 44.913  1.00 47.63  ? 224  LEU A C   1 
ATOM   1401  O O   . LEU A 1 202 ? -15.234 -16.547 44.413  1.00 47.81  ? 224  LEU A O   1 
ATOM   1402  C CB  . LEU A 1 202 ? -13.306 -16.490 46.923  1.00 45.95  ? 224  LEU A CB  1 
ATOM   1403  C CG  . LEU A 1 202 ? -12.430 -15.970 48.066  1.00 49.16  ? 224  LEU A CG  1 
ATOM   1404  C CD1 . LEU A 1 202 ? -11.283 -16.934 48.338  1.00 49.34  ? 224  LEU A CD1 1 
ATOM   1405  C CD2 . LEU A 1 202 ? -11.900 -14.579 47.744  1.00 48.48  ? 224  LEU A CD2 1 
ATOM   1406  N N   . ARG A 1 203 ? -13.923 -14.732 44.204  1.00 49.94  ? 225  ARG A N   1 
ATOM   1407  C CA  . ARG A 1 203 ? -14.013 -14.602 42.762  1.00 50.57  ? 225  ARG A CA  1 
ATOM   1408  C C   . ARG A 1 203 ? -12.660 -14.979 42.204  1.00 48.84  ? 225  ARG A C   1 
ATOM   1409  O O   . ARG A 1 203 ? -12.548 -15.789 41.280  1.00 49.76  ? 225  ARG A O   1 
ATOM   1410  C CB  . ARG A 1 203 ? -14.372 -13.171 42.370  1.00 52.81  ? 225  ARG A CB  1 
ATOM   1411  C CG  . ARG A 1 203 ? -15.719 -12.699 42.928  1.00 56.59  ? 225  ARG A CG  1 
ATOM   1412  C CD  . ARG A 1 203 ? -16.876 -13.181 42.086  1.00 63.83  ? 225  ARG A CD  1 
ATOM   1413  N NE  . ARG A 1 203 ? -18.149 -13.118 42.800  1.00 74.03  ? 225  ARG A NE  1 
ATOM   1414  C CZ  . ARG A 1 203 ? -19.299 -13.571 42.308  1.00 79.98  ? 225  ARG A CZ  1 
ATOM   1415  N NH1 . ARG A 1 203 ? -19.334 -14.116 41.098  1.00 82.03  ? 225  ARG A NH1 1 
ATOM   1416  N NH2 . ARG A 1 203 ? -20.415 -13.488 43.023  1.00 81.83  ? 225  ARG A NH2 1 
ATOM   1417  N N   . LYS A 1 204 ? -11.638 -14.298 42.706  1.00 49.92  ? 226  LYS A N   1 
ATOM   1418  C CA  . LYS A 1 204 ? -10.262 -14.530 42.289  1.00 48.49  ? 226  LYS A CA  1 
ATOM   1419  C C   . LYS A 1 204 ? -9.398  -14.966 43.473  1.00 44.20  ? 226  LYS A C   1 
ATOM   1420  O O   . LYS A 1 204 ? -9.426  -14.351 44.538  1.00 46.66  ? 226  LYS A O   1 
ATOM   1421  C CB  . LYS A 1 204 ? -9.709  -13.262 41.638  1.00 49.73  ? 226  LYS A CB  1 
ATOM   1422  C CG  . LYS A 1 204 ? -10.571 -12.792 40.478  1.00 50.47  ? 226  LYS A CG  1 
ATOM   1423  C CD  . LYS A 1 204 ? -9.886  -11.749 39.606  1.00 50.24  ? 226  LYS A CD  1 
ATOM   1424  C CE  . LYS A 1 204 ? -10.793 -11.366 38.443  1.00 52.29  ? 226  LYS A CE  1 
ATOM   1425  N NZ  . LYS A 1 204 ? -10.245 -10.218 37.684  1.00 55.41  ? 226  LYS A NZ  1 
ATOM   1426  N N   . LEU A 1 205 ? -8.650  -16.045 43.282  1.00 42.01  ? 227  LEU A N   1 
ATOM   1427  C CA  . LEU A 1 205 ? -7.785  -16.586 44.325  1.00 41.90  ? 227  LEU A CA  1 
ATOM   1428  C C   . LEU A 1 205 ? -6.384  -16.783 43.770  1.00 39.88  ? 227  LEU A C   1 
ATOM   1429  O O   . LEU A 1 205 ? -6.187  -17.616 42.882  1.00 36.74  ? 227  LEU A O   1 
ATOM   1430  C CB  . LEU A 1 205 ? -8.336  -17.926 44.810  1.00 45.07  ? 227  LEU A CB  1 
ATOM   1431  C CG  . LEU A 1 205 ? -7.554  -18.700 45.875  1.00 46.11  ? 227  LEU A CG  1 
ATOM   1432  C CD1 . LEU A 1 205 ? -7.398  -17.880 47.149  1.00 47.32  ? 227  LEU A CD1 1 
ATOM   1433  C CD2 . LEU A 1 205 ? -8.245  -20.021 46.175  1.00 37.36  ? 227  LEU A CD2 1 
ATOM   1434  N N   . PHE A 1 206 ? -5.417  -16.028 44.293  1.00 39.77  ? 228  PHE A N   1 
ATOM   1435  C CA  . PHE A 1 206 ? -4.038  -16.131 43.834  1.00 40.94  ? 228  PHE A CA  1 
ATOM   1436  C C   . PHE A 1 206 ? -3.159  -16.849 44.865  1.00 44.26  ? 228  PHE A C   1 
ATOM   1437  O O   . PHE A 1 206 ? -2.864  -16.322 45.944  1.00 43.88  ? 228  PHE A O   1 
ATOM   1438  C CB  . PHE A 1 206 ? -3.466  -14.742 43.515  1.00 41.33  ? 228  PHE A CB  1 
ATOM   1439  C CG  . PHE A 1 206 ? -4.283  -13.950 42.505  1.00 40.88  ? 228  PHE A CG  1 
ATOM   1440  C CD1 . PHE A 1 206 ? -3.998  -14.025 41.148  1.00 38.18  ? 228  PHE A CD1 1 
ATOM   1441  C CD2 . PHE A 1 206 ? -5.311  -13.107 42.918  1.00 39.13  ? 228  PHE A CD2 1 
ATOM   1442  C CE1 . PHE A 1 206 ? -4.724  -13.290 40.222  1.00 35.43  ? 228  PHE A CE1 1 
ATOM   1443  C CE2 . PHE A 1 206 ? -6.047  -12.364 41.991  1.00 37.45  ? 228  PHE A CE2 1 
ATOM   1444  C CZ  . PHE A 1 206 ? -5.759  -12.459 40.646  1.00 34.97  ? 228  PHE A CZ  1 
ATOM   1445  N N   . LEU A 1 207 ? -2.815  -18.088 44.524  1.00 44.00  ? 229  LEU A N   1 
ATOM   1446  C CA  . LEU A 1 207 ? -1.901  -18.964 45.263  1.00 39.84  ? 229  LEU A CA  1 
ATOM   1447  C C   . LEU A 1 207 ? -0.484  -19.172 44.665  1.00 45.25  ? 229  LEU A C   1 
ATOM   1448  O O   . LEU A 1 207 ? 0.181   -20.150 44.992  1.00 42.34  ? 229  LEU A O   1 
ATOM   1449  C CB  . LEU A 1 207 ? -2.591  -20.276 45.635  1.00 39.33  ? 229  LEU A CB  1 
ATOM   1450  C CG  . LEU A 1 207 ? -3.831  -20.022 46.512  1.00 41.99  ? 229  LEU A CG  1 
ATOM   1451  C CD1 . LEU A 1 207 ? -4.729  -21.254 46.627  1.00 40.85  ? 229  LEU A CD1 1 
ATOM   1452  C CD2 . LEU A 1 207 ? -3.435  -19.517 47.900  1.00 42.82  ? 229  LEU A CD2 1 
ATOM   1453  N N   . SER A 1 208 ? -0.080  -18.357 43.694  1.00 44.14  ? 230  SER A N   1 
ATOM   1454  C CA  . SER A 1 208 ? 1.203   -18.583 43.015  1.00 41.31  ? 230  SER A CA  1 
ATOM   1455  C C   . SER A 1 208 ? 2.445   -18.622 43.927  1.00 43.13  ? 230  SER A C   1 
ATOM   1456  O O   . SER A 1 208 ? 2.527   -17.906 44.927  1.00 45.87  ? 230  SER A O   1 
ATOM   1457  C CB  . SER A 1 208 ? 1.411   -17.576 41.882  1.00 38.12  ? 230  SER A CB  1 
ATOM   1458  O OG  . SER A 1 208 ? 2.658   -17.800 41.228  1.00 37.11  ? 230  SER A OG  1 
ATOM   1459  N N   . ASN A 1 209 ? 3.398   -19.474 43.565  1.00 40.28  ? 231  ASN A N   1 
ATOM   1460  C CA  . ASN A 1 209 ? 4.651   -19.620 44.307  1.00 40.69  ? 231  ASN A CA  1 
ATOM   1461  C C   . ASN A 1 209 ? 4.436   -19.744 45.829  1.00 39.37  ? 231  ASN A C   1 
ATOM   1462  O O   . ASN A 1 209 ? 5.027   -19.006 46.613  1.00 35.49  ? 231  ASN A O   1 
ATOM   1463  C CB  . ASN A 1 209 ? 5.601   -18.462 43.970  1.00 40.23  ? 231  ASN A CB  1 
ATOM   1464  C CG  . ASN A 1 209 ? 6.146   -18.544 42.543  1.00 41.34  ? 231  ASN A CG  1 
ATOM   1465  O OD1 . ASN A 1 209 ? 7.341   -18.746 42.333  1.00 42.09  ? 231  ASN A OD1 1 
ATOM   1466  N ND2 . ASN A 1 209 ? 5.265   -18.394 41.560  1.00 43.34  ? 231  ASN A ND2 1 
ATOM   1467  N N   . THR A 1 210 ? 3.517   -20.616 46.231  1.00 41.55  ? 232  THR A N   1 
ATOM   1468  C CA  . THR A 1 210 ? 3.230   -20.816 47.658  1.00 42.83  ? 232  THR A CA  1 
ATOM   1469  C C   . THR A 1 210 ? 3.811   -22.057 48.337  1.00 46.88  ? 232  THR A C   1 
ATOM   1470  O O   . THR A 1 210 ? 3.568   -22.278 49.516  1.00 46.76  ? 232  THR A O   1 
ATOM   1471  C CB  . THR A 1 210 ? 1.730   -20.695 47.976  1.00 39.07  ? 232  THR A CB  1 
ATOM   1472  O OG1 . THR A 1 210 ? 0.981   -21.591 47.146  1.00 37.79  ? 232  THR A OG1 1 
ATOM   1473  C CG2 . THR A 1 210 ? 1.277   -19.269 47.735  1.00 35.55  ? 232  THR A CG2 1 
ATOM   1474  N N   . GLN A 1 211 ? 4.556   -22.858 47.585  1.00 51.23  ? 233  GLN A N   1 
ATOM   1475  C CA  . GLN A 1 211 ? 5.094   -24.129 48.071  1.00 51.61  ? 233  GLN A CA  1 
ATOM   1476  C C   . GLN A 1 211 ? 3.996   -25.126 48.429  1.00 53.61  ? 233  GLN A C   1 
ATOM   1477  O O   . GLN A 1 211 ? 4.140   -25.912 49.364  1.00 57.94  ? 233  GLN A O   1 
ATOM   1478  C CB  . GLN A 1 211 ? 6.082   -23.919 49.232  1.00 53.10  ? 233  GLN A CB  1 
ATOM   1479  C CG  . GLN A 1 211 ? 7.255   -23.015 48.853  1.00 53.52  ? 233  GLN A CG  1 
ATOM   1480  C CD  . GLN A 1 211 ? 8.283   -22.858 49.953  1.00 58.38  ? 233  GLN A CD  1 
ATOM   1481  O OE1 . GLN A 1 211 ? 8.248   -23.557 50.962  1.00 62.58  ? 233  GLN A OE1 1 
ATOM   1482  N NE2 . GLN A 1 211 ? 9.215   -21.933 49.758  1.00 60.11  ? 233  GLN A NE2 1 
ATOM   1483  N N   . ILE A 1 212 ? 2.904   -25.096 47.667  1.00 51.09  ? 234  ILE A N   1 
ATOM   1484  C CA  . ILE A 1 212 ? 1.807   -26.041 47.852  1.00 49.43  ? 234  ILE A CA  1 
ATOM   1485  C C   . ILE A 1 212 ? 2.007   -27.244 46.954  1.00 52.38  ? 234  ILE A C   1 
ATOM   1486  O O   . ILE A 1 212 ? 1.890   -27.139 45.734  1.00 57.44  ? 234  ILE A O   1 
ATOM   1487  C CB  . ILE A 1 212 ? 0.439   -25.393 47.516  1.00 45.80  ? 234  ILE A CB  1 
ATOM   1488  C CG1 . ILE A 1 212 ? 0.056   -24.379 48.597  1.00 42.22  ? 234  ILE A CG1 1 
ATOM   1489  C CG2 . ILE A 1 212 ? -0.651  -26.455 47.409  1.00 47.75  ? 234  ILE A CG2 1 
ATOM   1490  C CD1 . ILE A 1 212 ? -1.195  -23.595 48.295  1.00 40.49  ? 234  ILE A CD1 1 
ATOM   1491  N N   . LYS A 1 213 ? 2.305   -28.389 47.556  1.00 52.57  ? 235  LYS A N   1 
ATOM   1492  C CA  . LYS A 1 213 ? 2.598   -29.602 46.795  1.00 54.53  ? 235  LYS A CA  1 
ATOM   1493  C C   . LYS A 1 213 ? 1.338   -30.297 46.298  1.00 50.11  ? 235  LYS A C   1 
ATOM   1494  O O   . LYS A 1 213 ? 1.312   -30.840 45.194  1.00 43.84  ? 235  LYS A O   1 
ATOM   1495  C CB  . LYS A 1 213 ? 3.414   -30.574 47.650  1.00 64.39  ? 235  LYS A CB  1 
ATOM   1496  C CG  . LYS A 1 213 ? 3.447   -32.018 47.142  1.00 73.42  ? 235  LYS A CG  1 
ATOM   1497  C CD  . LYS A 1 213 ? 4.149   -32.132 45.786  1.00 79.16  ? 235  LYS A CD  1 
ATOM   1498  C CE  . LYS A 1 213 ? 4.431   -33.585 45.409  1.00 83.97  ? 235  LYS A CE  1 
ATOM   1499  N NZ  . LYS A 1 213 ? 3.185   -34.406 45.308  1.00 86.76  ? 235  LYS A NZ  1 
ATOM   1500  N N   . TYR A 1 214 ? 0.297   -30.279 47.123  1.00 53.47  ? 236  TYR A N   1 
ATOM   1501  C CA  . TYR A 1 214 ? -0.873  -31.108 46.878  1.00 56.47  ? 236  TYR A CA  1 
ATOM   1502  C C   . TYR A 1 214 ? -2.163  -30.304 46.955  1.00 55.34  ? 236  TYR A C   1 
ATOM   1503  O O   . TYR A 1 214 ? -2.348  -29.479 47.849  1.00 56.17  ? 236  TYR A O   1 
ATOM   1504  C CB  . TYR A 1 214 ? -0.890  -32.285 47.866  1.00 59.88  ? 236  TYR A CB  1 
ATOM   1505  C CG  . TYR A 1 214 ? -2.147  -33.123 47.832  1.00 66.20  ? 236  TYR A CG  1 
ATOM   1506  C CD1 . TYR A 1 214 ? -2.474  -33.884 46.713  1.00 67.46  ? 236  TYR A CD1 1 
ATOM   1507  C CD2 . TYR A 1 214 ? -3.003  -33.168 48.931  1.00 69.61  ? 236  TYR A CD2 1 
ATOM   1508  C CE1 . TYR A 1 214 ? -3.632  -34.658 46.685  1.00 69.49  ? 236  TYR A CE1 1 
ATOM   1509  C CE2 . TYR A 1 214 ? -4.160  -33.940 48.917  1.00 69.38  ? 236  TYR A CE2 1 
ATOM   1510  C CZ  . TYR A 1 214 ? -4.471  -34.683 47.794  1.00 70.63  ? 236  TYR A CZ  1 
ATOM   1511  O OH  . TYR A 1 214 ? -5.621  -35.448 47.784  1.00 71.56  ? 236  TYR A OH  1 
ATOM   1512  N N   . ILE A 1 215 ? -3.048  -30.531 45.995  1.00 52.43  ? 237  ILE A N   1 
ATOM   1513  C CA  . ILE A 1 215 ? -4.371  -29.936 46.043  1.00 48.75  ? 237  ILE A CA  1 
ATOM   1514  C C   . ILE A 1 215 ? -5.388  -31.046 46.254  1.00 50.39  ? 237  ILE A C   1 
ATOM   1515  O O   . ILE A 1 215 ? -5.524  -31.930 45.411  1.00 51.16  ? 237  ILE A O   1 
ATOM   1516  C CB  . ILE A 1 215 ? -4.710  -29.180 44.745  1.00 43.49  ? 237  ILE A CB  1 
ATOM   1517  C CG1 . ILE A 1 215 ? -3.684  -28.066 44.480  1.00 42.32  ? 237  ILE A CG1 1 
ATOM   1518  C CG2 . ILE A 1 215 ? -6.120  -28.620 44.831  1.00 42.20  ? 237  ILE A CG2 1 
ATOM   1519  C CD1 . ILE A 1 215 ? -3.765  -26.906 45.462  1.00 39.71  ? 237  ILE A CD1 1 
ATOM   1520  N N   . SER A 1 216 ? -6.100  -30.997 47.377  1.00 51.06  ? 238  SER A N   1 
ATOM   1521  C CA  . SER A 1 216 ? -7.053  -32.050 47.714  1.00 53.66  ? 238  SER A CA  1 
ATOM   1522  C C   . SER A 1 216 ? -8.413  -31.691 47.177  1.00 56.87  ? 238  SER A C   1 
ATOM   1523  O O   . SER A 1 216 ? -8.611  -30.588 46.674  1.00 58.75  ? 238  SER A O   1 
ATOM   1524  C CB  . SER A 1 216 ? -7.145  -32.222 49.227  1.00 51.91  ? 238  SER A CB  1 
ATOM   1525  O OG  . SER A 1 216 ? -7.670  -31.049 49.819  1.00 52.55  ? 238  SER A OG  1 
ATOM   1526  N N   . GLU A 1 217 ? -9.367  -32.598 47.327  1.00 60.26  ? 239  GLU A N   1 
ATOM   1527  C CA  . GLU A 1 217 ? -10.679 -32.380 46.740  1.00 65.77  ? 239  GLU A CA  1 
ATOM   1528  C C   . GLU A 1 217 ? -11.507 -31.417 47.580  1.00 65.31  ? 239  GLU A C   1 
ATOM   1529  O O   . GLU A 1 217 ? -12.494 -30.861 47.104  1.00 65.67  ? 239  GLU A O   1 
ATOM   1530  C CB  . GLU A 1 217 ? -11.417 -33.705 46.518  1.00 72.03  ? 239  GLU A CB  1 
ATOM   1531  C CG  . GLU A 1 217 ? -11.636 -34.528 47.768  1.00 80.76  ? 239  GLU A CG  1 
ATOM   1532  C CD  . GLU A 1 217 ? -12.301 -35.864 47.473  1.00 88.55  ? 239  GLU A CD  1 
ATOM   1533  O OE1 . GLU A 1 217 ? -12.755 -36.062 46.324  1.00 89.84  ? 239  GLU A OE1 1 
ATOM   1534  O OE2 . GLU A 1 217 ? -12.369 -36.716 48.390  1.00 91.20  ? 239  GLU A OE2 1 
ATOM   1535  N N   . GLU A 1 218 ? -11.103 -31.219 48.830  1.00 65.07  ? 240  GLU A N   1 
ATOM   1536  C CA  . GLU A 1 218 ? -11.820 -30.298 49.712  1.00 65.77  ? 240  GLU A CA  1 
ATOM   1537  C C   . GLU A 1 218 ? -11.201 -28.898 49.807  1.00 61.22  ? 240  GLU A C   1 
ATOM   1538  O O   . GLU A 1 218 ? -11.747 -28.018 50.467  1.00 60.89  ? 240  GLU A O   1 
ATOM   1539  C CB  . GLU A 1 218 ? -11.992 -30.904 51.107  1.00 70.73  ? 240  GLU A CB  1 
ATOM   1540  C CG  . GLU A 1 218 ? -12.757 -32.219 51.103  1.00 78.17  ? 240  GLU A CG  1 
ATOM   1541  C CD  . GLU A 1 218 ? -13.478 -32.478 52.413  1.00 85.89  ? 240  GLU A CD  1 
ATOM   1542  O OE1 . GLU A 1 218 ? -13.239 -31.720 53.381  1.00 87.83  ? 240  GLU A OE1 1 
ATOM   1543  O OE2 . GLU A 1 218 ? -14.292 -33.430 52.472  1.00 88.61  ? 240  GLU A OE2 1 
ATOM   1544  N N   . ASP A 1 219 ? -10.069 -28.687 49.148  1.00 58.73  ? 241  ASP A N   1 
ATOM   1545  C CA  . ASP A 1 219 ? -9.428  -27.378 49.192  1.00 59.85  ? 241  ASP A CA  1 
ATOM   1546  C C   . ASP A 1 219 ? -10.335 -26.284 48.616  1.00 58.60  ? 241  ASP A C   1 
ATOM   1547  O O   . ASP A 1 219 ? -10.517 -25.227 49.218  1.00 58.44  ? 241  ASP A O   1 
ATOM   1548  C CB  . ASP A 1 219 ? -8.081  -27.409 48.462  1.00 61.54  ? 241  ASP A CB  1 
ATOM   1549  C CG  . ASP A 1 219 ? -6.968  -28.014 49.309  1.00 62.91  ? 241  ASP A CG  1 
ATOM   1550  O OD1 . ASP A 1 219 ? -7.086  -27.993 50.556  1.00 64.64  ? 241  ASP A OD1 1 
ATOM   1551  O OD2 . ASP A 1 219 ? -5.971  -28.500 48.732  1.00 60.60  ? 241  ASP A OD2 1 
ATOM   1552  N N   . PHE A 1 220 ? -10.869 -26.531 47.428  1.00 57.24  ? 242  PHE A N   1 
ATOM   1553  C CA  . PHE A 1 220 ? -11.744 -25.572 46.759  1.00 58.03  ? 242  PHE A CA  1 
ATOM   1554  C C   . PHE A 1 220 ? -13.255 -25.836 46.772  1.00 63.15  ? 242  PHE A C   1 
ATOM   1555  O O   . PHE A 1 220 ? -14.019 -25.044 46.219  1.00 62.46  ? 242  PHE A O   1 
ATOM   1556  C CB  . PHE A 1 220 ? -11.230 -25.346 45.344  1.00 52.84  ? 242  PHE A CB  1 
ATOM   1557  C CG  . PHE A 1 220 ? -9.778  -24.978 45.302  1.00 49.91  ? 242  PHE A CG  1 
ATOM   1558  C CD1 . PHE A 1 220 ? -9.298  -23.936 46.082  1.00 51.09  ? 242  PHE A CD1 1 
ATOM   1559  C CD2 . PHE A 1 220 ? -8.884  -25.689 44.512  1.00 48.83  ? 242  PHE A CD2 1 
ATOM   1560  C CE1 . PHE A 1 220 ? -7.954  -23.586 46.056  1.00 50.21  ? 242  PHE A CE1 1 
ATOM   1561  C CE2 . PHE A 1 220 ? -7.540  -25.346 44.479  1.00 48.61  ? 242  PHE A CE2 1 
ATOM   1562  C CZ  . PHE A 1 220 ? -7.073  -24.294 45.251  1.00 48.25  ? 242  PHE A CZ  1 
ATOM   1563  N N   . LYS A 1 221 ? -13.685 -26.935 47.392  1.00 67.83  ? 243  LYS A N   1 
ATOM   1564  C CA  . LYS A 1 221 ? -15.055 -27.444 47.210  1.00 69.38  ? 243  LYS A CA  1 
ATOM   1565  C C   . LYS A 1 221 ? -16.184 -26.429 47.471  1.00 66.86  ? 243  LYS A C   1 
ATOM   1566  O O   . LYS A 1 221 ? -17.298 -26.573 46.959  1.00 66.79  ? 243  LYS A O   1 
ATOM   1567  C CB  . LYS A 1 221 ? -15.283 -28.713 48.046  1.00 74.24  ? 243  LYS A CB  1 
ATOM   1568  C CG  . LYS A 1 221 ? -16.552 -29.469 47.665  1.00 77.63  ? 243  LYS A CG  1 
ATOM   1569  C CD  . LYS A 1 221 ? -16.791 -30.705 48.512  1.00 79.99  ? 243  LYS A CD  1 
ATOM   1570  C CE  . LYS A 1 221 ? -18.167 -31.293 48.200  1.00 83.24  ? 243  LYS A CE  1 
ATOM   1571  N NZ  . LYS A 1 221 ? -18.453 -32.550 48.942  1.00 85.04  ? 243  LYS A NZ  1 
ATOM   1572  N N   . GLY A 1 222 ? -15.900 -25.402 48.260  1.00 63.17  ? 244  GLY A N   1 
ATOM   1573  C CA  . GLY A 1 222 ? -16.921 -24.427 48.583  1.00 59.24  ? 244  GLY A CA  1 
ATOM   1574  C C   . GLY A 1 222 ? -16.908 -23.154 47.756  1.00 56.82  ? 244  GLY A C   1 
ATOM   1575  O O   . GLY A 1 222 ? -17.701 -22.256 48.016  1.00 55.73  ? 244  GLY A O   1 
ATOM   1576  N N   . LEU A 1 223 ? -16.030 -23.040 46.763  1.00 54.99  ? 245  LEU A N   1 
ATOM   1577  C CA  . LEU A 1 223 ? -16.011 -21.778 46.032  1.00 56.45  ? 245  LEU A CA  1 
ATOM   1578  C C   . LEU A 1 223 ? -16.737 -21.908 44.705  1.00 55.71  ? 245  LEU A C   1 
ATOM   1579  O O   . LEU A 1 223 ? -16.135 -22.220 43.675  1.00 56.88  ? 245  LEU A O   1 
ATOM   1580  C CB  . LEU A 1 223 ? -14.560 -21.352 45.788  1.00 52.72  ? 245  LEU A CB  1 
ATOM   1581  C CG  . LEU A 1 223 ? -13.674 -21.496 47.028  1.00 51.25  ? 245  LEU A CG  1 
ATOM   1582  C CD1 . LEU A 1 223 ? -12.213 -21.150 46.721  1.00 47.55  ? 245  LEU A CD1 1 
ATOM   1583  C CD2 . LEU A 1 223 ? -14.227 -20.639 48.164  1.00 50.19  ? 245  LEU A CD2 1 
ATOM   1584  N N   . ILE A 1 224 ? -18.002 -21.509 44.712  1.00 52.53  ? 246  ILE A N   1 
ATOM   1585  C CA  . ILE A 1 224 ? -18.842 -21.640 43.534  1.00 50.64  ? 246  ILE A CA  1 
ATOM   1586  C C   . ILE A 1 224 ? -18.878 -20.364 42.706  1.00 49.57  ? 246  ILE A C   1 
ATOM   1587  O O   . ILE A 1 224 ? -19.374 -20.362 41.580  1.00 52.91  ? 246  ILE A O   1 
ATOM   1588  C CB  . ILE A 1 224 ? -20.277 -22.036 43.922  1.00 49.90  ? 246  ILE A CB  1 
ATOM   1589  C CG1 . ILE A 1 224 ? -20.843 -21.055 44.967  1.00 48.94  ? 246  ILE A CG1 1 
ATOM   1590  C CG2 . ILE A 1 224 ? -20.291 -23.470 44.425  1.00 47.11  ? 246  ILE A CG2 1 
ATOM   1591  C CD1 . ILE A 1 224 ? -22.178 -21.484 45.519  1.00 51.55  ? 246  ILE A CD1 1 
ATOM   1592  N N   . ASN A 1 225 ? -18.341 -19.279 43.256  1.00 49.05  ? 247  ASN A N   1 
ATOM   1593  C CA  . ASN A 1 225 ? -18.210 -18.042 42.490  1.00 52.61  ? 247  ASN A CA  1 
ATOM   1594  C C   . ASN A 1 225 ? -16.828 -17.762 41.887  1.00 49.51  ? 247  ASN A C   1 
ATOM   1595  O O   . ASN A 1 225 ? -16.633 -16.721 41.261  1.00 53.09  ? 247  ASN A O   1 
ATOM   1596  C CB  . ASN A 1 225 ? -18.726 -16.852 43.296  1.00 55.75  ? 247  ASN A CB  1 
ATOM   1597  C CG  . ASN A 1 225 ? -20.235 -16.867 43.429  1.00 62.34  ? 247  ASN A CG  1 
ATOM   1598  O OD1 . ASN A 1 225 ? -20.922 -17.554 42.676  1.00 62.31  ? 247  ASN A OD1 1 
ATOM   1599  N ND2 . ASN A 1 225 ? -20.759 -16.114 44.390  1.00 67.55  ? 247  ASN A ND2 1 
ATOM   1600  N N   . LEU A 1 226 ? -15.877 -18.679 42.066  1.00 44.85  ? 248  LEU A N   1 
ATOM   1601  C CA  . LEU A 1 226 ? -14.513 -18.425 41.595  1.00 46.88  ? 248  LEU A CA  1 
ATOM   1602  C C   . LEU A 1 226 ? -14.474 -18.258 40.082  1.00 49.74  ? 248  LEU A C   1 
ATOM   1603  O O   . LEU A 1 226 ? -14.846 -19.162 39.337  1.00 48.80  ? 248  LEU A O   1 
ATOM   1604  C CB  . LEU A 1 226 ? -13.590 -19.590 41.965  1.00 47.94  ? 248  LEU A CB  1 
ATOM   1605  C CG  . LEU A 1 226 ? -12.542 -19.474 43.078  1.00 51.63  ? 248  LEU A CG  1 
ATOM   1606  C CD1 . LEU A 1 226 ? -11.336 -20.370 42.763  1.00 50.84  ? 248  LEU A CD1 1 
ATOM   1607  C CD2 . LEU A 1 226 ? -12.099 -18.038 43.336  1.00 38.63  ? 248  LEU A CD2 1 
ATOM   1608  N N   . THR A 1 227 ? -14.031 -17.085 39.640  1.00 51.66  ? 249  THR A N   1 
ATOM   1609  C CA  . THR A 1 227 ? -13.719 -16.829 38.236  1.00 49.66  ? 249  THR A CA  1 
ATOM   1610  C C   . THR A 1 227 ? -12.286 -17.165 37.853  1.00 47.91  ? 249  THR A C   1 
ATOM   1611  O O   . THR A 1 227 ? -12.025 -17.637 36.748  1.00 48.93  ? 249  THR A O   1 
ATOM   1612  C CB  . THR A 1 227 ? -14.070 -15.400 37.846  1.00 47.63  ? 249  THR A CB  1 
ATOM   1613  O OG1 . THR A 1 227 ? -13.292 -14.497 38.636  1.00 50.62  ? 249  THR A OG1 1 
ATOM   1614  C CG2 . THR A 1 227 ? -15.543 -15.159 38.134  1.00 46.07  ? 249  THR A CG2 1 
ATOM   1615  N N   . LEU A 1 228 ? -11.349 -16.874 38.751  1.00 47.65  ? 250  LEU A N   1 
ATOM   1616  C CA  . LEU A 1 228 ? -9.941  -17.170 38.490  1.00 45.95  ? 250  LEU A CA  1 
ATOM   1617  C C   . LEU A 1 228 ? -9.272  -17.935 39.620  1.00 43.93  ? 250  LEU A C   1 
ATOM   1618  O O   . LEU A 1 228 ? -9.489  -17.652 40.811  1.00 35.72  ? 250  LEU A O   1 
ATOM   1619  C CB  . LEU A 1 228 ? -9.146  -15.901 38.105  1.00 48.13  ? 250  LEU A CB  1 
ATOM   1620  C CG  . LEU A 1 228 ? -7.827  -15.313 38.671  1.00 39.20  ? 250  LEU A CG  1 
ATOM   1621  C CD1 . LEU A 1 228 ? -6.744  -16.262 39.113  1.00 38.74  ? 250  LEU A CD1 1 
ATOM   1622  C CD2 . LEU A 1 228 ? -7.212  -14.363 37.629  1.00 33.97  ? 250  LEU A CD2 1 
ATOM   1623  N N   . LEU A 1 229 ? -8.432  -18.886 39.218  1.00 39.85  ? 251  LEU A N   1 
ATOM   1624  C CA  . LEU A 1 229 ? -7.606  -19.633 40.150  1.00 41.00  ? 251  LEU A CA  1 
ATOM   1625  C C   . LEU A 1 229 ? -6.144  -19.653 39.670  1.00 41.09  ? 251  LEU A C   1 
ATOM   1626  O O   . LEU A 1 229 ? -5.831  -20.135 38.575  1.00 44.09  ? 251  LEU A O   1 
ATOM   1627  C CB  . LEU A 1 229 ? -8.153  -21.050 40.321  1.00 35.17  ? 251  LEU A CB  1 
ATOM   1628  C CG  . LEU A 1 229 ? -7.378  -21.996 41.246  1.00 37.37  ? 251  LEU A CG  1 
ATOM   1629  C CD1 . LEU A 1 229 ? -7.336  -21.452 42.673  1.00 38.53  ? 251  LEU A CD1 1 
ATOM   1630  C CD2 . LEU A 1 229 ? -7.981  -23.401 41.226  1.00 35.96  ? 251  LEU A CD2 1 
ATOM   1631  N N   . ASP A 1 230 ? -5.248  -19.126 40.493  1.00 38.39  ? 252  ASP A N   1 
ATOM   1632  C CA  . ASP A 1 230 ? -3.832  -19.134 40.160  1.00 36.86  ? 252  ASP A CA  1 
ATOM   1633  C C   . ASP A 1 230 ? -3.066  -20.077 41.076  1.00 38.14  ? 252  ASP A C   1 
ATOM   1634  O O   . ASP A 1 230 ? -2.829  -19.762 42.243  1.00 37.47  ? 252  ASP A O   1 
ATOM   1635  C CB  . ASP A 1 230 ? -3.284  -17.722 40.317  1.00 37.45  ? 252  ASP A CB  1 
ATOM   1636  C CG  . ASP A 1 230 ? -1.862  -17.590 39.821  1.00 38.96  ? 252  ASP A CG  1 
ATOM   1637  O OD1 . ASP A 1 230 ? -1.308  -18.579 39.291  1.00 41.25  ? 252  ASP A OD1 1 
ATOM   1638  O OD2 . ASP A 1 230 ? -1.304  -16.483 39.953  1.00 36.70  ? 252  ASP A OD2 1 
ATOM   1639  N N   . LEU A 1 231 ? -2.704  -21.237 40.528  1.00 40.63  ? 253  LEU A N   1 
ATOM   1640  C CA  . LEU A 1 231 ? -1.845  -22.243 41.174  1.00 42.43  ? 253  LEU A CA  1 
ATOM   1641  C C   . LEU A 1 231 ? -0.382  -22.286 40.708  1.00 43.01  ? 253  LEU A C   1 
ATOM   1642  O O   . LEU A 1 231 ? 0.343   -23.225 41.042  1.00 43.12  ? 253  LEU A O   1 
ATOM   1643  C CB  . LEU A 1 231 ? -2.459  -23.643 41.081  1.00 42.86  ? 253  LEU A CB  1 
ATOM   1644  C CG  . LEU A 1 231 ? -3.702  -23.864 41.941  1.00 40.15  ? 253  LEU A CG  1 
ATOM   1645  C CD1 . LEU A 1 231 ? -4.168  -25.288 41.786  1.00 40.71  ? 253  LEU A CD1 1 
ATOM   1646  C CD2 . LEU A 1 231 ? -3.425  -23.525 43.397  1.00 36.49  ? 253  LEU A CD2 1 
ATOM   1647  N N   . SER A 1 232 ? 0.017   -21.326 39.882  1.00 40.45  ? 254  SER A N   1 
ATOM   1648  C CA  . SER A 1 232 ? 1.321   -21.357 39.228  1.00 40.53  ? 254  SER A CA  1 
ATOM   1649  C C   . SER A 1 232 ? 2.505   -21.369 40.194  1.00 38.56  ? 254  SER A C   1 
ATOM   1650  O O   . SER A 1 232 ? 2.388   -20.921 41.342  1.00 36.22  ? 254  SER A O   1 
ATOM   1651  C CB  . SER A 1 232 ? 1.463   -20.203 38.210  1.00 39.85  ? 254  SER A CB  1 
ATOM   1652  O OG  . SER A 1 232 ? 1.634   -18.949 38.851  1.00 38.19  ? 254  SER A OG  1 
ATOM   1653  N N   . GLY A 1 233 ? 3.626   -21.928 39.728  1.00 33.14  ? 255  GLY A N   1 
ATOM   1654  C CA  . GLY A 1 233 ? 4.874   -21.889 40.473  1.00 32.67  ? 255  GLY A CA  1 
ATOM   1655  C C   . GLY A 1 233 ? 4.925   -22.796 41.696  1.00 34.23  ? 255  GLY A C   1 
ATOM   1656  O O   . GLY A 1 233 ? 5.818   -22.674 42.539  1.00 33.80  ? 255  GLY A O   1 
ATOM   1657  N N   . ASN A 1 234 ? 3.961   -23.704 41.800  1.00 33.28  ? 256  ASN A N   1 
ATOM   1658  C CA  . ASN A 1 234 ? 3.987   -24.730 42.837  1.00 37.07  ? 256  ASN A CA  1 
ATOM   1659  C C   . ASN A 1 234 ? 4.515   -26.034 42.262  1.00 38.49  ? 256  ASN A C   1 
ATOM   1660  O O   . ASN A 1 234 ? 3.964   -26.548 41.289  1.00 40.95  ? 256  ASN A O   1 
ATOM   1661  C CB  . ASN A 1 234 ? 2.591   -24.906 43.436  1.00 38.66  ? 256  ASN A CB  1 
ATOM   1662  C CG  . ASN A 1 234 ? 2.125   -23.657 44.139  1.00 43.35  ? 256  ASN A CG  1 
ATOM   1663  O OD1 . ASN A 1 234 ? 2.793   -23.177 45.061  1.00 46.53  ? 256  ASN A OD1 1 
ATOM   1664  N ND2 . ASN A 1 234 ? 1.010   -23.081 43.673  1.00 40.31  ? 256  ASN A ND2 1 
ATOM   1665  N N   . CYS A 1 235 ? 5.579   -26.560 42.871  1.00 36.58  ? 257  CYS A N   1 
ATOM   1666  C CA  . CYS A 1 235 ? 6.425   -27.553 42.215  1.00 35.38  ? 257  CYS A CA  1 
ATOM   1667  C C   . CYS A 1 235 ? 6.906   -26.983 40.874  1.00 36.91  ? 257  CYS A C   1 
ATOM   1668  O O   . CYS A 1 235 ? 6.519   -27.478 39.820  1.00 37.10  ? 257  CYS A O   1 
ATOM   1669  C CB  . CYS A 1 235 ? 5.665   -28.861 41.979  1.00 36.55  ? 257  CYS A CB  1 
ATOM   1670  S SG  . CYS A 1 235 ? 5.122   -29.702 43.487  1.00 49.65  ? 257  CYS A SG  1 
ATOM   1671  N N   . PRO A 1 236 ? 7.743   -25.932 40.914  1.00 36.52  ? 258  PRO A N   1 
ATOM   1672  C CA  . PRO A 1 236 ? 8.143   -25.229 39.691  1.00 36.21  ? 258  PRO A CA  1 
ATOM   1673  C C   . PRO A 1 236 ? 9.176   -25.995 38.882  1.00 36.40  ? 258  PRO A C   1 
ATOM   1674  O O   . PRO A 1 236 ? 9.917   -26.814 39.438  1.00 35.16  ? 258  PRO A O   1 
ATOM   1675  C CB  . PRO A 1 236 ? 8.801   -23.965 40.233  1.00 34.21  ? 258  PRO A CB  1 
ATOM   1676  C CG  . PRO A 1 236 ? 9.448   -24.440 41.511  1.00 35.59  ? 258  PRO A CG  1 
ATOM   1677  C CD  . PRO A 1 236 ? 8.428   -25.387 42.103  1.00 37.80  ? 258  PRO A CD  1 
ATOM   1678  N N   . ARG A 1 237 ? 9.242   -25.714 37.584  1.00 34.67  ? 259  ARG A N   1 
ATOM   1679  C CA  . ARG A 1 237 ? 10.350  -26.219 36.776  1.00 38.02  ? 259  ARG A CA  1 
ATOM   1680  C C   . ARG A 1 237 ? 11.518  -25.237 36.913  1.00 32.48  ? 259  ARG A C   1 
ATOM   1681  O O   . ARG A 1 237 ? 11.421  -24.093 36.489  1.00 30.79  ? 259  ARG A O   1 
ATOM   1682  C CB  . ARG A 1 237 ? 9.926   -26.328 35.310  1.00 42.54  ? 259  ARG A CB  1 
ATOM   1683  C CG  . ARG A 1 237 ? 11.057  -26.677 34.363  1.00 46.45  ? 259  ARG A CG  1 
ATOM   1684  C CD  . ARG A 1 237 ? 10.558  -26.781 32.936  1.00 48.03  ? 259  ARG A CD  1 
ATOM   1685  N NE  . ARG A 1 237 ? 11.641  -27.115 32.010  1.00 50.57  ? 259  ARG A NE  1 
ATOM   1686  C CZ  . ARG A 1 237 ? 11.467  -27.371 30.715  1.00 50.53  ? 259  ARG A CZ  1 
ATOM   1687  N NH1 . ARG A 1 237 ? 10.248  -27.341 30.191  1.00 48.01  ? 259  ARG A NH1 1 
ATOM   1688  N NH2 . ARG A 1 237 ? 12.512  -27.667 29.944  1.00 49.80  ? 259  ARG A NH2 1 
ATOM   1689  N N   . CYS A 1 238 ? 12.617  -25.687 37.500  1.00 33.40  ? 260  CYS A N   1 
ATOM   1690  C CA  . CYS A 1 238 ? 13.697  -24.777 37.876  1.00 36.63  ? 260  CYS A CA  1 
ATOM   1691  C C   . CYS A 1 238 ? 14.884  -24.683 36.918  1.00 38.33  ? 260  CYS A C   1 
ATOM   1692  O O   . CYS A 1 238 ? 15.789  -23.884 37.147  1.00 43.37  ? 260  CYS A O   1 
ATOM   1693  C CB  . CYS A 1 238 ? 14.192  -25.104 39.292  1.00 35.40  ? 260  CYS A CB  1 
ATOM   1694  S SG  . CYS A 1 238 ? 12.910  -24.759 40.556  1.00 44.24  ? 260  CYS A SG  1 
ATOM   1695  N N   . PHE A 1 239 ? 14.899  -25.479 35.856  1.00 34.00  ? 261  PHE A N   1 
ATOM   1696  C CA  . PHE A 1 239 ? 16.041  -25.424 34.957  1.00 35.15  ? 261  PHE A CA  1 
ATOM   1697  C C   . PHE A 1 239 ? 16.120  -24.078 34.230  1.00 32.99  ? 261  PHE A C   1 
ATOM   1698  O O   . PHE A 1 239 ? 15.139  -23.627 33.634  1.00 35.20  ? 261  PHE A O   1 
ATOM   1699  C CB  . PHE A 1 239 ? 16.055  -26.586 33.960  1.00 38.20  ? 261  PHE A CB  1 
ATOM   1700  C CG  . PHE A 1 239 ? 17.139  -26.460 32.934  1.00 37.76  ? 261  PHE A CG  1 
ATOM   1701  C CD1 . PHE A 1 239 ? 18.470  -26.658 33.288  1.00 36.61  ? 261  PHE A CD1 1 
ATOM   1702  C CD2 . PHE A 1 239 ? 16.839  -26.088 31.639  1.00 32.77  ? 261  PHE A CD2 1 
ATOM   1703  C CE1 . PHE A 1 239 ? 19.483  -26.511 32.347  1.00 37.57  ? 261  PHE A CE1 1 
ATOM   1704  C CE2 . PHE A 1 239 ? 17.848  -25.945 30.691  1.00 36.35  ? 261  PHE A CE2 1 
ATOM   1705  C CZ  . PHE A 1 239 ? 19.170  -26.155 31.044  1.00 35.23  ? 261  PHE A CZ  1 
ATOM   1706  N N   . ASN A 1 240 ? 17.285  -23.435 34.316  1.00 35.65  ? 262  ASN A N   1 
ATOM   1707  C CA  . ASN A 1 240 ? 17.542  -22.131 33.676  1.00 37.28  ? 262  ASN A CA  1 
ATOM   1708  C C   . ASN A 1 240 ? 16.625  -20.987 34.166  1.00 35.56  ? 262  ASN A C   1 
ATOM   1709  O O   . ASN A 1 240 ? 16.455  -19.980 33.485  1.00 32.31  ? 262  ASN A O   1 
ATOM   1710  C CB  . ASN A 1 240 ? 17.517  -22.259 32.137  1.00 37.40  ? 262  ASN A CB  1 
ATOM   1711  C CG  . ASN A 1 240 ? 18.096  -21.036 31.427  1.00 36.47  ? 262  ASN A CG  1 
ATOM   1712  O OD1 . ASN A 1 240 ? 19.141  -20.506 31.816  1.00 31.40  ? 262  ASN A OD1 1 
ATOM   1713  N ND2 . ASN A 1 240 ? 17.398  -20.571 30.392  1.00 36.08  ? 262  ASN A ND2 1 
ATOM   1714  N N   . ALA A 1 241 ? 16.092  -21.131 35.376  1.00 36.31  ? 263  ALA A N   1 
ATOM   1715  C CA  . ALA A 1 241 ? 15.247  -20.101 35.994  1.00 38.96  ? 263  ALA A CA  1 
ATOM   1716  C C   . ALA A 1 241 ? 15.991  -18.791 36.277  1.00 37.26  ? 263  ALA A C   1 
ATOM   1717  O O   . ALA A 1 241 ? 17.077  -18.799 36.860  1.00 33.13  ? 263  ALA A O   1 
ATOM   1718  C CB  . ALA A 1 241 ? 14.641  -20.637 37.300  1.00 40.22  ? 263  ALA A CB  1 
ATOM   1719  N N   . PRO A 1 242 ? 15.415  -17.653 35.863  1.00 40.76  ? 264  PRO A N   1 
ATOM   1720  C CA  . PRO A 1 242 ? 16.113  -16.419 36.230  1.00 43.04  ? 264  PRO A CA  1 
ATOM   1721  C C   . PRO A 1 242 ? 15.629  -15.873 37.567  1.00 42.06  ? 264  PRO A C   1 
ATOM   1722  O O   . PRO A 1 242 ? 15.461  -14.667 37.703  1.00 43.80  ? 264  PRO A O   1 
ATOM   1723  C CB  . PRO A 1 242 ? 15.641  -15.459 35.142  1.00 44.07  ? 264  PRO A CB  1 
ATOM   1724  C CG  . PRO A 1 242 ? 14.199  -15.869 34.942  1.00 43.07  ? 264  PRO A CG  1 
ATOM   1725  C CD  . PRO A 1 242 ? 14.183  -17.386 35.102  1.00 42.25  ? 264  PRO A CD  1 
ATOM   1726  N N   . PHE A 1 243 ? 15.404  -16.754 38.529  1.00 42.50  ? 265  PHE A N   1 
ATOM   1727  C CA  . PHE A 1 243 ? 15.117  -16.380 39.908  1.00 44.02  ? 265  PHE A CA  1 
ATOM   1728  C C   . PHE A 1 243 ? 15.519  -17.561 40.791  1.00 45.15  ? 265  PHE A C   1 
ATOM   1729  O O   . PHE A 1 243 ? 15.571  -18.690 40.299  1.00 48.24  ? 265  PHE A O   1 
ATOM   1730  C CB  . PHE A 1 243 ? 13.641  -15.994 40.086  1.00 43.12  ? 265  PHE A CB  1 
ATOM   1731  C CG  . PHE A 1 243 ? 12.677  -17.034 39.595  1.00 45.20  ? 265  PHE A CG  1 
ATOM   1732  C CD1 . PHE A 1 243 ? 12.215  -18.020 40.444  1.00 46.37  ? 265  PHE A CD1 1 
ATOM   1733  C CD2 . PHE A 1 243 ? 12.218  -17.015 38.286  1.00 45.85  ? 265  PHE A CD2 1 
ATOM   1734  C CE1 . PHE A 1 243 ? 11.327  -18.976 40.000  1.00 46.77  ? 265  PHE A CE1 1 
ATOM   1735  C CE2 . PHE A 1 243 ? 11.329  -17.974 37.837  1.00 44.81  ? 265  PHE A CE2 1 
ATOM   1736  C CZ  . PHE A 1 243 ? 10.884  -18.951 38.693  1.00 43.99  ? 265  PHE A CZ  1 
ATOM   1737  N N   . PRO A 1 244 ? 15.799  -17.321 42.083  1.00 42.14  ? 266  PRO A N   1 
ATOM   1738  C CA  . PRO A 1 244 ? 16.062  -18.479 42.954  1.00 41.48  ? 266  PRO A CA  1 
ATOM   1739  C C   . PRO A 1 244 ? 14.853  -19.406 42.925  1.00 40.05  ? 266  PRO A C   1 
ATOM   1740  O O   . PRO A 1 244 ? 13.729  -18.922 43.036  1.00 41.63  ? 266  PRO A O   1 
ATOM   1741  C CB  . PRO A 1 244 ? 16.228  -17.852 44.348  1.00 40.95  ? 266  PRO A CB  1 
ATOM   1742  C CG  . PRO A 1 244 ? 16.615  -16.439 44.095  1.00 41.35  ? 266  PRO A CG  1 
ATOM   1743  C CD  . PRO A 1 244 ? 15.892  -16.045 42.810  1.00 40.68  ? 266  PRO A CD  1 
ATOM   1744  N N   . CYS A 1 245 ? 15.071  -20.702 42.737  1.00 39.19  ? 267  CYS A N   1 
ATOM   1745  C CA  . CYS A 1 245 ? 13.967  -21.612 42.447  1.00 41.25  ? 267  CYS A CA  1 
ATOM   1746  C C   . CYS A 1 245 ? 14.116  -22.938 43.186  1.00 45.07  ? 267  CYS A C   1 
ATOM   1747  O O   . CYS A 1 245 ? 15.151  -23.589 43.091  1.00 48.05  ? 267  CYS A O   1 
ATOM   1748  C CB  . CYS A 1 245 ? 13.873  -21.838 40.933  1.00 40.16  ? 267  CYS A CB  1 
ATOM   1749  S SG  . CYS A 1 245 ? 12.449  -22.784 40.364  1.00 44.18  ? 267  CYS A SG  1 
ATOM   1750  N N   . VAL A 1 246 ? 13.081  -23.331 43.923  1.00 44.88  ? 268  VAL A N   1 
ATOM   1751  C CA  . VAL A 1 246 ? 13.140  -24.545 44.742  1.00 43.69  ? 268  VAL A CA  1 
ATOM   1752  C C   . VAL A 1 246 ? 12.123  -25.555 44.216  1.00 40.01  ? 268  VAL A C   1 
ATOM   1753  O O   . VAL A 1 246 ? 10.937  -25.387 44.417  1.00 40.63  ? 268  VAL A O   1 
ATOM   1754  C CB  . VAL A 1 246 ? 12.811  -24.227 46.234  1.00 55.81  ? 268  VAL A CB  1 
ATOM   1755  C CG1 . VAL A 1 246 ? 12.767  -25.483 47.060  1.00 57.44  ? 268  VAL A CG1 1 
ATOM   1756  C CG2 . VAL A 1 246 ? 13.831  -23.267 46.815  1.00 53.17  ? 268  VAL A CG2 1 
ATOM   1757  N N   . PRO A 1 247 ? 12.586  -26.620 43.552  1.00 38.11  ? 269  PRO A N   1 
ATOM   1758  C CA  . PRO A 1 247 ? 11.649  -27.601 42.993  1.00 38.09  ? 269  PRO A CA  1 
ATOM   1759  C C   . PRO A 1 247 ? 11.073  -28.508 44.077  1.00 38.52  ? 269  PRO A C   1 
ATOM   1760  O O   . PRO A 1 247 ? 11.640  -28.571 45.164  1.00 40.73  ? 269  PRO A O   1 
ATOM   1761  C CB  . PRO A 1 247 ? 12.539  -28.419 42.056  1.00 41.08  ? 269  PRO A CB  1 
ATOM   1762  C CG  . PRO A 1 247 ? 13.889  -28.374 42.710  1.00 39.87  ? 269  PRO A CG  1 
ATOM   1763  C CD  . PRO A 1 247 ? 13.992  -27.002 43.342  1.00 36.55  ? 269  PRO A CD  1 
ATOM   1764  N N   . CYS A 1 248 ? 9.971   -29.195 43.787  1.00 39.00  ? 270  CYS A N   1 
ATOM   1765  C CA  . CYS A 1 248 ? 9.488   -30.251 44.679  1.00 43.81  ? 270  CYS A CA  1 
ATOM   1766  C C   . CYS A 1 248 ? 10.472  -31.394 44.534  1.00 48.61  ? 270  CYS A C   1 
ATOM   1767  O O   . CYS A 1 248 ? 11.191  -31.456 43.536  1.00 47.80  ? 270  CYS A O   1 
ATOM   1768  C CB  . CYS A 1 248 ? 8.073   -30.712 44.302  1.00 43.11  ? 270  CYS A CB  1 
ATOM   1769  S SG  . CYS A 1 248 ? 6.740   -29.530 44.703  1.00 53.68  ? 270  CYS A SG  1 
ATOM   1770  N N   . ASP A 1 249 ? 10.515  -32.290 45.519  1.00 52.20  ? 271  ASP A N   1 
ATOM   1771  C CA  . ASP A 1 249 ? 11.515  -33.360 45.536  1.00 57.78  ? 271  ASP A CA  1 
ATOM   1772  C C   . ASP A 1 249 ? 11.511  -34.200 44.258  1.00 56.52  ? 271  ASP A C   1 
ATOM   1773  O O   . ASP A 1 249 ? 10.474  -34.703 43.832  1.00 56.38  ? 271  ASP A O   1 
ATOM   1774  C CB  . ASP A 1 249 ? 11.327  -34.266 46.760  1.00 66.91  ? 271  ASP A CB  1 
ATOM   1775  C CG  . ASP A 1 249 ? 11.465  -33.516 48.073  1.00 73.47  ? 271  ASP A CG  1 
ATOM   1776  O OD1 . ASP A 1 249 ? 12.044  -32.407 48.074  1.00 74.33  ? 271  ASP A OD1 1 
ATOM   1777  O OD2 . ASP A 1 249 ? 10.995  -34.041 49.108  1.00 78.32  ? 271  ASP A OD2 1 
ATOM   1778  N N   . GLY A 1 250 ? 12.685  -34.347 43.652  1.00 54.78  ? 272  GLY A N   1 
ATOM   1779  C CA  . GLY A 1 250 ? 12.816  -35.066 42.399  1.00 55.57  ? 272  GLY A CA  1 
ATOM   1780  C C   . GLY A 1 250 ? 12.462  -34.200 41.203  1.00 56.37  ? 272  GLY A C   1 
ATOM   1781  O O   . GLY A 1 250 ? 12.707  -34.572 40.058  1.00 57.16  ? 272  GLY A O   1 
ATOM   1782  N N   . GLY A 1 251 ? 11.899  -33.029 41.469  1.00 55.30  ? 273  GLY A N   1 
ATOM   1783  C CA  . GLY A 1 251 ? 11.365  -32.195 40.410  1.00 51.62  ? 273  GLY A CA  1 
ATOM   1784  C C   . GLY A 1 251 ? 9.962   -32.663 40.081  1.00 49.76  ? 273  GLY A C   1 
ATOM   1785  O O   . GLY A 1 251 ? 9.474   -32.481 38.963  1.00 50.76  ? 273  GLY A O   1 
ATOM   1786  N N   . ALA A 1 252 ? 9.310   -33.266 41.068  1.00 47.84  ? 274  ALA A N   1 
ATOM   1787  C CA  . ALA A 1 252 ? 7.984   -33.835 40.866  1.00 45.72  ? 274  ALA A CA  1 
ATOM   1788  C C   . ALA A 1 252 ? 6.941   -32.799 40.451  1.00 41.58  ? 274  ALA A C   1 
ATOM   1789  O O   . ALA A 1 252 ? 7.063   -31.599 40.734  1.00 39.95  ? 274  ALA A O   1 
ATOM   1790  C CB  . ALA A 1 252 ? 7.528   -34.565 42.106  1.00 44.77  ? 274  ALA A CB  1 
ATOM   1791  N N   . SER A 1 253 ? 5.931   -33.288 39.747  1.00 38.53  ? 275  SER A N   1 
ATOM   1792  C CA  . SER A 1 253 ? 4.778   -32.500 39.351  1.00 41.22  ? 275  SER A CA  1 
ATOM   1793  C C   . SER A 1 253 ? 3.952   -32.111 40.571  1.00 43.62  ? 275  SER A C   1 
ATOM   1794  O O   . SER A 1 253 ? 4.027   -32.771 41.606  1.00 45.34  ? 275  SER A O   1 
ATOM   1795  C CB  . SER A 1 253 ? 3.917   -33.333 38.402  1.00 44.49  ? 275  SER A CB  1 
ATOM   1796  O OG  . SER A 1 253 ? 2.763   -32.630 38.001  1.00 50.67  ? 275  SER A OG  1 
ATOM   1797  N N   . ILE A 1 254 ? 3.180   -31.030 40.455  1.00 44.80  ? 276  ILE A N   1 
ATOM   1798  C CA  . ILE A 1 254 ? 2.172   -30.704 41.461  1.00 43.52  ? 276  ILE A CA  1 
ATOM   1799  C C   . ILE A 1 254 ? 1.192   -31.870 41.456  1.00 44.42  ? 276  ILE A C   1 
ATOM   1800  O O   . ILE A 1 254 ? 0.998   -32.517 40.424  1.00 44.37  ? 276  ILE A O   1 
ATOM   1801  C CB  . ILE A 1 254 ? 1.429   -29.366 41.137  1.00 37.20  ? 276  ILE A CB  1 
ATOM   1802  C CG1 . ILE A 1 254 ? 0.704   -28.803 42.369  1.00 36.34  ? 276  ILE A CG1 1 
ATOM   1803  C CG2 . ILE A 1 254 ? 0.437   -29.535 39.982  1.00 37.50  ? 276  ILE A CG2 1 
ATOM   1804  C CD1 . ILE A 1 254 ? -0.268  -27.644 42.034  1.00 33.74  ? 276  ILE A CD1 1 
ATOM   1805  N N   . ASN A 1 255 ? 0.589   -32.161 42.603  1.00 46.28  ? 277  ASN A N   1 
ATOM   1806  C CA  . ASN A 1 255 ? -0.383  -33.245 42.673  1.00 49.11  ? 277  ASN A CA  1 
ATOM   1807  C C   . ASN A 1 255 ? -1.777  -32.700 42.898  1.00 50.16  ? 277  ASN A C   1 
ATOM   1808  O O   . ASN A 1 255 ? -2.108  -32.231 43.988  1.00 53.07  ? 277  ASN A O   1 
ATOM   1809  C CB  . ASN A 1 255 ? -0.031  -34.238 43.785  1.00 52.28  ? 277  ASN A CB  1 
ATOM   1810  C CG  . ASN A 1 255 ? -0.901  -35.493 43.748  1.00 59.47  ? 277  ASN A CG  1 
ATOM   1811  O OD1 . ASN A 1 255 ? -1.876  -35.574 42.997  1.00 62.40  ? 277  ASN A OD1 1 
ATOM   1812  N ND2 . ASN A 1 255 ? -0.553  -36.472 44.573  1.00 63.55  ? 277  ASN A ND2 1 
ATOM   1813  N N   . ILE A 1 256 ? -2.602  -32.791 41.867  1.00 47.88  ? 278  ILE A N   1 
ATOM   1814  C CA  . ILE A 1 256 ? -3.952  -32.275 41.940  1.00 48.48  ? 278  ILE A CA  1 
ATOM   1815  C C   . ILE A 1 256 ? -4.950  -33.419 41.871  1.00 51.33  ? 278  ILE A C   1 
ATOM   1816  O O   . ILE A 1 256 ? -4.972  -34.184 40.904  1.00 50.98  ? 278  ILE A O   1 
ATOM   1817  C CB  . ILE A 1 256 ? -4.226  -31.303 40.797  1.00 43.70  ? 278  ILE A CB  1 
ATOM   1818  C CG1 . ILE A 1 256 ? -3.199  -30.168 40.819  1.00 43.10  ? 278  ILE A CG1 1 
ATOM   1819  C CG2 . ILE A 1 256 ? -5.629  -30.760 40.900  1.00 40.99  ? 278  ILE A CG2 1 
ATOM   1820  C CD1 . ILE A 1 256 ? -3.182  -29.336 39.558  1.00 40.43  ? 278  ILE A CD1 1 
ATOM   1821  N N   . ASP A 1 257 ? -5.767  -33.539 42.908  1.00 50.94  ? 279  ASP A N   1 
ATOM   1822  C CA  . ASP A 1 257 ? -6.781  -34.579 42.950  1.00 54.46  ? 279  ASP A CA  1 
ATOM   1823  C C   . ASP A 1 257 ? -7.784  -34.446 41.796  1.00 51.44  ? 279  ASP A C   1 
ATOM   1824  O O   . ASP A 1 257 ? -8.161  -33.339 41.419  1.00 51.07  ? 279  ASP A O   1 
ATOM   1825  C CB  . ASP A 1 257 ? -7.509  -34.532 44.284  1.00 58.94  ? 279  ASP A CB  1 
ATOM   1826  C CG  . ASP A 1 257 ? -8.372  -35.734 44.498  1.00 63.08  ? 279  ASP A CG  1 
ATOM   1827  O OD1 . ASP A 1 257 ? -7.806  -36.834 44.674  1.00 66.37  ? 279  ASP A OD1 1 
ATOM   1828  O OD2 . ASP A 1 257 ? -9.608  -35.574 44.483  1.00 62.81  ? 279  ASP A OD2 1 
ATOM   1829  N N   . ARG A 1 258 ? -8.208  -35.579 41.243  1.00 49.19  ? 280  ARG A N   1 
ATOM   1830  C CA  . ARG A 1 258 ? -9.073  -35.588 40.064  1.00 50.72  ? 280  ARG A CA  1 
ATOM   1831  C C   . ARG A 1 258 ? -10.352 -34.767 40.260  1.00 50.56  ? 280  ARG A C   1 
ATOM   1832  O O   . ARG A 1 258 ? -10.911 -34.223 39.302  1.00 52.15  ? 280  ARG A O   1 
ATOM   1833  C CB  . ARG A 1 258 ? -9.410  -37.029 39.642  1.00 54.59  ? 280  ARG A CB  1 
ATOM   1834  C CG  . ARG A 1 258 ? -10.802 -37.481 40.014  1.00 59.31  ? 280  ARG A CG  1 
ATOM   1835  C CD  . ARG A 1 258 ? -11.112 -38.915 39.583  1.00 67.06  ? 280  ARG A CD  1 
ATOM   1836  N NE  . ARG A 1 258 ? -11.253 -39.079 38.133  1.00 71.47  ? 280  ARG A NE  1 
ATOM   1837  C CZ  . ARG A 1 258 ? -12.373 -38.842 37.448  1.00 73.07  ? 280  ARG A CZ  1 
ATOM   1838  N NH1 . ARG A 1 258 ? -13.461 -38.400 38.065  1.00 75.56  ? 280  ARG A NH1 1 
ATOM   1839  N NH2 . ARG A 1 258 ? -12.405 -39.031 36.135  1.00 72.03  ? 280  ARG A NH2 1 
ATOM   1840  N N   . PHE A 1 259 ? -10.822 -34.704 41.501  1.00 50.66  ? 281  PHE A N   1 
ATOM   1841  C CA  . PHE A 1 259 ? -12.036 -33.969 41.838  1.00 50.33  ? 281  PHE A CA  1 
ATOM   1842  C C   . PHE A 1 259 ? -11.780 -32.576 42.403  1.00 46.24  ? 281  PHE A C   1 
ATOM   1843  O O   . PHE A 1 259 ? -12.709 -31.921 42.883  1.00 47.00  ? 281  PHE A O   1 
ATOM   1844  C CB  . PHE A 1 259 ? -12.895 -34.775 42.816  1.00 55.94  ? 281  PHE A CB  1 
ATOM   1845  C CG  . PHE A 1 259 ? -13.398 -36.073 42.257  1.00 57.72  ? 281  PHE A CG  1 
ATOM   1846  C CD1 . PHE A 1 259 ? -14.312 -36.083 41.219  1.00 59.65  ? 281  PHE A CD1 1 
ATOM   1847  C CD2 . PHE A 1 259 ? -12.978 -37.282 42.791  1.00 60.46  ? 281  PHE A CD2 1 
ATOM   1848  C CE1 . PHE A 1 259 ? -14.789 -37.273 40.709  1.00 63.89  ? 281  PHE A CE1 1 
ATOM   1849  C CE2 . PHE A 1 259 ? -13.452 -38.482 42.287  1.00 63.38  ? 281  PHE A CE2 1 
ATOM   1850  C CZ  . PHE A 1 259 ? -14.362 -38.477 41.244  1.00 64.41  ? 281  PHE A CZ  1 
ATOM   1851  N N   . ALA A 1 260 ? -10.521 -32.151 42.410  1.00 43.30  ? 282  ALA A N   1 
ATOM   1852  C CA  . ALA A 1 260 ? -10.150 -30.880 43.039  1.00 43.74  ? 282  ALA A CA  1 
ATOM   1853  C C   . ALA A 1 260 ? -10.931 -29.659 42.540  1.00 43.81  ? 282  ALA A C   1 
ATOM   1854  O O   . ALA A 1 260 ? -11.118 -28.689 43.282  1.00 41.88  ? 282  ALA A O   1 
ATOM   1855  C CB  . ALA A 1 260 ? -8.658  -30.636 42.898  1.00 41.42  ? 282  ALA A CB  1 
ATOM   1856  N N   . PHE A 1 261 ? -11.322 -29.691 41.270  1.00 46.31  ? 283  PHE A N   1 
ATOM   1857  C CA  . PHE A 1 261 ? -11.998 -28.561 40.617  1.00 48.43  ? 283  PHE A CA  1 
ATOM   1858  C C   . PHE A 1 261 ? -13.521 -28.660 40.459  1.00 50.70  ? 283  PHE A C   1 
ATOM   1859  O O   . PHE A 1 261 ? -14.135 -27.809 39.819  1.00 51.44  ? 283  PHE A O   1 
ATOM   1860  C CB  . PHE A 1 261 ? -11.323 -28.248 39.284  1.00 46.95  ? 283  PHE A CB  1 
ATOM   1861  C CG  . PHE A 1 261 ? -9.872  -27.897 39.424  1.00 46.13  ? 283  PHE A CG  1 
ATOM   1862  C CD1 . PHE A 1 261 ? -9.414  -27.237 40.555  1.00 45.58  ? 283  PHE A CD1 1 
ATOM   1863  C CD2 . PHE A 1 261 ? -8.962  -28.236 38.445  1.00 45.49  ? 283  PHE A CD2 1 
ATOM   1864  C CE1 . PHE A 1 261 ? -8.075  -26.908 40.694  1.00 39.47  ? 283  PHE A CE1 1 
ATOM   1865  C CE2 . PHE A 1 261 ? -7.626  -27.902 38.586  1.00 44.95  ? 283  PHE A CE2 1 
ATOM   1866  C CZ  . PHE A 1 261 ? -7.191  -27.243 39.718  1.00 40.20  ? 283  PHE A CZ  1 
ATOM   1867  N N   . GLN A 1 262 ? -14.110 -29.712 41.015  1.00 52.70  ? 284  GLN A N   1 
ATOM   1868  C CA  . GLN A 1 262 ? -15.503 -30.080 40.750  1.00 57.93  ? 284  GLN A CA  1 
ATOM   1869  C C   . GLN A 1 262 ? -16.573 -28.978 40.862  1.00 57.27  ? 284  GLN A C   1 
ATOM   1870  O O   . GLN A 1 262 ? -17.470 -28.901 40.030  1.00 59.02  ? 284  GLN A O   1 
ATOM   1871  C CB  . GLN A 1 262 ? -15.900 -31.263 41.638  1.00 63.88  ? 284  GLN A CB  1 
ATOM   1872  C CG  . GLN A 1 262 ? -16.412 -32.462 40.867  1.00 68.46  ? 284  GLN A CG  1 
ATOM   1873  C CD  . GLN A 1 262 ? -16.852 -33.575 41.779  1.00 72.72  ? 284  GLN A CD  1 
ATOM   1874  O OE1 . GLN A 1 262 ? -16.662 -33.504 42.994  1.00 75.93  ? 284  GLN A OE1 1 
ATOM   1875  N NE2 . GLN A 1 262 ? -17.445 -34.616 41.202  1.00 73.75  ? 284  GLN A NE2 1 
ATOM   1876  N N   . ASN A 1 263 ? -16.496 -28.150 41.896  1.00 57.05  ? 285  ASN A N   1 
ATOM   1877  C CA  . ASN A 1 263 ? -17.502 -27.111 42.138  1.00 58.06  ? 285  ASN A CA  1 
ATOM   1878  C C   . ASN A 1 263 ? -17.170 -25.760 41.495  1.00 56.65  ? 285  ASN A C   1 
ATOM   1879  O O   . ASN A 1 263 ? -17.864 -24.763 41.706  1.00 55.58  ? 285  ASN A O   1 
ATOM   1880  C CB  . ASN A 1 263 ? -17.758 -26.957 43.634  1.00 64.29  ? 285  ASN A CB  1 
ATOM   1881  C CG  . ASN A 1 263 ? -18.569 -28.102 44.201  1.00 71.48  ? 285  ASN A CG  1 
ATOM   1882  O OD1 . ASN A 1 263 ? -18.854 -29.083 43.509  1.00 73.37  ? 285  ASN A OD1 1 
ATOM   1883  N ND2 . ASN A 1 263 ? -18.948 -27.987 45.469  1.00 75.05  ? 285  ASN A ND2 1 
ATOM   1884  N N   . LEU A 1 264 ? -16.112 -25.761 40.690  1.00 52.85  ? 286  LEU A N   1 
ATOM   1885  C CA  . LEU A 1 264 ? -15.517 -24.562 40.092  1.00 47.38  ? 286  LEU A CA  1 
ATOM   1886  C C   . LEU A 1 264 ? -16.185 -24.107 38.789  1.00 47.27  ? 286  LEU A C   1 
ATOM   1887  O O   . LEU A 1 264 ? -15.528 -23.549 37.918  1.00 46.11  ? 286  LEU A O   1 
ATOM   1888  C CB  . LEU A 1 264 ? -13.994 -24.684 39.951  1.00 43.84  ? 286  LEU A CB  1 
ATOM   1889  C CG  . LEU A 1 264 ? -13.278 -24.861 41.297  1.00 43.24  ? 286  LEU A CG  1 
ATOM   1890  C CD1 . LEU A 1 264 ? -11.820 -24.491 41.181  1.00 40.09  ? 286  LEU A CD1 1 
ATOM   1891  C CD2 . LEU A 1 264 ? -13.966 -24.062 42.415  1.00 42.22  ? 286  LEU A CD2 1 
ATOM   1892  N N   . THR A 1 265 ? -17.449 -24.485 38.611  1.00 48.69  ? 287  THR A N   1 
ATOM   1893  C CA  . THR A 1 265 ? -18.188 -24.285 37.362  1.00 48.25  ? 287  THR A CA  1 
ATOM   1894  C C   . THR A 1 265 ? -18.113 -22.886 36.748  1.00 48.08  ? 287  THR A C   1 
ATOM   1895  O O   . THR A 1 265 ? -18.336 -22.729 35.546  1.00 51.23  ? 287  THR A O   1 
ATOM   1896  C CB  . THR A 1 265 ? -19.685 -24.673 37.514  1.00 54.47  ? 287  THR A CB  1 
ATOM   1897  O OG1 . THR A 1 265 ? -20.381 -23.674 38.270  1.00 55.98  ? 287  THR A OG1 1 
ATOM   1898  C CG2 . THR A 1 265 ? -19.834 -26.014 38.207  1.00 55.35  ? 287  THR A CG2 1 
ATOM   1899  N N   . GLN A 1 266 ? -17.833 -21.869 37.555  1.00 45.49  ? 288  GLN A N   1 
ATOM   1900  C CA  . GLN A 1 266 ? -17.747 -20.504 37.031  1.00 45.91  ? 288  GLN A CA  1 
ATOM   1901  C C   . GLN A 1 266 ? -16.343 -20.046 36.588  1.00 47.55  ? 288  GLN A C   1 
ATOM   1902  O O   . GLN A 1 266 ? -16.172 -18.899 36.169  1.00 46.48  ? 288  GLN A O   1 
ATOM   1903  C CB  . GLN A 1 266 ? -18.314 -19.514 38.047  1.00 45.99  ? 288  GLN A CB  1 
ATOM   1904  C CG  . GLN A 1 266 ? -19.798 -19.696 38.306  1.00 49.25  ? 288  GLN A CG  1 
ATOM   1905  C CD  . GLN A 1 266 ? -20.610 -19.646 37.032  1.00 48.95  ? 288  GLN A CD  1 
ATOM   1906  O OE1 . GLN A 1 266 ? -20.639 -18.629 36.341  1.00 50.37  ? 288  GLN A OE1 1 
ATOM   1907  N NE2 . GLN A 1 266 ? -21.271 -20.749 36.710  1.00 48.61  ? 288  GLN A NE2 1 
ATOM   1908  N N   . LEU A 1 267 ? -15.348 -20.927 36.676  1.00 46.94  ? 289  LEU A N   1 
ATOM   1909  C CA  . LEU A 1 267 ? -13.970 -20.535 36.365  1.00 47.32  ? 289  LEU A CA  1 
ATOM   1910  C C   . LEU A 1 267 ? -13.761 -20.105 34.909  1.00 46.25  ? 289  LEU A C   1 
ATOM   1911  O O   . LEU A 1 267 ? -14.226 -20.754 33.975  1.00 47.12  ? 289  LEU A O   1 
ATOM   1912  C CB  . LEU A 1 267 ? -12.973 -21.632 36.752  1.00 46.90  ? 289  LEU A CB  1 
ATOM   1913  C CG  . LEU A 1 267 ? -11.611 -21.091 37.212  1.00 47.55  ? 289  LEU A CG  1 
ATOM   1914  C CD1 . LEU A 1 267 ? -11.733 -20.376 38.539  1.00 45.63  ? 289  LEU A CD1 1 
ATOM   1915  C CD2 . LEU A 1 267 ? -10.579 -22.196 37.308  1.00 50.34  ? 289  LEU A CD2 1 
ATOM   1916  N N   . ARG A 1 268 ? -13.068 -18.984 34.747  1.00 45.26  ? 290  ARG A N   1 
ATOM   1917  C CA  . ARG A 1 268 ? -12.712 -18.403 33.446  1.00 43.08  ? 290  ARG A CA  1 
ATOM   1918  C C   . ARG A 1 268 ? -11.209 -18.514 33.225  1.00 39.46  ? 290  ARG A C   1 
ATOM   1919  O O   . ARG A 1 268 ? -10.759 -18.823 32.133  1.00 38.44  ? 290  ARG A O   1 
ATOM   1920  C CB  . ARG A 1 268 ? -13.204 -16.962 33.276  1.00 43.30  ? 290  ARG A CB  1 
ATOM   1921  C CG  . ARG A 1 268 ? -14.567 -16.848 32.583  1.00 42.70  ? 290  ARG A CG  1 
ATOM   1922  C CD  . ARG A 1 268 ? -15.679 -17.175 33.557  1.00 41.67  ? 290  ARG A CD  1 
ATOM   1923  N NE  . ARG A 1 268 ? -17.015 -17.056 32.980  1.00 43.35  ? 290  ARG A NE  1 
ATOM   1924  C CZ  . ARG A 1 268 ? -18.139 -17.195 33.681  1.00 46.25  ? 290  ARG A CZ  1 
ATOM   1925  N NH1 . ARG A 1 268 ? -18.085 -17.456 34.982  1.00 41.64  ? 290  ARG A NH1 1 
ATOM   1926  N NH2 . ARG A 1 268 ? -19.316 -17.074 33.085  1.00 42.63  ? 290  ARG A NH2 1 
ATOM   1927  N N   . TYR A 1 269 ? -10.451 -18.098 34.234  1.00 42.13  ? 291  TYR A N   1 
ATOM   1928  C CA  . TYR A 1 269 ? -8.992  -18.142 34.213  1.00 41.52  ? 291  TYR A CA  1 
ATOM   1929  C C   . TYR A 1 269 ? -8.403  -19.209 35.144  1.00 41.38  ? 291  TYR A C   1 
ATOM   1930  O O   . TYR A 1 269 ? -8.728  -19.259 36.329  1.00 43.52  ? 291  TYR A O   1 
ATOM   1931  C CB  . TYR A 1 269 ? -8.445  -16.775 34.632  1.00 43.88  ? 291  TYR A CB  1 
ATOM   1932  C CG  . TYR A 1 269 ? -8.970  -15.622 33.806  1.00 45.86  ? 291  TYR A CG  1 
ATOM   1933  C CD1 . TYR A 1 269 ? -10.220 -15.071 34.056  1.00 46.52  ? 291  TYR A CD1 1 
ATOM   1934  C CD2 . TYR A 1 269 ? -8.203  -15.079 32.779  1.00 46.23  ? 291  TYR A CD2 1 
ATOM   1935  C CE1 . TYR A 1 269 ? -10.698 -14.016 33.294  1.00 49.99  ? 291  TYR A CE1 1 
ATOM   1936  C CE2 . TYR A 1 269 ? -8.671  -14.027 32.018  1.00 47.76  ? 291  TYR A CE2 1 
ATOM   1937  C CZ  . TYR A 1 269 ? -9.914  -13.502 32.277  1.00 52.80  ? 291  TYR A CZ  1 
ATOM   1938  O OH  . TYR A 1 269 ? -10.366 -12.454 31.511  1.00 60.55  ? 291  TYR A OH  1 
ATOM   1939  N N   . LEU A 1 270 ? -7.510  -20.038 34.613  1.00 37.82  ? 292  LEU A N   1 
ATOM   1940  C CA  . LEU A 1 270 ? -6.766  -20.978 35.438  1.00 38.92  ? 292  LEU A CA  1 
ATOM   1941  C C   . LEU A 1 270 ? -5.278  -20.912 35.099  1.00 38.30  ? 292  LEU A C   1 
ATOM   1942  O O   . LEU A 1 270 ? -4.894  -21.082 33.935  1.00 37.81  ? 292  LEU A O   1 
ATOM   1943  C CB  . LEU A 1 270 ? -7.300  -22.399 35.241  1.00 38.74  ? 292  LEU A CB  1 
ATOM   1944  C CG  . LEU A 1 270 ? -6.519  -23.543 35.883  1.00 38.10  ? 292  LEU A CG  1 
ATOM   1945  C CD1 . LEU A 1 270 ? -6.451  -23.396 37.391  1.00 37.44  ? 292  LEU A CD1 1 
ATOM   1946  C CD2 . LEU A 1 270 ? -7.158  -24.876 35.495  1.00 39.58  ? 292  LEU A CD2 1 
ATOM   1947  N N   . ASN A 1 271 ? -4.441  -20.657 36.105  1.00 35.51  ? 293  ASN A N   1 
ATOM   1948  C CA  . ASN A 1 271 ? -3.009  -20.542 35.850  1.00 36.04  ? 293  ASN A CA  1 
ATOM   1949  C C   . ASN A 1 271 ? -2.246  -21.703 36.501  1.00 39.08  ? 293  ASN A C   1 
ATOM   1950  O O   . ASN A 1 271 ? -2.066  -21.750 37.718  1.00 37.86  ? 293  ASN A O   1 
ATOM   1951  C CB  . ASN A 1 271 ? -2.486  -19.172 36.345  1.00 34.97  ? 293  ASN A CB  1 
ATOM   1952  C CG  . ASN A 1 271 ? -1.172  -18.765 35.678  1.00 38.48  ? 293  ASN A CG  1 
ATOM   1953  O OD1 . ASN A 1 271 ? -0.533  -19.591 35.023  1.00 35.00  ? 293  ASN A OD1 1 
ATOM   1954  N ND2 . ASN A 1 271 ? -0.743  -17.500 35.854  1.00 38.45  ? 293  ASN A ND2 1 
ATOM   1955  N N   . LEU A 1 272 ? -1.830  -22.652 35.667  1.00 40.78  ? 294  LEU A N   1 
ATOM   1956  C CA  . LEU A 1 272 ? -1.015  -23.801 36.071  1.00 37.95  ? 294  LEU A CA  1 
ATOM   1957  C C   . LEU A 1 272 ? 0.477   -23.712 35.719  1.00 41.66  ? 294  LEU A C   1 
ATOM   1958  O O   . LEU A 1 272 ? 1.196   -24.708 35.808  1.00 42.65  ? 294  LEU A O   1 
ATOM   1959  C CB  . LEU A 1 272 ? -1.625  -25.117 35.569  1.00 37.21  ? 294  LEU A CB  1 
ATOM   1960  C CG  . LEU A 1 272 ? -2.557  -25.896 36.510  1.00 41.59  ? 294  LEU A CG  1 
ATOM   1961  C CD1 . LEU A 1 272 ? -2.913  -25.093 37.757  1.00 40.29  ? 294  LEU A CD1 1 
ATOM   1962  C CD2 . LEU A 1 272 ? -3.820  -26.363 35.792  1.00 38.41  ? 294  LEU A CD2 1 
ATOM   1963  N N   . SER A 1 273 ? 0.921   -22.561 35.227  1.00 42.99  ? 295  SER A N   1 
ATOM   1964  C CA  . SER A 1 273 ? 2.305   -22.414 34.767  1.00 40.49  ? 295  SER A CA  1 
ATOM   1965  C C   . SER A 1 273 ? 3.311   -22.876 35.807  1.00 41.59  ? 295  SER A C   1 
ATOM   1966  O O   . SER A 1 273 ? 3.120   -22.660 37.005  1.00 43.85  ? 295  SER A O   1 
ATOM   1967  C CB  . SER A 1 273 ? 2.617   -20.963 34.408  1.00 41.10  ? 295  SER A CB  1 
ATOM   1968  O OG  . SER A 1 273 ? 1.735   -20.476 33.414  1.00 41.63  ? 295  SER A OG  1 
ATOM   1969  N N   . SER A 1 274 ? 4.369   -23.532 35.341  1.00 39.05  ? 296  SER A N   1 
ATOM   1970  C CA  . SER A 1 274 ? 5.484   -23.924 36.202  1.00 34.19  ? 296  SER A CA  1 
ATOM   1971  C C   . SER A 1 274 ? 5.020   -24.742 37.415  1.00 31.70  ? 296  SER A C   1 
ATOM   1972  O O   . SER A 1 274 ? 5.362   -24.444 38.558  1.00 31.72  ? 296  SER A O   1 
ATOM   1973  C CB  . SER A 1 274 ? 6.293   -22.696 36.629  1.00 34.98  ? 296  SER A CB  1 
ATOM   1974  O OG  . SER A 1 274 ? 7.532   -23.074 37.206  1.00 36.42  ? 296  SER A OG  1 
ATOM   1975  N N   . THR A 1 275 ? 4.146   -25.701 37.156  1.00 33.27  ? 297  THR A N   1 
ATOM   1976  C CA  . THR A 1 275 ? 3.751   -26.700 38.144  1.00 36.44  ? 297  THR A CA  1 
ATOM   1977  C C   . THR A 1 275 ? 4.406   -28.051 37.886  1.00 38.03  ? 297  THR A C   1 
ATOM   1978  O O   . THR A 1 275 ? 4.080   -29.043 38.547  1.00 36.74  ? 297  THR A O   1 
ATOM   1979  C CB  . THR A 1 275 ? 2.230   -26.834 38.232  1.00 33.98  ? 297  THR A CB  1 
ATOM   1980  O OG1 . THR A 1 275 ? 1.708   -27.139 36.938  1.00 31.41  ? 297  THR A OG1 1 
ATOM   1981  C CG2 . THR A 1 275 ? 1.639   -25.523 38.710  1.00 35.02  ? 297  THR A CG2 1 
ATOM   1982  N N   . SER A 1 276 ? 5.275   -28.080 36.878  1.00 37.73  ? 298  SER A N   1 
ATOM   1983  C CA  . SER A 1 276 ? 5.996   -29.284 36.465  1.00 40.07  ? 298  SER A CA  1 
ATOM   1984  C C   . SER A 1 276 ? 5.060   -30.372 35.968  1.00 41.60  ? 298  SER A C   1 
ATOM   1985  O O   . SER A 1 276 ? 5.341   -31.565 36.106  1.00 42.49  ? 298  SER A O   1 
ATOM   1986  C CB  . SER A 1 276 ? 6.902   -29.813 37.580  1.00 39.54  ? 298  SER A CB  1 
ATOM   1987  O OG  . SER A 1 276 ? 7.804   -28.805 37.994  1.00 37.24  ? 298  SER A OG  1 
ATOM   1988  N N   . LEU A 1 277 ? 3.950   -29.954 35.376  1.00 41.34  ? 299  LEU A N   1 
ATOM   1989  C CA  . LEU A 1 277 ? 2.997   -30.909 34.833  1.00 41.73  ? 299  LEU A CA  1 
ATOM   1990  C C   . LEU A 1 277 ? 3.576   -31.719 33.670  1.00 42.85  ? 299  LEU A C   1 
ATOM   1991  O O   . LEU A 1 277 ? 4.257   -31.188 32.787  1.00 38.35  ? 299  LEU A O   1 
ATOM   1992  C CB  . LEU A 1 277 ? 1.710   -30.209 34.401  1.00 40.41  ? 299  LEU A CB  1 
ATOM   1993  C CG  . LEU A 1 277 ? 0.754   -29.819 35.526  1.00 39.22  ? 299  LEU A CG  1 
ATOM   1994  C CD1 . LEU A 1 277 ? -0.358  -28.940 34.978  1.00 37.43  ? 299  LEU A CD1 1 
ATOM   1995  C CD2 . LEU A 1 277 ? 0.176   -31.065 36.194  1.00 39.04  ? 299  LEU A CD2 1 
ATOM   1996  N N   . ARG A 1 278 ? 3.274   -33.013 33.698  1.00 44.29  ? 300  ARG A N   1 
ATOM   1997  C CA  . ARG A 1 278 ? 3.636   -33.964 32.660  1.00 46.07  ? 300  ARG A CA  1 
ATOM   1998  C C   . ARG A 1 278 ? 2.384   -34.513 31.975  1.00 47.60  ? 300  ARG A C   1 
ATOM   1999  O O   . ARG A 1 278 ? 2.286   -34.491 30.749  1.00 45.61  ? 300  ARG A O   1 
ATOM   2000  C CB  . ARG A 1 278 ? 4.570   -35.050 33.187  1.00 50.41  ? 300  ARG A CB  1 
ATOM   2001  C CG  . ARG A 1 278 ? 6.046   -34.653 33.063  1.00 56.52  ? 300  ARG A CG  1 
ATOM   2002  C CD  . ARG A 1 278 ? 6.953   -35.366 34.062  1.00 62.11  ? 300  ARG A CD  1 
ATOM   2003  N NE  . ARG A 1 278 ? 7.102   -34.626 35.313  1.00 64.67  ? 300  ARG A NE  1 
ATOM   2004  C CZ  . ARG A 1 278 ? 8.200   -33.960 35.663  1.00 63.66  ? 300  ARG A CZ  1 
ATOM   2005  N NH1 . ARG A 1 278 ? 9.256   -33.933 34.858  1.00 66.17  ? 300  ARG A NH1 1 
ATOM   2006  N NH2 . ARG A 1 278 ? 8.252   -33.328 36.826  1.00 61.08  ? 300  ARG A NH2 1 
ATOM   2007  N N   . LYS A 1 279 ? 1.471   -35.084 32.752  1.00 52.53  ? 301  LYS A N   1 
ATOM   2008  C CA  . LYS A 1 279 ? 0.133   -35.361 32.233  1.00 55.17  ? 301  LYS A CA  1 
ATOM   2009  C C   . LYS A 1 279 ? -0.895  -34.384 32.787  1.00 54.97  ? 301  LYS A C   1 
ATOM   2010  O O   . LYS A 1 279 ? -0.781  -33.924 33.921  1.00 56.50  ? 301  LYS A O   1 
ATOM   2011  C CB  . LYS A 1 279 ? -0.292  -36.799 32.518  1.00 57.97  ? 301  LYS A CB  1 
ATOM   2012  C CG  . LYS A 1 279 ? -0.210  -37.216 33.969  1.00 61.98  ? 301  LYS A CG  1 
ATOM   2013  C CD  . LYS A 1 279 ? -0.596  -38.684 34.117  1.00 67.27  ? 301  LYS A CD  1 
ATOM   2014  C CE  . LYS A 1 279 ? -0.080  -39.282 35.425  1.00 70.38  ? 301  LYS A CE  1 
ATOM   2015  N NZ  . LYS A 1 279 ? -0.941  -38.984 36.603  1.00 72.21  ? 301  LYS A NZ  1 
ATOM   2016  N N   . ILE A 1 280 ? -1.890  -34.054 31.973  1.00 52.62  ? 302  ILE A N   1 
ATOM   2017  C CA  . ILE A 1 280 ? -2.994  -33.225 32.429  1.00 51.45  ? 302  ILE A CA  1 
ATOM   2018  C C   . ILE A 1 280 ? -4.249  -34.063 32.486  1.00 53.18  ? 302  ILE A C   1 
ATOM   2019  O O   . ILE A 1 280 ? -4.644  -34.659 31.487  1.00 53.76  ? 302  ILE A O   1 
ATOM   2020  C CB  . ILE A 1 280 ? -3.254  -32.050 31.488  1.00 48.30  ? 302  ILE A CB  1 
ATOM   2021  C CG1 . ILE A 1 280 ? -2.044  -31.132 31.468  1.00 47.42  ? 302  ILE A CG1 1 
ATOM   2022  C CG2 . ILE A 1 280 ? -4.483  -31.255 31.942  1.00 47.19  ? 302  ILE A CG2 1 
ATOM   2023  C CD1 . ILE A 1 280 ? -2.226  -29.961 30.584  1.00 48.04  ? 302  ILE A CD1 1 
ATOM   2024  N N   . ASN A 1 281 ? -4.879  -34.106 33.653  1.00 52.10  ? 303  ASN A N   1 
ATOM   2025  C CA  . ASN A 1 281 ? -6.057  -34.927 33.817  1.00 52.42  ? 303  ASN A CA  1 
ATOM   2026  C C   . ASN A 1 281 ? -7.240  -34.198 33.213  1.00 50.11  ? 303  ASN A C   1 
ATOM   2027  O O   . ASN A 1 281 ? -7.644  -33.139 33.691  1.00 50.12  ? 303  ASN A O   1 
ATOM   2028  C CB  . ASN A 1 281 ? -6.303  -35.187 35.302  1.00 53.05  ? 303  ASN A CB  1 
ATOM   2029  C CG  . ASN A 1 281 ? -7.350  -36.259 35.546  1.00 54.60  ? 303  ASN A CG  1 
ATOM   2030  O OD1 . ASN A 1 281 ? -8.163  -36.571 34.672  1.00 54.41  ? 303  ASN A OD1 1 
ATOM   2031  N ND2 . ASN A 1 281 ? -7.339  -36.825 36.746  1.00 56.60  ? 303  ASN A ND2 1 
ATOM   2032  N N   . ALA A 1 282 ? -7.811  -34.792 32.177  1.00 47.70  ? 304  ALA A N   1 
ATOM   2033  C CA  . ALA A 1 282 ? -8.924  -34.182 31.473  1.00 48.95  ? 304  ALA A CA  1 
ATOM   2034  C C   . ALA A 1 282 ? -10.118 -33.987 32.410  1.00 51.27  ? 304  ALA A C   1 
ATOM   2035  O O   . ALA A 1 282 ? -10.933 -33.083 32.218  1.00 48.35  ? 304  ALA A O   1 
ATOM   2036  C CB  . ALA A 1 282 ? -9.311  -35.031 30.268  1.00 48.51  ? 304  ALA A CB  1 
ATOM   2037  N N   . ALA A 1 283 ? -10.199 -34.826 33.438  1.00 52.33  ? 305  ALA A N   1 
ATOM   2038  C CA  . ALA A 1 283 ? -11.304 -34.763 34.386  1.00 52.86  ? 305  ALA A CA  1 
ATOM   2039  C C   . ALA A 1 283 ? -11.380 -33.432 35.133  1.00 51.38  ? 305  ALA A C   1 
ATOM   2040  O O   . ALA A 1 283 ? -12.455 -33.041 35.594  1.00 55.06  ? 305  ALA A O   1 
ATOM   2041  C CB  . ALA A 1 283 ? -11.235 -35.928 35.372  1.00 55.38  ? 305  ALA A CB  1 
ATOM   2042  N N   . TRP A 1 284 ? -10.254 -32.737 35.250  1.00 46.64  ? 306  TRP A N   1 
ATOM   2043  C CA  . TRP A 1 284 ? -10.235 -31.471 35.971  1.00 47.44  ? 306  TRP A CA  1 
ATOM   2044  C C   . TRP A 1 284 ? -11.188 -30.459 35.337  1.00 47.85  ? 306  TRP A C   1 
ATOM   2045  O O   . TRP A 1 284 ? -11.780 -29.635 36.032  1.00 39.92  ? 306  TRP A O   1 
ATOM   2046  C CB  . TRP A 1 284 ? -8.832  -30.881 36.004  1.00 48.04  ? 306  TRP A CB  1 
ATOM   2047  C CG  . TRP A 1 284 ? -7.825  -31.678 36.774  1.00 51.62  ? 306  TRP A CG  1 
ATOM   2048  C CD1 . TRP A 1 284 ? -8.067  -32.595 37.760  1.00 52.24  ? 306  TRP A CD1 1 
ATOM   2049  C CD2 . TRP A 1 284 ? -6.401  -31.620 36.619  1.00 50.49  ? 306  TRP A CD2 1 
ATOM   2050  N NE1 . TRP A 1 284 ? -6.878  -33.108 38.228  1.00 50.80  ? 306  TRP A NE1 1 
ATOM   2051  C CE2 . TRP A 1 284 ? -5.845  -32.528 37.543  1.00 48.92  ? 306  TRP A CE2 1 
ATOM   2052  C CE3 . TRP A 1 284 ? -5.548  -30.888 35.789  1.00 51.55  ? 306  TRP A CE3 1 
ATOM   2053  C CZ2 . TRP A 1 284 ? -4.472  -32.725 37.653  1.00 49.71  ? 306  TRP A CZ2 1 
ATOM   2054  C CZ3 . TRP A 1 284 ? -4.183  -31.086 35.901  1.00 51.54  ? 306  TRP A CZ3 1 
ATOM   2055  C CH2 . TRP A 1 284 ? -3.659  -31.998 36.828  1.00 51.10  ? 306  TRP A CH2 1 
ATOM   2056  N N   . PHE A 1 285 ? -11.329 -30.544 34.017  1.00 45.00  ? 307  PHE A N   1 
ATOM   2057  C CA  . PHE A 1 285 ? -12.107 -29.586 33.251  1.00 43.56  ? 307  PHE A CA  1 
ATOM   2058  C C   . PHE A 1 285 ? -13.545 -30.031 32.976  1.00 50.59  ? 307  PHE A C   1 
ATOM   2059  O O   . PHE A 1 285 ? -14.312 -29.309 32.336  1.00 50.16  ? 307  PHE A O   1 
ATOM   2060  C CB  . PHE A 1 285 ? -11.382 -29.280 31.939  1.00 41.97  ? 307  PHE A CB  1 
ATOM   2061  C CG  . PHE A 1 285 ? -9.949  -28.847 32.130  1.00 40.73  ? 307  PHE A CG  1 
ATOM   2062  C CD1 . PHE A 1 285 ? -9.650  -27.588 32.634  1.00 37.90  ? 307  PHE A CD1 1 
ATOM   2063  C CD2 . PHE A 1 285 ? -8.898  -29.709 31.824  1.00 41.05  ? 307  PHE A CD2 1 
ATOM   2064  C CE1 . PHE A 1 285 ? -8.318  -27.191 32.823  1.00 38.41  ? 307  PHE A CE1 1 
ATOM   2065  C CE2 . PHE A 1 285 ? -7.566  -29.319 32.012  1.00 39.50  ? 307  PHE A CE2 1 
ATOM   2066  C CZ  . PHE A 1 285 ? -7.277  -28.063 32.514  1.00 36.05  ? 307  PHE A CZ  1 
ATOM   2067  N N   . LYS A 1 286 ? -13.908 -31.214 33.464  1.00 55.49  ? 308  LYS A N   1 
ATOM   2068  C CA  . LYS A 1 286 ? -15.228 -31.774 33.219  1.00 60.98  ? 308  LYS A CA  1 
ATOM   2069  C C   . LYS A 1 286 ? -16.335 -30.814 33.645  1.00 60.07  ? 308  LYS A C   1 
ATOM   2070  O O   . LYS A 1 286 ? -17.384 -30.735 33.010  1.00 61.81  ? 308  LYS A O   1 
ATOM   2071  C CB  . LYS A 1 286 ? -15.388 -33.100 33.971  1.00 68.62  ? 308  LYS A CB  1 
ATOM   2072  C CG  . LYS A 1 286 ? -16.425 -34.039 33.368  1.00 76.48  ? 308  LYS A CG  1 
ATOM   2073  C CD  . LYS A 1 286 ? -15.828 -34.844 32.223  1.00 80.61  ? 308  LYS A CD  1 
ATOM   2074  C CE  . LYS A 1 286 ? -16.868 -35.176 31.159  1.00 84.19  ? 308  LYS A CE  1 
ATOM   2075  N NZ  . LYS A 1 286 ? -16.244 -35.762 29.937  1.00 85.52  ? 308  LYS A NZ  1 
ATOM   2076  N N   . ASN A 1 287 ? -16.109 -30.116 34.750  1.00 55.66  ? 309  ASN A N   1 
ATOM   2077  C CA  . ASN A 1 287 ? -17.108 -29.195 35.288  1.00 54.16  ? 309  ASN A CA  1 
ATOM   2078  C C   . ASN A 1 287 ? -16.953 -27.699 35.003  1.00 50.78  ? 309  ASN A C   1 
ATOM   2079  O O   . ASN A 1 287 ? -17.650 -26.895 35.611  1.00 55.16  ? 309  ASN A O   1 
ATOM   2080  C CB  . ASN A 1 287 ? -17.384 -29.464 36.769  1.00 56.74  ? 309  ASN A CB  1 
ATOM   2081  C CG  . ASN A 1 287 ? -18.268 -30.674 36.973  1.00 64.40  ? 309  ASN A CG  1 
ATOM   2082  O OD1 . ASN A 1 287 ? -18.988 -31.085 36.062  1.00 68.37  ? 309  ASN A OD1 1 
ATOM   2083  N ND2 . ASN A 1 287 ? -18.226 -31.248 38.167  1.00 67.58  ? 309  ASN A ND2 1 
ATOM   2084  N N   . MET A 1 288 ? -16.011 -27.309 34.149  1.00 45.50  ? 310  MET A N   1 
ATOM   2085  C CA  . MET A 1 288 ? -15.812 -25.883 33.886  1.00 45.31  ? 310  MET A CA  1 
ATOM   2086  C C   . MET A 1 288 ? -16.054 -25.482 32.421  1.00 45.44  ? 310  MET A C   1 
ATOM   2087  O O   . MET A 1 288 ? -15.105 -25.256 31.656  1.00 42.94  ? 310  MET A O   1 
ATOM   2088  C CB  . MET A 1 288 ? -14.451 -25.370 34.419  1.00 44.02  ? 310  MET A CB  1 
ATOM   2089  C CG  . MET A 1 288 ? -13.259 -26.313 34.265  1.00 47.29  ? 310  MET A CG  1 
ATOM   2090  S SD  . MET A 1 288 ? -11.655 -25.556 34.708  1.00 52.37  ? 310  MET A SD  1 
ATOM   2091  C CE  . MET A 1 288 ? -11.723 -25.625 36.497  1.00 40.44  ? 310  MET A CE  1 
ATOM   2092  N N   . PRO A 1 289 ? -17.342 -25.384 32.038  1.00 44.18  ? 311  PRO A N   1 
ATOM   2093  C CA  . PRO A 1 289 ? -17.774 -25.031 30.682  1.00 44.67  ? 311  PRO A CA  1 
ATOM   2094  C C   . PRO A 1 289 ? -17.433 -23.597 30.272  1.00 46.02  ? 311  PRO A C   1 
ATOM   2095  O O   . PRO A 1 289 ? -17.518 -23.287 29.088  1.00 47.62  ? 311  PRO A O   1 
ATOM   2096  C CB  . PRO A 1 289 ? -19.300 -25.239 30.734  1.00 46.00  ? 311  PRO A CB  1 
ATOM   2097  C CG  . PRO A 1 289 ? -19.661 -25.046 32.166  1.00 44.70  ? 311  PRO A CG  1 
ATOM   2098  C CD  . PRO A 1 289 ? -18.500 -25.638 32.923  1.00 44.77  ? 311  PRO A CD  1 
ATOM   2099  N N   . HIS A 1 290 ? -17.062 -22.738 31.219  1.00 48.45  ? 312  HIS A N   1 
ATOM   2100  C CA  . HIS A 1 290 ? -16.732 -21.346 30.889  1.00 47.23  ? 312  HIS A CA  1 
ATOM   2101  C C   . HIS A 1 290 ? -15.245 -21.040 30.667  1.00 45.84  ? 312  HIS A C   1 
ATOM   2102  O O   . HIS A 1 290 ? -14.892 -19.885 30.417  1.00 44.39  ? 312  HIS A O   1 
ATOM   2103  C CB  . HIS A 1 290 ? -17.273 -20.392 31.956  1.00 48.60  ? 312  HIS A CB  1 
ATOM   2104  C CG  . HIS A 1 290 ? -18.768 -20.349 32.025  1.00 53.88  ? 312  HIS A CG  1 
ATOM   2105  N ND1 . HIS A 1 290 ? -19.525 -19.531 31.216  1.00 56.05  ? 312  HIS A ND1 1 
ATOM   2106  C CD2 . HIS A 1 290 ? -19.645 -21.013 32.817  1.00 54.64  ? 312  HIS A CD2 1 
ATOM   2107  C CE1 . HIS A 1 290 ? -20.806 -19.700 31.499  1.00 57.57  ? 312  HIS A CE1 1 
ATOM   2108  N NE2 . HIS A 1 290 ? -20.906 -20.594 32.466  1.00 54.88  ? 312  HIS A NE2 1 
ATOM   2109  N N   . LEU A 1 291 ? -14.380 -22.047 30.760  1.00 42.88  ? 313  LEU A N   1 
ATOM   2110  C CA  . LEU A 1 291 ? -12.942 -21.777 30.751  1.00 44.28  ? 313  LEU A CA  1 
ATOM   2111  C C   . LEU A 1 291 ? -12.489 -20.999 29.515  1.00 43.78  ? 313  LEU A C   1 
ATOM   2112  O O   . LEU A 1 291 ? -12.805 -21.359 28.380  1.00 43.58  ? 313  LEU A O   1 
ATOM   2113  C CB  . LEU A 1 291 ? -12.124 -23.053 30.921  1.00 43.40  ? 313  LEU A CB  1 
ATOM   2114  C CG  . LEU A 1 291 ? -10.681 -22.825 31.375  1.00 41.44  ? 313  LEU A CG  1 
ATOM   2115  C CD1 . LEU A 1 291 ? -10.648 -22.002 32.655  1.00 39.52  ? 313  LEU A CD1 1 
ATOM   2116  C CD2 . LEU A 1 291 ? -9.982  -24.157 31.581  1.00 39.09  ? 313  LEU A CD2 1 
ATOM   2117  N N   . LYS A 1 292 ? -11.761 -19.918 29.767  1.00 42.65  ? 314  LYS A N   1 
ATOM   2118  C CA  . LYS A 1 292 ? -11.407 -18.936 28.750  1.00 46.84  ? 314  LYS A CA  1 
ATOM   2119  C C   . LYS A 1 292 ? -9.900  -18.857 28.554  1.00 46.26  ? 314  LYS A C   1 
ATOM   2120  O O   . LYS A 1 292 ? -9.399  -18.955 27.436  1.00 46.08  ? 314  LYS A O   1 
ATOM   2121  C CB  . LYS A 1 292 ? -11.974 -17.558 29.087  1.00 51.53  ? 314  LYS A CB  1 
ATOM   2122  C CG  . LYS A 1 292 ? -12.165 -16.677 27.855  1.00 56.19  ? 314  LYS A CG  1 
ATOM   2123  C CD  . LYS A 1 292 ? -11.878 -15.209 28.155  1.00 60.68  ? 314  LYS A CD  1 
ATOM   2124  C CE  . LYS A 1 292 ? -12.862 -14.615 29.155  1.00 63.30  ? 314  LYS A CE  1 
ATOM   2125  N NZ  . LYS A 1 292 ? -12.395 -13.292 29.671  1.00 63.61  ? 314  LYS A NZ  1 
ATOM   2126  N N   . VAL A 1 293 ? -9.194  -18.574 29.638  1.00 44.21  ? 315  VAL A N   1 
ATOM   2127  C CA  . VAL A 1 293 ? -7.747  -18.478 29.594  1.00 41.81  ? 315  VAL A CA  1 
ATOM   2128  C C   . VAL A 1 293 ? -7.064  -19.574 30.414  1.00 44.30  ? 315  VAL A C   1 
ATOM   2129  O O   . VAL A 1 293 ? -7.280  -19.688 31.627  1.00 45.49  ? 315  VAL A O   1 
ATOM   2130  C CB  . VAL A 1 293 ? -7.287  -17.094 30.072  1.00 40.15  ? 315  VAL A CB  1 
ATOM   2131  C CG1 . VAL A 1 293 ? -5.791  -16.982 29.975  1.00 30.72  ? 315  VAL A CG1 1 
ATOM   2132  C CG2 . VAL A 1 293 ? -7.986  -15.987 29.243  1.00 32.10  ? 315  VAL A CG2 1 
ATOM   2133  N N   . LEU A 1 294 ? -6.235  -20.374 29.743  1.00 42.45  ? 316  LEU A N   1 
ATOM   2134  C CA  . LEU A 1 294 ? -5.506  -21.460 30.389  1.00 40.72  ? 316  LEU A CA  1 
ATOM   2135  C C   . LEU A 1 294 ? -4.000  -21.326 30.196  1.00 42.27  ? 316  LEU A C   1 
ATOM   2136  O O   . LEU A 1 294 ? -3.496  -21.436 29.075  1.00 41.94  ? 316  LEU A O   1 
ATOM   2137  C CB  . LEU A 1 294 ? -5.977  -22.816 29.851  1.00 41.70  ? 316  LEU A CB  1 
ATOM   2138  C CG  . LEU A 1 294 ? -5.193  -24.049 30.311  1.00 41.91  ? 316  LEU A CG  1 
ATOM   2139  C CD1 . LEU A 1 294 ? -5.081  -24.114 31.842  1.00 42.37  ? 316  LEU A CD1 1 
ATOM   2140  C CD2 . LEU A 1 294 ? -5.820  -25.319 29.763  1.00 42.34  ? 316  LEU A CD2 1 
ATOM   2141  N N   . ASP A 1 295 ? -3.284  -21.103 31.298  1.00 45.58  ? 317  ASP A N   1 
ATOM   2142  C CA  . ASP A 1 295 ? -1.833  -20.915 31.254  1.00 43.90  ? 317  ASP A CA  1 
ATOM   2143  C C   . ASP A 1 295 ? -1.102  -22.181 31.710  1.00 42.97  ? 317  ASP A C   1 
ATOM   2144  O O   . ASP A 1 295 ? -1.136  -22.554 32.893  1.00 40.66  ? 317  ASP A O   1 
ATOM   2145  C CB  . ASP A 1 295 ? -1.424  -19.730 32.128  1.00 48.24  ? 317  ASP A CB  1 
ATOM   2146  C CG  . ASP A 1 295 ? -1.539  -18.389 31.409  1.00 52.92  ? 317  ASP A CG  1 
ATOM   2147  O OD1 . ASP A 1 295 ? -2.670  -17.943 31.105  1.00 56.46  ? 317  ASP A OD1 1 
ATOM   2148  O OD2 . ASP A 1 295 ? -0.488  -17.765 31.168  1.00 53.13  ? 317  ASP A OD2 1 
ATOM   2149  N N   . LEU A 1 296 ? -0.515  -22.864 30.730  1.00 39.50  ? 318  LEU A N   1 
ATOM   2150  C CA  . LEU A 1 296 ? 0.298   -24.063 30.909  1.00 36.69  ? 318  LEU A CA  1 
ATOM   2151  C C   . LEU A 1 296 ? 1.832   -23.919 30.758  1.00 43.25  ? 318  LEU A C   1 
ATOM   2152  O O   . LEU A 1 296 ? 2.543   -24.918 30.615  1.00 44.80  ? 318  LEU A O   1 
ATOM   2153  C CB  . LEU A 1 296 ? -0.280  -25.220 30.098  1.00 31.85  ? 318  LEU A CB  1 
ATOM   2154  C CG  . LEU A 1 296 ? -1.651  -25.579 30.681  1.00 35.81  ? 318  LEU A CG  1 
ATOM   2155  C CD1 . LEU A 1 296 ? -2.380  -26.577 29.820  1.00 39.17  ? 318  LEU A CD1 1 
ATOM   2156  C CD2 . LEU A 1 296 ? -1.499  -26.102 32.113  1.00 31.59  ? 318  LEU A CD2 1 
ATOM   2157  N N   . GLU A 1 297 ? 2.317   -22.684 30.688  1.00 44.41  ? 319  GLU A N   1 
ATOM   2158  C CA  . GLU A 1 297 ? 3.729   -22.396 30.412  1.00 42.55  ? 319  GLU A CA  1 
ATOM   2159  C C   . GLU A 1 297 ? 4.704   -22.990 31.420  1.00 39.14  ? 319  GLU A C   1 
ATOM   2160  O O   . GLU A 1 297 ? 4.351   -23.240 32.575  1.00 40.54  ? 319  GLU A O   1 
ATOM   2161  C CB  . GLU A 1 297 ? 3.963   -20.883 30.356  1.00 47.73  ? 319  GLU A CB  1 
ATOM   2162  C CG  . GLU A 1 297 ? 2.687   -20.068 30.254  1.00 52.82  ? 319  GLU A CG  1 
ATOM   2163  C CD  . GLU A 1 297 ? 2.896   -18.618 30.636  1.00 55.60  ? 319  GLU A CD  1 
ATOM   2164  O OE1 . GLU A 1 297 ? 2.130   -18.112 31.486  1.00 54.06  ? 319  GLU A OE1 1 
ATOM   2165  O OE2 . GLU A 1 297 ? 3.827   -17.988 30.089  1.00 56.84  ? 319  GLU A OE2 1 
ATOM   2166  N N   . PHE A 1 298 ? 5.929   -23.231 30.961  1.00 34.82  ? 320  PHE A N   1 
ATOM   2167  C CA  . PHE A 1 298 ? 7.012   -23.680 31.833  1.00 37.51  ? 320  PHE A CA  1 
ATOM   2168  C C   . PHE A 1 298 ? 6.660   -24.986 32.560  1.00 36.04  ? 320  PHE A C   1 
ATOM   2169  O O   . PHE A 1 298 ? 6.877   -25.135 33.763  1.00 32.24  ? 320  PHE A O   1 
ATOM   2170  C CB  . PHE A 1 298 ? 7.403   -22.580 32.830  1.00 39.61  ? 320  PHE A CB  1 
ATOM   2171  C CG  . PHE A 1 298 ? 8.022   -21.351 32.190  1.00 36.50  ? 320  PHE A CG  1 
ATOM   2172  C CD1 . PHE A 1 298 ? 9.348   -21.356 31.796  1.00 33.08  ? 320  PHE A CD1 1 
ATOM   2173  C CD2 . PHE A 1 298 ? 7.286   -20.190 32.020  1.00 38.64  ? 320  PHE A CD2 1 
ATOM   2174  C CE1 . PHE A 1 298 ? 9.930   -20.236 31.228  1.00 31.51  ? 320  PHE A CE1 1 
ATOM   2175  C CE2 . PHE A 1 298 ? 7.859   -19.054 31.445  1.00 35.17  ? 320  PHE A CE2 1 
ATOM   2176  C CZ  . PHE A 1 298 ? 9.188   -19.082 31.048  1.00 31.06  ? 320  PHE A CZ  1 
ATOM   2177  N N   . ASN A 1 299 ? 6.081   -25.914 31.811  1.00 37.44  ? 321  ASN A N   1 
ATOM   2178  C CA  . ASN A 1 299 ? 5.865   -27.277 32.266  1.00 37.08  ? 321  ASN A CA  1 
ATOM   2179  C C   . ASN A 1 299 ? 6.647   -28.253 31.380  1.00 37.36  ? 321  ASN A C   1 
ATOM   2180  O O   . ASN A 1 299 ? 7.492   -27.842 30.579  1.00 40.36  ? 321  ASN A O   1 
ATOM   2181  C CB  . ASN A 1 299 ? 4.373   -27.622 32.284  1.00 37.42  ? 321  ASN A CB  1 
ATOM   2182  C CG  . ASN A 1 299 ? 3.621   -26.870 33.349  1.00 37.31  ? 321  ASN A CG  1 
ATOM   2183  O OD1 . ASN A 1 299 ? 3.841   -27.086 34.541  1.00 39.29  ? 321  ASN A OD1 1 
ATOM   2184  N ND2 . ASN A 1 299 ? 2.734   -25.970 32.932  1.00 34.83  ? 321  ASN A ND2 1 
ATOM   2185  N N   . TYR A 1 300 ? 6.391   -29.538 31.590  1.00 34.41  ? 322  TYR A N   1 
ATOM   2186  C CA  . TYR A 1 300 ? 6.962   -30.672 30.844  1.00 40.83  ? 322  TYR A CA  1 
ATOM   2187  C C   . TYR A 1 300 ? 6.090   -31.267 29.716  1.00 43.43  ? 322  TYR A C   1 
ATOM   2188  O O   . TYR A 1 300 ? 6.159   -32.468 29.441  1.00 46.09  ? 322  TYR A O   1 
ATOM   2189  C CB  . TYR A 1 300 ? 7.522   -31.739 31.774  1.00 41.90  ? 322  TYR A CB  1 
ATOM   2190  C CG  . TYR A 1 300 ? 8.580   -31.207 32.710  1.00 44.37  ? 322  TYR A CG  1 
ATOM   2191  C CD1 . TYR A 1 300 ? 9.881   -30.983 32.269  1.00 45.74  ? 322  TYR A CD1 1 
ATOM   2192  C CD2 . TYR A 1 300 ? 8.279   -30.926 34.039  1.00 43.72  ? 322  TYR A CD2 1 
ATOM   2193  C CE1 . TYR A 1 300 ? 10.858  -30.503 33.136  1.00 45.11  ? 322  TYR A CE1 1 
ATOM   2194  C CE2 . TYR A 1 300 ? 9.245   -30.447 34.908  1.00 42.81  ? 322  TYR A CE2 1 
ATOM   2195  C CZ  . TYR A 1 300 ? 10.525  -30.243 34.457  1.00 46.58  ? 322  TYR A CZ  1 
ATOM   2196  O OH  . TYR A 1 300 ? 11.467  -29.769 35.339  1.00 52.18  ? 322  TYR A OH  1 
ATOM   2197  N N   . LEU A 1 301 ? 5.186   -30.461 29.175  1.00 39.93  ? 323  LEU A N   1 
ATOM   2198  C CA  . LEU A 1 301 ? 4.023   -30.929 28.420  1.00 38.50  ? 323  LEU A CA  1 
ATOM   2199  C C   . LEU A 1 301 ? 4.162   -31.411 26.967  1.00 41.17  ? 323  LEU A C   1 
ATOM   2200  O O   . LEU A 1 301 ? 3.142   -31.676 26.325  1.00 45.27  ? 323  LEU A O   1 
ATOM   2201  C CB  . LEU A 1 301 ? 2.960   -29.840 28.458  1.00 37.24  ? 323  LEU A CB  1 
ATOM   2202  C CG  . LEU A 1 301 ? 2.497   -29.630 29.888  1.00 36.80  ? 323  LEU A CG  1 
ATOM   2203  C CD1 . LEU A 1 301 ? 1.533   -28.460 29.977  1.00 38.86  ? 323  LEU A CD1 1 
ATOM   2204  C CD2 . LEU A 1 301 ? 1.877   -30.932 30.366  1.00 32.07  ? 323  LEU A CD2 1 
ATOM   2205  N N   . VAL A 1 302 ? 5.379   -31.482 26.433  1.00 38.78  ? 324  VAL A N   1 
ATOM   2206  C CA  . VAL A 1 302 ? 5.574   -31.940 25.053  1.00 42.31  ? 324  VAL A CA  1 
ATOM   2207  C C   . VAL A 1 302 ? 4.807   -33.216 24.698  1.00 41.71  ? 324  VAL A C   1 
ATOM   2208  O O   . VAL A 1 302 ? 4.206   -33.303 23.626  1.00 41.30  ? 324  VAL A O   1 
ATOM   2209  C CB  . VAL A 1 302 ? 7.071   -32.108 24.710  1.00 46.66  ? 324  VAL A CB  1 
ATOM   2210  C CG1 . VAL A 1 302 ? 7.253   -32.975 23.477  1.00 48.20  ? 324  VAL A CG1 1 
ATOM   2211  C CG2 . VAL A 1 302 ? 7.704   -30.751 24.489  1.00 45.82  ? 324  VAL A CG2 1 
ATOM   2212  N N   . GLY A 1 303 ? 4.802   -34.189 25.601  1.00 42.55  ? 325  GLY A N   1 
ATOM   2213  C CA  . GLY A 1 303 ? 4.010   -35.389 25.403  1.00 42.75  ? 325  GLY A CA  1 
ATOM   2214  C C   . GLY A 1 303 ? 2.527   -35.073 25.297  1.00 46.08  ? 325  GLY A C   1 
ATOM   2215  O O   . GLY A 1 303 ? 1.825   -35.615 24.440  1.00 48.81  ? 325  GLY A O   1 
ATOM   2216  N N   . GLU A 1 304 ? 2.042   -34.190 26.163  1.00 44.51  ? 326  GLU A N   1 
ATOM   2217  C CA  . GLU A 1 304 ? 0.627   -33.828 26.143  1.00 46.64  ? 326  GLU A CA  1 
ATOM   2218  C C   . GLU A 1 304 ? 0.260   -33.029 24.903  1.00 43.21  ? 326  GLU A C   1 
ATOM   2219  O O   . GLU A 1 304 ? -0.798  -33.231 24.321  1.00 46.47  ? 326  GLU A O   1 
ATOM   2220  C CB  . GLU A 1 304 ? 0.243   -33.042 27.393  1.00 48.64  ? 326  GLU A CB  1 
ATOM   2221  C CG  . GLU A 1 304 ? -0.010  -33.908 28.594  1.00 55.35  ? 326  GLU A CG  1 
ATOM   2222  C CD  . GLU A 1 304 ? -1.410  -34.489 28.616  1.00 60.76  ? 326  GLU A CD  1 
ATOM   2223  O OE1 . GLU A 1 304 ? -2.165  -34.284 27.640  1.00 61.36  ? 326  GLU A OE1 1 
ATOM   2224  O OE2 . GLU A 1 304 ? -1.755  -35.145 29.620  1.00 63.45  ? 326  GLU A OE2 1 
ATOM   2225  N N   . ILE A 1 305 ? 1.133   -32.114 24.503  1.00 37.40  ? 327  ILE A N   1 
ATOM   2226  C CA  . ILE A 1 305 ? 0.862   -31.295 23.331  1.00 39.14  ? 327  ILE A CA  1 
ATOM   2227  C C   . ILE A 1 305 ? 0.632   -32.187 22.108  1.00 42.14  ? 327  ILE A C   1 
ATOM   2228  O O   . ILE A 1 305 ? -0.206  -31.883 21.257  1.00 44.17  ? 327  ILE A O   1 
ATOM   2229  C CB  . ILE A 1 305 ? 1.977   -30.251 23.121  1.00 36.40  ? 327  ILE A CB  1 
ATOM   2230  C CG1 . ILE A 1 305 ? 1.774   -29.088 24.094  1.00 35.93  ? 327  ILE A CG1 1 
ATOM   2231  C CG2 . ILE A 1 305 ? 2.007   -29.750 21.694  1.00 35.05  ? 327  ILE A CG2 1 
ATOM   2232  C CD1 . ILE A 1 305 ? 2.951   -28.165 24.220  1.00 33.86  ? 327  ILE A CD1 1 
ATOM   2233  N N   . ALA A 1 306 ? 1.327   -33.322 22.083  1.00 41.51  ? 328  ALA A N   1 
ATOM   2234  C CA  . ALA A 1 306 ? 1.230   -34.305 21.003  1.00 43.71  ? 328  ALA A CA  1 
ATOM   2235  C C   . ALA A 1 306 ? -0.021  -35.194 21.037  1.00 50.47  ? 328  ALA A C   1 
ATOM   2236  O O   . ALA A 1 306 ? -0.524  -35.589 19.986  1.00 54.23  ? 328  ALA A O   1 
ATOM   2237  C CB  . ALA A 1 306 ? 2.484   -35.180 20.984  1.00 41.74  ? 328  ALA A CB  1 
ATOM   2238  N N   . SER A 1 307 ? -0.510  -35.528 22.228  1.00 50.76  ? 329  SER A N   1 
ATOM   2239  C CA  . SER A 1 307 ? -1.657  -36.430 22.352  1.00 54.88  ? 329  SER A CA  1 
ATOM   2240  C C   . SER A 1 307 ? -2.869  -35.687 22.913  1.00 58.01  ? 329  SER A C   1 
ATOM   2241  O O   . SER A 1 307 ? -3.876  -35.515 22.222  1.00 60.47  ? 329  SER A O   1 
ATOM   2242  C CB  . SER A 1 307 ? -1.305  -37.626 23.231  1.00 56.45  ? 329  SER A CB  1 
ATOM   2243  O OG  . SER A 1 307 ? -0.835  -37.198 24.497  1.00 57.01  ? 329  SER A OG  1 
ATOM   2244  N N   . GLY A 1 308 ? -2.774  -35.278 24.175  1.00 56.58  ? 330  GLY A N   1 
ATOM   2245  C CA  . GLY A 1 308 ? -3.613  -34.218 24.708  1.00 54.33  ? 330  GLY A CA  1 
ATOM   2246  C C   . GLY A 1 308 ? -5.111  -34.406 24.812  1.00 55.15  ? 330  GLY A C   1 
ATOM   2247  O O   . GLY A 1 308 ? -5.861  -33.628 24.224  1.00 55.82  ? 330  GLY A O   1 
ATOM   2248  N N   . ALA A 1 309 ? -5.551  -35.423 25.549  1.00 53.91  ? 331  ALA A N   1 
ATOM   2249  C CA  . ALA A 1 309 ? -6.977  -35.638 25.783  1.00 53.58  ? 331  ALA A CA  1 
ATOM   2250  C C   . ALA A 1 309 ? -7.694  -34.407 26.347  1.00 52.81  ? 331  ALA A C   1 
ATOM   2251  O O   . ALA A 1 309 ? -8.839  -34.143 25.992  1.00 52.90  ? 331  ALA A O   1 
ATOM   2252  C CB  . ALA A 1 309 ? -7.192  -36.839 26.694  1.00 55.24  ? 331  ALA A CB  1 
ATOM   2253  N N   . PHE A 1 310 ? -7.013  -33.644 27.201  1.00 54.20  ? 332  PHE A N   1 
ATOM   2254  C CA  . PHE A 1 310 ? -7.635  -32.486 27.856  1.00 55.96  ? 332  PHE A CA  1 
ATOM   2255  C C   . PHE A 1 310 ? -8.136  -31.401 26.903  1.00 59.64  ? 332  PHE A C   1 
ATOM   2256  O O   . PHE A 1 310 ? -8.882  -30.510 27.312  1.00 60.61  ? 332  PHE A O   1 
ATOM   2257  C CB  . PHE A 1 310 ? -6.714  -31.865 28.915  1.00 52.86  ? 332  PHE A CB  1 
ATOM   2258  C CG  . PHE A 1 310 ? -5.583  -31.039 28.353  1.00 48.58  ? 332  PHE A CG  1 
ATOM   2259  C CD1 . PHE A 1 310 ? -4.443  -31.649 27.855  1.00 48.14  ? 332  PHE A CD1 1 
ATOM   2260  C CD2 . PHE A 1 310 ? -5.643  -29.651 28.364  1.00 47.80  ? 332  PHE A CD2 1 
ATOM   2261  C CE1 . PHE A 1 310 ? -3.387  -30.896 27.354  1.00 47.14  ? 332  PHE A CE1 1 
ATOM   2262  C CE2 . PHE A 1 310 ? -4.590  -28.881 27.864  1.00 46.47  ? 332  PHE A CE2 1 
ATOM   2263  C CZ  . PHE A 1 310 ? -3.456  -29.507 27.365  1.00 46.13  ? 332  PHE A CZ  1 
ATOM   2264  N N   . LEU A 1 311 ? -7.737  -31.474 25.639  1.00 61.23  ? 333  LEU A N   1 
ATOM   2265  C CA  . LEU A 1 311 ? -8.189  -30.495 24.660  1.00 63.62  ? 333  LEU A CA  1 
ATOM   2266  C C   . LEU A 1 311 ? -9.634  -30.718 24.216  1.00 64.83  ? 333  LEU A C   1 
ATOM   2267  O O   . LEU A 1 311 ? -10.267 -29.819 23.664  1.00 67.70  ? 333  LEU A O   1 
ATOM   2268  C CB  . LEU A 1 311 ? -7.254  -30.468 23.456  1.00 64.81  ? 333  LEU A CB  1 
ATOM   2269  C CG  . LEU A 1 311 ? -6.081  -29.506 23.629  1.00 64.64  ? 333  LEU A CG  1 
ATOM   2270  C CD1 . LEU A 1 311 ? -5.117  -30.035 24.642  1.00 64.83  ? 333  LEU A CD1 1 
ATOM   2271  C CD2 . LEU A 1 311 ? -5.378  -29.281 22.325  1.00 67.24  ? 333  LEU A CD2 1 
ATOM   2272  N N   . THR A 1 312 ? -10.151 -31.916 24.467  1.00 63.07  ? 334  THR A N   1 
ATOM   2273  C CA  . THR A 1 312 ? -11.544 -32.234 24.167  1.00 63.59  ? 334  THR A CA  1 
ATOM   2274  C C   . THR A 1 312 ? -12.474 -31.421 25.069  1.00 60.87  ? 334  THR A C   1 
ATOM   2275  O O   . THR A 1 312 ? -13.618 -31.127 24.716  1.00 58.05  ? 334  THR A O   1 
ATOM   2276  C CB  . THR A 1 312 ? -11.818 -33.751 24.365  1.00 65.86  ? 334  THR A CB  1 
ATOM   2277  O OG1 . THR A 1 312 ? -11.155 -34.498 23.338  1.00 66.33  ? 334  THR A OG1 1 
ATOM   2278  C CG2 . THR A 1 312 ? -13.311 -34.063 24.310  1.00 68.65  ? 334  THR A CG2 1 
ATOM   2279  N N   . MET A 1 313 ? -11.951 -31.029 26.224  1.00 59.82  ? 335  MET A N   1 
ATOM   2280  C CA  . MET A 1 313 ? -12.768 -30.468 27.292  1.00 58.52  ? 335  MET A CA  1 
ATOM   2281  C C   . MET A 1 313 ? -12.875 -28.944 27.273  1.00 56.39  ? 335  MET A C   1 
ATOM   2282  O O   . MET A 1 313 ? -13.477 -28.365 28.176  1.00 59.34  ? 335  MET A O   1 
ATOM   2283  C CB  . MET A 1 313 ? -12.210 -30.906 28.648  1.00 59.02  ? 335  MET A CB  1 
ATOM   2284  C CG  . MET A 1 313 ? -11.758 -32.360 28.696  1.00 59.29  ? 335  MET A CG  1 
ATOM   2285  S SD  . MET A 1 313 ? -13.136 -33.497 28.498  1.00 71.88  ? 335  MET A SD  1 
ATOM   2286  C CE  . MET A 1 313 ? -14.152 -32.993 29.868  1.00 44.56  ? 335  MET A CE  1 
ATOM   2287  N N   . LEU A 1 314 ? -12.296 -28.282 26.273  1.00 50.58  ? 336  LEU A N   1 
ATOM   2288  C CA  . LEU A 1 314 ? -12.279 -26.816 26.297  1.00 50.01  ? 336  LEU A CA  1 
ATOM   2289  C C   . LEU A 1 314 ? -12.825 -26.123 25.046  1.00 50.15  ? 336  LEU A C   1 
ATOM   2290  O O   . LEU A 1 314 ? -12.081 -25.424 24.353  1.00 48.27  ? 336  LEU A O   1 
ATOM   2291  C CB  . LEU A 1 314 ? -10.860 -26.317 26.573  1.00 50.10  ? 336  LEU A CB  1 
ATOM   2292  C CG  . LEU A 1 314 ? -10.111 -27.057 27.681  1.00 50.94  ? 336  LEU A CG  1 
ATOM   2293  C CD1 . LEU A 1 314 ? -8.626  -26.741 27.633  1.00 48.03  ? 336  LEU A CD1 1 
ATOM   2294  C CD2 . LEU A 1 314 ? -10.707 -26.707 29.037  1.00 52.69  ? 336  LEU A CD2 1 
ATOM   2295  N N   . PRO A 1 315 ? -14.126 -26.300 24.760  1.00 48.23  ? 337  PRO A N   1 
ATOM   2296  C CA  . PRO A 1 315 ? -14.740 -25.704 23.567  1.00 48.46  ? 337  PRO A CA  1 
ATOM   2297  C C   . PRO A 1 315 ? -14.922 -24.180 23.662  1.00 46.61  ? 337  PRO A C   1 
ATOM   2298  O O   . PRO A 1 315 ? -15.175 -23.519 22.652  1.00 43.87  ? 337  PRO A O   1 
ATOM   2299  C CB  . PRO A 1 315 ? -16.100 -26.403 23.494  1.00 47.62  ? 337  PRO A CB  1 
ATOM   2300  C CG  . PRO A 1 315 ? -16.429 -26.688 24.909  1.00 47.18  ? 337  PRO A CG  1 
ATOM   2301  C CD  . PRO A 1 315 ? -15.119 -26.988 25.599  1.00 48.35  ? 337  PRO A CD  1 
ATOM   2302  N N   . ARG A 1 316 ? -14.873 -23.637 24.872  1.00 45.92  ? 338  ARG A N   1 
ATOM   2303  C CA  . ARG A 1 316 ? -14.899 -22.181 25.035  1.00 45.28  ? 338  ARG A CA  1 
ATOM   2304  C C   . ARG A 1 316 ? -13.539 -21.501 25.296  1.00 41.40  ? 338  ARG A C   1 
ATOM   2305  O O   . ARG A 1 316 ? -13.485 -20.297 25.543  1.00 41.51  ? 338  ARG A O   1 
ATOM   2306  C CB  . ARG A 1 316 ? -15.978 -21.742 26.034  1.00 46.29  ? 338  ARG A CB  1 
ATOM   2307  C CG  . ARG A 1 316 ? -17.392 -21.758 25.434  1.00 50.79  ? 338  ARG A CG  1 
ATOM   2308  C CD  . ARG A 1 316 ? -18.469 -21.868 26.516  1.00 55.29  ? 338  ARG A CD  1 
ATOM   2309  N NE  . ARG A 1 316 ? -19.819 -22.042 25.978  1.00 60.10  ? 338  ARG A NE  1 
ATOM   2310  C CZ  . ARG A 1 316 ? -20.862 -22.427 26.713  1.00 62.64  ? 338  ARG A CZ  1 
ATOM   2311  N NH1 . ARG A 1 316 ? -20.706 -22.680 28.008  1.00 61.45  ? 338  ARG A NH1 1 
ATOM   2312  N NH2 . ARG A 1 316 ? -22.058 -22.565 26.164  1.00 64.23  ? 338  ARG A NH2 1 
ATOM   2313  N N   . LEU A 1 317 ? -12.449 -22.259 25.262  1.00 41.77  ? 339  LEU A N   1 
ATOM   2314  C CA  . LEU A 1 317 ? -11.141 -21.662 25.554  1.00 42.31  ? 339  LEU A CA  1 
ATOM   2315  C C   . LEU A 1 317 ? -10.713 -20.688 24.450  1.00 42.96  ? 339  LEU A C   1 
ATOM   2316  O O   . LEU A 1 317 ? -10.683 -21.045 23.281  1.00 43.31  ? 339  LEU A O   1 
ATOM   2317  C CB  . LEU A 1 317 ? -10.077 -22.732 25.725  1.00 39.87  ? 339  LEU A CB  1 
ATOM   2318  C CG  . LEU A 1 317 ? -8.756  -22.175 26.270  1.00 43.20  ? 339  LEU A CG  1 
ATOM   2319  C CD1 . LEU A 1 317 ? -8.808  -22.025 27.798  1.00 33.95  ? 339  LEU A CD1 1 
ATOM   2320  C CD2 . LEU A 1 317 ? -7.584  -23.033 25.836  1.00 41.89  ? 339  LEU A CD2 1 
ATOM   2321  N N   . GLU A 1 318 ? -10.474 -19.438 24.832  1.00 43.20  ? 340  GLU A N   1 
ATOM   2322  C CA  . GLU A 1 318 ? -9.992  -18.397 23.925  1.00 45.57  ? 340  GLU A CA  1 
ATOM   2323  C C   . GLU A 1 318 ? -8.470  -18.265 23.805  1.00 44.73  ? 340  GLU A C   1 
ATOM   2324  O O   . GLU A 1 318 ? -7.931  -18.013 22.728  1.00 44.88  ? 340  GLU A O   1 
ATOM   2325  C CB  . GLU A 1 318 ? -10.665 -17.062 24.258  1.00 47.98  ? 340  GLU A CB  1 
ATOM   2326  C CG  . GLU A 1 318 ? -12.202 -17.135 24.121  1.00 48.34  ? 340  GLU A CG  1 
ATOM   2327  C CD  . GLU A 1 318 ? -12.892 -15.838 24.488  1.00 52.75  ? 340  GLU A CD  1 
ATOM   2328  O OE1 . GLU A 1 318 ? -12.481 -14.773 23.987  1.00 54.71  ? 340  GLU A OE1 1 
ATOM   2329  O OE2 . GLU A 1 318 ? -13.848 -15.879 25.283  1.00 58.18  ? 340  GLU A OE2 1 
ATOM   2330  N N   . ILE A 1 319 ? -7.799  -18.405 24.939  1.00 42.67  ? 341  ILE A N   1 
ATOM   2331  C CA  . ILE A 1 319 ? -6.368  -18.196 25.035  1.00 37.40  ? 341  ILE A CA  1 
ATOM   2332  C C   . ILE A 1 319 ? -5.677  -19.386 25.692  1.00 40.04  ? 341  ILE A C   1 
ATOM   2333  O O   . ILE A 1 319 ? -6.010  -19.780 26.822  1.00 37.48  ? 341  ILE A O   1 
ATOM   2334  C CB  . ILE A 1 319 ? -6.043  -16.948 25.862  1.00 36.05  ? 341  ILE A CB  1 
ATOM   2335  C CG1 . ILE A 1 319 ? -6.674  -15.706 25.224  1.00 38.85  ? 341  ILE A CG1 1 
ATOM   2336  C CG2 . ILE A 1 319 ? -4.536  -16.783 25.983  1.00 29.68  ? 341  ILE A CG2 1 
ATOM   2337  C CD1 . ILE A 1 319 ? -6.179  -14.414 25.820  1.00 41.04  ? 341  ILE A CD1 1 
ATOM   2338  N N   . LEU A 1 320 ? -4.704  -19.942 24.978  1.00 38.07  ? 342  LEU A N   1 
ATOM   2339  C CA  . LEU A 1 320 ? -3.953  -21.092 25.454  1.00 38.29  ? 342  LEU A CA  1 
ATOM   2340  C C   . LEU A 1 320 ? -2.446  -20.809 25.398  1.00 34.54  ? 342  LEU A C   1 
ATOM   2341  O O   . LEU A 1 320 ? -1.887  -20.637 24.310  1.00 32.79  ? 342  LEU A O   1 
ATOM   2342  C CB  . LEU A 1 320 ? -4.308  -22.306 24.592  1.00 38.51  ? 342  LEU A CB  1 
ATOM   2343  C CG  . LEU A 1 320 ? -3.648  -23.653 24.880  1.00 40.03  ? 342  LEU A CG  1 
ATOM   2344  C CD1 . LEU A 1 320 ? -3.815  -24.035 26.338  1.00 41.62  ? 342  LEU A CD1 1 
ATOM   2345  C CD2 . LEU A 1 320 ? -4.266  -24.707 23.980  1.00 40.74  ? 342  LEU A CD2 1 
ATOM   2346  N N   . ASP A 1 321 ? -1.785  -20.745 26.552  1.00 34.49  ? 343  ASP A N   1 
ATOM   2347  C CA  . ASP A 1 321 ? -0.330  -20.537 26.557  1.00 33.28  ? 343  ASP A CA  1 
ATOM   2348  C C   . ASP A 1 321 ? 0.407   -21.823 26.899  1.00 40.46  ? 343  ASP A C   1 
ATOM   2349  O O   . ASP A 1 321 ? 0.350   -22.309 28.035  1.00 43.12  ? 343  ASP A O   1 
ATOM   2350  C CB  . ASP A 1 321 ? 0.089   -19.415 27.518  1.00 32.84  ? 343  ASP A CB  1 
ATOM   2351  C CG  . ASP A 1 321 ? 1.561   -18.959 27.309  1.00 54.11  ? 343  ASP A CG  1 
ATOM   2352  O OD1 . ASP A 1 321 ? 2.394   -19.727 26.765  1.00 47.85  ? 343  ASP A OD1 1 
ATOM   2353  O OD2 . ASP A 1 321 ? 1.884   -17.820 27.709  1.00 55.45  ? 343  ASP A OD2 1 
ATOM   2354  N N   . LEU A 1 322 ? 1.044   -22.389 25.880  1.00 42.59  ? 344  LEU A N   1 
ATOM   2355  C CA  . LEU A 1 322 ? 1.871   -23.599 25.969  1.00 37.65  ? 344  LEU A CA  1 
ATOM   2356  C C   . LEU A 1 322 ? 3.392   -23.382 25.973  1.00 36.79  ? 344  LEU A C   1 
ATOM   2357  O O   . LEU A 1 322 ? 4.159   -24.313 25.697  1.00 31.41  ? 344  LEU A O   1 
ATOM   2358  C CB  . LEU A 1 322 ? 1.438   -24.624 24.925  1.00 37.76  ? 344  LEU A CB  1 
ATOM   2359  C CG  . LEU A 1 322 ? 0.069   -25.225 25.241  1.00 38.40  ? 344  LEU A CG  1 
ATOM   2360  C CD1 . LEU A 1 322 ? -0.469  -26.073 24.110  1.00 40.67  ? 344  LEU A CD1 1 
ATOM   2361  C CD2 . LEU A 1 322 ? 0.170   -26.042 26.509  1.00 39.66  ? 344  LEU A CD2 1 
ATOM   2362  N N   . SER A 1 323 ? 3.808   -22.132 26.154  1.00 37.28  ? 345  SER A N   1 
ATOM   2363  C CA  . SER A 1 323 ? 5.209   -21.734 26.029  1.00 34.92  ? 345  SER A CA  1 
ATOM   2364  C C   . SER A 1 323 ? 6.214   -22.383 26.981  1.00 40.38  ? 345  SER A C   1 
ATOM   2365  O O   . SER A 1 323 ? 5.904   -22.678 28.135  1.00 45.18  ? 345  SER A O   1 
ATOM   2366  C CB  . SER A 1 323 ? 5.340   -20.206 26.125  1.00 33.93  ? 345  SER A CB  1 
ATOM   2367  O OG  . SER A 1 323 ? 4.708   -19.575 25.032  1.00 32.36  ? 345  SER A OG  1 
ATOM   2368  N N   . PHE A 1 324 ? 7.435   -22.566 26.478  1.00 35.36  ? 346  PHE A N   1 
ATOM   2369  C CA  . PHE A 1 324 ? 8.546   -23.123 27.244  1.00 32.31  ? 346  PHE A CA  1 
ATOM   2370  C C   . PHE A 1 324 ? 8.284   -24.491 27.871  1.00 35.48  ? 346  PHE A C   1 
ATOM   2371  O O   . PHE A 1 324 ? 8.621   -24.741 29.023  1.00 38.27  ? 346  PHE A O   1 
ATOM   2372  C CB  . PHE A 1 324 ? 9.074   -22.113 28.266  1.00 30.31  ? 346  PHE A CB  1 
ATOM   2373  C CG  . PHE A 1 324 ? 9.674   -20.908 27.633  1.00 26.50  ? 346  PHE A CG  1 
ATOM   2374  C CD1 . PHE A 1 324 ? 10.944  -20.965 27.101  1.00 28.66  ? 346  PHE A CD1 1 
ATOM   2375  C CD2 . PHE A 1 324 ? 8.949   -19.729 27.522  1.00 28.91  ? 346  PHE A CD2 1 
ATOM   2376  C CE1 . PHE A 1 324 ? 11.498  -19.863 26.472  1.00 27.45  ? 346  PHE A CE1 1 
ATOM   2377  C CE2 . PHE A 1 324 ? 9.491   -18.619 26.903  1.00 27.86  ? 346  PHE A CE2 1 
ATOM   2378  C CZ  . PHE A 1 324 ? 10.774  -18.691 26.373  1.00 28.37  ? 346  PHE A CZ  1 
ATOM   2379  N N   . ASN A 1 325 ? 7.673   -25.370 27.093  1.00 36.35  ? 347  ASN A N   1 
ATOM   2380  C CA  . ASN A 1 325 ? 7.551   -26.773 27.462  1.00 37.80  ? 347  ASN A CA  1 
ATOM   2381  C C   . ASN A 1 325 ? 8.638   -27.678 26.871  1.00 40.50  ? 347  ASN A C   1 
ATOM   2382  O O   . ASN A 1 325 ? 8.539   -28.903 26.933  1.00 42.63  ? 347  ASN A O   1 
ATOM   2383  C CB  . ASN A 1 325 ? 6.143   -27.285 27.208  1.00 36.39  ? 347  ASN A CB  1 
ATOM   2384  C CG  . ASN A 1 325 ? 5.178   -26.812 28.273  1.00 37.34  ? 347  ASN A CG  1 
ATOM   2385  O OD1 . ASN A 1 325 ? 4.980   -27.491 29.271  1.00 35.89  ? 347  ASN A OD1 1 
ATOM   2386  N ND2 . ASN A 1 325 ? 4.596   -25.625 28.081  1.00 27.92  ? 347  ASN A ND2 1 
ATOM   2387  N N   . TYR A 1 326 ? 9.652   -27.055 26.275  1.00 39.41  ? 348  TYR A N   1 
ATOM   2388  C CA  . TYR A 1 326 ? 10.757  -27.763 25.627  1.00 36.52  ? 348  TYR A CA  1 
ATOM   2389  C C   . TYR A 1 326 ? 11.389  -28.817 26.525  1.00 34.90  ? 348  TYR A C   1 
ATOM   2390  O O   . TYR A 1 326 ? 11.457  -28.658 27.739  1.00 35.69  ? 348  TYR A O   1 
ATOM   2391  C CB  . TYR A 1 326 ? 11.852  -26.772 25.217  1.00 33.32  ? 348  TYR A CB  1 
ATOM   2392  C CG  . TYR A 1 326 ? 12.626  -26.188 26.392  1.00 34.33  ? 348  TYR A CG  1 
ATOM   2393  C CD1 . TYR A 1 326 ? 12.120  -25.116 27.126  1.00 33.36  ? 348  TYR A CD1 1 
ATOM   2394  C CD2 . TYR A 1 326 ? 13.864  -26.704 26.757  1.00 34.32  ? 348  TYR A CD2 1 
ATOM   2395  C CE1 . TYR A 1 326 ? 12.831  -24.571 28.188  1.00 33.69  ? 348  TYR A CE1 1 
ATOM   2396  C CE2 . TYR A 1 326 ? 14.584  -26.170 27.814  1.00 35.06  ? 348  TYR A CE2 1 
ATOM   2397  C CZ  . TYR A 1 326 ? 14.060  -25.105 28.530  1.00 36.11  ? 348  TYR A CZ  1 
ATOM   2398  O OH  . TYR A 1 326 ? 14.775  -24.581 29.587  1.00 34.35  ? 348  TYR A OH  1 
ATOM   2399  N N   . ILE A 1 327 ? 11.810  -29.913 25.908  1.00 33.78  ? 349  ILE A N   1 
ATOM   2400  C CA  . ILE A 1 327 ? 12.636  -30.910 26.564  1.00 36.79  ? 349  ILE A CA  1 
ATOM   2401  C C   . ILE A 1 327 ? 14.059  -30.384 26.546  1.00 39.40  ? 349  ILE A C   1 
ATOM   2402  O O   . ILE A 1 327 ? 14.573  -30.002 25.489  1.00 35.84  ? 349  ILE A O   1 
ATOM   2403  C CB  . ILE A 1 327 ? 12.579  -32.256 25.808  1.00 37.53  ? 349  ILE A CB  1 
ATOM   2404  C CG1 . ILE A 1 327 ? 11.134  -32.762 25.742  1.00 38.99  ? 349  ILE A CG1 1 
ATOM   2405  C CG2 . ILE A 1 327 ? 13.504  -33.294 26.459  1.00 33.23  ? 349  ILE A CG2 1 
ATOM   2406  C CD1 . ILE A 1 327 ? 10.977  -34.047 24.954  1.00 42.47  ? 349  ILE A CD1 1 
ATOM   2407  N N   . LYS A 1 328 ? 14.691  -30.343 27.713  1.00 42.56  ? 350  LYS A N   1 
ATOM   2408  C CA  . LYS A 1 328 ? 16.054  -29.838 27.808  1.00 46.88  ? 350  LYS A CA  1 
ATOM   2409  C C   . LYS A 1 328 ? 17.000  -30.643 26.920  1.00 46.48  ? 350  LYS A C   1 
ATOM   2410  O O   . LYS A 1 328 ? 17.045  -31.869 27.004  1.00 48.58  ? 350  LYS A O   1 
ATOM   2411  C CB  . LYS A 1 328 ? 16.543  -29.887 29.255  1.00 49.51  ? 350  LYS A CB  1 
ATOM   2412  C CG  . LYS A 1 328 ? 18.015  -29.540 29.421  1.00 54.77  ? 350  LYS A CG  1 
ATOM   2413  C CD  . LYS A 1 328 ? 18.536  -30.047 30.752  1.00 60.19  ? 350  LYS A CD  1 
ATOM   2414  C CE  . LYS A 1 328 ? 19.992  -29.686 30.961  1.00 62.42  ? 350  LYS A CE  1 
ATOM   2415  N NZ  . LYS A 1 328 ? 20.450  -30.108 32.318  1.00 63.91  ? 350  LYS A NZ  1 
ATOM   2416  N N   . GLY A 1 329 ? 17.740  -29.944 26.068  1.00 43.53  ? 351  GLY A N   1 
ATOM   2417  C CA  . GLY A 1 329 ? 18.786  -30.558 25.263  1.00 43.54  ? 351  GLY A CA  1 
ATOM   2418  C C   . GLY A 1 329 ? 18.268  -31.215 24.002  1.00 44.16  ? 351  GLY A C   1 
ATOM   2419  O O   . GLY A 1 329 ? 18.997  -31.945 23.323  1.00 44.80  ? 351  GLY A O   1 
ATOM   2420  N N   . SER A 1 330 ? 17.004  -30.949 23.687  1.00 42.57  ? 352  SER A N   1 
ATOM   2421  C CA  . SER A 1 330 ? 16.325  -31.609 22.577  1.00 43.63  ? 352  SER A CA  1 
ATOM   2422  C C   . SER A 1 330 ? 15.917  -30.600 21.506  1.00 43.39  ? 352  SER A C   1 
ATOM   2423  O O   . SER A 1 330 ? 15.250  -29.608 21.800  1.00 42.61  ? 352  SER A O   1 
ATOM   2424  C CB  . SER A 1 330 ? 15.095  -32.358 23.098  1.00 44.52  ? 352  SER A CB  1 
ATOM   2425  O OG  . SER A 1 330 ? 14.306  -32.878 22.045  1.00 47.15  ? 352  SER A OG  1 
ATOM   2426  N N   . TYR A 1 331 ? 16.320  -30.864 20.267  1.00 41.91  ? 353  TYR A N   1 
ATOM   2427  C CA  . TYR A 1 331 ? 16.077  -29.955 19.146  1.00 37.65  ? 353  TYR A CA  1 
ATOM   2428  C C   . TYR A 1 331 ? 15.440  -30.761 18.015  1.00 41.42  ? 353  TYR A C   1 
ATOM   2429  O O   . TYR A 1 331 ? 16.046  -30.933 16.960  1.00 41.66  ? 353  TYR A O   1 
ATOM   2430  C CB  . TYR A 1 331 ? 17.417  -29.361 18.684  1.00 32.00  ? 353  TYR A CB  1 
ATOM   2431  C CG  . TYR A 1 331 ? 17.381  -28.139 17.767  1.00 32.06  ? 353  TYR A CG  1 
ATOM   2432  C CD1 . TYR A 1 331 ? 16.272  -27.291 17.706  1.00 34.65  ? 353  TYR A CD1 1 
ATOM   2433  C CD2 . TYR A 1 331 ? 18.483  -27.831 16.970  1.00 32.89  ? 353  TYR A CD2 1 
ATOM   2434  C CE1 . TYR A 1 331 ? 16.269  -26.161 16.877  1.00 32.67  ? 353  TYR A CE1 1 
ATOM   2435  C CE2 . TYR A 1 331 ? 18.494  -26.724 16.144  1.00 34.92  ? 353  TYR A CE2 1 
ATOM   2436  C CZ  . TYR A 1 331 ? 17.388  -25.888 16.097  1.00 36.26  ? 353  TYR A CZ  1 
ATOM   2437  O OH  . TYR A 1 331 ? 17.421  -24.793 15.262  1.00 35.93  ? 353  TYR A OH  1 
ATOM   2438  N N   . PRO A 1 332 ? 14.210  -31.261 18.231  1.00 42.20  ? 354  PRO A N   1 
ATOM   2439  C CA  . PRO A 1 332 ? 13.552  -32.122 17.236  1.00 38.64  ? 354  PRO A CA  1 
ATOM   2440  C C   . PRO A 1 332 ? 13.349  -31.389 15.922  1.00 35.08  ? 354  PRO A C   1 
ATOM   2441  O O   . PRO A 1 332 ? 13.309  -30.159 15.914  1.00 32.51  ? 354  PRO A O   1 
ATOM   2442  C CB  . PRO A 1 332 ? 12.194  -32.418 17.870  1.00 40.35  ? 354  PRO A CB  1 
ATOM   2443  C CG  . PRO A 1 332 ? 11.948  -31.239 18.786  1.00 41.03  ? 354  PRO A CG  1 
ATOM   2444  C CD  . PRO A 1 332 ? 13.308  -30.917 19.345  1.00 40.05  ? 354  PRO A CD  1 
ATOM   2445  N N   . GLN A 1 333 ? 13.235  -32.141 14.831  1.00 38.14  ? 355  GLN A N   1 
ATOM   2446  C CA  . GLN A 1 333 ? 13.047  -31.564 13.507  1.00 45.35  ? 355  GLN A CA  1 
ATOM   2447  C C   . GLN A 1 333 ? 11.716  -30.844 13.399  1.00 46.49  ? 355  GLN A C   1 
ATOM   2448  O O   . GLN A 1 333 ? 11.595  -29.835 12.703  1.00 47.54  ? 355  GLN A O   1 
ATOM   2449  C CB  . GLN A 1 333 ? 13.116  -32.650 12.433  1.00 56.17  ? 355  GLN A CB  1 
ATOM   2450  C CG  . GLN A 1 333 ? 14.503  -32.923 11.899  1.00 66.15  ? 355  GLN A CG  1 
ATOM   2451  C CD  . GLN A 1 333 ? 14.490  -33.930 10.761  1.00 78.28  ? 355  GLN A CD  1 
ATOM   2452  O OE1 . GLN A 1 333 ? 13.453  -34.524 10.455  1.00 82.47  ? 355  GLN A OE1 1 
ATOM   2453  N NE2 . GLN A 1 333 ? 15.643  -34.128 10.128  1.00 81.77  ? 355  GLN A NE2 1 
ATOM   2454  N N   . HIS A 1 334 ? 10.705  -31.364 14.081  1.00 46.86  ? 356  HIS A N   1 
ATOM   2455  C CA  . HIS A 1 334 ? 9.360   -30.835 13.895  1.00 48.97  ? 356  HIS A CA  1 
ATOM   2456  C C   . HIS A 1 334 ? 8.640   -30.647 15.209  1.00 46.79  ? 356  HIS A C   1 
ATOM   2457  O O   . HIS A 1 334 ? 8.974   -31.285 16.208  1.00 48.68  ? 356  HIS A O   1 
ATOM   2458  C CB  . HIS A 1 334 ? 8.553   -31.756 12.972  1.00 52.55  ? 356  HIS A CB  1 
ATOM   2459  C CG  . HIS A 1 334 ? 9.195   -31.970 11.634  1.00 56.83  ? 356  HIS A CG  1 
ATOM   2460  N ND1 . HIS A 1 334 ? 9.655   -33.200 11.216  1.00 57.93  ? 356  HIS A ND1 1 
ATOM   2461  C CD2 . HIS A 1 334 ? 9.478   -31.103 10.632  1.00 57.64  ? 356  HIS A CD2 1 
ATOM   2462  C CE1 . HIS A 1 334 ? 10.181  -33.085 10.009  1.00 58.26  ? 356  HIS A CE1 1 
ATOM   2463  N NE2 . HIS A 1 334 ? 10.088  -31.823 9.633   1.00 58.34  ? 356  HIS A NE2 1 
ATOM   2464  N N   . ILE A 1 335 ? 7.660   -29.753 15.207  1.00 44.94  ? 357  ILE A N   1 
ATOM   2465  C CA  . ILE A 1 335 ? 6.755   -29.622 16.334  1.00 44.32  ? 357  ILE A CA  1 
ATOM   2466  C C   . ILE A 1 335 ? 5.607   -30.600 16.114  1.00 46.90  ? 357  ILE A C   1 
ATOM   2467  O O   . ILE A 1 335 ? 5.136   -30.760 14.988  1.00 50.17  ? 357  ILE A O   1 
ATOM   2468  C CB  . ILE A 1 335 ? 6.254   -28.164 16.502  1.00 33.14  ? 357  ILE A CB  1 
ATOM   2469  C CG1 . ILE A 1 335 ? 5.616   -27.958 17.881  1.00 32.01  ? 357  ILE A CG1 1 
ATOM   2470  C CG2 . ILE A 1 335 ? 5.295   -27.751 15.387  1.00 32.89  ? 357  ILE A CG2 1 
ATOM   2471  C CD1 . ILE A 1 335 ? 5.220   -26.524 18.132  1.00 32.13  ? 357  ILE A CD1 1 
ATOM   2472  N N   . ASN A 1 336 ? 5.183   -31.291 17.168  1.00 44.63  ? 358  ASN A N   1 
ATOM   2473  C CA  . ASN A 1 336 ? 4.097   -32.257 17.019  1.00 45.06  ? 358  ASN A CA  1 
ATOM   2474  C C   . ASN A 1 336 ? 2.803   -31.825 17.714  1.00 44.06  ? 358  ASN A C   1 
ATOM   2475  O O   . ASN A 1 336 ? 2.690   -31.873 18.941  1.00 39.86  ? 358  ASN A O   1 
ATOM   2476  C CB  . ASN A 1 336 ? 4.520   -33.643 17.512  1.00 46.06  ? 358  ASN A CB  1 
ATOM   2477  C CG  . ASN A 1 336 ? 3.605   -34.742 17.001  1.00 49.42  ? 358  ASN A CG  1 
ATOM   2478  O OD1 . ASN A 1 336 ? 2.495   -34.471 16.549  1.00 54.80  ? 358  ASN A OD1 1 
ATOM   2479  N ND2 . ASN A 1 336 ? 4.070   -35.985 17.057  1.00 49.63  ? 358  ASN A ND2 1 
ATOM   2480  N N   . ILE A 1 337 ? 1.817   -31.451 16.906  1.00 44.91  ? 359  ILE A N   1 
ATOM   2481  C CA  . ILE A 1 337 ? 0.553   -30.920 17.402  1.00 45.04  ? 359  ILE A CA  1 
ATOM   2482  C C   . ILE A 1 337 ? -0.563  -31.954 17.255  1.00 46.67  ? 359  ILE A C   1 
ATOM   2483  O O   . ILE A 1 337 ? -0.840  -32.420 16.150  1.00 48.97  ? 359  ILE A O   1 
ATOM   2484  C CB  . ILE A 1 337 ? 0.182   -29.626 16.645  1.00 45.24  ? 359  ILE A CB  1 
ATOM   2485  C CG1 . ILE A 1 337 ? 1.134   -28.498 17.030  1.00 45.36  ? 359  ILE A CG1 1 
ATOM   2486  C CG2 . ILE A 1 337 ? -1.241  -29.201 16.944  1.00 47.43  ? 359  ILE A CG2 1 
ATOM   2487  C CD1 . ILE A 1 337 ? 1.122   -28.191 18.510  1.00 46.96  ? 359  ILE A CD1 1 
ATOM   2488  N N   . SER A 1 338 ? -1.187  -32.319 18.375  1.00 46.05  ? 360  SER A N   1 
ATOM   2489  C CA  . SER A 1 338 ? -2.310  -33.262 18.377  1.00 42.65  ? 360  SER A CA  1 
ATOM   2490  C C   . SER A 1 338 ? -3.491  -32.751 17.570  1.00 46.14  ? 360  SER A C   1 
ATOM   2491  O O   . SER A 1 338 ? -3.855  -31.575 17.672  1.00 45.63  ? 360  SER A O   1 
ATOM   2492  C CB  . SER A 1 338 ? -2.787  -33.525 19.806  1.00 41.11  ? 360  SER A CB  1 
ATOM   2493  O OG  . SER A 1 338 ? -4.104  -34.071 19.817  1.00 39.10  ? 360  SER A OG  1 
ATOM   2494  N N   . ARG A 1 339 ? -4.102  -33.649 16.797  1.00 51.13  ? 361  ARG A N   1 
ATOM   2495  C CA  . ARG A 1 339 ? -5.298  -33.335 16.019  1.00 54.43  ? 361  ARG A CA  1 
ATOM   2496  C C   . ARG A 1 339 ? -6.435  -32.825 16.903  1.00 51.37  ? 361  ARG A C   1 
ATOM   2497  O O   . ARG A 1 339 ? -7.355  -32.163 16.425  1.00 52.23  ? 361  ARG A O   1 
ATOM   2498  C CB  . ARG A 1 339 ? -5.761  -34.550 15.197  1.00 61.41  ? 361  ARG A CB  1 
ATOM   2499  C CG  . ARG A 1 339 ? -5.015  -34.748 13.873  1.00 68.06  ? 361  ARG A CG  1 
ATOM   2500  C CD  . ARG A 1 339 ? -5.683  -35.823 13.007  1.00 77.59  ? 361  ARG A CD  1 
ATOM   2501  N NE  . ARG A 1 339 ? -4.820  -36.304 11.925  1.00 82.18  ? 361  ARG A NE  1 
ATOM   2502  C CZ  . ARG A 1 339 ? -4.913  -35.924 10.652  1.00 84.43  ? 361  ARG A CZ  1 
ATOM   2503  N NH1 . ARG A 1 339 ? -5.838  -35.051 10.276  1.00 85.31  ? 361  ARG A NH1 1 
ATOM   2504  N NH2 . ARG A 1 339 ? -4.079  -36.424 9.750   1.00 85.50  ? 361  ARG A NH2 1 
ATOM   2505  N N   . ASN A 1 340 ? -6.357  -33.121 18.195  1.00 48.01  ? 362  ASN A N   1 
ATOM   2506  C CA  . ASN A 1 340 ? -7.354  -32.650 19.153  1.00 50.80  ? 362  ASN A CA  1 
ATOM   2507  C C   . ASN A 1 340 ? -7.340  -31.138 19.388  1.00 51.64  ? 362  ASN A C   1 
ATOM   2508  O O   . ASN A 1 340 ? -8.246  -30.598 20.036  1.00 50.19  ? 362  ASN A O   1 
ATOM   2509  C CB  . ASN A 1 340 ? -7.229  -33.402 20.478  1.00 52.10  ? 362  ASN A CB  1 
ATOM   2510  C CG  . ASN A 1 340 ? -7.797  -34.803 20.398  1.00 55.69  ? 362  ASN A CG  1 
ATOM   2511  O OD1 . ASN A 1 340 ? -8.768  -35.046 19.682  1.00 56.77  ? 362  ASN A OD1 1 
ATOM   2512  N ND2 . ASN A 1 340 ? -7.188  -35.734 21.125  1.00 55.70  ? 362  ASN A ND2 1 
ATOM   2513  N N   . PHE A 1 341 ? -6.316  -30.461 18.866  1.00 49.66  ? 363  PHE A N   1 
ATOM   2514  C CA  . PHE A 1 341 ? -6.301  -29.002 18.848  1.00 45.32  ? 363  PHE A CA  1 
ATOM   2515  C C   . PHE A 1 341 ? -7.452  -28.487 17.990  1.00 43.13  ? 363  PHE A C   1 
ATOM   2516  O O   . PHE A 1 341 ? -7.870  -27.344 18.128  1.00 43.05  ? 363  PHE A O   1 
ATOM   2517  C CB  . PHE A 1 341 ? -4.963  -28.458 18.330  1.00 42.81  ? 363  PHE A CB  1 
ATOM   2518  C CG  . PHE A 1 341 ? -3.938  -28.220 19.414  1.00 40.70  ? 363  PHE A CG  1 
ATOM   2519  C CD1 . PHE A 1 341 ? -3.133  -29.253 19.866  1.00 41.06  ? 363  PHE A CD1 1 
ATOM   2520  C CD2 . PHE A 1 341 ? -3.778  -26.962 19.972  1.00 40.18  ? 363  PHE A CD2 1 
ATOM   2521  C CE1 . PHE A 1 341 ? -2.194  -29.041 20.859  1.00 42.34  ? 363  PHE A CE1 1 
ATOM   2522  C CE2 . PHE A 1 341 ? -2.840  -26.741 20.971  1.00 41.21  ? 363  PHE A CE2 1 
ATOM   2523  C CZ  . PHE A 1 341 ? -2.045  -27.779 21.416  1.00 41.91  ? 363  PHE A CZ  1 
ATOM   2524  N N   . SER A 1 342 ? -7.964  -29.341 17.111  1.00 44.30  ? 364  SER A N   1 
ATOM   2525  C CA  . SER A 1 342 ? -9.107  -28.984 16.274  1.00 48.67  ? 364  SER A CA  1 
ATOM   2526  C C   . SER A 1 342 ? -10.393 -28.882 17.088  1.00 52.21  ? 364  SER A C   1 
ATOM   2527  O O   . SER A 1 342 ? -11.404 -28.393 16.594  1.00 51.71  ? 364  SER A O   1 
ATOM   2528  C CB  . SER A 1 342 ? -9.294  -29.998 15.145  1.00 45.76  ? 364  SER A CB  1 
ATOM   2529  O OG  . SER A 1 342 ? -9.717  -31.248 15.665  1.00 48.44  ? 364  SER A OG  1 
ATOM   2530  N N   . LYS A 1 343 ? -10.342 -29.342 18.336  1.00 56.79  ? 365  LYS A N   1 
ATOM   2531  C CA  . LYS A 1 343 ? -11.506 -29.333 19.218  1.00 57.96  ? 365  LYS A CA  1 
ATOM   2532  C C   . LYS A 1 343 ? -11.656 -28.021 19.976  1.00 57.44  ? 365  LYS A C   1 
ATOM   2533  O O   . LYS A 1 343 ? -12.664 -27.807 20.657  1.00 59.34  ? 365  LYS A O   1 
ATOM   2534  C CB  . LYS A 1 343 ? -11.444 -30.493 20.213  1.00 59.74  ? 365  LYS A CB  1 
ATOM   2535  C CG  . LYS A 1 343 ? -12.153 -31.759 19.754  1.00 64.58  ? 365  LYS A CG  1 
ATOM   2536  C CD  . LYS A 1 343 ? -11.618 -32.237 18.420  1.00 68.29  ? 365  LYS A CD  1 
ATOM   2537  C CE  . LYS A 1 343 ? -12.405 -33.432 17.889  1.00 72.41  ? 365  LYS A CE  1 
ATOM   2538  N NZ  . LYS A 1 343 ? -12.014 -33.774 16.481  1.00 72.71  ? 365  LYS A NZ  1 
ATOM   2539  N N   . LEU A 1 344 ? -10.675 -27.129 19.862  1.00 53.79  ? 366  LEU A N   1 
ATOM   2540  C CA  . LEU A 1 344 ? -10.835 -25.847 20.519  1.00 50.29  ? 366  LEU A CA  1 
ATOM   2541  C C   . LEU A 1 344 ? -11.478 -24.929 19.497  1.00 52.91  ? 366  LEU A C   1 
ATOM   2542  O O   . LEU A 1 344 ? -10.799 -24.308 18.684  1.00 52.68  ? 366  LEU A O   1 
ATOM   2543  C CB  . LEU A 1 344 ? -9.464  -25.288 20.897  1.00 40.04  ? 366  LEU A CB  1 
ATOM   2544  C CG  . LEU A 1 344 ? -8.505  -26.204 21.654  1.00 38.29  ? 366  LEU A CG  1 
ATOM   2545  C CD1 . LEU A 1 344 ? -7.077  -25.668 21.588  1.00 34.66  ? 366  LEU A CD1 1 
ATOM   2546  C CD2 . LEU A 1 344 ? -8.942  -26.363 23.099  1.00 38.70  ? 366  LEU A CD2 1 
ATOM   2547  N N   . LEU A 1 345 ? -12.787 -24.762 19.620  1.00 54.30  ? 367  LEU A N   1 
ATOM   2548  C CA  . LEU A 1 345 ? -13.558 -24.060 18.604  1.00 55.03  ? 367  LEU A CA  1 
ATOM   2549  C C   . LEU A 1 345 ? -13.503 -22.554 18.791  1.00 52.77  ? 367  LEU A C   1 
ATOM   2550  O O   . LEU A 1 345 ? -13.660 -21.794 17.839  1.00 54.60  ? 367  LEU A O   1 
ATOM   2551  C CB  . LEU A 1 345 ? -15.004 -24.560 18.586  1.00 59.69  ? 367  LEU A CB  1 
ATOM   2552  C CG  . LEU A 1 345 ? -15.147 -26.032 18.196  1.00 62.71  ? 367  LEU A CG  1 
ATOM   2553  C CD1 . LEU A 1 345 ? -16.602 -26.412 18.068  1.00 65.24  ? 367  LEU A CD1 1 
ATOM   2554  C CD2 . LEU A 1 345 ? -14.399 -26.314 16.897  1.00 64.32  ? 367  LEU A CD2 1 
ATOM   2555  N N   . SER A 1 346 ? -13.301 -22.142 20.038  1.00 49.82  ? 368  SER A N   1 
ATOM   2556  C CA  . SER A 1 346 ? -13.298 -20.740 20.423  1.00 47.71  ? 368  SER A CA  1 
ATOM   2557  C C   . SER A 1 346 ? -11.907 -20.119 20.524  1.00 44.98  ? 368  SER A C   1 
ATOM   2558  O O   . SER A 1 346 ? -11.774 -18.984 20.979  1.00 44.59  ? 368  SER A O   1 
ATOM   2559  C CB  . SER A 1 346 ? -14.055 -20.551 21.740  1.00 48.74  ? 368  SER A CB  1 
ATOM   2560  O OG  . SER A 1 346 ? -15.440 -20.811 21.567  1.00 51.11  ? 368  SER A OG  1 
ATOM   2561  N N   . LEU A 1 347 ? -10.871 -20.858 20.131  1.00 42.90  ? 369  LEU A N   1 
ATOM   2562  C CA  . LEU A 1 347 ? -9.505  -20.394 20.366  1.00 44.48  ? 369  LEU A CA  1 
ATOM   2563  C C   . LEU A 1 347 ? -9.176  -19.153 19.537  1.00 44.58  ? 369  LEU A C   1 
ATOM   2564  O O   . LEU A 1 347 ? -9.291  -19.164 18.314  1.00 44.81  ? 369  LEU A O   1 
ATOM   2565  C CB  . LEU A 1 347 ? -8.499  -21.509 20.054  1.00 42.27  ? 369  LEU A CB  1 
ATOM   2566  C CG  . LEU A 1 347 ? -7.066  -21.212 20.482  1.00 41.11  ? 369  LEU A CG  1 
ATOM   2567  C CD1 . LEU A 1 347 ? -7.028  -21.024 21.984  1.00 43.37  ? 369  LEU A CD1 1 
ATOM   2568  C CD2 . LEU A 1 347 ? -6.137  -22.324 20.057  1.00 40.83  ? 369  LEU A CD2 1 
ATOM   2569  N N   . ARG A 1 348 ? -8.844  -18.068 20.239  1.00 42.62  ? 370  ARG A N   1 
ATOM   2570  C CA  . ARG A 1 348 ? -8.386  -16.814 19.635  1.00 43.81  ? 370  ARG A CA  1 
ATOM   2571  C C   . ARG A 1 348 ? -6.872  -16.670 19.443  1.00 42.91  ? 370  ARG A C   1 
ATOM   2572  O O   . ARG A 1 348 ? -6.411  -16.141 18.427  1.00 41.82  ? 370  ARG A O   1 
ATOM   2573  C CB  . ARG A 1 348 ? -8.990  -15.610 20.361  1.00 46.22  ? 370  ARG A CB  1 
ATOM   2574  C CG  . ARG A 1 348 ? -10.528 -15.617 20.339  1.00 49.46  ? 370  ARG A CG  1 
ATOM   2575  C CD  . ARG A 1 348 ? -11.100 -14.249 20.682  1.00 54.73  ? 370  ARG A CD  1 
ATOM   2576  N NE  . ARG A 1 348 ? -12.546 -14.298 20.874  1.00 65.06  ? 370  ARG A NE  1 
ATOM   2577  C CZ  . ARG A 1 348 ? -13.432 -14.175 19.892  1.00 72.63  ? 370  ARG A CZ  1 
ATOM   2578  N NH1 . ARG A 1 348 ? -13.023 -13.996 18.643  1.00 74.01  ? 370  ARG A NH1 1 
ATOM   2579  N NH2 . ARG A 1 348 ? -14.730 -14.230 20.158  1.00 77.03  ? 370  ARG A NH2 1 
ATOM   2580  N N   . ALA A 1 349 ? -6.115  -17.111 20.448  1.00 40.50  ? 371  ALA A N   1 
ATOM   2581  C CA  . ALA A 1 349 ? -4.657  -17.007 20.442  1.00 38.77  ? 371  ALA A CA  1 
ATOM   2582  C C   . ALA A 1 349 ? -3.976  -18.243 21.048  1.00 40.04  ? 371  ALA A C   1 
ATOM   2583  O O   . ALA A 1 349 ? -4.414  -18.790 22.072  1.00 40.23  ? 371  ALA A O   1 
ATOM   2584  C CB  . ALA A 1 349 ? -4.209  -15.753 21.175  1.00 36.49  ? 371  ALA A CB  1 
ATOM   2585  N N   . LEU A 1 350 ? -2.896  -18.661 20.399  1.00 35.84  ? 372  LEU A N   1 
ATOM   2586  C CA  . LEU A 1 350 ? -2.122  -19.815 20.813  1.00 35.20  ? 372  LEU A CA  1 
ATOM   2587  C C   . LEU A 1 350 ? -0.652  -19.410 20.949  1.00 34.64  ? 372  LEU A C   1 
ATOM   2588  O O   . LEU A 1 350 ? -0.046  -18.911 20.002  1.00 35.10  ? 372  LEU A O   1 
ATOM   2589  C CB  . LEU A 1 350 ? -2.274  -20.948 19.793  1.00 33.73  ? 372  LEU A CB  1 
ATOM   2590  C CG  . LEU A 1 350 ? -1.417  -22.196 20.026  1.00 31.96  ? 372  LEU A CG  1 
ATOM   2591  C CD1 . LEU A 1 350 ? -1.716  -22.827 21.386  1.00 31.51  ? 372  LEU A CD1 1 
ATOM   2592  C CD2 . LEU A 1 350 ? -1.636  -23.201 18.914  1.00 31.55  ? 372  LEU A CD2 1 
ATOM   2593  N N   . HIS A 1 351 ? -0.089  -19.611 22.134  1.00 31.12  ? 373  HIS A N   1 
ATOM   2594  C CA  . HIS A 1 351 ? 1.276   -19.197 22.393  1.00 32.94  ? 373  HIS A CA  1 
ATOM   2595  C C   . HIS A 1 351 ? 2.146   -20.441 22.563  1.00 36.36  ? 373  HIS A C   1 
ATOM   2596  O O   . HIS A 1 351 ? 2.017   -21.198 23.538  1.00 35.90  ? 373  HIS A O   1 
ATOM   2597  C CB  . HIS A 1 351 ? 1.321   -18.300 23.634  1.00 34.99  ? 373  HIS A CB  1 
ATOM   2598  C CG  . HIS A 1 351 ? 0.475   -17.068 23.518  1.00 38.86  ? 373  HIS A CG  1 
ATOM   2599  N ND1 . HIS A 1 351 ? 0.922   -15.910 22.918  1.00 40.19  ? 373  HIS A ND1 1 
ATOM   2600  C CD2 . HIS A 1 351 ? -0.799  -16.817 23.913  1.00 42.99  ? 373  HIS A CD2 1 
ATOM   2601  C CE1 . HIS A 1 351 ? -0.031  -14.995 22.959  1.00 40.32  ? 373  HIS A CE1 1 
ATOM   2602  N NE2 . HIS A 1 351 ? -1.085  -15.519 23.560  1.00 43.55  ? 373  HIS A NE2 1 
ATOM   2603  N N   . LEU A 1 352 ? 2.950   -20.681 21.532  1.00 35.40  ? 374  LEU A N   1 
ATOM   2604  C CA  . LEU A 1 352 ? 3.910   -21.785 21.419  1.00 34.83  ? 374  LEU A CA  1 
ATOM   2605  C C   . LEU A 1 352 ? 5.410   -21.475 21.599  1.00 36.24  ? 374  LEU A C   1 
ATOM   2606  O O   . LEU A 1 352 ? 6.246   -22.153 21.007  1.00 35.93  ? 374  LEU A O   1 
ATOM   2607  C CB  . LEU A 1 352 ? 3.603   -22.718 20.240  1.00 34.99  ? 374  LEU A CB  1 
ATOM   2608  C CG  . LEU A 1 352 ? 2.412   -23.643 20.545  1.00 37.02  ? 374  LEU A CG  1 
ATOM   2609  C CD1 . LEU A 1 352 ? 1.973   -24.468 19.345  1.00 37.27  ? 374  LEU A CD1 1 
ATOM   2610  C CD2 . LEU A 1 352 ? 2.757   -24.561 21.692  1.00 37.83  ? 374  LEU A CD2 1 
ATOM   2611  N N   . ARG A 1 353 ? 5.746   -20.360 22.234  1.00 34.12  ? 375  ARG A N   1 
ATOM   2612  C CA  . ARG A 1 353 ? 7.153   -20.034 22.464  1.00 35.83  ? 375  ARG A CA  1 
ATOM   2613  C C   . ARG A 1 353 ? 7.914   -21.180 23.134  1.00 34.64  ? 375  ARG A C   1 
ATOM   2614  O O   . ARG A 1 353 ? 7.338   -21.974 23.872  1.00 34.50  ? 375  ARG A O   1 
ATOM   2615  C CB  . ARG A 1 353 ? 7.293   -18.787 23.343  1.00 40.31  ? 375  ARG A CB  1 
ATOM   2616  C CG  . ARG A 1 353 ? 6.996   -17.474 22.646  1.00 46.37  ? 375  ARG A CG  1 
ATOM   2617  C CD  . ARG A 1 353 ? 6.413   -16.450 23.611  1.00 54.10  ? 375  ARG A CD  1 
ATOM   2618  N NE  . ARG A 1 353 ? 7.295   -16.111 24.727  1.00 57.45  ? 375  ARG A NE  1 
ATOM   2619  C CZ  . ARG A 1 353 ? 8.081   -15.036 24.762  1.00 59.88  ? 375  ARG A CZ  1 
ATOM   2620  N NH1 . ARG A 1 353 ? 8.116   -14.191 23.731  1.00 60.77  ? 375  ARG A NH1 1 
ATOM   2621  N NH2 . ARG A 1 353 ? 8.844   -14.805 25.824  1.00 58.17  ? 375  ARG A NH2 1 
ATOM   2622  N N   . GLY A 1 354 ? 9.205   -21.294 22.828  1.00 33.99  ? 376  GLY A N   1 
ATOM   2623  C CA  . GLY A 1 354 ? 10.100  -22.146 23.597  1.00 24.61  ? 376  GLY A CA  1 
ATOM   2624  C C   . GLY A 1 354 ? 9.779   -23.626 23.575  1.00 25.33  ? 376  GLY A C   1 
ATOM   2625  O O   . GLY A 1 354 ? 9.988   -24.321 24.570  1.00 35.94  ? 376  GLY A O   1 
ATOM   2626  N N   . TYR A 1 355 ? 9.219   -24.103 22.470  1.00 26.72  ? 377  TYR A N   1 
ATOM   2627  C CA  . TYR A 1 355 ? 9.055   -25.538 22.257  1.00 26.51  ? 377  TYR A CA  1 
ATOM   2628  C C   . TYR A 1 355 ? 10.402  -26.071 21.760  1.00 35.86  ? 377  TYR A C   1 
ATOM   2629  O O   . TYR A 1 355 ? 10.803  -27.162 22.139  1.00 33.76  ? 377  TYR A O   1 
ATOM   2630  C CB  . TYR A 1 355 ? 7.930   -25.805 21.247  1.00 30.32  ? 377  TYR A CB  1 
ATOM   2631  C CG  . TYR A 1 355 ? 7.619   -27.266 20.969  1.00 33.47  ? 377  TYR A CG  1 
ATOM   2632  C CD1 . TYR A 1 355 ? 8.445   -28.031 20.151  1.00 35.02  ? 377  TYR A CD1 1 
ATOM   2633  C CD2 . TYR A 1 355 ? 6.478   -27.867 21.491  1.00 37.10  ? 377  TYR A CD2 1 
ATOM   2634  C CE1 . TYR A 1 355 ? 8.161   -29.363 19.883  1.00 36.05  ? 377  TYR A CE1 1 
ATOM   2635  C CE2 . TYR A 1 355 ? 6.177   -29.204 21.224  1.00 37.83  ? 377  TYR A CE2 1 
ATOM   2636  C CZ  . TYR A 1 355 ? 7.028   -29.944 20.419  1.00 38.43  ? 377  TYR A CZ  1 
ATOM   2637  O OH  . TYR A 1 355 ? 6.758   -31.266 20.140  1.00 39.52  ? 377  TYR A OH  1 
ATOM   2638  N N   . VAL A 1 356 ? 11.128  -25.247 20.989  1.00 35.87  ? 378  VAL A N   1 
ATOM   2639  C CA  . VAL A 1 356 ? 12.422  -25.618 20.382  1.00 34.21  ? 378  VAL A CA  1 
ATOM   2640  C C   . VAL A 1 356 ? 12.400  -26.747 19.335  1.00 38.51  ? 378  VAL A C   1 
ATOM   2641  O O   . VAL A 1 356 ? 12.588  -27.920 19.663  1.00 39.20  ? 378  VAL A O   1 
ATOM   2642  C CB  . VAL A 1 356 ? 13.547  -25.865 21.437  1.00 34.80  ? 378  VAL A CB  1 
ATOM   2643  C CG1 . VAL A 1 356 ? 14.899  -25.994 20.740  1.00 36.12  ? 378  VAL A CG1 1 
ATOM   2644  C CG2 . VAL A 1 356 ? 13.588  -24.728 22.461  1.00 27.66  ? 378  VAL A CG2 1 
ATOM   2645  N N   . PHE A 1 357 ? 12.042  -26.384 18.105  1.00 38.15  ? 379  PHE A N   1 
ATOM   2646  C CA  . PHE A 1 357 ? 12.087  -27.293 16.959  1.00 36.71  ? 379  PHE A CA  1 
ATOM   2647  C C   . PHE A 1 357 ? 12.690  -26.594 15.723  1.00 35.42  ? 379  PHE A C   1 
ATOM   2648  O O   . PHE A 1 357 ? 12.733  -25.366 15.663  1.00 33.18  ? 379  PHE A O   1 
ATOM   2649  C CB  . PHE A 1 357 ? 10.681  -27.806 16.650  1.00 40.47  ? 379  PHE A CB  1 
ATOM   2650  C CG  . PHE A 1 357 ? 9.721   -26.726 16.222  1.00 37.35  ? 379  PHE A CG  1 
ATOM   2651  C CD1 . PHE A 1 357 ? 9.283   -25.765 17.129  1.00 33.31  ? 379  PHE A CD1 1 
ATOM   2652  C CD2 . PHE A 1 357 ? 9.251   -26.675 14.916  1.00 37.47  ? 379  PHE A CD2 1 
ATOM   2653  C CE1 . PHE A 1 357 ? 8.405   -24.767 16.740  1.00 34.34  ? 379  PHE A CE1 1 
ATOM   2654  C CE2 . PHE A 1 357 ? 8.359   -25.681 14.517  1.00 36.56  ? 379  PHE A CE2 1 
ATOM   2655  C CZ  . PHE A 1 357 ? 7.936   -24.727 15.433  1.00 36.08  ? 379  PHE A CZ  1 
ATOM   2656  N N   . GLN A 1 358 ? 13.177  -27.381 14.762  1.00 36.89  ? 380  GLN A N   1 
ATOM   2657  C CA  . GLN A 1 358 ? 13.943  -26.861 13.614  1.00 38.81  ? 380  GLN A CA  1 
ATOM   2658  C C   . GLN A 1 358 ? 13.159  -26.345 12.406  1.00 37.46  ? 380  GLN A C   1 
ATOM   2659  O O   . GLN A 1 358 ? 13.580  -25.400 11.735  1.00 33.98  ? 380  GLN A O   1 
ATOM   2660  C CB  . GLN A 1 358 ? 14.944  -27.908 13.123  1.00 42.31  ? 380  GLN A CB  1 
ATOM   2661  C CG  . GLN A 1 358 ? 15.901  -28.404 14.186  1.00 45.12  ? 380  GLN A CG  1 
ATOM   2662  C CD  . GLN A 1 358 ? 16.861  -29.428 13.633  1.00 47.60  ? 380  GLN A CD  1 
ATOM   2663  O OE1 . GLN A 1 358 ? 17.168  -29.422 12.441  1.00 50.37  ? 380  GLN A OE1 1 
ATOM   2664  N NE2 . GLN A 1 358 ? 17.327  -30.325 14.486  1.00 48.13  ? 380  GLN A NE2 1 
ATOM   2665  N N   . GLU A 1 359 ? 12.042  -26.996 12.106  1.00 39.53  ? 381  GLU A N   1 
ATOM   2666  C CA  . GLU A 1 359 ? 11.356  -26.761 10.845  1.00 43.35  ? 381  GLU A CA  1 
ATOM   2667  C C   . GLU A 1 359 ? 9.847   -26.794 11.016  1.00 41.76  ? 381  GLU A C   1 
ATOM   2668  O O   . GLU A 1 359 ? 9.307   -27.704 11.636  1.00 41.69  ? 381  GLU A O   1 
ATOM   2669  C CB  . GLU A 1 359 ? 11.789  -27.811 9.818   1.00 46.95  ? 381  GLU A CB  1 
ATOM   2670  C CG  . GLU A 1 359 ? 11.023  -27.765 8.509   1.00 52.93  ? 381  GLU A CG  1 
ATOM   2671  C CD  . GLU A 1 359 ? 11.350  -28.937 7.592   1.00 57.02  ? 381  GLU A CD  1 
ATOM   2672  O OE1 . GLU A 1 359 ? 12.041  -29.877 8.043   1.00 58.13  ? 381  GLU A OE1 1 
ATOM   2673  O OE2 . GLU A 1 359 ? 10.910  -28.917 6.420   1.00 59.55  ? 381  GLU A OE2 1 
ATOM   2674  N N   . LEU A 1 360 ? 9.169   -25.798 10.467  1.00 40.16  ? 382  LEU A N   1 
ATOM   2675  C CA  . LEU A 1 360 ? 7.715   -25.786 10.496  1.00 43.73  ? 382  LEU A CA  1 
ATOM   2676  C C   . LEU A 1 360 ? 7.132   -26.199 9.138   1.00 45.96  ? 382  LEU A C   1 
ATOM   2677  O O   . LEU A 1 360 ? 7.366   -25.534 8.128   1.00 46.08  ? 382  LEU A O   1 
ATOM   2678  C CB  . LEU A 1 360 ? 7.196   -24.404 10.906  1.00 40.22  ? 382  LEU A CB  1 
ATOM   2679  C CG  . LEU A 1 360 ? 5.675   -24.356 11.053  1.00 38.33  ? 382  LEU A CG  1 
ATOM   2680  C CD1 . LEU A 1 360 ? 5.221   -25.319 12.130  1.00 35.44  ? 382  LEU A CD1 1 
ATOM   2681  C CD2 . LEU A 1 360 ? 5.198   -22.952 11.355  1.00 38.83  ? 382  LEU A CD2 1 
ATOM   2682  N N   . ARG A 1 361 ? 6.365   -27.287 9.128   1.00 46.99  ? 383  ARG A N   1 
ATOM   2683  C CA  . ARG A 1 361 ? 5.786   -27.824 7.896   1.00 53.48  ? 383  ARG A CA  1 
ATOM   2684  C C   . ARG A 1 361 ? 4.288   -27.597 7.872   1.00 55.53  ? 383  ARG A C   1 
ATOM   2685  O O   . ARG A 1 361 ? 3.653   -27.490 8.924   1.00 56.10  ? 383  ARG A O   1 
ATOM   2686  C CB  . ARG A 1 361 ? 6.033   -29.326 7.783   1.00 58.87  ? 383  ARG A CB  1 
ATOM   2687  C CG  . ARG A 1 361 ? 7.475   -29.744 7.743   1.00 61.80  ? 383  ARG A CG  1 
ATOM   2688  C CD  . ARG A 1 361 ? 7.554   -31.261 7.723   1.00 66.02  ? 383  ARG A CD  1 
ATOM   2689  N NE  . ARG A 1 361 ? 6.932   -31.837 8.912   1.00 70.51  ? 383  ARG A NE  1 
ATOM   2690  C CZ  . ARG A 1 361 ? 6.994   -33.124 9.247   1.00 75.24  ? 383  ARG A CZ  1 
ATOM   2691  N NH1 . ARG A 1 361 ? 7.654   -33.982 8.481   1.00 76.61  ? 383  ARG A NH1 1 
ATOM   2692  N NH2 . ARG A 1 361 ? 6.397   -33.552 10.352  1.00 76.19  ? 383  ARG A NH2 1 
ATOM   2693  N N   . GLU A 1 362 ? 3.727   -27.514 6.669   1.00 59.00  ? 384  GLU A N   1 
ATOM   2694  C CA  . GLU A 1 362 ? 2.293   -27.292 6.503   1.00 63.10  ? 384  GLU A CA  1 
ATOM   2695  C C   . GLU A 1 362 ? 1.457   -28.337 7.224   1.00 61.49  ? 384  GLU A C   1 
ATOM   2696  O O   . GLU A 1 362 ? 0.397   -28.036 7.763   1.00 60.93  ? 384  GLU A O   1 
ATOM   2697  C CB  . GLU A 1 362 ? 1.920   -27.272 5.021   1.00 69.64  ? 384  GLU A CB  1 
ATOM   2698  C CG  . GLU A 1 362 ? 0.435   -27.114 4.781   1.00 75.86  ? 384  GLU A CG  1 
ATOM   2699  C CD  . GLU A 1 362 ? 0.127   -26.330 3.525   1.00 82.14  ? 384  GLU A CD  1 
ATOM   2700  O OE1 . GLU A 1 362 ? 1.065   -26.043 2.752   1.00 84.39  ? 384  GLU A OE1 1 
ATOM   2701  O OE2 . GLU A 1 362 ? -1.056  -25.996 3.314   1.00 84.72  ? 384  GLU A OE2 1 
ATOM   2702  N N   . ASP A 1 363 ? 1.946   -29.568 7.233   1.00 64.22  ? 385  ASP A N   1 
ATOM   2703  C CA  . ASP A 1 363 ? 1.209   -30.679 7.820   1.00 67.14  ? 385  ASP A CA  1 
ATOM   2704  C C   . ASP A 1 363 ? 1.173   -30.566 9.332   1.00 62.47  ? 385  ASP A C   1 
ATOM   2705  O O   . ASP A 1 363 ? 0.249   -31.053 9.978   1.00 64.30  ? 385  ASP A O   1 
ATOM   2706  C CB  . ASP A 1 363 ? 1.859   -31.992 7.407   1.00 73.64  ? 385  ASP A CB  1 
ATOM   2707  C CG  . ASP A 1 363 ? 2.376   -31.946 5.987   1.00 80.93  ? 385  ASP A CG  1 
ATOM   2708  O OD1 . ASP A 1 363 ? 3.344   -31.186 5.740   1.00 81.73  ? 385  ASP A OD1 1 
ATOM   2709  O OD2 . ASP A 1 363 ? 1.810   -32.650 5.118   1.00 83.32  ? 385  ASP A OD2 1 
ATOM   2710  N N   . ASP A 1 364 ? 2.177   -29.903 9.891   1.00 56.43  ? 386  ASP A N   1 
ATOM   2711  C CA  . ASP A 1 364 ? 2.309   -29.810 11.333  1.00 51.94  ? 386  ASP A CA  1 
ATOM   2712  C C   . ASP A 1 364 ? 1.228   -28.941 11.958  1.00 46.11  ? 386  ASP A C   1 
ATOM   2713  O O   . ASP A 1 364 ? 0.842   -29.153 13.099  1.00 44.79  ? 386  ASP A O   1 
ATOM   2714  C CB  . ASP A 1 364 ? 3.702   -29.306 11.702  1.00 52.07  ? 386  ASP A CB  1 
ATOM   2715  C CG  . ASP A 1 364 ? 4.796   -30.207 11.171  1.00 55.80  ? 386  ASP A CG  1 
ATOM   2716  O OD1 . ASP A 1 364 ? 4.530   -31.416 11.000  1.00 61.42  ? 386  ASP A OD1 1 
ATOM   2717  O OD2 . ASP A 1 364 ? 5.913   -29.714 10.921  1.00 56.22  ? 386  ASP A OD2 1 
ATOM   2718  N N   . PHE A 1 365 ? 0.749   -27.954 11.215  1.00 45.26  ? 387  PHE A N   1 
ATOM   2719  C CA  . PHE A 1 365 ? -0.300  -27.080 11.729  1.00 47.31  ? 387  PHE A CA  1 
ATOM   2720  C C   . PHE A 1 365 ? -1.727  -27.415 11.291  1.00 52.52  ? 387  PHE A C   1 
ATOM   2721  O O   . PHE A 1 365 ? -2.661  -26.661 11.569  1.00 55.58  ? 387  PHE A O   1 
ATOM   2722  C CB  . PHE A 1 365 ? 0.058   -25.607 11.546  1.00 47.37  ? 387  PHE A CB  1 
ATOM   2723  C CG  . PHE A 1 365 ? 0.836   -25.049 12.703  1.00 49.77  ? 387  PHE A CG  1 
ATOM   2724  C CD1 . PHE A 1 365 ? 1.156   -25.860 13.785  1.00 50.62  ? 387  PHE A CD1 1 
ATOM   2725  C CD2 . PHE A 1 365 ? 1.227   -23.725 12.729  1.00 48.03  ? 387  PHE A CD2 1 
ATOM   2726  C CE1 . PHE A 1 365 ? 1.863   -25.364 14.860  1.00 49.16  ? 387  PHE A CE1 1 
ATOM   2727  C CE2 . PHE A 1 365 ? 1.934   -23.226 13.803  1.00 48.60  ? 387  PHE A CE2 1 
ATOM   2728  C CZ  . PHE A 1 365 ? 2.250   -24.049 14.873  1.00 47.95  ? 387  PHE A CZ  1 
ATOM   2729  N N   . GLN A 1 366 ? -1.878  -28.542 10.603  1.00 53.32  ? 388  GLN A N   1 
ATOM   2730  C CA  . GLN A 1 366 ? -3.185  -29.005 10.136  1.00 55.96  ? 388  GLN A CA  1 
ATOM   2731  C C   . GLN A 1 366 ? -4.333  -28.845 11.146  1.00 53.40  ? 388  GLN A C   1 
ATOM   2732  O O   . GLN A 1 366 ? -5.357  -28.259 10.808  1.00 56.61  ? 388  GLN A O   1 
ATOM   2733  C CB  . GLN A 1 366 ? -3.099  -30.460 9.654   1.00 62.76  ? 388  GLN A CB  1 
ATOM   2734  C CG  . GLN A 1 366 ? -3.065  -30.613 8.146   1.00 69.00  ? 388  GLN A CG  1 
ATOM   2735  C CD  . GLN A 1 366 ? -4.431  -30.486 7.513   1.00 73.04  ? 388  GLN A CD  1 
ATOM   2736  O OE1 . GLN A 1 366 ? -5.392  -31.133 7.934   1.00 74.90  ? 388  GLN A OE1 1 
ATOM   2737  N NE2 . GLN A 1 366 ? -4.524  -29.653 6.485   1.00 73.95  ? 388  GLN A NE2 1 
ATOM   2738  N N   . PRO A 1 367 ? -4.171  -29.345 12.386  1.00 48.05  ? 389  PRO A N   1 
ATOM   2739  C CA  . PRO A 1 367 ? -5.281  -29.251 13.351  1.00 44.98  ? 389  PRO A CA  1 
ATOM   2740  C C   . PRO A 1 367 ? -5.666  -27.832 13.776  1.00 41.72  ? 389  PRO A C   1 
ATOM   2741  O O   . PRO A 1 367 ? -6.696  -27.661 14.425  1.00 42.73  ? 389  PRO A O   1 
ATOM   2742  C CB  . PRO A 1 367 ? -4.753  -30.016 14.571  1.00 46.69  ? 389  PRO A CB  1 
ATOM   2743  C CG  . PRO A 1 367 ? -3.672  -30.893 14.042  1.00 48.82  ? 389  PRO A CG  1 
ATOM   2744  C CD  . PRO A 1 367 ? -3.026  -30.075 12.961  1.00 47.08  ? 389  PRO A CD  1 
ATOM   2745  N N   . LEU A 1 368 ? -4.829  -26.844 13.478  1.00 39.45  ? 390  LEU A N   1 
ATOM   2746  C CA  . LEU A 1 368 ? -5.151  -25.470 13.827  1.00 41.26  ? 390  LEU A CA  1 
ATOM   2747  C C   . LEU A 1 368 ? -5.928  -24.752 12.730  1.00 47.94  ? 390  LEU A C   1 
ATOM   2748  O O   . LEU A 1 368 ? -6.498  -23.690 12.966  1.00 48.25  ? 390  LEU A O   1 
ATOM   2749  C CB  . LEU A 1 368 ? -3.871  -24.693 14.117  1.00 36.74  ? 390  LEU A CB  1 
ATOM   2750  C CG  . LEU A 1 368 ? -2.988  -25.191 15.263  1.00 33.15  ? 390  LEU A CG  1 
ATOM   2751  C CD1 . LEU A 1 368 ? -1.775  -24.277 15.411  1.00 33.47  ? 390  LEU A CD1 1 
ATOM   2752  C CD2 . LEU A 1 368 ? -3.777  -25.275 16.564  1.00 33.32  ? 390  LEU A CD2 1 
ATOM   2753  N N   . MET A 1 369 ? -5.972  -25.347 11.542  1.00 52.78  ? 391  MET A N   1 
ATOM   2754  C CA  . MET A 1 369 ? -6.332  -24.608 10.332  1.00 56.15  ? 391  MET A CA  1 
ATOM   2755  C C   . MET A 1 369 ? -7.831  -24.423 10.096  1.00 58.01  ? 391  MET A C   1 
ATOM   2756  O O   . MET A 1 369 ? -8.243  -23.595 9.279   1.00 54.05  ? 391  MET A O   1 
ATOM   2757  C CB  . MET A 1 369 ? -5.686  -25.260 9.109   1.00 59.60  ? 391  MET A CB  1 
ATOM   2758  C CG  . MET A 1 369 ? -4.179  -25.121 9.057   1.00 59.55  ? 391  MET A CG  1 
ATOM   2759  S SD  . MET A 1 369 ? -3.478  -26.041 7.680   1.00 55.36  ? 391  MET A SD  1 
ATOM   2760  C CE  . MET A 1 369 ? -1.905  -25.211 7.503   1.00 63.19  ? 391  MET A CE  1 
ATOM   2761  N N   . GLN A 1 370 ? -8.646  -25.205 10.790  1.00 60.98  ? 392  GLN A N   1 
ATOM   2762  C CA  . GLN A 1 370 ? -10.086 -25.059 10.664  1.00 63.18  ? 392  GLN A CA  1 
ATOM   2763  C C   . GLN A 1 370 ? -10.717 -24.232 11.786  1.00 59.79  ? 392  GLN A C   1 
ATOM   2764  O O   . GLN A 1 370 ? -11.927 -24.014 11.800  1.00 65.34  ? 392  GLN A O   1 
ATOM   2765  C CB  . GLN A 1 370 ? -10.754 -26.425 10.517  1.00 68.50  ? 392  GLN A CB  1 
ATOM   2766  C CG  . GLN A 1 370 ? -11.934 -26.418 9.568   1.00 75.18  ? 392  GLN A CG  1 
ATOM   2767  C CD  . GLN A 1 370 ? -11.595 -25.846 8.199   1.00 78.65  ? 392  GLN A CD  1 
ATOM   2768  O OE1 . GLN A 1 370 ? -10.450 -25.915 7.740   1.00 77.49  ? 392  GLN A OE1 1 
ATOM   2769  N NE2 . GLN A 1 370 ? -12.599 -25.277 7.536   1.00 81.10  ? 392  GLN A NE2 1 
ATOM   2770  N N   . LEU A 1 371 ? -9.894  -23.772 12.722  1.00 51.55  ? 393  LEU A N   1 
ATOM   2771  C CA  . LEU A 1 371 ? -10.373 -22.968 13.844  1.00 47.64  ? 393  LEU A CA  1 
ATOM   2772  C C   . LEU A 1 371 ? -10.787 -21.570 13.387  1.00 47.34  ? 393  LEU A C   1 
ATOM   2773  O O   . LEU A 1 371 ? -9.955  -20.797 12.925  1.00 45.15  ? 393  LEU A O   1 
ATOM   2774  C CB  . LEU A 1 371 ? -9.297  -22.884 14.929  1.00 46.26  ? 393  LEU A CB  1 
ATOM   2775  C CG  . LEU A 1 371 ? -8.798  -24.248 15.419  1.00 47.78  ? 393  LEU A CG  1 
ATOM   2776  C CD1 . LEU A 1 371 ? -7.799  -24.103 16.549  1.00 48.27  ? 393  LEU A CD1 1 
ATOM   2777  C CD2 . LEU A 1 371 ? -9.959  -25.133 15.844  1.00 50.30  ? 393  LEU A CD2 1 
ATOM   2778  N N   . PRO A 1 372 ? -12.083 -21.242 13.526  1.00 49.93  ? 394  PRO A N   1 
ATOM   2779  C CA  . PRO A 1 372 ? -12.661 -20.031 12.925  1.00 48.30  ? 394  PRO A CA  1 
ATOM   2780  C C   . PRO A 1 372 ? -12.118 -18.721 13.493  1.00 45.89  ? 394  PRO A C   1 
ATOM   2781  O O   . PRO A 1 372 ? -11.965 -17.744 12.762  1.00 43.20  ? 394  PRO A O   1 
ATOM   2782  C CB  . PRO A 1 372 ? -14.163 -20.164 13.239  1.00 48.99  ? 394  PRO A CB  1 
ATOM   2783  C CG  . PRO A 1 372 ? -14.230 -21.052 14.436  1.00 50.43  ? 394  PRO A CG  1 
ATOM   2784  C CD  . PRO A 1 372 ? -13.083 -22.014 14.290  1.00 51.06  ? 394  PRO A CD  1 
ATOM   2785  N N   . ASN A 1 373 ? -11.891 -18.690 14.799  1.00 45.92  ? 395  ASN A N   1 
ATOM   2786  C CA  . ASN A 1 373 ? -11.480 -17.468 15.485  1.00 44.14  ? 395  ASN A CA  1 
ATOM   2787  C C   . ASN A 1 373 ? -9.991  -17.272 15.810  1.00 41.72  ? 395  ASN A C   1 
ATOM   2788  O O   . ASN A 1 373 ? -9.636  -16.316 16.511  1.00 39.47  ? 395  ASN A O   1 
ATOM   2789  C CB  . ASN A 1 373 ? -12.395 -17.169 16.677  1.00 47.20  ? 395  ASN A CB  1 
ATOM   2790  C CG  . ASN A 1 373 ? -13.809 -16.801 16.233  1.00 53.76  ? 395  ASN A CG  1 
ATOM   2791  O OD1 . ASN A 1 373 ? -13.989 -16.092 15.244  1.00 56.86  ? 395  ASN A OD1 1 
ATOM   2792  N ND2 . ASN A 1 373 ? -14.813 -17.296 16.951  1.00 54.53  ? 395  ASN A ND2 1 
ATOM   2793  N N   . LEU A 1 374 ? -9.115  -18.141 15.308  1.00 40.29  ? 396  LEU A N   1 
ATOM   2794  C CA  . LEU A 1 374 ? -7.730  -18.072 15.765  1.00 39.76  ? 396  LEU A CA  1 
ATOM   2795  C C   . LEU A 1 374 ? -7.014  -17.007 14.947  1.00 40.13  ? 396  LEU A C   1 
ATOM   2796  O O   . LEU A 1 374 ? -6.636  -17.218 13.797  1.00 42.77  ? 396  LEU A O   1 
ATOM   2797  C CB  . LEU A 1 374 ? -7.047  -19.427 15.541  1.00 36.43  ? 396  LEU A CB  1 
ATOM   2798  C CG  . LEU A 1 374 ? -5.549  -19.554 15.849  1.00 37.92  ? 396  LEU A CG  1 
ATOM   2799  C CD1 . LEU A 1 374 ? -5.264  -19.073 17.257  1.00 41.49  ? 396  LEU A CD1 1 
ATOM   2800  C CD2 . LEU A 1 374 ? -5.079  -20.984 15.691  1.00 33.72  ? 396  LEU A CD2 1 
ATOM   2801  N N   . SER A 1 375 ? -6.866  -15.845 15.576  1.00 40.86  ? 397  SER A N   1 
ATOM   2802  C CA  . SER A 1 375 ? -6.222  -14.677 14.989  1.00 42.75  ? 397  SER A CA  1 
ATOM   2803  C C   . SER A 1 375 ? -4.716  -14.591 15.218  1.00 38.55  ? 397  SER A C   1 
ATOM   2804  O O   . SER A 1 375 ? -3.985  -14.046 14.389  1.00 40.35  ? 397  SER A O   1 
ATOM   2805  C CB  . SER A 1 375 ? -6.932  -13.385 15.416  1.00 44.88  ? 397  SER A CB  1 
ATOM   2806  O OG  . SER A 1 375 ? -7.059  -13.307 16.821  1.00 50.57  ? 397  SER A OG  1 
ATOM   2807  N N   . THR A 1 376 ? -4.268  -15.098 16.362  1.00 35.67  ? 398  THR A N   1 
ATOM   2808  C CA  . THR A 1 376 ? -2.876  -14.929 16.786  1.00 35.23  ? 398  THR A CA  1 
ATOM   2809  C C   . THR A 1 376 ? -2.141  -16.249 16.978  1.00 37.02  ? 398  THR A C   1 
ATOM   2810  O O   . THR A 1 376 ? -2.568  -17.098 17.772  1.00 37.47  ? 398  THR A O   1 
ATOM   2811  C CB  . THR A 1 376 ? -2.788  -14.123 18.101  1.00 36.29  ? 398  THR A CB  1 
ATOM   2812  O OG1 . THR A 1 376 ? -3.190  -12.774 17.863  1.00 41.48  ? 398  THR A OG1 1 
ATOM   2813  C CG2 . THR A 1 376 ? -1.365  -14.123 18.658  1.00 34.45  ? 398  THR A CG2 1 
ATOM   2814  N N   . ILE A 1 377 ? -1.031  -16.406 16.255  1.00 36.41  ? 399  ILE A N   1 
ATOM   2815  C CA  . ILE A 1 377 ? -0.122  -17.532 16.451  1.00 37.93  ? 399  ILE A CA  1 
ATOM   2816  C C   . ILE A 1 377 ? 1.243   -17.018 16.921  1.00 36.39  ? 399  ILE A C   1 
ATOM   2817  O O   . ILE A 1 377 ? 1.846   -16.145 16.290  1.00 34.96  ? 399  ILE A O   1 
ATOM   2818  C CB  . ILE A 1 377 ? 0.024   -18.401 15.165  1.00 46.57  ? 399  ILE A CB  1 
ATOM   2819  C CG1 . ILE A 1 377 ? 0.919   -19.608 15.420  1.00 47.96  ? 399  ILE A CG1 1 
ATOM   2820  C CG2 . ILE A 1 377 ? 0.546   -17.583 13.993  1.00 46.55  ? 399  ILE A CG2 1 
ATOM   2821  C CD1 . ILE A 1 377 ? 0.332   -20.599 16.403  1.00 50.14  ? 399  ILE A CD1 1 
ATOM   2822  N N   . ASN A 1 378 ? 1.725   -17.525 18.048  1.00 35.72  ? 400  ASN A N   1 
ATOM   2823  C CA  . ASN A 1 378 ? 3.010   -17.041 18.557  1.00 35.54  ? 400  ASN A CA  1 
ATOM   2824  C C   . ASN A 1 378 ? 4.068   -18.143 18.592  1.00 35.18  ? 400  ASN A C   1 
ATOM   2825  O O   . ASN A 1 378 ? 4.038   -19.028 19.451  1.00 32.22  ? 400  ASN A O   1 
ATOM   2826  C CB  . ASN A 1 378 ? 2.790   -16.380 19.927  1.00 36.36  ? 400  ASN A CB  1 
ATOM   2827  C CG  . ASN A 1 378 ? 4.081   -15.919 20.593  1.00 39.39  ? 400  ASN A CG  1 
ATOM   2828  O OD1 . ASN A 1 378 ? 5.160   -15.922 19.992  1.00 38.85  ? 400  ASN A OD1 1 
ATOM   2829  N ND2 . ASN A 1 378 ? 3.963   -15.505 21.857  1.00 37.45  ? 400  ASN A ND2 1 
ATOM   2830  N N   . LEU A 1 379 ? 4.994   -18.074 17.635  1.00 32.88  ? 401  LEU A N   1 
ATOM   2831  C CA  . LEU A 1 379 ? 6.120   -19.015 17.504  1.00 30.35  ? 401  LEU A CA  1 
ATOM   2832  C C   . LEU A 1 379 ? 7.495   -18.534 18.010  1.00 31.58  ? 401  LEU A C   1 
ATOM   2833  O O   . LEU A 1 379 ? 8.526   -19.101 17.626  1.00 27.47  ? 401  LEU A O   1 
ATOM   2834  C CB  . LEU A 1 379 ? 6.204   -19.617 16.089  1.00 29.10  ? 401  LEU A CB  1 
ATOM   2835  C CG  . LEU A 1 379 ? 5.060   -20.585 15.765  1.00 31.74  ? 401  LEU A CG  1 
ATOM   2836  C CD1 . LEU A 1 379 ? 5.130   -21.039 14.311  1.00 32.23  ? 401  LEU A CD1 1 
ATOM   2837  C CD2 . LEU A 1 379 ? 5.084   -21.786 16.708  1.00 32.12  ? 401  LEU A CD2 1 
ATOM   2838  N N   . GLY A 1 380 ? 7.517   -17.426 18.749  1.00 32.83  ? 402  GLY A N   1 
ATOM   2839  C CA  . GLY A 1 380 ? 8.765   -16.846 19.242  1.00 30.74  ? 402  GLY A CA  1 
ATOM   2840  C C   . GLY A 1 380 ? 9.711   -17.797 19.969  1.00 32.55  ? 402  GLY A C   1 
ATOM   2841  O O   . GLY A 1 380 ? 9.265   -18.766 20.587  1.00 33.02  ? 402  GLY A O   1 
ATOM   2842  N N   . ILE A 1 381 ? 11.018  -17.534 19.855  1.00 31.72  ? 403  ILE A N   1 
ATOM   2843  C CA  . ILE A 1 381 ? 12.081  -18.272 20.579  1.00 26.08  ? 403  ILE A CA  1 
ATOM   2844  C C   . ILE A 1 381 ? 12.018  -19.802 20.455  1.00 29.90  ? 403  ILE A C   1 
ATOM   2845  O O   . ILE A 1 381 ? 12.017  -20.521 21.466  1.00 29.83  ? 403  ILE A O   1 
ATOM   2846  C CB  . ILE A 1 381 ? 12.142  -17.860 22.073  1.00 33.86  ? 403  ILE A CB  1 
ATOM   2847  C CG1 . ILE A 1 381 ? 11.889  -16.356 22.215  1.00 33.11  ? 403  ILE A CG1 1 
ATOM   2848  C CG2 . ILE A 1 381 ? 13.500  -18.221 22.684  1.00 33.66  ? 403  ILE A CG2 1 
ATOM   2849  C CD1 . ILE A 1 381 ? 11.733  -15.892 23.649  1.00 35.00  ? 403  ILE A CD1 1 
ATOM   2850  N N   . ASN A 1 382 ? 11.843  -20.294 19.229  1.00 30.16  ? 404  ASN A N   1 
ATOM   2851  C CA  . ASN A 1 382 ? 11.965  -21.730 18.958  1.00 28.76  ? 404  ASN A CA  1 
ATOM   2852  C C   . ASN A 1 382 ? 13.233  -22.213 18.227  1.00 29.71  ? 404  ASN A C   1 
ATOM   2853  O O   . ASN A 1 382 ? 13.390  -23.411 17.979  1.00 32.10  ? 404  ASN A O   1 
ATOM   2854  C CB  . ASN A 1 382 ? 10.705  -22.264 18.291  1.00 34.06  ? 404  ASN A CB  1 
ATOM   2855  C CG  . ASN A 1 382 ? 9.517   -22.309 19.243  1.00 35.67  ? 404  ASN A CG  1 
ATOM   2856  O OD1 . ASN A 1 382 ? 9.461   -23.155 20.140  1.00 36.89  ? 404  ASN A OD1 1 
ATOM   2857  N ND2 . ASN A 1 382 ? 8.552   -21.405 19.041  1.00 28.43  ? 404  ASN A ND2 1 
ATOM   2858  N N   . PHE A 1 383 ? 14.112  -21.281 17.865  1.00 30.64  ? 405  PHE A N   1 
ATOM   2859  C CA  . PHE A 1 383 ? 15.276  -21.588 17.024  1.00 33.81  ? 405  PHE A CA  1 
ATOM   2860  C C   . PHE A 1 383 ? 14.870  -22.260 15.712  1.00 32.87  ? 405  PHE A C   1 
ATOM   2861  O O   . PHE A 1 383 ? 15.555  -23.146 15.210  1.00 32.85  ? 405  PHE A O   1 
ATOM   2862  C CB  . PHE A 1 383 ? 16.330  -22.411 17.789  1.00 32.99  ? 405  PHE A CB  1 
ATOM   2863  C CG  . PHE A 1 383 ? 16.957  -21.657 18.931  1.00 37.69  ? 405  PHE A CG  1 
ATOM   2864  C CD1 . PHE A 1 383 ? 18.070  -20.843 18.724  1.00 36.60  ? 405  PHE A CD1 1 
ATOM   2865  C CD2 . PHE A 1 383 ? 16.417  -21.730 20.204  1.00 40.93  ? 405  PHE A CD2 1 
ATOM   2866  C CE1 . PHE A 1 383 ? 18.634  -20.136 19.757  1.00 36.74  ? 405  PHE A CE1 1 
ATOM   2867  C CE2 . PHE A 1 383 ? 16.982  -21.019 21.247  1.00 42.35  ? 405  PHE A CE2 1 
ATOM   2868  C CZ  . PHE A 1 383 ? 18.094  -20.225 21.025  1.00 38.73  ? 405  PHE A CZ  1 
ATOM   2869  N N   . ILE A 1 384 ? 13.748  -21.813 15.158  1.00 33.71  ? 406  ILE A N   1 
ATOM   2870  C CA  . ILE A 1 384 ? 13.235  -22.374 13.915  1.00 35.58  ? 406  ILE A CA  1 
ATOM   2871  C C   . ILE A 1 384 ? 14.143  -21.977 12.760  1.00 34.57  ? 406  ILE A C   1 
ATOM   2872  O O   . ILE A 1 384 ? 14.468  -20.808 12.601  1.00 32.01  ? 406  ILE A O   1 
ATOM   2873  C CB  . ILE A 1 384 ? 11.794  -21.890 13.632  1.00 34.03  ? 406  ILE A CB  1 
ATOM   2874  C CG1 . ILE A 1 384 ? 10.869  -22.306 14.785  1.00 30.10  ? 406  ILE A CG1 1 
ATOM   2875  C CG2 . ILE A 1 384 ? 11.297  -22.426 12.274  1.00 26.14  ? 406  ILE A CG2 1 
ATOM   2876  C CD1 . ILE A 1 384 ? 9.459   -21.703 14.700  1.00 29.23  ? 406  ILE A CD1 1 
ATOM   2877  N N   . LYS A 1 385 ? 14.591  -22.965 11.994  1.00 36.84  ? 407  LYS A N   1 
ATOM   2878  C CA  . LYS A 1 385 ? 15.451  -22.726 10.839  1.00 36.98  ? 407  LYS A CA  1 
ATOM   2879  C C   . LYS A 1 385 ? 14.672  -22.381 9.584   1.00 41.16  ? 407  LYS A C   1 
ATOM   2880  O O   . LYS A 1 385 ? 15.075  -21.531 8.801   1.00 42.58  ? 407  LYS A O   1 
ATOM   2881  C CB  . LYS A 1 385 ? 16.346  -23.937 10.578  1.00 38.30  ? 407  LYS A CB  1 
ATOM   2882  C CG  . LYS A 1 385 ? 17.494  -24.073 11.559  1.00 41.27  ? 407  LYS A CG  1 
ATOM   2883  C CD  . LYS A 1 385 ? 18.164  -25.427 11.432  1.00 45.41  ? 407  LYS A CD  1 
ATOM   2884  C CE  . LYS A 1 385 ? 19.418  -25.479 12.282  1.00 52.71  ? 407  LYS A CE  1 
ATOM   2885  N NZ  . LYS A 1 385 ? 20.161  -26.765 12.121  1.00 56.04  ? 407  LYS A NZ  1 
ATOM   2886  N N   . GLN A 1 386 ? 13.567  -23.077 9.372   1.00 43.35  ? 408  GLN A N   1 
ATOM   2887  C CA  . GLN A 1 386 ? 12.815  -22.884 8.151   1.00 42.30  ? 408  GLN A CA  1 
ATOM   2888  C C   . GLN A 1 386 ? 11.328  -23.133 8.371   1.00 38.60  ? 408  GLN A C   1 
ATOM   2889  O O   . GLN A 1 386 ? 10.932  -24.018 9.126   1.00 38.59  ? 408  GLN A O   1 
ATOM   2890  C CB  . GLN A 1 386 ? 13.359  -23.788 7.039   1.00 46.53  ? 408  GLN A CB  1 
ATOM   2891  C CG  . GLN A 1 386 ? 13.207  -25.269 7.333   1.00 56.70  ? 408  GLN A CG  1 
ATOM   2892  C CD  . GLN A 1 386 ? 13.616  -26.158 6.166   1.00 64.75  ? 408  GLN A CD  1 
ATOM   2893  O OE1 . GLN A 1 386 ? 13.667  -25.715 5.015   1.00 68.61  ? 408  GLN A OE1 1 
ATOM   2894  N NE2 . GLN A 1 386 ? 13.907  -27.424 6.461   1.00 66.50  ? 408  GLN A NE2 1 
ATOM   2895  N N   . ILE A 1 387 ? 10.518  -22.338 7.688   1.00 36.51  ? 409  ILE A N   1 
ATOM   2896  C CA  . ILE A 1 387 ? 9.076   -22.454 7.743   1.00 37.52  ? 409  ILE A CA  1 
ATOM   2897  C C   . ILE A 1 387 ? 8.556   -22.601 6.322   1.00 37.09  ? 409  ILE A C   1 
ATOM   2898  O O   . ILE A 1 387 ? 8.992   -21.881 5.425   1.00 37.44  ? 409  ILE A O   1 
ATOM   2899  C CB  . ILE A 1 387 ? 8.453   -21.177 8.342   1.00 35.95  ? 409  ILE A CB  1 
ATOM   2900  C CG1 . ILE A 1 387 ? 8.955   -20.961 9.769   1.00 35.08  ? 409  ILE A CG1 1 
ATOM   2901  C CG2 . ILE A 1 387 ? 6.913   -21.230 8.263   1.00 31.46  ? 409  ILE A CG2 1 
ATOM   2902  C CD1 . ILE A 1 387 ? 8.583   -19.626 10.359  1.00 34.53  ? 409  ILE A CD1 1 
ATOM   2903  N N   . ASP A 1 388 ? 7.599   -23.492 6.111   1.00 36.58  ? 410  ASP A N   1 
ATOM   2904  C CA  . ASP A 1 388 ? 6.979   -23.539 4.799   1.00 41.14  ? 410  ASP A CA  1 
ATOM   2905  C C   . ASP A 1 388 ? 5.872   -22.510 4.936   1.00 39.10  ? 410  ASP A C   1 
ATOM   2906  O O   . ASP A 1 388 ? 4.821   -22.775 5.528   1.00 36.86  ? 410  ASP A O   1 
ATOM   2907  C CB  . ASP A 1 388 ? 6.385   -24.930 4.554   1.00 47.92  ? 410  ASP A CB  1 
ATOM   2908  C CG  . ASP A 1 388 ? 5.797   -25.083 3.160   1.00 59.82  ? 410  ASP A CG  1 
ATOM   2909  O OD1 . ASP A 1 388 ? 5.809   -24.098 2.389   1.00 63.78  ? 410  ASP A OD1 1 
ATOM   2910  O OD2 . ASP A 1 388 ? 5.312   -26.188 2.830   1.00 63.70  ? 410  ASP A OD2 1 
ATOM   2911  N N   . PHE A 1 389 ? 6.099   -21.343 4.336   1.00 39.49  ? 411  PHE A N   1 
ATOM   2912  C CA  . PHE A 1 389 ? 5.284   -20.162 4.620   1.00 40.05  ? 411  PHE A CA  1 
ATOM   2913  C C   . PHE A 1 389 ? 3.851   -20.213 4.081   1.00 45.92  ? 411  PHE A C   1 
ATOM   2914  O O   . PHE A 1 389 ? 2.979   -19.494 4.577   1.00 48.88  ? 411  PHE A O   1 
ATOM   2915  C CB  . PHE A 1 389 ? 5.982   -18.888 4.129   1.00 34.74  ? 411  PHE A CB  1 
ATOM   2916  C CG  . PHE A 1 389 ? 6.976   -18.341 5.103   1.00 33.52  ? 411  PHE A CG  1 
ATOM   2917  C CD1 . PHE A 1 389 ? 6.555   -17.580 6.176   1.00 33.55  ? 411  PHE A CD1 1 
ATOM   2918  C CD2 . PHE A 1 389 ? 8.332   -18.600 4.956   1.00 33.30  ? 411  PHE A CD2 1 
ATOM   2919  C CE1 . PHE A 1 389 ? 7.468   -17.078 7.094   1.00 32.23  ? 411  PHE A CE1 1 
ATOM   2920  C CE2 . PHE A 1 389 ? 9.258   -18.098 5.870   1.00 32.82  ? 411  PHE A CE2 1 
ATOM   2921  C CZ  . PHE A 1 389 ? 8.824   -17.339 6.939   1.00 32.55  ? 411  PHE A CZ  1 
ATOM   2922  N N   . LYS A 1 390 ? 3.613   -21.053 3.074   1.00 43.19  ? 412  LYS A N   1 
ATOM   2923  C CA  . LYS A 1 390 ? 2.291   -21.145 2.468   1.00 48.63  ? 412  LYS A CA  1 
ATOM   2924  C C   . LYS A 1 390 ? 1.239   -21.643 3.461   1.00 51.05  ? 412  LYS A C   1 
ATOM   2925  O O   . LYS A 1 390 ? 0.048   -21.401 3.281   1.00 52.45  ? 412  LYS A O   1 
ATOM   2926  C CB  . LYS A 1 390 ? 2.323   -22.044 1.230   1.00 51.85  ? 412  LYS A CB  1 
ATOM   2927  C CG  . LYS A 1 390 ? 2.627   -23.505 1.514   1.00 54.84  ? 412  LYS A CG  1 
ATOM   2928  C CD  . LYS A 1 390 ? 3.400   -24.137 0.362   1.00 60.47  ? 412  LYS A CD  1 
ATOM   2929  C CE  . LYS A 1 390 ? 2.579   -24.196 -0.920  1.00 65.32  ? 412  LYS A CE  1 
ATOM   2930  N NZ  . LYS A 1 390 ? 1.531   -25.256 -0.865  1.00 68.69  ? 412  LYS A NZ  1 
ATOM   2931  N N   . LEU A 1 391 ? 1.686   -22.323 4.514   1.00 49.89  ? 413  LEU A N   1 
ATOM   2932  C CA  . LEU A 1 391 ? 0.765   -22.873 5.508   1.00 45.49  ? 413  LEU A CA  1 
ATOM   2933  C C   . LEU A 1 391 ? -0.122  -21.819 6.168   1.00 42.34  ? 413  LEU A C   1 
ATOM   2934  O O   . LEU A 1 391 ? -1.265  -22.104 6.517   1.00 45.85  ? 413  LEU A O   1 
ATOM   2935  C CB  . LEU A 1 391 ? 1.512   -23.691 6.572   1.00 43.31  ? 413  LEU A CB  1 
ATOM   2936  C CG  . LEU A 1 391 ? 2.344   -23.002 7.656   1.00 42.93  ? 413  LEU A CG  1 
ATOM   2937  C CD1 . LEU A 1 391 ? 1.494   -22.586 8.859   1.00 42.96  ? 413  LEU A CD1 1 
ATOM   2938  C CD2 . LEU A 1 391 ? 3.482   -23.914 8.103   1.00 43.00  ? 413  LEU A CD2 1 
ATOM   2939  N N   . PHE A 1 392 ? 0.385   -20.607 6.344   1.00 38.62  ? 414  PHE A N   1 
ATOM   2940  C CA  . PHE A 1 392 ? -0.406  -19.587 7.038   1.00 44.24  ? 414  PHE A CA  1 
ATOM   2941  C C   . PHE A 1 392 ? -1.713  -19.186 6.326   1.00 48.94  ? 414  PHE A C   1 
ATOM   2942  O O   . PHE A 1 392 ? -2.687  -18.807 6.972   1.00 50.25  ? 414  PHE A O   1 
ATOM   2943  C CB  . PHE A 1 392 ? 0.461   -18.378 7.403   1.00 44.07  ? 414  PHE A CB  1 
ATOM   2944  C CG  . PHE A 1 392 ? 1.578   -18.717 8.355   1.00 43.31  ? 414  PHE A CG  1 
ATOM   2945  C CD1 . PHE A 1 392 ? 1.297   -19.143 9.641   1.00 40.83  ? 414  PHE A CD1 1 
ATOM   2946  C CD2 . PHE A 1 392 ? 2.903   -18.630 7.958   1.00 42.46  ? 414  PHE A CD2 1 
ATOM   2947  C CE1 . PHE A 1 392 ? 2.316   -19.467 10.518  1.00 40.92  ? 414  PHE A CE1 1 
ATOM   2948  C CE2 . PHE A 1 392 ? 3.923   -18.957 8.833   1.00 38.82  ? 414  PHE A CE2 1 
ATOM   2949  C CZ  . PHE A 1 392 ? 3.632   -19.373 10.109  1.00 38.89  ? 414  PHE A CZ  1 
ATOM   2950  N N   . GLN A 1 393 ? -1.742  -19.301 5.002   1.00 54.69  ? 415  GLN A N   1 
ATOM   2951  C CA  . GLN A 1 393 ? -2.964  -19.024 4.236   1.00 61.07  ? 415  GLN A CA  1 
ATOM   2952  C C   . GLN A 1 393 ? -4.122  -19.979 4.552   1.00 63.58  ? 415  GLN A C   1 
ATOM   2953  O O   . GLN A 1 393 ? -5.270  -19.550 4.662   1.00 61.84  ? 415  GLN A O   1 
ATOM   2954  C CB  . GLN A 1 393 ? -2.684  -19.051 2.734   1.00 64.36  ? 415  GLN A CB  1 
ATOM   2955  C CG  . GLN A 1 393 ? -2.146  -17.739 2.180   1.00 68.40  ? 415  GLN A CG  1 
ATOM   2956  C CD  . GLN A 1 393 ? -2.123  -17.716 0.661   1.00 73.72  ? 415  GLN A CD  1 
ATOM   2957  O OE1 . GLN A 1 393 ? -2.448  -18.708 0.013   1.00 76.93  ? 415  GLN A OE1 1 
ATOM   2958  N NE2 . GLN A 1 393 ? -1.737  -16.584 0.087   1.00 73.75  ? 415  GLN A NE2 1 
ATOM   2959  N N   . ASN A 1 394 ? -3.816  -21.269 4.690   1.00 66.93  ? 416  ASN A N   1 
ATOM   2960  C CA  . ASN A 1 394 ? -4.840  -22.291 4.925   1.00 67.92  ? 416  ASN A CA  1 
ATOM   2961  C C   . ASN A 1 394 ? -5.514  -22.194 6.295   1.00 66.28  ? 416  ASN A C   1 
ATOM   2962  O O   . ASN A 1 394 ? -6.483  -22.906 6.565   1.00 66.84  ? 416  ASN A O   1 
ATOM   2963  C CB  . ASN A 1 394 ? -4.266  -23.692 4.724   1.00 72.57  ? 416  ASN A CB  1 
ATOM   2964  C CG  . ASN A 1 394 ? -3.949  -23.994 3.270   1.00 79.71  ? 416  ASN A CG  1 
ATOM   2965  O OD1 . ASN A 1 394 ? -4.693  -23.619 2.358   1.00 81.75  ? 416  ASN A OD1 1 
ATOM   2966  N ND2 . ASN A 1 394 ? -2.840  -24.682 3.047   1.00 82.80  ? 416  ASN A ND2 1 
ATOM   2967  N N   . PHE A 1 395 ? -4.989  -21.329 7.162   1.00 63.15  ? 417  PHE A N   1 
ATOM   2968  C CA  . PHE A 1 395 ? -5.653  -21.015 8.423   1.00 60.78  ? 417  PHE A CA  1 
ATOM   2969  C C   . PHE A 1 395 ? -6.917  -20.234 8.117   1.00 61.40  ? 417  PHE A C   1 
ATOM   2970  O O   . PHE A 1 395 ? -6.997  -19.593 7.070   1.00 61.24  ? 417  PHE A O   1 
ATOM   2971  C CB  . PHE A 1 395 ? -4.756  -20.153 9.297   1.00 56.22  ? 417  PHE A CB  1 
ATOM   2972  C CG  . PHE A 1 395 ? -3.792  -20.931 10.133  1.00 54.00  ? 417  PHE A CG  1 
ATOM   2973  C CD1 . PHE A 1 395 ? -2.651  -21.475 9.572   1.00 54.87  ? 417  PHE A CD1 1 
ATOM   2974  C CD2 . PHE A 1 395 ? -4.010  -21.096 11.487  1.00 52.06  ? 417  PHE A CD2 1 
ATOM   2975  C CE1 . PHE A 1 395 ? -1.751  -22.185 10.346  1.00 54.41  ? 417  PHE A CE1 1 
ATOM   2976  C CE2 . PHE A 1 395 ? -3.112  -21.799 12.264  1.00 53.53  ? 417  PHE A CE2 1 
ATOM   2977  C CZ  . PHE A 1 395 ? -1.982  -22.345 11.693  1.00 52.73  ? 417  PHE A CZ  1 
ATOM   2978  N N   . SER A 1 396 ? -7.896  -20.277 9.020   1.00 61.98  ? 418  SER A N   1 
ATOM   2979  C CA  . SER A 1 396 ? -9.150  -19.557 8.795   1.00 63.66  ? 418  SER A CA  1 
ATOM   2980  C C   . SER A 1 396 ? -8.959  -18.044 8.603   1.00 64.09  ? 418  SER A C   1 
ATOM   2981  O O   . SER A 1 396 ? -9.116  -17.555 7.482   1.00 65.71  ? 418  SER A O   1 
ATOM   2982  C CB  . SER A 1 396 ? -10.171 -19.857 9.891   1.00 64.89  ? 418  SER A CB  1 
ATOM   2983  O OG  . SER A 1 396 ? -11.427 -19.290 9.561   1.00 68.53  ? 418  SER A OG  1 
ATOM   2984  N N   . ASN A 1 397 ? -8.679  -17.289 9.669   1.00 62.05  ? 419  ASN A N   1 
ATOM   2985  C CA  . ASN A 1 397 ? -8.052  -15.980 9.474   1.00 61.07  ? 419  ASN A CA  1 
ATOM   2986  C C   . ASN A 1 397 ? -7.010  -15.556 10.523  1.00 54.17  ? 419  ASN A C   1 
ATOM   2987  O O   . ASN A 1 397 ? -7.361  -15.116 11.619  1.00 51.78  ? 419  ASN A O   1 
ATOM   2988  C CB  . ASN A 1 397 ? -9.109  -14.888 9.270   1.00 68.23  ? 419  ASN A CB  1 
ATOM   2989  C CG  . ASN A 1 397 ? -8.570  -13.700 8.488   1.00 74.92  ? 419  ASN A CG  1 
ATOM   2990  O OD1 . ASN A 1 397 ? -8.436  -13.757 7.264   1.00 77.37  ? 419  ASN A OD1 1 
ATOM   2991  N ND2 . ASN A 1 397 ? -8.258  -12.616 9.193   1.00 75.71  ? 419  ASN A ND2 1 
ATOM   2992  N N   . LEU A 1 398 ? -5.739  -15.566 10.137  1.00 49.19  ? 420  LEU A N   1 
ATOM   2993  C CA  . LEU A 1 398 ? -4.672  -15.158 11.032  1.00 42.83  ? 420  LEU A CA  1 
ATOM   2994  C C   . LEU A 1 398 ? -4.443  -13.675 10.831  1.00 42.31  ? 420  LEU A C   1 
ATOM   2995  O O   . LEU A 1 398 ? -4.172  -13.247 9.712   1.00 43.35  ? 420  LEU A O   1 
ATOM   2996  C CB  . LEU A 1 398 ? -3.390  -15.907 10.698  1.00 43.33  ? 420  LEU A CB  1 
ATOM   2997  C CG  . LEU A 1 398 ? -3.252  -17.343 11.175  1.00 45.48  ? 420  LEU A CG  1 
ATOM   2998  C CD1 . LEU A 1 398 ? -2.064  -17.991 10.486  1.00 43.30  ? 420  LEU A CD1 1 
ATOM   2999  C CD2 . LEU A 1 398 ? -3.086  -17.359 12.693  1.00 47.67  ? 420  LEU A CD2 1 
ATOM   3000  N N   . GLU A 1 399 ? -4.643  -12.883 11.881  1.00 43.42  ? 421  GLU A N   1 
ATOM   3001  C CA  . GLU A 1 399 ? -4.288  -11.456 11.866  1.00 42.72  ? 421  GLU A CA  1 
ATOM   3002  C C   . GLU A 1 399 ? -2.840  -11.157 12.277  1.00 40.46  ? 421  GLU A C   1 
ATOM   3003  O O   . GLU A 1 399 ? -2.237  -10.183 11.833  1.00 41.30  ? 421  GLU A O   1 
ATOM   3004  C CB  . GLU A 1 399 ? -5.289  -10.651 12.688  1.00 48.16  ? 421  GLU A CB  1 
ATOM   3005  C CG  . GLU A 1 399 ? -6.702  -10.735 12.114  1.00 59.40  ? 421  GLU A CG  1 
ATOM   3006  C CD  . GLU A 1 399 ? -7.767  -10.316 13.104  1.00 70.31  ? 421  GLU A CD  1 
ATOM   3007  O OE1 . GLU A 1 399 ? -7.851  -9.111  13.420  1.00 74.11  ? 421  GLU A OE1 1 
ATOM   3008  O OE2 . GLU A 1 399 ? -8.520  -11.196 13.575  1.00 75.37  ? 421  GLU A OE2 1 
ATOM   3009  N N   . ILE A 1 400 ? -2.308  -11.997 13.151  1.00 39.28  ? 422  ILE A N   1 
ATOM   3010  C CA  . ILE A 1 400 ? -0.993  -11.792 13.742  1.00 37.98  ? 422  ILE A CA  1 
ATOM   3011  C C   . ILE A 1 400 ? -0.201  -13.091 13.690  1.00 36.18  ? 422  ILE A C   1 
ATOM   3012  O O   . ILE A 1 400 ? -0.568  -14.075 14.336  1.00 38.02  ? 422  ILE A O   1 
ATOM   3013  C CB  . ILE A 1 400 ? -1.139  -11.305 15.214  1.00 37.52  ? 422  ILE A CB  1 
ATOM   3014  C CG1 . ILE A 1 400 ? -1.714  -9.885  15.235  1.00 42.89  ? 422  ILE A CG1 1 
ATOM   3015  C CG2 . ILE A 1 400 ? 0.197   -11.363 15.968  1.00 36.09  ? 422  ILE A CG2 1 
ATOM   3016  C CD1 . ILE A 1 400 ? -1.985  -9.351  16.620  1.00 44.90  ? 422  ILE A CD1 1 
ATOM   3017  N N   . ILE A 1 401 ? 0.882   -13.090 12.916  1.00 33.34  ? 423  ILE A N   1 
ATOM   3018  C CA  . ILE A 1 401 ? 1.782   -14.236 12.843  1.00 35.13  ? 423  ILE A CA  1 
ATOM   3019  C C   . ILE A 1 401 ? 3.107   -13.848 13.494  1.00 36.12  ? 423  ILE A C   1 
ATOM   3020  O O   . ILE A 1 401 ? 3.908   -13.122 12.897  1.00 39.36  ? 423  ILE A O   1 
ATOM   3021  C CB  . ILE A 1 401 ? 2.035   -14.620 11.370  1.00 33.58  ? 423  ILE A CB  1 
ATOM   3022  C CG1 . ILE A 1 401 ? 0.709   -14.906 10.655  1.00 36.44  ? 423  ILE A CG1 1 
ATOM   3023  C CG2 . ILE A 1 401 ? 2.967   -15.822 11.261  1.00 31.94  ? 423  ILE A CG2 1 
ATOM   3024  C CD1 . ILE A 1 401 ? 0.792   -14.743 9.132   1.00 37.49  ? 423  ILE A CD1 1 
ATOM   3025  N N   . TYR A 1 402 ? 3.368   -14.338 14.701  1.00 35.34  ? 424  TYR A N   1 
ATOM   3026  C CA  . TYR A 1 402 ? 4.528   -13.825 15.427  1.00 33.14  ? 424  TYR A CA  1 
ATOM   3027  C C   . TYR A 1 402 ? 5.661   -14.839 15.423  1.00 33.21  ? 424  TYR A C   1 
ATOM   3028  O O   . TYR A 1 402 ? 5.643   -15.816 16.170  1.00 33.23  ? 424  TYR A O   1 
ATOM   3029  C CB  . TYR A 1 402 ? 4.135   -13.473 16.860  1.00 33.42  ? 424  TYR A CB  1 
ATOM   3030  C CG  . TYR A 1 402 ? 5.207   -12.745 17.636  1.00 36.05  ? 424  TYR A CG  1 
ATOM   3031  C CD1 . TYR A 1 402 ? 5.370   -11.376 17.510  1.00 37.81  ? 424  TYR A CD1 1 
ATOM   3032  C CD2 . TYR A 1 402 ? 6.045   -13.425 18.502  1.00 37.13  ? 424  TYR A CD2 1 
ATOM   3033  C CE1 . TYR A 1 402 ? 6.339   -10.703 18.224  1.00 40.07  ? 424  TYR A CE1 1 
ATOM   3034  C CE2 . TYR A 1 402 ? 7.025   -12.760 19.222  1.00 38.71  ? 424  TYR A CE2 1 
ATOM   3035  C CZ  . TYR A 1 402 ? 7.163   -11.404 19.081  1.00 41.19  ? 424  TYR A CZ  1 
ATOM   3036  O OH  . TYR A 1 402 ? 8.140   -10.743 19.786  1.00 46.61  ? 424  TYR A OH  1 
ATOM   3037  N N   . LEU A 1 403 ? 6.629   -14.575 14.547  1.00 35.08  ? 425  LEU A N   1 
ATOM   3038  C CA  . LEU A 1 403 ? 7.817   -15.398 14.318  1.00 33.81  ? 425  LEU A CA  1 
ATOM   3039  C C   . LEU A 1 403 ? 9.128   -14.843 14.902  1.00 33.44  ? 425  LEU A C   1 
ATOM   3040  O O   . LEU A 1 403 ? 10.219  -15.303 14.536  1.00 31.19  ? 425  LEU A O   1 
ATOM   3041  C CB  . LEU A 1 403 ? 7.946   -15.730 12.835  1.00 39.58  ? 425  LEU A CB  1 
ATOM   3042  C CG  . LEU A 1 403 ? 6.684   -16.409 12.279  1.00 41.79  ? 425  LEU A CG  1 
ATOM   3043  C CD1 . LEU A 1 403 ? 6.773   -16.572 10.772  1.00 42.66  ? 425  LEU A CD1 1 
ATOM   3044  C CD2 . LEU A 1 403 ? 6.456   -17.760 12.954  1.00 40.42  ? 425  LEU A CD2 1 
ATOM   3045  N N   . SER A 1 404 ? 9.020   -13.787 15.711  1.00 34.36  ? 426  SER A N   1 
ATOM   3046  C CA  . SER A 1 404 ? 10.189  -13.085 16.248  1.00 35.38  ? 426  SER A CA  1 
ATOM   3047  C C   . SER A 1 404 ? 11.137  -13.987 17.017  1.00 40.62  ? 426  SER A C   1 
ATOM   3048  O O   . SER A 1 404 ? 10.712  -14.938 17.674  1.00 40.76  ? 426  SER A O   1 
ATOM   3049  C CB  . SER A 1 404 ? 9.759   -11.943 17.168  1.00 33.41  ? 426  SER A CB  1 
ATOM   3050  O OG  . SER A 1 404 ? 10.843  -11.083 17.468  1.00 28.24  ? 426  SER A OG  1 
ATOM   3051  N N   . GLU A 1 405 ? 12.427  -13.670 16.923  1.00 42.01  ? 427  GLU A N   1 
ATOM   3052  C CA  . GLU A 1 405 ? 13.478  -14.369 17.658  1.00 36.32  ? 427  GLU A CA  1 
ATOM   3053  C C   . GLU A 1 405 ? 13.587  -15.866 17.320  1.00 37.36  ? 427  GLU A C   1 
ATOM   3054  O O   . GLU A 1 405 ? 13.354  -16.741 18.165  1.00 36.04  ? 427  GLU A O   1 
ATOM   3055  C CB  . GLU A 1 405 ? 13.310  -14.142 19.167  1.00 21.69  ? 427  GLU A CB  1 
ATOM   3056  C CG  . GLU A 1 405 ? 14.546  -14.495 19.963  1.00 30.14  ? 427  GLU A CG  1 
ATOM   3057  C CD  . GLU A 1 405 ? 15.766  -13.738 19.478  1.00 32.14  ? 427  GLU A CD  1 
ATOM   3058  O OE1 . GLU A 1 405 ? 16.549  -14.322 18.696  1.00 33.80  ? 427  GLU A OE1 1 
ATOM   3059  O OE2 . GLU A 1 405 ? 15.926  -12.559 19.863  1.00 28.66  ? 427  GLU A OE2 1 
ATOM   3060  N N   . ASN A 1 406 ? 13.974  -16.140 16.077  1.00 35.32  ? 428  ASN A N   1 
ATOM   3061  C CA  . ASN A 1 406 ? 14.219  -17.499 15.601  1.00 34.83  ? 428  ASN A CA  1 
ATOM   3062  C C   . ASN A 1 406 ? 15.507  -17.550 14.756  1.00 37.07  ? 428  ASN A C   1 
ATOM   3063  O O   . ASN A 1 406 ? 16.319  -16.629 14.799  1.00 37.18  ? 428  ASN A O   1 
ATOM   3064  C CB  . ASN A 1 406 ? 13.013  -18.054 14.808  1.00 33.47  ? 428  ASN A CB  1 
ATOM   3065  C CG  . ASN A 1 406 ? 11.874  -18.522 15.709  1.00 30.17  ? 428  ASN A CG  1 
ATOM   3066  O OD1 . ASN A 1 406 ? 11.975  -19.557 16.369  1.00 30.16  ? 428  ASN A OD1 1 
ATOM   3067  N ND2 . ASN A 1 406 ? 10.789  -17.762 15.738  1.00 25.01  ? 428  ASN A ND2 1 
ATOM   3068  N N   . ARG A 1 407 ? 15.733  -18.677 14.089  1.00 38.52  ? 429  ARG A N   1 
ATOM   3069  C CA  . ARG A 1 407 ? 16.840  -18.864 13.136  1.00 42.33  ? 429  ARG A CA  1 
ATOM   3070  C C   . ARG A 1 407 ? 16.478  -18.747 11.641  1.00 40.49  ? 429  ARG A C   1 
ATOM   3071  O O   . ARG A 1 407 ? 17.207  -19.270 10.799  1.00 38.94  ? 429  ARG A O   1 
ATOM   3072  C CB  . ARG A 1 407 ? 17.618  -20.158 13.403  1.00 45.38  ? 429  ARG A CB  1 
ATOM   3073  C CG  . ARG A 1 407 ? 18.276  -20.205 14.765  1.00 49.69  ? 429  ARG A CG  1 
ATOM   3074  C CD  . ARG A 1 407 ? 19.116  -18.967 15.035  1.00 55.38  ? 429  ARG A CD  1 
ATOM   3075  N NE  . ARG A 1 407 ? 20.542  -19.279 15.037  1.00 61.93  ? 429  ARG A NE  1 
ATOM   3076  C CZ  . ARG A 1 407 ? 21.365  -19.009 14.030  1.00 65.20  ? 429  ARG A CZ  1 
ATOM   3077  N NH1 . ARG A 1 407 ? 20.908  -18.402 12.938  1.00 63.81  ? 429  ARG A NH1 1 
ATOM   3078  N NH2 . ARG A 1 407 ? 22.645  -19.336 14.120  1.00 68.14  ? 429  ARG A NH2 1 
ATOM   3079  N N   . ILE A 1 408 ? 15.301  -18.221 11.319  1.00 37.42  ? 430  ILE A N   1 
ATOM   3080  C CA  . ILE A 1 408 ? 14.863  -18.187 9.916   1.00 38.55  ? 430  ILE A CA  1 
ATOM   3081  C C   . ILE A 1 408 ? 15.906  -17.557 8.981   1.00 38.24  ? 430  ILE A C   1 
ATOM   3082  O O   . ILE A 1 408 ? 16.351  -16.430 9.202   1.00 38.90  ? 430  ILE A O   1 
ATOM   3083  C CB  . ILE A 1 408 ? 13.535  -17.418 9.762   1.00 34.41  ? 430  ILE A CB  1 
ATOM   3084  C CG1 . ILE A 1 408 ? 12.487  -17.971 10.725  1.00 36.48  ? 430  ILE A CG1 1 
ATOM   3085  C CG2 . ILE A 1 408 ? 13.016  -17.519 8.330   1.00 33.61  ? 430  ILE A CG2 1 
ATOM   3086  C CD1 . ILE A 1 408 ? 12.280  -19.454 10.567  1.00 40.35  ? 430  ILE A CD1 1 
ATOM   3087  N N   . SER A 1 409 ? 16.280  -18.286 7.934   1.00 35.02  ? 431  SER A N   1 
ATOM   3088  C CA  . SER A 1 409 ? 17.318  -17.816 7.003   1.00 36.85  ? 431  SER A CA  1 
ATOM   3089  C C   . SER A 1 409 ? 16.709  -17.650 5.599   1.00 37.53  ? 431  SER A C   1 
ATOM   3090  O O   . SER A 1 409 ? 15.514  -17.900 5.429   1.00 38.56  ? 431  SER A O   1 
ATOM   3091  C CB  . SER A 1 409 ? 18.542  -18.761 7.037   1.00 33.31  ? 431  SER A CB  1 
ATOM   3092  O OG  . SER A 1 409 ? 18.212  -20.068 6.597   1.00 38.07  ? 431  SER A OG  1 
ATOM   3093  N N   . PRO A 1 410 ? 17.495  -17.186 4.601   1.00 37.09  ? 432  PRO A N   1 
ATOM   3094  C CA  . PRO A 1 410 ? 16.831  -16.967 3.304   1.00 38.57  ? 432  PRO A CA  1 
ATOM   3095  C C   . PRO A 1 410 ? 16.224  -18.219 2.682   1.00 42.68  ? 432  PRO A C   1 
ATOM   3096  O O   . PRO A 1 410 ? 16.824  -19.292 2.745   1.00 43.87  ? 432  PRO A O   1 
ATOM   3097  C CB  . PRO A 1 410 ? 17.959  -16.425 2.424   1.00 37.10  ? 432  PRO A CB  1 
ATOM   3098  C CG  . PRO A 1 410 ? 18.837  -15.691 3.398   1.00 34.98  ? 432  PRO A CG  1 
ATOM   3099  C CD  . PRO A 1 410 ? 18.819  -16.534 4.643   1.00 35.73  ? 432  PRO A CD  1 
ATOM   3100  N N   . LEU A 1 411 ? 15.037  -18.063 2.099   1.00 47.11  ? 433  LEU A N   1 
ATOM   3101  C CA  . LEU A 1 411 ? 14.295  -19.171 1.507   1.00 53.23  ? 433  LEU A CA  1 
ATOM   3102  C C   . LEU A 1 411 ? 15.109  -19.897 0.453   1.00 54.61  ? 433  LEU A C   1 
ATOM   3103  O O   . LEU A 1 411 ? 15.802  -19.274 -0.346  1.00 53.07  ? 433  LEU A O   1 
ATOM   3104  C CB  . LEU A 1 411 ? 12.986  -18.673 0.882   1.00 58.95  ? 433  LEU A CB  1 
ATOM   3105  C CG  . LEU A 1 411 ? 12.111  -19.723 0.177   1.00 62.85  ? 433  LEU A CG  1 
ATOM   3106  C CD1 . LEU A 1 411 ? 10.651  -19.586 0.573   1.00 64.27  ? 433  LEU A CD1 1 
ATOM   3107  C CD2 . LEU A 1 411 ? 12.252  -19.625 -1.331  1.00 64.87  ? 433  LEU A CD2 1 
ATOM   3108  N N   . VAL A 1 412 ? 15.014  -21.221 0.466   1.00 59.08  ? 434  VAL A N   1 
ATOM   3109  C CA  . VAL A 1 412 ? 15.623  -22.053 -0.561  1.00 63.63  ? 434  VAL A CA  1 
ATOM   3110  C C   . VAL A 1 412 ? 14.542  -22.771 -1.372  1.00 63.36  ? 434  VAL A C   1 
ATOM   3111  O O   . VAL A 1 412 ? 13.489  -23.136 -0.837  1.00 62.17  ? 434  VAL A O   1 
ATOM   3112  C CB  . VAL A 1 412 ? 16.573  -23.086 0.064   1.00 65.41  ? 434  VAL A CB  1 
ATOM   3113  C CG1 . VAL A 1 412 ? 16.810  -24.240 -0.891  1.00 66.83  ? 434  VAL A CG1 1 
ATOM   3114  C CG2 . VAL A 1 412 ? 17.880  -22.423 0.456   1.00 64.88  ? 434  VAL A CG2 1 
ATOM   3115  N N   . PHE A 1 437 ? 11.723  -2.785  42.006  1.00 70.30  ? 459  PHE A N   1 
ATOM   3116  C CA  . PHE A 1 437 ? 11.437  -4.214  42.066  1.00 68.50  ? 459  PHE A CA  1 
ATOM   3117  C C   . PHE A 1 437 ? 11.920  -4.924  40.814  1.00 67.06  ? 459  PHE A C   1 
ATOM   3118  O O   . PHE A 1 437 ? 11.564  -4.530  39.702  1.00 66.18  ? 459  PHE A O   1 
ATOM   3119  C CB  . PHE A 1 437 ? 9.939   -4.469  42.276  1.00 67.70  ? 459  PHE A CB  1 
ATOM   3120  C CG  . PHE A 1 437 ? 9.483   -4.243  43.684  1.00 66.34  ? 459  PHE A CG  1 
ATOM   3121  C CD1 . PHE A 1 437 ? 10.037  -4.973  44.723  1.00 67.03  ? 459  PHE A CD1 1 
ATOM   3122  C CD2 . PHE A 1 437 ? 8.493   -3.316  43.966  1.00 66.30  ? 459  PHE A CD2 1 
ATOM   3123  C CE1 . PHE A 1 437 ? 9.625   -4.772  46.022  1.00 67.83  ? 459  PHE A CE1 1 
ATOM   3124  C CE2 . PHE A 1 437 ? 8.070   -3.110  45.259  1.00 66.53  ? 459  PHE A CE2 1 
ATOM   3125  C CZ  . PHE A 1 437 ? 8.637   -3.838  46.290  1.00 67.55  ? 459  PHE A CZ  1 
ATOM   3126  N N   . GLU A 1 438 ? 12.745  -5.955  41.004  1.00 65.33  ? 460  GLU A N   1 
ATOM   3127  C CA  . GLU A 1 438 ? 13.144  -6.824  39.906  1.00 60.48  ? 460  GLU A CA  1 
ATOM   3128  C C   . GLU A 1 438 ? 11.895  -7.351  39.230  1.00 53.01  ? 460  GLU A C   1 
ATOM   3129  O O   . GLU A 1 438 ? 11.764  -7.275  38.008  1.00 47.88  ? 460  GLU A O   1 
ATOM   3130  C CB  . GLU A 1 438 ? 14.003  -7.996  40.386  1.00 61.59  ? 460  GLU A CB  1 
ATOM   3131  C CG  . GLU A 1 438 ? 14.483  -8.888  39.236  1.00 61.94  ? 460  GLU A CG  1 
ATOM   3132  C CD  . GLU A 1 438 ? 15.275  -10.103 39.695  1.00 63.95  ? 460  GLU A CD  1 
ATOM   3133  O OE1 . GLU A 1 438 ? 15.536  -10.240 40.913  1.00 67.32  ? 460  GLU A OE1 1 
ATOM   3134  O OE2 . GLU A 1 438 ? 15.630  -10.928 38.829  1.00 61.51  ? 460  GLU A OE2 1 
ATOM   3135  N N   . PHE A 1 439 ? 10.978  -7.883  40.035  1.00 51.73  ? 461  PHE A N   1 
ATOM   3136  C CA  . PHE A 1 439 ? 9.703   -8.372  39.523  1.00 50.47  ? 461  PHE A CA  1 
ATOM   3137  C C   . PHE A 1 439 ? 8.532   -7.549  40.039  1.00 51.13  ? 461  PHE A C   1 
ATOM   3138  O O   . PHE A 1 439 ? 8.205   -7.571  41.220  1.00 51.87  ? 461  PHE A O   1 
ATOM   3139  C CB  . PHE A 1 439 ? 9.500   -9.839  39.885  1.00 48.88  ? 461  PHE A CB  1 
ATOM   3140  C CG  . PHE A 1 439 ? 10.617  -10.725 39.443  1.00 49.73  ? 461  PHE A CG  1 
ATOM   3141  C CD1 . PHE A 1 439 ? 10.729  -11.111 38.117  1.00 51.44  ? 461  PHE A CD1 1 
ATOM   3142  C CD2 . PHE A 1 439 ? 11.561  -11.168 40.352  1.00 49.42  ? 461  PHE A CD2 1 
ATOM   3143  C CE1 . PHE A 1 439 ? 11.764  -11.929 37.706  1.00 51.73  ? 461  PHE A CE1 1 
ATOM   3144  C CE2 . PHE A 1 439 ? 12.587  -11.987 39.956  1.00 52.43  ? 461  PHE A CE2 1 
ATOM   3145  C CZ  . PHE A 1 439 ? 12.695  -12.369 38.627  1.00 53.34  ? 461  PHE A CZ  1 
ATOM   3146  N N   . ASP A 1 440 ? 7.892   -6.827  39.139  1.00 51.22  ? 462  ASP A N   1 
ATOM   3147  C CA  . ASP A 1 440 ? 6.755   -6.020  39.522  1.00 50.40  ? 462  ASP A CA  1 
ATOM   3148  C C   . ASP A 1 440 ? 5.618   -6.921  40.014  1.00 46.61  ? 462  ASP A C   1 
ATOM   3149  O O   . ASP A 1 440 ? 5.021   -7.660  39.236  1.00 40.71  ? 462  ASP A O   1 
ATOM   3150  C CB  . ASP A 1 440 ? 6.323   -5.198  38.316  1.00 49.72  ? 462  ASP A CB  1 
ATOM   3151  C CG  . ASP A 1 440 ? 5.172   -4.288  38.615  1.00 50.14  ? 462  ASP A CG  1 
ATOM   3152  O OD1 . ASP A 1 440 ? 4.790   -4.157  39.794  1.00 51.85  ? 462  ASP A OD1 1 
ATOM   3153  O OD2 . ASP A 1 440 ? 4.663   -3.685  37.653  1.00 53.52  ? 462  ASP A OD2 1 
ATOM   3154  N N   . PRO A 1 441 ? 5.293   -6.827  41.313  1.00 47.08  ? 463  PRO A N   1 
ATOM   3155  C CA  . PRO A 1 441 ? 4.275   -7.689  41.925  1.00 47.17  ? 463  PRO A CA  1 
ATOM   3156  C C   . PRO A 1 441 ? 2.892   -7.465  41.321  1.00 49.29  ? 463  PRO A C   1 
ATOM   3157  O O   . PRO A 1 441 ? 1.992   -8.297  41.494  1.00 48.46  ? 463  PRO A O   1 
ATOM   3158  C CB  . PRO A 1 441 ? 4.296   -7.269  43.401  1.00 46.15  ? 463  PRO A CB  1 
ATOM   3159  C CG  . PRO A 1 441 ? 4.912   -5.929  43.418  1.00 46.27  ? 463  PRO A CG  1 
ATOM   3160  C CD  . PRO A 1 441 ? 5.878   -5.884  42.282  1.00 45.31  ? 463  PRO A CD  1 
ATOM   3161  N N   . HIS A 1 442 ? 2.737   -6.351  40.610  1.00 47.78  ? 464  HIS A N   1 
ATOM   3162  C CA  . HIS A 1 442 ? 1.468   -6.008  39.977  1.00 47.54  ? 464  HIS A CA  1 
ATOM   3163  C C   . HIS A 1 442 ? 1.372   -6.469  38.527  1.00 48.05  ? 464  HIS A C   1 
ATOM   3164  O O   . HIS A 1 442 ? 0.400   -6.170  37.838  1.00 51.76  ? 464  HIS A O   1 
ATOM   3165  C CB  . HIS A 1 442 ? 1.205   -4.509  40.089  1.00 44.82  ? 464  HIS A CB  1 
ATOM   3166  C CG  . HIS A 1 442 ? 1.087   -4.040  41.502  1.00 43.87  ? 464  HIS A CG  1 
ATOM   3167  N ND1 . HIS A 1 442 ? -0.035  -4.270  42.266  1.00 43.59  ? 464  HIS A ND1 1 
ATOM   3168  C CD2 . HIS A 1 442 ? 1.963   -3.385  42.302  1.00 44.77  ? 464  HIS A CD2 1 
ATOM   3169  C CE1 . HIS A 1 442 ? 0.145   -3.761  43.473  1.00 46.01  ? 464  HIS A CE1 1 
ATOM   3170  N NE2 . HIS A 1 442 ? 1.350   -3.223  43.522  1.00 48.52  ? 464  HIS A NE2 1 
ATOM   3171  N N   . SER A 1 443 ? 2.374   -7.203  38.065  1.00 42.44  ? 465  SER A N   1 
ATOM   3172  C CA  . SER A 1 443 ? 2.362   -7.670  36.691  1.00 43.14  ? 465  SER A CA  1 
ATOM   3173  C C   . SER A 1 443 ? 2.452   -9.181  36.641  1.00 43.26  ? 465  SER A C   1 
ATOM   3174  O O   . SER A 1 443 ? 2.741   -9.826  37.648  1.00 42.72  ? 465  SER A O   1 
ATOM   3175  C CB  . SER A 1 443 ? 3.509   -7.047  35.886  1.00 45.38  ? 465  SER A CB  1 
ATOM   3176  O OG  . SER A 1 443 ? 4.769   -7.501  36.348  1.00 47.99  ? 465  SER A OG  1 
ATOM   3177  N N   . ASN A 1 444 ? 2.161   -9.732  35.467  1.00 40.76  ? 466  ASN A N   1 
ATOM   3178  C CA  . ASN A 1 444 ? 2.308   -11.151 35.201  1.00 43.43  ? 466  ASN A CA  1 
ATOM   3179  C C   . ASN A 1 444 ? 3.758   -11.609 35.361  1.00 44.52  ? 466  ASN A C   1 
ATOM   3180  O O   . ASN A 1 444 ? 4.674   -11.004 34.798  1.00 45.48  ? 466  ASN A O   1 
ATOM   3181  C CB  . ASN A 1 444 ? 1.845   -11.431 33.777  1.00 47.28  ? 466  ASN A CB  1 
ATOM   3182  C CG  . ASN A 1 444 ? 1.590   -12.894 33.524  1.00 50.13  ? 466  ASN A CG  1 
ATOM   3183  O OD1 . ASN A 1 444 ? 2.520   -13.674 33.281  1.00 50.87  ? 466  ASN A OD1 1 
ATOM   3184  N ND2 . ASN A 1 444 ? 0.316   -13.278 33.557  1.00 50.01  ? 466  ASN A ND2 1 
ATOM   3185  N N   . PHE A 1 445 ? 3.965   -12.685 36.116  1.00 42.00  ? 467  PHE A N   1 
ATOM   3186  C CA  . PHE A 1 445 ? 5.314   -13.193 36.377  1.00 39.41  ? 467  PHE A CA  1 
ATOM   3187  C C   . PHE A 1 445 ? 5.878   -14.016 35.226  1.00 42.19  ? 467  PHE A C   1 
ATOM   3188  O O   . PHE A 1 445 ? 7.086   -14.025 35.002  1.00 40.52  ? 467  PHE A O   1 
ATOM   3189  C CB  . PHE A 1 445 ? 5.293   -14.058 37.635  1.00 38.88  ? 467  PHE A CB  1 
ATOM   3190  C CG  . PHE A 1 445 ? 6.646   -14.431 38.159  1.00 35.14  ? 467  PHE A CG  1 
ATOM   3191  C CD1 . PHE A 1 445 ? 7.490   -13.469 38.691  1.00 26.30  ? 467  PHE A CD1 1 
ATOM   3192  C CD2 . PHE A 1 445 ? 7.052   -15.756 38.175  1.00 33.33  ? 467  PHE A CD2 1 
ATOM   3193  C CE1 . PHE A 1 445 ? 8.726   -13.821 39.211  1.00 26.22  ? 467  PHE A CE1 1 
ATOM   3194  C CE2 . PHE A 1 445 ? 8.290   -16.115 38.694  1.00 34.28  ? 467  PHE A CE2 1 
ATOM   3195  C CZ  . PHE A 1 445 ? 9.127   -15.143 39.222  1.00 29.91  ? 467  PHE A CZ  1 
ATOM   3196  N N   . TYR A 1 446 ? 5.019   -14.771 34.548  1.00 45.11  ? 468  TYR A N   1 
ATOM   3197  C CA  . TYR A 1 446 ? 5.491   -15.701 33.517  1.00 47.28  ? 468  TYR A CA  1 
ATOM   3198  C C   . TYR A 1 446 ? 5.702   -15.165 32.085  1.00 50.70  ? 468  TYR A C   1 
ATOM   3199  O O   . TYR A 1 446 ? 6.612   -15.605 31.380  1.00 49.71  ? 468  TYR A O   1 
ATOM   3200  C CB  . TYR A 1 446 ? 4.732   -17.033 33.609  1.00 44.05  ? 468  TYR A CB  1 
ATOM   3201  C CG  . TYR A 1 446 ? 5.005   -17.693 34.953  1.00 42.33  ? 468  TYR A CG  1 
ATOM   3202  C CD1 . TYR A 1 446 ? 6.197   -18.375 35.180  1.00 39.02  ? 468  TYR A CD1 1 
ATOM   3203  C CD2 . TYR A 1 446 ? 4.104   -17.586 36.005  1.00 40.61  ? 468  TYR A CD2 1 
ATOM   3204  C CE1 . TYR A 1 446 ? 6.469   -18.958 36.398  1.00 39.05  ? 468  TYR A CE1 1 
ATOM   3205  C CE2 . TYR A 1 446 ? 4.364   -18.166 37.236  1.00 37.76  ? 468  TYR A CE2 1 
ATOM   3206  C CZ  . TYR A 1 446 ? 5.545   -18.853 37.425  1.00 37.72  ? 468  TYR A CZ  1 
ATOM   3207  O OH  . TYR A 1 446 ? 5.822   -19.426 38.638  1.00 37.51  ? 468  TYR A OH  1 
ATOM   3208  N N   . HIS A 1 447 ? 4.880   -14.210 31.665  1.00 54.67  ? 469  HIS A N   1 
ATOM   3209  C CA  . HIS A 1 447 ? 5.077   -13.571 30.364  1.00 55.68  ? 469  HIS A CA  1 
ATOM   3210  C C   . HIS A 1 447 ? 4.775   -12.076 30.424  1.00 54.89  ? 469  HIS A C   1 
ATOM   3211  O O   . HIS A 1 447 ? 4.016   -11.622 31.281  1.00 53.68  ? 469  HIS A O   1 
ATOM   3212  C CB  . HIS A 1 447 ? 4.201   -14.236 29.298  1.00 56.23  ? 469  HIS A CB  1 
ATOM   3213  C CG  . HIS A 1 447 ? 2.741   -14.238 29.634  1.00 57.11  ? 469  HIS A CG  1 
ATOM   3214  N ND1 . HIS A 1 447 ? 2.050   -15.389 29.946  1.00 58.00  ? 469  HIS A ND1 1 
ATOM   3215  C CD2 . HIS A 1 447 ? 1.843   -13.228 29.717  1.00 58.10  ? 469  HIS A CD2 1 
ATOM   3216  C CE1 . HIS A 1 447 ? 0.788   -15.091 30.199  1.00 58.27  ? 469  HIS A CE1 1 
ATOM   3217  N NE2 . HIS A 1 447 ? 0.637   -13.785 30.070  1.00 60.53  ? 469  HIS A NE2 1 
ATOM   3218  N N   . PHE A 1 448 ? 5.372   -11.311 29.515  1.00 55.37  ? 470  PHE A N   1 
ATOM   3219  C CA  . PHE A 1 448 ? 5.053   -9.893  29.414  1.00 54.94  ? 470  PHE A CA  1 
ATOM   3220  C C   . PHE A 1 448 ? 3.647   -9.781  28.860  1.00 50.01  ? 470  PHE A C   1 
ATOM   3221  O O   . PHE A 1 448 ? 3.206   -10.658 28.126  1.00 51.45  ? 470  PHE A O   1 
ATOM   3222  C CB  . PHE A 1 448 ? 6.061   -9.147  28.523  1.00 59.34  ? 470  PHE A CB  1 
ATOM   3223  C CG  . PHE A 1 448 ? 6.012   -9.540  27.065  1.00 64.76  ? 470  PHE A CG  1 
ATOM   3224  C CD1 . PHE A 1 448 ? 4.972   -9.118  26.242  1.00 65.14  ? 470  PHE A CD1 1 
ATOM   3225  C CD2 . PHE A 1 448 ? 7.028   -10.302 26.506  1.00 67.05  ? 470  PHE A CD2 1 
ATOM   3226  C CE1 . PHE A 1 448 ? 4.930   -9.471  24.908  1.00 66.75  ? 470  PHE A CE1 1 
ATOM   3227  C CE2 . PHE A 1 448 ? 6.996   -10.655 25.162  1.00 66.73  ? 470  PHE A CE2 1 
ATOM   3228  C CZ  . PHE A 1 448 ? 5.948   -10.235 24.361  1.00 66.72  ? 470  PHE A CZ  1 
ATOM   3229  N N   . THR A 1 449 ? 2.939   -8.722  29.224  1.00 51.29  ? 471  THR A N   1 
ATOM   3230  C CA  . THR A 1 449 ? 1.565   -8.540  28.771  1.00 57.00  ? 471  THR A CA  1 
ATOM   3231  C C   . THR A 1 449 ? 1.408   -7.581  27.580  1.00 60.51  ? 471  THR A C   1 
ATOM   3232  O O   . THR A 1 449 ? 0.313   -7.444  27.039  1.00 63.39  ? 471  THR A O   1 
ATOM   3233  C CB  . THR A 1 449 ? 0.689   -8.051  29.930  1.00 60.23  ? 471  THR A CB  1 
ATOM   3234  O OG1 . THR A 1 449 ? 1.333   -6.939  30.565  1.00 62.95  ? 471  THR A OG1 1 
ATOM   3235  C CG2 . THR A 1 449 ? 0.504   -9.161  30.954  1.00 59.78  ? 471  THR A CG2 1 
ATOM   3236  N N   . ARG A 1 450 ? 2.496   -6.938  27.163  1.00 59.61  ? 472  ARG A N   1 
ATOM   3237  C CA  . ARG A 1 450 ? 2.431   -5.956  26.081  1.00 59.15  ? 472  ARG A CA  1 
ATOM   3238  C C   . ARG A 1 450 ? 1.999   -6.633  24.787  1.00 56.64  ? 472  ARG A C   1 
ATOM   3239  O O   . ARG A 1 450 ? 2.182   -7.839  24.626  1.00 58.13  ? 472  ARG A O   1 
ATOM   3240  C CB  . ARG A 1 450 ? 3.790   -5.298  25.863  1.00 60.87  ? 472  ARG A CB  1 
ATOM   3241  C CG  . ARG A 1 450 ? 4.665   -6.074  24.902  1.00 62.65  ? 472  ARG A CG  1 
ATOM   3242  C CD  . ARG A 1 450 ? 6.025   -5.444  24.706  1.00 64.20  ? 472  ARG A CD  1 
ATOM   3243  N NE  . ARG A 1 450 ? 6.885   -6.289  23.880  1.00 64.55  ? 472  ARG A NE  1 
ATOM   3244  C CZ  . ARG A 1 450 ? 8.012   -6.848  24.308  1.00 65.54  ? 472  ARG A CZ  1 
ATOM   3245  N NH1 . ARG A 1 450 ? 8.425   -6.644  25.556  1.00 62.33  ? 472  ARG A NH1 1 
ATOM   3246  N NH2 . ARG A 1 450 ? 8.734   -7.601  23.484  1.00 66.28  ? 472  ARG A NH2 1 
ATOM   3247  N N   . PRO A 1 451 ? 1.405   -5.863  23.866  1.00 52.00  ? 473  PRO A N   1 
ATOM   3248  C CA  . PRO A 1 451 ? 1.026   -6.426  22.565  1.00 47.44  ? 473  PRO A CA  1 
ATOM   3249  C C   . PRO A 1 451 ? 2.248   -6.992  21.844  1.00 40.54  ? 473  PRO A C   1 
ATOM   3250  O O   . PRO A 1 451 ? 3.330   -6.414  21.949  1.00 37.25  ? 473  PRO A O   1 
ATOM   3251  C CB  . PRO A 1 451 ? 0.473   -5.213  21.807  1.00 49.87  ? 473  PRO A CB  1 
ATOM   3252  C CG  . PRO A 1 451 ? 0.017   -4.275  22.868  1.00 50.67  ? 473  PRO A CG  1 
ATOM   3253  C CD  . PRO A 1 451 ? 0.958   -4.469  24.025  1.00 51.06  ? 473  PRO A CD  1 
ATOM   3254  N N   . LEU A 1 452 ? 2.075   -8.122  21.161  1.00 37.25  ? 474  LEU A N   1 
ATOM   3255  C CA  . LEU A 1 452 ? 3.147   -8.759  20.396  1.00 38.86  ? 474  LEU A CA  1 
ATOM   3256  C C   . LEU A 1 452 ? 3.638   -7.856  19.266  1.00 39.65  ? 474  LEU A C   1 
ATOM   3257  O O   . LEU A 1 452 ? 4.836   -7.777  18.978  1.00 41.38  ? 474  LEU A O   1 
ATOM   3258  C CB  . LEU A 1 452 ? 2.632   -10.070 19.801  1.00 41.15  ? 474  LEU A CB  1 
ATOM   3259  C CG  . LEU A 1 452 ? 2.204   -11.122 20.828  1.00 42.16  ? 474  LEU A CG  1 
ATOM   3260  C CD1 . LEU A 1 452 ? 1.542   -12.312 20.154  1.00 37.42  ? 474  LEU A CD1 1 
ATOM   3261  C CD2 . LEU A 1 452 ? 3.413   -11.567 21.651  1.00 39.65  ? 474  LEU A CD2 1 
ATOM   3262  N N   . ILE A 1 453 ? 2.686   -7.181  18.633  1.00 39.14  ? 475  ILE A N   1 
ATOM   3263  C CA  . ILE A 1 453 ? 2.939   -6.311  17.496  1.00 41.55  ? 475  ILE A CA  1 
ATOM   3264  C C   . ILE A 1 453 ? 2.639   -4.894  17.957  1.00 41.43  ? 475  ILE A C   1 
ATOM   3265  O O   . ILE A 1 453 ? 1.719   -4.672  18.743  1.00 38.69  ? 475  ILE A O   1 
ATOM   3266  C CB  . ILE A 1 453 ? 2.001   -6.670  16.319  1.00 45.52  ? 475  ILE A CB  1 
ATOM   3267  C CG1 . ILE A 1 453 ? 2.126   -8.153  15.973  1.00 47.01  ? 475  ILE A CG1 1 
ATOM   3268  C CG2 . ILE A 1 453 ? 2.298   -5.824  15.093  1.00 46.50  ? 475  ILE A CG2 1 
ATOM   3269  C CD1 . ILE A 1 453 ? 3.528   -8.565  15.609  1.00 41.44  ? 475  ILE A CD1 1 
ATOM   3270  N N   . LYS A 1 454 ? 3.428   -3.935  17.496  1.00 43.92  ? 476  LYS A N   1 
ATOM   3271  C CA  . LYS A 1 454 ? 3.142   -2.541  17.789  1.00 46.91  ? 476  LYS A CA  1 
ATOM   3272  C C   . LYS A 1 454 ? 1.748   -2.200  17.236  1.00 49.07  ? 476  LYS A C   1 
ATOM   3273  O O   . LYS A 1 454 ? 1.486   -2.379  16.039  1.00 49.27  ? 476  LYS A O   1 
ATOM   3274  C CB  . LYS A 1 454 ? 4.224   -1.656  17.176  1.00 49.99  ? 476  LYS A CB  1 
ATOM   3275  C CG  . LYS A 1 454 ? 4.132   -0.203  17.564  1.00 57.69  ? 476  LYS A CG  1 
ATOM   3276  C CD  . LYS A 1 454 ? 5.286   0.610   16.998  1.00 62.81  ? 476  LYS A CD  1 
ATOM   3277  C CE  . LYS A 1 454 ? 4.991   2.098   17.165  1.00 68.95  ? 476  LYS A CE  1 
ATOM   3278  N NZ  . LYS A 1 454 ? 5.960   3.002   16.474  1.00 70.56  ? 476  LYS A NZ  1 
ATOM   3279  N N   . PRO A 1 455 ? 0.841   -1.739  18.115  1.00 46.59  ? 477  PRO A N   1 
ATOM   3280  C CA  . PRO A 1 455 ? -0.553  -1.462  17.742  1.00 43.97  ? 477  PRO A CA  1 
ATOM   3281  C C   . PRO A 1 455 ? -0.683  -0.577  16.513  1.00 42.79  ? 477  PRO A C   1 
ATOM   3282  O O   . PRO A 1 455 ? -1.626  -0.771  15.738  1.00 40.10  ? 477  PRO A O   1 
ATOM   3283  C CB  . PRO A 1 455 ? -1.111  -0.747  18.977  1.00 44.76  ? 477  PRO A CB  1 
ATOM   3284  C CG  . PRO A 1 455 ? -0.300  -1.305  20.112  1.00 46.57  ? 477  PRO A CG  1 
ATOM   3285  C CD  . PRO A 1 455 ? 1.084   -1.527  19.556  1.00 44.73  ? 477  PRO A CD  1 
ATOM   3286  N N   . GLN A 1 456 ? 0.242   0.366   16.334  1.00 42.56  ? 478  GLN A N   1 
ATOM   3287  C CA  . GLN A 1 456 ? 0.175   1.276   15.190  1.00 44.77  ? 478  GLN A CA  1 
ATOM   3288  C C   . GLN A 1 456 ? 0.379   0.522   13.877  1.00 39.57  ? 478  GLN A C   1 
ATOM   3289  O O   . GLN A 1 456 ? -0.171  0.901   12.841  1.00 36.05  ? 478  GLN A O   1 
ATOM   3290  C CB  . GLN A 1 456 ? 1.188   2.422   15.306  1.00 44.36  ? 478  GLN A CB  1 
ATOM   3291  C CG  . GLN A 1 456 ? 0.891   3.434   16.408  1.00 43.65  ? 478  GLN A CG  1 
ATOM   3292  C CD  . GLN A 1 456 ? 1.556   3.075   17.734  1.00 41.88  ? 478  GLN A CD  1 
ATOM   3293  O OE1 . GLN A 1 456 ? 1.693   1.901   18.074  1.00 39.65  ? 478  GLN A OE1 1 
ATOM   3294  N NE2 . GLN A 1 456 ? 1.968   4.093   18.487  1.00 40.23  ? 478  GLN A NE2 1 
ATOM   3295  N N   . CYS A 1 457 ? 1.175   -0.540  13.932  1.00 36.65  ? 479  CYS A N   1 
ATOM   3296  C CA  . CYS A 1 457 ? 1.383   -1.401  12.776  1.00 37.93  ? 479  CYS A CA  1 
ATOM   3297  C C   . CYS A 1 457 ? 0.206   -2.351  12.561  1.00 41.05  ? 479  CYS A C   1 
ATOM   3298  O O   . CYS A 1 457 ? -0.292  -2.496  11.441  1.00 43.00  ? 479  CYS A O   1 
ATOM   3299  C CB  . CYS A 1 457 ? 2.662   -2.211  12.967  1.00 40.15  ? 479  CYS A CB  1 
ATOM   3300  S SG  . CYS A 1 457 ? 3.318   -2.996  11.481  1.00 37.31  ? 479  CYS A SG  1 
ATOM   3301  N N   . ALA A 1 458 ? -0.227  -2.995  13.644  1.00 41.09  ? 480  ALA A N   1 
ATOM   3302  C CA  . ALA A 1 458 ? -1.239  -4.045  13.586  1.00 42.54  ? 480  ALA A CA  1 
ATOM   3303  C C   . ALA A 1 458 ? -2.564  -3.511  13.077  1.00 41.47  ? 480  ALA A C   1 
ATOM   3304  O O   . ALA A 1 458 ? -3.336  -4.249  12.469  1.00 41.25  ? 480  ALA A O   1 
ATOM   3305  C CB  . ALA A 1 458 ? -1.426  -4.703  14.967  1.00 39.27  ? 480  ALA A CB  1 
ATOM   3306  N N   . ALA A 1 459 ? -2.802  -2.222  13.322  1.00 41.99  ? 481  ALA A N   1 
ATOM   3307  C CA  . ALA A 1 459 ? -4.059  -1.569  12.979  1.00 45.82  ? 481  ALA A CA  1 
ATOM   3308  C C   . ALA A 1 459 ? -4.273  -1.479  11.480  1.00 47.59  ? 481  ALA A C   1 
ATOM   3309  O O   . ALA A 1 459 ? -5.391  -1.220  11.022  1.00 47.56  ? 481  ALA A O   1 
ATOM   3310  C CB  . ALA A 1 459 ? -4.116  -0.174  13.593  1.00 49.01  ? 481  ALA A CB  1 
ATOM   3311  N N   . TYR A 1 460 ? -3.200  -1.669  10.719  1.00 46.49  ? 482  TYR A N   1 
ATOM   3312  C CA  . TYR A 1 460 ? -3.288  -1.600  9.263   1.00 43.88  ? 482  TYR A CA  1 
ATOM   3313  C C   . TYR A 1 460 ? -3.840  -2.894  8.665   1.00 43.42  ? 482  TYR A C   1 
ATOM   3314  O O   . TYR A 1 460 ? -4.406  -2.891  7.574   1.00 42.39  ? 482  TYR A O   1 
ATOM   3315  C CB  . TYR A 1 460 ? -1.929  -1.250  8.643   1.00 40.16  ? 482  TYR A CB  1 
ATOM   3316  C CG  . TYR A 1 460 ? -1.624  0.233   8.654   1.00 38.93  ? 482  TYR A CG  1 
ATOM   3317  C CD1 . TYR A 1 460 ? -2.294  1.105   7.794   1.00 39.45  ? 482  TYR A CD1 1 
ATOM   3318  C CD2 . TYR A 1 460 ? -0.668  0.766   9.514   1.00 32.68  ? 482  TYR A CD2 1 
ATOM   3319  C CE1 . TYR A 1 460 ? -2.022  2.464   7.792   1.00 39.78  ? 482  TYR A CE1 1 
ATOM   3320  C CE2 . TYR A 1 460 ? -0.392  2.128   9.523   1.00 33.64  ? 482  TYR A CE2 1 
ATOM   3321  C CZ  . TYR A 1 460 ? -1.068  2.971   8.658   1.00 39.79  ? 482  TYR A CZ  1 
ATOM   3322  O OH  . TYR A 1 460 ? -0.799  4.325   8.656   1.00 42.59  ? 482  TYR A OH  1 
ATOM   3323  N N   . GLY A 1 461 ? -3.672  -4.006  9.370   1.00 41.93  ? 483  GLY A N   1 
ATOM   3324  C CA  . GLY A 1 461 ? -4.116  -5.272  8.818   1.00 42.61  ? 483  GLY A CA  1 
ATOM   3325  C C   . GLY A 1 461 ? -3.308  -6.446  9.313   1.00 41.67  ? 483  GLY A C   1 
ATOM   3326  O O   . GLY A 1 461 ? -2.749  -6.415  10.415  1.00 38.88  ? 483  GLY A O   1 
ATOM   3327  N N   . LYS A 1 462 ? -3.274  -7.495  8.495   1.00 42.98  ? 484  LYS A N   1 
ATOM   3328  C CA  . LYS A 1 462 ? -2.545  -8.716  8.820   1.00 43.60  ? 484  LYS A CA  1 
ATOM   3329  C C   . LYS A 1 462 ? -1.069  -8.435  9.056   1.00 41.14  ? 484  LYS A C   1 
ATOM   3330  O O   . LYS A 1 462 ? -0.431  -7.705  8.294   1.00 38.49  ? 484  LYS A O   1 
ATOM   3331  C CB  . LYS A 1 462 ? -2.724  -9.760  7.717   1.00 42.66  ? 484  LYS A CB  1 
ATOM   3332  C CG  . LYS A 1 462 ? -4.179  -10.158 7.517   1.00 45.48  ? 484  LYS A CG  1 
ATOM   3333  C CD  . LYS A 1 462 ? -4.303  -11.373 6.620   1.00 45.88  ? 484  LYS A CD  1 
ATOM   3334  C CE  . LYS A 1 462 ? -5.721  -11.924 6.639   1.00 46.31  ? 484  LYS A CE  1 
ATOM   3335  N NZ  . LYS A 1 462 ? -5.933  -12.906 5.538   1.00 46.26  ? 484  LYS A NZ  1 
ATOM   3336  N N   . ALA A 1 463 ? -0.536  -9.027  10.120  1.00 40.34  ? 485  ALA A N   1 
ATOM   3337  C CA  . ALA A 1 463 ? 0.819   -8.740  10.548  1.00 37.88  ? 485  ALA A CA  1 
ATOM   3338  C C   . ALA A 1 463 ? 1.681   -9.983  10.519  1.00 38.49  ? 485  ALA A C   1 
ATOM   3339  O O   . ALA A 1 463 ? 1.275   -11.046 10.984  1.00 39.98  ? 485  ALA A O   1 
ATOM   3340  C CB  . ALA A 1 463 ? 0.818   -8.122  11.936  1.00 36.70  ? 485  ALA A CB  1 
ATOM   3341  N N   . LEU A 1 464 ? 2.866   -9.833  9.937   1.00 36.93  ? 486  LEU A N   1 
ATOM   3342  C CA  . LEU A 1 464 ? 3.895   -10.853 9.973   1.00 38.64  ? 486  LEU A CA  1 
ATOM   3343  C C   . LEU A 1 464 ? 5.164   -10.254 10.605  1.00 32.72  ? 486  LEU A C   1 
ATOM   3344  O O   . LEU A 1 464 ? 5.736   -9.286  10.088  1.00 29.16  ? 486  LEU A O   1 
ATOM   3345  C CB  . LEU A 1 464 ? 4.164   -11.356 8.558   1.00 42.42  ? 486  LEU A CB  1 
ATOM   3346  C CG  . LEU A 1 464 ? 5.367   -12.264 8.329   1.00 41.42  ? 486  LEU A CG  1 
ATOM   3347  C CD1 . LEU A 1 464 ? 5.255   -13.519 9.169   1.00 26.51  ? 486  LEU A CD1 1 
ATOM   3348  C CD2 . LEU A 1 464 ? 5.424   -12.600 6.856   1.00 42.71  ? 486  LEU A CD2 1 
ATOM   3349  N N   . ASP A 1 465 ? 5.572   -10.806 11.745  1.00 33.49  ? 487  ASP A N   1 
ATOM   3350  C CA  . ASP A 1 465 ? 6.730   -10.292 12.464  1.00 31.41  ? 487  ASP A CA  1 
ATOM   3351  C C   . ASP A 1 465 ? 7.862   -11.304 12.312  1.00 29.05  ? 487  ASP A C   1 
ATOM   3352  O O   . ASP A 1 465 ? 7.861   -12.377 12.919  1.00 25.69  ? 487  ASP A O   1 
ATOM   3353  C CB  . ASP A 1 465 ? 6.372   -10.075 13.943  1.00 32.16  ? 487  ASP A CB  1 
ATOM   3354  C CG  . ASP A 1 465 ? 7.473   -9.346  14.730  1.00 40.04  ? 487  ASP A CG  1 
ATOM   3355  O OD1 . ASP A 1 465 ? 8.673   -9.471  14.389  1.00 34.36  ? 487  ASP A OD1 1 
ATOM   3356  O OD2 . ASP A 1 465 ? 7.126   -8.640  15.704  1.00 44.63  ? 487  ASP A OD2 1 
ATOM   3357  N N   . LEU A 1 466 ? 8.809   -10.952 11.455  1.00 31.50  ? 488  LEU A N   1 
ATOM   3358  C CA  . LEU A 1 466 ? 10.001  -11.748 11.199  1.00 33.01  ? 488  LEU A CA  1 
ATOM   3359  C C   . LEU A 1 466 ? 11.250  -11.217 11.898  1.00 33.78  ? 488  LEU A C   1 
ATOM   3360  O O   . LEU A 1 466 ? 12.377  -11.610 11.560  1.00 34.15  ? 488  LEU A O   1 
ATOM   3361  C CB  . LEU A 1 466 ? 10.202  -11.981 9.704   1.00 31.47  ? 488  LEU A CB  1 
ATOM   3362  C CG  . LEU A 1 466 ? 9.214   -13.045 9.217   1.00 29.98  ? 488  LEU A CG  1 
ATOM   3363  C CD1 . LEU A 1 466 ? 9.001   -13.017 7.687   1.00 27.40  ? 488  LEU A CD1 1 
ATOM   3364  C CD2 . LEU A 1 466 ? 9.685   -14.410 9.677   1.00 27.04  ? 488  LEU A CD2 1 
ATOM   3365  N N   . SER A 1 467 ? 11.048  -10.259 12.799  1.00 29.93  ? 489  SER A N   1 
ATOM   3366  C CA  . SER A 1 467 ? 12.159  -9.617  13.497  1.00 26.72  ? 489  SER A CA  1 
ATOM   3367  C C   . SER A 1 467 ? 13.034  -10.589 14.275  1.00 25.12  ? 489  SER A C   1 
ATOM   3368  O O   . SER A 1 467 ? 12.597  -11.681 14.665  1.00 26.96  ? 489  SER A O   1 
ATOM   3369  C CB  . SER A 1 467 ? 11.683  -8.491  14.417  1.00 25.56  ? 489  SER A CB  1 
ATOM   3370  O OG  . SER A 1 467 ? 10.995  -8.988  15.552  1.00 29.20  ? 489  SER A OG  1 
ATOM   3371  N N   . LEU A 1 468 ? 14.291  -10.192 14.442  1.00 25.79  ? 490  LEU A N   1 
ATOM   3372  C CA  . LEU A 1 468 ? 15.271  -10.961 15.214  1.00 29.37  ? 490  LEU A CA  1 
ATOM   3373  C C   . LEU A 1 468 ? 15.464  -12.351 14.626  1.00 31.19  ? 490  LEU A C   1 
ATOM   3374  O O   . LEU A 1 468 ? 15.474  -13.356 15.339  1.00 33.71  ? 490  LEU A O   1 
ATOM   3375  C CB  . LEU A 1 468 ? 14.874  -11.001 16.691  1.00 30.73  ? 490  LEU A CB  1 
ATOM   3376  C CG  . LEU A 1 468 ? 14.930  -9.606  17.327  1.00 31.86  ? 490  LEU A CG  1 
ATOM   3377  C CD1 . LEU A 1 468 ? 14.148  -9.548  18.628  1.00 30.31  ? 490  LEU A CD1 1 
ATOM   3378  C CD2 . LEU A 1 468 ? 16.399  -9.166  17.558  1.00 23.68  ? 490  LEU A CD2 1 
ATOM   3379  N N   . ASN A 1 469 ? 15.601  -12.388 13.304  1.00 30.56  ? 491  ASN A N   1 
ATOM   3380  C CA  . ASN A 1 469 ? 15.920  -13.615 12.578  1.00 31.19  ? 491  ASN A CA  1 
ATOM   3381  C C   . ASN A 1 469 ? 17.175  -13.421 11.716  1.00 32.83  ? 491  ASN A C   1 
ATOM   3382  O O   . ASN A 1 469 ? 17.906  -12.458 11.887  1.00 29.79  ? 491  ASN A O   1 
ATOM   3383  C CB  . ASN A 1 469 ? 14.742  -14.077 11.707  1.00 31.91  ? 491  ASN A CB  1 
ATOM   3384  C CG  . ASN A 1 469 ? 13.755  -14.935 12.467  1.00 33.81  ? 491  ASN A CG  1 
ATOM   3385  O OD1 . ASN A 1 469 ? 13.997  -16.122 12.679  1.00 31.98  ? 491  ASN A OD1 1 
ATOM   3386  N ND2 . ASN A 1 469 ? 12.626  -14.339 12.878  1.00 29.12  ? 491  ASN A ND2 1 
ATOM   3387  N N   . SER A 1 470 ? 17.448  -14.405 10.865  1.00 33.85  ? 492  SER A N   1 
ATOM   3388  C CA  . SER A 1 470 ? 18.551  -14.409 9.905   1.00 33.18  ? 492  SER A CA  1 
ATOM   3389  C C   . SER A 1 470 ? 18.311  -14.134 8.406   1.00 37.06  ? 492  SER A C   1 
ATOM   3390  O O   . SER A 1 470 ? 19.090  -14.612 7.577   1.00 36.05  ? 492  SER A O   1 
ATOM   3391  C CB  . SER A 1 470 ? 19.510  -15.568 10.148  1.00 33.35  ? 492  SER A CB  1 
ATOM   3392  O OG  . SER A 1 470 ? 20.144  -15.339 11.390  1.00 38.98  ? 492  SER A OG  1 
ATOM   3393  N N   . ILE A 1 471 ? 17.213  -13.497 8.013   1.00 37.26  ? 493  ILE A N   1 
ATOM   3394  C CA  . ILE A 1 471 ? 17.025  -13.374 6.573   1.00 37.29  ? 493  ILE A CA  1 
ATOM   3395  C C   . ILE A 1 471 ? 17.852  -12.170 6.121   1.00 37.23  ? 493  ILE A C   1 
ATOM   3396  O O   . ILE A 1 471 ? 17.362  -11.040 6.027   1.00 36.00  ? 493  ILE A O   1 
ATOM   3397  C CB  . ILE A 1 471 ? 15.537  -13.079 6.300   1.00 35.63  ? 493  ILE A CB  1 
ATOM   3398  C CG1 . ILE A 1 471 ? 14.663  -14.097 7.040   1.00 36.23  ? 493  ILE A CG1 1 
ATOM   3399  C CG2 . ILE A 1 471 ? 15.225  -13.038 4.814   1.00 34.46  ? 493  ILE A CG2 1 
ATOM   3400  C CD1 . ILE A 1 471 ? 13.180  -13.824 6.912   1.00 36.00  ? 493  ILE A CD1 1 
ATOM   3401  N N   . PHE A 1 472 ? 19.077  -12.466 5.691   1.00 35.63  ? 494  PHE A N   1 
ATOM   3402  C CA  . PHE A 1 472 ? 20.087  -11.430 5.483   1.00 35.68  ? 494  PHE A CA  1 
ATOM   3403  C C   . PHE A 1 472 ? 20.059  -10.936 4.058   1.00 33.79  ? 494  PHE A C   1 
ATOM   3404  O O   . PHE A 1 472 ? 20.654  -9.896  3.737   1.00 35.50  ? 494  PHE A O   1 
ATOM   3405  C CB  . PHE A 1 472 ? 21.503  -11.943 5.826   1.00 31.87  ? 494  PHE A CB  1 
ATOM   3406  C CG  . PHE A 1 472 ? 21.911  -13.167 5.049   1.00 34.08  ? 494  PHE A CG  1 
ATOM   3407  C CD1 . PHE A 1 472 ? 22.340  -13.070 3.724   1.00 37.26  ? 494  PHE A CD1 1 
ATOM   3408  C CD2 . PHE A 1 472 ? 21.855  -14.419 5.636   1.00 33.64  ? 494  PHE A CD2 1 
ATOM   3409  C CE1 . PHE A 1 472 ? 22.701  -14.206 3.006   1.00 37.19  ? 494  PHE A CE1 1 
ATOM   3410  C CE2 . PHE A 1 472 ? 22.215  -15.558 4.924   1.00 35.59  ? 494  PHE A CE2 1 
ATOM   3411  C CZ  . PHE A 1 472 ? 22.645  -15.450 3.609   1.00 37.35  ? 494  PHE A CZ  1 
ATOM   3412  N N   . PHE A 1 473 ? 19.386  -11.712 3.215   1.00 32.73  ? 495  PHE A N   1 
ATOM   3413  C CA  . PHE A 1 473 ? 19.160  -11.373 1.812   1.00 36.92  ? 495  PHE A CA  1 
ATOM   3414  C C   . PHE A 1 473 ? 17.729  -11.785 1.466   1.00 38.75  ? 495  PHE A C   1 
ATOM   3415  O O   . PHE A 1 473 ? 17.367  -12.947 1.645   1.00 37.93  ? 495  PHE A O   1 
ATOM   3416  C CB  . PHE A 1 473 ? 20.157  -12.118 0.902   1.00 34.78  ? 495  PHE A CB  1 
ATOM   3417  C CG  . PHE A 1 473 ? 19.977  -11.836 -0.574  1.00 37.47  ? 495  PHE A CG  1 
ATOM   3418  C CD1 . PHE A 1 473 ? 20.506  -10.684 -1.147  1.00 36.85  ? 495  PHE A CD1 1 
ATOM   3419  C CD2 . PHE A 1 473 ? 19.303  -12.727 -1.390  1.00 39.25  ? 495  PHE A CD2 1 
ATOM   3420  C CE1 . PHE A 1 473 ? 20.350  -10.413 -2.507  1.00 37.05  ? 495  PHE A CE1 1 
ATOM   3421  C CE2 . PHE A 1 473 ? 19.139  -12.464 -2.764  1.00 42.90  ? 495  PHE A CE2 1 
ATOM   3422  C CZ  . PHE A 1 473 ? 19.658  -11.303 -3.319  1.00 39.37  ? 495  PHE A CZ  1 
ATOM   3423  N N   . ILE A 1 474 ? 16.916  -10.848 0.978   1.00 36.38  ? 496  ILE A N   1 
ATOM   3424  C CA  . ILE A 1 474 ? 15.562  -11.202 0.560   1.00 38.38  ? 496  ILE A CA  1 
ATOM   3425  C C   . ILE A 1 474 ? 15.579  -11.599 -0.905  1.00 41.08  ? 496  ILE A C   1 
ATOM   3426  O O   . ILE A 1 474 ? 15.890  -10.784 -1.766  1.00 38.59  ? 496  ILE A O   1 
ATOM   3427  C CB  . ILE A 1 474 ? 14.553  -10.047 0.758   1.00 36.22  ? 496  ILE A CB  1 
ATOM   3428  C CG1 . ILE A 1 474 ? 14.333  -9.776  2.244   1.00 33.66  ? 496  ILE A CG1 1 
ATOM   3429  C CG2 . ILE A 1 474 ? 13.217  -10.370 0.070   1.00 33.64  ? 496  ILE A CG2 1 
ATOM   3430  C CD1 . ILE A 1 474 ? 14.159  -8.307  2.569   1.00 30.75  ? 496  ILE A CD1 1 
ATOM   3431  N N   . GLY A 1 475 ? 15.252  -12.857 -1.172  1.00 44.69  ? 497  GLY A N   1 
ATOM   3432  C CA  . GLY A 1 475 ? 15.302  -13.392 -2.517  1.00 47.66  ? 497  GLY A CA  1 
ATOM   3433  C C   . GLY A 1 475 ? 14.006  -13.158 -3.258  1.00 50.12  ? 497  GLY A C   1 
ATOM   3434  O O   . GLY A 1 475 ? 13.043  -12.660 -2.680  1.00 56.30  ? 497  GLY A O   1 
ATOM   3435  N N   . PRO A 1 476 ? 13.971  -13.527 -4.543  1.00 48.14  ? 498  PRO A N   1 
ATOM   3436  C CA  . PRO A 1 476 ? 12.806  -13.269 -5.398  1.00 49.10  ? 498  PRO A CA  1 
ATOM   3437  C C   . PRO A 1 476 ? 11.543  -13.951 -4.875  1.00 49.31  ? 498  PRO A C   1 
ATOM   3438  O O   . PRO A 1 476 ? 10.446  -13.409 -5.010  1.00 51.80  ? 498  PRO A O   1 
ATOM   3439  C CB  . PRO A 1 476 ? 13.220  -13.881 -6.743  1.00 54.20  ? 498  PRO A CB  1 
ATOM   3440  C CG  . PRO A 1 476 ? 14.716  -13.934 -6.691  1.00 55.29  ? 498  PRO A CG  1 
ATOM   3441  C CD  . PRO A 1 476 ? 15.041  -14.232 -5.264  1.00 49.23  ? 498  PRO A CD  1 
ATOM   3442  N N   . ASN A 1 477 ? 11.702  -15.143 -4.310  1.00 50.38  ? 499  ASN A N   1 
ATOM   3443  C CA  . ASN A 1 477 ? 10.567  -15.936 -3.828  1.00 52.24  ? 499  ASN A CA  1 
ATOM   3444  C C   . ASN A 1 477 ? 10.292  -15.922 -2.320  1.00 49.69  ? 499  ASN A C   1 
ATOM   3445  O O   . ASN A 1 477 ? 9.400   -16.631 -1.856  1.00 50.21  ? 499  ASN A O   1 
ATOM   3446  C CB  . ASN A 1 477 ? 10.679  -17.369 -4.349  1.00 55.62  ? 499  ASN A CB  1 
ATOM   3447  C CG  . ASN A 1 477 ? 10.847  -17.418 -5.854  1.00 59.44  ? 499  ASN A CG  1 
ATOM   3448  O OD1 . ASN A 1 477 ? 10.073  -16.808 -6.594  1.00 61.34  ? 499  ASN A OD1 1 
ATOM   3449  N ND2 . ASN A 1 477 ? 11.874  -18.124 -6.315  1.00 60.87  ? 499  ASN A ND2 1 
ATOM   3450  N N   . GLN A 1 478 ? 11.069  -15.147 -1.564  1.00 49.62  ? 500  GLN A N   1 
ATOM   3451  C CA  . GLN A 1 478 ? 11.006  -15.164 -0.093  1.00 46.17  ? 500  GLN A CA  1 
ATOM   3452  C C   . GLN A 1 478 ? 9.590   -15.030 0.464   1.00 45.26  ? 500  GLN A C   1 
ATOM   3453  O O   . GLN A 1 478 ? 9.202   -15.746 1.378   1.00 44.44  ? 500  GLN A O   1 
ATOM   3454  C CB  . GLN A 1 478 ? 11.875  -14.049 0.502   1.00 42.90  ? 500  GLN A CB  1 
ATOM   3455  C CG  . GLN A 1 478 ? 11.802  -13.956 2.029   1.00 36.47  ? 500  GLN A CG  1 
ATOM   3456  C CD  . GLN A 1 478 ? 12.363  -15.193 2.692   1.00 36.76  ? 500  GLN A CD  1 
ATOM   3457  O OE1 . GLN A 1 478 ? 13.442  -15.667 2.333   1.00 34.54  ? 500  GLN A OE1 1 
ATOM   3458  N NE2 . GLN A 1 478 ? 11.623  -15.742 3.643   1.00 38.80  ? 500  GLN A NE2 1 
ATOM   3459  N N   . PHE A 1 479 ? 8.838   -14.089 -0.089  1.00 46.80  ? 501  PHE A N   1 
ATOM   3460  C CA  . PHE A 1 479 ? 7.480   -13.781 0.357   1.00 44.86  ? 501  PHE A CA  1 
ATOM   3461  C C   . PHE A 1 479 ? 6.323   -14.427 -0.435  1.00 47.65  ? 501  PHE A C   1 
ATOM   3462  O O   . PHE A 1 479 ? 5.169   -14.028 -0.292  1.00 50.57  ? 501  PHE A O   1 
ATOM   3463  C CB  . PHE A 1 479 ? 7.317   -12.272 0.588   1.00 41.83  ? 501  PHE A CB  1 
ATOM   3464  C CG  . PHE A 1 479 ? 8.305   -11.720 1.590   1.00 37.90  ? 501  PHE A CG  1 
ATOM   3465  C CD1 . PHE A 1 479 ? 8.352   -12.226 2.881   1.00 36.74  ? 501  PHE A CD1 1 
ATOM   3466  C CD2 . PHE A 1 479 ? 9.205   -10.730 1.233   1.00 38.55  ? 501  PHE A CD2 1 
ATOM   3467  C CE1 . PHE A 1 479 ? 9.257   -11.738 3.808   1.00 35.16  ? 501  PHE A CE1 1 
ATOM   3468  C CE2 . PHE A 1 479 ? 10.124  -10.234 2.154   1.00 38.33  ? 501  PHE A CE2 1 
ATOM   3469  C CZ  . PHE A 1 479 ? 10.150  -10.735 3.440   1.00 37.06  ? 501  PHE A CZ  1 
ATOM   3470  N N   . GLU A 1 480 ? 6.650   -15.374 -1.310  1.00 46.36  ? 502  GLU A N   1 
ATOM   3471  C CA  . GLU A 1 480 ? 5.644   -16.149 -2.045  1.00 51.14  ? 502  GLU A CA  1 
ATOM   3472  C C   . GLU A 1 480 ? 4.577   -16.786 -1.154  1.00 49.07  ? 502  GLU A C   1 
ATOM   3473  O O   . GLU A 1 480 ? 4.872   -17.254 -0.065  1.00 49.01  ? 502  GLU A O   1 
ATOM   3474  C CB  . GLU A 1 480 ? 6.329   -17.291 -2.796  1.00 58.56  ? 502  GLU A CB  1 
ATOM   3475  C CG  . GLU A 1 480 ? 6.433   -17.118 -4.295  1.00 67.32  ? 502  GLU A CG  1 
ATOM   3476  C CD  . GLU A 1 480 ? 6.692   -18.439 -5.002  1.00 73.08  ? 502  GLU A CD  1 
ATOM   3477  O OE1 . GLU A 1 480 ? 7.478   -19.256 -4.470  1.00 73.36  ? 502  GLU A OE1 1 
ATOM   3478  O OE2 . GLU A 1 480 ? 6.091   -18.666 -6.077  1.00 76.22  ? 502  GLU A OE2 1 
ATOM   3479  N N   . ASN A 1 481 ? 3.342   -16.809 -1.641  1.00 54.95  ? 503  ASN A N   1 
ATOM   3480  C CA  . ASN A 1 481 ? 2.255   -17.583 -1.030  1.00 57.04  ? 503  ASN A CA  1 
ATOM   3481  C C   . ASN A 1 481 ? 1.854   -17.149 0.369   1.00 54.97  ? 503  ASN A C   1 
ATOM   3482  O O   . ASN A 1 481 ? 1.266   -17.920 1.128   1.00 54.95  ? 503  ASN A O   1 
ATOM   3483  C CB  . ASN A 1 481 ? 2.583   -19.080 -1.046  1.00 58.22  ? 503  ASN A CB  1 
ATOM   3484  C CG  . ASN A 1 481 ? 2.545   -19.658 -2.442  1.00 58.95  ? 503  ASN A CG  1 
ATOM   3485  O OD1 . ASN A 1 481 ? 1.614   -19.393 -3.206  1.00 59.67  ? 503  ASN A OD1 1 
ATOM   3486  N ND2 . ASN A 1 481 ? 3.564   -20.438 -2.793  1.00 58.02  ? 503  ASN A ND2 1 
ATOM   3487  N N   . LEU A 1 482 ? 2.152   -15.899 0.689   1.00 52.13  ? 504  LEU A N   1 
ATOM   3488  C CA  . LEU A 1 482 ? 1.776   -15.316 1.959   1.00 49.48  ? 504  LEU A CA  1 
ATOM   3489  C C   . LEU A 1 482 ? 0.384   -14.721 1.819   1.00 52.14  ? 504  LEU A C   1 
ATOM   3490  O O   . LEU A 1 482 ? -0.072  -14.435 0.707   1.00 50.29  ? 504  LEU A O   1 
ATOM   3491  C CB  . LEU A 1 482 ? 2.775   -14.225 2.329   1.00 50.10  ? 504  LEU A CB  1 
ATOM   3492  C CG  . LEU A 1 482 ? 3.617   -14.378 3.596   1.00 53.47  ? 504  LEU A CG  1 
ATOM   3493  C CD1 . LEU A 1 482 ? 3.769   -15.823 4.017   1.00 55.32  ? 504  LEU A CD1 1 
ATOM   3494  C CD2 . LEU A 1 482 ? 4.975   -13.755 3.365   1.00 53.53  ? 504  LEU A CD2 1 
ATOM   3495  N N   . PRO A 1 483 ? -0.308  -14.526 2.947   1.00 54.74  ? 505  PRO A N   1 
ATOM   3496  C CA  . PRO A 1 483 ? -1.584  -13.806 2.888   1.00 54.26  ? 505  PRO A CA  1 
ATOM   3497  C C   . PRO A 1 483 ? -1.326  -12.356 2.503   1.00 53.02  ? 505  PRO A C   1 
ATOM   3498  O O   . PRO A 1 483 ? -0.185  -11.987 2.213   1.00 49.88  ? 505  PRO A O   1 
ATOM   3499  C CB  . PRO A 1 483 ? -2.096  -13.887 4.329   1.00 52.76  ? 505  PRO A CB  1 
ATOM   3500  C CG  . PRO A 1 483 ? -1.397  -15.086 4.913   1.00 52.45  ? 505  PRO A CG  1 
ATOM   3501  C CD  . PRO A 1 483 ? -0.039  -15.075 4.287   1.00 52.53  ? 505  PRO A CD  1 
ATOM   3502  N N   . ASP A 1 484 ? -2.350  -11.517 2.543   1.00 53.10  ? 506  ASP A N   1 
ATOM   3503  C CA  . ASP A 1 484 ? -2.137  -10.153 2.112   1.00 54.66  ? 506  ASP A CA  1 
ATOM   3504  C C   . ASP A 1 484 ? -1.642  -9.389  3.335   1.00 52.38  ? 506  ASP A C   1 
ATOM   3505  O O   . ASP A 1 484 ? -2.417  -9.030  4.223   1.00 57.08  ? 506  ASP A O   1 
ATOM   3506  C CB  . ASP A 1 484 ? -3.469  -9.579  1.631   1.00 58.43  ? 506  ASP A CB  1 
ATOM   3507  C CG  . ASP A 1 484 ? -3.372  -8.126  1.248   1.00 63.56  ? 506  ASP A CG  1 
ATOM   3508  O OD1 . ASP A 1 484 ? -2.319  -7.722  0.715   1.00 64.55  ? 506  ASP A OD1 1 
ATOM   3509  O OD2 . ASP A 1 484 ? -4.351  -7.385  1.481   1.00 67.48  ? 506  ASP A OD2 1 
ATOM   3510  N N   . ILE A 1 485 ? -0.346  -9.096  3.347   1.00 45.09  ? 507  ILE A N   1 
ATOM   3511  C CA  . ILE A 1 485 ? 0.310   -8.596  4.557   1.00 41.70  ? 507  ILE A CA  1 
ATOM   3512  C C   . ILE A 1 485 ? 0.317   -7.076  4.566   1.00 39.64  ? 507  ILE A C   1 
ATOM   3513  O O   . ILE A 1 485 ? 0.870   -6.443  3.662   1.00 41.94  ? 507  ILE A O   1 
ATOM   3514  C CB  . ILE A 1 485 ? 1.768   -9.101  4.673   1.00 42.53  ? 507  ILE A CB  1 
ATOM   3515  C CG1 . ILE A 1 485 ? 1.826   -10.631 4.738   1.00 42.21  ? 507  ILE A CG1 1 
ATOM   3516  C CG2 . ILE A 1 485 ? 2.450   -8.491  5.896   1.00 43.49  ? 507  ILE A CG2 1 
ATOM   3517  C CD1 . ILE A 1 485 ? 1.362   -11.224 6.063   1.00 41.17  ? 507  ILE A CD1 1 
ATOM   3518  N N   . ALA A 1 486 ? -0.372  -6.496  5.540   1.00 35.67  ? 508  ALA A N   1 
ATOM   3519  C CA  . ALA A 1 486 ? -0.357  -5.053  5.757   1.00 32.61  ? 508  ALA A CA  1 
ATOM   3520  C C   . ALA A 1 486 ? 0.807   -4.546  6.627   1.00 32.40  ? 508  ALA A C   1 
ATOM   3521  O O   . ALA A 1 486 ? 1.304   -3.443  6.422   1.00 32.49  ? 508  ALA A O   1 
ATOM   3522  C CB  . ALA A 1 486 ? -1.692  -4.591  6.308   1.00 33.32  ? 508  ALA A CB  1 
ATOM   3523  N N   . CYS A 1 487 ? 1.210   -5.347  7.611   1.00 32.70  ? 509  CYS A N   1 
ATOM   3524  C CA  . CYS A 1 487 ? 2.182   -4.923  8.622   1.00 32.30  ? 509  CYS A CA  1 
ATOM   3525  C C   . CYS A 1 487 ? 3.312   -5.930  8.673   1.00 36.62  ? 509  CYS A C   1 
ATOM   3526  O O   . CYS A 1 487 ? 3.084   -7.086  9.018   1.00 38.89  ? 509  CYS A O   1 
ATOM   3527  C CB  . CYS A 1 487 ? 1.513   -4.837  9.993   1.00 28.77  ? 509  CYS A CB  1 
ATOM   3528  S SG  . CYS A 1 487 ? 2.643   -4.905  11.439  1.00 35.63  ? 509  CYS A SG  1 
ATOM   3529  N N   . LEU A 1 488 ? 4.516   -5.488  8.311   1.00 35.01  ? 510  LEU A N   1 
ATOM   3530  C CA  . LEU A 1 488 ? 5.668   -6.375  8.144   1.00 33.45  ? 510  LEU A CA  1 
ATOM   3531  C C   . LEU A 1 488 ? 6.893   -5.910  8.949   1.00 33.44  ? 510  LEU A C   1 
ATOM   3532  O O   . LEU A 1 488 ? 7.365   -4.777  8.787   1.00 30.67  ? 510  LEU A O   1 
ATOM   3533  C CB  . LEU A 1 488 ? 6.049   -6.478  6.661   1.00 29.49  ? 510  LEU A CB  1 
ATOM   3534  C CG  . LEU A 1 488 ? 7.255   -7.375  6.346   1.00 30.14  ? 510  LEU A CG  1 
ATOM   3535  C CD1 . LEU A 1 488 ? 7.018   -8.795  6.845   1.00 30.32  ? 510  LEU A CD1 1 
ATOM   3536  C CD2 . LEU A 1 488 ? 7.537   -7.395  4.862   1.00 29.22  ? 510  LEU A CD2 1 
ATOM   3537  N N   . ASN A 1 489 ? 7.407   -6.787  9.806   1.00 30.10  ? 511  ASN A N   1 
ATOM   3538  C CA  . ASN A 1 489 ? 8.582   -6.473  10.614  1.00 26.06  ? 511  ASN A CA  1 
ATOM   3539  C C   . ASN A 1 489 ? 9.794   -7.303  10.169  1.00 25.94  ? 511  ASN A C   1 
ATOM   3540  O O   . ASN A 1 489 ? 9.823   -8.516  10.339  1.00 26.51  ? 511  ASN A O   1 
ATOM   3541  C CB  . ASN A 1 489 ? 8.288   -6.719  12.103  1.00 28.76  ? 511  ASN A CB  1 
ATOM   3542  C CG  . ASN A 1 489 ? 9.226   -5.952  13.031  1.00 30.02  ? 511  ASN A CG  1 
ATOM   3543  O OD1 . ASN A 1 489 ? 10.338  -5.569  12.651  1.00 28.91  ? 511  ASN A OD1 1 
ATOM   3544  N ND2 . ASN A 1 489 ? 8.771   -5.726  14.261  1.00 31.27  ? 511  ASN A ND2 1 
ATOM   3545  N N   . LEU A 1 490 ? 10.757  -6.642  9.534   1.00 29.52  ? 512  LEU A N   1 
ATOM   3546  C CA  . LEU A 1 490 ? 12.041  -7.256  9.176   1.00 33.29  ? 512  LEU A CA  1 
ATOM   3547  C C   . LEU A 1 490 ? 13.220  -6.881  10.096  1.00 32.60  ? 512  LEU A C   1 
ATOM   3548  O O   . LEU A 1 490 ? 14.380  -7.121  9.755   1.00 31.79  ? 512  LEU A O   1 
ATOM   3549  C CB  . LEU A 1 490 ? 12.353  -7.093  7.684   1.00 31.97  ? 512  LEU A CB  1 
ATOM   3550  C CG  . LEU A 1 490 ? 11.397  -7.906  6.804   1.00 31.95  ? 512  LEU A CG  1 
ATOM   3551  C CD1 . LEU A 1 490 ? 11.538  -7.533  5.335   1.00 33.78  ? 512  LEU A CD1 1 
ATOM   3552  C CD2 . LEU A 1 490 ? 11.650  -9.385  7.000   1.00 33.62  ? 512  LEU A CD2 1 
ATOM   3553  N N   . SER A 1 491 ? 12.916  -6.225  11.212  1.00 30.33  ? 513  SER A N   1 
ATOM   3554  C CA  . SER A 1 491 ? 13.939  -5.707  12.121  1.00 32.20  ? 513  SER A CA  1 
ATOM   3555  C C   . SER A 1 491 ? 15.017  -6.718  12.512  1.00 34.54  ? 513  SER A C   1 
ATOM   3556  O O   . SER A 1 491 ? 14.729  -7.892  12.736  1.00 35.69  ? 513  SER A O   1 
ATOM   3557  C CB  . SER A 1 491 ? 13.290  -5.151  13.400  1.00 33.98  ? 513  SER A CB  1 
ATOM   3558  O OG  . SER A 1 491 ? 14.254  -4.571  14.264  1.00 34.07  ? 513  SER A OG  1 
ATOM   3559  N N   . ALA A 1 492 ? 16.263  -6.244  12.564  1.00 34.75  ? 514  ALA A N   1 
ATOM   3560  C CA  . ALA A 1 492 ? 17.413  -7.030  13.053  1.00 29.49  ? 514  ALA A CA  1 
ATOM   3561  C C   . ALA A 1 492 ? 17.578  -8.403  12.396  1.00 31.26  ? 514  ALA A C   1 
ATOM   3562  O O   . ALA A 1 492 ? 17.613  -9.429  13.080  1.00 31.74  ? 514  ALA A O   1 
ATOM   3563  C CB  . ALA A 1 492 ? 17.370  -7.156  14.563  1.00 20.84  ? 514  ALA A CB  1 
ATOM   3564  N N   . ASN A 1 493 ? 17.588  -8.414  11.065  1.00 32.34  ? 515  ASN A N   1 
ATOM   3565  C CA  . ASN A 1 493 ? 17.876  -9.611  10.276  1.00 33.53  ? 515  ASN A CA  1 
ATOM   3566  C C   . ASN A 1 493 ? 19.275  -9.702  9.668   1.00 33.41  ? 515  ASN A C   1 
ATOM   3567  O O   . ASN A 1 493 ? 19.545  -10.590 8.855   1.00 29.68  ? 515  ASN A O   1 
ATOM   3568  C CB  . ASN A 1 493 ? 16.795  -9.847  9.219   1.00 35.75  ? 515  ASN A CB  1 
ATOM   3569  C CG  . ASN A 1 493 ? 15.586  -10.537 9.804   1.00 34.81  ? 515  ASN A CG  1 
ATOM   3570  O OD1 . ASN A 1 493 ? 15.534  -11.769 9.866   1.00 31.58  ? 515  ASN A OD1 1 
ATOM   3571  N ND2 . ASN A 1 493 ? 14.629  -9.748  10.286  1.00 31.37  ? 515  ASN A ND2 1 
ATOM   3572  N N   . SER A 1 494 ? 20.117  -8.733  10.004  1.00 32.19  ? 516  SER A N   1 
ATOM   3573  C CA  . SER A 1 494 ? 21.481  -8.660  9.490   1.00 37.05  ? 516  SER A CA  1 
ATOM   3574  C C   . SER A 1 494 ? 21.464  -8.454  7.987   1.00 34.51  ? 516  SER A C   1 
ATOM   3575  O O   . SER A 1 494 ? 22.347  -8.925  7.279   1.00 32.23  ? 516  SER A O   1 
ATOM   3576  C CB  . SER A 1 494 ? 22.283  -9.917  9.847   1.00 40.91  ? 516  SER A CB  1 
ATOM   3577  O OG  . SER A 1 494 ? 22.484  -10.014 11.245  1.00 43.41  ? 516  SER A OG  1 
ATOM   3578  N N   . ASN A 1 495 ? 20.463  -7.731  7.500   1.00 33.08  ? 517  ASN A N   1 
ATOM   3579  C CA  . ASN A 1 495 ? 20.314  -7.579  6.069   1.00 30.71  ? 517  ASN A CA  1 
ATOM   3580  C C   . ASN A 1 495 ? 21.268  -6.523  5.528   1.00 30.36  ? 517  ASN A C   1 
ATOM   3581  O O   . ASN A 1 495 ? 21.165  -5.350  5.882   1.00 29.14  ? 517  ASN A O   1 
ATOM   3582  C CB  . ASN A 1 495 ? 18.866  -7.226  5.731   1.00 30.05  ? 517  ASN A CB  1 
ATOM   3583  C CG  . ASN A 1 495 ? 18.592  -7.293  4.243   1.00 33.02  ? 517  ASN A CG  1 
ATOM   3584  O OD1 . ASN A 1 495 ? 19.318  -6.700  3.448   1.00 32.59  ? 517  ASN A OD1 1 
ATOM   3585  N ND2 . ASN A 1 495 ? 17.557  -8.038  3.854   1.00 32.12  ? 517  ASN A ND2 1 
ATOM   3586  N N   . ALA A 1 496 ? 22.201  -6.954  4.682   1.00 31.53  ? 518  ALA A N   1 
ATOM   3587  C CA  . ALA A 1 496 ? 23.158  -6.057  4.020   1.00 32.54  ? 518  ALA A CA  1 
ATOM   3588  C C   . ALA A 1 496 ? 22.840  -5.722  2.553   1.00 33.20  ? 518  ALA A C   1 
ATOM   3589  O O   . ALA A 1 496 ? 23.640  -5.074  1.871   1.00 30.24  ? 518  ALA A O   1 
ATOM   3590  C CB  . ALA A 1 496 ? 24.586  -6.596  4.151   1.00 26.10  ? 518  ALA A CB  1 
ATOM   3591  N N   . GLN A 1 497 ? 21.710  -6.209  2.052   1.00 33.07  ? 519  GLN A N   1 
ATOM   3592  C CA  . GLN A 1 497 ? 21.458  -6.173  0.616   1.00 32.93  ? 519  GLN A CA  1 
ATOM   3593  C C   . GLN A 1 497 ? 21.107  -4.788  0.071   1.00 36.13  ? 519  GLN A C   1 
ATOM   3594  O O   . GLN A 1 497 ? 20.755  -3.883  0.822   1.00 33.19  ? 519  GLN A O   1 
ATOM   3595  C CB  . GLN A 1 497 ? 20.389  -7.185  0.228   1.00 31.96  ? 519  GLN A CB  1 
ATOM   3596  C CG  . GLN A 1 497 ? 18.998  -6.599  0.104   1.00 31.77  ? 519  GLN A CG  1 
ATOM   3597  C CD  . GLN A 1 497 ? 17.990  -7.677  -0.141  1.00 35.53  ? 519  GLN A CD  1 
ATOM   3598  O OE1 . GLN A 1 497 ? 17.377  -8.188  0.797   1.00 32.76  ? 519  GLN A OE1 1 
ATOM   3599  N NE2 . GLN A 1 497 ? 17.822  -8.057  -1.406  1.00 41.13  ? 519  GLN A NE2 1 
ATOM   3600  N N   . VAL A 1 498 ? 21.226  -4.629  -1.244  1.00 39.07  ? 520  VAL A N   1 
ATOM   3601  C CA  . VAL A 1 498 ? 20.762  -3.415  -1.894  1.00 40.41  ? 520  VAL A CA  1 
ATOM   3602  C C   . VAL A 1 498 ? 19.330  -3.621  -2.394  1.00 39.24  ? 520  VAL A C   1 
ATOM   3603  O O   . VAL A 1 498 ? 19.097  -4.278  -3.418  1.00 34.46  ? 520  VAL A O   1 
ATOM   3604  C CB  . VAL A 1 498 ? 21.688  -3.054  -3.090  1.00 29.43  ? 520  VAL A CB  1 
ATOM   3605  C CG1 . VAL A 1 498 ? 21.140  -1.868  -3.860  1.00 26.90  ? 520  VAL A CG1 1 
ATOM   3606  C CG2 . VAL A 1 498 ? 23.105  -2.747  -2.589  1.00 33.08  ? 520  VAL A CG2 1 
ATOM   3607  N N   . LEU A 1 499 ? 18.370  -3.008  -1.708  1.00 39.24  ? 521  LEU A N   1 
ATOM   3608  C CA  . LEU A 1 499 ? 16.985  -3.163  -2.115  1.00 41.10  ? 521  LEU A CA  1 
ATOM   3609  C C   . LEU A 1 499 ? 16.808  -2.470  -3.462  1.00 44.32  ? 521  LEU A C   1 
ATOM   3610  O O   . LEU A 1 499 ? 17.185  -1.309  -3.624  1.00 43.26  ? 521  LEU A O   1 
ATOM   3611  C CB  . LEU A 1 499 ? 16.046  -2.599  -1.053  1.00 40.95  ? 521  LEU A CB  1 
ATOM   3612  C CG  . LEU A 1 499 ? 16.060  -3.399  0.258   1.00 40.79  ? 521  LEU A CG  1 
ATOM   3613  C CD1 . LEU A 1 499 ? 15.413  -2.599  1.366   1.00 43.61  ? 521  LEU A CD1 1 
ATOM   3614  C CD2 . LEU A 1 499 ? 15.361  -4.741  0.068   1.00 34.79  ? 521  LEU A CD2 1 
ATOM   3615  N N   . SER A 1 500 ? 16.352  -3.241  -4.449  1.00 46.30  ? 522  SER A N   1 
ATOM   3616  C CA  . SER A 1 500 ? 16.223  -2.783  -5.834  1.00 46.82  ? 522  SER A CA  1 
ATOM   3617  C C   . SER A 1 500 ? 14.810  -2.482  -6.371  1.00 52.17  ? 522  SER A C   1 
ATOM   3618  O O   . SER A 1 500 ? 14.661  -2.090  -7.534  1.00 53.53  ? 522  SER A O   1 
ATOM   3619  C CB  . SER A 1 500 ? 16.911  -3.775  -6.756  1.00 45.95  ? 522  SER A CB  1 
ATOM   3620  O OG  . SER A 1 500 ? 16.336  -5.053  -6.582  1.00 51.02  ? 522  SER A OG  1 
ATOM   3621  N N   . GLY A 1 501 ? 13.776  -2.702  -5.566  1.00 49.84  ? 523  GLY A N   1 
ATOM   3622  C CA  . GLY A 1 501 ? 12.421  -2.429  -6.019  1.00 47.56  ? 523  GLY A CA  1 
ATOM   3623  C C   . GLY A 1 501 ? 11.573  -3.644  -6.383  1.00 48.19  ? 523  GLY A C   1 
ATOM   3624  O O   . GLY A 1 501 ? 10.392  -3.495  -6.671  1.00 47.61  ? 523  GLY A O   1 
ATOM   3625  N N   . THR A 1 502 ? 12.180  -4.827  -6.455  1.00 46.83  ? 524  THR A N   1 
ATOM   3626  C CA  . THR A 1 502 ? 11.423  -6.058  -6.689  1.00 44.21  ? 524  THR A CA  1 
ATOM   3627  C C   . THR A 1 502 ? 11.200  -6.990  -5.490  1.00 42.01  ? 524  THR A C   1 
ATOM   3628  O O   . THR A 1 502 ? 10.444  -7.961  -5.592  1.00 41.98  ? 524  THR A O   1 
ATOM   3629  C CB  . THR A 1 502 ? 12.067  -6.876  -7.825  1.00 45.63  ? 524  THR A CB  1 
ATOM   3630  O OG1 . THR A 1 502 ? 13.372  -7.309  -7.421  1.00 48.60  ? 524  THR A OG1 1 
ATOM   3631  C CG2 . THR A 1 502 ? 12.176  -6.022  -9.096  1.00 42.89  ? 524  THR A CG2 1 
ATOM   3632  N N   . GLU A 1 503 ? 11.830  -6.700  -4.356  1.00 37.91  ? 525  GLU A N   1 
ATOM   3633  C CA  . GLU A 1 503 ? 11.931  -7.704  -3.298  1.00 39.72  ? 525  GLU A CA  1 
ATOM   3634  C C   . GLU A 1 503 ? 10.608  -7.952  -2.571  1.00 38.80  ? 525  GLU A C   1 
ATOM   3635  O O   . GLU A 1 503 ? 10.346  -9.046  -2.073  1.00 41.50  ? 525  GLU A O   1 
ATOM   3636  C CB  . GLU A 1 503 ? 13.042  -7.340  -2.305  1.00 38.71  ? 525  GLU A CB  1 
ATOM   3637  C CG  . GLU A 1 503 ? 14.444  -7.498  -2.860  1.00 37.17  ? 525  GLU A CG  1 
ATOM   3638  C CD  . GLU A 1 503 ? 14.883  -6.332  -3.730  1.00 40.54  ? 525  GLU A CD  1 
ATOM   3639  O OE1 . GLU A 1 503 ? 14.245  -5.260  -3.684  1.00 41.31  ? 525  GLU A OE1 1 
ATOM   3640  O OE2 . GLU A 1 503 ? 15.883  -6.488  -4.457  1.00 43.30  ? 525  GLU A OE2 1 
ATOM   3641  N N   . PHE A 1 504 ? 9.789   -6.916  -2.506  1.00 38.16  ? 526  PHE A N   1 
ATOM   3642  C CA  . PHE A 1 504 ? 8.482   -6.998  -1.874  1.00 40.56  ? 526  PHE A CA  1 
ATOM   3643  C C   . PHE A 1 504 ? 7.307   -7.234  -2.833  1.00 42.33  ? 526  PHE A C   1 
ATOM   3644  O O   . PHE A 1 504 ? 6.150   -7.126  -2.433  1.00 43.39  ? 526  PHE A O   1 
ATOM   3645  C CB  . PHE A 1 504 ? 8.266   -5.791  -0.965  1.00 42.15  ? 526  PHE A CB  1 
ATOM   3646  C CG  . PHE A 1 504 ? 9.211   -5.753  0.186   1.00 41.82  ? 526  PHE A CG  1 
ATOM   3647  C CD1 . PHE A 1 504 ? 8.913   -6.423  1.354   1.00 39.47  ? 526  PHE A CD1 1 
ATOM   3648  C CD2 . PHE A 1 504 ? 10.426  -5.087  0.086   1.00 42.81  ? 526  PHE A CD2 1 
ATOM   3649  C CE1 . PHE A 1 504 ? 9.798   -6.405  2.416   1.00 42.02  ? 526  PHE A CE1 1 
ATOM   3650  C CE2 . PHE A 1 504 ? 11.313  -5.069  1.139   1.00 39.03  ? 526  PHE A CE2 1 
ATOM   3651  C CZ  . PHE A 1 504 ? 11.002  -5.725  2.306   1.00 39.39  ? 526  PHE A CZ  1 
ATOM   3652  N N   . SER A 1 505 ? 7.609   -7.509  -4.099  1.00 41.95  ? 527  SER A N   1 
ATOM   3653  C CA  . SER A 1 505 ? 6.575   -7.619  -5.139  1.00 45.85  ? 527  SER A CA  1 
ATOM   3654  C C   . SER A 1 505 ? 5.381   -8.546  -4.818  1.00 49.25  ? 527  SER A C   1 
ATOM   3655  O O   . SER A 1 505 ? 4.260   -8.289  -5.257  1.00 53.01  ? 527  SER A O   1 
ATOM   3656  C CB  . SER A 1 505 ? 7.202   -8.015  -6.480  1.00 45.12  ? 527  SER A CB  1 
ATOM   3657  O OG  . SER A 1 505 ? 7.629   -9.366  -6.460  1.00 46.23  ? 527  SER A OG  1 
ATOM   3658  N N   . ALA A 1 506 ? 5.623   -9.614  -4.063  1.00 48.58  ? 528  ALA A N   1 
ATOM   3659  C CA  . ALA A 1 506 ? 4.572   -10.569 -3.691  1.00 48.72  ? 528  ALA A CA  1 
ATOM   3660  C C   . ALA A 1 506 ? 3.638   -10.079 -2.565  1.00 50.09  ? 528  ALA A C   1 
ATOM   3661  O O   . ALA A 1 506 ? 2.532   -10.592 -2.402  1.00 47.90  ? 528  ALA A O   1 
ATOM   3662  C CB  . ALA A 1 506 ? 5.191   -11.916 -3.319  1.00 46.93  ? 528  ALA A CB  1 
ATOM   3663  N N   . ILE A 1 507 ? 4.089   -9.104  -1.780  1.00 50.14  ? 529  ILE A N   1 
ATOM   3664  C CA  . ILE A 1 507 ? 3.219   -8.464  -0.789  1.00 46.31  ? 529  ILE A CA  1 
ATOM   3665  C C   . ILE A 1 507 ? 3.217   -6.942  -0.958  1.00 41.85  ? 529  ILE A C   1 
ATOM   3666  O O   . ILE A 1 507 ? 3.639   -6.206  -0.064  1.00 36.24  ? 529  ILE A O   1 
ATOM   3667  C CB  . ILE A 1 507 ? 3.591   -8.853  0.657   1.00 48.81  ? 529  ILE A CB  1 
ATOM   3668  C CG1 . ILE A 1 507 ? 5.111   -8.809  0.865   1.00 47.32  ? 529  ILE A CG1 1 
ATOM   3669  C CG2 . ILE A 1 507 ? 3.044   -10.240 0.995   1.00 48.01  ? 529  ILE A CG2 1 
ATOM   3670  C CD1 . ILE A 1 507 ? 5.528   -9.105  2.287   1.00 45.60  ? 529  ILE A CD1 1 
ATOM   3671  N N   . PRO A 1 508 ? 2.708   -6.470  -2.111  1.00 40.92  ? 530  PRO A N   1 
ATOM   3672  C CA  . PRO A 1 508 ? 2.764   -5.069  -2.542  1.00 42.45  ? 530  PRO A CA  1 
ATOM   3673  C C   . PRO A 1 508 ? 1.902   -4.159  -1.679  1.00 46.04  ? 530  PRO A C   1 
ATOM   3674  O O   . PRO A 1 508 ? 1.983   -2.936  -1.779  1.00 48.64  ? 530  PRO A O   1 
ATOM   3675  C CB  . PRO A 1 508 ? 2.228   -5.123  -3.972  1.00 43.04  ? 530  PRO A CB  1 
ATOM   3676  C CG  . PRO A 1 508 ? 1.248   -6.252  -3.953  1.00 44.89  ? 530  PRO A CG  1 
ATOM   3677  C CD  . PRO A 1 508 ? 1.813   -7.270  -2.970  1.00 43.52  ? 530  PRO A CD  1 
ATOM   3678  N N   . HIS A 1 509 ? 1.050   -4.762  -0.864  1.00 46.50  ? 531  HIS A N   1 
ATOM   3679  C CA  . HIS A 1 509 ? 0.139   -4.009  -0.014  1.00 46.34  ? 531  HIS A CA  1 
ATOM   3680  C C   . HIS A 1 509 ? 0.599   -3.721  1.425   1.00 41.39  ? 531  HIS A C   1 
ATOM   3681  O O   . HIS A 1 509 ? -0.207  -3.306  2.250   1.00 39.81  ? 531  HIS A O   1 
ATOM   3682  C CB  . HIS A 1 509 ? -1.261  -4.608  -0.065  1.00 50.76  ? 531  HIS A CB  1 
ATOM   3683  C CG  . HIS A 1 509 ? -1.809  -4.693  -1.456  1.00 59.42  ? 531  HIS A CG  1 
ATOM   3684  N ND1 . HIS A 1 509 ? -2.015  -3.578  -2.242  1.00 63.19  ? 531  HIS A ND1 1 
ATOM   3685  C CD2 . HIS A 1 509 ? -2.169  -5.758  -2.212  1.00 62.20  ? 531  HIS A CD2 1 
ATOM   3686  C CE1 . HIS A 1 509 ? -2.491  -3.952  -3.415  1.00 65.77  ? 531  HIS A CE1 1 
ATOM   3687  N NE2 . HIS A 1 509 ? -2.595  -5.269  -3.423  1.00 65.43  ? 531  HIS A NE2 1 
ATOM   3688  N N   . VAL A 1 510 ? 1.860   -3.995  1.747   1.00 41.83  ? 532  VAL A N   1 
ATOM   3689  C CA  . VAL A 1 510 ? 2.392   -3.589  3.053   1.00 38.00  ? 532  VAL A CA  1 
ATOM   3690  C C   . VAL A 1 510 ? 2.184   -2.083  3.266   1.00 36.75  ? 532  VAL A C   1 
ATOM   3691  O O   . VAL A 1 510 ? 2.620   -1.269  2.461   1.00 36.33  ? 532  VAL A O   1 
ATOM   3692  C CB  . VAL A 1 510 ? 3.909   -3.865  3.129   1.00 36.84  ? 532  VAL A CB  1 
ATOM   3693  C CG1 . VAL A 1 510 ? 4.549   -3.107  4.296   1.00 33.12  ? 532  VAL A CG1 1 
ATOM   3694  C CG2 . VAL A 1 510 ? 4.179   -5.370  3.206   1.00 36.02  ? 532  VAL A CG2 1 
ATOM   3695  N N   . LYS A 1 511 ? 1.469   -1.709  4.322   1.00 39.23  ? 533  LYS A N   1 
ATOM   3696  C CA  . LYS A 1 511 ? 1.328   -0.290  4.628   1.00 41.28  ? 533  LYS A CA  1 
ATOM   3697  C C   . LYS A 1 511 ? 2.282   0.227   5.726   1.00 39.79  ? 533  LYS A C   1 
ATOM   3698  O O   . LYS A 1 511 ? 2.473   1.436   5.870   1.00 40.45  ? 533  LYS A O   1 
ATOM   3699  C CB  . LYS A 1 511 ? -0.137  0.057   4.942   1.00 47.55  ? 533  LYS A CB  1 
ATOM   3700  C CG  . LYS A 1 511 ? -1.147  -0.548  3.934   1.00 51.14  ? 533  LYS A CG  1 
ATOM   3701  C CD  . LYS A 1 511 ? -2.295  0.405   3.590   1.00 57.03  ? 533  LYS A CD  1 
ATOM   3702  C CE  . LYS A 1 511 ? -3.521  -0.333  2.993   1.00 46.60  ? 533  LYS A CE  1 
ATOM   3703  N NZ  . LYS A 1 511 ? -4.325  -1.095  4.021   1.00 44.82  ? 533  LYS A NZ  1 
ATOM   3704  N N   . TYR A 1 512 ? 2.895   -0.684  6.478   1.00 34.85  ? 534  TYR A N   1 
ATOM   3705  C CA  . TYR A 1 512 ? 3.800   -0.302  7.565   1.00 34.45  ? 534  TYR A CA  1 
ATOM   3706  C C   . TYR A 1 512 ? 4.969   -1.259  7.478   1.00 32.15  ? 534  TYR A C   1 
ATOM   3707  O O   . TYR A 1 512 ? 4.810   -2.463  7.654   1.00 33.08  ? 534  TYR A O   1 
ATOM   3708  C CB  . TYR A 1 512 ? 3.092   -0.449  8.918   1.00 35.45  ? 534  TYR A CB  1 
ATOM   3709  C CG  . TYR A 1 512 ? 3.786   0.156   10.137  1.00 37.81  ? 534  TYR A CG  1 
ATOM   3710  C CD1 . TYR A 1 512 ? 5.082   -0.218  10.502  1.00 33.25  ? 534  TYR A CD1 1 
ATOM   3711  C CD2 . TYR A 1 512 ? 3.114   1.057   10.960  1.00 42.04  ? 534  TYR A CD2 1 
ATOM   3712  C CE1 . TYR A 1 512 ? 5.686   0.309   11.610  1.00 34.66  ? 534  TYR A CE1 1 
ATOM   3713  C CE2 . TYR A 1 512 ? 3.720   1.593   12.083  1.00 37.29  ? 534  TYR A CE2 1 
ATOM   3714  C CZ  . TYR A 1 512 ? 5.003   1.218   12.399  1.00 38.34  ? 534  TYR A CZ  1 
ATOM   3715  O OH  . TYR A 1 512 ? 5.609   1.740   13.522  1.00 39.31  ? 534  TYR A OH  1 
ATOM   3716  N N   . LEU A 1 513 ? 6.152   -0.733  7.224   1.00 33.09  ? 535  LEU A N   1 
ATOM   3717  C CA  . LEU A 1 513 ? 7.312   -1.595  7.092   1.00 31.42  ? 535  LEU A CA  1 
ATOM   3718  C C   . LEU A 1 513 ? 8.385   -1.228  8.120   1.00 28.71  ? 535  LEU A C   1 
ATOM   3719  O O   . LEU A 1 513 ? 8.841   -0.088  8.165   1.00 27.88  ? 535  LEU A O   1 
ATOM   3720  C CB  . LEU A 1 513 ? 7.871   -1.514  5.669   1.00 28.49  ? 535  LEU A CB  1 
ATOM   3721  C CG  . LEU A 1 513 ? 9.048   -2.445  5.391   1.00 30.92  ? 535  LEU A CG  1 
ATOM   3722  C CD1 . LEU A 1 513 ? 8.644   -3.891  5.616   1.00 25.90  ? 535  LEU A CD1 1 
ATOM   3723  C CD2 . LEU A 1 513 ? 9.549   -2.236  3.971   1.00 26.37  ? 535  LEU A CD2 1 
ATOM   3724  N N   . ASP A 1 514 ? 8.774   -2.195  8.949   1.00 28.21  ? 536  ASP A N   1 
ATOM   3725  C CA  . ASP A 1 514 ? 9.842   -1.980  9.919   1.00 28.31  ? 536  ASP A CA  1 
ATOM   3726  C C   . ASP A 1 514 ? 11.107  -2.700  9.426   1.00 28.29  ? 536  ASP A C   1 
ATOM   3727  O O   . ASP A 1 514 ? 11.173  -3.933  9.421   1.00 23.63  ? 536  ASP A O   1 
ATOM   3728  C CB  . ASP A 1 514 ? 9.392   -2.480  11.302  1.00 31.07  ? 536  ASP A CB  1 
ATOM   3729  C CG  . ASP A 1 514 ? 10.448  -2.260  12.409  1.00 34.18  ? 536  ASP A CG  1 
ATOM   3730  O OD1 . ASP A 1 514 ? 11.666  -2.387  12.149  1.00 36.78  ? 536  ASP A OD1 1 
ATOM   3731  O OD2 . ASP A 1 514 ? 10.045  -1.977  13.561  1.00 32.45  ? 536  ASP A OD2 1 
ATOM   3732  N N   . LEU A 1 515 ? 12.067  -1.902  8.951   1.00 30.94  ? 537  LEU A N   1 
ATOM   3733  C CA  . LEU A 1 515 ? 13.410  -2.337  8.519   1.00 30.94  ? 537  LEU A CA  1 
ATOM   3734  C C   . LEU A 1 515 ? 14.554  -2.082  9.519   1.00 31.61  ? 537  LEU A C   1 
ATOM   3735  O O   . LEU A 1 515 ? 15.731  -2.167  9.151   1.00 33.01  ? 537  LEU A O   1 
ATOM   3736  C CB  . LEU A 1 515 ? 13.759  -1.798  7.124   1.00 30.66  ? 537  LEU A CB  1 
ATOM   3737  C CG  . LEU A 1 515 ? 12.944  -2.424  5.987   1.00 33.96  ? 537  LEU A CG  1 
ATOM   3738  C CD1 . LEU A 1 515 ? 13.253  -1.782  4.642   1.00 33.10  ? 537  LEU A CD1 1 
ATOM   3739  C CD2 . LEU A 1 515 ? 13.162  -3.919  5.927   1.00 34.46  ? 537  LEU A CD2 1 
ATOM   3740  N N   . THR A 1 516 ? 14.212  -1.680  10.740  1.00 31.08  ? 538  THR A N   1 
ATOM   3741  C CA  . THR A 1 516 ? 15.203  -1.202  11.708  1.00 29.74  ? 538  THR A CA  1 
ATOM   3742  C C   . THR A 1 516 ? 16.285  -2.219  12.027  1.00 30.94  ? 538  THR A C   1 
ATOM   3743  O O   . THR A 1 516 ? 16.100  -3.425  11.853  1.00 30.76  ? 538  THR A O   1 
ATOM   3744  C CB  . THR A 1 516 ? 14.561  -0.733  13.054  1.00 29.53  ? 538  THR A CB  1 
ATOM   3745  O OG1 . THR A 1 516 ? 14.048  -1.860  13.783  1.00 29.71  ? 538  THR A OG1 1 
ATOM   3746  C CG2 . THR A 1 516 ? 13.439  0.250   12.795  1.00 27.51  ? 538  THR A CG2 1 
ATOM   3747  N N   . ASN A 1 517 ? 17.439  -1.712  12.442  1.00 32.25  ? 539  ASN A N   1 
ATOM   3748  C CA  . ASN A 1 517 ? 18.503  -2.558  12.960  1.00 31.07  ? 539  ASN A CA  1 
ATOM   3749  C C   . ASN A 1 517 ? 19.025  -3.579  11.953  1.00 29.74  ? 539  ASN A C   1 
ATOM   3750  O O   . ASN A 1 517 ? 19.246  -4.742  12.274  1.00 26.26  ? 539  ASN A O   1 
ATOM   3751  C CB  . ASN A 1 517 ? 18.061  -3.224  14.260  1.00 35.12  ? 539  ASN A CB  1 
ATOM   3752  C CG  . ASN A 1 517 ? 17.764  -2.209  15.346  1.00 40.31  ? 539  ASN A CG  1 
ATOM   3753  O OD1 . ASN A 1 517 ? 18.671  -1.706  16.004  1.00 43.17  ? 539  ASN A OD1 1 
ATOM   3754  N ND2 . ASN A 1 517 ? 16.493  -1.886  15.524  1.00 41.22  ? 539  ASN A ND2 1 
ATOM   3755  N N   . ASN A 1 518 ? 19.217  -3.121  10.726  1.00 27.37  ? 540  ASN A N   1 
ATOM   3756  C CA  . ASN A 1 518 ? 19.879  -3.930  9.726   1.00 32.61  ? 540  ASN A CA  1 
ATOM   3757  C C   . ASN A 1 518 ? 21.190  -3.307  9.257   1.00 34.15  ? 540  ASN A C   1 
ATOM   3758  O O   . ASN A 1 518 ? 21.714  -2.384  9.888   1.00 35.58  ? 540  ASN A O   1 
ATOM   3759  C CB  . ASN A 1 518 ? 18.943  -4.233  8.546   1.00 33.65  ? 540  ASN A CB  1 
ATOM   3760  C CG  . ASN A 1 518 ? 17.926  -5.305  8.882   1.00 30.40  ? 540  ASN A CG  1 
ATOM   3761  O OD1 . ASN A 1 518 ? 18.274  -6.482  9.005   1.00 32.65  ? 540  ASN A OD1 1 
ATOM   3762  N ND2 . ASN A 1 518 ? 16.662  -4.902  9.049   1.00 24.43  ? 540  ASN A ND2 1 
ATOM   3763  N N   . ARG A 1 519 ? 21.769  -3.924  8.234   1.00 34.17  ? 541  ARG A N   1 
ATOM   3764  C CA  . ARG A 1 519 ? 22.967  -3.454  7.530   1.00 36.42  ? 541  ARG A CA  1 
ATOM   3765  C C   . ARG A 1 519 ? 22.676  -2.775  6.190   1.00 33.97  ? 541  ARG A C   1 
ATOM   3766  O O   . ARG A 1 519 ? 23.560  -2.712  5.355   1.00 35.75  ? 541  ARG A O   1 
ATOM   3767  C CB  . ARG A 1 519 ? 23.969  -4.590  7.321   1.00 37.51  ? 541  ARG A CB  1 
ATOM   3768  C CG  . ARG A 1 519 ? 24.431  -5.220  8.595   1.00 40.67  ? 541  ARG A CG  1 
ATOM   3769  C CD  . ARG A 1 519 ? 25.214  -6.462  8.290   1.00 43.97  ? 541  ARG A CD  1 
ATOM   3770  N NE  . ARG A 1 519 ? 26.607  -6.306  8.673   1.00 52.10  ? 541  ARG A NE  1 
ATOM   3771  C CZ  . ARG A 1 519 ? 27.530  -7.245  8.507   1.00 57.70  ? 541  ARG A CZ  1 
ATOM   3772  N NH1 . ARG A 1 519 ? 27.203  -8.408  7.952   1.00 58.17  ? 541  ARG A NH1 1 
ATOM   3773  N NH2 . ARG A 1 519 ? 28.777  -7.019  8.896   1.00 59.54  ? 541  ARG A NH2 1 
ATOM   3774  N N   . LEU A 1 520 ? 21.426  -2.410  5.933   1.00 33.71  ? 542  LEU A N   1 
ATOM   3775  C CA  . LEU A 1 520 ? 20.973  -2.093  4.578   1.00 33.18  ? 542  LEU A CA  1 
ATOM   3776  C C   . LEU A 1 520 ? 21.891  -1.140  3.832   1.00 34.99  ? 542  LEU A C   1 
ATOM   3777  O O   . LEU A 1 520 ? 22.392  -0.163  4.393   1.00 31.55  ? 542  LEU A O   1 
ATOM   3778  C CB  . LEU A 1 520 ? 19.562  -1.514  4.609   1.00 31.70  ? 542  LEU A CB  1 
ATOM   3779  C CG  . LEU A 1 520 ? 18.522  -2.533  5.045   1.00 31.11  ? 542  LEU A CG  1 
ATOM   3780  C CD1 . LEU A 1 520 ? 17.226  -1.842  5.359   1.00 33.80  ? 542  LEU A CD1 1 
ATOM   3781  C CD2 . LEU A 1 520 ? 18.342  -3.571  3.947   1.00 28.36  ? 542  LEU A CD2 1 
ATOM   3782  N N   . ASP A 1 521 ? 22.135  -1.465  2.567   1.00 32.43  ? 543  ASP A N   1 
ATOM   3783  C CA  . ASP A 1 521 ? 23.011  -0.660  1.729   1.00 33.74  ? 543  ASP A CA  1 
ATOM   3784  C C   . ASP A 1 521 ? 22.118  0.031   0.713   1.00 37.82  ? 543  ASP A C   1 
ATOM   3785  O O   . ASP A 1 521 ? 21.684  -0.594  -0.263  1.00 38.80  ? 543  ASP A O   1 
ATOM   3786  C CB  . ASP A 1 521 ? 23.987  -1.609  1.027   1.00 32.56  ? 543  ASP A CB  1 
ATOM   3787  C CG  . ASP A 1 521 ? 24.881  -0.920  0.006   1.00 34.52  ? 543  ASP A CG  1 
ATOM   3788  O OD1 . ASP A 1 521 ? 24.890  0.322   -0.113  1.00 38.00  ? 543  ASP A OD1 1 
ATOM   3789  O OD2 . ASP A 1 521 ? 25.613  -1.652  -0.677  1.00 33.69  ? 543  ASP A OD2 1 
ATOM   3790  N N   . PHE A 1 522 ? 21.875  1.326   0.881   1.00 34.93  ? 544  PHE A N   1 
ATOM   3791  C CA  . PHE A 1 522 ? 20.935  1.926   -0.044  1.00 34.46  ? 544  PHE A CA  1 
ATOM   3792  C C   . PHE A 1 522 ? 21.730  2.449   -1.218  1.00 34.64  ? 544  PHE A C   1 
ATOM   3793  O O   . PHE A 1 522 ? 22.152  3.593   -1.241  1.00 33.50  ? 544  PHE A O   1 
ATOM   3794  C CB  . PHE A 1 522 ? 20.234  3.096   0.646   1.00 33.80  ? 544  PHE A CB  1 
ATOM   3795  C CG  . PHE A 1 522 ? 19.409  2.689   1.838   1.00 34.55  ? 544  PHE A CG  1 
ATOM   3796  C CD1 . PHE A 1 522 ? 18.123  2.189   1.666   1.00 36.50  ? 544  PHE A CD1 1 
ATOM   3797  C CD2 . PHE A 1 522 ? 19.915  2.797   3.122   1.00 33.54  ? 544  PHE A CD2 1 
ATOM   3798  C CE1 . PHE A 1 522 ? 17.353  1.806   2.764   1.00 36.18  ? 544  PHE A CE1 1 
ATOM   3799  C CE2 . PHE A 1 522 ? 19.156  2.409   4.225   1.00 32.88  ? 544  PHE A CE2 1 
ATOM   3800  C CZ  . PHE A 1 522 ? 17.867  1.917   4.042   1.00 32.86  ? 544  PHE A CZ  1 
ATOM   3801  N N   . ASP A 1 523 ? 21.857  1.580   -2.213  1.00 39.21  ? 545  ASP A N   1 
ATOM   3802  C CA  . ASP A 1 523 ? 22.548  1.830   -3.476  1.00 42.49  ? 545  ASP A CA  1 
ATOM   3803  C C   . ASP A 1 523 ? 21.630  1.947   -4.699  1.00 41.17  ? 545  ASP A C   1 
ATOM   3804  O O   . ASP A 1 523 ? 22.112  1.966   -5.817  1.00 45.11  ? 545  ASP A O   1 
ATOM   3805  C CB  . ASP A 1 523 ? 23.661  0.794   -3.704  1.00 45.10  ? 545  ASP A CB  1 
ATOM   3806  C CG  . ASP A 1 523 ? 24.794  1.335   -4.555  1.00 48.10  ? 545  ASP A CG  1 
ATOM   3807  O OD1 . ASP A 1 523 ? 24.902  2.573   -4.666  1.00 48.54  ? 545  ASP A OD1 1 
ATOM   3808  O OD2 . ASP A 1 523 ? 25.575  0.527   -5.104  1.00 48.93  ? 545  ASP A OD2 1 
ATOM   3809  N N   . ASN A 1 524 ? 20.317  1.929   -4.498  1.00 39.43  ? 546  ASN A N   1 
ATOM   3810  C CA  . ASN A 1 524 ? 19.395  1.906   -5.633  1.00 40.53  ? 546  ASN A CA  1 
ATOM   3811  C C   . ASN A 1 524 ? 18.222  2.865   -5.484  1.00 41.28  ? 546  ASN A C   1 
ATOM   3812  O O   . ASN A 1 524 ? 17.487  2.814   -4.493  1.00 42.14  ? 546  ASN A O   1 
ATOM   3813  C CB  . ASN A 1 524 ? 18.869  0.487   -5.861  1.00 44.80  ? 546  ASN A CB  1 
ATOM   3814  C CG  . ASN A 1 524 ? 18.297  0.291   -7.253  1.00 52.28  ? 546  ASN A CG  1 
ATOM   3815  O OD1 . ASN A 1 524 ? 17.179  0.720   -7.549  1.00 52.69  ? 546  ASN A OD1 1 
ATOM   3816  N ND2 . ASN A 1 524 ? 19.069  -0.364  -8.119  1.00 57.38  ? 546  ASN A ND2 1 
ATOM   3817  N N   . ALA A 1 525 ? 18.034  3.718   -6.488  1.00 38.82  ? 547  ALA A N   1 
ATOM   3818  C CA  . ALA A 1 525 ? 16.973  4.727   -6.473  1.00 40.52  ? 547  ALA A CA  1 
ATOM   3819  C C   . ALA A 1 525 ? 15.535  4.176   -6.527  1.00 40.47  ? 547  ALA A C   1 
ATOM   3820  O O   . ALA A 1 525 ? 14.581  4.895   -6.214  1.00 41.77  ? 547  ALA A O   1 
ATOM   3821  C CB  . ALA A 1 525 ? 17.189  5.737   -7.609  1.00 43.06  ? 547  ALA A CB  1 
ATOM   3822  N N   . SER A 1 526 ? 15.375  2.917   -6.925  1.00 36.09  ? 548  SER A N   1 
ATOM   3823  C CA  . SER A 1 526 ? 14.046  2.314   -7.018  1.00 39.35  ? 548  SER A CA  1 
ATOM   3824  C C   . SER A 1 526 ? 13.634  1.476   -5.797  1.00 41.93  ? 548  SER A C   1 
ATOM   3825  O O   . SER A 1 526 ? 12.552  0.876   -5.796  1.00 44.26  ? 548  SER A O   1 
ATOM   3826  C CB  . SER A 1 526 ? 13.954  1.449   -8.273  1.00 43.32  ? 548  SER A CB  1 
ATOM   3827  O OG  . SER A 1 526 ? 14.361  2.184   -9.414  1.00 47.86  ? 548  SER A OG  1 
ATOM   3828  N N   . ALA A 1 527 ? 14.492  1.427   -4.781  1.00 36.94  ? 549  ALA A N   1 
ATOM   3829  C CA  . ALA A 1 527 ? 14.276  0.587   -3.595  1.00 37.17  ? 549  ALA A CA  1 
ATOM   3830  C C   . ALA A 1 527 ? 12.904  0.797   -2.971  1.00 38.81  ? 549  ALA A C   1 
ATOM   3831  O O   . ALA A 1 527 ? 12.466  1.934   -2.809  1.00 44.03  ? 549  ALA A O   1 
ATOM   3832  C CB  . ALA A 1 527 ? 15.340  0.871   -2.571  1.00 36.61  ? 549  ALA A CB  1 
ATOM   3833  N N   . LEU A 1 528 ? 12.217  -0.301  -2.659  1.00 33.68  ? 550  LEU A N   1 
ATOM   3834  C CA  . LEU A 1 528 ? 10.942  -0.250  -1.938  1.00 34.05  ? 550  LEU A CA  1 
ATOM   3835  C C   . LEU A 1 528 ? 9.773   0.357   -2.721  1.00 36.46  ? 550  LEU A C   1 
ATOM   3836  O O   . LEU A 1 528 ? 8.647   0.373   -2.224  1.00 37.75  ? 550  LEU A O   1 
ATOM   3837  C CB  . LEU A 1 528 ? 11.088  0.456   -0.567  1.00 32.03  ? 550  LEU A CB  1 
ATOM   3838  C CG  . LEU A 1 528 ? 12.075  -0.151  0.436   1.00 28.67  ? 550  LEU A CG  1 
ATOM   3839  C CD1 . LEU A 1 528 ? 12.080  0.644   1.744   1.00 31.64  ? 550  LEU A CD1 1 
ATOM   3840  C CD2 . LEU A 1 528 ? 11.739  -1.598  0.716   1.00 26.99  ? 550  LEU A CD2 1 
ATOM   3841  N N   . THR A 1 529 ? 10.018  0.843   -3.936  1.00 36.17  ? 551  THR A N   1 
ATOM   3842  C CA  . THR A 1 529 ? 8.950   1.502   -4.690  1.00 36.16  ? 551  THR A CA  1 
ATOM   3843  C C   . THR A 1 529 ? 7.817   0.568   -5.127  1.00 40.22  ? 551  THR A C   1 
ATOM   3844  O O   . THR A 1 529 ? 6.756   1.036   -5.524  1.00 40.78  ? 551  THR A O   1 
ATOM   3845  C CB  . THR A 1 529 ? 9.469   2.339   -5.903  1.00 42.63  ? 551  THR A CB  1 
ATOM   3846  O OG1 . THR A 1 529 ? 10.180  1.509   -6.832  1.00 39.95  ? 551  THR A OG1 1 
ATOM   3847  C CG2 . THR A 1 529 ? 10.370  3.473   -5.429  1.00 43.59  ? 551  THR A CG2 1 
ATOM   3848  N N   . GLU A 1 530 ? 8.025   -0.745  -5.038  1.00 41.56  ? 552  GLU A N   1 
ATOM   3849  C CA  . GLU A 1 530 ? 6.942   -1.681  -5.350  1.00 39.89  ? 552  GLU A CA  1 
ATOM   3850  C C   . GLU A 1 530 ? 5.774   -1.578  -4.358  1.00 42.34  ? 552  GLU A C   1 
ATOM   3851  O O   . GLU A 1 530 ? 4.657   -1.969  -4.693  1.00 42.87  ? 552  GLU A O   1 
ATOM   3852  C CB  . GLU A 1 530 ? 7.443   -3.125  -5.421  1.00 38.32  ? 552  GLU A CB  1 
ATOM   3853  C CG  . GLU A 1 530 ? 7.910   -3.711  -4.074  1.00 37.25  ? 552  GLU A CG  1 
ATOM   3854  C CD  . GLU A 1 530 ? 9.375   -3.420  -3.778  1.00 38.24  ? 552  GLU A CD  1 
ATOM   3855  O OE1 . GLU A 1 530 ? 9.844   -2.320  -4.140  1.00 38.13  ? 552  GLU A OE1 1 
ATOM   3856  O OE2 . GLU A 1 530 ? 10.055  -4.296  -3.187  1.00 42.01  ? 552  GLU A OE2 1 
ATOM   3857  N N   . LEU A 1 531 ? 6.014   -1.038  -3.157  1.00 42.57  ? 553  LEU A N   1 
ATOM   3858  C CA  . LEU A 1 531 ? 4.927   -0.925  -2.180  1.00 43.19  ? 553  LEU A CA  1 
ATOM   3859  C C   . LEU A 1 531 ? 4.250   0.442   -2.311  1.00 44.33  ? 553  LEU A C   1 
ATOM   3860  O O   . LEU A 1 531 ? 4.648   1.404   -1.657  1.00 43.57  ? 553  LEU A O   1 
ATOM   3861  C CB  . LEU A 1 531 ? 5.515   -1.036  -0.761  1.00 41.23  ? 553  LEU A CB  1 
ATOM   3862  C CG  . LEU A 1 531 ? 6.412   -2.233  -0.430  1.00 38.59  ? 553  LEU A CG  1 
ATOM   3863  C CD1 . LEU A 1 531 ? 7.015   -2.147  0.984   1.00 36.03  ? 553  LEU A CD1 1 
ATOM   3864  C CD2 . LEU A 1 531 ? 5.631   -3.514  -0.589  1.00 38.39  ? 553  LEU A CD2 1 
ATOM   3865  N N   . SER A 1 532 ? 3.137   0.485   -3.038  1.00 45.06  ? 554  SER A N   1 
ATOM   3866  C CA  . SER A 1 532 ? 2.581   1.763   -3.468  1.00 45.81  ? 554  SER A CA  1 
ATOM   3867  C C   . SER A 1 532 ? 1.602   2.311   -2.450  1.00 45.44  ? 554  SER A C   1 
ATOM   3868  O O   . SER A 1 532 ? 1.230   3.477   -2.493  1.00 48.51  ? 554  SER A O   1 
ATOM   3869  C CB  . SER A 1 532 ? 1.893   1.615   -4.824  1.00 52.45  ? 554  SER A CB  1 
ATOM   3870  O OG  . SER A 1 532 ? 0.591   1.097   -4.651  1.00 60.76  ? 554  SER A OG  1 
ATOM   3871  N N   . ASP A 1 533 ? 1.182   1.449   -1.538  1.00 45.49  ? 555  ASP A N   1 
ATOM   3872  C CA  . ASP A 1 533 ? 0.335   1.857   -0.436  1.00 47.27  ? 555  ASP A CA  1 
ATOM   3873  C C   . ASP A 1 533 ? 1.157   2.178   0.829   1.00 46.89  ? 555  ASP A C   1 
ATOM   3874  O O   . ASP A 1 533 ? 0.580   2.381   1.899   1.00 46.77  ? 555  ASP A O   1 
ATOM   3875  C CB  . ASP A 1 533 ? -0.740  0.794   -0.153  1.00 48.65  ? 555  ASP A CB  1 
ATOM   3876  C CG  . ASP A 1 533 ? -1.612  0.487   -1.383  1.00 52.47  ? 555  ASP A CG  1 
ATOM   3877  O OD1 . ASP A 1 533 ? -1.591  1.269   -2.360  1.00 51.57  ? 555  ASP A OD1 1 
ATOM   3878  O OD2 . ASP A 1 533 ? -2.324  -0.541  -1.373  1.00 55.08  ? 555  ASP A OD2 1 
ATOM   3879  N N   . LEU A 1 534 ? 2.489   2.197   0.727   1.00 42.77  ? 556  LEU A N   1 
ATOM   3880  C CA  . LEU A 1 534 ? 3.302   2.337   1.943   1.00 40.85  ? 556  LEU A CA  1 
ATOM   3881  C C   . LEU A 1 534 ? 2.997   3.647   2.658   1.00 41.90  ? 556  LEU A C   1 
ATOM   3882  O O   . LEU A 1 534 ? 3.103   4.734   2.072   1.00 38.97  ? 556  LEU A O   1 
ATOM   3883  C CB  . LEU A 1 534 ? 4.794   2.277   1.619   1.00 30.95  ? 556  LEU A CB  1 
ATOM   3884  C CG  . LEU A 1 534 ? 5.690   2.204   2.867   1.00 35.04  ? 556  LEU A CG  1 
ATOM   3885  C CD1 . LEU A 1 534 ? 5.320   0.996   3.729   1.00 33.17  ? 556  LEU A CD1 1 
ATOM   3886  C CD2 . LEU A 1 534 ? 7.143   2.153   2.483   1.00 34.35  ? 556  LEU A CD2 1 
ATOM   3887  N N   . GLU A 1 535 ? 2.521   3.527   3.895   1.00 39.97  ? 557  GLU A N   1 
ATOM   3888  C CA  . GLU A 1 535 ? 2.298   4.688   4.763   1.00 43.48  ? 557  GLU A CA  1 
ATOM   3889  C C   . GLU A 1 535 ? 3.418   5.027   5.743   1.00 40.14  ? 557  GLU A C   1 
ATOM   3890  O O   . GLU A 1 535 ? 3.734   6.184   5.971   1.00 43.42  ? 557  GLU A O   1 
ATOM   3891  C CB  . GLU A 1 535 ? 0.924   4.627   5.436   1.00 45.60  ? 557  GLU A CB  1 
ATOM   3892  C CG  . GLU A 1 535 ? -0.205  4.603   4.415   1.00 50.49  ? 557  GLU A CG  1 
ATOM   3893  C CD  . GLU A 1 535 ? -1.553  4.890   5.030   1.00 55.75  ? 557  GLU A CD  1 
ATOM   3894  O OE1 . GLU A 1 535 ? -1.597  5.493   6.117   1.00 60.03  ? 557  GLU A OE1 1 
ATOM   3895  O OE2 . GLU A 1 535 ? -2.569  4.512   4.427   1.00 57.66  ? 557  GLU A OE2 1 
ATOM   3896  N N   . VAL A 1 536 ? 3.965   3.984   6.351   1.00 35.65  ? 558  VAL A N   1 
ATOM   3897  C CA  . VAL A 1 536 ? 4.910   4.110   7.441   1.00 36.51  ? 558  VAL A CA  1 
ATOM   3898  C C   . VAL A 1 536 ? 6.136   3.269   7.142   1.00 36.07  ? 558  VAL A C   1 
ATOM   3899  O O   . VAL A 1 536 ? 6.028   2.063   6.900   1.00 38.19  ? 558  VAL A O   1 
ATOM   3900  C CB  . VAL A 1 536 ? 4.287   3.629   8.770   1.00 34.47  ? 558  VAL A CB  1 
ATOM   3901  C CG1 . VAL A 1 536 ? 5.311   3.714   9.897   1.00 31.57  ? 558  VAL A CG1 1 
ATOM   3902  C CG2 . VAL A 1 536 ? 3.035   4.450   9.100   1.00 31.41  ? 558  VAL A CG2 1 
ATOM   3903  N N   . LEU A 1 537 ? 7.300   3.912   7.148   1.00 37.07  ? 559  LEU A N   1 
ATOM   3904  C CA  . LEU A 1 537 ? 8.560   3.224   6.887   1.00 37.04  ? 559  LEU A CA  1 
ATOM   3905  C C   . LEU A 1 537 ? 9.593   3.552   7.958   1.00 32.64  ? 559  LEU A C   1 
ATOM   3906  O O   . LEU A 1 537 ? 9.904   4.717   8.181   1.00 33.47  ? 559  LEU A O   1 
ATOM   3907  C CB  . LEU A 1 537 ? 9.087   3.601   5.502   1.00 38.49  ? 559  LEU A CB  1 
ATOM   3908  C CG  . LEU A 1 537 ? 10.440  2.992   5.124   1.00 37.62  ? 559  LEU A CG  1 
ATOM   3909  C CD1 . LEU A 1 537 ? 10.396  1.442   5.109   1.00 29.51  ? 559  LEU A CD1 1 
ATOM   3910  C CD2 . LEU A 1 537 ? 10.894  3.551   3.788   1.00 33.41  ? 559  LEU A CD2 1 
ATOM   3911  N N   . ASP A 1 538 ? 10.114  2.526   8.627   1.00 32.00  ? 560  ASP A N   1 
ATOM   3912  C CA  . ASP A 1 538 ? 11.094  2.736   9.694   1.00 32.05  ? 560  ASP A CA  1 
ATOM   3913  C C   . ASP A 1 538 ? 12.470  2.189   9.312   1.00 30.62  ? 560  ASP A C   1 
ATOM   3914  O O   . ASP A 1 538 ? 12.669  0.985   9.225   1.00 32.83  ? 560  ASP A O   1 
ATOM   3915  C CB  . ASP A 1 538 ? 10.615  2.106   11.010  1.00 36.03  ? 560  ASP A CB  1 
ATOM   3916  C CG  . ASP A 1 538 ? 11.328  2.683   12.230  1.00 40.44  ? 560  ASP A CG  1 
ATOM   3917  O OD1 . ASP A 1 538 ? 12.433  3.243   12.057  1.00 39.91  ? 560  ASP A OD1 1 
ATOM   3918  O OD2 . ASP A 1 538 ? 10.799  2.558   13.364  1.00 41.23  ? 560  ASP A OD2 1 
ATOM   3919  N N   . LEU A 1 539 ? 13.394  3.106   9.042   1.00 35.59  ? 561  LEU A N   1 
ATOM   3920  C CA  . LEU A 1 539 ? 14.778  2.800   8.681   1.00 33.52  ? 561  LEU A CA  1 
ATOM   3921  C C   . LEU A 1 539 ? 15.805  2.948   9.819   1.00 32.85  ? 561  LEU A C   1 
ATOM   3922  O O   . LEU A 1 539 ? 17.014  2.935   9.563   1.00 29.90  ? 561  LEU A O   1 
ATOM   3923  C CB  . LEU A 1 539 ? 15.199  3.582   7.429   1.00 31.63  ? 561  LEU A CB  1 
ATOM   3924  C CG  . LEU A 1 539 ? 14.298  3.374   6.199   1.00 33.14  ? 561  LEU A CG  1 
ATOM   3925  C CD1 . LEU A 1 539 ? 14.801  4.137   4.982   1.00 29.00  ? 561  LEU A CD1 1 
ATOM   3926  C CD2 . LEU A 1 539 ? 14.141  1.906   5.850   1.00 36.37  ? 561  LEU A CD2 1 
ATOM   3927  N N   . SER A 1 540 ? 15.334  3.162   11.047  1.00 32.61  ? 562  SER A N   1 
ATOM   3928  C CA  . SER A 1 540 ? 16.241  3.434   12.168  1.00 33.20  ? 562  SER A CA  1 
ATOM   3929  C C   . SER A 1 540 ? 17.364  2.394   12.283  1.00 32.62  ? 562  SER A C   1 
ATOM   3930  O O   . SER A 1 540 ? 17.166  1.215   11.986  1.00 32.97  ? 562  SER A O   1 
ATOM   3931  C CB  . SER A 1 540 ? 15.476  3.513   13.494  1.00 30.81  ? 562  SER A CB  1 
ATOM   3932  O OG  . SER A 1 540 ? 14.474  4.518   13.473  1.00 29.09  ? 562  SER A OG  1 
ATOM   3933  N N   . TYR A 1 541 ? 18.554  2.849   12.666  1.00 31.43  ? 563  TYR A N   1 
ATOM   3934  C CA  . TYR A 1 541 ? 19.657  1.938   12.978  1.00 34.19  ? 563  TYR A CA  1 
ATOM   3935  C C   . TYR A 1 541 ? 20.109  1.089   11.786  1.00 27.14  ? 563  TYR A C   1 
ATOM   3936  O O   . TYR A 1 541 ? 20.307  -0.116  11.910  1.00 27.38  ? 563  TYR A O   1 
ATOM   3937  C CB  . TYR A 1 541 ? 19.277  1.036   14.155  1.00 37.40  ? 563  TYR A CB  1 
ATOM   3938  C CG  . TYR A 1 541 ? 19.021  1.803   15.431  1.00 43.21  ? 563  TYR A CG  1 
ATOM   3939  C CD1 . TYR A 1 541 ? 20.074  2.237   16.218  1.00 44.58  ? 563  TYR A CD1 1 
ATOM   3940  C CD2 . TYR A 1 541 ? 17.727  2.082   15.854  1.00 44.49  ? 563  TYR A CD2 1 
ATOM   3941  C CE1 . TYR A 1 541 ? 19.850  2.936   17.380  1.00 45.58  ? 563  TYR A CE1 1 
ATOM   3942  C CE2 . TYR A 1 541 ? 17.494  2.785   17.022  1.00 45.57  ? 563  TYR A CE2 1 
ATOM   3943  C CZ  . TYR A 1 541 ? 18.563  3.205   17.777  1.00 45.84  ? 563  TYR A CZ  1 
ATOM   3944  O OH  . TYR A 1 541 ? 18.356  3.906   18.934  1.00 48.62  ? 563  TYR A OH  1 
ATOM   3945  N N   . ASN A 1 542 ? 20.167  1.717   10.619  1.00 25.56  ? 564  ASN A N   1 
ATOM   3946  C CA  . ASN A 1 542 ? 20.839  1.180   9.431   1.00 33.62  ? 564  ASN A CA  1 
ATOM   3947  C C   . ASN A 1 542 ? 22.224  1.760   9.128   1.00 41.61  ? 564  ASN A C   1 
ATOM   3948  O O   . ASN A 1 542 ? 22.671  1.755   7.978   1.00 46.29  ? 564  ASN A O   1 
ATOM   3949  C CB  . ASN A 1 542 ? 19.915  1.117   8.221   1.00 34.34  ? 564  ASN A CB  1 
ATOM   3950  C CG  . ASN A 1 542 ? 18.976  -0.047  8.318   1.00 32.76  ? 564  ASN A CG  1 
ATOM   3951  O OD1 . ASN A 1 542 ? 19.346  -1.185  8.008   1.00 32.36  ? 564  ASN A OD1 1 
ATOM   3952  N ND2 . ASN A 1 542 ? 17.770  0.206   8.820   1.00 32.27  ? 564  ASN A ND2 1 
ATOM   3953  N N   . SER A 1 543 ? 22.832  2.372   10.137  1.00 39.75  ? 565  SER A N   1 
ATOM   3954  C CA  . SER A 1 543 ? 24.022  3.192   9.957   1.00 40.60  ? 565  SER A CA  1 
ATOM   3955  C C   . SER A 1 543 ? 25.209  2.540   9.215   1.00 37.12  ? 565  SER A C   1 
ATOM   3956  O O   . SER A 1 543 ? 26.096  3.251   8.745   1.00 37.61  ? 565  SER A O   1 
ATOM   3957  C CB  . SER A 1 543 ? 24.483  3.708   11.324  1.00 34.66  ? 565  SER A CB  1 
ATOM   3958  O OG  . SER A 1 543 ? 24.940  2.624   12.110  1.00 33.88  ? 565  SER A OG  1 
ATOM   3959  N N   . HIS A 1 544 ? 25.208  1.214   9.088   1.00 32.81  ? 566  HIS A N   1 
ATOM   3960  C CA  . HIS A 1 544 ? 26.401  0.461   8.680   1.00 33.15  ? 566  HIS A CA  1 
ATOM   3961  C C   . HIS A 1 544 ? 27.099  1.069   7.462   1.00 35.51  ? 566  HIS A C   1 
ATOM   3962  O O   . HIS A 1 544 ? 28.287  1.411   7.516   1.00 36.08  ? 566  HIS A O   1 
ATOM   3963  C CB  . HIS A 1 544 ? 26.016  -1.000  8.388   1.00 30.36  ? 566  HIS A CB  1 
ATOM   3964  C CG  . HIS A 1 544 ? 27.177  -1.895  8.073   1.00 33.26  ? 566  HIS A CG  1 
ATOM   3965  N ND1 . HIS A 1 544 ? 27.596  -2.901  8.924   1.00 35.62  ? 566  HIS A ND1 1 
ATOM   3966  C CD2 . HIS A 1 544 ? 28.002  -1.944  7.000   1.00 33.95  ? 566  HIS A CD2 1 
ATOM   3967  C CE1 . HIS A 1 544 ? 28.635  -3.521  8.392   1.00 33.64  ? 566  HIS A CE1 1 
ATOM   3968  N NE2 . HIS A 1 544 ? 28.902  -2.959  7.226   1.00 34.76  ? 566  HIS A NE2 1 
ATOM   3969  N N   . TYR A 1 545 ? 26.347  1.231   6.381   1.00 31.32  ? 567  TYR A N   1 
ATOM   3970  C CA  . TYR A 1 545 ? 26.874  1.803   5.154   1.00 29.26  ? 567  TYR A CA  1 
ATOM   3971  C C   . TYR A 1 545 ? 26.900  3.319   5.106   1.00 31.17  ? 567  TYR A C   1 
ATOM   3972  O O   . TYR A 1 545 ? 27.797  3.896   4.504   1.00 29.03  ? 567  TYR A O   1 
ATOM   3973  C CB  . TYR A 1 545 ? 26.181  1.190   3.936   1.00 29.86  ? 567  TYR A CB  1 
ATOM   3974  C CG  . TYR A 1 545 ? 26.686  -0.211  3.735   1.00 31.52  ? 567  TYR A CG  1 
ATOM   3975  C CD1 . TYR A 1 545 ? 27.966  -0.431  3.240   1.00 29.66  ? 567  TYR A CD1 1 
ATOM   3976  C CD2 . TYR A 1 545 ? 25.916  -1.312  4.086   1.00 33.12  ? 567  TYR A CD2 1 
ATOM   3977  C CE1 . TYR A 1 545 ? 28.453  -1.702  3.062   1.00 33.07  ? 567  TYR A CE1 1 
ATOM   3978  C CE2 . TYR A 1 545 ? 26.400  -2.601  3.910   1.00 34.80  ? 567  TYR A CE2 1 
ATOM   3979  C CZ  . TYR A 1 545 ? 27.675  -2.784  3.403   1.00 33.27  ? 567  TYR A CZ  1 
ATOM   3980  O OH  . TYR A 1 545 ? 28.174  -4.047  3.227   1.00 30.91  ? 567  TYR A OH  1 
ATOM   3981  N N   . PHE A 1 546 ? 25.924  3.960   5.745   1.00 34.11  ? 568  PHE A N   1 
ATOM   3982  C CA  . PHE A 1 546 ? 25.888  5.417   5.797   1.00 36.82  ? 568  PHE A CA  1 
ATOM   3983  C C   . PHE A 1 546 ? 27.175  6.013   6.372   1.00 40.32  ? 568  PHE A C   1 
ATOM   3984  O O   . PHE A 1 546 ? 27.565  7.122   6.009   1.00 44.29  ? 568  PHE A O   1 
ATOM   3985  C CB  . PHE A 1 546 ? 24.679  5.920   6.594   1.00 35.48  ? 568  PHE A CB  1 
ATOM   3986  C CG  . PHE A 1 546 ? 23.386  5.923   5.807   1.00 34.36  ? 568  PHE A CG  1 
ATOM   3987  C CD1 . PHE A 1 546 ? 23.270  6.673   4.645   1.00 30.02  ? 568  PHE A CD1 1 
ATOM   3988  C CD2 . PHE A 1 546 ? 22.288  5.196   6.243   1.00 30.90  ? 568  PHE A CD2 1 
ATOM   3989  C CE1 . PHE A 1 546 ? 22.089  6.679   3.928   1.00 31.43  ? 568  PHE A CE1 1 
ATOM   3990  C CE2 . PHE A 1 546 ? 21.101  5.203   5.523   1.00 32.87  ? 568  PHE A CE2 1 
ATOM   3991  C CZ  . PHE A 1 546 ? 21.003  5.940   4.370   1.00 30.89  ? 568  PHE A CZ  1 
ATOM   3992  N N   . ARG A 1 547 ? 27.848  5.281   7.253   1.00 38.41  ? 569  ARG A N   1 
ATOM   3993  C CA  . ARG A 1 547 ? 29.031  5.842   7.888   1.00 40.39  ? 569  ARG A CA  1 
ATOM   3994  C C   . ARG A 1 547 ? 30.292  5.776   7.014   1.00 39.27  ? 569  ARG A C   1 
ATOM   3995  O O   . ARG A 1 547 ? 31.275  6.453   7.295   1.00 37.21  ? 569  ARG A O   1 
ATOM   3996  C CB  . ARG A 1 547 ? 29.262  5.259   9.290   1.00 43.65  ? 569  ARG A CB  1 
ATOM   3997  C CG  . ARG A 1 547 ? 29.455  3.766   9.363   1.00 50.81  ? 569  ARG A CG  1 
ATOM   3998  C CD  . ARG A 1 547 ? 29.567  3.298   10.816  1.00 56.50  ? 569  ARG A CD  1 
ATOM   3999  N NE  . ARG A 1 547 ? 28.353  3.555   11.589  1.00 61.72  ? 569  ARG A NE  1 
ATOM   4000  C CZ  . ARG A 1 547 ? 28.335  4.107   12.800  1.00 63.40  ? 569  ARG A CZ  1 
ATOM   4001  N NH1 . ARG A 1 547 ? 29.470  4.471   13.381  1.00 66.14  ? 569  ARG A NH1 1 
ATOM   4002  N NH2 . ARG A 1 547 ? 27.182  4.303   13.429  1.00 62.16  ? 569  ARG A NH2 1 
ATOM   4003  N N   . ILE A 1 548 ? 30.255  4.997   5.937   1.00 37.29  ? 570  ILE A N   1 
ATOM   4004  C CA  . ILE A 1 548 ? 31.419  4.916   5.059   1.00 38.41  ? 570  ILE A CA  1 
ATOM   4005  C C   . ILE A 1 548 ? 31.318  5.971   3.972   1.00 36.36  ? 570  ILE A C   1 
ATOM   4006  O O   . ILE A 1 548 ? 30.454  5.891   3.100   1.00 38.41  ? 570  ILE A O   1 
ATOM   4007  C CB  . ILE A 1 548 ? 31.545  3.540   4.384   1.00 38.45  ? 570  ILE A CB  1 
ATOM   4008  C CG1 . ILE A 1 548 ? 31.379  2.419   5.412   1.00 37.29  ? 570  ILE A CG1 1 
ATOM   4009  C CG2 . ILE A 1 548 ? 32.889  3.426   3.685   1.00 35.90  ? 570  ILE A CG2 1 
ATOM   4010  C CD1 . ILE A 1 548 ? 31.257  1.052   4.780   1.00 37.48  ? 570  ILE A CD1 1 
ATOM   4011  N N   . ALA A 1 549 ? 32.211  6.951   4.019   1.00 35.41  ? 571  ALA A N   1 
ATOM   4012  C CA  . ALA A 1 549 ? 32.146  8.083   3.099   1.00 39.10  ? 571  ALA A CA  1 
ATOM   4013  C C   . ALA A 1 549 ? 32.298  7.648   1.635   1.00 36.33  ? 571  ALA A C   1 
ATOM   4014  O O   . ALA A 1 549 ? 31.624  8.174   0.747   1.00 34.21  ? 571  ALA A O   1 
ATOM   4015  C CB  . ALA A 1 549 ? 33.206  9.125   3.472   1.00 39.01  ? 571  ALA A CB  1 
ATOM   4016  N N   . GLY A 1 550 ? 33.154  6.655   1.404   1.00 34.37  ? 572  GLY A N   1 
ATOM   4017  C CA  . GLY A 1 550 ? 33.518  6.238   0.058   1.00 31.53  ? 572  GLY A CA  1 
ATOM   4018  C C   . GLY A 1 550 ? 32.563  5.311   -0.677  1.00 35.97  ? 572  GLY A C   1 
ATOM   4019  O O   . GLY A 1 550 ? 32.786  5.032   -1.856  1.00 34.62  ? 572  GLY A O   1 
ATOM   4020  N N   . VAL A 1 551 ? 31.518  4.813   -0.006  1.00 37.49  ? 573  VAL A N   1 
ATOM   4021  C CA  . VAL A 1 551 ? 30.478  4.041   -0.708  1.00 33.39  ? 573  VAL A CA  1 
ATOM   4022  C C   . VAL A 1 551 ? 29.315  4.948   -1.105  1.00 35.93  ? 573  VAL A C   1 
ATOM   4023  O O   . VAL A 1 551 ? 29.005  5.909   -0.408  1.00 35.36  ? 573  VAL A O   1 
ATOM   4024  C CB  . VAL A 1 551 ? 29.947  2.806   0.095   1.00 31.83  ? 573  VAL A CB  1 
ATOM   4025  C CG1 . VAL A 1 551 ? 31.094  1.952   0.616   1.00 28.75  ? 573  VAL A CG1 1 
ATOM   4026  C CG2 . VAL A 1 551 ? 29.011  3.224   1.229   1.00 32.71  ? 573  VAL A CG2 1 
ATOM   4027  N N   . THR A 1 552 ? 28.694  4.675   -2.248  1.00 37.82  ? 574  THR A N   1 
ATOM   4028  C CA  . THR A 1 552 ? 27.552  5.476   -2.673  1.00 37.78  ? 574  THR A CA  1 
ATOM   4029  C C   . THR A 1 552 ? 26.338  5.272   -1.744  1.00 39.58  ? 574  THR A C   1 
ATOM   4030  O O   . THR A 1 552 ? 26.170  4.189   -1.171  1.00 35.70  ? 574  THR A O   1 
ATOM   4031  C CB  . THR A 1 552 ? 27.178  5.174   -4.134  1.00 35.20  ? 574  THR A CB  1 
ATOM   4032  O OG1 . THR A 1 552 ? 27.097  3.758   -4.322  1.00 32.98  ? 574  THR A OG1 1 
ATOM   4033  C CG2 . THR A 1 552 ? 28.242  5.735   -5.083  1.00 34.55  ? 574  THR A CG2 1 
ATOM   4034  N N   . HIS A 1 553 ? 25.521  6.321   -1.593  1.00 37.60  ? 575  HIS A N   1 
ATOM   4035  C CA  . HIS A 1 553 ? 24.282  6.274   -0.810  1.00 35.81  ? 575  HIS A CA  1 
ATOM   4036  C C   . HIS A 1 553 ? 23.140  6.978   -1.540  1.00 38.08  ? 575  HIS A C   1 
ATOM   4037  O O   . HIS A 1 553 ? 23.266  8.154   -1.915  1.00 40.10  ? 575  HIS A O   1 
ATOM   4038  C CB  . HIS A 1 553 ? 24.431  7.000   0.530   1.00 37.47  ? 575  HIS A CB  1 
ATOM   4039  C CG  . HIS A 1 553 ? 25.712  6.731   1.255   1.00 36.08  ? 575  HIS A CG  1 
ATOM   4040  N ND1 . HIS A 1 553 ? 26.827  7.527   1.111   1.00 34.82  ? 575  HIS A ND1 1 
ATOM   4041  C CD2 . HIS A 1 553 ? 26.034  5.794   2.179   1.00 38.33  ? 575  HIS A CD2 1 
ATOM   4042  C CE1 . HIS A 1 553 ? 27.788  7.079   1.899   1.00 40.78  ? 575  HIS A CE1 1 
ATOM   4043  N NE2 . HIS A 1 553 ? 27.334  6.026   2.556   1.00 39.99  ? 575  HIS A NE2 1 
ATOM   4044  N N   . HIS A 1 554 ? 22.007  6.303   -1.697  1.00 36.58  ? 576  HIS A N   1 
ATOM   4045  C CA  . HIS A 1 554 ? 20.878  6.915   -2.401  1.00 38.61  ? 576  HIS A CA  1 
ATOM   4046  C C   . HIS A 1 554 ? 19.567  6.872   -1.619  1.00 40.32  ? 576  HIS A C   1 
ATOM   4047  O O   . HIS A 1 554 ? 19.009  5.800   -1.375  1.00 40.78  ? 576  HIS A O   1 
ATOM   4048  C CB  . HIS A 1 554 ? 20.693  6.249   -3.766  1.00 39.56  ? 576  HIS A CB  1 
ATOM   4049  C CG  . HIS A 1 554 ? 21.831  6.484   -4.712  1.00 40.08  ? 576  HIS A CG  1 
ATOM   4050  N ND1 . HIS A 1 554 ? 21.801  7.459   -5.687  1.00 40.76  ? 576  HIS A ND1 1 
ATOM   4051  C CD2 . HIS A 1 554 ? 23.029  5.864   -4.838  1.00 38.04  ? 576  HIS A CD2 1 
ATOM   4052  C CE1 . HIS A 1 554 ? 22.932  7.435   -6.370  1.00 38.37  ? 576  HIS A CE1 1 
ATOM   4053  N NE2 . HIS A 1 554 ? 23.693  6.472   -5.879  1.00 38.79  ? 576  HIS A NE2 1 
ATOM   4054  N N   . LEU A 1 555 ? 19.089  8.044   -1.217  1.00 39.27  ? 577  LEU A N   1 
ATOM   4055  C CA  . LEU A 1 555 ? 17.767  8.185   -0.613  1.00 39.89  ? 577  LEU A CA  1 
ATOM   4056  C C   . LEU A 1 555 ? 16.641  8.650   -1.559  1.00 40.36  ? 577  LEU A C   1 
ATOM   4057  O O   . LEU A 1 555 ? 15.540  8.975   -1.107  1.00 38.50  ? 577  LEU A O   1 
ATOM   4058  C CB  . LEU A 1 555 ? 17.819  9.053   0.640   1.00 41.70  ? 577  LEU A CB  1 
ATOM   4059  C CG  . LEU A 1 555 ? 18.636  8.465   1.785   1.00 42.17  ? 577  LEU A CG  1 
ATOM   4060  C CD1 . LEU A 1 555 ? 18.415  9.281   3.047   1.00 42.65  ? 577  LEU A CD1 1 
ATOM   4061  C CD2 . LEU A 1 555 ? 18.276  7.012   2.015   1.00 41.85  ? 577  LEU A CD2 1 
ATOM   4062  N N   . GLU A 1 556 ? 16.918  8.729   -2.856  1.00 43.85  ? 578  GLU A N   1 
ATOM   4063  C CA  . GLU A 1 556 ? 15.925  9.250   -3.806  1.00 47.75  ? 578  GLU A CA  1 
ATOM   4064  C C   . GLU A 1 556 ? 14.584  8.500   -3.860  1.00 46.69  ? 578  GLU A C   1 
ATOM   4065  O O   . GLU A 1 556 ? 13.591  9.055   -4.312  1.00 47.27  ? 578  GLU A O   1 
ATOM   4066  C CB  . GLU A 1 556 ? 16.516  9.337   -5.215  1.00 53.84  ? 578  GLU A CB  1 
ATOM   4067  C CG  . GLU A 1 556 ? 17.927  9.863   -5.252  1.00 60.58  ? 578  GLU A CG  1 
ATOM   4068  C CD  . GLU A 1 556 ? 18.944  8.764   -5.428  1.00 65.42  ? 578  GLU A CD  1 
ATOM   4069  O OE1 . GLU A 1 556 ? 18.535  7.589   -5.488  1.00 69.84  ? 578  GLU A OE1 1 
ATOM   4070  O OE2 . GLU A 1 556 ? 20.147  9.072   -5.519  1.00 65.08  ? 578  GLU A OE2 1 
ATOM   4071  N N   . PHE A 1 557 ? 14.547  7.253   -3.402  1.00 45.90  ? 579  PHE A N   1 
ATOM   4072  C CA  . PHE A 1 557 ? 13.322  6.457   -3.476  1.00 45.41  ? 579  PHE A CA  1 
ATOM   4073  C C   . PHE A 1 557 ? 12.136  7.046   -2.696  1.00 48.41  ? 579  PHE A C   1 
ATOM   4074  O O   . PHE A 1 557 ? 10.979  6.750   -3.005  1.00 46.47  ? 579  PHE A O   1 
ATOM   4075  C CB  . PHE A 1 557 ? 13.579  5.000   -3.044  1.00 43.63  ? 579  PHE A CB  1 
ATOM   4076  C CG  . PHE A 1 557 ? 14.128  4.858   -1.650  1.00 39.07  ? 579  PHE A CG  1 
ATOM   4077  C CD1 . PHE A 1 557 ? 13.281  4.726   -0.562  1.00 40.16  ? 579  PHE A CD1 1 
ATOM   4078  C CD2 . PHE A 1 557 ? 15.498  4.854   -1.428  1.00 35.24  ? 579  PHE A CD2 1 
ATOM   4079  C CE1 . PHE A 1 557 ? 13.797  4.593   0.737   1.00 38.22  ? 579  PHE A CE1 1 
ATOM   4080  C CE2 . PHE A 1 557 ? 16.011  4.732   -0.150  1.00 34.03  ? 579  PHE A CE2 1 
ATOM   4081  C CZ  . PHE A 1 557 ? 15.161  4.602   0.935   1.00 35.92  ? 579  PHE A CZ  1 
ATOM   4082  N N   . ILE A 1 558 ? 12.426  7.879   -1.696  1.00 48.98  ? 580  ILE A N   1 
ATOM   4083  C CA  . ILE A 1 558 ? 11.400  8.437   -0.810  1.00 47.45  ? 580  ILE A CA  1 
ATOM   4084  C C   . ILE A 1 558 ? 10.279  9.172   -1.570  1.00 47.90  ? 580  ILE A C   1 
ATOM   4085  O O   . ILE A 1 558 ? 9.107   9.124   -1.178  1.00 44.26  ? 580  ILE A O   1 
ATOM   4086  C CB  . ILE A 1 558 ? 12.040  9.377   0.243   1.00 46.91  ? 580  ILE A CB  1 
ATOM   4087  C CG1 . ILE A 1 558 ? 12.915  8.581   1.211   1.00 45.20  ? 580  ILE A CG1 1 
ATOM   4088  C CG2 . ILE A 1 558 ? 10.986  10.145  1.035   1.00 47.53  ? 580  ILE A CG2 1 
ATOM   4089  C CD1 . ILE A 1 558 ? 13.804  9.470   2.062   1.00 45.73  ? 580  ILE A CD1 1 
ATOM   4090  N N   . GLN A 1 559 ? 10.640  9.824   -2.671  1.00 49.94  ? 581  GLN A N   1 
ATOM   4091  C CA  . GLN A 1 559 ? 9.694   10.652  -3.407  1.00 56.64  ? 581  GLN A CA  1 
ATOM   4092  C C   . GLN A 1 559 ? 8.591   9.858   -4.110  1.00 56.08  ? 581  GLN A C   1 
ATOM   4093  O O   . GLN A 1 559 ? 7.486   10.366  -4.280  1.00 56.20  ? 581  GLN A O   1 
ATOM   4094  C CB  . GLN A 1 559 ? 10.431  11.528  -4.419  1.00 61.91  ? 581  GLN A CB  1 
ATOM   4095  C CG  . GLN A 1 559 ? 11.252  10.719  -5.395  1.00 66.87  ? 581  GLN A CG  1 
ATOM   4096  C CD  . GLN A 1 559 ? 11.700  11.514  -6.592  1.00 72.01  ? 581  GLN A CD  1 
ATOM   4097  O OE1 . GLN A 1 559 ? 11.230  12.631  -6.824  1.00 75.57  ? 581  GLN A OE1 1 
ATOM   4098  N NE2 . GLN A 1 559 ? 12.613  10.941  -7.370  1.00 71.82  ? 581  GLN A NE2 1 
ATOM   4099  N N   . ASN A 1 560 ? 8.887   8.623   -4.509  1.00 55.98  ? 582  ASN A N   1 
ATOM   4100  C CA  . ASN A 1 560 ? 7.945   7.831   -5.303  1.00 59.38  ? 582  ASN A CA  1 
ATOM   4101  C C   . ASN A 1 560 ? 6.630   7.569   -4.610  1.00 56.07  ? 582  ASN A C   1 
ATOM   4102  O O   . ASN A 1 560 ? 5.586   7.478   -5.249  1.00 56.66  ? 582  ASN A O   1 
ATOM   4103  C CB  . ASN A 1 560 ? 8.550   6.491   -5.702  1.00 65.96  ? 582  ASN A CB  1 
ATOM   4104  C CG  . ASN A 1 560 ? 9.257   6.551   -7.028  1.00 74.92  ? 582  ASN A CG  1 
ATOM   4105  O OD1 . ASN A 1 560 ? 8.706   6.158   -8.062  1.00 76.48  ? 582  ASN A OD1 1 
ATOM   4106  N ND2 . ASN A 1 560 ? 10.490  7.049   -7.012  1.00 78.49  ? 582  ASN A ND2 1 
ATOM   4107  N N   . PHE A 1 561 ? 6.681   7.445   -3.294  1.00 54.01  ? 583  PHE A N   1 
ATOM   4108  C CA  . PHE A 1 561 ? 5.501   7.049   -2.556  1.00 51.76  ? 583  PHE A CA  1 
ATOM   4109  C C   . PHE A 1 561 ? 4.431   8.135   -2.572  1.00 49.79  ? 583  PHE A C   1 
ATOM   4110  O O   . PHE A 1 561 ? 4.701   9.291   -2.248  1.00 47.31  ? 583  PHE A O   1 
ATOM   4111  C CB  . PHE A 1 561 ? 5.887   6.655   -1.141  1.00 50.06  ? 583  PHE A CB  1 
ATOM   4112  C CG  . PHE A 1 561 ? 6.952   5.610   -1.091  1.00 49.04  ? 583  PHE A CG  1 
ATOM   4113  C CD1 . PHE A 1 561 ? 6.686   4.316   -1.502  1.00 48.95  ? 583  PHE A CD1 1 
ATOM   4114  C CD2 . PHE A 1 561 ? 8.219   5.916   -0.631  1.00 48.43  ? 583  PHE A CD2 1 
ATOM   4115  C CE1 . PHE A 1 561 ? 7.668   3.339   -1.456  1.00 47.09  ? 583  PHE A CE1 1 
ATOM   4116  C CE2 . PHE A 1 561 ? 9.199   4.950   -0.582  1.00 49.69  ? 583  PHE A CE2 1 
ATOM   4117  C CZ  . PHE A 1 561 ? 8.924   3.658   -0.995  1.00 48.03  ? 583  PHE A CZ  1 
ATOM   4118  N N   . THR A 1 562 ? 3.228   7.750   -2.995  1.00 49.36  ? 584  THR A N   1 
ATOM   4119  C CA  . THR A 1 562 ? 2.089   8.652   -3.036  1.00 48.88  ? 584  THR A CA  1 
ATOM   4120  C C   . THR A 1 562 ? 1.450   8.777   -1.660  1.00 52.58  ? 584  THR A C   1 
ATOM   4121  O O   . THR A 1 562 ? 0.885   9.814   -1.322  1.00 54.91  ? 584  THR A O   1 
ATOM   4122  C CB  . THR A 1 562 ? 1.013   8.187   -4.074  1.00 48.80  ? 584  THR A CB  1 
ATOM   4123  O OG1 . THR A 1 562 ? 0.451   6.927   -3.681  1.00 46.76  ? 584  THR A OG1 1 
ATOM   4124  C CG2 . THR A 1 562 ? 1.627   8.050   -5.460  1.00 47.09  ? 584  THR A CG2 1 
ATOM   4125  N N   . ASN A 1 563 ? 1.473   7.679   -0.910  1.00 51.54  ? 585  ASN A N   1 
ATOM   4126  C CA  . ASN A 1 563 ? 0.871   7.616   0.420   1.00 50.53  ? 585  ASN A CA  1 
ATOM   4127  C C   . ASN A 1 563 ? 1.795   7.696   1.650   1.00 49.17  ? 585  ASN A C   1 
ATOM   4128  O O   . ASN A 1 563 ? 1.336   7.478   2.771   1.00 49.70  ? 585  ASN A O   1 
ATOM   4129  C CB  . ASN A 1 563 ? -0.093  6.427   0.514   1.00 54.71  ? 585  ASN A CB  1 
ATOM   4130  C CG  . ASN A 1 563 ? -1.215  6.514   -0.517  1.00 66.53  ? 585  ASN A CG  1 
ATOM   4131  O OD1 . ASN A 1 563 ? -1.102  5.984   -1.628  1.00 70.08  ? 585  ASN A OD1 1 
ATOM   4132  N ND2 . ASN A 1 563 ? -2.292  7.206   -0.160  1.00 67.42  ? 585  ASN A ND2 1 
ATOM   4133  N N   . LEU A 1 564 ? 3.091   7.924   1.459   1.00 44.53  ? 586  LEU A N   1 
ATOM   4134  C CA  . LEU A 1 564 ? 3.989   7.917   2.612   1.00 42.68  ? 586  LEU A CA  1 
ATOM   4135  C C   . LEU A 1 564 ? 3.648   9.001   3.637   1.00 42.98  ? 586  LEU A C   1 
ATOM   4136  O O   . LEU A 1 564 ? 3.647   10.192  3.326   1.00 40.20  ? 586  LEU A O   1 
ATOM   4137  C CB  . LEU A 1 564 ? 5.443   8.053   2.177   1.00 41.56  ? 586  LEU A CB  1 
ATOM   4138  C CG  . LEU A 1 564 ? 6.456   7.787   3.291   1.00 40.11  ? 586  LEU A CG  1 
ATOM   4139  C CD1 . LEU A 1 564 ? 6.249   6.401   3.836   1.00 42.21  ? 586  LEU A CD1 1 
ATOM   4140  C CD2 . LEU A 1 564 ? 7.877   7.933   2.763   1.00 42.29  ? 586  LEU A CD2 1 
ATOM   4141  N N   . LYS A 1 565 ? 3.398   8.568   4.870   1.00 44.13  ? 587  LYS A N   1 
ATOM   4142  C CA  . LYS A 1 565 ? 3.052   9.468   5.971   1.00 49.01  ? 587  LYS A CA  1 
ATOM   4143  C C   . LYS A 1 565 ? 4.236   9.696   6.924   1.00 48.81  ? 587  LYS A C   1 
ATOM   4144  O O   . LYS A 1 565 ? 4.668   10.829  7.160   1.00 48.96  ? 587  LYS A O   1 
ATOM   4145  C CB  . LYS A 1 565 ? 1.862   8.924   6.765   1.00 50.44  ? 587  LYS A CB  1 
ATOM   4146  C CG  . LYS A 1 565 ? 0.526   9.041   6.072   1.00 54.60  ? 587  LYS A CG  1 
ATOM   4147  C CD  . LYS A 1 565 ? -0.597  8.697   7.038   1.00 59.44  ? 587  LYS A CD  1 
ATOM   4148  C CE  . LYS A 1 565 ? -1.946  8.696   6.340   1.00 62.88  ? 587  LYS A CE  1 
ATOM   4149  N NZ  . LYS A 1 565 ? -2.196  9.989   5.664   1.00 65.97  ? 587  LYS A NZ  1 
ATOM   4150  N N   . VAL A 1 566 ? 4.713   8.606   7.508   1.00 43.89  ? 588  VAL A N   1 
ATOM   4151  C CA  . VAL A 1 566 ? 5.735   8.675   8.534   1.00 41.56  ? 588  VAL A CA  1 
ATOM   4152  C C   . VAL A 1 566 ? 7.002   7.950   8.109   1.00 41.88  ? 588  VAL A C   1 
ATOM   4153  O O   . VAL A 1 566 ? 6.976   6.761   7.803   1.00 40.12  ? 588  VAL A O   1 
ATOM   4154  C CB  . VAL A 1 566 ? 5.209   8.047   9.821   1.00 38.73  ? 588  VAL A CB  1 
ATOM   4155  C CG1 . VAL A 1 566 ? 6.271   8.089   10.905  1.00 34.84  ? 588  VAL A CG1 1 
ATOM   4156  C CG2 . VAL A 1 566 ? 3.912   8.765   10.261  1.00 37.46  ? 588  VAL A CG2 1 
ATOM   4157  N N   . LEU A 1 567 ? 8.113   8.677   8.086   1.00 43.73  ? 589  LEU A N   1 
ATOM   4158  C CA  . LEU A 1 567 ? 9.407   8.091   7.761   1.00 42.31  ? 589  LEU A CA  1 
ATOM   4159  C C   . LEU A 1 567 ? 10.384  8.347   8.889   1.00 38.90  ? 589  LEU A C   1 
ATOM   4160  O O   . LEU A 1 567 ? 10.626  9.494   9.261   1.00 36.53  ? 589  LEU A O   1 
ATOM   4161  C CB  . LEU A 1 567 ? 9.962   8.705   6.477   1.00 39.76  ? 589  LEU A CB  1 
ATOM   4162  C CG  . LEU A 1 567 ? 11.381  8.288   6.095   1.00 35.12  ? 589  LEU A CG  1 
ATOM   4163  C CD1 . LEU A 1 567 ? 11.406  6.830   5.647   1.00 27.74  ? 589  LEU A CD1 1 
ATOM   4164  C CD2 . LEU A 1 567 ? 11.914  9.194   5.005   1.00 33.66  ? 589  LEU A CD2 1 
ATOM   4165  N N   . ASN A 1 568 ? 10.952  7.283   9.435   1.00 39.84  ? 590  ASN A N   1 
ATOM   4166  C CA  . ASN A 1 568 ? 11.936  7.423   10.502  1.00 36.63  ? 590  ASN A CA  1 
ATOM   4167  C C   . ASN A 1 568 ? 13.335  7.066   9.969   1.00 33.23  ? 590  ASN A C   1 
ATOM   4168  O O   . ASN A 1 568 ? 13.601  5.918   9.621   1.00 31.33  ? 590  ASN A O   1 
ATOM   4169  C CB  . ASN A 1 568 ? 11.535  6.558   11.712  1.00 32.81  ? 590  ASN A CB  1 
ATOM   4170  C CG  . ASN A 1 568 ? 12.393  6.834   12.955  1.00 35.61  ? 590  ASN A CG  1 
ATOM   4171  O OD1 . ASN A 1 568 ? 13.489  7.375   12.834  1.00 35.16  ? 590  ASN A OD1 1 
ATOM   4172  N ND2 . ASN A 1 568 ? 11.908  6.444   14.157  1.00 34.44  ? 590  ASN A ND2 1 
ATOM   4173  N N   . LEU A 1 569 ? 14.196  8.075   9.851   1.00 35.67  ? 591  LEU A N   1 
ATOM   4174  C CA  . LEU A 1 569 ? 15.610  7.907   9.463   1.00 37.41  ? 591  LEU A CA  1 
ATOM   4175  C C   . LEU A 1 569 ? 16.598  7.894   10.645  1.00 38.25  ? 591  LEU A C   1 
ATOM   4176  O O   . LEU A 1 569 ? 17.801  8.027   10.447  1.00 38.52  ? 591  LEU A O   1 
ATOM   4177  C CB  . LEU A 1 569 ? 16.028  8.916   8.381   1.00 36.88  ? 591  LEU A CB  1 
ATOM   4178  C CG  . LEU A 1 569 ? 15.221  8.851   7.067   1.00 38.27  ? 591  LEU A CG  1 
ATOM   4179  C CD1 . LEU A 1 569 ? 15.637  9.942   6.068   1.00 38.96  ? 591  LEU A CD1 1 
ATOM   4180  C CD2 . LEU A 1 569 ? 15.337  7.479   6.410   1.00 37.10  ? 591  LEU A CD2 1 
ATOM   4181  N N   . SER A 1 570 ? 16.084  7.820   11.870  1.00 35.33  ? 592  SER A N   1 
ATOM   4182  C CA  . SER A 1 570 ? 16.908  8.012   13.062  1.00 32.48  ? 592  SER A CA  1 
ATOM   4183  C C   . SER A 1 570 ? 18.112  7.083   13.237  1.00 32.69  ? 592  SER A C   1 
ATOM   4184  O O   . SER A 1 570 ? 18.085  5.913   12.855  1.00 29.61  ? 592  SER A O   1 
ATOM   4185  C CB  . SER A 1 570 ? 16.065  7.948   14.336  1.00 30.41  ? 592  SER A CB  1 
ATOM   4186  O OG  . SER A 1 570 ? 15.684  6.613   14.606  1.00 27.00  ? 592  SER A OG  1 
ATOM   4187  N N   . HIS A 1 571 ? 19.163  7.635   13.837  1.00 34.04  ? 593  HIS A N   1 
ATOM   4188  C CA  . HIS A 1 571 ? 20.358  6.876   14.196  1.00 34.92  ? 593  HIS A CA  1 
ATOM   4189  C C   . HIS A 1 571 ? 20.984  6.166   13.001  1.00 33.39  ? 593  HIS A C   1 
ATOM   4190  O O   . HIS A 1 571 ? 21.378  5.019   13.090  1.00 35.25  ? 593  HIS A O   1 
ATOM   4191  C CB  . HIS A 1 571 ? 20.046  5.900   15.333  1.00 40.15  ? 593  HIS A CB  1 
ATOM   4192  C CG  . HIS A 1 571 ? 19.695  6.586   16.615  1.00 45.89  ? 593  HIS A CG  1 
ATOM   4193  N ND1 . HIS A 1 571 ? 18.411  6.992   16.918  1.00 47.75  ? 593  HIS A ND1 1 
ATOM   4194  C CD2 . HIS A 1 571 ? 20.471  6.991   17.648  1.00 46.74  ? 593  HIS A CD2 1 
ATOM   4195  C CE1 . HIS A 1 571 ? 18.408  7.595   18.094  1.00 47.41  ? 593  HIS A CE1 1 
ATOM   4196  N NE2 . HIS A 1 571 ? 19.645  7.607   18.558  1.00 47.69  ? 593  HIS A NE2 1 
ATOM   4197  N N   . ASN A 1 572 ? 21.019  6.840   11.861  1.00 32.65  ? 594  ASN A N   1 
ATOM   4198  C CA  . ASN A 1 572 ? 21.746  6.305   10.729  1.00 36.63  ? 594  ASN A CA  1 
ATOM   4199  C C   . ASN A 1 572 ? 23.127  6.911   10.492  1.00 37.61  ? 594  ASN A C   1 
ATOM   4200  O O   . ASN A 1 572 ? 23.850  6.466   9.602   1.00 40.31  ? 594  ASN A O   1 
ATOM   4201  C CB  . ASN A 1 572 ? 20.876  6.349   9.477   1.00 35.52  ? 594  ASN A CB  1 
ATOM   4202  C CG  . ASN A 1 572 ? 19.845  5.246   9.479   1.00 35.29  ? 594  ASN A CG  1 
ATOM   4203  O OD1 . ASN A 1 572 ? 20.190  4.085   9.679   1.00 35.43  ? 594  ASN A OD1 1 
ATOM   4204  N ND2 . ASN A 1 572 ? 18.575  5.598   9.298   1.00 33.44  ? 594  ASN A ND2 1 
ATOM   4205  N N   . ASN A 1 573 ? 23.483  7.909   11.296  1.00 36.94  ? 595  ASN A N   1 
ATOM   4206  C CA  . ASN A 1 573 ? 24.733  8.654   11.117  1.00 43.27  ? 595  ASN A CA  1 
ATOM   4207  C C   . ASN A 1 573 ? 24.915  9.200   9.698   1.00 42.88  ? 595  ASN A C   1 
ATOM   4208  O O   . ASN A 1 573 ? 25.983  9.059   9.094   1.00 38.91  ? 595  ASN A O   1 
ATOM   4209  C CB  . ASN A 1 573 ? 25.939  7.802   11.526  1.00 52.51  ? 595  ASN A CB  1 
ATOM   4210  C CG  . ASN A 1 573 ? 27.184  8.641   11.785  1.00 64.76  ? 595  ASN A CG  1 
ATOM   4211  O OD1 . ASN A 1 573 ? 27.513  8.948   12.934  1.00 69.93  ? 595  ASN A OD1 1 
ATOM   4212  N ND2 . ASN A 1 573 ? 27.876  9.024   10.714  1.00 64.99  ? 595  ASN A ND2 1 
ATOM   4213  N N   . ILE A 1 574 ? 23.888  9.870   9.179   1.00 42.39  ? 596  ILE A N   1 
ATOM   4214  C CA  . ILE A 1 574 ? 23.902  10.257  7.782   1.00 39.09  ? 596  ILE A CA  1 
ATOM   4215  C C   . ILE A 1 574 ? 24.657  11.575  7.723   1.00 37.08  ? 596  ILE A C   1 
ATOM   4216  O O   . ILE A 1 574 ? 24.228  12.568  8.295   1.00 38.72  ? 596  ILE A O   1 
ATOM   4217  C CB  . ILE A 1 574 ? 22.448  10.469  7.282   1.00 29.91  ? 596  ILE A CB  1 
ATOM   4218  C CG1 . ILE A 1 574 ? 21.701  9.133   7.209   1.00 30.52  ? 596  ILE A CG1 1 
ATOM   4219  C CG2 . ILE A 1 574 ? 22.398  11.197  5.917   1.00 28.99  ? 596  ILE A CG2 1 
ATOM   4220  C CD1 . ILE A 1 574 ? 20.190  9.290   7.259   1.00 25.96  ? 596  ILE A CD1 1 
ATOM   4221  N N   . TYR A 1 575 ? 25.862  11.543  7.166   1.00 38.29  ? 597  TYR A N   1 
ATOM   4222  C CA  . TYR A 1 575 ? 26.590  12.769  6.844   1.00 39.32  ? 597  TYR A CA  1 
ATOM   4223  C C   . TYR A 1 575 ? 26.851  13.037  5.367   1.00 41.58  ? 597  TYR A C   1 
ATOM   4224  O O   . TYR A 1 575 ? 27.327  14.116  5.012   1.00 44.45  ? 597  TYR A O   1 
ATOM   4225  C CB  . TYR A 1 575 ? 27.884  12.860  7.650   1.00 35.64  ? 597  TYR A CB  1 
ATOM   4226  C CG  . TYR A 1 575 ? 28.927  11.852  7.252   1.00 33.52  ? 597  TYR A CG  1 
ATOM   4227  C CD1 . TYR A 1 575 ? 28.705  10.492  7.425   1.00 28.51  ? 597  TYR A CD1 1 
ATOM   4228  C CD2 . TYR A 1 575 ? 30.154  12.263  6.727   1.00 31.87  ? 597  TYR A CD2 1 
ATOM   4229  C CE1 . TYR A 1 575 ? 29.651  9.567   7.076   1.00 29.73  ? 597  TYR A CE1 1 
ATOM   4230  C CE2 . TYR A 1 575 ? 31.116  11.342  6.379   1.00 30.92  ? 597  TYR A CE2 1 
ATOM   4231  C CZ  . TYR A 1 575 ? 30.854  9.995   6.557   1.00 32.79  ? 597  TYR A CZ  1 
ATOM   4232  O OH  . TYR A 1 575 ? 31.791  9.061   6.225   1.00 36.93  ? 597  TYR A OH  1 
ATOM   4233  N N   . THR A 1 576 ? 26.570  12.060  4.508   1.00 39.37  ? 598  THR A N   1 
ATOM   4234  C CA  . THR A 1 576 ? 26.889  12.225  3.089   1.00 39.02  ? 598  THR A CA  1 
ATOM   4235  C C   . THR A 1 576 ? 25.999  11.418  2.136   1.00 35.20  ? 598  THR A C   1 
ATOM   4236  O O   . THR A 1 576 ? 25.636  10.282  2.415   1.00 33.24  ? 598  THR A O   1 
ATOM   4237  C CB  . THR A 1 576 ? 28.378  11.922  2.803   1.00 37.85  ? 598  THR A CB  1 
ATOM   4238  O OG1 . THR A 1 576 ? 28.625  12.026  1.396   1.00 41.98  ? 598  THR A OG1 1 
ATOM   4239  C CG2 . THR A 1 576 ? 28.732  10.518  3.273   1.00 36.96  ? 598  THR A CG2 1 
ATOM   4240  N N   . LEU A 1 577 ? 25.677  12.009  0.997   1.00 37.19  ? 599  LEU A N   1 
ATOM   4241  C CA  . LEU A 1 577 ? 24.818  11.359  0.009   1.00 40.11  ? 599  LEU A CA  1 
ATOM   4242  C C   . LEU A 1 577 ? 25.430  11.552  -1.371  1.00 39.38  ? 599  LEU A C   1 
ATOM   4243  O O   . LEU A 1 577 ? 26.239  12.452  -1.569  1.00 36.74  ? 599  LEU A O   1 
ATOM   4244  C CB  . LEU A 1 577 ? 23.400  11.949  0.048   1.00 41.72  ? 599  LEU A CB  1 
ATOM   4245  C CG  . LEU A 1 577 ? 22.580  11.784  1.337   1.00 41.52  ? 599  LEU A CG  1 
ATOM   4246  C CD1 . LEU A 1 577 ? 21.228  12.496  1.237   1.00 42.81  ? 599  LEU A CD1 1 
ATOM   4247  C CD2 . LEU A 1 577 ? 22.379  10.315  1.650   1.00 37.62  ? 599  LEU A CD2 1 
ATOM   4248  N N   . THR A 1 578 ? 25.036  10.708  -2.322  1.00 44.90  ? 600  THR A N   1 
ATOM   4249  C CA  . THR A 1 578 ? 25.559  10.758  -3.678  1.00 52.35  ? 600  THR A CA  1 
ATOM   4250  C C   . THR A 1 578 ? 24.564  11.467  -4.581  1.00 55.86  ? 600  THR A C   1 
ATOM   4251  O O   . THR A 1 578 ? 23.368  11.178  -4.515  1.00 58.87  ? 600  THR A O   1 
ATOM   4252  C CB  . THR A 1 578 ? 25.762  9.337   -4.227  1.00 54.17  ? 600  THR A CB  1 
ATOM   4253  O OG1 . THR A 1 578 ? 26.673  8.620   -3.386  1.00 56.43  ? 600  THR A OG1 1 
ATOM   4254  C CG2 . THR A 1 578 ? 26.311  9.375   -5.638  1.00 53.37  ? 600  THR A CG2 1 
ATOM   4255  N N   . ASP A 1 579 ? 25.037  12.369  -5.439  1.00 57.21  ? 601  ASP A N   1 
ATOM   4256  C CA  . ASP A 1 579 ? 24.113  13.032  -6.371  1.00 60.32  ? 601  ASP A CA  1 
ATOM   4257  C C   . ASP A 1 579 ? 22.998  13.805  -5.653  1.00 60.12  ? 601  ASP A C   1 
ATOM   4258  O O   . ASP A 1 579 ? 23.218  14.936  -5.219  1.00 60.57  ? 601  ASP A O   1 
ATOM   4259  C CB  . ASP A 1 579 ? 23.579  12.056  -7.427  1.00 59.10  ? 601  ASP A CB  1 
ATOM   4260  C CG  . ASP A 1 579 ? 24.697  11.448  -8.266  1.00 57.71  ? 601  ASP A CG  1 
ATOM   4261  O OD1 . ASP A 1 579 ? 25.732  12.126  -8.457  1.00 57.93  ? 601  ASP A OD1 1 
ATOM   4262  O OD2 . ASP A 1 579 ? 24.552  10.294  -8.724  1.00 56.15  ? 601  ASP A OD2 1 
ATOM   4263  N N   . LYS A 1 580 ? 21.785  13.259  -5.631  1.00 58.59  ? 602  LYS A N   1 
ATOM   4264  C CA  . LYS A 1 580 ? 20.682  13.914  -4.928  1.00 58.73  ? 602  LYS A CA  1 
ATOM   4265  C C   . LYS A 1 580 ? 20.948  14.145  -3.435  1.00 55.43  ? 602  LYS A C   1 
ATOM   4266  O O   . LYS A 1 580 ? 21.141  13.214  -2.666  1.00 52.00  ? 602  LYS A O   1 
ATOM   4267  C CB  . LYS A 1 580 ? 19.396  13.108  -5.106  1.00 61.99  ? 602  LYS A CB  1 
ATOM   4268  C CG  . LYS A 1 580 ? 18.123  13.908  -4.820  1.00 68.36  ? 602  LYS A CG  1 
ATOM   4269  C CD  . LYS A 1 580 ? 16.879  13.214  -5.385  1.00 71.43  ? 602  LYS A CD  1 
ATOM   4270  C CE  . LYS A 1 580 ? 15.593  13.954  -5.052  1.00 72.58  ? 602  LYS A CE  1 
ATOM   4271  N NZ  . LYS A 1 580 ? 14.433  13.016  -4.896  1.00 71.81  ? 602  LYS A NZ  1 
ATOM   4272  N N   . TYR A 1 581 ? 20.920  15.412  -3.043  1.00 56.37  ? 603  TYR A N   1 
ATOM   4273  C CA  . TYR A 1 581 ? 21.189  15.824  -1.674  1.00 52.59  ? 603  TYR A CA  1 
ATOM   4274  C C   . TYR A 1 581 ? 19.908  16.119  -0.893  1.00 52.59  ? 603  TYR A C   1 
ATOM   4275  O O   . TYR A 1 581 ? 19.955  16.376  0.313   1.00 50.63  ? 603  TYR A O   1 
ATOM   4276  C CB  . TYR A 1 581 ? 22.097  17.063  -1.700  1.00 51.23  ? 603  TYR A CB  1 
ATOM   4277  C CG  . TYR A 1 581 ? 23.373  16.857  -2.497  1.00 48.82  ? 603  TYR A CG  1 
ATOM   4278  C CD1 . TYR A 1 581 ? 24.182  15.758  -2.262  1.00 45.76  ? 603  TYR A CD1 1 
ATOM   4279  C CD2 . TYR A 1 581 ? 23.755  17.746  -3.502  1.00 49.30  ? 603  TYR A CD2 1 
ATOM   4280  C CE1 . TYR A 1 581 ? 25.350  15.545  -2.980  1.00 43.28  ? 603  TYR A CE1 1 
ATOM   4281  C CE2 . TYR A 1 581 ? 24.929  17.537  -4.240  1.00 46.79  ? 603  TYR A CE2 1 
ATOM   4282  C CZ  . TYR A 1 581 ? 25.716  16.424  -3.968  1.00 44.47  ? 603  TYR A CZ  1 
ATOM   4283  O OH  . TYR A 1 581 ? 26.878  16.183  -4.667  1.00 44.09  ? 603  TYR A OH  1 
ATOM   4284  N N   . ASN A 1 582 ? 18.765  16.068  -1.579  1.00 54.16  ? 604  ASN A N   1 
ATOM   4285  C CA  . ASN A 1 582 ? 17.500  16.495  -0.982  1.00 54.93  ? 604  ASN A CA  1 
ATOM   4286  C C   . ASN A 1 582 ? 16.506  15.366  -0.750  1.00 52.85  ? 604  ASN A C   1 
ATOM   4287  O O   . ASN A 1 582 ? 16.338  14.494  -1.600  1.00 52.02  ? 604  ASN A O   1 
ATOM   4288  C CB  . ASN A 1 582 ? 16.818  17.572  -1.834  1.00 57.58  ? 604  ASN A CB  1 
ATOM   4289  C CG  . ASN A 1 582 ? 17.654  18.824  -1.977  1.00 61.01  ? 604  ASN A CG  1 
ATOM   4290  O OD1 . ASN A 1 582 ? 17.934  19.513  -0.995  1.00 63.05  ? 604  ASN A OD1 1 
ATOM   4291  N ND2 . ASN A 1 582 ? 18.042  19.140  -3.210  1.00 61.40  ? 604  ASN A ND2 1 
ATOM   4292  N N   . LEU A 1 583 ? 15.846  15.402  0.404   1.00 50.63  ? 605  LEU A N   1 
ATOM   4293  C CA  . LEU A 1 583 ? 14.708  14.534  0.670   1.00 47.91  ? 605  LEU A CA  1 
ATOM   4294  C C   . LEU A 1 583 ? 13.433  15.222  0.160   1.00 52.73  ? 605  LEU A C   1 
ATOM   4295  O O   . LEU A 1 583 ? 13.105  16.340  0.575   1.00 50.24  ? 605  LEU A O   1 
ATOM   4296  C CB  . LEU A 1 583 ? 14.598  14.237  2.163   1.00 41.69  ? 605  LEU A CB  1 
ATOM   4297  C CG  . LEU A 1 583 ? 15.856  13.671  2.829   1.00 37.65  ? 605  LEU A CG  1 
ATOM   4298  C CD1 . LEU A 1 583 ? 15.558  13.234  4.260   1.00 32.16  ? 605  LEU A CD1 1 
ATOM   4299  C CD2 . LEU A 1 583 ? 16.425  12.514  2.014   1.00 37.51  ? 605  LEU A CD2 1 
ATOM   4300  N N   . GLU A 1 584 ? 12.733  14.559  -0.758  1.00 57.05  ? 606  GLU A N   1 
ATOM   4301  C CA  . GLU A 1 584 ? 11.507  15.106  -1.333  1.00 63.10  ? 606  GLU A CA  1 
ATOM   4302  C C   . GLU A 1 584 ? 10.336  14.141  -1.174  1.00 61.01  ? 606  GLU A C   1 
ATOM   4303  O O   . GLU A 1 584 ? 10.484  12.939  -1.408  1.00 60.55  ? 606  GLU A O   1 
ATOM   4304  C CB  . GLU A 1 584 ? 11.710  15.424  -2.819  1.00 66.83  ? 606  GLU A CB  1 
ATOM   4305  C CG  . GLU A 1 584 ? 12.808  16.431  -3.101  1.00 69.79  ? 606  GLU A CG  1 
ATOM   4306  C CD  . GLU A 1 584 ? 12.973  16.716  -4.582  1.00 73.78  ? 606  GLU A CD  1 
ATOM   4307  O OE1 . GLU A 1 584 ? 12.551  15.876  -5.407  1.00 75.75  ? 606  GLU A OE1 1 
ATOM   4308  O OE2 . GLU A 1 584 ? 13.520  17.786  -4.922  1.00 73.77  ? 606  GLU A OE2 1 
ATOM   4309  N N   . SER A 1 585 ? 9.196   14.658  -0.719  1.00 57.19  ? 607  SER A N   1 
ATOM   4310  C CA  . SER A 1 585 ? 7.928   13.932  -0.789  1.00 53.84  ? 607  SER A CA  1 
ATOM   4311  C C   . SER A 1 585 ? 6.758   14.904  -0.826  1.00 57.79  ? 607  SER A C   1 
ATOM   4312  O O   . SER A 1 585 ? 6.744   15.888  -0.085  1.00 61.53  ? 607  SER A O   1 
ATOM   4313  C CB  . SER A 1 585 ? 7.767   12.982  0.405   1.00 50.09  ? 607  SER A CB  1 
ATOM   4314  O OG  . SER A 1 585 ? 6.428   12.501  0.499   1.00 49.02  ? 607  SER A OG  1 
ATOM   4315  N N   . LYS A 1 586 ? 5.750   14.602  -1.639  1.00 58.17  ? 608  LYS A N   1 
ATOM   4316  C CA  . LYS A 1 586 ? 4.550   15.435  -1.682  1.00 61.83  ? 608  LYS A CA  1 
ATOM   4317  C C   . LYS A 1 586 ? 3.497   14.957  -0.672  1.00 63.29  ? 608  LYS A C   1 
ATOM   4318  O O   . LYS A 1 586 ? 2.495   15.632  -0.433  1.00 67.07  ? 608  LYS A O   1 
ATOM   4319  C CB  . LYS A 1 586 ? 3.990   15.501  -3.106  1.00 63.73  ? 608  LYS A CB  1 
ATOM   4320  C CG  . LYS A 1 586 ? 5.032   15.979  -4.125  1.00 68.12  ? 608  LYS A CG  1 
ATOM   4321  C CD  . LYS A 1 586 ? 4.408   16.460  -5.431  1.00 74.27  ? 608  LYS A CD  1 
ATOM   4322  C CE  . LYS A 1 586 ? 5.325   17.447  -6.150  1.00 76.60  ? 608  LYS A CE  1 
ATOM   4323  N NZ  . LYS A 1 586 ? 5.653   18.620  -5.282  1.00 78.07  ? 608  LYS A NZ  1 
ATOM   4324  N N   . SER A 1 587 ? 3.761   13.799  -0.072  1.00 58.70  ? 609  SER A N   1 
ATOM   4325  C CA  . SER A 1 587 ? 2.883   13.153  0.908   1.00 55.79  ? 609  SER A CA  1 
ATOM   4326  C C   . SER A 1 587 ? 3.331   13.374  2.360   1.00 51.80  ? 609  SER A C   1 
ATOM   4327  O O   . SER A 1 587 ? 2.510   13.682  3.220   1.00 52.94  ? 609  SER A O   1 
ATOM   4328  C CB  . SER A 1 587 ? 2.644   11.668  0.592   1.00 55.30  ? 609  SER A CB  1 
ATOM   4329  O OG  . SER A 1 587 ? 3.816   10.903  0.758   1.00 58.24  ? 609  SER A OG  1 
ATOM   4330  N N   . LEU A 1 588 ? 4.616   13.135  2.628   1.00 47.15  ? 610  LEU A N   1 
ATOM   4331  C CA  . LEU A 1 588 ? 5.139   12.934  3.980   1.00 44.57  ? 610  LEU A CA  1 
ATOM   4332  C C   . LEU A 1 588 ? 4.673   13.972  5.004   1.00 41.83  ? 610  LEU A C   1 
ATOM   4333  O O   . LEU A 1 588 ? 4.750   15.178  4.780   1.00 41.50  ? 610  LEU A O   1 
ATOM   4334  C CB  . LEU A 1 588 ? 6.674   12.929  3.925   1.00 43.60  ? 610  LEU A CB  1 
ATOM   4335  C CG  . LEU A 1 588 ? 7.494   12.351  5.083   1.00 43.51  ? 610  LEU A CG  1 
ATOM   4336  C CD1 . LEU A 1 588 ? 7.139   10.889  5.311   1.00 42.53  ? 610  LEU A CD1 1 
ATOM   4337  C CD2 . LEU A 1 588 ? 8.964   12.470  4.771   1.00 45.41  ? 610  LEU A CD2 1 
ATOM   4338  N N   . VAL A 1 589 ? 4.104   13.458  6.091   1.00 40.34  ? 611  VAL A N   1 
ATOM   4339  C CA  . VAL A 1 589 ? 3.684   14.238  7.260   1.00 40.89  ? 611  VAL A CA  1 
ATOM   4340  C C   . VAL A 1 589 ? 4.779   14.447  8.326   1.00 37.38  ? 611  VAL A C   1 
ATOM   4341  O O   . VAL A 1 589 ? 4.938   15.532  8.875   1.00 42.95  ? 611  VAL A O   1 
ATOM   4342  C CB  . VAL A 1 589 ? 2.450   13.571  7.923   1.00 59.05  ? 611  VAL A CB  1 
ATOM   4343  C CG1 . VAL A 1 589 ? 2.122   14.213  9.258   1.00 59.34  ? 611  VAL A CG1 1 
ATOM   4344  C CG2 . VAL A 1 589 ? 1.264   13.634  6.995   1.00 60.77  ? 611  VAL A CG2 1 
ATOM   4345  N N   . GLU A 1 590 ? 5.511   13.382  8.617   1.00 33.72  ? 612  GLU A N   1 
ATOM   4346  C CA  . GLU A 1 590 ? 6.420   13.350  9.762   1.00 43.37  ? 612  GLU A CA  1 
ATOM   4347  C C   . GLU A 1 590 ? 7.758   12.762  9.381   1.00 39.21  ? 612  GLU A C   1 
ATOM   4348  O O   . GLU A 1 590 ? 7.824   11.656  8.839   1.00 42.07  ? 612  GLU A O   1 
ATOM   4349  C CB  . GLU A 1 590 ? 5.830   12.504  10.900  1.00 43.68  ? 612  GLU A CB  1 
ATOM   4350  C CG  . GLU A 1 590 ? 6.837   12.132  11.999  1.00 41.59  ? 612  GLU A CG  1 
ATOM   4351  C CD  . GLU A 1 590 ? 6.183   11.445  13.190  1.00 45.07  ? 612  GLU A CD  1 
ATOM   4352  O OE1 . GLU A 1 590 ? 5.077   10.892  13.034  1.00 51.15  ? 612  GLU A OE1 1 
ATOM   4353  O OE2 . GLU A 1 590 ? 6.770   11.456  14.288  1.00 45.15  ? 612  GLU A OE2 1 
ATOM   4354  N N   . LEU A 1 591 ? 8.824   13.489  9.688   1.00 35.11  ? 613  LEU A N   1 
ATOM   4355  C CA  . LEU A 1 591 ? 10.172  12.989  9.436   1.00 36.05  ? 613  LEU A CA  1 
ATOM   4356  C C   . LEU A 1 591 ? 10.993  12.982  10.714  1.00 34.60  ? 613  LEU A C   1 
ATOM   4357  O O   . LEU A 1 591 ? 11.177  14.012  11.356  1.00 38.09  ? 613  LEU A O   1 
ATOM   4358  C CB  . LEU A 1 591 ? 10.890  13.818  8.358   1.00 36.91  ? 613  LEU A CB  1 
ATOM   4359  C CG  . LEU A 1 591 ? 12.355  13.415  8.156   1.00 37.83  ? 613  LEU A CG  1 
ATOM   4360  C CD1 . LEU A 1 591 ? 12.472  11.931  7.812   1.00 37.93  ? 613  LEU A CD1 1 
ATOM   4361  C CD2 . LEU A 1 591 ? 13.049  14.270  7.107   1.00 34.93  ? 613  LEU A CD2 1 
ATOM   4362  N N   . VAL A 1 592 ? 11.484  11.812  11.083  1.00 32.47  ? 614  VAL A N   1 
ATOM   4363  C CA  . VAL A 1 592 ? 12.355  11.700  12.234  1.00 31.90  ? 614  VAL A CA  1 
ATOM   4364  C C   . VAL A 1 592 ? 13.782  11.538  11.743  1.00 31.31  ? 614  VAL A C   1 
ATOM   4365  O O   . VAL A 1 592 ? 14.121  10.501  11.193  1.00 29.06  ? 614  VAL A O   1 
ATOM   4366  C CB  . VAL A 1 592 ? 11.954  10.486  13.053  1.00 32.39  ? 614  VAL A CB  1 
ATOM   4367  C CG1 . VAL A 1 592 ? 12.865  10.323  14.265  1.00 29.74  ? 614  VAL A CG1 1 
ATOM   4368  C CG2 . VAL A 1 592 ? 10.488  10.618  13.462  1.00 28.57  ? 614  VAL A CG2 1 
ATOM   4369  N N   . PHE A 1 593 ? 14.579  12.600  11.889  1.00 32.77  ? 615  PHE A N   1 
ATOM   4370  C CA  . PHE A 1 593 ? 15.981  12.653  11.456  1.00 34.85  ? 615  PHE A CA  1 
ATOM   4371  C C   . PHE A 1 593 ? 17.038  12.547  12.565  1.00 38.60  ? 615  PHE A C   1 
ATOM   4372  O O   . PHE A 1 593 ? 18.222  12.790  12.338  1.00 35.09  ? 615  PHE A O   1 
ATOM   4373  C CB  . PHE A 1 593 ? 16.243  13.867  10.563  1.00 38.95  ? 615  PHE A CB  1 
ATOM   4374  C CG  . PHE A 1 593 ? 17.340  13.649  9.554   1.00 41.32  ? 615  PHE A CG  1 
ATOM   4375  C CD1 . PHE A 1 593 ? 17.157  12.776  8.492   1.00 40.82  ? 615  PHE A CD1 1 
ATOM   4376  C CD2 . PHE A 1 593 ? 18.545  14.328  9.657   1.00 42.12  ? 615  PHE A CD2 1 
ATOM   4377  C CE1 . PHE A 1 593 ? 18.164  12.570  7.565   1.00 40.75  ? 615  PHE A CE1 1 
ATOM   4378  C CE2 . PHE A 1 593 ? 19.549  14.133  8.724   1.00 42.09  ? 615  PHE A CE2 1 
ATOM   4379  C CZ  . PHE A 1 593 ? 19.357  13.248  7.675   1.00 40.25  ? 615  PHE A CZ  1 
ATOM   4380  N N   . SER A 1 594 ? 16.593  12.270  13.778  1.00 40.50  ? 616  SER A N   1 
ATOM   4381  C CA  . SER A 1 594 ? 17.476  12.298  14.934  1.00 38.55  ? 616  SER A CA  1 
ATOM   4382  C C   . SER A 1 594 ? 18.647  11.312  14.868  1.00 38.84  ? 616  SER A C   1 
ATOM   4383  O O   . SER A 1 594 ? 18.580  10.273  14.201  1.00 39.83  ? 616  SER A O   1 
ATOM   4384  C CB  . SER A 1 594 ? 16.668  12.042  16.203  1.00 38.31  ? 616  SER A CB  1 
ATOM   4385  O OG  . SER A 1 594 ? 16.263  10.694  16.281  1.00 39.37  ? 616  SER A OG  1 
ATOM   4386  N N   . GLY A 1 595 ? 19.732  11.644  15.556  1.00 34.20  ? 617  GLY A N   1 
ATOM   4387  C CA  . GLY A 1 595 ? 20.849  10.723  15.626  1.00 34.12  ? 617  GLY A CA  1 
ATOM   4388  C C   . GLY A 1 595 ? 21.575  10.575  14.303  1.00 31.26  ? 617  GLY A C   1 
ATOM   4389  O O   . GLY A 1 595 ? 22.058  9.499   13.975  1.00 31.66  ? 617  GLY A O   1 
ATOM   4390  N N   . ASN A 1 596 ? 21.627  11.664  13.545  1.00 28.80  ? 618  ASN A N   1 
ATOM   4391  C CA  . ASN A 1 596 ? 22.396  11.757  12.303  1.00 34.12  ? 618  ASN A CA  1 
ATOM   4392  C C   . ASN A 1 596 ? 23.449  12.866  12.435  1.00 32.68  ? 618  ASN A C   1 
ATOM   4393  O O   . ASN A 1 596 ? 23.646  13.384  13.530  1.00 31.21  ? 618  ASN A O   1 
ATOM   4394  C CB  . ASN A 1 596 ? 21.456  12.006  11.116  1.00 32.64  ? 618  ASN A CB  1 
ATOM   4395  C CG  . ASN A 1 596 ? 20.583  10.805  10.817  1.00 31.71  ? 618  ASN A CG  1 
ATOM   4396  O OD1 . ASN A 1 596 ? 21.092  9.698   10.619  1.00 31.55  ? 618  ASN A OD1 1 
ATOM   4397  N ND2 . ASN A 1 596 ? 19.257  11.009  10.797  1.00 30.85  ? 618  ASN A ND2 1 
ATOM   4398  N N   . ARG A 1 597 ? 24.156  13.217  11.361  1.00 34.06  ? 619  ARG A N   1 
ATOM   4399  C CA  . ARG A 1 597 ? 25.031  14.373  11.486  1.00 35.25  ? 619  ARG A CA  1 
ATOM   4400  C C   . ARG A 1 597 ? 24.597  15.527  10.612  1.00 39.83  ? 619  ARG A C   1 
ATOM   4401  O O   . ARG A 1 597 ? 25.126  15.704  9.511   1.00 46.86  ? 619  ARG A O   1 
ATOM   4402  C CB  . ARG A 1 597 ? 26.433  13.973  11.032  1.00 35.76  ? 619  ARG A CB  1 
ATOM   4403  C CG  . ARG A 1 597 ? 26.993  12.781  11.747  1.00 34.39  ? 619  ARG A CG  1 
ATOM   4404  C CD  . ARG A 1 597 ? 27.163  13.078  13.223  1.00 39.71  ? 619  ARG A CD  1 
ATOM   4405  N NE  . ARG A 1 597 ? 28.146  14.134  13.462  1.00 46.82  ? 619  ARG A NE  1 
ATOM   4406  C CZ  . ARG A 1 597 ? 29.462  13.935  13.532  1.00 46.29  ? 619  ARG A CZ  1 
ATOM   4407  N NH1 . ARG A 1 597 ? 29.960  12.717  13.369  1.00 43.42  ? 619  ARG A NH1 1 
ATOM   4408  N NH2 . ARG A 1 597 ? 30.282  14.957  13.751  1.00 43.96  ? 619  ARG A NH2 1 
ATOM   4409  N N   . LEU A 1 598 ? 23.783  16.419  11.166  1.00 39.50  ? 620  LEU A N   1 
ATOM   4410  C CA  . LEU A 1 598 ? 23.359  17.601  10.422  1.00 41.54  ? 620  LEU A CA  1 
ATOM   4411  C C   . LEU A 1 598 ? 24.465  18.629  10.565  1.00 46.51  ? 620  LEU A C   1 
ATOM   4412  O O   . LEU A 1 598 ? 24.622  19.520  9.733   1.00 50.08  ? 620  LEU A O   1 
ATOM   4413  C CB  . LEU A 1 598 ? 22.012  18.137  10.923  1.00 40.47  ? 620  LEU A CB  1 
ATOM   4414  C CG  . LEU A 1 598 ? 20.785  17.477  10.281  1.00 41.88  ? 620  LEU A CG  1 
ATOM   4415  C CD1 . LEU A 1 598 ? 19.506  17.734  11.075  1.00 31.16  ? 620  LEU A CD1 1 
ATOM   4416  C CD2 . LEU A 1 598 ? 20.632  17.943  8.840   1.00 37.55  ? 620  LEU A CD2 1 
ATOM   4417  N N   . ASP A 1 599 ? 25.232  18.482  11.641  1.00 46.87  ? 621  ASP A N   1 
ATOM   4418  C CA  . ASP A 1 599 ? 26.359  19.359  11.901  1.00 47.84  ? 621  ASP A CA  1 
ATOM   4419  C C   . ASP A 1 599 ? 27.380  19.294  10.765  1.00 43.58  ? 621  ASP A C   1 
ATOM   4420  O O   . ASP A 1 599 ? 27.980  20.307  10.417  1.00 46.88  ? 621  ASP A O   1 
ATOM   4421  C CB  . ASP A 1 599 ? 27.002  19.034  13.251  1.00 46.06  ? 621  ASP A CB  1 
ATOM   4422  C CG  . ASP A 1 599 ? 27.782  17.744  13.233  1.00 47.38  ? 621  ASP A CG  1 
ATOM   4423  O OD1 . ASP A 1 599 ? 27.226  16.708  12.820  1.00 45.68  ? 621  ASP A OD1 1 
ATOM   4424  O OD2 . ASP A 1 599 ? 28.966  17.768  13.633  1.00 50.22  ? 621  ASP A OD2 1 
ATOM   4425  N N   . ILE A 1 600 ? 27.561  18.108  10.188  1.00 36.99  ? 622  ILE A N   1 
ATOM   4426  C CA  . ILE A 1 600 ? 28.412  17.939  9.011   1.00 36.94  ? 622  ILE A CA  1 
ATOM   4427  C C   . ILE A 1 600 ? 27.706  18.334  7.715   1.00 41.18  ? 622  ILE A C   1 
ATOM   4428  O O   . ILE A 1 600 ? 28.280  19.008  6.855   1.00 48.64  ? 622  ILE A O   1 
ATOM   4429  C CB  . ILE A 1 600 ? 28.894  16.486  8.884   1.00 36.01  ? 622  ILE A CB  1 
ATOM   4430  C CG1 . ILE A 1 600 ? 29.730  16.100  10.109  1.00 31.77  ? 622  ILE A CG1 1 
ATOM   4431  C CG2 . ILE A 1 600 ? 29.669  16.283  7.583   1.00 33.20  ? 622  ILE A CG2 1 
ATOM   4432  C CD1 . ILE A 1 600 ? 30.251  14.675  10.058  1.00 31.12  ? 622  ILE A CD1 1 
ATOM   4433  N N   . LEU A 1 601 ? 26.456  17.910  7.580   1.00 39.80  ? 623  LEU A N   1 
ATOM   4434  C CA  . LEU A 1 601 ? 25.671  18.196  6.387   1.00 38.80  ? 623  LEU A CA  1 
ATOM   4435  C C   . LEU A 1 601 ? 25.521  19.696  6.155   1.00 40.70  ? 623  LEU A C   1 
ATOM   4436  O O   . LEU A 1 601 ? 25.626  20.176  5.022   1.00 39.82  ? 623  LEU A O   1 
ATOM   4437  C CB  . LEU A 1 601 ? 24.293  17.536  6.497   1.00 37.72  ? 623  LEU A CB  1 
ATOM   4438  C CG  . LEU A 1 601 ? 24.253  16.007  6.427   1.00 35.73  ? 623  LEU A CG  1 
ATOM   4439  C CD1 . LEU A 1 601 ? 22.975  15.463  7.054   1.00 32.33  ? 623  LEU A CD1 1 
ATOM   4440  C CD2 . LEU A 1 601 ? 24.372  15.540  4.979   1.00 33.28  ? 623  LEU A CD2 1 
ATOM   4441  N N   . TRP A 1 602 ? 25.275  20.423  7.243   1.00 43.75  ? 624  TRP A N   1 
ATOM   4442  C CA  . TRP A 1 602 ? 25.073  21.879  7.220   1.00 44.98  ? 624  TRP A CA  1 
ATOM   4443  C C   . TRP A 1 602 ? 26.339  22.702  7.503   1.00 46.06  ? 624  TRP A C   1 
ATOM   4444  O O   . TRP A 1 602 ? 26.256  23.906  7.770   1.00 44.60  ? 624  TRP A O   1 
ATOM   4445  C CB  . TRP A 1 602 ? 23.922  22.307  8.141   1.00 45.29  ? 624  TRP A CB  1 
ATOM   4446  C CG  . TRP A 1 602 ? 22.539  22.010  7.586   1.00 44.90  ? 624  TRP A CG  1 
ATOM   4447  C CD1 . TRP A 1 602 ? 22.202  21.801  6.280   1.00 42.91  ? 624  TRP A CD1 1 
ATOM   4448  C CD2 . TRP A 1 602 ? 21.321  21.883  8.338   1.00 44.93  ? 624  TRP A CD2 1 
ATOM   4449  N NE1 . TRP A 1 602 ? 20.854  21.566  6.170   1.00 41.87  ? 624  TRP A NE1 1 
ATOM   4450  C CE2 . TRP A 1 602 ? 20.291  21.605  7.419   1.00 45.63  ? 624  TRP A CE2 1 
ATOM   4451  C CE3 . TRP A 1 602 ? 21.005  21.979  9.697   1.00 44.50  ? 624  TRP A CE3 1 
ATOM   4452  C CZ2 . TRP A 1 602 ? 18.965  21.419  7.818   1.00 46.93  ? 624  TRP A CZ2 1 
ATOM   4453  C CZ3 . TRP A 1 602 ? 19.694  21.794  10.089  1.00 46.08  ? 624  TRP A CZ3 1 
ATOM   4454  C CH2 . TRP A 1 602 ? 18.689  21.519  9.153   1.00 47.66  ? 624  TRP A CH2 1 
ATOM   4455  N N   . ASN A 1 603 ? 27.492  22.039  7.515   1.00 50.17  ? 625  ASN A N   1 
ATOM   4456  C CA  . ASN A 1 603 ? 28.770  22.719  7.741   1.00 51.50  ? 625  ASN A CA  1 
ATOM   4457  C C   . ASN A 1 603 ? 28.905  23.967  6.870   1.00 54.17  ? 625  ASN A C   1 
ATOM   4458  O O   . ASN A 1 603 ? 28.614  23.936  5.671   1.00 55.78  ? 625  ASN A O   1 
ATOM   4459  C CB  . ASN A 1 603 ? 29.935  21.758  7.466   1.00 49.90  ? 625  ASN A CB  1 
ATOM   4460  C CG  . ASN A 1 603 ? 31.281  22.460  7.424   1.00 51.90  ? 625  ASN A CG  1 
ATOM   4461  O OD1 . ASN A 1 603 ? 31.674  23.012  6.394   1.00 55.01  ? 625  ASN A OD1 1 
ATOM   4462  N ND2 . ASN A 1 603 ? 32.004  22.432  8.541   1.00 48.71  ? 625  ASN A ND2 1 
ATOM   4463  N N   . ASP A 1 604 ? 29.342  25.061  7.495   1.00 55.60  ? 626  ASP A N   1 
ATOM   4464  C CA  . ASP A 1 604 ? 29.392  26.381  6.861   1.00 59.11  ? 626  ASP A CA  1 
ATOM   4465  C C   . ASP A 1 604 ? 30.063  26.413  5.483   1.00 55.08  ? 626  ASP A C   1 
ATOM   4466  O O   . ASP A 1 604 ? 29.645  27.171  4.607   1.00 56.62  ? 626  ASP A O   1 
ATOM   4467  C CB  . ASP A 1 604 ? 30.076  27.392  7.786   1.00 66.81  ? 626  ASP A CB  1 
ATOM   4468  C CG  . ASP A 1 604 ? 29.242  27.736  9.000   1.00 73.25  ? 626  ASP A CG  1 
ATOM   4469  O OD1 . ASP A 1 604 ? 28.085  28.172  8.830   1.00 75.98  ? 626  ASP A OD1 1 
ATOM   4470  O OD2 . ASP A 1 604 ? 29.752  27.579  10.129  1.00 76.57  ? 626  ASP A OD2 1 
ATOM   4471  N N   . ASP A 1 605 ? 31.080  25.579  5.283   1.00 51.75  ? 627  ASP A N   1 
ATOM   4472  C CA  . ASP A 1 605 ? 31.822  25.551  4.016   1.00 53.70  ? 627  ASP A CA  1 
ATOM   4473  C C   . ASP A 1 605 ? 31.131  24.732  2.922   1.00 53.85  ? 627  ASP A C   1 
ATOM   4474  O O   . ASP A 1 605 ? 31.654  24.605  1.810   1.00 52.60  ? 627  ASP A O   1 
ATOM   4475  C CB  . ASP A 1 605 ? 33.241  25.021  4.245   1.00 53.94  ? 627  ASP A CB  1 
ATOM   4476  C CG  . ASP A 1 605 ? 34.005  25.848  5.252   1.00 54.11  ? 627  ASP A CG  1 
ATOM   4477  O OD1 . ASP A 1 605 ? 33.874  27.087  5.207   1.00 55.48  ? 627  ASP A OD1 1 
ATOM   4478  O OD2 . ASP A 1 605 ? 34.718  25.266  6.096   1.00 55.30  ? 627  ASP A OD2 1 
ATOM   4479  N N   . ASP A 1 606 ? 29.967  24.170  3.250   1.00 53.56  ? 628  ASP A N   1 
ATOM   4480  C CA  . ASP A 1 606 ? 29.231  23.311  2.327   1.00 52.17  ? 628  ASP A CA  1 
ATOM   4481  C C   . ASP A 1 606 ? 27.818  23.837  2.070   1.00 52.49  ? 628  ASP A C   1 
ATOM   4482  O O   . ASP A 1 606 ? 27.000  23.940  2.987   1.00 51.75  ? 628  ASP A O   1 
ATOM   4483  C CB  . ASP A 1 606 ? 29.184  21.880  2.874   1.00 48.95  ? 628  ASP A CB  1 
ATOM   4484  C CG  . ASP A 1 606 ? 28.726  20.865  1.839   1.00 47.39  ? 628  ASP A CG  1 
ATOM   4485  O OD1 . ASP A 1 606 ? 28.324  21.264  0.724   1.00 43.98  ? 628  ASP A OD1 1 
ATOM   4486  O OD2 . ASP A 1 606 ? 28.763  19.655  2.152   1.00 47.95  ? 628  ASP A OD2 1 
ATOM   4487  N N   . ASN A 1 607 ? 27.541  24.156  0.810   1.00 52.54  ? 629  ASN A N   1 
ATOM   4488  C CA  . ASN A 1 607 ? 26.235  24.658  0.404   1.00 54.49  ? 629  ASN A CA  1 
ATOM   4489  C C   . ASN A 1 607 ? 25.248  23.573  -0.040  1.00 50.29  ? 629  ASN A C   1 
ATOM   4490  O O   . ASN A 1 607 ? 24.065  23.852  -0.234  1.00 46.43  ? 629  ASN A O   1 
ATOM   4491  C CB  . ASN A 1 607 ? 26.398  25.663  -0.749  1.00 58.53  ? 629  ASN A CB  1 
ATOM   4492  C CG  . ASN A 1 607 ? 26.431  27.104  -0.278  1.00 64.36  ? 629  ASN A CG  1 
ATOM   4493  O OD1 . ASN A 1 607 ? 26.079  27.410  0.859   1.00 66.99  ? 629  ASN A OD1 1 
ATOM   4494  N ND2 . ASN A 1 607 ? 26.844  28.002  -1.161  1.00 66.55  ? 629  ASN A ND2 1 
ATOM   4495  N N   . ARG A 1 608 ? 25.727  22.343  -0.206  1.00 51.03  ? 630  ARG A N   1 
ATOM   4496  C CA  . ARG A 1 608 ? 24.947  21.296  -0.889  1.00 48.79  ? 630  ARG A CA  1 
ATOM   4497  C C   . ARG A 1 608 ? 23.659  20.821  -0.197  1.00 45.65  ? 630  ARG A C   1 
ATOM   4498  O O   . ARG A 1 608 ? 22.697  20.455  -0.866  1.00 44.97  ? 630  ARG A O   1 
ATOM   4499  C CB  . ARG A 1 608 ? 25.839  20.088  -1.204  1.00 46.23  ? 630  ARG A CB  1 
ATOM   4500  C CG  . ARG A 1 608 ? 26.936  20.396  -2.221  1.00 45.90  ? 630  ARG A CG  1 
ATOM   4501  C CD  . ARG A 1 608 ? 27.941  19.259  -2.298  1.00 46.31  ? 630  ARG A CD  1 
ATOM   4502  N NE  . ARG A 1 608 ? 28.508  18.969  -0.983  1.00 45.12  ? 630  ARG A NE  1 
ATOM   4503  C CZ  . ARG A 1 608 ? 29.085  17.821  -0.664  1.00 43.30  ? 630  ARG A CZ  1 
ATOM   4504  N NH1 . ARG A 1 608 ? 29.174  16.857  -1.570  1.00 44.14  ? 630  ARG A NH1 1 
ATOM   4505  N NH2 . ARG A 1 608 ? 29.568  17.636  0.557   1.00 40.92  ? 630  ARG A NH2 1 
ATOM   4506  N N   . TYR A 1 609 ? 23.659  20.787  1.131   1.00 45.81  ? 631  TYR A N   1 
ATOM   4507  C CA  . TYR A 1 609 ? 22.519  20.274  1.902   1.00 45.20  ? 631  TYR A CA  1 
ATOM   4508  C C   . TYR A 1 609 ? 21.539  21.320  2.471   1.00 47.14  ? 631  TYR A C   1 
ATOM   4509  O O   . TYR A 1 609 ? 20.659  20.975  3.253   1.00 45.43  ? 631  TYR A O   1 
ATOM   4510  C CB  . TYR A 1 609 ? 22.993  19.300  2.989   1.00 43.85  ? 631  TYR A CB  1 
ATOM   4511  C CG  . TYR A 1 609 ? 23.788  18.140  2.431   1.00 46.92  ? 631  TYR A CG  1 
ATOM   4512  C CD1 . TYR A 1 609 ? 23.151  17.001  1.946   1.00 45.36  ? 631  TYR A CD1 1 
ATOM   4513  C CD2 . TYR A 1 609 ? 25.179  18.187  2.375   1.00 49.23  ? 631  TYR A CD2 1 
ATOM   4514  C CE1 . TYR A 1 609 ? 23.876  15.939  1.429   1.00 44.91  ? 631  TYR A CE1 1 
ATOM   4515  C CE2 . TYR A 1 609 ? 25.911  17.135  1.856   1.00 49.05  ? 631  TYR A CE2 1 
ATOM   4516  C CZ  . TYR A 1 609 ? 25.256  16.016  1.384   1.00 48.24  ? 631  TYR A CZ  1 
ATOM   4517  O OH  . TYR A 1 609 ? 25.994  14.973  0.876   1.00 48.25  ? 631  TYR A OH  1 
ATOM   4518  N N   . ILE A 1 610 ? 21.706  22.591  2.116   1.00 52.37  ? 632  ILE A N   1 
ATOM   4519  C CA  . ILE A 1 610 ? 20.881  23.653  2.709   1.00 53.80  ? 632  ILE A CA  1 
ATOM   4520  C C   . ILE A 1 610 ? 19.371  23.545  2.432   1.00 54.17  ? 632  ILE A C   1 
ATOM   4521  O O   . ILE A 1 610 ? 18.567  24.121  3.160   1.00 54.12  ? 632  ILE A O   1 
ATOM   4522  C CB  . ILE A 1 610 ? 21.375  25.067  2.310   1.00 56.97  ? 632  ILE A CB  1 
ATOM   4523  C CG1 . ILE A 1 610 ? 21.258  25.281  0.804   1.00 55.67  ? 632  ILE A CG1 1 
ATOM   4524  C CG2 . ILE A 1 610 ? 22.802  25.288  2.769   1.00 58.05  ? 632  ILE A CG2 1 
ATOM   4525  C CD1 . ILE A 1 610 ? 21.415  26.731  0.397   1.00 57.00  ? 632  ILE A CD1 1 
ATOM   4526  N N   . SER A 1 611 ? 19.002  22.845  1.363   1.00 55.42  ? 633  SER A N   1 
ATOM   4527  C CA  . SER A 1 611 ? 17.598  22.584  1.023   1.00 57.04  ? 633  SER A CA  1 
ATOM   4528  C C   . SER A 1 611 ? 17.072  21.208  1.446   1.00 53.68  ? 633  SER A C   1 
ATOM   4529  O O   . SER A 1 611 ? 15.972  20.814  1.046   1.00 52.23  ? 633  SER A O   1 
ATOM   4530  C CB  . SER A 1 611 ? 17.338  22.816  -0.465  1.00 61.16  ? 633  SER A CB  1 
ATOM   4531  O OG  . SER A 1 611 ? 17.385  24.196  -0.762  1.00 65.88  ? 633  SER A OG  1 
ATOM   4532  N N   . ILE A 1 612 ? 17.878  20.473  2.210   1.00 49.79  ? 634  ILE A N   1 
ATOM   4533  C CA  . ILE A 1 612 ? 17.678  19.038  2.401   1.00 44.44  ? 634  ILE A CA  1 
ATOM   4534  C C   . ILE A 1 612 ? 16.248  18.604  2.745   1.00 42.55  ? 634  ILE A C   1 
ATOM   4535  O O   . ILE A 1 612 ? 15.801  17.567  2.270   1.00 40.64  ? 634  ILE A O   1 
ATOM   4536  C CB  . ILE A 1 612 ? 18.687  18.442  3.430   1.00 43.87  ? 634  ILE A CB  1 
ATOM   4537  C CG1 . ILE A 1 612 ? 18.697  16.914  3.358   1.00 39.99  ? 634  ILE A CG1 1 
ATOM   4538  C CG2 . ILE A 1 612 ? 18.388  18.933  4.838   1.00 46.23  ? 634  ILE A CG2 1 
ATOM   4539  C CD1 . ILE A 1 612 ? 19.605  16.251  4.368   1.00 40.57  ? 634  ILE A CD1 1 
ATOM   4540  N N   . PHE A 1 613 ? 15.550  19.366  3.588   1.00 42.47  ? 635  PHE A N   1 
ATOM   4541  C CA  . PHE A 1 613 ? 14.163  19.042  3.937   1.00 44.47  ? 635  PHE A CA  1 
ATOM   4542  C C   . PHE A 1 613 ? 13.096  19.873  3.199   1.00 46.68  ? 635  PHE A C   1 
ATOM   4543  O O   . PHE A 1 613 ? 11.902  19.649  3.376   1.00 47.98  ? 635  PHE A O   1 
ATOM   4544  C CB  . PHE A 1 613 ? 13.957  19.102  5.458   1.00 43.25  ? 635  PHE A CB  1 
ATOM   4545  C CG  . PHE A 1 613 ? 14.983  18.323  6.234   1.00 41.76  ? 635  PHE A CG  1 
ATOM   4546  C CD1 . PHE A 1 613 ? 15.181  16.974  5.984   1.00 40.87  ? 635  PHE A CD1 1 
ATOM   4547  C CD2 . PHE A 1 613 ? 15.759  18.941  7.202   1.00 42.41  ? 635  PHE A CD2 1 
ATOM   4548  C CE1 . PHE A 1 613 ? 16.124  16.255  6.686   1.00 40.58  ? 635  PHE A CE1 1 
ATOM   4549  C CE2 . PHE A 1 613 ? 16.710  18.231  7.910   1.00 39.96  ? 635  PHE A CE2 1 
ATOM   4550  C CZ  . PHE A 1 613 ? 16.894  16.882  7.652   1.00 42.34  ? 635  PHE A CZ  1 
ATOM   4551  N N   . LYS A 1 614 ? 13.525  20.818  2.367   1.00 48.00  ? 636  LYS A N   1 
ATOM   4552  C CA  . LYS A 1 614 ? 12.602  21.783  1.769   1.00 49.37  ? 636  LYS A CA  1 
ATOM   4553  C C   . LYS A 1 614 ? 11.578  21.190  0.798   1.00 47.37  ? 636  LYS A C   1 
ATOM   4554  O O   . LYS A 1 614 ? 10.448  21.674  0.698   1.00 49.61  ? 636  LYS A O   1 
ATOM   4555  C CB  . LYS A 1 614 ? 13.362  22.913  1.076   1.00 52.44  ? 636  LYS A CB  1 
ATOM   4556  C CG  . LYS A 1 614 ? 12.456  24.049  0.637   1.00 52.00  ? 636  LYS A CG  1 
ATOM   4557  C CD  . LYS A 1 614 ? 13.243  25.188  0.032   1.00 55.62  ? 636  LYS A CD  1 
ATOM   4558  C CE  . LYS A 1 614 ? 12.333  26.375  -0.264  1.00 58.41  ? 636  LYS A CE  1 
ATOM   4559  N NZ  . LYS A 1 614 ? 13.028  27.421  -1.058  1.00 61.62  ? 636  LYS A NZ  1 
ATOM   4560  N N   . GLY A 1 615 ? 11.983  20.152  0.078   1.00 43.43  ? 637  GLY A N   1 
ATOM   4561  C CA  . GLY A 1 615 ? 11.101  19.486  -0.858  1.00 45.61  ? 637  GLY A CA  1 
ATOM   4562  C C   . GLY A 1 615 ? 10.141  18.495  -0.222  1.00 51.44  ? 637  GLY A C   1 
ATOM   4563  O O   . GLY A 1 615 ? 9.490   17.722  -0.930  1.00 54.29  ? 637  GLY A O   1 
ATOM   4564  N N   . LEU A 1 616 ? 10.024  18.509  1.103   1.00 50.80  ? 638  LEU A N   1 
ATOM   4565  C CA  . LEU A 1 616 ? 9.011   17.677  1.724   1.00 48.99  ? 638  LEU A CA  1 
ATOM   4566  C C   . LEU A 1 616 ? 7.854   18.626  1.985   1.00 52.80  ? 638  LEU A C   1 
ATOM   4567  O O   . LEU A 1 616 ? 7.813   19.305  3.008   1.00 53.65  ? 638  LEU A O   1 
ATOM   4568  C CB  . LEU A 1 616 ? 9.536   17.123  3.049   1.00 45.21  ? 638  LEU A CB  1 
ATOM   4569  C CG  . LEU A 1 616 ? 10.820  16.278  3.033   1.00 43.72  ? 638  LEU A CG  1 
ATOM   4570  C CD1 . LEU A 1 616 ? 11.343  16.022  4.451   1.00 42.09  ? 638  LEU A CD1 1 
ATOM   4571  C CD2 . LEU A 1 616 ? 10.633  14.952  2.298   1.00 39.67  ? 638  LEU A CD2 1 
ATOM   4572  N N   . LYS A 1 617 ? 6.865   18.584  1.096   1.00 54.35  ? 639  LYS A N   1 
ATOM   4573  C CA  . LYS A 1 617 ? 5.903   19.675  0.963   1.00 57.90  ? 639  LYS A CA  1 
ATOM   4574  C C   . LYS A 1 617 ? 4.775   19.633  1.973   1.00 54.68  ? 639  LYS A C   1 
ATOM   4575  O O   . LYS A 1 617 ? 4.202   20.663  2.324   1.00 58.18  ? 639  LYS A O   1 
ATOM   4576  C CB  . LYS A 1 617 ? 5.333   19.719  -0.456  1.00 62.46  ? 639  LYS A CB  1 
ATOM   4577  C CG  . LYS A 1 617 ? 6.335   20.157  -1.504  1.00 65.10  ? 639  LYS A CG  1 
ATOM   4578  C CD  . LYS A 1 617 ? 6.816   21.567  -1.221  1.00 68.66  ? 639  LYS A CD  1 
ATOM   4579  C CE  . LYS A 1 617 ? 7.628   22.123  -2.378  1.00 70.86  ? 639  LYS A CE  1 
ATOM   4580  N NZ  . LYS A 1 617 ? 8.021   23.547  -2.153  1.00 71.70  ? 639  LYS A NZ  1 
ATOM   4581  N N   . ASN A 1 618 ? 4.451   18.427  2.411   1.00 49.54  ? 640  ASN A N   1 
ATOM   4582  C CA  . ASN A 1 618 ? 3.333   18.191  3.304   1.00 49.69  ? 640  ASN A CA  1 
ATOM   4583  C C   . ASN A 1 618 ? 3.763   18.118  4.772   1.00 48.26  ? 640  ASN A C   1 
ATOM   4584  O O   . ASN A 1 618 ? 2.948   17.843  5.652   1.00 49.00  ? 640  ASN A O   1 
ATOM   4585  C CB  . ASN A 1 618 ? 2.663   16.880  2.902   1.00 49.47  ? 640  ASN A CB  1 
ATOM   4586  C CG  . ASN A 1 618 ? 1.165   16.921  3.042   1.00 50.95  ? 640  ASN A CG  1 
ATOM   4587  O OD1 . ASN A 1 618 ? 0.558   17.995  3.091   1.00 42.43  ? 640  ASN A OD1 1 
ATOM   4588  N ND2 . ASN A 1 618 ? 0.553   15.741  3.071   1.00 53.78  ? 640  ASN A ND2 1 
ATOM   4589  N N   . LEU A 1 619 ? 5.045   18.349  5.029   1.00 45.18  ? 641  LEU A N   1 
ATOM   4590  C CA  . LEU A 1 619 ? 5.627   18.070  6.342   1.00 43.65  ? 641  LEU A CA  1 
ATOM   4591  C C   . LEU A 1 619 ? 5.066   18.937  7.471   1.00 44.78  ? 641  LEU A C   1 
ATOM   4592  O O   . LEU A 1 619 ? 4.971   20.152  7.343   1.00 44.93  ? 641  LEU A O   1 
ATOM   4593  C CB  . LEU A 1 619 ? 7.154   18.178  6.294   1.00 42.91  ? 641  LEU A CB  1 
ATOM   4594  C CG  . LEU A 1 619 ? 7.833   17.228  7.282   1.00 47.83  ? 641  LEU A CG  1 
ATOM   4595  C CD1 . LEU A 1 619 ? 7.729   15.793  6.775   1.00 48.07  ? 641  LEU A CD1 1 
ATOM   4596  C CD2 . LEU A 1 619 ? 9.281   17.615  7.560   1.00 47.36  ? 641  LEU A CD2 1 
ATOM   4597  N N   . THR A 1 620 ? 4.678   18.284  8.564   1.00 45.94  ? 642  THR A N   1 
ATOM   4598  C CA  . THR A 1 620 ? 4.183   18.956  9.770   1.00 49.12  ? 642  THR A CA  1 
ATOM   4599  C C   . THR A 1 620 ? 5.109   18.735  10.978  1.00 54.06  ? 642  THR A C   1 
ATOM   4600  O O   . THR A 1 620 ? 5.477   19.690  11.660  1.00 56.88  ? 642  THR A O   1 
ATOM   4601  C CB  . THR A 1 620 ? 2.700   18.647  10.089  1.00 48.69  ? 642  THR A CB  1 
ATOM   4602  O OG1 . THR A 1 620 ? 2.475   17.237  10.028  1.00 53.54  ? 642  THR A OG1 1 
ATOM   4603  C CG2 . THR A 1 620 ? 1.784   19.352  9.079   1.00 48.11  ? 642  THR A CG2 1 
ATOM   4604  N N   . ARG A 1 621 ? 5.394   17.475  11.301  1.00 52.78  ? 643  ARG A N   1 
ATOM   4605  C CA  . ARG A 1 621 ? 6.334   17.165  12.375  1.00 53.10  ? 643  ARG A CA  1 
ATOM   4606  C C   . ARG A 1 621 ? 7.761   16.855  11.883  1.00 48.64  ? 643  ARG A C   1 
ATOM   4607  O O   . ARG A 1 621 ? 7.968   16.022  10.997  1.00 45.33  ? 643  ARG A O   1 
ATOM   4608  C CB  . ARG A 1 621 ? 5.812   16.013  13.242  1.00 54.20  ? 643  ARG A CB  1 
ATOM   4609  C CG  . ARG A 1 621 ? 6.603   15.811  14.538  1.00 56.84  ? 643  ARG A CG  1 
ATOM   4610  C CD  . ARG A 1 621 ? 6.003   14.709  15.407  1.00 56.58  ? 643  ARG A CD  1 
ATOM   4611  N NE  . ARG A 1 621 ? 6.677   14.570  16.699  1.00 56.66  ? 643  ARG A NE  1 
ATOM   4612  C CZ  . ARG A 1 621 ? 7.715   13.763  16.923  1.00 56.68  ? 643  ARG A CZ  1 
ATOM   4613  N NH1 . ARG A 1 621 ? 8.215   13.030  15.932  1.00 52.41  ? 643  ARG A NH1 1 
ATOM   4614  N NH2 . ARG A 1 621 ? 8.261   13.692  18.138  1.00 55.77  ? 643  ARG A NH2 1 
ATOM   4615  N N   . LEU A 1 622 ? 8.744   17.523  12.479  1.00 45.72  ? 644  LEU A N   1 
ATOM   4616  C CA  . LEU A 1 622 ? 10.141  17.280  12.142  1.00 41.46  ? 644  LEU A CA  1 
ATOM   4617  C C   . LEU A 1 622 ? 11.016  17.169  13.383  1.00 40.57  ? 644  LEU A C   1 
ATOM   4618  O O   . LEU A 1 622 ? 11.006  18.059  14.238  1.00 43.74  ? 644  LEU A O   1 
ATOM   4619  C CB  . LEU A 1 622 ? 10.664  18.391  11.232  1.00 43.23  ? 644  LEU A CB  1 
ATOM   4620  C CG  . LEU A 1 622 ? 12.137  18.325  10.826  1.00 39.97  ? 644  LEU A CG  1 
ATOM   4621  C CD1 . LEU A 1 622 ? 12.446  17.036  10.086  1.00 36.17  ? 644  LEU A CD1 1 
ATOM   4622  C CD2 . LEU A 1 622 ? 12.465  19.522  9.958   1.00 41.57  ? 644  LEU A CD2 1 
ATOM   4623  N N   . ASP A 1 623 ? 11.780  16.076  13.466  1.00 37.80  ? 645  ASP A N   1 
ATOM   4624  C CA  . ASP A 1 623 ? 12.668  15.814  14.600  1.00 35.19  ? 645  ASP A CA  1 
ATOM   4625  C C   . ASP A 1 623 ? 14.147  15.888  14.176  1.00 36.75  ? 645  ASP A C   1 
ATOM   4626  O O   . ASP A 1 623 ? 14.644  15.027  13.439  1.00 30.11  ? 645  ASP A O   1 
ATOM   4627  C CB  . ASP A 1 623 ? 12.343  14.444  15.208  1.00 35.24  ? 645  ASP A CB  1 
ATOM   4628  C CG  . ASP A 1 623 ? 13.006  14.219  16.565  1.00 41.10  ? 645  ASP A CG  1 
ATOM   4629  O OD1 . ASP A 1 623 ? 13.946  14.963  16.898  1.00 43.89  ? 645  ASP A OD1 1 
ATOM   4630  O OD2 . ASP A 1 623 ? 12.594  13.283  17.302  1.00 41.94  ? 645  ASP A OD2 1 
ATOM   4631  N N   . LEU A 1 624 ? 14.813  16.953  14.626  1.00 39.06  ? 646  LEU A N   1 
ATOM   4632  C CA  . LEU A 1 624 ? 16.242  17.228  14.386  1.00 40.72  ? 646  LEU A CA  1 
ATOM   4633  C C   . LEU A 1 624 ? 17.167  16.903  15.564  1.00 44.31  ? 646  LEU A C   1 
ATOM   4634  O O   . LEU A 1 624 ? 18.326  17.331  15.592  1.00 41.61  ? 646  LEU A O   1 
ATOM   4635  C CB  . LEU A 1 624 ? 16.464  18.670  13.928  1.00 40.63  ? 646  LEU A CB  1 
ATOM   4636  C CG  . LEU A 1 624 ? 15.726  19.082  12.655  1.00 40.00  ? 646  LEU A CG  1 
ATOM   4637  C CD1 . LEU A 1 624 ? 16.195  20.448  12.172  1.00 39.04  ? 646  LEU A CD1 1 
ATOM   4638  C CD2 . LEU A 1 624 ? 15.888  18.031  11.570  1.00 39.61  ? 646  LEU A CD2 1 
ATOM   4639  N N   . SER A 1 625 ? 16.623  16.240  16.575  1.00 43.68  ? 647  SER A N   1 
ATOM   4640  C CA  . SER A 1 625 ? 17.351  15.991  17.812  1.00 40.87  ? 647  SER A CA  1 
ATOM   4641  C C   . SER A 1 625 ? 18.610  15.156  17.586  1.00 40.37  ? 647  SER A C   1 
ATOM   4642  O O   . SER A 1 625 ? 18.740  14.488  16.567  1.00 41.48  ? 647  SER A O   1 
ATOM   4643  C CB  . SER A 1 625 ? 16.442  15.284  18.827  1.00 37.60  ? 647  SER A CB  1 
ATOM   4644  O OG  . SER A 1 625 ? 16.084  13.979  18.390  1.00 32.62  ? 647  SER A OG  1 
ATOM   4645  N N   . LEU A 1 626 ? 19.548  15.240  18.527  1.00 36.08  ? 648  LEU A N   1 
ATOM   4646  C CA  . LEU A 1 626 ? 20.721  14.364  18.546  1.00 33.32  ? 648  LEU A CA  1 
ATOM   4647  C C   . LEU A 1 626 ? 21.541  14.449  17.240  1.00 31.93  ? 648  LEU A C   1 
ATOM   4648  O O   . LEU A 1 626 ? 21.989  13.439  16.699  1.00 30.55  ? 648  LEU A O   1 
ATOM   4649  C CB  . LEU A 1 626 ? 20.309  12.919  18.872  1.00 31.17  ? 648  LEU A CB  1 
ATOM   4650  C CG  . LEU A 1 626 ? 19.710  12.643  20.264  1.00 35.77  ? 648  LEU A CG  1 
ATOM   4651  C CD1 . LEU A 1 626 ? 19.367  11.166  20.472  1.00 26.65  ? 648  LEU A CD1 1 
ATOM   4652  C CD2 . LEU A 1 626 ? 20.647  13.089  21.368  1.00 39.74  ? 648  LEU A CD2 1 
ATOM   4653  N N   . ASN A 1 627 ? 21.640  15.662  16.705  1.00 30.73  ? 649  ASN A N   1 
ATOM   4654  C CA  . ASN A 1 627 ? 22.474  15.968  15.543  1.00 36.63  ? 649  ASN A CA  1 
ATOM   4655  C C   . ASN A 1 627 ? 23.818  16.679  15.782  1.00 39.51  ? 649  ASN A C   1 
ATOM   4656  O O   . ASN A 1 627 ? 24.469  17.079  14.823  1.00 40.40  ? 649  ASN A O   1 
ATOM   4657  C CB  . ASN A 1 627 ? 21.647  16.647  14.445  1.00 39.61  ? 649  ASN A CB  1 
ATOM   4658  C CG  . ASN A 1 627 ? 20.905  15.642  13.597  1.00 40.75  ? 649  ASN A CG  1 
ATOM   4659  O OD1 . ASN A 1 627 ? 21.365  15.262  12.514  1.00 41.86  ? 649  ASN A OD1 1 
ATOM   4660  N ND2 . ASN A 1 627 ? 19.778  15.155  14.112  1.00 37.36  ? 649  ASN A ND2 1 
ATOM   4661  N N   . ARG A 1 628 ? 24.187  16.896  17.046  1.00 42.71  ? 650  ARG A N   1 
ATOM   4662  C CA  . ARG A 1 628 ? 25.452  17.565  17.392  1.00 42.44  ? 650  ARG A CA  1 
ATOM   4663  C C   . ARG A 1 628 ? 25.539  18.978  16.804  1.00 44.04  ? 650  ARG A C   1 
ATOM   4664  O O   . ARG A 1 628 ? 26.623  19.453  16.465  1.00 41.06  ? 650  ARG A O   1 
ATOM   4665  C CB  . ARG A 1 628 ? 26.647  16.731  16.925  1.00 42.39  ? 650  ARG A CB  1 
ATOM   4666  C CG  . ARG A 1 628 ? 26.577  15.295  17.398  1.00 45.28  ? 650  ARG A CG  1 
ATOM   4667  C CD  . ARG A 1 628 ? 27.596  14.381  16.718  1.00 51.55  ? 650  ARG A CD  1 
ATOM   4668  N NE  . ARG A 1 628 ? 27.746  13.146  17.484  1.00 59.66  ? 650  ARG A NE  1 
ATOM   4669  C CZ  . ARG A 1 628 ? 28.211  11.995  17.007  1.00 64.38  ? 650  ARG A CZ  1 
ATOM   4670  N NH1 . ARG A 1 628 ? 28.567  11.889  15.741  1.00 67.45  ? 650  ARG A NH1 1 
ATOM   4671  N NH2 . ARG A 1 628 ? 28.308  10.936  17.799  1.00 65.67  ? 650  ARG A NH2 1 
ATOM   4672  N N   . LEU A 1 629 ? 24.389  19.638  16.671  1.00 47.78  ? 651  LEU A N   1 
ATOM   4673  C CA  . LEU A 1 629 ? 24.336  20.978  16.091  1.00 46.77  ? 651  LEU A CA  1 
ATOM   4674  C C   . LEU A 1 629 ? 24.729  22.020  17.125  1.00 46.94  ? 651  LEU A C   1 
ATOM   4675  O O   . LEU A 1 629 ? 24.130  22.083  18.200  1.00 43.97  ? 651  LEU A O   1 
ATOM   4676  C CB  . LEU A 1 629 ? 22.928  21.265  15.564  1.00 45.88  ? 651  LEU A CB  1 
ATOM   4677  C CG  . LEU A 1 629 ? 22.567  20.462  14.313  1.00 47.25  ? 651  LEU A CG  1 
ATOM   4678  C CD1 . LEU A 1 629 ? 21.073  20.457  14.060  1.00 48.74  ? 651  LEU A CD1 1 
ATOM   4679  C CD2 . LEU A 1 629 ? 23.301  21.049  13.121  1.00 47.97  ? 651  LEU A CD2 1 
ATOM   4680  N N   . LYS A 1 630 ? 25.768  22.793  16.819  1.00 50.19  ? 652  LYS A N   1 
ATOM   4681  C CA  . LYS A 1 630 ? 26.150  23.942  17.634  1.00 55.82  ? 652  LYS A CA  1 
ATOM   4682  C C   . LYS A 1 630 ? 25.420  25.191  17.162  1.00 56.72  ? 652  LYS A C   1 
ATOM   4683  O O   . LYS A 1 630 ? 25.323  26.183  17.888  1.00 55.22  ? 652  LYS A O   1 
ATOM   4684  C CB  . LYS A 1 630 ? 27.663  24.166  17.565  1.00 59.13  ? 652  LYS A CB  1 
ATOM   4685  C CG  . LYS A 1 630 ? 28.479  23.036  18.157  1.00 60.72  ? 652  LYS A CG  1 
ATOM   4686  C CD  . LYS A 1 630 ? 29.954  23.244  17.878  1.00 65.60  ? 652  LYS A CD  1 
ATOM   4687  C CE  . LYS A 1 630 ? 30.823  22.411  18.806  1.00 67.74  ? 652  LYS A CE  1 
ATOM   4688  N NZ  . LYS A 1 630 ? 30.499  20.958  18.730  1.00 68.95  ? 652  LYS A NZ  1 
ATOM   4689  N N   . HIS A 1 631 ? 24.900  25.113  15.941  1.00 59.61  ? 653  HIS A N   1 
ATOM   4690  C CA  . HIS A 1 631 ? 24.079  26.165  15.353  1.00 61.91  ? 653  HIS A CA  1 
ATOM   4691  C C   . HIS A 1 631 ? 23.619  25.750  13.965  1.00 57.00  ? 653  HIS A C   1 
ATOM   4692  O O   . HIS A 1 631 ? 24.243  24.913  13.312  1.00 55.52  ? 653  HIS A O   1 
ATOM   4693  C CB  . HIS A 1 631 ? 24.848  27.488  15.247  1.00 68.11  ? 653  HIS A CB  1 
ATOM   4694  C CG  . HIS A 1 631 ? 26.022  27.438  14.318  1.00 71.49  ? 653  HIS A CG  1 
ATOM   4695  N ND1 . HIS A 1 631 ? 25.905  27.627  12.958  1.00 72.80  ? 653  HIS A ND1 1 
ATOM   4696  C CD2 . HIS A 1 631 ? 27.338  27.227  14.556  1.00 72.91  ? 653  HIS A CD2 1 
ATOM   4697  C CE1 . HIS A 1 631 ? 27.097  27.531  12.397  1.00 72.93  ? 653  HIS A CE1 1 
ATOM   4698  N NE2 . HIS A 1 631 ? 27.984  27.287  13.345  1.00 73.56  ? 653  HIS A NE2 1 
ATOM   4699  N N   . ILE A 1 632 ? 22.531  26.365  13.520  1.00 54.12  ? 654  ILE A N   1 
ATOM   4700  C CA  . ILE A 1 632 ? 21.970  26.128  12.202  1.00 50.96  ? 654  ILE A CA  1 
ATOM   4701  C C   . ILE A 1 632 ? 22.134  27.386  11.367  1.00 51.79  ? 654  ILE A C   1 
ATOM   4702  O O   . ILE A 1 632 ? 21.715  28.465  11.793  1.00 52.91  ? 654  ILE A O   1 
ATOM   4703  C CB  . ILE A 1 632 ? 20.480  25.764  12.288  1.00 47.19  ? 654  ILE A CB  1 
ATOM   4704  C CG1 . ILE A 1 632 ? 20.249  24.742  13.404  1.00 45.72  ? 654  ILE A CG1 1 
ATOM   4705  C CG2 . ILE A 1 632 ? 19.983  25.240  10.957  1.00 43.86  ? 654  ILE A CG2 1 
ATOM   4706  C CD1 . ILE A 1 632 ? 18.812  24.352  13.568  1.00 46.29  ? 654  ILE A CD1 1 
ATOM   4707  N N   . PRO A 1 633 ? 22.766  27.265  10.185  1.00 49.54  ? 655  PRO A N   1 
ATOM   4708  C CA  . PRO A 1 633 ? 22.896  28.458  9.340   1.00 52.09  ? 655  PRO A CA  1 
ATOM   4709  C C   . PRO A 1 633 ? 21.516  29.027  9.022   1.00 57.94  ? 655  PRO A C   1 
ATOM   4710  O O   . PRO A 1 633 ? 20.545  28.269  8.879   1.00 57.34  ? 655  PRO A O   1 
ATOM   4711  C CB  . PRO A 1 633 ? 23.577  27.927  8.076   1.00 49.18  ? 655  PRO A CB  1 
ATOM   4712  C CG  . PRO A 1 633 ? 24.274  26.667  8.519   1.00 46.48  ? 655  PRO A CG  1 
ATOM   4713  C CD  . PRO A 1 633 ? 23.380  26.073  9.574   1.00 45.01  ? 655  PRO A CD  1 
ATOM   4714  N N   . ASN A 1 634 ? 21.441  30.353  8.951   1.00 60.16  ? 656  ASN A N   1 
ATOM   4715  C CA  . ASN A 1 634 ? 20.186  31.063  8.749   1.00 61.39  ? 656  ASN A CA  1 
ATOM   4716  C C   . ASN A 1 634 ? 19.414  30.580  7.530   1.00 64.04  ? 656  ASN A C   1 
ATOM   4717  O O   . ASN A 1 634 ? 18.207  30.367  7.606   1.00 65.88  ? 656  ASN A O   1 
ATOM   4718  C CB  . ASN A 1 634 ? 20.431  32.573  8.653   1.00 62.33  ? 656  ASN A CB  1 
ATOM   4719  C CG  . ASN A 1 634 ? 20.868  33.179  9.972   1.00 66.16  ? 656  ASN A CG  1 
ATOM   4720  O OD1 . ASN A 1 634 ? 20.345  32.835  11.030  1.00 66.16  ? 656  ASN A OD1 1 
ATOM   4721  N ND2 . ASN A 1 634 ? 21.832  34.093  9.916   1.00 69.37  ? 656  ASN A ND2 1 
ATOM   4722  N N   . GLU A 1 635 ? 20.105  30.398  6.408   1.00 64.02  ? 657  GLU A N   1 
ATOM   4723  C CA  . GLU A 1 635 ? 19.421  29.990  5.184   1.00 67.23  ? 657  GLU A CA  1 
ATOM   4724  C C   . GLU A 1 635 ? 18.940  28.545  5.259   1.00 60.90  ? 657  GLU A C   1 
ATOM   4725  O O   . GLU A 1 635 ? 17.937  28.191  4.646   1.00 61.55  ? 657  GLU A O   1 
ATOM   4726  C CB  . GLU A 1 635 ? 20.295  30.201  3.944   1.00 77.13  ? 657  GLU A CB  1 
ATOM   4727  C CG  . GLU A 1 635 ? 21.541  29.330  3.890   1.00 84.13  ? 657  GLU A CG  1 
ATOM   4728  C CD  . GLU A 1 635 ? 22.804  30.126  4.169   1.00 90.84  ? 657  GLU A CD  1 
ATOM   4729  O OE1 . GLU A 1 635 ? 22.830  30.840  5.195   1.00 93.25  ? 657  GLU A OE1 1 
ATOM   4730  O OE2 . GLU A 1 635 ? 23.757  30.056  3.357   1.00 92.64  ? 657  GLU A OE2 1 
ATOM   4731  N N   . ALA A 1 636 ? 19.644  27.716  6.022   1.00 54.89  ? 658  ALA A N   1 
ATOM   4732  C CA  . ALA A 1 636 ? 19.231  26.338  6.196   1.00 53.20  ? 658  ALA A CA  1 
ATOM   4733  C C   . ALA A 1 636 ? 17.977  26.253  7.061   1.00 55.12  ? 658  ALA A C   1 
ATOM   4734  O O   . ALA A 1 636 ? 17.107  25.423  6.814   1.00 57.90  ? 658  ALA A O   1 
ATOM   4735  C CB  . ALA A 1 636 ? 20.352  25.522  6.805   1.00 52.99  ? 658  ALA A CB  1 
ATOM   4736  N N   . PHE A 1 637 ? 17.889  27.100  8.081   1.00 53.34  ? 659  PHE A N   1 
ATOM   4737  C CA  . PHE A 1 637 ? 16.685  27.132  8.898   1.00 50.56  ? 659  PHE A CA  1 
ATOM   4738  C C   . PHE A 1 637 ? 15.514  27.669  8.077   1.00 50.64  ? 659  PHE A C   1 
ATOM   4739  O O   . PHE A 1 637 ? 14.387  27.193  8.197   1.00 50.73  ? 659  PHE A O   1 
ATOM   4740  C CB  . PHE A 1 637 ? 16.879  27.973  10.163  1.00 47.74  ? 659  PHE A CB  1 
ATOM   4741  C CG  . PHE A 1 637 ? 15.814  27.747  11.201  1.00 44.00  ? 659  PHE A CG  1 
ATOM   4742  C CD1 . PHE A 1 637 ? 14.636  28.470  11.178  1.00 46.61  ? 659  PHE A CD1 1 
ATOM   4743  C CD2 . PHE A 1 637 ? 15.986  26.799  12.186  1.00 44.35  ? 659  PHE A CD2 1 
ATOM   4744  C CE1 . PHE A 1 637 ? 13.650  28.253  12.128  1.00 47.15  ? 659  PHE A CE1 1 
ATOM   4745  C CE2 . PHE A 1 637 ? 15.012  26.577  13.133  1.00 44.94  ? 659  PHE A CE2 1 
ATOM   4746  C CZ  . PHE A 1 637 ? 13.843  27.307  13.108  1.00 46.02  ? 659  PHE A CZ  1 
ATOM   4747  N N   . LEU A 1 638 ? 15.790  28.659  7.239   1.00 53.09  ? 660  LEU A N   1 
ATOM   4748  C CA  . LEU A 1 638 ? 14.762  29.252  6.390   1.00 53.33  ? 660  LEU A CA  1 
ATOM   4749  C C   . LEU A 1 638 ? 14.248  28.248  5.374   1.00 53.86  ? 660  LEU A C   1 
ATOM   4750  O O   . LEU A 1 638 ? 13.143  28.383  4.859   1.00 54.20  ? 660  LEU A O   1 
ATOM   4751  C CB  . LEU A 1 638 ? 15.310  30.474  5.663   1.00 54.86  ? 660  LEU A CB  1 
ATOM   4752  C CG  . LEU A 1 638 ? 15.507  31.712  6.530   1.00 59.74  ? 660  LEU A CG  1 
ATOM   4753  C CD1 . LEU A 1 638 ? 15.886  32.910  5.672   1.00 57.84  ? 660  LEU A CD1 1 
ATOM   4754  C CD2 . LEU A 1 638 ? 14.243  31.994  7.334   1.00 64.12  ? 660  LEU A CD2 1 
ATOM   4755  N N   . ASN A 1 639 ? 15.059  27.235  5.089   1.00 56.25  ? 661  ASN A N   1 
ATOM   4756  C CA  . ASN A 1 639 ? 14.687  26.223  4.111   1.00 58.21  ? 661  ASN A CA  1 
ATOM   4757  C C   . ASN A 1 639 ? 13.966  25.006  4.684   1.00 56.71  ? 661  ASN A C   1 
ATOM   4758  O O   . ASN A 1 639 ? 13.739  24.027  3.980   1.00 56.28  ? 661  ASN A O   1 
ATOM   4759  C CB  . ASN A 1 639 ? 15.886  25.810  3.260   1.00 58.41  ? 661  ASN A CB  1 
ATOM   4760  C CG  . ASN A 1 639 ? 16.242  26.859  2.224   1.00 60.30  ? 661  ASN A CG  1 
ATOM   4761  O OD1 . ASN A 1 639 ? 15.403  27.680  1.837   1.00 61.68  ? 661  ASN A OD1 1 
ATOM   4762  N ND2 . ASN A 1 639 ? 17.491  26.840  1.770   1.00 59.36  ? 661  ASN A ND2 1 
ATOM   4763  N N   . LEU A 1 640 ? 13.637  25.049  5.969   1.00 56.40  ? 662  LEU A N   1 
ATOM   4764  C CA  . LEU A 1 640 ? 12.730  24.053  6.525   1.00 54.28  ? 662  LEU A CA  1 
ATOM   4765  C C   . LEU A 1 640 ? 11.336  24.305  5.950   1.00 54.40  ? 662  LEU A C   1 
ATOM   4766  O O   . LEU A 1 640 ? 10.970  25.456  5.703   1.00 57.48  ? 662  LEU A O   1 
ATOM   4767  C CB  . LEU A 1 640 ? 12.707  24.131  8.052   1.00 52.17  ? 662  LEU A CB  1 
ATOM   4768  C CG  . LEU A 1 640 ? 14.005  23.733  8.750   1.00 47.18  ? 662  LEU A CG  1 
ATOM   4769  C CD1 . LEU A 1 640 ? 13.804  23.695  10.257  1.00 44.73  ? 662  LEU A CD1 1 
ATOM   4770  C CD2 . LEU A 1 640 ? 14.501  22.389  8.227   1.00 44.12  ? 662  LEU A CD2 1 
ATOM   4771  N N   . PRO A 1 641 ? 10.563  23.232  5.717   1.00 49.39  ? 663  PRO A N   1 
ATOM   4772  C CA  . PRO A 1 641 ? 9.224   23.351  5.123   1.00 47.63  ? 663  PRO A CA  1 
ATOM   4773  C C   . PRO A 1 641 ? 8.359   24.364  5.857   1.00 51.91  ? 663  PRO A C   1 
ATOM   4774  O O   . PRO A 1 641 ? 8.315   24.377  7.090   1.00 53.94  ? 663  PRO A O   1 
ATOM   4775  C CB  . PRO A 1 641 ? 8.641   21.944  5.294   1.00 44.00  ? 663  PRO A CB  1 
ATOM   4776  C CG  . PRO A 1 641 ? 9.820   21.062  5.281   1.00 44.29  ? 663  PRO A CG  1 
ATOM   4777  C CD  . PRO A 1 641 ? 10.916  21.829  5.984   1.00 44.95  ? 663  PRO A CD  1 
ATOM   4778  N N   . ALA A 1 642 ? 7.680   25.209  5.093   1.00 54.27  ? 664  ALA A N   1 
ATOM   4779  C CA  . ALA A 1 642 ? 6.858   26.268  5.654   1.00 53.30  ? 664  ALA A CA  1 
ATOM   4780  C C   . ALA A 1 642 ? 5.675   25.710  6.445   1.00 53.01  ? 664  ALA A C   1 
ATOM   4781  O O   . ALA A 1 642 ? 5.078   26.412  7.261   1.00 53.58  ? 664  ALA A O   1 
ATOM   4782  C CB  . ALA A 1 642 ? 6.371   27.194  4.539   1.00 54.38  ? 664  ALA A CB  1 
ATOM   4783  N N   . SER A 1 643 ? 5.353   24.442  6.215   1.00 51.98  ? 665  SER A N   1 
ATOM   4784  C CA  . SER A 1 643 ? 4.129   23.856  6.756   1.00 52.95  ? 665  SER A CA  1 
ATOM   4785  C C   . SER A 1 643 ? 4.266   23.260  8.153   1.00 52.86  ? 665  SER A C   1 
ATOM   4786  O O   . SER A 1 643 ? 3.301   22.710  8.680   1.00 51.56  ? 665  SER A O   1 
ATOM   4787  C CB  . SER A 1 643 ? 3.612   22.776  5.812   1.00 50.67  ? 665  SER A CB  1 
ATOM   4788  O OG  . SER A 1 643 ? 4.573   21.746  5.678   1.00 49.18  ? 665  SER A OG  1 
ATOM   4789  N N   . LEU A 1 644 ? 5.450   23.355  8.751   1.00 54.74  ? 666  LEU A N   1 
ATOM   4790  C CA  . LEU A 1 644 ? 5.696   22.685  10.028  1.00 53.84  ? 666  LEU A CA  1 
ATOM   4791  C C   . LEU A 1 644 ? 4.808   23.233  11.136  1.00 53.59  ? 666  LEU A C   1 
ATOM   4792  O O   . LEU A 1 644 ? 4.759   24.444  11.365  1.00 56.81  ? 666  LEU A O   1 
ATOM   4793  C CB  . LEU A 1 644 ? 7.160   22.841  10.439  1.00 56.60  ? 666  LEU A CB  1 
ATOM   4794  C CG  . LEU A 1 644 ? 8.259   22.175  9.610   1.00 54.82  ? 666  LEU A CG  1 
ATOM   4795  C CD1 . LEU A 1 644 ? 9.624   22.581  10.141  1.00 53.22  ? 666  LEU A CD1 1 
ATOM   4796  C CD2 . LEU A 1 644 ? 8.101   20.674  9.644   1.00 54.85  ? 666  LEU A CD2 1 
ATOM   4797  N N   . THR A 1 645 ? 4.048   22.352  11.776  1.00 49.79  ? 667  THR A N   1 
ATOM   4798  C CA  . THR A 1 645 ? 3.390   22.698  13.034  1.00 50.32  ? 667  THR A CA  1 
ATOM   4799  C C   . THR A 1 645 ? 4.275   22.447  14.258  1.00 50.67  ? 667  THR A C   1 
ATOM   4800  O O   . THR A 1 645 ? 4.200   23.171  15.249  1.00 56.16  ? 667  THR A O   1 
ATOM   4801  C CB  . THR A 1 645 ? 2.005   22.026  13.195  1.00 49.98  ? 667  THR A CB  1 
ATOM   4802  O OG1 . THR A 1 645 ? 2.161   20.615  13.386  1.00 52.35  ? 667  THR A OG1 1 
ATOM   4803  C CG2 . THR A 1 645 ? 1.145   22.299  11.971  1.00 48.58  ? 667  THR A CG2 1 
ATOM   4804  N N   . GLU A 1 646 ? 5.090   21.400  14.180  1.00 47.29  ? 668  GLU A N   1 
ATOM   4805  C CA  . GLU A 1 646 ? 5.837   20.899  15.325  1.00 48.59  ? 668  GLU A CA  1 
ATOM   4806  C C   . GLU A 1 646 ? 7.304   20.633  14.942  1.00 48.05  ? 668  GLU A C   1 
ATOM   4807  O O   . GLU A 1 646 ? 7.580   19.787  14.090  1.00 44.44  ? 668  GLU A O   1 
ATOM   4808  C CB  . GLU A 1 646 ? 5.158   19.615  15.832  1.00 49.85  ? 668  GLU A CB  1 
ATOM   4809  C CG  . GLU A 1 646 ? 5.779   18.978  17.068  1.00 53.84  ? 668  GLU A CG  1 
ATOM   4810  C CD  . GLU A 1 646 ? 5.194   17.594  17.402  1.00 53.78  ? 668  GLU A CD  1 
ATOM   4811  O OE1 . GLU A 1 646 ? 4.086   17.257  16.932  1.00 53.36  ? 668  GLU A OE1 1 
ATOM   4812  O OE2 . GLU A 1 646 ? 5.854   16.837  18.139  1.00 53.74  ? 668  GLU A OE2 1 
ATOM   4813  N N   . LEU A 1 647 ? 8.239   21.349  15.573  1.00 49.46  ? 669  LEU A N   1 
ATOM   4814  C CA  . LEU A 1 647 ? 9.677   21.185  15.286  1.00 45.35  ? 669  LEU A CA  1 
ATOM   4815  C C   . LEU A 1 647 ? 10.516  20.895  16.533  1.00 43.81  ? 669  LEU A C   1 
ATOM   4816  O O   . LEU A 1 647 ? 10.574  21.722  17.442  1.00 45.86  ? 669  LEU A O   1 
ATOM   4817  C CB  . LEU A 1 647 ? 10.224  22.442  14.592  1.00 42.03  ? 669  LEU A CB  1 
ATOM   4818  C CG  . LEU A 1 647 ? 11.748  22.603  14.440  1.00 41.46  ? 669  LEU A CG  1 
ATOM   4819  C CD1 . LEU A 1 647 ? 12.350  21.518  13.568  1.00 37.19  ? 669  LEU A CD1 1 
ATOM   4820  C CD2 . LEU A 1 647 ? 12.083  23.963  13.850  1.00 44.52  ? 669  LEU A CD2 1 
ATOM   4821  N N   . HIS A 1 648 ? 11.182  19.739  16.566  1.00 43.63  ? 670  HIS A N   1 
ATOM   4822  C CA  . HIS A 1 648 ? 12.067  19.388  17.686  1.00 43.76  ? 670  HIS A CA  1 
ATOM   4823  C C   . HIS A 1 648 ? 13.569  19.498  17.352  1.00 44.06  ? 670  HIS A C   1 
ATOM   4824  O O   . HIS A 1 648 ? 14.102  18.713  16.567  1.00 44.10  ? 670  HIS A O   1 
ATOM   4825  C CB  . HIS A 1 648 ? 11.780  17.962  18.187  1.00 44.25  ? 670  HIS A CB  1 
ATOM   4826  C CG  . HIS A 1 648 ? 10.366  17.734  18.634  1.00 48.49  ? 670  HIS A CG  1 
ATOM   4827  N ND1 . HIS A 1 648 ? 10.011  17.638  19.962  1.00 50.96  ? 670  HIS A ND1 1 
ATOM   4828  C CD2 . HIS A 1 648 ? 9.224   17.554  17.926  1.00 49.92  ? 670  HIS A CD2 1 
ATOM   4829  C CE1 . HIS A 1 648 ? 8.710   17.422  20.054  1.00 53.43  ? 670  HIS A CE1 1 
ATOM   4830  N NE2 . HIS A 1 648 ? 8.210   17.365  18.833  1.00 52.02  ? 670  HIS A NE2 1 
ATOM   4831  N N   . ILE A 1 649 ? 14.243  20.489  17.926  1.00 45.44  ? 671  ILE A N   1 
ATOM   4832  C CA  . ILE A 1 649 ? 15.713  20.570  17.870  1.00 45.39  ? 671  ILE A CA  1 
ATOM   4833  C C   . ILE A 1 649 ? 16.444  20.127  19.145  1.00 49.40  ? 671  ILE A C   1 
ATOM   4834  O O   . ILE A 1 649 ? 17.633  20.395  19.324  1.00 49.70  ? 671  ILE A O   1 
ATOM   4835  C CB  . ILE A 1 649 ? 16.235  21.910  17.351  1.00 43.82  ? 671  ILE A CB  1 
ATOM   4836  C CG1 . ILE A 1 649 ? 15.158  22.615  16.519  1.00 40.28  ? 671  ILE A CG1 1 
ATOM   4837  C CG2 . ILE A 1 649 ? 17.505  21.677  16.531  1.00 42.46  ? 671  ILE A CG2 1 
ATOM   4838  C CD1 . ILE A 1 649 ? 15.607  23.936  15.913  1.00 37.93  ? 671  ILE A CD1 1 
ATOM   4839  N N   . ASN A 1 650 ? 15.704  19.520  20.060  1.00 49.75  ? 672  ASN A N   1 
ATOM   4840  C CA  . ASN A 1 650 ? 16.219  19.175  21.376  1.00 47.81  ? 672  ASN A CA  1 
ATOM   4841  C C   . ASN A 1 650 ? 17.457  18.265  21.404  1.00 46.97  ? 672  ASN A C   1 
ATOM   4842  O O   . ASN A 1 650 ? 17.706  17.506  20.473  1.00 47.11  ? 672  ASN A O   1 
ATOM   4843  C CB  . ASN A 1 650 ? 15.103  18.545  22.204  1.00 48.19  ? 672  ASN A CB  1 
ATOM   4844  C CG  . ASN A 1 650 ? 14.681  17.196  21.668  1.00 45.48  ? 672  ASN A CG  1 
ATOM   4845  O OD1 . ASN A 1 650 ? 14.138  17.096  20.563  1.00 46.84  ? 672  ASN A OD1 1 
ATOM   4846  N ND2 . ASN A 1 650 ? 14.923  16.146  22.449  1.00 41.17  ? 672  ASN A ND2 1 
ATOM   4847  N N   . ASP A 1 651 ? 18.238  18.380  22.479  1.00 46.39  ? 673  ASP A N   1 
ATOM   4848  C CA  . ASP A 1 651 ? 19.442  17.560  22.705  1.00 42.11  ? 673  ASP A CA  1 
ATOM   4849  C C   . ASP A 1 651 ? 20.434  17.615  21.555  1.00 38.45  ? 673  ASP A C   1 
ATOM   4850  O O   . ASP A 1 651 ? 20.885  16.591  21.025  1.00 34.76  ? 673  ASP A O   1 
ATOM   4851  C CB  . ASP A 1 651 ? 19.094  16.118  23.088  1.00 41.64  ? 673  ASP A CB  1 
ATOM   4852  C CG  . ASP A 1 651 ? 18.313  16.042  24.383  1.00 46.28  ? 673  ASP A CG  1 
ATOM   4853  O OD1 . ASP A 1 651 ? 18.746  16.655  25.381  1.00 48.93  ? 673  ASP A OD1 1 
ATOM   4854  O OD2 . ASP A 1 651 ? 17.250  15.393  24.397  1.00 49.00  ? 673  ASP A OD2 1 
ATOM   4855  N N   . ASN A 1 652 ? 20.734  18.847  21.180  1.00 40.63  ? 674  ASN A N   1 
ATOM   4856  C CA  . ASN A 1 652 ? 21.844  19.190  20.321  1.00 44.69  ? 674  ASN A CA  1 
ATOM   4857  C C   . ASN A 1 652 ? 22.799  20.002  21.178  1.00 48.09  ? 674  ASN A C   1 
ATOM   4858  O O   . ASN A 1 652 ? 22.680  20.001  22.394  1.00 46.12  ? 674  ASN A O   1 
ATOM   4859  C CB  . ASN A 1 652 ? 21.377  20.000  19.115  1.00 44.35  ? 674  ASN A CB  1 
ATOM   4860  C CG  . ASN A 1 652 ? 20.735  19.134  18.058  1.00 44.17  ? 674  ASN A CG  1 
ATOM   4861  O OD1 . ASN A 1 652 ? 21.427  18.442  17.308  1.00 44.38  ? 674  ASN A OD1 1 
ATOM   4862  N ND2 . ASN A 1 652 ? 19.404  19.156  17.997  1.00 41.66  ? 674  ASN A ND2 1 
ATOM   4863  N N   . MET A 1 653 ? 23.808  20.588  20.549  1.00 52.09  ? 675  MET A N   1 
ATOM   4864  C CA  . MET A 1 653 ? 24.744  21.505  21.205  1.00 52.76  ? 675  MET A CA  1 
ATOM   4865  C C   . MET A 1 653 ? 24.503  23.014  20.995  1.00 55.50  ? 675  MET A C   1 
ATOM   4866  O O   . MET A 1 653 ? 25.410  23.808  21.227  1.00 57.89  ? 675  MET A O   1 
ATOM   4867  C CB  . MET A 1 653 ? 26.195  21.090  20.951  1.00 51.19  ? 675  MET A CB  1 
ATOM   4868  C CG  . MET A 1 653 ? 26.518  19.729  21.569  1.00 49.93  ? 675  MET A CG  1 
ATOM   4869  S SD  . MET A 1 653 ? 28.146  19.099  21.128  1.00 102.23 ? 675  MET A SD  1 
ATOM   4870  C CE  . MET A 1 653 ? 29.194  20.354  21.878  1.00 64.43  ? 675  MET A CE  1 
ATOM   4871  N N   . LEU A 1 654 ? 23.330  23.390  20.479  1.00 55.61  ? 676  LEU A N   1 
ATOM   4872  C CA  . LEU A 1 654 ? 23.087  24.747  19.976  1.00 58.47  ? 676  LEU A CA  1 
ATOM   4873  C C   . LEU A 1 654 ? 23.450  25.875  20.949  1.00 62.16  ? 676  LEU A C   1 
ATOM   4874  O O   . LEU A 1 654 ? 22.938  25.942  22.068  1.00 62.43  ? 676  LEU A O   1 
ATOM   4875  C CB  . LEU A 1 654 ? 21.607  24.905  19.618  1.00 60.36  ? 676  LEU A CB  1 
ATOM   4876  C CG  . LEU A 1 654 ? 20.980  24.022  18.539  1.00 58.72  ? 676  LEU A CG  1 
ATOM   4877  C CD1 . LEU A 1 654 ? 19.463  24.176  18.567  1.00 60.23  ? 676  LEU A CD1 1 
ATOM   4878  C CD2 . LEU A 1 654 ? 21.522  24.386  17.174  1.00 55.90  ? 676  LEU A CD2 1 
ATOM   4879  N N   . LYS A 1 655 ? 24.333  26.761  20.490  1.00 63.34  ? 677  LYS A N   1 
ATOM   4880  C CA  . LYS A 1 655 ? 24.761  27.931  21.250  1.00 65.74  ? 677  LYS A CA  1 
ATOM   4881  C C   . LYS A 1 655 ? 24.025  29.187  20.804  1.00 62.37  ? 677  LYS A C   1 
ATOM   4882  O O   . LYS A 1 655 ? 24.181  30.253  21.397  1.00 61.92  ? 677  LYS A O   1 
ATOM   4883  C CB  . LYS A 1 655 ? 26.267  28.148  21.062  1.00 70.94  ? 677  LYS A CB  1 
ATOM   4884  C CG  . LYS A 1 655 ? 27.116  27.771  22.269  1.00 75.60  ? 677  LYS A CG  1 
ATOM   4885  C CD  . LYS A 1 655 ? 28.316  26.899  21.885  1.00 76.78  ? 677  LYS A CD  1 
ATOM   4886  C CE  . LYS A 1 655 ? 29.590  27.720  21.673  1.00 78.39  ? 677  LYS A CE  1 
ATOM   4887  N NZ  . LYS A 1 655 ? 30.802  26.861  21.482  1.00 76.93  ? 677  LYS A NZ  1 
ATOM   4888  N N   . PHE A 1 656 ? 23.221  29.053  19.758  1.00 59.54  ? 678  PHE A N   1 
ATOM   4889  C CA  . PHE A 1 656 ? 22.684  30.209  19.058  1.00 59.66  ? 678  PHE A CA  1 
ATOM   4890  C C   . PHE A 1 656 ? 21.334  29.859  18.461  1.00 58.67  ? 678  PHE A C   1 
ATOM   4891  O O   . PHE A 1 656 ? 21.146  28.750  17.963  1.00 60.13  ? 678  PHE A O   1 
ATOM   4892  C CB  . PHE A 1 656 ? 23.669  30.591  17.942  1.00 59.67  ? 678  PHE A CB  1 
ATOM   4893  C CG  . PHE A 1 656 ? 23.239  31.762  17.104  1.00 60.83  ? 678  PHE A CG  1 
ATOM   4894  C CD1 . PHE A 1 656 ? 23.624  33.051  17.442  1.00 62.21  ? 678  PHE A CD1 1 
ATOM   4895  C CD2 . PHE A 1 656 ? 22.485  31.573  15.955  1.00 60.58  ? 678  PHE A CD2 1 
ATOM   4896  C CE1 . PHE A 1 656 ? 23.245  34.128  16.666  1.00 63.65  ? 678  PHE A CE1 1 
ATOM   4897  C CE2 . PHE A 1 656 ? 22.102  32.649  15.177  1.00 61.25  ? 678  PHE A CE2 1 
ATOM   4898  C CZ  . PHE A 1 656 ? 22.483  33.927  15.533  1.00 63.55  ? 678  PHE A CZ  1 
ATOM   4899  N N   . PHE A 1 657 ? 20.394  30.796  18.507  1.00 57.55  ? 679  PHE A N   1 
ATOM   4900  C CA  . PHE A 1 657 ? 19.145  30.634  17.770  1.00 57.27  ? 679  PHE A CA  1 
ATOM   4901  C C   . PHE A 1 657 ? 18.644  31.968  17.222  1.00 58.12  ? 679  PHE A C   1 
ATOM   4902  O O   . PHE A 1 657 ? 18.567  32.955  17.951  1.00 58.71  ? 679  PHE A O   1 
ATOM   4903  C CB  . PHE A 1 657 ? 18.075  29.975  18.643  1.00 56.49  ? 679  PHE A CB  1 
ATOM   4904  C CG  . PHE A 1 657 ? 16.891  29.465  17.868  1.00 52.85  ? 679  PHE A CG  1 
ATOM   4905  C CD1 . PHE A 1 657 ? 16.952  28.249  17.209  1.00 49.66  ? 679  PHE A CD1 1 
ATOM   4906  C CD2 . PHE A 1 657 ? 15.718  30.200  17.801  1.00 52.87  ? 679  PHE A CD2 1 
ATOM   4907  C CE1 . PHE A 1 657 ? 15.867  27.775  16.492  1.00 50.36  ? 679  PHE A CE1 1 
ATOM   4908  C CE2 . PHE A 1 657 ? 14.627  29.731  17.089  1.00 52.36  ? 679  PHE A CE2 1 
ATOM   4909  C CZ  . PHE A 1 657 ? 14.701  28.518  16.432  1.00 51.23  ? 679  PHE A CZ  1 
ATOM   4910  N N   . ASN A 1 658 ? 18.289  31.994  15.943  1.00 57.31  ? 680  ASN A N   1 
ATOM   4911  C CA  . ASN A 1 658 ? 17.764  33.209  15.351  1.00 61.15  ? 680  ASN A CA  1 
ATOM   4912  C C   . ASN A 1 658 ? 16.242  33.158  15.436  1.00 61.08  ? 680  ASN A C   1 
ATOM   4913  O O   . ASN A 1 658 ? 15.587  32.443  14.674  1.00 60.21  ? 680  ASN A O   1 
ATOM   4914  C CB  . ASN A 1 658 ? 18.222  33.298  13.894  1.00 62.80  ? 680  ASN A CB  1 
ATOM   4915  C CG  . ASN A 1 658 ? 18.082  34.691  13.312  1.00 68.76  ? 680  ASN A CG  1 
ATOM   4916  O OD1 . ASN A 1 658 ? 17.175  35.445  13.672  1.00 69.19  ? 680  ASN A OD1 1 
ATOM   4917  N ND2 . ASN A 1 658 ? 18.994  35.041  12.401  1.00 73.96  ? 680  ASN A ND2 1 
ATOM   4918  N N   . TRP A 1 659 ? 15.679  33.955  16.336  1.00 60.97  ? 681  TRP A N   1 
ATOM   4919  C CA  . TRP A 1 659 ? 14.256  33.871  16.629  1.00 61.84  ? 681  TRP A CA  1 
ATOM   4920  C C   . TRP A 1 659 ? 13.452  34.555  15.545  1.00 64.68  ? 681  TRP A C   1 
ATOM   4921  O O   . TRP A 1 659 ? 12.300  34.199  15.298  1.00 67.47  ? 681  TRP A O   1 
ATOM   4922  C CB  . TRP A 1 659 ? 13.930  34.501  17.982  1.00 61.14  ? 681  TRP A CB  1 
ATOM   4923  C CG  . TRP A 1 659 ? 14.488  33.766  19.141  1.00 59.11  ? 681  TRP A CG  1 
ATOM   4924  C CD1 . TRP A 1 659 ? 15.677  34.002  19.765  1.00 58.01  ? 681  TRP A CD1 1 
ATOM   4925  C CD2 . TRP A 1 659 ? 13.882  32.668  19.830  1.00 60.11  ? 681  TRP A CD2 1 
ATOM   4926  N NE1 . TRP A 1 659 ? 15.851  33.119  20.801  1.00 58.02  ? 681  TRP A NE1 1 
ATOM   4927  C CE2 . TRP A 1 659 ? 14.763  32.287  20.863  1.00 59.42  ? 681  TRP A CE2 1 
ATOM   4928  C CE3 . TRP A 1 659 ? 12.679  31.970  19.676  1.00 59.82  ? 681  TRP A CE3 1 
ATOM   4929  C CZ2 . TRP A 1 659 ? 14.482  31.233  21.735  1.00 58.99  ? 681  TRP A CZ2 1 
ATOM   4930  C CZ3 . TRP A 1 659 ? 12.400  30.925  20.543  1.00 57.86  ? 681  TRP A CZ3 1 
ATOM   4931  C CH2 . TRP A 1 659 ? 13.298  30.567  21.559  1.00 58.54  ? 681  TRP A CH2 1 
ATOM   4932  N N   . THR A 1 660 ? 14.069  35.538  14.899  1.00 64.37  ? 682  THR A N   1 
ATOM   4933  C CA  . THR A 1 660 ? 13.414  36.275  13.833  1.00 67.54  ? 682  THR A CA  1 
ATOM   4934  C C   . THR A 1 660 ? 13.007  35.321  12.710  1.00 64.99  ? 682  THR A C   1 
ATOM   4935  O O   . THR A 1 660 ? 12.042  35.568  11.989  1.00 65.39  ? 682  THR A O   1 
ATOM   4936  C CB  . THR A 1 660 ? 14.323  37.398  13.294  1.00 72.12  ? 682  THR A CB  1 
ATOM   4937  O OG1 . THR A 1 660 ? 15.305  36.846  12.410  1.00 75.35  ? 682  THR A OG1 1 
ATOM   4938  C CG2 . THR A 1 660 ? 15.034  38.085  14.441  1.00 71.46  ? 682  THR A CG2 1 
ATOM   4939  N N   . LEU A 1 661 ? 13.722  34.206  12.600  1.00 63.08  ? 683  LEU A N   1 
ATOM   4940  C CA  . LEU A 1 661 ? 13.466  33.230  11.546  1.00 60.95  ? 683  LEU A CA  1 
ATOM   4941  C C   . LEU A 1 661 ? 12.121  32.515  11.663  1.00 64.00  ? 683  LEU A C   1 
ATOM   4942  O O   . LEU A 1 661 ? 11.676  31.872  10.712  1.00 64.40  ? 683  LEU A O   1 
ATOM   4943  C CB  . LEU A 1 661 ? 14.602  32.207  11.473  1.00 52.44  ? 683  LEU A CB  1 
ATOM   4944  C CG  . LEU A 1 661 ? 15.963  32.825  11.155  1.00 51.31  ? 683  LEU A CG  1 
ATOM   4945  C CD1 . LEU A 1 661 ? 16.932  31.764  10.715  1.00 49.18  ? 683  LEU A CD1 1 
ATOM   4946  C CD2 . LEU A 1 661 ? 15.836  33.919  10.096  1.00 52.37  ? 683  LEU A CD2 1 
ATOM   4947  N N   . LEU A 1 662 ? 11.463  32.642  12.811  1.00 65.08  ? 684  LEU A N   1 
ATOM   4948  C CA  . LEU A 1 662 ? 10.154  32.020  13.000  1.00 64.85  ? 684  LEU A CA  1 
ATOM   4949  C C   . LEU A 1 662 ? 9.049   32.724  12.191  1.00 68.41  ? 684  LEU A C   1 
ATOM   4950  O O   . LEU A 1 662 ? 7.916   32.246  12.127  1.00 70.33  ? 684  LEU A O   1 
ATOM   4951  C CB  . LEU A 1 662 ? 9.798   31.945  14.486  1.00 61.83  ? 684  LEU A CB  1 
ATOM   4952  C CG  . LEU A 1 662 ? 10.771  31.126  15.341  1.00 58.25  ? 684  LEU A CG  1 
ATOM   4953  C CD1 . LEU A 1 662 ? 10.388  31.168  16.805  1.00 57.49  ? 684  LEU A CD1 1 
ATOM   4954  C CD2 . LEU A 1 662 ? 10.869  29.677  14.861  1.00 55.78  ? 684  LEU A CD2 1 
ATOM   4955  N N   . GLN A 1 663 ? 9.392   33.843  11.557  1.00 69.97  ? 685  GLN A N   1 
ATOM   4956  C CA  . GLN A 1 663 ? 8.461   34.580  10.696  1.00 73.16  ? 685  GLN A CA  1 
ATOM   4957  C C   . GLN A 1 663 ? 7.984   33.763  9.503   1.00 72.46  ? 685  GLN A C   1 
ATOM   4958  O O   . GLN A 1 663 ? 6.889   33.994  8.986   1.00 72.55  ? 685  GLN A O   1 
ATOM   4959  C CB  . GLN A 1 663 ? 9.127   35.835  10.144  1.00 74.85  ? 685  GLN A CB  1 
ATOM   4960  C CG  . GLN A 1 663 ? 9.130   37.021  11.060  1.00 78.38  ? 685  GLN A CG  1 
ATOM   4961  C CD  . GLN A 1 663 ? 9.851   38.189  10.434  1.00 81.54  ? 685  GLN A CD  1 
ATOM   4962  O OE1 . GLN A 1 663 ? 10.998  38.061  10.003  1.00 82.10  ? 685  GLN A OE1 1 
ATOM   4963  N NE2 . GLN A 1 663 ? 9.178   39.329  10.355  1.00 83.73  ? 685  GLN A NE2 1 
ATOM   4964  N N   . GLN A 1 664 ? 8.825   32.835  9.054   1.00 70.01  ? 686  GLN A N   1 
ATOM   4965  C CA  . GLN A 1 664 ? 8.548   32.042  7.860   1.00 72.51  ? 686  GLN A CA  1 
ATOM   4966  C C   . GLN A 1 664 ? 7.780   30.778  8.209   1.00 69.49  ? 686  GLN A C   1 
ATOM   4967  O O   . GLN A 1 664 ? 7.552   29.924  7.355   1.00 69.70  ? 686  GLN A O   1 
ATOM   4968  C CB  . GLN A 1 664 ? 9.849   31.667  7.142   1.00 76.61  ? 686  GLN A CB  1 
ATOM   4969  C CG  . GLN A 1 664 ? 10.466  32.787  6.317   1.00 81.57  ? 686  GLN A CG  1 
ATOM   4970  C CD  . GLN A 1 664 ? 9.883   32.875  4.921   1.00 84.61  ? 686  GLN A CD  1 
ATOM   4971  O OE1 . GLN A 1 664 ? 10.250  32.106  4.033   1.00 84.82  ? 686  GLN A OE1 1 
ATOM   4972  N NE2 . GLN A 1 664 ? 8.969   33.818  4.719   1.00 86.76  ? 686  GLN A NE2 1 
ATOM   4973  N N   . PHE A 1 665 ? 7.401   30.651  9.474   1.00 66.54  ? 687  PHE A N   1 
ATOM   4974  C CA  . PHE A 1 665 ? 6.690   29.462  9.927   1.00 62.36  ? 687  PHE A CA  1 
ATOM   4975  C C   . PHE A 1 665 ? 5.385   29.833  10.618  1.00 61.08  ? 687  PHE A C   1 
ATOM   4976  O O   . PHE A 1 665 ? 5.264   29.718  11.840  1.00 60.91  ? 687  PHE A O   1 
ATOM   4977  C CB  . PHE A 1 665 ? 7.604   28.618  10.813  1.00 59.71  ? 687  PHE A CB  1 
ATOM   4978  C CG  . PHE A 1 665 ? 8.868   28.198  10.116  1.00 59.68  ? 687  PHE A CG  1 
ATOM   4979  C CD1 . PHE A 1 665 ? 8.905   27.034  9.368   1.00 56.90  ? 687  PHE A CD1 1 
ATOM   4980  C CD2 . PHE A 1 665 ? 10.005  28.993  10.166  1.00 60.25  ? 687  PHE A CD2 1 
ATOM   4981  C CE1 . PHE A 1 665 ? 10.055  26.656  8.707   1.00 55.61  ? 687  PHE A CE1 1 
ATOM   4982  C CE2 . PHE A 1 665 ? 11.164  28.614  9.508   1.00 57.80  ? 687  PHE A CE2 1 
ATOM   4983  C CZ  . PHE A 1 665 ? 11.188  27.447  8.779   1.00 55.57  ? 687  PHE A CZ  1 
ATOM   4984  N N   . PRO A 1 666 ? 4.403   30.287  9.818   1.00 60.31  ? 688  PRO A N   1 
ATOM   4985  C CA  . PRO A 1 666 ? 3.122   30.818  10.293  1.00 61.12  ? 688  PRO A CA  1 
ATOM   4986  C C   . PRO A 1 666 ? 2.211   29.729  10.860  1.00 61.30  ? 688  PRO A C   1 
ATOM   4987  O O   . PRO A 1 666 ? 1.228   30.052  11.517  1.00 63.81  ? 688  PRO A O   1 
ATOM   4988  C CB  . PRO A 1 666 ? 2.527   31.466  9.039   1.00 61.64  ? 688  PRO A CB  1 
ATOM   4989  C CG  . PRO A 1 666 ? 3.073   30.659  7.917   1.00 61.34  ? 688  PRO A CG  1 
ATOM   4990  C CD  . PRO A 1 666 ? 4.414   30.117  8.352   1.00 58.58  ? 688  PRO A CD  1 
ATOM   4991  N N   . ARG A 1 667 ? 2.521   28.466  10.580  1.00 59.84  ? 689  ARG A N   1 
ATOM   4992  C CA  . ARG A 1 667 ? 1.763   27.349  11.127  1.00 61.71  ? 689  ARG A CA  1 
ATOM   4993  C C   . ARG A 1 667 ? 2.419   26.726  12.367  1.00 61.95  ? 689  ARG A C   1 
ATOM   4994  O O   . ARG A 1 667 ? 1.875   25.784  12.953  1.00 60.55  ? 689  ARG A O   1 
ATOM   4995  C CB  . ARG A 1 667 ? 1.560   26.270  10.058  1.00 64.20  ? 689  ARG A CB  1 
ATOM   4996  C CG  . ARG A 1 667 ? 1.389   26.811  8.645   1.00 72.39  ? 689  ARG A CG  1 
ATOM   4997  C CD  . ARG A 1 667 ? 0.028   26.456  8.079   1.00 76.77  ? 689  ARG A CD  1 
ATOM   4998  N NE  . ARG A 1 667 ? -1.026  26.761  9.037   1.00 81.78  ? 689  ARG A NE  1 
ATOM   4999  C CZ  . ARG A 1 667 ? -2.327  26.688  8.777   1.00 86.16  ? 689  ARG A CZ  1 
ATOM   5000  N NH1 . ARG A 1 667 ? -3.202  26.986  9.726   1.00 87.11  ? 689  ARG A NH1 1 
ATOM   5001  N NH2 . ARG A 1 667 ? -2.752  26.322  7.575   1.00 87.89  ? 689  ARG A NH2 1 
ATOM   5002  N N   . LEU A 1 668 ? 3.580   27.240  12.767  1.00 61.97  ? 690  LEU A N   1 
ATOM   5003  C CA  . LEU A 1 668 ? 4.359   26.581  13.817  1.00 60.10  ? 690  LEU A CA  1 
ATOM   5004  C C   . LEU A 1 668 ? 3.724   26.692  15.199  1.00 60.52  ? 690  LEU A C   1 
ATOM   5005  O O   . LEU A 1 668 ? 3.472   27.788  15.695  1.00 64.51  ? 690  LEU A O   1 
ATOM   5006  C CB  . LEU A 1 668 ? 5.801   27.100  13.855  1.00 57.61  ? 690  LEU A CB  1 
ATOM   5007  C CG  . LEU A 1 668 ? 6.726   26.370  14.838  1.00 53.04  ? 690  LEU A CG  1 
ATOM   5008  C CD1 . LEU A 1 668 ? 6.969   24.930  14.394  1.00 50.51  ? 690  LEU A CD1 1 
ATOM   5009  C CD2 . LEU A 1 668 ? 8.034   27.109  15.002  1.00 52.40  ? 690  LEU A CD2 1 
ATOM   5010  N N   . GLU A 1 669 ? 3.501   25.538  15.817  1.00 56.56  ? 691  GLU A N   1 
ATOM   5011  C CA  . GLU A 1 669 ? 2.782   25.440  17.083  1.00 57.11  ? 691  GLU A CA  1 
ATOM   5012  C C   . GLU A 1 669 ? 3.710   25.086  18.236  1.00 55.69  ? 691  GLU A C   1 
ATOM   5013  O O   . GLU A 1 669 ? 3.741   25.781  19.244  1.00 56.79  ? 691  GLU A O   1 
ATOM   5014  C CB  . GLU A 1 669 ? 1.629   24.445  16.986  1.00 59.21  ? 691  GLU A CB  1 
ATOM   5015  C CG  . GLU A 1 669 ? 0.545   24.869  16.012  1.00 63.94  ? 691  GLU A CG  1 
ATOM   5016  C CD  . GLU A 1 669 ? -0.695  23.999  16.094  1.00 66.67  ? 691  GLU A CD  1 
ATOM   5017  O OE1 . GLU A 1 669 ? -0.648  22.947  16.774  1.00 65.36  ? 691  GLU A OE1 1 
ATOM   5018  O OE2 . GLU A 1 669 ? -1.718  24.375  15.477  1.00 68.17  ? 691  GLU A OE2 1 
ATOM   5019  N N   . LEU A 1 670 ? 4.398   23.956  18.111  1.00 54.94  ? 692  LEU A N   1 
ATOM   5020  C CA  . LEU A 1 670 ? 5.356   23.504  19.120  1.00 55.30  ? 692  LEU A CA  1 
ATOM   5021  C C   . LEU A 1 670 ? 6.796   23.690  18.654  1.00 54.93  ? 692  LEU A C   1 
ATOM   5022  O O   . LEU A 1 670 ? 7.177   23.234  17.575  1.00 53.94  ? 692  LEU A O   1 
ATOM   5023  C CB  . LEU A 1 670 ? 5.110   22.026  19.455  1.00 54.20  ? 692  LEU A CB  1 
ATOM   5024  C CG  . LEU A 1 670 ? 5.896   21.346  20.584  1.00 56.99  ? 692  LEU A CG  1 
ATOM   5025  C CD1 . LEU A 1 670 ? 5.090   20.187  21.161  1.00 57.02  ? 692  LEU A CD1 1 
ATOM   5026  C CD2 . LEU A 1 670 ? 7.253   20.838  20.119  1.00 57.35  ? 692  LEU A CD2 1 
ATOM   5027  N N   . LEU A 1 671 ? 7.600   24.344  19.484  1.00 55.54  ? 693  LEU A N   1 
ATOM   5028  C CA  . LEU A 1 671 ? 9.027   24.474  19.222  1.00 52.39  ? 693  LEU A CA  1 
ATOM   5029  C C   . LEU A 1 671 ? 9.810   23.853  20.376  1.00 51.47  ? 693  LEU A C   1 
ATOM   5030  O O   . LEU A 1 671 ? 9.784   24.365  21.492  1.00 55.39  ? 693  LEU A O   1 
ATOM   5031  C CB  . LEU A 1 671 ? 9.390   25.951  19.055  1.00 52.22  ? 693  LEU A CB  1 
ATOM   5032  C CG  . LEU A 1 671 ? 10.840  26.294  18.710  1.00 51.32  ? 693  LEU A CG  1 
ATOM   5033  C CD1 . LEU A 1 671 ? 11.286  25.560  17.446  1.00 50.24  ? 693  LEU A CD1 1 
ATOM   5034  C CD2 . LEU A 1 671 ? 11.009  27.798  18.554  1.00 49.53  ? 693  LEU A CD2 1 
ATOM   5035  N N   . ASP A 1 672 ? 10.506  22.750  20.114  1.00 49.79  ? 694  ASP A N   1 
ATOM   5036  C CA  . ASP A 1 672 ? 11.213  22.050  21.178  1.00 49.75  ? 694  ASP A CA  1 
ATOM   5037  C C   . ASP A 1 672 ? 12.727  22.299  21.111  1.00 52.72  ? 694  ASP A C   1 
ATOM   5038  O O   . ASP A 1 672 ? 13.438  21.735  20.279  1.00 51.90  ? 694  ASP A O   1 
ATOM   5039  C CB  . ASP A 1 672 ? 10.918  20.555  21.081  1.00 44.56  ? 694  ASP A CB  1 
ATOM   5040  C CG  . ASP A 1 672 ? 11.573  19.754  22.182  1.00 45.03  ? 694  ASP A CG  1 
ATOM   5041  O OD1 . ASP A 1 672 ? 12.040  20.363  23.165  1.00 48.60  ? 694  ASP A OD1 1 
ATOM   5042  O OD2 . ASP A 1 672 ? 11.605  18.507  22.077  1.00 43.11  ? 694  ASP A OD2 1 
ATOM   5043  N N   . LEU A 1 673 ? 13.191  23.157  22.013  1.00 52.33  ? 695  LEU A N   1 
ATOM   5044  C CA  . LEU A 1 673 ? 14.596  23.514  22.150  1.00 48.42  ? 695  LEU A CA  1 
ATOM   5045  C C   . LEU A 1 673 ? 15.352  22.886  23.330  1.00 49.33  ? 695  LEU A C   1 
ATOM   5046  O O   . LEU A 1 673 ? 16.486  23.262  23.602  1.00 51.82  ? 695  LEU A O   1 
ATOM   5047  C CB  . LEU A 1 673 ? 14.768  25.031  22.078  1.00 47.13  ? 695  LEU A CB  1 
ATOM   5048  C CG  . LEU A 1 673 ? 14.531  25.472  20.630  1.00 47.21  ? 695  LEU A CG  1 
ATOM   5049  C CD1 . LEU A 1 673 ? 14.645  26.972  20.435  1.00 48.45  ? 695  LEU A CD1 1 
ATOM   5050  C CD2 . LEU A 1 673 ? 15.502  24.745  19.723  1.00 47.11  ? 695  LEU A CD2 1 
ATOM   5051  N N   . ARG A 1 674 ? 14.711  21.971  24.051  1.00 47.46  ? 696  ARG A N   1 
ATOM   5052  C CA  . ARG A 1 674 ? 15.289  21.399  25.269  1.00 44.34  ? 696  ARG A CA  1 
ATOM   5053  C C   . ARG A 1 674 ? 16.686  20.810  25.102  1.00 43.65  ? 696  ARG A C   1 
ATOM   5054  O O   . ARG A 1 674 ? 17.035  20.296  24.045  1.00 43.49  ? 696  ARG A O   1 
ATOM   5055  C CB  . ARG A 1 674 ? 14.386  20.293  25.828  1.00 41.71  ? 696  ARG A CB  1 
ATOM   5056  C CG  . ARG A 1 674 ? 13.040  20.770  26.338  1.00 45.79  ? 696  ARG A CG  1 
ATOM   5057  C CD  . ARG A 1 674 ? 12.106  19.585  26.497  1.00 44.92  ? 696  ARG A CD  1 
ATOM   5058  N NE  . ARG A 1 674 ? 11.990  18.846  25.246  1.00 46.26  ? 696  ARG A NE  1 
ATOM   5059  C CZ  . ARG A 1 674 ? 11.577  17.589  25.160  1.00 48.76  ? 696  ARG A CZ  1 
ATOM   5060  N NH1 . ARG A 1 674 ? 11.244  16.930  26.261  1.00 49.63  ? 696  ARG A NH1 1 
ATOM   5061  N NH2 . ARG A 1 674 ? 11.508  16.992  23.978  1.00 48.48  ? 696  ARG A NH2 1 
ATOM   5062  N N   . GLY A 1 675 ? 17.484  20.887  26.160  1.00 43.26  ? 697  GLY A N   1 
ATOM   5063  C CA  . GLY A 1 675 ? 18.756  20.188  26.191  1.00 43.17  ? 697  GLY A CA  1 
ATOM   5064  C C   . GLY A 1 675 ? 19.796  20.750  25.245  1.00 44.47  ? 697  GLY A C   1 
ATOM   5065  O O   . GLY A 1 675 ? 20.475  20.010  24.545  1.00 44.71  ? 697  GLY A O   1 
ATOM   5066  N N   . ASN A 1 676 ? 19.919  22.070  25.232  1.00 47.75  ? 698  ASN A N   1 
ATOM   5067  C CA  . ASN A 1 676 ? 20.909  22.759  24.413  1.00 50.12  ? 698  ASN A CA  1 
ATOM   5068  C C   . ASN A 1 676 ? 21.751  23.683  25.273  1.00 52.31  ? 698  ASN A C   1 
ATOM   5069  O O   . ASN A 1 676 ? 21.797  23.519  26.490  1.00 49.09  ? 698  ASN A O   1 
ATOM   5070  C CB  . ASN A 1 676 ? 20.258  23.523  23.263  1.00 49.87  ? 698  ASN A CB  1 
ATOM   5071  C CG  . ASN A 1 676 ? 19.767  22.603  22.171  1.00 51.41  ? 698  ASN A CG  1 
ATOM   5072  O OD1 . ASN A 1 676 ? 20.549  22.134  21.347  1.00 53.15  ? 698  ASN A OD1 1 
ATOM   5073  N ND2 . ASN A 1 676 ? 18.467  22.325  22.167  1.00 49.08  ? 698  ASN A ND2 1 
ATOM   5074  N N   . LYS A 1 677 ? 22.519  24.548  24.619  1.00 57.29  ? 699  LYS A N   1 
ATOM   5075  C CA  . LYS A 1 677 ? 23.288  25.597  25.286  1.00 62.53  ? 699  LYS A CA  1 
ATOM   5076  C C   . LYS A 1 677 ? 22.728  27.034  25.256  1.00 63.90  ? 699  LYS A C   1 
ATOM   5077  O O   . LYS A 1 677 ? 23.408  27.957  25.699  1.00 63.18  ? 699  LYS A O   1 
ATOM   5078  C CB  . LYS A 1 677 ? 24.738  25.558  24.809  1.00 65.84  ? 699  LYS A CB  1 
ATOM   5079  C CG  . LYS A 1 677 ? 25.461  24.317  25.297  1.00 68.88  ? 699  LYS A CG  1 
ATOM   5080  C CD  . LYS A 1 677 ? 26.742  24.069  24.516  1.00 73.34  ? 699  LYS A CD  1 
ATOM   5081  C CE  . LYS A 1 677 ? 27.405  22.748  24.926  1.00 73.80  ? 699  LYS A CE  1 
ATOM   5082  N NZ  . LYS A 1 677 ? 28.781  22.579  24.338  1.00 71.97  ? 699  LYS A NZ  1 
ATOM   5083  N N   . LEU A 1 678 ? 21.525  27.222  24.711  1.00 64.28  ? 700  LEU A N   1 
ATOM   5084  C CA  . LEU A 1 678 ? 20.996  28.560  24.395  1.00 66.31  ? 700  LEU A CA  1 
ATOM   5085  C C   . LEU A 1 678 ? 21.027  29.552  25.559  1.00 69.83  ? 700  LEU A C   1 
ATOM   5086  O O   . LEU A 1 678 ? 20.566  29.236  26.653  1.00 69.26  ? 700  LEU A O   1 
ATOM   5087  C CB  . LEU A 1 678 ? 19.550  28.451  23.910  1.00 65.56  ? 700  LEU A CB  1 
ATOM   5088  C CG  . LEU A 1 678 ? 19.188  27.278  23.007  1.00 67.04  ? 700  LEU A CG  1 
ATOM   5089  C CD1 . LEU A 1 678 ? 17.695  27.255  22.770  1.00 69.47  ? 700  LEU A CD1 1 
ATOM   5090  C CD2 . LEU A 1 678 ? 19.929  27.379  21.699  1.00 70.08  ? 700  LEU A CD2 1 
ATOM   5091  N N   . LEU A 1 679 ? 21.616  30.727  25.326  1.00 72.47  ? 701  LEU A N   1 
ATOM   5092  C CA  . LEU A 1 679 ? 21.601  31.822  26.301  1.00 74.73  ? 701  LEU A CA  1 
ATOM   5093  C C   . LEU A 1 679 ? 20.593  32.974  26.120  1.00 71.14  ? 701  LEU A C   1 
ATOM   5094  O O   . LEU A 1 679 ? 20.344  33.716  27.066  1.00 72.04  ? 701  LEU A O   1 
ATOM   5095  C CB  . LEU A 1 679 ? 22.998  32.457  26.347  1.00 81.24  ? 701  LEU A CB  1 
ATOM   5096  C CG  . LEU A 1 679 ? 24.142  31.825  27.140  1.00 83.97  ? 701  LEU A CG  1 
ATOM   5097  C CD1 . LEU A 1 679 ? 25.474  32.208  26.512  1.00 85.06  ? 701  LEU A CD1 1 
ATOM   5098  C CD2 . LEU A 1 679 ? 24.086  32.291  28.593  1.00 85.53  ? 701  LEU A CD2 1 
ATOM   5099  N N   . PHE A 1 680 ? 20.020  33.127  24.930  1.00 67.82  ? 702  PHE A N   1 
ATOM   5100  C CA  . PHE A 1 680 ? 19.695  34.495  24.470  1.00 69.40  ? 702  PHE A CA  1 
ATOM   5101  C C   . PHE A 1 680 ? 18.309  35.205  24.552  1.00 79.22  ? 702  PHE A C   1 
ATOM   5102  O O   . PHE A 1 680 ? 18.293  36.430  24.521  1.00 83.88  ? 702  PHE A O   1 
ATOM   5103  C CB  . PHE A 1 680 ? 20.337  34.731  23.079  1.00 71.44  ? 702  PHE A CB  1 
ATOM   5104  C CG  . PHE A 1 680 ? 19.887  35.997  22.406  1.00 74.13  ? 702  PHE A CG  1 
ATOM   5105  C CD1 . PHE A 1 680 ? 20.438  37.221  22.753  1.00 76.13  ? 702  PHE A CD1 1 
ATOM   5106  C CD2 . PHE A 1 680 ? 18.877  35.969  21.458  1.00 75.87  ? 702  PHE A CD2 1 
ATOM   5107  C CE1 . PHE A 1 680 ? 20.000  38.390  22.152  1.00 79.03  ? 702  PHE A CE1 1 
ATOM   5108  C CE2 . PHE A 1 680 ? 18.437  37.131  20.852  1.00 77.56  ? 702  PHE A CE2 1 
ATOM   5109  C CZ  . PHE A 1 680 ? 19.000  38.344  21.198  1.00 79.47  ? 702  PHE A CZ  1 
ATOM   5110  N N   . LEU A 1 681 ? 17.192  34.540  24.837  1.00 76.15  ? 703  LEU A N   1 
ATOM   5111  C CA  . LEU A 1 681 ? 15.927  34.867  24.123  1.00 74.40  ? 703  LEU A CA  1 
ATOM   5112  C C   . LEU A 1 681 ? 15.602  36.332  23.779  1.00 75.59  ? 703  LEU A C   1 
ATOM   5113  O O   . LEU A 1 681 ? 15.817  37.255  24.565  1.00 81.03  ? 703  LEU A O   1 
ATOM   5114  C CB  . LEU A 1 681 ? 14.692  34.377  24.900  1.00 73.51  ? 703  LEU A CB  1 
ATOM   5115  C CG  . LEU A 1 681 ? 14.526  33.085  25.708  1.00 70.40  ? 703  LEU A CG  1 
ATOM   5116  C CD1 . LEU A 1 681 ? 15.171  31.899  25.032  1.00 68.60  ? 703  LEU A CD1 1 
ATOM   5117  C CD2 . LEU A 1 681 ? 15.023  33.253  27.127  1.00 68.83  ? 703  LEU A CD2 1 
ATOM   5118  N N   . THR A 1 682 ? 15.071  36.516  22.573  1.00 72.18  ? 704  THR A N   1 
ATOM   5119  C CA  . THR A 1 682 ? 14.590  37.817  22.102  1.00 74.80  ? 704  THR A CA  1 
ATOM   5120  C C   . THR A 1 682 ? 13.538  38.449  23.026  1.00 77.18  ? 704  THR A C   1 
ATOM   5121  O O   . THR A 1 682 ? 12.784  37.745  23.697  1.00 76.43  ? 704  THR A O   1 
ATOM   5122  C CB  . THR A 1 682 ? 13.990  37.707  20.674  1.00 74.52  ? 704  THR A CB  1 
ATOM   5123  O OG1 . THR A 1 682 ? 13.308  38.921  20.330  1.00 80.38  ? 704  THR A OG1 1 
ATOM   5124  C CG2 . THR A 1 682 ? 12.999  36.591  20.618  1.00 72.58  ? 704  THR A CG2 1 
ATOM   5125  N N   . ASP A 1 683 ? 13.522  39.780  23.075  1.00 80.29  ? 705  ASP A N   1 
ATOM   5126  C CA  . ASP A 1 683 ? 12.459  40.521  23.746  1.00 84.57  ? 705  ASP A CA  1 
ATOM   5127  C C   . ASP A 1 683 ? 11.335  40.850  22.763  1.00 83.94  ? 705  ASP A C   1 
ATOM   5128  O O   . ASP A 1 683 ? 10.302  41.406  23.143  1.00 85.76  ? 705  ASP A O   1 
ATOM   5129  C CB  . ASP A 1 683 ? 13.001  41.813  24.379  1.00 90.75  ? 705  ASP A CB  1 
ATOM   5130  C CG  . ASP A 1 683 ? 14.390  42.174  23.886  1.00 92.63  ? 705  ASP A CG  1 
ATOM   5131  O OD1 . ASP A 1 683 ? 14.795  41.668  22.820  1.00 92.53  ? 705  ASP A OD1 1 
ATOM   5132  O OD2 . ASP A 1 683 ? 15.075  42.968  24.566  1.00 94.13  ? 705  ASP A OD2 1 
ATOM   5133  N N   . SER A 1 684 ? 11.565  40.524  21.494  1.00 80.60  ? 706  SER A N   1 
ATOM   5134  C CA  . SER A 1 684 ? 10.623  40.816  20.409  1.00 80.15  ? 706  SER A CA  1 
ATOM   5135  C C   . SER A 1 684 ? 9.692   39.688  19.925  1.00 74.71  ? 706  SER A C   1 
ATOM   5136  O O   . SER A 1 684 ? 9.010   39.863  18.918  1.00 75.30  ? 706  SER A O   1 
ATOM   5137  C CB  . SER A 1 684 ? 11.361  41.430  19.218  1.00 82.02  ? 706  SER A CB  1 
ATOM   5138  O OG  . SER A 1 684 ? 12.199  42.487  19.645  1.00 82.57  ? 706  SER A OG  1 
ATOM   5139  N N   . LEU A 1 685 ? 9.675   38.547  20.614  1.00 70.67  ? 707  LEU A N   1 
ATOM   5140  C CA  . LEU A 1 685 ? 9.113   37.296  20.071  1.00 69.54  ? 707  LEU A CA  1 
ATOM   5141  C C   . LEU A 1 685 ? 7.740   37.383  19.391  1.00 68.47  ? 707  LEU A C   1 
ATOM   5142  O O   . LEU A 1 685 ? 7.487   36.677  18.414  1.00 66.44  ? 707  LEU A O   1 
ATOM   5143  C CB  . LEU A 1 685 ? 9.070   36.206  21.155  1.00 68.03  ? 707  LEU A CB  1 
ATOM   5144  C CG  . LEU A 1 685 ? 8.688   34.795  20.697  1.00 64.93  ? 707  LEU A CG  1 
ATOM   5145  C CD1 . LEU A 1 685 ? 9.660   34.320  19.642  1.00 65.34  ? 707  LEU A CD1 1 
ATOM   5146  C CD2 . LEU A 1 685 ? 8.654   33.818  21.858  1.00 63.08  ? 707  LEU A CD2 1 
ATOM   5147  N N   . SER A 1 686 ? 6.865   38.246  19.896  1.00 70.61  ? 708  SER A N   1 
ATOM   5148  C CA  . SER A 1 686 ? 5.544   38.427  19.292  1.00 73.74  ? 708  SER A CA  1 
ATOM   5149  C C   . SER A 1 686 ? 5.589   38.920  17.845  1.00 74.93  ? 708  SER A C   1 
ATOM   5150  O O   . SER A 1 686 ? 4.642   38.713  17.086  1.00 73.79  ? 708  SER A O   1 
ATOM   5151  C CB  . SER A 1 686 ? 4.689   39.378  20.130  1.00 79.47  ? 708  SER A CB  1 
ATOM   5152  O OG  . SER A 1 686 ? 3.637   39.933  19.359  1.00 84.26  ? 708  SER A OG  1 
ATOM   5153  N N   . ASP A 1 687 ? 6.682   39.580  17.471  1.00 76.98  ? 709  ASP A N   1 
ATOM   5154  C CA  . ASP A 1 687 ? 6.862   40.042  16.097  1.00 78.55  ? 709  ASP A CA  1 
ATOM   5155  C C   . ASP A 1 687 ? 7.168   38.891  15.141  1.00 75.64  ? 709  ASP A C   1 
ATOM   5156  O O   . ASP A 1 687 ? 6.929   38.998  13.936  1.00 61.77  ? 709  ASP A O   1 
ATOM   5157  C CB  . ASP A 1 687 ? 8.001   41.063  16.012  1.00 80.45  ? 709  ASP A CB  1 
ATOM   5158  C CG  . ASP A 1 687 ? 7.755   42.288  16.861  1.00 83.53  ? 709  ASP A CG  1 
ATOM   5159  O OD1 . ASP A 1 687 ? 6.627   42.824  16.838  1.00 84.04  ? 709  ASP A OD1 1 
ATOM   5160  O OD2 . ASP A 1 687 ? 8.700   42.717  17.555  1.00 84.91  ? 709  ASP A OD2 1 
ATOM   5161  N N   . PHE A 1 688 ? 7.768   37.827  15.670  1.00 70.49  ? 710  PHE A N   1 
ATOM   5162  C CA  . PHE A 1 688 ? 8.181   36.697  14.840  1.00 66.73  ? 710  PHE A CA  1 
ATOM   5163  C C   . PHE A 1 688 ? 7.228   35.488  14.779  1.00 64.58  ? 710  PHE A C   1 
ATOM   5164  O O   . PHE A 1 688 ? 7.379   34.620  13.917  1.00 59.51  ? 710  PHE A O   1 
ATOM   5165  C CB  . PHE A 1 688 ? 9.594   36.278  15.251  1.00 64.89  ? 710  PHE A CB  1 
ATOM   5166  C CG  . PHE A 1 688 ? 10.537  37.440  15.387  1.00 65.28  ? 710  PHE A CG  1 
ATOM   5167  C CD1 . PHE A 1 688 ? 10.595  38.416  14.403  1.00 64.37  ? 710  PHE A CD1 1 
ATOM   5168  C CD2 . PHE A 1 688 ? 11.337  37.578  16.508  1.00 64.83  ? 710  PHE A CD2 1 
ATOM   5169  C CE1 . PHE A 1 688 ? 11.443  39.495  14.525  1.00 65.89  ? 710  PHE A CE1 1 
ATOM   5170  C CE2 . PHE A 1 688 ? 12.189  38.657  16.637  1.00 66.40  ? 710  PHE A CE2 1 
ATOM   5171  C CZ  . PHE A 1 688 ? 12.239  39.619  15.644  1.00 67.61  ? 710  PHE A CZ  1 
ATOM   5172  N N   . THR A 1 689 ? 6.246   35.426  15.676  1.00 67.36  ? 711  THR A N   1 
ATOM   5173  C CA  . THR A 1 689 ? 5.239   34.366  15.604  1.00 67.73  ? 711  THR A CA  1 
ATOM   5174  C C   . THR A 1 689 ? 3.892   34.820  16.154  1.00 75.55  ? 711  THR A C   1 
ATOM   5175  O O   . THR A 1 689 ? 3.829   35.498  17.180  1.00 78.62  ? 711  THR A O   1 
ATOM   5176  C CB  . THR A 1 689 ? 5.701   33.104  16.375  1.00 65.25  ? 711  THR A CB  1 
ATOM   5177  O OG1 . THR A 1 689 ? 4.721   32.065  16.248  1.00 61.40  ? 711  THR A OG1 1 
ATOM   5178  C CG2 . THR A 1 689 ? 5.924   33.421  17.857  1.00 65.80  ? 711  THR A CG2 1 
ATOM   5179  N N   . SER A 1 690 ? 2.811   34.489  15.456  1.00 79.87  ? 712  SER A N   1 
ATOM   5180  C CA  . SER A 1 690 ? 1.485   34.580  16.054  1.00 81.27  ? 712  SER A CA  1 
ATOM   5181  C C   . SER A 1 690 ? 0.927   33.210  16.437  1.00 78.89  ? 712  SER A C   1 
ATOM   5182  O O   . SER A 1 690 ? -0.119  33.122  17.081  1.00 80.29  ? 712  SER A O   1 
ATOM   5183  C CB  . SER A 1 690 ? 0.526   35.269  15.084  1.00 83.28  ? 712  SER A CB  1 
ATOM   5184  O OG  . SER A 1 690 ? 0.426   34.534  13.876  1.00 83.63  ? 712  SER A OG  1 
ATOM   5185  N N   . SER A 1 691 ? 1.616   32.151  16.006  1.00 73.66  ? 713  SER A N   1 
ATOM   5186  C CA  . SER A 1 691 ? 1.105   30.781  16.118  1.00 66.43  ? 713  SER A CA  1 
ATOM   5187  C C   . SER A 1 691 ? 1.613   29.898  17.261  1.00 66.89  ? 713  SER A C   1 
ATOM   5188  O O   . SER A 1 691 ? 1.064   28.819  17.498  1.00 67.25  ? 713  SER A O   1 
ATOM   5189  C CB  . SER A 1 691 ? 1.312   30.047  14.793  1.00 61.25  ? 713  SER A CB  1 
ATOM   5190  O OG  . SER A 1 691 ? 2.688   29.926  14.501  1.00 60.41  ? 713  SER A OG  1 
ATOM   5191  N N   . LEU A 1 692 ? 2.654   30.336  17.961  1.00 65.27  ? 714  LEU A N   1 
ATOM   5192  C CA  . LEU A 1 692 ? 3.353   29.453  18.894  1.00 60.14  ? 714  LEU A CA  1 
ATOM   5193  C C   . LEU A 1 692 ? 2.506   29.135  20.140  1.00 64.28  ? 714  LEU A C   1 
ATOM   5194  O O   . LEU A 1 692 ? 2.032   30.031  20.834  1.00 66.49  ? 714  LEU A O   1 
ATOM   5195  C CB  . LEU A 1 692 ? 4.718   30.046  19.258  1.00 56.20  ? 714  LEU A CB  1 
ATOM   5196  C CG  . LEU A 1 692 ? 5.859   29.139  19.726  1.00 55.67  ? 714  LEU A CG  1 
ATOM   5197  C CD1 . LEU A 1 692 ? 6.083   27.980  18.771  1.00 52.92  ? 714  LEU A CD1 1 
ATOM   5198  C CD2 . LEU A 1 692 ? 7.122   29.966  19.845  1.00 57.21  ? 714  LEU A CD2 1 
ATOM   5199  N N   . ARG A 1 693 ? 2.315   27.844  20.393  1.00 65.15  ? 715  ARG A N   1 
ATOM   5200  C CA  . ARG A 1 693 ? 1.467   27.348  21.473  1.00 68.32  ? 715  ARG A CA  1 
ATOM   5201  C C   . ARG A 1 693 ? 2.329   26.849  22.621  1.00 67.15  ? 715  ARG A C   1 
ATOM   5202  O O   . ARG A 1 693 ? 2.176   27.260  23.769  1.00 69.78  ? 715  ARG A O   1 
ATOM   5203  C CB  . ARG A 1 693 ? 0.596   26.191  20.986  1.00 71.52  ? 715  ARG A CB  1 
ATOM   5204  C CG  . ARG A 1 693 ? -0.231  26.484  19.753  1.00 74.86  ? 715  ARG A CG  1 
ATOM   5205  C CD  . ARG A 1 693 ? -1.585  27.042  20.117  1.00 79.83  ? 715  ARG A CD  1 
ATOM   5206  N NE  . ARG A 1 693 ? -2.126  27.864  19.036  1.00 85.71  ? 715  ARG A NE  1 
ATOM   5207  C CZ  . ARG A 1 693 ? -3.152  27.521  18.262  1.00 85.26  ? 715  ARG A CZ  1 
ATOM   5208  N NH1 . ARG A 1 693 ? -3.776  26.360  18.446  1.00 82.51  ? 715  ARG A NH1 1 
ATOM   5209  N NH2 . ARG A 1 693 ? -3.555  28.347  17.305  1.00 86.27  ? 715  ARG A NH2 1 
ATOM   5210  N N   . THR A 1 694 ? 3.173   25.880  22.306  1.00 64.26  ? 716  THR A N   1 
ATOM   5211  C CA  . THR A 1 694 ? 4.087   25.302  23.273  1.00 65.03  ? 716  THR A CA  1 
ATOM   5212  C C   . THR A 1 694 ? 5.530   25.628  22.898  1.00 62.02  ? 716  THR A C   1 
ATOM   5213  O O   . THR A 1 694 ? 5.950   25.431  21.750  1.00 61.19  ? 716  THR A O   1 
ATOM   5214  C CB  . THR A 1 694 ? 3.899   23.782  23.347  1.00 64.35  ? 716  THR A CB  1 
ATOM   5215  O OG1 . THR A 1 694 ? 2.522   23.497  23.619  1.00 66.58  ? 716  THR A OG1 1 
ATOM   5216  C CG2 . THR A 1 694 ? 4.756   23.188  24.439  1.00 63.68  ? 716  THR A CG2 1 
ATOM   5217  N N   . LEU A 1 695 ? 6.278   26.145  23.869  1.00 57.36  ? 717  LEU A N   1 
ATOM   5218  C CA  . LEU A 1 695 ? 7.683   26.474  23.671  1.00 53.56  ? 717  LEU A CA  1 
ATOM   5219  C C   . LEU A 1 695 ? 8.517   25.825  24.767  1.00 51.19  ? 717  LEU A C   1 
ATOM   5220  O O   . LEU A 1 695 ? 8.401   26.180  25.937  1.00 53.26  ? 717  LEU A O   1 
ATOM   5221  C CB  . LEU A 1 695 ? 7.864   27.988  23.692  1.00 53.81  ? 717  LEU A CB  1 
ATOM   5222  C CG  . LEU A 1 695 ? 9.302   28.485  23.596  1.00 55.60  ? 717  LEU A CG  1 
ATOM   5223  C CD1 . LEU A 1 695 ? 9.968   27.971  22.318  1.00 45.56  ? 717  LEU A CD1 1 
ATOM   5224  C CD2 . LEU A 1 695 ? 9.327   30.008  23.673  1.00 58.68  ? 717  LEU A CD2 1 
ATOM   5225  N N   . LEU A 1 696 ? 9.358   24.870  24.394  1.00 50.59  ? 718  LEU A N   1 
ATOM   5226  C CA  . LEU A 1 696 ? 10.091  24.092  25.392  1.00 49.46  ? 718  LEU A CA  1 
ATOM   5227  C C   . LEU A 1 696 ? 11.555  24.505  25.466  1.00 48.40  ? 718  LEU A C   1 
ATOM   5228  O O   . LEU A 1 696 ? 12.339  24.201  24.572  1.00 48.19  ? 718  LEU A O   1 
ATOM   5229  C CB  . LEU A 1 696 ? 9.981   22.598  25.069  1.00 46.74  ? 718  LEU A CB  1 
ATOM   5230  C CG  . LEU A 1 696 ? 8.543   22.101  24.906  1.00 46.34  ? 718  LEU A CG  1 
ATOM   5231  C CD1 . LEU A 1 696 ? 8.492   20.608  24.601  1.00 43.02  ? 718  LEU A CD1 1 
ATOM   5232  C CD2 . LEU A 1 696 ? 7.741   22.429  26.157  1.00 48.78  ? 718  LEU A CD2 1 
ATOM   5233  N N   . LEU A 1 697 ? 11.900  25.226  26.530  1.00 48.93  ? 719  LEU A N   1 
ATOM   5234  C CA  . LEU A 1 697 ? 13.266  25.682  26.773  1.00 48.34  ? 719  LEU A CA  1 
ATOM   5235  C C   . LEU A 1 697 ? 14.077  24.928  27.836  1.00 51.18  ? 719  LEU A C   1 
ATOM   5236  O O   . LEU A 1 697 ? 15.175  25.355  28.195  1.00 53.21  ? 719  LEU A O   1 
ATOM   5237  C CB  . LEU A 1 697 ? 13.295  27.186  26.999  1.00 49.75  ? 719  LEU A CB  1 
ATOM   5238  C CG  . LEU A 1 697 ? 12.925  27.908  25.702  1.00 47.50  ? 719  LEU A CG  1 
ATOM   5239  C CD1 . LEU A 1 697 ? 12.686  29.384  25.935  1.00 47.49  ? 719  LEU A CD1 1 
ATOM   5240  C CD2 . LEU A 1 697 ? 14.024  27.692  24.687  1.00 47.09  ? 719  LEU A CD2 1 
ATOM   5241  N N   . SER A 1 698 ? 13.519  23.851  28.379  1.00 50.64  ? 720  SER A N   1 
ATOM   5242  C CA  . SER A 1 698 ? 14.153  23.174  29.508  1.00 49.70  ? 720  SER A CA  1 
ATOM   5243  C C   . SER A 1 698 ? 15.585  22.688  29.222  1.00 50.19  ? 720  SER A C   1 
ATOM   5244  O O   . SER A 1 698 ? 15.929  22.339  28.093  1.00 46.20  ? 720  SER A O   1 
ATOM   5245  C CB  . SER A 1 698 ? 13.278  22.036  30.037  1.00 47.57  ? 720  SER A CB  1 
ATOM   5246  O OG  . SER A 1 698 ? 13.572  20.804  29.403  1.00 51.44  ? 720  SER A OG  1 
ATOM   5247  N N   . HIS A 1 699 ? 16.414  22.697  30.261  1.00 53.03  ? 721  HIS A N   1 
ATOM   5248  C CA  . HIS A 1 699 ? 17.821  22.316  30.152  1.00 52.47  ? 721  HIS A CA  1 
ATOM   5249  C C   . HIS A 1 699 ? 18.588  23.163  29.145  1.00 52.03  ? 721  HIS A C   1 
ATOM   5250  O O   . HIS A 1 699 ? 19.064  22.676  28.118  1.00 50.93  ? 721  HIS A O   1 
ATOM   5251  C CB  . HIS A 1 699 ? 17.974  20.818  29.873  1.00 50.83  ? 721  HIS A CB  1 
ATOM   5252  C CG  . HIS A 1 699 ? 17.693  19.964  31.067  1.00 52.13  ? 721  HIS A CG  1 
ATOM   5253  N ND1 . HIS A 1 699 ? 18.617  19.767  32.071  1.00 55.00  ? 721  HIS A ND1 1 
ATOM   5254  C CD2 . HIS A 1 699 ? 16.584  19.283  31.437  1.00 51.52  ? 721  HIS A CD2 1 
ATOM   5255  C CE1 . HIS A 1 699 ? 18.093  18.991  33.003  1.00 54.74  ? 721  HIS A CE1 1 
ATOM   5256  N NE2 . HIS A 1 699 ? 16.859  18.682  32.641  1.00 52.81  ? 721  HIS A NE2 1 
ATOM   5257  N N   . ASN A 1 700 ? 18.689  24.446  29.462  1.00 54.07  ? 722  ASN A N   1 
ATOM   5258  C CA  . ASN A 1 700 ? 19.529  25.371  28.721  1.00 57.74  ? 722  ASN A CA  1 
ATOM   5259  C C   . ASN A 1 700 ? 20.203  26.293  29.717  1.00 59.40  ? 722  ASN A C   1 
ATOM   5260  O O   . ASN A 1 700 ? 20.140  26.052  30.924  1.00 60.70  ? 722  ASN A O   1 
ATOM   5261  C CB  . ASN A 1 700 ? 18.711  26.167  27.704  1.00 58.89  ? 722  ASN A CB  1 
ATOM   5262  C CG  . ASN A 1 700 ? 18.331  25.337  26.487  1.00 58.34  ? 722  ASN A CG  1 
ATOM   5263  O OD1 . ASN A 1 700 ? 19.086  25.260  25.523  1.00 58.35  ? 722  ASN A OD1 1 
ATOM   5264  N ND2 . ASN A 1 700 ? 17.160  24.707  26.534  1.00 56.58  ? 722  ASN A ND2 1 
ATOM   5265  N N   . ARG A 1 701 ? 20.890  27.317  29.233  1.00 60.05  ? 723  ARG A N   1 
ATOM   5266  C CA  . ARG A 1 701 ? 21.387  28.320  30.150  1.00 65.45  ? 723  ARG A CA  1 
ATOM   5267  C C   . ARG A 1 701 ? 20.703  29.625  29.832  1.00 70.98  ? 723  ARG A C   1 
ATOM   5268  O O   . ARG A 1 701 ? 21.109  30.342  28.932  1.00 74.92  ? 723  ARG A O   1 
ATOM   5269  C CB  . ARG A 1 701 ? 22.893  28.466  29.972  1.00 66.61  ? 723  ARG A CB  1 
ATOM   5270  C CG  . ARG A 1 701 ? 23.623  27.139  29.989  1.00 65.76  ? 723  ARG A CG  1 
ATOM   5271  C CD  . ARG A 1 701 ? 24.861  27.176  29.113  1.00 67.00  ? 723  ARG A CD  1 
ATOM   5272  N NE  . ARG A 1 701 ? 25.666  25.971  29.281  1.00 66.59  ? 723  ARG A NE  1 
ATOM   5273  C CZ  . ARG A 1 701 ? 26.824  25.751  28.670  1.00 65.96  ? 723  ARG A CZ  1 
ATOM   5274  N NH1 . ARG A 1 701 ? 27.319  26.656  27.836  1.00 67.65  ? 723  ARG A NH1 1 
ATOM   5275  N NH2 . ARG A 1 701 ? 27.486  24.624  28.893  1.00 64.10  ? 723  ARG A NH2 1 
ATOM   5276  N N   . ILE A 1 702 ? 19.713  29.980  30.632  1.00 71.88  ? 724  ILE A N   1 
ATOM   5277  C CA  . ILE A 1 702 ? 19.010  31.223  30.416  1.00 71.03  ? 724  ILE A CA  1 
ATOM   5278  C C   . ILE A 1 702 ? 19.089  31.982  31.720  1.00 74.28  ? 724  ILE A C   1 
ATOM   5279  O O   . ILE A 1 702 ? 18.514  31.569  32.728  1.00 76.15  ? 724  ILE A O   1 
ATOM   5280  C CB  . ILE A 1 702 ? 17.551  30.980  30.000  1.00 68.84  ? 724  ILE A CB  1 
ATOM   5281  C CG1 . ILE A 1 702 ? 17.492  30.330  28.611  1.00 67.96  ? 724  ILE A CG1 1 
ATOM   5282  C CG2 . ILE A 1 702 ? 16.780  32.280  30.008  1.00 67.67  ? 724  ILE A CG2 1 
ATOM   5283  C CD1 . ILE A 1 702 ? 16.084  29.936  28.173  1.00 66.91  ? 724  ILE A CD1 1 
ATOM   5284  N N   . SER A 1 703 ? 19.840  33.077  31.699  1.00 76.00  ? 725  SER A N   1 
ATOM   5285  C CA  . SER A 1 703 ? 20.103  33.845  32.901  1.00 79.42  ? 725  SER A CA  1 
ATOM   5286  C C   . SER A 1 703 ? 18.961  34.797  33.209  1.00 82.71  ? 725  SER A C   1 
ATOM   5287  O O   . SER A 1 703 ? 18.630  35.016  34.374  1.00 85.91  ? 725  SER A O   1 
ATOM   5288  C CB  . SER A 1 703 ? 21.428  34.597  32.783  1.00 82.36  ? 725  SER A CB  1 
ATOM   5289  O OG  . SER A 1 703 ? 21.521  35.276  31.542  1.00 85.01  ? 725  SER A OG  1 
ATOM   5290  N N   . HIS A 1 704 ? 18.349  35.355  32.168  1.00 82.38  ? 726  HIS A N   1 
ATOM   5291  C CA  . HIS A 1 704 ? 17.257  36.300  32.383  1.00 85.85  ? 726  HIS A CA  1 
ATOM   5292  C C   . HIS A 1 704 ? 16.190  36.301  31.290  1.00 81.40  ? 726  HIS A C   1 
ATOM   5293  O O   . HIS A 1 704 ? 16.468  36.040  30.119  1.00 79.91  ? 726  HIS A O   1 
ATOM   5294  C CB  . HIS A 1 704 ? 17.790  37.722  32.620  1.00 93.45  ? 726  HIS A CB  1 
ATOM   5295  C CG  . HIS A 1 704 ? 18.170  38.451  31.369  1.00 97.35  ? 726  HIS A CG  1 
ATOM   5296  N ND1 . HIS A 1 704 ? 17.366  39.412  30.794  1.00 99.92  ? 726  HIS A ND1 1 
ATOM   5297  C CD2 . HIS A 1 704 ? 19.275  38.371  30.591  1.00 98.05  ? 726  HIS A CD2 1 
ATOM   5298  C CE1 . HIS A 1 704 ? 17.955  39.887  29.711  1.00 100.67 ? 726  HIS A CE1 1 
ATOM   5299  N NE2 . HIS A 1 704 ? 19.116  39.272  29.566  1.00 99.57  ? 726  HIS A NE2 1 
ATOM   5300  N N   . LEU A 1 705 ? 14.959  36.588  31.698  1.00 78.67  ? 727  LEU A N   1 
ATOM   5301  C CA  . LEU A 1 705 ? 13.849  36.736  30.770  1.00 75.74  ? 727  LEU A CA  1 
ATOM   5302  C C   . LEU A 1 705 ? 13.749  38.183  30.332  1.00 77.32  ? 727  LEU A C   1 
ATOM   5303  O O   . LEU A 1 705 ? 13.767  39.089  31.165  1.00 80.66  ? 727  LEU A O   1 
ATOM   5304  C CB  . LEU A 1 705 ? 12.536  36.327  31.435  1.00 75.05  ? 727  LEU A CB  1 
ATOM   5305  C CG  . LEU A 1 705 ? 11.887  35.021  30.976  1.00 73.50  ? 727  LEU A CG  1 
ATOM   5306  C CD1 . LEU A 1 705 ? 12.841  33.859  31.172  1.00 70.70  ? 727  LEU A CD1 1 
ATOM   5307  C CD2 . LEU A 1 705 ? 10.587  34.788  31.726  1.00 73.56  ? 727  LEU A CD2 1 
ATOM   5308  N N   . PRO A 1 706 ? 13.635  38.409  29.020  1.00 75.85  ? 728  PRO A N   1 
ATOM   5309  C CA  . PRO A 1 706 ? 13.448  39.772  28.515  1.00 77.70  ? 728  PRO A CA  1 
ATOM   5310  C C   . PRO A 1 706 ? 12.129  40.377  28.981  1.00 81.06  ? 728  PRO A C   1 
ATOM   5311  O O   . PRO A 1 706 ? 11.326  39.698  29.620  1.00 82.07  ? 728  PRO A O   1 
ATOM   5312  C CB  . PRO A 1 706 ? 13.441  39.588  26.999  1.00 77.00  ? 728  PRO A CB  1 
ATOM   5313  C CG  . PRO A 1 706 ? 13.204  38.116  26.772  1.00 73.59  ? 728  PRO A CG  1 
ATOM   5314  C CD  . PRO A 1 706 ? 13.804  37.424  27.939  1.00 72.31  ? 728  PRO A CD  1 
ATOM   5315  N N   . SER A 1 707 ? 11.895  41.637  28.637  1.00 82.43  ? 729  SER A N   1 
ATOM   5316  C CA  . SER A 1 707 ? 10.805  42.382  29.247  1.00 83.84  ? 729  SER A CA  1 
ATOM   5317  C C   . SER A 1 707 ? 9.430   41.961  28.731  1.00 85.48  ? 729  SER A C   1 
ATOM   5318  O O   . SER A 1 707 ? 9.165   42.006  27.531  1.00 85.10  ? 729  SER A O   1 
ATOM   5319  C CB  . SER A 1 707 ? 11.014  43.883  29.049  1.00 83.39  ? 729  SER A CB  1 
ATOM   5320  O OG  . SER A 1 707 ? 10.189  44.619  29.929  1.00 83.71  ? 729  SER A OG  1 
ATOM   5321  N N   . GLY A 1 708 ? 8.562   41.557  29.656  1.00 86.83  ? 730  GLY A N   1 
ATOM   5322  C CA  . GLY A 1 708 ? 7.195   41.180  29.338  1.00 86.55  ? 730  GLY A CA  1 
ATOM   5323  C C   . GLY A 1 708 ? 7.080   39.885  28.558  1.00 82.49  ? 730  GLY A C   1 
ATOM   5324  O O   . GLY A 1 708 ? 6.184   39.732  27.726  1.00 80.95  ? 730  GLY A O   1 
ATOM   5325  N N   . PHE A 1 709 ? 7.987   38.951  28.833  1.00 79.98  ? 731  PHE A N   1 
ATOM   5326  C CA  . PHE A 1 709 ? 8.073   37.704  28.075  1.00 76.08  ? 731  PHE A CA  1 
ATOM   5327  C C   . PHE A 1 709 ? 6.864   36.810  28.309  1.00 77.76  ? 731  PHE A C   1 
ATOM   5328  O O   . PHE A 1 709 ? 6.377   36.151  27.391  1.00 77.37  ? 731  PHE A O   1 
ATOM   5329  C CB  . PHE A 1 709 ? 9.361   36.956  28.435  1.00 72.05  ? 731  PHE A CB  1 
ATOM   5330  C CG  . PHE A 1 709 ? 9.651   35.782  27.544  1.00 68.46  ? 731  PHE A CG  1 
ATOM   5331  C CD1 . PHE A 1 709 ? 10.045  35.976  26.232  1.00 67.42  ? 731  PHE A CD1 1 
ATOM   5332  C CD2 . PHE A 1 709 ? 9.538   34.487  28.019  1.00 65.28  ? 731  PHE A CD2 1 
ATOM   5333  C CE1 . PHE A 1 709 ? 10.311  34.906  25.406  1.00 63.66  ? 731  PHE A CE1 1 
ATOM   5334  C CE2 . PHE A 1 709 ? 9.806   33.410  27.198  1.00 63.45  ? 731  PHE A CE2 1 
ATOM   5335  C CZ  . PHE A 1 709 ? 10.196  33.625  25.886  1.00 62.90  ? 731  PHE A CZ  1 
ATOM   5336  N N   . LEU A 1 710 ? 6.381   36.797  29.545  1.00 80.18  ? 732  LEU A N   1 
ATOM   5337  C CA  . LEU A 1 710 ? 5.279   35.926  29.920  1.00 81.11  ? 732  LEU A CA  1 
ATOM   5338  C C   . LEU A 1 710 ? 3.979   36.417  29.295  1.00 84.03  ? 732  LEU A C   1 
ATOM   5339  O O   . LEU A 1 710 ? 3.056   35.637  29.062  1.00 86.17  ? 732  LEU A O   1 
ATOM   5340  C CB  . LEU A 1 710 ? 5.165   35.851  31.443  1.00 81.20  ? 732  LEU A CB  1 
ATOM   5341  C CG  . LEU A 1 710 ? 6.462   35.445  32.148  1.00 78.70  ? 732  LEU A CG  1 
ATOM   5342  C CD1 . LEU A 1 710 ? 6.273   35.369  33.648  1.00 79.20  ? 732  LEU A CD1 1 
ATOM   5343  C CD2 . LEU A 1 710 ? 6.962   34.119  31.611  1.00 75.24  ? 732  LEU A CD2 1 
ATOM   5344  N N   . SER A 1 711 ? 3.911   37.718  29.044  1.00 84.07  ? 733  SER A N   1 
ATOM   5345  C CA  . SER A 1 711 ? 2.765   38.335  28.385  1.00 86.74  ? 733  SER A CA  1 
ATOM   5346  C C   . SER A 1 711 ? 2.986   38.576  26.886  1.00 84.51  ? 733  SER A C   1 
ATOM   5347  O O   . SER A 1 711 ? 2.143   39.181  26.223  1.00 86.36  ? 733  SER A O   1 
ATOM   5348  C CB  . SER A 1 711 ? 2.405   39.657  29.076  1.00 91.84  ? 733  SER A CB  1 
ATOM   5349  O OG  . SER A 1 711 ? 2.198   39.471  30.468  1.00 94.04  ? 733  SER A OG  1 
ATOM   5350  N N   . GLU A 1 712 ? 4.130   38.142  26.364  1.00 80.37  ? 734  GLU A N   1 
ATOM   5351  C CA  . GLU A 1 712 ? 4.525   38.482  24.993  1.00 77.89  ? 734  GLU A CA  1 
ATOM   5352  C C   . GLU A 1 712 ? 3.663   37.877  23.876  1.00 73.03  ? 734  GLU A C   1 
ATOM   5353  O O   . GLU A 1 712 ? 3.090   38.606  23.063  1.00 71.99  ? 734  GLU A O   1 
ATOM   5354  C CB  . GLU A 1 712 ? 5.995   38.120  24.750  1.00 76.21  ? 734  GLU A CB  1 
ATOM   5355  C CG  . GLU A 1 712 ? 6.526   38.581  23.396  1.00 75.60  ? 734  GLU A CG  1 
ATOM   5356  C CD  . GLU A 1 712 ? 6.654   40.090  23.312  1.00 78.68  ? 734  GLU A CD  1 
ATOM   5357  O OE1 . GLU A 1 712 ? 6.476   40.651  22.213  1.00 78.17  ? 734  GLU A OE1 1 
ATOM   5358  O OE2 . GLU A 1 712 ? 6.936   40.719  24.351  1.00 82.29  ? 734  GLU A OE2 1 
ATOM   5359  N N   . VAL A 1 713 ? 3.567   36.551  23.841  1.00 68.28  ? 735  VAL A N   1 
ATOM   5360  C CA  . VAL A 1 713 ? 2.913   35.872  22.725  1.00 69.05  ? 735  VAL A CA  1 
ATOM   5361  C C   . VAL A 1 713 ? 1.488   35.420  23.062  1.00 69.44  ? 735  VAL A C   1 
ATOM   5362  O O   . VAL A 1 713 ? 1.282   34.650  24.002  1.00 67.31  ? 735  VAL A O   1 
ATOM   5363  C CB  . VAL A 1 713 ? 3.747   34.670  22.243  1.00 68.58  ? 735  VAL A CB  1 
ATOM   5364  C CG1 . VAL A 1 713 ? 3.217   34.163  20.915  1.00 68.47  ? 735  VAL A CG1 1 
ATOM   5365  C CG2 . VAL A 1 713 ? 5.199   35.072  22.113  1.00 69.54  ? 735  VAL A CG2 1 
ATOM   5366  N N   . SER A 1 714 ? 0.517   35.890  22.276  1.00 70.96  ? 736  SER A N   1 
ATOM   5367  C CA  . SER A 1 714 ? -0.906  35.645  22.539  1.00 71.58  ? 736  SER A CA  1 
ATOM   5368  C C   . SER A 1 714 ? -1.348  34.189  22.354  1.00 67.26  ? 736  SER A C   1 
ATOM   5369  O O   . SER A 1 714 ? -2.279  33.733  23.015  1.00 66.87  ? 736  SER A O   1 
ATOM   5370  C CB  . SER A 1 714 ? -1.782  36.562  21.683  1.00 72.92  ? 736  SER A CB  1 
ATOM   5371  O OG  . SER A 1 714 ? -2.312  37.613  22.465  1.00 77.17  ? 736  SER A OG  1 
ATOM   5372  N N   . SER A 1 715 ? -0.681  33.462  21.468  1.00 65.44  ? 737  SER A N   1 
ATOM   5373  C CA  . SER A 1 715 ? -1.024  32.066  21.238  1.00 64.84  ? 737  SER A CA  1 
ATOM   5374  C C   . SER A 1 715 ? -0.418  31.141  22.288  1.00 62.69  ? 737  SER A C   1 
ATOM   5375  O O   . SER A 1 715 ? -0.875  30.008  22.465  1.00 60.22  ? 737  SER A O   1 
ATOM   5376  C CB  . SER A 1 715 ? -0.580  31.638  19.838  1.00 67.12  ? 737  SER A CB  1 
ATOM   5377  O OG  . SER A 1 715 ? 0.758   32.046  19.582  1.00 67.69  ? 737  SER A OG  1 
ATOM   5378  N N   . LEU A 1 716 ? 0.591   31.636  22.999  1.00 62.05  ? 738  LEU A N   1 
ATOM   5379  C CA  . LEU A 1 716 ? 1.393   30.775  23.861  1.00 61.20  ? 738  LEU A CA  1 
ATOM   5380  C C   . LEU A 1 716 ? 0.655   30.305  25.115  1.00 61.13  ? 738  LEU A C   1 
ATOM   5381  O O   . LEU A 1 716 ? 0.216   31.105  25.945  1.00 64.99  ? 738  LEU A O   1 
ATOM   5382  C CB  . LEU A 1 716 ? 2.718   31.455  24.224  1.00 60.42  ? 738  LEU A CB  1 
ATOM   5383  C CG  . LEU A 1 716 ? 3.810   30.555  24.816  1.00 58.58  ? 738  LEU A CG  1 
ATOM   5384  C CD1 . LEU A 1 716 ? 4.248   29.475  23.829  1.00 52.95  ? 738  LEU A CD1 1 
ATOM   5385  C CD2 . LEU A 1 716 ? 5.009   31.372  25.276  1.00 59.84  ? 738  LEU A CD2 1 
ATOM   5386  N N   . LYS A 1 717 ? 0.566   28.990  25.252  1.00 58.50  ? 739  LYS A N   1 
ATOM   5387  C CA  . LYS A 1 717 ? -0.122  28.363  26.375  1.00 59.47  ? 739  LYS A CA  1 
ATOM   5388  C C   . LYS A 1 717 ? 0.897   27.762  27.335  1.00 59.57  ? 739  LYS A C   1 
ATOM   5389  O O   . LYS A 1 717 ? 0.912   28.084  28.518  1.00 62.79  ? 739  LYS A O   1 
ATOM   5390  C CB  . LYS A 1 717 ? -1.113  27.296  25.905  1.00 58.16  ? 739  LYS A CB  1 
ATOM   5391  C CG  . LYS A 1 717 ? -2.173  27.810  24.925  1.00 59.34  ? 739  LYS A CG  1 
ATOM   5392  C CD  . LYS A 1 717 ? -2.885  29.048  25.445  1.00 61.25  ? 739  LYS A CD  1 
ATOM   5393  C CE  . LYS A 1 717 ? -3.833  28.709  26.565  1.00 60.88  ? 739  LYS A CE  1 
ATOM   5394  N NZ  . LYS A 1 717 ? -4.651  29.870  26.974  1.00 65.44  ? 739  LYS A NZ  1 
ATOM   5395  N N   . HIS A 1 718 ? 1.707   26.848  26.816  1.00 58.55  ? 740  HIS A N   1 
ATOM   5396  C CA  . HIS A 1 718 ? 2.716   26.133  27.588  1.00 60.16  ? 740  HIS A CA  1 
ATOM   5397  C C   . HIS A 1 718 ? 4.127   26.677  27.334  1.00 61.92  ? 740  HIS A C   1 
ATOM   5398  O O   . HIS A 1 718 ? 4.638   26.621  26.214  1.00 62.39  ? 740  HIS A O   1 
ATOM   5399  C CB  . HIS A 1 718 ? 2.648   24.657  27.204  1.00 56.64  ? 740  HIS A CB  1 
ATOM   5400  C CG  . HIS A 1 718 ? 3.685   23.780  27.848  1.00 56.73  ? 740  HIS A CG  1 
ATOM   5401  N ND1 . HIS A 1 718 ? 3.745   22.433  27.606  1.00 53.45  ? 740  HIS A ND1 1 
ATOM   5402  C CD2 . HIS A 1 718 ? 4.690   24.062  28.715  1.00 59.51  ? 740  HIS A CD2 1 
ATOM   5403  C CE1 . HIS A 1 718 ? 4.736   21.901  28.313  1.00 53.74  ? 740  HIS A CE1 1 
ATOM   5404  N NE2 . HIS A 1 718 ? 5.310   22.863  29.000  1.00 58.26  ? 740  HIS A NE2 1 
ATOM   5405  N N   . LEU A 1 719 ? 4.752   27.182  28.393  1.00 61.52  ? 741  LEU A N   1 
ATOM   5406  C CA  . LEU A 1 719 ? 6.133   27.651  28.348  1.00 59.74  ? 741  LEU A CA  1 
ATOM   5407  C C   . LEU A 1 719 ? 6.983   26.884  29.365  1.00 58.67  ? 741  LEU A C   1 
ATOM   5408  O O   . LEU A 1 719 ? 6.702   26.922  30.567  1.00 60.01  ? 741  LEU A O   1 
ATOM   5409  C CB  . LEU A 1 719 ? 6.186   29.150  28.649  1.00 61.55  ? 741  LEU A CB  1 
ATOM   5410  C CG  . LEU A 1 719 ? 7.570   29.806  28.730  1.00 62.36  ? 741  LEU A CG  1 
ATOM   5411  C CD1 . LEU A 1 719 ? 8.249   29.834  27.368  1.00 61.67  ? 741  LEU A CD1 1 
ATOM   5412  C CD2 . LEU A 1 719 ? 7.470   31.201  29.303  1.00 63.49  ? 741  LEU A CD2 1 
ATOM   5413  N N   . ASP A 1 720 ? 8.008   26.179  28.886  1.00 55.33  ? 742  ASP A N   1 
ATOM   5414  C CA  . ASP A 1 720 ? 8.867   25.399  29.772  1.00 56.39  ? 742  ASP A CA  1 
ATOM   5415  C C   . ASP A 1 720 ? 10.226  26.078  29.981  1.00 57.60  ? 742  ASP A C   1 
ATOM   5416  O O   . ASP A 1 720 ? 11.076  26.091  29.091  1.00 56.36  ? 742  ASP A O   1 
ATOM   5417  C CB  . ASP A 1 720 ? 9.056   23.995  29.194  1.00 57.48  ? 742  ASP A CB  1 
ATOM   5418  C CG  . ASP A 1 720 ? 9.872   23.089  30.095  1.00 55.72  ? 742  ASP A CG  1 
ATOM   5419  O OD1 . ASP A 1 720 ? 10.197  23.501  31.231  1.00 58.02  ? 742  ASP A OD1 1 
ATOM   5420  O OD2 . ASP A 1 720 ? 10.167  21.952  29.669  1.00 51.26  ? 742  ASP A OD2 1 
ATOM   5421  N N   . LEU A 1 721 ? 10.398  26.664  31.164  1.00 57.87  ? 743  LEU A N   1 
ATOM   5422  C CA  . LEU A 1 721 ? 11.656  27.273  31.601  1.00 55.33  ? 743  LEU A CA  1 
ATOM   5423  C C   . LEU A 1 721 ? 12.495  26.451  32.581  1.00 54.44  ? 743  LEU A C   1 
ATOM   5424  O O   . LEU A 1 721 ? 13.485  26.951  33.120  1.00 56.94  ? 743  LEU A O   1 
ATOM   5425  C CB  . LEU A 1 721 ? 11.429  28.691  32.121  1.00 53.18  ? 743  LEU A CB  1 
ATOM   5426  C CG  . LEU A 1 721 ? 11.138  29.628  30.954  1.00 50.16  ? 743  LEU A CG  1 
ATOM   5427  C CD1 . LEU A 1 721 ? 10.667  30.989  31.424  1.00 52.32  ? 743  LEU A CD1 1 
ATOM   5428  C CD2 . LEU A 1 721 ? 12.378  29.741  30.090  1.00 49.40  ? 743  LEU A CD2 1 
ATOM   5429  N N   . SER A 1 722 ? 12.068  25.224  32.854  1.00 53.22  ? 744  SER A N   1 
ATOM   5430  C CA  . SER A 1 722 ? 12.710  24.392  33.870  1.00 53.42  ? 744  SER A CA  1 
ATOM   5431  C C   . SER A 1 722 ? 14.170  24.054  33.553  1.00 52.89  ? 744  SER A C   1 
ATOM   5432  O O   . SER A 1 722 ? 14.592  24.110  32.400  1.00 50.48  ? 744  SER A O   1 
ATOM   5433  C CB  . SER A 1 722 ? 11.912  23.102  34.093  1.00 51.17  ? 744  SER A CB  1 
ATOM   5434  O OG  . SER A 1 722 ? 11.849  22.323  32.914  1.00 47.09  ? 744  SER A OG  1 
ATOM   5435  N N   . SER A 1 723 ? 14.933  23.721  34.594  1.00 54.53  ? 745  SER A N   1 
ATOM   5436  C CA  . SER A 1 723 ? 16.358  23.401  34.465  1.00 56.08  ? 745  SER A CA  1 
ATOM   5437  C C   . SER A 1 723 ? 17.177  24.453  33.705  1.00 58.24  ? 745  SER A C   1 
ATOM   5438  O O   . SER A 1 723 ? 17.849  24.148  32.723  1.00 60.09  ? 745  SER A O   1 
ATOM   5439  C CB  . SER A 1 723 ? 16.551  22.013  33.850  1.00 54.28  ? 745  SER A CB  1 
ATOM   5440  O OG  . SER A 1 723 ? 16.298  21.006  34.813  1.00 53.00  ? 745  SER A OG  1 
ATOM   5441  N N   . ASN A 1 724 ? 17.095  25.694  34.165  1.00 59.13  ? 746  ASN A N   1 
ATOM   5442  C CA  . ASN A 1 724 ? 17.876  26.786  33.602  1.00 59.44  ? 746  ASN A CA  1 
ATOM   5443  C C   . ASN A 1 724 ? 18.609  27.535  34.698  1.00 63.40  ? 746  ASN A C   1 
ATOM   5444  O O   . ASN A 1 724 ? 18.665  27.075  35.835  1.00 64.98  ? 746  ASN A O   1 
ATOM   5445  C CB  . ASN A 1 724 ? 16.996  27.743  32.802  1.00 58.62  ? 746  ASN A CB  1 
ATOM   5446  C CG  . ASN A 1 724 ? 16.717  27.243  31.401  1.00 55.59  ? 746  ASN A CG  1 
ATOM   5447  O OD1 . ASN A 1 724 ? 17.269  27.753  30.423  1.00 54.13  ? 746  ASN A OD1 1 
ATOM   5448  N ND2 . ASN A 1 724 ? 15.854  26.240  31.297  1.00 53.19  ? 746  ASN A ND2 1 
ATOM   5449  N N   . LEU A 1 725 ? 19.209  28.663  34.333  1.00 65.64  ? 747  LEU A N   1 
ATOM   5450  C CA  . LEU A 1 725 ? 19.975  29.490  35.260  1.00 66.73  ? 747  LEU A CA  1 
ATOM   5451  C C   . LEU A 1 725 ? 19.232  30.693  35.859  1.00 71.61  ? 747  LEU A C   1 
ATOM   5452  O O   . LEU A 1 725 ? 19.859  31.542  36.489  1.00 72.85  ? 747  LEU A O   1 
ATOM   5453  C CB  . LEU A 1 725 ? 21.312  29.905  34.637  1.00 63.13  ? 747  LEU A CB  1 
ATOM   5454  C CG  . LEU A 1 725 ? 22.187  28.697  34.276  1.00 58.87  ? 747  LEU A CG  1 
ATOM   5455  C CD1 . LEU A 1 725 ? 23.559  29.122  33.805  1.00 56.84  ? 747  LEU A CD1 1 
ATOM   5456  C CD2 . LEU A 1 725 ? 22.294  27.737  35.453  1.00 58.72  ? 747  LEU A CD2 1 
ATOM   5457  N N   . LEU A 1 726 ? 17.924  30.798  35.619  1.00 73.32  ? 748  LEU A N   1 
ATOM   5458  C CA  . LEU A 1 726 ? 17.163  31.951  36.103  1.00 74.37  ? 748  LEU A CA  1 
ATOM   5459  C C   . LEU A 1 726 ? 17.261  32.065  37.620  1.00 76.27  ? 748  LEU A C   1 
ATOM   5460  O O   . LEU A 1 726 ? 16.870  31.150  38.340  1.00 74.19  ? 748  LEU A O   1 
ATOM   5461  C CB  . LEU A 1 726 ? 15.685  31.804  35.738  1.00 71.72  ? 748  LEU A CB  1 
ATOM   5462  C CG  . LEU A 1 726 ? 15.280  31.763  34.265  1.00 68.64  ? 748  LEU A CG  1 
ATOM   5463  C CD1 . LEU A 1 726 ? 13.861  31.247  34.130  1.00 66.95  ? 748  LEU A CD1 1 
ATOM   5464  C CD2 . LEU A 1 726 ? 15.396  33.138  33.660  1.00 69.35  ? 748  LEU A CD2 1 
ATOM   5465  N N   . LYS A 1 727 ? 17.788  33.192  38.100  1.00 79.09  ? 749  LYS A N   1 
ATOM   5466  C CA  . LYS A 1 727 ? 17.826  33.451  39.535  1.00 80.45  ? 749  LYS A CA  1 
ATOM   5467  C C   . LYS A 1 727 ? 16.650  34.281  40.023  1.00 81.39  ? 749  LYS A C   1 
ATOM   5468  O O   . LYS A 1 727 ? 16.360  34.308  41.215  1.00 82.01  ? 749  LYS A O   1 
ATOM   5469  C CB  . LYS A 1 727 ? 19.150  34.109  39.930  1.00 82.62  ? 749  LYS A CB  1 
ATOM   5470  C CG  . LYS A 1 727 ? 20.364  33.201  39.751  1.00 82.05  ? 749  LYS A CG  1 
ATOM   5471  C CD  . LYS A 1 727 ? 21.548  33.681  40.587  1.00 83.79  ? 749  LYS A CD  1 
ATOM   5472  C CE  . LYS A 1 727 ? 22.248  32.521  41.299  1.00 83.87  ? 749  LYS A CE  1 
ATOM   5473  N NZ  . LYS A 1 727 ? 22.831  31.522  40.351  1.00 81.91  ? 749  LYS A NZ  1 
ATOM   5474  N N   . THR A 1 728 ? 15.977  34.957  39.098  1.00 83.81  ? 750  THR A N   1 
ATOM   5475  C CA  . THR A 1 728 ? 14.751  35.684  39.424  1.00 88.00  ? 750  THR A CA  1 
ATOM   5476  C C   . THR A 1 728 ? 13.906  36.018  38.187  1.00 88.10  ? 750  THR A C   1 
ATOM   5477  O O   . THR A 1 728 ? 14.403  36.024  37.058  1.00 86.95  ? 750  THR A O   1 
ATOM   5478  C CB  . THR A 1 728 ? 15.035  36.973  40.235  1.00 91.19  ? 750  THR A CB  1 
ATOM   5479  O OG1 . THR A 1 728 ? 13.821  37.446  40.832  1.00 93.58  ? 750  THR A OG1 1 
ATOM   5480  C CG2 . THR A 1 728 ? 15.611  38.046  39.344  1.00 91.38  ? 750  THR A CG2 1 
ATOM   5481  N N   . ILE A 1 729 ? 12.624  36.281  38.411  1.00 88.32  ? 751  ILE A N   1 
ATOM   5482  C CA  . ILE A 1 729 ? 11.769  36.845  37.381  1.00 88.94  ? 751  ILE A CA  1 
ATOM   5483  C C   . ILE A 1 729 ? 11.384  38.221  37.893  1.00 92.71  ? 751  ILE A C   1 
ATOM   5484  O O   . ILE A 1 729 ? 10.590  38.332  38.825  1.00 95.11  ? 751  ILE A O   1 
ATOM   5485  C CB  . ILE A 1 729 ? 10.470  36.025  37.198  1.00 87.65  ? 751  ILE A CB  1 
ATOM   5486  C CG1 . ILE A 1 729 ? 10.727  34.523  37.350  1.00 84.13  ? 751  ILE A CG1 1 
ATOM   5487  C CG2 . ILE A 1 729 ? 9.833   36.330  35.849  1.00 88.92  ? 751  ILE A CG2 1 
ATOM   5488  C CD1 . ILE A 1 729 ? 11.186  33.846  36.079  1.00 81.67  ? 751  ILE A CD1 1 
ATOM   5489  N N   . ASN A 1 730 ? 11.928  39.276  37.298  1.00 94.10  ? 752  ASN A N   1 
ATOM   5490  C CA  . ASN A 1 730 ? 11.648  40.612  37.817  1.00 96.63  ? 752  ASN A CA  1 
ATOM   5491  C C   . ASN A 1 730 ? 10.418  41.266  37.192  1.00 96.36  ? 752  ASN A C   1 
ATOM   5492  O O   . ASN A 1 730 ? 9.732   40.660  36.365  1.00 94.14  ? 752  ASN A O   1 
ATOM   5493  C CB  . ASN A 1 730 ? 12.882  41.534  37.761  1.00 99.58  ? 752  ASN A CB  1 
ATOM   5494  C CG  . ASN A 1 730 ? 13.331  41.859  36.340  1.00 100.47 ? 752  ASN A CG  1 
ATOM   5495  O OD1 . ASN A 1 730 ? 12.646  41.552  35.365  1.00 100.87 ? 752  ASN A OD1 1 
ATOM   5496  N ND2 . ASN A 1 730 ? 14.490  42.495  36.224  1.00 100.91 ? 752  ASN A ND2 1 
ATOM   5497  N N   . LYS A 1 731 ? 10.150  42.498  37.611  1.00 98.50  ? 753  LYS A N   1 
ATOM   5498  C CA  . LYS A 1 731 ? 9.001   43.266  37.144  1.00 99.40  ? 753  LYS A CA  1 
ATOM   5499  C C   . LYS A 1 731 ? 8.932   43.367  35.621  1.00 100.54 ? 753  LYS A C   1 
ATOM   5500  O O   . LYS A 1 731 ? 7.847   43.376  35.040  1.00 102.91 ? 753  LYS A O   1 
ATOM   5501  C CB  . LYS A 1 731 ? 9.050   44.665  37.752  1.00 98.54  ? 753  LYS A CB  1 
ATOM   5502  C CG  . LYS A 1 731 ? 10.433  45.296  37.690  1.00 96.91  ? 753  LYS A CG  1 
ATOM   5503  C CD  . LYS A 1 731 ? 10.459  46.639  38.392  1.00 97.77  ? 753  LYS A CD  1 
ATOM   5504  C CE  . LYS A 1 731 ? 11.883  47.078  38.671  1.00 96.65  ? 753  LYS A CE  1 
ATOM   5505  N NZ  . LYS A 1 731 ? 11.916  48.294  39.527  1.00 98.63  ? 753  LYS A NZ  1 
ATOM   5506  N N   . SER A 1 732 ? 10.097  43.424  34.984  1.00 98.02  ? 754  SER A N   1 
ATOM   5507  C CA  . SER A 1 732 ? 10.179  43.576  33.534  1.00 96.08  ? 754  SER A CA  1 
ATOM   5508  C C   . SER A 1 732 ? 9.553   42.413  32.749  1.00 91.65  ? 754  SER A C   1 
ATOM   5509  O O   . SER A 1 732 ? 8.829   42.632  31.776  1.00 91.55  ? 754  SER A O   1 
ATOM   5510  C CB  . SER A 1 732 ? 11.632  43.794  33.104  1.00 96.47  ? 754  SER A CB  1 
ATOM   5511  O OG  . SER A 1 732 ? 12.130  45.027  33.597  1.00 100.54 ? 754  SER A OG  1 
ATOM   5512  N N   . ALA A 1 733 ? 9.823   41.181  33.168  1.00 88.00  ? 755  ALA A N   1 
ATOM   5513  C CA  . ALA A 1 733 ? 9.256   40.012  32.496  1.00 86.34  ? 755  ALA A CA  1 
ATOM   5514  C C   . ALA A 1 733 ? 7.736   39.967  32.651  1.00 89.83  ? 755  ALA A C   1 
ATOM   5515  O O   . ALA A 1 733 ? 7.041   39.240  31.935  1.00 87.54  ? 755  ALA A O   1 
ATOM   5516  C CB  . ALA A 1 733 ? 9.883   38.740  33.035  1.00 81.50  ? 755  ALA A CB  1 
ATOM   5517  N N   . LEU A 1 734 ? 7.241   40.724  33.624  1.00 95.16  ? 756  LEU A N   1 
ATOM   5518  C CA  . LEU A 1 734 ? 5.815   40.817  33.898  1.00 98.41  ? 756  LEU A CA  1 
ATOM   5519  C C   . LEU A 1 734 ? 5.142   42.067  33.318  1.00 103.45 ? 756  LEU A C   1 
ATOM   5520  O O   . LEU A 1 734 ? 3.927   42.227  33.430  1.00 104.60 ? 756  LEU A O   1 
ATOM   5521  C CB  . LEU A 1 734 ? 5.604   40.757  35.407  1.00 97.72  ? 756  LEU A CB  1 
ATOM   5522  C CG  . LEU A 1 734 ? 6.507   39.691  36.031  1.00 93.80  ? 756  LEU A CG  1 
ATOM   5523  C CD1 . LEU A 1 734 ? 6.622   39.875  37.534  1.00 95.07  ? 756  LEU A CD1 1 
ATOM   5524  C CD2 . LEU A 1 734 ? 5.990   38.302  35.692  1.00 89.76  ? 756  LEU A CD2 1 
ATOM   5525  N N   . GLU A 1 735 ? 5.924   42.944  32.693  1.00 106.98 ? 757  GLU A N   1 
ATOM   5526  C CA  . GLU A 1 735 ? 5.412   44.248  32.267  1.00 111.68 ? 757  GLU A CA  1 
ATOM   5527  C C   . GLU A 1 735 ? 4.943   44.286  30.810  1.00 113.81 ? 757  GLU A C   1 
ATOM   5528  O O   . GLU A 1 735 ? 5.758   44.216  29.886  1.00 113.53 ? 757  GLU A O   1 
ATOM   5529  C CB  . GLU A 1 735 ? 6.459   45.342  32.510  1.00 112.63 ? 757  GLU A CB  1 
ATOM   5530  N N   . THR A 1 736 ? 3.633   44.457  30.627  1.00 115.23 ? 758  THR A N   1 
ATOM   5531  C CA  . THR A 1 736 ? 3.003   44.501  29.306  1.00 113.47 ? 758  THR A CA  1 
ATOM   5532  C C   . THR A 1 736 ? 1.508   44.813  29.445  1.00 113.91 ? 758  THR A C   1 
ATOM   5533  O O   . THR A 1 736 ? 0.925   44.624  30.514  1.00 115.02 ? 758  THR A O   1 
ATOM   5534  C CB  . THR A 1 736 ? 3.159   43.157  28.558  1.00 109.64 ? 758  THR A CB  1 
ATOM   5535  N N   . LYS A 1 737 ? 0.888   45.268  28.356  1.00 112.13 ? 759  LYS A N   1 
ATOM   5536  C CA  . LYS A 1 737 ? -0.507  45.718  28.384  1.00 110.27 ? 759  LYS A CA  1 
ATOM   5537  C C   . LYS A 1 737 ? -1.521  44.583  28.527  1.00 108.99 ? 759  LYS A C   1 
ATOM   5538  O O   . LYS A 1 737 ? -2.400  44.628  29.390  1.00 111.41 ? 759  LYS A O   1 
ATOM   5539  C CB  . LYS A 1 737 ? -0.837  46.548  27.142  1.00 109.23 ? 759  LYS A CB  1 
ATOM   5540  C CG  . LYS A 1 737 ? -0.230  47.943  27.142  1.00 111.05 ? 759  LYS A CG  1 
ATOM   5541  N N   . THR A 1 738 ? -1.409  43.570  27.674  1.00 104.65 ? 760  THR A N   1 
ATOM   5542  C CA  . THR A 1 738 ? -2.306  42.424  27.751  1.00 102.28 ? 760  THR A CA  1 
ATOM   5543  C C   . THR A 1 738 ? -1.912  41.520  28.915  1.00 102.88 ? 760  THR A C   1 
ATOM   5544  O O   . THR A 1 738 ? -0.984  41.825  29.665  1.00 104.47 ? 760  THR A O   1 
ATOM   5545  C CB  . THR A 1 738 ? -2.307  41.611  26.443  1.00 98.49  ? 760  THR A CB  1 
ATOM   5546  N N   . THR A 1 739 ? -2.610  40.399  29.055  1.00 100.19 ? 761  THR A N   1 
ATOM   5547  C CA  . THR A 1 739 ? -2.370  39.495  30.170  1.00 97.63  ? 761  THR A CA  1 
ATOM   5548  C C   . THR A 1 739 ? -1.814  38.177  29.662  1.00 95.98  ? 761  THR A C   1 
ATOM   5549  O O   . THR A 1 739 ? -1.995  37.826  28.496  1.00 97.31  ? 761  THR A O   1 
ATOM   5550  C CB  . THR A 1 739 ? -3.656  39.230  30.977  1.00 97.51  ? 761  THR A CB  1 
ATOM   5551  N N   . THR A 1 740 ? -1.109  37.463  30.531  1.00 92.54  ? 762  THR A N   1 
ATOM   5552  C CA  . THR A 1 740 ? -0.596  36.150  30.181  1.00 87.67  ? 762  THR A CA  1 
ATOM   5553  C C   . THR A 1 740 ? -1.756  35.214  29.880  1.00 87.82  ? 762  THR A C   1 
ATOM   5554  O O   . THR A 1 740 ? -2.696  35.104  30.664  1.00 91.42  ? 762  THR A O   1 
ATOM   5555  C CB  . THR A 1 740 ? 0.249   35.551  31.318  1.00 83.82  ? 762  THR A CB  1 
ATOM   5556  N N   . LYS A 1 741 ? -1.699  34.575  28.718  1.00 84.07  ? 763  LYS A N   1 
ATOM   5557  C CA  . LYS A 1 741 ? -2.655  33.535  28.354  1.00 81.45  ? 763  LYS A CA  1 
ATOM   5558  C C   . LYS A 1 741 ? -2.089  32.147  28.630  1.00 77.83  ? 763  LYS A C   1 
ATOM   5559  O O   . LYS A 1 741 ? -2.692  31.131  28.291  1.00 78.67  ? 763  LYS A O   1 
ATOM   5560  C CB  . LYS A 1 741 ? -3.083  33.709  26.904  1.00 79.85  ? 763  LYS A CB  1 
ATOM   5561  C CG  . LYS A 1 741 ? -3.451  35.148  26.659  1.00 83.59  ? 763  LYS A CG  1 
ATOM   5562  C CD  . LYS A 1 741 ? -4.329  35.362  25.460  1.00 84.27  ? 763  LYS A CD  1 
ATOM   5563  C CE  . LYS A 1 741 ? -5.080  36.669  25.646  1.00 86.21  ? 763  LYS A CE  1 
ATOM   5564  N NZ  . LYS A 1 741 ? -5.344  37.391  24.374  1.00 87.59  ? 763  LYS A NZ  1 
ATOM   5565  N N   . LEU A 1 742 ? -0.909  32.122  29.235  1.00 72.34  ? 764  LEU A N   1 
ATOM   5566  C CA  . LEU A 1 742 ? -0.269  30.879  29.621  1.00 69.22  ? 764  LEU A CA  1 
ATOM   5567  C C   . LEU A 1 742 ? -1.135  30.054  30.570  1.00 67.00  ? 764  LEU A C   1 
ATOM   5568  O O   . LEU A 1 742 ? -1.605  30.561  31.587  1.00 68.83  ? 764  LEU A O   1 
ATOM   5569  C CB  . LEU A 1 742 ? 1.070   31.197  30.283  1.00 69.21  ? 764  LEU A CB  1 
ATOM   5570  C CG  . LEU A 1 742 ? 2.082   31.866  29.352  1.00 67.23  ? 764  LEU A CG  1 
ATOM   5571  C CD1 . LEU A 1 742 ? 3.166   32.539  30.159  1.00 66.46  ? 764  LEU A CD1 1 
ATOM   5572  C CD2 . LEU A 1 742 ? 2.677   30.829  28.407  1.00 63.56  ? 764  LEU A CD2 1 
ATOM   5573  N N   . SER A 1 743 ? -1.388  28.797  30.215  1.00 63.30  ? 765  SER A N   1 
ATOM   5574  C CA  . SER A 1 743 ? -1.995  27.862  31.158  1.00 64.74  ? 765  SER A CA  1 
ATOM   5575  C C   . SER A 1 743 ? -0.948  26.992  31.866  1.00 69.35  ? 765  SER A C   1 
ATOM   5576  O O   . SER A 1 743 ? -1.260  26.299  32.841  1.00 70.91  ? 765  SER A O   1 
ATOM   5577  C CB  . SER A 1 743 ? -3.049  26.988  30.469  1.00 61.28  ? 765  SER A CB  1 
ATOM   5578  O OG  . SER A 1 743 ? -2.436  26.090  29.564  1.00 59.67  ? 765  SER A OG  1 
ATOM   5579  N N   . MET A 1 744 ? 0.290   27.024  31.378  1.00 67.09  ? 766  MET A N   1 
ATOM   5580  C CA  . MET A 1 744 ? 1.374   26.338  32.081  1.00 62.44  ? 766  MET A CA  1 
ATOM   5581  C C   . MET A 1 744 ? 2.733   27.028  31.992  1.00 61.85  ? 766  MET A C   1 
ATOM   5582  O O   . MET A 1 744 ? 3.144   27.526  30.939  1.00 60.68  ? 766  MET A O   1 
ATOM   5583  C CB  . MET A 1 744 ? 1.491   24.878  31.639  1.00 56.99  ? 766  MET A CB  1 
ATOM   5584  C CG  . MET A 1 744 ? 2.356   24.004  32.587  1.00 70.97  ? 766  MET A CG  1 
ATOM   5585  S SD  . MET A 1 744 ? 1.730   22.326  32.787  1.00 98.80  ? 766  MET A SD  1 
ATOM   5586  C CE  . MET A 1 744 ? 2.605   21.409  31.556  1.00 69.06  ? 766  MET A CE  1 
ATOM   5587  N N   . LEU A 1 745 ? 3.411   27.075  33.128  1.00 60.08  ? 767  LEU A N   1 
ATOM   5588  C CA  . LEU A 1 745 ? 4.741   27.635  33.187  1.00 59.98  ? 767  LEU A CA  1 
ATOM   5589  C C   . LEU A 1 745 ? 5.612   26.761  34.086  1.00 61.81  ? 767  LEU A C   1 
ATOM   5590  O O   . LEU A 1 745 ? 5.340   26.626  35.280  1.00 66.18  ? 767  LEU A O   1 
ATOM   5591  C CB  . LEU A 1 745 ? 4.663   29.062  33.717  1.00 61.80  ? 767  LEU A CB  1 
ATOM   5592  C CG  . LEU A 1 745 ? 5.981   29.806  33.895  1.00 63.86  ? 767  LEU A CG  1 
ATOM   5593  C CD1 . LEU A 1 745 ? 6.723   29.882  32.576  1.00 63.78  ? 767  LEU A CD1 1 
ATOM   5594  C CD2 . LEU A 1 745 ? 5.732   31.196  34.467  1.00 65.42  ? 767  LEU A CD2 1 
ATOM   5595  N N   . GLU A 1 746 ? 6.669   26.182  33.527  1.00 60.06  ? 768  GLU A N   1 
ATOM   5596  C CA  . GLU A 1 746 ? 7.515   25.270  34.294  1.00 59.76  ? 768  GLU A CA  1 
ATOM   5597  C C   . GLU A 1 746 ? 8.806   25.946  34.757  1.00 61.13  ? 768  GLU A C   1 
ATOM   5598  O O   . GLU A 1 746 ? 9.672   26.267  33.956  1.00 63.13  ? 768  GLU A O   1 
ATOM   5599  C CB  . GLU A 1 746 ? 7.831   24.026  33.467  1.00 59.59  ? 768  GLU A CB  1 
ATOM   5600  C CG  . GLU A 1 746 ? 6.599   23.269  32.999  1.00 60.06  ? 768  GLU A CG  1 
ATOM   5601  C CD  . GLU A 1 746 ? 6.945   22.000  32.249  1.00 60.81  ? 768  GLU A CD  1 
ATOM   5602  O OE1 . GLU A 1 746 ? 7.397   21.027  32.890  1.00 60.97  ? 768  GLU A OE1 1 
ATOM   5603  O OE2 . GLU A 1 746 ? 6.766   21.975  31.015  1.00 60.61  ? 768  GLU A OE2 1 
ATOM   5604  N N   . LEU A 1 747 ? 8.895   26.213  36.055  1.00 60.40  ? 769  LEU A N   1 
ATOM   5605  C CA  . LEU A 1 747 ? 10.078  26.841  36.639  1.00 58.71  ? 769  LEU A CA  1 
ATOM   5606  C C   . LEU A 1 747 ? 11.050  25.952  37.425  1.00 58.43  ? 769  LEU A C   1 
ATOM   5607  O O   . LEU A 1 747 ? 12.069  26.431  37.912  1.00 58.77  ? 769  LEU A O   1 
ATOM   5608  C CB  . LEU A 1 747 ? 9.650   28.037  37.480  1.00 59.50  ? 769  LEU A CB  1 
ATOM   5609  C CG  . LEU A 1 747 ? 8.874   29.043  36.630  1.00 59.95  ? 769  LEU A CG  1 
ATOM   5610  C CD1 . LEU A 1 747 ? 8.235   30.059  37.518  1.00 61.47  ? 769  LEU A CD1 1 
ATOM   5611  C CD2 . LEU A 1 747 ? 9.777   29.720  35.601  1.00 57.79  ? 769  LEU A CD2 1 
ATOM   5612  N N   . HIS A 1 748 ? 10.738  24.672  37.571  1.00 58.39  ? 770  HIS A N   1 
ATOM   5613  C CA  . HIS A 1 748 ? 11.495  23.844  38.507  1.00 59.19  ? 770  HIS A CA  1 
ATOM   5614  C C   . HIS A 1 748 ? 12.943  23.600  38.105  1.00 60.23  ? 770  HIS A C   1 
ATOM   5615  O O   . HIS A 1 748 ? 13.232  23.402  36.935  1.00 60.66  ? 770  HIS A O   1 
ATOM   5616  C CB  . HIS A 1 748 ? 10.787  22.516  38.742  1.00 58.72  ? 770  HIS A CB  1 
ATOM   5617  C CG  . HIS A 1 748 ? 10.831  21.586  37.570  1.00 60.01  ? 770  HIS A CG  1 
ATOM   5618  N ND1 . HIS A 1 748 ? 9.814   21.507  36.641  1.00 61.39  ? 770  HIS A ND1 1 
ATOM   5619  C CD2 . HIS A 1 748 ? 11.759  20.678  37.190  1.00 56.95  ? 770  HIS A CD2 1 
ATOM   5620  C CE1 . HIS A 1 748 ? 10.121  20.596  35.734  1.00 58.29  ? 770  HIS A CE1 1 
ATOM   5621  N NE2 . HIS A 1 748 ? 11.296  20.081  36.043  1.00 55.23  ? 770  HIS A NE2 1 
ATOM   5622  N N   . GLY A 1 749 ? 13.848  23.607  39.081  1.00 61.01  ? 771  GLY A N   1 
ATOM   5623  C CA  . GLY A 1 749 ? 15.249  23.331  38.813  1.00 61.88  ? 771  GLY A CA  1 
ATOM   5624  C C   . GLY A 1 749 ? 16.099  24.576  38.634  1.00 65.09  ? 771  GLY A C   1 
ATOM   5625  O O   . GLY A 1 749 ? 17.324  24.491  38.529  1.00 68.20  ? 771  GLY A O   1 
ATOM   5626  N N   . ASN A 1 750 ? 15.450  25.733  38.586  1.00 63.60  ? 772  ASN A N   1 
ATOM   5627  C CA  . ASN A 1 750 ? 16.160  26.997  38.503  1.00 67.38  ? 772  ASN A CA  1 
ATOM   5628  C C   . ASN A 1 750 ? 16.702  27.419  39.871  1.00 68.20  ? 772  ASN A C   1 
ATOM   5629  O O   . ASN A 1 750 ? 16.060  27.185  40.896  1.00 70.75  ? 772  ASN A O   1 
ATOM   5630  C CB  . ASN A 1 750 ? 15.246  28.081  37.922  1.00 70.64  ? 772  ASN A CB  1 
ATOM   5631  C CG  . ASN A 1 750 ? 15.237  28.087  36.404  1.00 69.43  ? 772  ASN A CG  1 
ATOM   5632  O OD1 . ASN A 1 750 ? 16.133  28.641  35.775  1.00 69.76  ? 772  ASN A OD1 1 
ATOM   5633  N ND2 . ASN A 1 750 ? 14.215  27.484  35.811  1.00 69.49  ? 772  ASN A ND2 1 
ATOM   5634  N N   . PRO A 1 751 ? 17.895  28.036  39.890  1.00 66.66  ? 773  PRO A N   1 
ATOM   5635  C CA  . PRO A 1 751 ? 18.538  28.500  41.127  1.00 68.01  ? 773  PRO A CA  1 
ATOM   5636  C C   . PRO A 1 751 ? 17.966  29.829  41.618  1.00 69.40  ? 773  PRO A C   1 
ATOM   5637  O O   . PRO A 1 751 ? 18.629  30.857  41.495  1.00 71.02  ? 773  PRO A O   1 
ATOM   5638  C CB  . PRO A 1 751 ? 19.996  28.690  40.696  1.00 66.52  ? 773  PRO A CB  1 
ATOM   5639  C CG  . PRO A 1 751 ? 19.909  29.056  39.261  1.00 64.84  ? 773  PRO A CG  1 
ATOM   5640  C CD  . PRO A 1 751 ? 18.747  28.264  38.709  1.00 64.27  ? 773  PRO A CD  1 
ATOM   5641  N N   . PHE A 1 752 ? 16.760  29.808  42.173  1.00 70.45  ? 774  PHE A N   1 
ATOM   5642  C CA  . PHE A 1 752 ? 16.079  31.050  42.542  1.00 73.10  ? 774  PHE A CA  1 
ATOM   5643  C C   . PHE A 1 752 ? 16.682  31.783  43.737  1.00 76.78  ? 774  PHE A C   1 
ATOM   5644  O O   . PHE A 1 752 ? 17.119  31.170  44.713  1.00 77.46  ? 774  PHE A O   1 
ATOM   5645  C CB  . PHE A 1 752 ? 14.581  30.817  42.762  1.00 72.25  ? 774  PHE A CB  1 
ATOM   5646  C CG  . PHE A 1 752 ? 13.791  30.747  41.487  1.00 69.93  ? 774  PHE A CG  1 
ATOM   5647  C CD1 . PHE A 1 752 ? 13.478  31.900  40.789  1.00 70.96  ? 774  PHE A CD1 1 
ATOM   5648  C CD2 . PHE A 1 752 ? 13.361  29.532  40.988  1.00 66.33  ? 774  PHE A CD2 1 
ATOM   5649  C CE1 . PHE A 1 752 ? 12.754  31.841  39.612  1.00 70.17  ? 774  PHE A CE1 1 
ATOM   5650  C CE2 . PHE A 1 752 ? 12.634  29.470  39.813  1.00 66.83  ? 774  PHE A CE2 1 
ATOM   5651  C CZ  . PHE A 1 752 ? 12.331  30.623  39.125  1.00 67.51  ? 774  PHE A CZ  1 
ATOM   5652  N N   . GLU A 1 753 ? 16.695  33.107  43.637  1.00 78.87  ? 775  GLU A N   1 
ATOM   5653  C CA  . GLU A 1 753 ? 17.177  33.963  44.705  1.00 82.37  ? 775  GLU A CA  1 
ATOM   5654  C C   . GLU A 1 753 ? 15.994  34.405  45.562  1.00 83.93  ? 775  GLU A C   1 
ATOM   5655  O O   . GLU A 1 753 ? 15.119  35.140  45.107  1.00 85.59  ? 775  GLU A O   1 
ATOM   5656  C CB  . GLU A 1 753 ? 17.918  35.168  44.122  1.00 85.18  ? 775  GLU A CB  1 
ATOM   5657  C CG  . GLU A 1 753 ? 18.680  35.993  45.148  1.00 88.65  ? 775  GLU A CG  1 
ATOM   5658  C CD  . GLU A 1 753 ? 19.624  36.991  44.506  1.00 89.94  ? 775  GLU A CD  1 
ATOM   5659  O OE1 . GLU A 1 753 ? 20.491  36.570  43.709  1.00 89.50  ? 775  GLU A OE1 1 
ATOM   5660  O OE2 . GLU A 1 753 ? 19.496  38.199  44.795  1.00 92.14  ? 775  GLU A OE2 1 
ATOM   5661  N N   . CYS A 1 754 ? 15.993  33.960  46.813  1.00 82.60  ? 776  CYS A N   1 
ATOM   5662  C CA  . CYS A 1 754 ? 14.852  34.113  47.713  1.00 82.51  ? 776  CYS A CA  1 
ATOM   5663  C C   . CYS A 1 754 ? 14.836  35.406  48.520  1.00 86.48  ? 776  CYS A C   1 
ATOM   5664  O O   . CYS A 1 754 ? 14.070  35.537  49.471  1.00 86.72  ? 776  CYS A O   1 
ATOM   5665  C CB  . CYS A 1 754 ? 14.660  32.884  48.602  1.00 80.15  ? 776  CYS A CB  1 
ATOM   5666  S SG  . CYS A 1 754 ? 13.784  31.560  47.742  1.00 93.58  ? 776  CYS A SG  1 
ATOM   5667  N N   . THR A 1 755 ? 15.704  36.346  48.163  1.00 90.33  ? 777  THR A N   1 
ATOM   5668  C CA  . THR A 1 755 ? 15.660  37.666  48.778  1.00 94.29  ? 777  THR A CA  1 
ATOM   5669  C C   . THR A 1 755 ? 14.377  38.365  48.328  1.00 94.47  ? 777  THR A C   1 
ATOM   5670  O O   . THR A 1 755 ? 13.590  37.804  47.564  1.00 93.65  ? 777  THR A O   1 
ATOM   5671  C CB  . THR A 1 755 ? 16.861  38.533  48.357  1.00 97.57  ? 777  THR A CB  1 
ATOM   5672  O OG1 . THR A 1 755 ? 16.624  39.088  47.056  1.00 98.93  ? 777  THR A OG1 1 
ATOM   5673  C CG2 . THR A 1 755 ? 18.142  37.710  48.335  1.00 96.17  ? 777  THR A CG2 1 
ATOM   5674  N N   . CYS A 1 756 ? 14.173  39.591  48.798  1.00 95.19  ? 778  CYS A N   1 
ATOM   5675  C CA  . CYS A 1 756 ? 12.897  40.286  48.621  1.00 96.14  ? 778  CYS A CA  1 
ATOM   5676  C C   . CYS A 1 756 ? 12.444  40.487  47.175  1.00 96.10  ? 778  CYS A C   1 
ATOM   5677  O O   . CYS A 1 756 ? 11.252  40.615  46.909  1.00 98.11  ? 778  CYS A O   1 
ATOM   5678  C CB  . CYS A 1 756 ? 12.924  41.637  49.337  1.00 98.62  ? 778  CYS A CB  1 
ATOM   5679  S SG  . CYS A 1 756 ? 12.074  41.635  50.921  1.00 104.96 ? 778  CYS A SG  1 
ATOM   5680  N N   . ASP A 1 757 ? 13.388  40.514  46.243  1.00 95.30  ? 779  ASP A N   1 
ATOM   5681  C CA  . ASP A 1 757 ? 13.051  40.817  44.854  1.00 96.50  ? 779  ASP A CA  1 
ATOM   5682  C C   . ASP A 1 757 ? 12.313  39.682  44.141  1.00 94.87  ? 779  ASP A C   1 
ATOM   5683  O O   . ASP A 1 757 ? 11.890  39.832  42.996  1.00 96.12  ? 779  ASP A O   1 
ATOM   5684  C CB  . ASP A 1 757 ? 14.286  41.263  44.066  1.00 97.37  ? 779  ASP A CB  1 
ATOM   5685  C CG  . ASP A 1 757 ? 15.458  40.318  44.232  1.00 95.55  ? 779  ASP A CG  1 
ATOM   5686  O OD1 . ASP A 1 757 ? 15.265  39.089  44.103  1.00 93.96  ? 779  ASP A OD1 1 
ATOM   5687  O OD2 . ASP A 1 757 ? 16.577  40.808  44.496  1.00 96.17  ? 779  ASP A OD2 1 
ATOM   5688  N N   . ILE A 1 758 ? 12.175  38.543  44.812  1.00 91.78  ? 780  ILE A N   1 
ATOM   5689  C CA  . ILE A 1 758 ? 11.375  37.450  44.275  1.00 87.34  ? 780  ILE A CA  1 
ATOM   5690  C C   . ILE A 1 758 ? 9.900   37.675  44.590  1.00 85.99  ? 780  ILE A C   1 
ATOM   5691  O O   . ILE A 1 758 ? 9.027   37.034  44.003  1.00 82.99  ? 780  ILE A O   1 
ATOM   5692  C CB  . ILE A 1 758 ? 11.800  36.094  44.851  1.00 86.28  ? 780  ILE A CB  1 
ATOM   5693  C CG1 . ILE A 1 758 ? 11.502  34.979  43.850  1.00 84.84  ? 780  ILE A CG1 1 
ATOM   5694  C CG2 . ILE A 1 758 ? 11.105  35.826  46.187  1.00 87.64  ? 780  ILE A CG2 1 
ATOM   5695  C CD1 . ILE A 1 758 ? 11.771  33.600  44.389  1.00 83.60  ? 780  ILE A CD1 1 
ATOM   5696  N N   . GLY A 1 759 ? 9.636   38.594  45.519  1.00 86.31  ? 781  GLY A N   1 
ATOM   5697  C CA  . GLY A 1 759 ? 8.289   38.860  45.988  1.00 87.15  ? 781  GLY A CA  1 
ATOM   5698  C C   . GLY A 1 759 ? 7.366   39.313  44.878  1.00 87.91  ? 781  GLY A C   1 
ATOM   5699  O O   . GLY A 1 759 ? 6.180   38.982  44.870  1.00 89.00  ? 781  GLY A O   1 
ATOM   5700  N N   . ASP A 1 760 ? 7.921   40.067  43.935  1.00 87.80  ? 782  ASP A N   1 
ATOM   5701  C CA  . ASP A 1 760 ? 7.164   40.538  42.783  1.00 88.75  ? 782  ASP A CA  1 
ATOM   5702  C C   . ASP A 1 760 ? 6.591   39.394  41.942  1.00 86.66  ? 782  ASP A C   1 
ATOM   5703  O O   . ASP A 1 760 ? 5.427   39.439  41.545  1.00 89.26  ? 782  ASP A O   1 
ATOM   5704  C CB  . ASP A 1 760 ? 8.027   41.456  41.918  1.00 91.08  ? 782  ASP A CB  1 
ATOM   5705  C CG  . ASP A 1 760 ? 7.384   42.810  41.695  1.00 95.73  ? 782  ASP A CG  1 
ATOM   5706  O OD1 . ASP A 1 760 ? 6.152   42.855  41.495  1.00 98.35  ? 782  ASP A OD1 1 
ATOM   5707  O OD2 . ASP A 1 760 ? 8.107   43.828  41.728  1.00 95.55  ? 782  ASP A OD2 1 
ATOM   5708  N N   . PHE A 1 761 ? 7.402   38.375  41.669  1.00 81.35  ? 783  PHE A N   1 
ATOM   5709  C CA  . PHE A 1 761 ? 6.917   37.223  40.915  1.00 79.13  ? 783  PHE A CA  1 
ATOM   5710  C C   . PHE A 1 761 ? 5.918   36.388  41.718  1.00 79.78  ? 783  PHE A C   1 
ATOM   5711  O O   . PHE A 1 761 ? 5.074   35.692  41.153  1.00 79.35  ? 783  PHE A O   1 
ATOM   5712  C CB  . PHE A 1 761 ? 8.070   36.339  40.442  1.00 74.41  ? 783  PHE A CB  1 
ATOM   5713  C CG  . PHE A 1 761 ? 7.618   35.039  39.866  1.00 72.11  ? 783  PHE A CG  1 
ATOM   5714  C CD1 . PHE A 1 761 ? 6.976   35.002  38.641  1.00 71.29  ? 783  PHE A CD1 1 
ATOM   5715  C CD2 . PHE A 1 761 ? 7.810   33.851  40.558  1.00 71.41  ? 783  PHE A CD2 1 
ATOM   5716  C CE1 . PHE A 1 761 ? 6.546   33.801  38.107  1.00 69.23  ? 783  PHE A CE1 1 
ATOM   5717  C CE2 . PHE A 1 761 ? 7.381   32.649  40.031  1.00 68.55  ? 783  PHE A CE2 1 
ATOM   5718  C CZ  . PHE A 1 761 ? 6.743   32.628  38.808  1.00 66.93  ? 783  PHE A CZ  1 
ATOM   5719  N N   . ARG A 1 762 ? 6.016   36.458  43.039  1.00 80.00  ? 784  ARG A N   1 
ATOM   5720  C CA  . ARG A 1 762 ? 5.092   35.732  43.898  1.00 77.90  ? 784  ARG A CA  1 
ATOM   5721  C C   . ARG A 1 762 ? 3.695   36.349  43.847  1.00 78.32  ? 784  ARG A C   1 
ATOM   5722  O O   . ARG A 1 762 ? 2.691   35.644  43.948  1.00 78.36  ? 784  ARG A O   1 
ATOM   5723  C CB  . ARG A 1 762 ? 5.636   35.660  45.323  1.00 76.93  ? 784  ARG A CB  1 
ATOM   5724  C CG  . ARG A 1 762 ? 6.687   34.569  45.489  1.00 74.73  ? 784  ARG A CG  1 
ATOM   5725  C CD  . ARG A 1 762 ? 6.022   33.227  45.734  1.00 72.86  ? 784  ARG A CD  1 
ATOM   5726  N NE  . ARG A 1 762 ? 5.050   33.364  46.811  1.00 75.89  ? 784  ARG A NE  1 
ATOM   5727  C CZ  . ARG A 1 762 ? 5.364   33.359  48.102  1.00 75.26  ? 784  ARG A CZ  1 
ATOM   5728  N NH1 . ARG A 1 762 ? 6.626   33.194  48.479  1.00 74.98  ? 784  ARG A NH1 1 
ATOM   5729  N NH2 . ARG A 1 762 ? 4.413   33.510  49.014  1.00 74.18  ? 784  ARG A NH2 1 
ATOM   5730  N N   . ARG A 1 763 ? 3.638   37.661  43.648  1.00 78.81  ? 785  ARG A N   1 
ATOM   5731  C CA  . ARG A 1 763 ? 2.360   38.336  43.466  1.00 82.21  ? 785  ARG A CA  1 
ATOM   5732  C C   . ARG A 1 763 ? 1.739   37.982  42.116  1.00 80.99  ? 785  ARG A C   1 
ATOM   5733  O O   . ARG A 1 763 ? 0.523   37.800  42.022  1.00 83.08  ? 785  ARG A O   1 
ATOM   5734  C CB  . ARG A 1 763 ? 2.522   39.850  43.583  1.00 84.70  ? 785  ARG A CB  1 
ATOM   5735  C CG  . ARG A 1 763 ? 3.010   40.301  44.939  1.00 88.06  ? 785  ARG A CG  1 
ATOM   5736  C CD  . ARG A 1 763 ? 3.270   41.800  44.964  1.00 93.63  ? 785  ARG A CD  1 
ATOM   5737  N NE  . ARG A 1 763 ? 4.047   42.182  46.139  1.00 97.97  ? 785  ARG A NE  1 
ATOM   5738  C CZ  . ARG A 1 763 ? 5.309   42.603  46.100  1.00 99.42  ? 785  ARG A CZ  1 
ATOM   5739  N NH1 . ARG A 1 763 ? 5.944   42.719  44.941  1.00 96.85  ? 785  ARG A NH1 1 
ATOM   5740  N NH2 . ARG A 1 763 ? 5.934   42.924  47.224  1.00 102.78 ? 785  ARG A NH2 1 
ATOM   5741  N N   . TRP A 1 764 ? 2.570   37.896  41.078  1.00 77.37  ? 786  TRP A N   1 
ATOM   5742  C CA  . TRP A 1 764 ? 2.112   37.467  39.758  1.00 75.31  ? 786  TRP A CA  1 
ATOM   5743  C C   . TRP A 1 764 ? 1.482   36.089  39.855  1.00 74.32  ? 786  TRP A C   1 
ATOM   5744  O O   . TRP A 1 764 ? 0.476   35.811  39.206  1.00 76.01  ? 786  TRP A O   1 
ATOM   5745  C CB  . TRP A 1 764 ? 3.272   37.436  38.765  1.00 73.03  ? 786  TRP A CB  1 
ATOM   5746  C CG  . TRP A 1 764 ? 2.854   37.240  37.328  1.00 71.37  ? 786  TRP A CG  1 
ATOM   5747  C CD1 . TRP A 1 764 ? 2.563   38.219  36.422  1.00 70.12  ? 786  TRP A CD1 1 
ATOM   5748  C CD2 . TRP A 1 764 ? 2.689   35.993  36.635  1.00 66.48  ? 786  TRP A CD2 1 
ATOM   5749  N NE1 . TRP A 1 764 ? 2.231   37.661  35.211  1.00 68.71  ? 786  TRP A NE1 1 
ATOM   5750  C CE2 . TRP A 1 764 ? 2.299   36.298  35.315  1.00 66.48  ? 786  TRP A CE2 1 
ATOM   5751  C CE3 . TRP A 1 764 ? 2.835   34.651  37.000  1.00 71.00  ? 786  TRP A CE3 1 
ATOM   5752  C CZ2 . TRP A 1 764 ? 2.054   35.314  34.363  1.00 64.56  ? 786  TRP A CZ2 1 
ATOM   5753  C CZ3 . TRP A 1 764 ? 2.592   33.672  36.048  1.00 69.06  ? 786  TRP A CZ3 1 
ATOM   5754  C CH2 . TRP A 1 764 ? 2.203   34.011  34.747  1.00 62.62  ? 786  TRP A CH2 1 
ATOM   5755  N N   . MET A 1 765 ? 2.082   35.231  40.673  1.00 73.21  ? 787  MET A N   1 
ATOM   5756  C CA  . MET A 1 765 ? 1.538   33.902  40.918  1.00 73.70  ? 787  MET A CA  1 
ATOM   5757  C C   . MET A 1 765 ? 0.145   33.989  41.536  1.00 77.15  ? 787  MET A C   1 
ATOM   5758  O O   . MET A 1 765 ? -0.802  33.389  41.027  1.00 77.22  ? 787  MET A O   1 
ATOM   5759  C CB  . MET A 1 765 ? 2.468   33.086  41.821  1.00 65.29  ? 787  MET A CB  1 
ATOM   5760  C CG  . MET A 1 765 ? 3.582   32.362  41.089  1.00 63.07  ? 787  MET A CG  1 
ATOM   5761  S SD  . MET A 1 765 ? 4.701   31.537  42.237  1.00 76.05  ? 787  MET A SD  1 
ATOM   5762  C CE  . MET A 1 765 ? 5.255   30.159  41.247  1.00 91.72  ? 787  MET A CE  1 
ATOM   5763  N N   . ASP A 1 766 ? 0.023   34.743  42.627  1.00 79.84  ? 788  ASP A N   1 
ATOM   5764  C CA  . ASP A 1 766 ? -1.253  34.890  43.323  1.00 81.65  ? 788  ASP A CA  1 
ATOM   5765  C C   . ASP A 1 766 ? -2.292  35.512  42.403  1.00 82.83  ? 788  ASP A C   1 
ATOM   5766  O O   . ASP A 1 766 ? -3.478  35.199  42.483  1.00 83.45  ? 788  ASP A O   1 
ATOM   5767  C CB  . ASP A 1 766 ? -1.095  35.758  44.575  1.00 84.27  ? 788  ASP A CB  1 
ATOM   5768  C CG  . ASP A 1 766 ? -0.127  35.167  45.582  1.00 85.10  ? 788  ASP A CG  1 
ATOM   5769  O OD1 . ASP A 1 766 ? -0.041  33.920  45.686  1.00 84.83  ? 788  ASP A OD1 1 
ATOM   5770  O OD2 . ASP A 1 766 ? 0.554   35.952  46.271  1.00 86.49  ? 788  ASP A OD2 1 
ATOM   5771  N N   . GLU A 1 767 ? -1.836  36.390  41.518  1.00 84.15  ? 789  GLU A N   1 
ATOM   5772  C CA  . GLU A 1 767 ? -2.731  37.041  40.574  1.00 86.76  ? 789  GLU A CA  1 
ATOM   5773  C C   . GLU A 1 767 ? -3.315  36.023  39.616  1.00 84.58  ? 789  GLU A C   1 
ATOM   5774  O O   . GLU A 1 767 ? -4.530  35.973  39.419  1.00 87.02  ? 789  GLU A O   1 
ATOM   5775  C CB  . GLU A 1 767 ? -1.997  38.114  39.781  1.00 89.10  ? 789  GLU A CB  1 
ATOM   5776  C CG  . GLU A 1 767 ? -2.634  39.480  39.888  1.00 93.45  ? 789  GLU A CG  1 
ATOM   5777  C CD  . GLU A 1 767 ? -1.634  40.555  40.249  1.00 96.97  ? 789  GLU A CD  1 
ATOM   5778  O OE1 . GLU A 1 767 ? -1.111  41.214  39.329  1.00 97.64  ? 789  GLU A OE1 1 
ATOM   5779  O OE2 . GLU A 1 767 ? -1.369  40.742  41.454  1.00 98.56  ? 789  GLU A OE2 1 
ATOM   5780  N N   . HIS A 1 768 ? -2.456  35.209  39.012  1.00 80.12  ? 790  HIS A N   1 
ATOM   5781  C CA  . HIS A 1 768 ? -2.957  34.207  38.089  1.00 77.84  ? 790  HIS A CA  1 
ATOM   5782  C C   . HIS A 1 768 ? -2.809  32.814  38.674  1.00 78.91  ? 790  HIS A C   1 
ATOM   5783  O O   . HIS A 1 768 ? -1.731  32.218  38.631  1.00 76.83  ? 790  HIS A O   1 
ATOM   5784  C CB  . HIS A 1 768 ? -2.208  34.313  36.760  1.00 73.50  ? 790  HIS A CB  1 
ATOM   5785  C CG  . HIS A 1 768 ? -2.097  35.717  36.257  1.00 75.61  ? 790  HIS A CG  1 
ATOM   5786  N ND1 . HIS A 1 768 ? -0.988  36.501  36.483  1.00 76.77  ? 790  HIS A ND1 1 
ATOM   5787  C CD2 . HIS A 1 768 ? -2.978  36.497  35.585  1.00 79.07  ? 790  HIS A CD2 1 
ATOM   5788  C CE1 . HIS A 1 768 ? -1.180  37.697  35.953  1.00 80.48  ? 790  HIS A CE1 1 
ATOM   5789  N NE2 . HIS A 1 768 ? -2.380  37.720  35.401  1.00 81.29  ? 790  HIS A NE2 1 
ATOM   5790  N N   . LEU A 1 769 ? -3.923  32.273  39.156  1.00 81.12  ? 791  LEU A N   1 
ATOM   5791  C CA  . LEU A 1 769 ? -3.949  30.927  39.713  1.00 80.13  ? 791  LEU A CA  1 
ATOM   5792  C C   . LEU A 1 769 ? -4.205  29.950  38.583  1.00 77.11  ? 791  LEU A C   1 
ATOM   5793  O O   . LEU A 1 769 ? -3.960  28.757  38.707  1.00 77.33  ? 791  LEU A O   1 
ATOM   5794  C CB  . LEU A 1 769 ? -5.042  30.810  40.780  1.00 81.56  ? 791  LEU A CB  1 
ATOM   5795  C CG  . LEU A 1 769 ? -4.828  31.597  42.074  1.00 82.64  ? 791  LEU A CG  1 
ATOM   5796  C CD1 . LEU A 1 769 ? -6.048  31.503  42.958  1.00 84.04  ? 791  LEU A CD1 1 
ATOM   5797  C CD2 . LEU A 1 769 ? -3.603  31.087  42.814  1.00 81.28  ? 791  LEU A CD2 1 
ATOM   5798  N N   . ASN A 1 770 ? -4.676  30.487  37.465  1.00 78.46  ? 792  ASN A N   1 
ATOM   5799  C CA  . ASN A 1 770 ? -4.984  29.682  36.296  1.00 80.61  ? 792  ASN A CA  1 
ATOM   5800  C C   . ASN A 1 770 ? -3.721  29.225  35.578  1.00 76.21  ? 792  ASN A C   1 
ATOM   5801  O O   . ASN A 1 770 ? -3.770  28.306  34.766  1.00 74.64  ? 792  ASN A O   1 
ATOM   5802  C CB  . ASN A 1 770 ? -5.915  30.441  35.333  1.00 85.68  ? 792  ASN A CB  1 
ATOM   5803  C CG  . ASN A 1 770 ? -5.159  31.187  34.233  1.00 86.19  ? 792  ASN A CG  1 
ATOM   5804  O OD1 . ASN A 1 770 ? -4.869  30.630  33.170  1.00 85.59  ? 792  ASN A OD1 1 
ATOM   5805  N ND2 . ASN A 1 770 ? -4.855  32.457  34.481  1.00 86.85  ? 792  ASN A ND2 1 
ATOM   5806  N N   . VAL A 1 771 ? -2.594  29.861  35.888  1.00 75.49  ? 793  VAL A N   1 
ATOM   5807  C CA  . VAL A 1 771 ? -1.321  29.466  35.302  1.00 72.89  ? 793  VAL A CA  1 
ATOM   5808  C C   . VAL A 1 771 ? -0.724  28.393  36.194  1.00 71.74  ? 793  VAL A C   1 
ATOM   5809  O O   . VAL A 1 771 ? -0.333  28.666  37.331  1.00 73.54  ? 793  VAL A O   1 
ATOM   5810  C CB  . VAL A 1 771 ? -0.323  30.647  35.226  1.00 72.74  ? 793  VAL A CB  1 
ATOM   5811  C CG1 . VAL A 1 771 ? 1.018   30.181  34.654  1.00 70.98  ? 793  VAL A CG1 1 
ATOM   5812  C CG2 . VAL A 1 771 ? -0.887  31.780  34.395  1.00 74.96  ? 793  VAL A CG2 1 
ATOM   5813  N N   . LYS A 1 772 ? -0.634  27.180  35.660  1.00 69.18  ? 794  LYS A N   1 
ATOM   5814  C CA  . LYS A 1 772 ? -0.155  26.031  36.415  1.00 70.84  ? 794  LYS A CA  1 
ATOM   5815  C C   . LYS A 1 772 ? 1.367   25.940  36.407  1.00 69.96  ? 794  LYS A C   1 
ATOM   5816  O O   . LYS A 1 772 ? 1.985   25.759  35.358  1.00 68.47  ? 794  LYS A O   1 
ATOM   5817  C CB  . LYS A 1 772 ? -0.748  24.750  35.818  1.00 73.37  ? 794  LYS A CB  1 
ATOM   5818  C CG  . LYS A 1 772 ? -0.043  23.459  36.218  1.00 76.16  ? 794  LYS A CG  1 
ATOM   5819  C CD  . LYS A 1 772 ? -0.539  22.908  37.551  1.00 78.06  ? 794  LYS A CD  1 
ATOM   5820  C CE  . LYS A 1 772 ? -0.219  21.423  37.680  1.00 76.42  ? 794  LYS A CE  1 
ATOM   5821  N NZ  . LYS A 1 772 ? -0.525  20.876  39.033  1.00 78.72  ? 794  LYS A NZ  1 
ATOM   5822  N N   . ILE A 1 773 ? 1.960   26.063  37.590  1.00 69.93  ? 795  ILE A N   1 
ATOM   5823  C CA  . ILE A 1 773 ? 3.377   25.819  37.782  1.00 67.01  ? 795  ILE A CA  1 
ATOM   5824  C C   . ILE A 1 773 ? 3.476   24.510  38.521  1.00 65.46  ? 795  ILE A C   1 
ATOM   5825  O O   . ILE A 1 773 ? 3.169   24.452  39.707  1.00 69.66  ? 795  ILE A O   1 
ATOM   5826  C CB  . ILE A 1 773 ? 4.014   26.868  38.699  1.00 68.87  ? 795  ILE A CB  1 
ATOM   5827  C CG1 . ILE A 1 773 ? 3.428   28.256  38.441  1.00 71.06  ? 795  ILE A CG1 1 
ATOM   5828  C CG2 . ILE A 1 773 ? 5.530   26.846  38.540  1.00 69.32  ? 795  ILE A CG2 1 
ATOM   5829  C CD1 . ILE A 1 773 ? 3.935   28.918  37.192  1.00 71.76  ? 795  ILE A CD1 1 
ATOM   5830  N N   . PRO A 1 774 ? 3.918   23.451  37.839  1.00 61.74  ? 796  PRO A N   1 
ATOM   5831  C CA  . PRO A 1 774 ? 3.940   22.156  38.521  1.00 60.76  ? 796  PRO A CA  1 
ATOM   5832  C C   . PRO A 1 774 ? 5.177   21.985  39.400  1.00 58.80  ? 796  PRO A C   1 
ATOM   5833  O O   . PRO A 1 774 ? 6.010   22.887  39.444  1.00 56.56  ? 796  PRO A O   1 
ATOM   5834  C CB  . PRO A 1 774 ? 3.958   21.157  37.361  1.00 58.98  ? 796  PRO A CB  1 
ATOM   5835  C CG  . PRO A 1 774 ? 4.637   21.889  36.247  1.00 58.88  ? 796  PRO A CG  1 
ATOM   5836  C CD  . PRO A 1 774 ? 4.324   23.354  36.425  1.00 60.03  ? 796  PRO A CD  1 
ATOM   5837  N N   . ARG A 1 775 ? 5.264   20.847  40.092  1.00 59.05  ? 797  ARG A N   1 
ATOM   5838  C CA  . ARG A 1 775 ? 6.421   20.486  40.910  1.00 59.64  ? 797  ARG A CA  1 
ATOM   5839  C C   . ARG A 1 775 ? 6.933   21.650  41.744  1.00 59.51  ? 797  ARG A C   1 
ATOM   5840  O O   . ARG A 1 775 ? 8.079   22.071  41.591  1.00 60.10  ? 797  ARG A O   1 
ATOM   5841  C CB  . ARG A 1 775 ? 7.556   19.963  40.021  1.00 60.78  ? 797  ARG A CB  1 
ATOM   5842  C CG  . ARG A 1 775 ? 7.278   18.617  39.376  1.00 63.03  ? 797  ARG A CG  1 
ATOM   5843  C CD  . ARG A 1 775 ? 8.447   18.153  38.502  1.00 63.70  ? 797  ARG A CD  1 
ATOM   5844  N NE  . ARG A 1 775 ? 9.690   18.011  39.260  1.00 63.68  ? 797  ARG A NE  1 
ATOM   5845  C CZ  . ARG A 1 775 ? 10.856  17.657  38.727  1.00 61.94  ? 797  ARG A CZ  1 
ATOM   5846  N NH1 . ARG A 1 775 ? 10.944  17.399  37.431  1.00 60.87  ? 797  ARG A NH1 1 
ATOM   5847  N NH2 . ARG A 1 775 ? 11.935  17.557  39.490  1.00 61.27  ? 797  ARG A NH2 1 
ATOM   5848  N N   . LEU A 1 776 ? 6.096   22.164  42.633  1.00 60.47  ? 798  LEU A N   1 
ATOM   5849  C CA  . LEU A 1 776 ? 6.455   23.375  43.351  1.00 65.23  ? 798  LEU A CA  1 
ATOM   5850  C C   . LEU A 1 776 ? 7.459   23.107  44.467  1.00 67.45  ? 798  LEU A C   1 
ATOM   5851  O O   . LEU A 1 776 ? 8.188   24.009  44.886  1.00 65.53  ? 798  LEU A O   1 
ATOM   5852  C CB  . LEU A 1 776 ? 5.210   24.087  43.882  1.00 68.58  ? 798  LEU A CB  1 
ATOM   5853  C CG  . LEU A 1 776 ? 4.422   24.885  42.842  1.00 69.05  ? 798  LEU A CG  1 
ATOM   5854  C CD1 . LEU A 1 776 ? 3.309   25.671  43.516  1.00 69.75  ? 798  LEU A CD1 1 
ATOM   5855  C CD2 . LEU A 1 776 ? 5.336   25.811  42.051  1.00 69.56  ? 798  LEU A CD2 1 
ATOM   5856  N N   . VAL A 1 777 ? 7.494   21.864  44.941  1.00 70.34  ? 799  VAL A N   1 
ATOM   5857  C CA  . VAL A 1 777 ? 8.495   21.456  45.917  1.00 71.29  ? 799  VAL A CA  1 
ATOM   5858  C C   . VAL A 1 777 ? 9.865   21.444  45.255  1.00 69.35  ? 799  VAL A C   1 
ATOM   5859  O O   . VAL A 1 777 ? 10.888  21.505  45.934  1.00 70.92  ? 799  VAL A O   1 
ATOM   5860  C CB  . VAL A 1 777 ? 8.211   20.057  46.490  1.00 71.34  ? 799  VAL A CB  1 
ATOM   5861  C CG1 . VAL A 1 777 ? 6.962   20.082  47.353  1.00 74.19  ? 799  VAL A CG1 1 
ATOM   5862  C CG2 . VAL A 1 777 ? 8.078   19.042  45.367  1.00 70.28  ? 799  VAL A CG2 1 
ATOM   5863  N N   . ASP A 1 778 ? 9.874   21.351  43.929  1.00 65.45  ? 800  ASP A N   1 
ATOM   5864  C CA  . ASP A 1 778 ? 11.118  21.375  43.170  1.00 64.32  ? 800  ASP A CA  1 
ATOM   5865  C C   . ASP A 1 778 ? 11.472  22.735  42.573  1.00 61.92  ? 800  ASP A C   1 
ATOM   5866  O O   . ASP A 1 778 ? 12.519  22.882  41.944  1.00 60.86  ? 800  ASP A O   1 
ATOM   5867  C CB  . ASP A 1 778 ? 11.114  20.286  42.099  1.00 65.23  ? 800  ASP A CB  1 
ATOM   5868  C CG  . ASP A 1 778 ? 11.195  18.901  42.696  1.00 66.23  ? 800  ASP A CG  1 
ATOM   5869  O OD1 . ASP A 1 778 ? 11.915  18.737  43.706  1.00 67.25  ? 800  ASP A OD1 1 
ATOM   5870  O OD2 . ASP A 1 778 ? 10.528  17.985  42.174  1.00 66.38  ? 800  ASP A OD2 1 
ATOM   5871  N N   . VAL A 1 779 ? 10.609  23.728  42.768  1.00 59.86  ? 801  VAL A N   1 
ATOM   5872  C CA  . VAL A 1 779 ? 10.976  25.081  42.396  1.00 61.04  ? 801  VAL A CA  1 
ATOM   5873  C C   . VAL A 1 779 ? 11.565  25.636  43.669  1.00 69.51  ? 801  VAL A C   1 
ATOM   5874  O O   . VAL A 1 779 ? 10.844  25.940  44.622  1.00 73.32  ? 801  VAL A O   1 
ATOM   5875  C CB  . VAL A 1 779 ? 9.759   25.921  41.984  1.00 58.15  ? 801  VAL A CB  1 
ATOM   5876  C CG1 . VAL A 1 779 ? 10.195  27.328  41.600  1.00 57.05  ? 801  VAL A CG1 1 
ATOM   5877  C CG2 . VAL A 1 779 ? 9.024   25.257  40.832  1.00 53.80  ? 801  VAL A CG2 1 
ATOM   5878  N N   . ILE A 1 780 ? 12.880  25.801  43.665  1.00 71.37  ? 802  ILE A N   1 
ATOM   5879  C CA  . ILE A 1 780 ? 13.635  25.822  44.907  1.00 71.69  ? 802  ILE A CA  1 
ATOM   5880  C C   . ILE A 1 780 ? 14.620  26.969  44.991  1.00 73.33  ? 802  ILE A C   1 
ATOM   5881  O O   . ILE A 1 780 ? 15.363  27.233  44.045  1.00 72.33  ? 802  ILE A O   1 
ATOM   5882  C CB  . ILE A 1 780 ? 14.395  24.491  45.090  1.00 70.29  ? 802  ILE A CB  1 
ATOM   5883  C CG1 . ILE A 1 780 ? 13.438  23.401  45.564  1.00 70.35  ? 802  ILE A CG1 1 
ATOM   5884  C CG2 . ILE A 1 780 ? 15.544  24.637  46.069  1.00 71.22  ? 802  ILE A CG2 1 
ATOM   5885  C CD1 . ILE A 1 780 ? 14.121  22.098  45.913  1.00 69.93  ? 802  ILE A CD1 1 
ATOM   5886  N N   . CYS A 1 781 ? 14.615  27.643  46.140  1.00 76.30  ? 803  CYS A N   1 
ATOM   5887  C CA  . CYS A 1 781 ? 15.559  28.715  46.417  1.00 78.40  ? 803  CYS A CA  1 
ATOM   5888  C C   . CYS A 1 781 ? 16.985  28.176  46.461  1.00 77.35  ? 803  CYS A C   1 
ATOM   5889  O O   . CYS A 1 781 ? 17.255  27.152  47.093  1.00 75.93  ? 803  CYS A O   1 
ATOM   5890  C CB  . CYS A 1 781 ? 15.233  29.381  47.758  1.00 80.36  ? 803  CYS A CB  1 
ATOM   5891  S SG  . CYS A 1 781 ? 13.471  29.592  48.093  1.00 85.13  ? 803  CYS A SG  1 
ATOM   5892  N N   . ALA A 1 782 ? 17.895  28.865  45.783  1.00 77.24  ? 804  ALA A N   1 
ATOM   5893  C CA  . ALA A 1 782 ? 19.312  28.594  45.957  1.00 78.89  ? 804  ALA A CA  1 
ATOM   5894  C C   . ALA A 1 782 ? 19.875  29.536  47.026  1.00 82.96  ? 804  ALA A C   1 
ATOM   5895  O O   . ALA A 1 782 ? 20.189  29.106  48.136  1.00 81.65  ? 804  ALA A O   1 
ATOM   5896  C CB  . ALA A 1 782 ? 20.056  28.748  44.636  1.00 78.67  ? 804  ALA A CB  1 
ATOM   5897  N N   . SER A 1 783 ? 19.988  30.819  46.690  1.00 87.94  ? 805  SER A N   1 
ATOM   5898  C CA  . SER A 1 783 ? 20.485  31.837  47.617  1.00 93.17  ? 805  SER A CA  1 
ATOM   5899  C C   . SER A 1 783 ? 19.345  32.493  48.393  1.00 97.20  ? 805  SER A C   1 
ATOM   5900  O O   . SER A 1 783 ? 18.203  32.466  47.936  1.00 97.44  ? 805  SER A O   1 
ATOM   5901  C CB  . SER A 1 783 ? 21.247  32.916  46.839  1.00 95.64  ? 805  SER A CB  1 
ATOM   5902  O OG  . SER A 1 783 ? 22.155  32.340  45.915  1.00 94.98  ? 805  SER A OG  1 
ATOM   5903  N N   . PRO A 1 784 ? 19.641  33.061  49.582  1.00 100.23 ? 806  PRO A N   1 
ATOM   5904  C CA  . PRO A 1 784 ? 20.850  32.793  50.375  1.00 101.20 ? 806  PRO A CA  1 
ATOM   5905  C C   . PRO A 1 784 ? 20.698  31.519  51.209  1.00 101.31 ? 806  PRO A C   1 
ATOM   5906  O O   . PRO A 1 784 ? 19.719  30.797  51.026  1.00 100.65 ? 806  PRO A O   1 
ATOM   5907  C CB  . PRO A 1 784 ? 20.976  34.029  51.278  1.00 102.03 ? 806  PRO A CB  1 
ATOM   5908  C CG  . PRO A 1 784 ? 19.635  34.630  51.310  1.00 101.81 ? 806  PRO A CG  1 
ATOM   5909  C CD  . PRO A 1 784 ? 18.966  34.300  50.013  1.00 100.63 ? 806  PRO A CD  1 
ATOM   5910  N N   . GLY A 1 785 ? 21.647  31.255  52.105  1.00 101.14 ? 807  GLY A N   1 
ATOM   5911  C CA  . GLY A 1 785 ? 21.710  29.996  52.838  1.00 98.15  ? 807  GLY A CA  1 
ATOM   5912  C C   . GLY A 1 785 ? 20.551  29.606  53.744  1.00 97.32  ? 807  GLY A C   1 
ATOM   5913  O O   . GLY A 1 785 ? 20.216  28.426  53.849  1.00 95.56  ? 807  GLY A O   1 
ATOM   5914  N N   . ASP A 1 786 ? 19.949  30.589  54.405  1.00 99.28  ? 808  ASP A N   1 
ATOM   5915  C CA  . ASP A 1 786 ? 18.879  30.340  55.371  1.00 101.69 ? 808  ASP A CA  1 
ATOM   5916  C C   . ASP A 1 786 ? 17.661  29.711  54.698  1.00 99.54  ? 808  ASP A C   1 
ATOM   5917  O O   . ASP A 1 786 ? 17.075  28.753  55.209  1.00 98.78  ? 808  ASP A O   1 
ATOM   5918  C CB  . ASP A 1 786 ? 18.498  31.653  56.077  1.00 106.18 ? 808  ASP A CB  1 
ATOM   5919  C CG  . ASP A 1 786 ? 17.462  31.459  57.185  1.00 108.69 ? 808  ASP A CG  1 
ATOM   5920  O OD1 . ASP A 1 786 ? 17.113  30.299  57.493  1.00 108.55 ? 808  ASP A OD1 1 
ATOM   5921  O OD2 . ASP A 1 786 ? 16.996  32.472  57.757  1.00 110.76 ? 808  ASP A OD2 1 
ATOM   5922  N N   . GLN A 1 787 ? 17.301  30.244  53.535  1.00 97.87  ? 809  GLN A N   1 
ATOM   5923  C CA  . GLN A 1 787 ? 16.105  29.805  52.825  1.00 94.58  ? 809  GLN A CA  1 
ATOM   5924  C C   . GLN A 1 787 ? 16.351  28.635  51.878  1.00 90.27  ? 809  GLN A C   1 
ATOM   5925  O O   . GLN A 1 787 ? 15.415  28.132  51.254  1.00 89.83  ? 809  GLN A O   1 
ATOM   5926  C CB  . GLN A 1 787 ? 15.487  30.978  52.065  1.00 96.52  ? 809  GLN A CB  1 
ATOM   5927  C CG  . GLN A 1 787 ? 14.937  32.056  52.980  1.00 100.77 ? 809  GLN A CG  1 
ATOM   5928  C CD  . GLN A 1 787 ? 13.857  31.527  53.902  1.00 102.09 ? 809  GLN A CD  1 
ATOM   5929  O OE1 . GLN A 1 787 ? 14.122  31.161  55.049  1.00 104.88 ? 809  GLN A OE1 1 
ATOM   5930  N NE2 . GLN A 1 787 ? 12.629  31.475  53.399  1.00 100.60 ? 809  GLN A NE2 1 
ATOM   5931  N N   . ARG A 1 788 ? 17.606  28.200  51.789  1.00 87.95  ? 810  ARG A N   1 
ATOM   5932  C CA  . ARG A 1 788 ? 18.001  27.143  50.861  1.00 83.98  ? 810  ARG A CA  1 
ATOM   5933  C C   . ARG A 1 788 ? 17.225  25.854  51.115  1.00 79.98  ? 810  ARG A C   1 
ATOM   5934  O O   . ARG A 1 788 ? 16.848  25.556  52.250  1.00 81.13  ? 810  ARG A O   1 
ATOM   5935  C CB  . ARG A 1 788 ? 19.513  26.886  50.948  1.00 84.21  ? 810  ARG A CB  1 
ATOM   5936  C CG  . ARG A 1 788 ? 20.032  25.861  49.948  1.00 81.66  ? 810  ARG A CG  1 
ATOM   5937  C CD  . ARG A 1 788 ? 21.517  25.587  50.122  1.00 84.82  ? 810  ARG A CD  1 
ATOM   5938  N NE  . ARG A 1 788 ? 22.331  26.773  49.859  1.00 90.30  ? 810  ARG A NE  1 
ATOM   5939  C CZ  . ARG A 1 788 ? 22.767  27.139  48.655  1.00 92.67  ? 810  ARG A CZ  1 
ATOM   5940  N NH1 . ARG A 1 788 ? 22.466  26.419  47.580  1.00 90.65  ? 810  ARG A NH1 1 
ATOM   5941  N NH2 . ARG A 1 788 ? 23.503  28.234  48.524  1.00 95.92  ? 810  ARG A NH2 1 
ATOM   5942  N N   . GLY A 1 789 ? 16.968  25.109  50.044  1.00 74.23  ? 811  GLY A N   1 
ATOM   5943  C CA  . GLY A 1 789 ? 16.282  23.836  50.143  1.00 73.68  ? 811  GLY A CA  1 
ATOM   5944  C C   . GLY A 1 789 ? 14.773  23.973  50.153  1.00 75.14  ? 811  GLY A C   1 
ATOM   5945  O O   . GLY A 1 789 ? 14.048  22.989  50.007  1.00 73.28  ? 811  GLY A O   1 
ATOM   5946  N N   . LYS A 1 790 ? 14.295  25.200  50.315  1.00 79.58  ? 812  LYS A N   1 
ATOM   5947  C CA  . LYS A 1 790 ? 12.863  25.442  50.437  1.00 81.39  ? 812  LYS A CA  1 
ATOM   5948  C C   . LYS A 1 790 ? 12.225  25.948  49.145  1.00 80.43  ? 812  LYS A C   1 
ATOM   5949  O O   . LYS A 1 790 ? 12.856  26.654  48.358  1.00 79.59  ? 812  LYS A O   1 
ATOM   5950  C CB  . LYS A 1 790 ? 12.579  26.408  51.586  1.00 84.47  ? 812  LYS A CB  1 
ATOM   5951  C CG  . LYS A 1 790 ? 12.040  25.726  52.829  1.00 83.88  ? 812  LYS A CG  1 
ATOM   5952  C CD  . LYS A 1 790 ? 11.973  26.682  54.003  1.00 84.75  ? 812  LYS A CD  1 
ATOM   5953  C CE  . LYS A 1 790 ? 13.358  26.976  54.552  1.00 83.82  ? 812  LYS A CE  1 
ATOM   5954  N NZ  . LYS A 1 790 ? 13.300  27.832  55.771  1.00 85.56  ? 812  LYS A NZ  1 
ATOM   5955  N N   . SER A 1 791 ? 10.977  25.544  48.927  1.00 77.60  ? 813  SER A N   1 
ATOM   5956  C CA  . SER A 1 791 ? 10.188  26.021  47.800  1.00 73.54  ? 813  SER A CA  1 
ATOM   5957  C C   . SER A 1 791 ? 10.005  27.530  47.899  1.00 74.40  ? 813  SER A C   1 
ATOM   5958  O O   . SER A 1 791 ? 9.838   28.068  48.993  1.00 75.87  ? 813  SER A O   1 
ATOM   5959  C CB  . SER A 1 791 ? 8.825   25.327  47.786  1.00 69.68  ? 813  SER A CB  1 
ATOM   5960  O OG  . SER A 1 791 ? 7.942   25.925  46.854  1.00 66.96  ? 813  SER A OG  1 
ATOM   5961  N N   . ILE A 1 792 ? 10.034  28.210  46.757  1.00 72.95  ? 814  ILE A N   1 
ATOM   5962  C CA  . ILE A 1 792 ? 9.891   29.662  46.733  1.00 73.07  ? 814  ILE A CA  1 
ATOM   5963  C C   . ILE A 1 792 ? 8.499   30.089  47.190  1.00 73.92  ? 814  ILE A C   1 
ATOM   5964  O O   . ILE A 1 792 ? 8.286   31.238  47.591  1.00 75.88  ? 814  ILE A O   1 
ATOM   5965  C CB  . ILE A 1 792 ? 10.176  30.245  45.331  1.00 72.97  ? 814  ILE A CB  1 
ATOM   5966  C CG1 . ILE A 1 792 ? 9.182   29.699  44.302  1.00 71.48  ? 814  ILE A CG1 1 
ATOM   5967  C CG2 . ILE A 1 792 ? 11.599  29.932  44.903  1.00 70.78  ? 814  ILE A CG2 1 
ATOM   5968  C CD1 . ILE A 1 792 ? 8.860   30.676  43.193  1.00 72.61  ? 814  ILE A CD1 1 
ATOM   5969  N N   . VAL A 1 793 ? 7.557   29.152  47.141  1.00 73.17  ? 815  VAL A N   1 
ATOM   5970  C CA  . VAL A 1 793 ? 6.191   29.419  47.567  1.00 78.58  ? 815  VAL A CA  1 
ATOM   5971  C C   . VAL A 1 793 ? 6.115   29.512  49.097  1.00 82.50  ? 815  VAL A C   1 
ATOM   5972  O O   . VAL A 1 793 ? 5.132   30.009  49.649  1.00 82.51  ? 815  VAL A O   1 
ATOM   5973  C CB  . VAL A 1 793 ? 5.206   28.345  47.023  1.00 68.85  ? 815  VAL A CB  1 
ATOM   5974  C CG1 . VAL A 1 793 ? 4.972   27.250  48.049  1.00 66.27  ? 815  VAL A CG1 1 
ATOM   5975  C CG2 . VAL A 1 793 ? 3.888   28.986  46.621  1.00 70.42  ? 815  VAL A CG2 1 
ATOM   5976  N N   . SER A 1 794 ? 7.171   29.057  49.773  1.00 84.13  ? 816  SER A N   1 
ATOM   5977  C CA  . SER A 1 794 ? 7.178   28.959  51.235  1.00 85.82  ? 816  SER A CA  1 
ATOM   5978  C C   . SER A 1 794 ? 7.809   30.137  51.986  1.00 90.10  ? 816  SER A C   1 
ATOM   5979  O O   . SER A 1 794 ? 7.799   30.168  53.219  1.00 92.77  ? 816  SER A O   1 
ATOM   5980  C CB  . SER A 1 794 ? 7.849   27.657  51.673  1.00 83.96  ? 816  SER A CB  1 
ATOM   5981  O OG  . SER A 1 794 ? 7.082   26.537  51.271  1.00 83.47  ? 816  SER A OG  1 
ATOM   5982  N N   . LEU A 1 795 ? 8.346   31.107  51.254  1.00 89.98  ? 817  LEU A N   1 
ATOM   5983  C CA  . LEU A 1 795 ? 9.050   32.220  51.884  1.00 91.76  ? 817  LEU A CA  1 
ATOM   5984  C C   . LEU A 1 795 ? 8.100   33.332  52.325  1.00 94.33  ? 817  LEU A C   1 
ATOM   5985  O O   . LEU A 1 795 ? 7.007   33.485  51.779  1.00 94.32  ? 817  LEU A O   1 
ATOM   5986  C CB  . LEU A 1 795 ? 10.123  32.775  50.944  1.00 91.25  ? 817  LEU A CB  1 
ATOM   5987  N N   . SER B 1 9   ? 54.071  32.630  44.252  1.00 96.78  ? 31   SER B N   1 
ATOM   5988  C CA  . SER B 1 9   ? 52.654  32.283  44.307  1.00 94.63  ? 31   SER B CA  1 
ATOM   5989  C C   . SER B 1 9   ? 52.317  31.146  43.340  1.00 91.90  ? 31   SER B C   1 
ATOM   5990  O O   . SER B 1 9   ? 52.994  30.963  42.322  1.00 91.20  ? 31   SER B O   1 
ATOM   5991  C CB  . SER B 1 9   ? 51.793  33.510  43.997  1.00 94.44  ? 31   SER B CB  1 
ATOM   5992  N N   . ARG B 1 10  ? 51.272  30.389  43.671  1.00 90.05  ? 32   ARG B N   1 
ATOM   5993  C CA  . ARG B 1 10  ? 50.802  29.284  42.834  1.00 86.88  ? 32   ARG B CA  1 
ATOM   5994  C C   . ARG B 1 10  ? 50.524  29.770  41.414  1.00 86.34  ? 32   ARG B C   1 
ATOM   5995  O O   . ARG B 1 10  ? 49.829  30.769  41.226  1.00 87.48  ? 32   ARG B O   1 
ATOM   5996  C CB  . ARG B 1 10  ? 49.545  28.652  43.443  1.00 83.33  ? 32   ARG B CB  1 
ATOM   5997  C CG  . ARG B 1 10  ? 49.011  27.456  42.677  1.00 79.70  ? 32   ARG B CG  1 
ATOM   5998  C CD  . ARG B 1 10  ? 47.919  26.752  43.468  1.00 78.32  ? 32   ARG B CD  1 
ATOM   5999  N NE  . ARG B 1 10  ? 48.451  26.092  44.656  1.00 79.04  ? 32   ARG B NE  1 
ATOM   6000  C CZ  . ARG B 1 10  ? 48.599  24.779  44.779  1.00 77.89  ? 32   ARG B CZ  1 
ATOM   6001  N NH1 . ARG B 1 10  ? 48.242  23.974  43.786  1.00 76.45  ? 32   ARG B NH1 1 
ATOM   6002  N NH2 . ARG B 1 10  ? 49.097  24.268  45.898  1.00 77.56  ? 32   ARG B NH2 1 
ATOM   6003  N N   . SER B 1 11  ? 51.074  29.068  40.424  1.00 84.91  ? 33   SER B N   1 
ATOM   6004  C CA  . SER B 1 11  ? 51.033  29.549  39.046  1.00 86.80  ? 33   SER B CA  1 
ATOM   6005  C C   . SER B 1 11  ? 49.606  29.758  38.595  1.00 84.39  ? 33   SER B C   1 
ATOM   6006  O O   . SER B 1 11  ? 48.801  28.837  38.639  1.00 85.99  ? 33   SER B O   1 
ATOM   6007  C CB  . SER B 1 11  ? 51.725  28.562  38.106  1.00 89.35  ? 33   SER B CB  1 
ATOM   6008  O OG  . SER B 1 11  ? 53.026  28.258  38.571  1.00 93.14  ? 33   SER B OG  1 
ATOM   6009  N N   . TYR B 1 12  ? 49.296  30.976  38.168  1.00 81.04  ? 34   TYR B N   1 
ATOM   6010  C CA  . TYR B 1 12  ? 47.961  31.303  37.691  1.00 78.19  ? 34   TYR B CA  1 
ATOM   6011  C C   . TYR B 1 12  ? 48.033  32.403  36.619  1.00 78.93  ? 34   TYR B C   1 
ATOM   6012  O O   . TYR B 1 12  ? 48.887  33.287  36.703  1.00 80.10  ? 34   TYR B O   1 
ATOM   6013  C CB  . TYR B 1 12  ? 47.100  31.750  38.881  1.00 75.48  ? 34   TYR B CB  1 
ATOM   6014  C CG  . TYR B 1 12  ? 45.674  32.071  38.518  1.00 74.71  ? 34   TYR B CG  1 
ATOM   6015  C CD1 . TYR B 1 12  ? 44.719  31.066  38.416  1.00 71.58  ? 34   TYR B CD1 1 
ATOM   6016  C CD2 . TYR B 1 12  ? 45.283  33.378  38.271  1.00 77.70  ? 34   TYR B CD2 1 
ATOM   6017  C CE1 . TYR B 1 12  ? 43.419  31.356  38.077  1.00 72.58  ? 34   TYR B CE1 1 
ATOM   6018  C CE2 . TYR B 1 12  ? 43.987  33.679  37.931  1.00 78.64  ? 34   TYR B CE2 1 
ATOM   6019  C CZ  . TYR B 1 12  ? 43.057  32.668  37.835  1.00 78.44  ? 34   TYR B CZ  1 
ATOM   6020  O OH  . TYR B 1 12  ? 41.761  32.980  37.493  1.00 83.53  ? 34   TYR B OH  1 
ATOM   6021  N N   . PRO B 1 13  ? 47.130  32.379  35.620  1.00 76.28  ? 35   PRO B N   1 
ATOM   6022  C CA  . PRO B 1 13  ? 46.176  31.339  35.209  1.00 73.49  ? 35   PRO B CA  1 
ATOM   6023  C C   . PRO B 1 13  ? 46.846  30.150  34.514  1.00 70.59  ? 35   PRO B C   1 
ATOM   6024  O O   . PRO B 1 13  ? 46.247  29.090  34.332  1.00 61.69  ? 35   PRO B O   1 
ATOM   6025  C CB  . PRO B 1 13  ? 45.242  32.080  34.237  1.00 73.50  ? 35   PRO B CB  1 
ATOM   6026  C CG  . PRO B 1 13  ? 45.525  33.551  34.433  1.00 75.44  ? 35   PRO B CG  1 
ATOM   6027  C CD  . PRO B 1 13  ? 46.961  33.604  34.817  1.00 76.28  ? 35   PRO B CD  1 
ATOM   6028  N N   . CYS B 1 14  ? 48.086  30.349  34.094  1.00 75.86  ? 36   CYS B N   1 
ATOM   6029  C CA  . CYS B 1 14  ? 48.804  29.312  33.359  1.00 79.54  ? 36   CYS B CA  1 
ATOM   6030  C C   . CYS B 1 14  ? 49.310  28.182  34.241  1.00 85.75  ? 36   CYS B C   1 
ATOM   6031  O O   . CYS B 1 14  ? 49.690  28.410  35.387  1.00 90.18  ? 36   CYS B O   1 
ATOM   6032  C CB  . CYS B 1 14  ? 50.007  29.908  32.632  1.00 80.12  ? 36   CYS B CB  1 
ATOM   6033  S SG  . CYS B 1 14  ? 49.597  31.441  31.683  1.00 75.81  ? 36   CYS B SG  1 
ATOM   6034  N N   . ASP B 1 15  ? 49.326  26.966  33.702  1.00 86.80  ? 37   ASP B N   1 
ATOM   6035  C CA  . ASP B 1 15  ? 50.049  25.870  34.330  1.00 89.64  ? 37   ASP B CA  1 
ATOM   6036  C C   . ASP B 1 15  ? 51.425  25.833  33.710  1.00 89.53  ? 37   ASP B C   1 
ATOM   6037  O O   . ASP B 1 15  ? 51.584  25.482  32.544  1.00 89.40  ? 37   ASP B O   1 
ATOM   6038  C CB  . ASP B 1 15  ? 49.329  24.541  34.107  1.00 90.72  ? 37   ASP B CB  1 
ATOM   6039  C CG  . ASP B 1 15  ? 47.895  24.581  34.574  1.00 93.59  ? 37   ASP B CG  1 
ATOM   6040  O OD1 . ASP B 1 15  ? 47.538  23.811  35.490  1.00 95.12  ? 37   ASP B OD1 1 
ATOM   6041  O OD2 . ASP B 1 15  ? 47.122  25.387  34.022  1.00 94.44  ? 37   ASP B OD2 1 
ATOM   6042  N N   . GLU B 1 16  ? 52.421  26.195  34.500  1.00 90.38  ? 38   GLU B N   1 
ATOM   6043  C CA  . GLU B 1 16  ? 53.791  26.195  34.031  1.00 90.82  ? 38   GLU B CA  1 
ATOM   6044  C C   . GLU B 1 16  ? 54.399  24.875  34.460  1.00 94.13  ? 38   GLU B C   1 
ATOM   6045  O O   . GLU B 1 16  ? 54.188  24.439  35.589  1.00 96.95  ? 38   GLU B O   1 
ATOM   6046  C CB  . GLU B 1 16  ? 54.553  27.367  34.645  1.00 86.94  ? 38   GLU B CB  1 
ATOM   6047  C CG  . GLU B 1 16  ? 53.887  28.716  34.418  1.00 83.41  ? 38   GLU B CG  1 
ATOM   6048  C CD  . GLU B 1 16  ? 54.673  29.874  35.019  1.00 83.39  ? 38   GLU B CD  1 
ATOM   6049  O OE1 . GLU B 1 16  ? 55.821  29.657  35.459  1.00 81.64  ? 38   GLU B OE1 1 
ATOM   6050  O OE2 . GLU B 1 16  ? 54.140  31.004  35.050  1.00 83.76  ? 38   GLU B OE2 1 
ATOM   6051  N N   . LYS B 1 17  ? 55.126  24.228  33.556  1.00 94.70  ? 39   LYS B N   1 
ATOM   6052  C CA  . LYS B 1 17  ? 55.734  22.938  33.852  1.00 95.34  ? 39   LYS B CA  1 
ATOM   6053  C C   . LYS B 1 17  ? 56.833  22.581  32.853  1.00 95.22  ? 39   LYS B C   1 
ATOM   6054  O O   . LYS B 1 17  ? 56.785  22.983  31.691  1.00 94.75  ? 39   LYS B O   1 
ATOM   6055  C CB  . LYS B 1 17  ? 54.663  21.841  33.905  1.00 95.92  ? 39   LYS B CB  1 
ATOM   6056  C CG  . LYS B 1 17  ? 53.780  21.733  32.665  1.00 95.65  ? 39   LYS B CG  1 
ATOM   6057  C CD  . LYS B 1 17  ? 54.313  20.686  31.703  1.00 95.09  ? 39   LYS B CD  1 
ATOM   6058  C CE  . LYS B 1 17  ? 53.316  20.384  30.605  1.00 93.52  ? 39   LYS B CE  1 
ATOM   6059  N NZ  . LYS B 1 17  ? 53.860  19.400  29.629  1.00 92.79  ? 39   LYS B NZ  1 
ATOM   6060  N N   . VAL B 1 23  ? 60.886  25.923  29.306  1.00 88.33  ? 45   VAL B N   1 
ATOM   6061  C CA  . VAL B 1 23  ? 59.814  25.512  30.199  1.00 86.89  ? 45   VAL B CA  1 
ATOM   6062  C C   . VAL B 1 23  ? 58.486  26.162  29.771  1.00 86.75  ? 45   VAL B C   1 
ATOM   6063  O O   . VAL B 1 23  ? 58.397  27.382  29.604  1.00 88.15  ? 45   VAL B O   1 
ATOM   6064  C CB  . VAL B 1 23  ? 60.183  25.809  31.670  1.00 88.58  ? 45   VAL B CB  1 
ATOM   6065  C CG1 . VAL B 1 23  ? 60.349  27.293  31.893  1.00 90.82  ? 45   VAL B CG1 1 
ATOM   6066  C CG2 . VAL B 1 23  ? 59.145  25.243  32.607  1.00 86.86  ? 45   VAL B CG2 1 
ATOM   6067  N N   . ILE B 1 24  ? 57.462  25.338  29.574  1.00 86.13  ? 46   ILE B N   1 
ATOM   6068  C CA  . ILE B 1 24  ? 56.244  25.780  28.893  1.00 88.67  ? 46   ILE B CA  1 
ATOM   6069  C C   . ILE B 1 24  ? 55.138  26.259  29.840  1.00 90.88  ? 46   ILE B C   1 
ATOM   6070  O O   . ILE B 1 24  ? 54.970  25.735  30.940  1.00 93.63  ? 46   ILE B O   1 
ATOM   6071  C CB  . ILE B 1 24  ? 55.710  24.684  27.933  1.00 93.33  ? 46   ILE B CB  1 
ATOM   6072  C CG1 . ILE B 1 24  ? 54.948  23.598  28.690  1.00 92.18  ? 46   ILE B CG1 1 
ATOM   6073  C CG2 . ILE B 1 24  ? 56.858  24.041  27.169  1.00 93.57  ? 46   ILE B CG2 1 
ATOM   6074  C CD1 . ILE B 1 24  ? 54.874  22.287  27.932  1.00 91.02  ? 46   ILE B CD1 1 
ATOM   6075  N N   . ALA B 1 25  ? 54.411  27.286  29.412  1.00 89.40  ? 47   ALA B N   1 
ATOM   6076  C CA  . ALA B 1 25  ? 53.251  27.773  30.145  1.00 87.64  ? 47   ALA B CA  1 
ATOM   6077  C C   . ALA B 1 25  ? 52.006  27.451  29.339  1.00 85.87  ? 47   ALA B C   1 
ATOM   6078  O O   . ALA B 1 25  ? 51.888  27.858  28.190  1.00 87.06  ? 47   ALA B O   1 
ATOM   6079  C CB  . ALA B 1 25  ? 53.357  29.272  30.373  1.00 88.17  ? 47   ALA B CB  1 
ATOM   6080  N N   . GLU B 1 26  ? 51.081  26.704  29.925  1.00 83.89  ? 48   GLU B N   1 
ATOM   6081  C CA  . GLU B 1 26  ? 49.889  26.322  29.197  1.00 80.61  ? 48   GLU B CA  1 
ATOM   6082  C C   . GLU B 1 26  ? 48.696  27.139  29.674  1.00 76.40  ? 48   GLU B C   1 
ATOM   6083  O O   . GLU B 1 26  ? 48.166  26.889  30.752  1.00 76.36  ? 48   GLU B O   1 
ATOM   6084  C CB  . GLU B 1 26  ? 49.648  24.828  29.417  1.00 81.74  ? 48   GLU B CB  1 
ATOM   6085  C CG  . GLU B 1 26  ? 50.931  24.055  29.752  1.00 83.26  ? 48   GLU B CG  1 
ATOM   6086  C CD  . GLU B 1 26  ? 50.937  22.651  29.196  1.00 83.42  ? 48   GLU B CD  1 
ATOM   6087  O OE1 . GLU B 1 26  ? 50.085  21.834  29.608  1.00 83.15  ? 48   GLU B OE1 1 
ATOM   6088  O OE2 . GLU B 1 26  ? 51.795  22.371  28.335  1.00 84.44  ? 48   GLU B OE2 1 
ATOM   6089  N N   . CYS B 1 27  ? 48.288  28.113  28.865  1.00 73.20  ? 49   CYS B N   1 
ATOM   6090  C CA  . CYS B 1 27  ? 47.087  28.897  29.108  1.00 72.55  ? 49   CYS B CA  1 
ATOM   6091  C C   . CYS B 1 27  ? 45.862  28.514  28.278  1.00 71.92  ? 49   CYS B C   1 
ATOM   6092  O O   . CYS B 1 27  ? 44.845  29.205  28.359  1.00 69.08  ? 49   CYS B O   1 
ATOM   6093  C CB  . CYS B 1 27  ? 47.368  30.382  28.955  1.00 75.12  ? 49   CYS B CB  1 
ATOM   6094  S SG  . CYS B 1 27  ? 47.920  31.164  30.563  1.00 80.17  ? 49   CYS B SG  1 
ATOM   6095  N N   . SER B 1 28  ? 45.957  27.454  27.471  1.00 74.77  ? 50   SER B N   1 
ATOM   6096  C CA  . SER B 1 28  ? 44.907  27.098  26.502  1.00 76.45  ? 50   SER B CA  1 
ATOM   6097  C C   . SER B 1 28  ? 43.495  26.993  27.095  1.00 75.59  ? 50   SER B C   1 
ATOM   6098  O O   . SER B 1 28  ? 43.303  26.439  28.179  1.00 77.11  ? 50   SER B O   1 
ATOM   6099  C CB  . SER B 1 28  ? 45.242  25.768  25.804  1.00 77.40  ? 50   SER B CB  1 
ATOM   6100  O OG  . SER B 1 28  ? 46.484  25.219  26.231  1.00 79.54  ? 50   SER B OG  1 
ATOM   6101  N N   . ASN B 1 29  ? 42.514  27.525  26.369  1.00 73.13  ? 51   ASN B N   1 
ATOM   6102  C CA  . ASN B 1 29  ? 41.096  27.305  26.669  1.00 72.77  ? 51   ASN B CA  1 
ATOM   6103  C C   . ASN B 1 29  ? 40.657  27.759  28.064  1.00 74.95  ? 51   ASN B C   1 
ATOM   6104  O O   . ASN B 1 29  ? 39.778  27.153  28.685  1.00 73.65  ? 51   ASN B O   1 
ATOM   6105  C CB  . ASN B 1 29  ? 40.750  25.823  26.472  1.00 71.26  ? 51   ASN B CB  1 
ATOM   6106  C CG  . ASN B 1 29  ? 39.335  25.613  25.977  1.00 73.41  ? 51   ASN B CG  1 
ATOM   6107  O OD1 . ASN B 1 29  ? 38.605  26.572  25.727  1.00 75.48  ? 51   ASN B OD1 1 
ATOM   6108  N ND2 . ASN B 1 29  ? 38.942  24.351  25.817  1.00 72.56  ? 51   ASN B ND2 1 
ATOM   6109  N N   . ARG B 1 30  ? 41.287  28.816  28.557  1.00 77.83  ? 52   ARG B N   1 
ATOM   6110  C CA  . ARG B 1 30  ? 41.020  29.316  29.903  1.00 78.94  ? 52   ARG B CA  1 
ATOM   6111  C C   . ARG B 1 30  ? 40.044  30.488  30.018  1.00 79.88  ? 52   ARG B C   1 
ATOM   6112  O O   . ARG B 1 30  ? 39.899  31.071  31.091  1.00 81.62  ? 52   ARG B O   1 
ATOM   6113  C CB  . ARG B 1 30  ? 42.322  29.591  30.642  1.00 80.37  ? 52   ARG B CB  1 
ATOM   6114  C CG  . ARG B 1 30  ? 42.885  28.334  31.251  1.00 79.95  ? 52   ARG B CG  1 
ATOM   6115  C CD  . ARG B 1 30  ? 44.379  28.399  31.357  1.00 81.93  ? 52   ARG B CD  1 
ATOM   6116  N NE  . ARG B 1 30  ? 44.980  27.124  30.980  1.00 82.79  ? 52   ARG B NE  1 
ATOM   6117  C CZ  . ARG B 1 30  ? 45.439  26.226  31.844  1.00 82.71  ? 52   ARG B CZ  1 
ATOM   6118  N NH1 . ARG B 1 30  ? 45.378  26.462  33.148  1.00 83.38  ? 52   ARG B NH1 1 
ATOM   6119  N NH2 . ARG B 1 30  ? 45.973  25.096  31.403  1.00 81.38  ? 52   ARG B NH2 1 
ATOM   6120  N N   . ARG B 1 31  ? 39.415  30.846  28.904  1.00 79.17  ? 53   ARG B N   1 
ATOM   6121  C CA  . ARG B 1 31  ? 38.429  31.926  28.862  1.00 79.60  ? 53   ARG B CA  1 
ATOM   6122  C C   . ARG B 1 31  ? 39.043  33.288  29.163  1.00 83.70  ? 53   ARG B C   1 
ATOM   6123  O O   . ARG B 1 31  ? 38.370  34.191  29.659  1.00 87.16  ? 53   ARG B O   1 
ATOM   6124  C CB  . ARG B 1 31  ? 37.256  31.646  29.806  1.00 76.74  ? 53   ARG B CB  1 
ATOM   6125  C CG  . ARG B 1 31  ? 36.573  30.307  29.563  1.00 70.69  ? 53   ARG B CG  1 
ATOM   6126  C CD  . ARG B 1 31  ? 35.374  30.133  30.483  1.00 68.55  ? 53   ARG B CD  1 
ATOM   6127  N NE  . ARG B 1 31  ? 35.761  30.268  31.884  1.00 67.15  ? 53   ARG B NE  1 
ATOM   6128  C CZ  . ARG B 1 31  ? 36.199  29.264  32.638  1.00 61.92  ? 53   ARG B CZ  1 
ATOM   6129  N NH1 . ARG B 1 31  ? 36.304  28.040  32.126  1.00 56.04  ? 53   ARG B NH1 1 
ATOM   6130  N NH2 . ARG B 1 31  ? 36.539  29.488  33.902  1.00 61.22  ? 53   ARG B NH2 1 
ATOM   6131  N N   . LEU B 1 32  ? 40.326  33.432  28.853  1.00 83.97  ? 54   LEU B N   1 
ATOM   6132  C CA  . LEU B 1 32  ? 41.017  34.702  29.032  1.00 86.15  ? 54   LEU B CA  1 
ATOM   6133  C C   . LEU B 1 32  ? 40.528  35.745  28.031  1.00 87.62  ? 54   LEU B C   1 
ATOM   6134  O O   . LEU B 1 32  ? 40.431  35.471  26.836  1.00 86.76  ? 54   LEU B O   1 
ATOM   6135  C CB  . LEU B 1 32  ? 42.522  34.503  28.876  1.00 85.76  ? 54   LEU B CB  1 
ATOM   6136  C CG  . LEU B 1 32  ? 43.175  33.545  29.870  1.00 84.74  ? 54   LEU B CG  1 
ATOM   6137  C CD1 . LEU B 1 32  ? 44.636  33.273  29.508  1.00 83.28  ? 54   LEU B CD1 1 
ATOM   6138  C CD2 . LEU B 1 32  ? 43.054  34.100  31.284  1.00 86.17  ? 54   LEU B CD2 1 
ATOM   6139  N N   . GLN B 1 33  ? 40.213  36.938  28.527  1.00 88.56  ? 55   GLN B N   1 
ATOM   6140  C CA  . GLN B 1 33  ? 39.762  38.026  27.667  1.00 87.39  ? 55   GLN B CA  1 
ATOM   6141  C C   . GLN B 1 33  ? 40.902  38.952  27.271  1.00 88.84  ? 55   GLN B C   1 
ATOM   6142  O O   . GLN B 1 33  ? 40.717  39.870  26.471  1.00 91.45  ? 55   GLN B O   1 
ATOM   6143  C CB  . GLN B 1 33  ? 38.654  38.827  28.347  1.00 88.25  ? 55   GLN B CB  1 
ATOM   6144  C CG  . GLN B 1 33  ? 37.264  38.273  28.099  1.00 86.83  ? 55   GLN B CG  1 
ATOM   6145  C CD  . GLN B 1 33  ? 36.183  39.060  28.818  1.00 87.82  ? 55   GLN B CD  1 
ATOM   6146  O OE1 . GLN B 1 33  ? 36.475  39.979  29.590  1.00 89.09  ? 55   GLN B OE1 1 
ATOM   6147  N NE2 . GLN B 1 33  ? 34.921  38.703  28.567  1.00 84.89  ? 55   GLN B NE2 1 
ATOM   6148  N N   . GLU B 1 34  ? 42.082  38.697  27.825  1.00 87.09  ? 56   GLU B N   1 
ATOM   6149  C CA  . GLU B 1 34  ? 43.271  39.482  27.515  1.00 86.39  ? 56   GLU B CA  1 
ATOM   6150  C C   . GLU B 1 34  ? 44.495  38.591  27.661  1.00 81.28  ? 56   GLU B C   1 
ATOM   6151  O O   . GLU B 1 34  ? 44.445  37.566  28.339  1.00 76.91  ? 56   GLU B O   1 
ATOM   6152  C CB  . GLU B 1 34  ? 43.389  40.686  28.465  1.00 91.77  ? 56   GLU B CB  1 
ATOM   6153  C CG  . GLU B 1 34  ? 44.520  41.665  28.124  1.00 96.37  ? 56   GLU B CG  1 
ATOM   6154  C CD  . GLU B 1 34  ? 45.045  42.430  29.336  1.00 102.01 ? 56   GLU B CD  1 
ATOM   6155  O OE1 . GLU B 1 34  ? 44.543  42.198  30.458  1.00 102.35 ? 56   GLU B OE1 1 
ATOM   6156  O OE2 . GLU B 1 34  ? 45.966  43.262  29.166  1.00 104.47 ? 56   GLU B OE2 1 
ATOM   6157  N N   . VAL B 1 35  ? 45.591  38.978  27.017  1.00 82.99  ? 57   VAL B N   1 
ATOM   6158  C CA  . VAL B 1 35  ? 46.880  38.360  27.282  1.00 85.12  ? 57   VAL B CA  1 
ATOM   6159  C C   . VAL B 1 35  ? 47.184  38.518  28.762  1.00 90.79  ? 57   VAL B C   1 
ATOM   6160  O O   . VAL B 1 35  ? 47.038  39.603  29.313  1.00 94.12  ? 57   VAL B O   1 
ATOM   6161  C CB  . VAL B 1 35  ? 48.005  39.044  26.496  1.00 85.92  ? 57   VAL B CB  1 
ATOM   6162  C CG1 . VAL B 1 35  ? 49.296  38.245  26.623  1.00 85.30  ? 57   VAL B CG1 1 
ATOM   6163  C CG2 . VAL B 1 35  ? 47.605  39.203  25.041  1.00 86.38  ? 57   VAL B CG2 1 
ATOM   6164  N N   . PRO B 1 36  ? 47.592  37.429  29.420  1.00 92.08  ? 58   PRO B N   1 
ATOM   6165  C CA  . PRO B 1 36  ? 47.953  37.518  30.837  1.00 92.37  ? 58   PRO B CA  1 
ATOM   6166  C C   . PRO B 1 36  ? 49.154  38.411  31.086  1.00 93.50  ? 58   PRO B C   1 
ATOM   6167  O O   . PRO B 1 36  ? 50.156  38.284  30.391  1.00 91.91  ? 58   PRO B O   1 
ATOM   6168  C CB  . PRO B 1 36  ? 48.309  36.072  31.202  1.00 91.90  ? 58   PRO B CB  1 
ATOM   6169  C CG  . PRO B 1 36  ? 48.516  35.370  29.903  1.00 90.79  ? 58   PRO B CG  1 
ATOM   6170  C CD  . PRO B 1 36  ? 47.610  36.042  28.932  1.00 90.12  ? 58   PRO B CD  1 
ATOM   6171  N N   . GLN B 1 37  ? 49.040  39.306  32.065  1.00 98.62  ? 59   GLN B N   1 
ATOM   6172  C CA  . GLN B 1 37  ? 50.183  40.072  32.560  1.00 102.50 ? 59   GLN B CA  1 
ATOM   6173  C C   . GLN B 1 37  ? 50.733  39.307  33.756  1.00 102.91 ? 59   GLN B C   1 
ATOM   6174  O O   . GLN B 1 37  ? 51.750  39.675  34.346  1.00 102.52 ? 59   GLN B O   1 
ATOM   6175  C CB  . GLN B 1 37  ? 49.755  41.479  32.999  1.00 104.75 ? 59   GLN B CB  1 
ATOM   6176  C CG  . GLN B 1 37  ? 48.862  42.226  32.014  1.00 104.89 ? 59   GLN B CG  1 
ATOM   6177  C CD  . GLN B 1 37  ? 49.568  42.559  30.714  1.00 105.00 ? 59   GLN B CD  1 
ATOM   6178  O OE1 . GLN B 1 37  ? 50.785  42.735  30.684  1.00 105.57 ? 59   GLN B OE1 1 
ATOM   6179  N NE2 . GLN B 1 37  ? 48.803  42.641  29.627  1.00 104.45 ? 59   GLN B NE2 1 
ATOM   6180  N N   . THR B 1 38  ? 50.031  38.224  34.082  1.00 103.73 ? 60   THR B N   1 
ATOM   6181  C CA  . THR B 1 38  ? 50.297  37.392  35.250  1.00 106.36 ? 60   THR B CA  1 
ATOM   6182  C C   . THR B 1 38  ? 51.271  36.254  34.926  1.00 105.06 ? 60   THR B C   1 
ATOM   6183  O O   . THR B 1 38  ? 51.500  35.362  35.741  1.00 105.21 ? 60   THR B O   1 
ATOM   6184  C CB  . THR B 1 38  ? 48.978  36.811  35.820  1.00 106.35 ? 60   THR B CB  1 
ATOM   6185  O OG1 . THR B 1 38  ? 47.908  37.742  35.607  1.00 107.23 ? 60   THR B OG1 1 
ATOM   6186  C CG2 . THR B 1 38  ? 49.109  36.532  37.309  1.00 107.51 ? 60   THR B CG2 1 
ATOM   6187  N N   . VAL B 1 39  ? 51.824  36.285  33.719  1.00 103.18 ? 61   VAL B N   1 
ATOM   6188  C CA  . VAL B 1 39  ? 52.726  35.240  33.242  1.00 99.68  ? 61   VAL B CA  1 
ATOM   6189  C C   . VAL B 1 39  ? 54.003  35.169  34.091  1.00 97.51  ? 61   VAL B C   1 
ATOM   6190  O O   . VAL B 1 39  ? 54.359  36.134  34.762  1.00 99.65  ? 61   VAL B O   1 
ATOM   6191  C CB  . VAL B 1 39  ? 53.075  35.467  31.743  1.00 87.11  ? 61   VAL B CB  1 
ATOM   6192  C CG1 . VAL B 1 39  ? 54.014  36.668  31.574  1.00 88.25  ? 61   VAL B CG1 1 
ATOM   6193  C CG2 . VAL B 1 39  ? 53.651  34.201  31.105  1.00 83.81  ? 61   VAL B CG2 1 
ATOM   6194  N N   . GLY B 1 40  ? 54.670  34.018  34.077  1.00 93.90  ? 62   GLY B N   1 
ATOM   6195  C CA  . GLY B 1 40  ? 55.891  33.821  34.838  1.00 93.87  ? 62   GLY B CA  1 
ATOM   6196  C C   . GLY B 1 40  ? 57.083  34.576  34.281  1.00 95.86  ? 62   GLY B C   1 
ATOM   6197  O O   . GLY B 1 40  ? 56.947  35.347  33.334  1.00 95.90  ? 62   GLY B O   1 
ATOM   6198  N N   . LYS B 1 41  ? 58.251  34.352  34.882  1.00 98.00  ? 63   LYS B N   1 
ATOM   6199  C CA  . LYS B 1 41  ? 59.493  35.042  34.512  1.00 98.26  ? 63   LYS B CA  1 
ATOM   6200  C C   . LYS B 1 41  ? 60.271  34.302  33.429  1.00 96.32  ? 63   LYS B C   1 
ATOM   6201  O O   . LYS B 1 41  ? 60.548  34.850  32.362  1.00 96.41  ? 63   LYS B O   1 
ATOM   6202  C CB  . LYS B 1 41  ? 60.391  35.264  35.734  1.00 99.13  ? 63   LYS B CB  1 
ATOM   6203  C CG  . LYS B 1 41  ? 61.747  35.895  35.404  1.00 100.69 ? 63   LYS B CG  1 
ATOM   6204  C CD  . LYS B 1 41  ? 61.591  37.283  34.792  1.00 101.17 ? 63   LYS B CD  1 
ATOM   6205  C CE  . LYS B 1 41  ? 62.907  38.062  34.790  1.00 101.94 ? 63   LYS B CE  1 
ATOM   6206  N NZ  . LYS B 1 41  ? 63.975  37.405  33.984  1.00 100.38 ? 63   LYS B NZ  1 
ATOM   6207  N N   . TYR B 1 42  ? 60.657  33.065  33.727  1.00 94.45  ? 64   TYR B N   1 
ATOM   6208  C CA  . TYR B 1 42  ? 61.443  32.262  32.794  1.00 92.89  ? 64   TYR B CA  1 
ATOM   6209  C C   . TYR B 1 42  ? 60.589  31.471  31.798  1.00 89.49  ? 64   TYR B C   1 
ATOM   6210  O O   . TYR B 1 42  ? 61.095  30.587  31.107  1.00 90.27  ? 64   TYR B O   1 
ATOM   6211  C CB  . TYR B 1 42  ? 62.500  31.381  33.490  1.00 93.72  ? 64   TYR B CB  1 
ATOM   6212  C CG  . TYR B 1 42  ? 62.044  30.549  34.676  1.00 94.62  ? 64   TYR B CG  1 
ATOM   6213  C CD1 . TYR B 1 42  ? 61.110  29.528  34.530  1.00 93.29  ? 64   TYR B CD1 1 
ATOM   6214  C CD2 . TYR B 1 42  ? 62.599  30.752  35.935  1.00 97.54  ? 64   TYR B CD2 1 
ATOM   6215  C CE1 . TYR B 1 42  ? 60.714  28.757  35.616  1.00 93.82  ? 64   TYR B CE1 1 
ATOM   6216  C CE2 . TYR B 1 42  ? 62.213  29.987  37.024  1.00 98.27  ? 64   TYR B CE2 1 
ATOM   6217  C CZ  . TYR B 1 42  ? 61.270  28.993  36.861  1.00 96.92  ? 64   TYR B CZ  1 
ATOM   6218  O OH  . TYR B 1 42  ? 60.883  28.230  37.942  1.00 97.44  ? 64   TYR B OH  1 
ATOM   6219  N N   . VAL B 1 43  ? 59.292  31.767  31.768  1.00 86.02  ? 65   VAL B N   1 
ATOM   6220  C CA  . VAL B 1 43  ? 58.396  31.215  30.756  1.00 84.14  ? 65   VAL B CA  1 
ATOM   6221  C C   . VAL B 1 43  ? 58.988  31.404  29.354  1.00 84.55  ? 65   VAL B C   1 
ATOM   6222  O O   . VAL B 1 43  ? 59.492  32.476  29.009  1.00 84.25  ? 65   VAL B O   1 
ATOM   6223  C CB  . VAL B 1 43  ? 56.999  31.883  30.828  1.00 101.36 ? 65   VAL B CB  1 
ATOM   6224  C CG1 . VAL B 1 43  ? 57.139  33.378  30.851  1.00 104.22 ? 65   VAL B CG1 1 
ATOM   6225  C CG2 . VAL B 1 43  ? 56.127  31.467  29.660  1.00 98.68  ? 65   VAL B CG2 1 
ATOM   6226  N N   . THR B 1 44  ? 58.952  30.341  28.560  1.00 85.86  ? 66   THR B N   1 
ATOM   6227  C CA  . THR B 1 44  ? 59.521  30.372  27.217  1.00 86.91  ? 66   THR B CA  1 
ATOM   6228  C C   . THR B 1 44  ? 58.487  29.978  26.160  1.00 86.88  ? 66   THR B C   1 
ATOM   6229  O O   . THR B 1 44  ? 58.112  30.798  25.323  1.00 89.38  ? 66   THR B O   1 
ATOM   6230  C CB  . THR B 1 44  ? 60.782  29.500  27.142  1.00 85.24  ? 66   THR B CB  1 
ATOM   6231  O OG1 . THR B 1 44  ? 61.913  30.301  27.506  1.00 87.41  ? 66   THR B OG1 1 
ATOM   6232  C CG2 . THR B 1 44  ? 60.993  28.939  25.736  1.00 83.49  ? 66   THR B CG2 1 
ATOM   6233  N N   . GLU B 1 45  ? 58.023  28.731  26.201  1.00 84.64  ? 67   GLU B N   1 
ATOM   6234  C CA  . GLU B 1 45  ? 56.892  28.317  25.380  1.00 81.48  ? 67   GLU B CA  1 
ATOM   6235  C C   . GLU B 1 45  ? 55.611  28.818  26.021  1.00 78.11  ? 67   GLU B C   1 
ATOM   6236  O O   . GLU B 1 45  ? 55.421  28.711  27.226  1.00 78.13  ? 67   GLU B O   1 
ATOM   6237  C CB  . GLU B 1 45  ? 56.835  26.801  25.241  1.00 83.72  ? 67   GLU B CB  1 
ATOM   6238  C CG  . GLU B 1 45  ? 57.109  26.264  23.853  1.00 85.68  ? 67   GLU B CG  1 
ATOM   6239  C CD  . GLU B 1 45  ? 58.577  25.971  23.632  1.00 88.38  ? 67   GLU B CD  1 
ATOM   6240  O OE1 . GLU B 1 45  ? 59.410  26.829  23.988  1.00 91.39  ? 67   GLU B OE1 1 
ATOM   6241  O OE2 . GLU B 1 45  ? 58.899  24.877  23.119  1.00 87.94  ? 67   GLU B OE2 1 
ATOM   6242  N N   . LEU B 1 46  ? 54.744  29.399  25.209  1.00 76.75  ? 68   LEU B N   1 
ATOM   6243  C CA  . LEU B 1 46  ? 53.555  30.055  25.730  1.00 74.01  ? 68   LEU B CA  1 
ATOM   6244  C C   . LEU B 1 46  ? 52.368  29.757  24.839  1.00 74.48  ? 68   LEU B C   1 
ATOM   6245  O O   . LEU B 1 46  ? 52.410  30.088  23.664  1.00 74.05  ? 68   LEU B O   1 
ATOM   6246  C CB  . LEU B 1 46  ? 53.788  31.563  25.769  1.00 70.64  ? 68   LEU B CB  1 
ATOM   6247  C CG  . LEU B 1 46  ? 52.583  32.409  26.174  1.00 68.34  ? 68   LEU B CG  1 
ATOM   6248  C CD1 . LEU B 1 46  ? 51.975  31.995  27.499  1.00 70.43  ? 68   LEU B CD1 1 
ATOM   6249  C CD2 . LEU B 1 46  ? 52.908  33.891  26.202  1.00 61.68  ? 68   LEU B CD2 1 
ATOM   6250  N N   . ASP B 1 47  ? 51.317  29.145  25.382  1.00 74.96  ? 69   ASP B N   1 
ATOM   6251  C CA  . ASP B 1 47  ? 50.162  28.747  24.577  1.00 73.01  ? 69   ASP B CA  1 
ATOM   6252  C C   . ASP B 1 47  ? 48.898  29.483  25.031  1.00 75.56  ? 69   ASP B C   1 
ATOM   6253  O O   . ASP B 1 47  ? 48.287  29.100  26.024  1.00 75.91  ? 69   ASP B O   1 
ATOM   6254  C CB  . ASP B 1 47  ? 49.992  27.226  24.736  1.00 70.95  ? 69   ASP B CB  1 
ATOM   6255  C CG  . ASP B 1 47  ? 48.761  26.665  24.025  1.00 69.72  ? 69   ASP B CG  1 
ATOM   6256  O OD1 . ASP B 1 47  ? 48.114  27.395  23.252  1.00 72.32  ? 69   ASP B OD1 1 
ATOM   6257  O OD2 . ASP B 1 47  ? 48.452  25.468  24.228  1.00 65.68  ? 69   ASP B OD2 1 
ATOM   6258  N N   . LEU B 1 48  ? 48.463  30.480  24.267  1.00 76.55  ? 70   LEU B N   1 
ATOM   6259  C CA  . LEU B 1 48  ? 47.252  31.244  24.580  1.00 75.28  ? 70   LEU B CA  1 
ATOM   6260  C C   . LEU B 1 48  ? 46.033  30.760  23.835  1.00 72.18  ? 70   LEU B C   1 
ATOM   6261  O O   . LEU B 1 48  ? 44.982  31.392  23.897  1.00 72.55  ? 70   LEU B O   1 
ATOM   6262  C CB  . LEU B 1 48  ? 47.442  32.726  24.285  1.00 76.89  ? 70   LEU B CB  1 
ATOM   6263  C CG  . LEU B 1 48  ? 47.958  33.548  25.467  1.00 79.50  ? 70   LEU B CG  1 
ATOM   6264  C CD1 . LEU B 1 48  ? 49.480  33.466  25.609  1.00 80.22  ? 70   LEU B CD1 1 
ATOM   6265  C CD2 . LEU B 1 48  ? 47.539  34.977  25.351  1.00 81.29  ? 70   LEU B CD2 1 
ATOM   6266  N N   . SER B 1 49  ? 46.180  29.655  23.114  1.00 71.27  ? 71   SER B N   1 
ATOM   6267  C CA  . SER B 1 49  ? 45.142  29.188  22.203  1.00 71.88  ? 71   SER B CA  1 
ATOM   6268  C C   . SER B 1 49  ? 43.779  29.016  22.867  1.00 73.51  ? 71   SER B C   1 
ATOM   6269  O O   . SER B 1 49  ? 43.685  28.807  24.079  1.00 76.41  ? 71   SER B O   1 
ATOM   6270  C CB  . SER B 1 49  ? 45.557  27.879  21.514  1.00 69.91  ? 71   SER B CB  1 
ATOM   6271  O OG  . SER B 1 49  ? 45.546  26.775  22.409  1.00 69.25  ? 71   SER B OG  1 
ATOM   6272  N N   . ASP B 1 50  ? 42.733  29.176  22.062  1.00 74.17  ? 72   ASP B N   1 
ATOM   6273  C CA  . ASP B 1 50  ? 41.359  28.880  22.459  1.00 75.26  ? 72   ASP B CA  1 
ATOM   6274  C C   . ASP B 1 50  ? 40.748  29.903  23.414  1.00 76.42  ? 72   ASP B C   1 
ATOM   6275  O O   . ASP B 1 50  ? 39.577  29.794  23.782  1.00 76.00  ? 72   ASP B O   1 
ATOM   6276  C CB  . ASP B 1 50  ? 41.233  27.459  23.015  1.00 75.84  ? 72   ASP B CB  1 
ATOM   6277  C CG  . ASP B 1 50  ? 41.495  26.395  21.961  1.00 75.56  ? 72   ASP B CG  1 
ATOM   6278  O OD1 . ASP B 1 50  ? 40.630  26.210  21.081  1.00 74.08  ? 72   ASP B OD1 1 
ATOM   6279  O OD2 . ASP B 1 50  ? 42.558  25.737  22.016  1.00 75.58  ? 72   ASP B OD2 1 
ATOM   6280  N N   . ASN B 1 51  ? 41.540  30.892  23.816  1.00 78.19  ? 73   ASN B N   1 
ATOM   6281  C CA  . ASN B 1 51  ? 41.031  31.959  24.671  1.00 80.39  ? 73   ASN B CA  1 
ATOM   6282  C C   . ASN B 1 51  ? 40.170  32.972  23.910  1.00 83.30  ? 73   ASN B C   1 
ATOM   6283  O O   . ASN B 1 51  ? 39.940  32.838  22.705  1.00 82.71  ? 73   ASN B O   1 
ATOM   6284  C CB  . ASN B 1 51  ? 42.167  32.666  25.419  1.00 80.03  ? 73   ASN B CB  1 
ATOM   6285  C CG  . ASN B 1 51  ? 42.819  31.778  26.461  1.00 78.70  ? 73   ASN B CG  1 
ATOM   6286  O OD1 . ASN B 1 51  ? 42.187  31.395  27.444  1.00 78.65  ? 73   ASN B OD1 1 
ATOM   6287  N ND2 . ASN B 1 51  ? 44.093  31.458  26.259  1.00 77.96  ? 73   ASN B ND2 1 
ATOM   6288  N N   . PHE B 1 52  ? 39.685  33.972  24.641  1.00 84.51  ? 74   PHE B N   1 
ATOM   6289  C CA  . PHE B 1 52  ? 38.761  34.976  24.115  1.00 84.52  ? 74   PHE B CA  1 
ATOM   6290  C C   . PHE B 1 52  ? 39.404  36.281  23.650  1.00 85.27  ? 74   PHE B C   1 
ATOM   6291  O O   . PHE B 1 52  ? 38.701  37.255  23.386  1.00 86.86  ? 74   PHE B O   1 
ATOM   6292  C CB  . PHE B 1 52  ? 37.652  35.269  25.125  1.00 86.74  ? 74   PHE B CB  1 
ATOM   6293  C CG  . PHE B 1 52  ? 36.414  34.446  24.918  1.00 87.39  ? 74   PHE B CG  1 
ATOM   6294  C CD1 . PHE B 1 52  ? 36.459  33.066  25.022  1.00 86.35  ? 74   PHE B CD1 1 
ATOM   6295  C CD2 . PHE B 1 52  ? 35.202  35.054  24.626  1.00 88.57  ? 74   PHE B CD2 1 
ATOM   6296  C CE1 . PHE B 1 52  ? 35.320  32.304  24.835  1.00 84.68  ? 74   PHE B CE1 1 
ATOM   6297  C CE2 . PHE B 1 52  ? 34.059  34.300  24.439  1.00 87.74  ? 74   PHE B CE2 1 
ATOM   6298  C CZ  . PHE B 1 52  ? 34.118  32.921  24.543  1.00 85.91  ? 74   PHE B CZ  1 
ATOM   6299  N N   . ILE B 1 53  ? 40.730  36.325  23.605  1.00 83.68  ? 75   ILE B N   1 
ATOM   6300  C CA  . ILE B 1 53  ? 41.426  37.560  23.270  1.00 85.34  ? 75   ILE B CA  1 
ATOM   6301  C C   . ILE B 1 53  ? 41.006  38.158  21.935  1.00 88.36  ? 75   ILE B C   1 
ATOM   6302  O O   . ILE B 1 53  ? 41.144  37.526  20.891  1.00 88.33  ? 75   ILE B O   1 
ATOM   6303  C CB  . ILE B 1 53  ? 42.902  37.285  23.158  1.00 82.08  ? 75   ILE B CB  1 
ATOM   6304  C CG1 . ILE B 1 53  ? 43.430  36.812  24.495  1.00 79.09  ? 75   ILE B CG1 1 
ATOM   6305  C CG2 . ILE B 1 53  ? 43.643  38.523  22.707  1.00 84.14  ? 75   ILE B CG2 1 
ATOM   6306  C CD1 . ILE B 1 53  ? 44.882  36.915  24.545  1.00 78.66  ? 75   ILE B CD1 1 
ATOM   6307  N N   . THR B 1 54  ? 40.498  39.386  21.985  1.00 90.82  ? 76   THR B N   1 
ATOM   6308  C CA  . THR B 1 54  ? 40.064  40.109  20.791  1.00 91.28  ? 76   THR B CA  1 
ATOM   6309  C C   . THR B 1 54  ? 41.037  41.183  20.291  1.00 94.29  ? 76   THR B C   1 
ATOM   6310  O O   . THR B 1 54  ? 40.806  41.800  19.248  1.00 96.10  ? 76   THR B O   1 
ATOM   6311  C CB  . THR B 1 54  ? 38.677  40.738  21.013  1.00 91.17  ? 76   THR B CB  1 
ATOM   6312  O OG1 . THR B 1 54  ? 38.591  41.238  22.355  1.00 91.52  ? 76   THR B OG1 1 
ATOM   6313  C CG2 . THR B 1 54  ? 37.584  39.697  20.797  1.00 88.40  ? 76   THR B CG2 1 
ATOM   6314  N N   . HIS B 1 55  ? 42.119  41.397  21.036  1.00 93.18  ? 77   HIS B N   1 
ATOM   6315  C CA  . HIS B 1 55  ? 43.060  42.473  20.751  1.00 93.39  ? 77   HIS B CA  1 
ATOM   6316  C C   . HIS B 1 55  ? 44.496  42.059  21.069  1.00 92.11  ? 77   HIS B C   1 
ATOM   6317  O O   . HIS B 1 55  ? 44.748  41.308  22.003  1.00 92.64  ? 77   HIS B O   1 
ATOM   6318  C CB  . HIS B 1 55  ? 42.722  43.720  21.578  1.00 96.89  ? 77   HIS B CB  1 
ATOM   6319  C CG  . HIS B 1 55  ? 41.568  44.520  21.053  1.00 97.89  ? 77   HIS B CG  1 
ATOM   6320  N ND1 . HIS B 1 55  ? 40.258  44.244  21.383  1.00 97.33  ? 77   HIS B ND1 1 
ATOM   6321  C CD2 . HIS B 1 55  ? 41.532  45.607  20.246  1.00 98.36  ? 77   HIS B CD2 1 
ATOM   6322  C CE1 . HIS B 1 55  ? 39.464  45.121  20.792  1.00 97.74  ? 77   HIS B CE1 1 
ATOM   6323  N NE2 . HIS B 1 55  ? 40.212  45.958  20.096  1.00 98.30  ? 77   HIS B NE2 1 
ATOM   6324  N N   . ILE B 1 56  ? 45.441  42.576  20.296  1.00 89.94  ? 78   ILE B N   1 
ATOM   6325  C CA  . ILE B 1 56  ? 46.852  42.281  20.493  1.00 86.98  ? 78   ILE B CA  1 
ATOM   6326  C C   . ILE B 1 56  ? 47.618  43.573  20.237  1.00 91.02  ? 78   ILE B C   1 
ATOM   6327  O O   . ILE B 1 56  ? 47.210  44.364  19.385  1.00 91.27  ? 78   ILE B O   1 
ATOM   6328  C CB  . ILE B 1 56  ? 47.329  41.222  19.484  1.00 83.04  ? 78   ILE B CB  1 
ATOM   6329  C CG1 . ILE B 1 56  ? 46.554  39.906  19.644  1.00 79.37  ? 78   ILE B CG1 1 
ATOM   6330  C CG2 . ILE B 1 56  ? 48.833  41.000  19.599  1.00 82.83  ? 78   ILE B CG2 1 
ATOM   6331  C CD1 . ILE B 1 56  ? 46.906  39.117  20.892  1.00 76.83  ? 78   ILE B CD1 1 
ATOM   6332  N N   . THR B 1 57  ? 48.709  43.801  20.968  1.00 93.33  ? 79   THR B N   1 
ATOM   6333  C CA  . THR B 1 57  ? 49.522  45.006  20.779  1.00 95.51  ? 79   THR B CA  1 
ATOM   6334  C C   . THR B 1 57  ? 50.939  44.873  21.335  1.00 96.77  ? 79   THR B C   1 
ATOM   6335  O O   . THR B 1 57  ? 51.363  43.797  21.761  1.00 94.90  ? 79   THR B O   1 
ATOM   6336  C CB  . THR B 1 57  ? 48.863  46.261  21.410  1.00 91.65  ? 79   THR B CB  1 
ATOM   6337  O OG1 . THR B 1 57  ? 49.821  47.322  21.469  1.00 93.88  ? 79   THR B OG1 1 
ATOM   6338  C CG2 . THR B 1 57  ? 48.373  45.974  22.821  1.00 92.76  ? 79   THR B CG2 1 
ATOM   6339  N N   . ASN B 1 58  ? 51.665  45.985  21.315  1.00 100.37 ? 80   ASN B N   1 
ATOM   6340  C CA  . ASN B 1 58  ? 52.980  46.070  21.930  1.00 103.28 ? 80   ASN B CA  1 
ATOM   6341  C C   . ASN B 1 58  ? 52.849  46.048  23.447  1.00 104.10 ? 80   ASN B C   1 
ATOM   6342  O O   . ASN B 1 58  ? 53.765  45.635  24.161  1.00 103.46 ? 80   ASN B O   1 
ATOM   6343  C CB  . ASN B 1 58  ? 53.673  47.356  21.484  1.00 105.96 ? 80   ASN B CB  1 
ATOM   6344  C CG  . ASN B 1 58  ? 52.741  48.556  21.505  1.00 107.45 ? 80   ASN B CG  1 
ATOM   6345  O OD1 . ASN B 1 58  ? 51.962  48.742  22.441  1.00 107.00 ? 80   ASN B OD1 1 
ATOM   6346  N ND2 . ASN B 1 58  ? 52.806  49.371  20.458  1.00 109.36 ? 80   ASN B ND2 1 
ATOM   6347  N N   . GLU B 1 59  ? 51.698  46.509  23.925  1.00 104.22 ? 81   GLU B N   1 
ATOM   6348  C CA  . GLU B 1 59  ? 51.400  46.560  25.349  1.00 104.51 ? 81   GLU B CA  1 
ATOM   6349  C C   . GLU B 1 59  ? 51.002  45.195  25.902  1.00 104.15 ? 81   GLU B C   1 
ATOM   6350  O O   . GLU B 1 59  ? 51.463  44.796  26.972  1.00 104.02 ? 81   GLU B O   1 
ATOM   6351  C CB  . GLU B 1 59  ? 50.286  47.578  25.617  1.00 103.81 ? 81   GLU B CB  1 
ATOM   6352  C CG  . GLU B 1 59  ? 49.576  47.399  26.950  1.00 102.12 ? 81   GLU B CG  1 
ATOM   6353  C CD  . GLU B 1 59  ? 50.489  47.641  28.133  1.00 103.37 ? 81   GLU B CD  1 
ATOM   6354  O OE1 . GLU B 1 59  ? 50.340  46.942  29.158  1.00 103.63 ? 81   GLU B OE1 1 
ATOM   6355  O OE2 . GLU B 1 59  ? 51.353  48.534  28.037  1.00 104.12 ? 81   GLU B OE2 1 
ATOM   6356  N N   . SER B 1 60  ? 50.145  44.489  25.166  1.00 103.38 ? 82   SER B N   1 
ATOM   6357  C CA  . SER B 1 60  ? 49.566  43.226  25.629  1.00 102.29 ? 82   SER B CA  1 
ATOM   6358  C C   . SER B 1 60  ? 50.622  42.180  25.968  1.00 103.71 ? 82   SER B C   1 
ATOM   6359  O O   . SER B 1 60  ? 50.457  41.404  26.910  1.00 105.51 ? 82   SER B O   1 
ATOM   6360  C CB  . SER B 1 60  ? 48.595  42.661  24.591  1.00 98.05  ? 82   SER B CB  1 
ATOM   6361  O OG  . SER B 1 60  ? 49.286  42.223  23.434  1.00 96.16  ? 82   SER B OG  1 
ATOM   6362  N N   . PHE B 1 61  ? 51.698  42.153  25.190  1.00 102.05 ? 83   PHE B N   1 
ATOM   6363  C CA  . PHE B 1 61  ? 52.799  41.238  25.463  1.00 100.01 ? 83   PHE B CA  1 
ATOM   6364  C C   . PHE B 1 61  ? 53.934  41.870  26.264  1.00 105.08 ? 83   PHE B C   1 
ATOM   6365  O O   . PHE B 1 61  ? 54.978  41.241  26.444  1.00 104.93 ? 83   PHE B O   1 
ATOM   6366  C CB  . PHE B 1 61  ? 53.313  40.591  24.178  1.00 95.36  ? 83   PHE B CB  1 
ATOM   6367  C CG  . PHE B 1 61  ? 52.302  39.702  23.512  1.00 89.87  ? 83   PHE B CG  1 
ATOM   6368  C CD1 . PHE B 1 61  ? 51.821  38.574  24.156  1.00 87.90  ? 83   PHE B CD1 1 
ATOM   6369  C CD2 . PHE B 1 61  ? 51.825  39.995  22.248  1.00 87.70  ? 83   PHE B CD2 1 
ATOM   6370  C CE1 . PHE B 1 61  ? 50.886  37.753  23.550  1.00 84.07  ? 83   PHE B CE1 1 
ATOM   6371  C CE2 . PHE B 1 61  ? 50.893  39.177  21.638  1.00 84.68  ? 83   PHE B CE2 1 
ATOM   6372  C CZ  . PHE B 1 61  ? 50.423  38.056  22.290  1.00 83.17  ? 83   PHE B CZ  1 
ATOM   6373  N N   . GLN B 1 62  ? 53.730  43.114  26.713  1.00 109.44 ? 84   GLN B N   1 
ATOM   6374  C CA  . GLN B 1 62  ? 54.697  43.854  27.546  1.00 114.16 ? 84   GLN B CA  1 
ATOM   6375  C C   . GLN B 1 62  ? 56.109  43.804  26.946  1.00 118.09 ? 84   GLN B C   1 
ATOM   6376  O O   . GLN B 1 62  ? 56.350  44.365  25.878  1.00 119.88 ? 84   GLN B O   1 
ATOM   6377  C CB  . GLN B 1 62  ? 54.631  43.471  29.043  1.00 113.16 ? 84   GLN B CB  1 
ATOM   6378  C CG  . GLN B 1 62  ? 54.735  41.991  29.396  1.00 110.07 ? 84   GLN B CG  1 
ATOM   6379  C CD  . GLN B 1 62  ? 55.847  41.719  30.388  1.00 110.60 ? 84   GLN B CD  1 
ATOM   6380  O OE1 . GLN B 1 62  ? 56.029  42.461  31.356  1.00 112.82 ? 84   GLN B OE1 1 
ATOM   6381  N NE2 . GLN B 1 62  ? 56.606  40.660  30.146  1.00 108.19 ? 84   GLN B NE2 1 
ATOM   6382  N N   . GLY B 1 63  ? 57.042  43.171  27.644  1.00 119.00 ? 85   GLY B N   1 
ATOM   6383  C CA  . GLY B 1 63  ? 58.137  42.528  26.948  1.00 118.12 ? 85   GLY B CA  1 
ATOM   6384  C C   . GLY B 1 63  ? 58.647  41.384  27.790  1.00 115.82 ? 85   GLY B C   1 
ATOM   6385  O O   . GLY B 1 63  ? 58.678  41.465  29.021  1.00 115.72 ? 85   GLY B O   1 
ATOM   6386  N N   . LEU B 1 64  ? 59.072  40.313  27.129  1.00 112.51 ? 86   LEU B N   1 
ATOM   6387  C CA  . LEU B 1 64  ? 59.586  39.185  27.885  1.00 109.23 ? 86   LEU B CA  1 
ATOM   6388  C C   . LEU B 1 64  ? 60.802  38.450  27.322  1.00 107.36 ? 86   LEU B C   1 
ATOM   6389  O O   . LEU B 1 64  ? 60.710  37.792  26.284  1.00 103.60 ? 86   LEU B O   1 
ATOM   6390  C CB  . LEU B 1 64  ? 58.451  38.197  28.138  1.00 105.37 ? 86   LEU B CB  1 
ATOM   6391  C CG  . LEU B 1 64  ? 58.532  37.467  29.477  1.00 104.36 ? 86   LEU B CG  1 
ATOM   6392  C CD1 . LEU B 1 64  ? 58.814  38.440  30.655  1.00 94.93  ? 86   LEU B CD1 1 
ATOM   6393  C CD2 . LEU B 1 64  ? 57.260  36.655  29.685  1.00 100.14 ? 86   LEU B CD2 1 
ATOM   6394  N N   . GLN B 1 65  ? 61.944  38.612  27.988  1.00 110.17 ? 87   GLN B N   1 
ATOM   6395  C CA  . GLN B 1 65  ? 62.897  37.523  28.207  1.00 108.05 ? 87   GLN B CA  1 
ATOM   6396  C C   . GLN B 1 65  ? 63.059  36.504  27.075  1.00 104.21 ? 87   GLN B C   1 
ATOM   6397  O O   . GLN B 1 65  ? 63.381  36.835  25.934  1.00 103.07 ? 87   GLN B O   1 
ATOM   6398  C CB  . GLN B 1 65  ? 62.655  36.824  29.554  1.00 106.45 ? 87   GLN B CB  1 
ATOM   6399  C CG  . GLN B 1 65  ? 63.352  37.496  30.733  1.00 108.49 ? 87   GLN B CG  1 
ATOM   6400  C CD  . GLN B 1 65  ? 62.590  38.692  31.253  1.00 108.80 ? 87   GLN B CD  1 
ATOM   6401  O OE1 . GLN B 1 65  ? 61.605  38.546  31.974  1.00 106.95 ? 87   GLN B OE1 1 
ATOM   6402  N NE2 . GLN B 1 65  ? 63.042  39.887  30.888  1.00 110.97 ? 87   GLN B NE2 1 
ATOM   6403  N N   . ASN B 1 66  ? 62.800  35.252  27.433  1.00 100.42 ? 88   ASN B N   1 
ATOM   6404  C CA  . ASN B 1 66  ? 63.137  34.095  26.611  1.00 95.59  ? 88   ASN B CA  1 
ATOM   6405  C C   . ASN B 1 66  ? 62.095  33.467  25.675  1.00 89.99  ? 88   ASN B C   1 
ATOM   6406  O O   . ASN B 1 66  ? 62.369  32.380  25.160  1.00 89.25  ? 88   ASN B O   1 
ATOM   6407  C CB  . ASN B 1 66  ? 63.728  32.986  27.492  1.00 94.47  ? 88   ASN B CB  1 
ATOM   6408  C CG  . ASN B 1 66  ? 65.186  33.223  27.835  1.00 96.19  ? 88   ASN B CG  1 
ATOM   6409  O OD1 . ASN B 1 66  ? 65.999  33.542  26.966  1.00 97.48  ? 88   ASN B OD1 1 
ATOM   6410  N ND2 . ASN B 1 66  ? 65.524  33.067  29.109  1.00 96.85  ? 88   ASN B ND2 1 
ATOM   6411  N N   . LEU B 1 67  ? 60.917  34.073  25.482  1.00 86.23  ? 89   LEU B N   1 
ATOM   6412  C CA  . LEU B 1 67  ? 59.848  33.353  24.770  1.00 83.79  ? 89   LEU B CA  1 
ATOM   6413  C C   . LEU B 1 67  ? 60.328  32.851  23.404  1.00 81.36  ? 89   LEU B C   1 
ATOM   6414  O O   . LEU B 1 67  ? 60.665  33.635  22.521  1.00 81.67  ? 89   LEU B O   1 
ATOM   6415  C CB  . LEU B 1 67  ? 58.622  34.251  24.547  1.00 81.27  ? 89   LEU B CB  1 
ATOM   6416  C CG  . LEU B 1 67  ? 57.700  34.702  25.682  1.00 78.11  ? 89   LEU B CG  1 
ATOM   6417  C CD1 . LEU B 1 67  ? 56.466  35.397  25.115  1.00 74.97  ? 89   LEU B CD1 1 
ATOM   6418  C CD2 . LEU B 1 67  ? 57.292  33.544  26.563  1.00 75.63  ? 89   LEU B CD2 1 
ATOM   6419  N N   . THR B 1 68  ? 60.337  31.531  23.241  1.00 79.01  ? 90   THR B N   1 
ATOM   6420  C CA  . THR B 1 68  ? 60.794  30.921  22.000  1.00 79.14  ? 90   THR B CA  1 
ATOM   6421  C C   . THR B 1 68  ? 59.602  30.477  21.136  1.00 80.69  ? 90   THR B C   1 
ATOM   6422  O O   . THR B 1 68  ? 59.749  30.158  19.949  1.00 83.04  ? 90   THR B O   1 
ATOM   6423  C CB  . THR B 1 68  ? 61.838  29.781  22.292  1.00 91.39  ? 90   THR B CB  1 
ATOM   6424  O OG1 . THR B 1 68  ? 63.140  30.199  21.863  1.00 93.59  ? 90   THR B OG1 1 
ATOM   6425  C CG2 . THR B 1 68  ? 61.480  28.457  21.621  1.00 90.12  ? 90   THR B CG2 1 
ATOM   6426  N N   . LYS B 1 69  ? 58.410  30.536  21.725  1.00 77.15  ? 91   LYS B N   1 
ATOM   6427  C CA  . LYS B 1 69  ? 57.194  30.124  21.040  1.00 71.31  ? 91   LYS B CA  1 
ATOM   6428  C C   . LYS B 1 69  ? 55.962  30.816  21.611  1.00 69.97  ? 91   LYS B C   1 
ATOM   6429  O O   . LYS B 1 69  ? 55.878  31.059  22.814  1.00 73.29  ? 91   LYS B O   1 
ATOM   6430  C CB  . LYS B 1 69  ? 57.043  28.607  21.143  1.00 69.66  ? 91   LYS B CB  1 
ATOM   6431  C CG  . LYS B 1 69  ? 55.796  28.029  20.492  1.00 69.45  ? 91   LYS B CG  1 
ATOM   6432  C CD  . LYS B 1 69  ? 55.951  26.533  20.332  1.00 69.02  ? 91   LYS B CD  1 
ATOM   6433  C CE  . LYS B 1 69  ? 54.626  25.822  20.182  1.00 65.76  ? 91   LYS B CE  1 
ATOM   6434  N NZ  . LYS B 1 69  ? 54.853  24.357  20.100  1.00 62.60  ? 91   LYS B NZ  1 
ATOM   6435  N N   . ILE B 1 70  ? 55.003  31.115  20.745  1.00 67.58  ? 92   ILE B N   1 
ATOM   6436  C CA  . ILE B 1 70  ? 53.703  31.618  21.161  1.00 70.06  ? 92   ILE B CA  1 
ATOM   6437  C C   . ILE B 1 70  ? 52.660  30.930  20.299  1.00 70.91  ? 92   ILE B C   1 
ATOM   6438  O O   . ILE B 1 70  ? 52.825  30.843  19.086  1.00 73.62  ? 92   ILE B O   1 
ATOM   6439  C CB  . ILE B 1 70  ? 53.549  33.136  20.945  1.00 73.47  ? 92   ILE B CB  1 
ATOM   6440  C CG1 . ILE B 1 70  ? 54.552  33.924  21.788  1.00 79.08  ? 92   ILE B CG1 1 
ATOM   6441  C CG2 . ILE B 1 70  ? 52.137  33.579  21.295  1.00 72.44  ? 92   ILE B CG2 1 
ATOM   6442  C CD1 . ILE B 1 70  ? 54.427  35.434  21.639  1.00 81.04  ? 92   ILE B CD1 1 
ATOM   6443  N N   . ASN B 1 71  ? 51.597  30.434  20.924  1.00 68.34  ? 93   ASN B N   1 
ATOM   6444  C CA  . ASN B 1 71  ? 50.468  29.880  20.197  1.00 66.28  ? 93   ASN B CA  1 
ATOM   6445  C C   . ASN B 1 71  ? 49.253  30.775  20.423  1.00 66.73  ? 93   ASN B C   1 
ATOM   6446  O O   . ASN B 1 71  ? 48.659  30.772  21.504  1.00 68.19  ? 93   ASN B O   1 
ATOM   6447  C CB  . ASN B 1 71  ? 50.190  28.456  20.696  1.00 64.10  ? 93   ASN B CB  1 
ATOM   6448  C CG  . ASN B 1 71  ? 49.098  27.750  19.908  1.00 60.28  ? 93   ASN B CG  1 
ATOM   6449  O OD1 . ASN B 1 71  ? 48.161  28.375  19.414  1.00 60.10  ? 93   ASN B OD1 1 
ATOM   6450  N ND2 . ASN B 1 71  ? 49.208  26.431  19.807  1.00 56.80  ? 93   ASN B ND2 1 
ATOM   6451  N N   . LEU B 1 72  ? 48.884  31.535  19.397  1.00 61.71  ? 94   LEU B N   1 
ATOM   6452  C CA  . LEU B 1 72  ? 47.702  32.400  19.446  1.00 57.34  ? 94   LEU B CA  1 
ATOM   6453  C C   . LEU B 1 72  ? 46.442  31.789  18.819  1.00 56.99  ? 94   LEU B C   1 
ATOM   6454  O O   . LEU B 1 72  ? 45.462  32.499  18.593  1.00 56.70  ? 94   LEU B O   1 
ATOM   6455  C CB  . LEU B 1 72  ? 47.984  33.777  18.844  1.00 56.39  ? 94   LEU B CB  1 
ATOM   6456  C CG  . LEU B 1 72  ? 47.906  35.027  19.732  1.00 59.64  ? 94   LEU B CG  1 
ATOM   6457  C CD1 . LEU B 1 72  ? 47.099  34.800  21.010  1.00 58.07  ? 94   LEU B CD1 1 
ATOM   6458  C CD2 . LEU B 1 72  ? 49.299  35.551  20.056  1.00 62.50  ? 94   LEU B CD2 1 
ATOM   6459  N N   . ASN B 1 73  ? 46.491  30.503  18.478  1.00 55.86  ? 95   ASN B N   1 
ATOM   6460  C CA  . ASN B 1 73  ? 45.407  29.865  17.714  1.00 59.81  ? 95   ASN B CA  1 
ATOM   6461  C C   . ASN B 1 73  ? 43.997  30.028  18.287  1.00 66.44  ? 95   ASN B C   1 
ATOM   6462  O O   . ASN B 1 73  ? 43.800  29.997  19.498  1.00 68.93  ? 95   ASN B O   1 
ATOM   6463  C CB  . ASN B 1 73  ? 45.693  28.376  17.473  1.00 56.93  ? 95   ASN B CB  1 
ATOM   6464  C CG  . ASN B 1 73  ? 46.921  28.149  16.611  1.00 57.48  ? 95   ASN B CG  1 
ATOM   6465  O OD1 . ASN B 1 73  ? 47.384  29.056  15.924  1.00 60.97  ? 95   ASN B OD1 1 
ATOM   6466  N ND2 . ASN B 1 73  ? 47.455  26.933  16.646  1.00 54.51  ? 95   ASN B ND2 1 
ATOM   6467  N N   . HIS B 1 74  ? 43.034  30.212  17.386  1.00 68.55  ? 96   HIS B N   1 
ATOM   6468  C CA  . HIS B 1 74  ? 41.620  30.419  17.714  1.00 68.20  ? 96   HIS B CA  1 
ATOM   6469  C C   . HIS B 1 74  ? 41.388  31.409  18.852  1.00 71.29  ? 96   HIS B C   1 
ATOM   6470  O O   . HIS B 1 74  ? 40.647  31.128  19.792  1.00 71.82  ? 96   HIS B O   1 
ATOM   6471  C CB  . HIS B 1 74  ? 40.878  29.099  17.966  1.00 65.44  ? 96   HIS B CB  1 
ATOM   6472  C CG  . HIS B 1 74  ? 39.421  29.156  17.612  1.00 65.22  ? 96   HIS B CG  1 
ATOM   6473  N ND1 . HIS B 1 74  ? 38.480  28.329  18.186  1.00 64.85  ? 96   HIS B ND1 1 
ATOM   6474  C CD2 . HIS B 1 74  ? 38.744  29.940  16.736  1.00 64.00  ? 96   HIS B CD2 1 
ATOM   6475  C CE1 . HIS B 1 74  ? 37.289  28.600  17.682  1.00 62.85  ? 96   HIS B CE1 1 
ATOM   6476  N NE2 . HIS B 1 74  ? 37.421  29.573  16.798  1.00 62.48  ? 96   HIS B NE2 1 
ATOM   6477  N N   . ASN B 1 75  ? 42.062  32.551  18.777  1.00 74.00  ? 97   ASN B N   1 
ATOM   6478  C CA  . ASN B 1 75  ? 41.759  33.675  19.650  1.00 76.87  ? 97   ASN B CA  1 
ATOM   6479  C C   . ASN B 1 75  ? 41.111  34.775  18.825  1.00 78.33  ? 97   ASN B C   1 
ATOM   6480  O O   . ASN B 1 75  ? 41.764  35.378  17.974  1.00 78.85  ? 97   ASN B O   1 
ATOM   6481  C CB  . ASN B 1 75  ? 43.030  34.210  20.307  1.00 80.96  ? 97   ASN B CB  1 
ATOM   6482  C CG  . ASN B 1 75  ? 43.341  33.531  21.624  1.00 82.15  ? 97   ASN B CG  1 
ATOM   6483  O OD1 . ASN B 1 75  ? 42.833  33.929  22.671  1.00 83.85  ? 97   ASN B OD1 1 
ATOM   6484  N ND2 . ASN B 1 75  ? 44.191  32.513  21.582  1.00 81.16  ? 97   ASN B ND2 1 
ATOM   6485  N N   . PRO B 1 76  ? 39.823  35.052  19.068  1.00 81.02  ? 98   PRO B N   1 
ATOM   6486  C CA  . PRO B 1 76  ? 38.929  34.462  20.066  1.00 82.75  ? 98   PRO B CA  1 
ATOM   6487  C C   . PRO B 1 76  ? 38.275  33.178  19.564  1.00 82.73  ? 98   PRO B C   1 
ATOM   6488  O O   . PRO B 1 76  ? 38.595  32.711  18.473  1.00 83.19  ? 98   PRO B O   1 
ATOM   6489  C CB  . PRO B 1 76  ? 37.862  35.539  20.223  1.00 82.77  ? 98   PRO B CB  1 
ATOM   6490  C CG  . PRO B 1 76  ? 37.730  36.083  18.847  1.00 82.68  ? 98   PRO B CG  1 
ATOM   6491  C CD  . PRO B 1 76  ? 39.131  36.082  18.272  1.00 82.44  ? 98   PRO B CD  1 
ATOM   6492  N N   . ASN B 1 77  ? 37.355  32.629  20.352  1.00 83.59  ? 99   ASN B N   1 
ATOM   6493  C CA  . ASN B 1 77  ? 36.699  31.373  20.009  1.00 80.57  ? 99   ASN B CA  1 
ATOM   6494  C C   . ASN B 1 77  ? 35.299  31.591  19.456  1.00 83.02  ? 99   ASN B C   1 
ATOM   6495  O O   . ASN B 1 77  ? 34.373  31.896  20.210  1.00 86.13  ? 99   ASN B O   1 
ATOM   6496  C CB  . ASN B 1 77  ? 36.610  30.488  21.250  1.00 77.58  ? 99   ASN B CB  1 
ATOM   6497  C CG  . ASN B 1 77  ? 37.287  29.149  21.061  1.00 74.76  ? 99   ASN B CG  1 
ATOM   6498  O OD1 . ASN B 1 77  ? 38.514  29.062  21.017  1.00 76.24  ? 99   ASN B OD1 1 
ATOM   6499  N ND2 . ASN B 1 77  ? 36.491  28.094  20.955  1.00 69.41  ? 99   ASN B ND2 1 
ATOM   6500  N N   . VAL B 1 78  ? 35.148  31.388  18.148  1.00 80.83  ? 100  VAL B N   1 
ATOM   6501  C CA  . VAL B 1 78  ? 33.870  31.559  17.460  1.00 77.73  ? 100  VAL B CA  1 
ATOM   6502  C C   . VAL B 1 78  ? 33.153  32.854  17.847  1.00 79.16  ? 100  VAL B C   1 
ATOM   6503  O O   . VAL B 1 78  ? 33.357  33.899  17.231  1.00 78.92  ? 100  VAL B O   1 
ATOM   6504  C CB  . VAL B 1 78  ? 32.935  30.365  17.708  1.00 73.44  ? 100  VAL B CB  1 
ATOM   6505  N N   . GLY B 1 91  ? 36.920  39.109  14.254  1.00 82.90  ? 113  GLY B N   1 
ATOM   6506  C CA  . GLY B 1 91  ? 37.917  38.211  14.808  1.00 80.89  ? 113  GLY B CA  1 
ATOM   6507  C C   . GLY B 1 91  ? 38.966  38.933  15.628  1.00 82.73  ? 113  GLY B C   1 
ATOM   6508  O O   . GLY B 1 91  ? 38.643  39.798  16.439  1.00 86.11  ? 113  GLY B O   1 
ATOM   6509  N N   . LEU B 1 92  ? 40.229  38.581  15.409  1.00 80.82  ? 114  LEU B N   1 
ATOM   6510  C CA  . LEU B 1 92  ? 41.333  39.150  16.174  1.00 78.48  ? 114  LEU B CA  1 
ATOM   6511  C C   . LEU B 1 92  ? 41.872  40.420  15.525  1.00 82.88  ? 114  LEU B C   1 
ATOM   6512  O O   . LEU B 1 92  ? 42.055  40.467  14.313  1.00 83.26  ? 114  LEU B O   1 
ATOM   6513  C CB  . LEU B 1 92  ? 42.450  38.106  16.333  1.00 73.41  ? 114  LEU B CB  1 
ATOM   6514  C CG  . LEU B 1 92  ? 43.791  38.482  16.975  1.00 71.97  ? 114  LEU B CG  1 
ATOM   6515  C CD1 . LEU B 1 92  ? 44.450  37.281  17.628  1.00 67.74  ? 114  LEU B CD1 1 
ATOM   6516  C CD2 . LEU B 1 92  ? 44.740  39.080  15.943  1.00 74.00  ? 114  LEU B CD2 1 
ATOM   6517  N N   . ASN B 1 93  ? 42.135  41.442  16.337  1.00 86.98  ? 115  ASN B N   1 
ATOM   6518  C CA  . ASN B 1 93  ? 42.831  42.634  15.860  1.00 89.57  ? 115  ASN B CA  1 
ATOM   6519  C C   . ASN B 1 93  ? 44.258  42.685  16.398  1.00 90.74  ? 115  ASN B C   1 
ATOM   6520  O O   . ASN B 1 93  ? 44.467  42.912  17.585  1.00 92.56  ? 115  ASN B O   1 
ATOM   6521  C CB  . ASN B 1 93  ? 42.058  43.907  16.251  1.00 91.17  ? 115  ASN B CB  1 
ATOM   6522  C CG  . ASN B 1 93  ? 42.732  45.195  15.771  1.00 92.63  ? 115  ASN B CG  1 
ATOM   6523  O OD1 . ASN B 1 93  ? 43.837  45.181  15.235  1.00 92.81  ? 115  ASN B OD1 1 
ATOM   6524  N ND2 . ASN B 1 93  ? 42.059  46.321  15.982  1.00 94.31  ? 115  ASN B ND2 1 
ATOM   6525  N N   . ILE B 1 94  ? 45.230  42.471  15.515  1.00 90.27  ? 116  ILE B N   1 
ATOM   6526  C CA  . ILE B 1 94  ? 46.634  42.743  15.823  1.00 90.76  ? 116  ILE B CA  1 
ATOM   6527  C C   . ILE B 1 94  ? 47.104  43.997  15.078  1.00 92.42  ? 116  ILE B C   1 
ATOM   6528  O O   . ILE B 1 94  ? 47.174  44.017  13.844  1.00 91.25  ? 116  ILE B O   1 
ATOM   6529  C CB  . ILE B 1 94  ? 47.565  41.538  15.513  1.00 71.81  ? 116  ILE B CB  1 
ATOM   6530  C CG1 . ILE B 1 94  ? 49.028  41.979  15.550  1.00 73.08  ? 116  ILE B CG1 1 
ATOM   6531  C CG2 . ILE B 1 94  ? 47.221  40.905  14.176  1.00 72.63  ? 116  ILE B CG2 1 
ATOM   6532  C CD1 . ILE B 1 94  ? 50.013  40.925  15.107  1.00 72.56  ? 116  ILE B CD1 1 
ATOM   6533  N N   . THR B 1 95  ? 47.395  45.049  15.838  1.00 94.32  ? 117  THR B N   1 
ATOM   6534  C CA  . THR B 1 95  ? 47.883  46.302  15.270  1.00 96.51  ? 117  THR B CA  1 
ATOM   6535  C C   . THR B 1 95  ? 49.235  46.067  14.606  1.00 98.12  ? 117  THR B C   1 
ATOM   6536  O O   . THR B 1 95  ? 49.969  45.153  14.994  1.00 98.22  ? 117  THR B O   1 
ATOM   6537  C CB  . THR B 1 95  ? 48.030  47.390  16.358  1.00 96.93  ? 117  THR B CB  1 
ATOM   6538  O OG1 . THR B 1 95  ? 48.730  46.847  17.486  1.00 95.28  ? 117  THR B OG1 1 
ATOM   6539  C CG2 . THR B 1 95  ? 46.665  47.885  16.820  1.00 97.44  ? 117  THR B CG2 1 
ATOM   6540  N N   . ASP B 1 96  ? 49.558  46.884  13.605  1.00 99.10  ? 118  ASP B N   1 
ATOM   6541  C CA  . ASP B 1 96  ? 50.848  46.787  12.929  1.00 98.43  ? 118  ASP B CA  1 
ATOM   6542  C C   . ASP B 1 96  ? 51.977  46.852  13.953  1.00 98.51  ? 118  ASP B C   1 
ATOM   6543  O O   . ASP B 1 96  ? 52.038  47.778  14.764  1.00 101.24 ? 118  ASP B O   1 
ATOM   6544  C CB  . ASP B 1 96  ? 51.020  47.920  11.909  1.00 99.86  ? 118  ASP B CB  1 
ATOM   6545  C CG  . ASP B 1 96  ? 49.885  47.988  10.902  1.00 99.37  ? 118  ASP B CG  1 
ATOM   6546  O OD1 . ASP B 1 96  ? 49.122  47.007  10.785  1.00 95.87  ? 118  ASP B OD1 1 
ATOM   6547  O OD2 . ASP B 1 96  ? 49.763  49.028  10.221  1.00 102.72 ? 118  ASP B OD2 1 
ATOM   6548  N N   . GLY B 1 97  ? 52.855  45.854  13.916  1.00 96.46  ? 119  GLY B N   1 
ATOM   6549  C CA  . GLY B 1 97  ? 54.030  45.809  14.772  1.00 98.50  ? 119  GLY B CA  1 
ATOM   6550  C C   . GLY B 1 97  ? 53.817  45.432  16.233  1.00 100.78 ? 119  GLY B C   1 
ATOM   6551  O O   . GLY B 1 97  ? 54.439  46.010  17.122  1.00 104.05 ? 119  GLY B O   1 
ATOM   6552  N N   . ALA B 1 98  ? 52.973  44.436  16.482  1.00 98.54  ? 120  ALA B N   1 
ATOM   6553  C CA  . ALA B 1 98  ? 52.703  43.984  17.847  1.00 97.84  ? 120  ALA B CA  1 
ATOM   6554  C C   . ALA B 1 98  ? 53.815  43.103  18.425  1.00 95.59  ? 120  ALA B C   1 
ATOM   6555  O O   . ALA B 1 98  ? 54.251  43.304  19.557  1.00 98.39  ? 120  ALA B O   1 
ATOM   6556  C CB  . ALA B 1 98  ? 51.366  43.266  17.908  1.00 97.85  ? 120  ALA B CB  1 
ATOM   6557  N N   . PHE B 1 99  ? 54.275  42.133  17.642  1.00 91.54  ? 121  PHE B N   1 
ATOM   6558  C CA  . PHE B 1 99  ? 55.282  41.173  18.098  1.00 89.54  ? 121  PHE B CA  1 
ATOM   6559  C C   . PHE B 1 99  ? 56.685  41.732  17.928  1.00 92.26  ? 121  PHE B C   1 
ATOM   6560  O O   . PHE B 1 99  ? 57.678  41.043  18.177  1.00 92.37  ? 121  PHE B O   1 
ATOM   6561  C CB  . PHE B 1 99  ? 55.166  39.854  17.328  1.00 86.53  ? 121  PHE B CB  1 
ATOM   6562  C CG  . PHE B 1 99  ? 53.877  39.117  17.569  1.00 85.35  ? 121  PHE B CG  1 
ATOM   6563  C CD1 . PHE B 1 99  ? 53.721  38.313  18.688  1.00 85.38  ? 121  PHE B CD1 1 
ATOM   6564  C CD2 . PHE B 1 99  ? 52.823  39.223  16.678  1.00 84.63  ? 121  PHE B CD2 1 
ATOM   6565  C CE1 . PHE B 1 99  ? 52.536  37.634  18.913  1.00 84.68  ? 121  PHE B CE1 1 
ATOM   6566  C CE2 . PHE B 1 99  ? 51.639  38.543  16.898  1.00 84.21  ? 121  PHE B CE2 1 
ATOM   6567  C CZ  . PHE B 1 99  ? 51.494  37.750  18.016  1.00 84.55  ? 121  PHE B CZ  1 
ATOM   6568  N N   . LEU B 1 100 ? 56.739  42.990  17.504  1.00 95.08  ? 122  LEU B N   1 
ATOM   6569  C CA  . LEU B 1 100 ? 57.943  43.620  16.971  1.00 97.67  ? 122  LEU B CA  1 
ATOM   6570  C C   . LEU B 1 100 ? 59.237  43.480  17.769  1.00 98.59  ? 122  LEU B C   1 
ATOM   6571  O O   . LEU B 1 100 ? 60.246  43.036  17.220  1.00 98.37  ? 122  LEU B O   1 
ATOM   6572  C CB  . LEU B 1 100 ? 57.667  45.098  16.693  1.00 100.66 ? 122  LEU B CB  1 
ATOM   6573  C CG  . LEU B 1 100 ? 58.001  45.509  15.263  1.00 100.45 ? 122  LEU B CG  1 
ATOM   6574  C CD1 . LEU B 1 100 ? 57.417  44.486  14.338  1.00 97.87  ? 122  LEU B CD1 1 
ATOM   6575  C CD2 . LEU B 1 100 ? 57.467  46.891  14.943  1.00 101.88 ? 122  LEU B CD2 1 
ATOM   6576  N N   . ASN B 1 101 ? 59.239  43.844  19.045  1.00 99.86  ? 123  ASN B N   1 
ATOM   6577  C CA  . ASN B 1 101 ? 60.498  43.736  19.755  1.00 101.31 ? 123  ASN B CA  1 
ATOM   6578  C C   . ASN B 1 101 ? 60.468  42.461  20.561  1.00 101.57 ? 123  ASN B C   1 
ATOM   6579  O O   . ASN B 1 101 ? 59.958  42.417  21.681  1.00 102.23 ? 123  ASN B O   1 
ATOM   6580  C CB  . ASN B 1 101 ? 60.687  44.937  20.682  1.00 103.34 ? 123  ASN B CB  1 
ATOM   6581  C CG  . ASN B 1 101 ? 60.181  46.231  20.074  1.00 102.96 ? 123  ASN B CG  1 
ATOM   6582  O OD1 . ASN B 1 101 ? 59.020  46.603  20.252  1.00 101.39 ? 123  ASN B OD1 1 
ATOM   6583  N ND2 . ASN B 1 101 ? 61.053  46.928  19.357  1.00 104.37 ? 123  ASN B ND2 1 
ATOM   6584  N N   . LEU B 1 102 ? 61.069  41.433  19.975  1.00 102.32 ? 124  LEU B N   1 
ATOM   6585  C CA  . LEU B 1 102 ? 61.150  40.116  20.574  1.00 100.25 ? 124  LEU B CA  1 
ATOM   6586  C C   . LEU B 1 102 ? 62.559  39.576  20.372  1.00 104.01 ? 124  LEU B C   1 
ATOM   6587  O O   . LEU B 1 102 ? 63.318  39.382  21.325  1.00 107.91 ? 124  LEU B O   1 
ATOM   6588  C CB  . LEU B 1 102 ? 60.097  39.189  19.957  1.00 94.28  ? 124  LEU B CB  1 
ATOM   6589  C CG  . LEU B 1 102 ? 59.251  38.357  20.926  1.00 90.52  ? 124  LEU B CG  1 
ATOM   6590  C CD1 . LEU B 1 102 ? 59.722  38.582  22.347  1.00 89.34  ? 124  LEU B CD1 1 
ATOM   6591  C CD2 . LEU B 1 102 ? 57.763  38.669  20.783  1.00 88.92  ? 124  LEU B CD2 1 
ATOM   6592  N N   . LYS B 1 103 ? 62.874  39.317  19.103  1.00 102.64 ? 125  LYS B N   1 
ATOM   6593  C CA  . LYS B 1 103 ? 64.180  38.827  18.644  1.00 102.41 ? 125  LYS B CA  1 
ATOM   6594  C C   . LYS B 1 103 ? 64.488  37.409  19.104  1.00 98.04  ? 125  LYS B C   1 
ATOM   6595  O O   . LYS B 1 103 ? 65.395  36.746  18.584  1.00 95.72  ? 125  LYS B O   1 
ATOM   6596  C CB  . LYS B 1 103 ? 65.317  39.783  19.038  1.00 106.59 ? 125  LYS B CB  1 
ATOM   6597  C CG  . LYS B 1 103 ? 65.561  40.900  18.034  1.00 107.86 ? 125  LYS B CG  1 
ATOM   6598  C CD  . LYS B 1 103 ? 65.543  40.376  16.598  1.00 105.80 ? 125  LYS B CD  1 
ATOM   6599  C CE  . LYS B 1 103 ? 66.712  39.439  16.305  1.00 104.01 ? 125  LYS B CE  1 
ATOM   6600  N NZ  . LYS B 1 103 ? 66.422  38.577  15.124  1.00 100.30 ? 125  LYS B NZ  1 
ATOM   6601  N N   . ASN B 1 104 ? 63.714  36.961  20.084  1.00 95.34  ? 126  ASN B N   1 
ATOM   6602  C CA  . ASN B 1 104 ? 63.740  35.596  20.554  1.00 92.34  ? 126  ASN B CA  1 
ATOM   6603  C C   . ASN B 1 104 ? 62.664  34.742  19.897  1.00 85.00  ? 126  ASN B C   1 
ATOM   6604  O O   . ASN B 1 104 ? 62.666  33.518  20.042  1.00 84.02  ? 126  ASN B O   1 
ATOM   6605  C CB  . ASN B 1 104 ? 63.532  35.587  22.066  1.00 95.36  ? 126  ASN B CB  1 
ATOM   6606  C CG  . ASN B 1 104 ? 64.657  36.267  22.809  1.00 101.11 ? 126  ASN B CG  1 
ATOM   6607  O OD1 . ASN B 1 104 ? 65.544  35.602  23.336  1.00 103.68 ? 126  ASN B OD1 1 
ATOM   6608  N ND2 . ASN B 1 104 ? 64.635  37.598  22.847  1.00 102.44 ? 126  ASN B ND2 1 
ATOM   6609  N N   . LEU B 1 105 ? 61.747  35.362  19.161  1.00 79.19  ? 127  LEU B N   1 
ATOM   6610  C CA  . LEU B 1 105 ? 60.553  34.617  18.796  1.00 73.23  ? 127  LEU B CA  1 
ATOM   6611  C C   . LEU B 1 105 ? 60.914  33.766  17.590  1.00 71.11  ? 127  LEU B C   1 
ATOM   6612  O O   . LEU B 1 105 ? 61.197  34.274  16.507  1.00 68.05  ? 127  LEU B O   1 
ATOM   6613  C CB  . LEU B 1 105 ? 59.393  35.572  18.487  1.00 70.79  ? 127  LEU B CB  1 
ATOM   6614  C CG  . LEU B 1 105 ? 57.969  35.003  18.400  1.00 69.06  ? 127  LEU B CG  1 
ATOM   6615  C CD1 . LEU B 1 105 ? 57.581  34.291  19.678  1.00 67.49  ? 127  LEU B CD1 1 
ATOM   6616  C CD2 . LEU B 1 105 ? 56.958  36.099  18.087  1.00 70.42  ? 127  LEU B CD2 1 
ATOM   6617  N N   . ARG B 1 106 ? 60.965  32.462  17.838  1.00 73.63  ? 128  ARG B N   1 
ATOM   6618  C CA  . ARG B 1 106 ? 61.260  31.435  16.842  1.00 77.71  ? 128  ARG B CA  1 
ATOM   6619  C C   . ARG B 1 106 ? 60.030  30.894  16.090  1.00 77.34  ? 128  ARG B C   1 
ATOM   6620  O O   . ARG B 1 106 ? 60.064  30.695  14.874  1.00 75.48  ? 128  ARG B O   1 
ATOM   6621  C CB  . ARG B 1 106 ? 62.041  30.308  17.521  1.00 81.34  ? 128  ARG B CB  1 
ATOM   6622  C CG  . ARG B 1 106 ? 62.475  29.174  16.630  1.00 82.47  ? 128  ARG B CG  1 
ATOM   6623  C CD  . ARG B 1 106 ? 63.585  28.394  17.306  1.00 84.73  ? 128  ARG B CD  1 
ATOM   6624  N NE  . ARG B 1 106 ? 64.773  29.226  17.472  1.00 87.41  ? 128  ARG B NE  1 
ATOM   6625  C CZ  . ARG B 1 106 ? 65.653  29.445  16.502  1.00 88.38  ? 128  ARG B CZ  1 
ATOM   6626  N NH1 . ARG B 1 106 ? 65.469  28.888  15.311  1.00 89.23  ? 128  ARG B NH1 1 
ATOM   6627  N NH2 . ARG B 1 106 ? 66.711  30.216  16.715  1.00 89.44  ? 128  ARG B NH2 1 
ATOM   6628  N N   . GLU B 1 107 ? 58.953  30.646  16.832  1.00 77.85  ? 129  GLU B N   1 
ATOM   6629  C CA  . GLU B 1 107 ? 57.759  30.011  16.283  1.00 77.49  ? 129  GLU B CA  1 
ATOM   6630  C C   . GLU B 1 107 ? 56.493  30.738  16.717  1.00 76.79  ? 129  GLU B C   1 
ATOM   6631  O O   . GLU B 1 107 ? 56.320  31.044  17.895  1.00 76.95  ? 129  GLU B O   1 
ATOM   6632  C CB  . GLU B 1 107 ? 57.676  28.542  16.712  1.00 79.02  ? 129  GLU B CB  1 
ATOM   6633  C CG  . GLU B 1 107 ? 56.363  27.870  16.315  1.00 80.78  ? 129  GLU B CG  1 
ATOM   6634  C CD  . GLU B 1 107 ? 56.357  26.370  16.553  1.00 82.37  ? 129  GLU B CD  1 
ATOM   6635  O OE1 . GLU B 1 107 ? 57.428  25.814  16.877  1.00 83.85  ? 129  GLU B OE1 1 
ATOM   6636  O OE2 . GLU B 1 107 ? 55.278  25.748  16.415  1.00 80.57  ? 129  GLU B OE2 1 
ATOM   6637  N N   . LEU B 1 108 ? 55.609  31.009  15.762  1.00 75.38  ? 130  LEU B N   1 
ATOM   6638  C CA  . LEU B 1 108 ? 54.397  31.771  16.035  1.00 72.35  ? 130  LEU B CA  1 
ATOM   6639  C C   . LEU B 1 108 ? 53.172  31.172  15.335  1.00 73.01  ? 130  LEU B C   1 
ATOM   6640  O O   . LEU B 1 108 ? 53.130  31.099  14.101  1.00 72.44  ? 130  LEU B O   1 
ATOM   6641  C CB  . LEU B 1 108 ? 54.620  33.217  15.591  1.00 68.66  ? 130  LEU B CB  1 
ATOM   6642  C CG  . LEU B 1 108 ? 53.487  34.208  15.812  1.00 67.22  ? 130  LEU B CG  1 
ATOM   6643  C CD1 . LEU B 1 108 ? 53.029  34.194  17.256  1.00 67.76  ? 130  LEU B CD1 1 
ATOM   6644  C CD2 . LEU B 1 108 ? 53.917  35.606  15.406  1.00 69.22  ? 130  LEU B CD2 1 
ATOM   6645  N N   . LEU B 1 109 ? 52.167  30.762  16.107  1.00 71.34  ? 131  LEU B N   1 
ATOM   6646  C CA  . LEU B 1 109 ? 51.019  30.082  15.508  1.00 69.42  ? 131  LEU B CA  1 
ATOM   6647  C C   . LEU B 1 109 ? 49.742  30.928  15.564  1.00 69.83  ? 131  LEU B C   1 
ATOM   6648  O O   . LEU B 1 109 ? 49.130  31.086  16.621  1.00 69.13  ? 131  LEU B O   1 
ATOM   6649  C CB  . LEU B 1 109 ? 50.799  28.725  16.190  1.00 66.91  ? 131  LEU B CB  1 
ATOM   6650  C CG  . LEU B 1 109 ? 52.054  27.883  16.456  1.00 63.71  ? 131  LEU B CG  1 
ATOM   6651  C CD1 . LEU B 1 109 ? 51.690  26.563  17.119  1.00 58.00  ? 131  LEU B CD1 1 
ATOM   6652  C CD2 . LEU B 1 109 ? 52.833  27.641  15.171  1.00 64.85  ? 131  LEU B CD2 1 
ATOM   6653  N N   . LEU B 1 110 ? 49.353  31.469  14.413  1.00 68.97  ? 132  LEU B N   1 
ATOM   6654  C CA  . LEU B 1 110 ? 48.160  32.317  14.289  1.00 70.00  ? 132  LEU B CA  1 
ATOM   6655  C C   . LEU B 1 110 ? 46.872  31.715  13.730  1.00 69.28  ? 132  LEU B C   1 
ATOM   6656  O O   . LEU B 1 110 ? 45.969  32.461  13.342  1.00 70.73  ? 132  LEU B O   1 
ATOM   6657  C CB  . LEU B 1 110 ? 48.467  33.674  13.663  1.00 73.22  ? 132  LEU B CB  1 
ATOM   6658  C CG  . LEU B 1 110 ? 48.846  34.658  14.766  1.00 77.16  ? 132  LEU B CG  1 
ATOM   6659  C CD1 . LEU B 1 110 ? 50.335  34.894  14.746  1.00 79.08  ? 132  LEU B CD1 1 
ATOM   6660  C CD2 . LEU B 1 110 ? 48.078  35.958  14.654  1.00 79.27  ? 132  LEU B CD2 1 
ATOM   6661  N N   . GLU B 1 111 ? 46.825  30.393  13.608  1.00 65.43  ? 133  GLU B N   1 
ATOM   6662  C CA  . GLU B 1 111 ? 45.697  29.708  12.982  1.00 61.62  ? 133  GLU B CA  1 
ATOM   6663  C C   . GLU B 1 111 ? 44.320  30.133  13.502  1.00 62.24  ? 133  GLU B C   1 
ATOM   6664  O O   . GLU B 1 111 ? 44.156  30.417  14.690  1.00 64.44  ? 133  GLU B O   1 
ATOM   6665  C CB  . GLU B 1 111 ? 45.856  28.193  13.130  1.00 57.62  ? 133  GLU B CB  1 
ATOM   6666  C CG  . GLU B 1 111 ? 47.255  27.692  12.829  1.00 57.94  ? 133  GLU B CG  1 
ATOM   6667  C CD  . GLU B 1 111 ? 47.338  26.181  12.714  1.00 56.94  ? 133  GLU B CD  1 
ATOM   6668  O OE1 . GLU B 1 111 ? 46.314  25.497  12.926  1.00 58.42  ? 133  GLU B OE1 1 
ATOM   6669  O OE2 . GLU B 1 111 ? 48.435  25.673  12.406  1.00 56.80  ? 133  GLU B OE2 1 
ATOM   6670  N N   . ASP B 1 112 ? 43.362  30.231  12.579  1.00 60.60  ? 134  ASP B N   1 
ATOM   6671  C CA  . ASP B 1 112 ? 41.930  30.325  12.892  1.00 61.01  ? 134  ASP B CA  1 
ATOM   6672  C C   . ASP B 1 112 ? 41.510  31.610  13.612  1.00 62.64  ? 134  ASP B C   1 
ATOM   6673  O O   . ASP B 1 112 ? 40.550  31.622  14.386  1.00 60.35  ? 134  ASP B O   1 
ATOM   6674  C CB  . ASP B 1 112 ? 41.492  29.095  13.689  1.00 62.40  ? 134  ASP B CB  1 
ATOM   6675  C CG  . ASP B 1 112 ? 39.990  28.891  13.674  1.00 66.15  ? 134  ASP B CG  1 
ATOM   6676  O OD1 . ASP B 1 112 ? 39.305  29.558  12.865  1.00 69.00  ? 134  ASP B OD1 1 
ATOM   6677  O OD2 . ASP B 1 112 ? 39.495  28.061  14.466  1.00 65.33  ? 134  ASP B OD2 1 
ATOM   6678  N N   . ASN B 1 113 ? 42.249  32.684  13.368  1.00 65.65  ? 135  ASN B N   1 
ATOM   6679  C CA  . ASN B 1 113 ? 41.939  33.985  13.955  1.00 69.86  ? 135  ASN B CA  1 
ATOM   6680  C C   . ASN B 1 113 ? 41.198  34.956  13.037  1.00 71.66  ? 135  ASN B C   1 
ATOM   6681  O O   . ASN B 1 113 ? 41.034  36.136  13.367  1.00 73.01  ? 135  ASN B O   1 
ATOM   6682  C CB  . ASN B 1 113 ? 43.191  34.605  14.566  1.00 73.50  ? 135  ASN B CB  1 
ATOM   6683  C CG  . ASN B 1 113 ? 43.845  33.685  15.574  1.00 73.34  ? 135  ASN B CG  1 
ATOM   6684  O OD1 . ASN B 1 113 ? 43.166  32.891  16.223  1.00 72.88  ? 135  ASN B OD1 1 
ATOM   6685  N ND2 . ASN B 1 113 ? 45.166  33.768  15.696  1.00 72.13  ? 135  ASN B ND2 1 
ATOM   6686  N N   . GLN B 1 114 ? 40.807  34.463  11.865  1.00 71.99  ? 136  GLN B N   1 
ATOM   6687  C CA  . GLN B 1 114 ? 40.078  35.257  10.873  1.00 72.90  ? 136  GLN B CA  1 
ATOM   6688  C C   . GLN B 1 114 ? 40.865  36.474  10.376  1.00 69.67  ? 136  GLN B C   1 
ATOM   6689  O O   . GLN B 1 114 ? 40.341  37.585  10.307  1.00 69.41  ? 136  GLN B O   1 
ATOM   6690  C CB  . GLN B 1 114 ? 38.706  35.669  11.415  1.00 76.87  ? 136  GLN B CB  1 
ATOM   6691  C CG  . GLN B 1 114 ? 37.904  34.503  11.960  1.00 77.27  ? 136  GLN B CG  1 
ATOM   6692  C CD  . GLN B 1 114 ? 36.417  34.779  11.985  1.00 81.85  ? 136  GLN B CD  1 
ATOM   6693  O OE1 . GLN B 1 114 ? 35.831  35.002  13.045  1.00 83.70  ? 136  GLN B OE1 1 
ATOM   6694  N NE2 . GLN B 1 114 ? 35.795  34.755  10.813  1.00 83.72  ? 136  GLN B NE2 1 
ATOM   6695  N N   . LEU B 1 115 ? 42.125  36.247  10.018  1.00 69.06  ? 137  LEU B N   1 
ATOM   6696  C CA  . LEU B 1 115 ? 43.020  37.318  9.575   1.00 70.69  ? 137  LEU B CA  1 
ATOM   6697  C C   . LEU B 1 115 ? 42.757  37.722  8.131   1.00 68.64  ? 137  LEU B C   1 
ATOM   6698  O O   . LEU B 1 115 ? 42.886  36.900  7.229   1.00 65.43  ? 137  LEU B O   1 
ATOM   6699  C CB  . LEU B 1 115 ? 44.480  36.879  9.716   1.00 73.13  ? 137  LEU B CB  1 
ATOM   6700  C CG  . LEU B 1 115 ? 45.166  37.154  11.058  1.00 77.46  ? 137  LEU B CG  1 
ATOM   6701  C CD1 . LEU B 1 115 ? 44.268  36.772  12.217  1.00 76.35  ? 137  LEU B CD1 1 
ATOM   6702  C CD2 . LEU B 1 115 ? 46.501  36.421  11.156  1.00 77.29  ? 137  LEU B CD2 1 
ATOM   6703  N N   . PRO B 1 116 ? 42.393  38.997  7.911   1.00 70.13  ? 138  PRO B N   1 
ATOM   6704  C CA  . PRO B 1 116 ? 42.172  39.540  6.567   1.00 69.73  ? 138  PRO B CA  1 
ATOM   6705  C C   . PRO B 1 116 ? 43.486  39.684  5.818   1.00 71.50  ? 138  PRO B C   1 
ATOM   6706  O O   . PRO B 1 116 ? 43.502  39.728  4.591   1.00 74.27  ? 138  PRO B O   1 
ATOM   6707  C CB  . PRO B 1 116 ? 41.574  40.920  6.845   1.00 70.35  ? 138  PRO B CB  1 
ATOM   6708  C CG  . PRO B 1 116 ? 42.125  41.299  8.169   1.00 70.73  ? 138  PRO B CG  1 
ATOM   6709  C CD  . PRO B 1 116 ? 42.229  40.024  8.954   1.00 70.08  ? 138  PRO B CD  1 
ATOM   6710  N N   . GLN B 1 117 ? 44.581  39.767  6.564   1.00 71.26  ? 139  GLN B N   1 
ATOM   6711  C CA  . GLN B 1 117 ? 45.896  39.977  5.981   1.00 71.95  ? 139  GLN B CA  1 
ATOM   6712  C C   . GLN B 1 117 ? 46.964  39.355  6.883   1.00 68.81  ? 139  GLN B C   1 
ATOM   6713  O O   . GLN B 1 117 ? 46.730  39.125  8.072   1.00 65.65  ? 139  GLN B O   1 
ATOM   6714  C CB  . GLN B 1 117 ? 46.182  41.476  5.840   1.00 77.67  ? 139  GLN B CB  1 
ATOM   6715  C CG  . GLN B 1 117 ? 45.332  42.242  4.816   1.00 82.48  ? 139  GLN B CG  1 
ATOM   6716  C CD  . GLN B 1 117 ? 45.858  42.118  3.398   1.00 85.34  ? 139  GLN B CD  1 
ATOM   6717  O OE1 . GLN B 1 117 ? 46.946  41.591  3.173   1.00 86.16  ? 139  GLN B OE1 1 
ATOM   6718  N NE2 . GLN B 1 117 ? 45.085  42.607  2.433   1.00 86.58  ? 139  GLN B NE2 1 
ATOM   6719  N N   . ILE B 1 118 ? 48.131  39.071  6.310   1.00 67.37  ? 140  ILE B N   1 
ATOM   6720  C CA  . ILE B 1 118 ? 49.319  38.771  7.095   1.00 66.87  ? 140  ILE B CA  1 
ATOM   6721  C C   . ILE B 1 118 ? 49.579  40.025  7.908   1.00 71.99  ? 140  ILE B C   1 
ATOM   6722  O O   . ILE B 1 118 ? 49.542  41.119  7.358   1.00 75.23  ? 140  ILE B O   1 
ATOM   6723  C CB  . ILE B 1 118 ? 50.539  38.493  6.185   1.00 65.30  ? 140  ILE B CB  1 
ATOM   6724  C CG1 . ILE B 1 118 ? 50.307  37.243  5.340   1.00 62.51  ? 140  ILE B CG1 1 
ATOM   6725  C CG2 . ILE B 1 118 ? 51.797  38.299  7.003   1.00 67.71  ? 140  ILE B CG2 1 
ATOM   6726  C CD1 . ILE B 1 118 ? 51.424  36.933  4.358   1.00 60.27  ? 140  ILE B CD1 1 
ATOM   6727  N N   . PRO B 1 119 ? 49.786  39.880  9.226   1.00 73.38  ? 141  PRO B N   1 
ATOM   6728  C CA  . PRO B 1 119 ? 50.099  41.043  10.064  1.00 75.27  ? 141  PRO B CA  1 
ATOM   6729  C C   . PRO B 1 119 ? 51.337  41.774  9.563   1.00 77.17  ? 141  PRO B C   1 
ATOM   6730  O O   . PRO B 1 119 ? 52.370  41.145  9.341   1.00 76.86  ? 141  PRO B O   1 
ATOM   6731  C CB  . PRO B 1 119 ? 50.371  40.422  11.446  1.00 75.12  ? 141  PRO B CB  1 
ATOM   6732  C CG  . PRO B 1 119 ? 50.471  38.938  11.224  1.00 73.11  ? 141  PRO B CG  1 
ATOM   6733  C CD  . PRO B 1 119 ? 49.641  38.649  10.018  1.00 71.60  ? 141  PRO B CD  1 
ATOM   6734  N N   . SER B 1 120 ? 51.222  43.087  9.380   1.00 79.84  ? 142  SER B N   1 
ATOM   6735  C CA  . SER B 1 120 ? 52.361  43.916  9.014   1.00 81.44  ? 142  SER B CA  1 
ATOM   6736  C C   . SER B 1 120 ? 53.335  43.886  10.171  1.00 82.75  ? 142  SER B C   1 
ATOM   6737  O O   . SER B 1 120 ? 52.920  43.749  11.319  1.00 82.68  ? 142  SER B O   1 
ATOM   6738  C CB  . SER B 1 120 ? 51.919  45.363  8.791   1.00 84.55  ? 142  SER B CB  1 
ATOM   6739  O OG  . SER B 1 120 ? 51.247  45.535  7.557   1.00 85.94  ? 142  SER B OG  1 
ATOM   6740  N N   . GLY B 1 121 ? 54.624  44.036  9.888   1.00 84.41  ? 143  GLY B N   1 
ATOM   6741  C CA  . GLY B 1 121 ? 55.593  44.118  10.964  1.00 86.05  ? 143  GLY B CA  1 
ATOM   6742  C C   . GLY B 1 121 ? 55.753  42.849  11.778  1.00 85.95  ? 143  GLY B C   1 
ATOM   6743  O O   . GLY B 1 121 ? 55.433  42.830  12.959  1.00 88.29  ? 143  GLY B O   1 
ATOM   6744  N N   . LEU B 1 122 ? 56.174  41.767  11.143  1.00 82.38  ? 144  LEU B N   1 
ATOM   6745  C CA  . LEU B 1 122 ? 56.498  40.576  11.904  1.00 78.61  ? 144  LEU B CA  1 
ATOM   6746  C C   . LEU B 1 122 ? 57.970  40.638  12.373  1.00 80.92  ? 144  LEU B C   1 
ATOM   6747  O O   . LEU B 1 122 ? 58.773  41.358  11.761  1.00 82.38  ? 144  LEU B O   1 
ATOM   6748  C CB  . LEU B 1 122 ? 56.263  39.320  11.062  1.00 76.11  ? 144  LEU B CB  1 
ATOM   6749  C CG  . LEU B 1 122 ? 55.084  38.462  11.530  1.00 72.21  ? 144  LEU B CG  1 
ATOM   6750  C CD1 . LEU B 1 122 ? 53.929  39.333  12.005  1.00 72.67  ? 144  LEU B CD1 1 
ATOM   6751  C CD2 . LEU B 1 122 ? 54.644  37.539  10.413  1.00 69.22  ? 144  LEU B CD2 1 
ATOM   6752  N N   . PRO B 1 123 ? 58.350  39.875  13.425  1.00 82.24  ? 145  PRO B N   1 
ATOM   6753  C CA  . PRO B 1 123 ? 59.769  39.913  13.772  1.00 85.54  ? 145  PRO B CA  1 
ATOM   6754  C C   . PRO B 1 123 ? 60.662  39.224  12.735  1.00 86.12  ? 145  PRO B C   1 
ATOM   6755  O O   . PRO B 1 123 ? 60.188  38.355  12.020  1.00 85.55  ? 145  PRO B O   1 
ATOM   6756  C CB  . PRO B 1 123 ? 59.824  39.169  15.093  1.00 85.31  ? 145  PRO B CB  1 
ATOM   6757  C CG  . PRO B 1 123 ? 58.578  38.463  15.191  1.00 81.73  ? 145  PRO B CG  1 
ATOM   6758  C CD  . PRO B 1 123 ? 57.578  39.199  14.467  1.00 81.56  ? 145  PRO B CD  1 
ATOM   6759  N N   . GLU B 1 124 ? 61.933  39.615  12.668  1.00 87.88  ? 146  GLU B N   1 
ATOM   6760  C CA  . GLU B 1 124 ? 62.906  38.983  11.773  1.00 87.80  ? 146  GLU B CA  1 
ATOM   6761  C C   . GLU B 1 124 ? 63.395  37.620  12.295  1.00 83.87  ? 146  GLU B C   1 
ATOM   6762  O O   . GLU B 1 124 ? 64.000  36.828  11.558  1.00 82.62  ? 146  GLU B O   1 
ATOM   6763  C CB  . GLU B 1 124 ? 64.123  39.895  11.586  1.00 91.73  ? 146  GLU B CB  1 
ATOM   6764  C CG  . GLU B 1 124 ? 65.086  39.499  10.485  1.00 93.32  ? 146  GLU B CG  1 
ATOM   6765  C CD  . GLU B 1 124 ? 66.447  40.127  10.692  1.00 97.58  ? 146  GLU B CD  1 
ATOM   6766  O OE1 . GLU B 1 124 ? 66.484  41.239  11.255  1.00 99.99  ? 146  GLU B OE1 1 
ATOM   6767  O OE2 . GLU B 1 124 ? 67.473  39.503  10.335  1.00 98.13  ? 146  GLU B OE2 1 
ATOM   6768  N N   . SER B 1 125 ? 63.136  37.352  13.569  1.00 82.79  ? 147  SER B N   1 
ATOM   6769  C CA  . SER B 1 125 ? 63.592  36.122  14.218  1.00 81.40  ? 147  SER B CA  1 
ATOM   6770  C C   . SER B 1 125 ? 62.871  34.824  13.795  1.00 76.60  ? 147  SER B C   1 
ATOM   6771  O O   . SER B 1 125 ? 63.460  33.745  13.880  1.00 76.92  ? 147  SER B O   1 
ATOM   6772  C CB  . SER B 1 125 ? 63.569  36.283  15.753  1.00 81.68  ? 147  SER B CB  1 
ATOM   6773  O OG  . SER B 1 125 ? 62.266  36.538  16.256  1.00 81.91  ? 147  SER B OG  1 
ATOM   6774  N N   . LEU B 1 126 ? 61.627  34.929  13.328  1.00 72.39  ? 148  LEU B N   1 
ATOM   6775  C CA  . LEU B 1 126 ? 60.767  33.757  13.085  1.00 70.06  ? 148  LEU B CA  1 
ATOM   6776  C C   . LEU B 1 126 ? 61.364  32.686  12.162  1.00 67.84  ? 148  LEU B C   1 
ATOM   6777  O O   . LEU B 1 126 ? 61.767  32.982  11.035  1.00 68.75  ? 148  LEU B O   1 
ATOM   6778  C CB  . LEU B 1 126 ? 59.455  34.221  12.435  1.00 69.43  ? 148  LEU B CB  1 
ATOM   6779  C CG  . LEU B 1 126 ? 58.382  35.030  13.174  1.00 71.40  ? 148  LEU B CG  1 
ATOM   6780  C CD1 . LEU B 1 126 ? 57.132  35.067  12.327  1.00 73.13  ? 148  LEU B CD1 1 
ATOM   6781  C CD2 . LEU B 1 126 ? 58.068  34.312  14.467  1.00 71.20  ? 148  LEU B CD2 1 
ATOM   6782  N N   . THR B 1 127 ? 61.453  31.450  12.643  1.00 65.11  ? 149  THR B N   1 
ATOM   6783  C CA  . THR B 1 127 ? 61.706  30.322  11.754  1.00 63.19  ? 149  THR B CA  1 
ATOM   6784  C C   . THR B 1 127 ? 60.443  29.512  11.468  1.00 62.74  ? 149  THR B C   1 
ATOM   6785  O O   . THR B 1 127 ? 60.440  28.652  10.594  1.00 63.62  ? 149  THR B O   1 
ATOM   6786  C CB  . THR B 1 127 ? 62.783  29.397  12.335  1.00 63.47  ? 149  THR B CB  1 
ATOM   6787  O OG1 . THR B 1 127 ? 62.307  28.828  13.563  1.00 62.49  ? 149  THR B OG1 1 
ATOM   6788  C CG2 . THR B 1 127 ? 64.056  30.184  12.601  1.00 61.52  ? 149  THR B CG2 1 
ATOM   6789  N N   . GLU B 1 128 ? 59.361  29.801  12.183  1.00 63.12  ? 150  GLU B N   1 
ATOM   6790  C CA  . GLU B 1 128 ? 58.109  29.078  11.970  1.00 65.87  ? 150  GLU B CA  1 
ATOM   6791  C C   . GLU B 1 128 ? 56.900  29.988  12.088  1.00 65.57  ? 150  GLU B C   1 
ATOM   6792  O O   . GLU B 1 128 ? 56.726  30.675  13.094  1.00 67.83  ? 150  GLU B O   1 
ATOM   6793  C CB  . GLU B 1 128 ? 57.954  27.900  12.937  1.00 68.95  ? 150  GLU B CB  1 
ATOM   6794  C CG  . GLU B 1 128 ? 58.819  26.694  12.621  1.00 73.80  ? 150  GLU B CG  1 
ATOM   6795  C CD  . GLU B 1 128 ? 58.339  25.428  13.318  1.00 76.86  ? 150  GLU B CD  1 
ATOM   6796  O OE1 . GLU B 1 128 ? 57.350  24.821  12.840  1.00 77.10  ? 150  GLU B OE1 1 
ATOM   6797  O OE2 . GLU B 1 128 ? 58.949  25.037  14.339  1.00 77.34  ? 150  GLU B OE2 1 
ATOM   6798  N N   . LEU B 1 129 ? 56.053  29.968  11.066  1.00 60.41  ? 151  LEU B N   1 
ATOM   6799  C CA  . LEU B 1 129 ? 54.872  30.817  11.037  1.00 61.54  ? 151  LEU B CA  1 
ATOM   6800  C C   . LEU B 1 129 ? 53.712  30.032  10.462  1.00 63.05  ? 151  LEU B C   1 
ATOM   6801  O O   . LEU B 1 129 ? 53.824  29.490  9.361   1.00 66.82  ? 151  LEU B O   1 
ATOM   6802  C CB  . LEU B 1 129 ? 55.153  32.060  10.180  1.00 60.90  ? 151  LEU B CB  1 
ATOM   6803  C CG  . LEU B 1 129 ? 54.017  33.027  9.850   1.00 59.05  ? 151  LEU B CG  1 
ATOM   6804  C CD1 . LEU B 1 129 ? 53.360  33.520  11.121  1.00 59.47  ? 151  LEU B CD1 1 
ATOM   6805  C CD2 . LEU B 1 129 ? 54.551  34.193  9.043   1.00 57.04  ? 151  LEU B CD2 1 
ATOM   6806  N N   . SER B 1 130 ? 52.599  29.964  11.191  1.00 60.43  ? 152  SER B N   1 
ATOM   6807  C CA  . SER B 1 130 ? 51.415  29.290  10.661  1.00 58.44  ? 152  SER B CA  1 
ATOM   6808  C C   . SER B 1 130 ? 50.197  30.209  10.579  1.00 58.82  ? 152  SER B C   1 
ATOM   6809  O O   . SER B 1 130 ? 49.678  30.667  11.593  1.00 59.47  ? 152  SER B O   1 
ATOM   6810  C CB  . SER B 1 130 ? 51.096  28.038  11.472  1.00 55.73  ? 152  SER B CB  1 
ATOM   6811  O OG  . SER B 1 130 ? 49.956  27.395  10.944  1.00 56.09  ? 152  SER B OG  1 
ATOM   6812  N N   . LEU B 1 131 ? 49.795  30.524  9.355   1.00 58.09  ? 153  LEU B N   1 
ATOM   6813  C CA  . LEU B 1 131 ? 48.627  31.362  9.091   1.00 58.37  ? 153  LEU B CA  1 
ATOM   6814  C C   . LEU B 1 131 ? 47.378  30.578  8.714   1.00 57.95  ? 153  LEU B C   1 
ATOM   6815  O O   . LEU B 1 131 ? 46.393  31.148  8.242   1.00 61.02  ? 153  LEU B O   1 
ATOM   6816  C CB  . LEU B 1 131 ? 48.956  32.497  8.121   1.00 61.16  ? 153  LEU B CB  1 
ATOM   6817  C CG  . LEU B 1 131 ? 49.810  33.522  8.882   1.00 61.85  ? 153  LEU B CG  1 
ATOM   6818  C CD1 . LEU B 1 131 ? 50.336  34.631  8.007   1.00 63.14  ? 153  LEU B CD1 1 
ATOM   6819  C CD2 . LEU B 1 131 ? 49.006  34.092  10.036  1.00 63.34  ? 153  LEU B CD2 1 
ATOM   6820  N N   . ILE B 1 132 ? 47.460  29.262  8.886   1.00 56.31  ? 154  ILE B N   1 
ATOM   6821  C CA  . ILE B 1 132 ? 46.410  28.319  8.496   1.00 51.21  ? 154  ILE B CA  1 
ATOM   6822  C C   . ILE B 1 132 ? 45.010  28.730  8.949   1.00 50.43  ? 154  ILE B C   1 
ATOM   6823  O O   . ILE B 1 132 ? 44.830  29.247  10.049  1.00 51.75  ? 154  ILE B O   1 
ATOM   6824  C CB  . ILE B 1 132 ? 46.722  26.913  9.080   1.00 51.03  ? 154  ILE B CB  1 
ATOM   6825  C CG1 . ILE B 1 132 ? 47.879  26.253  8.327   1.00 52.61  ? 154  ILE B CG1 1 
ATOM   6826  C CG2 . ILE B 1 132 ? 45.500  26.001  9.061   1.00 46.16  ? 154  ILE B CG2 1 
ATOM   6827  C CD1 . ILE B 1 132 ? 48.330  24.930  8.948   1.00 52.42  ? 154  ILE B CD1 1 
ATOM   6828  N N   . GLN B 1 133 ? 44.036  28.528  8.064   1.00 52.95  ? 155  GLN B N   1 
ATOM   6829  C CA  . GLN B 1 133 ? 42.614  28.754  8.341   1.00 54.19  ? 155  GLN B CA  1 
ATOM   6830  C C   . GLN B 1 133 ? 42.270  30.203  8.644   1.00 57.18  ? 155  GLN B C   1 
ATOM   6831  O O   . GLN B 1 133 ? 41.518  30.504  9.575   1.00 60.16  ? 155  GLN B O   1 
ATOM   6832  C CB  . GLN B 1 133 ? 42.099  27.823  9.445   1.00 53.02  ? 155  GLN B CB  1 
ATOM   6833  C CG  . GLN B 1 133 ? 41.477  26.533  8.933   1.00 55.05  ? 155  GLN B CG  1 
ATOM   6834  C CD  . GLN B 1 133 ? 40.112  26.741  8.284   1.00 57.91  ? 155  GLN B CD  1 
ATOM   6835  O OE1 . GLN B 1 133 ? 39.519  27.813  8.379   1.00 60.10  ? 155  GLN B OE1 1 
ATOM   6836  N NE2 . GLN B 1 133 ? 39.611  25.705  7.622   1.00 58.13  ? 155  GLN B NE2 1 
ATOM   6837  N N   . ASN B 1 134 ? 42.829  31.090  7.836   1.00 57.16  ? 156  ASN B N   1 
ATOM   6838  C CA  . ASN B 1 134 ? 42.547  32.513  7.909   1.00 58.35  ? 156  ASN B CA  1 
ATOM   6839  C C   . ASN B 1 134 ? 41.892  33.037  6.631   1.00 60.32  ? 156  ASN B C   1 
ATOM   6840  O O   . ASN B 1 134 ? 41.551  32.277  5.724   1.00 59.54  ? 156  ASN B O   1 
ATOM   6841  C CB  . ASN B 1 134 ? 43.827  33.293  8.209   1.00 59.24  ? 156  ASN B CB  1 
ATOM   6842  C CG  . ASN B 1 134 ? 44.173  33.283  9.680   1.00 60.28  ? 156  ASN B CG  1 
ATOM   6843  O OD1 . ASN B 1 134 ? 43.323  33.566  10.519  1.00 62.21  ? 156  ASN B OD1 1 
ATOM   6844  N ND2 . ASN B 1 134 ? 45.414  32.944  10.004  1.00 58.88  ? 156  ASN B ND2 1 
ATOM   6845  N N   . ASN B 1 135 ? 41.696  34.346  6.591   1.00 61.01  ? 157  ASN B N   1 
ATOM   6846  C CA  . ASN B 1 135 ? 41.121  35.033  5.443   1.00 59.42  ? 157  ASN B CA  1 
ATOM   6847  C C   . ASN B 1 135 ? 42.142  35.634  4.472   1.00 63.00  ? 157  ASN B C   1 
ATOM   6848  O O   . ASN B 1 135 ? 41.792  36.503  3.679   1.00 67.74  ? 157  ASN B O   1 
ATOM   6849  C CB  . ASN B 1 135 ? 40.061  36.039  5.887   1.00 58.75  ? 157  ASN B CB  1 
ATOM   6850  C CG  . ASN B 1 135 ? 38.909  35.370  6.627   1.00 58.94  ? 157  ASN B CG  1 
ATOM   6851  O OD1 . ASN B 1 135 ? 38.763  34.144  6.608   1.00 55.83  ? 157  ASN B OD1 1 
ATOM   6852  N ND2 . ASN B 1 135 ? 38.070  36.175  7.254   1.00 61.43  ? 157  ASN B ND2 1 
ATOM   6853  N N   . ILE B 1 136 ? 43.410  35.241  4.589   1.00 61.29  ? 158  ILE B N   1 
ATOM   6854  C CA  . ILE B 1 136 ? 44.470  35.914  3.841   1.00 59.98  ? 158  ILE B CA  1 
ATOM   6855  C C   . ILE B 1 136 ? 44.456  35.518  2.363   1.00 60.48  ? 158  ILE B C   1 
ATOM   6856  O O   . ILE B 1 136 ? 44.756  34.380  1.998   1.00 60.08  ? 158  ILE B O   1 
ATOM   6857  C CB  . ILE B 1 136 ? 45.837  35.517  4.425   1.00 57.30  ? 158  ILE B CB  1 
ATOM   6858  C CG1 . ILE B 1 136 ? 45.858  35.785  5.931   1.00 61.34  ? 158  ILE B CG1 1 
ATOM   6859  C CG2 . ILE B 1 136 ? 46.956  36.272  3.751   1.00 58.07  ? 158  ILE B CG2 1 
ATOM   6860  C CD1 . ILE B 1 136 ? 47.183  35.507  6.597   1.00 62.71  ? 158  ILE B CD1 1 
ATOM   6861  N N   . TYR B 1 137 ? 44.103  36.488  1.523   1.00 58.57  ? 159  TYR B N   1 
ATOM   6862  C CA  . TYR B 1 137 ? 44.008  36.295  0.079   1.00 59.52  ? 159  TYR B CA  1 
ATOM   6863  C C   . TYR B 1 137 ? 45.172  36.918  -0.702  1.00 61.80  ? 159  TYR B C   1 
ATOM   6864  O O   . TYR B 1 137 ? 45.244  36.821  -1.930  1.00 58.77  ? 159  TYR B O   1 
ATOM   6865  C CB  . TYR B 1 137 ? 42.656  36.810  -0.416  1.00 59.43  ? 159  TYR B CB  1 
ATOM   6866  C CG  . TYR B 1 137 ? 41.486  36.302  0.404   1.00 58.41  ? 159  TYR B CG  1 
ATOM   6867  C CD1 . TYR B 1 137 ? 41.435  34.981  0.841   1.00 58.52  ? 159  TYR B CD1 1 
ATOM   6868  C CD2 . TYR B 1 137 ? 40.439  37.145  0.754   1.00 58.60  ? 159  TYR B CD2 1 
ATOM   6869  C CE1 . TYR B 1 137 ? 40.365  34.514  1.594   1.00 55.56  ? 159  TYR B CE1 1 
ATOM   6870  C CE2 . TYR B 1 137 ? 39.368  36.689  1.499   1.00 58.43  ? 159  TYR B CE2 1 
ATOM   6871  C CZ  . TYR B 1 137 ? 39.339  35.376  1.918   1.00 57.21  ? 159  TYR B CZ  1 
ATOM   6872  O OH  . TYR B 1 137 ? 38.276  34.932  2.661   1.00 59.19  ? 159  TYR B OH  1 
ATOM   6873  N N   . ASN B 1 138 ? 46.064  37.585  0.020   1.00 65.55  ? 160  ASN B N   1 
ATOM   6874  C CA  . ASN B 1 138 ? 47.162  38.309  -0.593  1.00 70.55  ? 160  ASN B CA  1 
ATOM   6875  C C   . ASN B 1 138 ? 48.460  38.006  0.156   1.00 69.47  ? 160  ASN B C   1 
ATOM   6876  O O   . ASN B 1 138 ? 48.617  38.381  1.316   1.00 70.15  ? 160  ASN B O   1 
ATOM   6877  C CB  . ASN B 1 138 ? 46.855  39.811  -0.544  1.00 77.13  ? 160  ASN B CB  1 
ATOM   6878  C CG  . ASN B 1 138 ? 47.247  40.544  -1.820  1.00 83.41  ? 160  ASN B CG  1 
ATOM   6879  O OD1 . ASN B 1 138 ? 48.175  40.145  -2.521  1.00 85.22  ? 160  ASN B OD1 1 
ATOM   6880  N ND2 . ASN B 1 138 ? 46.546  41.635  -2.115  1.00 86.63  ? 160  ASN B ND2 1 
ATOM   6881  N N   . ILE B 1 139 ? 49.396  37.340  -0.507  1.00 67.32  ? 161  ILE B N   1 
ATOM   6882  C CA  . ILE B 1 139 ? 50.692  37.073  0.091   1.00 68.10  ? 161  ILE B CA  1 
ATOM   6883  C C   . ILE B 1 139 ? 51.720  38.019  -0.545  1.00 69.45  ? 161  ILE B C   1 
ATOM   6884  O O   . ILE B 1 139 ? 52.086  37.875  -1.717  1.00 68.83  ? 161  ILE B O   1 
ATOM   6885  C CB  . ILE B 1 139 ? 51.113  35.586  -0.091  1.00 68.94  ? 161  ILE B CB  1 
ATOM   6886  C CG1 . ILE B 1 139 ? 50.000  34.617  0.328   1.00 67.59  ? 161  ILE B CG1 1 
ATOM   6887  C CG2 . ILE B 1 139 ? 52.345  35.286  0.707   1.00 69.58  ? 161  ILE B CG2 1 
ATOM   6888  C CD1 . ILE B 1 139 ? 49.474  34.847  1.728   1.00 69.90  ? 161  ILE B CD1 1 
ATOM   6889  N N   . THR B 1 140 ? 52.184  38.982  0.242   1.00 70.94  ? 162  THR B N   1 
ATOM   6890  C CA  . THR B 1 140 ? 52.900  40.126  -0.295  1.00 74.17  ? 162  THR B CA  1 
ATOM   6891  C C   . THR B 1 140 ? 54.293  40.258  0.292   1.00 76.55  ? 162  THR B C   1 
ATOM   6892  O O   . THR B 1 140 ? 54.595  39.679  1.333   1.00 76.20  ? 162  THR B O   1 
ATOM   6893  C CB  . THR B 1 140 ? 52.148  41.427  0.012   1.00 75.00  ? 162  THR B CB  1 
ATOM   6894  O OG1 . THR B 1 140 ? 52.342  41.780  1.390   1.00 77.43  ? 162  THR B OG1 1 
ATOM   6895  C CG2 . THR B 1 140 ? 50.666  41.267  -0.266  1.00 71.17  ? 162  THR B CG2 1 
ATOM   6896  N N   . LYS B 1 141 ? 55.138  41.026  -0.386  1.00 80.27  ? 163  LYS B N   1 
ATOM   6897  C CA  . LYS B 1 141 ? 56.498  41.268  0.075   1.00 84.77  ? 163  LYS B CA  1 
ATOM   6898  C C   . LYS B 1 141 ? 56.524  42.006  1.412   1.00 88.70  ? 163  LYS B C   1 
ATOM   6899  O O   . LYS B 1 141 ? 57.394  41.766  2.249   1.00 91.12  ? 163  LYS B O   1 
ATOM   6900  C CB  . LYS B 1 141 ? 57.285  42.057  -0.971  1.00 86.92  ? 163  LYS B CB  1 
ATOM   6901  C CG  . LYS B 1 141 ? 57.512  41.315  -2.282  1.00 86.72  ? 163  LYS B CG  1 
ATOM   6902  C CD  . LYS B 1 141 ? 58.509  42.067  -3.163  1.00 89.90  ? 163  LYS B CD  1 
ATOM   6903  C CE  . LYS B 1 141 ? 58.107  42.039  -4.629  1.00 89.72  ? 163  LYS B CE  1 
ATOM   6904  N NZ  . LYS B 1 141 ? 56.787  42.690  -4.856  1.00 89.17  ? 163  LYS B NZ  1 
ATOM   6905  N N   . GLU B 1 142 ? 55.560  42.895  1.618   1.00 89.64  ? 164  GLU B N   1 
ATOM   6906  C CA  . GLU B 1 142 ? 55.532  43.694  2.835   1.00 91.09  ? 164  GLU B CA  1 
ATOM   6907  C C   . GLU B 1 142 ? 55.171  42.857  4.065   1.00 87.76  ? 164  GLU B C   1 
ATOM   6908  O O   . GLU B 1 142 ? 55.336  43.305  5.198   1.00 86.96  ? 164  GLU B O   1 
ATOM   6909  C CB  . GLU B 1 142 ? 54.572  44.874  2.677   1.00 94.26  ? 164  GLU B CB  1 
ATOM   6910  C CG  . GLU B 1 142 ? 54.879  45.759  1.471   1.00 99.17  ? 164  GLU B CG  1 
ATOM   6911  C CD  . GLU B 1 142 ? 55.967  46.781  1.753   1.00 104.31 ? 164  GLU B CD  1 
ATOM   6912  O OE1 . GLU B 1 142 ? 56.324  46.951  2.939   1.00 105.96 ? 164  GLU B OE1 1 
ATOM   6913  O OE2 . GLU B 1 142 ? 56.465  47.414  0.794   1.00 106.48 ? 164  GLU B OE2 1 
ATOM   6914  N N   . GLY B 1 143 ? 54.671  41.646  3.848   1.00 86.51  ? 165  GLY B N   1 
ATOM   6915  C CA  . GLY B 1 143 ? 54.385  40.764  4.964   1.00 86.82  ? 165  GLY B CA  1 
ATOM   6916  C C   . GLY B 1 143 ? 55.382  39.640  5.186   1.00 87.28  ? 165  GLY B C   1 
ATOM   6917  O O   . GLY B 1 143 ? 55.424  39.052  6.262   1.00 89.00  ? 165  GLY B O   1 
ATOM   6918  N N   . ILE B 1 144 ? 56.213  39.365  4.187   1.00 86.04  ? 166  ILE B N   1 
ATOM   6919  C CA  . ILE B 1 144 ? 56.993  38.124  4.152   1.00 84.20  ? 166  ILE B CA  1 
ATOM   6920  C C   . ILE B 1 144 ? 58.494  38.304  3.930   1.00 82.66  ? 166  ILE B C   1 
ATOM   6921  O O   . ILE B 1 144 ? 59.304  37.800  4.697   1.00 82.17  ? 166  ILE B O   1 
ATOM   6922  C CB  . ILE B 1 144 ? 56.404  37.083  3.173   1.00 85.84  ? 166  ILE B CB  1 
ATOM   6923  C CG1 . ILE B 1 144 ? 55.010  36.663  3.634   1.00 84.48  ? 166  ILE B CG1 1 
ATOM   6924  C CG2 . ILE B 1 144 ? 57.291  35.849  3.101   1.00 86.58  ? 166  ILE B CG2 1 
ATOM   6925  C CD1 . ILE B 1 144 ? 54.996  36.028  5.004   1.00 83.90  ? 166  ILE B CD1 1 
ATOM   6926  N N   . SER B 1 145 ? 58.856  38.975  2.843   1.00 82.65  ? 167  SER B N   1 
ATOM   6927  C CA  . SER B 1 145 ? 60.227  38.981  2.337   1.00 83.52  ? 167  SER B CA  1 
ATOM   6928  C C   . SER B 1 145 ? 61.338  39.348  3.338   1.00 82.91  ? 167  SER B C   1 
ATOM   6929  O O   . SER B 1 145 ? 62.502  39.029  3.099   1.00 83.84  ? 167  SER B O   1 
ATOM   6930  C CB  . SER B 1 145 ? 60.315  39.894  1.107   1.00 88.18  ? 167  SER B CB  1 
ATOM   6931  O OG  . SER B 1 145 ? 59.356  39.527  0.122   1.00 87.94  ? 167  SER B OG  1 
ATOM   6932  N N   . ARG B 1 146 ? 60.993  40.004  4.445   1.00 82.12  ? 168  ARG B N   1 
ATOM   6933  C CA  . ARG B 1 146 ? 61.979  40.333  5.482   1.00 83.30  ? 168  ARG B CA  1 
ATOM   6934  C C   . ARG B 1 146 ? 62.180  39.185  6.483   1.00 80.90  ? 168  ARG B C   1 
ATOM   6935  O O   . ARG B 1 146 ? 62.970  39.287  7.418   1.00 83.35  ? 168  ARG B O   1 
ATOM   6936  C CB  . ARG B 1 146 ? 61.572  41.603  6.238   1.00 86.87  ? 168  ARG B CB  1 
ATOM   6937  C CG  . ARG B 1 146 ? 61.522  42.872  5.393   1.00 90.27  ? 168  ARG B CG  1 
ATOM   6938  C CD  . ARG B 1 146 ? 62.879  43.215  4.769   1.00 92.32  ? 168  ARG B CD  1 
ATOM   6939  N NE  . ARG B 1 146 ? 63.975  43.241  5.739   1.00 92.18  ? 168  ARG B NE  1 
ATOM   6940  C CZ  . ARG B 1 146 ? 64.384  44.329  6.385   1.00 93.20  ? 168  ARG B CZ  1 
ATOM   6941  N NH1 . ARG B 1 146 ? 63.787  45.495  6.174   1.00 95.17  ? 168  ARG B NH1 1 
ATOM   6942  N NH2 . ARG B 1 146 ? 65.391  44.251  7.245   1.00 93.14  ? 168  ARG B NH2 1 
ATOM   6943  N N   . LEU B 1 147 ? 61.481  38.085  6.248   1.00 76.58  ? 169  LEU B N   1 
ATOM   6944  C CA  . LEU B 1 147 ? 61.409  36.946  7.164   1.00 74.44  ? 169  LEU B CA  1 
ATOM   6945  C C   . LEU B 1 147 ? 62.541  35.939  6.979   1.00 75.44  ? 169  LEU B C   1 
ATOM   6946  O O   . LEU B 1 147 ? 62.389  34.768  7.323   1.00 76.58  ? 169  LEU B O   1 
ATOM   6947  C CB  . LEU B 1 147 ? 60.027  36.286  7.183   1.00 68.96  ? 169  LEU B CB  1 
ATOM   6948  C CG  . LEU B 1 147 ? 58.940  37.200  7.760   1.00 68.43  ? 169  LEU B CG  1 
ATOM   6949  C CD1 . LEU B 1 147 ? 57.656  36.437  8.083   1.00 65.57  ? 169  LEU B CD1 1 
ATOM   6950  C CD2 . LEU B 1 147 ? 59.464  37.943  8.989   1.00 69.78  ? 169  LEU B CD2 1 
ATOM   6951  N N   . ILE B 1 148 ? 63.655  36.409  6.412   1.00 75.50  ? 170  ILE B N   1 
ATOM   6952  C CA  . ILE B 1 148 ? 64.721  35.586  5.845   1.00 66.96  ? 170  ILE B CA  1 
ATOM   6953  C C   . ILE B 1 148 ? 65.037  34.323  6.640   1.00 77.56  ? 170  ILE B C   1 
ATOM   6954  O O   . ILE B 1 148 ? 65.449  33.315  6.067   1.00 79.79  ? 170  ILE B O   1 
ATOM   6955  C CB  . ILE B 1 148 ? 66.047  36.392  5.787   1.00 94.11  ? 170  ILE B CB  1 
ATOM   6956  C CG1 . ILE B 1 148 ? 65.793  37.842  5.366   1.00 96.99  ? 170  ILE B CG1 1 
ATOM   6957  C CG2 . ILE B 1 148 ? 67.059  35.711  4.870   1.00 93.09  ? 170  ILE B CG2 1 
ATOM   6958  C CD1 . ILE B 1 148 ? 67.008  38.763  5.512   1.00 99.44  ? 170  ILE B CD1 1 
ATOM   6959  N N   . ASN B 1 149 ? 64.852  34.361  7.952   1.00 75.73  ? 171  ASN B N   1 
ATOM   6960  C CA  . ASN B 1 149 ? 65.131  33.188  8.770   1.00 73.29  ? 171  ASN B CA  1 
ATOM   6961  C C   . ASN B 1 149 ? 64.098  32.058  8.711   1.00 69.53  ? 171  ASN B C   1 
ATOM   6962  O O   . ASN B 1 149 ? 64.296  31.019  9.341   1.00 68.74  ? 171  ASN B O   1 
ATOM   6963  C CB  . ASN B 1 149 ? 65.399  33.594  10.214  1.00 73.72  ? 171  ASN B CB  1 
ATOM   6964  C CG  . ASN B 1 149 ? 66.726  34.304  10.372  1.00 74.10  ? 171  ASN B CG  1 
ATOM   6965  O OD1 . ASN B 1 149 ? 66.782  35.445  10.829  1.00 73.31  ? 171  ASN B OD1 1 
ATOM   6966  N ND2 . ASN B 1 149 ? 67.805  33.632  9.984   1.00 74.53  ? 171  ASN B ND2 1 
ATOM   6967  N N   . LEU B 1 150 ? 62.999  32.263  7.984   1.00 67.00  ? 172  LEU B N   1 
ATOM   6968  C CA  . LEU B 1 150 ? 61.907  31.285  7.961   1.00 66.19  ? 172  LEU B CA  1 
ATOM   6969  C C   . LEU B 1 150 ? 62.306  29.879  7.511   1.00 66.92  ? 172  LEU B C   1 
ATOM   6970  O O   . LEU B 1 150 ? 63.005  29.702  6.514   1.00 58.79  ? 172  LEU B O   1 
ATOM   6971  C CB  . LEU B 1 150 ? 60.730  31.780  7.119   1.00 67.01  ? 172  LEU B CB  1 
ATOM   6972  C CG  . LEU B 1 150 ? 59.693  32.679  7.792   1.00 66.24  ? 172  LEU B CG  1 
ATOM   6973  C CD1 . LEU B 1 150 ? 58.528  32.911  6.849   1.00 61.90  ? 172  LEU B CD1 1 
ATOM   6974  C CD2 . LEU B 1 150 ? 59.211  32.086  9.109   1.00 65.93  ? 172  LEU B CD2 1 
ATOM   6975  N N   . LYS B 1 151 ? 61.844  28.888  8.271   1.00 66.21  ? 173  LYS B N   1 
ATOM   6976  C CA  . LYS B 1 151 ? 62.050  27.476  7.967   1.00 64.02  ? 173  LYS B CA  1 
ATOM   6977  C C   . LYS B 1 151 ? 60.764  26.895  7.412   1.00 62.80  ? 173  LYS B C   1 
ATOM   6978  O O   . LYS B 1 151 ? 60.727  26.382  6.295   1.00 61.37  ? 173  LYS B O   1 
ATOM   6979  C CB  . LYS B 1 151 ? 62.449  26.692  9.221   1.00 67.06  ? 173  LYS B CB  1 
ATOM   6980  C CG  . LYS B 1 151 ? 63.942  26.537  9.448   1.00 70.28  ? 173  LYS B CG  1 
ATOM   6981  C CD  . LYS B 1 151 ? 64.601  27.885  9.626   1.00 75.15  ? 173  LYS B CD  1 
ATOM   6982  C CE  . LYS B 1 151 ? 66.098  27.759  9.832   1.00 76.93  ? 173  LYS B CE  1 
ATOM   6983  N NZ  . LYS B 1 151 ? 66.754  29.097  9.906   1.00 78.44  ? 173  LYS B NZ  1 
ATOM   6984  N N   . ASN B 1 152 ? 59.718  26.940  8.230   1.00 64.12  ? 174  ASN B N   1 
ATOM   6985  C CA  . ASN B 1 152 ? 58.421  26.382  7.869   1.00 63.14  ? 174  ASN B CA  1 
ATOM   6986  C C   . ASN B 1 152 ? 57.357  27.470  7.801   1.00 63.08  ? 174  ASN B C   1 
ATOM   6987  O O   . ASN B 1 152 ? 57.227  28.278  8.720   1.00 65.72  ? 174  ASN B O   1 
ATOM   6988  C CB  . ASN B 1 152 ? 58.011  25.307  8.877   1.00 61.49  ? 174  ASN B CB  1 
ATOM   6989  C CG  . ASN B 1 152 ? 59.126  24.315  9.158   1.00 65.18  ? 174  ASN B CG  1 
ATOM   6990  O OD1 . ASN B 1 152 ? 59.917  23.985  8.275   1.00 67.07  ? 174  ASN B OD1 1 
ATOM   6991  N ND2 . ASN B 1 152 ? 59.199  23.839  10.395  1.00 67.79  ? 174  ASN B ND2 1 
ATOM   6992  N N   . LEU B 1 153 ? 56.601  27.494  6.707   1.00 58.74  ? 175  LEU B N   1 
ATOM   6993  C CA  . LEU B 1 153 ? 55.559  28.496  6.526   1.00 56.26  ? 175  LEU B CA  1 
ATOM   6994  C C   . LEU B 1 153 ? 54.266  27.843  6.041   1.00 55.95  ? 175  LEU B C   1 
ATOM   6995  O O   . LEU B 1 153 ? 54.225  27.243  4.963   1.00 53.02  ? 175  LEU B O   1 
ATOM   6996  C CB  . LEU B 1 153 ? 56.029  29.577  5.549   1.00 58.50  ? 175  LEU B CB  1 
ATOM   6997  C CG  . LEU B 1 153 ? 54.970  30.566  5.054   1.00 59.13  ? 175  LEU B CG  1 
ATOM   6998  C CD1 . LEU B 1 153 ? 54.449  31.416  6.207   1.00 59.80  ? 175  LEU B CD1 1 
ATOM   6999  C CD2 . LEU B 1 153 ? 55.517  31.439  3.923   1.00 54.13  ? 175  LEU B CD2 1 
ATOM   7000  N N   . TYR B 1 154 ? 53.214  27.959  6.847   1.00 56.82  ? 176  TYR B N   1 
ATOM   7001  C CA  . TYR B 1 154 ? 51.944  27.315  6.553   1.00 55.59  ? 176  TYR B CA  1 
ATOM   7002  C C   . TYR B 1 154 ? 50.892  28.365  6.228   1.00 57.20  ? 176  TYR B C   1 
ATOM   7003  O O   . TYR B 1 154 ? 50.490  29.138  7.097   1.00 57.47  ? 176  TYR B O   1 
ATOM   7004  C CB  . TYR B 1 154 ? 51.477  26.492  7.759   1.00 55.81  ? 176  TYR B CB  1 
ATOM   7005  C CG  . TYR B 1 154 ? 52.507  25.532  8.304   1.00 53.96  ? 176  TYR B CG  1 
ATOM   7006  C CD1 . TYR B 1 154 ? 53.474  25.961  9.209   1.00 55.83  ? 176  TYR B CD1 1 
ATOM   7007  C CD2 . TYR B 1 154 ? 52.510  24.195  7.923   1.00 52.28  ? 176  TYR B CD2 1 
ATOM   7008  C CE1 . TYR B 1 154 ? 54.419  25.090  9.714   1.00 54.81  ? 176  TYR B CE1 1 
ATOM   7009  C CE2 . TYR B 1 154 ? 53.452  23.314  8.425   1.00 52.82  ? 176  TYR B CE2 1 
ATOM   7010  C CZ  . TYR B 1 154 ? 54.401  23.769  9.322   1.00 53.94  ? 176  TYR B CZ  1 
ATOM   7011  O OH  . TYR B 1 154 ? 55.341  22.909  9.828   1.00 56.90  ? 176  TYR B OH  1 
ATOM   7012  N N   . LEU B 1 155 ? 50.511  28.448  4.958   1.00 57.11  ? 177  LEU B N   1 
ATOM   7013  C CA  . LEU B 1 155 ? 49.408  29.305  4.522   1.00 53.99  ? 177  LEU B CA  1 
ATOM   7014  C C   . LEU B 1 155 ? 48.109  28.567  4.181   1.00 50.35  ? 177  LEU B C   1 
ATOM   7015  O O   . LEU B 1 155 ? 47.160  29.163  3.681   1.00 49.17  ? 177  LEU B O   1 
ATOM   7016  C CB  . LEU B 1 155 ? 49.854  30.247  3.410   1.00 54.59  ? 177  LEU B CB  1 
ATOM   7017  C CG  . LEU B 1 155 ? 50.874  31.298  3.857   1.00 56.18  ? 177  LEU B CG  1 
ATOM   7018  C CD1 . LEU B 1 155 ? 51.535  31.941  2.658   1.00 58.18  ? 177  LEU B CD1 1 
ATOM   7019  C CD2 . LEU B 1 155 ? 50.218  32.360  4.712   1.00 58.91  ? 177  LEU B CD2 1 
ATOM   7020  N N   . ALA B 1 156 ? 48.091  27.263  4.420   1.00 48.30  ? 178  ALA B N   1 
ATOM   7021  C CA  . ALA B 1 156 ? 46.982  26.396  3.999   1.00 47.43  ? 178  ALA B CA  1 
ATOM   7022  C C   . ALA B 1 156 ? 45.589  26.781  4.509   1.00 46.65  ? 178  ALA B C   1 
ATOM   7023  O O   . ALA B 1 156 ? 45.450  27.423  5.551   1.00 48.13  ? 178  ALA B O   1 
ATOM   7024  C CB  . ALA B 1 156 ? 47.281  24.939  4.359   1.00 42.40  ? 178  ALA B CB  1 
ATOM   7025  N N   . TRP B 1 157 ? 44.573  26.406  3.731   1.00 44.98  ? 179  TRP B N   1 
ATOM   7026  C CA  . TRP B 1 157 ? 43.156  26.496  4.127   1.00 47.33  ? 179  TRP B CA  1 
ATOM   7027  C C   . TRP B 1 157 ? 42.602  27.907  4.344   1.00 50.34  ? 179  TRP B C   1 
ATOM   7028  O O   . TRP B 1 157 ? 41.773  28.120  5.238   1.00 48.72  ? 179  TRP B O   1 
ATOM   7029  C CB  . TRP B 1 157 ? 42.871  25.651  5.375   1.00 43.41  ? 179  TRP B CB  1 
ATOM   7030  C CG  . TRP B 1 157 ? 42.888  24.174  5.150   1.00 39.60  ? 179  TRP B CG  1 
ATOM   7031  C CD1 . TRP B 1 157 ? 43.945  23.335  5.333   1.00 39.29  ? 179  TRP B CD1 1 
ATOM   7032  C CD2 . TRP B 1 157 ? 41.786  23.348  4.729   1.00 38.46  ? 179  TRP B CD2 1 
ATOM   7033  N NE1 . TRP B 1 157 ? 43.574  22.040  5.044   1.00 41.64  ? 179  TRP B NE1 1 
ATOM   7034  C CE2 . TRP B 1 157 ? 42.258  22.024  4.668   1.00 37.50  ? 179  TRP B CE2 1 
ATOM   7035  C CE3 . TRP B 1 157 ? 40.452  23.605  4.393   1.00 42.02  ? 179  TRP B CE3 1 
ATOM   7036  C CZ2 . TRP B 1 157 ? 41.446  20.955  4.288   1.00 40.52  ? 179  TRP B CZ2 1 
ATOM   7037  C CZ3 . TRP B 1 157 ? 39.637  22.533  4.013   1.00 40.26  ? 179  TRP B CZ3 1 
ATOM   7038  C CH2 . TRP B 1 157 ? 40.142  21.228  3.961   1.00 40.37  ? 179  TRP B CH2 1 
ATOM   7039  N N   . ASN B 1 158 ? 43.085  28.866  3.564   1.00 51.57  ? 180  ASN B N   1 
ATOM   7040  C CA  . ASN B 1 158 ? 42.489  30.201  3.547   1.00 54.00  ? 180  ASN B CA  1 
ATOM   7041  C C   . ASN B 1 158 ? 41.281  30.390  2.622   1.00 56.27  ? 180  ASN B C   1 
ATOM   7042  O O   . ASN B 1 158 ? 40.331  31.085  2.975   1.00 60.05  ? 180  ASN B O   1 
ATOM   7043  C CB  . ASN B 1 158 ? 43.553  31.291  3.355   1.00 50.55  ? 180  ASN B CB  1 
ATOM   7044  C CG  . ASN B 1 158 ? 44.366  31.529  4.626   1.00 50.58  ? 180  ASN B CG  1 
ATOM   7045  O OD1 . ASN B 1 158 ? 44.378  32.628  5.173   1.00 51.63  ? 180  ASN B OD1 1 
ATOM   7046  N ND2 . ASN B 1 158 ? 45.024  30.483  5.112   1.00 47.26  ? 180  ASN B ND2 1 
ATOM   7047  N N   . CYS B 1 159 ? 41.330  29.799  1.431   1.00 54.00  ? 181  CYS B N   1 
ATOM   7048  C CA  . CYS B 1 159 ? 40.207  29.883  0.494   1.00 51.16  ? 181  CYS B CA  1 
ATOM   7049  C C   . CYS B 1 159 ? 39.918  28.517  -0.118  1.00 49.59  ? 181  CYS B C   1 
ATOM   7050  O O   . CYS B 1 159 ? 40.767  27.959  -0.812  1.00 51.02  ? 181  CYS B O   1 
ATOM   7051  C CB  . CYS B 1 159 ? 40.496  30.912  -0.603  1.00 49.97  ? 181  CYS B CB  1 
ATOM   7052  S SG  . CYS B 1 159 ? 39.087  31.264  -1.673  1.00 63.55  ? 181  CYS B SG  1 
ATOM   7053  N N   . TYR B 1 160 ? 38.728  27.977  0.152   1.00 46.59  ? 182  TYR B N   1 
ATOM   7054  C CA  . TYR B 1 160 ? 38.421  26.594  -0.197  1.00 47.75  ? 182  TYR B CA  1 
ATOM   7055  C C   . TYR B 1 160 ? 36.919  26.334  -0.207  1.00 48.59  ? 182  TYR B C   1 
ATOM   7056  O O   . TYR B 1 160 ? 36.150  27.117  0.345   1.00 51.03  ? 182  TYR B O   1 
ATOM   7057  C CB  . TYR B 1 160 ? 39.092  25.647  0.800   1.00 49.66  ? 182  TYR B CB  1 
ATOM   7058  C CG  . TYR B 1 160 ? 38.620  25.856  2.219   1.00 51.76  ? 182  TYR B CG  1 
ATOM   7059  C CD1 . TYR B 1 160 ? 39.133  26.887  3.000   1.00 53.05  ? 182  TYR B CD1 1 
ATOM   7060  C CD2 . TYR B 1 160 ? 37.651  25.034  2.772   1.00 52.54  ? 182  TYR B CD2 1 
ATOM   7061  C CE1 . TYR B 1 160 ? 38.693  27.085  4.297   1.00 53.20  ? 182  TYR B CE1 1 
ATOM   7062  C CE2 . TYR B 1 160 ? 37.209  25.219  4.065   1.00 53.17  ? 182  TYR B CE2 1 
ATOM   7063  C CZ  . TYR B 1 160 ? 37.734  26.245  4.823   1.00 53.19  ? 182  TYR B CZ  1 
ATOM   7064  O OH  . TYR B 1 160 ? 37.291  26.427  6.110   1.00 52.21  ? 182  TYR B OH  1 
ATOM   7065  N N   . PHE B 1 161 ? 36.520  25.228  -0.831  1.00 45.80  ? 183  PHE B N   1 
ATOM   7066  C CA  . PHE B 1 161 ? 35.131  24.767  -0.836  1.00 47.25  ? 183  PHE B CA  1 
ATOM   7067  C C   . PHE B 1 161 ? 34.140  25.866  -1.247  1.00 50.36  ? 183  PHE B C   1 
ATOM   7068  O O   . PHE B 1 161 ? 34.386  26.637  -2.182  1.00 49.85  ? 183  PHE B O   1 
ATOM   7069  C CB  . PHE B 1 161 ? 34.732  24.203  0.535   1.00 46.81  ? 183  PHE B CB  1 
ATOM   7070  C CG  . PHE B 1 161 ? 35.502  22.978  0.951   1.00 47.23  ? 183  PHE B CG  1 
ATOM   7071  C CD1 . PHE B 1 161 ? 36.262  22.262  0.035   1.00 48.31  ? 183  PHE B CD1 1 
ATOM   7072  C CD2 . PHE B 1 161 ? 35.445  22.530  2.262   1.00 47.20  ? 183  PHE B CD2 1 
ATOM   7073  C CE1 . PHE B 1 161 ? 36.963  21.132  0.426   1.00 47.78  ? 183  PHE B CE1 1 
ATOM   7074  C CE2 . PHE B 1 161 ? 36.138  21.395  2.664   1.00 48.64  ? 183  PHE B CE2 1 
ATOM   7075  C CZ  . PHE B 1 161 ? 36.897  20.693  1.745   1.00 49.18  ? 183  PHE B CZ  1 
ATOM   7076  N N   . ASN B 1 162 ? 33.027  25.941  -0.527  1.00 51.71  ? 184  ASN B N   1 
ATOM   7077  C CA  . ASN B 1 162 ? 32.041  26.985  -0.764  1.00 55.62  ? 184  ASN B CA  1 
ATOM   7078  C C   . ASN B 1 162 ? 32.251  28.242  0.075   1.00 60.77  ? 184  ASN B C   1 
ATOM   7079  O O   . ASN B 1 162 ? 31.408  29.138  0.063   1.00 65.14  ? 184  ASN B O   1 
ATOM   7080  C CB  . ASN B 1 162 ? 30.622  26.445  -0.587  1.00 54.01  ? 184  ASN B CB  1 
ATOM   7081  C CG  . ASN B 1 162 ? 30.272  25.398  -1.623  1.00 51.55  ? 184  ASN B CG  1 
ATOM   7082  O OD1 . ASN B 1 162 ? 29.659  24.380  -1.313  1.00 50.00  ? 184  ASN B OD1 1 
ATOM   7083  N ND2 . ASN B 1 162 ? 30.681  25.638  -2.862  1.00 51.59  ? 184  ASN B ND2 1 
ATOM   7084  N N   . LYS B 1 163 ? 33.351  28.298  0.823   1.00 61.08  ? 185  LYS B N   1 
ATOM   7085  C CA  . LYS B 1 163 ? 33.678  29.506  1.579   1.00 61.62  ? 185  LYS B CA  1 
ATOM   7086  C C   . LYS B 1 163 ? 33.706  30.703  0.645   1.00 65.45  ? 185  LYS B C   1 
ATOM   7087  O O   . LYS B 1 163 ? 34.350  30.661  -0.401  1.00 67.35  ? 185  LYS B O   1 
ATOM   7088  C CB  . LYS B 1 163 ? 35.035  29.393  2.274   1.00 57.56  ? 185  LYS B CB  1 
ATOM   7089  C CG  . LYS B 1 163 ? 35.490  30.698  2.922   1.00 55.88  ? 185  LYS B CG  1 
ATOM   7090  C CD  . LYS B 1 163 ? 36.886  30.586  3.516   1.00 53.95  ? 185  LYS B CD  1 
ATOM   7091  C CE  . LYS B 1 163 ? 37.220  31.799  4.382   1.00 56.23  ? 185  LYS B CE  1 
ATOM   7092  N NZ  . LYS B 1 163 ? 38.600  31.766  4.960   1.00 58.55  ? 185  LYS B NZ  1 
ATOM   7093  N N   . VAL B 1 164 ? 33.004  31.768  1.012   1.00 67.85  ? 186  VAL B N   1 
ATOM   7094  C CA  . VAL B 1 164 ? 33.097  32.980  0.225   1.00 71.93  ? 186  VAL B CA  1 
ATOM   7095  C C   . VAL B 1 164 ? 34.492  33.535  0.445   1.00 73.00  ? 186  VAL B C   1 
ATOM   7096  O O   . VAL B 1 164 ? 34.888  33.819  1.582   1.00 74.62  ? 186  VAL B O   1 
ATOM   7097  C CB  . VAL B 1 164 ? 32.038  34.022  0.623   1.00 73.75  ? 186  VAL B CB  1 
ATOM   7098  C CG1 . VAL B 1 164 ? 32.345  35.368  -0.033  1.00 73.32  ? 186  VAL B CG1 1 
ATOM   7099  C CG2 . VAL B 1 164 ? 30.651  33.533  0.233   1.00 73.56  ? 186  VAL B CG2 1 
ATOM   7100  N N   . CYS B 1 165 ? 35.231  33.673  -0.652  1.00 70.40  ? 187  CYS B N   1 
ATOM   7101  C CA  . CYS B 1 165 ? 36.615  34.127  -0.610  1.00 70.23  ? 187  CYS B CA  1 
ATOM   7102  C C   . CYS B 1 165 ? 37.120  34.465  -2.012  1.00 70.40  ? 187  CYS B C   1 
ATOM   7103  O O   . CYS B 1 165 ? 36.414  34.272  -3.000  1.00 67.46  ? 187  CYS B O   1 
ATOM   7104  C CB  . CYS B 1 165 ? 37.527  33.089  0.066   1.00 69.81  ? 187  CYS B CB  1 
ATOM   7105  S SG  . CYS B 1 165 ? 37.403  31.383  -0.542  1.00 67.62  ? 187  CYS B SG  1 
ATOM   7106  N N   . GLU B 1 166 ? 38.355  34.945  -2.091  1.00 75.27  ? 188  GLU B N   1 
ATOM   7107  C CA  . GLU B 1 166 ? 38.900  35.441  -3.346  1.00 80.40  ? 188  GLU B CA  1 
ATOM   7108  C C   . GLU B 1 166 ? 40.168  34.682  -3.712  1.00 78.64  ? 188  GLU B C   1 
ATOM   7109  O O   . GLU B 1 166 ? 40.879  34.180  -2.831  1.00 79.48  ? 188  GLU B O   1 
ATOM   7110  C CB  . GLU B 1 166 ? 39.175  36.945  -3.231  1.00 87.31  ? 188  GLU B CB  1 
ATOM   7111  C CG  . GLU B 1 166 ? 39.638  37.629  -4.515  1.00 93.52  ? 188  GLU B CG  1 
ATOM   7112  C CD  . GLU B 1 166 ? 38.894  37.148  -5.746  1.00 96.38  ? 188  GLU B CD  1 
ATOM   7113  O OE1 . GLU B 1 166 ? 37.648  37.240  -5.774  1.00 98.13  ? 188  GLU B OE1 1 
ATOM   7114  O OE2 . GLU B 1 166 ? 39.563  36.666  -6.684  1.00 96.34  ? 188  GLU B OE2 1 
ATOM   7115  N N   . LYS B 1 167 ? 40.427  34.588  -5.014  1.00 75.34  ? 189  LYS B N   1 
ATOM   7116  C CA  . LYS B 1 167 ? 41.602  33.912  -5.546  1.00 71.67  ? 189  LYS B CA  1 
ATOM   7117  C C   . LYS B 1 167 ? 42.876  34.462  -4.929  1.00 68.95  ? 189  LYS B C   1 
ATOM   7118  O O   . LYS B 1 167 ? 42.999  35.662  -4.709  1.00 72.06  ? 189  LYS B O   1 
ATOM   7119  C CB  . LYS B 1 167 ? 41.637  34.057  -7.067  1.00 73.61  ? 189  LYS B CB  1 
ATOM   7120  C CG  . LYS B 1 167 ? 40.422  33.452  -7.740  1.00 74.29  ? 189  LYS B CG  1 
ATOM   7121  C CD  . LYS B 1 167 ? 40.425  33.681  -9.241  1.00 75.99  ? 189  LYS B CD  1 
ATOM   7122  C CE  . LYS B 1 167 ? 39.232  33.004  -9.896  1.00 75.31  ? 189  LYS B CE  1 
ATOM   7123  N NZ  . LYS B 1 167 ? 39.252  31.537  -9.670  1.00 75.73  ? 189  LYS B NZ  1 
ATOM   7124  N N   . THR B 1 168 ? 43.825  33.575  -4.652  1.00 64.82  ? 190  THR B N   1 
ATOM   7125  C CA  . THR B 1 168 ? 45.009  33.947  -3.895  1.00 65.17  ? 190  THR B CA  1 
ATOM   7126  C C   . THR B 1 168 ? 46.073  34.556  -4.786  1.00 66.91  ? 190  THR B C   1 
ATOM   7127  O O   . THR B 1 168 ? 46.565  33.911  -5.710  1.00 66.02  ? 190  THR B O   1 
ATOM   7128  C CB  . THR B 1 168 ? 45.625  32.731  -3.185  1.00 64.97  ? 190  THR B CB  1 
ATOM   7129  O OG1 . THR B 1 168 ? 44.635  32.093  -2.361  1.00 62.46  ? 190  THR B OG1 1 
ATOM   7130  C CG2 . THR B 1 168 ? 46.824  33.160  -2.344  1.00 66.63  ? 190  THR B CG2 1 
ATOM   7131  N N   . ASN B 1 169 ? 46.436  35.800  -4.497  1.00 71.74  ? 191  ASN B N   1 
ATOM   7132  C CA  . ASN B 1 169 ? 47.492  36.474  -5.238  1.00 72.67  ? 191  ASN B CA  1 
ATOM   7133  C C   . ASN B 1 169 ? 48.838  36.421  -4.530  1.00 71.85  ? 191  ASN B C   1 
ATOM   7134  O O   . ASN B 1 169 ? 49.009  36.984  -3.453  1.00 73.18  ? 191  ASN B O   1 
ATOM   7135  C CB  . ASN B 1 169 ? 47.118  37.927  -5.519  1.00 75.16  ? 191  ASN B CB  1 
ATOM   7136  C CG  . ASN B 1 169 ? 48.221  38.677  -6.225  1.00 78.71  ? 191  ASN B CG  1 
ATOM   7137  O OD1 . ASN B 1 169 ? 48.609  38.324  -7.338  1.00 80.52  ? 191  ASN B OD1 1 
ATOM   7138  N ND2 . ASN B 1 169 ? 48.735  39.718  -5.583  1.00 80.42  ? 191  ASN B ND2 1 
ATOM   7139  N N   . ILE B 1 170 ? 49.791  35.746  -5.159  1.00 70.11  ? 192  ILE B N   1 
ATOM   7140  C CA  . ILE B 1 170 ? 51.149  35.637  -4.658  1.00 67.93  ? 192  ILE B CA  1 
ATOM   7141  C C   . ILE B 1 170 ? 52.040  36.630  -5.381  1.00 69.95  ? 192  ILE B C   1 
ATOM   7142  O O   . ILE B 1 170 ? 52.306  36.476  -6.577  1.00 70.26  ? 192  ILE B O   1 
ATOM   7143  C CB  . ILE B 1 170 ? 51.730  34.244  -4.973  1.00 63.20  ? 192  ILE B CB  1 
ATOM   7144  C CG1 . ILE B 1 170 ? 50.779  33.122  -4.553  1.00 58.99  ? 192  ILE B CG1 1 
ATOM   7145  C CG2 . ILE B 1 170 ? 53.106  34.083  -4.369  1.00 61.46  ? 192  ILE B CG2 1 
ATOM   7146  C CD1 . ILE B 1 170 ? 50.493  33.076  -3.098  1.00 56.26  ? 192  ILE B CD1 1 
ATOM   7147  N N   . GLU B 1 171 ? 52.519  37.637  -4.663  1.00 74.07  ? 193  GLU B N   1 
ATOM   7148  C CA  . GLU B 1 171 ? 53.416  38.599  -5.278  1.00 77.51  ? 193  GLU B CA  1 
ATOM   7149  C C   . GLU B 1 171 ? 54.671  37.921  -5.805  1.00 75.48  ? 193  GLU B C   1 
ATOM   7150  O O   . GLU B 1 171 ? 55.194  36.989  -5.191  1.00 73.17  ? 193  GLU B O   1 
ATOM   7151  C CB  . GLU B 1 171 ? 53.781  39.721  -4.312  1.00 83.13  ? 193  GLU B CB  1 
ATOM   7152  C CG  . GLU B 1 171 ? 52.967  40.989  -4.508  1.00 87.48  ? 193  GLU B CG  1 
ATOM   7153  C CD  . GLU B 1 171 ? 53.360  42.083  -3.539  1.00 91.02  ? 193  GLU B CD  1 
ATOM   7154  O OE1 . GLU B 1 171 ? 54.439  41.972  -2.918  1.00 92.05  ? 193  GLU B OE1 1 
ATOM   7155  O OE2 . GLU B 1 171 ? 52.586  43.051  -3.394  1.00 92.75  ? 193  GLU B OE2 1 
ATOM   7156  N N   . ASP B 1 172 ? 55.138  38.405  -6.955  1.00 73.68  ? 194  ASP B N   1 
ATOM   7157  C CA  . ASP B 1 172 ? 56.281  37.821  -7.649  1.00 72.53  ? 194  ASP B CA  1 
ATOM   7158  C C   . ASP B 1 172 ? 57.559  37.967  -6.832  1.00 71.20  ? 194  ASP B C   1 
ATOM   7159  O O   . ASP B 1 172 ? 57.942  39.072  -6.456  1.00 71.97  ? 194  ASP B O   1 
ATOM   7160  C CB  . ASP B 1 172 ? 56.441  38.469  -9.033  1.00 76.58  ? 194  ASP B CB  1 
ATOM   7161  C CG  . ASP B 1 172 ? 57.502  37.789  -9.888  1.00 77.16  ? 194  ASP B CG  1 
ATOM   7162  O OD1 . ASP B 1 172 ? 57.204  36.737  -10.505 1.00 80.10  ? 194  ASP B OD1 1 
ATOM   7163  O OD2 . ASP B 1 172 ? 58.628  38.324  -9.956  1.00 75.38  ? 194  ASP B OD2 1 
ATOM   7164  N N   . GLY B 1 173 ? 58.215  36.841  -6.565  1.00 70.07  ? 195  GLY B N   1 
ATOM   7165  C CA  . GLY B 1 173 ? 59.424  36.826  -5.759  1.00 71.50  ? 195  GLY B CA  1 
ATOM   7166  C C   . GLY B 1 173 ? 59.233  37.017  -4.256  1.00 70.58  ? 195  GLY B C   1 
ATOM   7167  O O   . GLY B 1 173 ? 60.180  37.365  -3.548  1.00 71.29  ? 195  GLY B O   1 
ATOM   7168  N N   . VAL B 1 174 ? 58.021  36.788  -3.760  1.00 69.28  ? 196  VAL B N   1 
ATOM   7169  C CA  . VAL B 1 174 ? 57.759  36.926  -2.327  1.00 70.24  ? 196  VAL B CA  1 
ATOM   7170  C C   . VAL B 1 174 ? 58.567  35.887  -1.529  1.00 69.82  ? 196  VAL B C   1 
ATOM   7171  O O   . VAL B 1 174 ? 59.207  36.219  -0.528  1.00 71.63  ? 196  VAL B O   1 
ATOM   7172  C CB  . VAL B 1 174 ? 56.236  36.859  -2.002  1.00 68.44  ? 196  VAL B CB  1 
ATOM   7173  C CG1 . VAL B 1 174 ? 55.653  35.547  -2.408  1.00 66.70  ? 196  VAL B CG1 1 
ATOM   7174  C CG2 . VAL B 1 174 ? 55.993  37.056  -0.544  1.00 69.29  ? 196  VAL B CG2 1 
ATOM   7175  N N   . PHE B 1 175 ? 58.586  34.647  -2.014  1.00 65.23  ? 197  PHE B N   1 
ATOM   7176  C CA  . PHE B 1 175 ? 59.300  33.557  -1.353  1.00 62.99  ? 197  PHE B CA  1 
ATOM   7177  C C   . PHE B 1 175 ? 60.782  33.530  -1.723  1.00 67.81  ? 197  PHE B C   1 
ATOM   7178  O O   . PHE B 1 175 ? 61.590  32.838  -1.096  1.00 70.34  ? 197  PHE B O   1 
ATOM   7179  C CB  . PHE B 1 175 ? 58.664  32.234  -1.747  1.00 57.66  ? 197  PHE B CB  1 
ATOM   7180  C CG  . PHE B 1 175 ? 57.187  32.174  -1.486  1.00 56.43  ? 197  PHE B CG  1 
ATOM   7181  C CD1 . PHE B 1 175 ? 56.696  32.350  -0.205  1.00 56.14  ? 197  PHE B CD1 1 
ATOM   7182  C CD2 . PHE B 1 175 ? 56.291  31.933  -2.516  1.00 55.65  ? 197  PHE B CD2 1 
ATOM   7183  C CE1 . PHE B 1 175 ? 55.336  32.288  0.051   1.00 61.96  ? 197  PHE B CE1 1 
ATOM   7184  C CE2 . PHE B 1 175 ? 54.926  31.864  -2.272  1.00 58.08  ? 197  PHE B CE2 1 
ATOM   7185  C CZ  . PHE B 1 175 ? 54.449  32.045  -0.984  1.00 60.49  ? 197  PHE B CZ  1 
ATOM   7186  N N   . GLU B 1 176 ? 61.119  34.302  -2.747  1.00 67.43  ? 198  GLU B N   1 
ATOM   7187  C CA  . GLU B 1 176 ? 62.453  34.353  -3.322  1.00 70.86  ? 198  GLU B CA  1 
ATOM   7188  C C   . GLU B 1 176 ? 63.505  34.802  -2.322  1.00 71.70  ? 198  GLU B C   1 
ATOM   7189  O O   . GLU B 1 176 ? 64.665  34.404  -2.402  1.00 69.92  ? 198  GLU B O   1 
ATOM   7190  C CB  . GLU B 1 176 ? 62.418  35.331  -4.490  1.00 72.16  ? 198  GLU B CB  1 
ATOM   7191  C CG  . GLU B 1 176 ? 63.708  35.524  -5.221  1.00 75.48  ? 198  GLU B CG  1 
ATOM   7192  C CD  . GLU B 1 176 ? 63.504  36.366  -6.461  1.00 78.32  ? 198  GLU B CD  1 
ATOM   7193  O OE1 . GLU B 1 176 ? 62.985  37.495  -6.336  1.00 79.42  ? 198  GLU B OE1 1 
ATOM   7194  O OE2 . GLU B 1 176 ? 63.838  35.888  -7.561  1.00 79.86  ? 198  GLU B OE2 1 
ATOM   7195  N N   . THR B 1 177 ? 63.089  35.642  -1.385  1.00 73.94  ? 199  THR B N   1 
ATOM   7196  C CA  . THR B 1 177 ? 63.999  36.224  -0.414  1.00 78.92  ? 199  THR B CA  1 
ATOM   7197  C C   . THR B 1 177 ? 64.365  35.258  0.702   1.00 78.18  ? 199  THR B C   1 
ATOM   7198  O O   . THR B 1 177 ? 65.361  35.454  1.392   1.00 80.46  ? 199  THR B O   1 
ATOM   7199  C CB  . THR B 1 177 ? 63.379  37.465  0.224   1.00 81.87  ? 199  THR B CB  1 
ATOM   7200  O OG1 . THR B 1 177 ? 61.959  37.285  0.290   1.00 82.11  ? 199  THR B OG1 1 
ATOM   7201  C CG2 . THR B 1 177 ? 63.691  38.701  -0.605  1.00 82.67  ? 199  THR B CG2 1 
ATOM   7202  N N   . LEU B 1 178 ? 63.572  34.210  0.879   1.00 73.99  ? 200  LEU B N   1 
ATOM   7203  C CA  . LEU B 1 178 ? 63.824  33.307  1.985   1.00 71.22  ? 200  LEU B CA  1 
ATOM   7204  C C   . LEU B 1 178 ? 64.713  32.179  1.493   1.00 72.83  ? 200  LEU B C   1 
ATOM   7205  O O   . LEU B 1 178 ? 64.239  31.256  0.843   1.00 72.58  ? 200  LEU B O   1 
ATOM   7206  C CB  . LEU B 1 178 ? 62.492  32.733  2.452   1.00 65.47  ? 200  LEU B CB  1 
ATOM   7207  C CG  . LEU B 1 178 ? 61.325  33.721  2.357   1.00 63.72  ? 200  LEU B CG  1 
ATOM   7208  C CD1 . LEU B 1 178 ? 59.997  33.023  2.541   1.00 59.40  ? 200  LEU B CD1 1 
ATOM   7209  C CD2 . LEU B 1 178 ? 61.482  34.838  3.376   1.00 66.69  ? 200  LEU B CD2 1 
ATOM   7210  N N   . THR B 1 179 ? 65.991  32.221  1.862   1.00 73.97  ? 201  THR B N   1 
ATOM   7211  C CA  . THR B 1 179 ? 66.960  31.258  1.346   1.00 74.48  ? 201  THR B CA  1 
ATOM   7212  C C   . THR B 1 179 ? 67.178  30.108  2.322   1.00 72.01  ? 201  THR B C   1 
ATOM   7213  O O   . THR B 1 179 ? 67.936  29.180  2.042   1.00 72.18  ? 201  THR B O   1 
ATOM   7214  C CB  . THR B 1 179 ? 68.315  31.921  1.029   1.00 79.17  ? 201  THR B CB  1 
ATOM   7215  O OG1 . THR B 1 179 ? 69.043  32.147  2.244   1.00 80.07  ? 201  THR B OG1 1 
ATOM   7216  C CG2 . THR B 1 179 ? 68.104  33.243  0.307   1.00 82.31  ? 201  THR B CG2 1 
ATOM   7217  N N   . ASN B 1 180 ? 66.546  30.202  3.487   1.00 70.09  ? 202  ASN B N   1 
ATOM   7218  C CA  . ASN B 1 180 ? 66.499  29.087  4.426   1.00 69.81  ? 202  ASN B CA  1 
ATOM   7219  C C   . ASN B 1 180 ? 65.188  28.289  4.420   1.00 69.77  ? 202  ASN B C   1 
ATOM   7220  O O   . ASN B 1 180 ? 65.015  27.366  5.220   1.00 71.71  ? 202  ASN B O   1 
ATOM   7221  C CB  . ASN B 1 180 ? 66.869  29.541  5.838   1.00 71.03  ? 202  ASN B CB  1 
ATOM   7222  C CG  . ASN B 1 180 ? 68.362  29.790  5.996   1.00 72.48  ? 202  ASN B CG  1 
ATOM   7223  O OD1 . ASN B 1 180 ? 69.149  28.853  6.145   1.00 73.84  ? 202  ASN B OD1 1 
ATOM   7224  N ND2 . ASN B 1 180 ? 68.756  31.057  5.967   1.00 72.37  ? 202  ASN B ND2 1 
ATOM   7225  N N   . LEU B 1 181 ? 64.261  28.654  3.538   1.00 66.54  ? 203  LEU B N   1 
ATOM   7226  C CA  . LEU B 1 181 ? 62.936  28.038  3.545   1.00 63.52  ? 203  LEU B CA  1 
ATOM   7227  C C   . LEU B 1 181 ? 62.964  26.560  3.160   1.00 61.29  ? 203  LEU B C   1 
ATOM   7228  O O   . LEU B 1 181 ? 63.468  26.193  2.102   1.00 59.32  ? 203  LEU B O   1 
ATOM   7229  C CB  . LEU B 1 181 ? 61.954  28.804  2.652   1.00 56.68  ? 203  LEU B CB  1 
ATOM   7230  C CG  . LEU B 1 181 ? 60.491  28.578  3.048   1.00 55.15  ? 203  LEU B CG  1 
ATOM   7231  C CD1 . LEU B 1 181 ? 60.284  28.958  4.513   1.00 55.38  ? 203  LEU B CD1 1 
ATOM   7232  C CD2 . LEU B 1 181 ? 59.536  29.352  2.160   1.00 55.10  ? 203  LEU B CD2 1 
ATOM   7233  N N   . GLU B 1 182 ? 62.393  25.731  4.032   1.00 62.10  ? 204  GLU B N   1 
ATOM   7234  C CA  . GLU B 1 182 ? 62.406  24.270  3.895   1.00 60.03  ? 204  GLU B CA  1 
ATOM   7235  C C   . GLU B 1 182 ? 61.039  23.695  3.535   1.00 55.45  ? 204  GLU B C   1 
ATOM   7236  O O   . GLU B 1 182 ? 60.902  22.958  2.563   1.00 52.97  ? 204  GLU B O   1 
ATOM   7237  C CB  . GLU B 1 182 ? 62.972  23.599  5.150   1.00 61.66  ? 204  GLU B CB  1 
ATOM   7238  C CG  . GLU B 1 182 ? 64.452  23.908  5.371   1.00 68.10  ? 204  GLU B CG  1 
ATOM   7239  C CD  . GLU B 1 182 ? 65.113  22.981  6.372   1.00 70.04  ? 204  GLU B CD  1 
ATOM   7240  O OE1 . GLU B 1 182 ? 64.408  22.134  6.964   1.00 70.32  ? 204  GLU B OE1 1 
ATOM   7241  O OE2 . GLU B 1 182 ? 66.342  23.099  6.557   1.00 70.16  ? 204  GLU B OE2 1 
ATOM   7242  N N   . LEU B 1 183 ? 60.055  23.964  4.383   1.00 50.59  ? 205  LEU B N   1 
ATOM   7243  C CA  . LEU B 1 183 ? 58.684  23.546  4.135   1.00 49.04  ? 205  LEU B CA  1 
ATOM   7244  C C   . LEU B 1 183 ? 57.823  24.745  3.783   1.00 54.69  ? 205  LEU B C   1 
ATOM   7245  O O   . LEU B 1 183 ? 57.881  25.776  4.452   1.00 56.52  ? 205  LEU B O   1 
ATOM   7246  C CB  . LEU B 1 183 ? 58.105  22.848  5.374   1.00 47.99  ? 205  LEU B CB  1 
ATOM   7247  C CG  . LEU B 1 183 ? 56.758  22.126  5.249   1.00 46.30  ? 205  LEU B CG  1 
ATOM   7248  C CD1 . LEU B 1 183 ? 56.661  20.984  6.260   1.00 45.35  ? 205  LEU B CD1 1 
ATOM   7249  C CD2 . LEU B 1 183 ? 55.597  23.088  5.444   1.00 47.40  ? 205  LEU B CD2 1 
ATOM   7250  N N   . LEU B 1 184 ? 57.012  24.591  2.741   1.00 51.27  ? 206  LEU B N   1 
ATOM   7251  C CA  . LEU B 1 184 ? 56.030  25.601  2.353   1.00 50.11  ? 206  LEU B CA  1 
ATOM   7252  C C   . LEU B 1 184 ? 54.685  24.938  2.063   1.00 47.16  ? 206  LEU B C   1 
ATOM   7253  O O   . LEU B 1 184 ? 54.605  24.035  1.231   1.00 56.71  ? 206  LEU B O   1 
ATOM   7254  C CB  . LEU B 1 184 ? 56.501  26.368  1.117   1.00 49.86  ? 206  LEU B CB  1 
ATOM   7255  C CG  . LEU B 1 184 ? 55.461  27.336  0.541   1.00 57.94  ? 206  LEU B CG  1 
ATOM   7256  C CD1 . LEU B 1 184 ? 55.123  28.413  1.560   1.00 58.38  ? 206  LEU B CD1 1 
ATOM   7257  C CD2 . LEU B 1 184 ? 55.912  27.957  -0.780  1.00 51.09  ? 206  LEU B CD2 1 
ATOM   7258  N N   . SER B 1 185 ? 53.630  25.371  2.748   1.00 46.75  ? 207  SER B N   1 
ATOM   7259  C CA  . SER B 1 185 ? 52.313  24.783  2.520   1.00 51.38  ? 207  SER B CA  1 
ATOM   7260  C C   . SER B 1 185 ? 51.293  25.815  2.061   1.00 52.66  ? 207  SER B C   1 
ATOM   7261  O O   . SER B 1 185 ? 50.907  26.701  2.819   1.00 54.28  ? 207  SER B O   1 
ATOM   7262  C CB  . SER B 1 185 ? 51.818  24.055  3.770   1.00 49.48  ? 207  SER B CB  1 
ATOM   7263  O OG  . SER B 1 185 ? 50.465  23.665  3.625   1.00 48.90  ? 207  SER B OG  1 
ATOM   7264  N N   . LEU B 1 186 ? 50.918  25.718  0.789   1.00 51.37  ? 208  LEU B N   1 
ATOM   7265  C CA  . LEU B 1 186 ? 49.887  26.559  0.180   1.00 51.33  ? 208  LEU B CA  1 
ATOM   7266  C C   . LEU B 1 186 ? 48.526  25.878  -0.058  1.00 52.46  ? 208  LEU B C   1 
ATOM   7267  O O   . LEU B 1 186 ? 47.659  26.445  -0.723  1.00 53.87  ? 208  LEU B O   1 
ATOM   7268  C CB  . LEU B 1 186 ? 50.421  27.247  -1.081  1.00 46.87  ? 208  LEU B CB  1 
ATOM   7269  C CG  . LEU B 1 186 ? 51.528  28.259  -0.772  1.00 48.46  ? 208  LEU B CG  1 
ATOM   7270  C CD1 . LEU B 1 186 ? 52.237  28.742  -2.035  1.00 51.22  ? 208  LEU B CD1 1 
ATOM   7271  C CD2 . LEU B 1 186 ? 50.955  29.435  -0.012  1.00 49.20  ? 208  LEU B CD2 1 
ATOM   7272  N N   . SER B 1 187 ? 48.369  24.649  0.427   1.00 49.14  ? 209  SER B N   1 
ATOM   7273  C CA  . SER B 1 187 ? 47.195  23.828  0.107   1.00 45.81  ? 209  SER B CA  1 
ATOM   7274  C C   . SER B 1 187 ? 45.856  24.454  0.501   1.00 44.06  ? 209  SER B C   1 
ATOM   7275  O O   . SER B 1 187 ? 45.786  25.285  1.406   1.00 44.53  ? 209  SER B O   1 
ATOM   7276  C CB  . SER B 1 187 ? 47.310  22.435  0.745   1.00 43.51  ? 209  SER B CB  1 
ATOM   7277  O OG  . SER B 1 187 ? 48.589  21.873  0.503   1.00 43.46  ? 209  SER B OG  1 
ATOM   7278  N N   . PHE B 1 188 ? 44.802  24.051  -0.207  1.00 41.69  ? 210  PHE B N   1 
ATOM   7279  C CA  . PHE B 1 188 ? 43.444  24.543  0.026   1.00 45.08  ? 210  PHE B CA  1 
ATOM   7280  C C   . PHE B 1 188 ? 43.376  26.061  -0.081  1.00 48.73  ? 210  PHE B C   1 
ATOM   7281  O O   . PHE B 1 188 ? 42.892  26.757  0.815   1.00 49.26  ? 210  PHE B O   1 
ATOM   7282  C CB  . PHE B 1 188 ? 42.871  24.004  1.344   1.00 43.11  ? 210  PHE B CB  1 
ATOM   7283  C CG  . PHE B 1 188 ? 42.672  22.516  1.332   1.00 43.35  ? 210  PHE B CG  1 
ATOM   7284  C CD1 . PHE B 1 188 ? 41.490  21.968  0.857   1.00 42.00  ? 210  PHE B CD1 1 
ATOM   7285  C CD2 . PHE B 1 188 ? 43.683  21.662  1.748   1.00 45.10  ? 210  PHE B CD2 1 
ATOM   7286  C CE1 . PHE B 1 188 ? 41.308  20.601  0.807   1.00 36.55  ? 210  PHE B CE1 1 
ATOM   7287  C CE2 . PHE B 1 188 ? 43.506  20.290  1.708   1.00 41.86  ? 210  PHE B CE2 1 
ATOM   7288  C CZ  . PHE B 1 188 ? 42.304  19.761  1.229   1.00 36.20  ? 210  PHE B CZ  1 
ATOM   7289  N N   . ASN B 1 189 ? 43.904  26.546  -1.199  1.00 48.63  ? 211  ASN B N   1 
ATOM   7290  C CA  . ASN B 1 189 ? 43.871  27.947  -1.583  1.00 47.92  ? 211  ASN B CA  1 
ATOM   7291  C C   . ASN B 1 189 ? 43.745  27.984  -3.094  1.00 49.90  ? 211  ASN B C   1 
ATOM   7292  O O   . ASN B 1 189 ? 44.176  27.052  -3.768  1.00 50.35  ? 211  ASN B O   1 
ATOM   7293  C CB  . ASN B 1 189 ? 45.166  28.644  -1.174  1.00 48.85  ? 211  ASN B CB  1 
ATOM   7294  C CG  . ASN B 1 189 ? 45.136  29.130  0.248   1.00 50.65  ? 211  ASN B CG  1 
ATOM   7295  O OD1 . ASN B 1 189 ? 44.399  30.059  0.581   1.00 53.75  ? 211  ASN B OD1 1 
ATOM   7296  N ND2 . ASN B 1 189 ? 45.946  28.516  1.099   1.00 47.76  ? 211  ASN B ND2 1 
ATOM   7297  N N   . SER B 1 190 ? 43.184  29.052  -3.644  1.00 52.41  ? 212  SER B N   1 
ATOM   7298  C CA  . SER B 1 190 ? 43.042  29.108  -5.092  1.00 53.25  ? 212  SER B CA  1 
ATOM   7299  C C   . SER B 1 190 ? 44.254  29.794  -5.721  1.00 53.28  ? 212  SER B C   1 
ATOM   7300  O O   . SER B 1 190 ? 44.412  31.015  -5.642  1.00 56.31  ? 212  SER B O   1 
ATOM   7301  C CB  . SER B 1 190 ? 41.751  29.825  -5.473  1.00 52.51  ? 212  SER B CB  1 
ATOM   7302  O OG  . SER B 1 190 ? 41.684  30.006  -6.871  1.00 55.97  ? 212  SER B OG  1 
ATOM   7303  N N   . LEU B 1 191 ? 45.079  28.989  -6.385  1.00 48.71  ? 213  LEU B N   1 
ATOM   7304  C CA  . LEU B 1 191 ? 46.375  29.423  -6.929  1.00 48.42  ? 213  LEU B CA  1 
ATOM   7305  C C   . LEU B 1 191 ? 46.357  29.513  -8.453  1.00 49.03  ? 213  LEU B C   1 
ATOM   7306  O O   . LEU B 1 191 ? 46.751  30.528  -9.012  1.00 54.96  ? 213  LEU B O   1 
ATOM   7307  C CB  . LEU B 1 191 ? 47.534  28.535  -6.450  1.00 49.32  ? 213  LEU B CB  1 
ATOM   7308  C CG  . LEU B 1 191 ? 47.862  28.530  -4.949  1.00 50.54  ? 213  LEU B CG  1 
ATOM   7309  C CD1 . LEU B 1 191 ? 49.192  27.830  -4.669  1.00 49.07  ? 213  LEU B CD1 1 
ATOM   7310  C CD2 . LEU B 1 191 ? 47.883  29.946  -4.418  1.00 53.05  ? 213  LEU B CD2 1 
ATOM   7311  N N   . SER B 1 192 ? 45.990  28.397  -9.085  1.00 57.16  ? 214  SER B N   1 
ATOM   7312  C CA  . SER B 1 192 ? 45.926  28.181  -10.542 1.00 59.81  ? 214  SER B CA  1 
ATOM   7313  C C   . SER B 1 192 ? 47.269  27.884  -11.192 1.00 60.87  ? 214  SER B C   1 
ATOM   7314  O O   . SER B 1 192 ? 47.311  27.271  -12.259 1.00 65.69  ? 214  SER B O   1 
ATOM   7315  C CB  . SER B 1 192 ? 45.278  29.372  -11.277 1.00 61.92  ? 214  SER B CB  1 
ATOM   7316  O OG  . SER B 1 192 ? 43.914  29.524  -10.934 1.00 64.61  ? 214  SER B OG  1 
ATOM   7317  N N   . HIS B 1 193 ? 48.357  28.242  -10.523 1.00 58.02  ? 215  HIS B N   1 
ATOM   7318  C CA  . HIS B 1 193 ? 49.690  27.990  -11.054 1.00 61.93  ? 215  HIS B CA  1 
ATOM   7319  C C   . HIS B 1 193 ? 50.655  27.833  -9.898  1.00 59.40  ? 215  HIS B C   1 
ATOM   7320  O O   . HIS B 1 193 ? 50.504  28.490  -8.873  1.00 58.64  ? 215  HIS B O   1 
ATOM   7321  C CB  . HIS B 1 193 ? 50.176  29.155  -11.935 1.00 67.97  ? 215  HIS B CB  1 
ATOM   7322  C CG  . HIS B 1 193 ? 49.314  29.427  -13.125 1.00 75.87  ? 215  HIS B CG  1 
ATOM   7323  N ND1 . HIS B 1 193 ? 49.417  28.713  -14.302 1.00 77.71  ? 215  HIS B ND1 1 
ATOM   7324  C CD2 . HIS B 1 193 ? 48.337  30.343  -13.327 1.00 79.23  ? 215  HIS B CD2 1 
ATOM   7325  C CE1 . HIS B 1 193 ? 48.535  29.172  -15.171 1.00 78.33  ? 215  HIS B CE1 1 
ATOM   7326  N NE2 . HIS B 1 193 ? 47.870  30.164  -14.606 1.00 79.08  ? 215  HIS B NE2 1 
ATOM   7327  N N   . VAL B 1 194 ? 51.653  26.975  -10.071 1.00 56.99  ? 216  VAL B N   1 
ATOM   7328  C CA  . VAL B 1 194 ? 52.757  26.909  -9.130  1.00 55.66  ? 216  VAL B CA  1 
ATOM   7329  C C   . VAL B 1 194 ? 53.402  28.281  -9.111  1.00 59.03  ? 216  VAL B C   1 
ATOM   7330  O O   . VAL B 1 194 ? 53.790  28.789  -10.163 1.00 61.59  ? 216  VAL B O   1 
ATOM   7331  C CB  . VAL B 1 194 ? 53.827  25.915  -9.594  1.00 54.23  ? 216  VAL B CB  1 
ATOM   7332  C CG1 . VAL B 1 194 ? 55.008  25.910  -8.617  1.00 52.91  ? 216  VAL B CG1 1 
ATOM   7333  C CG2 . VAL B 1 194 ? 53.234  24.526  -9.769  1.00 48.53  ? 216  VAL B CG2 1 
ATOM   7334  N N   . PRO B 1 195 ? 53.492  28.904  -7.925  1.00 57.08  ? 217  PRO B N   1 
ATOM   7335  C CA  . PRO B 1 195 ? 54.158  30.209  -7.860  1.00 54.92  ? 217  PRO B CA  1 
ATOM   7336  C C   . PRO B 1 195 ? 55.596  30.109  -8.354  1.00 56.90  ? 217  PRO B C   1 
ATOM   7337  O O   . PRO B 1 195 ? 56.275  29.124  -8.068  1.00 55.20  ? 217  PRO B O   1 
ATOM   7338  C CB  . PRO B 1 195 ? 54.105  30.570  -6.371  1.00 56.21  ? 217  PRO B CB  1 
ATOM   7339  C CG  . PRO B 1 195 ? 53.662  29.309  -5.655  1.00 55.12  ? 217  PRO B CG  1 
ATOM   7340  C CD  . PRO B 1 195 ? 52.883  28.515  -6.641  1.00 54.75  ? 217  PRO B CD  1 
ATOM   7341  N N   . PRO B 1 196 ? 56.044  31.099  -9.139  1.00 58.28  ? 218  PRO B N   1 
ATOM   7342  C CA  . PRO B 1 196 ? 57.430  31.037  -9.597  1.00 58.61  ? 218  PRO B CA  1 
ATOM   7343  C C   . PRO B 1 196 ? 58.390  31.596  -8.557  1.00 59.42  ? 218  PRO B C   1 
ATOM   7344  O O   . PRO B 1 196 ? 57.960  32.138  -7.534  1.00 58.62  ? 218  PRO B O   1 
ATOM   7345  C CB  . PRO B 1 196 ? 57.428  31.942  -10.836 1.00 60.37  ? 218  PRO B CB  1 
ATOM   7346  C CG  . PRO B 1 196 ? 56.329  32.914  -10.587 1.00 61.90  ? 218  PRO B CG  1 
ATOM   7347  C CD  . PRO B 1 196 ? 55.268  32.139  -9.837  1.00 60.16  ? 218  PRO B CD  1 
ATOM   7348  N N   . LYS B 1 197 ? 59.679  31.486  -8.854  1.00 59.08  ? 219  LYS B N   1 
ATOM   7349  C CA  . LYS B 1 197 ? 60.730  32.019  -8.002  1.00 65.12  ? 219  LYS B CA  1 
ATOM   7350  C C   . LYS B 1 197 ? 60.660  31.483  -6.573  1.00 65.83  ? 219  LYS B C   1 
ATOM   7351  O O   . LYS B 1 197 ? 60.654  32.242  -5.603  1.00 67.34  ? 219  LYS B O   1 
ATOM   7352  C CB  . LYS B 1 197 ? 60.717  33.546  -8.049  1.00 67.20  ? 219  LYS B CB  1 
ATOM   7353  C CG  . LYS B 1 197 ? 60.851  34.078  -9.471  1.00 69.34  ? 219  LYS B CG  1 
ATOM   7354  C CD  . LYS B 1 197 ? 60.629  35.575  -9.544  1.00 71.22  ? 219  LYS B CD  1 
ATOM   7355  C CE  . LYS B 1 197 ? 60.752  36.080  -10.973 1.00 73.59  ? 219  LYS B CE  1 
ATOM   7356  N NZ  . LYS B 1 197 ? 60.637  37.559  -11.041 1.00 67.23  ? 219  LYS B NZ  1 
ATOM   7357  N N   . LEU B 1 198 ? 60.600  30.159  -6.470  1.00 64.39  ? 220  LEU B N   1 
ATOM   7358  C CA  . LEU B 1 198 ? 60.660  29.468  -5.188  1.00 63.79  ? 220  LEU B CA  1 
ATOM   7359  C C   . LEU B 1 198 ? 62.110  29.122  -4.825  1.00 65.45  ? 220  LEU B C   1 
ATOM   7360  O O   . LEU B 1 198 ? 62.872  28.628  -5.657  1.00 64.08  ? 220  LEU B O   1 
ATOM   7361  C CB  . LEU B 1 198 ? 59.779  28.210  -5.203  1.00 60.42  ? 220  LEU B CB  1 
ATOM   7362  C CG  . LEU B 1 198 ? 58.276  28.481  -5.336  1.00 61.66  ? 220  LEU B CG  1 
ATOM   7363  C CD1 . LEU B 1 198 ? 57.434  27.227  -5.236  1.00 61.43  ? 220  LEU B CD1 1 
ATOM   7364  C CD2 . LEU B 1 198 ? 57.845  29.450  -4.283  1.00 62.69  ? 220  LEU B CD2 1 
ATOM   7365  N N   . PRO B 1 199 ? 62.498  29.399  -3.574  1.00 67.53  ? 221  PRO B N   1 
ATOM   7366  C CA  . PRO B 1 199 ? 63.854  29.137  -3.078  1.00 67.88  ? 221  PRO B CA  1 
ATOM   7367  C C   . PRO B 1 199 ? 64.249  27.666  -3.203  1.00 65.53  ? 221  PRO B C   1 
ATOM   7368  O O   . PRO B 1 199 ? 63.430  26.775  -2.973  1.00 63.17  ? 221  PRO B O   1 
ATOM   7369  C CB  . PRO B 1 199 ? 63.762  29.526  -1.602  1.00 69.17  ? 221  PRO B CB  1 
ATOM   7370  C CG  . PRO B 1 199 ? 62.302  29.471  -1.268  1.00 65.57  ? 221  PRO B CG  1 
ATOM   7371  C CD  . PRO B 1 199 ? 61.614  29.915  -2.517  1.00 67.96  ? 221  PRO B CD  1 
ATOM   7372  N N   . SER B 1 200 ? 65.511  27.421  -3.535  1.00 66.71  ? 222  SER B N   1 
ATOM   7373  C CA  . SER B 1 200 ? 65.970  26.073  -3.841  1.00 66.92  ? 222  SER B CA  1 
ATOM   7374  C C   . SER B 1 200 ? 66.298  25.286  -2.575  1.00 66.14  ? 222  SER B C   1 
ATOM   7375  O O   . SER B 1 200 ? 66.709  24.127  -2.637  1.00 64.43  ? 222  SER B O   1 
ATOM   7376  C CB  . SER B 1 200 ? 67.181  26.125  -4.772  1.00 68.89  ? 222  SER B CB  1 
ATOM   7377  O OG  . SER B 1 200 ? 68.228  26.884  -4.196  1.00 71.80  ? 222  SER B OG  1 
ATOM   7378  N N   . SER B 1 201 ? 66.118  25.928  -1.428  1.00 66.12  ? 223  SER B N   1 
ATOM   7379  C CA  . SER B 1 201 ? 66.346  25.280  -0.148  1.00 66.61  ? 223  SER B CA  1 
ATOM   7380  C C   . SER B 1 201 ? 65.175  24.390  0.250   1.00 69.23  ? 223  SER B C   1 
ATOM   7381  O O   . SER B 1 201 ? 65.259  23.665  1.242   1.00 71.73  ? 223  SER B O   1 
ATOM   7382  C CB  . SER B 1 201 ? 66.588  26.329  0.939   1.00 67.01  ? 223  SER B CB  1 
ATOM   7383  O OG  . SER B 1 201 ? 65.497  27.231  1.033   1.00 58.64  ? 223  SER B OG  1 
ATOM   7384  N N   . LEU B 1 202 ? 64.088  24.453  -0.519  1.00 66.94  ? 224  LEU B N   1 
ATOM   7385  C CA  . LEU B 1 202 ? 62.858  23.731  -0.189  1.00 62.98  ? 224  LEU B CA  1 
ATOM   7386  C C   . LEU B 1 202 ? 63.042  22.222  -0.058  1.00 61.47  ? 224  LEU B C   1 
ATOM   7387  O O   . LEU B 1 202 ? 63.705  21.581  -0.874  1.00 61.23  ? 224  LEU B O   1 
ATOM   7388  C CB  . LEU B 1 202 ? 61.747  24.021  -1.206  1.00 59.99  ? 224  LEU B CB  1 
ATOM   7389  C CG  . LEU B 1 202 ? 60.922  25.300  -1.060  1.00 57.38  ? 224  LEU B CG  1 
ATOM   7390  C CD1 . LEU B 1 202 ? 59.797  25.306  -2.086  1.00 54.33  ? 224  LEU B CD1 1 
ATOM   7391  C CD2 . LEU B 1 202 ? 60.355  25.421  0.351   1.00 54.35  ? 224  LEU B CD2 1 
ATOM   7392  N N   . ARG B 1 203 ? 62.434  21.679  0.988   1.00 59.40  ? 225  ARG B N   1 
ATOM   7393  C CA  . ARG B 1 203 ? 62.401  20.253  1.270   1.00 56.65  ? 225  ARG B CA  1 
ATOM   7394  C C   . ARG B 1 203 ? 61.038  19.702  0.885   1.00 51.70  ? 225  ARG B C   1 
ATOM   7395  O O   . ARG B 1 203 ? 60.923  18.687  0.201   1.00 49.81  ? 225  ARG B O   1 
ATOM   7396  C CB  . ARG B 1 203 ? 62.673  19.990  2.750   1.00 61.95  ? 225  ARG B CB  1 
ATOM   7397  C CG  . ARG B 1 203 ? 64.027  20.487  3.206   1.00 68.30  ? 225  ARG B CG  1 
ATOM   7398  C CD  . ARG B 1 203 ? 65.134  19.902  2.359   1.00 71.83  ? 225  ARG B CD  1 
ATOM   7399  N NE  . ARG B 1 203 ? 66.440  20.351  2.827   1.00 78.97  ? 225  ARG B NE  1 
ATOM   7400  C CZ  . ARG B 1 203 ? 67.136  19.755  3.792   1.00 82.01  ? 225  ARG B CZ  1 
ATOM   7401  N NH1 . ARG B 1 203 ? 66.657  18.674  4.395   1.00 79.88  ? 225  ARG B NH1 1 
ATOM   7402  N NH2 . ARG B 1 203 ? 68.318  20.242  4.154   1.00 85.37  ? 225  ARG B NH2 1 
ATOM   7403  N N   . LYS B 1 204 ? 60.008  20.317  1.446   1.00 51.63  ? 226  LYS B N   1 
ATOM   7404  C CA  . LYS B 1 204 ? 58.642  19.861  1.278   1.00 49.37  ? 226  LYS B CA  1 
ATOM   7405  C C   . LYS B 1 204 ? 57.788  20.991  0.726   1.00 47.07  ? 226  LYS B C   1 
ATOM   7406  O O   . LYS B 1 204 ? 57.845  22.114  1.215   1.00 48.99  ? 226  LYS B O   1 
ATOM   7407  C CB  . LYS B 1 204 ? 58.094  19.406  2.634   1.00 45.48  ? 226  LYS B CB  1 
ATOM   7408  C CG  . LYS B 1 204 ? 59.086  18.567  3.429   1.00 45.73  ? 226  LYS B CG  1 
ATOM   7409  C CD  . LYS B 1 204 ? 58.456  17.944  4.675   1.00 44.86  ? 226  LYS B CD  1 
ATOM   7410  C CE  . LYS B 1 204 ? 59.429  16.974  5.320   1.00 51.60  ? 226  LYS B CE  1 
ATOM   7411  N NZ  . LYS B 1 204 ? 58.777  16.038  6.274   1.00 55.72  ? 226  LYS B NZ  1 
ATOM   7412  N N   . LEU B 1 205 ? 56.990  20.691  -0.290  1.00 45.81  ? 227  LEU B N   1 
ATOM   7413  C CA  . LEU B 1 205 ? 56.136  21.700  -0.896  1.00 45.94  ? 227  LEU B CA  1 
ATOM   7414  C C   . LEU B 1 205 ? 54.721  21.169  -1.001  1.00 44.52  ? 227  LEU B C   1 
ATOM   7415  O O   . LEU B 1 205 ? 54.476  20.188  -1.700  1.00 53.06  ? 227  LEU B O   1 
ATOM   7416  C CB  . LEU B 1 205 ? 56.671  22.076  -2.282  1.00 53.62  ? 227  LEU B CB  1 
ATOM   7417  C CG  . LEU B 1 205 ? 55.844  23.024  -3.151  1.00 47.14  ? 227  LEU B CG  1 
ATOM   7418  C CD1 . LEU B 1 205 ? 55.629  24.354  -2.450  1.00 47.92  ? 227  LEU B CD1 1 
ATOM   7419  C CD2 . LEU B 1 205 ? 56.535  23.232  -4.493  1.00 48.11  ? 227  LEU B CD2 1 
ATOM   7420  N N   . PHE B 1 206 ? 53.786  21.815  -0.310  1.00 45.51  ? 228  PHE B N   1 
ATOM   7421  C CA  . PHE B 1 206 ? 52.393  21.361  -0.316  1.00 42.94  ? 228  PHE B CA  1 
ATOM   7422  C C   . PHE B 1 206 ? 51.511  22.245  -1.209  1.00 50.26  ? 228  PHE B C   1 
ATOM   7423  O O   . PHE B 1 206 ? 51.237  23.404  -0.890  1.00 52.13  ? 228  PHE B O   1 
ATOM   7424  C CB  . PHE B 1 206 ? 51.842  21.320  1.116   1.00 42.34  ? 228  PHE B CB  1 
ATOM   7425  C CG  . PHE B 1 206 ? 52.541  20.331  2.019   1.00 41.96  ? 228  PHE B CG  1 
ATOM   7426  C CD1 . PHE B 1 206 ? 53.684  20.694  2.726   1.00 42.95  ? 228  PHE B CD1 1 
ATOM   7427  C CD2 . PHE B 1 206 ? 52.040  19.049  2.187   1.00 40.69  ? 228  PHE B CD2 1 
ATOM   7428  C CE1 . PHE B 1 206 ? 54.318  19.795  3.567   1.00 42.70  ? 228  PHE B CE1 1 
ATOM   7429  C CE2 . PHE B 1 206 ? 52.669  18.143  3.031   1.00 40.42  ? 228  PHE B CE2 1 
ATOM   7430  C CZ  . PHE B 1 206 ? 53.818  18.522  3.722   1.00 41.44  ? 228  PHE B CZ  1 
ATOM   7431  N N   . LEU B 1 207 ? 51.144  21.703  -2.365  1.00 49.30  ? 229  LEU B N   1 
ATOM   7432  C CA  . LEU B 1 207 ? 50.229  22.336  -3.320  1.00 48.79  ? 229  LEU B CA  1 
ATOM   7433  C C   . LEU B 1 207 ? 48.805  21.752  -3.415  1.00 47.75  ? 229  LEU B C   1 
ATOM   7434  O O   . LEU B 1 207 ? 48.111  21.986  -4.405  1.00 48.29  ? 229  LEU B O   1 
ATOM   7435  C CB  . LEU B 1 207 ? 50.885  22.529  -4.691  1.00 43.86  ? 229  LEU B CB  1 
ATOM   7436  C CG  . LEU B 1 207 ? 52.158  23.389  -4.615  1.00 45.28  ? 229  LEU B CG  1 
ATOM   7437  C CD1 . LEU B 1 207 ? 52.934  23.367  -5.929  1.00 48.39  ? 229  LEU B CD1 1 
ATOM   7438  C CD2 . LEU B 1 207 ? 51.857  24.824  -4.192  1.00 46.18  ? 229  LEU B CD2 1 
ATOM   7439  N N   . SER B 1 208 ? 48.427  20.896  -2.471  1.00 46.28  ? 230  SER B N   1 
ATOM   7440  C CA  . SER B 1 208 ? 47.152  20.182  -2.542  1.00 44.65  ? 230  SER B CA  1 
ATOM   7441  C C   . SER B 1 208 ? 45.949  21.101  -2.742  1.00 44.51  ? 230  SER B C   1 
ATOM   7442  O O   . SER B 1 208 ? 45.929  22.204  -2.212  1.00 46.50  ? 230  SER B O   1 
ATOM   7443  C CB  . SER B 1 208 ? 46.939  19.334  -1.284  1.00 42.56  ? 230  SER B CB  1 
ATOM   7444  O OG  . SER B 1 208 ? 45.811  18.483  -1.429  1.00 39.53  ? 230  SER B OG  1 
ATOM   7445  N N   . ASN B 1 209 ? 44.968  20.643  -3.527  1.00 44.80  ? 231  ASN B N   1 
ATOM   7446  C CA  . ASN B 1 209 ? 43.692  21.345  -3.712  1.00 39.14  ? 231  ASN B CA  1 
ATOM   7447  C C   . ASN B 1 209 ? 43.849  22.827  -4.035  1.00 40.47  ? 231  ASN B C   1 
ATOM   7448  O O   . ASN B 1 209 ? 43.258  23.684  -3.381  1.00 40.77  ? 231  ASN B O   1 
ATOM   7449  C CB  . ASN B 1 209 ? 42.805  21.167  -2.475  1.00 50.98  ? 231  ASN B CB  1 
ATOM   7450  C CG  . ASN B 1 209 ? 42.152  19.801  -2.421  1.00 48.21  ? 231  ASN B CG  1 
ATOM   7451  O OD1 . ASN B 1 209 ? 40.950  19.681  -2.624  1.00 45.20  ? 231  ASN B OD1 1 
ATOM   7452  N ND2 . ASN B 1 209 ? 42.945  18.764  -2.178  1.00 36.52  ? 231  ASN B ND2 1 
ATOM   7453  N N   . THR B 1 210 ? 44.730  23.116  -4.987  1.00 42.62  ? 232  THR B N   1 
ATOM   7454  C CA  . THR B 1 210 ? 45.018  24.490  -5.388  1.00 44.48  ? 232  THR B CA  1 
ATOM   7455  C C   . THR B 1 210 ? 44.465  24.983  -6.724  1.00 46.23  ? 232  THR B C   1 
ATOM   7456  O O   . THR B 1 210 ? 44.767  26.107  -7.134  1.00 44.66  ? 232  THR B O   1 
ATOM   7457  C CB  . THR B 1 210 ? 46.507  24.800  -5.263  1.00 46.03  ? 232  THR B CB  1 
ATOM   7458  O OG1 . THR B 1 210 ? 47.258  23.807  -5.970  1.00 43.34  ? 232  THR B OG1 1 
ATOM   7459  C CG2 . THR B 1 210 ? 46.898  24.788  -3.791  1.00 43.37  ? 232  THR B CG2 1 
ATOM   7460  N N   . GLN B 1 211 ? 43.711  24.128  -7.411  1.00 48.80  ? 233  GLN B N   1 
ATOM   7461  C CA  . GLN B 1 211 ? 43.148  24.444  -8.729  1.00 50.81  ? 233  GLN B CA  1 
ATOM   7462  C C   . GLN B 1 211 ? 44.232  24.683  -9.773  1.00 52.18  ? 233  GLN B C   1 
ATOM   7463  O O   . GLN B 1 211 ? 44.096  25.557  -10.623 1.00 45.33  ? 233  GLN B O   1 
ATOM   7464  C CB  . GLN B 1 211 ? 42.219  25.663  -8.672  1.00 53.45  ? 233  GLN B CB  1 
ATOM   7465  C CG  . GLN B 1 211 ? 41.041  25.524  -7.735  1.00 59.66  ? 233  GLN B CG  1 
ATOM   7466  C CD  . GLN B 1 211 ? 40.211  26.792  -7.680  1.00 66.85  ? 233  GLN B CD  1 
ATOM   7467  O OE1 . GLN B 1 211 ? 40.428  27.724  -8.456  1.00 71.20  ? 233  GLN B OE1 1 
ATOM   7468  N NE2 . GLN B 1 211 ? 39.258  26.836  -6.759  1.00 67.54  ? 233  GLN B NE2 1 
ATOM   7469  N N   . ILE B 1 212 ? 45.314  23.918  -9.686  1.00 52.35  ? 234  ILE B N   1 
ATOM   7470  C CA  . ILE B 1 212 ? 46.376  23.974  -10.683 1.00 50.99  ? 234  ILE B CA  1 
ATOM   7471  C C   . ILE B 1 212 ? 46.146  22.879  -11.717 1.00 51.82  ? 234  ILE B C   1 
ATOM   7472  O O   . ILE B 1 212 ? 46.167  21.690  -11.387 1.00 55.63  ? 234  ILE B O   1 
ATOM   7473  C CB  . ILE B 1 212 ? 47.752  23.774  -10.038 1.00 51.78  ? 234  ILE B CB  1 
ATOM   7474  C CG1 . ILE B 1 212 ? 47.980  24.826  -8.948  1.00 54.17  ? 234  ILE B CG1 1 
ATOM   7475  C CG2 . ILE B 1 212 ? 48.846  23.829  -11.097 1.00 50.74  ? 234  ILE B CG2 1 
ATOM   7476  C CD1 . ILE B 1 212 ? 49.319  24.713  -8.247  1.00 54.17  ? 234  ILE B CD1 1 
ATOM   7477  N N   . LYS B 1 213 ? 45.883  23.287  -12.954 1.00 51.70  ? 235  LYS B N   1 
ATOM   7478  C CA  . LYS B 1 213 ? 45.592  22.354  -14.046 1.00 54.77  ? 235  LYS B CA  1 
ATOM   7479  C C   . LYS B 1 213 ? 46.864  21.785  -14.655 1.00 50.79  ? 235  LYS B C   1 
ATOM   7480  O O   . LYS B 1 213 ? 46.916  20.626  -15.060 1.00 49.21  ? 235  LYS B O   1 
ATOM   7481  C CB  . LYS B 1 213 ? 44.797  23.041  -15.165 1.00 60.67  ? 235  LYS B CB  1 
ATOM   7482  C CG  . LYS B 1 213 ? 43.739  24.037  -14.709 1.00 68.87  ? 235  LYS B CG  1 
ATOM   7483  C CD  . LYS B 1 213 ? 42.828  23.451  -13.634 1.00 73.23  ? 235  LYS B CD  1 
ATOM   7484  C CE  . LYS B 1 213 ? 41.601  24.322  -13.377 1.00 74.66  ? 235  LYS B CE  1 
ATOM   7485  N NZ  . LYS B 1 213 ? 40.384  23.789  -14.058 1.00 72.94  ? 235  LYS B NZ  1 
ATOM   7486  N N   . TYR B 1 214 ? 47.887  22.619  -14.741 1.00 50.38  ? 236  TYR B N   1 
ATOM   7487  C CA  . TYR B 1 214 ? 49.048  22.270  -15.536 1.00 55.86  ? 236  TYR B CA  1 
ATOM   7488  C C   . TYR B 1 214 ? 50.332  22.418  -14.743 1.00 55.65  ? 236  TYR B C   1 
ATOM   7489  O O   . TYR B 1 214 ? 50.549  23.426  -14.071 1.00 56.22  ? 236  TYR B O   1 
ATOM   7490  C CB  . TYR B 1 214 ? 49.078  23.116  -16.824 1.00 58.90  ? 236  TYR B CB  1 
ATOM   7491  C CG  . TYR B 1 214 ? 50.319  22.927  -17.664 1.00 64.33  ? 236  TYR B CG  1 
ATOM   7492  C CD1 . TYR B 1 214 ? 50.588  21.712  -18.282 1.00 65.23  ? 236  TYR B CD1 1 
ATOM   7493  C CD2 . TYR B 1 214 ? 51.221  23.970  -17.847 1.00 66.24  ? 236  TYR B CD2 1 
ATOM   7494  C CE1 . TYR B 1 214 ? 51.731  21.541  -19.051 1.00 64.77  ? 236  TYR B CE1 1 
ATOM   7495  C CE2 . TYR B 1 214 ? 52.356  23.807  -18.610 1.00 66.19  ? 236  TYR B CE2 1 
ATOM   7496  C CZ  . TYR B 1 214 ? 52.609  22.592  -19.208 1.00 66.38  ? 236  TYR B CZ  1 
ATOM   7497  O OH  . TYR B 1 214 ? 53.746  22.436  -19.969 1.00 67.34  ? 236  TYR B OH  1 
ATOM   7498  N N   . ILE B 1 215 ? 51.166  21.386  -14.808 1.00 56.31  ? 237  ILE B N   1 
ATOM   7499  C CA  . ILE B 1 215 ? 52.513  21.440  -14.247 1.00 54.25  ? 237  ILE B CA  1 
ATOM   7500  C C   . ILE B 1 215 ? 53.537  21.433  -15.387 1.00 52.62  ? 237  ILE B C   1 
ATOM   7501  O O   . ILE B 1 215 ? 53.621  20.468  -16.146 1.00 52.50  ? 237  ILE B O   1 
ATOM   7502  C CB  . ILE B 1 215 ? 52.795  20.242  -13.333 1.00 50.97  ? 237  ILE B CB  1 
ATOM   7503  C CG1 . ILE B 1 215 ? 51.806  20.209  -12.166 1.00 50.48  ? 237  ILE B CG1 1 
ATOM   7504  C CG2 . ILE B 1 215 ? 54.222  20.302  -12.823 1.00 54.25  ? 237  ILE B CG2 1 
ATOM   7505  C CD1 . ILE B 1 215 ? 51.828  21.450  -11.309 1.00 51.42  ? 237  ILE B CD1 1 
ATOM   7506  N N   . SER B 1 216 ? 54.315  22.500  -15.508 1.00 50.29  ? 238  SER B N   1 
ATOM   7507  C CA  . SER B 1 216 ? 55.286  22.580  -16.588 1.00 59.20  ? 238  SER B CA  1 
ATOM   7508  C C   . SER B 1 216 ? 56.670  22.103  -16.173 1.00 61.20  ? 238  SER B C   1 
ATOM   7509  O O   . SER B 1 216 ? 56.927  21.818  -15.003 1.00 58.92  ? 238  SER B O   1 
ATOM   7510  C CB  . SER B 1 216 ? 55.392  24.017  -17.114 1.00 63.65  ? 238  SER B CB  1 
ATOM   7511  O OG  . SER B 1 216 ? 56.075  24.861  -16.200 1.00 66.08  ? 238  SER B OG  1 
ATOM   7512  N N   . GLU B 1 217 ? 57.571  22.075  -17.146 1.00 64.34  ? 239  GLU B N   1 
ATOM   7513  C CA  . GLU B 1 217 ? 58.947  21.677  -16.919 1.00 66.28  ? 239  GLU B CA  1 
ATOM   7514  C C   . GLU B 1 217 ? 59.690  22.687  -16.034 1.00 67.43  ? 239  GLU B C   1 
ATOM   7515  O O   . GLU B 1 217 ? 60.655  22.334  -15.362 1.00 65.35  ? 239  GLU B O   1 
ATOM   7516  C CB  . GLU B 1 217 ? 59.647  21.507  -18.267 1.00 68.72  ? 239  GLU B CB  1 
ATOM   7517  C CG  . GLU B 1 217 ? 61.112  21.135  -18.206 1.00 72.55  ? 239  GLU B CG  1 
ATOM   7518  C CD  . GLU B 1 217 ? 61.771  21.274  -19.556 1.00 77.96  ? 239  GLU B CD  1 
ATOM   7519  O OE1 . GLU B 1 217 ? 61.049  21.576  -20.528 1.00 78.91  ? 239  GLU B OE1 1 
ATOM   7520  O OE2 . GLU B 1 217 ? 63.004  21.094  -19.650 1.00 80.95  ? 239  GLU B OE2 1 
ATOM   7521  N N   . GLU B 1 218 ? 59.231  23.938  -16.030 1.00 71.22  ? 240  GLU B N   1 
ATOM   7522  C CA  . GLU B 1 218 ? 59.873  25.005  -15.252 1.00 72.85  ? 240  GLU B CA  1 
ATOM   7523  C C   . GLU B 1 218 ? 59.348  25.206  -13.811 1.00 67.87  ? 240  GLU B C   1 
ATOM   7524  O O   . GLU B 1 218 ? 59.993  25.871  -13.001 1.00 67.88  ? 240  GLU B O   1 
ATOM   7525  C CB  . GLU B 1 218 ? 59.783  26.333  -16.016 1.00 77.64  ? 240  GLU B CB  1 
ATOM   7526  C CG  . GLU B 1 218 ? 60.507  26.351  -17.365 1.00 83.43  ? 240  GLU B CG  1 
ATOM   7527  C CD  . GLU B 1 218 ? 59.687  25.752  -18.499 1.00 87.14  ? 240  GLU B CD  1 
ATOM   7528  O OE1 . GLU B 1 218 ? 58.547  25.304  -18.248 1.00 88.31  ? 240  GLU B OE1 1 
ATOM   7529  O OE2 . GLU B 1 218 ? 60.185  25.734  -19.647 1.00 89.31  ? 240  GLU B OE2 1 
ATOM   7530  N N   . ASP B 1 219 ? 58.198  24.624  -13.493 1.00 62.28  ? 241  ASP B N   1 
ATOM   7531  C CA  . ASP B 1 219 ? 57.547  24.857  -12.206 1.00 58.68  ? 241  ASP B CA  1 
ATOM   7532  C C   . ASP B 1 219 ? 58.422  24.423  -11.026 1.00 58.27  ? 241  ASP B C   1 
ATOM   7533  O O   . ASP B 1 219 ? 58.654  25.189  -10.091 1.00 52.93  ? 241  ASP B O   1 
ATOM   7534  C CB  . ASP B 1 219 ? 56.207  24.115  -12.141 1.00 54.53  ? 241  ASP B CB  1 
ATOM   7535  C CG  . ASP B 1 219 ? 55.077  24.860  -12.840 1.00 55.82  ? 241  ASP B CG  1 
ATOM   7536  O OD1 . ASP B 1 219 ? 55.181  26.089  -13.002 1.00 58.89  ? 241  ASP B OD1 1 
ATOM   7537  O OD2 . ASP B 1 219 ? 54.069  24.219  -13.206 1.00 54.17  ? 241  ASP B OD2 1 
ATOM   7538  N N   . PHE B 1 220 ? 58.860  23.172  -11.069 1.00 57.71  ? 242  PHE B N   1 
ATOM   7539  C CA  . PHE B 1 220 ? 59.713  22.586  -10.038 1.00 57.64  ? 242  PHE B CA  1 
ATOM   7540  C C   . PHE B 1 220 ? 61.201  22.517  -10.396 1.00 61.98  ? 242  PHE B C   1 
ATOM   7541  O O   . PHE B 1 220 ? 62.003  22.000  -9.621  1.00 63.87  ? 242  PHE B O   1 
ATOM   7542  C CB  . PHE B 1 220 ? 59.177  21.204  -9.686  1.00 54.30  ? 242  PHE B CB  1 
ATOM   7543  C CG  . PHE B 1 220 ? 57.718  21.204  -9.367  1.00 48.99  ? 242  PHE B CG  1 
ATOM   7544  C CD1 . PHE B 1 220 ? 57.193  22.151  -8.504  1.00 48.95  ? 242  PHE B CD1 1 
ATOM   7545  C CD2 . PHE B 1 220 ? 56.868  20.285  -9.941  1.00 47.95  ? 242  PHE B CD2 1 
ATOM   7546  C CE1 . PHE B 1 220 ? 55.849  22.168  -8.205  1.00 47.88  ? 242  PHE B CE1 1 
ATOM   7547  C CE2 . PHE B 1 220 ? 55.524  20.296  -9.640  1.00 62.88  ? 242  PHE B CE2 1 
ATOM   7548  C CZ  . PHE B 1 220 ? 55.015  21.243  -8.775  1.00 46.84  ? 242  PHE B CZ  1 
ATOM   7549  N N   . LYS B 1 221 ? 61.559  23.048  -11.563 1.00 64.40  ? 243  LYS B N   1 
ATOM   7550  C CA  . LYS B 1 221 ? 62.885  22.843  -12.153 1.00 66.94  ? 243  LYS B CA  1 
ATOM   7551  C C   . LYS B 1 221 ? 64.084  23.021  -11.212 1.00 69.62  ? 243  LYS B C   1 
ATOM   7552  O O   . LYS B 1 221 ? 64.977  22.175  -11.182 1.00 69.06  ? 243  LYS B O   1 
ATOM   7553  C CB  . LYS B 1 221 ? 63.054  23.745  -13.382 1.00 65.93  ? 243  LYS B CB  1 
ATOM   7554  C CG  . LYS B 1 221 ? 64.400  23.630  -14.059 1.00 67.26  ? 243  LYS B CG  1 
ATOM   7555  C CD  . LYS B 1 221 ? 64.483  24.537  -15.291 1.00 69.33  ? 243  LYS B CD  1 
ATOM   7556  C CE  . LYS B 1 221 ? 63.532  24.073  -16.392 1.00 68.30  ? 243  LYS B CE  1 
ATOM   7557  N NZ  . LYS B 1 221 ? 63.505  25.015  -17.548 1.00 69.67  ? 243  LYS B NZ  1 
ATOM   7558  N N   . GLY B 1 222 ? 64.102  24.107  -10.444 1.00 71.01  ? 244  GLY B N   1 
ATOM   7559  C CA  . GLY B 1 222 ? 65.265  24.448  -9.643  1.00 57.90  ? 244  GLY B CA  1 
ATOM   7560  C C   . GLY B 1 222 ? 65.317  23.911  -8.217  1.00 60.86  ? 244  GLY B C   1 
ATOM   7561  O O   . GLY B 1 222 ? 66.164  24.340  -7.424  1.00 61.75  ? 244  GLY B O   1 
ATOM   7562  N N   . LEU B 1 223 ? 64.430  22.991  -7.852  1.00 55.49  ? 245  LEU B N   1 
ATOM   7563  C CA  . LEU B 1 223 ? 64.486  22.517  -6.474  1.00 62.13  ? 245  LEU B CA  1 
ATOM   7564  C C   . LEU B 1 223 ? 65.123  21.139  -6.418  1.00 62.29  ? 245  LEU B C   1 
ATOM   7565  O O   . LEU B 1 223 ? 64.446  20.127  -6.569  1.00 60.28  ? 245  LEU B O   1 
ATOM   7566  C CB  . LEU B 1 223 ? 63.068  22.448  -5.913  1.00 60.13  ? 245  LEU B CB  1 
ATOM   7567  C CG  . LEU B 1 223 ? 62.189  23.599  -6.399  1.00 53.49  ? 245  LEU B CG  1 
ATOM   7568  C CD1 . LEU B 1 223 ? 60.727  23.289  -6.213  1.00 51.93  ? 245  LEU B CD1 1 
ATOM   7569  C CD2 . LEU B 1 223 ? 62.554  24.896  -5.692  1.00 70.24  ? 245  LEU B CD2 1 
ATOM   7570  N N   . ILE B 1 224 ? 66.408  21.095  -6.092  1.00 64.41  ? 246  ILE B N   1 
ATOM   7571  C CA  . ILE B 1 224 ? 67.107  19.822  -6.120  1.00 65.79  ? 246  ILE B CA  1 
ATOM   7572  C C   . ILE B 1 224 ? 67.156  19.194  -4.739  1.00 65.72  ? 246  ILE B C   1 
ATOM   7573  O O   . ILE B 1 224 ? 67.593  18.059  -4.588  1.00 65.82  ? 246  ILE B O   1 
ATOM   7574  C CB  . ILE B 1 224 ? 68.523  19.936  -6.740  1.00 70.21  ? 246  ILE B CB  1 
ATOM   7575  C CG1 . ILE B 1 224 ? 69.074  21.358  -6.603  1.00 69.89  ? 246  ILE B CG1 1 
ATOM   7576  C CG2 . ILE B 1 224 ? 68.492  19.542  -8.214  1.00 69.70  ? 246  ILE B CG2 1 
ATOM   7577  C CD1 . ILE B 1 224 ? 69.749  21.635  -5.292  1.00 69.28  ? 246  ILE B CD1 1 
ATOM   7578  N N   . ASN B 1 225 ? 66.687  19.931  -3.738  1.00 54.73  ? 247  ASN B N   1 
ATOM   7579  C CA  . ASN B 1 225 ? 66.589  19.384  -2.397  1.00 57.92  ? 247  ASN B CA  1 
ATOM   7580  C C   . ASN B 1 225 ? 65.196  18.872  -1.999  1.00 58.21  ? 247  ASN B C   1 
ATOM   7581  O O   . ASN B 1 225 ? 65.002  18.429  -0.870  1.00 59.00  ? 247  ASN B O   1 
ATOM   7582  C CB  . ASN B 1 225 ? 67.136  20.378  -1.373  1.00 55.15  ? 247  ASN B CB  1 
ATOM   7583  C CG  . ASN B 1 225 ? 68.653  20.452  -1.392  1.00 56.86  ? 247  ASN B CG  1 
ATOM   7584  O OD1 . ASN B 1 225 ? 69.295  20.086  -2.380  1.00 66.32  ? 247  ASN B OD1 1 
ATOM   7585  N ND2 . ASN B 1 225 ? 69.236  20.914  -0.292  1.00 67.33  ? 247  ASN B ND2 1 
ATOM   7586  N N   . LEU B 1 226 ? 64.232  18.935  -2.918  1.00 57.56  ? 248  LEU B N   1 
ATOM   7587  C CA  . LEU B 1 226 ? 62.866  18.509  -2.608  1.00 58.04  ? 248  LEU B CA  1 
ATOM   7588  C C   . LEU B 1 226 ? 62.786  17.037  -2.221  1.00 58.63  ? 248  LEU B C   1 
ATOM   7589  O O   . LEU B 1 226 ? 63.227  16.170  -2.971  1.00 48.91  ? 248  LEU B O   1 
ATOM   7590  C CB  . LEU B 1 226 ? 61.949  18.740  -3.813  1.00 57.79  ? 248  LEU B CB  1 
ATOM   7591  C CG  . LEU B 1 226 ? 60.982  19.924  -3.795  1.00 58.02  ? 248  LEU B CG  1 
ATOM   7592  C CD1 . LEU B 1 226 ? 59.701  19.576  -4.561  1.00 55.01  ? 248  LEU B CD1 1 
ATOM   7593  C CD2 . LEU B 1 226 ? 60.659  20.361  -2.372  1.00 54.48  ? 248  LEU B CD2 1 
ATOM   7594  N N   . THR B 1 227 ? 62.277  16.761  -1.025  1.00 59.79  ? 249  THR B N   1 
ATOM   7595  C CA  . THR B 1 227 ? 61.924  15.398  -0.637  1.00 46.86  ? 249  THR B CA  1 
ATOM   7596  C C   . THR B 1 227 ? 60.428  15.106  -0.650  1.00 45.32  ? 249  THR B C   1 
ATOM   7597  O O   . THR B 1 227 ? 60.013  13.946  -0.695  1.00 44.78  ? 249  THR B O   1 
ATOM   7598  C CB  . THR B 1 227 ? 62.467  15.102  0.769   1.00 54.75  ? 249  THR B CB  1 
ATOM   7599  O OG1 . THR B 1 227 ? 61.718  15.861  1.721   1.00 46.63  ? 249  THR B OG1 1 
ATOM   7600  C CG2 . THR B 1 227 ? 63.940  15.515  0.855   1.00 48.71  ? 249  THR B CG2 1 
ATOM   7601  N N   . LEU B 1 228 ? 59.609  16.151  -0.644  1.00 45.14  ? 250  LEU B N   1 
ATOM   7602  C CA  . LEU B 1 228 ? 58.156  15.959  -0.676  1.00 54.33  ? 250  LEU B CA  1 
ATOM   7603  C C   . LEU B 1 228 ? 57.484  16.946  -1.616  1.00 43.96  ? 250  LEU B C   1 
ATOM   7604  O O   . LEU B 1 228 ? 57.780  18.136  -1.591  1.00 48.77  ? 250  LEU B O   1 
ATOM   7605  C CB  . LEU B 1 228 ? 57.520  16.062  0.726   1.00 43.11  ? 250  LEU B CB  1 
ATOM   7606  C CG  . LEU B 1 228 ? 55.990  15.869  0.842   1.00 41.75  ? 250  LEU B CG  1 
ATOM   7607  C CD1 . LEU B 1 228 ? 55.605  15.391  2.241   1.00 41.00  ? 250  LEU B CD1 1 
ATOM   7608  C CD2 . LEU B 1 228 ? 55.162  17.118  0.503   1.00 41.89  ? 250  LEU B CD2 1 
ATOM   7609  N N   . LEU B 1 229 ? 56.552  16.446  -2.414  1.00 43.10  ? 251  LEU B N   1 
ATOM   7610  C CA  . LEU B 1 229 ? 55.734  17.308  -3.259  1.00 43.16  ? 251  LEU B CA  1 
ATOM   7611  C C   . LEU B 1 229 ? 54.302  16.830  -3.195  1.00 41.82  ? 251  LEU B C   1 
ATOM   7612  O O   . LEU B 1 229 ? 54.021  15.673  -3.510  1.00 41.05  ? 251  LEU B O   1 
ATOM   7613  C CB  . LEU B 1 229 ? 56.231  17.285  -4.710  1.00 50.42  ? 251  LEU B CB  1 
ATOM   7614  C CG  . LEU B 1 229 ? 55.332  17.990  -5.736  1.00 53.07  ? 251  LEU B CG  1 
ATOM   7615  C CD1 . LEU B 1 229 ? 55.240  19.485  -5.455  1.00 44.73  ? 251  LEU B CD1 1 
ATOM   7616  C CD2 . LEU B 1 229 ? 55.812  17.746  -7.172  1.00 44.61  ? 251  LEU B CD2 1 
ATOM   7617  N N   . ASP B 1 230 ? 53.393  17.711  -2.785  1.00 43.85  ? 252  ASP B N   1 
ATOM   7618  C CA  . ASP B 1 230 ? 51.977  17.348  -2.731  1.00 40.43  ? 252  ASP B CA  1 
ATOM   7619  C C   . ASP B 1 230 ? 51.181  18.151  -3.760  1.00 40.69  ? 252  ASP B C   1 
ATOM   7620  O O   . ASP B 1 230 ? 50.986  19.349  -3.603  1.00 41.31  ? 252  ASP B O   1 
ATOM   7621  C CB  . ASP B 1 230 ? 51.432  17.562  -1.305  1.00 39.88  ? 252  ASP B CB  1 
ATOM   7622  C CG  . ASP B 1 230 ? 49.961  17.174  -1.165  1.00 44.36  ? 252  ASP B CG  1 
ATOM   7623  O OD1 . ASP B 1 230 ? 49.400  16.528  -2.084  1.00 43.24  ? 252  ASP B OD1 1 
ATOM   7624  O OD2 . ASP B 1 230 ? 49.364  17.509  -0.118  1.00 44.65  ? 252  ASP B OD2 1 
ATOM   7625  N N   . LEU B 1 231 ? 50.791  17.476  -4.840  1.00 40.35  ? 253  LEU B N   1 
ATOM   7626  C CA  . LEU B 1 231 ? 49.911  18.005  -5.892  1.00 40.50  ? 253  LEU B CA  1 
ATOM   7627  C C   . LEU B 1 231 ? 48.465  17.492  -5.833  1.00 44.25  ? 253  LEU B C   1 
ATOM   7628  O O   . LEU B 1 231 ? 47.672  17.727  -6.756  1.00 40.80  ? 253  LEU B O   1 
ATOM   7629  C CB  . LEU B 1 231 ? 50.520  17.772  -7.271  1.00 41.19  ? 253  LEU B CB  1 
ATOM   7630  C CG  . LEU B 1 231 ? 51.840  18.524  -7.472  1.00 47.11  ? 253  LEU B CG  1 
ATOM   7631  C CD1 . LEU B 1 231 ? 52.445  18.238  -8.835  1.00 47.74  ? 253  LEU B CD1 1 
ATOM   7632  C CD2 . LEU B 1 231 ? 51.643  20.028  -7.282  1.00 46.62  ? 253  LEU B CD2 1 
ATOM   7633  N N   . SER B 1 232 ? 48.148  16.742  -4.780  1.00 40.73  ? 254  SER B N   1 
ATOM   7634  C CA  . SER B 1 232 ? 46.861  16.065  -4.662  1.00 40.81  ? 254  SER B CA  1 
ATOM   7635  C C   . SER B 1 232 ? 45.682  17.028  -4.760  1.00 41.30  ? 254  SER B C   1 
ATOM   7636  O O   . SER B 1 232 ? 45.802  18.202  -4.418  1.00 43.86  ? 254  SER B O   1 
ATOM   7637  C CB  . SER B 1 232 ? 46.777  15.291  -3.340  1.00 41.14  ? 254  SER B CB  1 
ATOM   7638  O OG  . SER B 1 232 ? 46.489  16.159  -2.250  1.00 41.61  ? 254  SER B OG  1 
ATOM   7639  N N   . GLY B 1 233 ? 44.551  16.531  -5.254  1.00 36.70  ? 255  GLY B N   1 
ATOM   7640  C CA  . GLY B 1 233 ? 43.333  17.320  -5.325  1.00 44.11  ? 255  GLY B CA  1 
ATOM   7641  C C   . GLY B 1 233 ? 43.281  18.369  -6.426  1.00 40.65  ? 255  GLY B C   1 
ATOM   7642  O O   . GLY B 1 233 ? 42.341  19.155  -6.506  1.00 39.80  ? 255  GLY B O   1 
ATOM   7643  N N   . ASN B 1 234 ? 44.287  18.393  -7.287  1.00 42.61  ? 256  ASN B N   1 
ATOM   7644  C CA  . ASN B 1 234 ? 44.231  19.276  -8.438  1.00 42.40  ? 256  ASN B CA  1 
ATOM   7645  C C   . ASN B 1 234 ? 43.643  18.525  -9.634  1.00 43.61  ? 256  ASN B C   1 
ATOM   7646  O O   . ASN B 1 234 ? 44.190  17.497  -10.037 1.00 49.50  ? 256  ASN B O   1 
ATOM   7647  C CB  . ASN B 1 234 ? 45.610  19.852  -8.730  1.00 43.92  ? 256  ASN B CB  1 
ATOM   7648  C CG  . ASN B 1 234 ? 46.095  20.783  -7.628  1.00 46.99  ? 256  ASN B CG  1 
ATOM   7649  O OD1 . ASN B 1 234 ? 45.483  21.824  -7.362  1.00 46.60  ? 256  ASN B OD1 1 
ATOM   7650  N ND2 . ASN B 1 234 ? 47.207  20.415  -6.986  1.00 41.07  ? 256  ASN B ND2 1 
ATOM   7651  N N   . CYS B 1 235 ? 42.543  19.048  -10.193 1.00 41.87  ? 257  CYS B N   1 
ATOM   7652  C CA  . CYS B 1 235 ? 41.629  18.278  -11.066 1.00 39.23  ? 257  CYS B CA  1 
ATOM   7653  C C   . CYS B 1 235 ? 41.077  17.046  -10.334 1.00 45.73  ? 257  CYS B C   1 
ATOM   7654  O O   . CYS B 1 235 ? 41.363  15.909  -10.707 1.00 44.04  ? 257  CYS B O   1 
ATOM   7655  C CB  . CYS B 1 235 ? 42.303  17.857  -12.373 1.00 39.87  ? 257  CYS B CB  1 
ATOM   7656  S SG  . CYS B 1 235 ? 42.877  19.262  -13.425 1.00 44.86  ? 257  CYS B SG  1 
ATOM   7657  N N   . PRO B 1 236 ? 40.263  17.267  -9.291  1.00 48.75  ? 258  PRO B N   1 
ATOM   7658  C CA  . PRO B 1 236 ? 39.841  16.139  -8.451  1.00 46.24  ? 258  PRO B CA  1 
ATOM   7659  C C   . PRO B 1 236 ? 38.839  15.218  -9.147  1.00 46.79  ? 258  PRO B C   1 
ATOM   7660  O O   . PRO B 1 236 ? 38.166  15.626  -10.098 1.00 47.27  ? 258  PRO B O   1 
ATOM   7661  C CB  . PRO B 1 236 ? 39.179  16.831  -7.262  1.00 35.83  ? 258  PRO B CB  1 
ATOM   7662  C CG  . PRO B 1 236 ? 38.623  18.102  -7.859  1.00 45.23  ? 258  PRO B CG  1 
ATOM   7663  C CD  . PRO B 1 236 ? 39.622  18.535  -8.890  1.00 37.77  ? 258  PRO B CD  1 
ATOM   7664  N N   . ARG B 1 237 ? 38.747  13.985  -8.660  1.00 45.85  ? 259  ARG B N   1 
ATOM   7665  C CA  . ARG B 1 237 ? 37.694  13.082  -9.085  1.00 44.83  ? 259  ARG B CA  1 
ATOM   7666  C C   . ARG B 1 237 ? 36.558  13.314  -8.103  1.00 43.60  ? 259  ARG B C   1 
ATOM   7667  O O   . ARG B 1 237 ? 36.633  12.914  -6.946  1.00 43.20  ? 259  ARG B O   1 
ATOM   7668  C CB  . ARG B 1 237 ? 38.166  11.626  -9.004  1.00 43.39  ? 259  ARG B CB  1 
ATOM   7669  C CG  . ARG B 1 237 ? 37.065  10.618  -9.309  1.00 45.84  ? 259  ARG B CG  1 
ATOM   7670  C CD  . ARG B 1 237 ? 37.553  9.172   -9.341  1.00 45.29  ? 259  ARG B CD  1 
ATOM   7671  N NE  . ARG B 1 237 ? 36.415  8.260   -9.394  1.00 48.44  ? 259  ARG B NE  1 
ATOM   7672  C CZ  . ARG B 1 237 ? 36.480  6.938   -9.268  1.00 49.44  ? 259  ARG B CZ  1 
ATOM   7673  N NH1 . ARG B 1 237 ? 37.643  6.330   -9.076  1.00 48.51  ? 259  ARG B NH1 1 
ATOM   7674  N NH2 . ARG B 1 237 ? 35.365  6.222   -9.334  1.00 51.20  ? 259  ARG B NH2 1 
ATOM   7675  N N   . CYS B 1 238 ? 35.500  13.962  -8.576  1.00 43.50  ? 260  CYS B N   1 
ATOM   7676  C CA  . CYS B 1 238 ? 34.471  14.477  -7.683  1.00 43.26  ? 260  CYS B CA  1 
ATOM   7677  C C   . CYS B 1 238 ? 33.287  13.556  -7.402  1.00 42.60  ? 260  CYS B C   1 
ATOM   7678  O O   . CYS B 1 238 ? 32.508  13.836  -6.482  1.00 41.95  ? 260  CYS B O   1 
ATOM   7679  C CB  . CYS B 1 238 ? 33.949  15.819  -8.198  1.00 44.36  ? 260  CYS B CB  1 
ATOM   7680  S SG  . CYS B 1 238 ? 35.155  17.138  -8.097  1.00 47.51  ? 260  CYS B SG  1 
ATOM   7681  N N   . PHE B 1 239 ? 33.141  12.475  -8.173  1.00 38.47  ? 261  PHE B N   1 
ATOM   7682  C CA  . PHE B 1 239 ? 32.004  11.586  -7.965  1.00 38.99  ? 261  PHE B CA  1 
ATOM   7683  C C   . PHE B 1 239 ? 31.965  11.097  -6.520  1.00 38.71  ? 261  PHE B C   1 
ATOM   7684  O O   . PHE B 1 239 ? 32.975  10.623  -5.992  1.00 40.89  ? 261  PHE B O   1 
ATOM   7685  C CB  . PHE B 1 239 ? 32.009  10.392  -8.918  1.00 41.81  ? 261  PHE B CB  1 
ATOM   7686  C CG  . PHE B 1 239 ? 30.898  9.407   -8.638  1.00 42.29  ? 261  PHE B CG  1 
ATOM   7687  C CD1 . PHE B 1 239 ? 29.575  9.745   -8.895  1.00 37.25  ? 261  PHE B CD1 1 
ATOM   7688  C CD2 . PHE B 1 239 ? 31.173  8.166   -8.087  1.00 40.93  ? 261  PHE B CD2 1 
ATOM   7689  C CE1 . PHE B 1 239 ? 28.545  8.858   -8.621  1.00 35.78  ? 261  PHE B CE1 1 
ATOM   7690  C CE2 . PHE B 1 239 ? 30.150  7.269   -7.810  1.00 38.11  ? 261  PHE B CE2 1 
ATOM   7691  C CZ  . PHE B 1 239 ? 28.830  7.614   -8.081  1.00 35.85  ? 261  PHE B CZ  1 
ATOM   7692  N N   . ASN B 1 240 ? 30.804  11.256  -5.885  1.00 38.41  ? 262  ASN B N   1 
ATOM   7693  C CA  . ASN B 1 240 ? 30.589  10.871  -4.485  1.00 38.16  ? 262  ASN B CA  1 
ATOM   7694  C C   . ASN B 1 240 ? 31.525  11.561  -3.488  1.00 40.83  ? 262  ASN B C   1 
ATOM   7695  O O   . ASN B 1 240 ? 31.971  10.948  -2.524  1.00 42.36  ? 262  ASN B O   1 
ATOM   7696  C CB  . ASN B 1 240 ? 30.676  9.347   -4.310  1.00 35.43  ? 262  ASN B CB  1 
ATOM   7697  C CG  . ASN B 1 240 ? 29.953  8.858   -3.064  1.00 37.60  ? 262  ASN B CG  1 
ATOM   7698  O OD1 . ASN B 1 240 ? 28.834  9.285   -2.774  1.00 37.36  ? 262  ASN B OD1 1 
ATOM   7699  N ND2 . ASN B 1 240 ? 30.592  7.961   -2.320  1.00 37.25  ? 262  ASN B ND2 1 
ATOM   7700  N N   . ALA B 1 241 ? 31.797  12.842  -3.704  1.00 41.33  ? 263  ALA B N   1 
ATOM   7701  C CA  . ALA B 1 241 ? 32.661  13.596  -2.797  1.00 39.20  ? 263  ALA B CA  1 
ATOM   7702  C C   . ALA B 1 241 ? 31.993  13.902  -1.458  1.00 38.39  ? 263  ALA B C   1 
ATOM   7703  O O   . ALA B 1 241 ? 30.846  14.332  -1.422  1.00 36.38  ? 263  ALA B O   1 
ATOM   7704  C CB  . ALA B 1 241 ? 33.115  14.899  -3.459  1.00 40.60  ? 263  ALA B CB  1 
ATOM   7705  N N   . PRO B 1 242 ? 32.712  13.675  -0.339  1.00 38.58  ? 264  PRO B N   1 
ATOM   7706  C CA  . PRO B 1 242 ? 32.147  14.124  0.936   1.00 37.39  ? 264  PRO B CA  1 
ATOM   7707  C C   . PRO B 1 242 ? 32.547  15.556  1.269   1.00 42.07  ? 264  PRO B C   1 
ATOM   7708  O O   . PRO B 1 242 ? 32.814  15.859  2.434   1.00 44.73  ? 264  PRO B O   1 
ATOM   7709  C CB  . PRO B 1 242 ? 32.796  13.169  1.937   1.00 37.08  ? 264  PRO B CB  1 
ATOM   7710  C CG  . PRO B 1 242 ? 34.137  12.872  1.334   1.00 36.57  ? 264  PRO B CG  1 
ATOM   7711  C CD  . PRO B 1 242 ? 33.918  12.850  -0.159  1.00 36.49  ? 264  PRO B CD  1 
ATOM   7712  N N   . PHE B 1 243 ? 32.465  16.438  0.279   1.00 40.69  ? 265  PHE B N   1 
ATOM   7713  C CA  . PHE B 1 243 ? 32.861  17.834  0.410   1.00 40.49  ? 265  PHE B CA  1 
ATOM   7714  C C   . PHE B 1 243 ? 32.588  18.484  -0.943  1.00 43.08  ? 265  PHE B C   1 
ATOM   7715  O O   . PHE B 1 243 ? 32.555  17.790  -1.965  1.00 44.20  ? 265  PHE B O   1 
ATOM   7716  C CB  . PHE B 1 243 ? 34.353  17.961  0.796   1.00 38.16  ? 265  PHE B CB  1 
ATOM   7717  C CG  . PHE B 1 243 ? 35.291  17.318  -0.187  1.00 37.84  ? 265  PHE B CG  1 
ATOM   7718  C CD1 . PHE B 1 243 ? 35.724  18.008  -1.312  1.00 35.71  ? 265  PHE B CD1 1 
ATOM   7719  C CD2 . PHE B 1 243 ? 35.725  16.018  0.001   1.00 38.82  ? 265  PHE B CD2 1 
ATOM   7720  C CE1 . PHE B 1 243 ? 36.569  17.406  -2.234  1.00 35.44  ? 265  PHE B CE1 1 
ATOM   7721  C CE2 . PHE B 1 243 ? 36.570  15.416  -0.916  1.00 40.19  ? 265  PHE B CE2 1 
ATOM   7722  C CZ  . PHE B 1 243 ? 36.995  16.112  -2.032  1.00 32.87  ? 265  PHE B CZ  1 
ATOM   7723  N N   . PRO B 1 244 ? 32.373  19.810  -0.962  1.00 45.75  ? 266  PRO B N   1 
ATOM   7724  C CA  . PRO B 1 244 ? 32.207  20.501  -2.249  1.00 49.17  ? 266  PRO B CA  1 
ATOM   7725  C C   . PRO B 1 244 ? 33.426  20.268  -3.142  1.00 51.22  ? 266  PRO B C   1 
ATOM   7726  O O   . PRO B 1 244 ? 34.557  20.508  -2.718  1.00 55.85  ? 266  PRO B O   1 
ATOM   7727  C CB  . PRO B 1 244 ? 32.129  21.971  -1.843  1.00 48.11  ? 266  PRO B CB  1 
ATOM   7728  C CG  . PRO B 1 244 ? 31.614  21.945  -0.441  1.00 46.96  ? 266  PRO B CG  1 
ATOM   7729  C CD  . PRO B 1 244 ? 32.191  20.715  0.186   1.00 46.79  ? 266  PRO B CD  1 
ATOM   7730  N N   . CYS B 1 245 ? 33.187  19.805  -4.362  1.00 50.45  ? 267  CYS B N   1 
ATOM   7731  C CA  . CYS B 1 245 ? 34.257  19.372  -5.246  1.00 51.78  ? 267  CYS B CA  1 
ATOM   7732  C C   . CYS B 1 245 ? 34.039  19.921  -6.652  1.00 54.03  ? 267  CYS B C   1 
ATOM   7733  O O   . CYS B 1 245 ? 33.005  19.674  -7.277  1.00 55.53  ? 267  CYS B O   1 
ATOM   7734  C CB  . CYS B 1 245 ? 34.310  17.843  -5.281  1.00 51.56  ? 267  CYS B CB  1 
ATOM   7735  S SG  . CYS B 1 245 ? 35.726  17.119  -6.135  1.00 50.63  ? 267  CYS B SG  1 
ATOM   7736  N N   . VAL B 1 246 ? 35.019  20.665  -7.146  1.00 53.84  ? 268  VAL B N   1 
ATOM   7737  C CA  . VAL B 1 246 ? 34.941  21.237  -8.480  1.00 53.15  ? 268  VAL B CA  1 
ATOM   7738  C C   . VAL B 1 246 ? 35.962  20.577  -9.396  1.00 53.23  ? 268  VAL B C   1 
ATOM   7739  O O   . VAL B 1 246 ? 37.162  20.776  -9.238  1.00 55.33  ? 268  VAL B O   1 
ATOM   7740  C CB  . VAL B 1 246 ? 35.202  22.751  -8.447  1.00 52.57  ? 268  VAL B CB  1 
ATOM   7741  C CG1 . VAL B 1 246 ? 34.890  23.370  -9.799  1.00 49.87  ? 268  VAL B CG1 1 
ATOM   7742  C CG2 . VAL B 1 246 ? 34.379  23.406  -7.329  1.00 51.87  ? 268  VAL B CG2 1 
ATOM   7743  N N   . PRO B 1 247 ? 35.486  19.776  -10.351 1.00 52.12  ? 269  PRO B N   1 
ATOM   7744  C CA  . PRO B 1 247 ? 36.361  19.106  -11.319 1.00 51.56  ? 269  PRO B CA  1 
ATOM   7745  C C   . PRO B 1 247 ? 36.927  20.064  -12.365 1.00 49.39  ? 269  PRO B C   1 
ATOM   7746  O O   . PRO B 1 247 ? 36.386  21.142  -12.579 1.00 49.93  ? 269  PRO B O   1 
ATOM   7747  C CB  . PRO B 1 247 ? 35.417  18.116  -12.007 1.00 51.67  ? 269  PRO B CB  1 
ATOM   7748  C CG  . PRO B 1 247 ? 34.070  18.743  -11.885 1.00 52.18  ? 269  PRO B CG  1 
ATOM   7749  C CD  . PRO B 1 247 ? 34.072  19.409  -10.537 1.00 51.60  ? 269  PRO B CD  1 
ATOM   7750  N N   . CYS B 1 248 ? 38.017  19.662  -13.006 1.00 48.23  ? 270  CYS B N   1 
ATOM   7751  C CA  . CYS B 1 248 ? 38.526  20.369  -14.173 1.00 49.47  ? 270  CYS B CA  1 
ATOM   7752  C C   . CYS B 1 248 ? 37.528  20.179  -15.303 1.00 51.89  ? 270  CYS B C   1 
ATOM   7753  O O   . CYS B 1 248 ? 36.669  19.300  -15.227 1.00 52.47  ? 270  CYS B O   1 
ATOM   7754  C CB  . CYS B 1 248 ? 39.888  19.822  -14.581 1.00 48.78  ? 270  CYS B CB  1 
ATOM   7755  S SG  . CYS B 1 248 ? 41.257  20.472  -13.611 1.00 50.26  ? 270  CYS B SG  1 
ATOM   7756  N N   . ASP B 1 249 ? 37.622  21.011  -16.334 1.00 56.39  ? 271  ASP B N   1 
ATOM   7757  C CA  . ASP B 1 249 ? 36.690  20.943  -17.453 1.00 64.04  ? 271  ASP B CA  1 
ATOM   7758  C C   . ASP B 1 249 ? 36.624  19.531  -18.015 1.00 58.07  ? 271  ASP B C   1 
ATOM   7759  O O   . ASP B 1 249 ? 37.648  18.948  -18.364 1.00 55.41  ? 271  ASP B O   1 
ATOM   7760  C CB  . ASP B 1 249 ? 37.130  21.896  -18.563 1.00 75.60  ? 271  ASP B CB  1 
ATOM   7761  C CG  . ASP B 1 249 ? 36.081  22.941  -18.886 1.00 85.75  ? 271  ASP B CG  1 
ATOM   7762  O OD1 . ASP B 1 249 ? 35.122  22.621  -19.625 1.00 89.43  ? 271  ASP B OD1 1 
ATOM   7763  O OD2 . ASP B 1 249 ? 36.220  24.088  -18.405 1.00 89.51  ? 271  ASP B OD2 1 
ATOM   7764  N N   . GLY B 1 250 ? 35.414  18.987  -18.092 1.00 57.20  ? 272  GLY B N   1 
ATOM   7765  C CA  . GLY B 1 250 ? 35.203  17.655  -18.630 1.00 57.53  ? 272  GLY B CA  1 
ATOM   7766  C C   . GLY B 1 250 ? 35.606  16.540  -17.681 1.00 56.51  ? 272  GLY B C   1 
ATOM   7767  O O   . GLY B 1 250 ? 35.501  15.365  -18.016 1.00 56.10  ? 272  GLY B O   1 
ATOM   7768  N N   . GLY B 1 251 ? 36.065  16.900  -16.491 1.00 56.63  ? 273  GLY B N   1 
ATOM   7769  C CA  . GLY B 1 251 ? 36.553  15.906  -15.552 1.00 56.79  ? 273  GLY B CA  1 
ATOM   7770  C C   . GLY B 1 251 ? 37.949  15.461  -15.938 1.00 56.34  ? 273  GLY B C   1 
ATOM   7771  O O   . GLY B 1 251 ? 38.393  14.373  -15.564 1.00 58.04  ? 273  GLY B O   1 
ATOM   7772  N N   . ALA B 1 252 ? 38.645  16.325  -16.676 1.00 51.67  ? 274  ALA B N   1 
ATOM   7773  C CA  . ALA B 1 252 ? 39.980  16.036  -17.192 1.00 50.05  ? 274  ALA B CA  1 
ATOM   7774  C C   . ALA B 1 252 ? 41.038  15.759  -16.114 1.00 50.69  ? 274  ALA B C   1 
ATOM   7775  O O   . ALA B 1 252 ? 40.957  16.251  -14.985 1.00 53.21  ? 274  ALA B O   1 
ATOM   7776  C CB  . ALA B 1 252 ? 40.449  17.163  -18.097 1.00 42.50  ? 274  ALA B CB  1 
ATOM   7777  N N   . SER B 1 253 ? 42.025  14.962  -16.510 1.00 48.04  ? 275  SER B N   1 
ATOM   7778  C CA  . SER B 1 253 ? 43.199  14.647  -15.720 1.00 50.77  ? 275  SER B CA  1 
ATOM   7779  C C   . SER B 1 253 ? 44.013  15.907  -15.494 1.00 54.60  ? 275  SER B C   1 
ATOM   7780  O O   . SER B 1 253 ? 43.890  16.869  -16.244 1.00 57.54  ? 275  SER B O   1 
ATOM   7781  C CB  . SER B 1 253 ? 44.057  13.620  -16.470 1.00 51.39  ? 275  SER B CB  1 
ATOM   7782  O OG  . SER B 1 253 ? 45.305  13.395  -15.834 1.00 54.02  ? 275  SER B OG  1 
ATOM   7783  N N   . ILE B 1 254 ? 44.822  15.910  -14.438 1.00 52.30  ? 276  ILE B N   1 
ATOM   7784  C CA  . ILE B 1 254 ? 45.829  16.943  -14.276 1.00 50.54  ? 276  ILE B CA  1 
ATOM   7785  C C   . ILE B 1 254 ? 46.785  16.752  -15.445 1.00 48.14  ? 276  ILE B C   1 
ATOM   7786  O O   . ILE B 1 254 ? 46.925  15.640  -15.947 1.00 42.45  ? 276  ILE B O   1 
ATOM   7787  C CB  . ILE B 1 254 ? 46.579  16.793  -12.927 1.00 44.11  ? 276  ILE B CB  1 
ATOM   7788  C CG1 . ILE B 1 254 ? 47.418  18.040  -12.624 1.00 44.97  ? 276  ILE B CG1 1 
ATOM   7789  C CG2 . ILE B 1 254 ? 47.453  15.546  -12.919 1.00 43.51  ? 276  ILE B CG2 1 
ATOM   7790  C CD1 . ILE B 1 254 ? 48.087  17.996  -11.270 1.00 46.28  ? 276  ILE B CD1 1 
ATOM   7791  N N   . ASN B 1 255 ? 47.429  17.819  -15.899 1.00 49.56  ? 277  ASN B N   1 
ATOM   7792  C CA  . ASN B 1 255 ? 48.390  17.678  -16.989 1.00 51.12  ? 277  ASN B CA  1 
ATOM   7793  C C   . ASN B 1 255 ? 49.803  17.973  -16.509 1.00 50.72  ? 277  ASN B C   1 
ATOM   7794  O O   . ASN B 1 255 ? 50.169  19.124  -16.267 1.00 54.09  ? 277  ASN B O   1 
ATOM   7795  C CB  . ASN B 1 255 ? 48.004  18.579  -18.167 1.00 55.65  ? 277  ASN B CB  1 
ATOM   7796  C CG  . ASN B 1 255 ? 48.957  18.452  -19.361 1.00 56.77  ? 277  ASN B CG  1 
ATOM   7797  O OD1 . ASN B 1 255 ? 49.509  17.388  -19.638 1.00 59.05  ? 277  ASN B OD1 1 
ATOM   7798  N ND2 . ASN B 1 255 ? 49.137  19.547  -20.072 1.00 57.00  ? 277  ASN B ND2 1 
ATOM   7799  N N   . ILE B 1 256 ? 50.592  16.912  -16.390 1.00 45.17  ? 278  ILE B N   1 
ATOM   7800  C CA  . ILE B 1 256 ? 51.968  17.004  -15.930 1.00 51.44  ? 278  ILE B CA  1 
ATOM   7801  C C   . ILE B 1 256 ? 52.929  16.675  -17.072 1.00 53.45  ? 278  ILE B C   1 
ATOM   7802  O O   . ILE B 1 256 ? 52.965  15.549  -17.562 1.00 54.62  ? 278  ILE B O   1 
ATOM   7803  C CB  . ILE B 1 256 ? 52.208  16.053  -14.735 1.00 49.38  ? 278  ILE B CB  1 
ATOM   7804  C CG1 . ILE B 1 256 ? 51.293  16.439  -13.570 1.00 47.59  ? 278  ILE B CG1 1 
ATOM   7805  C CG2 . ILE B 1 256 ? 53.673  16.064  -14.310 1.00 45.35  ? 278  ILE B CG2 1 
ATOM   7806  C CD1 . ILE B 1 256 ? 51.256  15.429  -12.465 1.00 45.11  ? 278  ILE B CD1 1 
ATOM   7807  N N   . ASP B 1 257 ? 53.689  17.676  -17.500 1.00 55.53  ? 279  ASP B N   1 
ATOM   7808  C CA  . ASP B 1 257 ? 54.697  17.504  -18.539 1.00 57.42  ? 279  ASP B CA  1 
ATOM   7809  C C   . ASP B 1 257 ? 55.699  16.421  -18.157 1.00 61.10  ? 279  ASP B C   1 
ATOM   7810  O O   . ASP B 1 257 ? 56.082  16.310  -16.996 1.00 61.93  ? 279  ASP B O   1 
ATOM   7811  C CB  . ASP B 1 257 ? 55.434  18.816  -18.758 1.00 56.81  ? 279  ASP B CB  1 
ATOM   7812  C CG  . ASP B 1 257 ? 56.339  18.769  -19.958 1.00 60.65  ? 279  ASP B CG  1 
ATOM   7813  O OD1 . ASP B 1 257 ? 55.841  19.031  -21.074 1.00 62.84  ? 279  ASP B OD1 1 
ATOM   7814  O OD2 . ASP B 1 257 ? 57.538  18.464  -19.781 1.00 59.98  ? 279  ASP B OD2 1 
ATOM   7815  N N   . ARG B 1 258 ? 56.135  15.630  -19.130 1.00 63.52  ? 280  ARG B N   1 
ATOM   7816  C CA  . ARG B 1 258 ? 56.972  14.476  -18.812 1.00 66.13  ? 280  ARG B CA  1 
ATOM   7817  C C   . ARG B 1 258 ? 58.339  14.838  -18.226 1.00 61.83  ? 280  ARG B C   1 
ATOM   7818  O O   . ARG B 1 258 ? 59.002  13.990  -17.633 1.00 62.20  ? 280  ARG B O   1 
ATOM   7819  C CB  . ARG B 1 258 ? 57.130  13.547  -20.019 1.00 70.69  ? 280  ARG B CB  1 
ATOM   7820  C CG  . ARG B 1 258 ? 58.057  14.045  -21.085 1.00 74.87  ? 280  ARG B CG  1 
ATOM   7821  C CD  . ARG B 1 258 ? 58.883  12.897  -21.620 1.00 80.64  ? 280  ARG B CD  1 
ATOM   7822  N NE  . ARG B 1 258 ? 60.078  12.666  -20.814 1.00 85.14  ? 280  ARG B NE  1 
ATOM   7823  C CZ  . ARG B 1 258 ? 60.988  11.734  -21.084 1.00 89.19  ? 280  ARG B CZ  1 
ATOM   7824  N NH1 . ARG B 1 258 ? 60.823  10.939  -22.135 1.00 89.96  ? 280  ARG B NH1 1 
ATOM   7825  N NH2 . ARG B 1 258 ? 62.056  11.591  -20.305 1.00 90.32  ? 280  ARG B NH2 1 
ATOM   7826  N N   . PHE B 1 259 ? 58.760  16.087  -18.391 1.00 61.00  ? 281  PHE B N   1 
ATOM   7827  C CA  . PHE B 1 259 ? 60.008  16.543  -17.778 1.00 64.49  ? 281  PHE B CA  1 
ATOM   7828  C C   . PHE B 1 259 ? 59.825  17.283  -16.438 1.00 62.77  ? 281  PHE B C   1 
ATOM   7829  O O   . PHE B 1 259 ? 60.804  17.703  -15.825 1.00 61.28  ? 281  PHE B O   1 
ATOM   7830  C CB  . PHE B 1 259 ? 60.821  17.383  -18.761 1.00 68.28  ? 281  PHE B CB  1 
ATOM   7831  C CG  . PHE B 1 259 ? 61.278  16.615  -19.976 1.00 70.00  ? 281  PHE B CG  1 
ATOM   7832  C CD1 . PHE B 1 259 ? 62.287  15.673  -19.874 1.00 70.77  ? 281  PHE B CD1 1 
ATOM   7833  C CD2 . PHE B 1 259 ? 60.698  16.833  -21.215 1.00 69.17  ? 281  PHE B CD2 1 
ATOM   7834  C CE1 . PHE B 1 259 ? 62.707  14.960  -20.980 1.00 71.58  ? 281  PHE B CE1 1 
ATOM   7835  C CE2 . PHE B 1 259 ? 61.116  16.121  -22.325 1.00 71.21  ? 281  PHE B CE2 1 
ATOM   7836  C CZ  . PHE B 1 259 ? 62.124  15.186  -22.207 1.00 72.06  ? 281  PHE B CZ  1 
ATOM   7837  N N   . ALA B 1 260 ? 58.579  17.428  -15.993 1.00 50.39  ? 282  ALA B N   1 
ATOM   7838  C CA  . ALA B 1 260 ? 58.254  18.185  -14.774 1.00 62.57  ? 282  ALA B CA  1 
ATOM   7839  C C   . ALA B 1 260 ? 59.079  17.820  -13.540 1.00 58.95  ? 282  ALA B C   1 
ATOM   7840  O O   . ALA B 1 260 ? 59.453  18.692  -12.763 1.00 60.75  ? 282  ALA B O   1 
ATOM   7841  C CB  . ALA B 1 260 ? 56.763  18.068  -14.447 1.00 48.57  ? 282  ALA B CB  1 
ATOM   7842  N N   . PHE B 1 261 ? 59.325  16.526  -13.361 1.00 56.23  ? 283  PHE B N   1 
ATOM   7843  C CA  . PHE B 1 261 ? 60.009  15.994  -12.181 1.00 52.98  ? 283  PHE B CA  1 
ATOM   7844  C C   . PHE B 1 261 ? 61.514  15.711  -12.363 1.00 55.00  ? 283  PHE B C   1 
ATOM   7845  O O   . PHE B 1 261 ? 62.141  15.110  -11.489 1.00 53.50  ? 283  PHE B O   1 
ATOM   7846  C CB  . PHE B 1 261 ? 59.276  14.749  -11.678 1.00 52.45  ? 283  PHE B CB  1 
ATOM   7847  C CG  . PHE B 1 261 ? 57.838  15.001  -11.319 1.00 49.81  ? 283  PHE B CG  1 
ATOM   7848  C CD1 . PHE B 1 261 ? 57.434  16.243  -10.865 1.00 49.88  ? 283  PHE B CD1 1 
ATOM   7849  C CD2 . PHE B 1 261 ? 56.892  14.008  -11.455 1.00 50.49  ? 283  PHE B CD2 1 
ATOM   7850  C CE1 . PHE B 1 261 ? 56.120  16.486  -10.540 1.00 45.41  ? 283  PHE B CE1 1 
ATOM   7851  C CE2 . PHE B 1 261 ? 55.567  14.246  -11.120 1.00 50.67  ? 283  PHE B CE2 1 
ATOM   7852  C CZ  . PHE B 1 261 ? 55.186  15.489  -10.665 1.00 44.29  ? 283  PHE B CZ  1 
ATOM   7853  N N   . GLN B 1 262 ? 62.067  16.113  -13.507 1.00 51.33  ? 284  GLN B N   1 
ATOM   7854  C CA  . GLN B 1 262 ? 63.421  15.726  -13.934 1.00 55.84  ? 284  GLN B CA  1 
ATOM   7855  C C   . GLN B 1 262 ? 64.583  16.046  -12.974 1.00 57.22  ? 284  GLN B C   1 
ATOM   7856  O O   . GLN B 1 262 ? 65.523  15.263  -12.859 1.00 58.57  ? 284  GLN B O   1 
ATOM   7857  C CB  . GLN B 1 262 ? 63.716  16.323  -15.319 1.00 56.08  ? 284  GLN B CB  1 
ATOM   7858  C CG  . GLN B 1 262 ? 65.026  15.878  -15.947 1.00 57.96  ? 284  GLN B CG  1 
ATOM   7859  C CD  . GLN B 1 262 ? 65.279  16.534  -17.293 1.00 61.77  ? 284  GLN B CD  1 
ATOM   7860  O OE1 . GLN B 1 262 ? 64.424  17.249  -17.820 1.00 57.46  ? 284  GLN B OE1 1 
ATOM   7861  N NE2 . GLN B 1 262 ? 66.463  16.299  -17.852 1.00 71.05  ? 284  GLN B NE2 1 
ATOM   7862  N N   . ASN B 1 263 ? 64.539  17.209  -12.332 1.00 58.16  ? 285  ASN B N   1 
ATOM   7863  C CA  . ASN B 1 263 ? 65.577  17.636  -11.384 1.00 62.85  ? 285  ASN B CA  1 
ATOM   7864  C C   . ASN B 1 263 ? 65.231  17.319  -9.922  1.00 62.64  ? 285  ASN B C   1 
ATOM   7865  O O   . ASN B 1 263 ? 65.875  17.781  -8.983  1.00 63.86  ? 285  ASN B O   1 
ATOM   7866  C CB  . ASN B 1 263 ? 65.959  19.105  -11.598 1.00 69.87  ? 285  ASN B CB  1 
ATOM   7867  C CG  . ASN B 1 263 ? 66.624  19.341  -12.951 1.00 74.31  ? 285  ASN B CG  1 
ATOM   7868  O OD1 . ASN B 1 263 ? 67.228  18.435  -13.527 1.00 74.95  ? 285  ASN B OD1 1 
ATOM   7869  N ND2 . ASN B 1 263 ? 66.517  20.563  -13.461 1.00 77.02  ? 285  ASN B ND2 1 
ATOM   7870  N N   . LEU B 1 264 ? 64.173  16.536  -9.766  1.00 60.28  ? 286  LEU B N   1 
ATOM   7871  C CA  . LEU B 1 264 ? 63.582  16.160  -8.483  1.00 57.74  ? 286  LEU B CA  1 
ATOM   7872  C C   . LEU B 1 264 ? 64.245  14.947  -7.824  1.00 56.62  ? 286  LEU B C   1 
ATOM   7873  O O   . LEU B 1 264 ? 63.574  14.156  -7.168  1.00 53.80  ? 286  LEU B O   1 
ATOM   7874  C CB  . LEU B 1 264 ? 62.068  16.006  -8.582  1.00 55.79  ? 286  LEU B CB  1 
ATOM   7875  C CG  . LEU B 1 264 ? 61.281  17.205  -8.048  1.00 53.48  ? 286  LEU B CG  1 
ATOM   7876  C CD1 . LEU B 1 264 ? 61.948  18.536  -8.379  1.00 50.45  ? 286  LEU B CD1 1 
ATOM   7877  C CD2 . LEU B 1 264 ? 59.866  17.160  -8.579  1.00 49.01  ? 286  LEU B CD2 1 
ATOM   7878  N N   . THR B 1 265 ? 65.516  14.725  -8.150  1.00 51.83  ? 287  THR B N   1 
ATOM   7879  C CA  . THR B 1 265 ? 66.276  13.557  -7.703  1.00 55.14  ? 287  THR B CA  1 
ATOM   7880  C C   . THR B 1 265 ? 66.192  13.206  -6.217  1.00 51.30  ? 287  THR B C   1 
ATOM   7881  O O   . THR B 1 265 ? 66.381  12.045  -5.865  1.00 51.43  ? 287  THR B O   1 
ATOM   7882  C CB  . THR B 1 265 ? 67.775  13.695  -8.036  1.00 57.98  ? 287  THR B CB  1 
ATOM   7883  O OG1 . THR B 1 265 ? 68.337  14.765  -7.270  1.00 60.88  ? 287  THR B OG1 1 
ATOM   7884  C CG2 . THR B 1 265 ? 67.981  13.978  -9.519  1.00 61.27  ? 287  THR B CG2 1 
ATOM   7885  N N   . GLN B 1 266 ? 65.928  14.172  -5.341  1.00 51.20  ? 288  GLN B N   1 
ATOM   7886  C CA  . GLN B 1 266 ? 65.801  13.833  -3.912  1.00 60.53  ? 288  GLN B CA  1 
ATOM   7887  C C   . GLN B 1 266 ? 64.383  13.464  -3.456  1.00 59.81  ? 288  GLN B C   1 
ATOM   7888  O O   . GLN B 1 266 ? 64.163  13.258  -2.261  1.00 59.44  ? 288  GLN B O   1 
ATOM   7889  C CB  . GLN B 1 266 ? 66.345  14.949  -3.009  1.00 51.48  ? 288  GLN B CB  1 
ATOM   7890  C CG  . GLN B 1 266 ? 67.791  15.294  -3.264  1.00 65.61  ? 288  GLN B CG  1 
ATOM   7891  C CD  . GLN B 1 266 ? 68.688  14.079  -3.266  1.00 68.67  ? 288  GLN B CD  1 
ATOM   7892  O OE1 . GLN B 1 266 ? 69.248  13.716  -4.297  1.00 72.86  ? 288  GLN B OE1 1 
ATOM   7893  N NE2 . GLN B 1 266 ? 68.831  13.442  -2.111  1.00 68.61  ? 288  GLN B NE2 1 
ATOM   7894  N N   . LEU B 1 267 ? 63.419  13.392  -4.375  1.00 55.43  ? 289  LEU B N   1 
ATOM   7895  C CA  . LEU B 1 267 ? 62.027  13.169  -3.942  1.00 51.14  ? 289  LEU B CA  1 
ATOM   7896  C C   . LEU B 1 267 ? 61.783  11.809  -3.255  1.00 49.80  ? 289  LEU B C   1 
ATOM   7897  O O   . LEU B 1 267 ? 62.256  10.768  -3.709  1.00 45.78  ? 289  LEU B O   1 
ATOM   7898  C CB  . LEU B 1 267 ? 61.024  13.412  -5.087  1.00 48.98  ? 289  LEU B CB  1 
ATOM   7899  C CG  . LEU B 1 267 ? 59.641  13.884  -4.610  1.00 47.82  ? 289  LEU B CG  1 
ATOM   7900  C CD1 . LEU B 1 267 ? 59.689  15.287  -4.000  1.00 51.48  ? 289  LEU B CD1 1 
ATOM   7901  C CD2 . LEU B 1 267 ? 58.593  13.814  -5.717  1.00 45.57  ? 289  LEU B CD2 1 
ATOM   7902  N N   . ARG B 1 268 ? 61.040  11.847  -2.152  1.00 48.65  ? 290  ARG B N   1 
ATOM   7903  C CA  . ARG B 1 268 ? 60.696  10.675  -1.344  1.00 52.05  ? 290  ARG B CA  1 
ATOM   7904  C C   . ARG B 1 268 ? 59.179  10.473  -1.292  1.00 51.33  ? 290  ARG B C   1 
ATOM   7905  O O   . ARG B 1 268 ? 58.669  9.356   -1.450  1.00 47.94  ? 290  ARG B O   1 
ATOM   7906  C CB  . ARG B 1 268 ? 61.295  10.752  0.065   1.00 56.38  ? 290  ARG B CB  1 
ATOM   7907  C CG  . ARG B 1 268 ? 62.622  9.998   0.223   1.00 60.36  ? 290  ARG B CG  1 
ATOM   7908  C CD  . ARG B 1 268 ? 63.832  10.867  -0.076  1.00 63.90  ? 290  ARG B CD  1 
ATOM   7909  N NE  . ARG B 1 268 ? 65.077  10.096  -0.036  1.00 69.05  ? 290  ARG B NE  1 
ATOM   7910  C CZ  . ARG B 1 268 ? 66.298  10.618  -0.158  1.00 71.97  ? 290  ARG B CZ  1 
ATOM   7911  N NH1 . ARG B 1 268 ? 66.456  11.924  -0.326  1.00 71.64  ? 290  ARG B NH1 1 
ATOM   7912  N NH2 . ARG B 1 268 ? 67.366  9.833   -0.108  1.00 74.19  ? 290  ARG B NH2 1 
ATOM   7913  N N   . TYR B 1 269 ? 58.474  11.533  -0.922  1.00 50.87  ? 291  TYR B N   1 
ATOM   7914  C CA  . TYR B 1 269 ? 57.020  11.514  -0.911  1.00 48.79  ? 291  TYR B CA  1 
ATOM   7915  C C   . TYR B 1 269 ? 56.450  12.266  -2.136  1.00 46.14  ? 291  TYR B C   1 
ATOM   7916  O O   . TYR B 1 269 ? 56.946  13.337  -2.514  1.00 44.84  ? 291  TYR B O   1 
ATOM   7917  C CB  . TYR B 1 269 ? 56.514  12.093  0.411   1.00 51.86  ? 291  TYR B CB  1 
ATOM   7918  C CG  . TYR B 1 269 ? 57.179  11.473  1.630   1.00 52.38  ? 291  TYR B CG  1 
ATOM   7919  C CD1 . TYR B 1 269 ? 58.429  11.914  2.064   1.00 53.22  ? 291  TYR B CD1 1 
ATOM   7920  C CD2 . TYR B 1 269 ? 56.556  10.452  2.343   1.00 51.23  ? 291  TYR B CD2 1 
ATOM   7921  C CE1 . TYR B 1 269 ? 59.036  11.363  3.163   1.00 53.97  ? 291  TYR B CE1 1 
ATOM   7922  C CE2 . TYR B 1 269 ? 57.164  9.892   3.444   1.00 52.99  ? 291  TYR B CE2 1 
ATOM   7923  C CZ  . TYR B 1 269 ? 58.404  10.353  3.843   1.00 56.72  ? 291  TYR B CZ  1 
ATOM   7924  O OH  . TYR B 1 269 ? 59.029  9.812   4.937   1.00 64.62  ? 291  TYR B OH  1 
ATOM   7925  N N   . LEU B 1 270 ? 55.464  11.658  -2.793  1.00 40.02  ? 292  LEU B N   1 
ATOM   7926  C CA  . LEU B 1 270 ? 54.763  12.269  -3.927  1.00 40.06  ? 292  LEU B CA  1 
ATOM   7927  C C   . LEU B 1 270 ? 53.277  11.969  -3.808  1.00 38.82  ? 292  LEU B C   1 
ATOM   7928  O O   . LEU B 1 270 ? 52.873  10.798  -3.836  1.00 38.30  ? 292  LEU B O   1 
ATOM   7929  C CB  . LEU B 1 270 ? 55.293  11.722  -5.257  1.00 40.63  ? 292  LEU B CB  1 
ATOM   7930  C CG  . LEU B 1 270 ? 54.629  12.248  -6.537  1.00 51.86  ? 292  LEU B CG  1 
ATOM   7931  C CD1 . LEU B 1 270 ? 54.739  13.767  -6.639  1.00 41.56  ? 292  LEU B CD1 1 
ATOM   7932  C CD2 . LEU B 1 270 ? 55.247  11.578  -7.760  1.00 54.37  ? 292  LEU B CD2 1 
ATOM   7933  N N   . ASN B 1 271 ? 52.456  13.005  -3.679  1.00 38.68  ? 293  ASN B N   1 
ATOM   7934  C CA  . ASN B 1 271 ? 51.030  12.770  -3.462  1.00 44.32  ? 293  ASN B CA  1 
ATOM   7935  C C   . ASN B 1 271 ? 50.265  13.246  -4.685  1.00 41.28  ? 293  ASN B C   1 
ATOM   7936  O O   . ASN B 1 271 ? 50.131  14.447  -4.928  1.00 39.90  ? 293  ASN B O   1 
ATOM   7937  C CB  . ASN B 1 271 ? 50.530  13.475  -2.184  1.00 37.24  ? 293  ASN B CB  1 
ATOM   7938  C CG  . ASN B 1 271 ? 49.136  12.987  -1.740  1.00 44.54  ? 293  ASN B CG  1 
ATOM   7939  O OD1 . ASN B 1 271 ? 48.424  12.356  -2.522  1.00 41.20  ? 293  ASN B OD1 1 
ATOM   7940  N ND2 . ASN B 1 271 ? 48.737  13.284  -0.485  1.00 45.65  ? 293  ASN B ND2 1 
ATOM   7941  N N   . LEU B 1 272 ? 49.822  12.276  -5.476  1.00 42.97  ? 294  LEU B N   1 
ATOM   7942  C CA  . LEU B 1 272 ? 49.032  12.503  -6.684  1.00 43.30  ? 294  LEU B CA  1 
ATOM   7943  C C   . LEU B 1 272 ? 47.537  12.216  -6.511  1.00 46.54  ? 294  LEU B C   1 
ATOM   7944  O O   . LEU B 1 272 ? 46.801  12.103  -7.493  1.00 46.59  ? 294  LEU B O   1 
ATOM   7945  C CB  . LEU B 1 272 ? 49.655  11.800  -7.900  1.00 41.02  ? 294  LEU B CB  1 
ATOM   7946  C CG  . LEU B 1 272 ? 50.951  12.488  -8.388  1.00 42.29  ? 294  LEU B CG  1 
ATOM   7947  C CD1 . LEU B 1 272 ? 51.622  11.731  -9.527  1.00 39.76  ? 294  LEU B CD1 1 
ATOM   7948  C CD2 . LEU B 1 272 ? 50.710  13.938  -8.820  1.00 39.85  ? 294  LEU B CD2 1 
ATOM   7949  N N   . SER B 1 273 ? 47.110  12.000  -5.269  1.00 49.63  ? 295  SER B N   1 
ATOM   7950  C CA  . SER B 1 273 ? 45.718  11.648  -4.995  1.00 50.29  ? 295  SER B CA  1 
ATOM   7951  C C   . SER B 1 273 ? 44.707  12.617  -5.626  1.00 52.66  ? 295  SER B C   1 
ATOM   7952  O O   . SER B 1 273 ? 44.902  13.838  -5.621  1.00 35.51  ? 295  SER B O   1 
ATOM   7953  C CB  . SER B 1 273 ? 45.468  11.512  -3.493  1.00 51.49  ? 295  SER B CB  1 
ATOM   7954  O OG  . SER B 1 273 ? 46.410  10.631  -2.898  1.00 49.73  ? 295  SER B OG  1 
ATOM   7955  N N   . SER B 1 274 ? 43.649  12.049  -6.196  1.00 34.34  ? 296  SER B N   1 
ATOM   7956  C CA  . SER B 1 274 ? 42.549  12.828  -6.730  1.00 38.85  ? 296  SER B CA  1 
ATOM   7957  C C   . SER B 1 274 ? 43.024  13.880  -7.728  1.00 39.65  ? 296  SER B C   1 
ATOM   7958  O O   . SER B 1 274 ? 42.707  15.058  -7.607  1.00 39.26  ? 296  SER B O   1 
ATOM   7959  C CB  . SER B 1 274 ? 41.728  13.462  -5.599  1.00 40.61  ? 296  SER B CB  1 
ATOM   7960  O OG  . SER B 1 274 ? 40.471  13.929  -6.076  1.00 40.32  ? 296  SER B OG  1 
ATOM   7961  N N   . THR B 1 275 ? 43.873  13.447  -8.650  1.00 43.40  ? 297  THR B N   1 
ATOM   7962  C CA  . THR B 1 275 ? 44.267  14.241  -9.800  1.00 44.39  ? 297  THR B CA  1 
ATOM   7963  C C   . THR B 1 275 ? 43.540  13.822  -11.087 1.00 47.29  ? 297  THR B C   1 
ATOM   7964  O O   . THR B 1 275 ? 43.864  14.305  -12.173 1.00 49.39  ? 297  THR B O   1 
ATOM   7965  C CB  . THR B 1 275 ? 45.790  14.249  -9.977  1.00 44.68  ? 297  THR B CB  1 
ATOM   7966  O OG1 . THR B 1 275 ? 46.272  12.904  -10.023 1.00 43.13  ? 297  THR B OG1 1 
ATOM   7967  C CG2 . THR B 1 275 ? 46.443  14.960  -8.791  1.00 46.38  ? 297  THR B CG2 1 
ATOM   7968  N N   . SER B 1 276 ? 42.605  12.880  -10.961 1.00 44.87  ? 298  SER B N   1 
ATOM   7969  C CA  . SER B 1 276 ? 41.850  12.364  -12.106 1.00 45.49  ? 298  SER B CA  1 
ATOM   7970  C C   . SER B 1 276 ? 42.722  11.677  -13.166 1.00 46.53  ? 298  SER B C   1 
ATOM   7971  O O   . SER B 1 276 ? 42.366  11.651  -14.340 1.00 47.09  ? 298  SER B O   1 
ATOM   7972  C CB  . SER B 1 276 ? 41.014  13.478  -12.758 1.00 37.31  ? 298  SER B CB  1 
ATOM   7973  O OG  . SER B 1 276 ? 39.935  13.871  -11.925 1.00 36.80  ? 298  SER B OG  1 
ATOM   7974  N N   . LEU B 1 277 ? 43.853  11.119  -12.740 1.00 47.46  ? 299  LEU B N   1 
ATOM   7975  C CA  . LEU B 1 277 ? 44.793  10.439  -13.636 1.00 46.55  ? 299  LEU B CA  1 
ATOM   7976  C C   . LEU B 1 277 ? 44.224  9.126   -14.208 1.00 48.27  ? 299  LEU B C   1 
ATOM   7977  O O   . LEU B 1 277 ? 43.770  8.268   -13.430 1.00 45.22  ? 299  LEU B O   1 
ATOM   7978  C CB  . LEU B 1 277 ? 46.071  10.117  -12.843 1.00 41.17  ? 299  LEU B CB  1 
ATOM   7979  C CG  . LEU B 1 277 ? 47.099  11.239  -12.665 1.00 42.67  ? 299  LEU B CG  1 
ATOM   7980  C CD1 . LEU B 1 277 ? 48.281  10.791  -11.800 1.00 38.62  ? 299  LEU B CD1 1 
ATOM   7981  C CD2 . LEU B 1 277 ? 47.580  11.740  -14.044 1.00 39.88  ? 299  LEU B CD2 1 
ATOM   7982  N N   . ARG B 1 278 ? 44.187  8.972   -15.539 1.00 48.99  ? 300  ARG B N   1 
ATOM   7983  C CA  . ARG B 1 278 ? 43.978  7.629   -16.114 1.00 51.10  ? 300  ARG B CA  1 
ATOM   7984  C C   . ARG B 1 278 ? 45.244  6.965   -16.626 1.00 50.23  ? 300  ARG B C   1 
ATOM   7985  O O   . ARG B 1 278 ? 45.242  5.778   -16.954 1.00 52.13  ? 300  ARG B O   1 
ATOM   7986  C CB  . ARG B 1 278 ? 42.922  7.602   -17.228 1.00 53.55  ? 300  ARG B CB  1 
ATOM   7987  C CG  . ARG B 1 278 ? 42.411  8.933   -17.651 1.00 56.31  ? 300  ARG B CG  1 
ATOM   7988  C CD  . ARG B 1 278 ? 41.086  9.227   -16.999 1.00 57.77  ? 300  ARG B CD  1 
ATOM   7989  N NE  . ARG B 1 278 ? 40.993  10.649  -16.710 1.00 61.01  ? 300  ARG B NE  1 
ATOM   7990  C CZ  . ARG B 1 278 ? 39.859  11.308  -16.516 1.00 59.50  ? 300  ARG B CZ  1 
ATOM   7991  N NH1 . ARG B 1 278 ? 38.693  10.675  -16.590 1.00 56.56  ? 300  ARG B NH1 1 
ATOM   7992  N NH2 . ARG B 1 278 ? 39.901  12.609  -16.255 1.00 59.61  ? 300  ARG B NH2 1 
ATOM   7993  N N   . LYS B 1 279 ? 46.334  7.717   -16.652 1.00 50.42  ? 301  LYS B N   1 
ATOM   7994  C CA  . LYS B 1 279 ? 47.573  7.229   -17.232 1.00 55.07  ? 301  LYS B CA  1 
ATOM   7995  C C   . LYS B 1 279 ? 48.740  7.831   -16.486 1.00 53.98  ? 301  LYS B C   1 
ATOM   7996  O O   . LYS B 1 279 ? 48.717  9.000   -16.112 1.00 53.68  ? 301  LYS B O   1 
ATOM   7997  C CB  . LYS B 1 279 ? 47.658  7.593   -18.717 1.00 62.27  ? 301  LYS B CB  1 
ATOM   7998  C CG  . LYS B 1 279 ? 46.797  6.699   -19.622 1.00 69.71  ? 301  LYS B CG  1 
ATOM   7999  C CD  . LYS B 1 279 ? 45.745  7.493   -20.413 1.00 71.71  ? 301  LYS B CD  1 
ATOM   8000  C CE  . LYS B 1 279 ? 44.903  6.570   -21.286 1.00 72.19  ? 301  LYS B CE  1 
ATOM   8001  N NZ  . LYS B 1 279 ? 45.742  5.907   -22.326 1.00 74.00  ? 301  LYS B NZ  1 
ATOM   8002  N N   . ILE B 1 280 ? 49.770  7.034   -16.269 1.00 54.03  ? 302  ILE B N   1 
ATOM   8003  C CA  . ILE B 1 280 ? 50.915  7.514   -15.518 1.00 50.61  ? 302  ILE B CA  1 
ATOM   8004  C C   . ILE B 1 280 ? 52.194  7.342   -16.319 1.00 52.75  ? 302  ILE B C   1 
ATOM   8005  O O   . ILE B 1 280 ? 52.588  6.225   -16.665 1.00 48.79  ? 302  ILE B O   1 
ATOM   8006  C CB  . ILE B 1 280 ? 51.032  6.797   -14.186 1.00 46.38  ? 302  ILE B CB  1 
ATOM   8007  C CG1 . ILE B 1 280 ? 49.785  7.087   -13.347 1.00 44.38  ? 302  ILE B CG1 1 
ATOM   8008  C CG2 . ILE B 1 280 ? 52.304  7.238   -13.464 1.00 47.92  ? 302  ILE B CG2 1 
ATOM   8009  C CD1 . ILE B 1 280 ? 49.673  6.263   -12.135 1.00 43.11  ? 302  ILE B CD1 1 
ATOM   8010  N N   . ASN B 1 281 ? 52.843  8.466   -16.593 1.00 56.42  ? 303  ASN B N   1 
ATOM   8011  C CA  . ASN B 1 281 ? 54.021  8.489   -17.441 1.00 57.48  ? 303  ASN B CA  1 
ATOM   8012  C C   . ASN B 1 281 ? 55.192  7.934   -16.669 1.00 55.71  ? 303  ASN B C   1 
ATOM   8013  O O   . ASN B 1 281 ? 55.589  8.497   -15.653 1.00 44.61  ? 303  ASN B O   1 
ATOM   8014  C CB  . ASN B 1 281 ? 54.319  9.931   -17.842 1.00 59.07  ? 303  ASN B CB  1 
ATOM   8015  C CG  . ASN B 1 281 ? 55.297  10.030  -18.978 1.00 62.73  ? 303  ASN B CG  1 
ATOM   8016  O OD1 . ASN B 1 281 ? 56.344  9.383   -18.980 1.00 66.29  ? 303  ASN B OD1 1 
ATOM   8017  N ND2 . ASN B 1 281 ? 54.956  10.839  -19.964 1.00 62.72  ? 303  ASN B ND2 1 
ATOM   8018  N N   . ALA B 1 282 ? 55.763  6.850   -17.179 1.00 54.07  ? 304  ALA B N   1 
ATOM   8019  C CA  . ALA B 1 282 ? 56.873  6.188   -16.519 1.00 52.69  ? 304  ALA B CA  1 
ATOM   8020  C C   . ALA B 1 282 ? 58.073  7.122   -16.410 1.00 54.86  ? 304  ALA B C   1 
ATOM   8021  O O   . ALA B 1 282 ? 58.846  7.037   -15.453 1.00 55.13  ? 304  ALA B O   1 
ATOM   8022  C CB  . ALA B 1 282 ? 57.247  4.919   -17.260 1.00 52.12  ? 304  ALA B CB  1 
ATOM   8023  N N   . ALA B 1 283 ? 58.213  8.025   -17.379 1.00 50.88  ? 305  ALA B N   1 
ATOM   8024  C CA  . ALA B 1 283 ? 59.337  8.955   -17.386 1.00 51.65  ? 305  ALA B CA  1 
ATOM   8025  C C   . ALA B 1 283 ? 59.338  9.956   -16.223 1.00 48.17  ? 305  ALA B C   1 
ATOM   8026  O O   . ALA B 1 283 ? 60.349  10.598  -15.963 1.00 60.22  ? 305  ALA B O   1 
ATOM   8027  C CB  . ALA B 1 283 ? 59.432  9.687   -18.738 1.00 49.74  ? 305  ALA B CB  1 
ATOM   8028  N N   . TRP B 1 284 ? 58.215  10.096  -15.529 1.00 56.20  ? 306  TRP B N   1 
ATOM   8029  C CA  . TRP B 1 284 ? 58.166  10.959  -14.349 1.00 54.48  ? 306  TRP B CA  1 
ATOM   8030  C C   . TRP B 1 284 ? 59.095  10.462  -13.259 1.00 54.66  ? 306  TRP B C   1 
ATOM   8031  O O   . TRP B 1 284 ? 59.663  11.251  -12.509 1.00 56.88  ? 306  TRP B O   1 
ATOM   8032  C CB  . TRP B 1 284 ? 56.756  11.029  -13.783 1.00 45.12  ? 306  TRP B CB  1 
ATOM   8033  C CG  . TRP B 1 284 ? 55.807  11.776  -14.648 1.00 50.45  ? 306  TRP B CG  1 
ATOM   8034  C CD1 . TRP B 1 284 ? 56.119  12.637  -15.668 1.00 50.77  ? 306  TRP B CD1 1 
ATOM   8035  C CD2 . TRP B 1 284 ? 54.379  11.723  -14.588 1.00 47.96  ? 306  TRP B CD2 1 
ATOM   8036  N NE1 . TRP B 1 284 ? 54.969  13.125  -16.239 1.00 50.99  ? 306  TRP B NE1 1 
ATOM   8037  C CE2 . TRP B 1 284 ? 53.888  12.578  -15.596 1.00 48.77  ? 306  TRP B CE2 1 
ATOM   8038  C CE3 . TRP B 1 284 ? 53.469  11.041  -13.778 1.00 48.29  ? 306  TRP B CE3 1 
ATOM   8039  C CZ2 . TRP B 1 284 ? 52.528  12.767  -15.810 1.00 45.49  ? 306  TRP B CZ2 1 
ATOM   8040  C CZ3 . TRP B 1 284 ? 52.117  11.230  -13.995 1.00 47.38  ? 306  TRP B CZ3 1 
ATOM   8041  C CH2 . TRP B 1 284 ? 51.661  12.088  -15.002 1.00 45.69  ? 306  TRP B CH2 1 
ATOM   8042  N N   . PHE B 1 285 ? 59.234  9.145   -13.174 1.00 46.20  ? 307  PHE B N   1 
ATOM   8043  C CA  . PHE B 1 285 ? 59.998  8.511   -12.100 1.00 55.82  ? 307  PHE B CA  1 
ATOM   8044  C C   . PHE B 1 285 ? 61.445  8.162   -12.474 1.00 58.69  ? 307  PHE B C   1 
ATOM   8045  O O   . PHE B 1 285 ? 62.162  7.535   -11.685 1.00 57.49  ? 307  PHE B O   1 
ATOM   8046  C CB  . PHE B 1 285 ? 59.247  7.284   -11.583 1.00 49.44  ? 307  PHE B CB  1 
ATOM   8047  C CG  . PHE B 1 285 ? 57.812  7.562   -11.258 1.00 49.28  ? 307  PHE B CG  1 
ATOM   8048  C CD1 . PHE B 1 285 ? 57.470  8.238   -10.098 1.00 48.89  ? 307  PHE B CD1 1 
ATOM   8049  C CD2 . PHE B 1 285 ? 56.806  7.167   -12.114 1.00 49.95  ? 307  PHE B CD2 1 
ATOM   8050  C CE1 . PHE B 1 285 ? 56.152  8.504   -9.800  1.00 48.02  ? 307  PHE B CE1 1 
ATOM   8051  C CE2 . PHE B 1 285 ? 55.481  7.432   -11.820 1.00 50.31  ? 307  PHE B CE2 1 
ATOM   8052  C CZ  . PHE B 1 285 ? 55.150  8.103   -10.665 1.00 47.50  ? 307  PHE B CZ  1 
ATOM   8053  N N   . LYS B 1 286 ? 61.856  8.569   -13.674 1.00 61.25  ? 308  LYS B N   1 
ATOM   8054  C CA  . LYS B 1 286 ? 63.163  8.212   -14.224 1.00 63.64  ? 308  LYS B CA  1 
ATOM   8055  C C   . LYS B 1 286 ? 64.331  8.773   -13.421 1.00 62.61  ? 308  LYS B C   1 
ATOM   8056  O O   . LYS B 1 286 ? 65.346  8.108   -13.252 1.00 66.42  ? 308  LYS B O   1 
ATOM   8057  C CB  . LYS B 1 286 ? 63.264  8.670   -15.684 1.00 67.39  ? 308  LYS B CB  1 
ATOM   8058  C CG  . LYS B 1 286 ? 64.523  8.205   -16.419 1.00 72.69  ? 308  LYS B CG  1 
ATOM   8059  C CD  . LYS B 1 286 ? 64.206  7.110   -17.438 1.00 75.73  ? 308  LYS B CD  1 
ATOM   8060  C CE  . LYS B 1 286 ? 65.468  6.554   -18.095 1.00 78.83  ? 308  LYS B CE  1 
ATOM   8061  N NZ  . LYS B 1 286 ? 66.211  7.578   -18.880 1.00 82.42  ? 308  LYS B NZ  1 
ATOM   8062  N N   . ASN B 1 287 ? 64.194  10.017  -12.974 1.00 59.01  ? 309  ASN B N   1 
ATOM   8063  C CA  . ASN B 1 287 ? 65.203  10.696  -12.155 1.00 57.57  ? 309  ASN B CA  1 
ATOM   8064  C C   . ASN B 1 287 ? 64.940  10.639  -10.653 1.00 57.96  ? 309  ASN B C   1 
ATOM   8065  O O   . ASN B 1 287 ? 65.521  11.402  -9.885  1.00 56.02  ? 309  ASN B O   1 
ATOM   8066  C CB  . ASN B 1 287 ? 65.457  12.125  -12.622 1.00 52.48  ? 309  ASN B CB  1 
ATOM   8067  C CG  . ASN B 1 287 ? 65.908  12.185  -14.061 1.00 74.91  ? 309  ASN B CG  1 
ATOM   8068  O OD1 . ASN B 1 287 ? 65.366  12.946  -14.859 1.00 77.10  ? 309  ASN B OD1 1 
ATOM   8069  N ND2 . ASN B 1 287 ? 66.891  11.361  -14.410 1.00 75.62  ? 309  ASN B ND2 1 
ATOM   8070  N N   . MET B 1 288 ? 64.007  9.788   -10.250 1.00 60.38  ? 310  MET B N   1 
ATOM   8071  C CA  . MET B 1 288 ? 63.529  9.774   -8.877  1.00 60.23  ? 310  MET B CA  1 
ATOM   8072  C C   . MET B 1 288 ? 63.819  8.425   -8.206  1.00 48.00  ? 310  MET B C   1 
ATOM   8073  O O   . MET B 1 288 ? 62.892  7.710   -7.826  1.00 46.79  ? 310  MET B O   1 
ATOM   8074  C CB  . MET B 1 288 ? 62.023  10.009  -8.935  1.00 60.45  ? 310  MET B CB  1 
ATOM   8075  C CG  . MET B 1 288 ? 61.406  10.665  -7.737  1.00 61.19  ? 310  MET B CG  1 
ATOM   8076  S SD  . MET B 1 288 ? 59.667  10.976  -8.116  1.00 47.74  ? 310  MET B SD  1 
ATOM   8077  C CE  . MET B 1 288 ? 59.817  12.432  -9.127  1.00 45.91  ? 310  MET B CE  1 
ATOM   8078  N N   . PRO B 1 289 ? 65.114  8.086   -8.042  1.00 54.79  ? 311  PRO B N   1 
ATOM   8079  C CA  . PRO B 1 289 ? 65.482  6.756   -7.544  1.00 58.34  ? 311  PRO B CA  1 
ATOM   8080  C C   . PRO B 1 289 ? 65.177  6.524   -6.064  1.00 61.00  ? 311  PRO B C   1 
ATOM   8081  O O   . PRO B 1 289 ? 65.126  5.369   -5.649  1.00 60.89  ? 311  PRO B O   1 
ATOM   8082  C CB  . PRO B 1 289 ? 66.995  6.697   -7.794  1.00 60.83  ? 311  PRO B CB  1 
ATOM   8083  C CG  . PRO B 1 289 ? 67.444  8.104   -7.736  1.00 51.53  ? 311  PRO B CG  1 
ATOM   8084  C CD  . PRO B 1 289 ? 66.309  8.924   -8.281  1.00 55.60  ? 311  PRO B CD  1 
ATOM   8085  N N   . HIS B 1 290 ? 64.985  7.583   -5.283  1.00 63.40  ? 312  HIS B N   1 
ATOM   8086  C CA  . HIS B 1 290 ? 64.747  7.416   -3.847  1.00 63.33  ? 312  HIS B CA  1 
ATOM   8087  C C   . HIS B 1 290 ? 63.272  7.361   -3.489  1.00 58.20  ? 312  HIS B C   1 
ATOM   8088  O O   . HIS B 1 290 ? 62.943  7.386   -2.310  1.00 59.02  ? 312  HIS B O   1 
ATOM   8089  C CB  . HIS B 1 290 ? 65.390  8.536   -3.026  1.00 67.99  ? 312  HIS B CB  1 
ATOM   8090  C CG  . HIS B 1 290 ? 66.884  8.548   -3.073  1.00 76.46  ? 312  HIS B CG  1 
ATOM   8091  N ND1 . HIS B 1 290 ? 67.651  7.479   -2.661  1.00 79.09  ? 312  HIS B ND1 1 
ATOM   8092  C CD2 . HIS B 1 290 ? 67.754  9.508   -3.467  1.00 79.23  ? 312  HIS B CD2 1 
ATOM   8093  C CE1 . HIS B 1 290 ? 68.929  7.776   -2.814  1.00 81.38  ? 312  HIS B CE1 1 
ATOM   8094  N NE2 . HIS B 1 290 ? 69.019  9.002   -3.297  1.00 81.32  ? 312  HIS B NE2 1 
ATOM   8095  N N   . LEU B 1 291 ? 62.391  7.344   -4.489  1.00 50.39  ? 313  LEU B N   1 
ATOM   8096  C CA  . LEU B 1 291 ? 60.957  7.409   -4.214  1.00 43.71  ? 313  LEU B CA  1 
ATOM   8097  C C   . LEU B 1 291 ? 60.520  6.326   -3.228  1.00 42.79  ? 313  LEU B C   1 
ATOM   8098  O O   . LEU B 1 291 ? 60.914  5.168   -3.335  1.00 50.20  ? 313  LEU B O   1 
ATOM   8099  C CB  . LEU B 1 291 ? 60.139  7.338   -5.496  1.00 48.37  ? 313  LEU B CB  1 
ATOM   8100  C CG  . LEU B 1 291 ? 58.720  7.861   -5.297  1.00 49.21  ? 313  LEU B CG  1 
ATOM   8101  C CD1 . LEU B 1 291 ? 58.737  9.214   -4.586  1.00 42.32  ? 313  LEU B CD1 1 
ATOM   8102  C CD2 . LEU B 1 291 ? 58.010  7.964   -6.632  1.00 42.02  ? 313  LEU B CD2 1 
ATOM   8103  N N   . LYS B 1 292 ? 59.716  6.726   -2.255  1.00 45.93  ? 314  LYS B N   1 
ATOM   8104  C CA  . LYS B 1 292 ? 59.437  5.891   -1.094  1.00 44.81  ? 314  LYS B CA  1 
ATOM   8105  C C   . LYS B 1 292 ? 57.940  5.691   -0.917  1.00 39.76  ? 314  LYS B C   1 
ATOM   8106  O O   . LYS B 1 292 ? 57.464  4.557   -0.826  1.00 39.11  ? 314  LYS B O   1 
ATOM   8107  C CB  . LYS B 1 292 ? 60.062  6.485   0.168   1.00 43.71  ? 314  LYS B CB  1 
ATOM   8108  C CG  . LYS B 1 292 ? 60.060  5.542   1.345   1.00 49.47  ? 314  LYS B CG  1 
ATOM   8109  C CD  . LYS B 1 292 ? 60.207  6.316   2.639   1.00 53.97  ? 314  LYS B CD  1 
ATOM   8110  C CE  . LYS B 1 292 ? 60.998  5.537   3.651   1.00 57.41  ? 314  LYS B CE  1 
ATOM   8111  N NZ  . LYS B 1 292 ? 61.353  6.372   4.828   1.00 62.53  ? 314  LYS B NZ  1 
ATOM   8112  N N   . VAL B 1 293 ? 57.215  6.799   -0.779  1.00 39.36  ? 315  VAL B N   1 
ATOM   8113  C CA  . VAL B 1 293 ? 55.763  6.758   -0.663  1.00 39.34  ? 315  VAL B CA  1 
ATOM   8114  C C   . VAL B 1 293 ? 55.097  7.424   -1.870  1.00 39.40  ? 315  VAL B C   1 
ATOM   8115  O O   . VAL B 1 293 ? 55.381  8.583   -2.202  1.00 41.81  ? 315  VAL B O   1 
ATOM   8116  C CB  . VAL B 1 293 ? 55.282  7.416   0.654   1.00 40.88  ? 315  VAL B CB  1 
ATOM   8117  C CG1 . VAL B 1 293 ? 53.751  7.374   0.771   1.00 36.41  ? 315  VAL B CG1 1 
ATOM   8118  C CG2 . VAL B 1 293 ? 55.920  6.723   1.839   1.00 37.75  ? 315  VAL B CG2 1 
ATOM   8119  N N   . LEU B 1 294 ? 54.222  6.679   -2.535  1.00 38.27  ? 316  LEU B N   1 
ATOM   8120  C CA  . LEU B 1 294 ? 53.482  7.198   -3.679  1.00 40.37  ? 316  LEU B CA  1 
ATOM   8121  C C   . LEU B 1 294 ? 51.983  7.074   -3.433  1.00 41.48  ? 316  LEU B C   1 
ATOM   8122  O O   . LEU B 1 294 ? 51.469  5.977   -3.236  1.00 41.06  ? 316  LEU B O   1 
ATOM   8123  C CB  . LEU B 1 294 ? 53.882  6.459   -4.957  1.00 41.34  ? 316  LEU B CB  1 
ATOM   8124  C CG  . LEU B 1 294 ? 53.167  6.810   -6.262  1.00 41.05  ? 316  LEU B CG  1 
ATOM   8125  C CD1 . LEU B 1 294 ? 53.311  8.294   -6.551  1.00 38.48  ? 316  LEU B CD1 1 
ATOM   8126  C CD2 . LEU B 1 294 ? 53.750  5.982   -7.406  1.00 38.57  ? 316  LEU B CD2 1 
ATOM   8127  N N   . ASP B 1 295 ? 51.294  8.212   -3.422  1.00 43.59  ? 317  ASP B N   1 
ATOM   8128  C CA  . ASP B 1 295 ? 49.854  8.235   -3.232  1.00 43.39  ? 317  ASP B CA  1 
ATOM   8129  C C   . ASP B 1 295 ? 49.125  8.521   -4.553  1.00 41.64  ? 317  ASP B C   1 
ATOM   8130  O O   . ASP B 1 295 ? 49.217  9.612   -5.115  1.00 36.90  ? 317  ASP B O   1 
ATOM   8131  C CB  . ASP B 1 295 ? 49.486  9.256   -2.158  1.00 48.04  ? 317  ASP B CB  1 
ATOM   8132  C CG  . ASP B 1 295 ? 49.845  8.779   -0.748  1.00 55.90  ? 317  ASP B CG  1 
ATOM   8133  O OD1 . ASP B 1 295 ? 50.911  8.153   -0.566  1.00 60.02  ? 317  ASP B OD1 1 
ATOM   8134  O OD2 . ASP B 1 295 ? 49.053  9.022   0.181   1.00 57.86  ? 317  ASP B OD2 1 
ATOM   8135  N N   . LEU B 1 296 ? 48.498  7.470   -5.073  1.00 42.82  ? 318  LEU B N   1 
ATOM   8136  C CA  . LEU B 1 296 ? 47.682  7.464   -6.295  1.00 40.85  ? 318  LEU B CA  1 
ATOM   8137  C C   . LEU B 1 296 ? 46.147  7.380   -6.113  1.00 41.06  ? 318  LEU B C   1 
ATOM   8138  O O   . LEU B 1 296 ? 45.433  7.021   -7.048  1.00 40.95  ? 318  LEU B O   1 
ATOM   8139  C CB  . LEU B 1 296 ? 48.225  6.438   -7.281  1.00 38.01  ? 318  LEU B CB  1 
ATOM   8140  C CG  . LEU B 1 296 ? 49.628  6.854   -7.749  1.00 39.85  ? 318  LEU B CG  1 
ATOM   8141  C CD1 . LEU B 1 296 ? 50.256  5.813   -8.650  1.00 43.26  ? 318  LEU B CD1 1 
ATOM   8142  C CD2 . LEU B 1 296 ? 49.582  8.204   -8.454  1.00 36.86  ? 318  LEU B CD2 1 
ATOM   8143  N N   . GLU B 1 297 ? 45.675  7.580   -4.887  1.00 36.09  ? 319  GLU B N   1 
ATOM   8144  C CA  . GLU B 1 297 ? 44.264  7.440   -4.530  1.00 38.93  ? 319  GLU B CA  1 
ATOM   8145  C C   . GLU B 1 297 ? 43.289  8.313   -5.312  1.00 37.71  ? 319  GLU B C   1 
ATOM   8146  O O   . GLU B 1 297 ? 43.632  9.410   -5.764  1.00 37.71  ? 319  GLU B O   1 
ATOM   8147  C CB  . GLU B 1 297 ? 44.055  7.757   -3.050  1.00 44.88  ? 319  GLU B CB  1 
ATOM   8148  C CG  . GLU B 1 297 ? 44.773  6.865   -2.097  1.00 52.34  ? 319  GLU B CG  1 
ATOM   8149  C CD  . GLU B 1 297 ? 44.784  7.447   -0.694  1.00 59.10  ? 319  GLU B CD  1 
ATOM   8150  O OE1 . GLU B 1 297 ? 45.584  8.384   -0.454  1.00 61.10  ? 319  GLU B OE1 1 
ATOM   8151  O OE2 . GLU B 1 297 ? 43.982  6.982   0.153   1.00 58.28  ? 319  GLU B OE2 1 
ATOM   8152  N N   . PHE B 1 298 ? 42.062  7.813   -5.438  1.00 33.96  ? 320  PHE B N   1 
ATOM   8153  C CA  . PHE B 1 298 ? 40.951  8.578   -6.001  1.00 35.74  ? 320  PHE B CA  1 
ATOM   8154  C C   . PHE B 1 298 ? 41.255  9.096   -7.405  1.00 38.39  ? 320  PHE B C   1 
ATOM   8155  O O   . PHE B 1 298 ? 41.095  10.282  -7.692  1.00 41.55  ? 320  PHE B O   1 
ATOM   8156  C CB  . PHE B 1 298 ? 40.544  9.730   -5.078  1.00 38.83  ? 320  PHE B CB  1 
ATOM   8157  C CG  . PHE B 1 298 ? 39.855  9.285   -3.810  1.00 42.78  ? 320  PHE B CG  1 
ATOM   8158  C CD1 . PHE B 1 298 ? 38.495  9.013   -3.807  1.00 43.45  ? 320  PHE B CD1 1 
ATOM   8159  C CD2 . PHE B 1 298 ? 40.563  9.160   -2.622  1.00 43.32  ? 320  PHE B CD2 1 
ATOM   8160  C CE1 . PHE B 1 298 ? 37.853  8.619   -2.650  1.00 43.75  ? 320  PHE B CE1 1 
ATOM   8161  C CE2 . PHE B 1 298 ? 39.927  8.756   -1.453  1.00 44.80  ? 320  PHE B CE2 1 
ATOM   8162  C CZ  . PHE B 1 298 ? 38.566  8.485   -1.468  1.00 42.56  ? 320  PHE B CZ  1 
ATOM   8163  N N   . ASN B 1 299 ? 41.698  8.188   -8.264  1.00 36.99  ? 321  ASN B N   1 
ATOM   8164  C CA  . ASN B 1 299 ? 41.997  8.483   -9.662  1.00 40.93  ? 321  ASN B CA  1 
ATOM   8165  C C   . ASN B 1 299 ? 41.225  7.494   -10.529 1.00 40.40  ? 321  ASN B C   1 
ATOM   8166  O O   . ASN B 1 299 ? 40.307  6.842   -10.032 1.00 44.99  ? 321  ASN B O   1 
ATOM   8167  C CB  . ASN B 1 299 ? 43.501  8.413   -9.910  1.00 34.63  ? 321  ASN B CB  1 
ATOM   8168  C CG  . ASN B 1 299 ? 44.235  9.592   -9.308  1.00 36.92  ? 321  ASN B CG  1 
ATOM   8169  O OD1 . ASN B 1 299 ? 43.994  10.744  -9.690  1.00 35.76  ? 321  ASN B OD1 1 
ATOM   8170  N ND2 . ASN B 1 299 ? 45.144  9.319   -8.370  1.00 34.87  ? 321  ASN B ND2 1 
ATOM   8171  N N   . TYR B 1 300 ? 41.505  7.412   -11.822 1.00 37.91  ? 322  TYR B N   1 
ATOM   8172  C CA  . TYR B 1 300 ? 40.989  6.252   -12.529 1.00 41.41  ? 322  TYR B CA  1 
ATOM   8173  C C   . TYR B 1 300 ? 42.171  5.441   -13.042 1.00 45.40  ? 322  TYR B C   1 
ATOM   8174  O O   . TYR B 1 300 ? 42.531  5.514   -14.215 1.00 50.47  ? 322  TYR B O   1 
ATOM   8175  C CB  . TYR B 1 300 ? 40.155  6.729   -13.727 1.00 41.50  ? 322  TYR B CB  1 
ATOM   8176  C CG  . TYR B 1 300 ? 39.279  7.943   -13.470 1.00 39.98  ? 322  TYR B CG  1 
ATOM   8177  C CD1 . TYR B 1 300 ? 39.823  9.225   -13.382 1.00 39.87  ? 322  TYR B CD1 1 
ATOM   8178  C CD2 . TYR B 1 300 ? 37.903  7.808   -13.337 1.00 41.83  ? 322  TYR B CD2 1 
ATOM   8179  C CE1 . TYR B 1 300 ? 39.019  10.334  -13.158 1.00 42.01  ? 322  TYR B CE1 1 
ATOM   8180  C CE2 . TYR B 1 300 ? 37.087  8.907   -13.119 1.00 43.69  ? 322  TYR B CE2 1 
ATOM   8181  C CZ  . TYR B 1 300 ? 37.646  10.171  -13.040 1.00 43.97  ? 322  TYR B CZ  1 
ATOM   8182  O OH  . TYR B 1 300 ? 36.831  11.262  -12.828 1.00 42.29  ? 322  TYR B OH  1 
ATOM   8183  N N   . LEU B 1 301 ? 42.676  4.564   -12.189 1.00 45.59  ? 323  LEU B N   1 
ATOM   8184  C CA  . LEU B 1 301 ? 43.920  3.847   -12.461 1.00 45.80  ? 323  LEU B CA  1 
ATOM   8185  C C   . LEU B 1 301 ? 43.804  2.363   -12.784 1.00 44.63  ? 323  LEU B C   1 
ATOM   8186  O O   . LEU B 1 301 ? 44.821  1.672   -12.866 1.00 45.45  ? 323  LEU B O   1 
ATOM   8187  C CB  . LEU B 1 301 ? 44.975  4.137   -11.387 1.00 45.05  ? 323  LEU B CB  1 
ATOM   8188  C CG  . LEU B 1 301 ? 45.432  5.597   -11.461 1.00 46.29  ? 323  LEU B CG  1 
ATOM   8189  C CD1 . LEU B 1 301 ? 46.497  5.917   -10.410 1.00 45.94  ? 323  LEU B CD1 1 
ATOM   8190  C CD2 . LEU B 1 301 ? 45.932  5.946   -12.863 1.00 44.69  ? 323  LEU B CD2 1 
ATOM   8191  N N   . VAL B 1 302 ? 42.570  1.870   -12.874 1.00 34.71  ? 324  VAL B N   1 
ATOM   8192  C CA  . VAL B 1 302 ? 42.307  0.455   -13.144 1.00 44.44  ? 324  VAL B CA  1 
ATOM   8193  C C   . VAL B 1 302 ? 43.118  -0.068  -14.331 1.00 42.79  ? 324  VAL B C   1 
ATOM   8194  O O   . VAL B 1 302 ? 43.710  -1.143  -14.259 1.00 43.02  ? 324  VAL B O   1 
ATOM   8195  C CB  . VAL B 1 302 ? 40.795  0.194   -13.364 1.00 45.91  ? 324  VAL B CB  1 
ATOM   8196  C CG1 . VAL B 1 302 ? 40.559  -1.159  -14.013 1.00 41.62  ? 324  VAL B CG1 1 
ATOM   8197  C CG2 . VAL B 1 302 ? 40.058  0.284   -12.052 1.00 47.47  ? 324  VAL B CG2 1 
ATOM   8198  N N   . GLY B 1 303 ? 43.153  0.700   -15.414 1.00 44.40  ? 325  GLY B N   1 
ATOM   8199  C CA  . GLY B 1 303 ? 43.970  0.336   -16.555 1.00 47.29  ? 325  GLY B CA  1 
ATOM   8200  C C   . GLY B 1 303 ? 45.436  0.282   -16.174 1.00 51.78  ? 325  GLY B C   1 
ATOM   8201  O O   . GLY B 1 303 ? 46.116  -0.714  -16.421 1.00 56.06  ? 325  GLY B O   1 
ATOM   8202  N N   . GLU B 1 304 ? 45.923  1.358   -15.566 1.00 48.79  ? 326  GLU B N   1 
ATOM   8203  C CA  . GLU B 1 304 ? 47.310  1.427   -15.125 1.00 46.92  ? 326  GLU B CA  1 
ATOM   8204  C C   . GLU B 1 304 ? 47.671  0.333   -14.122 1.00 46.02  ? 326  GLU B C   1 
ATOM   8205  O O   . GLU B 1 304 ? 48.781  -0.185  -14.143 1.00 45.25  ? 326  GLU B O   1 
ATOM   8206  C CB  . GLU B 1 304 ? 47.621  2.805   -14.536 1.00 46.56  ? 326  GLU B CB  1 
ATOM   8207  C CG  . GLU B 1 304 ? 47.833  3.885   -15.582 1.00 48.96  ? 326  GLU B CG  1 
ATOM   8208  C CD  . GLU B 1 304 ? 49.147  3.732   -16.339 1.00 49.01  ? 326  GLU B CD  1 
ATOM   8209  O OE1 . GLU B 1 304 ? 50.051  3.012   -15.856 1.00 50.55  ? 326  GLU B OE1 1 
ATOM   8210  O OE2 . GLU B 1 304 ? 49.276  4.345   -17.417 1.00 47.06  ? 326  GLU B OE2 1 
ATOM   8211  N N   . ILE B 1 305 ? 46.742  -0.016  -13.239 1.00 47.13  ? 327  ILE B N   1 
ATOM   8212  C CA  . ILE B 1 305 ? 46.990  -1.093  -12.286 1.00 46.72  ? 327  ILE B CA  1 
ATOM   8213  C C   . ILE B 1 305 ? 47.175  -2.425  -13.020 1.00 45.59  ? 327  ILE B C   1 
ATOM   8214  O O   . ILE B 1 305 ? 48.034  -3.240  -12.650 1.00 43.55  ? 327  ILE B O   1 
ATOM   8215  C CB  . ILE B 1 305 ? 45.870  -1.177  -11.229 1.00 43.32  ? 327  ILE B CB  1 
ATOM   8216  C CG1 . ILE B 1 305 ? 46.010  -0.026  -10.236 1.00 42.52  ? 327  ILE B CG1 1 
ATOM   8217  C CG2 . ILE B 1 305 ? 45.928  -2.490  -10.475 1.00 42.56  ? 327  ILE B CG2 1 
ATOM   8218  C CD1 . ILE B 1 305 ? 44.773  0.218   -9.413  1.00 41.29  ? 327  ILE B CD1 1 
ATOM   8219  N N   . ALA B 1 306 ? 46.388  -2.609  -14.078 1.00 43.13  ? 328  ALA B N   1 
ATOM   8220  C CA  . ALA B 1 306 ? 46.434  -3.802  -14.933 1.00 46.36  ? 328  ALA B CA  1 
ATOM   8221  C C   . ALA B 1 306 ? 47.704  -3.945  -15.789 1.00 46.28  ? 328  ALA B C   1 
ATOM   8222  O O   . ALA B 1 306 ? 48.170  -5.060  -16.023 1.00 45.36  ? 328  ALA B O   1 
ATOM   8223  C CB  . ALA B 1 306 ? 45.196  -3.857  -15.831 1.00 38.00  ? 328  ALA B CB  1 
ATOM   8224  N N   . SER B 1 307 ? 48.250  -2.832  -16.268 1.00 48.63  ? 329  SER B N   1 
ATOM   8225  C CA  . SER B 1 307 ? 49.398  -2.891  -17.170 1.00 60.41  ? 329  SER B CA  1 
ATOM   8226  C C   . SER B 1 307 ? 50.616  -2.212  -16.553 1.00 67.12  ? 329  SER B C   1 
ATOM   8227  O O   . SER B 1 307 ? 51.603  -2.876  -16.227 1.00 71.32  ? 329  SER B O   1 
ATOM   8228  C CB  . SER B 1 307 ? 49.053  -2.280  -18.530 1.00 66.27  ? 329  SER B CB  1 
ATOM   8229  O OG  . SER B 1 307 ? 48.640  -0.933  -18.395 1.00 69.42  ? 329  SER B OG  1 
ATOM   8230  N N   . GLY B 1 308 ? 50.552  -0.891  -16.399 1.00 66.92  ? 330  GLY B N   1 
ATOM   8231  C CA  . GLY B 1 308 ? 51.445  -0.211  -15.479 1.00 63.89  ? 330  GLY B CA  1 
ATOM   8232  C C   . GLY B 1 308 ? 52.935  -0.154  -15.740 1.00 59.67  ? 330  GLY B C   1 
ATOM   8233  O O   . GLY B 1 308 ? 53.708  -0.710  -14.970 1.00 62.73  ? 330  GLY B O   1 
ATOM   8234  N N   . ALA B 1 309 ? 53.341  0.467   -16.837 1.00 55.34  ? 331  ALA B N   1 
ATOM   8235  C CA  . ALA B 1 309 ? 54.760  0.704   -17.085 1.00 54.09  ? 331  ALA B CA  1 
ATOM   8236  C C   . ALA B 1 309 ? 55.499  1.383   -15.915 1.00 50.12  ? 331  ALA B C   1 
ATOM   8237  O O   . ALA B 1 309 ? 56.673  1.109   -15.682 1.00 47.78  ? 331  ALA B O   1 
ATOM   8238  C CB  . ALA B 1 309 ? 54.942  1.510   -18.359 1.00 55.39  ? 331  ALA B CB  1 
ATOM   8239  N N   . PHE B 1 310 ? 54.812  2.261   -15.186 1.00 49.87  ? 332  PHE B N   1 
ATOM   8240  C CA  . PHE B 1 310 ? 55.458  3.073   -14.146 1.00 49.79  ? 332  PHE B CA  1 
ATOM   8241  C C   . PHE B 1 310 ? 56.001  2.235   -12.979 1.00 50.12  ? 332  PHE B C   1 
ATOM   8242  O O   . PHE B 1 310 ? 56.906  2.663   -12.251 1.00 51.44  ? 332  PHE B O   1 
ATOM   8243  C CB  . PHE B 1 310 ? 54.499  4.148   -13.620 1.00 46.02  ? 332  PHE B CB  1 
ATOM   8244  C CG  . PHE B 1 310 ? 53.462  3.626   -12.658 1.00 45.32  ? 332  PHE B CG  1 
ATOM   8245  C CD1 . PHE B 1 310 ? 52.309  3.020   -13.124 1.00 44.87  ? 332  PHE B CD1 1 
ATOM   8246  C CD2 . PHE B 1 310 ? 53.638  3.751   -11.290 1.00 45.23  ? 332  PHE B CD2 1 
ATOM   8247  C CE1 . PHE B 1 310 ? 51.360  2.542   -12.248 1.00 44.85  ? 332  PHE B CE1 1 
ATOM   8248  C CE2 . PHE B 1 310 ? 52.677  3.272   -10.401 1.00 41.89  ? 332  PHE B CE2 1 
ATOM   8249  C CZ  . PHE B 1 310 ? 51.546  2.673   -10.881 1.00 42.27  ? 332  PHE B CZ  1 
ATOM   8250  N N   . LEU B 1 311 ? 55.442  1.043   -12.815 1.00 48.50  ? 333  LEU B N   1 
ATOM   8251  C CA  . LEU B 1 311 ? 55.826  0.146   -11.737 1.00 52.98  ? 333  LEU B CA  1 
ATOM   8252  C C   . LEU B 1 311 ? 57.270  -0.334  -11.877 1.00 55.67  ? 333  LEU B C   1 
ATOM   8253  O O   . LEU B 1 311 ? 57.907  -0.717  -10.898 1.00 58.02  ? 333  LEU B O   1 
ATOM   8254  C CB  . LEU B 1 311 ? 54.861  -1.036  -11.686 1.00 55.34  ? 333  LEU B CB  1 
ATOM   8255  C CG  . LEU B 1 311 ? 53.424  -0.633  -11.362 1.00 58.45  ? 333  LEU B CG  1 
ATOM   8256  C CD1 . LEU B 1 311 ? 52.485  -1.792  -11.603 1.00 61.59  ? 333  LEU B CD1 1 
ATOM   8257  C CD2 . LEU B 1 311 ? 53.308  -0.156  -9.926  1.00 57.96  ? 333  LEU B CD2 1 
ATOM   8258  N N   . THR B 1 312 ? 57.792  -0.289  -13.097 1.00 54.35  ? 334  THR B N   1 
ATOM   8259  C CA  . THR B 1 312 ? 59.145  -0.752  -13.351 1.00 50.73  ? 334  THR B CA  1 
ATOM   8260  C C   . THR B 1 312 ? 60.181  0.252   -12.843 1.00 48.20  ? 334  THR B C   1 
ATOM   8261  O O   . THR B 1 312 ? 61.349  -0.083  -12.681 1.00 47.86  ? 334  THR B O   1 
ATOM   8262  C CB  . THR B 1 312 ? 59.360  -1.034  -14.864 1.00 53.12  ? 334  THR B CB  1 
ATOM   8263  O OG1 . THR B 1 312 ? 59.155  0.167   -15.618 1.00 54.36  ? 334  THR B OG1 1 
ATOM   8264  C CG2 . THR B 1 312 ? 58.389  -2.093  -15.354 1.00 48.88  ? 334  THR B CG2 1 
ATOM   8265  N N   . MET B 1 313 ? 59.740  1.482   -12.597 1.00 49.55  ? 335  MET B N   1 
ATOM   8266  C CA  . MET B 1 313 ? 60.640  2.593   -12.270 1.00 51.94  ? 335  MET B CA  1 
ATOM   8267  C C   . MET B 1 313 ? 60.793  2.889   -10.773 1.00 53.69  ? 335  MET B C   1 
ATOM   8268  O O   . MET B 1 313 ? 61.454  3.855   -10.398 1.00 58.05  ? 335  MET B O   1 
ATOM   8269  C CB  . MET B 1 313 ? 60.199  3.872   -12.999 1.00 53.93  ? 335  MET B CB  1 
ATOM   8270  C CG  . MET B 1 313 ? 59.972  3.709   -14.505 1.00 54.79  ? 335  MET B CG  1 
ATOM   8271  S SD  . MET B 1 313 ? 61.476  3.395   -15.434 1.00 66.83  ? 335  MET B SD  1 
ATOM   8272  C CE  . MET B 1 313 ? 62.329  4.949   -15.236 1.00 55.57  ? 335  MET B CE  1 
ATOM   8273  N N   . LEU B 1 314 ? 60.182  2.075   -9.916  1.00 51.06  ? 336  LEU B N   1 
ATOM   8274  C CA  . LEU B 1 314 ? 60.170  2.373   -8.485  1.00 51.48  ? 336  LEU B CA  1 
ATOM   8275  C C   . LEU B 1 314 ? 60.782  1.263   -7.610  1.00 54.10  ? 336  LEU B C   1 
ATOM   8276  O O   . LEU B 1 314 ? 60.085  0.655   -6.783  1.00 55.60  ? 336  LEU B O   1 
ATOM   8277  C CB  . LEU B 1 314 ? 58.731  2.652   -8.036  1.00 49.04  ? 336  LEU B CB  1 
ATOM   8278  C CG  . LEU B 1 314 ? 57.969  3.734   -8.813  1.00 49.69  ? 336  LEU B CG  1 
ATOM   8279  C CD1 . LEU B 1 314 ? 56.540  3.832   -8.370  1.00 40.75  ? 336  LEU B CD1 1 
ATOM   8280  C CD2 . LEU B 1 314 ? 58.651  5.069   -8.653  1.00 51.95  ? 336  LEU B CD2 1 
ATOM   8281  N N   . PRO B 1 315 ? 62.086  1.004   -7.773  1.00 52.59  ? 337  PRO B N   1 
ATOM   8282  C CA  . PRO B 1 315 ? 62.704  -0.103  -7.030  1.00 55.41  ? 337  PRO B CA  1 
ATOM   8283  C C   . PRO B 1 315 ? 62.827  0.119   -5.520  1.00 56.63  ? 337  PRO B C   1 
ATOM   8284  O O   . PRO B 1 315 ? 62.908  -0.858  -4.781  1.00 59.29  ? 337  PRO B O   1 
ATOM   8285  C CB  . PRO B 1 315 ? 64.093  -0.222  -7.666  1.00 56.47  ? 337  PRO B CB  1 
ATOM   8286  C CG  . PRO B 1 315 ? 64.370  1.133   -8.231  1.00 57.48  ? 337  PRO B CG  1 
ATOM   8287  C CD  . PRO B 1 315 ? 63.039  1.653   -8.691  1.00 55.96  ? 337  PRO B CD  1 
ATOM   8288  N N   . ARG B 1 316 ? 62.867  1.365   -5.067  1.00 54.79  ? 338  ARG B N   1 
ATOM   8289  C CA  . ARG B 1 316 ? 62.969  1.629   -3.631  1.00 51.08  ? 338  ARG B CA  1 
ATOM   8290  C C   . ARG B 1 316 ? 61.646  1.956   -2.941  1.00 50.12  ? 338  ARG B C   1 
ATOM   8291  O O   . ARG B 1 316 ? 61.624  2.246   -1.738  1.00 48.98  ? 338  ARG B O   1 
ATOM   8292  C CB  . ARG B 1 316 ? 64.034  2.692   -3.338  1.00 52.94  ? 338  ARG B CB  1 
ATOM   8293  C CG  . ARG B 1 316 ? 65.427  2.254   -3.776  1.00 59.24  ? 338  ARG B CG  1 
ATOM   8294  C CD  . ARG B 1 316 ? 66.532  3.163   -3.246  1.00 66.18  ? 338  ARG B CD  1 
ATOM   8295  N NE  . ARG B 1 316 ? 67.848  2.719   -3.700  1.00 72.41  ? 338  ARG B NE  1 
ATOM   8296  C CZ  . ARG B 1 316 ? 68.904  3.516   -3.829  1.00 78.82  ? 338  ARG B CZ  1 
ATOM   8297  N NH1 . ARG B 1 316 ? 68.807  4.803   -3.530  1.00 80.52  ? 338  ARG B NH1 1 
ATOM   8298  N NH2 . ARG B 1 316 ? 70.060  3.025   -4.255  1.00 81.36  ? 338  ARG B NH2 1 
ATOM   8299  N N   . LEU B 1 317 ? 60.549  1.891   -3.691  1.00 42.36  ? 339  LEU B N   1 
ATOM   8300  C CA  . LEU B 1 317 ? 59.260  2.330   -3.178  1.00 41.04  ? 339  LEU B CA  1 
ATOM   8301  C C   . LEU B 1 317 ? 58.767  1.422   -2.055  1.00 47.26  ? 339  LEU B C   1 
ATOM   8302  O O   . LEU B 1 317 ? 58.728  0.203   -2.186  1.00 40.17  ? 339  LEU B O   1 
ATOM   8303  C CB  . LEU B 1 317 ? 58.222  2.382   -4.294  1.00 40.46  ? 339  LEU B CB  1 
ATOM   8304  C CG  . LEU B 1 317 ? 56.914  3.017   -3.819  1.00 39.25  ? 339  LEU B CG  1 
ATOM   8305  C CD1 . LEU B 1 317 ? 57.038  4.540   -3.876  1.00 40.81  ? 339  LEU B CD1 1 
ATOM   8306  C CD2 . LEU B 1 317 ? 55.725  2.528   -4.631  1.00 38.50  ? 339  LEU B CD2 1 
ATOM   8307  N N   . GLU B 1 318 ? 58.494  2.023   -0.908  1.00 46.24  ? 340  GLU B N   1 
ATOM   8308  C CA  . GLU B 1 318 ? 57.978  1.286   0.236   1.00 42.66  ? 340  GLU B CA  1 
ATOM   8309  C C   . GLU B 1 318 ? 56.458  1.176   0.407   1.00 42.33  ? 340  GLU B C   1 
ATOM   8310  O O   . GLU B 1 318 ? 55.934  0.121   0.776   1.00 42.24  ? 340  GLU B O   1 
ATOM   8311  C CB  . GLU B 1 318 ? 58.700  1.735   1.492   1.00 41.86  ? 340  GLU B CB  1 
ATOM   8312  C CG  . GLU B 1 318 ? 60.175  1.399   1.385   1.00 40.75  ? 340  GLU B CG  1 
ATOM   8313  C CD  . GLU B 1 318 ? 60.969  1.841   2.579   1.00 41.37  ? 340  GLU B CD  1 
ATOM   8314  O OE1 . GLU B 1 318 ? 60.444  1.762   3.703   1.00 51.37  ? 340  GLU B OE1 1 
ATOM   8315  O OE2 . GLU B 1 318 ? 62.121  2.278   2.390   1.00 49.25  ? 340  GLU B OE2 1 
ATOM   8316  N N   . ILE B 1 319 ? 55.768  2.284   0.160   1.00 39.49  ? 341  ILE B N   1 
ATOM   8317  C CA  . ILE B 1 319 ? 54.335  2.381   0.391   1.00 37.59  ? 341  ILE B CA  1 
ATOM   8318  C C   . ILE B 1 319 ? 53.663  2.840   -0.904  1.00 39.80  ? 341  ILE B C   1 
ATOM   8319  O O   . ILE B 1 319 ? 54.024  3.875   -1.455  1.00 36.36  ? 341  ILE B O   1 
ATOM   8320  C CB  . ILE B 1 319 ? 54.010  3.409   1.498   1.00 36.57  ? 341  ILE B CB  1 
ATOM   8321  C CG1 . ILE B 1 319 ? 54.685  3.036   2.824   1.00 41.28  ? 341  ILE B CG1 1 
ATOM   8322  C CG2 . ILE B 1 319 ? 52.514  3.514   1.695   1.00 35.61  ? 341  ILE B CG2 1 
ATOM   8323  C CD1 . ILE B 1 319 ? 54.318  3.963   3.986   1.00 38.80  ? 341  ILE B CD1 1 
ATOM   8324  N N   . LEU B 1 320 ? 52.713  2.058   -1.397  1.00 35.12  ? 342  LEU B N   1 
ATOM   8325  C CA  . LEU B 1 320 ? 51.973  2.433   -2.589  1.00 34.98  ? 342  LEU B CA  1 
ATOM   8326  C C   . LEU B 1 320 ? 50.472  2.455   -2.282  1.00 36.45  ? 342  LEU B C   1 
ATOM   8327  O O   . LEU B 1 320 ? 49.886  1.432   -1.911  1.00 33.28  ? 342  LEU B O   1 
ATOM   8328  C CB  . LEU B 1 320 ? 52.291  1.468   -3.740  1.00 38.16  ? 342  LEU B CB  1 
ATOM   8329  C CG  . LEU B 1 320 ? 51.527  1.654   -5.057  1.00 38.43  ? 342  LEU B CG  1 
ATOM   8330  C CD1 . LEU B 1 320 ? 51.785  3.032   -5.663  1.00 36.02  ? 342  LEU B CD1 1 
ATOM   8331  C CD2 . LEU B 1 320 ? 51.881  0.555   -6.063  1.00 40.18  ? 342  LEU B CD2 1 
ATOM   8332  N N   . ASP B 1 321 ? 49.852  3.625   -2.409  1.00 37.07  ? 343  ASP B N   1 
ATOM   8333  C CA  . ASP B 1 321 ? 48.424  3.728   -2.142  1.00 41.41  ? 343  ASP B CA  1 
ATOM   8334  C C   . ASP B 1 321 ? 47.675  3.978   -3.445  1.00 41.65  ? 343  ASP B C   1 
ATOM   8335  O O   . ASP B 1 321 ? 47.746  5.064   -4.020  1.00 33.21  ? 343  ASP B O   1 
ATOM   8336  C CB  . ASP B 1 321 ? 48.135  4.849   -1.141  1.00 47.03  ? 343  ASP B CB  1 
ATOM   8337  C CG  . ASP B 1 321 ? 46.782  4.694   -0.454  1.00 52.30  ? 343  ASP B CG  1 
ATOM   8338  O OD1 . ASP B 1 321 ? 45.846  4.100   -1.038  1.00 49.13  ? 343  ASP B OD1 1 
ATOM   8339  O OD2 . ASP B 1 321 ? 46.655  5.175   0.689   1.00 60.33  ? 343  ASP B OD2 1 
ATOM   8340  N N   . LEU B 1 322 ? 47.002  2.925   -3.900  1.00 41.97  ? 344  LEU B N   1 
ATOM   8341  C CA  . LEU B 1 322 ? 46.132  2.892   -5.083  1.00 39.12  ? 344  LEU B CA  1 
ATOM   8342  C C   . LEU B 1 322 ? 44.621  2.936   -4.785  1.00 38.67  ? 344  LEU B C   1 
ATOM   8343  O O   . LEU B 1 322 ? 43.792  2.606   -5.640  1.00 41.10  ? 344  LEU B O   1 
ATOM   8344  C CB  . LEU B 1 322 ? 46.522  1.730   -6.006  1.00 39.69  ? 344  LEU B CB  1 
ATOM   8345  C CG  . LEU B 1 322 ? 47.797  1.996   -6.823  1.00 40.60  ? 344  LEU B CG  1 
ATOM   8346  C CD1 . LEU B 1 322 ? 48.377  0.717   -7.407  1.00 42.38  ? 344  LEU B CD1 1 
ATOM   8347  C CD2 . LEU B 1 322 ? 47.505  2.975   -7.941  1.00 42.11  ? 344  LEU B CD2 1 
ATOM   8348  N N   . SER B 1 323 ? 44.273  3.238   -3.540  1.00 39.83  ? 345  SER B N   1 
ATOM   8349  C CA  . SER B 1 323 ? 42.884  3.198   -3.085  1.00 37.53  ? 345  SER B CA  1 
ATOM   8350  C C   . SER B 1 323 ? 41.861  4.049   -3.873  1.00 38.95  ? 345  SER B C   1 
ATOM   8351  O O   . SER B 1 323 ? 42.167  5.129   -4.361  1.00 41.69  ? 345  SER B O   1 
ATOM   8352  C CB  . SER B 1 323 ? 42.811  3.532   -1.588  1.00 38.25  ? 345  SER B CB  1 
ATOM   8353  O OG  . SER B 1 323 ? 43.370  2.489   -0.803  1.00 36.47  ? 345  SER B OG  1 
ATOM   8354  N N   . PHE B 1 324 ? 40.641  3.524   -3.978  1.00 35.25  ? 346  PHE B N   1 
ATOM   8355  C CA  . PHE B 1 324 ? 39.506  4.220   -4.586  1.00 38.08  ? 346  PHE B CA  1 
ATOM   8356  C C   . PHE B 1 324 ? 39.704  4.601   -6.061  1.00 38.50  ? 346  PHE B C   1 
ATOM   8357  O O   . PHE B 1 324 ? 39.410  5.717   -6.496  1.00 36.28  ? 346  PHE B O   1 
ATOM   8358  C CB  . PHE B 1 324 ? 39.045  5.396   -3.717  1.00 36.48  ? 346  PHE B CB  1 
ATOM   8359  C CG  . PHE B 1 324 ? 38.384  4.960   -2.433  1.00 38.64  ? 346  PHE B CG  1 
ATOM   8360  C CD1 . PHE B 1 324 ? 37.093  4.468   -2.442  1.00 38.36  ? 346  PHE B CD1 1 
ATOM   8361  C CD2 . PHE B 1 324 ? 39.061  5.019   -1.218  1.00 37.59  ? 346  PHE B CD2 1 
ATOM   8362  C CE1 . PHE B 1 324 ? 36.478  4.048   -1.268  1.00 37.70  ? 346  PHE B CE1 1 
ATOM   8363  C CE2 . PHE B 1 324 ? 38.447  4.600   -0.037  1.00 33.17  ? 346  PHE B CE2 1 
ATOM   8364  C CZ  . PHE B 1 324 ? 37.154  4.114   -0.068  1.00 34.47  ? 346  PHE B CZ  1 
ATOM   8365  N N   . ASN B 1 325 ? 40.221  3.646   -6.820  1.00 37.20  ? 347  ASN B N   1 
ATOM   8366  C CA  . ASN B 1 325 ? 40.315  3.779   -8.261  1.00 36.45  ? 347  ASN B CA  1 
ATOM   8367  C C   . ASN B 1 325 ? 39.180  3.096   -9.041  1.00 38.00  ? 347  ASN B C   1 
ATOM   8368  O O   . ASN B 1 325 ? 39.242  3.009   -10.263 1.00 38.27  ? 347  ASN B O   1 
ATOM   8369  C CB  . ASN B 1 325 ? 41.697  3.381   -8.750  1.00 33.92  ? 347  ASN B CB  1 
ATOM   8370  C CG  . ASN B 1 325 ? 42.704  4.483   -8.541  1.00 38.18  ? 347  ASN B CG  1 
ATOM   8371  O OD1 . ASN B 1 325 ? 42.816  5.381   -9.364  1.00 36.08  ? 347  ASN B OD1 1 
ATOM   8372  N ND2 . ASN B 1 325 ? 43.427  4.441   -7.416  1.00 39.51  ? 347  ASN B ND2 1 
ATOM   8373  N N   . TYR B 1 326 ? 38.170  2.603   -8.316  1.00 37.41  ? 348  TYR B N   1 
ATOM   8374  C CA  . TYR B 1 326 ? 37.048  1.862   -8.898  1.00 37.35  ? 348  TYR B CA  1 
ATOM   8375  C C   . TYR B 1 326 ? 36.415  2.583   -10.070 1.00 38.80  ? 348  TYR B C   1 
ATOM   8376  O O   . TYR B 1 326 ? 36.266  3.805   -10.066 1.00 42.15  ? 348  TYR B O   1 
ATOM   8377  C CB  . TYR B 1 326 ? 35.940  1.633   -7.872  1.00 33.80  ? 348  TYR B CB  1 
ATOM   8378  C CG  . TYR B 1 326 ? 35.235  2.914   -7.453  1.00 36.29  ? 348  TYR B CG  1 
ATOM   8379  C CD1 . TYR B 1 326 ? 35.797  3.755   -6.495  1.00 34.98  ? 348  TYR B CD1 1 
ATOM   8380  C CD2 . TYR B 1 326 ? 34.012  3.285   -8.017  1.00 37.72  ? 348  TYR B CD2 1 
ATOM   8381  C CE1 . TYR B 1 326 ? 35.173  4.931   -6.111  1.00 35.17  ? 348  TYR B CE1 1 
ATOM   8382  C CE2 . TYR B 1 326 ? 33.375  4.456   -7.634  1.00 39.05  ? 348  TYR B CE2 1 
ATOM   8383  C CZ  . TYR B 1 326 ? 33.964  5.274   -6.680  1.00 40.19  ? 348  TYR B CZ  1 
ATOM   8384  O OH  . TYR B 1 326 ? 33.346  6.439   -6.288  1.00 43.62  ? 348  TYR B OH  1 
ATOM   8385  N N   . ILE B 1 327 ? 36.039  1.816   -11.078 1.00 36.60  ? 349  ILE B N   1 
ATOM   8386  C CA  . ILE B 1 327 ? 35.234  2.373   -12.153 1.00 39.04  ? 349  ILE B CA  1 
ATOM   8387  C C   . ILE B 1 327 ? 33.807  2.498   -11.639 1.00 42.45  ? 349  ILE B C   1 
ATOM   8388  O O   . ILE B 1 327 ? 33.238  1.536   -11.120 1.00 39.41  ? 349  ILE B O   1 
ATOM   8389  C CB  . ILE B 1 327 ? 35.294  1.497   -13.401 1.00 36.39  ? 349  ILE B CB  1 
ATOM   8390  C CG1 . ILE B 1 327 ? 36.725  1.468   -13.935 1.00 36.75  ? 349  ILE B CG1 1 
ATOM   8391  C CG2 . ILE B 1 327 ? 34.318  2.000   -14.471 1.00 33.81  ? 349  ILE B CG2 1 
ATOM   8392  C CD1 . ILE B 1 327 ? 36.909  0.586   -15.150 1.00 38.42  ? 349  ILE B CD1 1 
ATOM   8393  N N   . LYS B 1 328 ? 33.245  3.694   -11.768 1.00 49.27  ? 350  LYS B N   1 
ATOM   8394  C CA  . LYS B 1 328 ? 31.897  3.965   -11.286 1.00 54.03  ? 350  LYS B CA  1 
ATOM   8395  C C   . LYS B 1 328 ? 30.901  2.937   -11.830 1.00 52.99  ? 350  LYS B C   1 
ATOM   8396  O O   . LYS B 1 328 ? 30.876  2.656   -13.028 1.00 52.39  ? 350  LYS B O   1 
ATOM   8397  C CB  . LYS B 1 328 ? 31.489  5.388   -11.680 1.00 59.13  ? 350  LYS B CB  1 
ATOM   8398  C CG  . LYS B 1 328 ? 30.050  5.764   -11.359 1.00 64.23  ? 350  LYS B CG  1 
ATOM   8399  C CD  . LYS B 1 328 ? 29.850  7.260   -11.542 1.00 68.03  ? 350  LYS B CD  1 
ATOM   8400  C CE  . LYS B 1 328 ? 28.548  7.575   -12.254 1.00 70.25  ? 350  LYS B CE  1 
ATOM   8401  N NZ  . LYS B 1 328 ? 27.352  7.127   -11.491 1.00 70.21  ? 350  LYS B NZ  1 
ATOM   8402  N N   . GLY B 1 329 ? 30.113  2.355   -10.930 1.00 50.46  ? 351  GLY B N   1 
ATOM   8403  C CA  . GLY B 1 329 ? 29.111  1.372   -11.295 1.00 50.80  ? 351  GLY B CA  1 
ATOM   8404  C C   . GLY B 1 329 ? 29.649  0.057   -11.832 1.00 48.65  ? 351  GLY B C   1 
ATOM   8405  O O   . GLY B 1 329 ? 28.898  -0.744  -12.388 1.00 46.31  ? 351  GLY B O   1 
ATOM   8406  N N   . SER B 1 330 ? 30.946  -0.178  -11.675 1.00 46.91  ? 352  SER B N   1 
ATOM   8407  C CA  . SER B 1 330 ? 31.525  -1.432  -12.130 1.00 47.08  ? 352  SER B CA  1 
ATOM   8408  C C   . SER B 1 330 ? 31.828  -2.379  -10.956 1.00 46.25  ? 352  SER B C   1 
ATOM   8409  O O   . SER B 1 330 ? 32.269  -1.944  -9.886  1.00 46.47  ? 352  SER B O   1 
ATOM   8410  C CB  . SER B 1 330 ? 32.780  -1.163  -12.955 1.00 49.74  ? 352  SER B CB  1 
ATOM   8411  O OG  . SER B 1 330 ? 33.332  -2.366  -13.446 1.00 53.54  ? 352  SER B OG  1 
ATOM   8412  N N   . TYR B 1 331 ? 31.584  -3.670  -11.178 1.00 43.99  ? 353  TYR B N   1 
ATOM   8413  C CA  . TYR B 1 331 ? 31.761  -4.707  -10.171 1.00 39.02  ? 353  TYR B CA  1 
ATOM   8414  C C   . TYR B 1 331 ? 32.350  -5.961  -10.799 1.00 41.84  ? 353  TYR B C   1 
ATOM   8415  O O   . TYR B 1 331 ? 31.673  -6.988  -10.862 1.00 43.62  ? 353  TYR B O   1 
ATOM   8416  C CB  . TYR B 1 331 ? 30.404  -5.061  -9.576  1.00 36.36  ? 353  TYR B CB  1 
ATOM   8417  C CG  . TYR B 1 331 ? 30.426  -5.789  -8.245  1.00 37.52  ? 353  TYR B CG  1 
ATOM   8418  C CD1 . TYR B 1 331 ? 31.560  -5.789  -7.427  1.00 32.37  ? 353  TYR B CD1 1 
ATOM   8419  C CD2 . TYR B 1 331 ? 29.297  -6.468  -7.802  1.00 38.40  ? 353  TYR B CD2 1 
ATOM   8420  C CE1 . TYR B 1 331 ? 31.556  -6.449  -6.193  1.00 30.42  ? 353  TYR B CE1 1 
ATOM   8421  C CE2 . TYR B 1 331 ? 29.282  -7.127  -6.595  1.00 36.89  ? 353  TYR B CE2 1 
ATOM   8422  C CZ  . TYR B 1 331 ? 30.408  -7.121  -5.794  1.00 34.47  ? 353  TYR B CZ  1 
ATOM   8423  O OH  . TYR B 1 331 ? 30.353  -7.785  -4.597  1.00 32.27  ? 353  TYR B OH  1 
ATOM   8424  N N   . PRO B 1 332 ? 33.616  -5.893  -11.254 1.00 44.83  ? 354  PRO B N   1 
ATOM   8425  C CA  . PRO B 1 332 ? 34.249  -7.019  -11.961 1.00 46.38  ? 354  PRO B CA  1 
ATOM   8426  C C   . PRO B 1 332 ? 34.444  -8.247  -11.067 1.00 51.02  ? 354  PRO B C   1 
ATOM   8427  O O   . PRO B 1 332 ? 34.571  -8.124  -9.848  1.00 50.78  ? 354  PRO B O   1 
ATOM   8428  C CB  . PRO B 1 332 ? 35.615  -6.455  -12.370 1.00 44.50  ? 354  PRO B CB  1 
ATOM   8429  C CG  . PRO B 1 332 ? 35.901  -5.386  -11.346 1.00 44.85  ? 354  PRO B CG  1 
ATOM   8430  C CD  . PRO B 1 332 ? 34.553  -4.773  -11.046 1.00 45.46  ? 354  PRO B CD  1 
ATOM   8431  N N   . GLN B 1 333 ? 34.469  -9.422  -11.687 1.00 54.46  ? 355  GLN B N   1 
ATOM   8432  C CA  . GLN B 1 333 ? 34.623  -10.685 -10.981 1.00 55.76  ? 355  GLN B CA  1 
ATOM   8433  C C   . GLN B 1 333 ? 35.920  -10.725 -10.170 1.00 53.80  ? 355  GLN B C   1 
ATOM   8434  O O   . GLN B 1 333 ? 35.960  -11.251 -9.055  1.00 53.33  ? 355  GLN B O   1 
ATOM   8435  C CB  . GLN B 1 333 ? 34.626  -11.841 -11.990 1.00 60.87  ? 355  GLN B CB  1 
ATOM   8436  C CG  . GLN B 1 333 ? 33.399  -12.754 -11.940 1.00 67.29  ? 355  GLN B CG  1 
ATOM   8437  C CD  . GLN B 1 333 ? 33.260  -13.628 -13.190 1.00 74.78  ? 355  GLN B CD  1 
ATOM   8438  O OE1 . GLN B 1 333 ? 33.133  -13.126 -14.309 1.00 79.14  ? 355  GLN B OE1 1 
ATOM   8439  N NE2 . GLN B 1 333 ? 33.279  -14.940 -12.998 1.00 75.96  ? 355  GLN B NE2 1 
ATOM   8440  N N   . HIS B 1 334 ? 36.980  -10.163 -10.741 1.00 53.98  ? 356  HIS B N   1 
ATOM   8441  C CA  . HIS B 1 334 ? 38.314  -10.301 -10.177 1.00 52.89  ? 356  HIS B CA  1 
ATOM   8442  C C   . HIS B 1 334 ? 39.071  -8.996  -10.286 1.00 48.19  ? 356  HIS B C   1 
ATOM   8443  O O   . HIS B 1 334 ? 38.699  -8.118  -11.054 1.00 46.03  ? 356  HIS B O   1 
ATOM   8444  C CB  . HIS B 1 334 ? 39.096  -11.384 -10.921 1.00 57.43  ? 356  HIS B CB  1 
ATOM   8445  C CG  . HIS B 1 334 ? 38.335  -12.660 -11.102 1.00 62.86  ? 356  HIS B CG  1 
ATOM   8446  N ND1 . HIS B 1 334 ? 37.957  -13.136 -12.341 1.00 64.85  ? 356  HIS B ND1 1 
ATOM   8447  C CD2 . HIS B 1 334 ? 37.864  -13.551 -10.198 1.00 65.23  ? 356  HIS B CD2 1 
ATOM   8448  C CE1 . HIS B 1 334 ? 37.291  -14.267 -12.190 1.00 65.32  ? 356  HIS B CE1 1 
ATOM   8449  N NE2 . HIS B 1 334 ? 37.220  -14.541 -10.900 1.00 64.99  ? 356  HIS B NE2 1 
ATOM   8450  N N   . ILE B 1 335 ? 40.136  -8.872  -9.506  1.00 46.62  ? 357  ILE B N   1 
ATOM   8451  C CA  . ILE B 1 335 ? 40.996  -7.702  -9.577  1.00 44.66  ? 357  ILE B CA  1 
ATOM   8452  C C   . ILE B 1 335 ? 42.173  -7.991  -10.511 1.00 47.74  ? 357  ILE B C   1 
ATOM   8453  O O   . ILE B 1 335 ? 42.704  -9.105  -10.522 1.00 50.08  ? 357  ILE B O   1 
ATOM   8454  C CB  . ILE B 1 335 ? 41.489  -7.294  -8.172  1.00 38.80  ? 357  ILE B CB  1 
ATOM   8455  C CG1 . ILE B 1 335 ? 42.189  -5.934  -8.203  1.00 35.94  ? 357  ILE B CG1 1 
ATOM   8456  C CG2 . ILE B 1 335 ? 42.394  -8.379  -7.549  1.00 37.43  ? 357  ILE B CG2 1 
ATOM   8457  C CD1 . ILE B 1 335 ? 42.739  -5.518  -6.857  1.00 32.88  ? 357  ILE B CD1 1 
ATOM   8458  N N   . ASN B 1 336 ? 42.566  -7.010  -11.318 1.00 44.98  ? 358  ASN B N   1 
ATOM   8459  C CA  . ASN B 1 336 ? 43.619  -7.252  -12.294 1.00 43.49  ? 358  ASN B CA  1 
ATOM   8460  C C   . ASN B 1 336 ? 44.919  -6.534  -11.941 1.00 43.32  ? 358  ASN B C   1 
ATOM   8461  O O   . ASN B 1 336 ? 45.058  -5.326  -12.149 1.00 42.25  ? 358  ASN B O   1 
ATOM   8462  C CB  . ASN B 1 336 ? 43.149  -6.827  -13.684 1.00 47.73  ? 358  ASN B CB  1 
ATOM   8463  C CG  . ASN B 1 336 ? 43.959  -7.470  -14.788 1.00 51.46  ? 358  ASN B CG  1 
ATOM   8464  O OD1 . ASN B 1 336 ? 45.060  -7.971  -14.555 1.00 52.60  ? 358  ASN B OD1 1 
ATOM   8465  N ND2 . ASN B 1 336 ? 43.418  -7.463  -15.998 1.00 54.09  ? 358  ASN B ND2 1 
ATOM   8466  N N   . ILE B 1 337 ? 45.890  -7.309  -11.465 1.00 46.76  ? 359  ILE B N   1 
ATOM   8467  C CA  . ILE B 1 337 ? 47.156  -6.770  -10.986 1.00 48.36  ? 359  ILE B CA  1 
ATOM   8468  C C   . ILE B 1 337 ? 48.230  -7.098  -12.013 1.00 49.20  ? 359  ILE B C   1 
ATOM   8469  O O   . ILE B 1 337 ? 48.396  -8.259  -12.403 1.00 49.56  ? 359  ILE B O   1 
ATOM   8470  C CB  . ILE B 1 337 ? 47.534  -7.355  -9.586  1.00 39.88  ? 359  ILE B CB  1 
ATOM   8471  C CG1 . ILE B 1 337 ? 46.620  -6.792  -8.498  1.00 46.31  ? 359  ILE B CG1 1 
ATOM   8472  C CG2 . ILE B 1 337 ? 48.955  -7.013  -9.203  1.00 39.64  ? 359  ILE B CG2 1 
ATOM   8473  C CD1 . ILE B 1 337 ? 46.811  -5.304  -8.241  1.00 47.99  ? 359  ILE B CD1 1 
ATOM   8474  N N   . SER B 1 338 ? 48.946  -6.076  -12.469 1.00 48.08  ? 360  SER B N   1 
ATOM   8475  C CA  . SER B 1 338 ? 50.003  -6.288  -13.450 1.00 47.84  ? 360  SER B CA  1 
ATOM   8476  C C   . SER B 1 338 ? 51.167  -7.059  -12.856 1.00 51.06  ? 360  SER B C   1 
ATOM   8477  O O   . SER B 1 338 ? 51.500  -6.895  -11.673 1.00 47.99  ? 360  SER B O   1 
ATOM   8478  C CB  . SER B 1 338 ? 50.519  -4.960  -13.999 1.00 44.87  ? 360  SER B CB  1 
ATOM   8479  O OG  . SER B 1 338 ? 51.635  -5.183  -14.837 1.00 45.45  ? 360  SER B OG  1 
ATOM   8480  N N   . ARG B 1 339 ? 51.799  -7.877  -13.693 1.00 52.86  ? 361  ARG B N   1 
ATOM   8481  C CA  . ARG B 1 339 ? 52.969  -8.636  -13.281 1.00 56.06  ? 361  ARG B CA  1 
ATOM   8482  C C   . ARG B 1 339 ? 54.112  -7.704  -12.909 1.00 53.62  ? 361  ARG B C   1 
ATOM   8483  O O   . ARG B 1 339 ? 55.023  -8.101  -12.192 1.00 54.11  ? 361  ARG B O   1 
ATOM   8484  C CB  . ARG B 1 339 ? 53.405  -9.612  -14.381 1.00 65.39  ? 361  ARG B CB  1 
ATOM   8485  C CG  . ARG B 1 339 ? 52.403  -10.736 -14.618 1.00 72.10  ? 361  ARG B CG  1 
ATOM   8486  C CD  . ARG B 1 339 ? 53.036  -12.119 -14.493 1.00 77.48  ? 361  ARG B CD  1 
ATOM   8487  N NE  . ARG B 1 339 ? 52.017  -13.162 -14.368 1.00 80.07  ? 361  ARG B NE  1 
ATOM   8488  C CZ  . ARG B 1 339 ? 51.753  -13.827 -13.246 1.00 81.41  ? 361  ARG B CZ  1 
ATOM   8489  N NH1 . ARG B 1 339 ? 52.446  -13.574 -12.139 1.00 81.15  ? 361  ARG B NH1 1 
ATOM   8490  N NH2 . ARG B 1 339 ? 50.800  -14.754 -13.230 1.00 81.84  ? 361  ARG B NH2 1 
ATOM   8491  N N   . ASN B 1 340 ? 54.063  -6.466  -13.401 1.00 51.25  ? 362  ASN B N   1 
ATOM   8492  C CA  . ASN B 1 340 ? 55.077  -5.468  -13.063 1.00 51.28  ? 362  ASN B CA  1 
ATOM   8493  C C   . ASN B 1 340 ? 55.118  -5.059  -11.582 1.00 48.57  ? 362  ASN B C   1 
ATOM   8494  O O   . ASN B 1 340 ? 56.065  -4.403  -11.147 1.00 48.85  ? 362  ASN B O   1 
ATOM   8495  C CB  . ASN B 1 340 ? 54.947  -4.232  -13.958 1.00 54.04  ? 362  ASN B CB  1 
ATOM   8496  C CG  . ASN B 1 340 ? 55.469  -4.476  -15.364 1.00 57.84  ? 362  ASN B CG  1 
ATOM   8497  O OD1 . ASN B 1 340 ? 56.174  -5.454  -15.611 1.00 58.49  ? 362  ASN B OD1 1 
ATOM   8498  N ND2 . ASN B 1 340 ? 55.128  -3.587  -16.291 1.00 60.06  ? 362  ASN B ND2 1 
ATOM   8499  N N   . PHE B 1 341 ? 54.104  -5.446  -10.810 1.00 45.84  ? 363  PHE B N   1 
ATOM   8500  C CA  . PHE B 1 341 ? 54.137  -5.225  -9.364  1.00 46.29  ? 363  PHE B CA  1 
ATOM   8501  C C   . PHE B 1 341 ? 55.300  -6.004  -8.769  1.00 48.47  ? 363  PHE B C   1 
ATOM   8502  O O   . PHE B 1 341 ? 55.827  -5.649  -7.713  1.00 48.11  ? 363  PHE B O   1 
ATOM   8503  C CB  . PHE B 1 341 ? 52.832  -5.668  -8.700  1.00 40.05  ? 363  PHE B CB  1 
ATOM   8504  C CG  . PHE B 1 341 ? 51.798  -4.583  -8.605  1.00 38.81  ? 363  PHE B CG  1 
ATOM   8505  C CD1 . PHE B 1 341 ? 51.008  -4.260  -9.700  1.00 37.46  ? 363  PHE B CD1 1 
ATOM   8506  C CD2 . PHE B 1 341 ? 51.599  -3.900  -7.409  1.00 36.65  ? 363  PHE B CD2 1 
ATOM   8507  C CE1 . PHE B 1 341 ? 50.047  -3.263  -9.612  1.00 45.25  ? 363  PHE B CE1 1 
ATOM   8508  C CE2 . PHE B 1 341 ? 50.639  -2.903  -7.307  1.00 41.87  ? 363  PHE B CE2 1 
ATOM   8509  C CZ  . PHE B 1 341 ? 49.860  -2.584  -8.407  1.00 44.09  ? 363  PHE B CZ  1 
ATOM   8510  N N   . SER B 1 342 ? 55.698  -7.062  -9.467  1.00 47.24  ? 364  SER B N   1 
ATOM   8511  C CA  . SER B 1 342 ? 56.782  -7.928  -9.026  1.00 50.43  ? 364  SER B CA  1 
ATOM   8512  C C   . SER B 1 342 ? 58.123  -7.197  -9.009  1.00 48.60  ? 364  SER B C   1 
ATOM   8513  O O   . SER B 1 342 ? 59.105  -7.700  -8.475  1.00 45.63  ? 364  SER B O   1 
ATOM   8514  C CB  . SER B 1 342 ? 56.879  -9.148  -9.943  1.00 54.82  ? 364  SER B CB  1 
ATOM   8515  O OG  . SER B 1 342 ? 57.726  -10.134 -9.388  1.00 59.78  ? 364  SER B OG  1 
ATOM   8516  N N   . LYS B 1 343 ? 58.144  -6.007  -9.596  1.00 50.91  ? 365  LYS B N   1 
ATOM   8517  C CA  . LYS B 1 343 ? 59.353  -5.204  -9.686  1.00 52.03  ? 365  LYS B CA  1 
ATOM   8518  C C   . LYS B 1 343 ? 59.484  -4.168  -8.583  1.00 51.73  ? 365  LYS B C   1 
ATOM   8519  O O   . LYS B 1 343 ? 60.479  -3.451  -8.534  1.00 53.56  ? 365  LYS B O   1 
ATOM   8520  C CB  . LYS B 1 343 ? 59.455  -4.537  -11.060 1.00 53.75  ? 365  LYS B CB  1 
ATOM   8521  C CG  . LYS B 1 343 ? 60.123  -5.432  -12.090 1.00 56.24  ? 365  LYS B CG  1 
ATOM   8522  C CD  . LYS B 1 343 ? 59.507  -5.262  -13.464 1.00 60.71  ? 365  LYS B CD  1 
ATOM   8523  C CE  . LYS B 1 343 ? 60.164  -6.196  -14.468 1.00 64.21  ? 365  LYS B CE  1 
ATOM   8524  N NZ  . LYS B 1 343 ? 59.551  -6.058  -15.813 1.00 66.11  ? 365  LYS B NZ  1 
ATOM   8525  N N   . LEU B 1 344 ? 58.513  -4.090  -7.680  1.00 50.07  ? 366  LEU B N   1 
ATOM   8526  C CA  . LEU B 1 344 ? 58.737  -3.232  -6.534  1.00 52.08  ? 366  LEU B CA  1 
ATOM   8527  C C   . LEU B 1 344 ? 59.332  -4.123  -5.468  1.00 51.51  ? 366  LEU B C   1 
ATOM   8528  O O   . LEU B 1 344 ? 58.618  -4.755  -4.690  1.00 47.91  ? 366  LEU B O   1 
ATOM   8529  C CB  . LEU B 1 344 ? 57.404  -2.681  -6.039  1.00 50.70  ? 366  LEU B CB  1 
ATOM   8530  C CG  . LEU B 1 344 ? 56.514  -2.114  -7.143  1.00 50.57  ? 366  LEU B CG  1 
ATOM   8531  C CD1 . LEU B 1 344 ? 55.095  -1.939  -6.646  1.00 48.54  ? 366  LEU B CD1 1 
ATOM   8532  C CD2 . LEU B 1 344 ? 57.089  -0.801  -7.645  1.00 51.63  ? 366  LEU B CD2 1 
ATOM   8533  N N   . LEU B 1 345 ? 60.654  -4.077  -5.361  1.00 53.99  ? 367  LEU B N   1 
ATOM   8534  C CA  . LEU B 1 345 ? 61.357  -5.050  -4.545  1.00 52.22  ? 367  LEU B CA  1 
ATOM   8535  C C   . LEU B 1 345 ? 61.365  -4.604  -3.095  1.00 50.05  ? 367  LEU B C   1 
ATOM   8536  O O   . LEU B 1 345 ? 61.519  -5.419  -2.188  1.00 53.78  ? 367  LEU B O   1 
ATOM   8537  C CB  . LEU B 1 345 ? 62.777  -5.259  -5.069  1.00 55.87  ? 367  LEU B CB  1 
ATOM   8538  C CG  . LEU B 1 345 ? 62.896  -5.661  -6.543  1.00 56.89  ? 367  LEU B CG  1 
ATOM   8539  C CD1 . LEU B 1 345 ? 64.356  -5.751  -6.946  1.00 55.86  ? 367  LEU B CD1 1 
ATOM   8540  C CD2 . LEU B 1 345 ? 62.174  -6.975  -6.830  1.00 58.12  ? 367  LEU B CD2 1 
ATOM   8541  N N   . SER B 1 346 ? 61.178  -3.305  -2.886  1.00 46.07  ? 368  SER B N   1 
ATOM   8542  C CA  . SER B 1 346 ? 61.231  -2.728  -1.550  1.00 48.02  ? 368  SER B CA  1 
ATOM   8543  C C   . SER B 1 346 ? 59.852  -2.546  -0.925  1.00 47.12  ? 368  SER B C   1 
ATOM   8544  O O   . SER B 1 346 ? 59.742  -2.049  0.203   1.00 48.07  ? 368  SER B O   1 
ATOM   8545  C CB  . SER B 1 346 ? 61.974  -1.392  -1.580  1.00 49.95  ? 368  SER B CB  1 
ATOM   8546  O OG  . SER B 1 346 ? 63.224  -1.524  -2.240  1.00 51.08  ? 368  SER B OG  1 
ATOM   8547  N N   . LEU B 1 347 ? 58.809  -2.948  -1.651  1.00 41.80  ? 369  LEU B N   1 
ATOM   8548  C CA  . LEU B 1 347 ? 57.439  -2.702  -1.206  1.00 41.33  ? 369  LEU B CA  1 
ATOM   8549  C C   . LEU B 1 347 ? 57.167  -3.276  0.188   1.00 40.50  ? 369  LEU B C   1 
ATOM   8550  O O   . LEU B 1 347 ? 57.444  -4.442  0.450   1.00 40.63  ? 369  LEU B O   1 
ATOM   8551  C CB  . LEU B 1 347 ? 56.422  -3.236  -2.224  1.00 41.61  ? 369  LEU B CB  1 
ATOM   8552  C CG  . LEU B 1 347 ? 55.000  -2.684  -2.070  1.00 43.29  ? 369  LEU B CG  1 
ATOM   8553  C CD1 . LEU B 1 347 ? 55.021  -1.168  -1.951  1.00 41.64  ? 369  LEU B CD1 1 
ATOM   8554  C CD2 . LEU B 1 347 ? 54.096  -3.108  -3.232  1.00 44.62  ? 369  LEU B CD2 1 
ATOM   8555  N N   . ARG B 1 348 ? 56.638  -2.427  1.067   1.00 40.03  ? 370  ARG B N   1 
ATOM   8556  C CA  . ARG B 1 348 ? 56.322  -2.765  2.458   1.00 43.96  ? 370  ARG B CA  1 
ATOM   8557  C C   . ARG B 1 348 ? 54.811  -2.913  2.711   1.00 47.25  ? 370  ARG B C   1 
ATOM   8558  O O   . ARG B 1 348 ? 54.358  -3.920  3.267   1.00 46.65  ? 370  ARG B O   1 
ATOM   8559  C CB  . ARG B 1 348 ? 56.972  -1.776  3.433   1.00 43.10  ? 370  ARG B CB  1 
ATOM   8560  C CG  . ARG B 1 348 ? 58.498  -1.901  3.495   1.00 47.22  ? 370  ARG B CG  1 
ATOM   8561  C CD  . ARG B 1 348 ? 59.099  -1.099  4.647   1.00 50.52  ? 370  ARG B CD  1 
ATOM   8562  N NE  . ARG B 1 348 ? 60.558  -1.024  4.572   1.00 55.89  ? 370  ARG B NE  1 
ATOM   8563  C CZ  . ARG B 1 348 ? 61.387  -1.856  5.200   1.00 56.61  ? 370  ARG B CZ  1 
ATOM   8564  N NH1 . ARG B 1 348 ? 60.904  -2.836  5.955   1.00 56.41  ? 370  ARG B NH1 1 
ATOM   8565  N NH2 . ARG B 1 348 ? 62.700  -1.709  5.072   1.00 53.55  ? 370  ARG B NH2 1 
ATOM   8566  N N   . ALA B 1 349 ? 54.055  -1.863  2.402   1.00 45.52  ? 371  ALA B N   1 
ATOM   8567  C CA  . ALA B 1 349 ? 52.599  -1.929  2.427   1.00 40.84  ? 371  ALA B CA  1 
ATOM   8568  C C   . ALA B 1 349 ? 51.976  -1.614  1.057   1.00 38.98  ? 371  ALA B C   1 
ATOM   8569  O O   . ALA B 1 349 ? 52.484  -0.773  0.303   1.00 37.17  ? 371  ALA B O   1 
ATOM   8570  C CB  . ALA B 1 349 ? 52.044  -0.988  3.490   1.00 39.64  ? 371  ALA B CB  1 
ATOM   8571  N N   . LEU B 1 350 ? 50.875  -2.293  0.746   1.00 36.97  ? 372  LEU B N   1 
ATOM   8572  C CA  . LEU B 1 350 ? 50.105  -2.008  -0.462  1.00 36.40  ? 372  LEU B CA  1 
ATOM   8573  C C   . LEU B 1 350 ? 48.652  -1.732  -0.095  1.00 33.90  ? 372  LEU B C   1 
ATOM   8574  O O   . LEU B 1 350 ? 48.003  -2.560  0.540   1.00 32.88  ? 372  LEU B O   1 
ATOM   8575  C CB  . LEU B 1 350 ? 50.177  -3.178  -1.453  1.00 37.91  ? 372  LEU B CB  1 
ATOM   8576  C CG  . LEU B 1 350 ? 49.393  -3.001  -2.756  1.00 38.58  ? 372  LEU B CG  1 
ATOM   8577  C CD1 . LEU B 1 350 ? 49.861  -1.753  -3.506  1.00 33.67  ? 372  LEU B CD1 1 
ATOM   8578  C CD2 . LEU B 1 350 ? 49.504  -4.227  -3.652  1.00 37.53  ? 372  LEU B CD2 1 
ATOM   8579  N N   . HIS B 1 351 ? 48.138  -0.571  -0.480  1.00 31.56  ? 373  HIS B N   1 
ATOM   8580  C CA  . HIS B 1 351 ? 46.754  -0.238  -0.165  1.00 39.66  ? 373  HIS B CA  1 
ATOM   8581  C C   . HIS B 1 351 ? 45.860  -0.241  -1.400  1.00 41.31  ? 373  HIS B C   1 
ATOM   8582  O O   . HIS B 1 351 ? 45.952  0.654   -2.249  1.00 41.84  ? 373  HIS B O   1 
ATOM   8583  C CB  . HIS B 1 351 ? 46.689  1.126   0.507   1.00 36.81  ? 373  HIS B CB  1 
ATOM   8584  C CG  . HIS B 1 351 ? 47.534  1.221   1.736   1.00 36.88  ? 373  HIS B CG  1 
ATOM   8585  N ND1 . HIS B 1 351 ? 47.067  0.877   2.984   1.00 34.86  ? 373  HIS B ND1 1 
ATOM   8586  C CD2 . HIS B 1 351 ? 48.822  1.597   1.903   1.00 37.41  ? 373  HIS B CD2 1 
ATOM   8587  C CE1 . HIS B 1 351 ? 48.029  1.045   3.872   1.00 33.54  ? 373  HIS B CE1 1 
ATOM   8588  N NE2 . HIS B 1 351 ? 49.103  1.482   3.243   1.00 37.89  ? 373  HIS B NE2 1 
ATOM   8589  N N   . LEU B 1 352 ? 45.011  -1.258  -1.513  1.00 38.73  ? 374  LEU B N   1 
ATOM   8590  C CA  . LEU B 1 352 ? 44.014  -1.242  -2.556  1.00 38.71  ? 374  LEU B CA  1 
ATOM   8591  C C   . LEU B 1 352 ? 42.632  -1.279  -1.943  1.00 41.56  ? 374  LEU B C   1 
ATOM   8592  O O   . LEU B 1 352 ? 42.024  -2.335  -1.856  1.00 44.62  ? 374  LEU B O   1 
ATOM   8593  C CB  . LEU B 1 352 ? 44.210  -2.489  -3.425  1.00 39.14  ? 374  LEU B CB  1 
ATOM   8594  C CG  . LEU B 1 352 ? 45.526  -2.531  -4.212  1.00 39.02  ? 374  LEU B CG  1 
ATOM   8595  C CD1 . LEU B 1 352 ? 45.918  -3.941  -4.662  1.00 37.55  ? 374  LEU B CD1 1 
ATOM   8596  C CD2 . LEU B 1 352 ? 45.410  -1.625  -5.408  1.00 37.78  ? 374  LEU B CD2 1 
ATOM   8597  N N   . ARG B 1 353 ? 42.057  -0.111  -1.709  1.00 41.54  ? 375  ARG B N   1 
ATOM   8598  C CA  . ARG B 1 353 ? 40.728  -0.040  -1.150  1.00 39.88  ? 375  ARG B CA  1 
ATOM   8599  C C   . ARG B 1 353 ? 39.877  0.525   -2.250  1.00 35.32  ? 375  ARG B C   1 
ATOM   8600  O O   . ARG B 1 353 ? 40.378  1.239   -3.126  1.00 32.09  ? 375  ARG B O   1 
ATOM   8601  C CB  . ARG B 1 353 ? 40.646  0.911   0.042   1.00 42.35  ? 375  ARG B CB  1 
ATOM   8602  C CG  . ARG B 1 353 ? 41.295  0.424   1.310   1.00 49.54  ? 375  ARG B CG  1 
ATOM   8603  C CD  . ARG B 1 353 ? 41.666  1.616   2.164   1.00 54.58  ? 375  ARG B CD  1 
ATOM   8604  N NE  . ARG B 1 353 ? 40.569  2.085   3.003   1.00 59.45  ? 375  ARG B NE  1 
ATOM   8605  C CZ  . ARG B 1 353 ? 40.309  3.369   3.238   1.00 63.95  ? 375  ARG B CZ  1 
ATOM   8606  N NH1 . ARG B 1 353 ? 41.058  4.311   2.676   1.00 68.42  ? 375  ARG B NH1 1 
ATOM   8607  N NH2 . ARG B 1 353 ? 39.294  3.713   4.023   1.00 62.35  ? 375  ARG B NH2 1 
ATOM   8608  N N   . GLY B 1 354 ? 38.590  0.215   -2.182  1.00 27.63  ? 376  GLY B N   1 
ATOM   8609  C CA  . GLY B 1 354 ? 37.623  0.729   -3.130  1.00 36.32  ? 376  GLY B CA  1 
ATOM   8610  C C   . GLY B 1 354 ? 38.046  0.477   -4.561  1.00 33.36  ? 376  GLY B C   1 
ATOM   8611  O O   . GLY B 1 354 ? 37.931  1.363   -5.392  1.00 32.36  ? 376  GLY B O   1 
ATOM   8612  N N   . TYR B 1 355 ? 38.600  -0.704  -4.825  1.00 33.84  ? 377  TYR B N   1 
ATOM   8613  C CA  . TYR B 1 355 ? 38.783  -1.157  -6.201  1.00 38.35  ? 377  TYR B CA  1 
ATOM   8614  C C   . TYR B 1 355 ? 37.433  -1.708  -6.665  1.00 39.22  ? 377  TYR B C   1 
ATOM   8615  O O   . TYR B 1 355 ? 37.057  -1.512  -7.804  1.00 40.34  ? 377  TYR B O   1 
ATOM   8616  C CB  . TYR B 1 355 ? 39.879  -2.223  -6.294  1.00 38.89  ? 377  TYR B CB  1 
ATOM   8617  C CG  . TYR B 1 355 ? 40.218  -2.651  -7.707  1.00 38.76  ? 377  TYR B CG  1 
ATOM   8618  C CD1 . TYR B 1 355 ? 39.341  -3.450  -8.447  1.00 38.35  ? 377  TYR B CD1 1 
ATOM   8619  C CD2 . TYR B 1 355 ? 41.426  -2.290  -8.291  1.00 31.46  ? 377  TYR B CD2 1 
ATOM   8620  C CE1 . TYR B 1 355 ? 39.642  -3.845  -9.738  1.00 37.48  ? 377  TYR B CE1 1 
ATOM   8621  C CE2 . TYR B 1 355 ? 41.741  -2.684  -9.587  1.00 32.33  ? 377  TYR B CE2 1 
ATOM   8622  C CZ  . TYR B 1 355 ? 40.844  -3.459  -10.301 1.00 36.34  ? 377  TYR B CZ  1 
ATOM   8623  O OH  . TYR B 1 355 ? 41.146  -3.858  -11.572 1.00 39.08  ? 377  TYR B OH  1 
ATOM   8624  N N   . VAL B 1 356 ? 36.685  -2.323  -5.739  1.00 39.77  ? 378  VAL B N   1 
ATOM   8625  C CA  . VAL B 1 356 ? 35.365  -2.909  -6.023  1.00 38.83  ? 378  VAL B CA  1 
ATOM   8626  C C   . VAL B 1 356 ? 35.343  -4.108  -6.972  1.00 42.68  ? 378  VAL B C   1 
ATOM   8627  O O   . VAL B 1 356 ? 35.183  -3.949  -8.181  1.00 42.34  ? 378  VAL B O   1 
ATOM   8628  C CB  . VAL B 1 356 ? 34.340  -1.852  -6.468  1.00 37.25  ? 378  VAL B CB  1 
ATOM   8629  C CG1 . VAL B 1 356 ? 32.962  -2.458  -6.533  1.00 36.58  ? 378  VAL B CG1 1 
ATOM   8630  C CG2 . VAL B 1 356 ? 34.359  -0.675  -5.497  1.00 37.72  ? 378  VAL B CG2 1 
ATOM   8631  N N   . PHE B 1 357 ? 35.634  -5.291  -6.424  1.00 41.73  ? 379  PHE B N   1 
ATOM   8632  C CA  . PHE B 1 357 ? 35.558  -6.545  -7.178  1.00 37.63  ? 379  PHE B CA  1 
ATOM   8633  C C   . PHE B 1 357 ? 34.920  -7.673  -6.357  1.00 34.38  ? 379  PHE B C   1 
ATOM   8634  O O   . PHE B 1 357 ? 34.813  -7.574  -5.144  1.00 32.65  ? 379  PHE B O   1 
ATOM   8635  C CB  . PHE B 1 357 ? 36.944  -6.949  -7.706  1.00 36.36  ? 379  PHE B CB  1 
ATOM   8636  C CG  . PHE B 1 357 ? 37.950  -7.254  -6.619  1.00 38.91  ? 379  PHE B CG  1 
ATOM   8637  C CD1 . PHE B 1 357 ? 38.441  -6.247  -5.799  1.00 37.64  ? 379  PHE B CD1 1 
ATOM   8638  C CD2 . PHE B 1 357 ? 38.412  -8.552  -6.430  1.00 38.72  ? 379  PHE B CD2 1 
ATOM   8639  C CE1 . PHE B 1 357 ? 39.369  -6.530  -4.802  1.00 39.49  ? 379  PHE B CE1 1 
ATOM   8640  C CE2 . PHE B 1 357 ? 39.332  -8.840  -5.441  1.00 36.61  ? 379  PHE B CE2 1 
ATOM   8641  C CZ  . PHE B 1 357 ? 39.814  -7.825  -4.624  1.00 38.15  ? 379  PHE B CZ  1 
ATOM   8642  N N   . GLN B 1 358 ? 34.470  -8.728  -7.029  1.00 37.65  ? 380  GLN B N   1 
ATOM   8643  C CA  . GLN B 1 358 ? 33.707  -9.797  -6.375  1.00 37.50  ? 380  GLN B CA  1 
ATOM   8644  C C   . GLN B 1 358 ? 34.525  -10.868 -5.657  1.00 35.95  ? 380  GLN B C   1 
ATOM   8645  O O   . GLN B 1 358 ? 34.129  -11.359 -4.598  1.00 33.31  ? 380  GLN B O   1 
ATOM   8646  C CB  . GLN B 1 358 ? 32.798  -10.495 -7.381  1.00 40.45  ? 380  GLN B CB  1 
ATOM   8647  C CG  . GLN B 1 358 ? 31.615  -9.670  -7.832  1.00 42.60  ? 380  GLN B CG  1 
ATOM   8648  C CD  . GLN B 1 358 ? 30.798  -10.370 -8.909  1.00 41.14  ? 380  GLN B CD  1 
ATOM   8649  O OE1 . GLN B 1 358 ? 30.432  -11.540 -8.775  1.00 44.83  ? 380  GLN B OE1 1 
ATOM   8650  N NE2 . GLN B 1 358 ? 30.527  -9.658  -9.990  1.00 32.91  ? 380  GLN B NE2 1 
ATOM   8651  N N   . GLU B 1 359 ? 35.641  -11.267 -6.256  1.00 34.06  ? 381  GLU B N   1 
ATOM   8652  C CA  . GLU B 1 359 ? 36.355  -12.429 -5.754  1.00 35.97  ? 381  GLU B CA  1 
ATOM   8653  C C   . GLU B 1 359 ? 37.857  -12.283 -5.908  1.00 37.80  ? 381  GLU B C   1 
ATOM   8654  O O   . GLU B 1 359 ? 38.334  -11.764 -6.916  1.00 41.27  ? 381  GLU B O   1 
ATOM   8655  C CB  . GLU B 1 359 ? 35.857  -13.672 -6.490  1.00 43.60  ? 381  GLU B CB  1 
ATOM   8656  C CG  . GLU B 1 359 ? 36.904  -14.735 -6.706  1.00 52.28  ? 381  GLU B CG  1 
ATOM   8657  C CD  . GLU B 1 359 ? 36.371  -15.894 -7.506  1.00 58.02  ? 381  GLU B CD  1 
ATOM   8658  O OE1 . GLU B 1 359 ? 35.574  -15.645 -8.439  1.00 59.46  ? 381  GLU B OE1 1 
ATOM   8659  O OE2 . GLU B 1 359 ? 36.740  -17.049 -7.194  1.00 60.06  ? 381  GLU B OE2 1 
ATOM   8660  N N   . LEU B 1 360 ? 38.601  -12.736 -4.907  1.00 41.92  ? 382  LEU B N   1 
ATOM   8661  C CA  . LEU B 1 360 ? 40.059  -12.717 -4.971  1.00 42.22  ? 382  LEU B CA  1 
ATOM   8662  C C   . LEU B 1 360 ? 40.615  -14.135 -5.077  1.00 44.17  ? 382  LEU B C   1 
ATOM   8663  O O   . LEU B 1 360 ? 40.537  -14.919 -4.130  1.00 46.10  ? 382  LEU B O   1 
ATOM   8664  C CB  . LEU B 1 360 ? 40.644  -12.014 -3.743  1.00 41.15  ? 382  LEU B CB  1 
ATOM   8665  C CG  . LEU B 1 360 ? 42.176  -11.965 -3.672  1.00 39.51  ? 382  LEU B CG  1 
ATOM   8666  C CD1 . LEU B 1 360 ? 42.726  -10.985 -4.697  1.00 39.53  ? 382  LEU B CD1 1 
ATOM   8667  C CD2 . LEU B 1 360 ? 42.654  -11.611 -2.275  1.00 36.18  ? 382  LEU B CD2 1 
ATOM   8668  N N   . ARG B 1 361 ? 41.177  -14.458 -6.236  1.00 48.57  ? 383  ARG B N   1 
ATOM   8669  C CA  . ARG B 1 361 ? 41.713  -15.791 -6.476  1.00 53.91  ? 383  ARG B CA  1 
ATOM   8670  C C   . ARG B 1 361 ? 43.216  -15.856 -6.232  1.00 53.52  ? 383  ARG B C   1 
ATOM   8671  O O   . ARG B 1 361 ? 43.857  -14.831 -5.997  1.00 54.21  ? 383  ARG B O   1 
ATOM   8672  C CB  . ARG B 1 361 ? 41.405  -16.234 -7.907  1.00 58.30  ? 383  ARG B CB  1 
ATOM   8673  C CG  . ARG B 1 361 ? 39.943  -16.117 -8.289  1.00 61.29  ? 383  ARG B CG  1 
ATOM   8674  C CD  . ARG B 1 361 ? 39.775  -16.268 -9.783  1.00 66.65  ? 383  ARG B CD  1 
ATOM   8675  N NE  . ARG B 1 361 ? 40.624  -15.331 -10.516 1.00 71.60  ? 383  ARG B NE  1 
ATOM   8676  C CZ  . ARG B 1 361 ? 40.815  -15.365 -11.833 1.00 75.78  ? 383  ARG B CZ  1 
ATOM   8677  N NH1 . ARG B 1 361 ? 40.215  -16.292 -12.571 1.00 76.28  ? 383  ARG B NH1 1 
ATOM   8678  N NH2 . ARG B 1 361 ? 41.610  -14.472 -12.412 1.00 77.20  ? 383  ARG B NH2 1 
ATOM   8679  N N   . GLU B 1 362 ? 43.778  -17.057 -6.333  1.00 53.71  ? 384  GLU B N   1 
ATOM   8680  C CA  . GLU B 1 362 ? 45.196  -17.261 -6.049  1.00 59.72  ? 384  GLU B CA  1 
ATOM   8681  C C   . GLU B 1 362 ? 46.107  -16.589 -7.071  1.00 61.56  ? 384  GLU B C   1 
ATOM   8682  O O   . GLU B 1 362 ? 47.089  -15.943 -6.707  1.00 63.53  ? 384  GLU B O   1 
ATOM   8683  C CB  . GLU B 1 362 ? 45.524  -18.752 -5.965  1.00 65.80  ? 384  GLU B CB  1 
ATOM   8684  C CG  . GLU B 1 362 ? 46.950  -19.032 -5.528  1.00 73.54  ? 384  GLU B CG  1 
ATOM   8685  C CD  . GLU B 1 362 ? 47.219  -20.508 -5.286  1.00 80.14  ? 384  GLU B CD  1 
ATOM   8686  O OE1 . GLU B 1 362 ? 46.261  -21.309 -5.325  1.00 82.51  ? 384  GLU B OE1 1 
ATOM   8687  O OE2 . GLU B 1 362 ? 48.393  -20.865 -5.060  1.00 81.68  ? 384  GLU B OE2 1 
ATOM   8688  N N   . ASP B 1 363 ? 45.776  -16.735 -8.348  1.00 60.96  ? 385  ASP B N   1 
ATOM   8689  C CA  . ASP B 1 363 ? 46.639  -16.243 -9.412  1.00 61.47  ? 385  ASP B CA  1 
ATOM   8690  C C   . ASP B 1 363 ? 46.631  -14.722 -9.500  1.00 54.84  ? 385  ASP B C   1 
ATOM   8691  O O   . ASP B 1 363 ? 47.573  -14.113 -10.001 1.00 50.75  ? 385  ASP B O   1 
ATOM   8692  C CB  . ASP B 1 363 ? 46.236  -16.847 -10.759 1.00 66.21  ? 385  ASP B CB  1 
ATOM   8693  C CG  . ASP B 1 363 ? 47.312  -16.678 -11.816 1.00 73.77  ? 385  ASP B CG  1 
ATOM   8694  O OD1 . ASP B 1 363 ? 47.426  -15.572 -12.389 1.00 75.20  ? 385  ASP B OD1 1 
ATOM   8695  O OD2 . ASP B 1 363 ? 48.044  -17.657 -12.080 1.00 77.87  ? 385  ASP B OD2 1 
ATOM   8696  N N   . ASP B 1 364 ? 45.571  -14.104 -9.004  1.00 53.15  ? 386  ASP B N   1 
ATOM   8697  C CA  . ASP B 1 364 ? 45.447  -12.659 -9.112  1.00 52.93  ? 386  ASP B CA  1 
ATOM   8698  C C   . ASP B 1 364 ? 46.514  -11.910 -8.313  1.00 51.32  ? 386  ASP B C   1 
ATOM   8699  O O   . ASP B 1 364 ? 46.955  -10.840 -8.717  1.00 52.17  ? 386  ASP B O   1 
ATOM   8700  C CB  . ASP B 1 364 ? 44.044  -12.219 -8.701  1.00 56.96  ? 386  ASP B CB  1 
ATOM   8701  C CG  . ASP B 1 364 ? 42.966  -12.910 -9.511  1.00 64.22  ? 386  ASP B CG  1 
ATOM   8702  O OD1 . ASP B 1 364 ? 43.294  -13.461 -10.583 1.00 69.14  ? 386  ASP B OD1 1 
ATOM   8703  O OD2 . ASP B 1 364 ? 41.796  -12.904 -9.083  1.00 67.19  ? 386  ASP B OD2 1 
ATOM   8704  N N   . PHE B 1 365 ? 46.922  -12.466 -7.178  1.00 47.41  ? 387  PHE B N   1 
ATOM   8705  C CA  . PHE B 1 365 ? 47.969  -11.846 -6.371  1.00 49.00  ? 387  PHE B CA  1 
ATOM   8706  C C   . PHE B 1 365 ? 49.381  -12.406 -6.603  1.00 51.70  ? 387  PHE B C   1 
ATOM   8707  O O   . PHE B 1 365 ? 50.325  -12.055 -5.893  1.00 53.36  ? 387  PHE B O   1 
ATOM   8708  C CB  . PHE B 1 365 ? 47.594  -11.840 -4.888  1.00 45.19  ? 387  PHE B CB  1 
ATOM   8709  C CG  . PHE B 1 365 ? 46.810  -10.622 -4.467  1.00 42.55  ? 387  PHE B CG  1 
ATOM   8710  C CD1 . PHE B 1 365 ? 46.356  -9.715  -5.411  1.00 38.90  ? 387  PHE B CD1 1 
ATOM   8711  C CD2 . PHE B 1 365 ? 46.552  -10.372 -3.126  1.00 42.68  ? 387  PHE B CD2 1 
ATOM   8712  C CE1 . PHE B 1 365 ? 45.654  -8.593  -5.032  1.00 36.15  ? 387  PHE B CE1 1 
ATOM   8713  C CE2 . PHE B 1 365 ? 45.846  -9.251  -2.739  1.00 41.16  ? 387  PHE B CE2 1 
ATOM   8714  C CZ  . PHE B 1 365 ? 45.398  -8.359  -3.696  1.00 37.61  ? 387  PHE B CZ  1 
ATOM   8715  N N   . GLN B 1 366 ? 49.520  -13.284 -7.589  1.00 50.23  ? 388  GLN B N   1 
ATOM   8716  C CA  . GLN B 1 366 ? 50.817  -13.889 -7.911  1.00 50.15  ? 388  GLN B CA  1 
ATOM   8717  C C   . GLN B 1 366 ? 52.037  -12.943 -8.033  1.00 47.22  ? 388  GLN B C   1 
ATOM   8718  O O   . GLN B 1 366 ? 53.135  -13.321 -7.637  1.00 48.71  ? 388  GLN B O   1 
ATOM   8719  C CB  . GLN B 1 366 ? 50.695  -14.774 -9.160  1.00 58.32  ? 388  GLN B CB  1 
ATOM   8720  C CG  . GLN B 1 366 ? 51.430  -16.104 -9.059  1.00 67.34  ? 388  GLN B CG  1 
ATOM   8721  C CD  . GLN B 1 366 ? 50.483  -17.282 -8.881  1.00 74.61  ? 388  GLN B CD  1 
ATOM   8722  O OE1 . GLN B 1 366 ? 49.552  -17.469 -9.668  1.00 75.76  ? 388  GLN B OE1 1 
ATOM   8723  N NE2 . GLN B 1 366 ? 50.712  -18.079 -7.836  1.00 77.46  ? 388  GLN B NE2 1 
ATOM   8724  N N   . PRO B 1 367 ? 51.867  -11.732 -8.609  1.00 44.94  ? 389  PRO B N   1 
ATOM   8725  C CA  . PRO B 1 367 ? 53.021  -10.822 -8.710  1.00 46.04  ? 389  PRO B CA  1 
ATOM   8726  C C   . PRO B 1 367 ? 53.523  -10.220 -7.389  1.00 45.94  ? 389  PRO B C   1 
ATOM   8727  O O   . PRO B 1 367 ? 54.612  -9.646  -7.364  1.00 46.93  ? 389  PRO B O   1 
ATOM   8728  C CB  . PRO B 1 367 ? 52.509  -9.695  -9.621  1.00 39.73  ? 389  PRO B CB  1 
ATOM   8729  C CG  . PRO B 1 367 ? 51.394  -10.285 -10.377 1.00 39.57  ? 389  PRO B CG  1 
ATOM   8730  C CD  . PRO B 1 367 ? 50.739  -11.245 -9.422  1.00 42.74  ? 389  PRO B CD  1 
ATOM   8731  N N   . LEU B 1 368 ? 52.729  -10.290 -6.331  1.00 45.65  ? 390  LEU B N   1 
ATOM   8732  C CA  . LEU B 1 368 ? 53.148  -9.734  -5.047  1.00 48.70  ? 390  LEU B CA  1 
ATOM   8733  C C   . LEU B 1 368 ? 53.917  -10.727 -4.177  1.00 48.16  ? 390  LEU B C   1 
ATOM   8734  O O   . LEU B 1 368 ? 54.615  -10.330 -3.249  1.00 46.75  ? 390  LEU B O   1 
ATOM   8735  C CB  . LEU B 1 368 ? 51.923  -9.252  -4.268  1.00 50.53  ? 390  LEU B CB  1 
ATOM   8736  C CG  . LEU B 1 368 ? 51.054  -8.158  -4.879  1.00 50.38  ? 390  LEU B CG  1 
ATOM   8737  C CD1 . LEU B 1 368 ? 49.749  -8.088  -4.108  1.00 51.17  ? 390  LEU B CD1 1 
ATOM   8738  C CD2 . LEU B 1 368 ? 51.773  -6.815  -4.849  1.00 50.06  ? 390  LEU B CD2 1 
ATOM   8739  N N   . MET B 1 369 ? 53.820  -12.010 -4.513  1.00 51.42  ? 391  MET B N   1 
ATOM   8740  C CA  . MET B 1 369 ? 54.190  -13.090 -3.592  1.00 48.96  ? 391  MET B CA  1 
ATOM   8741  C C   . MET B 1 369 ? 55.681  -13.251 -3.291  1.00 49.64  ? 391  MET B C   1 
ATOM   8742  O O   . MET B 1 369 ? 56.048  -13.838 -2.268  1.00 48.76  ? 391  MET B O   1 
ATOM   8743  C CB  . MET B 1 369 ? 53.630  -14.418 -4.099  1.00 49.05  ? 391  MET B CB  1 
ATOM   8744  C CG  . MET B 1 369 ? 52.134  -14.523 -3.977  1.00 48.62  ? 391  MET B CG  1 
ATOM   8745  S SD  . MET B 1 369 ? 51.452  -15.982 -4.777  1.00 50.15  ? 391  MET B SD  1 
ATOM   8746  C CE  . MET B 1 369 ? 49.751  -15.857 -4.228  1.00 43.58  ? 391  MET B CE  1 
ATOM   8747  N N   . GLN B 1 370 ? 56.537  -12.785 -4.194  1.00 48.29  ? 392  GLN B N   1 
ATOM   8748  C CA  . GLN B 1 370 ? 57.972  -12.855 -3.955  1.00 53.87  ? 392  GLN B CA  1 
ATOM   8749  C C   . GLN B 1 370 ? 58.566  -11.549 -3.431  1.00 55.11  ? 392  GLN B C   1 
ATOM   8750  O O   . GLN B 1 370 ? 59.776  -11.450 -3.259  1.00 62.36  ? 392  GLN B O   1 
ATOM   8751  C CB  . GLN B 1 370 ? 58.735  -13.348 -5.193  1.00 58.63  ? 392  GLN B CB  1 
ATOM   8752  C CG  . GLN B 1 370 ? 58.168  -14.626 -5.826  1.00 65.25  ? 392  GLN B CG  1 
ATOM   8753  C CD  . GLN B 1 370 ? 58.148  -15.821 -4.879  1.00 69.61  ? 392  GLN B CD  1 
ATOM   8754  O OE1 . GLN B 1 370 ? 59.032  -15.978 -4.034  1.00 71.73  ? 392  GLN B OE1 1 
ATOM   8755  N NE2 . GLN B 1 370 ? 57.132  -16.668 -5.019  1.00 69.19  ? 392  GLN B NE2 1 
ATOM   8756  N N   . LEU B 1 371 ? 57.736  -10.539 -3.195  1.00 49.73  ? 393  LEU B N   1 
ATOM   8757  C CA  . LEU B 1 371 ? 58.251  -9.309  -2.599  1.00 45.34  ? 393  LEU B CA  1 
ATOM   8758  C C   . LEU B 1 371 ? 58.667  -9.598  -1.161  1.00 44.31  ? 393  LEU B C   1 
ATOM   8759  O O   . LEU B 1 371 ? 57.833  -9.944  -0.330  1.00 50.50  ? 393  LEU B O   1 
ATOM   8760  C CB  . LEU B 1 371 ? 57.222  -8.183  -2.656  1.00 41.56  ? 393  LEU B CB  1 
ATOM   8761  C CG  . LEU B 1 371 ? 56.550  -7.940  -4.019  1.00 45.09  ? 393  LEU B CG  1 
ATOM   8762  C CD1 . LEU B 1 371 ? 55.686  -6.691  -3.991  1.00 42.86  ? 393  LEU B CD1 1 
ATOM   8763  C CD2 . LEU B 1 371 ? 57.565  -7.859  -5.148  1.00 41.13  ? 393  LEU B CD2 1 
ATOM   8764  N N   . PRO B 1 372 ? 59.971  -9.475  -0.869  1.00 43.70  ? 394  PRO B N   1 
ATOM   8765  C CA  . PRO B 1 372 ? 60.524  -9.849  0.443   1.00 44.23  ? 394  PRO B CA  1 
ATOM   8766  C C   . PRO B 1 372 ? 59.952  -9.050  1.616   1.00 43.71  ? 394  PRO B C   1 
ATOM   8767  O O   . PRO B 1 372 ? 59.700  -9.627  2.673   1.00 41.55  ? 394  PRO B O   1 
ATOM   8768  C CB  . PRO B 1 372 ? 62.020  -9.545  0.292   1.00 44.15  ? 394  PRO B CB  1 
ATOM   8769  C CG  . PRO B 1 372 ? 62.098  -8.556  -0.847  1.00 46.27  ? 394  PRO B CG  1 
ATOM   8770  C CD  . PRO B 1 372 ? 61.014  -8.982  -1.788  1.00 43.52  ? 394  PRO B CD  1 
ATOM   8771  N N   . ASN B 1 373 ? 59.773  -7.745  1.436   1.00 43.35  ? 395  ASN B N   1 
ATOM   8772  C CA  . ASN B 1 373 ? 59.359  -6.866  2.529   1.00 44.25  ? 395  ASN B CA  1 
ATOM   8773  C C   . ASN B 1 373 ? 57.869  -6.537  2.665   1.00 44.88  ? 395  ASN B C   1 
ATOM   8774  O O   . ASN B 1 373 ? 57.507  -5.700  3.497   1.00 38.13  ? 395  ASN B O   1 
ATOM   8775  C CB  . ASN B 1 373 ? 60.198  -5.585  2.560   1.00 45.79  ? 395  ASN B CB  1 
ATOM   8776  C CG  . ASN B 1 373 ? 61.612  -5.837  3.055   1.00 50.65  ? 395  ASN B CG  1 
ATOM   8777  O OD1 . ASN B 1 373 ? 61.863  -6.827  3.743   1.00 49.01  ? 395  ASN B OD1 1 
ATOM   8778  N ND2 . ASN B 1 373 ? 62.543  -4.953  2.697   1.00 54.86  ? 395  ASN B ND2 1 
ATOM   8779  N N   . LEU B 1 374 ? 56.998  -7.176  1.885   1.00 38.24  ? 396  LEU B N   1 
ATOM   8780  C CA  . LEU B 1 374 ? 55.622  -6.700  1.845   1.00 39.14  ? 396  LEU B CA  1 
ATOM   8781  C C   . LEU B 1 374 ? 54.898  -7.346  3.017   1.00 39.27  ? 396  LEU B C   1 
ATOM   8782  O O   . LEU B 1 374 ? 54.562  -8.528  2.989   1.00 42.79  ? 396  LEU B O   1 
ATOM   8783  C CB  . LEU B 1 374 ? 54.969  -7.141  0.536   1.00 40.73  ? 396  LEU B CB  1 
ATOM   8784  C CG  . LEU B 1 374 ? 53.517  -6.745  0.250   1.00 42.00  ? 396  LEU B CG  1 
ATOM   8785  C CD1 . LEU B 1 374 ? 53.337  -5.245  0.358   1.00 42.16  ? 396  LEU B CD1 1 
ATOM   8786  C CD2 . LEU B 1 374 ? 53.086  -7.223  -1.131  1.00 42.68  ? 396  LEU B CD2 1 
ATOM   8787  N N   . SER B 1 375 ? 54.695  -6.549  4.061   1.00 36.32  ? 397  SER B N   1 
ATOM   8788  C CA  . SER B 1 375 ? 54.115  -7.043  5.299   1.00 39.81  ? 397  SER B CA  1 
ATOM   8789  C C   . SER B 1 375 ? 52.646  -6.701  5.479   1.00 36.00  ? 397  SER B C   1 
ATOM   8790  O O   . SER B 1 375 ? 51.960  -7.314  6.302   1.00 37.03  ? 397  SER B O   1 
ATOM   8791  C CB  . SER B 1 375 ? 54.919  -6.525  6.495   1.00 43.00  ? 397  SER B CB  1 
ATOM   8792  O OG  . SER B 1 375 ? 54.919  -5.109  6.523   1.00 45.07  ? 397  SER B OG  1 
ATOM   8793  N N   . THR B 1 376 ? 52.165  -5.749  4.688   1.00 33.36  ? 398  THR B N   1 
ATOM   8794  C CA  . THR B 1 376 ? 50.799  -5.250  4.809   1.00 32.68  ? 398  THR B CA  1 
ATOM   8795  C C   . THR B 1 376 ? 50.088  -5.185  3.457   1.00 35.93  ? 398  THR B C   1 
ATOM   8796  O O   . THR B 1 376 ? 50.577  -4.555  2.514   1.00 41.37  ? 398  THR B O   1 
ATOM   8797  C CB  . THR B 1 376 ? 50.758  -3.837  5.440   1.00 34.82  ? 398  THR B CB  1 
ATOM   8798  O OG1 . THR B 1 376 ? 51.165  -3.904  6.816   1.00 40.42  ? 398  THR B OG1 1 
ATOM   8799  C CG2 . THR B 1 376 ? 49.339  -3.269  5.388   1.00 30.97  ? 398  THR B CG2 1 
ATOM   8800  N N   . ILE B 1 377 ? 48.939  -5.848  3.369   1.00 31.27  ? 399  ILE B N   1 
ATOM   8801  C CA  . ILE B 1 377 ? 48.025  -5.699  2.238   1.00 38.00  ? 399  ILE B CA  1 
ATOM   8802  C C   . ILE B 1 377 ? 46.668  -5.169  2.724   1.00 38.24  ? 399  ILE B C   1 
ATOM   8803  O O   . ILE B 1 377 ? 46.052  -5.750  3.612   1.00 38.75  ? 399  ILE B O   1 
ATOM   8804  C CB  . ILE B 1 377 ? 47.844  -7.040  1.477   1.00 36.20  ? 399  ILE B CB  1 
ATOM   8805  C CG1 . ILE B 1 377 ? 46.894  -6.868  0.293   1.00 32.66  ? 399  ILE B CG1 1 
ATOM   8806  C CG2 . ILE B 1 377 ? 47.355  -8.144  2.407   1.00 33.19  ? 399  ILE B CG2 1 
ATOM   8807  C CD1 . ILE B 1 377 ? 47.549  -6.263  -0.950  1.00 35.55  ? 399  ILE B CD1 1 
ATOM   8808  N N   . ASN B 1 378 ? 46.202  -4.058  2.159   1.00 38.97  ? 400  ASN B N   1 
ATOM   8809  C CA  . ASN B 1 378 ? 44.949  -3.460  2.615   1.00 37.26  ? 400  ASN B CA  1 
ATOM   8810  C C   . ASN B 1 378 ? 43.835  -3.575  1.562   1.00 40.92  ? 400  ASN B C   1 
ATOM   8811  O O   . ASN B 1 378 ? 43.826  -2.849  0.563   1.00 40.12  ? 400  ASN B O   1 
ATOM   8812  C CB  . ASN B 1 378 ? 45.216  -2.000  3.012   1.00 38.20  ? 400  ASN B CB  1 
ATOM   8813  C CG  . ASN B 1 378 ? 43.959  -1.240  3.422   1.00 40.80  ? 400  ASN B CG  1 
ATOM   8814  O OD1 . ASN B 1 378 ? 42.879  -1.811  3.588   1.00 42.50  ? 400  ASN B OD1 1 
ATOM   8815  N ND2 . ASN B 1 378 ? 44.108  0.074   3.591   1.00 37.74  ? 400  ASN B ND2 1 
ATOM   8816  N N   . LEU B 1 379 ? 42.904  -4.499  1.817   1.00 42.17  ? 401  LEU B N   1 
ATOM   8817  C CA  . LEU B 1 379 ? 41.755  -4.816  0.947   1.00 40.35  ? 401  LEU B CA  1 
ATOM   8818  C C   . LEU B 1 379 ? 40.379  -4.241  1.357   1.00 38.73  ? 401  LEU B C   1 
ATOM   8819  O O   . LEU B 1 379 ? 39.341  -4.648  0.820   1.00 34.97  ? 401  LEU B O   1 
ATOM   8820  C CB  . LEU B 1 379 ? 41.683  -6.320  0.650   1.00 38.53  ? 401  LEU B CB  1 
ATOM   8821  C CG  . LEU B 1 379 ? 42.278  -6.756  -0.701  1.00 43.29  ? 401  LEU B CG  1 
ATOM   8822  C CD1 . LEU B 1 379 ? 43.405  -5.837  -1.153  1.00 44.81  ? 401  LEU B CD1 1 
ATOM   8823  C CD2 . LEU B 1 379 ? 42.772  -8.192  -0.642  1.00 43.01  ? 401  LEU B CD2 1 
ATOM   8824  N N   . GLY B 1 380 ? 40.370  -3.364  2.357   1.00 35.68  ? 402  GLY B N   1 
ATOM   8825  C CA  . GLY B 1 380 ? 39.139  -2.773  2.855   1.00 35.82  ? 402  GLY B CA  1 
ATOM   8826  C C   . GLY B 1 380 ? 38.207  -2.164  1.810   1.00 37.50  ? 402  GLY B C   1 
ATOM   8827  O O   . GLY B 1 380 ? 38.665  -1.620  0.811   1.00 43.71  ? 402  GLY B O   1 
ATOM   8828  N N   . ILE B 1 381 ? 36.898  -2.300  2.040   1.00 30.67  ? 403  ILE B N   1 
ATOM   8829  C CA  . ILE B 1 381 ? 35.853  -1.634  1.254   1.00 29.10  ? 403  ILE B CA  1 
ATOM   8830  C C   . ILE B 1 381 ? 35.888  -1.992  -0.237  1.00 28.38  ? 403  ILE B C   1 
ATOM   8831  O O   . ILE B 1 381 ? 35.914  -1.108  -1.094  1.00 27.81  ? 403  ILE B O   1 
ATOM   8832  C CB  . ILE B 1 381 ? 35.847  -0.087  1.473   1.00 32.65  ? 403  ILE B CB  1 
ATOM   8833  C CG1 . ILE B 1 381 ? 36.105  0.261   2.946   1.00 25.13  ? 403  ILE B CG1 1 
ATOM   8834  C CG2 . ILE B 1 381 ? 34.509  0.506   1.062   1.00 35.01  ? 403  ILE B CG2 1 
ATOM   8835  C CD1 . ILE B 1 381 ? 36.176  1.763   3.234   1.00 25.31  ? 403  ILE B CD1 1 
ATOM   8836  N N   . ASN B 1 382 ? 36.005  -3.288  -0.530  1.00 26.03  ? 404  ASN B N   1 
ATOM   8837  C CA  . ASN B 1 382 ? 35.913  -3.795  -1.901  1.00 29.71  ? 404  ASN B CA  1 
ATOM   8838  C C   . ASN B 1 382 ? 34.633  -4.552  -2.304  1.00 34.68  ? 404  ASN B C   1 
ATOM   8839  O O   . ASN B 1 382 ? 34.496  -4.933  -3.458  1.00 37.97  ? 404  ASN B O   1 
ATOM   8840  C CB  . ASN B 1 382 ? 37.163  -4.599  -2.280  1.00 32.19  ? 404  ASN B CB  1 
ATOM   8841  C CG  . ASN B 1 382 ? 38.349  -3.710  -2.591  1.00 33.18  ? 404  ASN B CG  1 
ATOM   8842  O OD1 . ASN B 1 382 ? 38.345  -2.969  -3.589  1.00 30.97  ? 404  ASN B OD1 1 
ATOM   8843  N ND2 . ASN B 1 382 ? 39.367  -3.757  -1.728  1.00 31.37  ? 404  ASN B ND2 1 
ATOM   8844  N N   . PHE B 1 383 ? 33.714  -4.765  -1.361  1.00 32.27  ? 405  PHE B N   1 
ATOM   8845  C CA  . PHE B 1 383 ? 32.552  -5.640  -1.571  1.00 30.68  ? 405  PHE B CA  1 
ATOM   8846  C C   . PHE B 1 383 ? 32.932  -7.029  -2.075  1.00 33.48  ? 405  PHE B C   1 
ATOM   8847  O O   . PHE B 1 383 ? 32.192  -7.647  -2.844  1.00 33.44  ? 405  PHE B O   1 
ATOM   8848  C CB  . PHE B 1 383 ? 31.498  -5.001  -2.491  1.00 25.92  ? 405  PHE B CB  1 
ATOM   8849  C CG  . PHE B 1 383 ? 30.871  -3.775  -1.909  1.00 33.81  ? 405  PHE B CG  1 
ATOM   8850  C CD1 . PHE B 1 383 ? 31.434  -2.534  -2.117  1.00 35.17  ? 405  PHE B CD1 1 
ATOM   8851  C CD2 . PHE B 1 383 ? 29.735  -3.868  -1.120  1.00 31.73  ? 405  PHE B CD2 1 
ATOM   8852  C CE1 . PHE B 1 383 ? 30.868  -1.401  -1.567  1.00 36.91  ? 405  PHE B CE1 1 
ATOM   8853  C CE2 . PHE B 1 383 ? 29.167  -2.743  -0.573  1.00 32.95  ? 405  PHE B CE2 1 
ATOM   8854  C CZ  . PHE B 1 383 ? 29.735  -1.503  -0.796  1.00 34.36  ? 405  PHE B CZ  1 
ATOM   8855  N N   . ILE B 1 384 ? 34.079  -7.520  -1.615  1.00 33.37  ? 406  ILE B N   1 
ATOM   8856  C CA  . ILE B 1 384 ? 34.548  -8.848  -1.973  1.00 34.58  ? 406  ILE B CA  1 
ATOM   8857  C C   . ILE B 1 384 ? 33.634  -9.888  -1.341  1.00 35.77  ? 406  ILE B C   1 
ATOM   8858  O O   . ILE B 1 384 ? 33.397  -9.844  -0.137  1.00 35.19  ? 406  ILE B O   1 
ATOM   8859  C CB  . ILE B 1 384 ? 35.991  -9.090  -1.456  1.00 34.60  ? 406  ILE B CB  1 
ATOM   8860  C CG1 . ILE B 1 384 ? 36.947  -8.041  -2.010  1.00 32.72  ? 406  ILE B CG1 1 
ATOM   8861  C CG2 . ILE B 1 384 ? 36.481  -10.490 -1.831  1.00 38.77  ? 406  ILE B CG2 1 
ATOM   8862  C CD1 . ILE B 1 384 ? 38.364  -8.122  -1.397  1.00 32.93  ? 406  ILE B CD1 1 
ATOM   8863  N N   . LYS B 1 385 ? 33.096  -10.791 -2.159  1.00 38.75  ? 407  LYS B N   1 
ATOM   8864  C CA  . LYS B 1 385 ? 32.286  -11.907 -1.663  1.00 41.91  ? 407  LYS B CA  1 
ATOM   8865  C C   . LYS B 1 385 ? 33.104  -13.117 -1.207  1.00 42.12  ? 407  LYS B C   1 
ATOM   8866  O O   . LYS B 1 385 ? 32.793  -13.731 -0.198  1.00 41.47  ? 407  LYS B O   1 
ATOM   8867  C CB  . LYS B 1 385 ? 31.291  -12.378 -2.713  1.00 46.02  ? 407  LYS B CB  1 
ATOM   8868  C CG  . LYS B 1 385 ? 30.266  -11.347 -3.158  1.00 48.95  ? 407  LYS B CG  1 
ATOM   8869  C CD  . LYS B 1 385 ? 29.658  -11.807 -4.478  1.00 49.63  ? 407  LYS B CD  1 
ATOM   8870  C CE  . LYS B 1 385 ? 28.663  -10.815 -5.034  1.00 54.43  ? 407  LYS B CE  1 
ATOM   8871  N NZ  . LYS B 1 385 ? 28.130  -11.291 -6.345  1.00 56.42  ? 407  LYS B NZ  1 
ATOM   8872  N N   . GLN B 1 386 ? 34.132  -13.478 -1.971  1.00 43.17  ? 408  GLN B N   1 
ATOM   8873  C CA  . GLN B 1 386 ? 34.894  -14.688 -1.684  1.00 46.68  ? 408  GLN B CA  1 
ATOM   8874  C C   . GLN B 1 386 ? 36.397  -14.481 -1.891  1.00 46.65  ? 408  GLN B C   1 
ATOM   8875  O O   . GLN B 1 386 ? 36.817  -13.631 -2.681  1.00 49.75  ? 408  GLN B O   1 
ATOM   8876  C CB  . GLN B 1 386 ? 34.382  -15.861 -2.536  1.00 50.55  ? 408  GLN B CB  1 
ATOM   8877  C CG  . GLN B 1 386 ? 33.054  -16.456 -2.052  1.00 55.90  ? 408  GLN B CG  1 
ATOM   8878  C CD  . GLN B 1 386 ? 33.200  -17.332 -0.808  1.00 62.58  ? 408  GLN B CD  1 
ATOM   8879  O OE1 . GLN B 1 386 ? 33.658  -18.475 -0.889  1.00 66.41  ? 408  GLN B OE1 1 
ATOM   8880  N NE2 . GLN B 1 386 ? 32.806  -16.800 0.348   1.00 63.37  ? 408  GLN B NE2 1 
ATOM   8881  N N   . ILE B 1 387 ? 37.193  -15.259 -1.161  1.00 39.94  ? 409  ILE B N   1 
ATOM   8882  C CA  . ILE B 1 387 ? 38.648  -15.212 -1.239  1.00 41.24  ? 409  ILE B CA  1 
ATOM   8883  C C   . ILE B 1 387 ? 39.192  -16.630 -1.097  1.00 42.45  ? 409  ILE B C   1 
ATOM   8884  O O   . ILE B 1 387 ? 38.670  -17.408 -0.307  1.00 39.55  ? 409  ILE B O   1 
ATOM   8885  C CB  . ILE B 1 387 ? 39.256  -14.373 -0.078  1.00 49.89  ? 409  ILE B CB  1 
ATOM   8886  C CG1 . ILE B 1 387 ? 38.656  -12.966 -0.044  1.00 50.31  ? 409  ILE B CG1 1 
ATOM   8887  C CG2 . ILE B 1 387 ? 40.794  -14.312 -0.184  1.00 48.34  ? 409  ILE B CG2 1 
ATOM   8888  C CD1 . ILE B 1 387 ? 39.105  -12.139 1.140   1.00 50.21  ? 409  ILE B CD1 1 
ATOM   8889  N N   . ASP B 1 388 ? 40.238  -16.980 -1.837  1.00 47.12  ? 410  ASP B N   1 
ATOM   8890  C CA  . ASP B 1 388 ? 40.889  -18.243 -1.538  1.00 52.29  ? 410  ASP B CA  1 
ATOM   8891  C C   . ASP B 1 388 ? 41.975  -17.881 -0.570  1.00 48.59  ? 410  ASP B C   1 
ATOM   8892  O O   . ASP B 1 388 ? 43.017  -17.345 -0.959  1.00 51.44  ? 410  ASP B O   1 
ATOM   8893  C CB  . ASP B 1 388 ? 41.521  -18.862 -2.778  1.00 59.87  ? 410  ASP B CB  1 
ATOM   8894  C CG  . ASP B 1 388 ? 40.549  -18.992 -3.914  1.00 66.80  ? 410  ASP B CG  1 
ATOM   8895  O OD1 . ASP B 1 388 ? 39.750  -19.952 -3.909  1.00 69.96  ? 410  ASP B OD1 1 
ATOM   8896  O OD2 . ASP B 1 388 ? 40.584  -18.131 -4.813  1.00 69.84  ? 410  ASP B OD2 1 
ATOM   8897  N N   . PHE B 1 389 ? 41.755  -18.233 0.687   1.00 42.39  ? 411  PHE B N   1 
ATOM   8898  C CA  . PHE B 1 389 ? 42.604  -17.747 1.754   1.00 42.47  ? 411  PHE B CA  1 
ATOM   8899  C C   . PHE B 1 389 ? 44.000  -18.351 1.678   1.00 45.61  ? 411  PHE B C   1 
ATOM   8900  O O   . PHE B 1 389 ? 44.952  -17.782 2.209   1.00 49.44  ? 411  PHE B O   1 
ATOM   8901  C CB  . PHE B 1 389 ? 41.948  -18.000 3.115   1.00 39.66  ? 411  PHE B CB  1 
ATOM   8902  C CG  . PHE B 1 389 ? 40.818  -17.064 3.417   1.00 40.36  ? 411  PHE B CG  1 
ATOM   8903  C CD1 . PHE B 1 389 ? 41.062  -15.842 4.032   1.00 40.37  ? 411  PHE B CD1 1 
ATOM   8904  C CD2 . PHE B 1 389 ? 39.510  -17.396 3.077   1.00 40.35  ? 411  PHE B CD2 1 
ATOM   8905  C CE1 . PHE B 1 389 ? 40.019  -14.968 4.319   1.00 40.07  ? 411  PHE B CE1 1 
ATOM   8906  C CE2 . PHE B 1 389 ? 38.464  -16.530 3.351   1.00 38.47  ? 411  PHE B CE2 1 
ATOM   8907  C CZ  . PHE B 1 389 ? 38.718  -15.311 3.972   1.00 40.17  ? 411  PHE B CZ  1 
ATOM   8908  N N   . LYS B 1 390 ? 44.119  -19.480 0.983   1.00 45.01  ? 412  LYS B N   1 
ATOM   8909  C CA  . LYS B 1 390 ? 45.385  -20.206 0.899   1.00 47.34  ? 412  LYS B CA  1 
ATOM   8910  C C   . LYS B 1 390 ? 46.463  -19.437 0.134   1.00 50.87  ? 412  LYS B C   1 
ATOM   8911  O O   . LYS B 1 390 ? 47.639  -19.827 0.143   1.00 51.92  ? 412  LYS B O   1 
ATOM   8912  C CB  . LYS B 1 390 ? 45.177  -21.590 0.274   1.00 49.95  ? 412  LYS B CB  1 
ATOM   8913  C CG  . LYS B 1 390 ? 44.941  -21.578 -1.238  1.00 55.58  ? 412  LYS B CG  1 
ATOM   8914  C CD  . LYS B 1 390 ? 44.474  -22.943 -1.726  1.00 60.32  ? 412  LYS B CD  1 
ATOM   8915  C CE  . LYS B 1 390 ? 45.167  -23.356 -3.024  1.00 64.90  ? 412  LYS B CE  1 
ATOM   8916  N NZ  . LYS B 1 390 ? 44.750  -22.527 -4.199  1.00 65.82  ? 412  LYS B NZ  1 
ATOM   8917  N N   . LEU B 1 391 ? 46.068  -18.353 -0.531  1.00 48.67  ? 413  LEU B N   1 
ATOM   8918  C CA  . LEU B 1 391 ? 47.028  -17.552 -1.285  1.00 46.45  ? 413  LEU B CA  1 
ATOM   8919  C C   . LEU B 1 391 ? 47.977  -16.816 -0.340  1.00 48.13  ? 413  LEU B C   1 
ATOM   8920  O O   . LEU B 1 391 ? 49.165  -16.673 -0.642  1.00 46.68  ? 413  LEU B O   1 
ATOM   8921  C CB  . LEU B 1 391 ? 46.326  -16.576 -2.246  1.00 41.29  ? 413  LEU B CB  1 
ATOM   8922  C CG  . LEU B 1 391 ? 45.494  -15.409 -1.691  1.00 43.34  ? 413  LEU B CG  1 
ATOM   8923  C CD1 . LEU B 1 391 ? 46.361  -14.188 -1.436  1.00 45.84  ? 413  LEU B CD1 1 
ATOM   8924  C CD2 . LEU B 1 391 ? 44.341  -15.040 -2.623  1.00 42.68  ? 413  LEU B CD2 1 
ATOM   8925  N N   . PHE B 1 392 ? 47.451  -16.366 0.803   1.00 48.43  ? 414  PHE B N   1 
ATOM   8926  C CA  . PHE B 1 392 ? 48.232  -15.564 1.750   1.00 49.02  ? 414  PHE B CA  1 
ATOM   8927  C C   . PHE B 1 392 ? 49.451  -16.298 2.299   1.00 55.90  ? 414  PHE B C   1 
ATOM   8928  O O   . PHE B 1 392 ? 50.434  -15.668 2.688   1.00 55.48  ? 414  PHE B O   1 
ATOM   8929  C CB  . PHE B 1 392 ? 47.361  -15.049 2.899   1.00 42.58  ? 414  PHE B CB  1 
ATOM   8930  C CG  . PHE B 1 392 ? 46.283  -14.109 2.458   1.00 39.55  ? 414  PHE B CG  1 
ATOM   8931  C CD1 . PHE B 1 392 ? 46.599  -12.890 1.882   1.00 38.97  ? 414  PHE B CD1 1 
ATOM   8932  C CD2 . PHE B 1 392 ? 44.949  -14.445 2.614   1.00 34.52  ? 414  PHE B CD2 1 
ATOM   8933  C CE1 . PHE B 1 392 ? 45.600  -12.024 1.466   1.00 37.36  ? 414  PHE B CE1 1 
ATOM   8934  C CE2 . PHE B 1 392 ? 43.959  -13.590 2.211   1.00 32.01  ? 414  PHE B CE2 1 
ATOM   8935  C CZ  . PHE B 1 392 ? 44.277  -12.374 1.642   1.00 35.20  ? 414  PHE B CZ  1 
ATOM   8936  N N   . GLN B 1 393 ? 49.375  -17.625 2.327   1.00 63.31  ? 415  GLN B N   1 
ATOM   8937  C CA  . GLN B 1 393 ? 50.514  -18.465 2.696   1.00 69.56  ? 415  GLN B CA  1 
ATOM   8938  C C   . GLN B 1 393 ? 51.700  -18.263 1.764   1.00 69.47  ? 415  GLN B C   1 
ATOM   8939  O O   . GLN B 1 393 ? 52.846  -18.210 2.213   1.00 66.25  ? 415  GLN B O   1 
ATOM   8940  C CB  . GLN B 1 393 ? 50.121  -19.937 2.638   1.00 72.95  ? 415  GLN B CB  1 
ATOM   8941  C CG  . GLN B 1 393 ? 49.732  -20.549 3.957   1.00 74.00  ? 415  GLN B CG  1 
ATOM   8942  C CD  . GLN B 1 393 ? 49.309  -21.992 3.793   1.00 75.82  ? 415  GLN B CD  1 
ATOM   8943  O OE1 . GLN B 1 393 ? 49.002  -22.440 2.684   1.00 75.11  ? 415  GLN B OE1 1 
ATOM   8944  N NE2 . GLN B 1 393 ? 49.294  -22.731 4.894   1.00 76.84  ? 415  GLN B NE2 1 
ATOM   8945  N N   . ASN B 1 394 ? 51.410  -18.173 0.466   1.00 70.59  ? 416  ASN B N   1 
ATOM   8946  C CA  . ASN B 1 394 ? 52.440  -18.131 -0.572  1.00 71.42  ? 416  ASN B CA  1 
ATOM   8947  C C   . ASN B 1 394 ? 53.275  -16.859 -0.494  1.00 69.32  ? 416  ASN B C   1 
ATOM   8948  O O   . ASN B 1 394 ? 54.410  -16.822 -0.967  1.00 72.98  ? 416  ASN B O   1 
ATOM   8949  C CB  . ASN B 1 394 ? 51.800  -18.251 -1.961  1.00 73.30  ? 416  ASN B CB  1 
ATOM   8950  C CG  . ASN B 1 394 ? 52.763  -18.789 -3.016  1.00 78.34  ? 416  ASN B CG  1 
ATOM   8951  O OD1 . ASN B 1 394 ? 53.716  -18.115 -3.418  1.00 80.13  ? 416  ASN B OD1 1 
ATOM   8952  N ND2 . ASN B 1 394 ? 52.502  -20.006 -3.483  1.00 80.21  ? 416  ASN B ND2 1 
ATOM   8953  N N   . PHE B 1 395 ? 52.705  -15.817 0.103   1.00 64.01  ? 417  PHE B N   1 
ATOM   8954  C CA  . PHE B 1 395 ? 53.401  -14.544 0.248   1.00 58.18  ? 417  PHE B CA  1 
ATOM   8955  C C   . PHE B 1 395 ? 54.679  -14.734 1.034   1.00 54.53  ? 417  PHE B C   1 
ATOM   8956  O O   . PHE B 1 395 ? 54.765  -15.630 1.869   1.00 48.55  ? 417  PHE B O   1 
ATOM   8957  C CB  . PHE B 1 395 ? 52.518  -13.527 0.959   1.00 54.84  ? 417  PHE B CB  1 
ATOM   8958  C CG  . PHE B 1 395 ? 51.667  -12.707 0.037   1.00 55.60  ? 417  PHE B CG  1 
ATOM   8959  C CD1 . PHE B 1 395 ? 50.579  -13.266 -0.603  1.00 56.84  ? 417  PHE B CD1 1 
ATOM   8960  C CD2 . PHE B 1 395 ? 51.940  -11.367 -0.163  1.00 54.86  ? 417  PHE B CD2 1 
ATOM   8961  C CE1 . PHE B 1 395 ? 49.789  -12.507 -1.434  1.00 57.08  ? 417  PHE B CE1 1 
ATOM   8962  C CE2 . PHE B 1 395 ? 51.153  -10.607 -0.987  1.00 56.65  ? 417  PHE B CE2 1 
ATOM   8963  C CZ  . PHE B 1 395 ? 50.074  -11.179 -1.627  1.00 56.77  ? 417  PHE B CZ  1 
ATOM   8964  N N   . SER B 1 396 ? 55.680  -13.910 0.745   1.00 60.33  ? 418  SER B N   1 
ATOM   8965  C CA  . SER B 1 396 ? 56.963  -14.010 1.429   1.00 62.26  ? 418  SER B CA  1 
ATOM   8966  C C   . SER B 1 396 ? 56.782  -13.872 2.939   1.00 63.55  ? 418  SER B C   1 
ATOM   8967  O O   . SER B 1 396 ? 56.885  -14.860 3.669   1.00 64.30  ? 418  SER B O   1 
ATOM   8968  C CB  . SER B 1 396 ? 57.928  -12.949 0.902   1.00 62.68  ? 418  SER B CB  1 
ATOM   8969  O OG  . SER B 1 396 ? 59.197  -13.053 1.519   1.00 66.90  ? 418  SER B OG  1 
ATOM   8970  N N   . ASN B 1 397 ? 56.530  -12.655 3.417   1.00 61.23  ? 419  ASN B N   1 
ATOM   8971  C CA  . ASN B 1 397 ? 56.132  -12.494 4.808   1.00 57.49  ? 419  ASN B CA  1 
ATOM   8972  C C   . ASN B 1 397 ? 55.042  -11.427 5.024   1.00 51.78  ? 419  ASN B C   1 
ATOM   8973  O O   . ASN B 1 397 ? 55.349  -10.244 5.176   1.00 55.11  ? 419  ASN B O   1 
ATOM   8974  C CB  . ASN B 1 397 ? 57.390  -12.129 5.600   1.00 60.34  ? 419  ASN B CB  1 
ATOM   8975  C CG  . ASN B 1 397 ? 57.200  -12.257 7.089   1.00 65.19  ? 419  ASN B CG  1 
ATOM   8976  O OD1 . ASN B 1 397 ? 56.402  -13.072 7.564   1.00 65.92  ? 419  ASN B OD1 1 
ATOM   8977  N ND2 . ASN B 1 397 ? 57.934  -11.447 7.845   1.00 65.46  ? 419  ASN B ND2 1 
ATOM   8978  N N   . LEU B 1 398 ? 53.798  -11.852 5.194   1.00 44.01  ? 420  LEU B N   1 
ATOM   8979  C CA  . LEU B 1 398 ? 52.707  -10.915 5.452   1.00 42.74  ? 420  LEU B CA  1 
ATOM   8980  C C   . LEU B 1 398 ? 52.497  -10.851 6.953   1.00 38.64  ? 420  LEU B C   1 
ATOM   8981  O O   . LEU B 1 398 ? 52.425  -11.890 7.589   1.00 37.01  ? 420  LEU B O   1 
ATOM   8982  C CB  . LEU B 1 398 ? 51.415  -11.380 4.787   1.00 43.15  ? 420  LEU B CB  1 
ATOM   8983  C CG  . LEU B 1 398 ? 51.242  -11.044 3.313   1.00 44.97  ? 420  LEU B CG  1 
ATOM   8984  C CD1 . LEU B 1 398 ? 49.919  -11.607 2.795   1.00 45.89  ? 420  LEU B CD1 1 
ATOM   8985  C CD2 . LEU B 1 398 ? 51.330  -9.531  3.107   1.00 42.82  ? 420  LEU B CD2 1 
ATOM   8986  N N   . GLU B 1 399 ? 52.564  -9.650  7.520   1.00 40.34  ? 421  GLU B N   1 
ATOM   8987  C CA  . GLU B 1 399 ? 52.204  -9.394  8.918   1.00 45.05  ? 421  GLU B CA  1 
ATOM   8988  C C   . GLU B 1 399 ? 50.745  -8.994  9.171   1.00 42.68  ? 421  GLU B C   1 
ATOM   8989  O O   . GLU B 1 399 ? 50.159  -9.332  10.197  1.00 42.54  ? 421  GLU B O   1 
ATOM   8990  C CB  . GLU B 1 399 ? 53.168  -8.383  9.547   1.00 52.28  ? 421  GLU B CB  1 
ATOM   8991  C CG  . GLU B 1 399 ? 54.579  -8.924  9.759   1.00 60.74  ? 421  GLU B CG  1 
ATOM   8992  C CD  . GLU B 1 399 ? 55.617  -7.814  9.865   1.00 67.33  ? 421  GLU B CD  1 
ATOM   8993  O OE1 . GLU B 1 399 ? 56.675  -7.932  9.210   1.00 72.30  ? 421  GLU B OE1 1 
ATOM   8994  O OE2 . GLU B 1 399 ? 55.375  -6.823  10.593  1.00 66.52  ? 421  GLU B OE2 1 
ATOM   8995  N N   . ILE B 1 400 ? 50.195  -8.212  8.248   1.00 40.92  ? 422  ILE B N   1 
ATOM   8996  C CA  . ILE B 1 400 ? 48.870  -7.627  8.409   1.00 37.68  ? 422  ILE B CA  1 
ATOM   8997  C C   . ILE B 1 400 ? 47.989  -7.866  7.183   1.00 38.65  ? 422  ILE B C   1 
ATOM   8998  O O   . ILE B 1 400 ? 48.219  -7.306  6.107   1.00 37.55  ? 422  ILE B O   1 
ATOM   8999  C CB  . ILE B 1 400 ? 48.988  -6.112  8.675   1.00 33.87  ? 422  ILE B CB  1 
ATOM   9000  C CG1 . ILE B 1 400 ? 49.592  -5.863  10.066  1.00 34.07  ? 422  ILE B CG1 1 
ATOM   9001  C CG2 . ILE B 1 400 ? 47.642  -5.429  8.544   1.00 32.01  ? 422  ILE B CG2 1 
ATOM   9002  C CD1 . ILE B 1 400 ? 49.955  -4.412  10.306  1.00 31.05  ? 422  ILE B CD1 1 
ATOM   9003  N N   . ILE B 1 401 ? 46.957  -8.679  7.350   1.00 37.13  ? 423  ILE B N   1 
ATOM   9004  C CA  . ILE B 1 401 ? 46.075  -8.949  6.234   1.00 38.74  ? 423  ILE B CA  1 
ATOM   9005  C C   . ILE B 1 401 ? 44.756  -8.266  6.560   1.00 36.50  ? 423  ILE B C   1 
ATOM   9006  O O   . ILE B 1 401 ? 43.965  -8.773  7.346   1.00 41.29  ? 423  ILE B O   1 
ATOM   9007  C CB  . ILE B 1 401 ? 45.910  -10.471 6.081   1.00 37.25  ? 423  ILE B CB  1 
ATOM   9008  C CG1 . ILE B 1 401 ? 47.290  -11.103 5.898   1.00 30.65  ? 423  ILE B CG1 1 
ATOM   9009  C CG2 . ILE B 1 401 ? 44.956  -10.830 4.929   1.00 35.37  ? 423  ILE B CG2 1 
ATOM   9010  C CD1 . ILE B 1 401 ? 47.331  -12.603 6.147   1.00 31.08  ? 423  ILE B CD1 1 
ATOM   9011  N N   . TYR B 1 402 ? 44.508  -7.118  5.937   1.00 33.95  ? 424  TYR B N   1 
ATOM   9012  C CA  . TYR B 1 402 ? 43.361  -6.306  6.330   1.00 34.61  ? 424  TYR B CA  1 
ATOM   9013  C C   . TYR B 1 402 ? 42.238  -6.458  5.302   1.00 33.60  ? 424  TYR B C   1 
ATOM   9014  O O   . TYR B 1 402 ? 42.294  -5.871  4.213   1.00 33.43  ? 424  TYR B O   1 
ATOM   9015  C CB  . TYR B 1 402 ? 43.803  -4.839  6.426   1.00 34.29  ? 424  TYR B CB  1 
ATOM   9016  C CG  . TYR B 1 402 ? 42.776  -3.908  7.024   1.00 34.32  ? 424  TYR B CG  1 
ATOM   9017  C CD1 . TYR B 1 402 ? 42.546  -3.893  8.392   1.00 36.86  ? 424  TYR B CD1 1 
ATOM   9018  C CD2 . TYR B 1 402 ? 42.038  -3.043  6.222   1.00 36.80  ? 424  TYR B CD2 1 
ATOM   9019  C CE1 . TYR B 1 402 ? 41.603  -3.044  8.954   1.00 37.81  ? 424  TYR B CE1 1 
ATOM   9020  C CE2 . TYR B 1 402 ? 41.094  -2.184  6.772   1.00 37.93  ? 424  TYR B CE2 1 
ATOM   9021  C CZ  . TYR B 1 402 ? 40.880  -2.198  8.140   1.00 40.04  ? 424  TYR B CZ  1 
ATOM   9022  O OH  . TYR B 1 402 ? 39.947  -1.367  8.713   1.00 43.72  ? 424  TYR B OH  1 
ATOM   9023  N N   . LEU B 1 403 ? 41.246  -7.273  5.664   1.00 31.22  ? 425  LEU B N   1 
ATOM   9024  C CA  . LEU B 1 403 ? 40.028  -7.543  4.868   1.00 26.10  ? 425  LEU B CA  1 
ATOM   9025  C C   . LEU B 1 403 ? 38.744  -6.868  5.355   1.00 28.13  ? 425  LEU B C   1 
ATOM   9026  O O   . LEU B 1 403 ? 37.640  -7.218  4.921   1.00 29.81  ? 425  LEU B O   1 
ATOM   9027  C CB  . LEU B 1 403 ? 39.830  -9.042  4.657   1.00 34.04  ? 425  LEU B CB  1 
ATOM   9028  C CG  . LEU B 1 403 ? 41.033  -9.760  4.039   1.00 35.81  ? 425  LEU B CG  1 
ATOM   9029  C CD1 . LEU B 1 403 ? 40.855  -11.270 4.133   1.00 36.00  ? 425  LEU B CD1 1 
ATOM   9030  C CD2 . LEU B 1 403 ? 41.262  -9.336  2.585   1.00 36.21  ? 425  LEU B CD2 1 
ATOM   9031  N N   . SER B 1 404 ? 38.876  -5.967  6.318   1.00 29.17  ? 426  SER B N   1 
ATOM   9032  C CA  . SER B 1 404 ? 37.725  -5.297  6.905   1.00 30.41  ? 426  SER B CA  1 
ATOM   9033  C C   . SER B 1 404 ? 36.797  -4.644  5.873   1.00 36.41  ? 426  SER B C   1 
ATOM   9034  O O   . SER B 1 404 ? 37.234  -4.164  4.820   1.00 39.64  ? 426  SER B O   1 
ATOM   9035  C CB  . SER B 1 404 ? 38.187  -4.234  7.905   1.00 33.01  ? 426  SER B CB  1 
ATOM   9036  O OG  . SER B 1 404 ? 37.073  -3.607  8.535   1.00 32.89  ? 426  SER B OG  1 
ATOM   9037  N N   . GLU B 1 405 ? 35.509  -4.646  6.197   1.00 38.37  ? 427  GLU B N   1 
ATOM   9038  C CA  . GLU B 1 405 ? 34.476  -3.996  5.392   1.00 38.10  ? 427  GLU B CA  1 
ATOM   9039  C C   . GLU B 1 405 ? 34.345  -4.552  3.966   1.00 37.82  ? 427  GLU B C   1 
ATOM   9040  O O   . GLU B 1 405 ? 34.672  -3.890  2.981   1.00 36.17  ? 427  GLU B O   1 
ATOM   9041  C CB  . GLU B 1 405 ? 34.665  -2.477  5.377   1.00 37.65  ? 427  GLU B CB  1 
ATOM   9042  C CG  . GLU B 1 405 ? 33.435  -1.750  4.873   1.00 38.35  ? 427  GLU B CG  1 
ATOM   9043  C CD  . GLU B 1 405 ? 32.192  -2.121  5.672   1.00 37.08  ? 427  GLU B CD  1 
ATOM   9044  O OE1 . GLU B 1 405 ? 31.413  -2.987  5.212   1.00 34.23  ? 427  GLU B OE1 1 
ATOM   9045  O OE2 . GLU B 1 405 ? 32.003  -1.542  6.764   1.00 35.05  ? 427  GLU B OE2 1 
ATOM   9046  N N   . ASN B 1 406 ? 33.845  -5.778  3.886   1.00 36.81  ? 428  ASN B N   1 
ATOM   9047  C CA  . ASN B 1 406 ? 33.640  -6.461  2.617   1.00 35.48  ? 428  ASN B CA  1 
ATOM   9048  C C   . ASN B 1 406 ? 32.352  -7.300  2.662   1.00 34.76  ? 428  ASN B C   1 
ATOM   9049  O O   . ASN B 1 406 ? 31.467  -7.048  3.490   1.00 28.57  ? 428  ASN B O   1 
ATOM   9050  C CB  . ASN B 1 406 ? 34.865  -7.308  2.217   1.00 29.62  ? 428  ASN B CB  1 
ATOM   9051  C CG  . ASN B 1 406 ? 35.979  -6.473  1.580   1.00 34.42  ? 428  ASN B CG  1 
ATOM   9052  O OD1 . ASN B 1 406 ? 35.825  -5.965  0.466   1.00 33.09  ? 428  ASN B OD1 1 
ATOM   9053  N ND2 . ASN B 1 406 ? 37.119  -6.349  2.279   1.00 25.54  ? 428  ASN B ND2 1 
ATOM   9054  N N   . ARG B 1 407 ? 32.194  -8.176  1.680   1.00 34.81  ? 429  ARG B N   1 
ATOM   9055  C CA  . ARG B 1 407 ? 31.074  -9.114  1.619   1.00 41.02  ? 429  ARG B CA  1 
ATOM   9056  C C   . ARG B 1 407 ? 31.375  -10.569 1.966   1.00 42.48  ? 429  ARG B C   1 
ATOM   9057  O O   . ARG B 1 407 ? 30.603  -11.441 1.579   1.00 39.18  ? 429  ARG B O   1 
ATOM   9058  C CB  . ARG B 1 407 ? 30.310  -9.021  0.288   1.00 41.93  ? 429  ARG B CB  1 
ATOM   9059  C CG  . ARG B 1 407 ? 29.744  -7.647  -0.001  1.00 44.87  ? 429  ARG B CG  1 
ATOM   9060  C CD  . ARG B 1 407 ? 29.147  -7.006  1.249   1.00 51.71  ? 429  ARG B CD  1 
ATOM   9061  N NE  . ARG B 1 407 ? 28.260  -7.930  1.948   1.00 60.11  ? 429  ARG B NE  1 
ATOM   9062  C CZ  . ARG B 1 407 ? 26.942  -7.971  1.798   1.00 63.84  ? 429  ARG B CZ  1 
ATOM   9063  N NH1 . ARG B 1 407 ? 26.237  -8.869  2.469   1.00 65.46  ? 429  ARG B NH1 1 
ATOM   9064  N NH2 . ARG B 1 407 ? 26.330  -7.121  0.980   1.00 64.18  ? 429  ARG B NH2 1 
ATOM   9065  N N   . ILE B 1 408 ? 32.548  -10.849 2.529   1.00 45.58  ? 430  ILE B N   1 
ATOM   9066  C CA  . ILE B 1 408 ? 32.969  -12.228 2.773   1.00 44.67  ? 430  ILE B CA  1 
ATOM   9067  C C   . ILE B 1 408 ? 31.928  -13.012 3.554   1.00 43.34  ? 430  ILE B C   1 
ATOM   9068  O O   . ILE B 1 408 ? 31.490  -12.582 4.614   1.00 39.82  ? 430  ILE B O   1 
ATOM   9069  C CB  . ILE B 1 408 ? 34.291  -12.280 3.558   1.00 45.60  ? 430  ILE B CB  1 
ATOM   9070  C CG1 . ILE B 1 408 ? 35.352  -11.400 2.890   1.00 46.48  ? 430  ILE B CG1 1 
ATOM   9071  C CG2 . ILE B 1 408 ? 34.783  -13.719 3.682   1.00 41.95  ? 430  ILE B CG2 1 
ATOM   9072  C CD1 . ILE B 1 408 ? 35.492  -11.687 1.434   1.00 50.75  ? 430  ILE B CD1 1 
ATOM   9073  N N   . SER B 1 409 ? 31.548  -14.167 3.019   1.00 43.55  ? 431  SER B N   1 
ATOM   9074  C CA  . SER B 1 409 ? 30.551  -15.018 3.651   1.00 42.82  ? 431  SER B CA  1 
ATOM   9075  C C   . SER B 1 409 ? 31.200  -16.371 3.965   1.00 39.65  ? 431  SER B C   1 
ATOM   9076  O O   . SER B 1 409 ? 32.359  -16.571 3.637   1.00 42.85  ? 431  SER B O   1 
ATOM   9077  C CB  . SER B 1 409 ? 29.332  -15.154 2.725   1.00 44.37  ? 431  SER B CB  1 
ATOM   9078  O OG  . SER B 1 409 ? 29.716  -15.641 1.454   1.00 49.33  ? 431  SER B OG  1 
ATOM   9079  N N   . PRO B 1 410 ? 30.478  -17.291 4.630   1.00 39.10  ? 432  PRO B N   1 
ATOM   9080  C CA  . PRO B 1 410 ? 31.106  -18.580 4.950   1.00 41.03  ? 432  PRO B CA  1 
ATOM   9081  C C   . PRO B 1 410 ? 31.701  -19.324 3.758   1.00 45.98  ? 432  PRO B C   1 
ATOM   9082  O O   . PRO B 1 410 ? 31.074  -19.377 2.700   1.00 47.09  ? 432  PRO B O   1 
ATOM   9083  C CB  . PRO B 1 410 ? 29.946  -19.381 5.549   1.00 39.45  ? 432  PRO B CB  1 
ATOM   9084  C CG  . PRO B 1 410 ? 29.174  -18.355 6.280   1.00 37.75  ? 432  PRO B CG  1 
ATOM   9085  C CD  . PRO B 1 410 ? 29.238  -17.099 5.410   1.00 36.60  ? 432  PRO B CD  1 
ATOM   9086  N N   . LEU B 1 411 ? 32.898  -19.880 3.954   1.00 50.30  ? 433  LEU B N   1 
ATOM   9087  C CA  . LEU B 1 411 ? 33.627  -20.635 2.933   1.00 56.67  ? 433  LEU B CA  1 
ATOM   9088  C C   . LEU B 1 411 ? 32.796  -21.762 2.338   1.00 61.37  ? 433  LEU B C   1 
ATOM   9089  O O   . LEU B 1 411 ? 32.145  -22.514 3.066   1.00 62.63  ? 433  LEU B O   1 
ATOM   9090  C CB  . LEU B 1 411 ? 34.926  -21.215 3.525   1.00 57.55  ? 433  LEU B CB  1 
ATOM   9091  C CG  . LEU B 1 411 ? 35.871  -22.104 2.689   1.00 59.90  ? 433  LEU B CG  1 
ATOM   9092  C CD1 . LEU B 1 411 ? 37.312  -21.971 3.184   1.00 59.24  ? 433  LEU B CD1 1 
ATOM   9093  C CD2 . LEU B 1 411 ? 35.470  -23.578 2.709   1.00 60.67  ? 433  LEU B CD2 1 
ATOM   9094  N N   . VAL B 1 412 ? 32.841  -21.890 1.015   1.00 63.30  ? 434  VAL B N   1 
ATOM   9095  C CA  . VAL B 1 412 ? 32.194  -23.010 0.342   1.00 66.16  ? 434  VAL B CA  1 
ATOM   9096  C C   . VAL B 1 412 ? 33.209  -23.966 -0.272  1.00 68.16  ? 434  VAL B C   1 
ATOM   9097  O O   . VAL B 1 412 ? 34.262  -23.543 -0.744  1.00 70.42  ? 434  VAL B O   1 
ATOM   9098  C CB  . VAL B 1 412 ? 31.228  -22.529 -0.744  1.00 67.38  ? 434  VAL B CB  1 
ATOM   9099  C CG1 . VAL B 1 412 ? 30.728  -23.708 -1.558  1.00 68.65  ? 434  VAL B CG1 1 
ATOM   9100  C CG2 . VAL B 1 412 ? 30.069  -21.770 -0.110  1.00 66.32  ? 434  VAL B CG2 1 
ATOM   9101  N N   . PHE B 1 437 ? 35.277  23.772  11.400  1.00 68.41  ? 459  PHE B N   1 
ATOM   9102  C CA  . PHE B 1 437 ? 35.597  23.198  10.097  1.00 69.23  ? 459  PHE B CA  1 
ATOM   9103  C C   . PHE B 1 437 ? 35.787  21.674  10.156  1.00 69.97  ? 459  PHE B C   1 
ATOM   9104  O O   . PHE B 1 437 ? 36.369  21.137  11.103  1.00 69.29  ? 459  PHE B O   1 
ATOM   9105  C CB  . PHE B 1 437 ? 36.800  23.906  9.452   1.00 69.81  ? 459  PHE B CB  1 
ATOM   9106  C CG  . PHE B 1 437 ? 37.909  24.221  10.408  1.00 67.30  ? 459  PHE B CG  1 
ATOM   9107  C CD1 . PHE B 1 437 ? 38.626  23.200  11.025  1.00 65.24  ? 459  PHE B CD1 1 
ATOM   9108  C CD2 . PHE B 1 437 ? 38.248  25.538  10.674  1.00 66.98  ? 459  PHE B CD2 1 
ATOM   9109  C CE1 . PHE B 1 437 ? 39.656  23.490  11.899  1.00 65.13  ? 459  PHE B CE1 1 
ATOM   9110  C CE2 . PHE B 1 437 ? 39.275  25.841  11.541  1.00 67.56  ? 459  PHE B CE2 1 
ATOM   9111  C CZ  . PHE B 1 437 ? 39.982  24.819  12.161  1.00 67.03  ? 459  PHE B CZ  1 
ATOM   9112  N N   . GLU B 1 438 ? 35.291  21.000  9.120   1.00 69.02  ? 460  GLU B N   1 
ATOM   9113  C CA  . GLU B 1 438 ? 35.107  19.545  9.095   1.00 63.26  ? 460  GLU B CA  1 
ATOM   9114  C C   . GLU B 1 438 ? 36.394  18.709  9.063   1.00 59.06  ? 460  GLU B C   1 
ATOM   9115  O O   . GLU B 1 438 ? 36.429  17.581  9.564   1.00 56.61  ? 460  GLU B O   1 
ATOM   9116  C CB  . GLU B 1 438 ? 34.209  19.174  7.899   1.00 60.74  ? 460  GLU B CB  1 
ATOM   9117  C CG  . GLU B 1 438 ? 33.921  17.677  7.709   1.00 58.34  ? 460  GLU B CG  1 
ATOM   9118  C CD  . GLU B 1 438 ? 32.915  17.419  6.585   1.00 58.75  ? 460  GLU B CD  1 
ATOM   9119  O OE1 . GLU B 1 438 ? 32.262  18.387  6.142   1.00 58.26  ? 460  GLU B OE1 1 
ATOM   9120  O OE2 . GLU B 1 438 ? 32.768  16.255  6.145   1.00 58.60  ? 460  GLU B OE2 1 
ATOM   9121  N N   . PHE B 1 439 ? 37.449  19.248  8.468   1.00 56.40  ? 461  PHE B N   1 
ATOM   9122  C CA  . PHE B 1 439 ? 38.635  18.443  8.224   1.00 54.48  ? 461  PHE B CA  1 
ATOM   9123  C C   . PHE B 1 439 ? 39.817  19.010  8.956   1.00 55.61  ? 461  PHE B C   1 
ATOM   9124  O O   . PHE B 1 439 ? 40.110  20.199  8.847   1.00 58.09  ? 461  PHE B O   1 
ATOM   9125  C CB  . PHE B 1 439 ? 38.929  18.359  6.728   1.00 53.80  ? 461  PHE B CB  1 
ATOM   9126  C CG  . PHE B 1 439 ? 37.787  17.810  5.927   1.00 53.26  ? 461  PHE B CG  1 
ATOM   9127  C CD1 . PHE B 1 439 ? 36.789  18.648  5.461   1.00 52.58  ? 461  PHE B CD1 1 
ATOM   9128  C CD2 . PHE B 1 439 ? 37.699  16.453  5.661   1.00 53.44  ? 461  PHE B CD2 1 
ATOM   9129  C CE1 . PHE B 1 439 ? 35.724  18.145  4.730   1.00 55.11  ? 461  PHE B CE1 1 
ATOM   9130  C CE2 . PHE B 1 439 ? 36.641  15.942  4.932   1.00 54.56  ? 461  PHE B CE2 1 
ATOM   9131  C CZ  . PHE B 1 439 ? 35.650  16.792  4.463   1.00 54.82  ? 461  PHE B CZ  1 
ATOM   9132  N N   . ASP B 1 440 ? 40.491  18.156  9.713   1.00 52.64  ? 462  ASP B N   1 
ATOM   9133  C CA  . ASP B 1 440 ? 41.670  18.585  10.434  1.00 52.62  ? 462  ASP B CA  1 
ATOM   9134  C C   . ASP B 1 440 ? 42.707  19.000  9.407   1.00 48.62  ? 462  ASP B C   1 
ATOM   9135  O O   . ASP B 1 440 ? 43.154  18.171  8.612   1.00 46.19  ? 462  ASP B O   1 
ATOM   9136  C CB  . ASP B 1 440 ? 42.195  17.448  11.314  1.00 53.98  ? 462  ASP B CB  1 
ATOM   9137  C CG  . ASP B 1 440 ? 43.469  17.812  12.045  1.00 57.32  ? 462  ASP B CG  1 
ATOM   9138  O OD1 . ASP B 1 440 ? 43.848  18.999  12.050  1.00 55.64  ? 462  ASP B OD1 1 
ATOM   9139  O OD2 . ASP B 1 440 ? 44.093  16.904  12.630  1.00 63.94  ? 462  ASP B OD2 1 
ATOM   9140  N N   . PRO B 1 441 ? 43.082  20.290  9.416   1.00 50.61  ? 463  PRO B N   1 
ATOM   9141  C CA  . PRO B 1 441 ? 44.072  20.822  8.467   1.00 52.31  ? 463  PRO B CA  1 
ATOM   9142  C C   . PRO B 1 441 ? 45.461  20.240  8.685   1.00 52.76  ? 463  PRO B C   1 
ATOM   9143  O O   . PRO B 1 441 ? 46.291  20.325  7.790   1.00 55.75  ? 463  PRO B O   1 
ATOM   9144  C CB  . PRO B 1 441 ? 44.077  22.326  8.761   1.00 52.04  ? 463  PRO B CB  1 
ATOM   9145  C CG  . PRO B 1 441 ? 43.527  22.448  10.144  1.00 52.68  ? 463  PRO B CG  1 
ATOM   9146  C CD  . PRO B 1 441 ? 42.555  21.336  10.309  1.00 50.36  ? 463  PRO B CD  1 
ATOM   9147  N N   . HIS B 1 442 ? 45.705  19.660  9.857   1.00 51.30  ? 464  HIS B N   1 
ATOM   9148  C CA  . HIS B 1 442 ? 46.997  19.042  10.162  1.00 48.05  ? 464  HIS B CA  1 
ATOM   9149  C C   . HIS B 1 442 ? 47.018  17.528  9.914   1.00 44.32  ? 464  HIS B C   1 
ATOM   9150  O O   . HIS B 1 442 ? 48.006  16.859  10.194  1.00 45.75  ? 464  HIS B O   1 
ATOM   9151  C CB  . HIS B 1 442 ? 47.424  19.373  11.600  1.00 45.74  ? 464  HIS B CB  1 
ATOM   9152  C CG  . HIS B 1 442 ? 47.598  20.837  11.844  1.00 44.21  ? 464  HIS B CG  1 
ATOM   9153  N ND1 . HIS B 1 442 ? 48.727  21.525  11.448  1.00 45.44  ? 464  HIS B ND1 1 
ATOM   9154  C CD2 . HIS B 1 442 ? 46.779  21.754  12.412  1.00 44.61  ? 464  HIS B CD2 1 
ATOM   9155  C CE1 . HIS B 1 442 ? 48.601  22.798  11.774  1.00 46.30  ? 464  HIS B CE1 1 
ATOM   9156  N NE2 . HIS B 1 442 ? 47.429  22.965  12.361  1.00 46.84  ? 464  HIS B NE2 1 
ATOM   9157  N N   . SER B 1 443 ? 45.926  16.995  9.388   1.00 43.09  ? 465  SER B N   1 
ATOM   9158  C CA  . SER B 1 443 ? 45.832  15.565  9.134   1.00 47.75  ? 465  SER B CA  1 
ATOM   9159  C C   . SER B 1 443 ? 45.760  15.281  7.635   1.00 48.36  ? 465  SER B C   1 
ATOM   9160  O O   . SER B 1 443 ? 45.382  16.155  6.854   1.00 47.19  ? 465  SER B O   1 
ATOM   9161  C CB  . SER B 1 443 ? 44.595  14.995  9.830   1.00 52.70  ? 465  SER B CB  1 
ATOM   9162  O OG  . SER B 1 443 ? 44.118  13.848  9.151   1.00 57.58  ? 465  SER B OG  1 
ATOM   9163  N N   . ASN B 1 444 ? 46.155  14.068  7.245   1.00 48.20  ? 466  ASN B N   1 
ATOM   9164  C CA  . ASN B 1 444 ? 45.979  13.595  5.876   1.00 47.41  ? 466  ASN B CA  1 
ATOM   9165  C C   . ASN B 1 444 ? 44.525  13.675  5.489   1.00 47.34  ? 466  ASN B C   1 
ATOM   9166  O O   . ASN B 1 444 ? 43.654  13.164  6.191   1.00 51.26  ? 466  ASN B O   1 
ATOM   9167  C CB  . ASN B 1 444 ? 46.442  12.146  5.735   1.00 48.91  ? 466  ASN B CB  1 
ATOM   9168  C CG  . ASN B 1 444 ? 46.732  11.752  4.284   1.00 48.68  ? 466  ASN B CG  1 
ATOM   9169  O OD1 . ASN B 1 444 ? 45.835  11.715  3.433   1.00 48.03  ? 466  ASN B OD1 1 
ATOM   9170  N ND2 . ASN B 1 444 ? 47.995  11.435  4.007   1.00 46.77  ? 466  ASN B ND2 1 
ATOM   9171  N N   . PHE B 1 445 ? 44.271  14.324  4.362   1.00 47.30  ? 467  PHE B N   1 
ATOM   9172  C CA  . PHE B 1 445 ? 42.924  14.558  3.872   1.00 45.59  ? 467  PHE B CA  1 
ATOM   9173  C C   . PHE B 1 445 ? 42.314  13.336  3.186   1.00 45.75  ? 467  PHE B C   1 
ATOM   9174  O O   . PHE B 1 445 ? 41.099  13.143  3.211   1.00 42.13  ? 467  PHE B O   1 
ATOM   9175  C CB  . PHE B 1 445 ? 42.963  15.730  2.891   1.00 45.14  ? 467  PHE B CB  1 
ATOM   9176  C CG  . PHE B 1 445 ? 41.622  16.147  2.376   1.00 44.63  ? 467  PHE B CG  1 
ATOM   9177  C CD1 . PHE B 1 445 ? 40.717  16.789  3.205   1.00 46.31  ? 467  PHE B CD1 1 
ATOM   9178  C CD2 . PHE B 1 445 ? 41.278  15.931  1.053   1.00 45.28  ? 467  PHE B CD2 1 
ATOM   9179  C CE1 . PHE B 1 445 ? 39.480  17.196  2.731   1.00 47.81  ? 467  PHE B CE1 1 
ATOM   9180  C CE2 . PHE B 1 445 ? 40.044  16.338  0.566   1.00 48.48  ? 467  PHE B CE2 1 
ATOM   9181  C CZ  . PHE B 1 445 ? 39.140  16.972  1.413   1.00 47.50  ? 467  PHE B CZ  1 
ATOM   9182  N N   . TYR B 1 446 ? 43.145  12.553  2.508   1.00 47.71  ? 468  TYR B N   1 
ATOM   9183  C CA  . TYR B 1 446 ? 42.630  11.425  1.728   1.00 48.93  ? 468  TYR B CA  1 
ATOM   9184  C C   . TYR B 1 446 ? 42.411  10.092  2.458   1.00 55.90  ? 468  TYR B C   1 
ATOM   9185  O O   . TYR B 1 446 ? 41.450  9.376   2.165   1.00 56.71  ? 468  TYR B O   1 
ATOM   9186  C CB  . TYR B 1 446 ? 43.358  11.298  0.384   1.00 43.30  ? 468  TYR B CB  1 
ATOM   9187  C CG  . TYR B 1 446 ? 43.101  12.533  -0.455  1.00 39.89  ? 468  TYR B CG  1 
ATOM   9188  C CD1 . TYR B 1 446 ? 41.893  12.703  -1.113  1.00 37.14  ? 468  TYR B CD1 1 
ATOM   9189  C CD2 . TYR B 1 446 ? 44.037  13.559  -0.530  1.00 40.49  ? 468  TYR B CD2 1 
ATOM   9190  C CE1 . TYR B 1 446 ? 41.635  13.846  -1.851  1.00 37.18  ? 468  TYR B CE1 1 
ATOM   9191  C CE2 . TYR B 1 446 ? 43.791  14.704  -1.270  1.00 34.07  ? 468  TYR B CE2 1 
ATOM   9192  C CZ  . TYR B 1 446 ? 42.589  14.839  -1.930  1.00 37.87  ? 468  TYR B CZ  1 
ATOM   9193  O OH  . TYR B 1 446 ? 42.334  15.972  -2.673  1.00 41.74  ? 468  TYR B OH  1 
ATOM   9194  N N   . HIS B 1 447 ? 43.288  9.760   3.402   1.00 57.39  ? 469  HIS B N   1 
ATOM   9195  C CA  . HIS B 1 447 ? 43.093  8.542   4.183   1.00 60.24  ? 469  HIS B CA  1 
ATOM   9196  C C   . HIS B 1 447 ? 43.531  8.693   5.631   1.00 63.75  ? 469  HIS B C   1 
ATOM   9197  O O   . HIS B 1 447 ? 44.444  9.460   5.955   1.00 62.65  ? 469  HIS B O   1 
ATOM   9198  C CB  . HIS B 1 447 ? 43.816  7.358   3.551   1.00 62.33  ? 469  HIS B CB  1 
ATOM   9199  C CG  . HIS B 1 447 ? 45.305  7.458   3.621   1.00 65.16  ? 469  HIS B CG  1 
ATOM   9200  N ND1 . HIS B 1 447 ? 46.022  8.388   2.899   1.00 65.62  ? 469  HIS B ND1 1 
ATOM   9201  C CD2 . HIS B 1 447 ? 46.216  6.747   4.330   1.00 66.62  ? 469  HIS B CD2 1 
ATOM   9202  C CE1 . HIS B 1 447 ? 47.309  8.246   3.159   1.00 66.86  ? 469  HIS B CE1 1 
ATOM   9203  N NE2 . HIS B 1 447 ? 47.454  7.259   4.026   1.00 66.65  ? 469  HIS B NE2 1 
ATOM   9204  N N   . PHE B 1 448 ? 42.870  7.939   6.499   1.00 66.60  ? 470  PHE B N   1 
ATOM   9205  C CA  . PHE B 1 448 ? 43.126  8.032   7.928   1.00 69.26  ? 470  PHE B CA  1 
ATOM   9206  C C   . PHE B 1 448 ? 44.485  7.447   8.279   1.00 67.95  ? 470  PHE B C   1 
ATOM   9207  O O   . PHE B 1 448 ? 44.969  6.525   7.618   1.00 64.89  ? 470  PHE B O   1 
ATOM   9208  C CB  . PHE B 1 448 ? 42.006  7.367   8.736   1.00 70.68  ? 470  PHE B CB  1 
ATOM   9209  C CG  . PHE B 1 448 ? 41.864  5.893   8.482   1.00 74.11  ? 470  PHE B CG  1 
ATOM   9210  C CD1 . PHE B 1 448 ? 42.572  4.980   9.232   1.00 74.50  ? 470  PHE B CD1 1 
ATOM   9211  C CD2 . PHE B 1 448 ? 41.022  5.420   7.493   1.00 77.01  ? 470  PHE B CD2 1 
ATOM   9212  C CE1 . PHE B 1 448 ? 42.452  3.627   9.011   1.00 74.17  ? 470  PHE B CE1 1 
ATOM   9213  C CE2 . PHE B 1 448 ? 40.900  4.070   7.266   1.00 76.17  ? 470  PHE B CE2 1 
ATOM   9214  C CZ  . PHE B 1 448 ? 41.622  3.168   8.029   1.00 75.09  ? 470  PHE B CZ  1 
ATOM   9215  N N   . THR B 1 449 ? 45.111  8.018   9.302   1.00 69.41  ? 471  THR B N   1 
ATOM   9216  C CA  . THR B 1 449 ? 46.470  7.635   9.668   1.00 69.56  ? 471  THR B CA  1 
ATOM   9217  C C   . THR B 1 449 ? 46.631  6.644   10.836  1.00 66.79  ? 471  THR B C   1 
ATOM   9218  O O   . THR B 1 449 ? 47.754  6.215   11.114  1.00 65.66  ? 471  THR B O   1 
ATOM   9219  C CB  . THR B 1 449 ? 47.347  8.877   9.918   1.00 70.40  ? 471  THR B CB  1 
ATOM   9220  O OG1 . THR B 1 449 ? 46.669  9.767   10.815  1.00 71.55  ? 471  THR B OG1 1 
ATOM   9221  C CG2 . THR B 1 449 ? 47.637  9.597   8.604   1.00 69.55  ? 471  THR B CG2 1 
ATOM   9222  N N   . ARG B 1 450 ? 45.529  6.267   11.491  1.00 66.96  ? 472  ARG B N   1 
ATOM   9223  C CA  . ARG B 1 450 ? 45.578  5.294   12.599  1.00 67.35  ? 472  ARG B CA  1 
ATOM   9224  C C   . ARG B 1 450 ? 46.055  3.941   12.070  1.00 61.14  ? 472  ARG B C   1 
ATOM   9225  O O   . ARG B 1 450 ? 45.891  3.646   10.885  1.00 57.35  ? 472  ARG B O   1 
ATOM   9226  C CB  . ARG B 1 450 ? 44.197  5.096   13.241  1.00 70.68  ? 472  ARG B CB  1 
ATOM   9227  C CG  . ARG B 1 450 ? 43.194  4.358   12.347  1.00 73.96  ? 472  ARG B CG  1 
ATOM   9228  C CD  . ARG B 1 450 ? 42.182  3.545   13.129  1.00 78.46  ? 472  ARG B CD  1 
ATOM   9229  N NE  . ARG B 1 450 ? 42.079  2.218   12.534  1.00 81.52  ? 472  ARG B NE  1 
ATOM   9230  C CZ  . ARG B 1 450 ? 41.103  1.818   11.725  1.00 82.22  ? 472  ARG B CZ  1 
ATOM   9231  N NH1 . ARG B 1 450 ? 40.075  2.617   11.440  1.00 82.96  ? 472  ARG B NH1 1 
ATOM   9232  N NH2 . ARG B 1 450 ? 41.146  0.591   11.219  1.00 80.65  ? 472  ARG B NH2 1 
ATOM   9233  N N   . PRO B 1 451 ? 46.653  3.111   12.944  1.00 58.55  ? 473  PRO B N   1 
ATOM   9234  C CA  . PRO B 1 451 ? 47.005  1.737   12.563  1.00 54.78  ? 473  PRO B CA  1 
ATOM   9235  C C   . PRO B 1 451 ? 45.788  0.991   12.019  1.00 48.46  ? 473  PRO B C   1 
ATOM   9236  O O   . PRO B 1 451 ? 44.675  1.253   12.462  1.00 45.10  ? 473  PRO B O   1 
ATOM   9237  C CB  . PRO B 1 451 ? 47.456  1.118   13.892  1.00 55.15  ? 473  PRO B CB  1 
ATOM   9238  C CG  . PRO B 1 451 ? 47.947  2.270   14.690  1.00 55.69  ? 473  PRO B CG  1 
ATOM   9239  C CD  . PRO B 1 451 ? 47.035  3.405   14.339  1.00 56.95  ? 473  PRO B CD  1 
ATOM   9240  N N   . LEU B 1 452 ? 45.992  0.106   11.049  1.00 46.58  ? 474  LEU B N   1 
ATOM   9241  C CA  . LEU B 1 452 ? 44.886  -0.649  10.472  1.00 45.35  ? 474  LEU B CA  1 
ATOM   9242  C C   . LEU B 1 452 ? 44.362  -1.609  11.521  1.00 42.26  ? 474  LEU B C   1 
ATOM   9243  O O   . LEU B 1 452 ? 43.161  -1.839  11.649  1.00 39.56  ? 474  LEU B O   1 
ATOM   9244  C CB  . LEU B 1 452 ? 45.357  -1.441  9.258   1.00 46.23  ? 474  LEU B CB  1 
ATOM   9245  C CG  . LEU B 1 452 ? 45.728  -0.659  7.998   1.00 45.25  ? 474  LEU B CG  1 
ATOM   9246  C CD1 . LEU B 1 452 ? 46.491  -1.565  7.060   1.00 45.12  ? 474  LEU B CD1 1 
ATOM   9247  C CD2 . LEU B 1 452 ? 44.478  -0.102  7.304   1.00 42.62  ? 474  LEU B CD2 1 
ATOM   9248  N N   . ILE B 1 453 ? 45.293  -2.168  12.271  1.00 41.23  ? 475  ILE B N   1 
ATOM   9249  C CA  . ILE B 1 453 ? 44.978  -3.149  13.276  1.00 41.28  ? 475  ILE B CA  1 
ATOM   9250  C C   . ILE B 1 453 ? 45.445  -2.615  14.616  1.00 42.00  ? 475  ILE B C   1 
ATOM   9251  O O   . ILE B 1 453 ? 46.510  -1.993  14.706  1.00 42.22  ? 475  ILE B O   1 
ATOM   9252  C CB  . ILE B 1 453 ? 45.639  -4.489  12.929  1.00 40.66  ? 475  ILE B CB  1 
ATOM   9253  C CG1 . ILE B 1 453 ? 45.182  -4.898  11.511  1.00 38.99  ? 475  ILE B CG1 1 
ATOM   9254  C CG2 . ILE B 1 453 ? 45.335  -5.530  14.007  1.00 36.62  ? 475  ILE B CG2 1 
ATOM   9255  C CD1 . ILE B 1 453 ? 44.907  -6.363  11.284  1.00 37.47  ? 475  ILE B CD1 1 
ATOM   9256  N N   . LYS B 1 454 ? 44.621  -2.810  15.641  1.00 38.68  ? 476  LYS B N   1 
ATOM   9257  C CA  . LYS B 1 454 ? 44.967  -2.360  16.980  1.00 41.69  ? 476  LYS B CA  1 
ATOM   9258  C C   . LYS B 1 454 ? 46.351  -2.872  17.360  1.00 38.71  ? 476  LYS B C   1 
ATOM   9259  O O   . LYS B 1 454 ? 46.631  -4.063  17.207  1.00 35.21  ? 476  LYS B O   1 
ATOM   9260  C CB  . LYS B 1 454 ? 43.942  -2.853  17.993  1.00 47.90  ? 476  LYS B CB  1 
ATOM   9261  C CG  . LYS B 1 454 ? 43.057  -1.759  18.534  1.00 55.19  ? 476  LYS B CG  1 
ATOM   9262  C CD  . LYS B 1 454 ? 43.163  -1.685  20.047  1.00 59.45  ? 476  LYS B CD  1 
ATOM   9263  C CE  . LYS B 1 454 ? 42.470  -2.873  20.713  1.00 60.38  ? 476  LYS B CE  1 
ATOM   9264  N NZ  . LYS B 1 454 ? 42.361  -2.707  22.200  1.00 57.94  ? 476  LYS B NZ  1 
ATOM   9265  N N   . PRO B 1 455 ? 47.225  -1.966  17.829  1.00 41.40  ? 477  PRO B N   1 
ATOM   9266  C CA  . PRO B 1 455 ? 48.621  -2.309  18.146  1.00 45.50  ? 477  PRO B CA  1 
ATOM   9267  C C   . PRO B 1 455 ? 48.743  -3.408  19.190  1.00 44.73  ? 477  PRO B C   1 
ATOM   9268  O O   . PRO B 1 455 ? 49.647  -4.234  19.106  1.00 46.11  ? 477  PRO B O   1 
ATOM   9269  C CB  . PRO B 1 455 ? 49.192  -0.994  18.681  1.00 44.52  ? 477  PRO B CB  1 
ATOM   9270  C CG  . PRO B 1 455 ? 48.393  0.048   18.003  1.00 43.35  ? 477  PRO B CG  1 
ATOM   9271  C CD  . PRO B 1 455 ? 46.991  -0.513  17.895  1.00 38.97  ? 477  PRO B CD  1 
ATOM   9272  N N   . GLN B 1 456 ? 47.833  -3.432  20.153  1.00 46.24  ? 478  GLN B N   1 
ATOM   9273  C CA  . GLN B 1 456 ? 47.895  -4.449  21.202  1.00 44.13  ? 478  GLN B CA  1 
ATOM   9274  C C   . GLN B 1 456 ? 47.665  -5.836  20.613  1.00 40.05  ? 478  GLN B C   1 
ATOM   9275  O O   . GLN B 1 456 ? 48.194  -6.829  21.116  1.00 30.72  ? 478  GLN B O   1 
ATOM   9276  C CB  . GLN B 1 456 ? 46.880  -4.159  22.305  1.00 45.65  ? 478  GLN B CB  1 
ATOM   9277  C CG  . GLN B 1 456 ? 47.170  -2.905  23.121  1.00 47.24  ? 478  GLN B CG  1 
ATOM   9278  C CD  . GLN B 1 456 ? 46.563  -1.647  22.513  1.00 48.83  ? 478  GLN B CD  1 
ATOM   9279  O OE1 . GLN B 1 456 ? 46.297  -1.582  21.312  1.00 51.02  ? 478  GLN B OE1 1 
ATOM   9280  N NE2 . GLN B 1 456 ? 46.341  -0.641  23.348  1.00 48.00  ? 478  GLN B NE2 1 
ATOM   9281  N N   . CYS B 1 457 ? 46.862  -5.889  19.548  1.00 35.87  ? 479  CYS B N   1 
ATOM   9282  C CA  . CYS B 1 457 ? 46.581  -7.137  18.846  1.00 35.50  ? 479  CYS B CA  1 
ATOM   9283  C C   . CYS B 1 457 ? 47.732  -7.532  17.911  1.00 41.24  ? 479  CYS B C   1 
ATOM   9284  O O   . CYS B 1 457 ? 48.172  -8.679  17.920  1.00 42.90  ? 479  CYS B O   1 
ATOM   9285  C CB  . CYS B 1 457 ? 45.266  -7.014  18.071  1.00 33.54  ? 479  CYS B CB  1 
ATOM   9286  S SG  . CYS B 1 457 ? 44.560  -8.566  17.445  1.00 43.34  ? 479  CYS B SG  1 
ATOM   9287  N N   . ALA B 1 458 ? 48.219  -6.569  17.124  1.00 43.40  ? 480  ALA B N   1 
ATOM   9288  C CA  . ALA B 1 458 ? 49.315  -6.793  16.168  1.00 45.37  ? 480  ALA B CA  1 
ATOM   9289  C C   . ALA B 1 458 ? 50.633  -7.252  16.799  1.00 45.87  ? 480  ALA B C   1 
ATOM   9290  O O   . ALA B 1 458 ? 51.376  -8.017  16.182  1.00 47.69  ? 480  ALA B O   1 
ATOM   9291  C CB  . ALA B 1 458 ? 49.558  -5.537  15.327  1.00 41.32  ? 480  ALA B CB  1 
ATOM   9292  N N   . ALA B 1 459 ? 50.923  -6.780  18.011  1.00 43.78  ? 481  ALA B N   1 
ATOM   9293  C CA  . ALA B 1 459 ? 52.179  -7.119  18.692  1.00 44.95  ? 481  ALA B CA  1 
ATOM   9294  C C   . ALA B 1 459 ? 52.329  -8.616  18.912  1.00 47.55  ? 481  ALA B C   1 
ATOM   9295  O O   . ALA B 1 459 ? 53.437  -9.127  19.011  1.00 52.15  ? 481  ALA B O   1 
ATOM   9296  C CB  . ALA B 1 459 ? 52.302  -6.373  20.036  1.00 33.83  ? 481  ALA B CB  1 
ATOM   9297  N N   . TYR B 1 460 ? 51.209  -9.321  18.999  1.00 45.85  ? 482  TYR B N   1 
ATOM   9298  C CA  . TYR B 1 460 ? 51.254  -10.765 19.189  1.00 41.30  ? 482  TYR B CA  1 
ATOM   9299  C C   . TYR B 1 460 ? 51.774  -11.503 17.957  1.00 37.82  ? 482  TYR B C   1 
ATOM   9300  O O   . TYR B 1 460 ? 52.299  -12.595 18.072  1.00 37.93  ? 482  TYR B O   1 
ATOM   9301  C CB  . TYR B 1 460 ? 49.872  -11.304 19.585  1.00 37.58  ? 482  TYR B CB  1 
ATOM   9302  C CG  . TYR B 1 460 ? 49.568  -11.114 21.045  1.00 40.64  ? 482  TYR B CG  1 
ATOM   9303  C CD1 . TYR B 1 460 ? 50.265  -11.836 22.008  1.00 39.38  ? 482  TYR B CD1 1 
ATOM   9304  C CD2 . TYR B 1 460 ? 48.594  -10.201 21.472  1.00 39.72  ? 482  TYR B CD2 1 
ATOM   9305  C CE1 . TYR B 1 460 ? 50.002  -11.674 23.355  1.00 41.42  ? 482  TYR B CE1 1 
ATOM   9306  C CE2 . TYR B 1 460 ? 48.324  -10.029 22.826  1.00 38.89  ? 482  TYR B CE2 1 
ATOM   9307  C CZ  . TYR B 1 460 ? 49.038  -10.774 23.763  1.00 39.89  ? 482  TYR B CZ  1 
ATOM   9308  O OH  . TYR B 1 460 ? 48.800  -10.630 25.107  1.00 39.19  ? 482  TYR B OH  1 
ATOM   9309  N N   . GLY B 1 461 ? 51.589  -10.936 16.770  1.00 37.45  ? 483  GLY B N   1 
ATOM   9310  C CA  . GLY B 1 461 ? 52.035  -11.634 15.580  1.00 38.47  ? 483  GLY B CA  1 
ATOM   9311  C C   . GLY B 1 461 ? 51.209  -11.354 14.347  1.00 40.16  ? 483  GLY B C   1 
ATOM   9312  O O   . GLY B 1 461 ? 50.600  -10.288 14.215  1.00 38.50  ? 483  GLY B O   1 
ATOM   9313  N N   . LYS B 1 462 ? 51.213  -12.325 13.433  1.00 41.22  ? 484  LYS B N   1 
ATOM   9314  C CA  . LYS B 1 462 ? 50.467  -12.229 12.183  1.00 40.04  ? 484  LYS B CA  1 
ATOM   9315  C C   . LYS B 1 462 ? 48.976  -11.970 12.438  1.00 39.46  ? 484  LYS B C   1 
ATOM   9316  O O   . LYS B 1 462 ? 48.298  -12.735 13.143  1.00 36.24  ? 484  LYS B O   1 
ATOM   9317  C CB  . LYS B 1 462 ? 50.670  -13.499 11.343  1.00 39.37  ? 484  LYS B CB  1 
ATOM   9318  C CG  . LYS B 1 462 ? 52.122  -13.723 10.877  1.00 44.96  ? 484  LYS B CG  1 
ATOM   9319  C CD  . LYS B 1 462 ? 52.243  -14.998 10.046  1.00 50.50  ? 484  LYS B CD  1 
ATOM   9320  C CE  . LYS B 1 462 ? 53.673  -15.280 9.587   1.00 54.14  ? 484  LYS B CE  1 
ATOM   9321  N NZ  . LYS B 1 462 ? 54.193  -14.189 8.724   1.00 59.68  ? 484  LYS B NZ  1 
ATOM   9322  N N   . ALA B 1 463 ? 48.478  -10.890 11.843  1.00 40.37  ? 485  ALA B N   1 
ATOM   9323  C CA  . ALA B 1 463 ? 47.116  -10.434 12.084  1.00 37.53  ? 485  ALA B CA  1 
ATOM   9324  C C   . ALA B 1 463 ? 46.247  -10.594 10.859  1.00 35.60  ? 485  ALA B C   1 
ATOM   9325  O O   . ALA B 1 463 ? 46.637  -10.222 9.747   1.00 35.92  ? 485  ALA B O   1 
ATOM   9326  C CB  . ALA B 1 463 ? 47.110  -8.977  12.541  1.00 37.45  ? 485  ALA B CB  1 
ATOM   9327  N N   . LEU B 1 464 ? 45.068  -11.158 11.077  1.00 35.20  ? 486  LEU B N   1 
ATOM   9328  C CA  . LEU B 1 464 ? 44.036  -11.247 10.052  1.00 35.00  ? 486  LEU B CA  1 
ATOM   9329  C C   . LEU B 1 464 ? 42.791  -10.511 10.550  1.00 33.55  ? 486  LEU B C   1 
ATOM   9330  O O   . LEU B 1 464 ? 42.226  -10.858 11.596  1.00 32.21  ? 486  LEU B O   1 
ATOM   9331  C CB  . LEU B 1 464 ? 43.724  -12.716 9.747   1.00 35.19  ? 486  LEU B CB  1 
ATOM   9332  C CG  . LEU B 1 464 ? 42.529  -13.074 8.860   1.00 34.34  ? 486  LEU B CG  1 
ATOM   9333  C CD1 . LEU B 1 464 ? 42.716  -12.547 7.437   1.00 27.96  ? 486  LEU B CD1 1 
ATOM   9334  C CD2 . LEU B 1 464 ? 42.320  -14.585 8.842   1.00 35.90  ? 486  LEU B CD2 1 
ATOM   9335  N N   . ASP B 1 465 ? 42.386  -9.474  9.824   1.00 35.91  ? 487  ASP B N   1 
ATOM   9336  C CA  . ASP B 1 465 ? 41.200  -8.715  10.189  1.00 36.11  ? 487  ASP B CA  1 
ATOM   9337  C C   . ASP B 1 465 ? 40.079  -8.990  9.196   1.00 35.00  ? 487  ASP B C   1 
ATOM   9338  O O   . ASP B 1 465 ? 40.095  -8.500  8.076   1.00 30.04  ? 487  ASP B O   1 
ATOM   9339  C CB  . ASP B 1 465 ? 41.509  -7.216  10.210  1.00 37.07  ? 487  ASP B CB  1 
ATOM   9340  C CG  . ASP B 1 465 ? 40.347  -6.380  10.739  1.00 40.45  ? 487  ASP B CG  1 
ATOM   9341  O OD1 . ASP B 1 465 ? 39.164  -6.758  10.556  1.00 36.00  ? 487  ASP B OD1 1 
ATOM   9342  O OD2 . ASP B 1 465 ? 40.623  -5.330  11.351  1.00 46.77  ? 487  ASP B OD2 1 
ATOM   9343  N N   . LEU B 1 466 ? 39.105  -9.769  9.648   1.00 36.42  ? 488  LEU B N   1 
ATOM   9344  C CA  . LEU B 1 466 ? 37.887  -10.101 8.908   1.00 30.62  ? 488  LEU B CA  1 
ATOM   9345  C C   . LEU B 1 466 ? 36.659  -9.282  9.324   1.00 33.23  ? 488  LEU B C   1 
ATOM   9346  O O   . LEU B 1 466 ? 35.530  -9.643  8.999   1.00 32.81  ? 488  LEU B O   1 
ATOM   9347  C CB  . LEU B 1 466 ? 37.623  -11.605 8.961   1.00 28.74  ? 488  LEU B CB  1 
ATOM   9348  C CG  . LEU B 1 466 ? 38.596  -12.355 8.044   1.00 27.53  ? 488  LEU B CG  1 
ATOM   9349  C CD1 . LEU B 1 466 ? 38.549  -13.831 8.272   1.00 27.30  ? 488  LEU B CD1 1 
ATOM   9350  C CD2 . LEU B 1 466 ? 38.237  -12.043 6.599   1.00 33.56  ? 488  LEU B CD2 1 
ATOM   9351  N N   . SER B 1 467 ? 36.876  -8.244  10.127  1.00 33.19  ? 489  SER B N   1 
ATOM   9352  C CA  . SER B 1 467 ? 35.779  -7.446  10.667  1.00 30.58  ? 489  SER B CA  1 
ATOM   9353  C C   . SER B 1 467 ? 34.849  -6.809  9.628   1.00 30.52  ? 489  SER B C   1 
ATOM   9354  O O   . SER B 1 467 ? 35.255  -6.509  8.500   1.00 34.19  ? 489  SER B O   1 
ATOM   9355  C CB  . SER B 1 467 ? 36.300  -6.366  11.630  1.00 32.64  ? 489  SER B CB  1 
ATOM   9356  O OG  . SER B 1 467 ? 37.089  -5.394  10.967  1.00 32.23  ? 489  SER B OG  1 
ATOM   9357  N N   . LEU B 1 468 ? 33.597  -6.616  10.031  1.00 28.10  ? 490  LEU B N   1 
ATOM   9358  C CA  . LEU B 1 468 ? 32.590  -5.951  9.205   1.00 29.61  ? 490  LEU B CA  1 
ATOM   9359  C C   . LEU B 1 468 ? 32.442  -6.693  7.884   1.00 34.12  ? 490  LEU B C   1 
ATOM   9360  O O   . LEU B 1 468 ? 32.551  -6.125  6.801   1.00 33.28  ? 490  LEU B O   1 
ATOM   9361  C CB  . LEU B 1 468 ? 32.938  -4.476  8.994   1.00 24.02  ? 490  LEU B CB  1 
ATOM   9362  C CG  . LEU B 1 468 ? 32.969  -3.636  10.280  1.00 28.34  ? 490  LEU B CG  1 
ATOM   9363  C CD1 . LEU B 1 468 ? 33.840  -2.400  10.102  1.00 27.34  ? 490  LEU B CD1 1 
ATOM   9364  C CD2 . LEU B 1 468 ? 31.538  -3.237  10.682  1.00 26.89  ? 490  LEU B CD2 1 
ATOM   9365  N N   . ASN B 1 469 ? 32.230  -7.992  8.016   1.00 34.43  ? 491  ASN B N   1 
ATOM   9366  C CA  . ASN B 1 469 ? 31.949  -8.868  6.905   1.00 33.90  ? 491  ASN B CA  1 
ATOM   9367  C C   . ASN B 1 469 ? 30.701  -9.676  7.216   1.00 34.92  ? 491  ASN B C   1 
ATOM   9368  O O   . ASN B 1 469 ? 29.966  -9.357  8.143   1.00 34.71  ? 491  ASN B O   1 
ATOM   9369  C CB  . ASN B 1 469 ? 33.142  -9.776  6.633   1.00 33.97  ? 491  ASN B CB  1 
ATOM   9370  C CG  . ASN B 1 469 ? 34.196  -9.088  5.798   1.00 37.11  ? 491  ASN B CG  1 
ATOM   9371  O OD1 . ASN B 1 469 ? 34.093  -9.043  4.568   1.00 38.28  ? 491  ASN B OD1 1 
ATOM   9372  N ND2 . ASN B 1 469 ? 35.198  -8.516  6.457   1.00 32.09  ? 491  ASN B ND2 1 
ATOM   9373  N N   . SER B 1 470 ? 30.431  -10.660 6.372   1.00 33.73  ? 492  SER B N   1 
ATOM   9374  C CA  . SER B 1 470 ? 29.309  -11.589 6.509   1.00 32.65  ? 492  SER B CA  1 
ATOM   9375  C C   . SER B 1 470 ? 29.533  -13.007 7.049   1.00 32.94  ? 492  SER B C   1 
ATOM   9376  O O   . SER B 1 470 ? 28.755  -13.897 6.700   1.00 31.06  ? 492  SER B O   1 
ATOM   9377  C CB  . SER B 1 470 ? 28.398  -11.591 5.281   1.00 35.47  ? 492  SER B CB  1 
ATOM   9378  O OG  . SER B 1 470 ? 27.427  -10.570 5.427   1.00 38.40  ? 492  SER B OG  1 
ATOM   9379  N N   . ILE B 1 471 ? 30.621  -13.295 7.755   1.00 35.21  ? 493  ILE B N   1 
ATOM   9380  C CA  . ILE B 1 471 ? 30.822  -14.702 8.076   1.00 38.47  ? 493  ILE B CA  1 
ATOM   9381  C C   . ILE B 1 471 ? 29.994  -14.991 9.329   1.00 37.09  ? 493  ILE B C   1 
ATOM   9382  O O   . ILE B 1 471 ? 30.477  -14.869 10.460  1.00 33.59  ? 493  ILE B O   1 
ATOM   9383  C CB  . ILE B 1 471 ? 32.319  -14.944 8.398   1.00 43.45  ? 493  ILE B CB  1 
ATOM   9384  C CG1 . ILE B 1 471 ? 33.209  -14.369 7.282   1.00 45.01  ? 493  ILE B CG1 1 
ATOM   9385  C CG2 . ILE B 1 471 ? 32.613  -16.420 8.644   1.00 41.47  ? 493  ILE B CG2 1 
ATOM   9386  C CD1 . ILE B 1 471 ? 34.728  -14.574 7.517   1.00 26.11  ? 493  ILE B CD1 1 
ATOM   9387  N N   . PHE B 1 472 ? 28.776  -15.498 9.103   1.00 37.21  ? 494  PHE B N   1 
ATOM   9388  C CA  . PHE B 1 472 ? 27.759  -15.586 10.169  1.00 36.62  ? 494  PHE B CA  1 
ATOM   9389  C C   . PHE B 1 472 ? 27.796  -16.945 10.824  1.00 33.81  ? 494  PHE B C   1 
ATOM   9390  O O   . PHE B 1 472 ? 27.189  -17.164 11.873  1.00 35.00  ? 494  PHE B O   1 
ATOM   9391  C CB  . PHE B 1 472 ? 26.333  -15.279 9.640   1.00 27.37  ? 494  PHE B CB  1 
ATOM   9392  C CG  . PHE B 1 472 ? 25.904  -16.153 8.486   1.00 28.75  ? 494  PHE B CG  1 
ATOM   9393  C CD1 . PHE B 1 472 ? 25.394  -17.427 8.705   1.00 27.25  ? 494  PHE B CD1 1 
ATOM   9394  C CD2 . PHE B 1 472 ? 26.013  -15.695 7.171   1.00 34.43  ? 494  PHE B CD2 1 
ATOM   9395  C CE1 . PHE B 1 472 ? 24.995  -18.243 7.631   1.00 31.16  ? 494  PHE B CE1 1 
ATOM   9396  C CE2 . PHE B 1 472 ? 25.622  -16.502 6.089   1.00 36.28  ? 494  PHE B CE2 1 
ATOM   9397  C CZ  . PHE B 1 472 ? 25.116  -17.780 6.321   1.00 35.25  ? 494  PHE B CZ  1 
ATOM   9398  N N   . PHE B 1 473 ? 28.514  -17.858 10.185  1.00 35.73  ? 495  PHE B N   1 
ATOM   9399  C CA  . PHE B 1 473 ? 28.715  -19.190 10.710  1.00 36.02  ? 495  PHE B CA  1 
ATOM   9400  C C   . PHE B 1 473 ? 30.138  -19.607 10.396  1.00 39.32  ? 495  PHE B C   1 
ATOM   9401  O O   . PHE B 1 473 ? 30.552  -19.574 9.236   1.00 41.25  ? 495  PHE B O   1 
ATOM   9402  C CB  . PHE B 1 473 ? 27.730  -20.177 10.067  1.00 33.35  ? 495  PHE B CB  1 
ATOM   9403  C CG  . PHE B 1 473 ? 27.840  -21.570 10.610  1.00 36.82  ? 495  PHE B CG  1 
ATOM   9404  C CD1 . PHE B 1 473 ? 27.219  -21.914 11.804  1.00 39.81  ? 495  PHE B CD1 1 
ATOM   9405  C CD2 . PHE B 1 473 ? 28.575  -22.536 9.937   1.00 39.45  ? 495  PHE B CD2 1 
ATOM   9406  C CE1 . PHE B 1 473 ? 27.322  -23.199 12.315  1.00 41.27  ? 495  PHE B CE1 1 
ATOM   9407  C CE2 . PHE B 1 473 ? 28.689  -23.821 10.446  1.00 39.63  ? 495  PHE B CE2 1 
ATOM   9408  C CZ  . PHE B 1 473 ? 28.067  -24.151 11.635  1.00 41.26  ? 495  PHE B CZ  1 
ATOM   9409  N N   . ILE B 1 474 ? 30.890  -20.024 11.409  1.00 37.33  ? 496  ILE B N   1 
ATOM   9410  C CA  . ILE B 1 474 ? 32.227  -20.538 11.141  1.00 37.13  ? 496  ILE B CA  1 
ATOM   9411  C C   . ILE B 1 474 ? 32.163  -22.046 10.956  1.00 37.59  ? 496  ILE B C   1 
ATOM   9412  O O   . ILE B 1 474 ? 31.873  -22.783 11.894  1.00 36.38  ? 496  ILE B O   1 
ATOM   9413  C CB  . ILE B 1 474 ? 33.224  -20.203 12.265  1.00 34.37  ? 496  ILE B CB  1 
ATOM   9414  C CG1 . ILE B 1 474 ? 33.320  -18.684 12.435  1.00 32.28  ? 496  ILE B CG1 1 
ATOM   9415  C CG2 . ILE B 1 474 ? 34.590  -20.822 11.947  1.00 30.80  ? 496  ILE B CG2 1 
ATOM   9416  C CD1 . ILE B 1 474 ? 34.043  -18.249 13.683  1.00 32.94  ? 496  ILE B CD1 1 
ATOM   9417  N N   . GLY B 1 475 ? 32.415  -22.490 9.730   1.00 40.87  ? 497  GLY B N   1 
ATOM   9418  C CA  . GLY B 1 475 ? 32.385  -23.902 9.406   1.00 43.83  ? 497  GLY B CA  1 
ATOM   9419  C C   . GLY B 1 475 ? 33.755  -24.531 9.568   1.00 46.61  ? 497  GLY B C   1 
ATOM   9420  O O   . GLY B 1 475 ? 34.759  -23.827 9.647   1.00 46.44  ? 497  GLY B O   1 
ATOM   9421  N N   . PRO B 1 476 ? 33.803  -25.868 9.592   1.00 50.41  ? 498  PRO B N   1 
ATOM   9422  C CA  . PRO B 1 476 ? 35.018  -26.613 9.954   1.00 53.07  ? 498  PRO B CA  1 
ATOM   9423  C C   . PRO B 1 476 ? 36.235  -26.309 9.076   1.00 51.72  ? 498  PRO B C   1 
ATOM   9424  O O   . PRO B 1 476 ? 37.359  -26.509 9.530   1.00 47.35  ? 498  PRO B O   1 
ATOM   9425  C CB  . PRO B 1 476 ? 34.588  -28.083 9.819   1.00 54.96  ? 498  PRO B CB  1 
ATOM   9426  C CG  . PRO B 1 476 ? 33.353  -28.058 8.953   1.00 54.57  ? 498  PRO B CG  1 
ATOM   9427  C CD  . PRO B 1 476 ? 32.677  -26.759 9.260   1.00 51.88  ? 498  PRO B CD  1 
ATOM   9428  N N   . ASN B 1 477 ? 36.010  -25.870 7.840   1.00 53.40  ? 499  ASN B N   1 
ATOM   9429  C CA  . ASN B 1 477 ? 37.100  -25.541 6.923   1.00 55.34  ? 499  ASN B CA  1 
ATOM   9430  C C   . ASN B 1 477 ? 37.439  -24.058 6.738   1.00 51.44  ? 499  ASN B C   1 
ATOM   9431  O O   . ASN B 1 477 ? 38.346  -23.732 5.968   1.00 48.64  ? 499  ASN B O   1 
ATOM   9432  C CB  . ASN B 1 477 ? 36.858  -26.197 5.563   1.00 60.11  ? 499  ASN B CB  1 
ATOM   9433  C CG  . ASN B 1 477 ? 36.688  -27.695 5.668   1.00 64.04  ? 499  ASN B CG  1 
ATOM   9434  O OD1 . ASN B 1 477 ? 37.497  -28.383 6.294   1.00 65.52  ? 499  ASN B OD1 1 
ATOM   9435  N ND2 . ASN B 1 477 ? 35.620  -28.210 5.070   1.00 65.60  ? 499  ASN B ND2 1 
ATOM   9436  N N   . GLN B 1 478 ? 36.701  -23.173 7.410   1.00 46.75  ? 500  GLN B N   1 
ATOM   9437  C CA  . GLN B 1 478 ? 36.821  -21.725 7.187   1.00 43.23  ? 500  GLN B CA  1 
ATOM   9438  C C   . GLN B 1 478 ? 38.254  -21.191 7.261   1.00 40.16  ? 500  GLN B C   1 
ATOM   9439  O O   . GLN B 1 478 ? 38.664  -20.350 6.467   1.00 39.52  ? 500  GLN B O   1 
ATOM   9440  C CB  . GLN B 1 478 ? 35.954  -20.959 8.195   1.00 43.03  ? 500  GLN B CB  1 
ATOM   9441  C CG  . GLN B 1 478 ? 35.998  -19.432 8.046   1.00 41.98  ? 500  GLN B CG  1 
ATOM   9442  C CD  . GLN B 1 478 ? 35.277  -18.934 6.789   1.00 40.46  ? 500  GLN B CD  1 
ATOM   9443  O OE1 . GLN B 1 478 ? 34.143  -19.323 6.515   1.00 36.92  ? 500  GLN B OE1 1 
ATOM   9444  N NE2 . GLN B 1 478 ? 35.941  -18.074 6.023   1.00 40.60  ? 500  GLN B NE2 1 
ATOM   9445  N N   . PHE B 1 479 ? 38.991  -21.642 8.262   1.00 38.71  ? 501  PHE B N   1 
ATOM   9446  C CA  . PHE B 1 479 ? 40.316  -21.104 8.526   1.00 39.15  ? 501  PHE B CA  1 
ATOM   9447  C C   . PHE B 1 479 ? 41.492  -21.948 8.024   1.00 40.06  ? 501  PHE B C   1 
ATOM   9448  O O   . PHE B 1 479 ? 42.641  -21.689 8.372   1.00 41.97  ? 501  PHE B O   1 
ATOM   9449  C CB  . PHE B 1 479 ? 40.439  -20.665 9.993   1.00 38.19  ? 501  PHE B CB  1 
ATOM   9450  C CG  . PHE B 1 479 ? 39.446  -19.594 10.377  1.00 36.19  ? 501  PHE B CG  1 
ATOM   9451  C CD1 . PHE B 1 479 ? 39.438  -18.371 9.720   1.00 33.86  ? 501  PHE B CD1 1 
ATOM   9452  C CD2 . PHE B 1 479 ? 38.517  -19.813 11.389  1.00 37.82  ? 501  PHE B CD2 1 
ATOM   9453  C CE1 . PHE B 1 479 ? 38.520  -17.373 10.060  1.00 33.21  ? 501  PHE B CE1 1 
ATOM   9454  C CE2 . PHE B 1 479 ? 37.599  -18.823 11.741  1.00 36.14  ? 501  PHE B CE2 1 
ATOM   9455  C CZ  . PHE B 1 479 ? 37.597  -17.601 11.070  1.00 36.75  ? 501  PHE B CZ  1 
ATOM   9456  N N   . GLU B 1 480 ? 41.192  -22.996 7.264   1.00 40.61  ? 502  GLU B N   1 
ATOM   9457  C CA  . GLU B 1 480 ? 42.224  -23.874 6.745   1.00 47.84  ? 502  GLU B CA  1 
ATOM   9458  C C   . GLU B 1 480 ? 43.201  -23.144 5.805   1.00 53.09  ? 502  GLU B C   1 
ATOM   9459  O O   . GLU B 1 480 ? 42.856  -22.124 5.192   1.00 54.13  ? 502  GLU B O   1 
ATOM   9460  C CB  . GLU B 1 480 ? 41.596  -25.077 6.040   1.00 56.69  ? 502  GLU B CB  1 
ATOM   9461  C CG  . GLU B 1 480 ? 41.013  -24.764 4.670   1.00 66.21  ? 502  GLU B CG  1 
ATOM   9462  C CD  . GLU B 1 480 ? 40.613  -26.015 3.909   1.00 72.05  ? 502  GLU B CD  1 
ATOM   9463  O OE1 . GLU B 1 480 ? 40.810  -27.132 4.441   1.00 74.54  ? 502  GLU B OE1 1 
ATOM   9464  O OE2 . GLU B 1 480 ? 40.103  -25.879 2.777   1.00 73.46  ? 502  GLU B OE2 1 
ATOM   9465  N N   . ASN B 1 481 ? 44.424  -23.667 5.730   1.00 52.89  ? 503  ASN B N   1 
ATOM   9466  C CA  . ASN B 1 481 ? 45.479  -23.150 4.850   1.00 56.85  ? 503  ASN B CA  1 
ATOM   9467  C C   . ASN B 1 481 ? 45.907  -21.713 5.138   1.00 52.32  ? 503  ASN B C   1 
ATOM   9468  O O   . ASN B 1 481 ? 46.434  -21.024 4.262   1.00 49.56  ? 503  ASN B O   1 
ATOM   9469  C CB  . ASN B 1 481 ? 45.083  -23.276 3.373   1.00 61.91  ? 503  ASN B CB  1 
ATOM   9470  C CG  . ASN B 1 481 ? 44.640  -24.676 3.000   1.00 65.11  ? 503  ASN B CG  1 
ATOM   9471  O OD1 . ASN B 1 481 ? 43.593  -24.859 2.374   1.00 68.31  ? 503  ASN B OD1 1 
ATOM   9472  N ND2 . ASN B 1 481 ? 45.432  -25.671 3.380   1.00 64.21  ? 503  ASN B ND2 1 
ATOM   9473  N N   . LEU B 1 482 ? 45.686  -21.266 6.366   1.00 51.44  ? 504  LEU B N   1 
ATOM   9474  C CA  . LEU B 1 482 ? 46.086  -19.930 6.769   1.00 52.51  ? 504  LEU B CA  1 
ATOM   9475  C C   . LEU B 1 482 ? 47.509  -19.936 7.329   1.00 55.63  ? 504  LEU B C   1 
ATOM   9476  O O   . LEU B 1 482 ? 48.011  -20.979 7.763   1.00 57.80  ? 504  LEU B O   1 
ATOM   9477  C CB  . LEU B 1 482 ? 45.100  -19.387 7.803   1.00 55.31  ? 504  LEU B CB  1 
ATOM   9478  C CG  . LEU B 1 482 ? 44.207  -18.206 7.411   1.00 59.37  ? 504  LEU B CG  1 
ATOM   9479  C CD1 . LEU B 1 482 ? 44.137  -18.004 5.907   1.00 60.47  ? 504  LEU B CD1 1 
ATOM   9480  C CD2 . LEU B 1 482 ? 42.809  -18.384 7.991   1.00 60.69  ? 504  LEU B CD2 1 
ATOM   9481  N N   . PRO B 1 483 ? 48.174  -18.769 7.321   1.00 56.13  ? 505  PRO B N   1 
ATOM   9482  C CA  . PRO B 1 483 ? 49.440  -18.646 8.054   1.00 56.26  ? 505  PRO B CA  1 
ATOM   9483  C C   . PRO B 1 483 ? 49.161  -18.803 9.546   1.00 57.57  ? 505  PRO B C   1 
ATOM   9484  O O   . PRO B 1 483 ? 48.000  -18.990 9.922   1.00 57.12  ? 505  PRO B O   1 
ATOM   9485  C CB  . PRO B 1 483 ? 49.883  -17.210 7.752   1.00 55.51  ? 505  PRO B CB  1 
ATOM   9486  C CG  . PRO B 1 483 ? 49.128  -16.814 6.511   1.00 55.69  ? 505  PRO B CG  1 
ATOM   9487  C CD  . PRO B 1 483 ? 47.812  -17.523 6.622   1.00 54.62  ? 505  PRO B CD  1 
ATOM   9488  N N   . ASP B 1 484 ? 50.170  -18.683 10.402  1.00 57.53  ? 506  ASP B N   1 
ATOM   9489  C CA  . ASP B 1 484 ? 49.904  -18.944 11.810  1.00 56.77  ? 506  ASP B CA  1 
ATOM   9490  C C   . ASP B 1 484 ? 49.453  -17.631 12.425  1.00 48.96  ? 506  ASP B C   1 
ATOM   9491  O O   . ASP B 1 484 ? 50.269  -16.797 12.826  1.00 49.39  ? 506  ASP B O   1 
ATOM   9492  C CB  . ASP B 1 484 ? 51.196  -19.425 12.477  1.00 62.22  ? 506  ASP B CB  1 
ATOM   9493  C CG  . ASP B 1 484 ? 51.045  -19.649 13.969  1.00 65.25  ? 506  ASP B CG  1 
ATOM   9494  O OD1 . ASP B 1 484 ? 49.909  -19.869 14.426  1.00 64.87  ? 506  ASP B OD1 1 
ATOM   9495  O OD2 . ASP B 1 484 ? 52.070  -19.618 14.683  1.00 67.56  ? 506  ASP B OD2 1 
ATOM   9496  N N   . ILE B 1 485 ? 48.140  -17.508 12.594  1.00 41.32  ? 507  ILE B N   1 
ATOM   9497  C CA  . ILE B 1 485 ? 47.529  -16.233 12.935  1.00 40.42  ? 507  ILE B CA  1 
ATOM   9498  C C   . ILE B 1 485 ? 47.575  -16.021 14.441  1.00 43.00  ? 507  ILE B C   1 
ATOM   9499  O O   . ILE B 1 485 ? 47.085  -16.844 15.205  1.00 46.18  ? 507  ILE B O   1 
ATOM   9500  C CB  . ILE B 1 485 ? 46.059  -16.156 12.437  1.00 42.98  ? 507  ILE B CB  1 
ATOM   9501  C CG1 . ILE B 1 485 ? 46.008  -16.203 10.904  1.00 41.50  ? 507  ILE B CG1 1 
ATOM   9502  C CG2 . ILE B 1 485 ? 45.382  -14.881 12.933  1.00 29.70  ? 507  ILE B CG2 1 
ATOM   9503  C CD1 . ILE B 1 485 ? 46.791  -15.074 10.216  1.00 38.09  ? 507  ILE B CD1 1 
ATOM   9504  N N   . ALA B 1 486 ? 48.246  -14.959 14.861  1.00 43.43  ? 508  ALA B N   1 
ATOM   9505  C CA  . ALA B 1 486 ? 48.266  -14.555 16.261  1.00 44.83  ? 508  ALA B CA  1 
ATOM   9506  C C   . ALA B 1 486 ? 47.099  -13.648 16.665  1.00 44.56  ? 508  ALA B C   1 
ATOM   9507  O O   . ALA B 1 486 ? 46.602  -13.716 17.791  1.00 47.67  ? 508  ALA B O   1 
ATOM   9508  C CB  . ALA B 1 486 ? 49.590  -13.925 16.610  1.00 32.53  ? 508  ALA B CB  1 
ATOM   9509  N N   . CYS B 1 487 ? 46.705  -12.774 15.746  1.00 44.14  ? 509  CYS B N   1 
ATOM   9510  C CA  . CYS B 1 487 ? 45.721  -11.724 16.010  1.00 39.67  ? 509  CYS B CA  1 
ATOM   9511  C C   . CYS B 1 487 ? 44.603  -11.836 14.982  1.00 40.31  ? 509  CYS B C   1 
ATOM   9512  O O   . CYS B 1 487 ? 44.842  -11.683 13.789  1.00 35.18  ? 509  CYS B O   1 
ATOM   9513  C CB  . CYS B 1 487 ? 46.407  -10.354 15.915  1.00 38.57  ? 509  CYS B CB  1 
ATOM   9514  S SG  . CYS B 1 487 ? 45.357  -8.901  15.604  1.00 40.72  ? 509  CYS B SG  1 
ATOM   9515  N N   . LEU B 1 488 ? 43.391  -12.117 15.455  1.00 38.31  ? 510  LEU B N   1 
ATOM   9516  C CA  . LEU B 1 488 ? 42.249  -12.371 14.590  1.00 35.99  ? 510  LEU B CA  1 
ATOM   9517  C C   . LEU B 1 488 ? 41.072  -11.448 14.925  1.00 37.28  ? 510  LEU B C   1 
ATOM   9518  O O   . LEU B 1 488 ? 40.639  -11.374 16.073  1.00 35.23  ? 510  LEU B O   1 
ATOM   9519  C CB  . LEU B 1 488 ? 41.815  -13.839 14.711  1.00 31.70  ? 510  LEU B CB  1 
ATOM   9520  C CG  . LEU B 1 488 ? 40.583  -14.210 13.891  1.00 30.44  ? 510  LEU B CG  1 
ATOM   9521  C CD1 . LEU B 1 488 ? 40.817  -13.864 12.432  1.00 31.55  ? 510  LEU B CD1 1 
ATOM   9522  C CD2 . LEU B 1 488 ? 40.271  -15.675 14.031  1.00 26.85  ? 510  LEU B CD2 1 
ATOM   9523  N N   . ASN B 1 489 ? 40.557  -10.739 13.922  1.00 32.87  ? 511  ASN B N   1 
ATOM   9524  C CA  . ASN B 1 489 ? 39.432  -9.858  14.155  1.00 32.78  ? 511  ASN B CA  1 
ATOM   9525  C C   . ASN B 1 489 ? 38.199  -10.350 13.405  1.00 33.44  ? 511  ASN B C   1 
ATOM   9526  O O   . ASN B 1 489 ? 38.135  -10.238 12.177  1.00 29.88  ? 511  ASN B O   1 
ATOM   9527  C CB  . ASN B 1 489 ? 39.794  -8.440  13.699  1.00 35.12  ? 511  ASN B CB  1 
ATOM   9528  C CG  . ASN B 1 489 ? 38.866  -7.383  14.273  1.00 35.09  ? 511  ASN B CG  1 
ATOM   9529  O OD1 . ASN B 1 489 ? 37.796  -7.695  14.786  1.00 36.23  ? 511  ASN B OD1 1 
ATOM   9530  N ND2 . ASN B 1 489 ? 39.278  -6.122  14.177  1.00 34.64  ? 511  ASN B ND2 1 
ATOM   9531  N N   . LEU B 1 490 ? 37.251  -10.927 14.149  1.00 32.88  ? 512  LEU B N   1 
ATOM   9532  C CA  . LEU B 1 490 ? 35.937  -11.359 13.632  1.00 33.27  ? 512  LEU B CA  1 
ATOM   9533  C C   . LEU B 1 490 ? 34.760  -10.437 13.961  1.00 31.25  ? 512  LEU B C   1 
ATOM   9534  O O   . LEU B 1 490 ? 33.600  -10.837 13.834  1.00 32.79  ? 512  LEU B O   1 
ATOM   9535  C CB  . LEU B 1 490 ? 35.620  -12.801 14.033  1.00 35.33  ? 512  LEU B CB  1 
ATOM   9536  C CG  . LEU B 1 490 ? 36.496  -13.847 13.351  1.00 34.79  ? 512  LEU B CG  1 
ATOM   9537  C CD1 . LEU B 1 490 ? 36.254  -15.223 13.952  1.00 31.90  ? 512  LEU B CD1 1 
ATOM   9538  C CD2 . LEU B 1 490 ? 36.194  -13.839 11.854  1.00 37.08  ? 512  LEU B CD2 1 
ATOM   9539  N N   . SER B 1 491 ? 35.054  -9.259  14.493  1.00 28.25  ? 513  SER B N   1 
ATOM   9540  C CA  . SER B 1 491 ? 34.020  -8.310  14.883  1.00 29.16  ? 513  SER B CA  1 
ATOM   9541  C C   . SER B 1 491 ? 33.002  -7.995  13.764  1.00 29.66  ? 513  SER B C   1 
ATOM   9542  O O   . SER B 1 491 ? 33.348  -7.953  12.583  1.00 29.43  ? 513  SER B O   1 
ATOM   9543  C CB  . SER B 1 491 ? 34.666  -7.017  15.374  1.00 33.65  ? 513  SER B CB  1 
ATOM   9544  O OG  . SER B 1 491 ? 33.696  -6.010  15.595  1.00 40.83  ? 513  SER B OG  1 
ATOM   9545  N N   . ALA B 1 492 ? 31.749  -7.799  14.163  1.00 29.00  ? 514  ALA B N   1 
ATOM   9546  C CA  . ALA B 1 492 ? 30.655  -7.416  13.261  1.00 32.18  ? 514  ALA B CA  1 
ATOM   9547  C C   . ALA B 1 492 ? 30.490  -8.324  12.044  1.00 35.44  ? 514  ALA B C   1 
ATOM   9548  O O   . ALA B 1 492 ? 30.535  -7.863  10.907  1.00 34.92  ? 514  ALA B O   1 
ATOM   9549  C CB  . ALA B 1 492 ? 30.786  -5.949  12.842  1.00 25.56  ? 514  ALA B CB  1 
ATOM   9550  N N   . ASN B 1 493 ? 30.408  -9.626  12.300  1.00 35.84  ? 515  ASN B N   1 
ATOM   9551  C CA  . ASN B 1 493 ? 30.042  -10.621 11.292  1.00 31.19  ? 515  ASN B CA  1 
ATOM   9552  C C   . ASN B 1 493 ? 28.624  -11.190 11.360  1.00 30.55  ? 515  ASN B C   1 
ATOM   9553  O O   . ASN B 1 493 ? 28.321  -12.168 10.663  1.00 32.59  ? 515  ASN B O   1 
ATOM   9554  C CB  . ASN B 1 493 ? 31.072  -11.741 11.228  1.00 32.45  ? 515  ASN B CB  1 
ATOM   9555  C CG  . ASN B 1 493 ? 32.255  -11.369 10.365  1.00 35.43  ? 515  ASN B CG  1 
ATOM   9556  O OD1 . ASN B 1 493 ? 32.205  -11.515 9.143   1.00 36.19  ? 515  ASN B OD1 1 
ATOM   9557  N ND2 . ASN B 1 493 ? 33.314  -10.850 10.989  1.00 32.99  ? 515  ASN B ND2 1 
ATOM   9558  N N   . SER B 1 494 ? 27.804  -10.644 12.257  1.00 24.39  ? 516  SER B N   1 
ATOM   9559  C CA  . SER B 1 494 ? 26.446  -11.125 12.470  1.00 28.81  ? 516  SER B CA  1 
ATOM   9560  C C   . SER B 1 494 ? 26.440  -12.603 12.824  1.00 28.47  ? 516  SER B C   1 
ATOM   9561  O O   . SER B 1 494 ? 25.592  -13.352 12.376  1.00 29.78  ? 516  SER B O   1 
ATOM   9562  C CB  . SER B 1 494 ? 25.589  -10.864 11.240  1.00 36.31  ? 516  SER B CB  1 
ATOM   9563  O OG  . SER B 1 494 ? 25.629  -9.487  10.904  1.00 39.05  ? 516  SER B OG  1 
ATOM   9564  N N   . ASN B 1 495 ? 27.404  -13.023 13.630  1.00 30.33  ? 517  ASN B N   1 
ATOM   9565  C CA  . ASN B 1 495 ? 27.539  -14.437 13.937  1.00 34.63  ? 517  ASN B CA  1 
ATOM   9566  C C   . ASN B 1 495 ? 26.631  -14.843 15.096  1.00 34.45  ? 517  ASN B C   1 
ATOM   9567  O O   . ASN B 1 495 ? 26.734  -14.302 16.198  1.00 31.92  ? 517  ASN B O   1 
ATOM   9568  C CB  . ASN B 1 495 ? 29.001  -14.790 14.217  1.00 33.00  ? 517  ASN B CB  1 
ATOM   9569  C CG  . ASN B 1 495 ? 29.236  -16.287 14.253  1.00 39.11  ? 517  ASN B CG  1 
ATOM   9570  O OD1 . ASN B 1 495 ? 28.493  -17.028 14.897  1.00 42.06  ? 517  ASN B OD1 1 
ATOM   9571  N ND2 . ASN B 1 495 ? 30.269  -16.744 13.551  1.00 40.38  ? 517  ASN B ND2 1 
ATOM   9572  N N   . ALA B 1 496 ? 25.695  -15.740 14.793  1.00 34.53  ? 518  ALA B N   1 
ATOM   9573  C CA  . ALA B 1 496 ? 24.714  -16.265 15.749  1.00 34.30  ? 518  ALA B CA  1 
ATOM   9574  C C   . ALA B 1 496 ? 25.015  -17.670 16.288  1.00 34.43  ? 518  ALA B C   1 
ATOM   9575  O O   . ALA B 1 496 ? 24.193  -18.271 16.979  1.00 35.95  ? 518  ALA B O   1 
ATOM   9576  C CB  . ALA B 1 496 ? 23.314  -16.209 15.158  1.00 30.47  ? 518  ALA B CB  1 
ATOM   9577  N N   . GLN B 1 497 ? 26.152  -18.224 15.907  1.00 31.90  ? 519  GLN B N   1 
ATOM   9578  C CA  . GLN B 1 497 ? 26.431  -19.638 16.167  1.00 30.89  ? 519  GLN B CA  1 
ATOM   9579  C C   . GLN B 1 497 ? 26.793  -19.993 17.610  1.00 29.26  ? 519  GLN B C   1 
ATOM   9580  O O   . GLN B 1 497 ? 27.107  -19.127 18.426  1.00 29.04  ? 519  GLN B O   1 
ATOM   9581  C CB  . GLN B 1 497 ? 27.493  -20.164 15.221  1.00 29.58  ? 519  GLN B CB  1 
ATOM   9582  C CG  . GLN B 1 497 ? 28.889  -20.133 15.777  1.00 32.43  ? 519  GLN B CG  1 
ATOM   9583  C CD  . GLN B 1 497 ? 29.888  -20.423 14.686  1.00 33.63  ? 519  GLN B CD  1 
ATOM   9584  O OE1 . GLN B 1 497 ? 30.582  -19.525 14.207  1.00 34.38  ? 519  GLN B OE1 1 
ATOM   9585  N NE2 . GLN B 1 497 ? 29.934  -21.674 14.253  1.00 32.63  ? 519  GLN B NE2 1 
ATOM   9586  N N   . VAL B 1 498 ? 26.732  -21.282 17.907  1.00 30.28  ? 520  VAL B N   1 
ATOM   9587  C CA  . VAL B 1 498 ? 27.164  -21.778 19.196  1.00 32.21  ? 520  VAL B CA  1 
ATOM   9588  C C   . VAL B 1 498 ? 28.577  -22.328 19.030  1.00 32.02  ? 520  VAL B C   1 
ATOM   9589  O O   . VAL B 1 498 ? 28.774  -23.418 18.498  1.00 34.01  ? 520  VAL B O   1 
ATOM   9590  C CB  . VAL B 1 498 ? 26.219  -22.911 19.642  1.00 32.16  ? 520  VAL B CB  1 
ATOM   9591  C CG1 . VAL B 1 498 ? 26.660  -23.502 20.986  1.00 32.47  ? 520  VAL B CG1 1 
ATOM   9592  C CG2 . VAL B 1 498 ? 24.774  -22.384 19.718  1.00 27.24  ? 520  VAL B CG2 1 
ATOM   9593  N N   . LEU B 1 499 ? 29.563  -21.585 19.522  1.00 31.33  ? 521  LEU B N   1 
ATOM   9594  C CA  . LEU B 1 499 ? 30.950  -22.001 19.365  1.00 31.17  ? 521  LEU B CA  1 
ATOM   9595  C C   . LEU B 1 499 ? 31.128  -23.231 20.232  1.00 39.70  ? 521  LEU B C   1 
ATOM   9596  O O   . LEU B 1 499 ? 30.740  -23.226 21.401  1.00 42.00  ? 521  LEU B O   1 
ATOM   9597  C CB  . LEU B 1 499 ? 31.892  -20.864 19.750  1.00 27.92  ? 521  LEU B CB  1 
ATOM   9598  C CG  . LEU B 1 499 ? 31.819  -19.754 18.693  1.00 29.17  ? 521  LEU B CG  1 
ATOM   9599  C CD1 . LEU B 1 499 ? 32.227  -18.382 19.211  1.00 27.94  ? 521  LEU B CD1 1 
ATOM   9600  C CD2 . LEU B 1 499 ? 32.670  -20.155 17.510  1.00 30.39  ? 521  LEU B CD2 1 
ATOM   9601  N N   . SER B 1 500 ? 31.569  -24.320 19.606  1.00 44.26  ? 522  SER B N   1 
ATOM   9602  C CA  . SER B 1 500 ? 31.648  -25.629 20.261  1.00 46.82  ? 522  SER B CA  1 
ATOM   9603  C C   . SER B 1 500 ? 33.044  -26.086 20.685  1.00 47.77  ? 522  SER B C   1 
ATOM   9604  O O   . SER B 1 500 ? 33.194  -27.164 21.259  1.00 48.63  ? 522  SER B O   1 
ATOM   9605  C CB  . SER B 1 500 ? 31.001  -26.702 19.383  1.00 51.68  ? 522  SER B CB  1 
ATOM   9606  O OG  . SER B 1 500 ? 31.801  -26.958 18.240  1.00 59.27  ? 522  SER B OG  1 
ATOM   9607  N N   . GLY B 1 501 ? 34.063  -25.290 20.382  1.00 45.69  ? 523  GLY B N   1 
ATOM   9608  C CA  . GLY B 1 501 ? 35.430  -25.685 20.670  1.00 46.07  ? 523  GLY B CA  1 
ATOM   9609  C C   . GLY B 1 501 ? 36.208  -26.270 19.493  1.00 48.20  ? 523  GLY B C   1 
ATOM   9610  O O   . GLY B 1 501 ? 37.389  -26.556 19.627  1.00 50.63  ? 523  GLY B O   1 
ATOM   9611  N N   . THR B 1 502 ? 35.550  -26.523 18.365  1.00 45.89  ? 524  THR B N   1 
ATOM   9612  C CA  . THR B 1 502 ? 36.266  -26.987 17.174  1.00 46.09  ? 524  THR B CA  1 
ATOM   9613  C C   . THR B 1 502 ? 36.513  -25.927 16.088  1.00 47.92  ? 524  THR B C   1 
ATOM   9614  O O   . THR B 1 502 ? 37.194  -26.205 15.104  1.00 50.87  ? 524  THR B O   1 
ATOM   9615  C CB  . THR B 1 502 ? 35.560  -28.194 16.529  1.00 45.66  ? 524  THR B CB  1 
ATOM   9616  O OG1 . THR B 1 502 ? 34.235  -27.816 16.134  1.00 49.08  ? 524  THR B OG1 1 
ATOM   9617  C CG2 . THR B 1 502 ? 35.477  -29.350 17.512  1.00 44.66  ? 524  THR B CG2 1 
ATOM   9618  N N   . GLU B 1 503 ? 35.981  -24.721 16.268  1.00 42.89  ? 525  GLU B N   1 
ATOM   9619  C CA  . GLU B 1 503 ? 35.887  -23.773 15.158  1.00 43.89  ? 525  GLU B CA  1 
ATOM   9620  C C   . GLU B 1 503 ? 37.212  -23.124 14.753  1.00 43.52  ? 525  GLU B C   1 
ATOM   9621  O O   . GLU B 1 503 ? 37.433  -22.808 13.579  1.00 42.36  ? 525  GLU B O   1 
ATOM   9622  C CB  . GLU B 1 503 ? 34.819  -22.704 15.448  1.00 44.55  ? 525  GLU B CB  1 
ATOM   9623  C CG  . GLU B 1 503 ? 33.373  -23.228 15.450  1.00 42.36  ? 525  GLU B CG  1 
ATOM   9624  C CD  . GLU B 1 503 ? 33.012  -24.000 16.710  1.00 44.76  ? 525  GLU B CD  1 
ATOM   9625  O OE1 . GLU B 1 503 ? 33.765  -23.913 17.705  1.00 45.51  ? 525  GLU B OE1 1 
ATOM   9626  O OE2 . GLU B 1 503 ? 31.974  -24.695 16.706  1.00 45.82  ? 525  GLU B OE2 1 
ATOM   9627  N N   . PHE B 1 504 ? 38.074  -22.898 15.735  1.00 41.82  ? 526  PHE B N   1 
ATOM   9628  C CA  . PHE B 1 504 ? 39.385  -22.294 15.514  1.00 39.42  ? 526  PHE B CA  1 
ATOM   9629  C C   . PHE B 1 504 ? 40.552  -23.264 15.429  1.00 41.93  ? 526  PHE B C   1 
ATOM   9630  O O   . PHE B 1 504 ? 41.710  -22.846 15.463  1.00 44.49  ? 526  PHE B O   1 
ATOM   9631  C CB  . PHE B 1 504 ? 39.641  -21.190 16.531  1.00 39.81  ? 526  PHE B CB  1 
ATOM   9632  C CG  . PHE B 1 504 ? 38.674  -20.070 16.416  1.00 38.46  ? 526  PHE B CG  1 
ATOM   9633  C CD1 . PHE B 1 504 ? 38.864  -19.080 15.469  1.00 31.28  ? 526  PHE B CD1 1 
ATOM   9634  C CD2 . PHE B 1 504 ? 37.541  -20.031 17.212  1.00 37.11  ? 526  PHE B CD2 1 
ATOM   9635  C CE1 . PHE B 1 504 ? 37.968  -18.055 15.337  1.00 29.43  ? 526  PHE B CE1 1 
ATOM   9636  C CE2 . PHE B 1 504 ? 36.633  -19.009 17.076  1.00 32.68  ? 526  PHE B CE2 1 
ATOM   9637  C CZ  . PHE B 1 504 ? 36.849  -18.011 16.133  1.00 30.16  ? 526  PHE B CZ  1 
ATOM   9638  N N   . SER B 1 505 ? 40.254  -24.557 15.385  1.00 42.22  ? 527  SER B N   1 
ATOM   9639  C CA  . SER B 1 505 ? 41.290  -25.585 15.442  1.00 41.25  ? 527  SER B CA  1 
ATOM   9640  C C   . SER B 1 505 ? 42.397  -25.489 14.370  1.00 40.19  ? 527  SER B C   1 
ATOM   9641  O O   . SER B 1 505 ? 43.508  -25.983 14.587  1.00 38.95  ? 527  SER B O   1 
ATOM   9642  C CB  . SER B 1 505 ? 40.657  -26.975 15.406  1.00 44.20  ? 527  SER B CB  1 
ATOM   9643  O OG  . SER B 1 505 ? 40.191  -27.271 14.105  1.00 48.99  ? 527  SER B OG  1 
ATOM   9644  N N   . ALA B 1 506 ? 42.113  -24.878 13.221  1.00 38.69  ? 528  ALA B N   1 
ATOM   9645  C CA  . ALA B 1 506 ? 43.146  -24.765 12.179  1.00 44.99  ? 528  ALA B CA  1 
ATOM   9646  C C   . ALA B 1 506 ? 44.082  -23.580 12.433  1.00 46.88  ? 528  ALA B C   1 
ATOM   9647  O O   . ALA B 1 506 ? 45.167  -23.509 11.872  1.00 42.34  ? 528  ALA B O   1 
ATOM   9648  C CB  . ALA B 1 506 ? 42.529  -24.689 10.772  1.00 45.79  ? 528  ALA B CB  1 
ATOM   9649  N N   . ILE B 1 507 ? 43.657  -22.659 13.295  1.00 49.07  ? 529  ILE B N   1 
ATOM   9650  C CA  . ILE B 1 507 ? 44.526  -21.575 13.746  1.00 47.97  ? 529  ILE B CA  1 
ATOM   9651  C C   . ILE B 1 507 ? 44.608  -21.578 15.270  1.00 46.80  ? 529  ILE B C   1 
ATOM   9652  O O   . ILE B 1 507 ? 44.263  -20.590 15.908  1.00 41.74  ? 529  ILE B O   1 
ATOM   9653  C CB  . ILE B 1 507 ? 44.028  -20.183 13.259  1.00 40.63  ? 529  ILE B CB  1 
ATOM   9654  C CG1 . ILE B 1 507 ? 42.500  -20.079 13.356  1.00 40.70  ? 529  ILE B CG1 1 
ATOM   9655  C CG2 . ILE B 1 507 ? 44.481  -19.921 11.830  1.00 42.19  ? 529  ILE B CG2 1 
ATOM   9656  C CD1 . ILE B 1 507 ? 41.922  -18.750 12.811  1.00 35.71  ? 529  ILE B CD1 1 
ATOM   9657  N N   . PRO B 1 508 ? 45.127  -22.675 15.850  1.00 47.85  ? 530  PRO B N   1 
ATOM   9658  C CA  . PRO B 1 508 ? 45.057  -22.951 17.291  1.00 46.27  ? 530  PRO B CA  1 
ATOM   9659  C C   . PRO B 1 508 ? 45.888  -21.973 18.100  1.00 48.02  ? 530  PRO B C   1 
ATOM   9660  O O   . PRO B 1 508 ? 45.790  -21.942 19.325  1.00 54.43  ? 530  PRO B O   1 
ATOM   9661  C CB  . PRO B 1 508 ? 45.661  -24.359 17.421  1.00 46.97  ? 530  PRO B CB  1 
ATOM   9662  C CG  . PRO B 1 508 ? 46.042  -24.791 16.014  1.00 49.63  ? 530  PRO B CG  1 
ATOM   9663  C CD  . PRO B 1 508 ? 46.089  -23.566 15.176  1.00 47.71  ? 530  PRO B CD  1 
ATOM   9664  N N   . HIS B 1 509 ? 46.735  -21.218 17.415  1.00 43.63  ? 531  HIS B N   1 
ATOM   9665  C CA  . HIS B 1 509 ? 47.692  -20.336 18.067  1.00 42.51  ? 531  HIS B CA  1 
ATOM   9666  C C   . HIS B 1 509 ? 47.247  -18.880 18.257  1.00 39.11  ? 531  HIS B C   1 
ATOM   9667  O O   . HIS B 1 509 ? 48.060  -18.043 18.644  1.00 44.43  ? 531  HIS B O   1 
ATOM   9668  C CB  . HIS B 1 509 ? 49.072  -20.430 17.399  1.00 45.36  ? 531  HIS B CB  1 
ATOM   9669  C CG  . HIS B 1 509 ? 49.726  -21.768 17.571  1.00 50.43  ? 531  HIS B CG  1 
ATOM   9670  N ND1 . HIS B 1 509 ? 49.968  -22.322 18.810  1.00 50.08  ? 531  HIS B ND1 1 
ATOM   9671  C CD2 . HIS B 1 509 ? 50.177  -22.664 16.660  1.00 53.72  ? 531  HIS B CD2 1 
ATOM   9672  C CE1 . HIS B 1 509 ? 50.543  -23.503 18.656  1.00 53.94  ? 531  HIS B CE1 1 
ATOM   9673  N NE2 . HIS B 1 509 ? 50.683  -23.732 17.363  1.00 55.88  ? 531  HIS B NE2 1 
ATOM   9674  N N   . VAL B 1 510 ? 45.984  -18.572 17.972  1.00 35.97  ? 532  VAL B N   1 
ATOM   9675  C CA  . VAL B 1 510 ? 45.496  -17.205 18.173  1.00 36.27  ? 532  VAL B CA  1 
ATOM   9676  C C   . VAL B 1 510 ? 45.725  -16.760 19.631  1.00 38.92  ? 532  VAL B C   1 
ATOM   9677  O O   . VAL B 1 510 ? 45.367  -17.456 20.578  1.00 40.28  ? 532  VAL B O   1 
ATOM   9678  C CB  . VAL B 1 510 ? 44.011  -17.055 17.770  1.00 36.09  ? 532  VAL B CB  1 
ATOM   9679  C CG1 . VAL B 1 510 ? 43.500  -15.648 18.087  1.00 31.19  ? 532  VAL B CG1 1 
ATOM   9680  C CG2 . VAL B 1 510 ? 43.836  -17.350 16.282  1.00 39.02  ? 532  VAL B CG2 1 
ATOM   9681  N N   . LYS B 1 511 ? 46.447  -15.656 19.778  1.00 42.14  ? 533  LYS B N   1 
ATOM   9682  C CA  . LYS B 1 511 ? 46.708  -15.003 21.059  1.00 31.15  ? 533  LYS B CA  1 
ATOM   9683  C C   . LYS B 1 511 ? 45.626  -13.992 21.446  1.00 37.99  ? 533  LYS B C   1 
ATOM   9684  O O   . LYS B 1 511 ? 45.278  -13.846 22.620  1.00 37.87  ? 533  LYS B O   1 
ATOM   9685  C CB  . LYS B 1 511 ? 48.060  -14.301 21.002  1.00 36.05  ? 533  LYS B CB  1 
ATOM   9686  C CG  . LYS B 1 511 ? 49.229  -15.202 20.598  1.00 36.82  ? 533  LYS B CG  1 
ATOM   9687  C CD  . LYS B 1 511 ? 49.607  -16.183 21.695  1.00 41.81  ? 533  LYS B CD  1 
ATOM   9688  C CE  . LYS B 1 511 ? 51.101  -16.550 21.620  1.00 46.17  ? 533  LYS B CE  1 
ATOM   9689  N NZ  . LYS B 1 511 ? 51.589  -16.729 20.221  1.00 50.99  ? 533  LYS B NZ  1 
ATOM   9690  N N   . TYR B 1 512 ? 45.137  -13.261 20.445  1.00 38.37  ? 534  TYR B N   1 
ATOM   9691  C CA  . TYR B 1 512 ? 44.238  -12.137 20.677  1.00 35.55  ? 534  TYR B CA  1 
ATOM   9692  C C   . TYR B 1 512 ? 43.047  -12.266 19.749  1.00 33.94  ? 534  TYR B C   1 
ATOM   9693  O O   . TYR B 1 512 ? 43.179  -12.169 18.530  1.00 32.64  ? 534  TYR B O   1 
ATOM   9694  C CB  . TYR B 1 512 ? 44.982  -10.832 20.409  1.00 35.09  ? 534  TYR B CB  1 
ATOM   9695  C CG  . TYR B 1 512 ? 44.281  -9.550  20.823  1.00 36.77  ? 534  TYR B CG  1 
ATOM   9696  C CD1 . TYR B 1 512 ? 43.022  -9.215  20.317  1.00 32.46  ? 534  TYR B CD1 1 
ATOM   9697  C CD2 . TYR B 1 512 ? 44.906  -8.638  21.677  1.00 36.81  ? 534  TYR B CD2 1 
ATOM   9698  C CE1 . TYR B 1 512 ? 42.396  -8.033  20.666  1.00 31.26  ? 534  TYR B CE1 1 
ATOM   9699  C CE2 . TYR B 1 512 ? 44.278  -7.444  22.032  1.00 37.56  ? 534  TYR B CE2 1 
ATOM   9700  C CZ  . TYR B 1 512 ? 43.022  -7.152  21.519  1.00 35.39  ? 534  TYR B CZ  1 
ATOM   9701  O OH  . TYR B 1 512 ? 42.389  -5.977  21.864  1.00 37.61  ? 534  TYR B OH  1 
ATOM   9702  N N   . LEU B 1 513 ? 41.873  -12.459 20.334  1.00 34.61  ? 535  LEU B N   1 
ATOM   9703  C CA  . LEU B 1 513 ? 40.676  -12.732 19.551  1.00 31.57  ? 535  LEU B CA  1 
ATOM   9704  C C   . LEU B 1 513 ? 39.598  -11.676 19.785  1.00 33.63  ? 535  LEU B C   1 
ATOM   9705  O O   . LEU B 1 513 ? 39.149  -11.478 20.919  1.00 36.37  ? 535  LEU B O   1 
ATOM   9706  C CB  . LEU B 1 513 ? 40.148  -14.135 19.886  1.00 30.54  ? 535  LEU B CB  1 
ATOM   9707  C CG  . LEU B 1 513 ? 38.945  -14.577 19.048  1.00 31.95  ? 535  LEU B CG  1 
ATOM   9708  C CD1 . LEU B 1 513 ? 39.313  -14.582 17.563  1.00 31.29  ? 535  LEU B CD1 1 
ATOM   9709  C CD2 . LEU B 1 513 ? 38.423  -15.937 19.491  1.00 27.75  ? 535  LEU B CD2 1 
ATOM   9710  N N   . ASP B 1 514 ? 39.194  -10.995 18.711  1.00 34.65  ? 536  ASP B N   1 
ATOM   9711  C CA  . ASP B 1 514 ? 38.112  -10.017 18.772  1.00 32.85  ? 536  ASP B CA  1 
ATOM   9712  C C   . ASP B 1 514 ? 36.836  -10.572 18.111  1.00 33.07  ? 536  ASP B C   1 
ATOM   9713  O O   . ASP B 1 514 ? 36.740  -10.675 16.889  1.00 33.11  ? 536  ASP B O   1 
ATOM   9714  C CB  . ASP B 1 514 ? 38.555  -8.712  18.080  1.00 34.01  ? 536  ASP B CB  1 
ATOM   9715  C CG  . ASP B 1 514 ? 37.561  -7.548  18.273  1.00 34.88  ? 536  ASP B CG  1 
ATOM   9716  O OD1 . ASP B 1 514 ? 36.326  -7.768  18.301  1.00 34.85  ? 536  ASP B OD1 1 
ATOM   9717  O OD2 . ASP B 1 514 ? 38.026  -6.392  18.374  1.00 34.09  ? 536  ASP B OD2 1 
ATOM   9718  N N   . LEU B 1 515 ? 35.879  -10.946 18.956  1.00 33.21  ? 537  LEU B N   1 
ATOM   9719  C CA  . LEU B 1 515 ? 34.522  -11.363 18.584  1.00 29.79  ? 537  LEU B CA  1 
ATOM   9720  C C   . LEU B 1 515 ? 33.404  -10.323 18.823  1.00 31.36  ? 537  LEU B C   1 
ATOM   9721  O O   . LEU B 1 515 ? 32.221  -10.691 18.949  1.00 27.36  ? 537  LEU B O   1 
ATOM   9722  C CB  . LEU B 1 515 ? 34.177  -12.699 19.228  1.00 31.07  ? 537  LEU B CB  1 
ATOM   9723  C CG  . LEU B 1 515 ? 34.994  -13.886 18.729  1.00 33.24  ? 537  LEU B CG  1 
ATOM   9724  C CD1 . LEU B 1 515 ? 34.597  -15.144 19.494  1.00 32.87  ? 537  LEU B CD1 1 
ATOM   9725  C CD2 . LEU B 1 515 ? 34.788  -14.086 17.245  1.00 33.82  ? 537  LEU B CD2 1 
ATOM   9726  N N   . THR B 1 516 ? 33.779  -9.066  19.053  1.00 29.53  ? 538  THR B N   1 
ATOM   9727  C CA  . THR B 1 516 ? 32.791  -8.044  19.394  1.00 26.15  ? 538  THR B CA  1 
ATOM   9728  C C   . THR B 1 516 ? 31.724  -7.823  18.305  1.00 28.77  ? 538  THR B C   1 
ATOM   9729  O O   . THR B 1 516 ? 31.913  -8.199  17.145  1.00 28.13  ? 538  THR B O   1 
ATOM   9730  C CB  . THR B 1 516 ? 33.426  -6.673  19.644  1.00 27.56  ? 538  THR B CB  1 
ATOM   9731  O OG1 . THR B 1 516 ? 33.960  -6.169  18.415  1.00 30.24  ? 538  THR B OG1 1 
ATOM   9732  C CG2 . THR B 1 516 ? 34.526  -6.749  20.689  1.00 25.44  ? 538  THR B CG2 1 
ATOM   9733  N N   . ASN B 1 517 ? 30.592  -7.255  18.728  1.00 28.40  ? 539  ASN B N   1 
ATOM   9734  C CA  . ASN B 1 517 ? 29.486  -6.856  17.853  1.00 32.82  ? 539  ASN B CA  1 
ATOM   9735  C C   . ASN B 1 517 ? 28.972  -7.983  16.980  1.00 34.88  ? 539  ASN B C   1 
ATOM   9736  O O   . ASN B 1 517 ? 28.751  -7.817  15.776  1.00 33.08  ? 539  ASN B O   1 
ATOM   9737  C CB  . ASN B 1 517 ? 29.856  -5.643  16.999  1.00 39.65  ? 539  ASN B CB  1 
ATOM   9738  C CG  . ASN B 1 517 ? 30.213  -4.435  17.841  1.00 44.66  ? 539  ASN B CG  1 
ATOM   9739  O OD1 . ASN B 1 517 ? 31.380  -4.204  18.153  1.00 45.95  ? 539  ASN B OD1 1 
ATOM   9740  N ND2 . ASN B 1 517 ? 29.207  -3.667  18.225  1.00 45.42  ? 539  ASN B ND2 1 
ATOM   9741  N N   . ASN B 1 518 ? 28.806  -9.138  17.605  1.00 31.82  ? 540  ASN B N   1 
ATOM   9742  C CA  . ASN B 1 518 ? 28.110  -10.244 16.977  1.00 33.97  ? 540  ASN B CA  1 
ATOM   9743  C C   . ASN B 1 518 ? 26.808  -10.583 17.728  1.00 33.67  ? 540  ASN B C   1 
ATOM   9744  O O   . ASN B 1 518 ? 26.343  -9.797  18.540  1.00 34.77  ? 540  ASN B O   1 
ATOM   9745  C CB  . ASN B 1 518 ? 29.054  -11.435 16.801  1.00 29.96  ? 540  ASN B CB  1 
ATOM   9746  C CG  . ASN B 1 518 ? 30.037  -11.217 15.652  1.00 32.56  ? 540  ASN B CG  1 
ATOM   9747  O OD1 . ASN B 1 518 ? 29.647  -11.239 14.473  1.00 31.65  ? 540  ASN B OD1 1 
ATOM   9748  N ND2 . ASN B 1 518 ? 31.312  -10.974 15.989  1.00 27.94  ? 540  ASN B ND2 1 
ATOM   9749  N N   . ARG B 1 519 ? 26.153  -11.655 17.322  1.00 33.44  ? 541  ARG B N   1 
ATOM   9750  C CA  . ARG B 1 519 ? 25.020  -12.261 18.043  1.00 32.65  ? 541  ARG B CA  1 
ATOM   9751  C C   . ARG B 1 519 ? 25.281  -13.558 18.805  1.00 28.49  ? 541  ARG B C   1 
ATOM   9752  O O   . ARG B 1 519 ? 24.383  -14.383 18.917  1.00 28.51  ? 541  ARG B O   1 
ATOM   9753  C CB  . ARG B 1 519 ? 23.708  -12.296 17.262  1.00 31.25  ? 541  ARG B CB  1 
ATOM   9754  C CG  . ARG B 1 519 ? 23.815  -12.340 15.765  1.00 39.13  ? 541  ARG B CG  1 
ATOM   9755  C CD  . ARG B 1 519 ? 22.491  -11.866 15.205  1.00 46.52  ? 541  ARG B CD  1 
ATOM   9756  N NE  . ARG B 1 519 ? 22.231  -12.366 13.864  1.00 56.23  ? 541  ARG B NE  1 
ATOM   9757  C CZ  . ARG B 1 519 ? 21.090  -12.160 13.212  1.00 62.93  ? 541  ARG B CZ  1 
ATOM   9758  N NH1 . ARG B 1 519 ? 20.109  -11.465 13.787  1.00 63.51  ? 541  ARG B NH1 1 
ATOM   9759  N NH2 . ARG B 1 519 ? 20.931  -12.646 11.987  1.00 63.84  ? 541  ARG B NH2 1 
ATOM   9760  N N   . LEU B 1 520 ? 26.530  -13.816 19.149  1.00 31.61  ? 542  LEU B N   1 
ATOM   9761  C CA  . LEU B 1 520 ? 26.931  -15.121 19.636  1.00 34.74  ? 542  LEU B CA  1 
ATOM   9762  C C   . LEU B 1 520 ? 25.995  -15.683 20.712  1.00 37.85  ? 542  LEU B C   1 
ATOM   9763  O O   . LEU B 1 520 ? 25.502  -14.971 21.603  1.00 35.72  ? 542  LEU B O   1 
ATOM   9764  C CB  . LEU B 1 520 ? 28.368  -15.053 20.143  1.00 35.53  ? 542  LEU B CB  1 
ATOM   9765  C CG  . LEU B 1 520 ? 29.391  -14.826 19.026  1.00 36.62  ? 542  LEU B CG  1 
ATOM   9766  C CD1 . LEU B 1 520 ? 30.791  -14.632 19.605  1.00 34.72  ? 542  LEU B CD1 1 
ATOM   9767  C CD2 . LEU B 1 520 ? 29.376  -16.001 18.058  1.00 35.16  ? 542  LEU B CD2 1 
ATOM   9768  N N   . ASP B 1 521 ? 25.712  -16.970 20.572  1.00 36.82  ? 543  ASP B N   1 
ATOM   9769  C CA  . ASP B 1 521 ? 24.837  -17.658 21.493  1.00 36.32  ? 543  ASP B CA  1 
ATOM   9770  C C   . ASP B 1 521 ? 25.728  -18.573 22.297  1.00 34.40  ? 543  ASP B C   1 
ATOM   9771  O O   . ASP B 1 521 ? 26.124  -19.636 21.806  1.00 33.77  ? 543  ASP B O   1 
ATOM   9772  C CB  . ASP B 1 521 ? 23.860  -18.487 20.661  1.00 36.73  ? 543  ASP B CB  1 
ATOM   9773  C CG  . ASP B 1 521 ? 22.984  -19.393 21.497  1.00 36.28  ? 543  ASP B CG  1 
ATOM   9774  O OD1 . ASP B 1 521 ? 22.977  -19.285 22.745  1.00 38.14  ? 543  ASP B OD1 1 
ATOM   9775  O OD2 . ASP B 1 521 ? 22.275  -20.208 20.883  1.00 32.41  ? 543  ASP B OD2 1 
ATOM   9776  N N   . PHE B 1 522 ? 26.018  -18.219 23.547  1.00 34.15  ? 544  PHE B N   1 
ATOM   9777  C CA  . PHE B 1 522 ? 26.998  -19.042 24.242  1.00 35.01  ? 544  PHE B CA  1 
ATOM   9778  C C   . PHE B 1 522 ? 26.229  -20.122 24.961  1.00 36.68  ? 544  PHE B C   1 
ATOM   9779  O O   . PHE B 1 522 ? 25.769  -19.952 26.084  1.00 36.47  ? 544  PHE B O   1 
ATOM   9780  C CB  . PHE B 1 522 ? 27.763  -18.188 25.248  1.00 33.53  ? 544  PHE B CB  1 
ATOM   9781  C CG  . PHE B 1 522 ? 28.567  -17.094 24.619  1.00 32.84  ? 544  PHE B CG  1 
ATOM   9782  C CD1 . PHE B 1 522 ? 29.876  -17.322 24.218  1.00 33.28  ? 544  PHE B CD1 1 
ATOM   9783  C CD2 . PHE B 1 522 ? 28.017  -15.844 24.414  1.00 35.62  ? 544  PHE B CD2 1 
ATOM   9784  C CE1 . PHE B 1 522 ? 30.618  -16.319 23.640  1.00 32.49  ? 544  PHE B CE1 1 
ATOM   9785  C CE2 . PHE B 1 522 ? 28.757  -14.839 23.831  1.00 37.73  ? 544  PHE B CE2 1 
ATOM   9786  C CZ  . PHE B 1 522 ? 30.061  -15.078 23.446  1.00 34.37  ? 544  PHE B CZ  1 
ATOM   9787  N N   . ASP B 1 523 ? 26.114  -21.241 24.261  1.00 39.26  ? 545  ASP B N   1 
ATOM   9788  C CA  . ASP B 1 523 ? 25.398  -22.425 24.705  1.00 41.31  ? 545  ASP B CA  1 
ATOM   9789  C C   . ASP B 1 523 ? 26.279  -23.640 24.982  1.00 44.48  ? 545  ASP B C   1 
ATOM   9790  O O   . ASP B 1 523 ? 25.771  -24.744 25.126  1.00 48.76  ? 545  ASP B O   1 
ATOM   9791  C CB  . ASP B 1 523 ? 24.245  -22.748 23.748  1.00 41.97  ? 545  ASP B CB  1 
ATOM   9792  C CG  . ASP B 1 523 ? 23.169  -23.581 24.404  1.00 42.38  ? 545  ASP B CG  1 
ATOM   9793  O OD1 . ASP B 1 523 ? 23.149  -23.620 25.649  1.00 40.27  ? 545  ASP B OD1 1 
ATOM   9794  O OD2 . ASP B 1 523 ? 22.351  -24.194 23.684  1.00 44.84  ? 545  ASP B OD2 1 
ATOM   9795  N N   . ASN B 1 524 ? 27.593  -23.471 24.927  1.00 45.34  ? 546  ASN B N   1 
ATOM   9796  C CA  . ASN B 1 524 ? 28.486  -24.614 25.063  1.00 42.06  ? 546  ASN B CA  1 
ATOM   9797  C C   . ASN B 1 524 ? 29.674  -24.319 25.966  1.00 40.02  ? 546  ASN B C   1 
ATOM   9798  O O   . ASN B 1 524 ? 30.382  -23.333 25.769  1.00 42.20  ? 546  ASN B O   1 
ATOM   9799  C CB  . ASN B 1 524 ? 28.975  -25.081 23.685  1.00 44.52  ? 546  ASN B CB  1 
ATOM   9800  C CG  . ASN B 1 524 ? 29.594  -26.476 23.720  1.00 48.44  ? 546  ASN B CG  1 
ATOM   9801  O OD1 . ASN B 1 524 ? 30.684  -26.671 24.259  1.00 47.38  ? 546  ASN B OD1 1 
ATOM   9802  N ND2 . ASN B 1 524 ? 28.886  -27.454 23.151  1.00 56.43  ? 546  ASN B ND2 1 
ATOM   9803  N N   . ALA B 1 525 ? 29.902  -25.195 26.938  1.00 33.65  ? 547  ALA B N   1 
ATOM   9804  C CA  . ALA B 1 525 ? 30.957  -24.992 27.926  1.00 34.26  ? 547  ALA B CA  1 
ATOM   9805  C C   . ALA B 1 525 ? 32.360  -25.152 27.352  1.00 40.81  ? 547  ALA B C   1 
ATOM   9806  O O   . ALA B 1 525 ? 33.332  -24.731 27.972  1.00 42.46  ? 547  ALA B O   1 
ATOM   9807  C CB  . ALA B 1 525 ? 30.762  -25.932 29.112  1.00 32.73  ? 547  ALA B CB  1 
ATOM   9808  N N   . SER B 1 526 ? 32.469  -25.768 26.178  1.00 44.73  ? 548  SER B N   1 
ATOM   9809  C CA  . SER B 1 526 ? 33.771  -25.987 25.548  1.00 47.01  ? 548  SER B CA  1 
ATOM   9810  C C   . SER B 1 526 ? 34.153  -24.925 24.505  1.00 42.56  ? 548  SER B C   1 
ATOM   9811  O O   . SER B 1 526 ? 35.198  -25.033 23.870  1.00 42.87  ? 548  SER B O   1 
ATOM   9812  C CB  . SER B 1 526 ? 33.837  -27.385 24.923  1.00 50.97  ? 548  SER B CB  1 
ATOM   9813  O OG  . SER B 1 526 ? 33.817  -28.387 25.924  1.00 54.79  ? 548  SER B OG  1 
ATOM   9814  N N   . ALA B 1 527 ? 33.310  -23.911 24.334  1.00 38.35  ? 549  ALA B N   1 
ATOM   9815  C CA  . ALA B 1 527 ? 33.560  -22.847 23.352  1.00 34.95  ? 549  ALA B CA  1 
ATOM   9816  C C   . ALA B 1 527 ? 34.972  -22.249 23.470  1.00 33.46  ? 549  ALA B C   1 
ATOM   9817  O O   . ALA B 1 527 ? 35.418  -21.911 24.566  1.00 31.32  ? 549  ALA B O   1 
ATOM   9818  C CB  . ALA B 1 527 ? 32.533  -21.750 23.526  1.00 31.55  ? 549  ALA B CB  1 
ATOM   9819  N N   . LEU B 1 528 ? 35.676  -22.148 22.343  1.00 33.58  ? 550  LEU B N   1 
ATOM   9820  C CA  . LEU B 1 528 ? 36.948  -21.419 22.278  1.00 34.12  ? 550  LEU B CA  1 
ATOM   9821  C C   . LEU B 1 528 ? 38.118  -22.092 23.010  1.00 40.87  ? 550  LEU B C   1 
ATOM   9822  O O   . LEU B 1 528 ? 39.245  -21.595 22.982  1.00 45.43  ? 550  LEU B O   1 
ATOM   9823  C CB  . LEU B 1 528 ? 36.772  -19.953 22.727  1.00 33.63  ? 550  LEU B CB  1 
ATOM   9824  C CG  . LEU B 1 528 ? 35.784  -19.109 21.897  1.00 31.26  ? 550  LEU B CG  1 
ATOM   9825  C CD1 . LEU B 1 528 ? 35.549  -17.748 22.504  1.00 31.30  ? 550  LEU B CD1 1 
ATOM   9826  C CD2 . LEU B 1 528 ? 36.276  -18.948 20.456  1.00 29.29  ? 550  LEU B CD2 1 
ATOM   9827  N N   . THR B 1 529 ? 37.863  -23.225 23.655  1.00 40.70  ? 551  THR B N   1 
ATOM   9828  C CA  . THR B 1 529 ? 38.907  -23.880 24.437  1.00 38.39  ? 551  THR B CA  1 
ATOM   9829  C C   . THR B 1 529 ? 40.039  -24.481 23.584  1.00 39.67  ? 551  THR B C   1 
ATOM   9830  O O   . THR B 1 529 ? 41.114  -24.796 24.108  1.00 34.81  ? 551  THR B O   1 
ATOM   9831  C CB  . THR B 1 529 ? 38.322  -24.945 25.396  1.00 37.97  ? 551  THR B CB  1 
ATOM   9832  O OG1 . THR B 1 529 ? 37.572  -25.904 24.647  1.00 40.89  ? 551  THR B OG1 1 
ATOM   9833  C CG2 . THR B 1 529 ? 37.395  -24.293 26.415  1.00 30.82  ? 551  THR B CG2 1 
ATOM   9834  N N   . GLU B 1 530 ? 39.806  -24.628 22.279  1.00 44.73  ? 552  GLU B N   1 
ATOM   9835  C CA  . GLU B 1 530 ? 40.847  -25.123 21.362  1.00 46.00  ? 552  GLU B CA  1 
ATOM   9836  C C   . GLU B 1 530 ? 42.000  -24.143 21.214  1.00 48.25  ? 552  GLU B C   1 
ATOM   9837  O O   . GLU B 1 530 ? 43.079  -24.517 20.753  1.00 50.60  ? 552  GLU B O   1 
ATOM   9838  C CB  . GLU B 1 530 ? 40.281  -25.425 19.974  1.00 47.75  ? 552  GLU B CB  1 
ATOM   9839  C CG  . GLU B 1 530 ? 39.833  -24.187 19.184  1.00 48.95  ? 552  GLU B CG  1 
ATOM   9840  C CD  . GLU B 1 530 ? 38.394  -23.789 19.475  1.00 49.95  ? 552  GLU B CD  1 
ATOM   9841  O OE1 . GLU B 1 530 ? 37.991  -23.833 20.650  1.00 49.86  ? 552  GLU B OE1 1 
ATOM   9842  O OE2 . GLU B 1 530 ? 37.657  -23.454 18.524  1.00 50.33  ? 552  GLU B OE2 1 
ATOM   9843  N N   . LEU B 1 531 ? 41.784  -22.889 21.608  1.00 48.98  ? 553  LEU B N   1 
ATOM   9844  C CA  . LEU B 1 531 ? 42.873  -21.931 21.576  1.00 49.36  ? 553  LEU B CA  1 
ATOM   9845  C C   . LEU B 1 531 ? 43.539  -21.991 22.935  1.00 50.81  ? 553  LEU B C   1 
ATOM   9846  O O   . LEU B 1 531 ? 43.065  -21.388 23.898  1.00 54.14  ? 553  LEU B O   1 
ATOM   9847  C CB  . LEU B 1 531 ? 42.307  -20.527 21.368  1.00 45.14  ? 553  LEU B CB  1 
ATOM   9848  C CG  . LEU B 1 531 ? 41.554  -20.246 20.069  1.00 42.98  ? 553  LEU B CG  1 
ATOM   9849  C CD1 . LEU B 1 531 ? 40.952  -18.847 20.120  1.00 41.15  ? 553  LEU B CD1 1 
ATOM   9850  C CD2 . LEU B 1 531 ? 42.478  -20.416 18.854  1.00 30.19  ? 553  LEU B CD2 1 
ATOM   9851  N N   . SER B 1 532 ? 44.686  -22.651 22.989  1.00 48.70  ? 554  SER B N   1 
ATOM   9852  C CA  . SER B 1 532 ? 45.346  -22.926 24.264  1.00 49.26  ? 554  SER B CA  1 
ATOM   9853  C C   . SER B 1 532 ? 46.116  -21.713 24.722  1.00 47.43  ? 554  SER B C   1 
ATOM   9854  O O   . SER B 1 532 ? 46.207  -21.426 25.915  1.00 50.93  ? 554  SER B O   1 
ATOM   9855  C CB  . SER B 1 532 ? 46.297  -24.118 24.135  1.00 54.65  ? 554  SER B CB  1 
ATOM   9856  O OG  . SER B 1 532 ? 45.579  -25.336 24.032  1.00 58.24  ? 554  SER B OG  1 
ATOM   9857  N N   . ASP B 1 533 ? 46.665  -20.996 23.749  1.00 41.82  ? 555  ASP B N   1 
ATOM   9858  C CA  . ASP B 1 533 ? 47.543  -19.877 24.025  1.00 39.67  ? 555  ASP B CA  1 
ATOM   9859  C C   . ASP B 1 533 ? 46.780  -18.561 24.162  1.00 40.15  ? 555  ASP B C   1 
ATOM   9860  O O   . ASP B 1 533 ? 47.397  -17.496 24.230  1.00 40.33  ? 555  ASP B O   1 
ATOM   9861  C CB  . ASP B 1 533 ? 48.624  -19.769 22.949  1.00 43.90  ? 555  ASP B CB  1 
ATOM   9862  C CG  . ASP B 1 533 ? 49.457  -21.047 22.815  1.00 44.50  ? 555  ASP B CG  1 
ATOM   9863  O OD1 . ASP B 1 533 ? 49.543  -21.831 23.783  1.00 36.97  ? 555  ASP B OD1 1 
ATOM   9864  O OD2 . ASP B 1 533 ? 50.017  -21.268 21.724  1.00 48.76  ? 555  ASP B OD2 1 
ATOM   9865  N N   . LEU B 1 534 ? 45.445  -18.627 24.177  1.00 37.97  ? 556  LEU B N   1 
ATOM   9866  C CA  . LEU B 1 534 ? 44.637  -17.402 24.176  1.00 39.06  ? 556  LEU B CA  1 
ATOM   9867  C C   . LEU B 1 534 ? 44.960  -16.499 25.370  1.00 38.10  ? 556  LEU B C   1 
ATOM   9868  O O   . LEU B 1 534 ? 45.026  -16.949 26.512  1.00 33.67  ? 556  LEU B O   1 
ATOM   9869  C CB  . LEU B 1 534 ? 43.135  -17.702 24.089  1.00 34.74  ? 556  LEU B CB  1 
ATOM   9870  C CG  . LEU B 1 534 ? 42.211  -16.493 23.862  1.00 34.00  ? 556  LEU B CG  1 
ATOM   9871  C CD1 . LEU B 1 534 ? 42.368  -15.894 22.468  1.00 32.59  ? 556  LEU B CD1 1 
ATOM   9872  C CD2 . LEU B 1 534 ? 40.758  -16.841 24.125  1.00 33.04  ? 556  LEU B CD2 1 
ATOM   9873  N N   . GLU B 1 535 ? 45.186  -15.224 25.074  1.00 37.95  ? 557  GLU B N   1 
ATOM   9874  C CA  . GLU B 1 535 ? 45.570  -14.232 26.077  1.00 37.17  ? 557  GLU B CA  1 
ATOM   9875  C C   . GLU B 1 535 ? 44.522  -13.140 26.272  1.00 40.12  ? 557  GLU B C   1 
ATOM   9876  O O   . GLU B 1 535 ? 44.146  -12.830 27.398  1.00 40.71  ? 557  GLU B O   1 
ATOM   9877  C CB  . GLU B 1 535 ? 46.969  -13.688 25.834  1.00 39.30  ? 557  GLU B CB  1 
ATOM   9878  C CG  . GLU B 1 535 ? 48.019  -14.763 26.071  1.00 40.27  ? 557  GLU B CG  1 
ATOM   9879  C CD  . GLU B 1 535 ? 49.415  -14.217 26.199  1.00 45.17  ? 557  GLU B CD  1 
ATOM   9880  O OE1 . GLU B 1 535 ? 49.567  -12.991 26.377  1.00 48.81  ? 557  GLU B OE1 1 
ATOM   9881  O OE2 . GLU B 1 535 ? 50.366  -15.023 26.117  1.00 48.73  ? 557  GLU B OE2 1 
ATOM   9882  N N   . VAL B 1 536 ? 44.140  -12.501 25.173  1.00 38.40  ? 558  VAL B N   1 
ATOM   9883  C CA  . VAL B 1 536 ? 43.106  -11.492 25.182  1.00 36.83  ? 558  VAL B CA  1 
ATOM   9884  C C   . VAL B 1 536 ? 41.863  -11.959 24.425  1.00 39.20  ? 558  VAL B C   1 
ATOM   9885  O O   . VAL B 1 536 ? 41.939  -12.395 23.269  1.00 40.90  ? 558  VAL B O   1 
ATOM   9886  C CB  . VAL B 1 536 ? 43.613  -10.200 24.520  1.00 37.47  ? 558  VAL B CB  1 
ATOM   9887  C CG1 . VAL B 1 536 ? 42.505  -9.123  24.504  1.00 32.49  ? 558  VAL B CG1 1 
ATOM   9888  C CG2 . VAL B 1 536 ? 44.894  -9.717  25.214  1.00 29.58  ? 558  VAL B CG2 1 
ATOM   9889  N N   . LEU B 1 537 ? 40.714  -11.858 25.078  1.00 33.14  ? 559  LEU B N   1 
ATOM   9890  C CA  . LEU B 1 537 ? 39.461  -12.217 24.452  1.00 31.70  ? 559  LEU B CA  1 
ATOM   9891  C C   . LEU B 1 537 ? 38.487  -11.051 24.591  1.00 33.89  ? 559  LEU B C   1 
ATOM   9892  O O   . LEU B 1 537 ? 38.220  -10.584 25.699  1.00 37.88  ? 559  LEU B O   1 
ATOM   9893  C CB  . LEU B 1 537 ? 38.886  -13.494 25.079  1.00 31.80  ? 559  LEU B CB  1 
ATOM   9894  C CG  . LEU B 1 537 ? 37.571  -13.999 24.463  1.00 31.36  ? 559  LEU B CG  1 
ATOM   9895  C CD1 . LEU B 1 537 ? 37.779  -14.351 22.994  1.00 25.65  ? 559  LEU B CD1 1 
ATOM   9896  C CD2 . LEU B 1 537 ? 37.038  -15.199 25.224  1.00 31.33  ? 559  LEU B CD2 1 
ATOM   9897  N N   . ASP B 1 538 ? 37.980  -10.557 23.466  1.00 34.12  ? 560  ASP B N   1 
ATOM   9898  C CA  . ASP B 1 538 ? 36.996  -9.483  23.516  1.00 33.13  ? 560  ASP B CA  1 
ATOM   9899  C C   . ASP B 1 538 ? 35.632  -9.981  23.067  1.00 35.10  ? 560  ASP B C   1 
ATOM   9900  O O   . ASP B 1 538 ? 35.419  -10.253 21.887  1.00 39.33  ? 560  ASP B O   1 
ATOM   9901  C CB  . ASP B 1 538 ? 37.437  -8.306  22.650  1.00 32.08  ? 560  ASP B CB  1 
ATOM   9902  C CG  . ASP B 1 538 ? 36.744  -7.011  23.034  1.00 34.37  ? 560  ASP B CG  1 
ATOM   9903  O OD1 . ASP B 1 538 ? 35.703  -7.077  23.725  1.00 32.05  ? 560  ASP B OD1 1 
ATOM   9904  O OD2 . ASP B 1 538 ? 37.233  -5.929  22.635  1.00 36.19  ? 560  ASP B OD2 1 
ATOM   9905  N N   . LEU B 1 539 ? 34.728  -10.123 24.033  1.00 33.07  ? 561  LEU B N   1 
ATOM   9906  C CA  . LEU B 1 539 ? 33.354  -10.554 23.790  1.00 30.30  ? 561  LEU B CA  1 
ATOM   9907  C C   . LEU B 1 539 ? 32.308  -9.429  23.740  1.00 33.07  ? 561  LEU B C   1 
ATOM   9908  O O   . LEU B 1 539 ? 31.114  -9.720  23.720  1.00 32.39  ? 561  LEU B O   1 
ATOM   9909  C CB  . LEU B 1 539 ? 32.936  -11.682 24.749  1.00 27.62  ? 561  LEU B CB  1 
ATOM   9910  C CG  . LEU B 1 539 ? 33.749  -12.982 24.631  1.00 32.50  ? 561  LEU B CG  1 
ATOM   9911  C CD1 . LEU B 1 539 ? 33.126  -14.104 25.450  1.00 29.74  ? 561  LEU B CD1 1 
ATOM   9912  C CD2 . LEU B 1 539 ? 33.930  -13.409 23.170  1.00 33.56  ? 561  LEU B CD2 1 
ATOM   9913  N N   . SER B 1 540 ? 32.748  -8.166  23.763  1.00 31.95  ? 562  SER B N   1 
ATOM   9914  C CA  . SER B 1 540 ? 31.834  -7.021  23.900  1.00 30.24  ? 562  SER B CA  1 
ATOM   9915  C C   . SER B 1 540 ? 30.711  -6.999  22.853  1.00 28.88  ? 562  SER B C   1 
ATOM   9916  O O   . SER B 1 540 ? 30.893  -7.478  21.731  1.00 29.32  ? 562  SER B O   1 
ATOM   9917  C CB  . SER B 1 540 ? 32.591  -5.685  23.828  1.00 29.08  ? 562  SER B CB  1 
ATOM   9918  O OG  . SER B 1 540 ? 33.662  -5.621  24.749  1.00 32.04  ? 562  SER B OG  1 
ATOM   9919  N N   . TYR B 1 541 ? 29.557  -6.450  23.238  1.00 25.15  ? 563  TYR B N   1 
ATOM   9920  C CA  . TYR B 1 541 ? 28.417  -6.241  22.318  1.00 28.56  ? 563  TYR B CA  1 
ATOM   9921  C C   . TYR B 1 541 ? 27.916  -7.544  21.676  1.00 30.90  ? 563  TYR B C   1 
ATOM   9922  O O   . TYR B 1 541 ? 27.736  -7.624  20.465  1.00 32.17  ? 563  TYR B O   1 
ATOM   9923  C CB  . TYR B 1 541 ? 28.749  -5.190  21.245  1.00 28.65  ? 563  TYR B CB  1 
ATOM   9924  C CG  . TYR B 1 541 ? 28.993  -3.813  21.819  1.00 30.97  ? 563  TYR B CG  1 
ATOM   9925  C CD1 . TYR B 1 541 ? 27.930  -2.955  22.077  1.00 33.53  ? 563  TYR B CD1 1 
ATOM   9926  C CD2 . TYR B 1 541 ? 30.278  -3.376  22.120  1.00 32.01  ? 563  TYR B CD2 1 
ATOM   9927  C CE1 . TYR B 1 541 ? 28.134  -1.700  22.619  1.00 37.12  ? 563  TYR B CE1 1 
ATOM   9928  C CE2 . TYR B 1 541 ? 30.494  -2.114  22.674  1.00 36.51  ? 563  TYR B CE2 1 
ATOM   9929  C CZ  . TYR B 1 541 ? 29.411  -1.288  22.922  1.00 40.55  ? 563  TYR B CZ  1 
ATOM   9930  O OH  . TYR B 1 541 ? 29.595  -0.039  23.458  1.00 46.76  ? 563  TYR B OH  1 
ATOM   9931  N N   . ASN B 1 542 ? 27.826  -8.590  22.492  1.00 30.30  ? 564  ASN B N   1 
ATOM   9932  C CA  . ASN B 1 542 ? 27.143  -9.856  22.182  1.00 30.34  ? 564  ASN B CA  1 
ATOM   9933  C C   . ASN B 1 542 ? 25.768  -10.076 22.864  1.00 32.47  ? 564  ASN B C   1 
ATOM   9934  O O   . ASN B 1 542 ? 25.385  -11.213 23.194  1.00 32.17  ? 564  ASN B O   1 
ATOM   9935  C CB  . ASN B 1 542 ? 28.087  -11.053 22.221  1.00 29.51  ? 564  ASN B CB  1 
ATOM   9936  C CG  . ASN B 1 542 ? 28.997  -11.108 20.984  1.00 28.17  ? 564  ASN B CG  1 
ATOM   9937  O OD1 . ASN B 1 542 ? 28.576  -11.513 19.899  1.00 23.94  ? 564  ASN B OD1 1 
ATOM   9938  N ND2 . ASN B 1 542 ? 30.240  -10.683 21.148  1.00 22.08  ? 564  ASN B ND2 1 
ATOM   9939  N N   . SER B 1 543 ? 25.143  -8.975  23.251  1.00 30.90  ? 565  SER B N   1 
ATOM   9940  C CA  . SER B 1 543 ? 23.936  -8.990  24.081  1.00 30.96  ? 565  SER B CA  1 
ATOM   9941  C C   . SER B 1 543 ? 22.726  -9.778  23.555  1.00 29.89  ? 565  SER B C   1 
ATOM   9942  O O   . SER B 1 543 ? 21.817  -10.072 24.327  1.00 27.25  ? 565  SER B O   1 
ATOM   9943  C CB  . SER B 1 543 ? 23.508  -7.557  24.399  1.00 30.17  ? 565  SER B CB  1 
ATOM   9944  O OG  . SER B 1 543 ? 22.947  -6.951  23.239  1.00 34.98  ? 565  SER B OG  1 
ATOM   9945  N N   . HIS B 1 544 ? 22.730  -10.140 22.273  1.00 30.03  ? 566  HIS B N   1 
ATOM   9946  C CA  . HIS B 1 544 ? 21.538  -10.682 21.611  1.00 29.98  ? 566  HIS B CA  1 
ATOM   9947  C C   . HIS B 1 544 ? 20.854  -11.789 22.411  1.00 30.00  ? 566  HIS B C   1 
ATOM   9948  O O   . HIS B 1 544 ? 19.668  -11.686 22.724  1.00 30.33  ? 566  HIS B O   1 
ATOM   9949  C CB  . HIS B 1 544 ? 21.897  -11.233 20.224  1.00 32.36  ? 566  HIS B CB  1 
ATOM   9950  C CG  . HIS B 1 544 ? 20.707  -11.628 19.410  1.00 34.96  ? 566  HIS B CG  1 
ATOM   9951  N ND1 . HIS B 1 544 ? 20.271  -10.897 18.323  1.00 36.16  ? 566  HIS B ND1 1 
ATOM   9952  C CD2 . HIS B 1 544 ? 19.846  -12.666 19.535  1.00 38.15  ? 566  HIS B CD2 1 
ATOM   9953  C CE1 . HIS B 1 544 ? 19.194  -11.470 17.816  1.00 38.80  ? 566  HIS B CE1 1 
ATOM   9954  N NE2 . HIS B 1 544 ? 18.912  -12.541 18.536  1.00 40.08  ? 566  HIS B NE2 1 
ATOM   9955  N N   . TYR B 1 545 ? 21.608  -12.834 22.741  1.00 25.91  ? 567  TYR B N   1 
ATOM   9956  C CA  . TYR B 1 545 ? 21.071  -13.970 23.485  1.00 27.95  ? 567  TYR B CA  1 
ATOM   9957  C C   . TYR B 1 545 ? 21.041  -13.814 25.014  1.00 34.23  ? 567  TYR B C   1 
ATOM   9958  O O   . TYR B 1 545 ? 20.092  -14.269 25.659  1.00 37.86  ? 567  TYR B O   1 
ATOM   9959  C CB  . TYR B 1 545 ? 21.709  -15.287 23.012  1.00 24.73  ? 567  TYR B CB  1 
ATOM   9960  C CG  . TYR B 1 545 ? 21.211  -15.660 21.629  1.00 28.94  ? 567  TYR B CG  1 
ATOM   9961  C CD1 . TYR B 1 545 ? 19.923  -16.150 21.450  1.00 28.75  ? 567  TYR B CD1 1 
ATOM   9962  C CD2 . TYR B 1 545 ? 22.006  -15.489 20.499  1.00 32.04  ? 567  TYR B CD2 1 
ATOM   9963  C CE1 . TYR B 1 545 ? 19.444  -16.484 20.206  1.00 28.61  ? 567  TYR B CE1 1 
ATOM   9964  C CE2 . TYR B 1 545 ? 21.527  -15.823 19.230  1.00 28.77  ? 567  TYR B CE2 1 
ATOM   9965  C CZ  . TYR B 1 545 ? 20.244  -16.320 19.098  1.00 30.44  ? 567  TYR B CZ  1 
ATOM   9966  O OH  . TYR B 1 545 ? 19.738  -16.659 17.860  1.00 28.34  ? 567  TYR B OH  1 
ATOM   9967  N N   . PHE B 1 546 ? 22.047  -13.142 25.584  1.00 33.38  ? 568  PHE B N   1 
ATOM   9968  C CA  . PHE B 1 546 ? 22.073  -12.874 27.033  1.00 29.20  ? 568  PHE B CA  1 
ATOM   9969  C C   . PHE B 1 546 ? 20.793  -12.198 27.507  1.00 31.56  ? 568  PHE B C   1 
ATOM   9970  O O   . PHE B 1 546 ? 20.362  -12.388 28.652  1.00 31.47  ? 568  PHE B O   1 
ATOM   9971  C CB  . PHE B 1 546 ? 23.252  -11.981 27.422  1.00 26.05  ? 568  PHE B CB  1 
ATOM   9972  C CG  . PHE B 1 546 ? 24.576  -12.694 27.477  1.00 27.46  ? 568  PHE B CG  1 
ATOM   9973  C CD1 . PHE B 1 546 ? 24.790  -13.730 28.381  1.00 28.73  ? 568  PHE B CD1 1 
ATOM   9974  C CD2 . PHE B 1 546 ? 25.627  -12.294 26.659  1.00 29.19  ? 568  PHE B CD2 1 
ATOM   9975  C CE1 . PHE B 1 546 ? 26.021  -14.371 28.445  1.00 29.84  ? 568  PHE B CE1 1 
ATOM   9976  C CE2 . PHE B 1 546 ? 26.865  -12.927 26.723  1.00 32.30  ? 568  PHE B CE2 1 
ATOM   9977  C CZ  . PHE B 1 546 ? 27.057  -13.971 27.619  1.00 32.01  ? 568  PHE B CZ  1 
ATOM   9978  N N   . ARG B 1 547 ? 20.179  -11.430 26.609  1.00 33.88  ? 569  ARG B N   1 
ATOM   9979  C CA  . ARG B 1 547 ? 18.981  -10.650 26.915  1.00 38.54  ? 569  ARG B CA  1 
ATOM   9980  C C   . ARG B 1 547 ? 17.754  -11.514 27.146  1.00 32.01  ? 569  ARG B C   1 
ATOM   9981  O O   . ARG B 1 547 ? 16.784  -11.076 27.756  1.00 29.79  ? 569  ARG B O   1 
ATOM   9982  C CB  . ARG B 1 547 ? 18.666  -9.710  25.754  1.00 45.72  ? 569  ARG B CB  1 
ATOM   9983  C CG  . ARG B 1 547 ? 19.079  -8.298  25.995  1.00 53.06  ? 569  ARG B CG  1 
ATOM   9984  C CD  . ARG B 1 547 ? 19.252  -7.547  24.685  1.00 58.96  ? 569  ARG B CD  1 
ATOM   9985  N NE  . ARG B 1 547 ? 20.001  -6.327  24.942  1.00 61.29  ? 569  ARG B NE  1 
ATOM   9986  C CZ  . ARG B 1 547 ? 20.440  -5.509  24.000  1.00 62.11  ? 569  ARG B CZ  1 
ATOM   9987  N NH1 . ARG B 1 547 ? 20.199  -5.776  22.719  1.00 61.15  ? 569  ARG B NH1 1 
ATOM   9988  N NH2 . ARG B 1 547 ? 21.121  -4.423  24.345  1.00 62.65  ? 569  ARG B NH2 1 
ATOM   9989  N N   . ILE B 1 548 ? 17.774  -12.728 26.615  1.00 33.56  ? 570  ILE B N   1 
ATOM   9990  C CA  . ILE B 1 548 ? 16.585  -13.554 26.676  1.00 36.06  ? 570  ILE B CA  1 
ATOM   9991  C C   . ILE B 1 548 ? 16.694  -14.515 27.845  1.00 35.73  ? 570  ILE B C   1 
ATOM   9992  O O   . ILE B 1 548 ? 17.507  -15.435 27.816  1.00 34.21  ? 570  ILE B O   1 
ATOM   9993  C CB  . ILE B 1 548 ? 16.399  -14.349 25.394  1.00 33.85  ? 570  ILE B CB  1 
ATOM   9994  C CG1 . ILE B 1 548 ? 16.484  -13.416 24.176  1.00 31.43  ? 570  ILE B CG1 1 
ATOM   9995  C CG2 . ILE B 1 548 ? 15.075  -15.107 25.443  1.00 30.56  ? 570  ILE B CG2 1 
ATOM   9996  C CD1 . ILE B 1 548 ? 16.791  -14.133 22.890  1.00 31.55  ? 570  ILE B CD1 1 
ATOM   9997  N N   . ALA B 1 549 ? 15.856  -14.299 28.855  1.00 37.18  ? 571  ALA B N   1 
ATOM   9998  C CA  . ALA B 1 549 ? 15.891  -15.100 30.072  1.00 35.02  ? 571  ALA B CA  1 
ATOM   9999  C C   . ALA B 1 549 ? 15.723  -16.581 29.753  1.00 29.47  ? 571  ALA B C   1 
ATOM   10000 O O   . ALA B 1 549 ? 16.396  -17.428 30.329  1.00 27.99  ? 571  ALA B O   1 
ATOM   10001 C CB  . ALA B 1 549 ? 14.812  -14.636 31.025  1.00 36.37  ? 571  ALA B CB  1 
ATOM   10002 N N   . GLY B 1 550 ? 14.859  -16.876 28.788  1.00 22.54  ? 572  GLY B N   1 
ATOM   10003 C CA  . GLY B 1 550 ? 14.466  -18.243 28.505  1.00 35.30  ? 572  GLY B CA  1 
ATOM   10004 C C   . GLY B 1 550 ? 15.431  -19.120 27.721  1.00 33.96  ? 572  GLY B C   1 
ATOM   10005 O O   . GLY B 1 550 ? 15.246  -20.330 27.673  1.00 34.76  ? 572  GLY B O   1 
ATOM   10006 N N   . VAL B 1 551 ? 16.411  -18.527 27.051  1.00 33.31  ? 573  VAL B N   1 
ATOM   10007 C CA  . VAL B 1 551 ? 17.480  -19.320 26.436  1.00 33.82  ? 573  VAL B CA  1 
ATOM   10008 C C   . VAL B 1 551 ? 18.585  -19.645 27.445  1.00 30.80  ? 573  VAL B C   1 
ATOM   10009 O O   . VAL B 1 551 ? 18.785  -18.919 28.414  1.00 30.35  ? 573  VAL B O   1 
ATOM   10010 C CB  . VAL B 1 551 ? 18.069  -18.626 25.194  1.00 34.53  ? 573  VAL B CB  1 
ATOM   10011 C CG1 . VAL B 1 551 ? 16.952  -18.284 24.216  1.00 31.74  ? 573  VAL B CG1 1 
ATOM   10012 C CG2 . VAL B 1 551 ? 18.835  -17.377 25.601  1.00 34.58  ? 573  VAL B CG2 1 
ATOM   10013 N N   . THR B 1 552 ? 19.310  -20.729 27.230  1.00 29.97  ? 574  THR B N   1 
ATOM   10014 C CA  . THR B 1 552 ? 20.398  -21.040 28.145  1.00 33.70  ? 574  THR B CA  1 
ATOM   10015 C C   . THR B 1 552 ? 21.611  -20.171 27.841  1.00 33.06  ? 574  THR B C   1 
ATOM   10016 O O   . THR B 1 552 ? 21.777  -19.707 26.711  1.00 27.79  ? 574  THR B O   1 
ATOM   10017 C CB  . THR B 1 552 ? 20.769  -22.518 28.095  1.00 36.41  ? 574  THR B CB  1 
ATOM   10018 O OG1 . THR B 1 552 ? 20.823  -22.950 26.725  1.00 38.52  ? 574  THR B OG1 1 
ATOM   10019 C CG2 . THR B 1 552 ? 19.714  -23.328 28.846  1.00 35.80  ? 574  THR B CG2 1 
ATOM   10020 N N   . HIS B 1 553 ? 22.429  -19.933 28.863  1.00 31.40  ? 575  HIS B N   1 
ATOM   10021 C CA  . HIS B 1 553 ? 23.637  -19.129 28.731  1.00 29.35  ? 575  HIS B CA  1 
ATOM   10022 C C   . HIS B 1 553 ? 24.779  -19.804 29.483  1.00 31.64  ? 575  HIS B C   1 
ATOM   10023 O O   . HIS B 1 553 ? 24.623  -20.171 30.656  1.00 29.76  ? 575  HIS B O   1 
ATOM   10024 C CB  . HIS B 1 553 ? 23.430  -17.736 29.318  1.00 30.36  ? 575  HIS B CB  1 
ATOM   10025 C CG  . HIS B 1 553 ? 22.154  -17.075 28.902  1.00 27.88  ? 575  HIS B CG  1 
ATOM   10026 N ND1 . HIS B 1 553 ? 21.030  -17.065 29.699  1.00 29.24  ? 575  HIS B ND1 1 
ATOM   10027 C CD2 . HIS B 1 553 ? 21.833  -16.374 27.789  1.00 29.38  ? 575  HIS B CD2 1 
ATOM   10028 C CE1 . HIS B 1 553 ? 20.067  -16.394 29.090  1.00 29.57  ? 575  HIS B CE1 1 
ATOM   10029 N NE2 . HIS B 1 553 ? 20.529  -15.962 27.931  1.00 26.65  ? 575  HIS B NE2 1 
ATOM   10030 N N   . HIS B 1 554 ? 25.920  -19.968 28.813  1.00 32.83  ? 576  HIS B N   1 
ATOM   10031 C CA  . HIS B 1 554 ? 27.045  -20.703 29.386  1.00 36.28  ? 576  HIS B CA  1 
ATOM   10032 C C   . HIS B 1 554 ? 28.392  -19.991 29.216  1.00 39.96  ? 576  HIS B C   1 
ATOM   10033 O O   . HIS B 1 554 ? 28.882  -19.826 28.098  1.00 40.35  ? 576  HIS B O   1 
ATOM   10034 C CB  . HIS B 1 554 ? 27.116  -22.084 28.737  1.00 35.48  ? 576  HIS B CB  1 
ATOM   10035 C CG  . HIS B 1 554 ? 26.006  -23.001 29.138  1.00 33.00  ? 576  HIS B CG  1 
ATOM   10036 N ND1 . HIS B 1 554 ? 26.014  -23.701 30.324  1.00 31.94  ? 576  HIS B ND1 1 
ATOM   10037 C CD2 . HIS B 1 554 ? 24.862  -23.350 28.501  1.00 33.28  ? 576  HIS B CD2 1 
ATOM   10038 C CE1 . HIS B 1 554 ? 24.922  -24.443 30.403  1.00 32.90  ? 576  HIS B CE1 1 
ATOM   10039 N NE2 . HIS B 1 554 ? 24.203  -24.243 29.313  1.00 33.31  ? 576  HIS B NE2 1 
ATOM   10040 N N   . LEU B 1 555 ? 28.960  -19.544 30.333  1.00 39.77  ? 577  LEU B N   1 
ATOM   10041 C CA  . LEU B 1 555 ? 30.277  -18.906 30.366  1.00 39.16  ? 577  LEU B CA  1 
ATOM   10042 C C   . LEU B 1 555 ? 31.421  -19.769 30.907  1.00 38.53  ? 577  LEU B C   1 
ATOM   10043 O O   . LEU B 1 555 ? 32.535  -19.281 31.091  1.00 40.57  ? 577  LEU B O   1 
ATOM   10044 C CB  . LEU B 1 555 ? 30.209  -17.550 31.075  1.00 39.85  ? 577  LEU B CB  1 
ATOM   10045 C CG  . LEU B 1 555 ? 29.361  -16.501 30.347  1.00 38.70  ? 577  LEU B CG  1 
ATOM   10046 C CD1 . LEU B 1 555 ? 29.485  -15.142 31.015  1.00 41.04  ? 577  LEU B CD1 1 
ATOM   10047 C CD2 . LEU B 1 555 ? 29.761  -16.402 28.899  1.00 36.06  ? 577  LEU B CD2 1 
ATOM   10048 N N   . GLU B 1 556 ? 31.127  -21.030 31.212  1.00 37.86  ? 578  GLU B N   1 
ATOM   10049 C CA  . GLU B 1 556 ? 32.075  -21.924 31.880  1.00 38.19  ? 578  GLU B CA  1 
ATOM   10050 C C   . GLU B 1 556 ? 33.427  -22.042 31.163  1.00 40.14  ? 578  GLU B C   1 
ATOM   10051 O O   . GLU B 1 556 ? 34.437  -22.348 31.807  1.00 40.57  ? 578  GLU B O   1 
ATOM   10052 C CB  . GLU B 1 556 ? 31.490  -23.338 32.018  1.00 42.59  ? 578  GLU B CB  1 
ATOM   10053 C CG  . GLU B 1 556 ? 30.178  -23.459 32.759  1.00 44.01  ? 578  GLU B CG  1 
ATOM   10054 C CD  . GLU B 1 556 ? 28.988  -23.144 31.876  1.00 48.47  ? 578  GLU B CD  1 
ATOM   10055 O OE1 . GLU B 1 556 ? 29.223  -22.627 30.768  1.00 50.32  ? 578  GLU B OE1 1 
ATOM   10056 O OE2 . GLU B 1 556 ? 27.831  -23.409 32.278  1.00 47.66  ? 578  GLU B OE2 1 
ATOM   10057 N N   . PHE B 1 557 ? 33.448  -21.815 29.845  1.00 36.56  ? 579  PHE B N   1 
ATOM   10058 C CA  . PHE B 1 557 ? 34.677  -21.989 29.057  1.00 35.07  ? 579  PHE B CA  1 
ATOM   10059 C C   . PHE B 1 557 ? 35.823  -21.119 29.548  1.00 36.91  ? 579  PHE B C   1 
ATOM   10060 O O   . PHE B 1 557 ? 36.980  -21.421 29.295  1.00 39.34  ? 579  PHE B O   1 
ATOM   10061 C CB  . PHE B 1 557 ? 34.434  -21.741 27.555  1.00 36.44  ? 579  PHE B CB  1 
ATOM   10062 C CG  . PHE B 1 557 ? 33.916  -20.362 27.227  1.00 37.27  ? 579  PHE B CG  1 
ATOM   10063 C CD1 . PHE B 1 557 ? 34.790  -19.312 26.985  1.00 36.30  ? 579  PHE B CD1 1 
ATOM   10064 C CD2 . PHE B 1 557 ? 32.553  -20.123 27.137  1.00 38.63  ? 579  PHE B CD2 1 
ATOM   10065 C CE1 . PHE B 1 557 ? 34.309  -18.036 26.679  1.00 35.16  ? 579  PHE B CE1 1 
ATOM   10066 C CE2 . PHE B 1 557 ? 32.069  -18.856 26.826  1.00 38.13  ? 579  PHE B CE2 1 
ATOM   10067 C CZ  . PHE B 1 557 ? 32.949  -17.810 26.596  1.00 35.61  ? 579  PHE B CZ  1 
ATOM   10068 N N   . ILE B 1 558 ? 35.484  -20.050 30.265  1.00 38.82  ? 580  ILE B N   1 
ATOM   10069 C CA  . ILE B 1 558 ? 36.451  -19.063 30.739  1.00 39.13  ? 580  ILE B CA  1 
ATOM   10070 C C   . ILE B 1 558 ? 37.612  -19.687 31.531  1.00 41.75  ? 580  ILE B C   1 
ATOM   10071 O O   . ILE B 1 558 ? 38.754  -19.241 31.423  1.00 40.70  ? 580  ILE B O   1 
ATOM   10072 C CB  . ILE B 1 558 ? 35.722  -17.963 31.568  1.00 45.93  ? 580  ILE B CB  1 
ATOM   10073 C CG1 . ILE B 1 558 ? 34.971  -17.012 30.637  1.00 48.94  ? 580  ILE B CG1 1 
ATOM   10074 C CG2 . ILE B 1 558 ? 36.690  -17.160 32.411  1.00 46.21  ? 580  ILE B CG2 1 
ATOM   10075 C CD1 . ILE B 1 558 ? 34.032  -16.052 31.357  1.00 48.77  ? 580  ILE B CD1 1 
ATOM   10076 N N   . GLN B 1 559 ? 37.314  -20.738 32.293  1.00 42.33  ? 581  GLN B N   1 
ATOM   10077 C CA  . GLN B 1 559 ? 38.287  -21.371 33.180  1.00 45.93  ? 581  GLN B CA  1 
ATOM   10078 C C   . GLN B 1 559 ? 39.338  -22.248 32.483  1.00 44.69  ? 581  GLN B C   1 
ATOM   10079 O O   . GLN B 1 559 ? 40.393  -22.505 33.055  1.00 40.21  ? 581  GLN B O   1 
ATOM   10080 C CB  . GLN B 1 559 ? 37.558  -22.209 34.251  1.00 50.41  ? 581  GLN B CB  1 
ATOM   10081 C CG  . GLN B 1 559 ? 36.943  -23.473 33.674  1.00 57.42  ? 581  GLN B CG  1 
ATOM   10082 C CD  . GLN B 1 559 ? 36.108  -24.248 34.665  1.00 62.53  ? 581  GLN B CD  1 
ATOM   10083 O OE1 . GLN B 1 559 ? 36.458  -24.359 35.844  1.00 66.86  ? 581  GLN B OE1 1 
ATOM   10084 N NE2 . GLN B 1 559 ? 34.998  -24.805 34.188  1.00 60.03  ? 581  GLN B NE2 1 
ATOM   10085 N N   . ASN B 1 560 ? 39.064  -22.708 31.265  1.00 49.13  ? 582  ASN B N   1 
ATOM   10086 C CA  . ASN B 1 560 ? 39.947  -23.685 30.626  1.00 53.77  ? 582  ASN B CA  1 
ATOM   10087 C C   . ASN B 1 560 ? 41.291  -23.121 30.183  1.00 54.02  ? 582  ASN B C   1 
ATOM   10088 O O   . ASN B 1 560 ? 42.271  -23.852 30.058  1.00 58.48  ? 582  ASN B O   1 
ATOM   10089 C CB  . ASN B 1 560 ? 39.250  -24.349 29.446  1.00 56.72  ? 582  ASN B CB  1 
ATOM   10090 C CG  . ASN B 1 560 ? 38.122  -25.261 29.878  1.00 62.63  ? 582  ASN B CG  1 
ATOM   10091 O OD1 . ASN B 1 560 ? 37.025  -24.801 30.200  1.00 62.52  ? 582  ASN B OD1 1 
ATOM   10092 N ND2 . ASN B 1 560 ? 38.384  -26.566 29.889  1.00 67.36  ? 582  ASN B ND2 1 
ATOM   10093 N N   . PHE B 1 561 ? 41.331  -21.814 29.965  1.00 50.09  ? 583  PHE B N   1 
ATOM   10094 C CA  . PHE B 1 561 ? 42.525  -21.148 29.461  1.00 44.39  ? 583  PHE B CA  1 
ATOM   10095 C C   . PHE B 1 561 ? 43.568  -20.965 30.562  1.00 45.43  ? 583  PHE B C   1 
ATOM   10096 O O   . PHE B 1 561 ? 43.258  -20.433 31.618  1.00 48.87  ? 583  PHE B O   1 
ATOM   10097 C CB  . PHE B 1 561 ? 42.138  -19.792 28.879  1.00 38.09  ? 583  PHE B CB  1 
ATOM   10098 C CG  . PHE B 1 561 ? 41.057  -19.873 27.845  1.00 38.19  ? 583  PHE B CG  1 
ATOM   10099 C CD1 . PHE B 1 561 ? 41.345  -20.303 26.557  1.00 38.33  ? 583  PHE B CD1 1 
ATOM   10100 C CD2 . PHE B 1 561 ? 39.749  -19.521 28.156  1.00 36.40  ? 583  PHE B CD2 1 
ATOM   10101 C CE1 . PHE B 1 561 ? 40.351  -20.388 25.596  1.00 37.39  ? 583  PHE B CE1 1 
ATOM   10102 C CE2 . PHE B 1 561 ? 38.751  -19.602 27.195  1.00 38.87  ? 583  PHE B CE2 1 
ATOM   10103 C CZ  . PHE B 1 561 ? 39.055  -20.031 25.911  1.00 36.46  ? 583  PHE B CZ  1 
ATOM   10104 N N   . THR B 1 562 ? 44.787  -21.446 30.336  1.00 42.96  ? 584  THR B N   1 
ATOM   10105 C CA  . THR B 1 562 ? 45.863  -21.235 31.303  1.00 47.20  ? 584  THR B CA  1 
ATOM   10106 C C   . THR B 1 562 ? 46.614  -19.922 31.118  1.00 48.17  ? 584  THR B C   1 
ATOM   10107 O O   . THR B 1 562 ? 47.311  -19.468 32.020  1.00 49.94  ? 584  THR B O   1 
ATOM   10108 C CB  . THR B 1 562 ? 46.870  -22.389 31.289  1.00 50.42  ? 584  THR B CB  1 
ATOM   10109 O OG1 . THR B 1 562 ? 47.648  -22.332 30.089  1.00 54.53  ? 584  THR B OG1 1 
ATOM   10110 C CG2 . THR B 1 562 ? 46.139  -23.713 31.354  1.00 51.07  ? 584  THR B CG2 1 
ATOM   10111 N N   . ASN B 1 563 ? 46.548  -19.363 29.917  1.00 47.25  ? 585  ASN B N   1 
ATOM   10112 C CA  . ASN B 1 563 ? 47.188  -18.081 29.629  1.00 47.76  ? 585  ASN B CA  1 
ATOM   10113 C C   . ASN B 1 563 ? 46.278  -16.839 29.550  1.00 44.51  ? 585  ASN B C   1 
ATOM   10114 O O   . ASN B 1 563 ? 46.763  -15.729 29.302  1.00 46.77  ? 585  ASN B O   1 
ATOM   10115 C CB  . ASN B 1 563 ? 48.056  -18.196 28.372  1.00 55.32  ? 585  ASN B CB  1 
ATOM   10116 C CG  . ASN B 1 563 ? 49.125  -19.277 28.497  1.00 62.52  ? 585  ASN B CG  1 
ATOM   10117 O OD1 . ASN B 1 563 ? 48.815  -20.451 28.701  1.00 64.71  ? 585  ASN B OD1 1 
ATOM   10118 N ND2 . ASN B 1 563 ? 50.388  -18.883 28.356  1.00 63.68  ? 585  ASN B ND2 1 
ATOM   10119 N N   . LEU B 1 564 ? 44.969  -17.014 29.707  1.00 37.76  ? 586  LEU B N   1 
ATOM   10120 C CA  . LEU B 1 564 ? 44.055  -15.881 29.530  1.00 37.34  ? 586  LEU B CA  1 
ATOM   10121 C C   . LEU B 1 564 ? 44.379  -14.770 30.541  1.00 40.79  ? 586  LEU B C   1 
ATOM   10122 O O   . LEU B 1 564 ? 44.483  -15.014 31.746  1.00 41.83  ? 586  LEU B O   1 
ATOM   10123 C CB  . LEU B 1 564 ? 42.590  -16.321 29.633  1.00 30.82  ? 586  LEU B CB  1 
ATOM   10124 C CG  . LEU B 1 564 ? 41.489  -15.342 29.226  1.00 39.64  ? 586  LEU B CG  1 
ATOM   10125 C CD1 . LEU B 1 564 ? 41.545  -15.051 27.730  1.00 38.19  ? 586  LEU B CD1 1 
ATOM   10126 C CD2 . LEU B 1 564 ? 40.111  -15.897 29.605  1.00 39.47  ? 586  LEU B CD2 1 
ATOM   10127 N N   . LYS B 1 565 ? 44.571  -13.562 30.020  1.00 41.25  ? 587  LYS B N   1 
ATOM   10128 C CA  . LYS B 1 565 ? 44.945  -12.389 30.808  1.00 40.24  ? 587  LYS B CA  1 
ATOM   10129 C C   . LYS B 1 565 ? 43.793  -11.388 30.931  1.00 37.95  ? 587  LYS B C   1 
ATOM   10130 O O   . LYS B 1 565 ? 43.421  -10.987 32.031  1.00 38.55  ? 587  LYS B O   1 
ATOM   10131 C CB  . LYS B 1 565 ? 46.142  -11.659 30.202  1.00 40.65  ? 587  LYS B CB  1 
ATOM   10132 C CG  . LYS B 1 565 ? 47.470  -12.378 30.323  1.00 47.76  ? 587  LYS B CG  1 
ATOM   10133 C CD  . LYS B 1 565 ? 48.603  -11.435 29.943  1.00 53.43  ? 587  LYS B CD  1 
ATOM   10134 C CE  . LYS B 1 565 ? 49.960  -12.119 30.039  1.00 57.42  ? 587  LYS B CE  1 
ATOM   10135 N NZ  . LYS B 1 565 ? 51.058  -11.131 29.835  1.00 57.03  ? 587  LYS B NZ  1 
ATOM   10136 N N   . VAL B 1 566 ? 43.319  -10.920 29.780  1.00 36.87  ? 588  VAL B N   1 
ATOM   10137 C CA  . VAL B 1 566 ? 42.334  -9.857  29.681  1.00 37.22  ? 588  VAL B CA  1 
ATOM   10138 C C   . VAL B 1 566 ? 41.077  -10.402 29.003  1.00 38.53  ? 588  VAL B C   1 
ATOM   10139 O O   . VAL B 1 566 ? 41.152  -11.016 27.928  1.00 37.88  ? 588  VAL B O   1 
ATOM   10140 C CB  . VAL B 1 566 ? 42.885  -8.714  28.816  1.00 37.02  ? 588  VAL B CB  1 
ATOM   10141 C CG1 . VAL B 1 566 ? 41.877  -7.560  28.715  1.00 35.52  ? 588  VAL B CG1 1 
ATOM   10142 C CG2 . VAL B 1 566 ? 44.221  -8.240  29.360  1.00 30.40  ? 588  VAL B CG2 1 
ATOM   10143 N N   . LEU B 1 567 ? 39.928  -10.172 29.629  1.00 35.21  ? 589  LEU B N   1 
ATOM   10144 C CA  . LEU B 1 567 ? 38.648  -10.613 29.100  1.00 36.07  ? 589  LEU B CA  1 
ATOM   10145 C C   . LEU B 1 567 ? 37.646  -9.474  29.151  1.00 35.79  ? 589  LEU B C   1 
ATOM   10146 O O   . LEU B 1 567 ? 37.396  -8.900  30.219  1.00 39.12  ? 589  LEU B O   1 
ATOM   10147 C CB  . LEU B 1 567 ? 38.112  -11.788 29.919  1.00 33.53  ? 589  LEU B CB  1 
ATOM   10148 C CG  . LEU B 1 567 ? 36.740  -12.276 29.460  1.00 31.84  ? 589  LEU B CG  1 
ATOM   10149 C CD1 . LEU B 1 567 ? 36.819  -12.896 28.069  1.00 26.02  ? 589  LEU B CD1 1 
ATOM   10150 C CD2 . LEU B 1 567 ? 36.155  -13.257 30.462  1.00 35.77  ? 589  LEU B CD2 1 
ATOM   10151 N N   . ASN B 1 568 ? 37.070  -9.143  28.001  1.00 30.72  ? 590  ASN B N   1 
ATOM   10152 C CA  . ASN B 1 568 ? 36.088  -8.067  27.927  1.00 30.07  ? 590  ASN B CA  1 
ATOM   10153 C C   . ASN B 1 568 ? 34.669  -8.597  27.672  1.00 30.00  ? 590  ASN B C   1 
ATOM   10154 O O   . ASN B 1 568 ? 34.328  -9.005  26.554  1.00 29.71  ? 590  ASN B O   1 
ATOM   10155 C CB  . ASN B 1 568 ? 36.481  -7.045  26.839  1.00 29.79  ? 590  ASN B CB  1 
ATOM   10156 C CG  . ASN B 1 568 ? 35.740  -5.720  26.988  1.00 34.72  ? 590  ASN B CG  1 
ATOM   10157 O OD1 . ASN B 1 568 ? 34.764  -5.645  27.732  1.00 37.29  ? 590  ASN B OD1 1 
ATOM   10158 N ND2 . ASN B 1 568 ? 36.163  -4.683  26.258  1.00 34.30  ? 590  ASN B ND2 1 
ATOM   10159 N N   . LEU B 1 569 ? 33.846  -8.573  28.718  1.00 26.49  ? 591  LEU B N   1 
ATOM   10160 C CA  . LEU B 1 569 ? 32.417  -8.945  28.639  1.00 24.71  ? 591  LEU B CA  1 
ATOM   10161 C C   . LEU B 1 569 ? 31.438  -7.752  28.522  1.00 28.63  ? 591  LEU B C   1 
ATOM   10162 O O   . LEU B 1 569 ? 30.235  -7.899  28.786  1.00 28.46  ? 591  LEU B O   1 
ATOM   10163 C CB  . LEU B 1 569 ? 32.021  -9.914  29.764  1.00 29.29  ? 591  LEU B CB  1 
ATOM   10164 C CG  . LEU B 1 569 ? 32.680  -11.308 29.757  1.00 29.84  ? 591  LEU B CG  1 
ATOM   10165 C CD1 . LEU B 1 569 ? 32.318  -12.097 31.009  1.00 24.84  ? 591  LEU B CD1 1 
ATOM   10166 C CD2 . LEU B 1 569 ? 32.293  -12.111 28.513  1.00 28.55  ? 591  LEU B CD2 1 
ATOM   10167 N N   . SER B 1 570 ? 31.965  -6.559  28.238  1.00 29.16  ? 592  SER B N   1 
ATOM   10168 C CA  . SER B 1 570 ? 31.149  -5.343  28.242  1.00 29.85  ? 592  SER B CA  1 
ATOM   10169 C C   . SER B 1 570 ? 29.927  -5.328  27.311  1.00 31.61  ? 592  SER B C   1 
ATOM   10170 O O   . SER B 1 570 ? 29.945  -5.909  26.220  1.00 28.93  ? 592  SER B O   1 
ATOM   10171 C CB  . SER B 1 570 ? 31.998  -4.086  27.989  1.00 32.81  ? 592  SER B CB  1 
ATOM   10172 O OG  . SER B 1 570 ? 32.405  -4.002  26.633  1.00 35.58  ? 592  SER B OG  1 
ATOM   10173 N N   . HIS B 1 571 ? 28.875  -4.649  27.777  1.00 30.91  ? 593  HIS B N   1 
ATOM   10174 C CA  . HIS B 1 571 ? 27.688  -4.325  26.979  1.00 33.14  ? 593  HIS B CA  1 
ATOM   10175 C C   . HIS B 1 571 ? 26.997  -5.564  26.458  1.00 31.86  ? 593  HIS B C   1 
ATOM   10176 O O   . HIS B 1 571 ? 26.470  -5.580  25.358  1.00 33.32  ? 593  HIS B O   1 
ATOM   10177 C CB  . HIS B 1 571 ? 28.036  -3.369  25.826  1.00 35.05  ? 593  HIS B CB  1 
ATOM   10178 C CG  . HIS B 1 571 ? 28.542  -2.043  26.290  1.00 36.53  ? 593  HIS B CG  1 
ATOM   10179 N ND1 . HIS B 1 571 ? 29.886  -1.738  26.350  1.00 39.10  ? 593  HIS B ND1 1 
ATOM   10180 C CD2 . HIS B 1 571 ? 27.889  -0.960  26.773  1.00 31.14  ? 593  HIS B CD2 1 
ATOM   10181 C CE1 . HIS B 1 571 ? 30.037  -0.514  26.823  1.00 37.14  ? 593  HIS B CE1 1 
ATOM   10182 N NE2 . HIS B 1 571 ? 28.840  -0.021  27.088  1.00 33.01  ? 593  HIS B NE2 1 
ATOM   10183 N N   . ASN B 1 572 ? 27.038  -6.615  27.258  1.00 30.04  ? 594  ASN B N   1 
ATOM   10184 C CA  . ASN B 1 572 ? 26.394  -7.858  26.900  1.00 32.53  ? 594  ASN B CA  1 
ATOM   10185 C C   . ASN B 1 572 ? 25.024  -8.046  27.548  1.00 33.66  ? 594  ASN B C   1 
ATOM   10186 O O   . ASN B 1 572 ? 24.328  -9.025  27.272  1.00 33.48  ? 594  ASN B O   1 
ATOM   10187 C CB  . ASN B 1 572 ? 27.323  -9.015  27.248  1.00 30.51  ? 594  ASN B CB  1 
ATOM   10188 C CG  . ASN B 1 572 ? 28.279  -9.317  26.123  1.00 30.12  ? 594  ASN B CG  1 
ATOM   10189 O OD1 . ASN B 1 572 ? 27.857  -9.428  24.984  1.00 26.28  ? 594  ASN B OD1 1 
ATOM   10190 N ND2 . ASN B 1 572 ? 29.565  -9.429  26.427  1.00 28.30  ? 594  ASN B ND2 1 
ATOM   10191 N N   . ASN B 1 573 ? 24.654  -7.110  28.412  1.00 33.60  ? 595  ASN B N   1 
ATOM   10192 C CA  . ASN B 1 573 ? 23.388  -7.194  29.126  1.00 39.16  ? 595  ASN B CA  1 
ATOM   10193 C C   . ASN B 1 573 ? 23.221  -8.466  29.957  1.00 35.40  ? 595  ASN B C   1 
ATOM   10194 O O   . ASN B 1 573 ? 22.116  -8.995  30.062  1.00 32.11  ? 595  ASN B O   1 
ATOM   10195 C CB  . ASN B 1 573 ? 22.231  -7.084  28.139  1.00 46.88  ? 595  ASN B CB  1 
ATOM   10196 C CG  . ASN B 1 573 ? 21.141  -6.202  28.644  1.00 55.49  ? 595  ASN B CG  1 
ATOM   10197 O OD1 . ASN B 1 573 ? 21.187  -4.988  28.458  1.00 62.91  ? 595  ASN B OD1 1 
ATOM   10198 N ND2 . ASN B 1 573 ? 20.158  -6.793  29.313  1.00 54.09  ? 595  ASN B ND2 1 
ATOM   10199 N N   . ILE B 1 574 ? 24.304  -8.948  30.563  1.00 31.69  ? 596  ILE B N   1 
ATOM   10200 C CA  . ILE B 1 574 ? 24.217  -10.202 31.293  1.00 31.11  ? 596  ILE B CA  1 
ATOM   10201 C C   . ILE B 1 574 ? 23.436  -9.970  32.587  1.00 30.62  ? 596  ILE B C   1 
ATOM   10202 O O   . ILE B 1 574 ? 23.827  -9.140  33.414  1.00 24.69  ? 596  ILE B O   1 
ATOM   10203 C CB  . ILE B 1 574 ? 25.635  -10.679 31.646  1.00 30.54  ? 596  ILE B CB  1 
ATOM   10204 C CG1 . ILE B 1 574 ? 26.455  -10.873 30.365  1.00 29.99  ? 596  ILE B CG1 1 
ATOM   10205 C CG2 . ILE B 1 574 ? 25.603  -11.948 32.492  1.00 25.39  ? 596  ILE B CG2 1 
ATOM   10206 C CD1 . ILE B 1 574 ? 27.927  -11.139 30.630  1.00 28.86  ? 596  ILE B CD1 1 
ATOM   10207 N N   . TYR B 1 575 ? 22.255  -10.587 32.687  1.00 33.41  ? 597  TYR B N   1 
ATOM   10208 C CA  . TYR B 1 575 ? 21.560  -10.773 33.962  1.00 34.90  ? 597  TYR B CA  1 
ATOM   10209 C C   . TYR B 1 575 ? 21.319  -12.200 34.470  1.00 36.50  ? 597  TYR B C   1 
ATOM   10210 O O   . TYR B 1 575 ? 20.838  -12.377 35.592  1.00 35.02  ? 597  TYR B O   1 
ATOM   10211 C CB  . TYR B 1 575 ? 20.256  -9.974  33.996  1.00 36.92  ? 597  TYR B CB  1 
ATOM   10212 C CG  . TYR B 1 575 ? 19.186  -10.449 33.042  1.00 35.08  ? 597  TYR B CG  1 
ATOM   10213 C CD1 . TYR B 1 575 ? 19.383  -10.389 31.662  1.00 31.10  ? 597  TYR B CD1 1 
ATOM   10214 C CD2 . TYR B 1 575 ? 17.964  -10.939 33.520  1.00 34.63  ? 597  TYR B CD2 1 
ATOM   10215 C CE1 . TYR B 1 575 ? 18.402  -10.809 30.775  1.00 26.81  ? 597  TYR B CE1 1 
ATOM   10216 C CE2 . TYR B 1 575 ? 16.968  -11.354 32.637  1.00 34.26  ? 597  TYR B CE2 1 
ATOM   10217 C CZ  . TYR B 1 575 ? 17.203  -11.283 31.265  1.00 32.52  ? 597  TYR B CZ  1 
ATOM   10218 O OH  . TYR B 1 575 ? 16.245  -11.690 30.376  1.00 39.28  ? 597  TYR B OH  1 
ATOM   10219 N N   . THR B 1 576 ? 21.573  -13.207 33.638  1.00 35.48  ? 598  THR B N   1 
ATOM   10220 C CA  . THR B 1 576 ? 21.269  -14.584 34.036  1.00 33.97  ? 598  THR B CA  1 
ATOM   10221 C C   . THR B 1 576 ? 22.117  -15.628 33.314  1.00 36.45  ? 598  THR B C   1 
ATOM   10222 O O   . THR B 1 576 ? 22.334  -15.531 32.111  1.00 37.26  ? 598  THR B O   1 
ATOM   10223 C CB  . THR B 1 576 ? 19.757  -14.905 33.866  1.00 29.46  ? 598  THR B CB  1 
ATOM   10224 O OG1 . THR B 1 576 ? 19.510  -16.282 34.185  1.00 32.86  ? 598  THR B OG1 1 
ATOM   10225 C CG2 . THR B 1 576 ? 19.285  -14.619 32.443  1.00 30.24  ? 598  THR B CG2 1 
ATOM   10226 N N   . LEU B 1 577 ? 22.555  -16.647 34.046  1.00 39.58  ? 599  LEU B N   1 
ATOM   10227 C CA  . LEU B 1 577 ? 23.364  -17.718 33.471  1.00 40.96  ? 599  LEU B CA  1 
ATOM   10228 C C   . LEU B 1 577 ? 22.786  -19.059 33.883  1.00 38.52  ? 599  LEU B C   1 
ATOM   10229 O O   . LEU B 1 577 ? 22.051  -19.150 34.863  1.00 32.35  ? 599  LEU B O   1 
ATOM   10230 C CB  . LEU B 1 577 ? 24.827  -17.625 33.922  1.00 39.02  ? 599  LEU B CB  1 
ATOM   10231 C CG  . LEU B 1 577 ? 25.616  -16.361 33.580  1.00 36.38  ? 599  LEU B CG  1 
ATOM   10232 C CD1 . LEU B 1 577 ? 26.950  -16.374 34.305  1.00 33.91  ? 599  LEU B CD1 1 
ATOM   10233 C CD2 . LEU B 1 577 ? 25.823  -16.251 32.086  1.00 34.82  ? 599  LEU B CD2 1 
ATOM   10234 N N   . THR B 1 578 ? 23.136  -20.094 33.132  1.00 40.65  ? 600  THR B N   1 
ATOM   10235 C CA  . THR B 1 578 ? 22.589  -21.424 33.332  1.00 43.67  ? 600  THR B CA  1 
ATOM   10236 C C   . THR B 1 578 ? 23.532  -22.302 34.140  1.00 44.57  ? 600  THR B C   1 
ATOM   10237 O O   . THR B 1 578 ? 24.671  -22.519 33.746  1.00 43.97  ? 600  THR B O   1 
ATOM   10238 C CB  . THR B 1 578 ? 22.365  -22.120 31.981  1.00 44.21  ? 600  THR B CB  1 
ATOM   10239 O OG1 . THR B 1 578 ? 21.614  -21.262 31.120  1.00 38.03  ? 600  THR B OG1 1 
ATOM   10240 C CG2 . THR B 1 578 ? 21.618  -23.427 32.174  1.00 47.69  ? 600  THR B CG2 1 
ATOM   10241 N N   . ASP B 1 579 ? 23.058  -22.751 35.297  1.00 46.56  ? 601  ASP B N   1 
ATOM   10242 C CA  . ASP B 1 579 ? 23.703  -23.776 36.127  1.00 49.75  ? 601  ASP B CA  1 
ATOM   10243 C C   . ASP B 1 579 ? 25.033  -23.384 36.744  1.00 50.16  ? 601  ASP B C   1 
ATOM   10244 O O   . ASP B 1 579 ? 25.364  -23.852 37.830  1.00 51.79  ? 601  ASP B O   1 
ATOM   10245 C CB  . ASP B 1 579 ? 23.946  -25.060 35.313  1.00 50.77  ? 601  ASP B CB  1 
ATOM   10246 C CG  . ASP B 1 579 ? 22.678  -25.847 35.075  1.00 55.34  ? 601  ASP B CG  1 
ATOM   10247 O OD1 . ASP B 1 579 ? 21.753  -25.745 35.912  1.00 52.42  ? 601  ASP B OD1 1 
ATOM   10248 O OD2 . ASP B 1 579 ? 22.609  -26.568 34.054  1.00 58.69  ? 601  ASP B OD2 1 
ATOM   10249 N N   . LYS B 1 580 ? 25.737  -22.446 36.123  1.00 48.58  ? 602  LYS B N   1 
ATOM   10250 C CA  . LYS B 1 580 ? 27.035  -22.032 36.623  1.00 45.21  ? 602  LYS B CA  1 
ATOM   10251 C C   . LYS B 1 580 ? 27.037  -20.521 36.760  1.00 39.67  ? 602  LYS B C   1 
ATOM   10252 O O   . LYS B 1 580 ? 27.058  -19.804 35.772  1.00 40.95  ? 602  LYS B O   1 
ATOM   10253 C CB  . LYS B 1 580 ? 28.129  -22.479 35.663  1.00 48.77  ? 602  LYS B CB  1 
ATOM   10254 C CG  . LYS B 1 580 ? 29.515  -21.959 36.012  1.00 54.30  ? 602  LYS B CG  1 
ATOM   10255 C CD  . LYS B 1 580 ? 30.020  -22.528 37.319  1.00 56.46  ? 602  LYS B CD  1 
ATOM   10256 C CE  . LYS B 1 580 ? 31.430  -22.033 37.621  1.00 60.21  ? 602  LYS B CE  1 
ATOM   10257 N NZ  . LYS B 1 580 ? 32.481  -22.619 36.733  1.00 60.53  ? 602  LYS B NZ  1 
ATOM   10258 N N   . TYR B 1 581 ? 27.023  -20.048 38.000  1.00 39.28  ? 603  TYR B N   1 
ATOM   10259 C CA  . TYR B 1 581 ? 26.836  -18.630 38.266  1.00 39.57  ? 603  TYR B CA  1 
ATOM   10260 C C   . TYR B 1 581 ? 28.144  -17.878 38.434  1.00 41.72  ? 603  TYR B C   1 
ATOM   10261 O O   . TYR B 1 581 ? 28.166  -16.650 38.370  1.00 43.38  ? 603  TYR B O   1 
ATOM   10262 C CB  . TYR B 1 581 ? 25.969  -18.477 39.519  1.00 39.91  ? 603  TYR B CB  1 
ATOM   10263 C CG  . TYR B 1 581 ? 24.729  -19.338 39.456  1.00 38.88  ? 603  TYR B CG  1 
ATOM   10264 C CD1 . TYR B 1 581 ? 23.803  -19.160 38.432  1.00 35.02  ? 603  TYR B CD1 1 
ATOM   10265 C CD2 . TYR B 1 581 ? 24.487  -20.331 40.401  1.00 38.18  ? 603  TYR B CD2 1 
ATOM   10266 C CE1 . TYR B 1 581 ? 22.677  -19.919 38.346  1.00 32.19  ? 603  TYR B CE1 1 
ATOM   10267 C CE2 . TYR B 1 581 ? 23.340  -21.110 40.328  1.00 39.78  ? 603  TYR B CE2 1 
ATOM   10268 C CZ  . TYR B 1 581 ? 22.438  -20.891 39.286  1.00 38.79  ? 603  TYR B CZ  1 
ATOM   10269 O OH  . TYR B 1 581 ? 21.293  -21.642 39.161  1.00 40.98  ? 603  TYR B OH  1 
ATOM   10270 N N   . ASN B 1 582 ? 29.236  -18.625 38.601  1.00 37.63  ? 604  ASN B N   1 
ATOM   10271 C CA  . ASN B 1 582 ? 30.541  -18.039 38.873  1.00 37.15  ? 604  ASN B CA  1 
ATOM   10272 C C   . ASN B 1 582 ? 31.468  -18.007 37.675  1.00 40.87  ? 604  ASN B C   1 
ATOM   10273 O O   . ASN B 1 582 ? 31.517  -18.947 36.882  1.00 41.54  ? 604  ASN B O   1 
ATOM   10274 C CB  . ASN B 1 582 ? 31.239  -18.804 39.997  1.00 40.40  ? 604  ASN B CB  1 
ATOM   10275 C CG  . ASN B 1 582 ? 30.505  -18.693 41.302  1.00 44.28  ? 604  ASN B CG  1 
ATOM   10276 O OD1 . ASN B 1 582 ? 30.054  -17.612 41.676  1.00 46.38  ? 604  ASN B OD1 1 
ATOM   10277 N ND2 . ASN B 1 582 ? 30.354  -19.814 41.996  1.00 46.34  ? 604  ASN B ND2 1 
ATOM   10278 N N   . LEU B 1 583 ? 32.231  -16.927 37.565  1.00 41.93  ? 605  LEU B N   1 
ATOM   10279 C CA  . LEU B 1 583 ? 33.289  -16.860 36.580  1.00 37.51  ? 605  LEU B CA  1 
ATOM   10280 C C   . LEU B 1 583 ? 34.579  -17.299 37.271  1.00 42.66  ? 605  LEU B C   1 
ATOM   10281 O O   . LEU B 1 583 ? 34.933  -16.788 38.340  1.00 43.93  ? 605  LEU B O   1 
ATOM   10282 C CB  . LEU B 1 583 ? 33.434  -15.449 36.009  1.00 34.55  ? 605  LEU B CB  1 
ATOM   10283 C CG  . LEU B 1 583 ? 32.188  -14.715 35.497  1.00 33.65  ? 605  LEU B CG  1 
ATOM   10284 C CD1 . LEU B 1 583 ? 32.561  -13.568 34.552  1.00 33.46  ? 605  LEU B CD1 1 
ATOM   10285 C CD2 . LEU B 1 583 ? 31.203  -15.657 34.832  1.00 32.38  ? 605  LEU B CD2 1 
ATOM   10286 N N   . GLU B 1 584 ? 35.272  -18.258 36.666  1.00 41.41  ? 606  GLU B N   1 
ATOM   10287 C CA  . GLU B 1 584 ? 36.465  -18.822 37.273  1.00 47.07  ? 606  GLU B CA  1 
ATOM   10288 C C   . GLU B 1 584 ? 37.627  -18.808 36.297  1.00 46.70  ? 606  GLU B C   1 
ATOM   10289 O O   . GLU B 1 584 ? 37.479  -19.196 35.135  1.00 44.98  ? 606  GLU B O   1 
ATOM   10290 C CB  . GLU B 1 584 ? 36.188  -20.239 37.786  1.00 49.72  ? 606  GLU B CB  1 
ATOM   10291 C CG  . GLU B 1 584 ? 35.328  -20.233 39.046  1.00 55.58  ? 606  GLU B CG  1 
ATOM   10292 C CD  . GLU B 1 584 ? 34.815  -21.607 39.450  1.00 59.73  ? 606  GLU B CD  1 
ATOM   10293 O OE1 . GLU B 1 584 ? 35.108  -22.600 38.751  1.00 60.97  ? 606  GLU B OE1 1 
ATOM   10294 O OE2 . GLU B 1 584 ? 34.107  -21.686 40.477  1.00 63.03  ? 606  GLU B OE2 1 
ATOM   10295 N N   . SER B 1 585 ? 38.754  -18.264 36.744  1.00 43.69  ? 607  SER B N   1 
ATOM   10296 C CA  . SER B 1 585 ? 40.006  -18.419 36.025  1.00 40.65  ? 607  SER B CA  1 
ATOM   10297 C C   . SER B 1 585 ? 41.149  -18.304 36.998  1.00 43.48  ? 607  SER B C   1 
ATOM   10298 O O   . SER B 1 585 ? 41.131  -17.436 37.863  1.00 44.52  ? 607  SER B O   1 
ATOM   10299 C CB  . SER B 1 585 ? 40.149  -17.346 34.948  1.00 31.67  ? 607  SER B CB  1 
ATOM   10300 O OG  . SER B 1 585 ? 41.438  -17.400 34.367  1.00 36.11  ? 607  SER B OG  1 
ATOM   10301 N N   . LYS B 1 586 ? 42.159  -19.152 36.842  1.00 43.52  ? 608  LYS B N   1 
ATOM   10302 C CA  . LYS B 1 586 ? 43.369  -19.037 37.655  1.00 45.08  ? 608  LYS B CA  1 
ATOM   10303 C C   . LYS B 1 586 ? 44.357  -18.024 37.080  1.00 47.36  ? 608  LYS B C   1 
ATOM   10304 O O   . LYS B 1 586 ? 45.213  -17.503 37.801  1.00 47.63  ? 608  LYS B O   1 
ATOM   10305 C CB  . LYS B 1 586 ? 44.017  -20.408 37.878  1.00 42.82  ? 608  LYS B CB  1 
ATOM   10306 C CG  . LYS B 1 586 ? 43.158  -21.299 38.741  1.00 46.24  ? 608  LYS B CG  1 
ATOM   10307 C CD  . LYS B 1 586 ? 43.758  -22.671 38.964  1.00 52.64  ? 608  LYS B CD  1 
ATOM   10308 C CE  . LYS B 1 586 ? 43.021  -23.401 40.095  1.00 52.84  ? 608  LYS B CE  1 
ATOM   10309 N NZ  . LYS B 1 586 ? 43.493  -24.814 40.226  1.00 57.19  ? 608  LYS B NZ  1 
ATOM   10310 N N   . SER B 1 587 ? 44.278  -17.821 35.762  1.00 44.26  ? 609  SER B N   1 
ATOM   10311 C CA  . SER B 1 587 ? 45.138  -16.873 35.051  1.00 40.40  ? 609  SER B CA  1 
ATOM   10312 C C   . SER B 1 587 ? 44.659  -15.413 34.997  1.00 39.20  ? 609  SER B C   1 
ATOM   10313 O O   . SER B 1 587 ? 45.480  -14.494 35.029  1.00 37.65  ? 609  SER B O   1 
ATOM   10314 C CB  . SER B 1 587 ? 45.473  -17.383 33.639  1.00 34.94  ? 609  SER B CB  1 
ATOM   10315 O OG  . SER B 1 587 ? 44.343  -17.339 32.776  1.00 34.71  ? 609  SER B OG  1 
ATOM   10316 N N   . LEU B 1 588 ? 43.341  -15.214 34.885  1.00 38.00  ? 610  LEU B N   1 
ATOM   10317 C CA  . LEU B 1 588 ? 42.770  -13.919 34.476  1.00 38.27  ? 610  LEU B CA  1 
ATOM   10318 C C   . LEU B 1 588 ? 43.263  -12.718 35.286  1.00 40.37  ? 610  LEU B C   1 
ATOM   10319 O O   . LEU B 1 588 ? 43.313  -12.753 36.518  1.00 39.52  ? 610  LEU B O   1 
ATOM   10320 C CB  . LEU B 1 588 ? 41.236  -13.949 34.470  1.00 34.42  ? 610  LEU B CB  1 
ATOM   10321 C CG  . LEU B 1 588 ? 40.600  -12.802 33.671  1.00 34.40  ? 610  LEU B CG  1 
ATOM   10322 C CD1 . LEU B 1 588 ? 40.865  -12.951 32.166  1.00 38.11  ? 610  LEU B CD1 1 
ATOM   10323 C CD2 . LEU B 1 588 ? 39.112  -12.682 33.932  1.00 32.54  ? 610  LEU B CD2 1 
ATOM   10324 N N   . VAL B 1 589 ? 43.618  -11.664 34.560  1.00 41.54  ? 611  VAL B N   1 
ATOM   10325 C CA  . VAL B 1 589 ? 44.209  -10.444 35.107  1.00 42.77  ? 611  VAL B CA  1 
ATOM   10326 C C   . VAL B 1 589 ? 43.195  -9.304  35.136  1.00 41.38  ? 611  VAL B C   1 
ATOM   10327 O O   . VAL B 1 589 ? 43.002  -8.657  36.166  1.00 44.43  ? 611  VAL B O   1 
ATOM   10328 C CB  . VAL B 1 589 ? 45.491  -10.022 34.340  1.00 51.93  ? 611  VAL B CB  1 
ATOM   10329 C CG1 . VAL B 1 589 ? 45.904  -8.610  34.711  1.00 51.23  ? 611  VAL B CG1 1 
ATOM   10330 C CG2 . VAL B 1 589 ? 46.617  -10.991 34.634  1.00 54.27  ? 611  VAL B CG2 1 
ATOM   10331 N N   . GLU B 1 590 ? 42.629  -9.002  33.974  1.00 39.13  ? 612  GLU B N   1 
ATOM   10332 C CA  . GLU B 1 590 ? 41.667  -7.922  33.846  1.00 40.43  ? 612  GLU B CA  1 
ATOM   10333 C C   . GLU B 1 590 ? 40.312  -8.401  33.308  1.00 40.69  ? 612  GLU B C   1 
ATOM   10334 O O   . GLU B 1 590 ? 40.249  -9.153  32.332  1.00 40.55  ? 612  GLU B O   1 
ATOM   10335 C CB  . GLU B 1 590 ? 42.246  -6.831  32.949  1.00 39.40  ? 612  GLU B CB  1 
ATOM   10336 C CG  . GLU B 1 590 ? 41.255  -5.769  32.531  1.00 39.78  ? 612  GLU B CG  1 
ATOM   10337 C CD  . GLU B 1 590 ? 41.847  -4.784  31.543  1.00 42.13  ? 612  GLU B CD  1 
ATOM   10338 O OE1 . GLU B 1 590 ? 42.833  -5.136  30.857  1.00 44.05  ? 612  GLU B OE1 1 
ATOM   10339 O OE2 . GLU B 1 590 ? 41.331  -3.656  31.448  1.00 44.90  ? 612  GLU B OE2 1 
ATOM   10340 N N   . LEU B 1 591 ? 39.234  -7.985  33.966  1.00 39.42  ? 613  LEU B N   1 
ATOM   10341 C CA  . LEU B 1 591 ? 37.885  -8.303  33.503  1.00 36.70  ? 613  LEU B CA  1 
ATOM   10342 C C   . LEU B 1 591 ? 37.050  -7.041  33.324  1.00 33.05  ? 613  LEU B C   1 
ATOM   10343 O O   . LEU B 1 591 ? 36.851  -6.275  34.264  1.00 34.20  ? 613  LEU B O   1 
ATOM   10344 C CB  . LEU B 1 591 ? 37.159  -9.256  34.459  1.00 35.45  ? 613  LEU B CB  1 
ATOM   10345 C CG  . LEU B 1 591 ? 35.670  -9.410  34.113  1.00 33.15  ? 613  LEU B CG  1 
ATOM   10346 C CD1 . LEU B 1 591 ? 35.525  -10.108 32.770  1.00 31.26  ? 613  LEU B CD1 1 
ATOM   10347 C CD2 . LEU B 1 591 ? 34.871  -10.135 35.179  1.00 27.52  ? 613  LEU B CD2 1 
ATOM   10348 N N   . VAL B 1 592 ? 36.544  -6.835  32.118  1.00 31.25  ? 614  VAL B N   1 
ATOM   10349 C CA  . VAL B 1 592 ? 35.698  -5.684  31.872  1.00 30.26  ? 614  VAL B CA  1 
ATOM   10350 C C   . VAL B 1 592 ? 34.260  -6.173  31.874  1.00 31.77  ? 614  VAL B C   1 
ATOM   10351 O O   . VAL B 1 592 ? 33.841  -6.916  30.985  1.00 33.94  ? 614  VAL B O   1 
ATOM   10352 C CB  . VAL B 1 592 ? 36.068  -5.020  30.532  1.00 31.93  ? 614  VAL B CB  1 
ATOM   10353 C CG1 . VAL B 1 592 ? 35.163  -3.832  30.247  1.00 25.78  ? 614  VAL B CG1 1 
ATOM   10354 C CG2 . VAL B 1 592 ? 37.530  -4.587  30.570  1.00 29.71  ? 614  VAL B CG2 1 
ATOM   10355 N N   . PHE B 1 593 ? 33.533  -5.820  32.930  1.00 30.38  ? 615  PHE B N   1 
ATOM   10356 C CA  . PHE B 1 593 ? 32.144  -6.230  33.087  1.00 29.72  ? 615  PHE B CA  1 
ATOM   10357 C C   . PHE B 1 593 ? 31.099  -5.153  32.799  1.00 32.19  ? 615  PHE B C   1 
ATOM   10358 O O   . PHE B 1 593 ? 29.935  -5.320  33.137  1.00 31.20  ? 615  PHE B O   1 
ATOM   10359 C CB  . PHE B 1 593 ? 31.902  -6.920  34.434  1.00 35.40  ? 615  PHE B CB  1 
ATOM   10360 C CG  . PHE B 1 593 ? 30.803  -7.955  34.395  1.00 36.97  ? 615  PHE B CG  1 
ATOM   10361 C CD1 . PHE B 1 593 ? 31.018  -9.198  33.806  1.00 35.26  ? 615  PHE B CD1 1 
ATOM   10362 C CD2 . PHE B 1 593 ? 29.561  -7.691  34.956  1.00 35.33  ? 615  PHE B CD2 1 
ATOM   10363 C CE1 . PHE B 1 593 ? 30.009  -10.150 33.773  1.00 31.81  ? 615  PHE B CE1 1 
ATOM   10364 C CE2 . PHE B 1 593 ? 28.558  -8.643  34.931  1.00 24.95  ? 615  PHE B CE2 1 
ATOM   10365 C CZ  . PHE B 1 593 ? 28.784  -9.869  34.345  1.00 31.18  ? 615  PHE B CZ  1 
ATOM   10366 N N   . SER B 1 594 ? 31.530  -4.015  32.273  1.00 30.37  ? 616  SER B N   1 
ATOM   10367 C CA  . SER B 1 594 ? 30.632  -2.883  32.116  1.00 29.98  ? 616  SER B CA  1 
ATOM   10368 C C   . SER B 1 594 ? 29.452  -3.136  31.186  1.00 31.19  ? 616  SER B C   1 
ATOM   10369 O O   . SER B 1 594 ? 29.522  -3.966  30.282  1.00 31.75  ? 616  SER B O   1 
ATOM   10370 C CB  . SER B 1 594 ? 31.401  -1.649  31.662  1.00 31.74  ? 616  SER B CB  1 
ATOM   10371 O OG  . SER B 1 594 ? 32.285  -1.995  30.630  1.00 39.31  ? 616  SER B OG  1 
ATOM   10372 N N   . GLY B 1 595 ? 28.360  -2.418  31.437  1.00 28.46  ? 617  GLY B N   1 
ATOM   10373 C CA  . GLY B 1 595 ? 27.162  -2.517  30.623  1.00 28.82  ? 617  GLY B CA  1 
ATOM   10374 C C   . GLY B 1 595 ? 26.432  -3.840  30.740  1.00 26.16  ? 617  GLY B C   1 
ATOM   10375 O O   . GLY B 1 595 ? 25.949  -4.377  29.761  1.00 27.32  ? 617  GLY B O   1 
ATOM   10376 N N   . ASN B 1 596 ? 26.343  -4.367  31.946  1.00 26.90  ? 618  ASN B N   1 
ATOM   10377 C CA  . ASN B 1 596 ? 25.579  -5.584  32.190  1.00 29.59  ? 618  ASN B CA  1 
ATOM   10378 C C   . ASN B 1 596 ? 24.590  -5.272  33.291  1.00 25.40  ? 618  ASN B C   1 
ATOM   10379 O O   . ASN B 1 596 ? 24.380  -4.101  33.601  1.00 29.45  ? 618  ASN B O   1 
ATOM   10380 C CB  . ASN B 1 596 ? 26.511  -6.740  32.542  1.00 26.15  ? 618  ASN B CB  1 
ATOM   10381 C CG  . ASN B 1 596 ? 27.368  -7.158  31.358  1.00 26.63  ? 618  ASN B CG  1 
ATOM   10382 O OD1 . ASN B 1 596 ? 26.843  -7.467  30.283  1.00 28.48  ? 618  ASN B OD1 1 
ATOM   10383 N ND2 . ASN B 1 596 ? 28.688  -7.128  31.535  1.00 24.23  ? 618  ASN B ND2 1 
ATOM   10384 N N   . ARG B 1 597 ? 23.909  -6.266  33.844  1.00 28.24  ? 619  ARG B N   1 
ATOM   10385 C CA  . ARG B 1 597 ? 23.063  -5.911  34.959  1.00 28.00  ? 619  ARG B CA  1 
ATOM   10386 C C   . ARG B 1 597 ? 23.462  -6.592  36.246  1.00 31.37  ? 619  ARG B C   1 
ATOM   10387 O O   . ARG B 1 597 ? 22.842  -7.579  36.657  1.00 33.88  ? 619  ARG B O   1 
ATOM   10388 C CB  . ARG B 1 597 ? 21.635  -6.319  34.601  1.00 32.48  ? 619  ARG B CB  1 
ATOM   10389 C CG  . ARG B 1 597 ? 21.199  -5.820  33.218  1.00 28.25  ? 619  ARG B CG  1 
ATOM   10390 C CD  . ARG B 1 597 ? 21.012  -4.317  33.261  1.00 26.35  ? 619  ARG B CD  1 
ATOM   10391 N NE  . ARG B 1 597 ? 20.116  -3.961  34.358  1.00 32.61  ? 619  ARG B NE  1 
ATOM   10392 C CZ  . ARG B 1 597 ? 18.794  -3.870  34.228  1.00 36.90  ? 619  ARG B CZ  1 
ATOM   10393 N NH1 . ARG B 1 597 ? 18.233  -4.100  33.044  1.00 34.93  ? 619  ARG B NH1 1 
ATOM   10394 N NH2 . ARG B 1 597 ? 18.036  -3.547  35.273  1.00 34.69  ? 619  ARG B NH2 1 
ATOM   10395 N N   . LEU B 1 598 ? 24.331  -5.927  36.996  1.00 31.38  ? 620  LEU B N   1 
ATOM   10396 C CA  . LEU B 1 598 ? 24.747  -6.458  38.273  1.00 29.09  ? 620  LEU B CA  1 
ATOM   10397 C C   . LEU B 1 598 ? 23.662  -6.077  39.260  1.00 30.32  ? 620  LEU B C   1 
ATOM   10398 O O   . LEU B 1 598 ? 23.533  -6.696  40.297  1.00 26.67  ? 620  LEU B O   1 
ATOM   10399 C CB  . LEU B 1 598 ? 26.125  -5.927  38.682  1.00 30.00  ? 620  LEU B CB  1 
ATOM   10400 C CG  . LEU B 1 598 ? 27.284  -6.744  38.094  1.00 29.17  ? 620  LEU B CG  1 
ATOM   10401 C CD1 . LEU B 1 598 ? 28.575  -5.934  38.128  1.00 26.76  ? 620  LEU B CD1 1 
ATOM   10402 C CD2 . LEU B 1 598 ? 27.448  -8.109  38.804  1.00 26.58  ? 620  LEU B CD2 1 
ATOM   10403 N N   . ASP B 1 599 ? 22.854  -5.079  38.896  1.00 33.73  ? 621  ASP B N   1 
ATOM   10404 C CA  . ASP B 1 599 ? 21.708  -4.704  39.717  1.00 37.89  ? 621  ASP B CA  1 
ATOM   10405 C C   . ASP B 1 599 ? 20.747  -5.886  39.817  1.00 38.06  ? 621  ASP B C   1 
ATOM   10406 O O   . ASP B 1 599 ? 20.216  -6.165  40.890  1.00 37.47  ? 621  ASP B O   1 
ATOM   10407 C CB  . ASP B 1 599 ? 21.025  -3.418  39.218  1.00 37.59  ? 621  ASP B CB  1 
ATOM   10408 C CG  . ASP B 1 599 ? 20.367  -3.573  37.848  1.00 38.29  ? 621  ASP B CG  1 
ATOM   10409 O OD1 . ASP B 1 599 ? 20.990  -4.134  36.918  1.00 37.33  ? 621  ASP B OD1 1 
ATOM   10410 O OD2 . ASP B 1 599 ? 19.210  -3.121  37.707  1.00 38.64  ? 621  ASP B OD2 1 
ATOM   10411 N N   . ILE B 1 600 ? 20.569  -6.606  38.712  1.00 36.16  ? 622  ILE B N   1 
ATOM   10412 C CA  . ILE B 1 600 ? 19.785  -7.842  38.726  1.00 34.64  ? 622  ILE B CA  1 
ATOM   10413 C C   . ILE B 1 600 ? 20.538  -9.038  39.328  1.00 34.53  ? 622  ILE B C   1 
ATOM   10414 O O   . ILE B 1 600 ? 20.033  -9.692  40.244  1.00 37.99  ? 622  ILE B O   1 
ATOM   10415 C CB  . ILE B 1 600 ? 19.263  -8.194  37.314  1.00 31.12  ? 622  ILE B CB  1 
ATOM   10416 C CG1 . ILE B 1 600 ? 18.424  -7.034  36.763  1.00 28.12  ? 622  ILE B CG1 1 
ATOM   10417 C CG2 . ILE B 1 600 ? 18.464  -9.507  37.335  1.00 28.01  ? 622  ILE B CG2 1 
ATOM   10418 C CD1 . ILE B 1 600 ? 17.856  -7.303  35.364  1.00 29.78  ? 622  ILE B CD1 1 
ATOM   10419 N N   . LEU B 1 601 ? 21.747  -9.302  38.837  1.00 31.85  ? 623  LEU B N   1 
ATOM   10420 C CA  . LEU B 1 601 ? 22.563  -10.408 39.348  1.00 31.28  ? 623  LEU B CA  1 
ATOM   10421 C C   . LEU B 1 601 ? 22.698  -10.396 40.872  1.00 33.03  ? 623  LEU B C   1 
ATOM   10422 O O   . LEU B 1 601 ? 22.564  -11.433 41.521  1.00 30.84  ? 623  LEU B O   1 
ATOM   10423 C CB  . LEU B 1 601 ? 23.950  -10.413 38.703  1.00 32.75  ? 623  LEU B CB  1 
ATOM   10424 C CG  . LEU B 1 601 ? 23.976  -10.699 37.200  1.00 32.75  ? 623  LEU B CG  1 
ATOM   10425 C CD1 . LEU B 1 601 ? 25.294  -10.246 36.584  1.00 32.40  ? 623  LEU B CD1 1 
ATOM   10426 C CD2 . LEU B 1 601 ? 23.758  -12.186 36.962  1.00 31.96  ? 623  LEU B CD2 1 
ATOM   10427 N N   . TRP B 1 602 ? 22.945  -9.210  41.422  1.00 35.47  ? 624  TRP B N   1 
ATOM   10428 C CA  . TRP B 1 602 ? 23.126  -8.996  42.864  1.00 34.57  ? 624  TRP B CA  1 
ATOM   10429 C C   . TRP B 1 602 ? 21.862  -8.584  43.647  1.00 35.58  ? 624  TRP B C   1 
ATOM   10430 O O   . TRP B 1 602 ? 21.973  -8.118  44.784  1.00 39.63  ? 624  TRP B O   1 
ATOM   10431 C CB  . TRP B 1 602 ? 24.279  -8.021  43.154  1.00 34.23  ? 624  TRP B CB  1 
ATOM   10432 C CG  . TRP B 1 602 ? 25.651  -8.611  42.956  1.00 33.53  ? 624  TRP B CG  1 
ATOM   10433 C CD1 . TRP B 1 602 ? 25.981  -9.933  42.938  1.00 31.35  ? 624  TRP B CD1 1 
ATOM   10434 C CD2 . TRP B 1 602 ? 26.877  -7.891  42.733  1.00 33.85  ? 624  TRP B CD2 1 
ATOM   10435 N NE1 . TRP B 1 602 ? 27.329  -10.082 42.732  1.00 32.65  ? 624  TRP B NE1 1 
ATOM   10436 C CE2 . TRP B 1 602 ? 27.898  -8.846  42.589  1.00 35.30  ? 624  TRP B CE2 1 
ATOM   10437 C CE3 . TRP B 1 602 ? 27.202  -6.532  42.628  1.00 32.71  ? 624  TRP B CE3 1 
ATOM   10438 C CZ2 . TRP B 1 602 ? 29.221  -8.486  42.345  1.00 35.83  ? 624  TRP B CZ2 1 
ATOM   10439 C CZ3 . TRP B 1 602 ? 28.520  -6.178  42.393  1.00 29.25  ? 624  TRP B CZ3 1 
ATOM   10440 C CH2 . TRP B 1 602 ? 29.507  -7.148  42.250  1.00 36.13  ? 624  TRP B CH2 1 
ATOM   10441 N N   . ASN B 1 603 ? 20.688  -8.686  43.033  1.00 33.70  ? 625  ASN B N   1 
ATOM   10442 C CA  . ASN B 1 603 ? 19.425  -8.339  43.706  1.00 39.65  ? 625  ASN B CA  1 
ATOM   10443 C C   . ASN B 1 603 ? 19.328  -8.952  45.103  1.00 44.06  ? 625  ASN B C   1 
ATOM   10444 O O   . ASN B 1 603 ? 19.712  -10.103 45.309  1.00 46.28  ? 625  ASN B O   1 
ATOM   10445 C CB  . ASN B 1 603 ? 18.231  -8.843  42.893  1.00 39.79  ? 625  ASN B CB  1 
ATOM   10446 C CG  . ASN B 1 603 ? 16.912  -8.697  43.645  1.00 45.30  ? 625  ASN B CG  1 
ATOM   10447 O OD1 . ASN B 1 603 ? 16.472  -9.614  44.344  1.00 47.14  ? 625  ASN B OD1 1 
ATOM   10448 N ND2 . ASN B 1 603 ? 16.276  -7.536  43.502  1.00 45.33  ? 625  ASN B ND2 1 
ATOM   10449 N N   . ASP B 1 604 ? 18.827  -8.179  46.059  1.00 44.52  ? 626  ASP B N   1 
ATOM   10450 C CA  . ASP B 1 604 ? 18.900  -8.576  47.471  1.00 46.69  ? 626  ASP B CA  1 
ATOM   10451 C C   . ASP B 1 604 ? 18.236  -9.909  47.791  1.00 39.20  ? 626  ASP B C   1 
ATOM   10452 O O   . ASP B 1 604 ? 18.678  -10.610 48.686  1.00 36.56  ? 626  ASP B O   1 
ATOM   10453 C CB  . ASP B 1 604 ? 18.343  -7.480  48.383  1.00 56.11  ? 626  ASP B CB  1 
ATOM   10454 C CG  . ASP B 1 604 ? 19.123  -6.190  48.278  1.00 63.60  ? 626  ASP B CG  1 
ATOM   10455 O OD1 . ASP B 1 604 ? 20.327  -6.252  47.966  1.00 68.51  ? 626  ASP B OD1 1 
ATOM   10456 O OD2 . ASP B 1 604 ? 18.536  -5.113  48.504  1.00 66.51  ? 626  ASP B OD2 1 
ATOM   10457 N N   . ASP B 1 605 ? 17.197  -10.267 47.044  1.00 37.93  ? 627  ASP B N   1 
ATOM   10458 C CA  . ASP B 1 605 ? 16.461  -11.505 47.291  1.00 38.27  ? 627  ASP B CA  1 
ATOM   10459 C C   . ASP B 1 605 ? 17.095  -12.736 46.639  1.00 37.13  ? 627  ASP B C   1 
ATOM   10460 O O   . ASP B 1 605 ? 16.560  -13.837 46.751  1.00 36.69  ? 627  ASP B O   1 
ATOM   10461 C CB  . ASP B 1 605 ? 15.020  -11.366 46.789  1.00 41.05  ? 627  ASP B CB  1 
ATOM   10462 C CG  . ASP B 1 605 ? 14.308  -10.154 47.370  1.00 43.37  ? 627  ASP B CG  1 
ATOM   10463 O OD1 . ASP B 1 605 ? 14.447  -9.901  48.580  1.00 41.80  ? 627  ASP B OD1 1 
ATOM   10464 O OD2 . ASP B 1 605 ? 13.610  -9.450  46.612  1.00 47.41  ? 627  ASP B OD2 1 
ATOM   10465 N N   . ASP B 1 606 ? 18.219  -12.550 45.953  1.00 32.87  ? 628  ASP B N   1 
ATOM   10466 C CA  . ASP B 1 606 ? 18.850  -13.627 45.193  1.00 36.19  ? 628  ASP B CA  1 
ATOM   10467 C C   . ASP B 1 606 ? 20.318  -13.782 45.608  1.00 39.58  ? 628  ASP B C   1 
ATOM   10468 O O   . ASP B 1 606 ? 21.123  -12.856 45.456  1.00 40.09  ? 628  ASP B O   1 
ATOM   10469 C CB  . ASP B 1 606 ? 18.736  -13.327 43.688  1.00 35.43  ? 628  ASP B CB  1 
ATOM   10470 C CG  . ASP B 1 606 ? 19.328  -14.421 42.799  1.00 39.18  ? 628  ASP B CG  1 
ATOM   10471 O OD1 . ASP B 1 606 ? 19.705  -15.497 43.304  1.00 39.58  ? 628  ASP B OD1 1 
ATOM   10472 O OD2 . ASP B 1 606 ? 19.393  -14.205 41.562  1.00 42.60  ? 628  ASP B OD2 1 
ATOM   10473 N N   . ASN B 1 607 ? 20.665  -14.943 46.154  1.00 37.90  ? 629  ASN B N   1 
ATOM   10474 C CA  . ASN B 1 607 ? 22.055  -15.179 46.520  1.00 41.00  ? 629  ASN B CA  1 
ATOM   10475 C C   . ASN B 1 607 ? 22.919  -15.984 45.530  1.00 38.88  ? 629  ASN B C   1 
ATOM   10476 O O   . ASN B 1 607 ? 24.085  -16.240 45.797  1.00 39.60  ? 629  ASN B O   1 
ATOM   10477 C CB  . ASN B 1 607 ? 22.193  -15.674 47.976  1.00 47.89  ? 629  ASN B CB  1 
ATOM   10478 C CG  . ASN B 1 607 ? 21.590  -17.040 48.204  1.00 51.56  ? 629  ASN B CG  1 
ATOM   10479 O OD1 . ASN B 1 607 ? 21.656  -17.919 47.343  1.00 52.36  ? 629  ASN B OD1 1 
ATOM   10480 N ND2 . ASN B 1 607 ? 21.005  -17.233 49.388  1.00 53.29  ? 629  ASN B ND2 1 
ATOM   10481 N N   . ARG B 1 608 ? 22.360  -16.374 44.388  1.00 36.62  ? 630  ARG B N   1 
ATOM   10482 C CA  . ARG B 1 608 ? 23.102  -17.245 43.470  1.00 39.73  ? 630  ARG B CA  1 
ATOM   10483 C C   . ARG B 1 608 ? 24.399  -16.614 42.910  1.00 36.58  ? 630  ARG B C   1 
ATOM   10484 O O   . ARG B 1 608 ? 25.406  -17.288 42.730  1.00 32.14  ? 630  ARG B O   1 
ATOM   10485 C CB  . ARG B 1 608 ? 22.194  -17.734 42.336  1.00 39.68  ? 630  ARG B CB  1 
ATOM   10486 C CG  . ARG B 1 608 ? 21.097  -18.706 42.791  1.00 38.38  ? 630  ARG B CG  1 
ATOM   10487 C CD  . ARG B 1 608 ? 20.049  -18.880 41.693  1.00 37.61  ? 630  ARG B CD  1 
ATOM   10488 N NE  . ARG B 1 608 ? 19.551  -17.586 41.226  1.00 36.06  ? 630  ARG B NE  1 
ATOM   10489 C CZ  . ARG B 1 608 ? 18.962  -17.396 40.048  1.00 35.14  ? 630  ARG B CZ  1 
ATOM   10490 N NH1 . ARG B 1 608 ? 18.805  -18.424 39.216  1.00 30.69  ? 630  ARG B NH1 1 
ATOM   10491 N NH2 . ARG B 1 608 ? 18.539  -16.181 39.699  1.00 33.58  ? 630  ARG B NH2 1 
ATOM   10492 N N   . TYR B 1 609 ? 24.365  -15.313 42.663  1.00 35.97  ? 631  TYR B N   1 
ATOM   10493 C CA  . TYR B 1 609 ? 25.500  -14.616 42.071  1.00 34.74  ? 631  TYR B CA  1 
ATOM   10494 C C   . TYR B 1 609 ? 26.440  -13.909 43.073  1.00 37.15  ? 631  TYR B C   1 
ATOM   10495 O O   . TYR B 1 609 ? 27.336  -13.165 42.664  1.00 34.38  ? 631  TYR B O   1 
ATOM   10496 C CB  . TYR B 1 609 ? 25.009  -13.687 40.963  1.00 27.21  ? 631  TYR B CB  1 
ATOM   10497 C CG  . TYR B 1 609 ? 24.199  -14.413 39.889  1.00 32.68  ? 631  TYR B CG  1 
ATOM   10498 C CD1 . TYR B 1 609 ? 24.827  -15.052 38.817  1.00 32.32  ? 631  TYR B CD1 1 
ATOM   10499 C CD2 . TYR B 1 609 ? 22.808  -14.470 39.960  1.00 32.24  ? 631  TYR B CD2 1 
ATOM   10500 C CE1 . TYR B 1 609 ? 24.091  -15.712 37.835  1.00 31.28  ? 631  TYR B CE1 1 
ATOM   10501 C CE2 . TYR B 1 609 ? 22.061  -15.128 38.989  1.00 33.55  ? 631  TYR B CE2 1 
ATOM   10502 C CZ  . TYR B 1 609 ? 22.711  -15.748 37.928  1.00 36.11  ? 631  TYR B CZ  1 
ATOM   10503 O OH  . TYR B 1 609 ? 21.973  -16.396 36.961  1.00 37.63  ? 631  TYR B OH  1 
ATOM   10504 N N   . ILE B 1 610 ? 26.213  -14.125 44.373  1.00 38.92  ? 632  ILE B N   1 
ATOM   10505 C CA  . ILE B 1 610 ? 27.023  -13.491 45.437  1.00 42.31  ? 632  ILE B CA  1 
ATOM   10506 C C   . ILE B 1 610 ? 28.530  -13.680 45.255  1.00 42.05  ? 632  ILE B C   1 
ATOM   10507 O O   . ILE B 1 610 ? 29.320  -12.821 45.642  1.00 43.48  ? 632  ILE B O   1 
ATOM   10508 C CB  . ILE B 1 610 ? 26.596  -13.957 46.876  1.00 52.10  ? 632  ILE B CB  1 
ATOM   10509 C CG1 . ILE B 1 610 ? 25.144  -13.599 47.127  1.00 58.93  ? 632  ILE B CG1 1 
ATOM   10510 C CG2 . ILE B 1 610 ? 27.376  -13.254 47.954  1.00 52.82  ? 632  ILE B CG2 1 
ATOM   10511 C CD1 . ILE B 1 610 ? 24.799  -12.220 46.651  1.00 63.97  ? 632  ILE B CD1 1 
ATOM   10512 N N   . SER B 1 611 ? 28.923  -14.822 44.699  1.00 39.05  ? 633  SER B N   1 
ATOM   10513 C CA  . SER B 1 611 ? 30.338  -15.134 44.467  1.00 35.76  ? 633  SER B CA  1 
ATOM   10514 C C   . SER B 1 611 ? 30.890  -14.948 43.044  1.00 37.42  ? 633  SER B C   1 
ATOM   10515 O O   . SER B 1 611 ? 32.018  -15.374 42.755  1.00 33.28  ? 633  SER B O   1 
ATOM   10516 C CB  . SER B 1 611 ? 30.681  -16.500 45.050  1.00 32.71  ? 633  SER B CB  1 
ATOM   10517 O OG  . SER B 1 611 ? 30.477  -16.452 46.453  1.00 35.27  ? 633  SER B OG  1 
ATOM   10518 N N   . ILE B 1 612 ? 30.086  -14.351 42.161  1.00 33.65  ? 634  ILE B N   1 
ATOM   10519 C CA  . ILE B 1 612 ? 30.334  -14.389 40.718  1.00 32.56  ? 634  ILE B CA  1 
ATOM   10520 C C   . ILE B 1 612 ? 31.780  -14.116 40.275  1.00 33.04  ? 634  ILE B C   1 
ATOM   10521 O O   . ILE B 1 612 ? 32.233  -14.699 39.296  1.00 31.71  ? 634  ILE B O   1 
ATOM   10522 C CB  . ILE B 1 612 ? 29.369  -13.447 39.940  1.00 29.44  ? 634  ILE B CB  1 
ATOM   10523 C CG1 . ILE B 1 612 ? 29.513  -13.643 38.427  1.00 29.11  ? 634  ILE B CG1 1 
ATOM   10524 C CG2 . ILE B 1 612 ? 29.612  -11.996 40.308  1.00 28.11  ? 634  ILE B CG2 1 
ATOM   10525 C CD1 . ILE B 1 612 ? 28.441  -12.930 37.591  1.00 30.73  ? 634  ILE B CD1 1 
ATOM   10526 N N   . PHE B 1 613 ? 32.477  -13.205 40.953  1.00 33.38  ? 635  PHE B N   1 
ATOM   10527 C CA  . PHE B 1 613 ? 33.862  -12.874 40.589  1.00 35.86  ? 635  PHE B CA  1 
ATOM   10528 C C   . PHE B 1 613 ? 34.971  -13.502 41.461  1.00 37.68  ? 635  PHE B C   1 
ATOM   10529 O O   . PHE B 1 613 ? 36.164  -13.335 41.177  1.00 33.83  ? 635  PHE B O   1 
ATOM   10530 C CB  . PHE B 1 613 ? 34.023  -11.353 40.497  1.00 36.21  ? 635  PHE B CB  1 
ATOM   10531 C CG  . PHE B 1 613 ? 33.103  -10.715 39.494  1.00 36.31  ? 635  PHE B CG  1 
ATOM   10532 C CD1 . PHE B 1 613 ? 32.898  -11.305 38.258  1.00 33.41  ? 635  PHE B CD1 1 
ATOM   10533 C CD2 . PHE B 1 613 ? 32.427  -9.544  39.790  1.00 39.30  ? 635  PHE B CD2 1 
ATOM   10534 C CE1 . PHE B 1 613 ? 32.048  -10.737 37.335  1.00 32.87  ? 635  PHE B CE1 1 
ATOM   10535 C CE2 . PHE B 1 613 ? 31.568  -8.969  38.865  1.00 37.37  ? 635  PHE B CE2 1 
ATOM   10536 C CZ  . PHE B 1 613 ? 31.385  -9.567  37.633  1.00 32.91  ? 635  PHE B CZ  1 
ATOM   10537 N N   . LYS B 1 614 ? 34.580  -14.225 42.506  1.00 39.91  ? 636  LYS B N   1 
ATOM   10538 C CA  . LYS B 1 614 ? 35.538  -14.720 43.493  1.00 39.36  ? 636  LYS B CA  1 
ATOM   10539 C C   . LYS B 1 614 ? 36.525  -15.715 42.892  1.00 39.22  ? 636  LYS B C   1 
ATOM   10540 O O   . LYS B 1 614 ? 37.705  -15.759 43.270  1.00 36.67  ? 636  LYS B O   1 
ATOM   10541 C CB  . LYS B 1 614 ? 34.822  -15.357 44.693  1.00 39.10  ? 636  LYS B CB  1 
ATOM   10542 C CG  . LYS B 1 614 ? 35.765  -15.624 45.875  1.00 43.51  ? 636  LYS B CG  1 
ATOM   10543 C CD  . LYS B 1 614 ? 34.992  -15.987 47.142  1.00 46.29  ? 636  LYS B CD  1 
ATOM   10544 C CE  . LYS B 1 614 ? 35.914  -16.072 48.338  1.00 51.48  ? 636  LYS B CE  1 
ATOM   10545 N NZ  . LYS B 1 614 ? 35.150  -16.298 49.600  1.00 56.83  ? 636  LYS B NZ  1 
ATOM   10546 N N   . GLY B 1 615 ? 36.031  -16.504 41.944  1.00 39.90  ? 637  GLY B N   1 
ATOM   10547 C CA  . GLY B 1 615 ? 36.844  -17.511 41.290  1.00 42.59  ? 637  GLY B CA  1 
ATOM   10548 C C   . GLY B 1 615 ? 37.879  -16.966 40.320  1.00 46.47  ? 637  GLY B C   1 
ATOM   10549 O O   . GLY B 1 615 ? 38.587  -17.741 39.678  1.00 45.84  ? 637  GLY B O   1 
ATOM   10550 N N   . LEU B 1 616 ? 37.998  -15.647 40.199  1.00 46.67  ? 638  LEU B N   1 
ATOM   10551 C CA  . LEU B 1 616 ? 39.070  -15.142 39.365  1.00 45.64  ? 638  LEU B CA  1 
ATOM   10552 C C   . LEU B 1 616 ? 40.162  -14.750 40.336  1.00 48.07  ? 638  LEU B C   1 
ATOM   10553 O O   . LEU B 1 616 ? 40.187  -13.640 40.854  1.00 48.52  ? 638  LEU B O   1 
ATOM   10554 C CB  . LEU B 1 616 ? 38.591  -13.920 38.582  1.00 42.07  ? 638  LEU B CB  1 
ATOM   10555 C CG  . LEU B 1 616 ? 37.324  -14.087 37.738  1.00 40.27  ? 638  LEU B CG  1 
ATOM   10556 C CD1 . LEU B 1 616 ? 36.801  -12.740 37.247  1.00 38.32  ? 638  LEU B CD1 1 
ATOM   10557 C CD2 . LEU B 1 616 ? 37.601  -14.993 36.567  1.00 40.68  ? 638  LEU B CD2 1 
ATOM   10558 N N   . LYS B 1 617 ? 41.132  -15.640 40.489  1.00 50.95  ? 639  LYS B N   1 
ATOM   10559 C CA  . LYS B 1 617 ? 42.012  -15.591 41.641  1.00 49.98  ? 639  LYS B CA  1 
ATOM   10560 C C   . LYS B 1 617 ? 43.265  -14.771 41.395  1.00 48.23  ? 639  LYS B C   1 
ATOM   10561 O O   . LYS B 1 617 ? 44.001  -14.443 42.320  1.00 53.67  ? 639  LYS B O   1 
ATOM   10562 C CB  . LYS B 1 617 ? 42.353  -17.017 42.070  1.00 55.63  ? 639  LYS B CB  1 
ATOM   10563 C CG  . LYS B 1 617 ? 41.191  -17.728 42.774  1.00 58.23  ? 639  LYS B CG  1 
ATOM   10564 C CD  . LYS B 1 617 ? 41.311  -19.241 42.673  1.00 61.57  ? 639  LYS B CD  1 
ATOM   10565 C CE  . LYS B 1 617 ? 40.449  -19.948 43.718  1.00 65.88  ? 639  LYS B CE  1 
ATOM   10566 N NZ  . LYS B 1 617 ? 41.100  -20.001 45.065  1.00 69.92  ? 639  LYS B NZ  1 
ATOM   10567 N N   . ASN B 1 618 ? 43.509  -14.464 40.132  1.00 43.46  ? 640  ASN B N   1 
ATOM   10568 C CA  . ASN B 1 618 ? 44.642  -13.645 39.728  1.00 45.62  ? 640  ASN B CA  1 
ATOM   10569 C C   . ASN B 1 618 ? 44.262  -12.180 39.441  1.00 45.51  ? 640  ASN B C   1 
ATOM   10570 O O   . ASN B 1 618 ? 45.132  -11.368 39.126  1.00 46.12  ? 640  ASN B O   1 
ATOM   10571 C CB  . ASN B 1 618 ? 45.270  -14.282 38.483  1.00 47.14  ? 640  ASN B CB  1 
ATOM   10572 C CG  . ASN B 1 618 ? 46.781  -14.163 38.446  1.00 49.11  ? 640  ASN B CG  1 
ATOM   10573 O OD1 . ASN B 1 618 ? 47.425  -13.838 39.448  1.00 45.71  ? 640  ASN B OD1 1 
ATOM   10574 N ND2 . ASN B 1 618 ? 47.357  -14.453 37.274  1.00 54.53  ? 640  ASN B ND2 1 
ATOM   10575 N N   . LEU B 1 619 ? 42.970  -11.845 39.551  1.00 45.62  ? 641  LEU B N   1 
ATOM   10576 C CA  . LEU B 1 619 ? 42.437  -10.600 38.962  1.00 43.39  ? 641  LEU B CA  1 
ATOM   10577 C C   . LEU B 1 619 ? 42.963  -9.348  39.661  1.00 44.41  ? 641  LEU B C   1 
ATOM   10578 O O   . LEU B 1 619 ? 42.807  -9.199  40.872  1.00 44.81  ? 641  LEU B O   1 
ATOM   10579 C CB  . LEU B 1 619 ? 40.908  -10.599 39.053  1.00 39.12  ? 641  LEU B CB  1 
ATOM   10580 C CG  . LEU B 1 619 ? 40.138  -9.688  38.093  1.00 36.45  ? 641  LEU B CG  1 
ATOM   10581 C CD1 . LEU B 1 619 ? 40.214  -10.244 36.675  1.00 34.32  ? 641  LEU B CD1 1 
ATOM   10582 C CD2 . LEU B 1 619 ? 38.695  -9.523  38.526  1.00 33.31  ? 641  LEU B CD2 1 
ATOM   10583 N N   . THR B 1 620 ? 43.644  -8.479  38.916  1.00 42.69  ? 642  THR B N   1 
ATOM   10584 C CA  . THR B 1 620 ? 44.023  -7.168  39.454  1.00 43.35  ? 642  THR B CA  1 
ATOM   10585 C C   . THR B 1 620 ? 43.216  -5.955  38.995  1.00 44.55  ? 642  THR B C   1 
ATOM   10586 O O   . THR B 1 620 ? 43.337  -4.878  39.580  1.00 47.07  ? 642  THR B O   1 
ATOM   10587 C CB  . THR B 1 620 ? 45.518  -6.887  39.273  1.00 40.00  ? 642  THR B CB  1 
ATOM   10588 O OG1 . THR B 1 620 ? 45.849  -6.936  37.878  1.00 40.32  ? 642  THR B OG1 1 
ATOM   10589 C CG2 . THR B 1 620 ? 46.332  -7.922  40.055  1.00 40.19  ? 642  THR B CG2 1 
ATOM   10590 N N   . ARG B 1 621 ? 42.411  -6.125  37.950  1.00 42.20  ? 643  ARG B N   1 
ATOM   10591 C CA  . ARG B 1 621 ? 41.642  -5.016  37.397  1.00 44.54  ? 643  ARG B CA  1 
ATOM   10592 C C   . ARG B 1 621 ? 40.225  -5.454  37.069  1.00 39.53  ? 643  ARG B C   1 
ATOM   10593 O O   . ARG B 1 621 ? 40.009  -6.391  36.295  1.00 35.37  ? 643  ARG B O   1 
ATOM   10594 C CB  . ARG B 1 621 ? 42.304  -4.426  36.145  1.00 50.18  ? 643  ARG B CB  1 
ATOM   10595 C CG  . ARG B 1 621 ? 41.520  -3.251  35.552  1.00 55.49  ? 643  ARG B CG  1 
ATOM   10596 C CD  . ARG B 1 621 ? 42.188  -2.637  34.307  1.00 57.46  ? 643  ARG B CD  1 
ATOM   10597 N NE  . ARG B 1 621 ? 41.770  -1.250  34.079  1.00 56.12  ? 643  ARG B NE  1 
ATOM   10598 C CZ  . ARG B 1 621 ? 40.710  -0.884  33.356  1.00 55.68  ? 643  ARG B CZ  1 
ATOM   10599 N NH1 . ARG B 1 621 ? 39.933  -1.799  32.768  1.00 48.55  ? 643  ARG B NH1 1 
ATOM   10600 N NH2 . ARG B 1 621 ? 40.420  0.407   33.219  1.00 56.68  ? 643  ARG B NH2 1 
ATOM   10601 N N   . LEU B 1 622 ? 39.263  -4.761  37.663  1.00 39.03  ? 644  LEU B N   1 
ATOM   10602 C CA  . LEU B 1 622 ? 37.860  -5.103  37.493  1.00 34.84  ? 644  LEU B CA  1 
ATOM   10603 C C   . LEU B 1 622 ? 37.079  -3.840  37.191  1.00 33.58  ? 644  LEU B C   1 
ATOM   10604 O O   . LEU B 1 622 ? 37.153  -2.856  37.934  1.00 32.28  ? 644  LEU B O   1 
ATOM   10605 C CB  . LEU B 1 622 ? 37.325  -5.758  38.760  1.00 33.26  ? 644  LEU B CB  1 
ATOM   10606 C CG  . LEU B 1 622 ? 35.858  -6.182  38.741  1.00 31.42  ? 644  LEU B CG  1 
ATOM   10607 C CD1 . LEU B 1 622 ? 35.650  -7.294  37.716  1.00 30.72  ? 644  LEU B CD1 1 
ATOM   10608 C CD2 . LEU B 1 622 ? 35.428  -6.622  40.139  1.00 30.63  ? 644  LEU B CD2 1 
ATOM   10609 N N   . ASP B 1 623 ? 36.345  -3.865  36.088  1.00 34.53  ? 645  ASP B N   1 
ATOM   10610 C CA  . ASP B 1 623 ? 35.538  -2.723  35.690  1.00 38.47  ? 645  ASP B CA  1 
ATOM   10611 C C   . ASP B 1 623 ? 34.050  -3.070  35.836  1.00 36.43  ? 645  ASP B C   1 
ATOM   10612 O O   . ASP B 1 623 ? 33.502  -3.843  35.042  1.00 31.53  ? 645  ASP B O   1 
ATOM   10613 C CB  . ASP B 1 623 ? 35.876  -2.330  34.244  1.00 36.62  ? 645  ASP B CB  1 
ATOM   10614 C CG  . ASP B 1 623 ? 35.216  -1.032  33.817  1.00 37.93  ? 645  ASP B CG  1 
ATOM   10615 O OD1 . ASP B 1 623 ? 34.217  -0.626  34.447  1.00 35.23  ? 645  ASP B OD1 1 
ATOM   10616 O OD2 . ASP B 1 623 ? 35.694  -0.413  32.837  1.00 39.85  ? 645  ASP B OD2 1 
ATOM   10617 N N   . LEU B 1 624 ? 33.419  -2.486  36.859  1.00 34.04  ? 646  LEU B N   1 
ATOM   10618 C CA  . LEU B 1 624 ? 31.988  -2.662  37.161  1.00 34.50  ? 646  LEU B CA  1 
ATOM   10619 C C   . LEU B 1 624 ? 31.056  -1.553  36.671  1.00 35.12  ? 646  LEU B C   1 
ATOM   10620 O O   . LEU B 1 624 ? 29.911  -1.460  37.131  1.00 32.79  ? 646  LEU B O   1 
ATOM   10621 C CB  . LEU B 1 624 ? 31.762  -2.889  38.654  1.00 38.52  ? 646  LEU B CB  1 
ATOM   10622 C CG  . LEU B 1 624 ? 32.413  -4.132  39.235  1.00 29.03  ? 646  LEU B CG  1 
ATOM   10623 C CD1 . LEU B 1 624 ? 31.961  -4.320  40.676  1.00 29.70  ? 646  LEU B CD1 1 
ATOM   10624 C CD2 . LEU B 1 624 ? 32.111  -5.351  38.397  1.00 28.22  ? 646  LEU B CD2 1 
ATOM   10625 N N   . SER B 1 625 ? 31.561  -0.650  35.837  1.00 32.33  ? 647  SER B N   1 
ATOM   10626 C CA  . SER B 1 625 ? 30.774  0.514   35.438  1.00 27.48  ? 647  SER B CA  1 
ATOM   10627 C C   . SER B 1 625 ? 29.479  0.151   34.706  1.00 32.62  ? 647  SER B C   1 
ATOM   10628 O O   . SER B 1 625 ? 29.341  -0.953  34.184  1.00 33.31  ? 647  SER B O   1 
ATOM   10629 C CB  . SER B 1 625 ? 31.624  1.459   34.574  1.00 34.01  ? 647  SER B CB  1 
ATOM   10630 O OG  . SER B 1 625 ? 32.033  0.856   33.352  1.00 31.24  ? 647  SER B OG  1 
ATOM   10631 N N   . LEU B 1 626 ? 28.519  1.073   34.714  1.00 33.27  ? 648  LEU B N   1 
ATOM   10632 C CA  . LEU B 1 626 ? 27.323  0.977   33.863  1.00 33.84  ? 648  LEU B CA  1 
ATOM   10633 C C   . LEU B 1 626 ? 26.527  -0.313  34.096  1.00 36.97  ? 648  LEU B C   1 
ATOM   10634 O O   . LEU B 1 626 ? 26.004  -0.924  33.168  1.00 32.24  ? 648  LEU B O   1 
ATOM   10635 C CB  . LEU B 1 626 ? 27.699  1.128   32.381  1.00 32.05  ? 648  LEU B CB  1 
ATOM   10636 C CG  . LEU B 1 626 ? 28.113  2.519   31.889  1.00 33.28  ? 648  LEU B CG  1 
ATOM   10637 C CD1 . LEU B 1 626 ? 28.650  2.477   30.442  1.00 29.27  ? 648  LEU B CD1 1 
ATOM   10638 C CD2 . LEU B 1 626 ? 26.918  3.472   31.982  1.00 30.61  ? 648  LEU B CD2 1 
ATOM   10639 N N   . ASN B 1 627 ? 26.508  -0.759  35.345  1.00 39.64  ? 649  ASN B N   1 
ATOM   10640 C CA  . ASN B 1 627 ? 25.653  -1.861  35.766  1.00 35.08  ? 649  ASN B CA  1 
ATOM   10641 C C   . ASN B 1 627 ? 24.375  -1.444  36.505  1.00 34.57  ? 649  ASN B C   1 
ATOM   10642 O O   . ASN B 1 627 ? 23.722  -2.284  37.130  1.00 31.97  ? 649  ASN B O   1 
ATOM   10643 C CB  . ASN B 1 627 ? 26.448  -2.928  36.513  1.00 30.79  ? 649  ASN B CB  1 
ATOM   10644 C CG  . ASN B 1 627 ? 27.197  -3.837  35.569  1.00 33.37  ? 649  ASN B CG  1 
ATOM   10645 O OD1 . ASN B 1 627 ? 26.781  -4.973  35.317  1.00 30.20  ? 649  ASN B OD1 1 
ATOM   10646 N ND2 . ASN B 1 627 ? 28.300  -3.330  35.012  1.00 25.53  ? 649  ASN B ND2 1 
ATOM   10647 N N   . ARG B 1 628 ? 24.095  -0.141  36.526  1.00 35.83  ? 650  ARG B N   1 
ATOM   10648 C CA  . ARG B 1 628 ? 22.860  0.378   37.122  1.00 37.95  ? 650  ARG B CA  1 
ATOM   10649 C C   . ARG B 1 628 ? 22.744  0.052   38.612  1.00 38.04  ? 650  ARG B C   1 
ATOM   10650 O O   . ARG B 1 628 ? 21.656  -0.146  39.127  1.00 27.38  ? 650  ARG B O   1 
ATOM   10651 C CB  . ARG B 1 628 ? 21.631  -0.150  36.377  1.00 39.32  ? 650  ARG B CB  1 
ATOM   10652 C CG  . ARG B 1 628 ? 21.679  0.081   34.876  1.00 41.28  ? 650  ARG B CG  1 
ATOM   10653 C CD  . ARG B 1 628 ? 20.370  -0.278  34.201  1.00 43.20  ? 650  ARG B CD  1 
ATOM   10654 N NE  . ARG B 1 628 ? 20.585  -0.591  32.792  1.00 47.86  ? 650  ARG B NE  1 
ATOM   10655 C CZ  . ARG B 1 628 ? 19.615  -0.726  31.894  1.00 46.56  ? 650  ARG B CZ  1 
ATOM   10656 N NH1 . ARG B 1 628 ? 18.352  -0.564  32.249  1.00 45.97  ? 650  ARG B NH1 1 
ATOM   10657 N NH2 . ARG B 1 628 ? 19.913  -1.021  30.642  1.00 45.72  ? 650  ARG B NH2 1 
ATOM   10658 N N   . LEU B 1 629 ? 23.879  -0.002  39.295  1.00 36.78  ? 651  LEU B N   1 
ATOM   10659 C CA  . LEU B 1 629 ? 23.895  -0.351  40.705  1.00 33.69  ? 651  LEU B CA  1 
ATOM   10660 C C   . LEU B 1 629 ? 23.496  0.839   41.588  1.00 35.06  ? 651  LEU B C   1 
ATOM   10661 O O   . LEU B 1 629 ? 24.060  1.930   41.482  1.00 32.06  ? 651  LEU B O   1 
ATOM   10662 C CB  . LEU B 1 629 ? 25.280  -0.863  41.095  1.00 28.83  ? 651  LEU B CB  1 
ATOM   10663 C CG  . LEU B 1 629 ? 25.644  -2.224  40.488  1.00 29.02  ? 651  LEU B CG  1 
ATOM   10664 C CD1 . LEU B 1 629 ? 27.108  -2.485  40.663  1.00 28.50  ? 651  LEU B CD1 1 
ATOM   10665 C CD2 . LEU B 1 629 ? 24.828  -3.360  41.119  1.00 28.03  ? 651  LEU B CD2 1 
ATOM   10666 N N   . LYS B 1 630 ? 22.465  0.636   42.396  1.00 35.04  ? 652  LYS B N   1 
ATOM   10667 C CA  . LYS B 1 630 ? 22.111  1.560   43.468  1.00 40.34  ? 652  LYS B CA  1 
ATOM   10668 C C   . LYS B 1 630 ? 22.864  1.282   44.780  1.00 40.51  ? 652  LYS B C   1 
ATOM   10669 O O   . LYS B 1 630 ? 23.091  2.191   45.595  1.00 36.49  ? 652  LYS B O   1 
ATOM   10670 C CB  . LYS B 1 630 ? 20.595  1.555   43.669  1.00 44.02  ? 652  LYS B CB  1 
ATOM   10671 C CG  . LYS B 1 630 ? 19.838  2.034   42.432  1.00 45.33  ? 652  LYS B CG  1 
ATOM   10672 C CD  . LYS B 1 630 ? 18.346  1.785   42.576  1.00 51.79  ? 652  LYS B CD  1 
ATOM   10673 C CE  . LYS B 1 630 ? 17.577  2.186   41.325  1.00 54.88  ? 652  LYS B CE  1 
ATOM   10674 N NZ  . LYS B 1 630 ? 16.921  3.519   41.476  1.00 58.38  ? 652  LYS B NZ  1 
ATOM   10675 N N   . HIS B 1 631 ? 23.185  0.010   45.008  1.00 41.57  ? 653  HIS B N   1 
ATOM   10676 C CA  . HIS B 1 631 ? 24.017  -0.394  46.136  1.00 46.97  ? 653  HIS B CA  1 
ATOM   10677 C C   . HIS B 1 631 ? 24.597  -1.782  45.887  1.00 43.90  ? 653  HIS B C   1 
ATOM   10678 O O   . HIS B 1 631 ? 24.015  -2.585  45.163  1.00 36.72  ? 653  HIS B O   1 
ATOM   10679 C CB  . HIS B 1 631 ? 23.191  -0.416  47.426  1.00 54.31  ? 653  HIS B CB  1 
ATOM   10680 C CG  . HIS B 1 631 ? 22.183  -1.522  47.472  1.00 60.38  ? 653  HIS B CG  1 
ATOM   10681 N ND1 . HIS B 1 631 ? 21.256  -1.724  46.472  1.00 61.15  ? 653  HIS B ND1 1 
ATOM   10682 C CD2 . HIS B 1 631 ? 21.966  -2.495  48.388  1.00 63.64  ? 653  HIS B CD2 1 
ATOM   10683 C CE1 . HIS B 1 631 ? 20.509  -2.771  46.771  1.00 61.82  ? 653  HIS B CE1 1 
ATOM   10684 N NE2 . HIS B 1 631 ? 20.919  -3.257  47.928  1.00 63.06  ? 653  HIS B NE2 1 
ATOM   10685 N N   . ILE B 1 632 ? 25.715  -2.083  46.535  1.00 44.18  ? 654  ILE B N   1 
ATOM   10686 C CA  . ILE B 1 632 ? 26.304  -3.408  46.444  1.00 39.24  ? 654  ILE B CA  1 
ATOM   10687 C C   . ILE B 1 632 ? 26.118  -4.117  47.782  1.00 39.45  ? 654  ILE B C   1 
ATOM   10688 O O   . ILE B 1 632 ? 26.479  -3.573  48.825  1.00 43.40  ? 654  ILE B O   1 
ATOM   10689 C CB  . ILE B 1 632 ? 27.788  -3.337  46.048  1.00 38.49  ? 654  ILE B CB  1 
ATOM   10690 C CG1 . ILE B 1 632 ? 27.919  -2.691  44.667  1.00 39.06  ? 654  ILE B CG1 1 
ATOM   10691 C CG2 . ILE B 1 632 ? 28.404  -4.724  46.021  1.00 37.16  ? 654  ILE B CG2 1 
ATOM   10692 C CD1 . ILE B 1 632 ? 29.323  -2.276  44.299  1.00 41.41  ? 654  ILE B CD1 1 
ATOM   10693 N N   . PRO B 1 633 ? 25.501  -5.307  47.767  1.00 37.12  ? 655  PRO B N   1 
ATOM   10694 C CA  . PRO B 1 633 ? 25.343  -6.014  49.046  1.00 39.79  ? 655  PRO B CA  1 
ATOM   10695 C C   . PRO B 1 633 ? 26.714  -6.305  49.675  1.00 43.45  ? 655  PRO B C   1 
ATOM   10696 O O   . PRO B 1 633 ? 27.656  -6.688  48.949  1.00 40.98  ? 655  PRO B O   1 
ATOM   10697 C CB  . PRO B 1 633 ? 24.627  -7.315  48.653  1.00 39.09  ? 655  PRO B CB  1 
ATOM   10698 C CG  . PRO B 1 633 ? 23.948  -6.999  47.330  1.00 31.32  ? 655  PRO B CG  1 
ATOM   10699 C CD  . PRO B 1 633 ? 24.865  -6.018  46.641  1.00 31.19  ? 655  PRO B CD  1 
ATOM   10700 N N   . ASN B 1 634 ? 26.822  -6.103  50.990  1.00 35.20  ? 656  ASN B N   1 
ATOM   10701 C CA  . ASN B 1 634 ? 28.098  -6.248  51.692  1.00 36.22  ? 656  ASN B CA  1 
ATOM   10702 C C   . ASN B 1 634 ? 28.796  -7.543  51.317  1.00 39.18  ? 656  ASN B C   1 
ATOM   10703 O O   . ASN B 1 634 ? 29.973  -7.542  50.971  1.00 40.19  ? 656  ASN B O   1 
ATOM   10704 C CB  . ASN B 1 634 ? 27.906  -6.189  53.220  1.00 37.54  ? 656  ASN B CB  1 
ATOM   10705 C CG  . ASN B 1 634 ? 27.441  -4.820  53.701  1.00 45.02  ? 656  ASN B CG  1 
ATOM   10706 O OD1 . ASN B 1 634 ? 27.862  -3.788  53.179  1.00 41.64  ? 656  ASN B OD1 1 
ATOM   10707 N ND2 . ASN B 1 634 ? 26.558  -4.809  54.702  1.00 47.55  ? 656  ASN B ND2 1 
ATOM   10708 N N   . GLU B 1 635 ? 28.041  -8.638  51.351  1.00 42.71  ? 657  GLU B N   1 
ATOM   10709 C CA  . GLU B 1 635 ? 28.574  -9.963  51.082  1.00 44.60  ? 657  GLU B CA  1 
ATOM   10710 C C   . GLU B 1 635 ? 29.164  -9.992  49.683  1.00 43.85  ? 657  GLU B C   1 
ATOM   10711 O O   . GLU B 1 635 ? 30.257  -10.517 49.468  1.00 41.28  ? 657  GLU B O   1 
ATOM   10712 C CB  . GLU B 1 635 ? 27.470  -11.009 51.205  1.00 52.33  ? 657  GLU B CB  1 
ATOM   10713 C CG  . GLU B 1 635 ? 27.959  -12.446 51.318  1.00 62.30  ? 657  GLU B CG  1 
ATOM   10714 C CD  . GLU B 1 635 ? 26.837  -13.416 51.694  1.00 70.54  ? 657  GLU B CD  1 
ATOM   10715 O OE1 . GLU B 1 635 ? 25.656  -13.002 51.676  1.00 71.90  ? 657  GLU B OE1 1 
ATOM   10716 O OE2 . GLU B 1 635 ? 27.137  -14.589 52.013  1.00 73.25  ? 657  GLU B OE2 1 
ATOM   10717 N N   . ALA B 1 636 ? 28.439  -9.409  48.735  1.00 41.84  ? 658  ALA B N   1 
ATOM   10718 C CA  . ALA B 1 636 ? 28.884  -9.400  47.348  1.00 39.99  ? 658  ALA B CA  1 
ATOM   10719 C C   . ALA B 1 636 ? 30.202  -8.646  47.154  1.00 38.96  ? 658  ALA B C   1 
ATOM   10720 O O   . ALA B 1 636 ? 31.087  -9.098  46.424  1.00 43.08  ? 658  ALA B O   1 
ATOM   10721 C CB  . ALA B 1 636 ? 27.806  -8.820  46.459  1.00 31.53  ? 658  ALA B CB  1 
ATOM   10722 N N   . PHE B 1 637 ? 30.324  -7.493  47.801  1.00 35.16  ? 659  PHE B N   1 
ATOM   10723 C CA  . PHE B 1 637 ? 31.540  -6.694  47.709  1.00 36.02  ? 659  PHE B CA  1 
ATOM   10724 C C   . PHE B 1 637 ? 32.709  -7.413  48.380  1.00 35.16  ? 659  PHE B C   1 
ATOM   10725 O O   . PHE B 1 637 ? 33.831  -7.411  47.874  1.00 35.73  ? 659  PHE B O   1 
ATOM   10726 C CB  . PHE B 1 637 ? 31.341  -5.323  48.358  1.00 37.72  ? 659  PHE B CB  1 
ATOM   10727 C CG  . PHE B 1 637 ? 32.371  -4.308  47.950  1.00 38.79  ? 659  PHE B CG  1 
ATOM   10728 C CD1 . PHE B 1 637 ? 33.617  -4.275  48.563  1.00 36.29  ? 659  PHE B CD1 1 
ATOM   10729 C CD2 . PHE B 1 637 ? 32.096  -3.396  46.936  1.00 36.42  ? 659  PHE B CD2 1 
ATOM   10730 C CE1 . PHE B 1 637 ? 34.571  -3.340  48.173  1.00 40.65  ? 659  PHE B CE1 1 
ATOM   10731 C CE2 . PHE B 1 637 ? 33.032  -2.463  46.549  1.00 34.80  ? 659  PHE B CE2 1 
ATOM   10732 C CZ  . PHE B 1 637 ? 34.277  -2.432  47.168  1.00 39.54  ? 659  PHE B CZ  1 
ATOM   10733 N N   . LEU B 1 638 ? 32.438  -8.037  49.518  1.00 38.71  ? 660  LEU B N   1 
ATOM   10734 C CA  . LEU B 1 638 ? 33.470  -8.801  50.214  1.00 42.07  ? 660  LEU B CA  1 
ATOM   10735 C C   . LEU B 1 638 ? 33.875  -10.036 49.401  1.00 43.91  ? 660  LEU B C   1 
ATOM   10736 O O   . LEU B 1 638 ? 34.942  -10.600 49.606  1.00 43.85  ? 660  LEU B O   1 
ATOM   10737 C CB  . LEU B 1 638 ? 33.006  -9.182  51.620  1.00 39.52  ? 660  LEU B CB  1 
ATOM   10738 C CG  . LEU B 1 638 ? 32.847  -8.015  52.602  1.00 42.61  ? 660  LEU B CG  1 
ATOM   10739 C CD1 . LEU B 1 638 ? 32.110  -8.441  53.875  1.00 43.79  ? 660  LEU B CD1 1 
ATOM   10740 C CD2 . LEU B 1 638 ? 34.207  -7.449  52.972  1.00 43.62  ? 660  LEU B CD2 1 
ATOM   10741 N N   . ASN B 1 639 ? 33.036  -10.434 48.453  1.00 42.63  ? 661  ASN B N   1 
ATOM   10742 C CA  . ASN B 1 639 ? 33.376  -11.561 47.597  1.00 43.91  ? 661  ASN B CA  1 
ATOM   10743 C C   . ASN B 1 639 ? 34.157  -11.183 46.351  1.00 41.94  ? 661  ASN B C   1 
ATOM   10744 O O   . ASN B 1 639 ? 34.382  -12.027 45.494  1.00 44.91  ? 661  ASN B O   1 
ATOM   10745 C CB  . ASN B 1 639 ? 32.144  -12.385 47.228  1.00 45.65  ? 661  ASN B CB  1 
ATOM   10746 C CG  . ASN B 1 639 ? 31.732  -13.328 48.340  1.00 44.53  ? 661  ASN B CG  1 
ATOM   10747 O OD1 . ASN B 1 639 ? 32.500  -13.565 49.259  1.00 35.66  ? 661  ASN B OD1 1 
ATOM   10748 N ND2 . ASN B 1 639 ? 30.514  -13.877 48.253  1.00 45.44  ? 661  ASN B ND2 1 
ATOM   10749 N N   . LEU B 1 640 ? 34.552  -9.918  46.232  1.00 42.16  ? 662  LEU B N   1 
ATOM   10750 C CA  . LEU B 1 640 ? 35.426  -9.508  45.124  1.00 41.92  ? 662  LEU B CA  1 
ATOM   10751 C C   . LEU B 1 640 ? 36.867  -9.963  45.410  1.00 44.52  ? 662  LEU B C   1 
ATOM   10752 O O   . LEU B 1 640 ? 37.291  -9.982  46.572  1.00 44.30  ? 662  LEU B O   1 
ATOM   10753 C CB  . LEU B 1 640 ? 35.375  -7.992  44.901  1.00 37.44  ? 662  LEU B CB  1 
ATOM   10754 C CG  . LEU B 1 640 ? 34.063  -7.343  44.430  1.00 36.56  ? 662  LEU B CG  1 
ATOM   10755 C CD1 . LEU B 1 640 ? 34.300  -5.865  44.108  1.00 32.84  ? 662  LEU B CD1 1 
ATOM   10756 C CD2 . LEU B 1 640 ? 33.479  -8.062  43.224  1.00 33.29  ? 662  LEU B CD2 1 
ATOM   10757 N N   . PRO B 1 641 ? 37.629  -10.312 44.354  1.00 43.81  ? 663  PRO B N   1 
ATOM   10758 C CA  . PRO B 1 641 ? 38.935  -10.953 44.576  1.00 43.83  ? 663  PRO B CA  1 
ATOM   10759 C C   . PRO B 1 641 ? 39.846  -10.094 45.445  1.00 43.79  ? 663  PRO B C   1 
ATOM   10760 O O   . PRO B 1 641 ? 39.979  -8.906  45.169  1.00 46.57  ? 663  PRO B O   1 
ATOM   10761 C CB  . PRO B 1 641 ? 39.516  -11.086 43.161  1.00 41.43  ? 663  PRO B CB  1 
ATOM   10762 C CG  . PRO B 1 641 ? 38.338  -10.965 42.238  1.00 40.04  ? 663  PRO B CG  1 
ATOM   10763 C CD  . PRO B 1 641 ? 37.377  -10.043 42.928  1.00 39.72  ? 663  PRO B CD  1 
ATOM   10764 N N   . ALA B 1 642 ? 40.435  -10.689 46.480  1.00 38.04  ? 664  ALA B N   1 
ATOM   10765 C CA  . ALA B 1 642 ? 41.348  -9.987  47.391  1.00 39.42  ? 664  ALA B CA  1 
ATOM   10766 C C   . ALA B 1 642 ? 42.564  -9.453  46.653  1.00 43.00  ? 664  ALA B C   1 
ATOM   10767 O O   . ALA B 1 642 ? 43.252  -8.544  47.122  1.00 45.41  ? 664  ALA B O   1 
ATOM   10768 C CB  . ALA B 1 642 ? 41.786  -10.916 48.533  1.00 40.72  ? 664  ALA B CB  1 
ATOM   10769 N N   . SER B 1 643 ? 42.816  -10.017 45.481  1.00 42.04  ? 665  SER B N   1 
ATOM   10770 C CA  . SER B 1 643 ? 43.970  -9.632  44.691  1.00 44.07  ? 665  SER B CA  1 
ATOM   10771 C C   . SER B 1 643 ? 43.832  -8.260  44.013  1.00 43.74  ? 665  SER B C   1 
ATOM   10772 O O   . SER B 1 643 ? 44.818  -7.731  43.509  1.00 45.47  ? 665  SER B O   1 
ATOM   10773 C CB  . SER B 1 643 ? 44.248  -10.707 43.638  1.00 45.47  ? 665  SER B CB  1 
ATOM   10774 O OG  . SER B 1 643 ? 43.187  -10.771 42.697  1.00 47.80  ? 665  SER B OG  1 
ATOM   10775 N N   . LEU B 1 644 ? 42.631  -7.685  43.997  1.00 43.75  ? 666  LEU B N   1 
ATOM   10776 C CA  . LEU B 1 644 ? 42.389  -6.463  43.214  1.00 44.01  ? 666  LEU B CA  1 
ATOM   10777 C C   . LEU B 1 644 ? 43.333  -5.324  43.575  1.00 42.59  ? 666  LEU B C   1 
ATOM   10778 O O   . LEU B 1 644 ? 43.496  -4.998  44.753  1.00 42.26  ? 666  LEU B O   1 
ATOM   10779 C CB  . LEU B 1 644 ? 40.948  -5.977  43.369  1.00 36.18  ? 666  LEU B CB  1 
ATOM   10780 C CG  . LEU B 1 644 ? 39.850  -6.794  42.693  1.00 34.88  ? 666  LEU B CG  1 
ATOM   10781 C CD1 . LEU B 1 644 ? 38.488  -6.174  42.964  1.00 34.72  ? 666  LEU B CD1 1 
ATOM   10782 C CD2 . LEU B 1 644 ? 40.095  -6.897  41.198  1.00 33.99  ? 666  LEU B CD2 1 
ATOM   10783 N N   . THR B 1 645 ? 44.017  -4.781  42.570  1.00 41.05  ? 667  THR B N   1 
ATOM   10784 C CA  . THR B 1 645 ? 44.698  -3.504  42.724  1.00 41.71  ? 667  THR B CA  1 
ATOM   10785 C C   . THR B 1 645 ? 43.906  -2.301  42.189  1.00 40.14  ? 667  THR B C   1 
ATOM   10786 O O   . THR B 1 645 ? 44.163  -1.156  42.577  1.00 40.62  ? 667  THR B O   1 
ATOM   10787 C CB  . THR B 1 645 ? 46.074  -3.544  42.036  1.00 42.15  ? 667  THR B CB  1 
ATOM   10788 O OG1 . THR B 1 645 ? 45.907  -3.864  40.644  1.00 43.30  ? 667  THR B OG1 1 
ATOM   10789 C CG2 . THR B 1 645 ? 46.946  -4.599  42.692  1.00 40.40  ? 667  THR B CG2 1 
ATOM   10790 N N   . GLU B 1 646 ? 42.934  -2.568  41.321  1.00 36.60  ? 668  GLU B N   1 
ATOM   10791 C CA  . GLU B 1 646 ? 42.197  -1.504  40.635  1.00 45.05  ? 668  GLU B CA  1 
ATOM   10792 C C   . GLU B 1 646 ? 40.724  -1.865  40.443  1.00 40.47  ? 668  GLU B C   1 
ATOM   10793 O O   . GLU B 1 646 ? 40.398  -2.890  39.846  1.00 36.05  ? 668  GLU B O   1 
ATOM   10794 C CB  . GLU B 1 646 ? 42.849  -1.204  39.275  1.00 50.24  ? 668  GLU B CB  1 
ATOM   10795 C CG  . GLU B 1 646 ? 42.007  -0.364  38.312  1.00 53.97  ? 668  GLU B CG  1 
ATOM   10796 C CD  . GLU B 1 646 ? 42.759  -0.015  37.020  1.00 58.22  ? 668  GLU B CD  1 
ATOM   10797 O OE1 . GLU B 1 646 ? 43.944  -0.402  36.891  1.00 58.58  ? 668  GLU B OE1 1 
ATOM   10798 O OE2 . GLU B 1 646 ? 42.165  0.644   36.135  1.00 56.95  ? 668  GLU B OE2 1 
ATOM   10799 N N   . LEU B 1 647 ? 39.839  -0.994  40.903  1.00 40.90  ? 669  LEU B N   1 
ATOM   10800 C CA  . LEU B 1 647 ? 38.414  -1.288  40.888  1.00 35.93  ? 669  LEU B CA  1 
ATOM   10801 C C   . LEU B 1 647 ? 37.607  -0.098  40.372  1.00 34.88  ? 669  LEU B C   1 
ATOM   10802 O O   . LEU B 1 647 ? 37.661  0.990   40.935  1.00 39.55  ? 669  LEU B O   1 
ATOM   10803 C CB  . LEU B 1 647 ? 37.953  -1.702  42.293  1.00 35.96  ? 669  LEU B CB  1 
ATOM   10804 C CG  . LEU B 1 647 ? 36.456  -1.836  42.583  1.00 37.40  ? 669  LEU B CG  1 
ATOM   10805 C CD1 . LEU B 1 647 ? 35.812  -2.880  41.686  1.00 32.43  ? 669  LEU B CD1 1 
ATOM   10806 C CD2 . LEU B 1 647 ? 36.243  -2.190  44.033  1.00 37.80  ? 669  LEU B CD2 1 
ATOM   10807 N N   . HIS B 1 648 ? 36.872  -0.311  39.288  1.00 36.00  ? 670  HIS B N   1 
ATOM   10808 C CA  . HIS B 1 648 ? 36.026  0.736   38.717  1.00 35.35  ? 670  HIS B CA  1 
ATOM   10809 C C   . HIS B 1 648 ? 34.546  0.458   38.961  1.00 33.38  ? 670  HIS B C   1 
ATOM   10810 O O   . HIS B 1 648 ? 33.997  -0.525  38.474  1.00 33.65  ? 670  HIS B O   1 
ATOM   10811 C CB  . HIS B 1 648 ? 36.284  0.887   37.219  1.00 34.60  ? 670  HIS B CB  1 
ATOM   10812 C CG  . HIS B 1 648 ? 37.660  1.382   36.891  1.00 39.64  ? 670  HIS B CG  1 
ATOM   10813 N ND1 . HIS B 1 648 ? 37.950  2.720   36.729  1.00 40.09  ? 670  HIS B ND1 1 
ATOM   10814 C CD2 . HIS B 1 648 ? 38.826  0.719   36.695  1.00 39.08  ? 670  HIS B CD2 1 
ATOM   10815 C CE1 . HIS B 1 648 ? 39.231  2.860   36.444  1.00 38.67  ? 670  HIS B CE1 1 
ATOM   10816 N NE2 . HIS B 1 648 ? 39.784  1.659   36.411  1.00 40.68  ? 670  HIS B NE2 1 
ATOM   10817 N N   . ILE B 1 649 ? 33.936  1.273   39.802  1.00 31.49  ? 671  ILE B N   1 
ATOM   10818 C CA  . ILE B 1 649 ? 32.487  1.279   39.982  1.00 38.45  ? 671  ILE B CA  1 
ATOM   10819 C C   . ILE B 1 649 ? 31.744  2.472   39.340  1.00 37.15  ? 671  ILE B C   1 
ATOM   10820 O O   . ILE B 1 649 ? 30.602  2.782   39.701  1.00 37.43  ? 671  ILE B O   1 
ATOM   10821 C CB  . ILE B 1 649 ? 32.080  0.971   41.424  1.00 38.77  ? 671  ILE B CB  1 
ATOM   10822 C CG1 . ILE B 1 649 ? 33.171  0.124   42.094  1.00 32.31  ? 671  ILE B CG1 1 
ATOM   10823 C CG2 . ILE B 1 649 ? 30.757  0.215   41.427  1.00 36.26  ? 671  ILE B CG2 1 
ATOM   10824 C CD1 . ILE B 1 649 ? 32.813  -0.357  43.492  1.00 33.00  ? 671  ILE B CD1 1 
ATOM   10825 N N   . ASN B 1 650 ? 32.439  3.210   38.481  1.00 35.23  ? 672  ASN B N   1 
ATOM   10826 C CA  . ASN B 1 650 ? 31.928  4.486   37.982  1.00 30.88  ? 672  ASN B CA  1 
ATOM   10827 C C   . ASN B 1 650 ? 30.669  4.400   37.113  1.00 29.90  ? 672  ASN B C   1 
ATOM   10828 O O   . ASN B 1 650 ? 30.342  3.349   36.599  1.00 34.56  ? 672  ASN B O   1 
ATOM   10829 C CB  . ASN B 1 650 ? 33.019  5.213   37.213  1.00 41.21  ? 672  ASN B CB  1 
ATOM   10830 C CG  . ASN B 1 650 ? 33.459  4.441   36.003  1.00 35.86  ? 672  ASN B CG  1 
ATOM   10831 O OD1 . ASN B 1 650 ? 34.115  3.407   36.130  1.00 36.33  ? 672  ASN B OD1 1 
ATOM   10832 N ND2 . ASN B 1 650 ? 33.064  4.907   34.820  1.00 33.37  ? 672  ASN B ND2 1 
ATOM   10833 N N   . ASP B 1 651 ? 29.963  5.522   36.987  1.00 36.38  ? 673  ASP B N   1 
ATOM   10834 C CA  . ASP B 1 651 ? 28.736  5.632   36.189  1.00 34.47  ? 673  ASP B CA  1 
ATOM   10835 C C   . ASP B 1 651 ? 27.693  4.558   36.491  1.00 33.63  ? 673  ASP B C   1 
ATOM   10836 O O   . ASP B 1 651 ? 27.110  3.962   35.590  1.00 30.35  ? 673  ASP B O   1 
ATOM   10837 C CB  . ASP B 1 651 ? 29.053  5.695   34.688  1.00 38.36  ? 673  ASP B CB  1 
ATOM   10838 C CG  . ASP B 1 651 ? 29.945  6.879   34.334  1.00 42.82  ? 673  ASP B CG  1 
ATOM   10839 O OD1 . ASP B 1 651 ? 29.671  8.000