data_3WSZ
# 
_entry.id   3WSZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3WSZ         
RCSB  RCSB096753   
WWPDB D_1000096753 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3WSX 'same protein Ligand-free form'                         unspecified 
PDB 3WSY 'same protein complex with its own propeptide fragment' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3WSZ 
_pdbx_database_status.recvd_initial_deposition_date   2014-03-30 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kitago, Y.' 1 
'Nakata, Z.' 2 
'Nagae, M.'  3 
'Nogi, T.'   4 
'Takagi, J.' 5 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for amyloidogenic peptide recognition by sorLA.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            22 
_citation.page_first                199 
_citation.page_last                 206 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25643321 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2954 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kitago, Y.'         1 ? 
primary 'Nagae, M.'          2 ? 
primary 'Nakata, Z.'         3 ? 
primary 'Yagi-Utsumi, M.'    4 ? 
primary 'Takagi-Niidome, S.' 5 ? 
primary 'Mihara, E.'         6 ? 
primary 'Nogi, T.'           7 ? 
primary 'Kato, K.'           8 ? 
primary 'Takagi, J.'         9 ? 
# 
_cell.entry_id           3WSZ 
_cell.length_a           163.735 
_cell.length_b           163.735 
_cell.length_c           121.093 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3WSZ 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sortilin-related receptor'              76568.766 1 ? ? 'N-terminal domain, UNP residues 86-753' ? 
2 polymer     syn '10-mer peptide'                         728.793   1 ? ? ?                                        ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4 ? ? ?                                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Neuronal extracellular receptor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVI
AQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMI
QEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSV
QLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVR
YFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQL
LNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYS
TNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECL
LGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRR
TRGYRKISGDTCSGGDVEARLEGELVPCPSRLENLYFQ
;
;EQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVI
AQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMI
QEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSV
QLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVR
YFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQL
LNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYS
TNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECL
LGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRR
TRGYRKISGDTCSGGDVEARLEGELVPCPSRLENLYFQ
;
A ? 
2 'polypeptide(L)' no no AAAAAAAAAA AAAAAAAAAA C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLN n 
1 3   PRO n 
1 4   GLU n 
1 5   PRO n 
1 6   ILE n 
1 7   LYS n 
1 8   VAL n 
1 9   TYR n 
1 10  GLY n 
1 11  GLN n 
1 12  VAL n 
1 13  SER n 
1 14  LEU n 
1 15  ASN n 
1 16  ASP n 
1 17  SER n 
1 18  HIS n 
1 19  ASN n 
1 20  GLN n 
1 21  MET n 
1 22  VAL n 
1 23  VAL n 
1 24  HIS n 
1 25  TRP n 
1 26  ALA n 
1 27  GLY n 
1 28  GLU n 
1 29  LYS n 
1 30  SER n 
1 31  ASN n 
1 32  VAL n 
1 33  ILE n 
1 34  VAL n 
1 35  ALA n 
1 36  LEU n 
1 37  ALA n 
1 38  ARG n 
1 39  ASP n 
1 40  SER n 
1 41  LEU n 
1 42  ALA n 
1 43  LEU n 
1 44  ALA n 
1 45  ARG n 
1 46  PRO n 
1 47  LYS n 
1 48  SER n 
1 49  SER n 
1 50  ASP n 
1 51  VAL n 
1 52  TYR n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  ASP n 
1 57  TYR n 
1 58  GLY n 
1 59  LYS n 
1 60  SER n 
1 61  PHE n 
1 62  LYS n 
1 63  LYS n 
1 64  ILE n 
1 65  SER n 
1 66  ASP n 
1 67  LYS n 
1 68  LEU n 
1 69  ASN n 
1 70  PHE n 
1 71  GLY n 
1 72  LEU n 
1 73  GLY n 
1 74  ASN n 
1 75  ARG n 
1 76  SER n 
1 77  GLU n 
1 78  ALA n 
1 79  VAL n 
1 80  ILE n 
1 81  ALA n 
1 82  GLN n 
1 83  PHE n 
1 84  TYR n 
1 85  HIS n 
1 86  SER n 
1 87  PRO n 
1 88  ALA n 
1 89  ASP n 
1 90  ASN n 
1 91  LYS n 
1 92  ARG n 
1 93  TYR n 
1 94  ILE n 
1 95  PHE n 
1 96  ALA n 
1 97  ASP n 
1 98  ALA n 
1 99  TYR n 
1 100 ALA n 
1 101 GLN n 
1 102 TYR n 
1 103 LEU n 
1 104 TRP n 
1 105 ILE n 
1 106 THR n 
1 107 PHE n 
1 108 ASP n 
1 109 PHE n 
1 110 CYS n 
1 111 ASN n 
1 112 THR n 
1 113 LEU n 
1 114 GLN n 
1 115 GLY n 
1 116 PHE n 
1 117 SER n 
1 118 ILE n 
1 119 PRO n 
1 120 PHE n 
1 121 ARG n 
1 122 ALA n 
1 123 ALA n 
1 124 ASP n 
1 125 LEU n 
1 126 LEU n 
1 127 LEU n 
1 128 HIS n 
1 129 SER n 
1 130 LYS n 
1 131 ALA n 
1 132 SER n 
1 133 ASN n 
1 134 LEU n 
1 135 LEU n 
1 136 LEU n 
1 137 GLY n 
1 138 PHE n 
1 139 ASP n 
1 140 ARG n 
1 141 SER n 
1 142 HIS n 
1 143 PRO n 
1 144 ASN n 
1 145 LYS n 
1 146 GLN n 
1 147 LEU n 
1 148 TRP n 
1 149 LYS n 
1 150 SER n 
1 151 ASP n 
1 152 ASP n 
1 153 PHE n 
1 154 GLY n 
1 155 GLN n 
1 156 THR n 
1 157 TRP n 
1 158 ILE n 
1 159 MET n 
1 160 ILE n 
1 161 GLN n 
1 162 GLU n 
1 163 HIS n 
1 164 VAL n 
1 165 LYS n 
1 166 SER n 
1 167 PHE n 
1 168 SER n 
1 169 TRP n 
1 170 GLY n 
1 171 ILE n 
1 172 ASP n 
1 173 PRO n 
1 174 TYR n 
1 175 ASP n 
1 176 LYS n 
1 177 PRO n 
1 178 ASN n 
1 179 THR n 
1 180 ILE n 
1 181 TYR n 
1 182 ILE n 
1 183 GLU n 
1 184 ARG n 
1 185 HIS n 
1 186 GLU n 
1 187 PRO n 
1 188 SER n 
1 189 GLY n 
1 190 TYR n 
1 191 SER n 
1 192 THR n 
1 193 VAL n 
1 194 PHE n 
1 195 ARG n 
1 196 SER n 
1 197 THR n 
1 198 ASP n 
1 199 PHE n 
1 200 PHE n 
1 201 GLN n 
1 202 SER n 
1 203 ARG n 
1 204 GLU n 
1 205 ASN n 
1 206 GLN n 
1 207 GLU n 
1 208 VAL n 
1 209 ILE n 
1 210 LEU n 
1 211 GLU n 
1 212 GLU n 
1 213 VAL n 
1 214 ARG n 
1 215 ASP n 
1 216 PHE n 
1 217 GLN n 
1 218 LEU n 
1 219 ARG n 
1 220 ASP n 
1 221 LYS n 
1 222 TYR n 
1 223 MET n 
1 224 PHE n 
1 225 ALA n 
1 226 THR n 
1 227 LYS n 
1 228 VAL n 
1 229 VAL n 
1 230 HIS n 
1 231 LEU n 
1 232 LEU n 
1 233 GLY n 
1 234 SER n 
1 235 GLU n 
1 236 GLN n 
1 237 GLN n 
1 238 SER n 
1 239 SER n 
1 240 VAL n 
1 241 GLN n 
1 242 LEU n 
1 243 TRP n 
1 244 VAL n 
1 245 SER n 
1 246 PHE n 
1 247 GLY n 
1 248 ARG n 
1 249 LYS n 
1 250 PRO n 
1 251 MET n 
1 252 ARG n 
1 253 ALA n 
1 254 ALA n 
1 255 GLN n 
1 256 PHE n 
1 257 VAL n 
1 258 THR n 
1 259 ARG n 
1 260 HIS n 
1 261 PRO n 
1 262 ILE n 
1 263 ASN n 
1 264 GLU n 
1 265 TYR n 
1 266 TYR n 
1 267 ILE n 
1 268 ALA n 
1 269 ASP n 
1 270 ALA n 
1 271 SER n 
1 272 GLU n 
1 273 ASP n 
1 274 GLN n 
1 275 VAL n 
1 276 PHE n 
1 277 VAL n 
1 278 CYS n 
1 279 VAL n 
1 280 SER n 
1 281 HIS n 
1 282 SER n 
1 283 ASN n 
1 284 ASN n 
1 285 ARG n 
1 286 THR n 
1 287 ASN n 
1 288 LEU n 
1 289 TYR n 
1 290 ILE n 
1 291 SER n 
1 292 GLU n 
1 293 ALA n 
1 294 GLU n 
1 295 GLY n 
1 296 LEU n 
1 297 LYS n 
1 298 PHE n 
1 299 SER n 
1 300 LEU n 
1 301 SER n 
1 302 LEU n 
1 303 GLU n 
1 304 ASN n 
1 305 VAL n 
1 306 LEU n 
1 307 TYR n 
1 308 TYR n 
1 309 SER n 
1 310 PRO n 
1 311 GLY n 
1 312 GLY n 
1 313 ALA n 
1 314 GLY n 
1 315 SER n 
1 316 ASP n 
1 317 THR n 
1 318 LEU n 
1 319 VAL n 
1 320 ARG n 
1 321 TYR n 
1 322 PHE n 
1 323 ALA n 
1 324 ASN n 
1 325 GLU n 
1 326 PRO n 
1 327 PHE n 
1 328 ALA n 
1 329 ASP n 
1 330 PHE n 
1 331 HIS n 
1 332 ARG n 
1 333 VAL n 
1 334 GLU n 
1 335 GLY n 
1 336 LEU n 
1 337 GLN n 
1 338 GLY n 
1 339 VAL n 
1 340 TYR n 
1 341 ILE n 
1 342 ALA n 
1 343 THR n 
1 344 LEU n 
1 345 ILE n 
1 346 ASN n 
1 347 GLY n 
1 348 SER n 
1 349 MET n 
1 350 ASN n 
1 351 GLU n 
1 352 GLU n 
1 353 ASN n 
1 354 MET n 
1 355 ARG n 
1 356 SER n 
1 357 VAL n 
1 358 ILE n 
1 359 THR n 
1 360 PHE n 
1 361 ASP n 
1 362 LYS n 
1 363 GLY n 
1 364 GLY n 
1 365 THR n 
1 366 TRP n 
1 367 GLU n 
1 368 PHE n 
1 369 LEU n 
1 370 GLN n 
1 371 ALA n 
1 372 PRO n 
1 373 ALA n 
1 374 PHE n 
1 375 THR n 
1 376 GLY n 
1 377 TYR n 
1 378 GLY n 
1 379 GLU n 
1 380 LYS n 
1 381 ILE n 
1 382 ASN n 
1 383 CYS n 
1 384 GLU n 
1 385 LEU n 
1 386 SER n 
1 387 GLN n 
1 388 GLY n 
1 389 CYS n 
1 390 SER n 
1 391 LEU n 
1 392 HIS n 
1 393 LEU n 
1 394 ALA n 
1 395 GLN n 
1 396 ARG n 
1 397 LEU n 
1 398 SER n 
1 399 GLN n 
1 400 LEU n 
1 401 LEU n 
1 402 ASN n 
1 403 LEU n 
1 404 GLN n 
1 405 LEU n 
1 406 ARG n 
1 407 ARG n 
1 408 MET n 
1 409 PRO n 
1 410 ILE n 
1 411 LEU n 
1 412 SER n 
1 413 LYS n 
1 414 GLU n 
1 415 SER n 
1 416 ALA n 
1 417 PRO n 
1 418 GLY n 
1 419 LEU n 
1 420 ILE n 
1 421 ILE n 
1 422 ALA n 
1 423 THR n 
1 424 GLY n 
1 425 SER n 
1 426 VAL n 
1 427 GLY n 
1 428 LYS n 
1 429 ASN n 
1 430 LEU n 
1 431 ALA n 
1 432 SER n 
1 433 LYS n 
1 434 THR n 
1 435 ASN n 
1 436 VAL n 
1 437 TYR n 
1 438 ILE n 
1 439 SER n 
1 440 SER n 
1 441 SER n 
1 442 ALA n 
1 443 GLY n 
1 444 ALA n 
1 445 ARG n 
1 446 TRP n 
1 447 ARG n 
1 448 GLU n 
1 449 ALA n 
1 450 LEU n 
1 451 PRO n 
1 452 GLY n 
1 453 PRO n 
1 454 HIS n 
1 455 TYR n 
1 456 TYR n 
1 457 THR n 
1 458 TRP n 
1 459 GLY n 
1 460 ASP n 
1 461 HIS n 
1 462 GLY n 
1 463 GLY n 
1 464 ILE n 
1 465 ILE n 
1 466 THR n 
1 467 ALA n 
1 468 ILE n 
1 469 ALA n 
1 470 GLN n 
1 471 GLY n 
1 472 MET n 
1 473 GLU n 
1 474 THR n 
1 475 ASN n 
1 476 GLU n 
1 477 LEU n 
1 478 LYS n 
1 479 TYR n 
1 480 SER n 
1 481 THR n 
1 482 ASN n 
1 483 GLU n 
1 484 GLY n 
1 485 GLU n 
1 486 THR n 
1 487 TRP n 
1 488 LYS n 
1 489 THR n 
1 490 PHE n 
1 491 ILE n 
1 492 PHE n 
1 493 SER n 
1 494 GLU n 
1 495 LYS n 
1 496 PRO n 
1 497 VAL n 
1 498 PHE n 
1 499 VAL n 
1 500 TYR n 
1 501 GLY n 
1 502 LEU n 
1 503 LEU n 
1 504 THR n 
1 505 GLU n 
1 506 PRO n 
1 507 GLY n 
1 508 GLU n 
1 509 LYS n 
1 510 SER n 
1 511 THR n 
1 512 VAL n 
1 513 PHE n 
1 514 THR n 
1 515 ILE n 
1 516 PHE n 
1 517 GLY n 
1 518 SER n 
1 519 ASN n 
1 520 LYS n 
1 521 GLU n 
1 522 ASN n 
1 523 VAL n 
1 524 HIS n 
1 525 SER n 
1 526 TRP n 
1 527 LEU n 
1 528 ILE n 
1 529 LEU n 
1 530 GLN n 
1 531 VAL n 
1 532 ASN n 
1 533 ALA n 
1 534 THR n 
1 535 ASP n 
1 536 ALA n 
1 537 LEU n 
1 538 GLY n 
1 539 VAL n 
1 540 PRO n 
1 541 CYS n 
1 542 THR n 
1 543 GLU n 
1 544 ASN n 
1 545 ASP n 
1 546 TYR n 
1 547 LYS n 
1 548 LEU n 
1 549 TRP n 
1 550 SER n 
1 551 PRO n 
1 552 SER n 
1 553 ASP n 
1 554 GLU n 
1 555 ARG n 
1 556 GLY n 
1 557 ASN n 
1 558 GLU n 
1 559 CYS n 
1 560 LEU n 
1 561 LEU n 
1 562 GLY n 
1 563 HIS n 
1 564 LYS n 
1 565 THR n 
1 566 VAL n 
1 567 PHE n 
1 568 LYS n 
1 569 ARG n 
1 570 ARG n 
1 571 THR n 
1 572 PRO n 
1 573 HIS n 
1 574 ALA n 
1 575 THR n 
1 576 CYS n 
1 577 PHE n 
1 578 ASN n 
1 579 GLY n 
1 580 GLU n 
1 581 ASP n 
1 582 PHE n 
1 583 ASP n 
1 584 ARG n 
1 585 PRO n 
1 586 VAL n 
1 587 VAL n 
1 588 VAL n 
1 589 SER n 
1 590 ASN n 
1 591 CYS n 
1 592 SER n 
1 593 CYS n 
1 594 THR n 
1 595 ARG n 
1 596 GLU n 
1 597 ASP n 
1 598 TYR n 
1 599 GLU n 
1 600 CYS n 
1 601 ASP n 
1 602 PHE n 
1 603 GLY n 
1 604 PHE n 
1 605 LYS n 
1 606 MET n 
1 607 SER n 
1 608 GLU n 
1 609 ASP n 
1 610 LEU n 
1 611 SER n 
1 612 LEU n 
1 613 GLU n 
1 614 VAL n 
1 615 CYS n 
1 616 VAL n 
1 617 PRO n 
1 618 ASP n 
1 619 PRO n 
1 620 GLU n 
1 621 PHE n 
1 622 SER n 
1 623 GLY n 
1 624 LYS n 
1 625 SER n 
1 626 TYR n 
1 627 SER n 
1 628 PRO n 
1 629 PRO n 
1 630 VAL n 
1 631 PRO n 
1 632 CYS n 
1 633 PRO n 
1 634 VAL n 
1 635 GLY n 
1 636 SER n 
1 637 THR n 
1 638 TYR n 
1 639 ARG n 
1 640 ARG n 
1 641 THR n 
1 642 ARG n 
1 643 GLY n 
1 644 TYR n 
1 645 ARG n 
1 646 LYS n 
1 647 ILE n 
1 648 SER n 
1 649 GLY n 
1 650 ASP n 
1 651 THR n 
1 652 CYS n 
1 653 SER n 
1 654 GLY n 
1 655 GLY n 
1 656 ASP n 
1 657 VAL n 
1 658 GLU n 
1 659 ALA n 
1 660 ARG n 
1 661 LEU n 
1 662 GLU n 
1 663 GLY n 
1 664 GLU n 
1 665 LEU n 
1 666 VAL n 
1 667 PRO n 
1 668 CYS n 
1 669 PRO n 
1 670 SER n 
1 671 ARG n 
1 672 LEU n 
1 673 GLU n 
1 674 ASN n 
1 675 LEU n 
1 676 TYR n 
1 677 PHE n 
1 678 GLN n 
2 1   ALA n 
2 2   ALA n 
2 3   ALA n 
2 4   ALA n 
2 5   ALA n 
2 6   ALA n 
2 7   ALA n 
2 8   ALA n 
2 9   ALA n 
2 10  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SORL1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'lec 3.2.8.1' 
_entity_src_gen.pdbx_host_org_cell_line            'CHO Cells' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pEF 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SORL_HUMAN Q92673 1 
;QPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIA
QFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQ
EHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQ
LWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRY
FANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLL
NLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYST
NEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLL
GHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRT
RGYRKISGDTCSGGDVEARLEGELVPCP
;
86 ? 
2 PDB 3WSZ       3WSZ   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3WSZ A 2 ? 669 ? Q92673 86 ? 753 ? 86 753 
2 2 3WSZ C 1 ? 10  ? 3WSZ   6  ? 15  ? 6  15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3WSZ GLU A 1   ? UNP Q92673 ? ? 'SEE REMARK 999' 85  1  
1 3WSZ SER A 670 ? UNP Q92673 ? ? 'expression tag' 754 2  
1 3WSZ ARG A 671 ? UNP Q92673 ? ? 'expression tag' 755 3  
1 3WSZ LEU A 672 ? UNP Q92673 ? ? 'expression tag' 756 4  
1 3WSZ GLU A 673 ? UNP Q92673 ? ? 'expression tag' 757 5  
1 3WSZ ASN A 674 ? UNP Q92673 ? ? 'expression tag' 758 6  
1 3WSZ LEU A 675 ? UNP Q92673 ? ? 'expression tag' 759 7  
1 3WSZ TYR A 676 ? UNP Q92673 ? ? 'expression tag' 760 8  
1 3WSZ PHE A 677 ? UNP Q92673 ? ? 'expression tag' 761 9  
1 3WSZ GLN A 678 ? UNP Q92673 ? ? 'expression tag' 762 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3WSZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_percent_sol   59.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    '0.1M Tris, 1.41M Sodium Acetate, pH 7.8, VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2012-04-18 
_diffrn_detector.details                'The double crystal monochromator and the K-B mirror system' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Si 111 crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     3WSZ 
_reflns.observed_criterion_sigma_I   -1 
_reflns.observed_criterion_sigma_F   -1 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.20 
_reflns.number_obs                   16271 
_reflns.number_all                   16303 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.070 
_reflns.pdbx_netI_over_sigmaI        29.1 
_reflns.B_iso_Wilson_estimate        99.1 
_reflns.pdbx_redundancy              7.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.20 
_reflns_shell.d_res_low                   3.31 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             0.480 
_reflns_shell.meanI_over_sigI_obs         4.77 
_reflns_shell.pdbx_redundancy             7.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           1580 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3WSZ 
_refine.ls_number_reflns_obs                     16244 
_refine.ls_number_reflns_all                     16293 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.009 
_refine.ls_d_res_high                            3.201 
_refine.ls_percent_reflns_obs                    99.70 
_refine.ls_R_factor_obs                          0.2740 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2729 
_refine.ls_R_factor_R_free                       0.2963 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_number_reflns_R_free                  816 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               129.9300 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3WSY 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.overall_FOM_work_R_set                   0.7513 
_refine.B_iso_max                                207.770 
_refine.B_iso_min                                88.550 
_refine.pdbx_overall_phase_error                 30.3500 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4525 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4581 
_refine_hist.d_res_high                       3.201 
_refine_hist.d_res_low                        49.009 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           4702 0.006  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          6367 1.049  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     689  0.068  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      812  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1688 14.279 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
3.2015 3.4020  6 100.0000 2503 . 0.3314 0.3477 . 136 . 2639 . 'X-RAY DIFFRACTION' . 
3.4020 3.6646  6 100.0000 2512 . 0.3239 0.3790 . 141 . 2653 . 'X-RAY DIFFRACTION' . 
3.6646 4.0332  6 100.0000 2509 . 0.3050 0.3367 . 157 . 2666 . 'X-RAY DIFFRACTION' . 
4.0332 4.6165  6 100.0000 2562 . 0.2637 0.2952 . 126 . 2688 . 'X-RAY DIFFRACTION' . 
4.6165 5.8148  6 100.0000 2611 . 0.2479 0.2571 . 132 . 2743 . 'X-RAY DIFFRACTION' . 
5.8148 49.0149 6 99.0000  2731 . 0.2589 0.2667 . 124 . 2855 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3WSZ 
_struct.title                     'SorLA Vps10p domain in complex with Abeta-derived peptide' 
_struct.pdbx_descriptor           'Sortilin-related receptor, 10-mer peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3WSZ 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'Beta-Propeller, Receptor, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 65  ? LEU A 68  ? SER A 149 LEU A 152 5 ? 4 
HELX_P HELX_P2 2 THR A 317 ? PHE A 322 ? THR A 401 PHE A 406 5 ? 6 
HELX_P HELX_P3 3 GLN A 395 ? ASN A 402 ? GLN A 479 ASN A 486 1 ? 8 
HELX_P HELX_P4 4 ALA A 533 ? GLY A 538 ? ALA A 617 GLY A 622 1 ? 6 
HELX_P HELX_P5 5 THR A 542 ? ASN A 544 ? THR A 626 ASN A 628 5 ? 3 
HELX_P HELX_P6 6 SER A 550 ? ARG A 555 ? SER A 634 ARG A 639 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 383 SG  ? ? ? 1_555 A CYS 389 SG ? ? A CYS 467 A CYS 473 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2 disulf ?   ? A CYS 541 SG  ? ? ? 1_555 A CYS 576 SG ? ? A CYS 625 A CYS 660 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf3 disulf ?   ? A CYS 559 SG  ? ? ? 1_555 A CYS 591 SG ? ? A CYS 643 A CYS 675 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1 covale one ? A ASN 74  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 158 A NAG 801 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale2 covale one ? A ASN 346 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 430 A NAG 802 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale3 covale one ? A ASN 532 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 616 A NAG 803 1_555 ? ? ? ? ? ? ? 1.461 ? N-Glycosylation 
covale4 covale one ? A ASN 590 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 674 A NAG 804 1_555 ? ? ? ? ? ? ? 1.460 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 172 A . ? ASP 256 A PRO 173 A ? PRO 257 A 1 4.67  
2 GLY 311 A . ? GLY 395 A GLY 312 A ? GLY 396 A 1 -0.07 
3 GLU 521 A . ? GLU 605 A ASN 522 A ? ASN 606 A 1 3.02  
4 GLY 556 A . ? GLY 640 A ASN 557 A ? ASN 641 A 1 9.19  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 2 ? 
I ? 4 ? 
J ? 3 ? 
K ? 4 ? 
L ? 4 ? 
M ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 7   ? VAL A 12  ? LYS A 91  VAL A 96  
A 2 TRP A 526 ? ASN A 532 ? TRP A 610 ASN A 616 
A 3 VAL A 512 ? SER A 518 ? VAL A 596 SER A 602 
A 4 PHE A 498 ? LEU A 503 ? PHE A 582 LEU A 587 
B 1 LYS A 62  ? LYS A 63  ? LYS A 146 LYS A 147 
B 2 ASP A 50  ? SER A 54  ? ASP A 134 SER A 138 
B 3 ILE A 33  ? ARG A 38  ? ILE A 117 ARG A 122 
B 4 GLN A 20  ? TRP A 25  ? GLN A 104 TRP A 109 
B 5 ALA B 7   ? ALA B 8   ? ALA C 12  ALA C 13  
C 1 ILE A 80  ? HIS A 85  ? ILE A 164 HIS A 169 
C 2 TYR A 93  ? ASP A 97  ? TYR A 177 ASP A 181 
C 3 TYR A 102 ? THR A 106 ? TYR A 186 THR A 190 
C 4 GLN A 114 ? SER A 117 ? GLN A 198 SER A 201 
D 1 ASP A 124 ? LEU A 127 ? ASP A 208 LEU A 211 
D 2 LEU A 135 ? PHE A 138 ? LEU A 219 PHE A 222 
D 3 LEU A 147 ? SER A 150 ? LEU A 231 SER A 234 
D 4 ILE A 158 ? GLN A 161 ? ILE A 242 GLN A 245 
E 1 VAL A 164 ? TRP A 169 ? VAL A 248 TRP A 253 
E 2 ILE A 180 ? HIS A 185 ? ILE A 264 HIS A 269 
E 3 SER A 191 ? SER A 196 ? SER A 275 SER A 280 
E 4 GLU A 207 ? VAL A 208 ? GLU A 291 VAL A 292 
F 1 ASP A 215 ? ARG A 219 ? ASP A 299 ARG A 303 
F 2 TYR A 222 ? THR A 226 ? TYR A 306 THR A 310 
F 3 TRP A 243 ? PHE A 246 ? TRP A 327 PHE A 330 
F 4 LYS A 249 ? ALA A 253 ? LYS A 333 ALA A 337 
G 1 ILE A 262 ? SER A 271 ? ILE A 346 SER A 355 
G 2 GLN A 274 ? HIS A 281 ? GLN A 358 HIS A 365 
G 3 THR A 286 ? ILE A 290 ? THR A 370 ILE A 374 
G 4 SER A 299 ? GLU A 303 ? SER A 383 GLU A 387 
H 1 TYR A 307 ? TYR A 308 ? TYR A 391 TYR A 392 
H 2 PHE A 327 ? ALA A 328 ? PHE A 411 ALA A 412 
I 1 PHE A 330 ? ARG A 332 ? PHE A 414 ARG A 416 
I 2 TYR A 340 ? ILE A 345 ? TYR A 424 ILE A 429 
I 3 MET A 354 ? THR A 359 ? MET A 438 THR A 443 
I 4 GLU A 367 ? PHE A 368 ? GLU A 451 PHE A 452 
J 1 SER A 390 ? ALA A 394 ? SER A 474 ALA A 478 
J 2 ILE A 420 ? GLY A 427 ? ILE A 504 GLY A 511 
J 3 LEU A 411 ? SER A 412 ? LEU A 495 SER A 496 
K 1 SER A 390 ? ALA A 394 ? SER A 474 ALA A 478 
K 2 ILE A 420 ? GLY A 427 ? ILE A 504 GLY A 511 
K 3 ASN A 435 ? SER A 439 ? ASN A 519 SER A 523 
K 4 ARG A 447 ? LEU A 450 ? ARG A 531 LEU A 534 
L 1 HIS A 454 ? GLY A 459 ? HIS A 538 GLY A 543 
L 2 ILE A 464 ? ALA A 469 ? ILE A 548 ALA A 553 
L 3 GLU A 476 ? SER A 480 ? GLU A 560 SER A 564 
L 4 LYS A 488 ? ILE A 491 ? LYS A 572 ILE A 575 
M 1 TYR A 546 ? TRP A 549 ? TYR A 630 TRP A 633 
M 2 THR A 565 ? ARG A 570 ? THR A 649 ARG A 654 
M 3 VAL A 586 ? VAL A 588 ? VAL A 670 VAL A 672 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 7   ? N LYS A 91  O ASN A 532 ? O ASN A 616 
A 2 3 O LEU A 529 ? O LEU A 613 N ILE A 515 ? N ILE A 599 
A 3 4 O THR A 514 ? O THR A 598 N LEU A 503 ? N LEU A 587 
B 1 2 O LYS A 62  ? O LYS A 146 N VAL A 53  ? N VAL A 137 
B 2 3 O TYR A 52  ? O TYR A 136 N ALA A 35  ? N ALA A 119 
B 3 4 O VAL A 34  ? O VAL A 118 N HIS A 24  ? N HIS A 108 
B 4 5 N VAL A 23  ? N VAL A 107 O ALA B 8   ? O ALA C 13  
C 1 2 N TYR A 84  ? N TYR A 168 O ILE A 94  ? O ILE A 178 
C 2 3 N PHE A 95  ? N PHE A 179 O TRP A 104 ? O TRP A 188 
C 3 4 N LEU A 103 ? N LEU A 187 O PHE A 116 ? O PHE A 200 
D 1 2 N LEU A 126 ? N LEU A 210 O LEU A 136 ? O LEU A 220 
D 2 3 N GLY A 137 ? N GLY A 221 O TRP A 148 ? O TRP A 232 
D 3 4 N LEU A 147 ? N LEU A 231 O GLN A 161 ? O GLN A 245 
E 1 2 N LYS A 165 ? N LYS A 249 O GLU A 183 ? O GLU A 267 
E 2 3 N ILE A 182 ? N ILE A 266 O PHE A 194 ? O PHE A 278 
E 3 4 N ARG A 195 ? N ARG A 279 O GLU A 207 ? O GLU A 291 
F 1 2 N GLN A 217 ? N GLN A 301 O PHE A 224 ? O PHE A 308 
F 2 3 N ALA A 225 ? N ALA A 309 O TRP A 243 ? O TRP A 327 
F 3 4 N VAL A 244 ? N VAL A 328 O ARG A 252 ? O ARG A 336 
G 1 2 N TYR A 266 ? N TYR A 350 O CYS A 278 ? O CYS A 362 
G 2 3 N VAL A 279 ? N VAL A 363 O ASN A 287 ? O ASN A 371 
G 3 4 N LEU A 288 ? N LEU A 372 O LEU A 302 ? O LEU A 386 
H 1 2 N TYR A 308 ? N TYR A 392 O PHE A 327 ? O PHE A 411 
I 1 2 N HIS A 331 ? N HIS A 415 O ILE A 341 ? O ILE A 425 
I 2 3 N LEU A 344 ? N LEU A 428 O ARG A 355 ? O ARG A 439 
I 3 4 N ILE A 358 ? N ILE A 442 O GLU A 367 ? O GLU A 451 
J 1 2 N HIS A 392 ? N HIS A 476 O SER A 425 ? O SER A 509 
J 2 3 O ILE A 421 ? O ILE A 505 N LEU A 411 ? N LEU A 495 
K 1 2 N HIS A 392 ? N HIS A 476 O SER A 425 ? O SER A 509 
K 2 3 N ALA A 422 ? N ALA A 506 O TYR A 437 ? O TYR A 521 
K 3 4 N VAL A 436 ? N VAL A 520 O LEU A 450 ? O LEU A 534 
L 1 2 N TYR A 455 ? N TYR A 539 O ILE A 468 ? O ILE A 552 
L 2 3 N ALA A 467 ? N ALA A 551 O LYS A 478 ? O LYS A 562 
L 3 4 N LEU A 477 ? N LEU A 561 O PHE A 490 ? O PHE A 574 
M 1 2 N TRP A 549 ? N TRP A 633 O PHE A 567 ? O PHE A 651 
M 2 3 N VAL A 566 ? N VAL A 650 O VAL A 587 ? O VAL A 671 
# 
_database_PDB_matrix.entry_id          3WSZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3WSZ 
_atom_sites.fract_transf_matrix[1][1]   0.006107 
_atom_sites.fract_transf_matrix[1][2]   0.003526 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007052 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008258 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 4   ? -43.955 64.985 1.124   1.00 117.97 ? 88  GLU A N   1 
ATOM   2    C CA  . GLU A 1 4   ? -42.571 65.303 0.782   1.00 119.35 ? 88  GLU A CA  1 
ATOM   3    C C   . GLU A 1 4   ? -42.179 64.707 -0.575  1.00 117.57 ? 88  GLU A C   1 
ATOM   4    O O   . GLU A 1 4   ? -42.710 63.665 -0.976  1.00 115.59 ? 88  GLU A O   1 
ATOM   5    C CB  . GLU A 1 4   ? -41.622 64.824 1.887   1.00 120.89 ? 88  GLU A CB  1 
ATOM   6    C CG  . GLU A 1 4   ? -41.697 65.647 3.181   1.00 128.93 ? 88  GLU A CG  1 
ATOM   7    C CD  . GLU A 1 4   ? -40.957 66.986 3.100   1.00 127.70 ? 88  GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 4   ? -39.949 67.084 2.354   1.00 120.33 ? 88  GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 4   ? -41.392 67.937 3.794   1.00 128.25 ? 88  GLU A OE2 1 
ATOM   10   N N   . PRO A 1 5   ? -41.249 65.374 -1.290  1.00 115.71 ? 89  PRO A N   1 
ATOM   11   C CA  . PRO A 1 5   ? -40.896 64.964 -2.656  1.00 111.23 ? 89  PRO A CA  1 
ATOM   12   C C   . PRO A 1 5   ? -39.971 63.753 -2.669  1.00 108.81 ? 89  PRO A C   1 
ATOM   13   O O   . PRO A 1 5   ? -39.837 63.079 -3.690  1.00 107.37 ? 89  PRO A O   1 
ATOM   14   C CB  . PRO A 1 5   ? -40.138 66.185 -3.210  1.00 106.67 ? 89  PRO A CB  1 
ATOM   15   C CG  . PRO A 1 5   ? -40.243 67.260 -2.171  1.00 109.05 ? 89  PRO A CG  1 
ATOM   16   C CD  . PRO A 1 5   ? -40.490 66.566 -0.873  1.00 113.14 ? 89  PRO A CD  1 
ATOM   17   N N   . ILE A 1 6   ? -39.325 63.491 -1.541  1.00 106.81 ? 90  ILE A N   1 
ATOM   18   C CA  . ILE A 1 6   ? -38.294 62.469 -1.484  1.00 103.20 ? 90  ILE A CA  1 
ATOM   19   C C   . ILE A 1 6   ? -38.461 61.604 -0.242  1.00 104.80 ? 90  ILE A C   1 
ATOM   20   O O   . ILE A 1 6   ? -38.503 62.111 0.876   1.00 106.86 ? 90  ILE A O   1 
ATOM   21   C CB  . ILE A 1 6   ? -36.902 63.113 -1.455  1.00 102.99 ? 90  ILE A CB  1 
ATOM   22   C CG1 . ILE A 1 6   ? -36.668 63.946 -2.714  1.00 101.08 ? 90  ILE A CG1 1 
ATOM   23   C CG2 . ILE A 1 6   ? -35.835 62.060 -1.325  1.00 102.01 ? 90  ILE A CG2 1 
ATOM   24   C CD1 . ILE A 1 6   ? -35.232 64.389 -2.877  1.00 102.12 ? 90  ILE A CD1 1 
ATOM   25   N N   . LYS A 1 7   ? -38.560 60.296 -0.430  1.00 102.72 ? 91  LYS A N   1 
ATOM   26   C CA  . LYS A 1 7   ? -38.767 59.408 0.701   1.00 101.09 ? 91  LYS A CA  1 
ATOM   27   C C   . LYS A 1 7   ? -37.488 58.652 1.027   1.00 101.26 ? 91  LYS A C   1 
ATOM   28   O O   . LYS A 1 7   ? -36.768 58.238 0.122   1.00 102.99 ? 91  LYS A O   1 
ATOM   29   C CB  . LYS A 1 7   ? -39.906 58.429 0.408   1.00 100.70 ? 91  LYS A CB  1 
ATOM   30   C CG  . LYS A 1 7   ? -41.274 59.082 0.290   1.00 106.61 ? 91  LYS A CG  1 
ATOM   31   C CD  . LYS A 1 7   ? -42.347 58.054 -0.045  1.00 120.73 ? 91  LYS A CD  1 
ATOM   32   C CE  . LYS A 1 7   ? -43.738 58.690 -0.102  1.00 127.90 ? 91  LYS A CE  1 
ATOM   33   N NZ  . LYS A 1 7   ? -44.804 57.680 -0.408  1.00 126.33 ? 91  LYS A NZ  1 
ATOM   34   N N   . VAL A 1 8   ? -37.190 58.489 2.314   1.00 100.29 ? 92  VAL A N   1 
ATOM   35   C CA  . VAL A 1 8   ? -36.102 57.607 2.724   1.00 99.99  ? 92  VAL A CA  1 
ATOM   36   C C   . VAL A 1 8   ? -36.634 56.182 2.835   1.00 103.31 ? 92  VAL A C   1 
ATOM   37   O O   . VAL A 1 8   ? -37.185 55.787 3.858   1.00 107.54 ? 92  VAL A O   1 
ATOM   38   C CB  . VAL A 1 8   ? -35.459 58.030 4.053   1.00 101.43 ? 92  VAL A CB  1 
ATOM   39   C CG1 . VAL A 1 8   ? -34.448 56.990 4.498   1.00 104.06 ? 92  VAL A CG1 1 
ATOM   40   C CG2 . VAL A 1 8   ? -34.791 59.389 3.916   1.00 102.49 ? 92  VAL A CG2 1 
ATOM   41   N N   . TYR A 1 9   ? -36.467 55.423 1.757   1.00 106.13 ? 93  TYR A N   1 
ATOM   42   C CA  . TYR A 1 9   ? -37.014 54.072 1.611   1.00 105.66 ? 93  TYR A CA  1 
ATOM   43   C C   . TYR A 1 9   ? -36.486 53.063 2.634   1.00 105.78 ? 93  TYR A C   1 
ATOM   44   O O   . TYR A 1 9   ? -37.195 52.128 2.998   1.00 105.72 ? 93  TYR A O   1 
ATOM   45   C CB  . TYR A 1 9   ? -36.744 53.579 0.185   1.00 104.61 ? 93  TYR A CB  1 
ATOM   46   C CG  . TYR A 1 9   ? -37.068 52.132 -0.059  1.00 105.36 ? 93  TYR A CG  1 
ATOM   47   C CD1 . TYR A 1 9   ? -38.380 51.680 -0.019  1.00 109.44 ? 93  TYR A CD1 1 
ATOM   48   C CD2 . TYR A 1 9   ? -36.068 51.222 -0.362  1.00 105.11 ? 93  TYR A CD2 1 
ATOM   49   C CE1 . TYR A 1 9   ? -38.694 50.347 -0.255  1.00 109.32 ? 93  TYR A CE1 1 
ATOM   50   C CE2 . TYR A 1 9   ? -36.365 49.886 -0.599  1.00 108.74 ? 93  TYR A CE2 1 
ATOM   51   C CZ  . TYR A 1 9   ? -37.684 49.451 -0.544  1.00 108.83 ? 93  TYR A CZ  1 
ATOM   52   O OH  . TYR A 1 9   ? -37.995 48.126 -0.780  1.00 103.44 ? 93  TYR A OH  1 
ATOM   53   N N   . GLY A 1 10  ? -35.247 53.251 3.091   1.00 105.52 ? 94  GLY A N   1 
ATOM   54   C CA  . GLY A 1 10  ? -34.663 52.374 4.094   1.00 105.31 ? 94  GLY A CA  1 
ATOM   55   C C   . GLY A 1 10  ? -33.444 52.957 4.790   1.00 106.41 ? 94  GLY A C   1 
ATOM   56   O O   . GLY A 1 10  ? -32.633 53.641 4.169   1.00 106.56 ? 94  GLY A O   1 
ATOM   57   N N   . GLN A 1 11  ? -33.323 52.697 6.089   1.00 106.96 ? 95  GLN A N   1 
ATOM   58   C CA  . GLN A 1 11  ? -32.130 53.075 6.840   1.00 107.83 ? 95  GLN A CA  1 
ATOM   59   C C   . GLN A 1 11  ? -31.563 51.841 7.501   1.00 108.99 ? 95  GLN A C   1 
ATOM   60   O O   . GLN A 1 11  ? -32.181 51.269 8.401   1.00 111.11 ? 95  GLN A O   1 
ATOM   61   C CB  . GLN A 1 11  ? -32.450 54.067 7.946   1.00 110.13 ? 95  GLN A CB  1 
ATOM   62   C CG  . GLN A 1 11  ? -33.337 55.203 7.554   1.00 116.93 ? 95  GLN A CG  1 
ATOM   63   C CD  . GLN A 1 11  ? -33.502 56.180 8.698   1.00 123.46 ? 95  GLN A CD  1 
ATOM   64   O OE1 . GLN A 1 11  ? -32.585 56.362 9.510   1.00 114.68 ? 95  GLN A OE1 1 
ATOM   65   N NE2 . GLN A 1 11  ? -34.680 56.804 8.783   1.00 127.82 ? 95  GLN A NE2 1 
ATOM   66   N N   . VAL A 1 12  ? -30.380 51.434 7.072   1.00 106.30 ? 96  VAL A N   1 
ATOM   67   C CA  . VAL A 1 12  ? -29.797 50.225 7.611   1.00 106.48 ? 96  VAL A CA  1 
ATOM   68   C C   . VAL A 1 12  ? -28.494 50.534 8.326   1.00 105.87 ? 96  VAL A C   1 
ATOM   69   O O   . VAL A 1 12  ? -27.529 50.955 7.700   1.00 107.35 ? 96  VAL A O   1 
ATOM   70   C CB  . VAL A 1 12  ? -29.537 49.196 6.501   1.00 105.55 ? 96  VAL A CB  1 
ATOM   71   C CG1 . VAL A 1 12  ? -29.318 47.836 7.103   1.00 105.66 ? 96  VAL A CG1 1 
ATOM   72   C CG2 . VAL A 1 12  ? -30.708 49.162 5.509   1.00 104.91 ? 96  VAL A CG2 1 
ATOM   73   N N   . SER A 1 13  ? -28.474 50.345 9.641   1.00 107.05 ? 97  SER A N   1 
ATOM   74   C CA  . SER A 1 13  ? -27.236 50.452 10.396  1.00 106.77 ? 97  SER A CA  1 
ATOM   75   C C   . SER A 1 13  ? -26.654 49.064 10.564  1.00 110.84 ? 97  SER A C   1 
ATOM   76   O O   . SER A 1 13  ? -26.982 48.359 11.516  1.00 115.63 ? 97  SER A O   1 
ATOM   77   C CB  . SER A 1 13  ? -27.467 51.064 11.780  1.00 108.92 ? 97  SER A CB  1 
ATOM   78   O OG  . SER A 1 13  ? -28.153 52.299 11.709  1.00 111.41 ? 97  SER A OG  1 
ATOM   79   N N   . LEU A 1 14  ? -25.817 48.655 9.621   1.00 112.10 ? 98  LEU A N   1 
ATOM   80   C CA  . LEU A 1 14  ? -24.993 47.475 9.811   1.00 111.34 ? 98  LEU A CA  1 
ATOM   81   C C   . LEU A 1 14  ? -24.129 47.789 11.025  1.00 113.98 ? 98  LEU A C   1 
ATOM   82   O O   . LEU A 1 14  ? -23.595 48.893 11.137  1.00 118.07 ? 98  LEU A O   1 
ATOM   83   C CB  . LEU A 1 14  ? -24.104 47.244 8.583   1.00 110.28 ? 98  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 14  ? -24.635 46.622 7.282   1.00 104.95 ? 98  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 14  ? -25.850 47.329 6.772   1.00 105.19 ? 98  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 14  ? -23.559 46.642 6.205   1.00 101.87 ? 98  LEU A CD2 1 
ATOM   87   N N   . ASN A 1 15  ? -24.009 46.856 11.958  1.00 112.59 ? 99  ASN A N   1 
ATOM   88   C CA  . ASN A 1 15  ? -23.115 47.078 13.087  1.00 115.48 ? 99  ASN A CA  1 
ATOM   89   C C   . ASN A 1 15  ? -21.704 46.665 12.676  1.00 117.10 ? 99  ASN A C   1 
ATOM   90   O O   . ASN A 1 15  ? -21.123 45.732 13.240  1.00 118.55 ? 99  ASN A O   1 
ATOM   91   C CB  . ASN A 1 15  ? -23.591 46.310 14.322  1.00 117.42 ? 99  ASN A CB  1 
ATOM   92   C CG  . ASN A 1 15  ? -22.845 46.709 15.588  1.00 119.55 ? 99  ASN A CG  1 
ATOM   93   O OD1 . ASN A 1 15  ? -22.369 47.840 15.716  1.00 120.17 ? 99  ASN A OD1 1 
ATOM   94   N ND2 . ASN A 1 15  ? -22.739 45.776 16.531  1.00 118.64 ? 99  ASN A ND2 1 
ATOM   95   N N   . ASP A 1 16  ? -21.165 47.371 11.681  1.00 115.46 ? 100 ASP A N   1 
ATOM   96   C CA  . ASP A 1 16  ? -19.947 46.946 10.992  1.00 116.48 ? 100 ASP A CA  1 
ATOM   97   C C   . ASP A 1 16  ? -18.863 48.016 11.003  1.00 116.32 ? 100 ASP A C   1 
ATOM   98   O O   . ASP A 1 16  ? -19.112 49.162 10.638  1.00 116.93 ? 100 ASP A O   1 
ATOM   99   C CB  . ASP A 1 16  ? -20.271 46.556 9.545   1.00 113.50 ? 100 ASP A CB  1 
ATOM   100  C CG  . ASP A 1 16  ? -19.100 45.892 8.842   1.00 113.47 ? 100 ASP A CG  1 
ATOM   101  O OD1 . ASP A 1 16  ? -18.211 46.607 8.341   1.00 115.50 ? 100 ASP A OD1 1 
ATOM   102  O OD2 . ASP A 1 16  ? -19.066 44.649 8.787   1.00 112.84 ? 100 ASP A OD2 1 
ATOM   103  N N   . SER A 1 17  ? -17.652 47.628 11.399  1.00 118.99 ? 101 SER A N   1 
ATOM   104  C CA  . SER A 1 17  ? -16.543 48.574 11.526  1.00 121.17 ? 101 SER A CA  1 
ATOM   105  C C   . SER A 1 17  ? -15.436 48.361 10.489  1.00 119.30 ? 101 SER A C   1 
ATOM   106  O O   . SER A 1 17  ? -14.350 48.926 10.609  1.00 120.47 ? 101 SER A O   1 
ATOM   107  C CB  . SER A 1 17  ? -15.946 48.512 12.933  1.00 120.61 ? 101 SER A CB  1 
ATOM   108  O OG  . SER A 1 17  ? -15.311 47.264 13.152  1.00 121.17 ? 101 SER A OG  1 
ATOM   109  N N   . HIS A 1 18  ? -15.704 47.547 9.477   1.00 117.68 ? 102 HIS A N   1 
ATOM   110  C CA  . HIS A 1 18  ? -14.747 47.371 8.393   1.00 119.05 ? 102 HIS A CA  1 
ATOM   111  C C   . HIS A 1 18  ? -14.616 48.664 7.612   1.00 118.59 ? 102 HIS A C   1 
ATOM   112  O O   . HIS A 1 18  ? -15.591 49.381 7.435   1.00 118.98 ? 102 HIS A O   1 
ATOM   113  C CB  . HIS A 1 18  ? -15.186 46.248 7.456   1.00 117.65 ? 102 HIS A CB  1 
ATOM   114  C CG  . HIS A 1 18  ? -15.096 44.889 8.066   1.00 113.76 ? 102 HIS A CG  1 
ATOM   115  N ND1 . HIS A 1 18  ? -16.208 44.126 8.353   1.00 113.45 ? 102 HIS A ND1 1 
ATOM   116  C CD2 . HIS A 1 18  ? -14.028 44.156 8.456   1.00 114.24 ? 102 HIS A CD2 1 
ATOM   117  C CE1 . HIS A 1 18  ? -15.827 42.981 8.884   1.00 114.02 ? 102 HIS A CE1 1 
ATOM   118  N NE2 . HIS A 1 18  ? -14.507 42.973 8.959   1.00 114.76 ? 102 HIS A NE2 1 
ATOM   119  N N   . ASN A 1 19  ? -13.412 48.954 7.137   1.00 120.48 ? 103 ASN A N   1 
ATOM   120  C CA  . ASN A 1 19  ? -13.158 50.205 6.433   1.00 122.76 ? 103 ASN A CA  1 
ATOM   121  C C   . ASN A 1 19  ? -13.542 50.160 4.960   1.00 122.48 ? 103 ASN A C   1 
ATOM   122  O O   . ASN A 1 19  ? -13.852 51.187 4.361   1.00 123.86 ? 103 ASN A O   1 
ATOM   123  C CB  . ASN A 1 19  ? -11.691 50.619 6.583   1.00 125.66 ? 103 ASN A CB  1 
ATOM   124  C CG  . ASN A 1 19  ? -10.735 49.456 6.398   1.00 125.60 ? 103 ASN A CG  1 
ATOM   125  O OD1 . ASN A 1 19  ? -10.958 48.364 6.921   1.00 125.64 ? 103 ASN A OD1 1 
ATOM   126  N ND2 . ASN A 1 19  ? -9.663  49.684 5.648   1.00 126.29 ? 103 ASN A ND2 1 
ATOM   127  N N   . GLN A 1 20  ? -13.521 48.967 4.378   1.00 122.35 ? 104 GLN A N   1 
ATOM   128  C CA  . GLN A 1 20  ? -13.771 48.813 2.948   1.00 121.56 ? 104 GLN A CA  1 
ATOM   129  C C   . GLN A 1 20  ? -15.154 48.216 2.687   1.00 118.41 ? 104 GLN A C   1 
ATOM   130  O O   . GLN A 1 20  ? -15.544 47.240 3.324   1.00 118.67 ? 104 GLN A O   1 
ATOM   131  C CB  . GLN A 1 20  ? -12.677 47.945 2.315   1.00 123.95 ? 104 GLN A CB  1 
ATOM   132  C CG  . GLN A 1 20  ? -12.725 47.877 0.800   1.00 124.92 ? 104 GLN A CG  1 
ATOM   133  C CD  . GLN A 1 20  ? -12.731 49.253 0.161   1.00 127.26 ? 104 GLN A CD  1 
ATOM   134  O OE1 . GLN A 1 20  ? -13.755 49.702 -0.360  1.00 126.56 ? 104 GLN A OE1 1 
ATOM   135  N NE2 . GLN A 1 20  ? -11.585 49.931 0.197   1.00 129.68 ? 104 GLN A NE2 1 
ATOM   136  N N   . MET A 1 21  ? -15.888 48.805 1.749   1.00 115.94 ? 105 MET A N   1 
ATOM   137  C CA  . MET A 1 21  ? -17.239 48.351 1.435   1.00 112.89 ? 105 MET A CA  1 
ATOM   138  C C   . MET A 1 21  ? -17.439 48.187 -0.068  1.00 111.77 ? 105 MET A C   1 
ATOM   139  O O   . MET A 1 21  ? -17.399 49.162 -0.817  1.00 113.64 ? 105 MET A O   1 
ATOM   140  C CB  . MET A 1 21  ? -18.267 49.342 1.985   1.00 115.53 ? 105 MET A CB  1 
ATOM   141  C CG  . MET A 1 21  ? -19.707 49.032 1.594   1.00 115.21 ? 105 MET A CG  1 
ATOM   142  S SD  . MET A 1 21  ? -20.462 47.775 2.644   1.00 112.99 ? 105 MET A SD  1 
ATOM   143  C CE  . MET A 1 21  ? -20.782 48.728 4.124   1.00 112.81 ? 105 MET A CE  1 
ATOM   144  N N   . VAL A 1 22  ? -17.667 46.954 -0.505  1.00 110.14 ? 106 VAL A N   1 
ATOM   145  C CA  . VAL A 1 22  ? -17.881 46.667 -1.921  1.00 109.43 ? 106 VAL A CA  1 
ATOM   146  C C   . VAL A 1 22  ? -19.328 46.230 -2.188  1.00 107.31 ? 106 VAL A C   1 
ATOM   147  O O   . VAL A 1 22  ? -19.816 45.264 -1.597  1.00 106.31 ? 106 VAL A O   1 
ATOM   148  C CB  . VAL A 1 22  ? -16.916 45.572 -2.416  1.00 108.58 ? 106 VAL A CB  1 
ATOM   149  C CG1 . VAL A 1 22  ? -17.126 45.303 -3.894  1.00 106.59 ? 106 VAL A CG1 1 
ATOM   150  C CG2 . VAL A 1 22  ? -15.468 45.964 -2.126  1.00 112.77 ? 106 VAL A CG2 1 
ATOM   151  N N   . VAL A 1 23  ? -20.001 46.933 -3.092  1.00 104.95 ? 107 VAL A N   1 
ATOM   152  C CA  . VAL A 1 23  ? -21.433 46.755 -3.289  1.00 98.78  ? 107 VAL A CA  1 
ATOM   153  C C   . VAL A 1 23  ? -21.793 46.333 -4.707  1.00 99.38  ? 107 VAL A C   1 
ATOM   154  O O   . VAL A 1 23  ? -21.280 46.890 -5.682  1.00 101.35 ? 107 VAL A O   1 
ATOM   155  C CB  . VAL A 1 23  ? -22.168 48.053 -2.952  1.00 100.69 ? 107 VAL A CB  1 
ATOM   156  C CG1 . VAL A 1 23  ? -23.628 47.970 -3.349  1.00 100.22 ? 107 VAL A CG1 1 
ATOM   157  C CG2 . VAL A 1 23  ? -22.015 48.365 -1.470  1.00 105.39 ? 107 VAL A CG2 1 
ATOM   158  N N   . HIS A 1 24  ? -22.671 45.342 -4.818  0.50 97.59  ? 108 HIS A N   1 
ATOM   159  C CA  . HIS A 1 24  ? -23.135 44.894 -6.118  0.50 96.55  ? 108 HIS A CA  1 
ATOM   160  C C   . HIS A 1 24  ? -24.647 44.910 -6.209  0.50 94.56  ? 108 HIS A C   1 
ATOM   161  O O   . HIS A 1 24  ? -25.341 44.533 -5.273  0.50 96.06  ? 108 HIS A O   1 
ATOM   162  C CB  . HIS A 1 24  ? -22.620 43.489 -6.435  1.00 97.51  ? 108 HIS A CB  1 
ATOM   163  C CG  . HIS A 1 24  ? -22.922 43.044 -7.834  1.00 99.17  ? 108 HIS A CG  1 
ATOM   164  N ND1 . HIS A 1 24  ? -23.630 41.894 -8.115  1.00 98.75  ? 108 HIS A ND1 1 
ATOM   165  C CD2 . HIS A 1 24  ? -22.624 43.602 -9.033  1.00 98.36  ? 108 HIS A CD2 1 
ATOM   166  C CE1 . HIS A 1 24  ? -23.751 41.762 -9.425  1.00 99.61  ? 108 HIS A CE1 1 
ATOM   167  N NE2 . HIS A 1 24  ? -23.148 42.786 -10.005 1.00 97.86  ? 108 HIS A NE2 1 
ATOM   168  N N   . TRP A 1 25  ? -25.148 45.354 -7.351  1.00 92.37  ? 109 TRP A N   1 
ATOM   169  C CA  . TRP A 1 25  ? -26.565 45.247 -7.672  1.00 96.07  ? 109 TRP A CA  1 
ATOM   170  C C   . TRP A 1 25  ? -26.793 44.123 -8.689  1.00 99.73  ? 109 TRP A C   1 
ATOM   171  O O   . TRP A 1 25  ? -26.375 44.249 -9.838  1.00 101.02 ? 109 TRP A O   1 
ATOM   172  C CB  . TRP A 1 25  ? -27.066 46.552 -8.295  1.00 98.76  ? 109 TRP A CB  1 
ATOM   173  C CG  . TRP A 1 25  ? -27.368 47.669 -7.329  1.00 98.49  ? 109 TRP A CG  1 
ATOM   174  C CD1 . TRP A 1 25  ? -28.591 48.002 -6.817  1.00 99.70  ? 109 TRP A CD1 1 
ATOM   175  C CD2 . TRP A 1 25  ? -26.438 48.613 -6.780  1.00 99.76  ? 109 TRP A CD2 1 
ATOM   176  N NE1 . TRP A 1 25  ? -28.480 49.084 -5.981  1.00 99.17  ? 109 TRP A NE1 1 
ATOM   177  C CE2 . TRP A 1 25  ? -27.169 49.476 -5.938  1.00 98.25  ? 109 TRP A CE2 1 
ATOM   178  C CE3 . TRP A 1 25  ? -25.057 48.806 -6.909  1.00 101.25 ? 109 TRP A CE3 1 
ATOM   179  C CZ2 . TRP A 1 25  ? -26.569 50.514 -5.234  1.00 99.50  ? 109 TRP A CZ2 1 
ATOM   180  C CZ3 . TRP A 1 25  ? -24.462 49.837 -6.206  1.00 99.38  ? 109 TRP A CZ3 1 
ATOM   181  C CH2 . TRP A 1 25  ? -25.218 50.676 -5.379  1.00 101.71 ? 109 TRP A CH2 1 
ATOM   182  N N   . ALA A 1 26  ? -27.457 43.040 -8.284  1.00 100.84 ? 110 ALA A N   1 
ATOM   183  C CA  . ALA A 1 26  ? -27.835 41.985 -9.224  1.00 100.55 ? 110 ALA A CA  1 
ATOM   184  C C   . ALA A 1 26  ? -28.606 42.632 -10.361 1.00 104.38 ? 110 ALA A C   1 
ATOM   185  O O   . ALA A 1 26  ? -28.372 42.344 -11.531 1.00 106.11 ? 110 ALA A O   1 
ATOM   186  C CB  . ALA A 1 26  ? -28.682 40.937 -8.542  1.00 100.55 ? 110 ALA A CB  1 
ATOM   187  N N   . GLY A 1 27  ? -29.527 43.516 -9.989  1.00 106.03 ? 111 GLY A N   1 
ATOM   188  C CA  . GLY A 1 27  ? -30.128 44.476 -10.899 1.00 107.79 ? 111 GLY A CA  1 
ATOM   189  C C   . GLY A 1 27  ? -30.762 44.016 -12.202 1.00 108.08 ? 111 GLY A C   1 
ATOM   190  O O   . GLY A 1 27  ? -30.533 44.609 -13.254 1.00 110.85 ? 111 GLY A O   1 
ATOM   191  N N   . GLU A 1 28  ? -31.576 42.976 -12.154 1.00 105.77 ? 112 GLU A N   1 
ATOM   192  C CA  . GLU A 1 28  ? -32.298 42.592 -13.353 1.00 108.15 ? 112 GLU A CA  1 
ATOM   193  C C   . GLU A 1 28  ? -33.765 42.781 -13.046 1.00 108.85 ? 112 GLU A C   1 
ATOM   194  O O   . GLU A 1 28  ? -34.617 42.029 -13.518 1.00 112.11 ? 112 GLU A O   1 
ATOM   195  C CB  . GLU A 1 28  ? -31.994 41.144 -13.723 1.00 115.22 ? 112 GLU A CB  1 
ATOM   196  C CG  . GLU A 1 28  ? -31.711 40.946 -15.187 1.00 115.49 ? 112 GLU A CG  1 
ATOM   197  C CD  . GLU A 1 28  ? -30.652 39.909 -15.439 1.00 118.43 ? 112 GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 28  ? -30.520 38.947 -14.648 1.00 120.52 ? 112 GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 28  ? -29.948 40.062 -16.449 1.00 123.44 ? 112 GLU A OE2 1 
ATOM   200  N N   . LYS A 1 29  ? -34.027 43.810 -12.247 1.00 108.39 ? 113 LYS A N   1 
ATOM   201  C CA  . LYS A 1 29  ? -35.306 44.039 -11.576 1.00 106.56 ? 113 LYS A CA  1 
ATOM   202  C C   . LYS A 1 29  ? -35.440 43.128 -10.367 1.00 105.18 ? 113 LYS A C   1 
ATOM   203  O O   . LYS A 1 29  ? -36.450 43.148 -9.677  1.00 107.61 ? 113 LYS A O   1 
ATOM   204  C CB  . LYS A 1 29  ? -36.510 43.943 -12.515 1.00 103.84 ? 113 LYS A CB  1 
ATOM   205  C CG  . LYS A 1 29  ? -37.173 45.279 -12.756 1.00 102.08 ? 113 LYS A CG  1 
ATOM   206  C CD  . LYS A 1 29  ? -37.310 45.579 -14.235 1.00 103.12 ? 113 LYS A CD  1 
ATOM   207  C CE  . LYS A 1 29  ? -38.114 46.855 -14.449 1.00 102.75 ? 113 LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 29  ? -38.190 47.237 -15.887 1.00 104.18 ? 113 LYS A NZ  1 
ATOM   209  N N   . SER A 1 30  ? -34.400 42.342 -10.110 1.00 107.03 ? 114 SER A N   1 
ATOM   210  C CA  . SER A 1 30  ? -34.259 41.639 -8.841  1.00 105.62 ? 114 SER A CA  1 
ATOM   211  C C   . SER A 1 30  ? -33.896 42.697 -7.817  1.00 106.05 ? 114 SER A C   1 
ATOM   212  O O   . SER A 1 30  ? -33.033 43.533 -8.083  1.00 110.85 ? 114 SER A O   1 
ATOM   213  C CB  . SER A 1 30  ? -33.120 40.632 -8.933  1.00 104.02 ? 114 SER A CB  1 
ATOM   214  O OG  . SER A 1 30  ? -31.893 41.299 -9.179  1.00 103.48 ? 114 SER A OG  1 
ATOM   215  N N   . ASN A 1 31  ? -34.535 42.691 -6.653  1.00 103.25 ? 115 ASN A N   1 
ATOM   216  C CA  . ASN A 1 31  ? -34.214 43.709 -5.653  1.00 101.63 ? 115 ASN A CA  1 
ATOM   217  C C   . ASN A 1 31  ? -33.080 43.222 -4.762  1.00 100.21 ? 115 ASN A C   1 
ATOM   218  O O   . ASN A 1 31  ? -33.028 43.510 -3.568  1.00 100.38 ? 115 ASN A O   1 
ATOM   219  C CB  . ASN A 1 31  ? -35.452 44.104 -4.844  1.00 102.04 ? 115 ASN A CB  1 
ATOM   220  C CG  . ASN A 1 31  ? -36.600 44.581 -5.731  1.00 104.75 ? 115 ASN A CG  1 
ATOM   221  O OD1 . ASN A 1 31  ? -36.410 45.395 -6.643  1.00 102.47 ? 115 ASN A OD1 1 
ATOM   222  N ND2 . ASN A 1 31  ? -37.796 44.061 -5.474  1.00 107.38 ? 115 ASN A ND2 1 
ATOM   223  N N   . VAL A 1 32  ? -32.170 42.472 -5.375  1.00 100.50 ? 116 VAL A N   1 
ATOM   224  C CA  . VAL A 1 32  ? -31.037 41.901 -4.678  1.00 98.58  ? 116 VAL A CA  1 
ATOM   225  C C   . VAL A 1 32  ? -29.839 42.836 -4.740  1.00 96.11  ? 116 VAL A C   1 
ATOM   226  O O   . VAL A 1 32  ? -29.524 43.395 -5.791  1.00 95.47  ? 116 VAL A O   1 
ATOM   227  C CB  . VAL A 1 32  ? -30.649 40.551 -5.288  1.00 100.52 ? 116 VAL A CB  1 
ATOM   228  C CG1 . VAL A 1 32  ? -29.763 39.768 -4.329  1.00 99.31  ? 116 VAL A CG1 1 
ATOM   229  C CG2 . VAL A 1 32  ? -31.900 39.761 -5.629  1.00 100.86 ? 116 VAL A CG2 1 
ATOM   230  N N   . ILE A 1 33  ? -29.188 43.000 -3.594  1.00 95.88  ? 117 ILE A N   1 
ATOM   231  C CA  . ILE A 1 33  ? -27.994 43.821 -3.469  1.00 95.49  ? 117 ILE A CA  1 
ATOM   232  C C   . ILE A 1 33  ? -26.996 43.106 -2.563  1.00 94.95  ? 117 ILE A C   1 
ATOM   233  O O   . ILE A 1 33  ? -27.308 42.784 -1.420  1.00 96.42  ? 117 ILE A O   1 
ATOM   234  C CB  . ILE A 1 33  ? -28.336 45.207 -2.883  1.00 95.20  ? 117 ILE A CB  1 
ATOM   235  C CG1 . ILE A 1 33  ? -29.139 46.023 -3.901  1.00 96.06  ? 117 ILE A CG1 1 
ATOM   236  C CG2 . ILE A 1 33  ? -27.074 45.959 -2.472  1.00 92.17  ? 117 ILE A CG2 1 
ATOM   237  C CD1 . ILE A 1 33  ? -29.820 47.246 -3.323  1.00 96.29  ? 117 ILE A CD1 1 
ATOM   238  N N   . VAL A 1 34  ? -25.799 42.846 -3.075  1.00 94.34  ? 118 VAL A N   1 
ATOM   239  C CA  . VAL A 1 34  ? -24.785 42.162 -2.287  1.00 95.17  ? 118 VAL A CA  1 
ATOM   240  C C   . VAL A 1 34  ? -23.724 43.138 -1.816  1.00 96.11  ? 118 VAL A C   1 
ATOM   241  O O   . VAL A 1 34  ? -23.288 44.001 -2.573  1.00 99.27  ? 118 VAL A O   1 
ATOM   242  C CB  . VAL A 1 34  ? -24.110 41.055 -3.093  1.00 97.17  ? 118 VAL A CB  1 
ATOM   243  C CG1 . VAL A 1 34  ? -23.373 40.096 -2.158  1.00 92.43  ? 118 VAL A CG1 1 
ATOM   244  C CG2 . VAL A 1 34  ? -25.147 40.316 -3.917  1.00 101.80 ? 118 VAL A CG2 1 
ATOM   245  N N   . ALA A 1 35  ? -23.306 42.989 -0.564  1.00 96.50  ? 119 ALA A N   1 
ATOM   246  C CA  . ALA A 1 35  ? -22.302 43.872 0.012   1.00 99.10  ? 119 ALA A CA  1 
ATOM   247  C C   . ALA A 1 35  ? -21.181 43.116 0.731   1.00 101.97 ? 119 ALA A C   1 
ATOM   248  O O   . ALA A 1 35  ? -21.431 42.322 1.636   1.00 101.69 ? 119 ALA A O   1 
ATOM   249  C CB  . ALA A 1 35  ? -22.957 44.864 0.959   1.00 100.34 ? 119 ALA A CB  1 
ATOM   250  N N   . LEU A 1 36  ? -19.942 43.376 0.328   1.00 105.20 ? 120 LEU A N   1 
ATOM   251  C CA  . LEU A 1 36  ? -18.787 42.838 1.035   1.00 106.26 ? 120 LEU A CA  1 
ATOM   252  C C   . LEU A 1 36  ? -18.140 43.926 1.886   1.00 107.02 ? 120 LEU A C   1 
ATOM   253  O O   . LEU A 1 36  ? -17.665 44.930 1.361   1.00 108.20 ? 120 LEU A O   1 
ATOM   254  C CB  . LEU A 1 36  ? -17.772 42.263 0.047   1.00 105.95 ? 120 LEU A CB  1 
ATOM   255  C CG  . LEU A 1 36  ? -16.459 41.716 0.613   1.00 106.26 ? 120 LEU A CG  1 
ATOM   256  C CD1 . LEU A 1 36  ? -16.696 40.635 1.655   1.00 105.47 ? 120 LEU A CD1 1 
ATOM   257  C CD2 . LEU A 1 36  ? -15.595 41.186 -0.513  1.00 107.27 ? 120 LEU A CD2 1 
ATOM   258  N N   . ALA A 1 37  ? -18.152 43.736 3.201   1.00 107.23 ? 121 ALA A N   1 
ATOM   259  C CA  . ALA A 1 37  ? -17.455 44.636 4.106   1.00 109.49 ? 121 ALA A CA  1 
ATOM   260  C C   . ALA A 1 37  ? -16.149 43.958 4.478   1.00 113.17 ? 121 ALA A C   1 
ATOM   261  O O   . ALA A 1 37  ? -16.153 42.791 4.872   1.00 114.02 ? 121 ALA A O   1 
ATOM   262  C CB  . ALA A 1 37  ? -18.291 44.912 5.340   1.00 106.87 ? 121 ALA A CB  1 
ATOM   263  N N   . ARG A 1 38  ? -15.035 44.674 4.333   1.00 115.07 ? 122 ARG A N   1 
ATOM   264  C CA  . ARG A 1 38  ? -13.713 44.078 4.524   1.00 118.34 ? 122 ARG A CA  1 
ATOM   265  C C   . ARG A 1 38  ? -12.662 45.125 4.880   1.00 120.42 ? 122 ARG A C   1 
ATOM   266  O O   . ARG A 1 38  ? -12.985 46.293 5.094   1.00 120.90 ? 122 ARG A O   1 
ATOM   267  C CB  . ARG A 1 38  ? -13.274 43.333 3.261   1.00 115.84 ? 122 ARG A CB  1 
ATOM   268  C CG  . ARG A 1 38  ? -13.116 44.243 2.061   1.00 117.85 ? 122 ARG A CG  1 
ATOM   269  C CD  . ARG A 1 38  ? -12.425 43.547 0.903   1.00 121.76 ? 122 ARG A CD  1 
ATOM   270  N NE  . ARG A 1 38  ? -11.884 44.519 -0.045  1.00 126.86 ? 122 ARG A NE  1 
ATOM   271  C CZ  . ARG A 1 38  ? -12.150 44.531 -1.347  1.00 125.69 ? 122 ARG A CZ  1 
ATOM   272  N NH1 . ARG A 1 38  ? -12.947 43.612 -1.875  1.00 122.11 ? 122 ARG A NH1 1 
ATOM   273  N NH2 . ARG A 1 38  ? -11.612 45.462 -2.126  1.00 128.11 ? 122 ARG A NH2 1 
ATOM   274  N N   . ASP A 1 39  ? -11.405 44.694 4.942   1.00 120.78 ? 123 ASP A N   1 
ATOM   275  C CA  . ASP A 1 39  ? -10.292 45.596 5.221   1.00 124.56 ? 123 ASP A CA  1 
ATOM   276  C C   . ASP A 1 39  ? -9.582  46.047 3.938   1.00 129.46 ? 123 ASP A C   1 
ATOM   277  O O   . ASP A 1 39  ? -9.653  45.372 2.901   1.00 127.67 ? 123 ASP A O   1 
ATOM   278  C CB  . ASP A 1 39  ? -9.290  44.930 6.165   1.00 123.34 ? 123 ASP A CB  1 
ATOM   279  C CG  . ASP A 1 39  ? -9.859  44.691 7.544   1.00 122.48 ? 123 ASP A CG  1 
ATOM   280  O OD1 . ASP A 1 39  ? -10.569 45.584 8.056   1.00 121.93 ? 123 ASP A OD1 1 
ATOM   281  O OD2 . ASP A 1 39  ? -9.597  43.610 8.117   1.00 123.35 ? 123 ASP A OD2 1 
ATOM   282  N N   . SER A 1 40  ? -8.894  47.187 4.018   1.00 131.72 ? 124 SER A N   1 
ATOM   283  C CA  . SER A 1 40  ? -8.146  47.722 2.880   1.00 133.84 ? 124 SER A CA  1 
ATOM   284  C C   . SER A 1 40  ? -7.116  46.712 2.384   1.00 137.21 ? 124 SER A C   1 
ATOM   285  O O   . SER A 1 40  ? -6.667  45.852 3.144   1.00 137.35 ? 124 SER A O   1 
ATOM   286  C CB  . SER A 1 40  ? -7.457  49.038 3.251   1.00 135.14 ? 124 SER A CB  1 
ATOM   287  O OG  . SER A 1 40  ? -8.408  50.051 3.531   1.00 137.94 ? 124 SER A OG  1 
ATOM   288  N N   . LEU A 1 41  ? -6.747  46.814 1.109   1.00 139.15 ? 125 LEU A N   1 
ATOM   289  C CA  . LEU A 1 41  ? -5.837  45.839 0.505   1.00 140.37 ? 125 LEU A CA  1 
ATOM   290  C C   . LEU A 1 41  ? -4.413  46.371 0.357   1.00 139.52 ? 125 LEU A C   1 
ATOM   291  O O   . LEU A 1 41  ? -3.450  45.681 0.699   1.00 138.07 ? 125 LEU A O   1 
ATOM   292  C CB  . LEU A 1 41  ? -6.377  45.358 -0.845  1.00 138.13 ? 125 LEU A CB  1 
ATOM   293  C CG  . LEU A 1 41  ? -7.737  44.650 -0.796  1.00 136.43 ? 125 LEU A CG  1 
ATOM   294  C CD1 . LEU A 1 41  ? -8.188  44.263 -2.194  1.00 132.04 ? 125 LEU A CD1 1 
ATOM   295  C CD2 . LEU A 1 41  ? -7.701  43.427 0.120   1.00 132.85 ? 125 LEU A CD2 1 
ATOM   296  N N   . PRO A 1 46  ? -6.085  40.845 4.228   1.00 124.83 ? 130 PRO A N   1 
ATOM   297  C CA  . PRO A 1 46  ? -7.328  41.294 4.872   1.00 124.63 ? 130 PRO A CA  1 
ATOM   298  C C   . PRO A 1 46  ? -7.590  40.494 6.144   1.00 123.42 ? 130 PRO A C   1 
ATOM   299  O O   . PRO A 1 46  ? -7.528  39.267 6.101   1.00 124.58 ? 130 PRO A O   1 
ATOM   300  C CB  . PRO A 1 46  ? -8.408  40.986 3.822   1.00 120.17 ? 130 PRO A CB  1 
ATOM   301  C CG  . PRO A 1 46  ? -7.662  40.695 2.546   1.00 123.80 ? 130 PRO A CG  1 
ATOM   302  C CD  . PRO A 1 46  ? -6.345  40.130 2.968   1.00 124.48 ? 130 PRO A CD  1 
ATOM   303  N N   . LYS A 1 47  ? -7.878  41.171 7.253   1.00 121.58 ? 131 LYS A N   1 
ATOM   304  C CA  . LYS A 1 47  ? -8.022  40.488 8.539   1.00 122.19 ? 131 LYS A CA  1 
ATOM   305  C C   . LYS A 1 47  ? -9.368  39.785 8.731   1.00 123.24 ? 131 LYS A C   1 
ATOM   306  O O   . LYS A 1 47  ? -9.412  38.657 9.227   1.00 122.87 ? 131 LYS A O   1 
ATOM   307  C CB  . LYS A 1 47  ? -7.744  41.438 9.710   1.00 125.67 ? 131 LYS A CB  1 
ATOM   308  C CG  . LYS A 1 47  ? -6.262  41.671 9.979   1.00 129.65 ? 131 LYS A CG  1 
ATOM   309  C CD  . LYS A 1 47  ? -6.002  41.936 11.457  1.00 131.89 ? 131 LYS A CD  1 
ATOM   310  C CE  . LYS A 1 47  ? -4.509  41.914 11.763  1.00 134.79 ? 131 LYS A CE  1 
ATOM   311  N NZ  . LYS A 1 47  ? -4.229  41.670 13.213  1.00 135.00 ? 131 LYS A NZ  1 
ATOM   312  N N   . SER A 1 48  ? -10.459 40.446 8.350   1.00 121.27 ? 132 SER A N   1 
ATOM   313  C CA  . SER A 1 48  ? -11.785 39.846 8.485   1.00 116.70 ? 132 SER A CA  1 
ATOM   314  C C   . SER A 1 48  ? -12.790 40.414 7.488   1.00 114.47 ? 132 SER A C   1 
ATOM   315  O O   . SER A 1 48  ? -12.516 41.389 6.788   1.00 114.79 ? 132 SER A O   1 
ATOM   316  C CB  . SER A 1 48  ? -12.315 40.041 9.900   1.00 114.93 ? 132 SER A CB  1 
ATOM   317  O OG  . SER A 1 48  ? -12.597 41.407 10.128  1.00 113.77 ? 132 SER A OG  1 
ATOM   318  N N   . SER A 1 49  ? -13.964 39.798 7.435   1.00 113.19 ? 133 SER A N   1 
ATOM   319  C CA  . SER A 1 49  ? -15.004 40.255 6.529   1.00 111.32 ? 133 SER A CA  1 
ATOM   320  C C   . SER A 1 49  ? -16.384 39.843 7.010   1.00 112.34 ? 133 SER A C   1 
ATOM   321  O O   . SER A 1 49  ? -16.535 38.931 7.837   1.00 113.29 ? 133 SER A O   1 
ATOM   322  C CB  . SER A 1 49  ? -14.774 39.700 5.123   1.00 109.74 ? 133 SER A CB  1 
ATOM   323  O OG  . SER A 1 49  ? -14.969 38.299 5.096   1.00 109.03 ? 133 SER A OG  1 
ATOM   324  N N   . ASP A 1 50  ? -17.385 40.534 6.476   1.00 108.64 ? 134 ASP A N   1 
ATOM   325  C CA  . ASP A 1 50  ? -18.776 40.173 6.674   1.00 106.06 ? 134 ASP A CA  1 
ATOM   326  C C   . ASP A 1 50  ? -19.561 40.436 5.393   1.00 106.48 ? 134 ASP A C   1 
ATOM   327  O O   . ASP A 1 50  ? -19.519 41.540 4.850   1.00 107.16 ? 134 ASP A O   1 
ATOM   328  C CB  . ASP A 1 50  ? -19.381 40.958 7.836   1.00 104.61 ? 134 ASP A CB  1 
ATOM   329  C CG  . ASP A 1 50  ? -18.812 40.547 9.169   1.00 107.98 ? 134 ASP A CG  1 
ATOM   330  O OD1 . ASP A 1 50  ? -19.085 39.409 9.607   1.00 109.86 ? 134 ASP A OD1 1 
ATOM   331  O OD2 . ASP A 1 50  ? -18.096 41.364 9.783   1.00 110.69 ? 134 ASP A OD2 1 
ATOM   332  N N   . VAL A 1 51  ? -20.265 39.421 4.899   1.00 104.47 ? 135 VAL A N   1 
ATOM   333  C CA  . VAL A 1 51  ? -21.093 39.589 3.704   1.00 104.12 ? 135 VAL A CA  1 
ATOM   334  C C   . VAL A 1 51  ? -22.559 39.836 4.079   1.00 104.51 ? 135 VAL A C   1 
ATOM   335  O O   . VAL A 1 51  ? -23.110 39.138 4.925   1.00 106.34 ? 135 VAL A O   1 
ATOM   336  C CB  . VAL A 1 51  ? -20.997 38.364 2.764   1.00 100.98 ? 135 VAL A CB  1 
ATOM   337  C CG1 . VAL A 1 51  ? -21.938 38.511 1.567   1.00 96.80  ? 135 VAL A CG1 1 
ATOM   338  C CG2 . VAL A 1 51  ? -19.563 38.165 2.305   1.00 102.89 ? 135 VAL A CG2 1 
ATOM   339  N N   . TYR A 1 52  ? -23.183 40.832 3.454   1.00 104.21 ? 136 TYR A N   1 
ATOM   340  C CA  . TYR A 1 52  ? -24.584 41.154 3.709   1.00 100.89 ? 136 TYR A CA  1 
ATOM   341  C C   . TYR A 1 52  ? -25.404 41.004 2.430   1.00 100.01 ? 136 TYR A C   1 
ATOM   342  O O   . TYR A 1 52  ? -24.851 40.994 1.334   1.00 100.35 ? 136 TYR A O   1 
ATOM   343  C CB  . TYR A 1 52  ? -24.711 42.585 4.233   1.00 101.53 ? 136 TYR A CB  1 
ATOM   344  C CG  . TYR A 1 52  ? -23.895 42.878 5.478   1.00 103.62 ? 136 TYR A CG  1 
ATOM   345  C CD1 . TYR A 1 52  ? -22.561 43.258 5.386   1.00 103.85 ? 136 TYR A CD1 1 
ATOM   346  C CD2 . TYR A 1 52  ? -24.464 42.797 6.744   1.00 103.70 ? 136 TYR A CD2 1 
ATOM   347  C CE1 . TYR A 1 52  ? -21.814 43.538 6.520   1.00 103.96 ? 136 TYR A CE1 1 
ATOM   348  C CE2 . TYR A 1 52  ? -23.723 43.075 7.883   1.00 104.39 ? 136 TYR A CE2 1 
ATOM   349  C CZ  . TYR A 1 52  ? -22.397 43.445 7.763   1.00 104.32 ? 136 TYR A CZ  1 
ATOM   350  O OH  . TYR A 1 52  ? -21.654 43.727 8.888   1.00 106.53 ? 136 TYR A OH  1 
ATOM   351  N N   . VAL A 1 53  ? -26.720 40.889 2.563   1.00 100.55 ? 137 VAL A N   1 
ATOM   352  C CA  . VAL A 1 53  ? -27.574 40.792 1.385   1.00 98.77  ? 137 VAL A CA  1 
ATOM   353  C C   . VAL A 1 53  ? -28.982 41.330 1.643   1.00 97.74  ? 137 VAL A C   1 
ATOM   354  O O   . VAL A 1 53  ? -29.578 41.073 2.688   1.00 99.14  ? 137 VAL A O   1 
ATOM   355  C CB  . VAL A 1 53  ? -27.622 39.348 0.832   1.00 99.22  ? 137 VAL A CB  1 
ATOM   356  C CG1 . VAL A 1 53  ? -28.265 38.409 1.836   1.00 100.54 ? 137 VAL A CG1 1 
ATOM   357  C CG2 . VAL A 1 53  ? -28.352 39.308 -0.504  1.00 99.04  ? 137 VAL A CG2 1 
ATOM   358  N N   . SER A 1 54  ? -29.485 42.102 0.686   1.00 94.48  ? 138 SER A N   1 
ATOM   359  C CA  . SER A 1 54  ? -30.819 42.664 0.752   1.00 93.23  ? 138 SER A CA  1 
ATOM   360  C C   . SER A 1 54  ? -31.645 42.100 -0.378  1.00 94.17  ? 138 SER A C   1 
ATOM   361  O O   . SER A 1 54  ? -31.135 41.879 -1.470  1.00 93.51  ? 138 SER A O   1 
ATOM   362  C CB  . SER A 1 54  ? -30.762 44.181 0.603   1.00 97.03  ? 138 SER A CB  1 
ATOM   363  O OG  . SER A 1 54  ? -32.046 44.712 0.300   1.00 98.07  ? 138 SER A OG  1 
ATOM   364  N N   . TYR A 1 55  ? -32.927 41.876 -0.117  1.00 99.63  ? 139 TYR A N   1 
ATOM   365  C CA  . TYR A 1 55  ? -33.842 41.431 -1.165  1.00 98.59  ? 139 TYR A CA  1 
ATOM   366  C C   . TYR A 1 55  ? -34.950 42.444 -1.398  1.00 96.92  ? 139 TYR A C   1 
ATOM   367  O O   . TYR A 1 55  ? -35.739 42.303 -2.323  1.00 99.80  ? 139 TYR A O   1 
ATOM   368  C CB  . TYR A 1 55  ? -34.453 40.072 -0.825  1.00 95.63  ? 139 TYR A CB  1 
ATOM   369  C CG  . TYR A 1 55  ? -33.428 38.986 -0.636  1.00 95.22  ? 139 TYR A CG  1 
ATOM   370  C CD1 . TYR A 1 55  ? -33.000 38.217 -1.708  1.00 97.23  ? 139 TYR A CD1 1 
ATOM   371  C CD2 . TYR A 1 55  ? -32.882 38.737 0.611   1.00 97.81  ? 139 TYR A CD2 1 
ATOM   372  C CE1 . TYR A 1 55  ? -32.060 37.226 -1.543  1.00 99.03  ? 139 TYR A CE1 1 
ATOM   373  C CE2 . TYR A 1 55  ? -31.939 37.751 0.788   1.00 101.34 ? 139 TYR A CE2 1 
ATOM   374  C CZ  . TYR A 1 55  ? -31.528 36.998 -0.289  1.00 101.35 ? 139 TYR A CZ  1 
ATOM   375  O OH  . TYR A 1 55  ? -30.582 36.014 -0.099  1.00 102.45 ? 139 TYR A OH  1 
ATOM   376  N N   . ASP A 1 56  ? -35.012 43.461 -0.554  0.50 95.50  ? 140 ASP A N   1 
ATOM   377  C CA  . ASP A 1 56  ? -36.045 44.467 -0.678  0.50 97.08  ? 140 ASP A CA  1 
ATOM   378  C C   . ASP A 1 56  ? -35.409 45.763 -1.113  0.50 98.34  ? 140 ASP A C   1 
ATOM   379  O O   . ASP A 1 56  ? -35.827 46.844 -0.708  0.50 98.91  ? 140 ASP A O   1 
ATOM   380  C CB  . ASP A 1 56  ? -36.715 44.657 0.662   1.00 99.47  ? 140 ASP A CB  1 
ATOM   381  C CG  . ASP A 1 56  ? -35.733 44.602 1.793   1.00 99.32  ? 140 ASP A CG  1 
ATOM   382  O OD1 . ASP A 1 56  ? -34.525 44.807 1.544   1.00 98.79  ? 140 ASP A OD1 1 
ATOM   383  O OD2 . ASP A 1 56  ? -36.169 44.345 2.930   1.00 100.31 ? 140 ASP A OD2 1 
ATOM   384  N N   . TYR A 1 57  ? -34.365 45.627 -1.915  1.00 98.94  ? 141 TYR A N   1 
ATOM   385  C CA  . TYR A 1 57  ? -33.678 46.762 -2.520  1.00 99.95  ? 141 TYR A CA  1 
ATOM   386  C C   . TYR A 1 57  ? -33.140 47.746 -1.489  1.00 100.91 ? 141 TYR A C   1 
ATOM   387  O O   . TYR A 1 57  ? -33.377 48.953 -1.580  1.00 101.30 ? 141 TYR A O   1 
ATOM   388  C CB  . TYR A 1 57  ? -34.604 47.472 -3.507  1.00 100.22 ? 141 TYR A CB  1 
ATOM   389  C CG  . TYR A 1 57  ? -33.885 48.159 -4.644  1.00 98.95  ? 141 TYR A CG  1 
ATOM   390  C CD1 . TYR A 1 57  ? -33.095 47.440 -5.519  1.00 99.72  ? 141 TYR A CD1 1 
ATOM   391  C CD2 . TYR A 1 57  ? -34.016 49.525 -4.852  1.00 101.41 ? 141 TYR A CD2 1 
ATOM   392  C CE1 . TYR A 1 57  ? -32.439 48.059 -6.563  1.00 100.31 ? 141 TYR A CE1 1 
ATOM   393  C CE2 . TYR A 1 57  ? -33.372 50.156 -5.902  1.00 100.35 ? 141 TYR A CE2 1 
ATOM   394  C CZ  . TYR A 1 57  ? -32.583 49.416 -6.754  1.00 100.21 ? 141 TYR A CZ  1 
ATOM   395  O OH  . TYR A 1 57  ? -31.931 50.030 -7.803  1.00 99.58  ? 141 TYR A OH  1 
ATOM   396  N N   . GLY A 1 58  ? -32.422 47.222 -0.500  1.00 99.62  ? 142 GLY A N   1 
ATOM   397  C CA  . GLY A 1 58  ? -31.777 48.059 0.496   1.00 99.62  ? 142 GLY A CA  1 
ATOM   398  C C   . GLY A 1 58  ? -32.688 48.586 1.589   1.00 101.92 ? 142 GLY A C   1 
ATOM   399  O O   . GLY A 1 58  ? -32.259 49.400 2.415   1.00 102.98 ? 142 GLY A O   1 
ATOM   400  N N   . LYS A 1 59  ? -33.943 48.139 1.596   1.00 100.16 ? 143 LYS A N   1 
ATOM   401  C CA  . LYS A 1 59  ? -34.846 48.466 2.688   1.00 99.83  ? 143 LYS A CA  1 
ATOM   402  C C   . LYS A 1 59  ? -34.334 47.791 3.960   1.00 101.92 ? 143 LYS A C   1 
ATOM   403  O O   . LYS A 1 59  ? -34.299 48.396 5.033   1.00 102.68 ? 143 LYS A O   1 
ATOM   404  C CB  . LYS A 1 59  ? -36.265 47.999 2.375   1.00 101.46 ? 143 LYS A CB  1 
ATOM   405  C CG  . LYS A 1 59  ? -37.305 48.481 3.383   1.00 103.55 ? 143 LYS A CG  1 
ATOM   406  C CD  . LYS A 1 59  ? -38.574 47.630 3.351   1.00 107.96 ? 143 LYS A CD  1 
ATOM   407  C CE  . LYS A 1 59  ? -39.339 47.753 2.028   1.00 109.43 ? 143 LYS A CE  1 
ATOM   408  N NZ  . LYS A 1 59  ? -40.178 46.542 1.715   1.00 107.87 ? 143 LYS A NZ  1 
ATOM   409  N N   . SER A 1 60  ? -33.918 46.535 3.817   1.00 102.24 ? 144 SER A N   1 
ATOM   410  C CA  . SER A 1 60  ? -33.391 45.747 4.924   1.00 101.76 ? 144 SER A CA  1 
ATOM   411  C C   . SER A 1 60  ? -32.212 44.908 4.448   1.00 103.42 ? 144 SER A C   1 
ATOM   412  O O   . SER A 1 60  ? -32.147 44.534 3.278   1.00 102.58 ? 144 SER A O   1 
ATOM   413  C CB  . SER A 1 60  ? -34.461 44.799 5.445   1.00 105.18 ? 144 SER A CB  1 
ATOM   414  O OG  . SER A 1 60  ? -34.699 43.762 4.504   1.00 100.70 ? 144 SER A OG  1 
ATOM   415  N N   . PHE A 1 61  ? -31.294 44.592 5.356   1.00 102.98 ? 145 PHE A N   1 
ATOM   416  C CA  . PHE A 1 61  ? -30.130 43.790 5.000   1.00 100.86 ? 145 PHE A CA  1 
ATOM   417  C C   . PHE A 1 61  ? -29.949 42.613 5.940   1.00 103.67 ? 145 PHE A C   1 
ATOM   418  O O   . PHE A 1 61  ? -29.937 42.780 7.159   1.00 105.74 ? 145 PHE A O   1 
ATOM   419  C CB  . PHE A 1 61  ? -28.865 44.641 5.032   1.00 100.92 ? 145 PHE A CB  1 
ATOM   420  C CG  . PHE A 1 61  ? -28.571 45.340 3.746   1.00 98.90  ? 145 PHE A CG  1 
ATOM   421  C CD1 . PHE A 1 61  ? -29.009 46.637 3.529   1.00 99.94  ? 145 PHE A CD1 1 
ATOM   422  C CD2 . PHE A 1 61  ? -27.845 44.708 2.757   1.00 98.68  ? 145 PHE A CD2 1 
ATOM   423  C CE1 . PHE A 1 61  ? -28.733 47.287 2.341   1.00 97.70  ? 145 PHE A CE1 1 
ATOM   424  C CE2 . PHE A 1 61  ? -27.560 45.351 1.570   1.00 97.60  ? 145 PHE A CE2 1 
ATOM   425  C CZ  . PHE A 1 61  ? -28.005 46.642 1.360   1.00 96.06  ? 145 PHE A CZ  1 
ATOM   426  N N   . LYS A 1 62  ? -29.789 41.425 5.368   1.00 103.20 ? 146 LYS A N   1 
ATOM   427  C CA  . LYS A 1 62  ? -29.517 40.233 6.156   1.00 104.10 ? 146 LYS A CA  1 
ATOM   428  C C   . LYS A 1 62  ? -28.023 39.952 6.146   1.00 102.41 ? 146 LYS A C   1 
ATOM   429  O O   . LYS A 1 62  ? -27.427 39.803 5.082   1.00 103.59 ? 146 LYS A O   1 
ATOM   430  C CB  . LYS A 1 62  ? -30.274 39.031 5.584   1.00 105.01 ? 146 LYS A CB  1 
ATOM   431  C CG  . LYS A 1 62  ? -31.756 39.300 5.336   1.00 114.38 ? 146 LYS A CG  1 
ATOM   432  C CD  . LYS A 1 62  ? -32.483 38.060 4.813   1.00 119.69 ? 146 LYS A CD  1 
ATOM   433  C CE  . LYS A 1 62  ? -33.983 38.316 4.628   1.00 112.99 ? 146 LYS A CE  1 
ATOM   434  N NZ  . LYS A 1 62  ? -34.722 37.063 4.302   1.00 109.06 ? 146 LYS A NZ  1 
ATOM   435  N N   . LYS A 1 63  ? -27.415 39.891 7.327   1.00 103.02 ? 147 LYS A N   1 
ATOM   436  C CA  . LYS A 1 63  ? -26.011 39.500 7.432   1.00 102.87 ? 147 LYS A CA  1 
ATOM   437  C C   . LYS A 1 63  ? -25.846 37.988 7.280   1.00 105.15 ? 147 LYS A C   1 
ATOM   438  O O   . LYS A 1 63  ? -26.372 37.221 8.084   1.00 106.70 ? 147 LYS A O   1 
ATOM   439  C CB  . LYS A 1 63  ? -25.418 39.943 8.767   1.00 102.42 ? 147 LYS A CB  1 
ATOM   440  C CG  . LYS A 1 63  ? -23.921 39.678 8.878   1.00 104.37 ? 147 LYS A CG  1 
ATOM   441  C CD  . LYS A 1 63  ? -23.538 39.078 10.225  1.00 105.70 ? 147 LYS A CD  1 
ATOM   442  C CE  . LYS A 1 63  ? -22.507 39.933 10.948  1.00 104.84 ? 147 LYS A CE  1 
ATOM   443  N NZ  . LYS A 1 63  ? -21.973 39.247 12.155  1.00 109.33 ? 147 LYS A NZ  1 
ATOM   444  N N   . ILE A 1 64  ? -25.096 37.563 6.265   1.00 106.32 ? 148 ILE A N   1 
ATOM   445  C CA  . ILE A 1 64  ? -24.957 36.141 5.956   1.00 105.20 ? 148 ILE A CA  1 
ATOM   446  C C   . ILE A 1 64  ? -23.533 35.597 6.091   1.00 106.73 ? 148 ILE A C   1 
ATOM   447  O O   . ILE A 1 64  ? -23.172 34.633 5.417   1.00 109.16 ? 148 ILE A O   1 
ATOM   448  C CB  . ILE A 1 64  ? -25.502 35.835 4.547   1.00 104.84 ? 148 ILE A CB  1 
ATOM   449  C CG1 . ILE A 1 64  ? -24.606 36.438 3.458   1.00 103.20 ? 148 ILE A CG1 1 
ATOM   450  C CG2 . ILE A 1 64  ? -26.921 36.361 4.418   1.00 102.88 ? 148 ILE A CG2 1 
ATOM   451  C CD1 . ILE A 1 64  ? -24.988 36.003 2.038   1.00 101.63 ? 148 ILE A CD1 1 
ATOM   452  N N   . SER A 1 65  ? -22.741 36.201 6.976   1.00 108.71 ? 149 SER A N   1 
ATOM   453  C CA  . SER A 1 65  ? -21.341 35.805 7.182   1.00 108.87 ? 149 SER A CA  1 
ATOM   454  C C   . SER A 1 65  ? -21.218 34.423 7.805   1.00 111.45 ? 149 SER A C   1 
ATOM   455  O O   . SER A 1 65  ? -20.280 33.684 7.511   1.00 111.59 ? 149 SER A O   1 
ATOM   456  C CB  . SER A 1 65  ? -20.618 36.819 8.065   1.00 105.97 ? 149 SER A CB  1 
ATOM   457  O OG  . SER A 1 65  ? -20.822 38.125 7.576   1.00 105.58 ? 149 SER A OG  1 
ATOM   458  N N   . ASP A 1 66  ? -22.170 34.088 8.671   1.00 112.16 ? 150 ASP A N   1 
ATOM   459  C CA  . ASP A 1 66  ? -22.182 32.803 9.360   1.00 111.06 ? 150 ASP A CA  1 
ATOM   460  C C   . ASP A 1 66  ? -22.538 31.649 8.418   1.00 111.57 ? 150 ASP A C   1 
ATOM   461  O O   . ASP A 1 66  ? -22.349 30.485 8.757   1.00 113.87 ? 150 ASP A O   1 
ATOM   462  C CB  . ASP A 1 66  ? -23.153 32.850 10.544  1.00 113.12 ? 150 ASP A CB  1 
ATOM   463  C CG  . ASP A 1 66  ? -24.499 33.476 10.175  1.00 118.85 ? 150 ASP A CG  1 
ATOM   464  O OD1 . ASP A 1 66  ? -25.437 32.730 9.786   1.00 117.34 ? 150 ASP A OD1 1 
ATOM   465  O OD2 . ASP A 1 66  ? -24.613 34.720 10.274  1.00 116.80 ? 150 ASP A OD2 1 
ATOM   466  N N   . LYS A 1 67  ? -23.051 31.974 7.236   1.00 108.96 ? 151 LYS A N   1 
ATOM   467  C CA  . LYS A 1 67  ? -23.358 30.954 6.244   1.00 108.27 ? 151 LYS A CA  1 
ATOM   468  C C   . LYS A 1 67  ? -22.136 30.647 5.398   1.00 111.96 ? 151 LYS A C   1 
ATOM   469  O O   . LYS A 1 67  ? -22.138 29.715 4.598   1.00 115.43 ? 151 LYS A O   1 
ATOM   470  C CB  . LYS A 1 67  ? -24.546 31.372 5.377   1.00 106.02 ? 151 LYS A CB  1 
ATOM   471  C CG  . LYS A 1 67  ? -25.869 31.236 6.112   1.00 109.08 ? 151 LYS A CG  1 
ATOM   472  C CD  . LYS A 1 67  ? -26.978 32.021 5.455   1.00 106.08 ? 151 LYS A CD  1 
ATOM   473  C CE  . LYS A 1 67  ? -27.390 31.398 4.145   1.00 107.81 ? 151 LYS A CE  1 
ATOM   474  N NZ  . LYS A 1 67  ? -28.428 32.231 3.473   1.00 109.90 ? 151 LYS A NZ  1 
ATOM   475  N N   . LEU A 1 68  ? -21.085 31.434 5.594   1.00 112.49 ? 152 LEU A N   1 
ATOM   476  C CA  . LEU A 1 68  ? -19.810 31.198 4.927   1.00 113.25 ? 152 LEU A CA  1 
ATOM   477  C C   . LEU A 1 68  ? -18.842 30.512 5.882   1.00 116.14 ? 152 LEU A C   1 
ATOM   478  O O   . LEU A 1 68  ? -18.005 31.161 6.513   1.00 114.47 ? 152 LEU A O   1 
ATOM   479  C CB  . LEU A 1 68  ? -19.217 32.515 4.439   1.00 111.70 ? 152 LEU A CB  1 
ATOM   480  C CG  . LEU A 1 68  ? -20.045 33.208 3.362   1.00 111.27 ? 152 LEU A CG  1 
ATOM   481  C CD1 . LEU A 1 68  ? -19.493 34.581 3.006   1.00 108.55 ? 152 LEU A CD1 1 
ATOM   482  C CD2 . LEU A 1 68  ? -20.085 32.311 2.149   1.00 113.02 ? 152 LEU A CD2 1 
ATOM   483  N N   . ASN A 1 69  ? -18.971 29.195 5.993   1.00 118.79 ? 153 ASN A N   1 
ATOM   484  C CA  . ASN A 1 69  ? -18.130 28.420 6.897   1.00 121.56 ? 153 ASN A CA  1 
ATOM   485  C C   . ASN A 1 69  ? -17.604 27.157 6.237   1.00 122.68 ? 153 ASN A C   1 
ATOM   486  O O   . ASN A 1 69  ? -18.045 26.773 5.149   1.00 120.57 ? 153 ASN A O   1 
ATOM   487  C CB  . ASN A 1 69  ? -18.895 28.060 8.172   1.00 121.50 ? 153 ASN A CB  1 
ATOM   488  C CG  . ASN A 1 69  ? -20.164 27.281 7.886   1.00 123.64 ? 153 ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 69  ? -20.131 26.062 7.702   1.00 126.44 ? 153 ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 69  ? -21.290 27.985 7.834   1.00 120.01 ? 153 ASN A ND2 1 
ATOM   491  N N   . PHE A 1 70  ? -16.661 26.514 6.916   1.00 125.47 ? 154 PHE A N   1 
ATOM   492  C CA  . PHE A 1 70  ? -16.012 25.320 6.399   1.00 127.68 ? 154 PHE A CA  1 
ATOM   493  C C   . PHE A 1 70  ? -16.628 24.065 6.997   1.00 131.80 ? 154 PHE A C   1 
ATOM   494  O O   . PHE A 1 70  ? -16.034 22.988 6.939   1.00 133.41 ? 154 PHE A O   1 
ATOM   495  C CB  . PHE A 1 70  ? -14.521 25.358 6.718   1.00 128.96 ? 154 PHE A CB  1 
ATOM   496  C CG  . PHE A 1 70  ? -13.873 26.674 6.410   1.00 127.50 ? 154 PHE A CG  1 
ATOM   497  C CD1 . PHE A 1 70  ? -13.409 26.953 5.136   1.00 124.51 ? 154 PHE A CD1 1 
ATOM   498  C CD2 . PHE A 1 70  ? -13.728 27.634 7.395   1.00 127.25 ? 154 PHE A CD2 1 
ATOM   499  C CE1 . PHE A 1 70  ? -12.814 28.164 4.852   1.00 120.47 ? 154 PHE A CE1 1 
ATOM   500  C CE2 . PHE A 1 70  ? -13.133 28.845 7.116   1.00 124.69 ? 154 PHE A CE2 1 
ATOM   501  C CZ  . PHE A 1 70  ? -12.677 29.110 5.844   1.00 120.89 ? 154 PHE A CZ  1 
ATOM   502  N N   . GLY A 1 71  ? -17.818 24.214 7.575   1.00 134.73 ? 155 GLY A N   1 
ATOM   503  C CA  . GLY A 1 71  ? -18.537 23.097 8.162   1.00 137.35 ? 155 GLY A CA  1 
ATOM   504  C C   . GLY A 1 71  ? -18.225 22.901 9.634   1.00 141.38 ? 155 GLY A C   1 
ATOM   505  O O   . GLY A 1 71  ? -17.491 23.686 10.236  1.00 139.42 ? 155 GLY A O   1 
ATOM   506  N N   . LEU A 1 72  ? -18.791 21.850 10.217  1.00 143.06 ? 156 LEU A N   1 
ATOM   507  C CA  . LEU A 1 72  ? -18.545 21.533 11.616  1.00 141.61 ? 156 LEU A CA  1 
ATOM   508  C C   . LEU A 1 72  ? -17.260 20.732 11.715  1.00 141.27 ? 156 LEU A C   1 
ATOM   509  O O   . LEU A 1 72  ? -16.845 20.092 10.748  1.00 141.16 ? 156 LEU A O   1 
ATOM   510  C CB  . LEU A 1 72  ? -19.722 20.754 12.199  1.00 147.32 ? 156 LEU A CB  1 
ATOM   511  C CG  . LEU A 1 72  ? -21.069 21.482 12.136  1.00 149.26 ? 156 LEU A CG  1 
ATOM   512  C CD1 . LEU A 1 72  ? -22.220 20.526 12.397  1.00 149.17 ? 156 LEU A CD1 1 
ATOM   513  C CD2 . LEU A 1 72  ? -21.104 22.637 13.126  1.00 147.01 ? 156 LEU A CD2 1 
ATOM   514  N N   . GLY A 1 73  ? -16.624 20.774 12.879  1.00 143.08 ? 157 GLY A N   1 
ATOM   515  C CA  . GLY A 1 73  ? -15.290 20.223 13.027  1.00 144.45 ? 157 GLY A CA  1 
ATOM   516  C C   . GLY A 1 73  ? -14.279 21.259 12.573  1.00 145.35 ? 157 GLY A C   1 
ATOM   517  O O   . GLY A 1 73  ? -13.071 21.079 12.707  1.00 148.16 ? 157 GLY A O   1 
ATOM   518  N N   . ASN A 1 74  ? -14.795 22.351 12.019  1.00 144.00 ? 158 ASN A N   1 
ATOM   519  C CA  . ASN A 1 74  ? -13.990 23.491 11.617  1.00 143.00 ? 158 ASN A CA  1 
ATOM   520  C C   . ASN A 1 74  ? -14.809 24.746 11.863  1.00 144.50 ? 158 ASN A C   1 
ATOM   521  O O   . ASN A 1 74  ? -15.427 25.286 10.950  1.00 141.86 ? 158 ASN A O   1 
ATOM   522  C CB  . ASN A 1 74  ? -13.610 23.398 10.141  1.00 140.80 ? 158 ASN A CB  1 
ATOM   523  C CG  . ASN A 1 74  ? -12.481 24.346 9.765   1.00 140.96 ? 158 ASN A CG  1 
ATOM   524  O OD1 . ASN A 1 74  ? -12.229 25.341 10.453  1.00 139.71 ? 158 ASN A OD1 1 
ATOM   525  N ND2 . ASN A 1 74  ? -11.779 24.009 8.672   1.00 140.24 ? 158 ASN A ND2 1 
ATOM   526  N N   . ARG A 1 75  ? -14.832 25.195 13.111  1.00 147.11 ? 159 ARG A N   1 
ATOM   527  C CA  . ARG A 1 75  ? -15.583 26.389 13.476  1.00 148.99 ? 159 ARG A CA  1 
ATOM   528  C C   . ARG A 1 75  ? -14.968 27.670 12.915  1.00 147.39 ? 159 ARG A C   1 
ATOM   529  O O   . ARG A 1 75  ? -15.690 28.599 12.550  1.00 146.79 ? 159 ARG A O   1 
ATOM   530  C CB  . ARG A 1 75  ? -15.679 26.501 14.995  1.00 154.52 ? 159 ARG A CB  1 
ATOM   531  C CG  . ARG A 1 75  ? -16.538 25.440 15.644  1.00 157.45 ? 159 ARG A CG  1 
ATOM   532  C CD  . ARG A 1 75  ? -16.605 25.663 17.139  1.00 163.09 ? 159 ARG A CD  1 
ATOM   533  N NE  . ARG A 1 75  ? -17.411 24.644 17.800  1.00 166.93 ? 159 ARG A NE  1 
ATOM   534  C CZ  . ARG A 1 75  ? -17.554 24.544 19.117  1.00 168.77 ? 159 ARG A CZ  1 
ATOM   535  N NH1 . ARG A 1 75  ? -16.939 25.404 19.920  1.00 168.29 ? 159 ARG A NH1 1 
ATOM   536  N NH2 . ARG A 1 75  ? -18.309 23.580 19.629  1.00 167.86 ? 159 ARG A NH2 1 
ATOM   537  N N   . SER A 1 76  ? -13.636 27.704 12.855  1.00 146.02 ? 160 SER A N   1 
ATOM   538  C CA  . SER A 1 76  ? -12.876 28.912 12.506  1.00 142.08 ? 160 SER A CA  1 
ATOM   539  C C   . SER A 1 76  ? -13.527 29.823 11.457  1.00 141.14 ? 160 SER A C   1 
ATOM   540  O O   . SER A 1 76  ? -14.043 29.355 10.438  1.00 139.59 ? 160 SER A O   1 
ATOM   541  C CB  . SER A 1 76  ? -11.441 28.558 12.095  1.00 138.77 ? 160 SER A CB  1 
ATOM   542  O OG  . SER A 1 76  ? -11.414 27.648 11.011  1.00 138.89 ? 160 SER A OG  1 
ATOM   543  N N   . GLU A 1 77  ? -13.501 31.124 11.733  1.00 141.81 ? 161 GLU A N   1 
ATOM   544  C CA  . GLU A 1 77  ? -14.194 32.127 10.925  1.00 136.86 ? 161 GLU A CA  1 
ATOM   545  C C   . GLU A 1 77  ? -13.498 32.340 9.576   1.00 131.55 ? 161 GLU A C   1 
ATOM   546  O O   . GLU A 1 77  ? -12.270 32.287 9.484   1.00 131.65 ? 161 GLU A O   1 
ATOM   547  C CB  . GLU A 1 77  ? -14.275 33.443 11.709  1.00 134.00 ? 161 GLU A CB  1 
ATOM   548  C CG  . GLU A 1 77  ? -15.536 34.266 11.475  1.00 135.64 ? 161 GLU A CG  1 
ATOM   549  C CD  . GLU A 1 77  ? -15.693 35.397 12.493  1.00 147.65 ? 161 GLU A CD  1 
ATOM   550  O OE1 . GLU A 1 77  ? -15.145 35.266 13.611  1.00 151.35 ? 161 GLU A OE1 1 
ATOM   551  O OE2 . GLU A 1 77  ? -16.357 36.415 12.179  1.00 144.46 ? 161 GLU A OE2 1 
ATOM   552  N N   . ALA A 1 78  ? -14.285 32.569 8.531   1.00 123.58 ? 162 ALA A N   1 
ATOM   553  C CA  . ALA A 1 78  ? -13.733 32.788 7.201   1.00 118.15 ? 162 ALA A CA  1 
ATOM   554  C C   . ALA A 1 78  ? -13.490 34.266 6.947   1.00 118.96 ? 162 ALA A C   1 
ATOM   555  O O   . ALA A 1 78  ? -14.051 35.127 7.629   1.00 120.66 ? 162 ALA A O   1 
ATOM   556  C CB  . ALA A 1 78  ? -14.656 32.220 6.143   1.00 118.58 ? 162 ALA A CB  1 
ATOM   557  N N   . VAL A 1 79  ? -12.645 34.552 5.961   1.00 117.95 ? 163 VAL A N   1 
ATOM   558  C CA  . VAL A 1 79  ? -12.349 35.920 5.553   1.00 113.71 ? 163 VAL A CA  1 
ATOM   559  C C   . VAL A 1 79  ? -12.481 36.007 4.039   1.00 112.56 ? 163 VAL A C   1 
ATOM   560  O O   . VAL A 1 79  ? -11.731 35.365 3.312   1.00 114.08 ? 163 VAL A O   1 
ATOM   561  C CB  . VAL A 1 79  ? -10.924 36.347 5.971   1.00 113.90 ? 163 VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 79  ? -10.610 37.729 5.443   1.00 115.64 ? 163 VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 79  ? -10.771 36.310 7.486   1.00 113.91 ? 163 VAL A CG2 1 
ATOM   564  N N   . ILE A 1 80  ? -13.446 36.785 3.563   1.00 113.11 ? 164 ILE A N   1 
ATOM   565  C CA  . ILE A 1 80  ? -13.689 36.902 2.129   1.00 112.76 ? 164 ILE A CA  1 
ATOM   566  C C   . ILE A 1 80  ? -12.870 38.024 1.510   1.00 113.16 ? 164 ILE A C   1 
ATOM   567  O O   . ILE A 1 80  ? -13.065 39.195 1.828   1.00 112.50 ? 164 ILE A O   1 
ATOM   568  C CB  . ILE A 1 80  ? -15.176 37.158 1.816   1.00 112.85 ? 164 ILE A CB  1 
ATOM   569  C CG1 . ILE A 1 80  ? -16.046 36.057 2.423   1.00 111.71 ? 164 ILE A CG1 1 
ATOM   570  C CG2 . ILE A 1 80  ? -15.396 37.264 0.312   1.00 110.63 ? 164 ILE A CG2 1 
ATOM   571  C CD1 . ILE A 1 80  ? -15.578 34.662 2.089   1.00 112.57 ? 164 ILE A CD1 1 
ATOM   572  N N   . ALA A 1 81  ? -11.955 37.657 0.620   1.00 115.43 ? 165 ALA A N   1 
ATOM   573  C CA  . ALA A 1 81  ? -11.127 38.627 -0.084  1.00 114.55 ? 165 ALA A CA  1 
ATOM   574  C C   . ALA A 1 81  ? -11.951 39.393 -1.111  1.00 115.26 ? 165 ALA A C   1 
ATOM   575  O O   . ALA A 1 81  ? -11.957 40.628 -1.128  1.00 115.24 ? 165 ALA A O   1 
ATOM   576  C CB  . ALA A 1 81  ? -9.975  37.923 -0.770  1.00 115.18 ? 165 ALA A CB  1 
ATOM   577  N N   . GLN A 1 82  ? -12.645 38.644 -1.963  1.00 115.00 ? 166 GLN A N   1 
ATOM   578  C CA  . GLN A 1 82  ? -13.422 39.224 -3.048  1.00 115.14 ? 166 GLN A CA  1 
ATOM   579  C C   . GLN A 1 82  ? -14.633 38.334 -3.342  1.00 112.90 ? 166 GLN A C   1 
ATOM   580  O O   . GLN A 1 82  ? -14.653 37.161 -2.959  1.00 112.76 ? 166 GLN A O   1 
ATOM   581  C CB  . GLN A 1 82  ? -12.538 39.361 -4.292  1.00 116.25 ? 166 GLN A CB  1 
ATOM   582  C CG  . GLN A 1 82  ? -13.035 40.353 -5.337  1.00 120.72 ? 166 GLN A CG  1 
ATOM   583  C CD  . GLN A 1 82  ? -11.960 40.706 -6.360  1.00 127.84 ? 166 GLN A CD  1 
ATOM   584  O OE1 . GLN A 1 82  ? -10.768 40.479 -6.125  1.00 132.05 ? 166 GLN A OE1 1 
ATOM   585  N NE2 . GLN A 1 82  ? -12.376 41.261 -7.501  1.00 125.28 ? 166 GLN A NE2 1 
ATOM   586  N N   . PHE A 1 83  ? -15.649 38.893 -3.994  1.00 109.08 ? 167 PHE A N   1 
ATOM   587  C CA  . PHE A 1 83  ? -16.755 38.080 -4.493  1.00 108.83 ? 167 PHE A CA  1 
ATOM   588  C C   . PHE A 1 83  ? -17.011 38.389 -5.975  1.00 110.82 ? 167 PHE A C   1 
ATOM   589  O O   . PHE A 1 83  ? -16.793 39.519 -6.425  1.00 111.65 ? 167 PHE A O   1 
ATOM   590  C CB  . PHE A 1 83  ? -18.020 38.226 -3.621  1.00 104.57 ? 167 PHE A CB  1 
ATOM   591  C CG  . PHE A 1 83  ? -18.785 39.501 -3.844  1.00 104.16 ? 167 PHE A CG  1 
ATOM   592  C CD1 . PHE A 1 83  ? -18.478 40.648 -3.129  1.00 104.65 ? 167 PHE A CD1 1 
ATOM   593  C CD2 . PHE A 1 83  ? -19.824 39.548 -4.761  1.00 101.92 ? 167 PHE A CD2 1 
ATOM   594  C CE1 . PHE A 1 83  ? -19.186 41.821 -3.336  1.00 102.23 ? 167 PHE A CE1 1 
ATOM   595  C CE2 . PHE A 1 83  ? -20.532 40.716 -4.970  1.00 99.40  ? 167 PHE A CE2 1 
ATOM   596  C CZ  . PHE A 1 83  ? -20.214 41.852 -4.258  1.00 99.39  ? 167 PHE A CZ  1 
ATOM   597  N N   . TYR A 1 84  ? -17.446 37.380 -6.730  1.00 109.21 ? 168 TYR A N   1 
ATOM   598  C CA  . TYR A 1 84  ? -17.587 37.501 -8.182  1.00 109.02 ? 168 TYR A CA  1 
ATOM   599  C C   . TYR A 1 84  ? -19.027 37.260 -8.632  1.00 108.26 ? 168 TYR A C   1 
ATOM   600  O O   . TYR A 1 84  ? -19.764 36.507 -8.002  1.00 109.62 ? 168 TYR A O   1 
ATOM   601  C CB  . TYR A 1 84  ? -16.640 36.521 -8.897  1.00 108.53 ? 168 TYR A CB  1 
ATOM   602  C CG  . TYR A 1 84  ? -15.202 36.612 -8.436  1.00 109.39 ? 168 TYR A CG  1 
ATOM   603  C CD1 . TYR A 1 84  ? -14.773 35.936 -7.296  1.00 112.15 ? 168 TYR A CD1 1 
ATOM   604  C CD2 . TYR A 1 84  ? -14.272 37.373 -9.135  1.00 111.22 ? 168 TYR A CD2 1 
ATOM   605  C CE1 . TYR A 1 84  ? -13.460 36.020 -6.859  1.00 115.88 ? 168 TYR A CE1 1 
ATOM   606  C CE2 . TYR A 1 84  ? -12.953 37.465 -8.708  1.00 115.48 ? 168 TYR A CE2 1 
ATOM   607  C CZ  . TYR A 1 84  ? -12.553 36.785 -7.566  1.00 117.61 ? 168 TYR A CZ  1 
ATOM   608  O OH  . TYR A 1 84  ? -11.250 36.861 -7.119  1.00 119.64 ? 168 TYR A OH  1 
ATOM   609  N N   . HIS A 1 85  ? -19.425 37.895 -9.727  1.00 107.12 ? 169 HIS A N   1 
ATOM   610  C CA  . HIS A 1 85  ? -20.756 37.680 -10.274 1.00 107.47 ? 169 HIS A CA  1 
ATOM   611  C C   . HIS A 1 85  ? -20.681 37.099 -11.682 1.00 109.68 ? 169 HIS A C   1 
ATOM   612  O O   . HIS A 1 85  ? -19.693 37.290 -12.388 1.00 111.07 ? 169 HIS A O   1 
ATOM   613  C CB  . HIS A 1 85  ? -21.542 38.992 -10.301 1.00 106.47 ? 169 HIS A CB  1 
ATOM   614  C CG  . HIS A 1 85  ? -21.257 39.849 -11.497 1.00 110.05 ? 169 HIS A CG  1 
ATOM   615  N ND1 . HIS A 1 85  ? -20.196 40.731 -11.551 1.00 111.71 ? 169 HIS A ND1 1 
ATOM   616  C CD2 . HIS A 1 85  ? -21.906 39.974 -12.681 1.00 112.22 ? 169 HIS A CD2 1 
ATOM   617  C CE1 . HIS A 1 85  ? -20.200 41.356 -12.716 1.00 111.43 ? 169 HIS A CE1 1 
ATOM   618  N NE2 . HIS A 1 85  ? -21.229 40.916 -13.420 1.00 111.96 ? 169 HIS A NE2 1 
ATOM   619  N N   . SER A 1 86  ? -21.722 36.386 -12.093 1.00 109.05 ? 170 SER A N   1 
ATOM   620  C CA  . SER A 1 86  ? -21.810 35.952 -13.476 1.00 108.47 ? 170 SER A CA  1 
ATOM   621  C C   . SER A 1 86  ? -22.444 37.049 -14.323 1.00 109.91 ? 170 SER A C   1 
ATOM   622  O O   . SER A 1 86  ? -23.554 37.496 -14.039 1.00 110.35 ? 170 SER A O   1 
ATOM   623  C CB  . SER A 1 86  ? -22.620 34.668 -13.600 1.00 109.17 ? 170 SER A CB  1 
ATOM   624  O OG  . SER A 1 86  ? -23.044 34.485 -14.942 1.00 110.15 ? 170 SER A OG  1 
ATOM   625  N N   . PRO A 1 87  ? -21.730 37.500 -15.365 1.00 110.78 ? 171 PRO A N   1 
ATOM   626  C CA  . PRO A 1 87  ? -22.286 38.470 -16.315 1.00 110.69 ? 171 PRO A CA  1 
ATOM   627  C C   . PRO A 1 87  ? -23.431 37.858 -17.115 1.00 111.36 ? 171 PRO A C   1 
ATOM   628  O O   . PRO A 1 87  ? -24.220 38.585 -17.720 1.00 115.28 ? 171 PRO A O   1 
ATOM   629  C CB  . PRO A 1 87  ? -21.104 38.771 -17.244 1.00 109.57 ? 171 PRO A CB  1 
ATOM   630  C CG  . PRO A 1 87  ? -19.895 38.386 -16.469 1.00 109.59 ? 171 PRO A CG  1 
ATOM   631  C CD  . PRO A 1 87  ? -20.309 37.222 -15.629 1.00 110.09 ? 171 PRO A CD  1 
ATOM   632  N N   . ALA A 1 88  ? -23.513 36.531 -17.104 1.00 110.53 ? 172 ALA A N   1 
ATOM   633  C CA  . ALA A 1 88  ? -24.515 35.797 -17.872 1.00 113.34 ? 172 ALA A CA  1 
ATOM   634  C C   . ALA A 1 88  ? -25.776 35.542 -17.054 1.00 112.71 ? 172 ALA A C   1 
ATOM   635  O O   . ALA A 1 88  ? -26.897 35.571 -17.573 1.00 113.52 ? 172 ALA A O   1 
ATOM   636  C CB  . ALA A 1 88  ? -23.933 34.475 -18.346 1.00 114.04 ? 172 ALA A CB  1 
ATOM   637  N N   . ASP A 1 89  ? -25.577 35.294 -15.766 1.00 109.33 ? 173 ASP A N   1 
ATOM   638  C CA  . ASP A 1 89  ? -26.664 34.936 -14.879 1.00 107.56 ? 173 ASP A CA  1 
ATOM   639  C C   . ASP A 1 89  ? -26.512 35.647 -13.548 1.00 108.75 ? 173 ASP A C   1 
ATOM   640  O O   . ASP A 1 89  ? -25.698 35.253 -12.707 1.00 108.00 ? 173 ASP A O   1 
ATOM   641  C CB  . ASP A 1 89  ? -26.655 33.432 -14.652 1.00 112.23 ? 173 ASP A CB  1 
ATOM   642  C CG  . ASP A 1 89  ? -27.775 32.976 -13.745 1.00 111.93 ? 173 ASP A CG  1 
ATOM   643  O OD1 . ASP A 1 89  ? -28.884 33.547 -13.852 1.00 111.66 ? 173 ASP A OD1 1 
ATOM   644  O OD2 . ASP A 1 89  ? -27.544 32.048 -12.934 1.00 110.62 ? 173 ASP A OD2 1 
ATOM   645  N N   . ASN A 1 90  ? -27.306 36.693 -13.353 1.00 109.43 ? 174 ASN A N   1 
ATOM   646  C CA  . ASN A 1 90  ? -27.228 37.505 -12.141 1.00 110.40 ? 174 ASN A CA  1 
ATOM   647  C C   . ASN A 1 90  ? -27.636 36.749 -10.877 1.00 108.08 ? 174 ASN A C   1 
ATOM   648  O O   . ASN A 1 90  ? -27.499 37.265 -9.767  1.00 110.20 ? 174 ASN A O   1 
ATOM   649  C CB  . ASN A 1 90  ? -28.119 38.731 -12.276 1.00 108.91 ? 174 ASN A CB  1 
ATOM   650  C CG  . ASN A 1 90  ? -29.579 38.385 -12.148 1.00 110.85 ? 174 ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 90  ? -30.288 38.917 -11.293 1.00 109.49 ? 174 ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 90  ? -30.043 37.476 -13.000 1.00 114.82 ? 174 ASN A ND2 1 
ATOM   653  N N   . LYS A 1 91  ? -28.153 35.538 -11.035 1.00 105.53 ? 175 LYS A N   1 
ATOM   654  C CA  . LYS A 1 91  ? -28.605 34.788 -9.876  1.00 106.09 ? 175 LYS A CA  1 
ATOM   655  C C   . LYS A 1 91  ? -27.415 34.230 -9.113  1.00 105.23 ? 175 LYS A C   1 
ATOM   656  O O   . LYS A 1 91  ? -27.482 34.039 -7.898  1.00 104.33 ? 175 LYS A O   1 
ATOM   657  C CB  . LYS A 1 91  ? -29.562 33.658 -10.282 1.00 107.77 ? 175 LYS A CB  1 
ATOM   658  C CG  . LYS A 1 91  ? -30.913 34.129 -10.819 1.00 108.45 ? 175 LYS A CG  1 
ATOM   659  C CD  . LYS A 1 91  ? -31.839 32.952 -11.110 1.00 110.47 ? 175 LYS A CD  1 
ATOM   660  C CE  . LYS A 1 91  ? -31.321 32.102 -12.266 1.00 113.67 ? 175 LYS A CE  1 
ATOM   661  N NZ  . LYS A 1 91  ? -31.178 32.892 -13.533 1.00 114.68 ? 175 LYS A NZ  1 
ATOM   662  N N   . ARG A 1 92  ? -26.321 33.989 -9.831  1.00 108.12 ? 176 ARG A N   1 
ATOM   663  C CA  . ARG A 1 92  ? -25.186 33.251 -9.269  1.00 108.76 ? 176 ARG A CA  1 
ATOM   664  C C   . ARG A 1 92  ? -23.962 34.110 -8.897  1.00 106.89 ? 176 ARG A C   1 
ATOM   665  O O   . ARG A 1 92  ? -23.629 35.086 -9.579  1.00 103.15 ? 176 ARG A O   1 
ATOM   666  C CB  . ARG A 1 92  ? -24.796 32.046 -10.162 1.00 107.73 ? 176 ARG A CB  1 
ATOM   667  C CG  . ARG A 1 92  ? -24.589 32.362 -11.641 1.00 109.67 ? 176 ARG A CG  1 
ATOM   668  C CD  . ARG A 1 92  ? -23.985 31.185 -12.400 1.00 110.90 ? 176 ARG A CD  1 
ATOM   669  N NE  . ARG A 1 92  ? -24.984 30.224 -12.867 1.00 114.34 ? 176 ARG A NE  1 
ATOM   670  C CZ  . ARG A 1 92  ? -24.695 29.116 -13.547 1.00 113.80 ? 176 ARG A CZ  1 
ATOM   671  N NH1 . ARG A 1 92  ? -23.434 28.820 -13.839 1.00 113.56 ? 176 ARG A NH1 1 
ATOM   672  N NH2 . ARG A 1 92  ? -25.665 28.301 -13.936 1.00 111.37 ? 176 ARG A NH2 1 
ATOM   673  N N   . TYR A 1 93  ? -23.317 33.726 -7.796  1.00 105.61 ? 177 TYR A N   1 
ATOM   674  C CA  . TYR A 1 93  ? -22.146 34.416 -7.273  1.00 105.40 ? 177 TYR A CA  1 
ATOM   675  C C   . TYR A 1 93  ? -21.117 33.416 -6.749  1.00 108.45 ? 177 TYR A C   1 
ATOM   676  O O   . TYR A 1 93  ? -21.447 32.259 -6.482  1.00 108.65 ? 177 TYR A O   1 
ATOM   677  C CB  . TYR A 1 93  ? -22.549 35.367 -6.146  1.00 105.32 ? 177 TYR A CB  1 
ATOM   678  C CG  . TYR A 1 93  ? -23.433 36.498 -6.605  1.00 107.63 ? 177 TYR A CG  1 
ATOM   679  C CD1 . TYR A 1 93  ? -22.886 37.695 -7.054  1.00 107.25 ? 177 TYR A CD1 1 
ATOM   680  C CD2 . TYR A 1 93  ? -24.817 36.370 -6.601  1.00 106.35 ? 177 TYR A CD2 1 
ATOM   681  C CE1 . TYR A 1 93  ? -23.692 38.728 -7.482  1.00 105.01 ? 177 TYR A CE1 1 
ATOM   682  C CE2 . TYR A 1 93  ? -25.628 37.396 -7.030  1.00 102.66 ? 177 TYR A CE2 1 
ATOM   683  C CZ  . TYR A 1 93  ? -25.061 38.569 -7.468  1.00 103.82 ? 177 TYR A CZ  1 
ATOM   684  O OH  . TYR A 1 93  ? -25.869 39.592 -7.895  1.00 109.08 ? 177 TYR A OH  1 
ATOM   685  N N   . ILE A 1 94  ? -19.869 33.865 -6.612  1.00 108.00 ? 178 ILE A N   1 
ATOM   686  C CA  . ILE A 1 94  ? -18.821 33.055 -5.997  1.00 107.92 ? 178 ILE A CA  1 
ATOM   687  C C   . ILE A 1 94  ? -18.059 33.881 -4.963  1.00 108.36 ? 178 ILE A C   1 
ATOM   688  O O   . ILE A 1 94  ? -17.773 35.055 -5.197  1.00 108.96 ? 178 ILE A O   1 
ATOM   689  C CB  . ILE A 1 94  ? -17.830 32.505 -7.044  1.00 109.57 ? 178 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 94  ? -18.584 31.900 -8.229  1.00 109.51 ? 178 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 94  ? -16.896 31.474 -6.407  1.00 109.74 ? 178 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 94  ? -17.719 31.537 -9.409  1.00 108.26 ? 178 ILE A CD1 1 
ATOM   693  N N   . PHE A 1 95  ? -17.742 33.266 -3.824  1.00 108.56 ? 179 PHE A N   1 
ATOM   694  C CA  . PHE A 1 95  ? -17.026 33.937 -2.734  1.00 109.49 ? 179 PHE A CA  1 
ATOM   695  C C   . PHE A 1 95  ? -15.721 33.219 -2.424  1.00 112.11 ? 179 PHE A C   1 
ATOM   696  O O   . PHE A 1 95  ? -15.725 32.096 -1.915  1.00 113.57 ? 179 PHE A O   1 
ATOM   697  C CB  . PHE A 1 95  ? -17.873 33.982 -1.456  1.00 109.89 ? 179 PHE A CB  1 
ATOM   698  C CG  . PHE A 1 95  ? -19.137 34.784 -1.584  1.00 106.73 ? 179 PHE A CG  1 
ATOM   699  C CD1 . PHE A 1 95  ? -20.276 34.221 -2.126  1.00 102.94 ? 179 PHE A CD1 1 
ATOM   700  C CD2 . PHE A 1 95  ? -19.185 36.099 -1.146  1.00 106.40 ? 179 PHE A CD2 1 
ATOM   701  C CE1 . PHE A 1 95  ? -21.429 34.957 -2.243  1.00 103.33 ? 179 PHE A CE1 1 
ATOM   702  C CE2 . PHE A 1 95  ? -20.343 36.842 -1.259  1.00 102.08 ? 179 PHE A CE2 1 
ATOM   703  C CZ  . PHE A 1 95  ? -21.465 36.272 -1.806  1.00 100.10 ? 179 PHE A CZ  1 
ATOM   704  N N   . ALA A 1 96  ? -14.607 33.879 -2.717  1.00 112.18 ? 180 ALA A N   1 
ATOM   705  C CA  . ALA A 1 96  ? -13.291 33.282 -2.539  1.00 113.70 ? 180 ALA A CA  1 
ATOM   706  C C   . ALA A 1 96  ? -12.735 33.619 -1.169  1.00 114.10 ? 180 ALA A C   1 
ATOM   707  O O   . ALA A 1 96  ? -12.761 34.778 -0.760  1.00 115.56 ? 180 ALA A O   1 
ATOM   708  C CB  . ALA A 1 96  ? -12.351 33.791 -3.612  1.00 117.30 ? 180 ALA A CB  1 
ATOM   709  N N   . ASP A 1 97  ? -12.228 32.623 -0.453  1.00 112.93 ? 181 ASP A N   1 
ATOM   710  C CA  . ASP A 1 97  ? -11.545 32.920 0.797   1.00 113.50 ? 181 ASP A CA  1 
ATOM   711  C C   . ASP A 1 97  ? -10.178 33.518 0.479   1.00 117.93 ? 181 ASP A C   1 
ATOM   712  O O   . ASP A 1 97  ? -9.576  33.198 -0.548  1.00 119.58 ? 181 ASP A O   1 
ATOM   713  C CB  . ASP A 1 97  ? -11.411 31.678 1.679   1.00 114.62 ? 181 ASP A CB  1 
ATOM   714  C CG  . ASP A 1 97  ? -11.023 32.021 3.115   1.00 116.63 ? 181 ASP A CG  1 
ATOM   715  O OD1 . ASP A 1 97  ? -11.926 32.173 3.963   1.00 115.44 ? 181 ASP A OD1 1 
ATOM   716  O OD2 . ASP A 1 97  ? -9.815  32.143 3.405   1.00 119.52 ? 181 ASP A OD2 1 
ATOM   717  N N   . ALA A 1 98  ? -9.703  34.397 1.358   1.00 120.57 ? 182 ALA A N   1 
ATOM   718  C CA  . ALA A 1 98  ? -8.418  35.079 1.177   1.00 121.93 ? 182 ALA A CA  1 
ATOM   719  C C   . ALA A 1 98  ? -7.237  34.180 1.520   1.00 123.60 ? 182 ALA A C   1 
ATOM   720  O O   . ALA A 1 98  ? -6.202  34.211 0.852   1.00 127.00 ? 182 ALA A O   1 
ATOM   721  C CB  . ALA A 1 98  ? -8.366  36.346 2.027   1.00 119.42 ? 182 ALA A CB  1 
ATOM   722  N N   . TYR A 1 99  ? -7.402  33.379 2.565   1.00 121.91 ? 183 TYR A N   1 
ATOM   723  C CA  . TYR A 1 99  ? -6.303  32.597 3.103   1.00 124.86 ? 183 TYR A CA  1 
ATOM   724  C C   . TYR A 1 99  ? -6.399  31.108 2.780   1.00 126.92 ? 183 TYR A C   1 
ATOM   725  O O   . TYR A 1 99  ? -5.388  30.468 2.483   1.00 129.31 ? 183 TYR A O   1 
ATOM   726  C CB  . TYR A 1 99  ? -6.199  32.835 4.608   1.00 125.89 ? 183 TYR A CB  1 
ATOM   727  C CG  . TYR A 1 99  ? -5.957  34.290 4.921   1.00 125.79 ? 183 TYR A CG  1 
ATOM   728  C CD1 . TYR A 1 99  ? -5.062  35.032 4.160   1.00 125.99 ? 183 TYR A CD1 1 
ATOM   729  C CD2 . TYR A 1 99  ? -6.639  34.930 5.945   1.00 122.79 ? 183 TYR A CD2 1 
ATOM   730  C CE1 . TYR A 1 99  ? -4.832  36.363 4.424   1.00 124.75 ? 183 TYR A CE1 1 
ATOM   731  C CE2 . TYR A 1 99  ? -6.417  36.268 6.218   1.00 122.77 ? 183 TYR A CE2 1 
ATOM   732  C CZ  . TYR A 1 99  ? -5.511  36.980 5.451   1.00 124.26 ? 183 TYR A CZ  1 
ATOM   733  O OH  . TYR A 1 99  ? -5.275  38.313 5.702   1.00 124.98 ? 183 TYR A OH  1 
ATOM   734  N N   . ALA A 1 100 ? -7.609  30.560 2.827   1.00 124.78 ? 184 ALA A N   1 
ATOM   735  C CA  . ALA A 1 100 ? -7.801  29.136 2.545   1.00 124.73 ? 184 ALA A CA  1 
ATOM   736  C C   . ALA A 1 100 ? -8.185  28.869 1.093   1.00 124.21 ? 184 ALA A C   1 
ATOM   737  O O   . ALA A 1 100 ? -8.833  29.692 0.443   1.00 124.01 ? 184 ALA A O   1 
ATOM   738  C CB  . ALA A 1 100 ? -8.825  28.528 3.488   1.00 121.13 ? 184 ALA A CB  1 
ATOM   739  N N   . GLN A 1 101 ? -7.771  27.711 0.591   1.00 123.43 ? 185 GLN A N   1 
ATOM   740  C CA  . GLN A 1 101 ? -8.081  27.311 -0.771  1.00 124.49 ? 185 GLN A CA  1 
ATOM   741  C C   . GLN A 1 101 ? -9.514  26.819 -0.817  1.00 125.19 ? 185 GLN A C   1 
ATOM   742  O O   . GLN A 1 101 ? -9.758  25.618 -0.964  1.00 125.33 ? 185 GLN A O   1 
ATOM   743  C CB  . GLN A 1 101 ? -7.141  26.194 -1.216  1.00 126.65 ? 185 GLN A CB  1 
ATOM   744  C CG  . GLN A 1 101 ? -5.674  26.525 -1.051  1.00 127.19 ? 185 GLN A CG  1 
ATOM   745  C CD  . GLN A 1 101 ? -4.777  25.393 -1.493  1.00 127.33 ? 185 GLN A CD  1 
ATOM   746  O OE1 . GLN A 1 101 ? -5.249  24.379 -2.001  1.00 128.58 ? 185 GLN A OE1 1 
ATOM   747  N NE2 . GLN A 1 101 ? -3.474  25.559 -1.301  1.00 127.84 ? 185 GLN A NE2 1 
ATOM   748  N N   . TYR A 1 102 ? -10.458 27.751 -0.708  1.00 123.70 ? 186 TYR A N   1 
ATOM   749  C CA  . TYR A 1 102 ? -11.857 27.404 -0.483  1.00 119.89 ? 186 TYR A CA  1 
ATOM   750  C C   . TYR A 1 102 ? -12.794 28.368 -1.204  1.00 117.24 ? 186 TYR A C   1 
ATOM   751  O O   . TYR A 1 102 ? -12.471 29.541 -1.388  1.00 117.71 ? 186 TYR A O   1 
ATOM   752  C CB  . TYR A 1 102 ? -12.140 27.413 1.023   1.00 120.81 ? 186 TYR A CB  1 
ATOM   753  C CG  . TYR A 1 102 ? -13.269 26.510 1.488   1.00 122.94 ? 186 TYR A CG  1 
ATOM   754  C CD1 . TYR A 1 102 ? -13.082 25.138 1.637   1.00 123.89 ? 186 TYR A CD1 1 
ATOM   755  C CD2 . TYR A 1 102 ? -14.514 27.034 1.806   1.00 122.24 ? 186 TYR A CD2 1 
ATOM   756  C CE1 . TYR A 1 102 ? -14.116 24.316 2.073   1.00 123.11 ? 186 TYR A CE1 1 
ATOM   757  C CE2 . TYR A 1 102 ? -15.546 26.223 2.246   1.00 121.57 ? 186 TYR A CE2 1 
ATOM   758  C CZ  . TYR A 1 102 ? -15.345 24.870 2.377   1.00 121.75 ? 186 TYR A CZ  1 
ATOM   759  O OH  . TYR A 1 102 ? -16.385 24.079 2.814   1.00 124.20 ? 186 TYR A OH  1 
ATOM   760  N N   . LEU A 1 103 ? -13.954 27.862 -1.614  1.00 119.12 ? 187 LEU A N   1 
ATOM   761  C CA  . LEU A 1 103 ? -14.979 28.676 -2.265  1.00 116.65 ? 187 LEU A CA  1 
ATOM   762  C C   . LEU A 1 103 ? -16.336 28.543 -1.586  1.00 116.65 ? 187 LEU A C   1 
ATOM   763  O O   . LEU A 1 103 ? -16.532 27.712 -0.697  1.00 117.11 ? 187 LEU A O   1 
ATOM   764  C CB  . LEU A 1 103 ? -15.137 28.279 -3.731  1.00 113.86 ? 187 LEU A CB  1 
ATOM   765  C CG  . LEU A 1 103 ? -14.032 28.716 -4.680  1.00 116.16 ? 187 LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 103 ? -14.342 28.251 -6.090  1.00 115.63 ? 187 LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 103 ? -13.867 30.223 -4.622  1.00 116.82 ? 187 LEU A CD2 1 
ATOM   768  N N   . TRP A 1 104 ? -17.265 29.386 -2.016  1.00 113.90 ? 188 TRP A N   1 
ATOM   769  C CA  . TRP A 1 104 ? -18.673 29.217 -1.703  1.00 111.64 ? 188 TRP A CA  1 
ATOM   770  C C   . TRP A 1 104 ? -19.455 29.623 -2.939  1.00 110.63 ? 188 TRP A C   1 
ATOM   771  O O   . TRP A 1 104 ? -19.313 30.743 -3.425  1.00 110.27 ? 188 TRP A O   1 
ATOM   772  C CB  . TRP A 1 104 ? -19.075 30.079 -0.516  1.00 109.08 ? 188 TRP A CB  1 
ATOM   773  C CG  . TRP A 1 104 ? -18.513 29.611 0.784   1.00 113.69 ? 188 TRP A CG  1 
ATOM   774  C CD1 . TRP A 1 104 ? -19.074 28.714 1.646   1.00 116.19 ? 188 TRP A CD1 1 
ATOM   775  C CD2 . TRP A 1 104 ? -17.281 30.024 1.383   1.00 115.44 ? 188 TRP A CD2 1 
ATOM   776  N NE1 . TRP A 1 104 ? -18.267 28.541 2.743   1.00 117.46 ? 188 TRP A NE1 1 
ATOM   777  C CE2 . TRP A 1 104 ? -17.158 29.335 2.605   1.00 117.03 ? 188 TRP A CE2 1 
ATOM   778  C CE3 . TRP A 1 104 ? -16.269 30.912 1.006   1.00 115.10 ? 188 TRP A CE3 1 
ATOM   779  C CZ2 . TRP A 1 104 ? -16.064 29.506 3.453   1.00 118.28 ? 188 TRP A CZ2 1 
ATOM   780  C CZ3 . TRP A 1 104 ? -15.182 31.077 1.849   1.00 116.48 ? 188 TRP A CZ3 1 
ATOM   781  C CH2 . TRP A 1 104 ? -15.088 30.377 3.057   1.00 115.63 ? 188 TRP A CH2 1 
ATOM   782  N N   . ILE A 1 105 ? -20.261 28.713 -3.471  1.00 111.76 ? 189 ILE A N   1 
ATOM   783  C CA  . ILE A 1 105 ? -21.032 29.036 -4.665  1.00 111.55 ? 189 ILE A CA  1 
ATOM   784  C C   . ILE A 1 105 ? -22.528 29.198 -4.380  1.00 110.79 ? 189 ILE A C   1 
ATOM   785  O O   . ILE A 1 105 ? -23.043 28.713 -3.370  1.00 111.21 ? 189 ILE A O   1 
ATOM   786  C CB  . ILE A 1 105 ? -20.776 28.041 -5.823  1.00 111.55 ? 189 ILE A CB  1 
ATOM   787  C CG1 . ILE A 1 105 ? -21.142 26.612 -5.419  1.00 109.78 ? 189 ILE A CG1 1 
ATOM   788  C CG2 . ILE A 1 105 ? -19.320 28.113 -6.269  1.00 111.71 ? 189 ILE A CG2 1 
ATOM   789  C CD1 . ILE A 1 105 ? -20.986 25.622 -6.552  1.00 108.16 ? 189 ILE A CD1 1 
ATOM   790  N N   . THR A 1 106 ? -23.209 29.903 -5.277  1.00 107.10 ? 190 THR A N   1 
ATOM   791  C CA  . THR A 1 106 ? -24.602 30.256 -5.090  1.00 105.88 ? 190 THR A CA  1 
ATOM   792  C C   . THR A 1 106 ? -25.248 30.316 -6.444  1.00 107.75 ? 190 THR A C   1 
ATOM   793  O O   . THR A 1 106 ? -24.690 30.899 -7.368  1.00 106.03 ? 190 THR A O   1 
ATOM   794  C CB  . THR A 1 106 ? -24.736 31.644 -4.445  1.00 107.38 ? 190 THR A CB  1 
ATOM   795  O OG1 . THR A 1 106 ? -24.693 31.508 -3.023  1.00 110.79 ? 190 THR A OG1 1 
ATOM   796  C CG2 . THR A 1 106 ? -26.047 32.305 -4.834  1.00 106.40 ? 190 THR A CG2 1 
ATOM   797  N N   . PHE A 1 107 ? -26.425 29.711 -6.567  1.00 109.48 ? 191 PHE A N   1 
ATOM   798  C CA  . PHE A 1 107 ? -27.182 29.797 -7.808  1.00 105.73 ? 191 PHE A CA  1 
ATOM   799  C C   . PHE A 1 107 ? -28.486 30.534 -7.580  1.00 106.03 ? 191 PHE A C   1 
ATOM   800  O O   . PHE A 1 107 ? -29.187 30.884 -8.532  1.00 108.08 ? 191 PHE A O   1 
ATOM   801  C CB  . PHE A 1 107 ? -27.438 28.403 -8.357  1.00 103.62 ? 191 PHE A CB  1 
ATOM   802  C CG  . PHE A 1 107 ? -26.188 27.597 -8.539  1.00 101.53 ? 191 PHE A CG  1 
ATOM   803  C CD1 . PHE A 1 107 ? -25.523 27.593 -9.753  1.00 103.68 ? 191 PHE A CD1 1 
ATOM   804  C CD2 . PHE A 1 107 ? -25.664 26.866 -7.491  1.00 98.36  ? 191 PHE A CD2 1 
ATOM   805  C CE1 . PHE A 1 107 ? -24.367 26.859 -9.916  1.00 103.99 ? 191 PHE A CE1 1 
ATOM   806  C CE2 . PHE A 1 107 ? -24.515 26.135 -7.648  1.00 100.00 ? 191 PHE A CE2 1 
ATOM   807  C CZ  . PHE A 1 107 ? -23.863 26.130 -8.860  1.00 102.47 ? 191 PHE A CZ  1 
ATOM   808  N N   . ASP A 1 108 ? -28.789 30.783 -6.306  1.00 107.39 ? 192 ASP A N   1 
ATOM   809  C CA  . ASP A 1 108 ? -30.045 31.414 -5.905  1.00 107.40 ? 192 ASP A CA  1 
ATOM   810  C C   . ASP A 1 108 ? -29.892 32.640 -5.003  1.00 108.00 ? 192 ASP A C   1 
ATOM   811  O O   . ASP A 1 108 ? -30.311 32.608 -3.841  1.00 106.23 ? 192 ASP A O   1 
ATOM   812  C CB  . ASP A 1 108 ? -30.936 30.398 -5.197  1.00 107.69 ? 192 ASP A CB  1 
ATOM   813  C CG  . ASP A 1 108 ? -30.250 29.753 -4.005  1.00 111.71 ? 192 ASP A CG  1 
ATOM   814  O OD1 . ASP A 1 108 ? -30.557 30.126 -2.852  1.00 112.46 ? 192 ASP A OD1 1 
ATOM   815  O OD2 . ASP A 1 108 ? -29.392 28.870 -4.218  1.00 115.31 ? 192 ASP A OD2 1 
ATOM   816  N N   . PHE A 1 109 ? -29.313 33.717 -5.538  1.00 106.24 ? 193 PHE A N   1 
ATOM   817  C CA  . PHE A 1 109 ? -29.290 35.010 -4.849  1.00 102.50 ? 193 PHE A CA  1 
ATOM   818  C C   . PHE A 1 109 ? -28.868 34.915 -3.372  1.00 105.47 ? 193 PHE A C   1 
ATOM   819  O O   . PHE A 1 109 ? -29.389 35.622 -2.513  1.00 105.73 ? 193 PHE A O   1 
ATOM   820  C CB  . PHE A 1 109 ? -30.662 35.676 -4.962  1.00 102.36 ? 193 PHE A CB  1 
ATOM   821  C CG  . PHE A 1 109 ? -30.977 36.188 -6.336  1.00 102.10 ? 193 PHE A CG  1 
ATOM   822  C CD1 . PHE A 1 109 ? -30.069 36.967 -7.016  1.00 102.09 ? 193 PHE A CD1 1 
ATOM   823  C CD2 . PHE A 1 109 ? -32.181 35.884 -6.951  1.00 102.57 ? 193 PHE A CD2 1 
ATOM   824  C CE1 . PHE A 1 109 ? -30.356 37.440 -8.279  1.00 101.99 ? 193 PHE A CE1 1 
ATOM   825  C CE2 . PHE A 1 109 ? -32.468 36.353 -8.216  1.00 99.93  ? 193 PHE A CE2 1 
ATOM   826  C CZ  . PHE A 1 109 ? -31.557 37.130 -8.879  1.00 100.24 ? 193 PHE A CZ  1 
ATOM   827  N N   . CYS A 1 110 ? -27.943 34.008 -3.089  1.00 106.84 ? 194 CYS A N   1 
ATOM   828  C CA  . CYS A 1 110 ? -27.398 33.809 -1.748  1.00 106.66 ? 194 CYS A CA  1 
ATOM   829  C C   . CYS A 1 110 ? -28.373 33.290 -0.690  1.00 107.91 ? 194 CYS A C   1 
ATOM   830  O O   . CYS A 1 110 ? -28.078 33.376 0.501   1.00 108.37 ? 194 CYS A O   1 
ATOM   831  C CB  . CYS A 1 110 ? -26.688 35.071 -1.236  1.00 106.75 ? 194 CYS A CB  1 
ATOM   832  S SG  . CYS A 1 110 ? -25.435 35.734 -2.352  1.00 104.96 ? 194 CYS A SG  1 
ATOM   833  N N   . ASN A 1 111 ? -29.513 32.734 -1.095  1.00 109.14 ? 195 ASN A N   1 
ATOM   834  C CA  . ASN A 1 111 ? -30.362 32.060 -0.108  1.00 110.58 ? 195 ASN A CA  1 
ATOM   835  C C   . ASN A 1 111 ? -29.727 30.743 0.333   1.00 110.47 ? 195 ASN A C   1 
ATOM   836  O O   . ASN A 1 111 ? -30.003 30.253 1.427   1.00 111.63 ? 195 ASN A O   1 
ATOM   837  C CB  . ASN A 1 111 ? -31.793 31.823 -0.612  1.00 110.26 ? 195 ASN A CB  1 
ATOM   838  C CG  . ASN A 1 111 ? -32.575 33.115 -0.816  1.00 110.18 ? 195 ASN A CG  1 
ATOM   839  O OD1 . ASN A 1 111 ? -33.020 33.752 0.145   1.00 109.86 ? 195 ASN A OD1 1 
ATOM   840  N ND2 . ASN A 1 111 ? -32.768 33.494 -2.076  1.00 107.98 ? 195 ASN A ND2 1 
ATOM   841  N N   . THR A 1 112 ? -28.876 30.176 -0.523  1.00 110.34 ? 196 THR A N   1 
ATOM   842  C CA  . THR A 1 112 ? -28.185 28.920 -0.217  1.00 112.64 ? 196 THR A CA  1 
ATOM   843  C C   . THR A 1 112 ? -26.745 28.854 -0.762  1.00 112.03 ? 196 THR A C   1 
ATOM   844  O O   . THR A 1 112 ? -26.505 29.069 -1.954  1.00 109.96 ? 196 THR A O   1 
ATOM   845  C CB  . THR A 1 112 ? -28.969 27.684 -0.729  1.00 112.98 ? 196 THR A CB  1 
ATOM   846  O OG1 . THR A 1 112 ? -29.224 27.814 -2.131  1.00 113.06 ? 196 THR A OG1 1 
ATOM   847  C CG2 . THR A 1 112 ? -30.289 27.518 0.016   1.00 112.52 ? 196 THR A CG2 1 
ATOM   848  N N   . LEU A 1 113 ? -25.805 28.528 0.125   1.00 113.12 ? 197 LEU A N   1 
ATOM   849  C CA  . LEU A 1 113 ? -24.377 28.469 -0.198  1.00 114.17 ? 197 LEU A CA  1 
ATOM   850  C C   . LEU A 1 113 ? -23.761 27.073 -0.006  1.00 118.04 ? 197 LEU A C   1 
ATOM   851  O O   . LEU A 1 113 ? -24.173 26.317 0.878   1.00 121.99 ? 197 LEU A O   1 
ATOM   852  C CB  . LEU A 1 113 ? -23.616 29.457 0.682   1.00 110.33 ? 197 LEU A CB  1 
ATOM   853  C CG  . LEU A 1 113 ? -23.870 30.941 0.453   1.00 107.12 ? 197 LEU A CG  1 
ATOM   854  C CD1 . LEU A 1 113 ? -23.687 31.701 1.750   1.00 109.16 ? 197 LEU A CD1 1 
ATOM   855  C CD2 . LEU A 1 113 ? -22.911 31.454 -0.585  1.00 107.43 ? 197 LEU A CD2 1 
ATOM   856  N N   . GLN A 1 114 ? -22.758 26.741 -0.816  1.00 116.29 ? 198 GLN A N   1 
ATOM   857  C CA  . GLN A 1 114 ? -22.070 25.457 -0.693  1.00 119.86 ? 198 GLN A CA  1 
ATOM   858  C C   . GLN A 1 114 ? -20.566 25.645 -0.566  1.00 119.06 ? 198 GLN A C   1 
ATOM   859  O O   . GLN A 1 114 ? -19.928 26.172 -1.476  1.00 118.37 ? 198 GLN A O   1 
ATOM   860  C CB  . GLN A 1 114 ? -22.361 24.557 -1.901  1.00 122.70 ? 198 GLN A CB  1 
ATOM   861  C CG  . GLN A 1 114 ? -23.752 23.941 -1.938  1.00 122.57 ? 198 GLN A CG  1 
ATOM   862  C CD  . GLN A 1 114 ? -23.851 22.818 -2.954  1.00 125.45 ? 198 GLN A CD  1 
ATOM   863  O OE1 . GLN A 1 114 ? -23.024 21.900 -2.965  1.00 122.95 ? 198 GLN A OE1 1 
ATOM   864  N NE2 . GLN A 1 114 ? -24.857 22.890 -3.823  1.00 126.30 ? 198 GLN A NE2 1 
ATOM   865  N N   . GLY A 1 115 ? -19.999 25.205 0.553   1.00 119.97 ? 199 GLY A N   1 
ATOM   866  C CA  . GLY A 1 115 ? -18.561 25.267 0.742   1.00 120.28 ? 199 GLY A CA  1 
ATOM   867  C C   . GLY A 1 115 ? -17.812 24.223 -0.075  1.00 122.98 ? 199 GLY A C   1 
ATOM   868  O O   . GLY A 1 115 ? -18.077 23.027 0.050   1.00 124.71 ? 199 GLY A O   1 
ATOM   869  N N   . PHE A 1 116 ? -16.877 24.675 -0.912  1.00 123.22 ? 200 PHE A N   1 
ATOM   870  C CA  . PHE A 1 116 ? -16.057 23.775 -1.732  1.00 123.66 ? 200 PHE A CA  1 
ATOM   871  C C   . PHE A 1 116 ? -14.563 24.007 -1.564  1.00 122.64 ? 200 PHE A C   1 
ATOM   872  O O   . PHE A 1 116 ? -14.111 25.146 -1.485  1.00 122.38 ? 200 PHE A O   1 
ATOM   873  C CB  . PHE A 1 116 ? -16.398 23.922 -3.215  1.00 120.53 ? 200 PHE A CB  1 
ATOM   874  C CG  . PHE A 1 116 ? -17.625 23.189 -3.621  1.00 120.86 ? 200 PHE A CG  1 
ATOM   875  C CD1 . PHE A 1 116 ? -18.110 22.149 -2.844  1.00 123.68 ? 200 PHE A CD1 1 
ATOM   876  C CD2 . PHE A 1 116 ? -18.299 23.530 -4.775  1.00 120.19 ? 200 PHE A CD2 1 
ATOM   877  C CE1 . PHE A 1 116 ? -19.248 21.461 -3.208  1.00 124.19 ? 200 PHE A CE1 1 
ATOM   878  C CE2 . PHE A 1 116 ? -19.441 22.851 -5.144  1.00 122.69 ? 200 PHE A CE2 1 
ATOM   879  C CZ  . PHE A 1 116 ? -19.916 21.812 -4.363  1.00 124.81 ? 200 PHE A CZ  1 
ATOM   880  N N   . SER A 1 117 ? -13.797 22.923 -1.526  1.00 124.42 ? 201 SER A N   1 
ATOM   881  C CA  . SER A 1 117 ? -12.347 23.032 -1.568  1.00 124.89 ? 201 SER A CA  1 
ATOM   882  C C   . SER A 1 117 ? -11.875 23.119 -3.018  1.00 125.03 ? 201 SER A C   1 
ATOM   883  O O   . SER A 1 117 ? -12.529 22.618 -3.937  1.00 122.68 ? 201 SER A O   1 
ATOM   884  C CB  . SER A 1 117 ? -11.677 21.857 -0.847  1.00 126.28 ? 201 SER A CB  1 
ATOM   885  O OG  . SER A 1 117 ? -11.637 22.068 0.557   1.00 126.87 ? 201 SER A OG  1 
ATOM   886  N N   . ILE A 1 118 ? -10.742 23.778 -3.217  1.00 125.77 ? 202 ILE A N   1 
ATOM   887  C CA  . ILE A 1 118 ? -10.174 23.932 -4.545  1.00 126.82 ? 202 ILE A CA  1 
ATOM   888  C C   . ILE A 1 118 ? -8.676  23.684 -4.456  1.00 129.00 ? 202 ILE A C   1 
ATOM   889  O O   . ILE A 1 118 ? -8.081  23.885 -3.394  1.00 129.35 ? 202 ILE A O   1 
ATOM   890  C CB  . ILE A 1 118 ? -10.463 25.330 -5.107  1.00 125.60 ? 202 ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 118 ? -10.258 26.380 -4.020  1.00 123.57 ? 202 ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 118 ? -11.887 25.402 -5.617  1.00 124.01 ? 202 ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 118 ? -10.588 27.789 -4.451  1.00 123.32 ? 202 ILE A CD1 1 
ATOM   894  N N   . PRO A 1 119 ? -8.068  23.217 -5.562  1.00 128.41 ? 203 PRO A N   1 
ATOM   895  C CA  . PRO A 1 119 ? -6.632  22.909 -5.611  1.00 129.97 ? 203 PRO A CA  1 
ATOM   896  C C   . PRO A 1 119 ? -5.729  24.121 -5.361  1.00 129.68 ? 203 PRO A C   1 
ATOM   897  O O   . PRO A 1 119 ? -4.600  23.957 -4.895  1.00 129.21 ? 203 PRO A O   1 
ATOM   898  C CB  . PRO A 1 119 ? -6.440  22.403 -7.042  1.00 130.25 ? 203 PRO A CB  1 
ATOM   899  C CG  . PRO A 1 119 ? -7.784  21.885 -7.440  1.00 127.87 ? 203 PRO A CG  1 
ATOM   900  C CD  . PRO A 1 119 ? -8.758  22.812 -6.800  1.00 125.60 ? 203 PRO A CD  1 
ATOM   901  N N   . PHE A 1 120 ? -6.226  25.316 -5.662  1.00 129.02 ? 204 PHE A N   1 
ATOM   902  C CA  . PHE A 1 120 ? -5.426  26.532 -5.552  1.00 128.40 ? 204 PHE A CA  1 
ATOM   903  C C   . PHE A 1 120 ? -6.111  27.576 -4.671  1.00 127.98 ? 204 PHE A C   1 
ATOM   904  O O   . PHE A 1 120 ? -7.290  27.443 -4.359  1.00 128.27 ? 204 PHE A O   1 
ATOM   905  C CB  . PHE A 1 120 ? -5.160  27.107 -6.947  1.00 127.95 ? 204 PHE A CB  1 
ATOM   906  C CG  . PHE A 1 120 ? -6.402  27.547 -7.671  1.00 127.96 ? 204 PHE A CG  1 
ATOM   907  C CD1 . PHE A 1 120 ? -7.247  26.620 -8.261  1.00 128.22 ? 204 PHE A CD1 1 
ATOM   908  C CD2 . PHE A 1 120 ? -6.719  28.891 -7.774  1.00 128.00 ? 204 PHE A CD2 1 
ATOM   909  C CE1 . PHE A 1 120 ? -8.393  27.030 -8.928  1.00 126.19 ? 204 PHE A CE1 1 
ATOM   910  C CE2 . PHE A 1 120 ? -7.858  29.305 -8.439  1.00 124.53 ? 204 PHE A CE2 1 
ATOM   911  C CZ  . PHE A 1 120 ? -8.693  28.375 -9.020  1.00 122.88 ? 204 PHE A CZ  1 
ATOM   912  N N   . ARG A 1 121 ? -5.370  28.603 -4.255  1.00 129.47 ? 205 ARG A N   1 
ATOM   913  C CA  . ARG A 1 121 ? -5.967  29.726 -3.539  1.00 128.45 ? 205 ARG A CA  1 
ATOM   914  C C   . ARG A 1 121 ? -6.661  30.599 -4.564  1.00 129.78 ? 205 ARG A C   1 
ATOM   915  O O   . ARG A 1 121 ? -6.122  30.851 -5.640  1.00 128.80 ? 205 ARG A O   1 
ATOM   916  C CB  . ARG A 1 121 ? -4.917  30.549 -2.788  1.00 129.79 ? 205 ARG A CB  1 
ATOM   917  C CG  . ARG A 1 121 ? -5.497  31.756 -2.030  1.00 130.43 ? 205 ARG A CG  1 
ATOM   918  C CD  . ARG A 1 121 ? -4.473  32.882 -1.853  1.00 134.94 ? 205 ARG A CD  1 
ATOM   919  N NE  . ARG A 1 121 ? -3.637  33.031 -3.041  1.00 138.52 ? 205 ARG A NE  1 
ATOM   920  C CZ  . ARG A 1 121 ? -2.355  32.684 -3.105  1.00 139.61 ? 205 ARG A CZ  1 
ATOM   921  N NH1 . ARG A 1 121 ? -1.742  32.185 -2.037  1.00 138.61 ? 205 ARG A NH1 1 
ATOM   922  N NH2 . ARG A 1 121 ? -1.684  32.839 -4.237  1.00 137.75 ? 205 ARG A NH2 1 
ATOM   923  N N   . ALA A 1 122 ? -7.860  31.061 -4.238  1.00 130.92 ? 206 ALA A N   1 
ATOM   924  C CA  . ALA A 1 122 ? -8.628  31.835 -5.195  1.00 127.18 ? 206 ALA A CA  1 
ATOM   925  C C   . ALA A 1 122 ? -8.225  33.301 -5.151  1.00 128.14 ? 206 ALA A C   1 
ATOM   926  O O   . ALA A 1 122 ? -9.022  34.168 -4.785  1.00 129.92 ? 206 ALA A O   1 
ATOM   927  C CB  . ALA A 1 122 ? -10.111 31.663 -4.947  1.00 124.53 ? 206 ALA A CB  1 
ATOM   928  N N   . ALA A 1 123 ? -6.979  33.568 -5.529  1.00 127.88 ? 207 ALA A N   1 
ATOM   929  C CA  . ALA A 1 123 ? -6.463  34.930 -5.573  1.00 127.48 ? 207 ALA A CA  1 
ATOM   930  C C   . ALA A 1 123 ? -7.218  35.773 -6.592  1.00 124.82 ? 207 ALA A C   1 
ATOM   931  O O   . ALA A 1 123 ? -7.513  36.938 -6.344  1.00 127.19 ? 207 ALA A O   1 
ATOM   932  C CB  . ALA A 1 123 ? -4.974  34.923 -5.893  1.00 132.72 ? 207 ALA A CB  1 
ATOM   933  N N   . ASP A 1 124 ? -7.539  35.176 -7.735  1.00 122.92 ? 208 ASP A N   1 
ATOM   934  C CA  . ASP A 1 124 ? -8.143  35.926 -8.831  1.00 124.39 ? 208 ASP A CA  1 
ATOM   935  C C   . ASP A 1 124 ? -8.940  35.023 -9.777  1.00 122.39 ? 208 ASP A C   1 
ATOM   936  O O   . ASP A 1 124 ? -8.385  34.095 -10.359 1.00 122.73 ? 208 ASP A O   1 
ATOM   937  C CB  . ASP A 1 124 ? -7.049  36.676 -9.596  1.00 128.24 ? 208 ASP A CB  1 
ATOM   938  C CG  . ASP A 1 124 ? -7.600  37.573 -10.689 1.00 128.60 ? 208 ASP A CG  1 
ATOM   939  O OD1 . ASP A 1 124 ? -8.788  37.955 -10.623 1.00 126.81 ? 208 ASP A OD1 1 
ATOM   940  O OD2 . ASP A 1 124 ? -6.831  37.910 -11.614 1.00 130.95 ? 208 ASP A OD2 1 
ATOM   941  N N   . LEU A 1 125 ? -10.237 35.302 -9.924  1.00 120.58 ? 209 LEU A N   1 
ATOM   942  C CA  . LEU A 1 125 ? -11.136 34.496 -10.763 1.00 117.32 ? 209 LEU A CA  1 
ATOM   943  C C   . LEU A 1 125 ? -11.744 35.296 -11.919 1.00 114.08 ? 209 LEU A C   1 
ATOM   944  O O   . LEU A 1 125 ? -12.008 36.489 -11.788 1.00 116.54 ? 209 LEU A O   1 
ATOM   945  C CB  . LEU A 1 125 ? -12.263 33.888 -9.921  1.00 116.15 ? 209 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 125 ? -11.915 32.791 -8.911  1.00 118.50 ? 209 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 125 ? -13.134 32.400 -8.080  1.00 115.95 ? 209 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 125 ? -11.360 31.581 -9.627  1.00 118.90 ? 209 LEU A CD2 1 
ATOM   949  N N   . LEU A 1 126 ? -11.978 34.632 -13.046 1.00 110.69 ? 210 LEU A N   1 
ATOM   950  C CA  . LEU A 1 126 ? -12.527 35.302 -14.217 1.00 109.66 ? 210 LEU A CA  1 
ATOM   951  C C   . LEU A 1 126 ? -13.673 34.484 -14.805 1.00 114.24 ? 210 LEU A C   1 
ATOM   952  O O   . LEU A 1 126 ? -13.464 33.396 -15.347 1.00 115.45 ? 210 LEU A O   1 
ATOM   953  C CB  . LEU A 1 126 ? -11.439 35.533 -15.266 1.00 109.86 ? 210 LEU A CB  1 
ATOM   954  C CG  . LEU A 1 126 ? -11.714 36.615 -16.310 1.00 108.54 ? 210 LEU A CG  1 
ATOM   955  C CD1 . LEU A 1 126 ? -11.740 37.987 -15.655 1.00 109.34 ? 210 LEU A CD1 1 
ATOM   956  C CD2 . LEU A 1 126 ? -10.686 36.576 -17.428 1.00 113.00 ? 210 LEU A CD2 1 
ATOM   957  N N   . LEU A 1 127 ? -14.885 35.018 -14.688 1.00 112.67 ? 211 LEU A N   1 
ATOM   958  C CA  . LEU A 1 127 ? -16.092 34.329 -15.124 1.00 108.60 ? 211 LEU A CA  1 
ATOM   959  C C   . LEU A 1 127 ? -16.469 34.717 -16.554 1.00 111.51 ? 211 LEU A C   1 
ATOM   960  O O   . LEU A 1 127 ? -16.389 35.888 -16.934 1.00 110.54 ? 211 LEU A O   1 
ATOM   961  C CB  . LEU A 1 127 ? -17.245 34.652 -14.172 1.00 105.45 ? 211 LEU A CB  1 
ATOM   962  C CG  . LEU A 1 127 ? -17.377 33.858 -12.867 1.00 106.11 ? 211 LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 127 ? -16.156 33.983 -11.990 1.00 107.10 ? 211 LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 127 ? -18.611 34.299 -12.097 1.00 107.97 ? 211 LEU A CD2 1 
ATOM   965  N N   . HIS A 1 128 ? -16.883 33.729 -17.342 1.00 114.18 ? 212 HIS A N   1 
ATOM   966  C CA  . HIS A 1 128 ? -17.278 33.965 -18.728 1.00 114.15 ? 212 HIS A CA  1 
ATOM   967  C C   . HIS A 1 128 ? -18.535 34.823 -18.782 1.00 110.86 ? 212 HIS A C   1 
ATOM   968  O O   . HIS A 1 128 ? -19.403 34.731 -17.916 1.00 111.12 ? 212 HIS A O   1 
ATOM   969  C CB  . HIS A 1 128 ? -17.504 32.633 -19.464 1.00 115.13 ? 212 HIS A CB  1 
ATOM   970  C CG  . HIS A 1 128 ? -17.402 32.733 -20.952 1.00 117.20 ? 212 HIS A CG  1 
ATOM   971  N ND1 . HIS A 1 128 ? -17.170 33.929 -21.623 1.00 118.30 ? 212 HIS A ND1 1 
ATOM   972  C CD2 . HIS A 1 128 ? -17.487 31.791 -21.924 1.00 117.48 ? 212 HIS A CD2 1 
ATOM   973  C CE1 . HIS A 1 128 ? -17.124 33.713 -22.909 1.00 117.47 ? 212 HIS A CE1 1 
ATOM   974  N NE2 . HIS A 1 128 ? -17.313 32.420 -23.135 1.00 117.18 ? 212 HIS A NE2 1 
ATOM   975  N N   . SER A 1 129 ? -18.625 35.660 -19.805 1.00 109.61 ? 213 SER A N   1 
ATOM   976  C CA  . SER A 1 129 ? -19.781 36.522 -19.983 1.00 112.12 ? 213 SER A CA  1 
ATOM   977  C C   . SER A 1 129 ? -21.031 35.773 -20.462 1.00 115.13 ? 213 SER A C   1 
ATOM   978  O O   . SER A 1 129 ? -22.149 36.173 -20.142 1.00 116.69 ? 213 SER A O   1 
ATOM   979  C CB  . SER A 1 129 ? -19.448 37.642 -20.964 1.00 110.39 ? 213 SER A CB  1 
ATOM   980  O OG  . SER A 1 129 ? -19.239 37.113 -22.258 1.00 116.32 ? 213 SER A OG  1 
ATOM   981  N N   . LYS A 1 130 ? -20.846 34.706 -21.236 1.00 116.63 ? 214 LYS A N   1 
ATOM   982  C CA  . LYS A 1 130 ? -21.976 33.953 -21.792 1.00 115.83 ? 214 LYS A CA  1 
ATOM   983  C C   . LYS A 1 130 ? -22.167 32.573 -21.160 1.00 113.80 ? 214 LYS A C   1 
ATOM   984  O O   . LYS A 1 130 ? -23.277 32.203 -20.791 1.00 112.03 ? 214 LYS A O   1 
ATOM   985  C CB  . LYS A 1 130 ? -21.830 33.801 -23.307 1.00 116.77 ? 214 LYS A CB  1 
ATOM   986  C CG  . LYS A 1 130 ? -21.931 35.100 -24.085 1.00 118.80 ? 214 LYS A CG  1 
ATOM   987  C CD  . LYS A 1 130 ? -21.991 34.816 -25.581 1.00 128.23 ? 214 LYS A CD  1 
ATOM   988  C CE  . LYS A 1 130 ? -22.299 36.078 -26.369 1.00 133.79 ? 214 LYS A CE  1 
ATOM   989  N NZ  . LYS A 1 130 ? -21.239 37.106 -26.191 1.00 132.65 ? 214 LYS A NZ  1 
ATOM   990  N N   . ALA A 1 131 ? -21.081 31.811 -21.057 1.00 113.75 ? 215 ALA A N   1 
ATOM   991  C CA  . ALA A 1 131 ? -21.136 30.460 -20.509 1.00 114.15 ? 215 ALA A CA  1 
ATOM   992  C C   . ALA A 1 131 ? -21.155 30.484 -18.984 1.00 115.32 ? 215 ALA A C   1 
ATOM   993  O O   . ALA A 1 131 ? -20.126 30.290 -18.338 1.00 116.93 ? 215 ALA A O   1 
ATOM   994  C CB  . ALA A 1 131 ? -19.960 29.649 -21.005 1.00 115.29 ? 215 ALA A CB  1 
ATOM   995  N N   . SER A 1 132 ? -22.335 30.704 -18.415 1.00 114.02 ? 216 SER A N   1 
ATOM   996  C CA  . SER A 1 132 ? -22.474 30.935 -16.979 1.00 113.90 ? 216 SER A CA  1 
ATOM   997  C C   . SER A 1 132 ? -21.763 29.926 -16.073 1.00 115.07 ? 216 SER A C   1 
ATOM   998  O O   . SER A 1 132 ? -21.408 30.249 -14.941 1.00 116.18 ? 216 SER A O   1 
ATOM   999  C CB  . SER A 1 132 ? -23.949 31.013 -16.595 1.00 112.93 ? 216 SER A CB  1 
ATOM   1000 O OG  . SER A 1 132 ? -24.538 29.726 -16.575 1.00 118.13 ? 216 SER A OG  1 
ATOM   1001 N N   . ASN A 1 133 ? -21.561 28.711 -16.563 1.00 114.78 ? 217 ASN A N   1 
ATOM   1002 C CA  . ASN A 1 133 ? -20.924 27.666 -15.768 1.00 116.51 ? 217 ASN A CA  1 
ATOM   1003 C C   . ASN A 1 133 ? -19.399 27.648 -15.895 1.00 116.02 ? 217 ASN A C   1 
ATOM   1004 O O   . ASN A 1 133 ? -18.727 26.836 -15.262 1.00 116.48 ? 217 ASN A O   1 
ATOM   1005 C CB  . ASN A 1 133 ? -21.486 26.307 -16.176 1.00 117.77 ? 217 ASN A CB  1 
ATOM   1006 C CG  . ASN A 1 133 ? -21.460 26.103 -17.680 1.00 119.29 ? 217 ASN A CG  1 
ATOM   1007 O OD1 . ASN A 1 133 ? -22.323 26.610 -18.398 1.00 119.30 ? 217 ASN A OD1 1 
ATOM   1008 N ND2 . ASN A 1 133 ? -20.459 25.372 -18.165 1.00 118.47 ? 217 ASN A ND2 1 
ATOM   1009 N N   . LEU A 1 134 ? -18.861 28.562 -16.695 1.00 115.25 ? 218 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 134 ? -17.463 28.512 -17.105 1.00 115.57 ? 218 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 134 ? -16.629 29.659 -16.541 1.00 117.12 ? 218 LEU A C   1 
ATOM   1012 O O   . LEU A 1 134 ? -17.022 30.821 -16.636 1.00 117.35 ? 218 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 134 ? -17.408 28.558 -18.628 1.00 116.97 ? 218 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 134 ? -16.057 28.360 -19.299 1.00 119.40 ? 218 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 134 ? -15.504 26.978 -18.966 1.00 121.25 ? 218 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 134 ? -16.216 28.546 -20.796 1.00 119.30 ? 218 LEU A CD2 1 
ATOM   1017 N N   . LEU A 1 135 ? -15.463 29.341 -15.984 1.00 117.41 ? 219 LEU A N   1 
ATOM   1018 C CA  . LEU A 1 135 ? -14.599 30.373 -15.406 1.00 116.78 ? 219 LEU A CA  1 
ATOM   1019 C C   . LEU A 1 135 ? -13.118 29.974 -15.307 1.00 118.16 ? 219 LEU A C   1 
ATOM   1020 O O   . LEU A 1 135 ? -12.755 28.807 -15.466 1.00 117.93 ? 219 LEU A O   1 
ATOM   1021 C CB  . LEU A 1 135 ? -15.117 30.798 -14.024 1.00 114.13 ? 219 LEU A CB  1 
ATOM   1022 C CG  . LEU A 1 135 ? -14.956 29.788 -12.886 1.00 110.72 ? 219 LEU A CG  1 
ATOM   1023 C CD1 . LEU A 1 135 ? -14.933 30.497 -11.558 1.00 108.92 ? 219 LEU A CD1 1 
ATOM   1024 C CD2 . LEU A 1 135 ? -16.063 28.758 -12.909 1.00 112.23 ? 219 LEU A CD2 1 
ATOM   1025 N N   . LEU A 1 136 ? -12.270 30.959 -15.032 1.00 117.81 ? 220 LEU A N   1 
ATOM   1026 C CA  . LEU A 1 136 ? -10.838 30.720 -14.889 1.00 119.65 ? 220 LEU A CA  1 
ATOM   1027 C C   . LEU A 1 136 ? -10.331 31.146 -13.513 1.00 120.34 ? 220 LEU A C   1 
ATOM   1028 O O   . LEU A 1 136 ? -10.900 32.039 -12.888 1.00 120.53 ? 220 LEU A O   1 
ATOM   1029 C CB  . LEU A 1 136 ? -10.059 31.450 -15.989 1.00 120.81 ? 220 LEU A CB  1 
ATOM   1030 C CG  . LEU A 1 136 ? -10.263 30.911 -17.409 1.00 121.24 ? 220 LEU A CG  1 
ATOM   1031 C CD1 . LEU A 1 136 ? -9.369  31.621 -18.426 1.00 115.60 ? 220 LEU A CD1 1 
ATOM   1032 C CD2 . LEU A 1 136 ? -10.058 29.393 -17.443 1.00 121.36 ? 220 LEU A CD2 1 
ATOM   1033 N N   . GLY A 1 137 ? -9.260  30.506 -13.049 1.00 123.47 ? 221 GLY A N   1 
ATOM   1034 C CA  . GLY A 1 137 ? -8.700  30.795 -11.739 1.00 125.55 ? 221 GLY A CA  1 
ATOM   1035 C C   . GLY A 1 137 ? -7.190  30.955 -11.735 1.00 127.36 ? 221 GLY A C   1 
ATOM   1036 O O   . GLY A 1 137 ? -6.498  30.314 -12.520 1.00 128.58 ? 221 GLY A O   1 
ATOM   1037 N N   . PHE A 1 138 ? -6.674  31.799 -10.844 1.00 128.55 ? 222 PHE A N   1 
ATOM   1038 C CA  . PHE A 1 138 ? -5.244  32.092 -10.820 1.00 130.41 ? 222 PHE A CA  1 
ATOM   1039 C C   . PHE A 1 138 ? -4.659  32.170 -9.406  1.00 131.88 ? 222 PHE A C   1 
ATOM   1040 O O   . PHE A 1 138 ? -5.161  32.898 -8.548  1.00 130.18 ? 222 PHE A O   1 
ATOM   1041 C CB  . PHE A 1 138 ? -4.957  33.375 -11.605 1.00 130.70 ? 222 PHE A CB  1 
ATOM   1042 C CG  . PHE A 1 138 ? -3.493  33.669 -11.780 1.00 134.88 ? 222 PHE A CG  1 
ATOM   1043 C CD1 . PHE A 1 138 ? -2.712  32.902 -12.627 1.00 134.42 ? 222 PHE A CD1 1 
ATOM   1044 C CD2 . PHE A 1 138 ? -2.901  34.726 -11.110 1.00 137.45 ? 222 PHE A CD2 1 
ATOM   1045 C CE1 . PHE A 1 138 ? -1.365  33.178 -12.790 1.00 136.47 ? 222 PHE A CE1 1 
ATOM   1046 C CE2 . PHE A 1 138 ? -1.555  35.009 -11.269 1.00 137.13 ? 222 PHE A CE2 1 
ATOM   1047 C CZ  . PHE A 1 138 ? -0.787  34.235 -12.109 1.00 137.18 ? 222 PHE A CZ  1 
ATOM   1048 N N   . ASP A 1 139 ? -3.593  31.404 -9.185  1.00 134.49 ? 223 ASP A N   1 
ATOM   1049 C CA  . ASP A 1 139 ? -2.889  31.354 -7.906  1.00 136.80 ? 223 ASP A CA  1 
ATOM   1050 C C   . ASP A 1 139 ? -1.644  32.243 -8.003  1.00 137.82 ? 223 ASP A C   1 
ATOM   1051 O O   . ASP A 1 139 ? -0.601  31.810 -8.491  1.00 136.95 ? 223 ASP A O   1 
ATOM   1052 C CB  . ASP A 1 139 ? -2.493  29.899 -7.600  1.00 136.10 ? 223 ASP A CB  1 
ATOM   1053 C CG  . ASP A 1 139 ? -2.270  29.638 -6.110  1.00 136.89 ? 223 ASP A CG  1 
ATOM   1054 O OD1 . ASP A 1 139 ? -2.304  30.605 -5.311  1.00 136.60 ? 223 ASP A OD1 1 
ATOM   1055 O OD2 . ASP A 1 139 ? -2.046  28.456 -5.748  1.00 132.93 ? 223 ASP A OD2 1 
ATOM   1056 N N   . ARG A 1 140 ? -1.755  33.487 -7.544  1.00 138.64 ? 224 ARG A N   1 
ATOM   1057 C CA  . ARG A 1 140 ? -0.702  34.488 -7.759  1.00 139.46 ? 224 ARG A CA  1 
ATOM   1058 C C   . ARG A 1 140 ? 0.596   34.231 -6.991  1.00 136.80 ? 224 ARG A C   1 
ATOM   1059 O O   . ARG A 1 140 ? 1.690   34.360 -7.540  1.00 135.45 ? 224 ARG A O   1 
ATOM   1060 C CB  . ARG A 1 140 ? -1.218  35.890 -7.415  1.00 141.80 ? 224 ARG A CB  1 
ATOM   1061 C CG  . ARG A 1 140 ? -2.377  36.350 -8.270  1.00 140.87 ? 224 ARG A CG  1 
ATOM   1062 C CD  . ARG A 1 140 ? -2.734  37.794 -8.024  1.00 138.73 ? 224 ARG A CD  1 
ATOM   1063 N NE  . ARG A 1 140 ? -3.835  38.202 -8.888  1.00 141.13 ? 224 ARG A NE  1 
ATOM   1064 C CZ  . ARG A 1 140 ? -4.482  39.355 -8.769  1.00 146.69 ? 224 ARG A CZ  1 
ATOM   1065 N NH1 . ARG A 1 140 ? -4.133  40.210 -7.815  1.00 150.63 ? 224 ARG A NH1 1 
ATOM   1066 N NH2 . ARG A 1 140 ? -5.477  39.655 -9.597  1.00 144.33 ? 224 ARG A NH2 1 
ATOM   1067 N N   . SER A 1 141 ? 0.467   33.895 -5.713  1.00 136.23 ? 225 SER A N   1 
ATOM   1068 C CA  . SER A 1 141 ? 1.626   33.648 -4.866  1.00 135.44 ? 225 SER A CA  1 
ATOM   1069 C C   . SER A 1 141 ? 2.004   32.173 -4.895  1.00 133.85 ? 225 SER A C   1 
ATOM   1070 O O   . SER A 1 141 ? 2.531   31.633 -3.921  1.00 132.37 ? 225 SER A O   1 
ATOM   1071 C CB  . SER A 1 141 ? 1.362   34.100 -3.429  1.00 136.10 ? 225 SER A CB  1 
ATOM   1072 O OG  . SER A 1 141 ? 0.562   33.155 -2.743  1.00 138.57 ? 225 SER A OG  1 
ATOM   1073 N N   . HIS A 1 142 ? 1.714   31.526 -6.016  1.00 132.69 ? 226 HIS A N   1 
ATOM   1074 C CA  . HIS A 1 142 ? 2.195   30.178 -6.261  1.00 134.14 ? 226 HIS A CA  1 
ATOM   1075 C C   . HIS A 1 142 ? 3.381   30.280 -7.210  1.00 135.91 ? 226 HIS A C   1 
ATOM   1076 O O   . HIS A 1 142 ? 3.284   30.938 -8.250  1.00 135.43 ? 226 HIS A O   1 
ATOM   1077 C CB  . HIS A 1 142 ? 1.096   29.315 -6.874  1.00 136.31 ? 226 HIS A CB  1 
ATOM   1078 C CG  . HIS A 1 142 ? 1.437   27.859 -6.948  1.00 134.93 ? 226 HIS A CG  1 
ATOM   1079 N ND1 . HIS A 1 142 ? 2.287   27.341 -7.901  1.00 133.56 ? 226 HIS A ND1 1 
ATOM   1080 C CD2 . HIS A 1 142 ? 1.032   26.809 -6.194  1.00 134.40 ? 226 HIS A CD2 1 
ATOM   1081 C CE1 . HIS A 1 142 ? 2.395   26.035 -7.728  1.00 134.27 ? 226 HIS A CE1 1 
ATOM   1082 N NE2 . HIS A 1 142 ? 1.643   25.688 -6.700  1.00 134.21 ? 226 HIS A NE2 1 
ATOM   1083 N N   . PRO A 1 143 ? 4.506   29.634 -6.851  1.00 134.38 ? 227 PRO A N   1 
ATOM   1084 C CA  . PRO A 1 143 ? 5.781   29.720 -7.575  1.00 131.27 ? 227 PRO A CA  1 
ATOM   1085 C C   . PRO A 1 143 ? 5.653   29.418 -9.069  1.00 133.38 ? 227 PRO A C   1 
ATOM   1086 O O   . PRO A 1 143 ? 6.454   29.894 -9.878  1.00 133.38 ? 227 PRO A O   1 
ATOM   1087 C CB  . PRO A 1 143 ? 6.648   28.660 -6.883  1.00 130.53 ? 227 PRO A CB  1 
ATOM   1088 C CG  . PRO A 1 143 ? 5.710   27.836 -6.059  1.00 131.50 ? 227 PRO A CG  1 
ATOM   1089 C CD  . PRO A 1 143 ? 4.609   28.751 -5.679  1.00 132.08 ? 227 PRO A CD  1 
ATOM   1090 N N   . ASN A 1 144 ? 4.631   28.649 -9.426  1.00 135.09 ? 228 ASN A N   1 
ATOM   1091 C CA  . ASN A 1 144 ? 4.443   28.212 -10.806 1.00 136.20 ? 228 ASN A CA  1 
ATOM   1092 C C   . ASN A 1 144 ? 3.604   29.138 -11.674 1.00 135.35 ? 228 ASN A C   1 
ATOM   1093 O O   . ASN A 1 144 ? 3.671   29.067 -12.907 1.00 132.99 ? 228 ASN A O   1 
ATOM   1094 C CB  . ASN A 1 144 ? 3.830   26.814 -10.834 1.00 136.22 ? 228 ASN A CB  1 
ATOM   1095 C CG  . ASN A 1 144 ? 4.844   25.746 -10.567 1.00 138.85 ? 228 ASN A CG  1 
ATOM   1096 O OD1 . ASN A 1 144 ? 4.762   25.011 -9.579  1.00 140.69 ? 228 ASN A OD1 1 
ATOM   1097 N ND2 . ASN A 1 144 ? 5.824   25.649 -11.452 1.00 137.99 ? 228 ASN A ND2 1 
ATOM   1098 N N   . LYS A 1 145 ? 2.822   29.997 -11.026 1.00 135.44 ? 229 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 145 ? 1.836   30.816 -11.717 1.00 133.47 ? 229 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 145 ? 0.913   29.934 -12.541 1.00 131.64 ? 229 LYS A C   1 
ATOM   1101 O O   . LYS A 1 145 ? 0.913   30.002 -13.766 1.00 130.79 ? 229 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 145 ? 2.519   31.855 -12.605 1.00 134.54 ? 229 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 145 ? 3.366   32.833 -11.815 1.00 134.74 ? 229 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 145 ? 4.110   33.832 -12.692 1.00 136.50 ? 229 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 145 ? 4.825   34.852 -11.817 1.00 144.31 ? 229 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 145 ? 5.753   35.746 -12.559 1.00 149.34 ? 229 LYS A NZ  1 
ATOM   1107 N N   . GLN A 1 146 ? 0.135   29.101 -11.857 1.00 131.95 ? 230 GLN A N   1 
ATOM   1108 C CA  . GLN A 1 146 ? -0.764  28.163 -12.519 1.00 130.00 ? 230 GLN A CA  1 
ATOM   1109 C C   . GLN A 1 146 ? -2.100  28.801 -12.873 1.00 127.45 ? 230 GLN A C   1 
ATOM   1110 O O   . GLN A 1 146 ? -2.638  29.609 -12.119 1.00 127.58 ? 230 GLN A O   1 
ATOM   1111 C CB  . GLN A 1 146 ? -1.006  26.948 -11.626 1.00 130.28 ? 230 GLN A CB  1 
ATOM   1112 C CG  . GLN A 1 146 ? 0.263   26.308 -11.097 1.00 133.07 ? 230 GLN A CG  1 
ATOM   1113 C CD  . GLN A 1 146 ? -0.019  25.229 -10.073 1.00 132.66 ? 230 GLN A CD  1 
ATOM   1114 O OE1 . GLN A 1 146 ? -0.481  25.512 -8.966  1.00 133.80 ? 230 GLN A OE1 1 
ATOM   1115 N NE2 . GLN A 1 146 ? 0.249   23.982 -10.440 1.00 129.71 ? 230 GLN A NE2 1 
ATOM   1116 N N   . LEU A 1 147 ? -2.625  28.421 -14.030 1.00 128.07 ? 231 LEU A N   1 
ATOM   1117 C CA  . LEU A 1 147 ? -3.934  28.870 -14.484 1.00 126.42 ? 231 LEU A CA  1 
ATOM   1118 C C   . LEU A 1 147 ? -4.907  27.698 -14.413 1.00 126.11 ? 231 LEU A C   1 
ATOM   1119 O O   . LEU A 1 147 ? -4.570  26.584 -14.803 1.00 128.24 ? 231 LEU A O   1 
ATOM   1120 C CB  . LEU A 1 147 ? -3.838  29.390 -15.918 1.00 126.62 ? 231 LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 147 ? -5.116  29.901 -16.581 1.00 126.35 ? 231 LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 147 ? -5.643  31.128 -15.863 1.00 128.94 ? 231 LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 147 ? -4.865  30.221 -18.041 1.00 129.08 ? 231 LEU A CD2 1 
ATOM   1124 N N   . TRP A 1 148 ? -6.110  27.942 -13.910 1.00 125.81 ? 232 TRP A N   1 
ATOM   1125 C CA  . TRP A 1 148 ? -7.072  26.863 -13.728 1.00 124.65 ? 232 TRP A CA  1 
ATOM   1126 C C   . TRP A 1 148 ? -8.399  27.150 -14.424 1.00 126.02 ? 232 TRP A C   1 
ATOM   1127 O O   . TRP A 1 148 ? -8.758  28.308 -14.647 1.00 124.11 ? 232 TRP A O   1 
ATOM   1128 C CB  . TRP A 1 148 ? -7.303  26.592 -12.244 1.00 122.90 ? 232 TRP A CB  1 
ATOM   1129 C CG  . TRP A 1 148 ? -6.063  26.245 -11.496 1.00 123.95 ? 232 TRP A CG  1 
ATOM   1130 C CD1 . TRP A 1 148 ? -5.063  27.095 -11.133 1.00 125.79 ? 232 TRP A CD1 1 
ATOM   1131 C CD2 . TRP A 1 148 ? -5.696  24.957 -10.994 1.00 125.09 ? 232 TRP A CD2 1 
ATOM   1132 N NE1 . TRP A 1 148 ? -4.090  26.418 -10.444 1.00 126.66 ? 232 TRP A NE1 1 
ATOM   1133 C CE2 . TRP A 1 148 ? -4.455  25.102 -10.344 1.00 126.74 ? 232 TRP A CE2 1 
ATOM   1134 C CE3 . TRP A 1 148 ? -6.293  23.693 -11.034 1.00 125.10 ? 232 TRP A CE3 1 
ATOM   1135 C CZ2 . TRP A 1 148 ? -3.799  24.032 -9.741  1.00 127.26 ? 232 TRP A CZ2 1 
ATOM   1136 C CZ3 . TRP A 1 148 ? -5.639  22.634 -10.437 1.00 125.36 ? 232 TRP A CZ3 1 
ATOM   1137 C CH2 . TRP A 1 148 ? -4.403  22.810 -9.799  1.00 126.15 ? 232 TRP A CH2 1 
ATOM   1138 N N   . LYS A 1 149 ? -9.118  26.081 -14.765 1.00 126.71 ? 233 LYS A N   1 
ATOM   1139 C CA  . LYS A 1 149 ? -10.397 26.180 -15.466 1.00 124.22 ? 233 LYS A CA  1 
ATOM   1140 C C   . LYS A 1 149 ? -11.450 25.332 -14.768 1.00 122.57 ? 233 LYS A C   1 
ATOM   1141 O O   . LYS A 1 149 ? -11.137 24.278 -14.213 1.00 122.08 ? 233 LYS A O   1 
ATOM   1142 C CB  . LYS A 1 149 ? -10.236 25.751 -16.931 1.00 124.02 ? 233 LYS A CB  1 
ATOM   1143 C CG  . LYS A 1 149 ? -11.522 25.351 -17.646 1.00 124.23 ? 233 LYS A CG  1 
ATOM   1144 C CD  . LYS A 1 149 ? -11.673 23.832 -17.705 1.00 125.94 ? 233 LYS A CD  1 
ATOM   1145 C CE  . LYS A 1 149 ? -12.837 23.414 -18.592 1.00 128.55 ? 233 LYS A CE  1 
ATOM   1146 N NZ  . LYS A 1 149 ? -13.068 21.941 -18.551 1.00 127.62 ? 233 LYS A NZ  1 
ATOM   1147 N N   . SER A 1 150 ? -12.693 25.807 -14.777 1.00 122.19 ? 234 SER A N   1 
ATOM   1148 C CA  . SER A 1 150 ? -13.809 25.031 -14.252 1.00 120.82 ? 234 SER A CA  1 
ATOM   1149 C C   . SER A 1 150 ? -15.003 25.074 -15.192 1.00 120.04 ? 234 SER A C   1 
ATOM   1150 O O   . SER A 1 150 ? -15.294 26.104 -15.803 1.00 118.08 ? 234 SER A O   1 
ATOM   1151 C CB  . SER A 1 150 ? -14.220 25.518 -12.870 1.00 119.29 ? 234 SER A CB  1 
ATOM   1152 O OG  . SER A 1 150 ? -15.298 24.739 -12.389 1.00 119.13 ? 234 SER A OG  1 
ATOM   1153 N N   . ASP A 1 151 ? -15.692 23.941 -15.299 1.00 122.15 ? 235 ASP A N   1 
ATOM   1154 C CA  . ASP A 1 151 ? -16.835 23.817 -16.194 1.00 121.67 ? 235 ASP A CA  1 
ATOM   1155 C C   . ASP A 1 151 ? -18.131 23.745 -15.393 1.00 119.40 ? 235 ASP A C   1 
ATOM   1156 O O   . ASP A 1 151 ? -19.220 23.976 -15.917 1.00 116.10 ? 235 ASP A O   1 
ATOM   1157 C CB  . ASP A 1 151 ? -16.682 22.577 -17.077 1.00 123.16 ? 235 ASP A CB  1 
ATOM   1158 C CG  . ASP A 1 151 ? -16.978 22.866 -18.535 1.00 127.11 ? 235 ASP A CG  1 
ATOM   1159 O OD1 . ASP A 1 151 ? -17.816 23.759 -18.796 1.00 125.56 ? 235 ASP A OD1 1 
ATOM   1160 O OD2 . ASP A 1 151 ? -16.371 22.210 -19.416 1.00 128.10 ? 235 ASP A OD2 1 
ATOM   1161 N N   . ASP A 1 152 ? -17.993 23.437 -14.109 1.00 119.29 ? 236 ASP A N   1 
ATOM   1162 C CA  . ASP A 1 152 ? -19.133 23.294 -13.218 1.00 118.48 ? 236 ASP A CA  1 
ATOM   1163 C C   . ASP A 1 152 ? -19.307 24.495 -12.289 1.00 119.41 ? 236 ASP A C   1 
ATOM   1164 O O   . ASP A 1 152 ? -19.784 24.336 -11.161 1.00 118.18 ? 236 ASP A O   1 
ATOM   1165 C CB  . ASP A 1 152 ? -18.960 22.037 -12.376 1.00 117.88 ? 236 ASP A CB  1 
ATOM   1166 C CG  . ASP A 1 152 ? -17.580 21.944 -11.755 1.00 119.88 ? 236 ASP A CG  1 
ATOM   1167 O OD1 . ASP A 1 152 ? -16.819 22.931 -11.823 1.00 119.50 ? 236 ASP A OD1 1 
ATOM   1168 O OD2 . ASP A 1 152 ? -17.255 20.880 -11.195 1.00 122.84 ? 236 ASP A OD2 1 
ATOM   1169 N N   . PHE A 1 153 ? -18.915 25.680 -12.759 1.00 117.65 ? 237 PHE A N   1 
ATOM   1170 C CA  . PHE A 1 153 ? -19.008 26.910 -11.969 1.00 113.75 ? 237 PHE A CA  1 
ATOM   1171 C C   . PHE A 1 153 ? -18.278 26.785 -10.632 1.00 113.69 ? 237 PHE A C   1 
ATOM   1172 O O   . PHE A 1 153 ? -18.841 27.069 -9.576  1.00 111.47 ? 237 PHE A O   1 
ATOM   1173 C CB  . PHE A 1 153 ? -20.473 27.307 -11.756 1.00 113.76 ? 237 PHE A CB  1 
ATOM   1174 C CG  . PHE A 1 153 ? -20.665 28.728 -11.311 1.00 112.37 ? 237 PHE A CG  1 
ATOM   1175 C CD1 . PHE A 1 153 ? -20.373 29.776 -12.167 1.00 113.01 ? 237 PHE A CD1 1 
ATOM   1176 C CD2 . PHE A 1 153 ? -21.165 29.017 -10.048 1.00 110.90 ? 237 PHE A CD2 1 
ATOM   1177 C CE1 . PHE A 1 153 ? -20.555 31.091 -11.767 1.00 113.07 ? 237 PHE A CE1 1 
ATOM   1178 C CE2 . PHE A 1 153 ? -21.356 30.330 -9.641  1.00 109.11 ? 237 PHE A CE2 1 
ATOM   1179 C CZ  . PHE A 1 153 ? -21.053 31.369 -10.503 1.00 109.53 ? 237 PHE A CZ  1 
ATOM   1180 N N   . GLY A 1 154 ? -17.032 26.322 -10.690 1.00 116.71 ? 238 GLY A N   1 
ATOM   1181 C CA  . GLY A 1 154 ? -16.123 26.377 -9.556  1.00 115.37 ? 238 GLY A CA  1 
ATOM   1182 C C   . GLY A 1 154 ? -16.131 25.223 -8.572  1.00 116.20 ? 238 GLY A C   1 
ATOM   1183 O O   . GLY A 1 154 ? -15.543 25.335 -7.495  1.00 113.93 ? 238 GLY A O   1 
ATOM   1184 N N   . GLN A 1 155 ? -16.786 24.119 -8.927  1.00 119.32 ? 239 GLN A N   1 
ATOM   1185 C CA  . GLN A 1 155 ? -16.847 22.953 -8.040  1.00 119.93 ? 239 GLN A CA  1 
ATOM   1186 C C   . GLN A 1 155 ? -15.627 22.055 -8.220  1.00 121.54 ? 239 GLN A C   1 
ATOM   1187 O O   . GLN A 1 155 ? -15.057 21.540 -7.254  1.00 122.41 ? 239 GLN A O   1 
ATOM   1188 C CB  . GLN A 1 155 ? -18.113 22.135 -8.292  1.00 117.93 ? 239 GLN A CB  1 
ATOM   1189 C CG  . GLN A 1 155 ? -19.377 22.946 -8.476  1.00 118.08 ? 239 GLN A CG  1 
ATOM   1190 C CD  . GLN A 1 155 ? -20.629 22.112 -8.268  1.00 119.82 ? 239 GLN A CD  1 
ATOM   1191 O OE1 . GLN A 1 155 ? -20.631 21.163 -7.481  1.00 120.71 ? 239 GLN A OE1 1 
ATOM   1192 N NE2 . GLN A 1 155 ? -21.699 22.457 -8.978  1.00 115.67 ? 239 GLN A NE2 1 
ATOM   1193 N N   . THR A 1 156 ? -15.243 21.853 -9.472  1.00 119.50 ? 240 THR A N   1 
ATOM   1194 C CA  . THR A 1 156 ? -14.048 21.091 -9.780  1.00 120.89 ? 240 THR A CA  1 
ATOM   1195 C C   . THR A 1 156 ? -13.149 21.915 -10.690 1.00 122.89 ? 240 THR A C   1 
ATOM   1196 O O   . THR A 1 156 ? -13.622 22.767 -11.443 1.00 122.63 ? 240 THR A O   1 
ATOM   1197 C CB  . THR A 1 156 ? -14.395 19.761 -10.454 1.00 120.51 ? 240 THR A CB  1 
ATOM   1198 O OG1 . THR A 1 156 ? -15.119 20.011 -11.668 1.00 119.70 ? 240 THR A OG1 1 
ATOM   1199 C CG2 . THR A 1 156 ? -15.245 18.912 -9.520  1.00 118.80 ? 240 THR A CG2 1 
ATOM   1200 N N   . TRP A 1 157 ? -11.849 21.663 -10.616 1.00 123.08 ? 241 TRP A N   1 
ATOM   1201 C CA  . TRP A 1 157 ? -10.899 22.430 -11.401 1.00 123.14 ? 241 TRP A CA  1 
ATOM   1202 C C   . TRP A 1 157 ? -9.847  21.560 -12.079 1.00 124.93 ? 241 TRP A C   1 
ATOM   1203 O O   . TRP A 1 157 ? -9.531  20.461 -11.616 1.00 125.81 ? 241 TRP A O   1 
ATOM   1204 C CB  . TRP A 1 157 ? -10.207 23.459 -10.510 1.00 125.32 ? 241 TRP A CB  1 
ATOM   1205 C CG  . TRP A 1 157 ? -11.117 24.529 -9.994  1.00 124.99 ? 241 TRP A CG  1 
ATOM   1206 C CD1 . TRP A 1 157 ? -11.882 24.479 -8.866  1.00 124.95 ? 241 TRP A CD1 1 
ATOM   1207 C CD2 . TRP A 1 157 ? -11.345 25.821 -10.578 1.00 123.48 ? 241 TRP A CD2 1 
ATOM   1208 N NE1 . TRP A 1 157 ? -12.576 25.658 -8.714  1.00 125.12 ? 241 TRP A NE1 1 
ATOM   1209 C CE2 . TRP A 1 157 ? -12.262 26.498 -9.751  1.00 122.79 ? 241 TRP A CE2 1 
ATOM   1210 C CE3 . TRP A 1 157 ? -10.862 26.468 -11.718 1.00 122.98 ? 241 TRP A CE3 1 
ATOM   1211 C CZ2 . TRP A 1 157 ? -12.709 27.789 -10.030 1.00 119.78 ? 241 TRP A CZ2 1 
ATOM   1212 C CZ3 . TRP A 1 157 ? -11.305 27.750 -11.994 1.00 121.78 ? 241 TRP A CZ3 1 
ATOM   1213 C CH2 . TRP A 1 157 ? -12.217 28.395 -11.153 1.00 120.61 ? 241 TRP A CH2 1 
ATOM   1214 N N   . ILE A 1 158 ? -9.315  22.063 -13.188 1.00 125.10 ? 242 ILE A N   1 
ATOM   1215 C CA  . ILE A 1 158 ? -8.131  21.485 -13.814 1.00 125.92 ? 242 ILE A CA  1 
ATOM   1216 C C   . ILE A 1 158 ? -7.154  22.592 -14.195 1.00 125.81 ? 242 ILE A C   1 
ATOM   1217 O O   . ILE A 1 158 ? -7.557  23.717 -14.481 1.00 125.90 ? 242 ILE A O   1 
ATOM   1218 C CB  . ILE A 1 158 ? -8.473  20.666 -15.073 1.00 125.59 ? 242 ILE A CB  1 
ATOM   1219 C CG1 . ILE A 1 158 ? -9.102  21.556 -16.142 1.00 125.37 ? 242 ILE A CG1 1 
ATOM   1220 C CG2 . ILE A 1 158 ? -9.390  19.508 -14.729 1.00 126.28 ? 242 ILE A CG2 1 
ATOM   1221 C CD1 . ILE A 1 158 ? -9.340  20.845 -17.442 1.00 126.98 ? 242 ILE A CD1 1 
ATOM   1222 N N   . MET A 1 159 ? -5.866  22.273 -14.195 1.00 126.63 ? 243 MET A N   1 
ATOM   1223 C CA  . MET A 1 159 ? -4.848  23.259 -14.533 1.00 128.13 ? 243 MET A CA  1 
ATOM   1224 C C   . MET A 1 159 ? -4.512  23.218 -16.016 1.00 130.17 ? 243 MET A C   1 
ATOM   1225 O O   . MET A 1 159 ? -4.207  22.156 -16.560 1.00 133.08 ? 243 MET A O   1 
ATOM   1226 C CB  . MET A 1 159 ? -3.596  23.019 -13.705 1.00 126.46 ? 243 MET A CB  1 
ATOM   1227 C CG  . MET A 1 159 ? -2.404  23.829 -14.149 1.00 128.96 ? 243 MET A CG  1 
ATOM   1228 S SD  . MET A 1 159 ? -1.082  23.608 -12.959 1.00 140.91 ? 243 MET A SD  1 
ATOM   1229 C CE  . MET A 1 159 ? -1.173  21.834 -12.702 1.00 132.52 ? 243 MET A CE  1 
ATOM   1230 N N   . ILE A 1 160 ? -4.556  24.375 -16.667 1.00 127.64 ? 244 ILE A N   1 
ATOM   1231 C CA  . ILE A 1 160 ? -4.397  24.426 -18.114 1.00 129.83 ? 244 ILE A CA  1 
ATOM   1232 C C   . ILE A 1 160 ? -3.120  25.118 -18.598 1.00 134.20 ? 244 ILE A C   1 
ATOM   1233 O O   . ILE A 1 160 ? -2.843  25.122 -19.801 1.00 136.64 ? 244 ILE A O   1 
ATOM   1234 C CB  . ILE A 1 160 ? -5.622  25.073 -18.791 1.00 131.03 ? 244 ILE A CB  1 
ATOM   1235 C CG1 . ILE A 1 160 ? -5.906  26.453 -18.196 1.00 129.67 ? 244 ILE A CG1 1 
ATOM   1236 C CG2 . ILE A 1 160 ? -6.837  24.185 -18.634 1.00 132.03 ? 244 ILE A CG2 1 
ATOM   1237 C CD1 . ILE A 1 160 ? -7.017  27.203 -18.912 1.00 130.26 ? 244 ILE A CD1 1 
ATOM   1238 N N   . GLN A 1 161 ? -2.351  25.695 -17.673 1.00 134.54 ? 245 GLN A N   1 
ATOM   1239 C CA  . GLN A 1 161 ? -1.101  26.384 -18.017 1.00 132.83 ? 245 GLN A CA  1 
ATOM   1240 C C   . GLN A 1 161 ? -0.289  26.787 -16.787 1.00 131.74 ? 245 GLN A C   1 
ATOM   1241 O O   . GLN A 1 161 ? -0.825  26.918 -15.684 1.00 129.51 ? 245 GLN A O   1 
ATOM   1242 C CB  . GLN A 1 161 ? -1.369  27.621 -18.883 1.00 132.86 ? 245 GLN A CB  1 
ATOM   1243 C CG  . GLN A 1 161 ? -0.185  28.051 -19.749 1.00 139.50 ? 245 GLN A CG  1 
ATOM   1244 C CD  . GLN A 1 161 ? 0.181   27.026 -20.816 1.00 142.36 ? 245 GLN A CD  1 
ATOM   1245 O OE1 . GLN A 1 161 ? 1.339   26.927 -21.231 1.00 144.25 ? 245 GLN A OE1 1 
ATOM   1246 N NE2 . GLN A 1 161 ? -0.810  26.266 -21.274 1.00 143.37 ? 245 GLN A NE2 1 
ATOM   1247 N N   . GLU A 1 162 ? 1.012   26.976 -16.993 1.00 133.93 ? 246 GLU A N   1 
ATOM   1248 C CA  . GLU A 1 162 ? 1.916   27.427 -15.941 1.00 132.19 ? 246 GLU A CA  1 
ATOM   1249 C C   . GLU A 1 162 ? 2.747   28.608 -16.420 1.00 131.64 ? 246 GLU A C   1 
ATOM   1250 O O   . GLU A 1 162 ? 2.847   28.858 -17.625 1.00 131.32 ? 246 GLU A O   1 
ATOM   1251 C CB  . GLU A 1 162 ? 2.827   26.288 -15.479 1.00 128.84 ? 246 GLU A CB  1 
ATOM   1252 C CG  . GLU A 1 162 ? 2.238   25.445 -14.364 1.00 130.99 ? 246 GLU A CG  1 
ATOM   1253 C CD  . GLU A 1 162 ? 2.689   24.005 -14.432 1.00 134.04 ? 246 GLU A CD  1 
ATOM   1254 O OE1 . GLU A 1 162 ? 3.134   23.581 -15.520 1.00 136.05 ? 246 GLU A OE1 1 
ATOM   1255 O OE2 . GLU A 1 162 ? 2.598   23.297 -13.404 1.00 132.93 ? 246 GLU A OE2 1 
ATOM   1256 N N   . HIS A 1 163 ? 3.330   29.327 -15.465 1.00 130.86 ? 247 HIS A N   1 
ATOM   1257 C CA  . HIS A 1 163 ? 4.163   30.495 -15.747 1.00 133.09 ? 247 HIS A CA  1 
ATOM   1258 C C   . HIS A 1 163 ? 3.423   31.537 -16.590 1.00 136.28 ? 247 HIS A C   1 
ATOM   1259 O O   . HIS A 1 163 ? 3.915   31.963 -17.634 1.00 137.67 ? 247 HIS A O   1 
ATOM   1260 C CB  . HIS A 1 163 ? 5.476   30.079 -16.426 1.00 132.56 ? 247 HIS A CB  1 
ATOM   1261 C CG  . HIS A 1 163 ? 6.105   28.858 -15.830 1.00 127.11 ? 247 HIS A CG  1 
ATOM   1262 N ND1 . HIS A 1 163 ? 6.514   28.797 -14.515 1.00 127.91 ? 247 HIS A ND1 1 
ATOM   1263 C CD2 . HIS A 1 163 ? 6.388   27.649 -16.368 1.00 122.75 ? 247 HIS A CD2 1 
ATOM   1264 C CE1 . HIS A 1 163 ? 7.021   27.603 -14.268 1.00 128.65 ? 247 HIS A CE1 1 
ATOM   1265 N NE2 . HIS A 1 163 ? 6.955   26.886 -15.376 1.00 126.34 ? 247 HIS A NE2 1 
ATOM   1266 N N   . VAL A 1 164 ? 2.242   31.944 -16.129 1.00 136.51 ? 248 VAL A N   1 
ATOM   1267 C CA  . VAL A 1 164 ? 1.427   32.917 -16.855 1.00 135.71 ? 248 VAL A CA  1 
ATOM   1268 C C   . VAL A 1 164 ? 1.534   34.315 -16.243 1.00 134.57 ? 248 VAL A C   1 
ATOM   1269 O O   . VAL A 1 164 ? 1.497   34.474 -15.023 1.00 134.37 ? 248 VAL A O   1 
ATOM   1270 C CB  . VAL A 1 164 ? -0.053  32.488 -16.895 1.00 134.07 ? 248 VAL A CB  1 
ATOM   1271 C CG1 . VAL A 1 164 ? -0.826  33.344 -17.887 1.00 133.74 ? 248 VAL A CG1 1 
ATOM   1272 C CG2 . VAL A 1 164 ? -0.166  31.017 -17.263 1.00 132.55 ? 248 VAL A CG2 1 
ATOM   1273 N N   . LYS A 1 165 ? 1.674   35.323 -17.101 1.00 135.08 ? 249 LYS A N   1 
ATOM   1274 C CA  . LYS A 1 165 ? 1.811   36.712 -16.662 1.00 134.80 ? 249 LYS A CA  1 
ATOM   1275 C C   . LYS A 1 165 ? 0.461   37.417 -16.620 1.00 133.44 ? 249 LYS A C   1 
ATOM   1276 O O   . LYS A 1 165 ? 0.125   38.078 -15.636 1.00 130.44 ? 249 LYS A O   1 
ATOM   1277 C CB  . LYS A 1 165 ? 2.768   37.473 -17.586 1.00 134.97 ? 249 LYS A CB  1 
ATOM   1278 C CG  . LYS A 1 165 ? 2.829   38.974 -17.338 1.00 133.03 ? 249 LYS A CG  1 
ATOM   1279 C CD  . LYS A 1 165 ? 3.871   39.637 -18.224 1.00 135.55 ? 249 LYS A CD  1 
ATOM   1280 C CE  . LYS A 1 165 ? 3.879   41.145 -18.044 1.00 133.49 ? 249 LYS A CE  1 
ATOM   1281 N NZ  . LYS A 1 165 ? 2.653   41.765 -18.612 1.00 134.15 ? 249 LYS A NZ  1 
ATOM   1282 N N   . SER A 1 166 ? -0.302  37.278 -17.701 1.00 133.31 ? 250 SER A N   1 
ATOM   1283 C CA  . SER A 1 166 ? -1.637  37.856 -17.798 1.00 130.43 ? 250 SER A CA  1 
ATOM   1284 C C   . SER A 1 166 ? -2.530  36.936 -18.623 1.00 131.01 ? 250 SER A C   1 
ATOM   1285 O O   . SER A 1 166 ? -2.039  36.012 -19.266 1.00 132.98 ? 250 SER A O   1 
ATOM   1286 C CB  . SER A 1 166 ? -1.580  39.235 -18.445 1.00 129.23 ? 250 SER A CB  1 
ATOM   1287 O OG  . SER A 1 166 ? -1.273  39.126 -19.818 1.00 131.83 ? 250 SER A OG  1 
ATOM   1288 N N   . PHE A 1 167 ? -3.837  37.184 -18.596 1.00 133.04 ? 251 PHE A N   1 
ATOM   1289 C CA  . PHE A 1 167 ? -4.798  36.369 -19.344 1.00 130.98 ? 251 PHE A CA  1 
ATOM   1290 C C   . PHE A 1 167 ? -6.174  37.013 -19.441 1.00 128.59 ? 251 PHE A C   1 
ATOM   1291 O O   . PHE A 1 167 ? -6.503  37.909 -18.663 1.00 131.22 ? 251 PHE A O   1 
ATOM   1292 C CB  . PHE A 1 167 ? -4.940  34.979 -18.729 1.00 128.89 ? 251 PHE A CB  1 
ATOM   1293 C CG  . PHE A 1 167 ? -5.604  34.974 -17.389 1.00 127.70 ? 251 PHE A CG  1 
ATOM   1294 C CD1 . PHE A 1 167 ? -4.899  35.326 -16.249 1.00 130.49 ? 251 PHE A CD1 1 
ATOM   1295 C CD2 . PHE A 1 167 ? -6.929  34.597 -17.262 1.00 127.77 ? 251 PHE A CD2 1 
ATOM   1296 C CE1 . PHE A 1 167 ? -5.503  35.311 -15.007 1.00 130.77 ? 251 PHE A CE1 1 
ATOM   1297 C CE2 . PHE A 1 167 ? -7.543  34.579 -16.022 1.00 127.20 ? 251 PHE A CE2 1 
ATOM   1298 C CZ  . PHE A 1 167 ? -6.828  34.937 -14.893 1.00 129.74 ? 251 PHE A CZ  1 
ATOM   1299 N N   . SER A 1 168 ? -6.972  36.547 -20.397 1.00 126.47 ? 252 SER A N   1 
ATOM   1300 C CA  . SER A 1 168 ? -8.329  37.052 -20.585 1.00 127.77 ? 252 SER A CA  1 
ATOM   1301 C C   . SER A 1 168 ? -9.128  36.112 -21.476 1.00 126.48 ? 252 SER A C   1 
ATOM   1302 O O   . SER A 1 168 ? -8.568  35.209 -22.093 1.00 128.08 ? 252 SER A O   1 
ATOM   1303 C CB  . SER A 1 168 ? -8.316  38.460 -21.190 1.00 123.60 ? 252 SER A CB  1 
ATOM   1304 O OG  . SER A 1 168 ? -7.817  38.450 -22.513 1.00 122.72 ? 252 SER A OG  1 
ATOM   1305 N N   . TRP A 1 169 ? -10.439 36.317 -21.530 1.00 125.34 ? 253 TRP A N   1 
ATOM   1306 C CA  . TRP A 1 169 ? -11.274 35.578 -22.463 1.00 123.44 ? 253 TRP A CA  1 
ATOM   1307 C C   . TRP A 1 169 ? -11.208 36.266 -23.811 1.00 124.85 ? 253 TRP A C   1 
ATOM   1308 O O   . TRP A 1 169 ? -10.783 37.416 -23.908 1.00 126.40 ? 253 TRP A O   1 
ATOM   1309 C CB  . TRP A 1 169 ? -12.723 35.519 -21.979 1.00 121.81 ? 253 TRP A CB  1 
ATOM   1310 C CG  . TRP A 1 169 ? -12.921 34.641 -20.788 1.00 118.72 ? 253 TRP A CG  1 
ATOM   1311 C CD1 . TRP A 1 169 ? -13.097 35.040 -19.495 1.00 117.42 ? 253 TRP A CD1 1 
ATOM   1312 C CD2 . TRP A 1 169 ? -12.957 33.210 -20.775 1.00 118.37 ? 253 TRP A CD2 1 
ATOM   1313 N NE1 . TRP A 1 169 ? -13.238 33.946 -18.677 1.00 115.28 ? 253 TRP A NE1 1 
ATOM   1314 C CE2 . TRP A 1 169 ? -13.156 32.810 -19.439 1.00 117.73 ? 253 TRP A CE2 1 
ATOM   1315 C CE3 . TRP A 1 169 ? -12.836 32.228 -21.763 1.00 121.40 ? 253 TRP A CE3 1 
ATOM   1316 C CZ2 . TRP A 1 169 ? -13.243 31.466 -19.066 1.00 118.79 ? 253 TRP A CZ2 1 
ATOM   1317 C CZ3 . TRP A 1 169 ? -12.918 30.894 -21.391 1.00 121.92 ? 253 TRP A CZ3 1 
ATOM   1318 C CH2 . TRP A 1 169 ? -13.119 30.527 -20.053 1.00 119.66 ? 253 TRP A CH2 1 
ATOM   1319 N N   . GLY A 1 170 ? -11.625 35.562 -24.854 1.00 126.59 ? 254 GLY A N   1 
ATOM   1320 C CA  . GLY A 1 170 ? -11.731 36.170 -26.163 1.00 130.21 ? 254 GLY A CA  1 
ATOM   1321 C C   . GLY A 1 170 ? -12.852 37.187 -26.134 1.00 131.62 ? 254 GLY A C   1 
ATOM   1322 O O   . GLY A 1 170 ? -13.591 37.278 -25.156 1.00 131.03 ? 254 GLY A O   1 
ATOM   1323 N N   . ILE A 1 171 ? -12.983 37.960 -27.204 1.00 133.95 ? 255 ILE A N   1 
ATOM   1324 C CA  . ILE A 1 171 ? -14.055 38.940 -27.286 1.00 135.53 ? 255 ILE A CA  1 
ATOM   1325 C C   . ILE A 1 171 ? -14.973 38.658 -28.474 1.00 139.45 ? 255 ILE A C   1 
ATOM   1326 O O   . ILE A 1 171 ? -14.589 38.856 -29.629 1.00 141.80 ? 255 ILE A O   1 
ATOM   1327 C CB  . ILE A 1 171 ? -13.502 40.376 -27.366 1.00 136.91 ? 255 ILE A CB  1 
ATOM   1328 C CG1 . ILE A 1 171 ? -12.654 40.686 -26.128 1.00 135.77 ? 255 ILE A CG1 1 
ATOM   1329 C CG2 . ILE A 1 171 ? -14.634 41.383 -27.508 1.00 135.97 ? 255 ILE A CG2 1 
ATOM   1330 C CD1 . ILE A 1 171 ? -12.085 42.092 -26.110 1.00 137.44 ? 255 ILE A CD1 1 
ATOM   1331 N N   . ASP A 1 172 ? -16.182 38.189 -28.176 1.00 139.60 ? 256 ASP A N   1 
ATOM   1332 C CA  . ASP A 1 172 ? -17.190 37.889 -29.192 1.00 140.69 ? 256 ASP A CA  1 
ATOM   1333 C C   . ASP A 1 172 ? -17.625 39.168 -29.921 1.00 139.20 ? 256 ASP A C   1 
ATOM   1334 O O   . ASP A 1 172 ? -17.798 40.211 -29.293 1.00 133.12 ? 256 ASP A O   1 
ATOM   1335 C CB  . ASP A 1 172 ? -18.393 37.206 -28.532 1.00 141.40 ? 256 ASP A CB  1 
ATOM   1336 C CG  . ASP A 1 172 ? -19.189 36.350 -29.500 1.00 145.65 ? 256 ASP A CG  1 
ATOM   1337 O OD1 . ASP A 1 172 ? -18.695 35.263 -29.882 1.00 144.93 ? 256 ASP A OD1 1 
ATOM   1338 O OD2 . ASP A 1 172 ? -20.312 36.762 -29.872 1.00 148.66 ? 256 ASP A OD2 1 
ATOM   1339 N N   . PRO A 1 173 ? -17.811 39.091 -31.253 1.00 141.99 ? 257 PRO A N   1 
ATOM   1340 C CA  . PRO A 1 173 ? -17.738 37.894 -32.097 1.00 140.70 ? 257 PRO A CA  1 
ATOM   1341 C C   . PRO A 1 173 ? -16.346 37.666 -32.655 1.00 140.18 ? 257 PRO A C   1 
ATOM   1342 O O   . PRO A 1 173 ? -16.103 36.633 -33.276 1.00 142.53 ? 257 PRO A O   1 
ATOM   1343 C CB  . PRO A 1 173 ? -18.661 38.258 -33.253 1.00 139.73 ? 257 PRO A CB  1 
ATOM   1344 C CG  . PRO A 1 173 ? -18.396 39.719 -33.443 1.00 138.39 ? 257 PRO A CG  1 
ATOM   1345 C CD  . PRO A 1 173 ? -18.167 40.282 -32.048 1.00 139.43 ? 257 PRO A CD  1 
ATOM   1346 N N   . TYR A 1 174 ? -15.460 38.632 -32.438 1.00 140.60 ? 258 TYR A N   1 
ATOM   1347 C CA  . TYR A 1 174 ? -14.145 38.657 -33.062 1.00 142.29 ? 258 TYR A CA  1 
ATOM   1348 C C   . TYR A 1 174 ? -13.405 37.341 -32.855 1.00 143.18 ? 258 TYR A C   1 
ATOM   1349 O O   . TYR A 1 174 ? -12.943 36.717 -33.812 1.00 143.79 ? 258 TYR A O   1 
ATOM   1350 C CB  . TYR A 1 174 ? -13.344 39.840 -32.524 1.00 141.17 ? 258 TYR A CB  1 
ATOM   1351 C CG  . TYR A 1 174 ? -14.112 41.140 -32.590 1.00 140.13 ? 258 TYR A CG  1 
ATOM   1352 C CD1 . TYR A 1 174 ? -14.819 41.493 -33.732 1.00 139.93 ? 258 TYR A CD1 1 
ATOM   1353 C CD2 . TYR A 1 174 ? -14.149 42.005 -31.504 1.00 142.14 ? 258 TYR A CD2 1 
ATOM   1354 C CE1 . TYR A 1 174 ? -15.531 42.679 -33.798 1.00 142.68 ? 258 TYR A CE1 1 
ATOM   1355 C CE2 . TYR A 1 174 ? -14.859 43.197 -31.559 1.00 142.06 ? 258 TYR A CE2 1 
ATOM   1356 C CZ  . TYR A 1 174 ? -15.549 43.527 -32.708 1.00 142.37 ? 258 TYR A CZ  1 
ATOM   1357 O OH  . TYR A 1 174 ? -16.257 44.706 -32.768 1.00 140.57 ? 258 TYR A OH  1 
ATOM   1358 N N   . ASP A 1 175 ? -13.326 36.902 -31.607 1.00 141.28 ? 259 ASP A N   1 
ATOM   1359 C CA  . ASP A 1 175 ? -12.696 35.629 -31.312 1.00 142.13 ? 259 ASP A CA  1 
ATOM   1360 C C   . ASP A 1 175 ? -13.754 34.561 -31.116 1.00 142.26 ? 259 ASP A C   1 
ATOM   1361 O O   . ASP A 1 175 ? -14.795 34.811 -30.508 1.00 142.17 ? 259 ASP A O   1 
ATOM   1362 C CB  . ASP A 1 175 ? -11.810 35.745 -30.073 1.00 142.27 ? 259 ASP A CB  1 
ATOM   1363 C CG  . ASP A 1 175 ? -10.787 36.854 -30.200 1.00 144.94 ? 259 ASP A CG  1 
ATOM   1364 O OD1 . ASP A 1 175 ? -9.797  36.657 -30.937 1.00 146.90 ? 259 ASP A OD1 1 
ATOM   1365 O OD2 . ASP A 1 175 ? -10.973 37.925 -29.574 1.00 144.01 ? 259 ASP A OD2 1 
ATOM   1366 N N   . LYS A 1 176 ? -13.479 33.373 -31.645 1.00 142.72 ? 260 LYS A N   1 
ATOM   1367 C CA  . LYS A 1 176 ? -14.375 32.232 -31.518 1.00 144.10 ? 260 LYS A CA  1 
ATOM   1368 C C   . LYS A 1 176 ? -14.634 31.946 -30.045 1.00 143.11 ? 260 LYS A C   1 
ATOM   1369 O O   . LYS A 1 176 ? -13.862 32.368 -29.187 1.00 141.83 ? 260 LYS A O   1 
ATOM   1370 C CB  . LYS A 1 176 ? -13.744 31.004 -32.181 1.00 148.01 ? 260 LYS A CB  1 
ATOM   1371 C CG  . LYS A 1 176 ? -13.196 31.255 -33.581 1.00 150.07 ? 260 LYS A CG  1 
ATOM   1372 C CD  . LYS A 1 176 ? -12.151 30.211 -33.956 1.00 153.93 ? 260 LYS A CD  1 
ATOM   1373 C CE  . LYS A 1 176 ? -11.453 30.567 -35.259 1.00 159.10 ? 260 LYS A CE  1 
ATOM   1374 N NZ  . LYS A 1 176 ? -10.323 29.642 -35.559 1.00 162.77 ? 260 LYS A NZ  1 
ATOM   1375 N N   . PRO A 1 177 ? -15.736 31.244 -29.741 1.00 145.97 ? 261 PRO A N   1 
ATOM   1376 C CA  . PRO A 1 177 ? -15.993 30.817 -28.361 1.00 147.66 ? 261 PRO A CA  1 
ATOM   1377 C C   . PRO A 1 177 ? -14.811 30.049 -27.761 1.00 144.30 ? 261 PRO A C   1 
ATOM   1378 O O   . PRO A 1 177 ? -14.053 29.418 -28.499 1.00 144.36 ? 261 PRO A O   1 
ATOM   1379 C CB  . PRO A 1 177 ? -17.210 29.902 -28.510 1.00 148.42 ? 261 PRO A CB  1 
ATOM   1380 C CG  . PRO A 1 177 ? -17.944 30.476 -29.675 1.00 147.01 ? 261 PRO A CG  1 
ATOM   1381 C CD  . PRO A 1 177 ? -16.878 30.956 -30.628 1.00 146.76 ? 261 PRO A CD  1 
ATOM   1382 N N   . ASN A 1 178 ? -14.659 30.135 -26.441 1.00 141.69 ? 262 ASN A N   1 
ATOM   1383 C CA  . ASN A 1 178 ? -13.588 29.454 -25.703 1.00 140.31 ? 262 ASN A CA  1 
ATOM   1384 C C   . ASN A 1 178 ? -12.176 29.995 -25.940 1.00 138.74 ? 262 ASN A C   1 
ATOM   1385 O O   . ASN A 1 178 ? -11.213 29.489 -25.363 1.00 137.60 ? 262 ASN A O   1 
ATOM   1386 C CB  . ASN A 1 178 ? -13.623 27.938 -25.928 1.00 142.10 ? 262 ASN A CB  1 
ATOM   1387 C CG  . ASN A 1 178 ? -14.845 27.287 -25.317 1.00 145.46 ? 262 ASN A CG  1 
ATOM   1388 O OD1 . ASN A 1 178 ? -15.474 27.844 -24.418 1.00 146.97 ? 262 ASN A OD1 1 
ATOM   1389 N ND2 . ASN A 1 178 ? -15.187 26.096 -25.799 1.00 149.54 ? 262 ASN A ND2 1 
ATOM   1390 N N   . THR A 1 179 ? -12.060 31.018 -26.783 1.00 138.17 ? 263 THR A N   1 
ATOM   1391 C CA  . THR A 1 179 ? -10.780 31.671 -27.028 1.00 135.00 ? 263 THR A CA  1 
ATOM   1392 C C   . THR A 1 179 ? -10.209 32.190 -25.724 1.00 132.20 ? 263 THR A C   1 
ATOM   1393 O O   . THR A 1 179 ? -10.934 32.739 -24.896 1.00 130.90 ? 263 THR A O   1 
ATOM   1394 C CB  . THR A 1 179 ? -10.925 32.866 -27.987 1.00 137.60 ? 263 THR A CB  1 
ATOM   1395 O OG1 . THR A 1 179 ? -11.511 32.428 -29.217 1.00 141.69 ? 263 THR A OG1 1 
ATOM   1396 C CG2 . THR A 1 179 ? -9.569  33.500 -28.274 1.00 137.67 ? 263 THR A CG2 1 
ATOM   1397 N N   . ILE A 1 180 ? -8.911  31.996 -25.535 1.00 132.62 ? 264 ILE A N   1 
ATOM   1398 C CA  . ILE A 1 180 ? -8.221  32.540 -24.380 1.00 130.70 ? 264 ILE A CA  1 
ATOM   1399 C C   . ILE A 1 180 ? -6.916  33.165 -24.839 1.00 132.87 ? 264 ILE A C   1 
ATOM   1400 O O   . ILE A 1 180 ? -6.188  32.576 -25.627 1.00 137.02 ? 264 ILE A O   1 
ATOM   1401 C CB  . ILE A 1 180 ? -7.908  31.452 -23.339 1.00 130.09 ? 264 ILE A CB  1 
ATOM   1402 C CG1 . ILE A 1 180 ? -9.182  30.720 -22.922 1.00 129.80 ? 264 ILE A CG1 1 
ATOM   1403 C CG2 . ILE A 1 180 ? -7.236  32.062 -22.125 1.00 130.96 ? 264 ILE A CG2 1 
ATOM   1404 C CD1 . ILE A 1 180 ? -8.951  29.640 -21.899 1.00 131.21 ? 264 ILE A CD1 1 
ATOM   1405 N N   . TYR A 1 181 ? -6.631  34.369 -24.360 1.00 131.27 ? 265 TYR A N   1 
ATOM   1406 C CA  . TYR A 1 181 ? -5.347  35.003 -24.607 1.00 131.57 ? 265 TYR A CA  1 
ATOM   1407 C C   . TYR A 1 181 ? -4.547  34.997 -23.312 1.00 132.91 ? 265 TYR A C   1 
ATOM   1408 O O   . TYR A 1 181 ? -5.103  35.286 -22.258 1.00 132.35 ? 265 TYR A O   1 
ATOM   1409 C CB  . TYR A 1 181 ? -5.552  36.444 -25.066 1.00 131.09 ? 265 TYR A CB  1 
ATOM   1410 C CG  . TYR A 1 181 ? -6.143  36.589 -26.449 1.00 135.69 ? 265 TYR A CG  1 
ATOM   1411 C CD1 . TYR A 1 181 ? -7.516  36.499 -26.659 1.00 134.46 ? 265 TYR A CD1 1 
ATOM   1412 C CD2 . TYR A 1 181 ? -5.328  36.837 -27.545 1.00 137.97 ? 265 TYR A CD2 1 
ATOM   1413 C CE1 . TYR A 1 181 ? -8.056  36.645 -27.929 1.00 136.33 ? 265 TYR A CE1 1 
ATOM   1414 C CE2 . TYR A 1 181 ? -5.856  36.982 -28.813 1.00 139.66 ? 265 TYR A CE2 1 
ATOM   1415 C CZ  . TYR A 1 181 ? -7.217  36.887 -29.001 1.00 140.44 ? 265 TYR A CZ  1 
ATOM   1416 O OH  . TYR A 1 181 ? -7.725  37.037 -30.270 1.00 142.63 ? 265 TYR A OH  1 
ATOM   1417 N N   . ILE A 1 182 ? -3.258  34.653 -23.383 1.00 135.64 ? 266 ILE A N   1 
ATOM   1418 C CA  . ILE A 1 182 ? -2.367  34.725 -22.215 1.00 133.39 ? 266 ILE A CA  1 
ATOM   1419 C C   . ILE A 1 182 ? -0.963  35.247 -22.545 1.00 136.37 ? 266 ILE A C   1 
ATOM   1420 O O   . ILE A 1 182 ? -0.491  35.111 -23.669 1.00 139.21 ? 266 ILE A O   1 
ATOM   1421 C CB  . ILE A 1 182 ? -2.190  33.352 -21.510 1.00 130.67 ? 266 ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 182 ? -1.324  32.414 -22.347 1.00 133.64 ? 266 ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 182 ? -3.528  32.705 -21.198 1.00 134.03 ? 266 ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 182 ? -0.956  31.140 -21.623 1.00 136.06 ? 266 ILE A CD1 1 
ATOM   1425 N N   . GLU A 1 183 ? -0.306  35.845 -21.552 1.00 136.64 ? 267 GLU A N   1 
ATOM   1426 C CA  . GLU A 1 183 ? 1.124   36.136 -21.614 1.00 134.07 ? 267 GLU A CA  1 
ATOM   1427 C C   . GLU A 1 183 ? 1.860   35.096 -20.777 1.00 136.71 ? 267 GLU A C   1 
ATOM   1428 O O   . GLU A 1 183 ? 1.668   35.035 -19.564 1.00 134.90 ? 267 GLU A O   1 
ATOM   1429 C CB  . GLU A 1 183 ? 1.430   37.521 -21.041 1.00 131.77 ? 267 GLU A CB  1 
ATOM   1430 C CG  . GLU A 1 183 ? 1.046   38.698 -21.922 1.00 136.60 ? 267 GLU A CG  1 
ATOM   1431 C CD  . GLU A 1 183 ? 1.483   40.038 -21.332 1.00 138.17 ? 267 GLU A CD  1 
ATOM   1432 O OE1 . GLU A 1 183 ? 2.622   40.470 -21.607 1.00 139.52 ? 267 GLU A OE1 1 
ATOM   1433 O OE2 . GLU A 1 183 ? 0.690   40.663 -20.593 1.00 137.31 ? 267 GLU A OE2 1 
ATOM   1434 N N   . ARG A 1 184 ? 2.694   34.276 -21.411 1.00 140.18 ? 268 ARG A N   1 
ATOM   1435 C CA  . ARG A 1 184 ? 3.508   33.314 -20.670 1.00 139.76 ? 268 ARG A CA  1 
ATOM   1436 C C   . ARG A 1 184 ? 4.954   33.801 -20.506 1.00 142.04 ? 268 ARG A C   1 
ATOM   1437 O O   . ARG A 1 184 ? 5.585   34.242 -21.465 1.00 141.15 ? 268 ARG A O   1 
ATOM   1438 C CB  . ARG A 1 184 ? 3.470   31.942 -21.342 1.00 142.29 ? 268 ARG A CB  1 
ATOM   1439 C CG  . ARG A 1 184 ? 4.034   30.831 -20.474 1.00 144.58 ? 268 ARG A CG  1 
ATOM   1440 C CD  . ARG A 1 184 ? 3.824   29.457 -21.087 1.00 146.88 ? 268 ARG A CD  1 
ATOM   1441 N NE  . ARG A 1 184 ? 4.372   29.390 -22.437 1.00 151.01 ? 268 ARG A NE  1 
ATOM   1442 C CZ  . ARG A 1 184 ? 5.669   29.292 -22.714 1.00 153.18 ? 268 ARG A CZ  1 
ATOM   1443 N NH1 . ARG A 1 184 ? 6.559   29.248 -21.731 1.00 153.90 ? 268 ARG A NH1 1 
ATOM   1444 N NH2 . ARG A 1 184 ? 6.078   29.243 -23.975 1.00 153.06 ? 268 ARG A NH2 1 
ATOM   1445 N N   . HIS A 1 185 ? 5.467   33.712 -19.282 1.00 142.65 ? 269 HIS A N   1 
ATOM   1446 C CA  . HIS A 1 185 ? 6.789   34.232 -18.939 1.00 143.53 ? 269 HIS A CA  1 
ATOM   1447 C C   . HIS A 1 185 ? 7.927   33.567 -19.694 1.00 148.28 ? 269 HIS A C   1 
ATOM   1448 O O   . HIS A 1 185 ? 8.016   32.335 -19.767 1.00 149.66 ? 269 HIS A O   1 
ATOM   1449 C CB  . HIS A 1 185 ? 7.041   34.097 -17.438 1.00 141.33 ? 269 HIS A CB  1 
ATOM   1450 C CG  . HIS A 1 185 ? 6.310   35.104 -16.608 1.00 139.30 ? 269 HIS A CG  1 
ATOM   1451 N ND1 . HIS A 1 185 ? 6.452   36.462 -16.795 1.00 140.38 ? 269 HIS A ND1 1 
ATOM   1452 C CD2 . HIS A 1 185 ? 5.441   34.954 -15.580 1.00 137.90 ? 269 HIS A CD2 1 
ATOM   1453 C CE1 . HIS A 1 185 ? 5.698   37.104 -15.920 1.00 139.03 ? 269 HIS A CE1 1 
ATOM   1454 N NE2 . HIS A 1 185 ? 5.069   36.212 -15.176 1.00 138.82 ? 269 HIS A NE2 1 
ATOM   1455 N N   . GLU A 1 186 ? 8.809   34.399 -20.239 1.00 149.62 ? 270 GLU A N   1 
ATOM   1456 C CA  . GLU A 1 186 ? 10.013  33.914 -20.896 1.00 150.07 ? 270 GLU A CA  1 
ATOM   1457 C C   . GLU A 1 186 ? 11.229  34.133 -20.007 1.00 150.45 ? 270 GLU A C   1 
ATOM   1458 O O   . GLU A 1 186 ? 11.225  35.032 -19.160 1.00 150.04 ? 270 GLU A O   1 
ATOM   1459 C CB  . GLU A 1 186 ? 10.191  34.600 -22.253 1.00 149.24 ? 270 GLU A CB  1 
ATOM   1460 C CG  . GLU A 1 186 ? 9.067   34.313 -23.251 1.00 149.26 ? 270 GLU A CG  1 
ATOM   1461 C CD  . GLU A 1 186 ? 8.910   32.831 -23.583 1.00 149.75 ? 270 GLU A CD  1 
ATOM   1462 O OE1 . GLU A 1 186 ? 9.739   32.010 -23.133 1.00 149.54 ? 270 GLU A OE1 1 
ATOM   1463 O OE2 . GLU A 1 186 ? 7.948   32.483 -24.302 1.00 148.99 ? 270 GLU A OE2 1 
ATOM   1464 N N   . PRO A 1 187 ? 12.276  33.297 -20.197 1.00 150.34 ? 271 PRO A N   1 
ATOM   1465 C CA  . PRO A 1 187 ? 13.451  33.437 -19.327 1.00 149.24 ? 271 PRO A CA  1 
ATOM   1466 C C   . PRO A 1 187 ? 14.065  34.826 -19.436 1.00 146.45 ? 271 PRO A C   1 
ATOM   1467 O O   . PRO A 1 187 ? 14.673  35.308 -18.482 1.00 147.12 ? 271 PRO A O   1 
ATOM   1468 C CB  . PRO A 1 187 ? 14.416  32.368 -19.855 1.00 148.51 ? 271 PRO A CB  1 
ATOM   1469 C CG  . PRO A 1 187 ? 13.550  31.364 -20.546 1.00 153.02 ? 271 PRO A CG  1 
ATOM   1470 C CD  . PRO A 1 187 ? 12.442  32.187 -21.162 1.00 150.86 ? 271 PRO A CD  1 
ATOM   1471 N N   . SER A 1 188 ? 13.886  35.474 -20.581 1.00 145.28 ? 272 SER A N   1 
ATOM   1472 C CA  . SER A 1 188 ? 14.276  36.869 -20.725 1.00 146.71 ? 272 SER A CA  1 
ATOM   1473 C C   . SER A 1 188 ? 13.593  37.729 -19.660 1.00 149.25 ? 272 SER A C   1 
ATOM   1474 O O   . SER A 1 188 ? 14.059  38.817 -19.331 1.00 148.03 ? 272 SER A O   1 
ATOM   1475 C CB  . SER A 1 188 ? 13.907  37.381 -22.116 1.00 146.50 ? 272 SER A CB  1 
ATOM   1476 O OG  . SER A 1 188 ? 12.507  37.328 -22.329 1.00 148.10 ? 272 SER A OG  1 
ATOM   1477 N N   . GLY A 1 189 ? 12.488  37.230 -19.117 1.00 150.39 ? 273 GLY A N   1 
ATOM   1478 C CA  . GLY A 1 189 ? 11.689  37.995 -18.183 1.00 149.49 ? 273 GLY A CA  1 
ATOM   1479 C C   . GLY A 1 189 ? 10.550  38.617 -18.958 1.00 151.04 ? 273 GLY A C   1 
ATOM   1480 O O   . GLY A 1 189 ? 9.580   39.115 -18.387 1.00 154.66 ? 273 GLY A O   1 
ATOM   1481 N N   . TYR A 1 190 ? 10.686  38.585 -20.279 1.00 149.87 ? 274 TYR A N   1 
ATOM   1482 C CA  . TYR A 1 190 ? 9.626   39.007 -21.181 1.00 150.90 ? 274 TYR A CA  1 
ATOM   1483 C C   . TYR A 1 190 ? 8.603   37.892 -21.312 1.00 150.24 ? 274 TYR A C   1 
ATOM   1484 O O   . TYR A 1 190 ? 8.722   36.849 -20.663 1.00 148.77 ? 274 TYR A O   1 
ATOM   1485 C CB  . TYR A 1 190 ? 10.198  39.357 -22.555 1.00 150.03 ? 274 TYR A CB  1 
ATOM   1486 C CG  . TYR A 1 190 ? 10.845  40.715 -22.608 1.00 150.46 ? 274 TYR A CG  1 
ATOM   1487 C CD1 . TYR A 1 190 ? 10.394  41.685 -23.496 1.00 150.35 ? 274 TYR A CD1 1 
ATOM   1488 C CD2 . TYR A 1 190 ? 11.895  41.038 -21.756 1.00 153.00 ? 274 TYR A CD2 1 
ATOM   1489 C CE1 . TYR A 1 190 ? 10.979  42.937 -23.544 1.00 152.39 ? 274 TYR A CE1 1 
ATOM   1490 C CE2 . TYR A 1 190 ? 12.486  42.289 -21.793 1.00 155.14 ? 274 TYR A CE2 1 
ATOM   1491 C CZ  . TYR A 1 190 ? 12.024  43.235 -22.688 1.00 155.12 ? 274 TYR A CZ  1 
ATOM   1492 O OH  . TYR A 1 190 ? 12.608  44.480 -22.728 1.00 153.93 ? 274 TYR A OH  1 
ATOM   1493 N N   . SER A 1 191 ? 7.601   38.108 -22.158 1.00 147.87 ? 275 SER A N   1 
ATOM   1494 C CA  . SER A 1 191 ? 6.547   37.119 -22.332 1.00 147.57 ? 275 SER A CA  1 
ATOM   1495 C C   . SER A 1 191 ? 6.125   36.989 -23.794 1.00 147.18 ? 275 SER A C   1 
ATOM   1496 O O   . SER A 1 191 ? 6.368   37.887 -24.598 1.00 146.13 ? 275 SER A O   1 
ATOM   1497 C CB  . SER A 1 191 ? 5.347   37.463 -21.443 1.00 143.43 ? 275 SER A CB  1 
ATOM   1498 O OG  . SER A 1 191 ? 4.852   38.757 -21.734 1.00 143.49 ? 275 SER A OG  1 
ATOM   1499 N N   . THR A 1 192 ? 5.517   35.854 -24.134 1.00 146.90 ? 276 THR A N   1 
ATOM   1500 C CA  . THR A 1 192 ? 4.975   35.633 -25.474 1.00 146.78 ? 276 THR A CA  1 
ATOM   1501 C C   . THR A 1 192 ? 3.470   35.376 -25.411 1.00 145.70 ? 276 THR A C   1 
ATOM   1502 O O   . THR A 1 192 ? 3.004   34.544 -24.631 1.00 144.78 ? 276 THR A O   1 
ATOM   1503 C CB  . THR A 1 192 ? 5.657   34.442 -26.192 1.00 148.39 ? 276 THR A CB  1 
ATOM   1504 O OG1 . THR A 1 192 ? 5.462   33.236 -25.438 1.00 147.52 ? 276 THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 192 ? 7.150   34.701 -26.374 1.00 148.80 ? 276 THR A CG2 1 
ATOM   1506 N N   . VAL A 1 193 ? 2.704   36.077 -26.238 1.00 144.39 ? 277 VAL A N   1 
ATOM   1507 C CA  . VAL A 1 193 ? 1.251   35.980 -26.147 1.00 144.22 ? 277 VAL A CA  1 
ATOM   1508 C C   . VAL A 1 193 ? 0.666   34.812 -26.949 1.00 143.35 ? 277 VAL A C   1 
ATOM   1509 O O   . VAL A 1 193 ? 0.906   34.677 -28.148 1.00 144.50 ? 277 VAL A O   1 
ATOM   1510 C CB  . VAL A 1 193 ? 0.566   37.313 -26.525 1.00 142.68 ? 277 VAL A CB  1 
ATOM   1511 C CG1 . VAL A 1 193 ? -0.941  37.260 -26.208 1.00 143.11 ? 277 VAL A CG1 1 
ATOM   1512 C CG2 . VAL A 1 193 ? 1.247   38.473 -25.797 1.00 140.39 ? 277 VAL A CG2 1 
ATOM   1513 N N   . PHE A 1 194 ? -0.109  33.976 -26.265 1.00 143.27 ? 278 PHE A N   1 
ATOM   1514 C CA  . PHE A 1 194 ? -0.729  32.804 -26.875 1.00 144.71 ? 278 PHE A CA  1 
ATOM   1515 C C   . PHE A 1 194 ? -2.235  32.968 -27.080 1.00 142.02 ? 278 PHE A C   1 
ATOM   1516 O O   . PHE A 1 194 ? -2.866  33.837 -26.481 1.00 139.91 ? 278 PHE A O   1 
ATOM   1517 C CB  . PHE A 1 194 ? -0.473  31.565 -26.013 1.00 144.93 ? 278 PHE A CB  1 
ATOM   1518 C CG  . PHE A 1 194 ? 0.940   31.064 -26.070 1.00 145.79 ? 278 PHE A CG  1 
ATOM   1519 C CD1 . PHE A 1 194 ? 1.786   31.450 -27.096 1.00 145.18 ? 278 PHE A CD1 1 
ATOM   1520 C CD2 . PHE A 1 194 ? 1.420   30.194 -25.100 1.00 148.41 ? 278 PHE A CD2 1 
ATOM   1521 C CE1 . PHE A 1 194 ? 3.086   30.985 -27.150 1.00 147.13 ? 278 PHE A CE1 1 
ATOM   1522 C CE2 . PHE A 1 194 ? 2.717   29.724 -25.148 1.00 147.37 ? 278 PHE A CE2 1 
ATOM   1523 C CZ  . PHE A 1 194 ? 3.552   30.120 -26.174 1.00 149.04 ? 278 PHE A CZ  1 
ATOM   1524 N N   . ARG A 1 195 ? -2.799  32.119 -27.931 1.00 141.84 ? 279 ARG A N   1 
ATOM   1525 C CA  . ARG A 1 195 ? -4.240  32.065 -28.137 1.00 140.83 ? 279 ARG A CA  1 
ATOM   1526 C C   . ARG A 1 195 ? -4.678  30.643 -28.441 1.00 141.57 ? 279 ARG A C   1 
ATOM   1527 O O   . ARG A 1 195 ? -4.253  30.057 -29.431 1.00 144.58 ? 279 ARG A O   1 
ATOM   1528 C CB  . ARG A 1 195 ? -4.674  32.972 -29.286 1.00 139.04 ? 279 ARG A CB  1 
ATOM   1529 C CG  . ARG A 1 195 ? -6.142  32.808 -29.638 1.00 137.11 ? 279 ARG A CG  1 
ATOM   1530 C CD  . ARG A 1 195 ? -6.386  33.111 -31.093 1.00 136.16 ? 279 ARG A CD  1 
ATOM   1531 N NE  . ARG A 1 195 ? -5.904  34.440 -31.438 1.00 137.03 ? 279 ARG A NE  1 
ATOM   1532 C CZ  . ARG A 1 195 ? -5.822  34.900 -32.679 1.00 138.29 ? 279 ARG A CZ  1 
ATOM   1533 N NH1 . ARG A 1 195 ? -6.188  34.130 -33.692 1.00 138.80 ? 279 ARG A NH1 1 
ATOM   1534 N NH2 . ARG A 1 195 ? -5.370  36.124 -32.911 1.00 141.43 ? 279 ARG A NH2 1 
ATOM   1535 N N   . SER A 1 196 ? -5.536  30.091 -27.592 1.00 140.78 ? 280 SER A N   1 
ATOM   1536 C CA  . SER A 1 196 ? -6.036  28.741 -27.795 1.00 141.37 ? 280 SER A CA  1 
ATOM   1537 C C   . SER A 1 196 ? -7.543  28.701 -27.656 1.00 141.50 ? 280 SER A C   1 
ATOM   1538 O O   . SER A 1 196 ? -8.142  29.569 -27.026 1.00 141.93 ? 280 SER A O   1 
ATOM   1539 C CB  . SER A 1 196 ? -5.404  27.778 -26.794 1.00 143.82 ? 280 SER A CB  1 
ATOM   1540 O OG  . SER A 1 196 ? -6.006  26.499 -26.863 1.00 146.83 ? 280 SER A OG  1 
ATOM   1541 N N   . THR A 1 197 ? -8.155  27.691 -28.256 1.00 143.33 ? 281 THR A N   1 
ATOM   1542 C CA  . THR A 1 197 ? -9.581  27.476 -28.099 1.00 143.02 ? 281 THR A CA  1 
ATOM   1543 C C   . THR A 1 197 ? -9.789  26.126 -27.441 1.00 143.93 ? 281 THR A C   1 
ATOM   1544 O O   . THR A 1 197 ? -10.876 25.815 -26.964 1.00 145.87 ? 281 THR A O   1 
ATOM   1545 C CB  . THR A 1 197 ? -10.307 27.502 -29.447 1.00 141.47 ? 281 THR A CB  1 
ATOM   1546 O OG1 . THR A 1 197 ? -9.751  26.494 -30.299 1.00 147.27 ? 281 THR A OG1 1 
ATOM   1547 C CG2 . THR A 1 197 ? -10.156 28.864 -30.111 1.00 139.06 ? 281 THR A CG2 1 
ATOM   1548 N N   . ASP A 1 198 ? -8.733  25.323 -27.415 1.00 145.76 ? 282 ASP A N   1 
ATOM   1549 C CA  . ASP A 1 198 ? -8.804  24.005 -26.800 1.00 148.20 ? 282 ASP A CA  1 
ATOM   1550 C C   . ASP A 1 198 ? -8.368  24.054 -25.351 1.00 148.04 ? 282 ASP A C   1 
ATOM   1551 O O   . ASP A 1 198 ? -8.073  23.017 -24.751 1.00 148.60 ? 282 ASP A O   1 
ATOM   1552 C CB  . ASP A 1 198 ? -7.939  23.005 -27.559 1.00 151.73 ? 282 ASP A CB  1 
ATOM   1553 C CG  . ASP A 1 198 ? -8.690  22.325 -28.681 1.00 155.83 ? 282 ASP A CG  1 
ATOM   1554 O OD1 . ASP A 1 198 ? -9.541  22.987 -29.316 1.00 156.12 ? 282 ASP A OD1 1 
ATOM   1555 O OD2 . ASP A 1 198 ? -8.439  21.125 -28.922 1.00 157.38 ? 282 ASP A OD2 1 
ATOM   1556 N N   . PHE A 1 199 ? -8.338  25.265 -24.801 1.00 145.05 ? 283 PHE A N   1 
ATOM   1557 C CA  . PHE A 1 199 ? -7.865  25.500 -23.442 1.00 143.76 ? 283 PHE A CA  1 
ATOM   1558 C C   . PHE A 1 199 ? -6.464  24.928 -23.313 1.00 145.47 ? 283 PHE A C   1 
ATOM   1559 O O   . PHE A 1 199 ? -6.121  24.341 -22.284 1.00 144.80 ? 283 PHE A O   1 
ATOM   1560 C CB  . PHE A 1 199 ? -8.785  24.857 -22.393 1.00 142.79 ? 283 PHE A CB  1 
ATOM   1561 C CG  . PHE A 1 199 ? -10.194 25.402 -22.381 1.00 142.62 ? 283 PHE A CG  1 
ATOM   1562 C CD1 . PHE A 1 199 ? -10.558 26.479 -23.177 1.00 141.64 ? 283 PHE A CD1 1 
ATOM   1563 C CD2 . PHE A 1 199 ? -11.154 24.833 -21.558 1.00 138.92 ? 283 PHE A CD2 1 
ATOM   1564 C CE1 . PHE A 1 199 ? -11.850 26.967 -23.158 1.00 138.54 ? 283 PHE A CE1 1 
ATOM   1565 C CE2 . PHE A 1 199 ? -12.446 25.319 -21.534 1.00 136.19 ? 283 PHE A CE2 1 
ATOM   1566 C CZ  . PHE A 1 199 ? -12.794 26.388 -22.336 1.00 136.30 ? 283 PHE A CZ  1 
ATOM   1567 N N   . PHE A 1 200 ? -5.680  25.081 -24.380 1.00 147.57 ? 284 PHE A N   1 
ATOM   1568 C CA  . PHE A 1 200 ? -4.301  24.594 -24.445 1.00 148.41 ? 284 PHE A CA  1 
ATOM   1569 C C   . PHE A 1 200 ? -4.176  23.103 -24.174 1.00 148.80 ? 284 PHE A C   1 
ATOM   1570 O O   . PHE A 1 200 ? -3.371  22.668 -23.345 1.00 147.52 ? 284 PHE A O   1 
ATOM   1571 C CB  . PHE A 1 200 ? -3.408  25.391 -23.501 1.00 146.61 ? 284 PHE A CB  1 
ATOM   1572 C CG  . PHE A 1 200 ? -3.510  26.866 -23.701 1.00 146.93 ? 284 PHE A CG  1 
ATOM   1573 C CD1 . PHE A 1 200 ? -2.725  27.503 -24.645 1.00 148.17 ? 284 PHE A CD1 1 
ATOM   1574 C CD2 . PHE A 1 200 ? -4.409  27.617 -22.964 1.00 146.95 ? 284 PHE A CD2 1 
ATOM   1575 C CE1 . PHE A 1 200 ? -2.821  28.866 -24.841 1.00 148.02 ? 284 PHE A CE1 1 
ATOM   1576 C CE2 . PHE A 1 200 ? -4.514  28.980 -23.155 1.00 145.67 ? 284 PHE A CE2 1 
ATOM   1577 C CZ  . PHE A 1 200 ? -3.719  29.607 -24.095 1.00 146.45 ? 284 PHE A CZ  1 
ATOM   1578 N N   . GLN A 1 201 ? -4.997  22.330 -24.871 1.00 150.23 ? 285 GLN A N   1 
ATOM   1579 C CA  . GLN A 1 201 ? -4.860  20.886 -24.877 1.00 152.21 ? 285 GLN A CA  1 
ATOM   1580 C C   . GLN A 1 201 ? -4.507  20.465 -26.296 1.00 152.55 ? 285 GLN A C   1 
ATOM   1581 O O   . GLN A 1 201 ? -4.199  19.305 -26.556 1.00 150.74 ? 285 GLN A O   1 
ATOM   1582 C CB  . GLN A 1 201 ? -6.157  20.221 -24.417 1.00 151.16 ? 285 GLN A CB  1 
ATOM   1583 C CG  . GLN A 1 201 ? -6.634  20.678 -23.044 1.00 149.24 ? 285 GLN A CG  1 
ATOM   1584 C CD  . GLN A 1 201 ? -6.009  19.895 -21.902 1.00 151.39 ? 285 GLN A CD  1 
ATOM   1585 O OE1 . GLN A 1 201 ? -5.883  18.670 -21.965 1.00 153.16 ? 285 GLN A OE1 1 
ATOM   1586 N NE2 . GLN A 1 201 ? -5.621  20.601 -20.845 1.00 147.01 ? 285 GLN A NE2 1 
ATOM   1587 N N   . SER A 1 202 ? -4.542  21.424 -27.212 1.00 153.27 ? 286 SER A N   1 
ATOM   1588 C CA  . SER A 1 202 ? -4.251  21.133 -28.603 1.00 154.34 ? 286 SER A CA  1 
ATOM   1589 C C   . SER A 1 202 ? -3.241  22.102 -29.144 1.00 157.36 ? 286 SER A C   1 
ATOM   1590 O O   . SER A 1 202 ? -3.425  23.314 -29.042 1.00 157.47 ? 286 SER A O   1 
ATOM   1591 C CB  . SER A 1 202 ? -5.499  21.289 -29.450 1.00 156.97 ? 286 SER A CB  1 
ATOM   1592 O OG  . SER A 1 202 ? -5.751  22.661 -29.703 1.00 157.62 ? 286 SER A OG  1 
ATOM   1593 N N   . ARG A 1 203 ? -2.192  21.562 -29.748 1.00 157.82 ? 287 ARG A N   1 
ATOM   1594 C CA  . ARG A 1 203 ? -1.216  22.361 -30.466 1.00 159.02 ? 287 ARG A CA  1 
ATOM   1595 C C   . ARG A 1 203 ? -1.814  22.992 -31.722 1.00 157.32 ? 287 ARG A C   1 
ATOM   1596 O O   . ARG A 1 203 ? -1.459  24.110 -32.094 1.00 156.25 ? 287 ARG A O   1 
ATOM   1597 C CB  . ARG A 1 203 ? -0.019  21.493 -30.826 1.00 163.93 ? 287 ARG A CB  1 
ATOM   1598 C CG  . ARG A 1 203 ? 0.715   20.978 -29.612 1.00 165.49 ? 287 ARG A CG  1 
ATOM   1599 C CD  . ARG A 1 203 ? 1.903   20.145 -30.022 1.00 169.83 ? 287 ARG A CD  1 
ATOM   1600 N NE  . ARG A 1 203 ? 2.620   19.620 -28.867 1.00 174.80 ? 287 ARG A NE  1 
ATOM   1601 C CZ  . ARG A 1 203 ? 3.648   18.781 -28.946 1.00 174.51 ? 287 ARG A CZ  1 
ATOM   1602 N NH1 . ARG A 1 203 ? 4.242   18.353 -27.841 1.00 172.52 ? 287 ARG A NH1 1 
ATOM   1603 N NH2 . ARG A 1 203 ? 4.080   18.369 -30.131 1.00 173.34 ? 287 ARG A NH2 1 
ATOM   1604 N N   . GLU A 1 204 ? -2.723  22.274 -32.373 1.00 157.70 ? 288 GLU A N   1 
ATOM   1605 C CA  . GLU A 1 204 ? -3.356  22.792 -33.579 1.00 160.61 ? 288 GLU A CA  1 
ATOM   1606 C C   . GLU A 1 204 ? -4.132  24.076 -33.298 1.00 159.33 ? 288 GLU A C   1 
ATOM   1607 O O   . GLU A 1 204 ? -4.108  25.010 -34.102 1.00 159.76 ? 288 GLU A O   1 
ATOM   1608 C CB  . GLU A 1 204 ? -4.280  21.747 -34.207 1.00 162.19 ? 288 GLU A CB  1 
ATOM   1609 C CG  . GLU A 1 204 ? -4.918  22.199 -35.517 1.00 164.76 ? 288 GLU A CG  1 
ATOM   1610 C CD  . GLU A 1 204 ? -5.848  21.153 -36.105 1.00 169.53 ? 288 GLU A CD  1 
ATOM   1611 O OE1 . GLU A 1 204 ? -6.045  20.102 -35.459 1.00 168.99 ? 288 GLU A OE1 1 
ATOM   1612 O OE2 . GLU A 1 204 ? -6.381  21.380 -37.213 1.00 173.69 ? 288 GLU A OE2 1 
ATOM   1613 N N   . ASN A 1 205 ? -4.815  24.119 -32.155 1.00 158.60 ? 289 ASN A N   1 
ATOM   1614 C CA  . ASN A 1 205 ? -5.604  25.292 -31.776 1.00 157.44 ? 289 ASN A CA  1 
ATOM   1615 C C   . ASN A 1 205 ? -4.829  26.282 -30.906 1.00 152.74 ? 289 ASN A C   1 
ATOM   1616 O O   . ASN A 1 205 ? -5.238  27.433 -30.760 1.00 150.36 ? 289 ASN A O   1 
ATOM   1617 C CB  . ASN A 1 205 ? -6.923  24.883 -31.109 1.00 155.32 ? 289 ASN A CB  1 
ATOM   1618 C CG  . ASN A 1 205 ? -7.578  23.694 -31.801 1.00 157.37 ? 289 ASN A CG  1 
ATOM   1619 O OD1 . ASN A 1 205 ? -7.141  22.549 -31.658 1.00 158.25 ? 289 ASN A OD1 1 
ATOM   1620 N ND2 . ASN A 1 205 ? -8.625  23.965 -32.562 1.00 156.35 ? 289 ASN A ND2 1 
ATOM   1621 N N   . GLN A 1 206 ? -3.713  25.832 -30.335 1.00 152.05 ? 290 GLN A N   1 
ATOM   1622 C CA  . GLN A 1 206 ? -2.766  26.738 -29.692 1.00 148.28 ? 290 GLN A CA  1 
ATOM   1623 C C   . GLN A 1 206 ? -2.077  27.508 -30.810 1.00 146.50 ? 290 GLN A C   1 
ATOM   1624 O O   . GLN A 1 206 ? -1.797  26.949 -31.865 1.00 150.36 ? 290 GLN A O   1 
ATOM   1625 C CB  . GLN A 1 206 ? -1.749  25.961 -28.850 1.00 149.08 ? 290 GLN A CB  1 
ATOM   1626 C CG  . GLN A 1 206 ? -1.037  26.784 -27.775 1.00 148.30 ? 290 GLN A CG  1 
ATOM   1627 C CD  . GLN A 1 206 ? -0.458  25.921 -26.654 1.00 148.79 ? 290 GLN A CD  1 
ATOM   1628 O OE1 . GLN A 1 206 ? -0.756  24.727 -26.555 1.00 149.85 ? 290 GLN A OE1 1 
ATOM   1629 N NE2 . GLN A 1 206 ? 0.370   26.526 -25.804 1.00 144.19 ? 290 GLN A NE2 1 
ATOM   1630 N N   . GLU A 1 207 ? -1.813  28.790 -30.590 1.00 143.70 ? 291 GLU A N   1 
ATOM   1631 C CA  . GLU A 1 207 ? -1.364  29.657 -31.673 1.00 143.69 ? 291 GLU A CA  1 
ATOM   1632 C C   . GLU A 1 207 ? -0.639  30.891 -31.147 1.00 143.24 ? 291 GLU A C   1 
ATOM   1633 O O   . GLU A 1 207 ? -1.228  31.721 -30.457 1.00 145.04 ? 291 GLU A O   1 
ATOM   1634 C CB  . GLU A 1 207 ? -2.570  30.074 -32.520 1.00 143.37 ? 291 GLU A CB  1 
ATOM   1635 C CG  . GLU A 1 207 ? -2.267  31.036 -33.652 1.00 142.80 ? 291 GLU A CG  1 
ATOM   1636 C CD  . GLU A 1 207 ? -3.520  31.430 -34.422 1.00 144.64 ? 291 GLU A CD  1 
ATOM   1637 O OE1 . GLU A 1 207 ? -3.387  32.017 -35.519 1.00 146.19 ? 291 GLU A OE1 1 
ATOM   1638 O OE2 . GLU A 1 207 ? -4.638  31.153 -33.931 1.00 141.37 ? 291 GLU A OE2 1 
ATOM   1639 N N   . VAL A 1 208 ? 0.643   31.011 -31.471 1.00 143.71 ? 292 VAL A N   1 
ATOM   1640 C CA  . VAL A 1 208 ? 1.423   32.160 -31.023 1.00 144.29 ? 292 VAL A CA  1 
ATOM   1641 C C   . VAL A 1 208 ? 1.016   33.396 -31.809 1.00 142.26 ? 292 VAL A C   1 
ATOM   1642 O O   . VAL A 1 208 ? 0.786   33.325 -33.014 1.00 140.79 ? 292 VAL A O   1 
ATOM   1643 C CB  . VAL A 1 208 ? 2.937   31.932 -31.193 1.00 144.35 ? 292 VAL A CB  1 
ATOM   1644 C CG1 . VAL A 1 208 ? 3.722   33.053 -30.517 1.00 142.28 ? 292 VAL A CG1 1 
ATOM   1645 C CG2 . VAL A 1 208 ? 3.338   30.577 -30.633 1.00 141.26 ? 292 VAL A CG2 1 
ATOM   1646 N N   . ILE A 1 209 ? 0.913   34.531 -31.129 1.00 143.96 ? 293 ILE A N   1 
ATOM   1647 C CA  . ILE A 1 209 ? 0.468   35.746 -31.794 1.00 145.59 ? 293 ILE A CA  1 
ATOM   1648 C C   . ILE A 1 209 ? 1.485   36.879 -31.655 1.00 144.73 ? 293 ILE A C   1 
ATOM   1649 O O   . ILE A 1 209 ? 1.440   37.852 -32.407 1.00 144.78 ? 293 ILE A O   1 
ATOM   1650 C CB  . ILE A 1 209 ? -0.938  36.176 -31.313 1.00 145.28 ? 293 ILE A CB  1 
ATOM   1651 C CG1 . ILE A 1 209 ? -0.874  36.748 -29.902 1.00 144.18 ? 293 ILE A CG1 1 
ATOM   1652 C CG2 . ILE A 1 209 ? -1.896  34.993 -31.339 1.00 143.13 ? 293 ILE A CG2 1 
ATOM   1653 C CD1 . ILE A 1 209 ? -2.236  36.943 -29.275 1.00 147.13 ? 293 ILE A CD1 1 
ATOM   1654 N N   . LEU A 1 210 ? 2.404   36.733 -30.703 1.00 143.61 ? 294 LEU A N   1 
ATOM   1655 C CA  . LEU A 1 210 ? 3.549   37.634 -30.578 1.00 145.72 ? 294 LEU A CA  1 
ATOM   1656 C C   . LEU A 1 210 ? 4.674   36.994 -29.776 1.00 148.44 ? 294 LEU A C   1 
ATOM   1657 O O   . LEU A 1 210 ? 4.443   36.072 -28.985 1.00 146.98 ? 294 LEU A O   1 
ATOM   1658 C CB  . LEU A 1 210 ? 3.154   38.969 -29.951 1.00 145.51 ? 294 LEU A CB  1 
ATOM   1659 C CG  . LEU A 1 210 ? 2.947   40.129 -30.926 1.00 148.73 ? 294 LEU A CG  1 
ATOM   1660 C CD1 . LEU A 1 210 ? 2.976   41.441 -30.185 1.00 152.19 ? 294 LEU A CD1 1 
ATOM   1661 C CD2 . LEU A 1 210 ? 3.990   40.124 -32.029 1.00 147.71 ? 294 LEU A CD2 1 
ATOM   1662 N N   . GLU A 1 211 ? 5.890   37.497 -29.983 1.00 148.57 ? 295 GLU A N   1 
ATOM   1663 C CA  . GLU A 1 211 ? 7.079   36.929 -29.358 1.00 147.34 ? 295 GLU A CA  1 
ATOM   1664 C C   . GLU A 1 211 ? 7.836   37.948 -28.515 1.00 146.72 ? 295 GLU A C   1 
ATOM   1665 O O   . GLU A 1 211 ? 8.072   39.077 -28.947 1.00 145.99 ? 295 GLU A O   1 
ATOM   1666 C CB  . GLU A 1 211 ? 8.025   36.363 -30.419 1.00 148.50 ? 295 GLU A CB  1 
ATOM   1667 C CG  . GLU A 1 211 ? 7.345   35.816 -31.668 1.00 148.23 ? 295 GLU A CG  1 
ATOM   1668 C CD  . GLU A 1 211 ? 7.113   36.878 -32.734 1.00 151.08 ? 295 GLU A CD  1 
ATOM   1669 O OE1 . GLU A 1 211 ? 6.421   36.575 -33.733 1.00 151.08 ? 295 GLU A OE1 1 
ATOM   1670 O OE2 . GLU A 1 211 ? 7.625   38.010 -32.576 1.00 150.67 ? 295 GLU A OE2 1 
ATOM   1671 N N   . GLU A 1 212 ? 8.225   37.530 -27.317 1.00 146.45 ? 296 GLU A N   1 
ATOM   1672 C CA  . GLU A 1 212 ? 9.089   38.332 -26.458 1.00 147.32 ? 296 GLU A CA  1 
ATOM   1673 C C   . GLU A 1 212 ? 8.548   39.746 -26.245 1.00 147.05 ? 296 GLU A C   1 
ATOM   1674 O O   . GLU A 1 212 ? 9.192   40.730 -26.602 1.00 146.98 ? 296 GLU A O   1 
ATOM   1675 C CB  . GLU A 1 212 ? 10.506  38.373 -27.038 1.00 146.72 ? 296 GLU A CB  1 
ATOM   1676 C CG  . GLU A 1 212 ? 11.604  38.065 -26.024 1.00 147.15 ? 296 GLU A CG  1 
ATOM   1677 C CD  . GLU A 1 212 ? 11.560  36.630 -25.504 1.00 148.61 ? 296 GLU A CD  1 
ATOM   1678 O OE1 . GLU A 1 212 ? 12.200  36.356 -24.464 1.00 147.20 ? 296 GLU A OE1 1 
ATOM   1679 O OE2 . GLU A 1 212 ? 10.896  35.774 -26.134 1.00 145.98 ? 296 GLU A OE2 1 
ATOM   1680 N N   . VAL A 1 213 ? 7.361   39.840 -25.659 1.00 147.80 ? 297 VAL A N   1 
ATOM   1681 C CA  . VAL A 1 213 ? 6.678   41.121 -25.554 1.00 146.00 ? 297 VAL A CA  1 
ATOM   1682 C C   . VAL A 1 213 ? 6.611   41.618 -24.116 1.00 144.69 ? 297 VAL A C   1 
ATOM   1683 O O   . VAL A 1 213 ? 6.396   40.841 -23.185 1.00 145.26 ? 297 VAL A O   1 
ATOM   1684 C CB  . VAL A 1 213 ? 5.263   41.049 -26.167 1.00 144.71 ? 297 VAL A CB  1 
ATOM   1685 C CG1 . VAL A 1 213 ? 4.407   40.030 -25.432 1.00 144.37 ? 297 VAL A CG1 1 
ATOM   1686 C CG2 . VAL A 1 213 ? 4.610   42.409 -26.150 1.00 145.88 ? 297 VAL A CG2 1 
ATOM   1687 N N   . ARG A 1 214 ? 6.813   42.917 -23.938 1.00 143.60 ? 298 ARG A N   1 
ATOM   1688 C CA  . ARG A 1 214 ? 6.774   43.503 -22.609 1.00 143.38 ? 298 ARG A CA  1 
ATOM   1689 C C   . ARG A 1 214 ? 5.389   43.440 -21.971 1.00 143.28 ? 298 ARG A C   1 
ATOM   1690 O O   . ARG A 1 214 ? 5.249   43.010 -20.830 1.00 143.46 ? 298 ARG A O   1 
ATOM   1691 C CB  . ARG A 1 214 ? 7.254   44.950 -22.637 1.00 143.90 ? 298 ARG A CB  1 
ATOM   1692 C CG  . ARG A 1 214 ? 7.104   45.629 -21.293 1.00 143.61 ? 298 ARG A CG  1 
ATOM   1693 C CD  . ARG A 1 214 ? 8.136   46.706 -21.088 1.00 141.14 ? 298 ARG A CD  1 
ATOM   1694 N NE  . ARG A 1 214 ? 7.795   47.926 -21.803 1.00 140.92 ? 298 ARG A NE  1 
ATOM   1695 C CZ  . ARG A 1 214 ? 8.253   49.122 -21.460 1.00 142.58 ? 298 ARG A CZ  1 
ATOM   1696 N NH1 . ARG A 1 214 ? 9.058   49.236 -20.415 1.00 141.12 ? 298 ARG A NH1 1 
ATOM   1697 N NH2 . ARG A 1 214 ? 7.906   50.198 -22.152 1.00 146.64 ? 298 ARG A NH2 1 
ATOM   1698 N N   . ASP A 1 215 ? 4.370   43.885 -22.698 1.00 143.55 ? 299 ASP A N   1 
ATOM   1699 C CA  . ASP A 1 215 ? 3.009   43.877 -22.166 1.00 141.62 ? 299 ASP A CA  1 
ATOM   1700 C C   . ASP A 1 215 ? 1.971   43.621 -23.253 1.00 142.56 ? 299 ASP A C   1 
ATOM   1701 O O   . ASP A 1 215 ? 2.221   43.866 -24.430 1.00 142.63 ? 299 ASP A O   1 
ATOM   1702 C CB  . ASP A 1 215 ? 2.698   45.191 -21.453 1.00 142.26 ? 299 ASP A CB  1 
ATOM   1703 C CG  . ASP A 1 215 ? 2.513   46.347 -22.415 1.00 145.97 ? 299 ASP A CG  1 
ATOM   1704 O OD1 . ASP A 1 215 ? 1.462   46.413 -23.096 1.00 143.84 ? 299 ASP A OD1 1 
ATOM   1705 O OD2 . ASP A 1 215 ? 3.421   47.201 -22.474 1.00 148.44 ? 299 ASP A OD2 1 
ATOM   1706 N N   . PHE A 1 216 ? 0.797   43.149 -22.851 1.00 142.48 ? 300 PHE A N   1 
ATOM   1707 C CA  . PHE A 1 216 ? -0.249  42.819 -23.811 1.00 140.31 ? 300 PHE A CA  1 
ATOM   1708 C C   . PHE A 1 216 ? -1.620  43.307 -23.364 1.00 140.58 ? 300 PHE A C   1 
ATOM   1709 O O   . PHE A 1 216 ? -2.036  43.082 -22.226 1.00 142.53 ? 300 PHE A O   1 
ATOM   1710 C CB  . PHE A 1 216 ? -0.287  41.313 -24.052 1.00 139.53 ? 300 PHE A CB  1 
ATOM   1711 C CG  . PHE A 1 216 ? -1.385  40.877 -24.971 1.00 139.38 ? 300 PHE A CG  1 
ATOM   1712 C CD1 . PHE A 1 216 ? -1.288  41.088 -26.334 1.00 140.15 ? 300 PHE A CD1 1 
ATOM   1713 C CD2 . PHE A 1 216 ? -2.512  40.249 -24.473 1.00 139.88 ? 300 PHE A CD2 1 
ATOM   1714 C CE1 . PHE A 1 216 ? -2.295  40.687 -27.183 1.00 139.99 ? 300 PHE A CE1 1 
ATOM   1715 C CE2 . PHE A 1 216 ? -3.524  39.843 -25.316 1.00 140.12 ? 300 PHE A CE2 1 
ATOM   1716 C CZ  . PHE A 1 216 ? -3.416  40.063 -26.673 1.00 139.85 ? 300 PHE A CZ  1 
ATOM   1717 N N   . GLN A 1 217 ? -2.323  43.970 -24.273 1.00 139.79 ? 301 GLN A N   1 
ATOM   1718 C CA  . GLN A 1 217 ? -3.642  44.497 -23.972 1.00 137.87 ? 301 GLN A CA  1 
ATOM   1719 C C   . GLN A 1 217 ? -4.633  44.193 -25.091 1.00 137.90 ? 301 GLN A C   1 
ATOM   1720 O O   . GLN A 1 217 ? -4.380  44.474 -26.261 1.00 137.93 ? 301 GLN A O   1 
ATOM   1721 C CB  . GLN A 1 217 ? -3.570  46.002 -23.714 1.00 138.81 ? 301 GLN A CB  1 
ATOM   1722 C CG  . GLN A 1 217 ? -4.889  46.609 -23.273 1.00 142.95 ? 301 GLN A CG  1 
ATOM   1723 C CD  . GLN A 1 217 ? -4.762  48.070 -22.899 1.00 145.15 ? 301 GLN A CD  1 
ATOM   1724 O OE1 . GLN A 1 217 ? -5.754  48.733 -22.591 1.00 144.90 ? 301 GLN A OE1 1 
ATOM   1725 N NE2 . GLN A 1 217 ? -3.536  48.581 -22.917 1.00 147.91 ? 301 GLN A NE2 1 
ATOM   1726 N N   . LEU A 1 218 ? -5.765  43.613 -24.711 1.00 139.18 ? 302 LEU A N   1 
ATOM   1727 C CA  . LEU A 1 218 ? -6.831  43.271 -25.644 1.00 138.44 ? 302 LEU A CA  1 
ATOM   1728 C C   . LEU A 1 218 ? -7.934  44.335 -25.563 1.00 136.54 ? 302 LEU A C   1 
ATOM   1729 O O   . LEU A 1 218 ? -8.459  44.593 -24.486 1.00 137.21 ? 302 LEU A O   1 
ATOM   1730 C CB  . LEU A 1 218 ? -7.379  41.891 -25.276 1.00 135.69 ? 302 LEU A CB  1 
ATOM   1731 C CG  . LEU A 1 218 ? -8.292  41.153 -26.247 1.00 135.87 ? 302 LEU A CG  1 
ATOM   1732 C CD1 . LEU A 1 218 ? -7.666  41.134 -27.618 1.00 141.36 ? 302 LEU A CD1 1 
ATOM   1733 C CD2 . LEU A 1 218 ? -8.523  39.739 -25.751 1.00 131.34 ? 302 LEU A CD2 1 
ATOM   1734 N N   . ARG A 1 219 ? -8.271  44.961 -26.690 1.00 136.52 ? 303 ARG A N   1 
ATOM   1735 C CA  . ARG A 1 219 ? -9.249  46.057 -26.700 1.00 138.80 ? 303 ARG A CA  1 
ATOM   1736 C C   . ARG A 1 219 ? -10.190 46.015 -27.905 1.00 142.22 ? 303 ARG A C   1 
ATOM   1737 O O   . ARG A 1 219 ? -9.848  46.524 -28.975 1.00 143.43 ? 303 ARG A O   1 
ATOM   1738 C CB  . ARG A 1 219 ? -8.540  47.417 -26.693 1.00 139.38 ? 303 ARG A CB  1 
ATOM   1739 C CG  . ARG A 1 219 ? -7.704  47.714 -25.457 1.00 141.23 ? 303 ARG A CG  1 
ATOM   1740 C CD  . ARG A 1 219 ? -8.564  48.110 -24.272 1.00 140.35 ? 303 ARG A CD  1 
ATOM   1741 N NE  . ARG A 1 219 ? -9.128  49.452 -24.405 1.00 140.67 ? 303 ARG A NE  1 
ATOM   1742 C CZ  . ARG A 1 219 ? -8.636  50.531 -23.803 1.00 141.16 ? 303 ARG A CZ  1 
ATOM   1743 N NH1 . ARG A 1 219 ? -7.565  50.425 -23.029 1.00 142.70 ? 303 ARG A NH1 1 
ATOM   1744 N NH2 . ARG A 1 219 ? -9.212  51.714 -23.969 1.00 140.75 ? 303 ARG A NH2 1 
ATOM   1745 N N   . ASP A 1 220 ? -11.375 45.435 -27.723 1.00 142.67 ? 304 ASP A N   1 
ATOM   1746 C CA  . ASP A 1 220 ? -12.368 45.348 -28.794 1.00 143.32 ? 304 ASP A CA  1 
ATOM   1747 C C   . ASP A 1 220 ? -11.796 44.660 -30.030 1.00 144.64 ? 304 ASP A C   1 
ATOM   1748 O O   . ASP A 1 220 ? -11.265 43.552 -29.947 1.00 143.16 ? 304 ASP A O   1 
ATOM   1749 C CB  . ASP A 1 220 ? -12.906 46.739 -29.149 1.00 145.00 ? 304 ASP A CB  1 
ATOM   1750 C CG  . ASP A 1 220 ? -13.728 47.347 -28.028 1.00 148.35 ? 304 ASP A CG  1 
ATOM   1751 O OD1 . ASP A 1 220 ? -13.669 46.819 -26.896 1.00 148.15 ? 304 ASP A OD1 1 
ATOM   1752 O OD2 . ASP A 1 220 ? -14.431 48.351 -28.274 1.00 149.36 ? 304 ASP A OD2 1 
ATOM   1753 N N   . LYS A 1 221 ? -11.905 45.323 -31.174 1.00 144.78 ? 305 LYS A N   1 
ATOM   1754 C CA  . LYS A 1 221 ? -11.328 44.800 -32.400 1.00 145.07 ? 305 LYS A CA  1 
ATOM   1755 C C   . LYS A 1 221 ? -9.796  44.762 -32.311 1.00 147.88 ? 305 LYS A C   1 
ATOM   1756 O O   . LYS A 1 221 ? -9.160  43.801 -32.755 1.00 147.78 ? 305 LYS A O   1 
ATOM   1757 C CB  . LYS A 1 221 ? -11.779 45.648 -33.590 1.00 147.09 ? 305 LYS A CB  1 
ATOM   1758 C CG  . LYS A 1 221 ? -11.326 45.104 -34.932 1.00 153.84 ? 305 LYS A CG  1 
ATOM   1759 C CD  . LYS A 1 221 ? -11.879 45.893 -36.128 1.00 158.20 ? 305 LYS A CD  1 
ATOM   1760 C CE  . LYS A 1 221 ? -11.369 45.300 -37.442 1.00 158.93 ? 305 LYS A CE  1 
ATOM   1761 N NZ  . LYS A 1 221 ? -12.123 45.690 -38.657 1.00 157.11 ? 305 LYS A NZ  1 
ATOM   1762 N N   . TYR A 1 222 ? -9.210  45.803 -31.721 1.00 144.44 ? 306 TYR A N   1 
ATOM   1763 C CA  . TYR A 1 222 ? -7.757  45.919 -31.640 1.00 141.44 ? 306 TYR A CA  1 
ATOM   1764 C C   . TYR A 1 222 ? -7.132  45.046 -30.572 1.00 139.90 ? 306 TYR A C   1 
ATOM   1765 O O   . TYR A 1 222 ? -7.752  44.719 -29.566 1.00 138.30 ? 306 TYR A O   1 
ATOM   1766 C CB  . TYR A 1 222 ? -7.338  47.353 -31.352 1.00 142.50 ? 306 TYR A CB  1 
ATOM   1767 C CG  . TYR A 1 222 ? -7.862  48.375 -32.315 1.00 144.27 ? 306 TYR A CG  1 
ATOM   1768 C CD1 . TYR A 1 222 ? -7.045  48.918 -33.296 1.00 142.81 ? 306 TYR A CD1 1 
ATOM   1769 C CD2 . TYR A 1 222 ? -9.173  48.812 -32.234 1.00 147.62 ? 306 TYR A CD2 1 
ATOM   1770 C CE1 . TYR A 1 222 ? -7.524  49.860 -34.174 1.00 144.26 ? 306 TYR A CE1 1 
ATOM   1771 C CE2 . TYR A 1 222 ? -9.661  49.751 -33.104 1.00 151.33 ? 306 TYR A CE2 1 
ATOM   1772 C CZ  . TYR A 1 222 ? -8.832  50.275 -34.071 1.00 150.84 ? 306 TYR A CZ  1 
ATOM   1773 O OH  . TYR A 1 222 ? -9.317  51.215 -34.938 1.00 154.17 ? 306 TYR A OH  1 
ATOM   1774 N N   . MET A 1 223 ? -5.877  44.690 -30.810 1.00 143.15 ? 307 MET A N   1 
ATOM   1775 C CA  . MET A 1 223 ? -5.029  44.061 -29.815 1.00 142.30 ? 307 MET A CA  1 
ATOM   1776 C C   . MET A 1 223 ? -3.773  44.917 -29.738 1.00 141.88 ? 307 MET A C   1 
ATOM   1777 O O   . MET A 1 223 ? -3.383  45.538 -30.724 1.00 143.12 ? 307 MET A O   1 
ATOM   1778 C CB  . MET A 1 223 ? -4.696  42.631 -30.231 1.00 142.19 ? 307 MET A CB  1 
ATOM   1779 C CG  . MET A 1 223 ? -5.934  41.806 -30.549 1.00 147.64 ? 307 MET A CG  1 
ATOM   1780 S SD  . MET A 1 223 ? -5.597  40.120 -31.093 1.00 157.40 ? 307 MET A SD  1 
ATOM   1781 C CE  . MET A 1 223 ? -4.195  39.731 -30.058 1.00 145.10 ? 307 MET A CE  1 
ATOM   1782 N N   . PHE A 1 224 ? -3.155  44.983 -28.567 1.00 141.22 ? 308 PHE A N   1 
ATOM   1783 C CA  . PHE A 1 224 ? -1.962  45.806 -28.416 1.00 141.21 ? 308 PHE A CA  1 
ATOM   1784 C C   . PHE A 1 224 ? -0.859  45.080 -27.666 1.00 141.84 ? 308 PHE A C   1 
ATOM   1785 O O   . PHE A 1 224 ? -1.119  44.125 -26.933 1.00 140.76 ? 308 PHE A O   1 
ATOM   1786 C CB  . PHE A 1 224 ? -2.291  47.123 -27.715 1.00 139.88 ? 308 PHE A CB  1 
ATOM   1787 C CG  . PHE A 1 224 ? -3.327  47.943 -28.422 1.00 140.61 ? 308 PHE A CG  1 
ATOM   1788 C CD1 . PHE A 1 224 ? -2.992  48.699 -29.528 1.00 143.01 ? 308 PHE A CD1 1 
ATOM   1789 C CD2 . PHE A 1 224 ? -4.637  47.965 -27.974 1.00 141.31 ? 308 PHE A CD2 1 
ATOM   1790 C CE1 . PHE A 1 224 ? -3.949  49.464 -30.182 1.00 143.52 ? 308 PHE A CE1 1 
ATOM   1791 C CE2 . PHE A 1 224 ? -5.597  48.728 -28.623 1.00 141.29 ? 308 PHE A CE2 1 
ATOM   1792 C CZ  . PHE A 1 224 ? -5.250  49.479 -29.727 1.00 141.13 ? 308 PHE A CZ  1 
ATOM   1793 N N   . ALA A 1 225 ? 0.371   45.551 -27.859 1.00 145.72 ? 309 ALA A N   1 
ATOM   1794 C CA  . ALA A 1 225 ? 1.548   44.962 -27.229 1.00 145.79 ? 309 ALA A CA  1 
ATOM   1795 C C   . ALA A 1 225 ? 2.799   45.812 -27.458 1.00 145.41 ? 309 ALA A C   1 
ATOM   1796 O O   . ALA A 1 225 ? 2.969   46.412 -28.519 1.00 145.65 ? 309 ALA A O   1 
ATOM   1797 C CB  . ALA A 1 225 ? 1.765   43.552 -27.736 1.00 143.25 ? 309 ALA A CB  1 
ATOM   1798 N N   . THR A 1 226 ? 3.670   45.865 -26.455 1.00 144.89 ? 310 THR A N   1 
ATOM   1799 C CA  . THR A 1 226 ? 4.904   46.632 -26.566 1.00 146.12 ? 310 THR A CA  1 
ATOM   1800 C C   . THR A 1 226 ? 6.094   45.714 -26.781 1.00 148.50 ? 310 THR A C   1 
ATOM   1801 O O   . THR A 1 226 ? 6.461   44.934 -25.897 1.00 146.86 ? 310 THR A O   1 
ATOM   1802 C CB  . THR A 1 226 ? 5.160   47.513 -25.323 1.00 147.96 ? 310 THR A CB  1 
ATOM   1803 O OG1 . THR A 1 226 ? 4.213   48.586 -25.291 1.00 151.56 ? 310 THR A OG1 1 
ATOM   1804 C CG2 . THR A 1 226 ? 6.555   48.110 -25.372 1.00 149.72 ? 310 THR A CG2 1 
ATOM   1805 N N   . LYS A 1 227 ? 6.686   45.804 -27.968 1.00 151.13 ? 311 LYS A N   1 
ATOM   1806 C CA  . LYS A 1 227 ? 7.910   45.076 -28.257 1.00 149.60 ? 311 LYS A CA  1 
ATOM   1807 C C   . LYS A 1 227 ? 9.109   45.961 -27.957 1.00 148.14 ? 311 LYS A C   1 
ATOM   1808 O O   . LYS A 1 227 ? 9.116   47.155 -28.276 1.00 142.66 ? 311 LYS A O   1 
ATOM   1809 C CB  . LYS A 1 227 ? 7.948   44.606 -29.712 1.00 149.62 ? 311 LYS A CB  1 
ATOM   1810 C CG  . LYS A 1 227 ? 6.873   43.600 -30.070 1.00 149.28 ? 311 LYS A CG  1 
ATOM   1811 C CD  . LYS A 1 227 ? 7.402   42.565 -31.042 1.00 149.07 ? 311 LYS A CD  1 
ATOM   1812 C CE  . LYS A 1 227 ? 8.577   41.814 -30.437 1.00 146.52 ? 311 LYS A CE  1 
ATOM   1813 N NZ  . LYS A 1 227 ? 8.961   40.617 -31.237 1.00 145.41 ? 311 LYS A NZ  1 
ATOM   1814 N N   . VAL A 1 228 ? 10.116  45.367 -27.329 1.00 150.70 ? 312 VAL A N   1 
ATOM   1815 C CA  . VAL A 1 228 ? 11.343  46.082 -27.005 1.00 150.34 ? 312 VAL A CA  1 
ATOM   1816 C C   . VAL A 1 228 ? 12.460  45.740 -27.988 1.00 147.07 ? 312 VAL A C   1 
ATOM   1817 O O   . VAL A 1 228 ? 12.808  44.572 -28.182 1.00 144.17 ? 312 VAL A O   1 
ATOM   1818 C CB  . VAL A 1 228 ? 11.797  45.801 -25.562 1.00 150.59 ? 312 VAL A CB  1 
ATOM   1819 C CG1 . VAL A 1 228 ? 13.200  46.334 -25.330 1.00 148.94 ? 312 VAL A CG1 1 
ATOM   1820 C CG2 . VAL A 1 228 ? 10.821  46.421 -24.580 1.00 149.63 ? 312 VAL A CG2 1 
ATOM   1821 N N   . VAL A 1 229 ? 13.003  46.779 -28.612 1.00 145.53 ? 313 VAL A N   1 
ATOM   1822 C CA  . VAL A 1 229 ? 14.057  46.632 -29.602 1.00 141.34 ? 313 VAL A CA  1 
ATOM   1823 C C   . VAL A 1 229 ? 15.312  47.370 -29.132 1.00 142.45 ? 313 VAL A C   1 
ATOM   1824 O O   . VAL A 1 229 ? 15.363  48.602 -29.121 1.00 143.44 ? 313 VAL A O   1 
ATOM   1825 C CB  . VAL A 1 229 ? 13.582  47.129 -30.991 1.00 138.94 ? 313 VAL A CB  1 
ATOM   1826 C CG1 . VAL A 1 229 ? 12.807  48.443 -30.868 1.00 142.07 ? 313 VAL A CG1 1 
ATOM   1827 C CG2 . VAL A 1 229 ? 14.748  47.254 -31.957 1.00 135.98 ? 313 VAL A CG2 1 
ATOM   1828 N N   . HIS A 1 230 ? 16.314  46.602 -28.713 1.00 141.69 ? 314 HIS A N   1 
ATOM   1829 C CA  . HIS A 1 230 ? 17.556  47.163 -28.188 1.00 139.76 ? 314 HIS A CA  1 
ATOM   1830 C C   . HIS A 1 230 ? 18.629  47.265 -29.262 1.00 132.67 ? 314 HIS A C   1 
ATOM   1831 O O   . HIS A 1 230 ? 19.303  46.282 -29.569 1.00 128.99 ? 314 HIS A O   1 
ATOM   1832 C CB  . HIS A 1 230 ? 18.082  46.309 -27.032 1.00 144.02 ? 314 HIS A CB  1 
ATOM   1833 C CG  . HIS A 1 230 ? 17.398  46.567 -25.725 1.00 151.34 ? 314 HIS A CG  1 
ATOM   1834 N ND1 . HIS A 1 230 ? 17.035  47.832 -25.312 1.00 154.57 ? 314 HIS A ND1 1 
ATOM   1835 C CD2 . HIS A 1 230 ? 17.014  45.724 -24.738 1.00 152.79 ? 314 HIS A CD2 1 
ATOM   1836 C CE1 . HIS A 1 230 ? 16.456  47.756 -24.126 1.00 155.81 ? 314 HIS A CE1 1 
ATOM   1837 N NE2 . HIS A 1 230 ? 16.430  46.488 -23.756 1.00 156.01 ? 314 HIS A NE2 1 
ATOM   1838 N N   . LEU A 1 231 ? 18.798  48.454 -29.829 1.00 128.34 ? 315 LEU A N   1 
ATOM   1839 C CA  . LEU A 1 231 ? 19.841  48.644 -30.825 1.00 121.63 ? 315 LEU A CA  1 
ATOM   1840 C C   . LEU A 1 231 ? 21.206  48.952 -30.189 1.00 117.89 ? 315 LEU A C   1 
ATOM   1841 O O   . LEU A 1 231 ? 21.322  49.052 -28.965 1.00 117.58 ? 315 LEU A O   1 
ATOM   1842 C CB  . LEU A 1 231 ? 19.423  49.668 -31.888 1.00 116.86 ? 315 LEU A CB  1 
ATOM   1843 C CG  . LEU A 1 231 ? 18.620  50.904 -31.504 1.00 119.34 ? 315 LEU A CG  1 
ATOM   1844 C CD1 . LEU A 1 231 ? 19.526  51.993 -30.928 1.00 119.24 ? 315 LEU A CD1 1 
ATOM   1845 C CD2 . LEU A 1 231 ? 17.872  51.397 -32.732 1.00 117.24 ? 315 LEU A CD2 1 
ATOM   1846 N N   . LEU A 1 232 ? 22.234  49.078 -31.023 1.00 114.22 ? 316 LEU A N   1 
ATOM   1847 C CA  . LEU A 1 232 ? 23.609  49.068 -30.539 1.00 112.13 ? 316 LEU A CA  1 
ATOM   1848 C C   . LEU A 1 232 ? 24.399  50.348 -30.796 1.00 114.23 ? 316 LEU A C   1 
ATOM   1849 O O   . LEU A 1 232 ? 25.364  50.641 -30.087 1.00 116.70 ? 316 LEU A O   1 
ATOM   1850 C CB  . LEU A 1 232 ? 24.351  47.882 -31.143 1.00 106.84 ? 316 LEU A CB  1 
ATOM   1851 C CG  . LEU A 1 232 ? 24.023  46.557 -30.476 1.00 107.50 ? 316 LEU A CG  1 
ATOM   1852 C CD1 . LEU A 1 232 ? 24.549  45.401 -31.294 1.00 108.65 ? 316 LEU A CD1 1 
ATOM   1853 C CD2 . LEU A 1 232 ? 24.638  46.544 -29.100 1.00 109.68 ? 316 LEU A CD2 1 
ATOM   1854 N N   . GLY A 1 233 ? 24.003  51.112 -31.806 1.00 111.96 ? 317 GLY A N   1 
ATOM   1855 C CA  . GLY A 1 233 ? 24.788  52.268 -32.207 1.00 112.74 ? 317 GLY A CA  1 
ATOM   1856 C C   . GLY A 1 233 ? 24.685  53.506 -31.332 1.00 114.82 ? 317 GLY A C   1 
ATOM   1857 O O   . GLY A 1 233 ? 24.248  54.561 -31.800 1.00 115.33 ? 317 GLY A O   1 
ATOM   1858 N N   . SER A 1 234 ? 25.094  53.379 -30.071 1.00 115.32 ? 318 SER A N   1 
ATOM   1859 C CA  . SER A 1 234 ? 25.182  54.516 -29.149 1.00 118.93 ? 318 SER A CA  1 
ATOM   1860 C C   . SER A 1 234 ? 23.934  55.411 -29.126 1.00 121.76 ? 318 SER A C   1 
ATOM   1861 O O   . SER A 1 234 ? 23.865  56.432 -29.825 1.00 118.40 ? 318 SER A O   1 
ATOM   1862 C CB  . SER A 1 234 ? 26.432  55.358 -29.449 1.00 115.59 ? 318 SER A CB  1 
ATOM   1863 O OG  . SER A 1 234 ? 26.270  56.134 -30.625 1.00 113.90 ? 318 SER A OG  1 
ATOM   1864 N N   . LEU A 1 242 ? 4.741   50.651 -31.343 1.00 152.11 ? 326 LEU A N   1 
ATOM   1865 C CA  . LEU A 1 242 ? 4.164   49.447 -30.754 1.00 153.24 ? 326 LEU A CA  1 
ATOM   1866 C C   . LEU A 1 242 ? 3.528   48.554 -31.816 1.00 153.55 ? 326 LEU A C   1 
ATOM   1867 O O   . LEU A 1 242 ? 3.318   48.983 -32.951 1.00 154.47 ? 326 LEU A O   1 
ATOM   1868 C CB  . LEU A 1 242 ? 3.135   49.816 -29.680 1.00 153.23 ? 326 LEU A CB  1 
ATOM   1869 C CG  . LEU A 1 242 ? 1.897   50.618 -30.090 1.00 150.88 ? 326 LEU A CG  1 
ATOM   1870 C CD1 . LEU A 1 242 ? 0.707   49.697 -30.267 1.00 150.68 ? 326 LEU A CD1 1 
ATOM   1871 C CD2 . LEU A 1 242 ? 1.583   51.692 -29.064 1.00 149.58 ? 326 LEU A CD2 1 
ATOM   1872 N N   . TRP A 1 243 ? 3.226   47.312 -31.442 1.00 152.21 ? 327 TRP A N   1 
ATOM   1873 C CA  . TRP A 1 243 ? 2.615   46.354 -32.361 1.00 152.43 ? 327 TRP A CA  1 
ATOM   1874 C C   . TRP A 1 243 ? 1.088   46.300 -32.224 1.00 151.69 ? 327 TRP A C   1 
ATOM   1875 O O   . TRP A 1 243 ? 0.552   46.291 -31.117 1.00 150.94 ? 327 TRP A O   1 
ATOM   1876 C CB  . TRP A 1 243 ? 3.246   44.965 -32.197 1.00 152.27 ? 327 TRP A CB  1 
ATOM   1877 C CG  . TRP A 1 243 ? 4.365   44.707 -33.178 1.00 157.05 ? 327 TRP A CG  1 
ATOM   1878 C CD1 . TRP A 1 243 ? 4.328   43.879 -34.266 1.00 156.84 ? 327 TRP A CD1 1 
ATOM   1879 C CD2 . TRP A 1 243 ? 5.674   45.299 -33.171 1.00 157.82 ? 327 TRP A CD2 1 
ATOM   1880 N NE1 . TRP A 1 243 ? 5.532   43.912 -34.929 1.00 156.21 ? 327 TRP A NE1 1 
ATOM   1881 C CE2 . TRP A 1 243 ? 6.375   44.776 -34.279 1.00 157.71 ? 327 TRP A CE2 1 
ATOM   1882 C CE3 . TRP A 1 243 ? 6.321   46.218 -32.337 1.00 156.05 ? 327 TRP A CE3 1 
ATOM   1883 C CZ2 . TRP A 1 243 ? 7.691   45.140 -34.571 1.00 161.21 ? 327 TRP A CZ2 1 
ATOM   1884 C CZ3 . TRP A 1 243 ? 7.631   46.579 -32.630 1.00 156.98 ? 327 TRP A CZ3 1 
ATOM   1885 C CH2 . TRP A 1 243 ? 8.300   46.041 -33.737 1.00 159.30 ? 327 TRP A CH2 1 
ATOM   1886 N N   . VAL A 1 244 ? 0.400   46.270 -33.362 1.00 150.97 ? 328 VAL A N   1 
ATOM   1887 C CA  . VAL A 1 244 ? -1.053  46.391 -33.402 1.00 147.29 ? 328 VAL A CA  1 
ATOM   1888 C C   . VAL A 1 244 ? -1.712  45.288 -34.222 1.00 149.41 ? 328 VAL A C   1 
ATOM   1889 O O   . VAL A 1 244 ? -1.255  44.954 -35.313 1.00 151.85 ? 328 VAL A O   1 
ATOM   1890 C CB  . VAL A 1 244 ? -1.476  47.716 -34.072 1.00 146.64 ? 328 VAL A CB  1 
ATOM   1891 C CG1 . VAL A 1 244 ? -2.982  47.906 -33.987 1.00 148.39 ? 328 VAL A CG1 1 
ATOM   1892 C CG2 . VAL A 1 244 ? -0.755  48.891 -33.456 1.00 148.65 ? 328 VAL A CG2 1 
ATOM   1893 N N   . SER A 1 245 ? -2.801  44.736 -33.702 1.00 148.58 ? 329 SER A N   1 
ATOM   1894 C CA  . SER A 1 245 ? -3.691  43.927 -34.517 1.00 147.09 ? 329 SER A CA  1 
ATOM   1895 C C   . SER A 1 245 ? -4.939  44.745 -34.814 1.00 146.80 ? 329 SER A C   1 
ATOM   1896 O O   . SER A 1 245 ? -5.334  45.597 -34.020 1.00 146.44 ? 329 SER A O   1 
ATOM   1897 C CB  . SER A 1 245 ? -4.078  42.639 -33.798 1.00 145.79 ? 329 SER A CB  1 
ATOM   1898 O OG  . SER A 1 245 ? -5.045  41.932 -34.547 1.00 144.93 ? 329 SER A OG  1 
ATOM   1899 N N   . PHE A 1 246 ? -5.546  44.501 -35.968 1.00 147.42 ? 330 PHE A N   1 
ATOM   1900 C CA  . PHE A 1 246 ? -6.804  45.148 -36.314 1.00 147.01 ? 330 PHE A CA  1 
ATOM   1901 C C   . PHE A 1 246 ? -7.711  44.099 -36.924 1.00 148.69 ? 330 PHE A C   1 
ATOM   1902 O O   . PHE A 1 246 ? -7.439  43.598 -38.010 1.00 148.80 ? 330 PHE A O   1 
ATOM   1903 C CB  . PHE A 1 246 ? -6.578  46.295 -37.303 1.00 147.89 ? 330 PHE A CB  1 
ATOM   1904 C CG  . PHE A 1 246 ? -7.847  46.973 -37.748 1.00 151.32 ? 330 PHE A CG  1 
ATOM   1905 C CD1 . PHE A 1 246 ? -8.533  47.823 -36.894 1.00 152.74 ? 330 PHE A CD1 1 
ATOM   1906 C CD2 . PHE A 1 246 ? -8.356  46.765 -39.021 1.00 152.54 ? 330 PHE A CD2 1 
ATOM   1907 C CE1 . PHE A 1 246 ? -9.706  48.451 -37.299 1.00 152.72 ? 330 PHE A CE1 1 
ATOM   1908 C CE2 . PHE A 1 246 ? -9.527  47.397 -39.433 1.00 153.37 ? 330 PHE A CE2 1 
ATOM   1909 C CZ  . PHE A 1 246 ? -10.200 48.240 -38.569 1.00 152.18 ? 330 PHE A CZ  1 
ATOM   1910 N N   . GLY A 1 247 ? -8.775  43.739 -36.218 1.00 147.87 ? 331 GLY A N   1 
ATOM   1911 C CA  . GLY A 1 247 ? -9.643  42.682 -36.696 1.00 146.93 ? 331 GLY A CA  1 
ATOM   1912 C C   . GLY A 1 247 ? -8.868  41.395 -36.728 1.00 146.62 ? 331 GLY A C   1 
ATOM   1913 O O   . GLY A 1 247 ? -9.092  40.531 -37.567 1.00 147.65 ? 331 GLY A O   1 
ATOM   1914 N N   . ARG A 1 248 ? -7.914  41.297 -35.813 1.00 147.08 ? 332 ARG A N   1 
ATOM   1915 C CA  . ARG A 1 248 ? -7.168  40.064 -35.580 1.00 148.96 ? 332 ARG A CA  1 
ATOM   1916 C C   . ARG A 1 248 ? -6.177  39.737 -36.706 1.00 147.38 ? 332 ARG A C   1 
ATOM   1917 O O   . ARG A 1 248 ? -5.441  38.749 -36.625 1.00 146.84 ? 332 ARG A O   1 
ATOM   1918 C CB  . ARG A 1 248 ? -8.100  38.873 -35.260 1.00 151.04 ? 332 ARG A CB  1 
ATOM   1919 C CG  . ARG A 1 248 ? -9.112  39.118 -34.163 1.00 150.04 ? 332 ARG A CG  1 
ATOM   1920 C CD  . ARG A 1 248 ? -8.553  38.982 -32.842 1.00 151.16 ? 332 ARG A CD  1 
ATOM   1921 N NE  . ARG A 1 248 ? -9.558  39.156 -31.813 1.00 151.41 ? 332 ARG A NE  1 
ATOM   1922 C CZ  . ARG A 1 248 ? -9.819  40.325 -31.215 1.00 150.61 ? 332 ARG A CZ  1 
ATOM   1923 N NH1 . ARG A 1 248 ? -9.209  41.450 -31.610 1.00 148.85 ? 332 ARG A NH1 1 
ATOM   1924 N NH2 . ARG A 1 248 ? -10.696 40.396 -30.215 1.00 147.59 ? 332 ARG A NH2 1 
ATOM   1925 N N   . LYS A 1 249 ? -6.115  40.597 -37.723 1.00 145.71 ? 333 LYS A N   1 
ATOM   1926 C CA  . LYS A 1 249 ? -5.074  40.492 -38.745 1.00 144.89 ? 333 LYS A CA  1 
ATOM   1927 C C   . LYS A 1 249 ? -3.729  40.649 -38.048 1.00 147.81 ? 333 LYS A C   1 
ATOM   1928 O O   . LYS A 1 249 ? -3.570  41.540 -37.212 1.00 148.45 ? 333 LYS A O   1 
ATOM   1929 C CB  . LYS A 1 249 ? -5.237  41.570 -39.818 1.00 142.96 ? 333 LYS A CB  1 
ATOM   1930 C CG  . LYS A 1 249 ? -6.659  41.768 -40.310 1.00 142.56 ? 333 LYS A CG  1 
ATOM   1931 C CD  . LYS A 1 249 ? -6.706  42.845 -41.378 1.00 138.54 ? 333 LYS A CD  1 
ATOM   1932 C CE  . LYS A 1 249 ? -8.072  43.491 -41.448 1.00 141.88 ? 333 LYS A CE  1 
ATOM   1933 N NZ  . LYS A 1 249 ? -8.028  44.723 -42.280 1.00 144.93 ? 333 LYS A NZ  1 
ATOM   1934 N N   . PRO A 1 250 ? -2.761  39.783 -38.388 1.00 147.64 ? 334 PRO A N   1 
ATOM   1935 C CA  . PRO A 1 250 ? -1.494  39.646 -37.656 1.00 148.78 ? 334 PRO A CA  1 
ATOM   1936 C C   . PRO A 1 250 ? -0.854  40.985 -37.297 1.00 150.66 ? 334 PRO A C   1 
ATOM   1937 O O   . PRO A 1 250 ? -1.025  41.969 -38.019 1.00 149.25 ? 334 PRO A O   1 
ATOM   1938 C CB  . PRO A 1 250 ? -0.607  38.865 -38.632 1.00 151.28 ? 334 PRO A CB  1 
ATOM   1939 C CG  . PRO A 1 250 ? -1.298  38.967 -39.964 1.00 148.29 ? 334 PRO A CG  1 
ATOM   1940 C CD  . PRO A 1 250 ? -2.744  39.018 -39.644 1.00 147.49 ? 334 PRO A CD  1 
ATOM   1941 N N   . MET A 1 251 ? -0.124  41.010 -36.187 1.00 152.25 ? 335 MET A N   1 
ATOM   1942 C CA  . MET A 1 251 ? 0.325   42.266 -35.593 1.00 152.07 ? 335 MET A CA  1 
ATOM   1943 C C   . MET A 1 251 ? 1.570   42.860 -36.253 1.00 154.33 ? 335 MET A C   1 
ATOM   1944 O O   . MET A 1 251 ? 2.580   42.178 -36.433 1.00 154.47 ? 335 MET A O   1 
ATOM   1945 C CB  . MET A 1 251 ? 0.533   42.096 -34.084 1.00 151.40 ? 335 MET A CB  1 
ATOM   1946 C CG  . MET A 1 251 ? -0.681  41.523 -33.363 1.00 148.72 ? 335 MET A CG  1 
ATOM   1947 S SD  . MET A 1 251 ? -0.523  41.509 -31.567 1.00 146.38 ? 335 MET A SD  1 
ATOM   1948 C CE  . MET A 1 251 ? -0.404  43.264 -31.225 1.00 143.72 ? 335 MET A CE  1 
ATOM   1949 N N   . ARG A 1 252 ? 1.476   44.138 -36.612 1.00 154.79 ? 336 ARG A N   1 
ATOM   1950 C CA  . ARG A 1 252 ? 2.576   44.860 -37.244 1.00 157.36 ? 336 ARG A CA  1 
ATOM   1951 C C   . ARG A 1 252 ? 2.814   46.194 -36.545 1.00 156.16 ? 336 ARG A C   1 
ATOM   1952 O O   . ARG A 1 252 ? 1.869   46.841 -36.096 1.00 154.00 ? 336 ARG A O   1 
ATOM   1953 C CB  . ARG A 1 252 ? 2.274   45.114 -38.722 1.00 161.08 ? 336 ARG A CB  1 
ATOM   1954 C CG  . ARG A 1 252 ? 1.967   43.870 -39.542 1.00 161.29 ? 336 ARG A CG  1 
ATOM   1955 C CD  . ARG A 1 252 ? 1.842   44.227 -41.015 1.00 165.88 ? 336 ARG A CD  1 
ATOM   1956 N NE  . ARG A 1 252 ? 0.956   45.372 -41.217 1.00 170.88 ? 336 ARG A NE  1 
ATOM   1957 C CZ  . ARG A 1 252 ? 1.083   46.251 -42.207 1.00 172.11 ? 336 ARG A CZ  1 
ATOM   1958 N NH1 . ARG A 1 252 ? 0.229   47.262 -42.312 1.00 169.51 ? 336 ARG A NH1 1 
ATOM   1959 N NH2 . ARG A 1 252 ? 2.064   46.122 -43.090 1.00 172.93 ? 336 ARG A NH2 1 
ATOM   1960 N N   . ALA A 1 253 ? 4.077   46.609 -36.471 1.00 156.98 ? 337 ALA A N   1 
ATOM   1961 C CA  . ALA A 1 253 ? 4.445   47.847 -35.785 1.00 156.20 ? 337 ALA A CA  1 
ATOM   1962 C C   . ALA A 1 253 ? 3.864   49.087 -36.464 1.00 157.21 ? 337 ALA A C   1 
ATOM   1963 O O   . ALA A 1 253 ? 3.777   49.152 -37.689 1.00 157.98 ? 337 ALA A O   1 
ATOM   1964 C CB  . ALA A 1 253 ? 5.957   47.962 -35.672 1.00 155.45 ? 337 ALA A CB  1 
ATOM   1965 N N   . ALA A 1 254 ? 3.473   50.070 -35.658 1.00 155.93 ? 338 ALA A N   1 
ATOM   1966 C CA  . ALA A 1 254 ? 2.875   51.292 -36.182 1.00 156.43 ? 338 ALA A CA  1 
ATOM   1967 C C   . ALA A 1 254 ? 3.905   52.404 -36.335 1.00 157.16 ? 338 ALA A C   1 
ATOM   1968 O O   . ALA A 1 254 ? 4.786   52.578 -35.492 1.00 154.96 ? 338 ALA A O   1 
ATOM   1969 C CB  . ALA A 1 254 ? 1.728   51.748 -35.293 1.00 156.76 ? 338 ALA A CB  1 
ATOM   1970 N N   . GLN A 1 255 ? 3.786   53.153 -37.425 1.00 159.75 ? 339 GLN A N   1 
ATOM   1971 C CA  . GLN A 1 255 ? 4.667   54.282 -37.675 1.00 161.66 ? 339 GLN A CA  1 
ATOM   1972 C C   . GLN A 1 255 ? 4.311   55.444 -36.760 1.00 162.01 ? 339 GLN A C   1 
ATOM   1973 O O   . GLN A 1 255 ? 3.136   55.762 -36.568 1.00 159.85 ? 339 GLN A O   1 
ATOM   1974 C CB  . GLN A 1 255 ? 4.568   54.737 -39.132 1.00 164.13 ? 339 GLN A CB  1 
ATOM   1975 C CG  . GLN A 1 255 ? 5.082   53.736 -40.149 1.00 166.99 ? 339 GLN A CG  1 
ATOM   1976 C CD  . GLN A 1 255 ? 4.800   54.169 -41.579 1.00 168.25 ? 339 GLN A CD  1 
ATOM   1977 O OE1 . GLN A 1 255 ? 4.057   55.124 -41.815 1.00 165.10 ? 339 GLN A OE1 1 
ATOM   1978 N NE2 . GLN A 1 255 ? 5.392   53.466 -42.540 1.00 169.39 ? 339 GLN A NE2 1 
ATOM   1979 N N   . PHE A 1 256 ? 5.341   56.069 -36.201 1.00 164.10 ? 340 PHE A N   1 
ATOM   1980 C CA  . PHE A 1 256 ? 5.181   57.248 -35.362 1.00 163.47 ? 340 PHE A CA  1 
ATOM   1981 C C   . PHE A 1 256 ? 6.019   58.394 -35.910 1.00 165.56 ? 340 PHE A C   1 
ATOM   1982 O O   . PHE A 1 256 ? 7.186   58.210 -36.254 1.00 168.39 ? 340 PHE A O   1 
ATOM   1983 C CB  . PHE A 1 256 ? 5.612   56.946 -33.926 1.00 164.11 ? 340 PHE A CB  1 
ATOM   1984 C CG  . PHE A 1 256 ? 4.588   56.194 -33.128 1.00 161.82 ? 340 PHE A CG  1 
ATOM   1985 C CD1 . PHE A 1 256 ? 3.656   56.876 -32.360 1.00 159.64 ? 340 PHE A CD1 1 
ATOM   1986 C CD2 . PHE A 1 256 ? 4.560   54.807 -33.137 1.00 159.61 ? 340 PHE A CD2 1 
ATOM   1987 C CE1 . PHE A 1 256 ? 2.713   56.193 -31.620 1.00 158.93 ? 340 PHE A CE1 1 
ATOM   1988 C CE2 . PHE A 1 256 ? 3.618   54.117 -32.399 1.00 159.18 ? 340 PHE A CE2 1 
ATOM   1989 C CZ  . PHE A 1 256 ? 2.694   54.810 -31.639 1.00 158.23 ? 340 PHE A CZ  1 
ATOM   1990 N N   . VAL A 1 257 ? 5.426   59.578 -35.986 1.00 165.76 ? 341 VAL A N   1 
ATOM   1991 C CA  . VAL A 1 257 ? 6.148   60.747 -36.470 1.00 169.54 ? 341 VAL A CA  1 
ATOM   1992 C C   . VAL A 1 257 ? 6.790   61.536 -35.325 1.00 169.15 ? 341 VAL A C   1 
ATOM   1993 O O   . VAL A 1 257 ? 6.174   62.426 -34.738 1.00 166.93 ? 341 VAL A O   1 
ATOM   1994 C CB  . VAL A 1 257 ? 5.248   61.658 -37.342 1.00 168.31 ? 341 VAL A CB  1 
ATOM   1995 C CG1 . VAL A 1 257 ? 5.192   61.135 -38.767 1.00 166.95 ? 341 VAL A CG1 1 
ATOM   1996 C CG2 . VAL A 1 257 ? 3.848   61.760 -36.754 1.00 163.36 ? 341 VAL A CG2 1 
ATOM   1997 N N   . THR A 1 258 ? 8.036   61.196 -35.010 1.00 170.22 ? 342 THR A N   1 
ATOM   1998 C CA  . THR A 1 258 ? 8.755   61.846 -33.921 1.00 173.70 ? 342 THR A CA  1 
ATOM   1999 C C   . THR A 1 258 ? 10.218  62.107 -34.258 1.00 178.78 ? 342 THR A C   1 
ATOM   2000 O O   . THR A 1 258 ? 10.798  61.445 -35.119 1.00 181.76 ? 342 THR A O   1 
ATOM   2001 C CB  . THR A 1 258 ? 8.726   60.988 -32.644 1.00 171.57 ? 342 THR A CB  1 
ATOM   2002 O OG1 . THR A 1 258 ? 9.007   59.624 -32.981 1.00 170.79 ? 342 THR A OG1 1 
ATOM   2003 C CG2 . THR A 1 258 ? 7.374   61.064 -31.976 1.00 166.24 ? 342 THR A CG2 1 
ATOM   2004 N N   . ARG A 1 259 ? 10.806  63.079 -33.567 1.00 178.64 ? 343 ARG A N   1 
ATOM   2005 C CA  . ARG A 1 259 ? 12.249  63.276 -33.583 1.00 181.26 ? 343 ARG A CA  1 
ATOM   2006 C C   . ARG A 1 259 ? 12.822  62.816 -32.251 1.00 181.15 ? 343 ARG A C   1 
ATOM   2007 O O   . ARG A 1 259 ? 13.993  62.447 -32.157 1.00 183.47 ? 343 ARG A O   1 
ATOM   2008 C CB  . ARG A 1 259 ? 12.605  64.742 -33.820 1.00 187.22 ? 343 ARG A CB  1 
ATOM   2009 C CG  . ARG A 1 259 ? 12.538  65.175 -35.270 1.00 193.05 ? 343 ARG A CG  1 
ATOM   2010 C CD  . ARG A 1 259 ? 13.188  66.533 -35.448 1.00 198.68 ? 343 ARG A CD  1 
ATOM   2011 N NE  . ARG A 1 259 ? 13.087  67.016 -36.821 1.00 203.46 ? 343 ARG A NE  1 
ATOM   2012 C CZ  . ARG A 1 259 ? 13.573  68.181 -37.235 1.00 206.11 ? 343 ARG A CZ  1 
ATOM   2013 N NH1 . ARG A 1 259 ? 14.195  68.981 -36.380 1.00 207.74 ? 343 ARG A NH1 1 
ATOM   2014 N NH2 . ARG A 1 259 ? 13.437  68.547 -38.501 1.00 207.77 ? 343 ARG A NH2 1 
ATOM   2015 N N   . HIS A 1 260 ? 11.984  62.844 -31.220 1.00 178.21 ? 344 HIS A N   1 
ATOM   2016 C CA  . HIS A 1 260 ? 12.379  62.393 -29.892 1.00 174.64 ? 344 HIS A CA  1 
ATOM   2017 C C   . HIS A 1 260 ? 12.090  60.899 -29.711 1.00 171.49 ? 344 HIS A C   1 
ATOM   2018 O O   . HIS A 1 260 ? 11.127  60.376 -30.276 1.00 169.13 ? 344 HIS A O   1 
ATOM   2019 C CB  . HIS A 1 260 ? 11.667  63.226 -28.823 1.00 172.78 ? 344 HIS A CB  1 
ATOM   2020 C CG  . HIS A 1 260 ? 12.148  64.644 -28.743 1.00 176.47 ? 344 HIS A CG  1 
ATOM   2021 N ND1 . HIS A 1 260 ? 13.119  65.048 -27.858 1.00 177.16 ? 344 HIS A ND1 1 
ATOM   2022 C CD2 . HIS A 1 260 ? 11.788  65.746 -29.446 1.00 176.91 ? 344 HIS A CD2 1 
ATOM   2023 C CE1 . HIS A 1 260 ? 13.341  66.346 -28.014 1.00 177.17 ? 344 HIS A CE1 1 
ATOM   2024 N NE2 . HIS A 1 260 ? 12.548  66.790 -28.967 1.00 177.26 ? 344 HIS A NE2 1 
ATOM   2025 N N   . PRO A 1 261 ? 12.935  60.204 -28.927 1.00 170.82 ? 345 PRO A N   1 
ATOM   2026 C CA  . PRO A 1 261 ? 12.775  58.764 -28.696 1.00 166.83 ? 345 PRO A CA  1 
ATOM   2027 C C   . PRO A 1 261 ? 11.576  58.485 -27.798 1.00 164.65 ? 345 PRO A C   1 
ATOM   2028 O O   . PRO A 1 261 ? 11.170  59.354 -27.029 1.00 164.32 ? 345 PRO A O   1 
ATOM   2029 C CB  . PRO A 1 261 ? 14.070  58.389 -27.972 1.00 164.08 ? 345 PRO A CB  1 
ATOM   2030 C CG  . PRO A 1 261 ? 14.437  59.628 -27.229 1.00 166.26 ? 345 PRO A CG  1 
ATOM   2031 C CD  . PRO A 1 261 ? 14.059  60.760 -28.150 1.00 171.30 ? 345 PRO A CD  1 
ATOM   2032 N N   . ILE A 1 262 ? 11.019  57.284 -27.893 1.00 161.53 ? 346 ILE A N   1 
ATOM   2033 C CA  . ILE A 1 262 ? 9.838   56.926 -27.118 1.00 158.89 ? 346 ILE A CA  1 
ATOM   2034 C C   . ILE A 1 262 ? 10.177  55.934 -26.012 1.00 156.66 ? 346 ILE A C   1 
ATOM   2035 O O   . ILE A 1 262 ? 10.899  54.965 -26.237 1.00 155.48 ? 346 ILE A O   1 
ATOM   2036 C CB  . ILE A 1 262 ? 8.745   56.336 -28.030 1.00 159.86 ? 346 ILE A CB  1 
ATOM   2037 C CG1 . ILE A 1 262 ? 8.368   57.344 -29.121 1.00 160.85 ? 346 ILE A CG1 1 
ATOM   2038 C CG2 . ILE A 1 262 ? 7.535   55.891 -27.215 1.00 156.81 ? 346 ILE A CG2 1 
ATOM   2039 C CD1 . ILE A 1 262 ? 7.197   56.942 -29.983 1.00 157.20 ? 346 ILE A CD1 1 
ATOM   2040 N N   . ASN A 1 263 ? 9.649   56.175 -24.817 1.00 156.84 ? 347 ASN A N   1 
ATOM   2041 C CA  . ASN A 1 263 ? 9.963   55.333 -23.669 1.00 156.25 ? 347 ASN A CA  1 
ATOM   2042 C C   . ASN A 1 263 ? 8.798   54.456 -23.188 1.00 155.40 ? 347 ASN A C   1 
ATOM   2043 O O   . ASN A 1 263 ? 8.988   53.287 -22.839 1.00 150.60 ? 347 ASN A O   1 
ATOM   2044 C CB  . ASN A 1 263 ? 10.487  56.199 -22.521 1.00 155.13 ? 347 ASN A CB  1 
ATOM   2045 C CG  . ASN A 1 263 ? 10.972  55.379 -21.346 1.00 155.12 ? 347 ASN A CG  1 
ATOM   2046 O OD1 . ASN A 1 263 ? 11.300  54.202 -21.488 1.00 156.47 ? 347 ASN A OD1 1 
ATOM   2047 N ND2 . ASN A 1 263 ? 11.024  56.000 -20.174 1.00 157.07 ? 347 ASN A ND2 1 
ATOM   2048 N N   . GLU A 1 264 ? 7.594   55.022 -23.176 1.00 155.53 ? 348 GLU A N   1 
ATOM   2049 C CA  . GLU A 1 264 ? 6.436   54.347 -22.597 1.00 151.80 ? 348 GLU A CA  1 
ATOM   2050 C C   . GLU A 1 264 ? 5.196   54.502 -23.468 1.00 150.13 ? 348 GLU A C   1 
ATOM   2051 O O   . GLU A 1 264 ? 4.949   55.570 -24.023 1.00 150.29 ? 348 GLU A O   1 
ATOM   2052 C CB  . GLU A 1 264 ? 6.159   54.903 -21.200 1.00 153.30 ? 348 GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 264 ? 5.040   54.223 -20.451 1.00 151.64 ? 348 GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 264 ? 5.523   53.075 -19.594 1.00 152.67 ? 348 GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 264 ? 5.839   53.312 -18.413 1.00 152.77 ? 348 GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 264 ? 5.589   51.935 -20.099 1.00 152.08 ? 348 GLU A OE2 1 
ATOM   2057 N N   . TYR A 1 265 ? 4.418   53.427 -23.575 1.00 151.27 ? 349 TYR A N   1 
ATOM   2058 C CA  . TYR A 1 265 ? 3.177   53.427 -24.350 1.00 149.27 ? 349 TYR A CA  1 
ATOM   2059 C C   . TYR A 1 265 ? 1.951   53.224 -23.455 1.00 147.66 ? 349 TYR A C   1 
ATOM   2060 O O   . TYR A 1 265 ? 2.010   52.501 -22.459 1.00 149.38 ? 349 TYR A O   1 
ATOM   2061 C CB  . TYR A 1 265 ? 3.229   52.339 -25.424 1.00 147.83 ? 349 TYR A CB  1 
ATOM   2062 C CG  . TYR A 1 265 ? 3.919   52.763 -26.701 1.00 150.13 ? 349 TYR A CG  1 
ATOM   2063 C CD1 . TYR A 1 265 ? 3.698   54.022 -27.245 1.00 151.97 ? 349 TYR A CD1 1 
ATOM   2064 C CD2 . TYR A 1 265 ? 4.791   51.907 -27.363 1.00 150.37 ? 349 TYR A CD2 1 
ATOM   2065 C CE1 . TYR A 1 265 ? 4.321   54.417 -28.414 1.00 152.72 ? 349 TYR A CE1 1 
ATOM   2066 C CE2 . TYR A 1 265 ? 5.421   52.294 -28.533 1.00 152.32 ? 349 TYR A CE2 1 
ATOM   2067 C CZ  . TYR A 1 265 ? 5.181   53.551 -29.053 1.00 154.45 ? 349 TYR A CZ  1 
ATOM   2068 O OH  . TYR A 1 265 ? 5.802   53.945 -30.215 1.00 157.88 ? 349 TYR A OH  1 
ATOM   2069 N N   . TYR A 1 266 ? 0.842   53.863 -23.810 1.00 143.19 ? 350 TYR A N   1 
ATOM   2070 C CA  . TYR A 1 266 ? -0.389  53.721 -23.043 1.00 142.48 ? 350 TYR A CA  1 
ATOM   2071 C C   . TYR A 1 266 ? -1.595  53.948 -23.934 1.00 143.03 ? 350 TYR A C   1 
ATOM   2072 O O   . TYR A 1 266 ? -1.683  54.973 -24.607 1.00 143.72 ? 350 TYR A O   1 
ATOM   2073 C CB  . TYR A 1 266 ? -0.416  54.709 -21.879 1.00 142.54 ? 350 TYR A CB  1 
ATOM   2074 C CG  . TYR A 1 266 ? -1.679  54.648 -21.052 1.00 140.58 ? 350 TYR A CG  1 
ATOM   2075 C CD1 . TYR A 1 266 ? -1.853  53.664 -20.088 1.00 141.20 ? 350 TYR A CD1 1 
ATOM   2076 C CD2 . TYR A 1 266 ? -2.695  55.578 -21.229 1.00 139.81 ? 350 TYR A CD2 1 
ATOM   2077 C CE1 . TYR A 1 266 ? -3.006  53.604 -19.327 1.00 142.28 ? 350 TYR A CE1 1 
ATOM   2078 C CE2 . TYR A 1 266 ? -3.853  55.525 -20.472 1.00 140.08 ? 350 TYR A CE2 1 
ATOM   2079 C CZ  . TYR A 1 266 ? -4.002  54.536 -19.522 1.00 140.20 ? 350 TYR A CZ  1 
ATOM   2080 O OH  . TYR A 1 266 ? -5.148  54.476 -18.765 1.00 137.77 ? 350 TYR A OH  1 
ATOM   2081 N N   . ILE A 1 267 ? -2.526  52.995 -23.932 1.00 142.96 ? 351 ILE A N   1 
ATOM   2082 C CA  . ILE A 1 267 ? -3.718  53.100 -24.769 1.00 142.27 ? 351 ILE A CA  1 
ATOM   2083 C C   . ILE A 1 267 ? -4.838  53.831 -24.045 1.00 141.15 ? 351 ILE A C   1 
ATOM   2084 O O   . ILE A 1 267 ? -5.452  53.301 -23.118 1.00 141.23 ? 351 ILE A O   1 
ATOM   2085 C CB  . ILE A 1 267 ? -4.216  51.728 -25.224 1.00 141.51 ? 351 ILE A CB  1 
ATOM   2086 C CG1 . ILE A 1 267 ? -3.038  50.869 -25.684 1.00 142.12 ? 351 ILE A CG1 1 
ATOM   2087 C CG2 . ILE A 1 267 ? -5.245  51.885 -26.334 1.00 140.52 ? 351 ILE A CG2 1 
ATOM   2088 C CD1 . ILE A 1 267 ? -2.278  51.450 -26.849 1.00 142.21 ? 351 ILE A CD1 1 
ATOM   2089 N N   . ALA A 1 268 ? -5.102  55.054 -24.486 1.00 140.26 ? 352 ALA A N   1 
ATOM   2090 C CA  . ALA A 1 268 ? -6.008  55.949 -23.782 1.00 140.66 ? 352 ALA A CA  1 
ATOM   2091 C C   . ALA A 1 268 ? -7.477  55.648 -24.058 1.00 142.67 ? 352 ALA A C   1 
ATOM   2092 O O   . ALA A 1 268 ? -8.316  55.718 -23.157 1.00 144.90 ? 352 ALA A O   1 
ATOM   2093 C CB  . ALA A 1 268 ? -5.689  57.381 -24.139 1.00 140.52 ? 352 ALA A CB  1 
ATOM   2094 N N   . ASP A 1 269 ? -7.785  55.332 -25.310 1.00 141.22 ? 353 ASP A N   1 
ATOM   2095 C CA  . ASP A 1 269 ? -9.139  54.975 -25.707 1.00 140.76 ? 353 ASP A CA  1 
ATOM   2096 C C   . ASP A 1 269 ? -9.108  54.159 -26.995 1.00 144.14 ? 353 ASP A C   1 
ATOM   2097 O O   . ASP A 1 269 ? -8.377  54.480 -27.931 1.00 146.48 ? 353 ASP A O   1 
ATOM   2098 C CB  . ASP A 1 269 ? -9.996  56.229 -25.886 1.00 138.25 ? 353 ASP A CB  1 
ATOM   2099 C CG  . ASP A 1 269 ? -11.348 55.932 -26.509 1.00 139.77 ? 353 ASP A CG  1 
ATOM   2100 O OD1 . ASP A 1 269 ? -11.953 56.859 -27.080 1.00 135.98 ? 353 ASP A OD1 1 
ATOM   2101 O OD2 . ASP A 1 269 ? -11.814 54.777 -26.436 1.00 143.18 ? 353 ASP A OD2 1 
ATOM   2102 N N   . ALA A 1 270 ? -9.912  53.104 -27.038 1.00 143.07 ? 354 ALA A N   1 
ATOM   2103 C CA  . ALA A 1 270 ? -9.979  52.259 -28.217 1.00 143.52 ? 354 ALA A CA  1 
ATOM   2104 C C   . ALA A 1 270 ? -11.401 52.122 -28.748 1.00 149.55 ? 354 ALA A C   1 
ATOM   2105 O O   . ALA A 1 270 ? -12.301 51.629 -28.066 1.00 150.30 ? 354 ALA A O   1 
ATOM   2106 C CB  . ALA A 1 270 ? -9.384  50.899 -27.932 1.00 141.27 ? 354 ALA A CB  1 
ATOM   2107 N N   . SER A 1 271 ? -11.583 52.597 -29.972 1.00 153.77 ? 355 SER A N   1 
ATOM   2108 C CA  . SER A 1 271 ? -12.787 52.382 -30.753 1.00 153.84 ? 355 SER A CA  1 
ATOM   2109 C C   . SER A 1 271 ? -12.281 52.062 -32.145 1.00 158.23 ? 355 SER A C   1 
ATOM   2110 O O   . SER A 1 271 ? -11.176 52.471 -32.507 1.00 159.40 ? 355 SER A O   1 
ATOM   2111 C CB  . SER A 1 271 ? -13.636 53.651 -30.781 1.00 152.68 ? 355 SER A CB  1 
ATOM   2112 O OG  . SER A 1 271 ? -14.388 53.749 -31.979 1.00 152.37 ? 355 SER A OG  1 
ATOM   2113 N N   . GLU A 1 272 ? -13.062 51.326 -32.925 1.00 160.22 ? 356 GLU A N   1 
ATOM   2114 C CA  . GLU A 1 272 ? -12.635 50.988 -34.280 1.00 161.69 ? 356 GLU A CA  1 
ATOM   2115 C C   . GLU A 1 272 ? -12.260 52.238 -35.083 1.00 161.34 ? 356 GLU A C   1 
ATOM   2116 O O   . GLU A 1 272 ? -12.946 53.255 -35.007 1.00 161.17 ? 356 GLU A O   1 
ATOM   2117 C CB  . GLU A 1 272 ? -13.714 50.192 -35.015 1.00 163.00 ? 356 GLU A CB  1 
ATOM   2118 C CG  . GLU A 1 272 ? -13.997 48.820 -34.431 1.00 163.21 ? 356 GLU A CG  1 
ATOM   2119 C CD  . GLU A 1 272 ? -15.111 48.104 -35.171 1.00 166.91 ? 356 GLU A CD  1 
ATOM   2120 O OE1 . GLU A 1 272 ? -15.750 48.739 -36.040 1.00 169.10 ? 356 GLU A OE1 1 
ATOM   2121 O OE2 . GLU A 1 272 ? -15.345 46.909 -34.885 1.00 164.73 ? 356 GLU A OE2 1 
ATOM   2122 N N   . ASP A 1 273 ? -11.144 52.147 -35.803 1.00 160.78 ? 357 ASP A N   1 
ATOM   2123 C CA  . ASP A 1 273 ? -10.685 53.153 -36.774 1.00 161.05 ? 357 ASP A CA  1 
ATOM   2124 C C   . ASP A 1 273 ? -9.930  54.368 -36.214 1.00 158.78 ? 357 ASP A C   1 
ATOM   2125 O O   . ASP A 1 273 ? -9.270  55.068 -36.970 1.00 160.20 ? 357 ASP A O   1 
ATOM   2126 C CB  . ASP A 1 273 ? -11.795 53.561 -37.769 1.00 160.92 ? 357 ASP A CB  1 
ATOM   2127 C CG  . ASP A 1 273 ? -12.485 54.865 -37.398 1.00 162.20 ? 357 ASP A CG  1 
ATOM   2128 O OD1 . ASP A 1 273 ? -11.874 55.943 -37.556 1.00 161.69 ? 357 ASP A OD1 1 
ATOM   2129 O OD2 . ASP A 1 273 ? -13.662 54.818 -36.987 1.00 163.33 ? 357 ASP A OD2 1 
ATOM   2130 N N   . GLN A 1 274 ? -10.031 54.620 -34.912 1.00 155.00 ? 358 GLN A N   1 
ATOM   2131 C CA  . GLN A 1 274 ? -9.290  55.711 -34.277 1.00 153.56 ? 358 GLN A CA  1 
ATOM   2132 C C   . GLN A 1 274 ? -8.805  55.235 -32.922 1.00 152.82 ? 358 GLN A C   1 
ATOM   2133 O O   . GLN A 1 274 ? -9.602  54.812 -32.092 1.00 152.98 ? 358 GLN A O   1 
ATOM   2134 C CB  . GLN A 1 274 ? -10.168 56.953 -34.068 1.00 152.71 ? 358 GLN A CB  1 
ATOM   2135 C CG  . GLN A 1 274 ? -10.671 57.668 -35.327 1.00 153.99 ? 358 GLN A CG  1 
ATOM   2136 C CD  . GLN A 1 274 ? -9.577  58.365 -36.117 1.00 157.11 ? 358 GLN A CD  1 
ATOM   2137 O OE1 . GLN A 1 274 ? -8.675  57.718 -36.618 1.00 160.13 ? 358 GLN A OE1 1 
ATOM   2138 N NE2 . GLN A 1 274 ? -9.672  59.680 -36.253 1.00 153.48 ? 358 GLN A NE2 1 
ATOM   2139 N N   . VAL A 1 275 ? -7.501  55.299 -32.690 1.00 151.79 ? 359 VAL A N   1 
ATOM   2140 C CA  . VAL A 1 275 ? -6.963  54.903 -31.398 1.00 149.37 ? 359 VAL A CA  1 
ATOM   2141 C C   . VAL A 1 275 ? -6.223  56.074 -30.776 1.00 147.28 ? 359 VAL A C   1 
ATOM   2142 O O   . VAL A 1 275 ? -5.515  56.805 -31.464 1.00 148.78 ? 359 VAL A O   1 
ATOM   2143 C CB  . VAL A 1 275 ? -6.024  53.684 -31.520 1.00 146.16 ? 359 VAL A CB  1 
ATOM   2144 C CG1 . VAL A 1 275 ? -5.484  53.275 -30.155 1.00 145.01 ? 359 VAL A CG1 1 
ATOM   2145 C CG2 . VAL A 1 275 ? -6.758  52.529 -32.160 1.00 146.18 ? 359 VAL A CG2 1 
ATOM   2146 N N   . PHE A 1 276 ? -6.411  56.269 -29.478 1.00 144.35 ? 360 PHE A N   1 
ATOM   2147 C CA  . PHE A 1 276 ? -5.693  57.313 -28.767 1.00 142.45 ? 360 PHE A CA  1 
ATOM   2148 C C   . PHE A 1 276 ? -4.600  56.700 -27.917 1.00 144.46 ? 360 PHE A C   1 
ATOM   2149 O O   . PHE A 1 276 ? -4.871  55.860 -27.058 1.00 144.53 ? 360 PHE A O   1 
ATOM   2150 C CB  . PHE A 1 276 ? -6.649  58.136 -27.912 1.00 140.52 ? 360 PHE A CB  1 
ATOM   2151 C CG  . PHE A 1 276 ? -7.425  59.140 -28.698 1.00 142.51 ? 360 PHE A CG  1 
ATOM   2152 C CD1 . PHE A 1 276 ? -8.443  58.734 -29.547 1.00 142.69 ? 360 PHE A CD1 1 
ATOM   2153 C CD2 . PHE A 1 276 ? -7.126  60.488 -28.610 1.00 143.06 ? 360 PHE A CD2 1 
ATOM   2154 C CE1 . PHE A 1 276 ? -9.155  59.656 -30.287 1.00 140.85 ? 360 PHE A CE1 1 
ATOM   2155 C CE2 . PHE A 1 276 ? -7.835  61.418 -29.346 1.00 142.39 ? 360 PHE A CE2 1 
ATOM   2156 C CZ  . PHE A 1 276 ? -8.850  60.999 -30.185 1.00 140.83 ? 360 PHE A CZ  1 
ATOM   2157 N N   . VAL A 1 277 ? -3.361  57.108 -28.172 1.00 145.30 ? 361 VAL A N   1 
ATOM   2158 C CA  . VAL A 1 277 ? -2.221  56.566 -27.448 1.00 143.67 ? 361 VAL A CA  1 
ATOM   2159 C C   . VAL A 1 277 ? -1.380  57.673 -26.852 1.00 143.49 ? 361 VAL A C   1 
ATOM   2160 O O   . VAL A 1 277 ? -0.967  58.599 -27.548 1.00 144.67 ? 361 VAL A O   1 
ATOM   2161 C CB  . VAL A 1 277 ? -1.312  55.711 -28.351 1.00 143.53 ? 361 VAL A CB  1 
ATOM   2162 C CG1 . VAL A 1 277 ? -0.161  55.145 -27.542 1.00 143.30 ? 361 VAL A CG1 1 
ATOM   2163 C CG2 . VAL A 1 277 ? -2.102  54.592 -29.002 1.00 144.23 ? 361 VAL A CG2 1 
ATOM   2164 N N   . CYS A 1 278 ? -1.136  57.575 -25.553 1.00 143.73 ? 362 CYS A N   1 
ATOM   2165 C CA  . CYS A 1 278 ? -0.198  58.464 -24.902 1.00 143.30 ? 362 CYS A CA  1 
ATOM   2166 C C   . CYS A 1 278 ? 1.208   57.947 -25.108 1.00 145.40 ? 362 CYS A C   1 
ATOM   2167 O O   . CYS A 1 278 ? 1.470   56.750 -24.994 1.00 145.52 ? 362 CYS A O   1 
ATOM   2168 C CB  . CYS A 1 278 ? -0.508  58.601 -23.417 1.00 142.86 ? 362 CYS A CB  1 
ATOM   2169 S SG  . CYS A 1 278 ? -1.716  59.883 -23.089 1.00 143.53 ? 362 CYS A SG  1 
ATOM   2170 N N   . VAL A 1 279 ? 2.108   58.867 -25.427 1.00 149.54 ? 363 VAL A N   1 
ATOM   2171 C CA  . VAL A 1 279 ? 3.505   58.540 -25.654 1.00 149.64 ? 363 VAL A CA  1 
ATOM   2172 C C   . VAL A 1 279 ? 4.378   59.400 -24.751 1.00 149.37 ? 363 VAL A C   1 
ATOM   2173 O O   . VAL A 1 279 ? 4.426   60.617 -24.908 1.00 151.56 ? 363 VAL A O   1 
ATOM   2174 C CB  . VAL A 1 279 ? 3.883   58.781 -27.126 1.00 149.66 ? 363 VAL A CB  1 
ATOM   2175 C CG1 . VAL A 1 279 ? 5.385   58.727 -27.310 1.00 154.58 ? 363 VAL A CG1 1 
ATOM   2176 C CG2 . VAL A 1 279 ? 3.190   57.768 -28.023 1.00 148.68 ? 363 VAL A CG2 1 
ATOM   2177 N N   . SER A 1 280 ? 5.056   58.768 -23.800 1.00 150.07 ? 364 SER A N   1 
ATOM   2178 C CA  . SER A 1 280 ? 5.912   59.493 -22.871 1.00 153.71 ? 364 SER A CA  1 
ATOM   2179 C C   . SER A 1 280 ? 7.374   59.299 -23.247 1.00 156.69 ? 364 SER A C   1 
ATOM   2180 O O   . SER A 1 280 ? 7.856   58.171 -23.363 1.00 154.95 ? 364 SER A O   1 
ATOM   2181 C CB  . SER A 1 280 ? 5.673   59.029 -21.435 1.00 153.22 ? 364 SER A CB  1 
ATOM   2182 O OG  . SER A 1 280 ? 6.370   57.829 -21.167 1.00 152.99 ? 364 SER A OG  1 
ATOM   2183 N N   . HIS A 1 281 ? 8.080   60.405 -23.431 1.00 158.52 ? 365 HIS A N   1 
ATOM   2184 C CA  . HIS A 1 281 ? 9.444   60.343 -23.924 0.50 160.18 ? 365 HIS A CA  1 
ATOM   2185 C C   . HIS A 1 281 ? 10.488  60.340 -22.815 1.00 162.42 ? 365 HIS A C   1 
ATOM   2186 O O   . HIS A 1 281 ? 10.162  60.396 -21.628 1.00 162.49 ? 365 HIS A O   1 
ATOM   2187 C CB  . HIS A 1 281 ? 9.706   61.487 -24.903 1.00 160.90 ? 365 HIS A CB  1 
ATOM   2188 C CG  . HIS A 1 281 ? 9.021   61.319 -26.222 1.00 161.02 ? 365 HIS A CG  1 
ATOM   2189 N ND1 . HIS A 1 281 ? 9.169   60.189 -26.994 1.00 163.04 ? 365 HIS A ND1 1 
ATOM   2190 C CD2 . HIS A 1 281 ? 8.191   62.139 -26.910 1.00 160.02 ? 365 HIS A CD2 1 
ATOM   2191 C CE1 . HIS A 1 281 ? 8.462   60.320 -28.102 1.00 163.33 ? 365 HIS A CE1 1 
ATOM   2192 N NE2 . HIS A 1 281 ? 7.855   61.492 -28.074 1.00 161.15 ? 365 HIS A NE2 1 
ATOM   2193 N N   . SER A 1 282 ? 11.746  60.255 -23.235 1.00 164.00 ? 366 SER A N   1 
ATOM   2194 C CA  . SER A 1 282 ? 12.901  60.308 -22.349 1.00 164.42 ? 366 SER A CA  1 
ATOM   2195 C C   . SER A 1 282 ? 12.863  61.535 -21.445 1.00 163.87 ? 366 SER A C   1 
ATOM   2196 O O   . SER A 1 282 ? 13.195  61.464 -20.261 1.00 163.02 ? 366 SER A O   1 
ATOM   2197 C CB  . SER A 1 282 ? 14.168  60.354 -23.198 1.00 162.48 ? 366 SER A CB  1 
ATOM   2198 O OG  . SER A 1 282 ? 14.004  61.267 -24.273 1.00 160.22 ? 366 SER A OG  1 
ATOM   2199 N N   . ASN A 1 283 ? 12.455  62.659 -22.026 1.00 162.98 ? 367 ASN A N   1 
ATOM   2200 C CA  . ASN A 1 283 ? 12.400  63.949 -21.342 1.00 163.55 ? 367 ASN A CA  1 
ATOM   2201 C C   . ASN A 1 283 ? 11.325  63.989 -20.257 1.00 164.38 ? 367 ASN A C   1 
ATOM   2202 O O   . ASN A 1 283 ? 11.246  64.952 -19.495 1.00 163.97 ? 367 ASN A O   1 
ATOM   2203 C CB  . ASN A 1 283 ? 12.082  65.029 -22.368 1.00 162.52 ? 367 ASN A CB  1 
ATOM   2204 C CG  . ASN A 1 283 ? 10.853  64.688 -23.172 1.00 163.84 ? 367 ASN A CG  1 
ATOM   2205 O OD1 . ASN A 1 283 ? 10.158  63.726 -22.858 1.00 164.50 ? 367 ASN A OD1 1 
ATOM   2206 N ND2 . ASN A 1 283 ? 10.584  65.449 -24.215 1.00 166.40 ? 367 ASN A ND2 1 
ATOM   2207 N N   . ASN A 1 284 ? 10.482  62.957 -20.227 1.00 164.81 ? 368 ASN A N   1 
ATOM   2208 C CA  . ASN A 1 284 ? 9.275   62.919 -19.392 1.00 163.00 ? 368 ASN A CA  1 
ATOM   2209 C C   . ASN A 1 284 ? 8.141   63.829 -19.886 1.00 160.81 ? 368 ASN A C   1 
ATOM   2210 O O   . ASN A 1 284 ? 7.231   64.162 -19.126 1.00 161.92 ? 368 ASN A O   1 
ATOM   2211 C CB  . ASN A 1 284 ? 9.589   63.176 -17.909 1.00 163.85 ? 368 ASN A CB  1 
ATOM   2212 C CG  . ASN A 1 284 ? 10.551  62.155 -17.330 1.00 166.83 ? 368 ASN A CG  1 
ATOM   2213 O OD1 . ASN A 1 284 ? 10.549  60.988 -17.724 1.00 167.76 ? 368 ASN A OD1 1 
ATOM   2214 N ND2 . ASN A 1 284 ? 11.378  62.590 -16.385 1.00 167.52 ? 368 ASN A ND2 1 
ATOM   2215 N N   . ARG A 1 285 ? 8.213   64.232 -21.156 1.00 160.19 ? 369 ARG A N   1 
ATOM   2216 C CA  . ARG A 1 285 ? 7.099   64.885 -21.848 1.00 159.27 ? 369 ARG A CA  1 
ATOM   2217 C C   . ARG A 1 285 ? 6.207   63.788 -22.424 1.00 157.85 ? 369 ARG A C   1 
ATOM   2218 O O   . ARG A 1 285 ? 6.706   62.766 -22.896 1.00 157.03 ? 369 ARG A O   1 
ATOM   2219 C CB  . ARG A 1 285 ? 7.593   65.809 -22.978 1.00 161.29 ? 369 ARG A CB  1 
ATOM   2220 C CG  . ARG A 1 285 ? 8.082   67.192 -22.541 1.00 165.29 ? 369 ARG A CG  1 
ATOM   2221 C CD  . ARG A 1 285 ? 8.271   68.142 -23.743 1.00 167.44 ? 369 ARG A CD  1 
ATOM   2222 N NE  . ARG A 1 285 ? 9.496   67.891 -24.504 1.00 168.75 ? 369 ARG A NE  1 
ATOM   2223 C CZ  . ARG A 1 285 ? 9.532   67.601 -25.804 1.00 170.12 ? 369 ARG A CZ  1 
ATOM   2224 N NH1 . ARG A 1 285 ? 8.405   67.519 -26.499 1.00 166.04 ? 369 ARG A NH1 1 
ATOM   2225 N NH2 . ARG A 1 285 ? 10.697  67.384 -26.406 1.00 172.32 ? 369 ARG A NH2 1 
ATOM   2226 N N   . THR A 1 286 ? 4.893   63.990 -22.370 1.00 155.79 ? 370 THR A N   1 
ATOM   2227 C CA  . THR A 1 286 ? 3.948   62.993 -22.863 1.00 151.84 ? 370 THR A CA  1 
ATOM   2228 C C   . THR A 1 286 ? 3.077   63.568 -23.981 1.00 150.08 ? 370 THR A C   1 
ATOM   2229 O O   . THR A 1 286 ? 2.658   64.722 -23.914 1.00 148.98 ? 370 THR A O   1 
ATOM   2230 C CB  . THR A 1 286 ? 3.071   62.468 -21.725 1.00 150.55 ? 370 THR A CB  1 
ATOM   2231 O OG1 . THR A 1 286 ? 3.843   62.420 -20.518 1.00 149.96 ? 370 THR A OG1 1 
ATOM   2232 C CG2 . THR A 1 286 ? 2.564   61.078 -22.057 1.00 150.95 ? 370 THR A CG2 1 
ATOM   2233 N N   . ASN A 1 287 ? 2.817   62.765 -25.011 1.00 149.74 ? 371 ASN A N   1 
ATOM   2234 C CA  . ASN A 1 287 ? 2.109   63.237 -26.202 1.00 150.32 ? 371 ASN A CA  1 
ATOM   2235 C C   . ASN A 1 287 ? 0.969   62.316 -26.630 1.00 149.10 ? 371 ASN A C   1 
ATOM   2236 O O   . ASN A 1 287 ? 0.958   61.136 -26.287 1.00 149.05 ? 371 ASN A O   1 
ATOM   2237 C CB  . ASN A 1 287 ? 3.084   63.402 -27.370 1.00 154.04 ? 371 ASN A CB  1 
ATOM   2238 C CG  . ASN A 1 287 ? 4.228   64.349 -27.051 1.00 156.50 ? 371 ASN A CG  1 
ATOM   2239 O OD1 . ASN A 1 287 ? 4.055   65.329 -26.322 1.00 155.09 ? 371 ASN A OD1 1 
ATOM   2240 N ND2 . ASN A 1 287 ? 5.409   64.058 -27.598 1.00 156.38 ? 371 ASN A ND2 1 
ATOM   2241 N N   . LEU A 1 288 ? 0.028   62.857 -27.401 1.00 148.77 ? 372 LEU A N   1 
ATOM   2242 C CA  . LEU A 1 288 ? -1.152  62.104 -27.831 1.00 149.15 ? 372 LEU A CA  1 
ATOM   2243 C C   . LEU A 1 288 ? -1.229  61.880 -29.349 1.00 148.21 ? 372 LEU A C   1 
ATOM   2244 O O   . LEU A 1 288 ? -1.210  62.834 -30.125 1.00 148.64 ? 372 LEU A O   1 
ATOM   2245 C CB  . LEU A 1 288 ? -2.426  62.810 -27.354 1.00 147.32 ? 372 LEU A CB  1 
ATOM   2246 C CG  . LEU A 1 288 ? -3.738  62.117 -27.732 1.00 144.49 ? 372 LEU A CG  1 
ATOM   2247 C CD1 . LEU A 1 288 ? -3.910  60.828 -26.942 1.00 143.37 ? 372 LEU A CD1 1 
ATOM   2248 C CD2 . LEU A 1 288 ? -4.917  63.041 -27.527 1.00 140.28 ? 372 LEU A CD2 1 
ATOM   2249 N N   . TYR A 1 289 ? -1.345  60.619 -29.762 1.00 146.33 ? 373 TYR A N   1 
ATOM   2250 C CA  . TYR A 1 289 ? -1.421  60.273 -31.184 1.00 149.46 ? 373 TYR A CA  1 
ATOM   2251 C C   . TYR A 1 289 ? -2.734  59.575 -31.587 1.00 149.24 ? 373 TYR A C   1 
ATOM   2252 O O   . TYR A 1 289 ? -3.430  59.022 -30.741 1.00 149.15 ? 373 TYR A O   1 
ATOM   2253 C CB  . TYR A 1 289 ? -0.205  59.425 -31.584 1.00 153.58 ? 373 TYR A CB  1 
ATOM   2254 C CG  . TYR A 1 289 ? 1.102   60.177 -31.472 1.00 152.67 ? 373 TYR A CG  1 
ATOM   2255 C CD1 . TYR A 1 289 ? 1.458   61.123 -32.421 1.00 151.79 ? 373 TYR A CD1 1 
ATOM   2256 C CD2 . TYR A 1 289 ? 1.972   59.951 -30.415 1.00 152.64 ? 373 TYR A CD2 1 
ATOM   2257 C CE1 . TYR A 1 289 ? 2.641   61.825 -32.324 1.00 151.88 ? 373 TYR A CE1 1 
ATOM   2258 C CE2 . TYR A 1 289 ? 3.163   60.649 -30.310 1.00 154.13 ? 373 TYR A CE2 1 
ATOM   2259 C CZ  . TYR A 1 289 ? 3.490   61.587 -31.269 1.00 153.22 ? 373 TYR A CZ  1 
ATOM   2260 O OH  . TYR A 1 289 ? 4.668   62.289 -31.175 1.00 151.70 ? 373 TYR A OH  1 
ATOM   2261 N N   . ILE A 1 290 ? -3.061  59.609 -32.880 1.00 149.02 ? 374 ILE A N   1 
ATOM   2262 C CA  . ILE A 1 290 ? -4.323  59.074 -33.398 1.00 148.63 ? 374 ILE A CA  1 
ATOM   2263 C C   . ILE A 1 290 ? -4.136  58.288 -34.698 1.00 150.84 ? 374 ILE A C   1 
ATOM   2264 O O   . ILE A 1 290 ? -3.618  58.817 -35.686 1.00 152.40 ? 374 ILE A O   1 
ATOM   2265 C CB  . ILE A 1 290 ? -5.324  60.212 -33.667 1.00 148.58 ? 374 ILE A CB  1 
ATOM   2266 C CG1 . ILE A 1 290 ? -5.545  61.031 -32.401 1.00 147.34 ? 374 ILE A CG1 1 
ATOM   2267 C CG2 . ILE A 1 290 ? -6.654  59.675 -34.171 1.00 149.32 ? 374 ILE A CG2 1 
ATOM   2268 C CD1 . ILE A 1 290 ? -6.226  62.323 -32.659 1.00 145.20 ? 374 ILE A CD1 1 
ATOM   2269 N N   . SER A 1 291 ? -4.587  57.035 -34.694 1.00 151.34 ? 375 SER A N   1 
ATOM   2270 C CA  . SER A 1 291 ? -4.445  56.131 -35.842 1.00 154.73 ? 375 SER A CA  1 
ATOM   2271 C C   . SER A 1 291 ? -5.591  56.199 -36.847 1.00 154.07 ? 375 SER A C   1 
ATOM   2272 O O   . SER A 1 291 ? -6.397  57.113 -36.800 1.00 153.38 ? 375 SER A O   1 
ATOM   2273 C CB  . SER A 1 291 ? -4.282  54.690 -35.353 1.00 155.78 ? 375 SER A CB  1 
ATOM   2274 O OG  . SER A 1 291 ? -4.500  53.749 -36.391 1.00 158.17 ? 375 SER A OG  1 
ATOM   2275 N N   . GLU A 1 292 ? -5.624  55.248 -37.782 1.00 156.57 ? 376 GLU A N   1 
ATOM   2276 C CA  . GLU A 1 292 ? -6.786  55.062 -38.655 1.00 157.69 ? 376 GLU A CA  1 
ATOM   2277 C C   . GLU A 1 292 ? -6.937  53.628 -39.180 1.00 159.09 ? 376 GLU A C   1 
ATOM   2278 O O   . GLU A 1 292 ? -6.996  52.660 -38.416 1.00 157.07 ? 376 GLU A O   1 
ATOM   2279 C CB  . GLU A 1 292 ? -6.784  56.053 -39.822 1.00 155.62 ? 376 GLU A CB  1 
ATOM   2280 C CG  . GLU A 1 292 ? -8.138  56.165 -40.530 1.00 156.46 ? 376 GLU A CG  1 
ATOM   2281 C CD  . GLU A 1 292 ? -9.002  57.296 -39.981 1.00 161.57 ? 376 GLU A CD  1 
ATOM   2282 O OE1 . GLU A 1 292 ? -10.206 57.375 -40.321 1.00 161.81 ? 376 GLU A OE1 1 
ATOM   2283 O OE2 . GLU A 1 292 ? -8.464  58.121 -39.214 1.00 162.51 ? 376 GLU A OE2 1 
ATOM   2284 N N   . LYS A 1 297 ? 0.348   54.194 -38.202 1.00 153.67 ? 381 LYS A N   1 
ATOM   2285 C CA  . LYS A 1 297 ? -0.045  55.469 -38.787 1.00 155.96 ? 381 LYS A CA  1 
ATOM   2286 C C   . LYS A 1 297 ? -0.608  56.379 -37.706 1.00 156.74 ? 381 LYS A C   1 
ATOM   2287 O O   . LYS A 1 297 ? -1.819  56.443 -37.522 1.00 156.87 ? 381 LYS A O   1 
ATOM   2288 C CB  . LYS A 1 297 ? -1.094  55.255 -39.882 1.00 158.01 ? 381 LYS A CB  1 
ATOM   2289 C CG  . LYS A 1 297 ? -1.572  56.531 -40.584 1.00 162.49 ? 381 LYS A CG  1 
ATOM   2290 C CD  . LYS A 1 297 ? -0.646  56.948 -41.720 1.00 165.91 ? 381 LYS A CD  1 
ATOM   2291 C CE  . LYS A 1 297 ? -1.260  58.080 -42.540 1.00 167.50 ? 381 LYS A CE  1 
ATOM   2292 N NZ  . LYS A 1 297 ? -0.479  58.385 -43.774 1.00 169.18 ? 381 LYS A NZ  1 
ATOM   2293 N N   . PHE A 1 298 ? 0.268   57.087 -36.998 1.00 156.61 ? 382 PHE A N   1 
ATOM   2294 C CA  . PHE A 1 298 ? -0.154  57.914 -35.866 1.00 153.71 ? 382 PHE A CA  1 
ATOM   2295 C C   . PHE A 1 298 ? 0.222   59.386 -35.977 1.00 152.84 ? 382 PHE A C   1 
ATOM   2296 O O   . PHE A 1 298 ? 1.366   59.757 -35.726 1.00 156.53 ? 382 PHE A O   1 
ATOM   2297 C CB  . PHE A 1 298 ? 0.425   57.361 -34.565 1.00 154.71 ? 382 PHE A CB  1 
ATOM   2298 C CG  . PHE A 1 298 ? -0.351  56.216 -34.000 1.00 155.93 ? 382 PHE A CG  1 
ATOM   2299 C CD1 . PHE A 1 298 ? -1.495  56.445 -33.251 1.00 154.15 ? 382 PHE A CD1 1 
ATOM   2300 C CD2 . PHE A 1 298 ? 0.059   54.911 -34.212 1.00 157.91 ? 382 PHE A CD2 1 
ATOM   2301 C CE1 . PHE A 1 298 ? -2.215  55.397 -32.724 1.00 152.68 ? 382 PHE A CE1 1 
ATOM   2302 C CE2 . PHE A 1 298 ? -0.660  53.855 -33.689 1.00 158.02 ? 382 PHE A CE2 1 
ATOM   2303 C CZ  . PHE A 1 298 ? -1.799  54.099 -32.944 1.00 154.60 ? 382 PHE A CZ  1 
ATOM   2304 N N   . SER A 1 299 ? -0.749  60.226 -36.322 1.00 152.61 ? 383 SER A N   1 
ATOM   2305 C CA  . SER A 1 299 ? -0.533  61.671 -36.365 1.00 154.68 ? 383 SER A CA  1 
ATOM   2306 C C   . SER A 1 299 ? -0.550  62.274 -34.957 1.00 151.92 ? 383 SER A C   1 
ATOM   2307 O O   . SER A 1 299 ? -1.158  61.715 -34.049 1.00 151.78 ? 383 SER A O   1 
ATOM   2308 C CB  . SER A 1 299 ? -1.593  62.343 -37.241 1.00 153.89 ? 383 SER A CB  1 
ATOM   2309 O OG  . SER A 1 299 ? -1.339  63.729 -37.378 1.00 152.08 ? 383 SER A OG  1 
ATOM   2310 N N   . LEU A 1 300 ? 0.117   63.410 -34.776 1.00 150.52 ? 384 LEU A N   1 
ATOM   2311 C CA  . LEU A 1 300 ? 0.156   64.067 -33.469 1.00 149.83 ? 384 LEU A CA  1 
ATOM   2312 C C   . LEU A 1 300 ? -1.097  64.890 -33.198 1.00 151.24 ? 384 LEU A C   1 
ATOM   2313 O O   . LEU A 1 300 ? -1.510  65.706 -34.024 1.00 153.92 ? 384 LEU A O   1 
ATOM   2314 C CB  . LEU A 1 300 ? 1.402   64.944 -33.325 1.00 149.48 ? 384 LEU A CB  1 
ATOM   2315 C CG  . LEU A 1 300 ? 1.532   65.746 -32.027 1.00 146.67 ? 384 LEU A CG  1 
ATOM   2316 C CD1 . LEU A 1 300 ? 1.581   64.831 -30.818 1.00 149.40 ? 384 LEU A CD1 1 
ATOM   2317 C CD2 . LEU A 1 300 ? 2.761   66.622 -32.069 1.00 146.96 ? 384 LEU A CD2 1 
ATOM   2318 N N   . SER A 1 301 ? -1.693  64.677 -32.028 1.00 149.76 ? 385 SER A N   1 
ATOM   2319 C CA  . SER A 1 301 ? -2.924  65.360 -31.657 1.00 148.09 ? 385 SER A CA  1 
ATOM   2320 C C   . SER A 1 301 ? -2.669  66.435 -30.611 1.00 145.31 ? 385 SER A C   1 
ATOM   2321 O O   . SER A 1 301 ? -3.020  67.601 -30.797 1.00 141.74 ? 385 SER A O   1 
ATOM   2322 C CB  . SER A 1 301 ? -3.937  64.354 -31.120 1.00 146.90 ? 385 SER A CB  1 
ATOM   2323 O OG  . SER A 1 301 ? -5.184  64.971 -30.865 1.00 144.93 ? 385 SER A OG  1 
ATOM   2324 N N   . LEU A 1 302 ? -2.054  66.036 -29.506 1.00 144.03 ? 386 LEU A N   1 
ATOM   2325 C CA  . LEU A 1 302 ? -1.815  66.963 -28.413 1.00 145.99 ? 386 LEU A CA  1 
ATOM   2326 C C   . LEU A 1 302 ? -0.578  66.561 -27.626 1.00 148.55 ? 386 LEU A C   1 
ATOM   2327 O O   . LEU A 1 302 ? -0.327  65.373 -27.415 1.00 149.05 ? 386 LEU A O   1 
ATOM   2328 C CB  . LEU A 1 302 ? -3.041  67.017 -27.500 1.00 146.39 ? 386 LEU A CB  1 
ATOM   2329 C CG  . LEU A 1 302 ? -2.979  67.856 -26.223 1.00 146.14 ? 386 LEU A CG  1 
ATOM   2330 C CD1 . LEU A 1 302 ? -2.615  69.310 -26.527 1.00 148.32 ? 386 LEU A CD1 1 
ATOM   2331 C CD2 . LEU A 1 302 ? -4.309  67.763 -25.488 1.00 139.65 ? 386 LEU A CD2 1 
ATOM   2332 N N   . GLU A 1 303 ? 0.191   67.562 -27.202 1.00 148.00 ? 387 GLU A N   1 
ATOM   2333 C CA  . GLU A 1 303 ? 1.429   67.333 -26.464 1.00 150.06 ? 387 GLU A CA  1 
ATOM   2334 C C   . GLU A 1 303 ? 1.317   67.791 -25.016 1.00 149.06 ? 387 GLU A C   1 
ATOM   2335 O O   . GLU A 1 303 ? 0.441   68.586 -24.675 1.00 146.43 ? 387 GLU A O   1 
ATOM   2336 C CB  . GLU A 1 303 ? 2.593   68.063 -27.136 1.00 152.75 ? 387 GLU A CB  1 
ATOM   2337 C CG  . GLU A 1 303 ? 2.972   67.522 -28.504 1.00 154.49 ? 387 GLU A CG  1 
ATOM   2338 C CD  . GLU A 1 303 ? 4.196   68.211 -29.080 1.00 158.82 ? 387 GLU A CD  1 
ATOM   2339 O OE1 . GLU A 1 303 ? 4.399   69.409 -28.779 1.00 159.22 ? 387 GLU A OE1 1 
ATOM   2340 O OE2 . GLU A 1 303 ? 4.957   67.554 -29.826 1.00 159.50 ? 387 GLU A OE2 1 
ATOM   2341 N N   . ASN A 1 304 ? 2.221   67.289 -24.178 1.00 150.12 ? 388 ASN A N   1 
ATOM   2342 C CA  . ASN A 1 304 ? 2.268   67.643 -22.758 1.00 150.94 ? 388 ASN A CA  1 
ATOM   2343 C C   . ASN A 1 304 ? 0.980   67.334 -22.005 1.00 147.05 ? 388 ASN A C   1 
ATOM   2344 O O   . ASN A 1 304 ? 0.466   68.169 -21.263 1.00 145.47 ? 388 ASN A O   1 
ATOM   2345 C CB  . ASN A 1 304 ? 2.675   69.108 -22.560 1.00 151.11 ? 388 ASN A CB  1 
ATOM   2346 C CG  . ASN A 1 304 ? 4.119   69.253 -22.118 1.00 155.36 ? 388 ASN A CG  1 
ATOM   2347 O OD1 . ASN A 1 304 ? 4.655   68.390 -21.419 1.00 155.76 ? 388 ASN A OD1 1 
ATOM   2348 N ND2 . ASN A 1 304 ? 4.757   70.344 -22.527 1.00 156.33 ? 388 ASN A ND2 1 
ATOM   2349 N N   . VAL A 1 305 ? 0.471   66.123 -22.200 1.00 146.57 ? 389 VAL A N   1 
ATOM   2350 C CA  . VAL A 1 305 ? -0.731  65.673 -21.514 1.00 143.11 ? 389 VAL A CA  1 
ATOM   2351 C C   . VAL A 1 305 ? -0.344  65.045 -20.190 1.00 141.17 ? 389 VAL A C   1 
ATOM   2352 O O   . VAL A 1 305 ? 0.610   64.272 -20.125 1.00 141.14 ? 389 VAL A O   1 
ATOM   2353 C CB  . VAL A 1 305 ? -1.502  64.638 -22.351 1.00 142.43 ? 389 VAL A CB  1 
ATOM   2354 C CG1 . VAL A 1 305 ? -2.705  64.124 -21.586 1.00 141.17 ? 389 VAL A CG1 1 
ATOM   2355 C CG2 . VAL A 1 305 ? -1.937  65.245 -23.672 1.00 143.73 ? 389 VAL A CG2 1 
ATOM   2356 N N   . LEU A 1 306 ? -1.081  65.391 -19.138 1.00 141.31 ? 390 LEU A N   1 
ATOM   2357 C CA  . LEU A 1 306 ? -0.835  64.848 -17.811 1.00 140.52 ? 390 LEU A CA  1 
ATOM   2358 C C   . LEU A 1 306 ? -0.930  63.332 -17.853 1.00 140.32 ? 390 LEU A C   1 
ATOM   2359 O O   . LEU A 1 306 ? -1.988  62.768 -18.117 1.00 140.94 ? 390 LEU A O   1 
ATOM   2360 C CB  . LEU A 1 306 ? -1.824  65.432 -16.802 1.00 139.16 ? 390 LEU A CB  1 
ATOM   2361 C CG  . LEU A 1 306 ? -1.532  65.170 -15.328 1.00 139.17 ? 390 LEU A CG  1 
ATOM   2362 C CD1 . LEU A 1 306 ? -0.052  65.305 -15.051 1.00 142.26 ? 390 LEU A CD1 1 
ATOM   2363 C CD2 . LEU A 1 306 ? -2.321  66.135 -14.457 1.00 141.95 ? 390 LEU A CD2 1 
ATOM   2364 N N   . TYR A 1 307 ? 0.203   62.682 -17.625 1.00 142.97 ? 391 TYR A N   1 
ATOM   2365 C CA  . TYR A 1 307 ? 0.294   61.232 -17.690 1.00 143.68 ? 391 TYR A CA  1 
ATOM   2366 C C   . TYR A 1 307 ? 1.118   60.703 -16.525 1.00 147.90 ? 391 TYR A C   1 
ATOM   2367 O O   . TYR A 1 307 ? 2.003   61.384 -16.009 1.00 151.04 ? 391 TYR A O   1 
ATOM   2368 C CB  . TYR A 1 307 ? 0.916   60.804 -19.023 1.00 143.31 ? 391 TYR A CB  1 
ATOM   2369 C CG  . TYR A 1 307 ? 1.363   59.358 -19.092 1.00 145.50 ? 391 TYR A CG  1 
ATOM   2370 C CD1 . TYR A 1 307 ? 0.577   58.398 -19.705 1.00 143.22 ? 391 TYR A CD1 1 
ATOM   2371 C CD2 . TYR A 1 307 ? 2.584   58.959 -18.561 1.00 148.73 ? 391 TYR A CD2 1 
ATOM   2372 C CE1 . TYR A 1 307 ? 0.983   57.087 -19.772 1.00 143.56 ? 391 TYR A CE1 1 
ATOM   2373 C CE2 . TYR A 1 307 ? 2.992   57.649 -18.618 1.00 150.15 ? 391 TYR A CE2 1 
ATOM   2374 C CZ  . TYR A 1 307 ? 2.189   56.717 -19.225 1.00 148.39 ? 391 TYR A CZ  1 
ATOM   2375 O OH  . TYR A 1 307 ? 2.594   55.408 -19.288 1.00 149.42 ? 391 TYR A OH  1 
ATOM   2376 N N   . TYR A 1 308 ? 0.823   59.476 -16.118 1.00 148.93 ? 392 TYR A N   1 
ATOM   2377 C CA  . TYR A 1 308 ? 1.605   58.802 -15.100 1.00 150.78 ? 392 TYR A CA  1 
ATOM   2378 C C   . TYR A 1 308 ? 1.980   57.412 -15.594 1.00 152.60 ? 392 TYR A C   1 
ATOM   2379 O O   . TYR A 1 308 ? 1.190   56.739 -16.253 1.00 151.98 ? 392 TYR A O   1 
ATOM   2380 C CB  . TYR A 1 308 ? 0.822   58.715 -13.779 1.00 150.48 ? 392 TYR A CB  1 
ATOM   2381 C CG  . TYR A 1 308 ? 1.376   57.709 -12.787 1.00 155.74 ? 392 TYR A CG  1 
ATOM   2382 C CD1 . TYR A 1 308 ? 2.148   58.115 -11.705 1.00 158.40 ? 392 TYR A CD1 1 
ATOM   2383 C CD2 . TYR A 1 308 ? 1.117   56.349 -12.930 1.00 157.06 ? 392 TYR A CD2 1 
ATOM   2384 C CE1 . TYR A 1 308 ? 2.653   57.191 -10.805 1.00 159.89 ? 392 TYR A CE1 1 
ATOM   2385 C CE2 . TYR A 1 308 ? 1.625   55.426 -12.051 1.00 159.53 ? 392 TYR A CE2 1 
ATOM   2386 C CZ  . TYR A 1 308 ? 2.387   55.848 -10.987 1.00 160.99 ? 392 TYR A CZ  1 
ATOM   2387 O OH  . TYR A 1 308 ? 2.881   54.917 -10.103 1.00 162.79 ? 392 TYR A OH  1 
ATOM   2388 N N   . SER A 1 309 ? 3.197   56.993 -15.278 1.00 156.22 ? 393 SER A N   1 
ATOM   2389 C CA  . SER A 1 309 ? 3.558   55.585 -15.319 1.00 157.25 ? 393 SER A CA  1 
ATOM   2390 C C   . SER A 1 309 ? 4.366   55.331 -14.057 1.00 161.57 ? 393 SER A C   1 
ATOM   2391 O O   . SER A 1 309 ? 4.884   56.278 -13.469 1.00 163.62 ? 393 SER A O   1 
ATOM   2392 C CB  . SER A 1 309 ? 4.354   55.244 -16.580 1.00 157.19 ? 393 SER A CB  1 
ATOM   2393 O OG  . SER A 1 309 ? 5.666   55.772 -16.549 1.00 162.55 ? 393 SER A OG  1 
ATOM   2394 N N   . PRO A 1 310 ? 4.447   54.067 -13.606 1.00 161.46 ? 394 PRO A N   1 
ATOM   2395 C CA  . PRO A 1 310 ? 5.258   53.763 -12.421 1.00 162.05 ? 394 PRO A CA  1 
ATOM   2396 C C   . PRO A 1 310 ? 6.719   54.105 -12.674 1.00 166.12 ? 394 PRO A C   1 
ATOM   2397 O O   . PRO A 1 310 ? 7.417   54.563 -11.765 1.00 168.37 ? 394 PRO A O   1 
ATOM   2398 C CB  . PRO A 1 310 ? 5.094   52.250 -12.262 1.00 159.40 ? 394 PRO A CB  1 
ATOM   2399 C CG  . PRO A 1 310 ? 3.798   51.942 -12.915 1.00 160.90 ? 394 PRO A CG  1 
ATOM   2400 C CD  . PRO A 1 310 ? 3.674   52.900 -14.062 1.00 161.02 ? 394 PRO A CD  1 
ATOM   2401 N N   . GLY A 1 311 ? 7.146   53.895 -13.918 1.00 166.11 ? 395 GLY A N   1 
ATOM   2402 C CA  . GLY A 1 311 ? 8.513   54.114 -14.367 1.00 167.66 ? 395 GLY A CA  1 
ATOM   2403 C C   . GLY A 1 311 ? 9.333   55.243 -13.763 1.00 170.05 ? 395 GLY A C   1 
ATOM   2404 O O   . GLY A 1 311 ? 10.380  54.990 -13.170 1.00 171.02 ? 395 GLY A O   1 
ATOM   2405 N N   . GLY A 1 312 ? 8.895   56.489 -13.922 1.00 170.21 ? 396 GLY A N   1 
ATOM   2406 C CA  . GLY A 1 312 ? 7.683   56.838 -14.638 1.00 168.07 ? 396 GLY A CA  1 
ATOM   2407 C C   . GLY A 1 312 ? 7.698   58.322 -14.932 1.00 170.45 ? 396 GLY A C   1 
ATOM   2408 O O   . GLY A 1 312 ? 8.549   59.043 -14.409 1.00 170.69 ? 396 GLY A O   1 
ATOM   2409 N N   . ALA A 1 313 ? 6.777   58.784 -15.771 1.00 169.70 ? 397 ALA A N   1 
ATOM   2410 C CA  . ALA A 1 313 ? 6.738   60.196 -16.133 1.00 169.76 ? 397 ALA A CA  1 
ATOM   2411 C C   . ALA A 1 313 ? 6.584   61.056 -14.883 1.00 171.04 ? 397 ALA A C   1 
ATOM   2412 O O   . ALA A 1 313 ? 7.349   61.996 -14.667 1.00 171.89 ? 397 ALA A O   1 
ATOM   2413 C CB  . ALA A 1 313 ? 5.614   60.468 -17.117 1.00 160.98 ? 397 ALA A CB  1 
ATOM   2414 N N   . GLY A 1 314 ? 5.607   60.716 -14.048 1.00 168.83 ? 398 GLY A N   1 
ATOM   2415 C CA  . GLY A 1 314 ? 5.418   61.419 -12.794 1.00 169.10 ? 398 GLY A CA  1 
ATOM   2416 C C   . GLY A 1 314 ? 5.852   60.636 -11.565 1.00 170.53 ? 398 GLY A C   1 
ATOM   2417 O O   . GLY A 1 314 ? 5.431   60.946 -10.463 1.00 168.61 ? 398 GLY A O   1 
ATOM   2418 N N   . SER A 1 315 ? 6.719   59.645 -11.752 1.00 172.79 ? 399 SER A N   1 
ATOM   2419 C CA  . SER A 1 315 ? 7.039   58.652 -10.715 1.00 172.50 ? 399 SER A CA  1 
ATOM   2420 C C   . SER A 1 315 ? 7.517   59.188 -9.367  1.00 172.79 ? 399 SER A C   1 
ATOM   2421 O O   . SER A 1 315 ? 7.136   58.659 -8.319  1.00 170.59 ? 399 SER A O   1 
ATOM   2422 C CB  . SER A 1 315 ? 8.094   57.679 -11.230 1.00 172.03 ? 399 SER A CB  1 
ATOM   2423 O OG  . SER A 1 315 ? 9.322   58.346 -11.476 1.00 174.41 ? 399 SER A OG  1 
ATOM   2424 N N   . ASP A 1 316 ? 8.372   60.208 -9.407  1.00 173.42 ? 400 ASP A N   1 
ATOM   2425 C CA  . ASP A 1 316 ? 8.996   60.751 -8.204  1.00 171.04 ? 400 ASP A CA  1 
ATOM   2426 C C   . ASP A 1 316 ? 7.979   60.990 -7.106  1.00 171.64 ? 400 ASP A C   1 
ATOM   2427 O O   . ASP A 1 316 ? 8.206   60.662 -5.939  1.00 170.34 ? 400 ASP A O   1 
ATOM   2428 C CB  . ASP A 1 316 ? 9.704   62.074 -8.518  1.00 171.50 ? 400 ASP A CB  1 
ATOM   2429 C CG  . ASP A 1 316 ? 8.767   63.131 -9.098  1.00 172.73 ? 400 ASP A CG  1 
ATOM   2430 O OD1 . ASP A 1 316 ? 7.841   63.568 -8.389  1.00 171.15 ? 400 ASP A OD1 1 
ATOM   2431 O OD2 . ASP A 1 316 ? 8.980   63.563 -10.249 1.00 174.23 ? 400 ASP A OD2 1 
ATOM   2432 N N   . THR A 1 317 ? 6.838   61.536 -7.518  1.00 172.14 ? 401 THR A N   1 
ATOM   2433 C CA  . THR A 1 317 ? 5.877   62.122 -6.605  1.00 167.97 ? 401 THR A CA  1 
ATOM   2434 C C   . THR A 1 317 ? 5.012   61.158 -5.834  1.00 166.86 ? 401 THR A C   1 
ATOM   2435 O O   . THR A 1 317 ? 5.206   59.943 -5.845  1.00 167.82 ? 401 THR A O   1 
ATOM   2436 C CB  . THR A 1 317 ? 4.928   63.102 -7.320  1.00 165.29 ? 401 THR A CB  1 
ATOM   2437 O OG1 . THR A 1 317 ? 4.056   63.694 -6.353  1.00 165.41 ? 401 THR A OG1 1 
ATOM   2438 C CG2 . THR A 1 317 ? 4.083   62.386 -8.344  1.00 165.27 ? 401 THR A CG2 1 
ATOM   2439 N N   . LEU A 1 318 ? 4.039   61.767 -5.175  1.00 166.37 ? 402 LEU A N   1 
ATOM   2440 C CA  . LEU A 1 318 ? 3.129   61.130 -4.254  1.00 166.53 ? 402 LEU A CA  1 
ATOM   2441 C C   . LEU A 1 318 ? 2.508   59.853 -4.761  1.00 165.06 ? 402 LEU A C   1 
ATOM   2442 O O   . LEU A 1 318 ? 2.418   58.865 -4.036  1.00 164.53 ? 402 LEU A O   1 
ATOM   2443 C CB  . LEU A 1 318 ? 2.009   62.101 -3.934  1.00 166.83 ? 402 LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 318 ? 2.032   62.380 -2.450  1.00 167.97 ? 402 LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 318 ? 0.768   63.043 -2.005  1.00 165.56 ? 402 LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 318 ? 2.313   61.125 -1.595  1.00 167.01 ? 402 LEU A CD2 1 
ATOM   2447 N N   . VAL A 1 319 ? 2.089   59.889 -6.016  1.00 164.84 ? 403 VAL A N   1 
ATOM   2448 C CA  . VAL A 1 319 ? 1.176   58.897 -6.548  1.00 165.10 ? 403 VAL A CA  1 
ATOM   2449 C C   . VAL A 1 319 ? 1.673   57.474 -6.351  1.00 164.52 ? 403 VAL A C   1 
ATOM   2450 O O   . VAL A 1 319 ? 0.887   56.578 -6.060  1.00 165.38 ? 403 VAL A O   1 
ATOM   2451 C CB  . VAL A 1 319 ? 0.934   59.135 -8.040  1.00 162.34 ? 403 VAL A CB  1 
ATOM   2452 C CG1 . VAL A 1 319 ? -0.364  58.495 -8.463  1.00 160.69 ? 403 VAL A CG1 1 
ATOM   2453 C CG2 . VAL A 1 319 ? 0.909   60.626 -8.339  1.00 159.18 ? 403 VAL A CG2 1 
ATOM   2454 N N   . ARG A 1 320 ? 2.981   57.279 -6.492  1.00 164.02 ? 404 ARG A N   1 
ATOM   2455 C CA  . ARG A 1 320 ? 3.576   55.942 -6.447  1.00 165.87 ? 404 ARG A CA  1 
ATOM   2456 C C   . ARG A 1 320 ? 2.994   55.004 -5.374  1.00 167.88 ? 404 ARG A C   1 
ATOM   2457 O O   . ARG A 1 320 ? 2.842   53.803 -5.613  1.00 168.67 ? 404 ARG A O   1 
ATOM   2458 C CB  . ARG A 1 320 ? 5.106   56.026 -6.343  1.00 165.87 ? 404 ARG A CB  1 
ATOM   2459 C CG  . ARG A 1 320 ? 5.636   56.842 -5.174  1.00 165.62 ? 404 ARG A CG  1 
ATOM   2460 C CD  . ARG A 1 320 ? 7.137   57.128 -5.315  1.00 166.32 ? 404 ARG A CD  1 
ATOM   2461 N NE  . ARG A 1 320 ? 7.760   57.490 -4.041  1.00 165.02 ? 404 ARG A NE  1 
ATOM   2462 C CZ  . ARG A 1 320 ? 9.063   57.701 -3.875  1.00 159.56 ? 404 ARG A CZ  1 
ATOM   2463 N NH1 . ARG A 1 320 ? 9.889   57.591 -4.907  1.00 158.79 ? 404 ARG A NH1 1 
ATOM   2464 N NH2 . ARG A 1 320 ? 9.540   58.019 -2.678  1.00 154.51 ? 404 ARG A NH2 1 
ATOM   2465 N N   . TYR A 1 321 ? 2.636   55.559 -4.216  1.00 168.32 ? 405 TYR A N   1 
ATOM   2466 C CA  . TYR A 1 321 ? 2.033   54.781 -3.128  1.00 167.10 ? 405 TYR A CA  1 
ATOM   2467 C C   . TYR A 1 321 ? 0.525   54.588 -3.285  1.00 165.72 ? 405 TYR A C   1 
ATOM   2468 O O   . TYR A 1 321 ? -0.115  53.966 -2.437  1.00 166.87 ? 405 TYR A O   1 
ATOM   2469 C CB  . TYR A 1 321 ? 2.318   55.439 -1.776  1.00 166.08 ? 405 TYR A CB  1 
ATOM   2470 C CG  . TYR A 1 321 ? 3.763   55.811 -1.598  1.00 165.88 ? 405 TYR A CG  1 
ATOM   2471 C CD1 . TYR A 1 321 ? 4.231   57.045 -2.004  1.00 165.31 ? 405 TYR A CD1 1 
ATOM   2472 C CD2 . TYR A 1 321 ? 4.666   54.920 -1.040  1.00 165.67 ? 405 TYR A CD2 1 
ATOM   2473 C CE1 . TYR A 1 321 ? 5.553   57.374 -1.866  1.00 165.50 ? 405 TYR A CE1 1 
ATOM   2474 C CE2 . TYR A 1 321 ? 5.996   55.253 -0.883  1.00 166.63 ? 405 TYR A CE2 1 
ATOM   2475 C CZ  . TYR A 1 321 ? 6.433   56.489 -1.291  1.00 167.13 ? 405 TYR A CZ  1 
ATOM   2476 O OH  . TYR A 1 321 ? 7.763   56.837 -1.147  1.00 165.98 ? 405 TYR A OH  1 
ATOM   2477 N N   . PHE A 1 322 ? -0.038  55.126 -4.363  1.00 165.21 ? 406 PHE A N   1 
ATOM   2478 C CA  . PHE A 1 322 ? -1.475  55.037 -4.613  1.00 164.63 ? 406 PHE A CA  1 
ATOM   2479 C C   . PHE A 1 322 ? -1.761  54.250 -5.886  1.00 161.90 ? 406 PHE A C   1 
ATOM   2480 O O   . PHE A 1 322 ? -2.698  53.454 -5.943  1.00 159.78 ? 406 PHE A O   1 
ATOM   2481 C CB  . PHE A 1 322 ? -2.086  56.438 -4.720  1.00 163.46 ? 406 PHE A CB  1 
ATOM   2482 C CG  . PHE A 1 322 ? -2.086  57.199 -3.428  1.00 162.05 ? 406 PHE A CG  1 
ATOM   2483 C CD1 . PHE A 1 322 ? -0.922  57.771 -2.944  1.00 162.86 ? 406 PHE A CD1 1 
ATOM   2484 C CD2 . PHE A 1 322 ? -3.251  57.343 -2.699  1.00 162.39 ? 406 PHE A CD2 1 
ATOM   2485 C CE1 . PHE A 1 322 ? -0.920  58.467 -1.755  1.00 162.81 ? 406 PHE A CE1 1 
ATOM   2486 C CE2 . PHE A 1 322 ? -3.256  58.040 -1.510  1.00 163.95 ? 406 PHE A CE2 1 
ATOM   2487 C CZ  . PHE A 1 322 ? -2.088  58.603 -1.037  1.00 163.51 ? 406 PHE A CZ  1 
ATOM   2488 N N   . ALA A 1 323 ? -0.943  54.475 -6.907  1.00 161.96 ? 407 ALA A N   1 
ATOM   2489 C CA  . ALA A 1 323 ? -1.147  53.835 -8.197  1.00 160.49 ? 407 ALA A CA  1 
ATOM   2490 C C   . ALA A 1 323 ? 0.033   52.956 -8.601  1.00 160.08 ? 407 ALA A C   1 
ATOM   2491 O O   . ALA A 1 323 ? 1.176   53.411 -8.662  1.00 159.25 ? 407 ALA A O   1 
ATOM   2492 C CB  . ALA A 1 323 ? -1.428  54.878 -9.266  1.00 159.74 ? 407 ALA A CB  1 
ATOM   2493 N N   . ASN A 1 324 ? -0.266  51.692 -8.874  1.00 159.75 ? 408 ASN A N   1 
ATOM   2494 C CA  . ASN A 1 324 ? 0.724   50.728 -9.329  1.00 158.67 ? 408 ASN A CA  1 
ATOM   2495 C C   . ASN A 1 324 ? 0.652   50.575 -10.840 1.00 159.07 ? 408 ASN A C   1 
ATOM   2496 O O   . ASN A 1 324 ? 1.606   50.140 -11.485 1.00 158.16 ? 408 ASN A O   1 
ATOM   2497 C CB  . ASN A 1 324 ? 0.462   49.381 -8.665  1.00 158.22 ? 408 ASN A CB  1 
ATOM   2498 C CG  . ASN A 1 324 ? -1.012  49.016 -8.657  1.00 161.78 ? 408 ASN A CG  1 
ATOM   2499 O OD1 . ASN A 1 324 ? -1.805  49.548 -9.439  1.00 161.45 ? 408 ASN A OD1 1 
ATOM   2500 N ND2 . ASN A 1 324 ? -1.389  48.108 -7.765  1.00 164.72 ? 408 ASN A ND2 1 
ATOM   2501 N N   . GLU A 1 325 ? -0.502  50.934 -11.393 1.00 158.37 ? 409 GLU A N   1 
ATOM   2502 C CA  . GLU A 1 325 ? -0.746  50.835 -12.823 1.00 156.96 ? 409 GLU A CA  1 
ATOM   2503 C C   . GLU A 1 325 ? -0.832  52.232 -13.425 1.00 155.60 ? 409 GLU A C   1 
ATOM   2504 O O   . GLU A 1 325 ? -1.522  53.096 -12.884 1.00 154.72 ? 409 GLU A O   1 
ATOM   2505 C CB  . GLU A 1 325 ? -2.045  50.068 -13.072 1.00 157.08 ? 409 GLU A CB  1 
ATOM   2506 C CG  . GLU A 1 325 ? -2.423  49.924 -14.533 1.00 157.65 ? 409 GLU A CG  1 
ATOM   2507 C CD  . GLU A 1 325 ? -3.740  49.204 -14.716 1.00 160.10 ? 409 GLU A CD  1 
ATOM   2508 O OE1 . GLU A 1 325 ? -4.265  48.670 -13.716 1.00 159.56 ? 409 GLU A OE1 1 
ATOM   2509 O OE2 . GLU A 1 325 ? -4.249  49.177 -15.857 1.00 162.36 ? 409 GLU A OE2 1 
ATOM   2510 N N   . PRO A 1 326 ? -0.130  52.460 -14.548 1.00 154.24 ? 410 PRO A N   1 
ATOM   2511 C CA  . PRO A 1 326 ? -0.121  53.770 -15.205 1.00 151.41 ? 410 PRO A CA  1 
ATOM   2512 C C   . PRO A 1 326 ? -1.508  54.181 -15.672 1.00 147.36 ? 410 PRO A C   1 
ATOM   2513 O O   . PRO A 1 326 ? -2.379  53.335 -15.853 1.00 148.41 ? 410 PRO A O   1 
ATOM   2514 C CB  . PRO A 1 326 ? 0.789   53.547 -16.416 1.00 150.63 ? 410 PRO A CB  1 
ATOM   2515 C CG  . PRO A 1 326 ? 0.740   52.086 -16.663 1.00 151.83 ? 410 PRO A CG  1 
ATOM   2516 C CD  . PRO A 1 326 ? 0.652   51.468 -15.304 1.00 155.22 ? 410 PRO A CD  1 
ATOM   2517 N N   . PHE A 1 327 ? -1.694  55.480 -15.861 1.00 145.69 ? 411 PHE A N   1 
ATOM   2518 C CA  . PHE A 1 327 ? -2.957  56.037 -16.314 1.00 143.27 ? 411 PHE A CA  1 
ATOM   2519 C C   . PHE A 1 327 ? -2.727  57.499 -16.660 1.00 142.60 ? 411 PHE A C   1 
ATOM   2520 O O   . PHE A 1 327 ? -1.656  58.037 -16.408 1.00 144.74 ? 411 PHE A O   1 
ATOM   2521 C CB  . PHE A 1 327 ? -4.019  55.919 -15.224 1.00 145.06 ? 411 PHE A CB  1 
ATOM   2522 C CG  . PHE A 1 327 ? -3.704  56.704 -13.988 1.00 144.95 ? 411 PHE A CG  1 
ATOM   2523 C CD1 . PHE A 1 327 ? -2.887  56.174 -13.007 1.00 148.23 ? 411 PHE A CD1 1 
ATOM   2524 C CD2 . PHE A 1 327 ? -4.228  57.971 -13.804 1.00 143.64 ? 411 PHE A CD2 1 
ATOM   2525 C CE1 . PHE A 1 327 ? -2.595  56.896 -11.869 1.00 150.46 ? 411 PHE A CE1 1 
ATOM   2526 C CE2 . PHE A 1 327 ? -3.940  58.694 -12.670 1.00 144.57 ? 411 PHE A CE2 1 
ATOM   2527 C CZ  . PHE A 1 327 ? -3.125  58.157 -11.699 1.00 149.03 ? 411 PHE A CZ  1 
ATOM   2528 N N   . ALA A 1 328 ? -3.736  58.149 -17.222 1.00 140.74 ? 412 ALA A N   1 
ATOM   2529 C CA  . ALA A 1 328 ? -3.582  59.530 -17.645 1.00 137.04 ? 412 ALA A CA  1 
ATOM   2530 C C   . ALA A 1 328 ? -4.849  60.322 -17.380 1.00 136.34 ? 412 ALA A C   1 
ATOM   2531 O O   . ALA A 1 328 ? -5.936  59.754 -17.291 1.00 138.31 ? 412 ALA A O   1 
ATOM   2532 C CB  . ALA A 1 328 ? -3.226  59.583 -19.115 1.00 135.66 ? 412 ALA A CB  1 
ATOM   2533 N N   . ASP A 1 329 ? -4.706  61.636 -17.245 1.00 134.71 ? 413 ASP A N   1 
ATOM   2534 C CA  . ASP A 1 329 ? -5.860  62.513 -17.119 1.00 133.59 ? 413 ASP A CA  1 
ATOM   2535 C C   . ASP A 1 329 ? -6.494  62.728 -18.488 1.00 133.52 ? 413 ASP A C   1 
ATOM   2536 O O   . ASP A 1 329 ? -6.310  63.770 -19.116 1.00 133.62 ? 413 ASP A O   1 
ATOM   2537 C CB  . ASP A 1 329 ? -5.462  63.847 -16.487 1.00 134.54 ? 413 ASP A CB  1 
ATOM   2538 C CG  . ASP A 1 329 ? -5.678  63.867 -14.988 1.00 136.90 ? 413 ASP A CG  1 
ATOM   2539 O OD1 . ASP A 1 329 ? -6.042  62.811 -14.433 1.00 138.04 ? 413 ASP A OD1 1 
ATOM   2540 O OD2 . ASP A 1 329 ? -5.489  64.934 -14.364 1.00 136.11 ? 413 ASP A OD2 1 
ATOM   2541 N N   . PHE A 1 330 ? -7.239  61.725 -18.943 1.00 133.36 ? 414 PHE A N   1 
ATOM   2542 C CA  . PHE A 1 330 ? -7.844  61.737 -20.270 1.00 131.28 ? 414 PHE A CA  1 
ATOM   2543 C C   . PHE A 1 330 ? -9.211  61.082 -20.206 1.00 131.21 ? 414 PHE A C   1 
ATOM   2544 O O   . PHE A 1 330 ? -9.326  59.864 -20.062 1.00 133.18 ? 414 PHE A O   1 
ATOM   2545 C CB  . PHE A 1 330 ? -6.953  60.987 -21.255 1.00 131.51 ? 414 PHE A CB  1 
ATOM   2546 C CG  . PHE A 1 330 ? -7.452  61.006 -22.672 1.00 128.80 ? 414 PHE A CG  1 
ATOM   2547 C CD1 . PHE A 1 330 ? -7.526  62.192 -23.383 1.00 131.00 ? 414 PHE A CD1 1 
ATOM   2548 C CD2 . PHE A 1 330 ? -7.816  59.833 -23.301 1.00 129.29 ? 414 PHE A CD2 1 
ATOM   2549 C CE1 . PHE A 1 330 ? -7.970  62.207 -24.695 1.00 131.91 ? 414 PHE A CE1 1 
ATOM   2550 C CE2 . PHE A 1 330 ? -8.255  59.838 -24.608 1.00 131.56 ? 414 PHE A CE2 1 
ATOM   2551 C CZ  . PHE A 1 330 ? -8.331  61.028 -25.307 1.00 131.96 ? 414 PHE A CZ  1 
ATOM   2552 N N   . HIS A 1 331 ? -10.249 61.897 -20.313 1.00 128.37 ? 415 HIS A N   1 
ATOM   2553 C CA  . HIS A 1 331 ? -11.602 61.419 -20.121 1.00 122.89 ? 415 HIS A CA  1 
ATOM   2554 C C   . HIS A 1 331 ? -12.315 61.367 -21.455 1.00 120.94 ? 415 HIS A C   1 
ATOM   2555 O O   . HIS A 1 331 ? -12.278 62.330 -22.218 1.00 121.78 ? 415 HIS A O   1 
ATOM   2556 C CB  . HIS A 1 331 ? -12.337 62.363 -19.169 1.00 122.90 ? 415 HIS A CB  1 
ATOM   2557 C CG  . HIS A 1 331 ? -13.736 61.936 -18.845 1.00 121.33 ? 415 HIS A CG  1 
ATOM   2558 N ND1 . HIS A 1 331 ? -14.049 61.215 -17.721 1.00 120.93 ? 415 HIS A ND1 1 
ATOM   2559 C CD2 . HIS A 1 331 ? -14.900 62.138 -19.511 1.00 119.54 ? 415 HIS A CD2 1 
ATOM   2560 C CE1 . HIS A 1 331 ? -15.354 60.983 -17.701 1.00 118.27 ? 415 HIS A CE1 1 
ATOM   2561 N NE2 . HIS A 1 331 ? -15.888 61.530 -18.771 1.00 115.65 ? 415 HIS A NE2 1 
ATOM   2562 N N   . ARG A 1 332 ? -12.946 60.238 -21.753 1.00 120.82 ? 416 ARG A N   1 
ATOM   2563 C CA  . ARG A 1 332 ? -13.877 60.197 -22.872 1.00 121.10 ? 416 ARG A CA  1 
ATOM   2564 C C   . ARG A 1 332 ? -15.310 60.394 -22.395 1.00 119.77 ? 416 ARG A C   1 
ATOM   2565 O O   . ARG A 1 332 ? -15.789 59.651 -21.536 1.00 119.13 ? 416 ARG A O   1 
ATOM   2566 C CB  . ARG A 1 332 ? -13.794 58.885 -23.643 1.00 120.46 ? 416 ARG A CB  1 
ATOM   2567 C CG  . ARG A 1 332 ? -15.015 58.715 -24.527 1.00 121.93 ? 416 ARG A CG  1 
ATOM   2568 C CD  . ARG A 1 332 ? -14.876 57.628 -25.552 1.00 126.82 ? 416 ARG A CD  1 
ATOM   2569 N NE  . ARG A 1 332 ? -15.902 57.782 -26.575 1.00 128.88 ? 416 ARG A NE  1 
ATOM   2570 C CZ  . ARG A 1 332 ? -16.089 56.937 -27.581 1.00 133.05 ? 416 ARG A CZ  1 
ATOM   2571 N NH1 . ARG A 1 332 ? -15.315 55.863 -27.704 1.00 133.83 ? 416 ARG A NH1 1 
ATOM   2572 N NH2 . ARG A 1 332 ? -17.055 57.168 -28.462 1.00 132.03 ? 416 ARG A NH2 1 
ATOM   2573 N N   . VAL A 1 333 ? -15.991 61.393 -22.948 1.00 118.53 ? 417 VAL A N   1 
ATOM   2574 C CA  . VAL A 1 333 ? -17.421 61.558 -22.703 1.00 119.96 ? 417 VAL A CA  1 
ATOM   2575 C C   . VAL A 1 333 ? -18.152 60.349 -23.292 1.00 121.87 ? 417 VAL A C   1 
ATOM   2576 O O   . VAL A 1 333 ? -18.085 60.095 -24.496 1.00 122.97 ? 417 VAL A O   1 
ATOM   2577 C CB  . VAL A 1 333 ? -17.946 62.863 -23.305 1.00 119.01 ? 417 VAL A CB  1 
ATOM   2578 C CG1 . VAL A 1 333 ? -19.387 63.091 -22.890 1.00 119.84 ? 417 VAL A CG1 1 
ATOM   2579 C CG2 . VAL A 1 333 ? -17.077 64.017 -22.851 1.00 119.69 ? 417 VAL A CG2 1 
ATOM   2580 N N   . GLU A 1 334 ? -18.853 59.613 -22.433 1.00 119.21 ? 418 GLU A N   1 
ATOM   2581 C CA  . GLU A 1 334 ? -19.161 58.211 -22.708 1.00 118.53 ? 418 GLU A CA  1 
ATOM   2582 C C   . GLU A 1 334 ? -20.164 57.918 -23.819 1.00 121.79 ? 418 GLU A C   1 
ATOM   2583 O O   . GLU A 1 334 ? -19.909 57.078 -24.688 1.00 125.26 ? 418 GLU A O   1 
ATOM   2584 C CB  . GLU A 1 334 ? -19.584 57.493 -21.431 1.00 115.35 ? 418 GLU A CB  1 
ATOM   2585 C CG  . GLU A 1 334 ? -19.416 55.994 -21.529 1.00 117.90 ? 418 GLU A CG  1 
ATOM   2586 C CD  . GLU A 1 334 ? -19.786 55.284 -20.250 1.00 119.21 ? 418 GLU A CD  1 
ATOM   2587 O OE1 . GLU A 1 334 ? -21.001 55.074 -20.013 1.00 116.88 ? 418 GLU A OE1 1 
ATOM   2588 O OE2 . GLU A 1 334 ? -18.857 54.938 -19.486 1.00 118.25 ? 418 GLU A OE2 1 
ATOM   2589 N N   . GLY A 1 335 ? -21.307 58.588 -23.789 1.00 119.78 ? 419 GLY A N   1 
ATOM   2590 C CA  . GLY A 1 335 ? -22.356 58.279 -24.739 1.00 122.03 ? 419 GLY A CA  1 
ATOM   2591 C C   . GLY A 1 335 ? -22.013 58.682 -26.159 1.00 125.12 ? 419 GLY A C   1 
ATOM   2592 O O   . GLY A 1 335 ? -22.670 58.267 -27.115 1.00 124.95 ? 419 GLY A O   1 
ATOM   2593 N N   . LEU A 1 336 ? -20.965 59.483 -26.297 1.00 126.09 ? 420 LEU A N   1 
ATOM   2594 C CA  . LEU A 1 336 ? -20.666 60.120 -27.568 1.00 128.40 ? 420 LEU A CA  1 
ATOM   2595 C C   . LEU A 1 336 ? -19.572 59.439 -28.371 1.00 131.65 ? 420 LEU A C   1 
ATOM   2596 O O   . LEU A 1 336 ? -19.029 58.397 -27.984 1.00 129.76 ? 420 LEU A O   1 
ATOM   2597 C CB  . LEU A 1 336 ? -20.279 61.578 -27.334 1.00 125.97 ? 420 LEU A CB  1 
ATOM   2598 C CG  . LEU A 1 336 ? -21.313 62.336 -26.509 1.00 127.02 ? 420 LEU A CG  1 
ATOM   2599 C CD1 . LEU A 1 336 ? -20.936 63.808 -26.382 1.00 125.78 ? 420 LEU A CD1 1 
ATOM   2600 C CD2 . LEU A 1 336 ? -22.695 62.162 -27.128 1.00 125.05 ? 420 LEU A CD2 1 
ATOM   2601 N N   . GLN A 1 337 ? -19.276 60.050 -29.512 1.00 134.43 ? 421 GLN A N   1 
ATOM   2602 C CA  . GLN A 1 337 ? -18.124 59.700 -30.320 1.00 135.46 ? 421 GLN A CA  1 
ATOM   2603 C C   . GLN A 1 337 ? -17.436 61.003 -30.662 1.00 133.34 ? 421 GLN A C   1 
ATOM   2604 O O   . GLN A 1 337 ? -18.059 61.890 -31.244 1.00 131.51 ? 421 GLN A O   1 
ATOM   2605 C CB  . GLN A 1 337 ? -18.566 59.027 -31.615 1.00 134.57 ? 421 GLN A CB  1 
ATOM   2606 C CG  . GLN A 1 337 ? -19.429 57.809 -31.420 1.00 138.44 ? 421 GLN A CG  1 
ATOM   2607 C CD  . GLN A 1 337 ? -19.569 56.983 -32.688 1.00 145.24 ? 421 GLN A CD  1 
ATOM   2608 O OE1 . GLN A 1 337 ? -18.861 57.208 -33.676 1.00 143.56 ? 421 GLN A OE1 1 
ATOM   2609 N NE2 . GLN A 1 337 ? -20.485 56.017 -32.665 1.00 145.02 ? 421 GLN A NE2 1 
ATOM   2610 N N   . GLY A 1 338 ? -16.169 61.135 -30.287 1.00 131.47 ? 422 GLY A N   1 
ATOM   2611 C CA  . GLY A 1 338 ? -15.386 62.278 -30.713 1.00 131.85 ? 422 GLY A CA  1 
ATOM   2612 C C   . GLY A 1 338 ? -15.096 63.326 -29.668 1.00 131.82 ? 422 GLY A C   1 
ATOM   2613 O O   . GLY A 1 338 ? -14.276 64.212 -29.883 1.00 133.00 ? 422 GLY A O   1 
ATOM   2614 N N   . VAL A 1 339 ? -15.771 63.238 -28.533 1.00 130.95 ? 423 VAL A N   1 
ATOM   2615 C CA  . VAL A 1 339 ? -15.607 64.256 -27.512 1.00 127.46 ? 423 VAL A CA  1 
ATOM   2616 C C   . VAL A 1 339 ? -14.779 63.733 -26.347 1.00 126.14 ? 423 VAL A C   1 
ATOM   2617 O O   . VAL A 1 339 ? -15.128 62.728 -25.727 1.00 125.03 ? 423 VAL A O   1 
ATOM   2618 C CB  . VAL A 1 339 ? -16.962 64.775 -27.027 1.00 128.41 ? 423 VAL A CB  1 
ATOM   2619 C CG1 . VAL A 1 339 ? -16.771 65.923 -26.052 1.00 126.77 ? 423 VAL A CG1 1 
ATOM   2620 C CG2 . VAL A 1 339 ? -17.802 65.216 -28.218 1.00 128.61 ? 423 VAL A CG2 1 
ATOM   2621 N N   . TYR A 1 340 ? -13.666 64.408 -26.073 1.00 127.72 ? 424 TYR A N   1 
ATOM   2622 C CA  . TYR A 1 340 ? -12.775 64.016 -24.984 1.00 125.52 ? 424 TYR A CA  1 
ATOM   2623 C C   . TYR A 1 340 ? -12.345 65.236 -24.184 1.00 125.67 ? 424 TYR A C   1 
ATOM   2624 O O   . TYR A 1 340 ? -12.464 66.367 -24.648 1.00 127.77 ? 424 TYR A O   1 
ATOM   2625 C CB  . TYR A 1 340 ? -11.530 63.297 -25.507 1.00 125.49 ? 424 TYR A CB  1 
ATOM   2626 C CG  . TYR A 1 340 ? -11.791 62.039 -26.304 1.00 125.57 ? 424 TYR A CG  1 
ATOM   2627 C CD1 . TYR A 1 340 ? -12.225 62.105 -27.622 1.00 128.68 ? 424 TYR A CD1 1 
ATOM   2628 C CD2 . TYR A 1 340 ? -11.569 60.789 -25.752 1.00 124.87 ? 424 TYR A CD2 1 
ATOM   2629 C CE1 . TYR A 1 340 ? -12.452 60.964 -28.357 1.00 128.75 ? 424 TYR A CE1 1 
ATOM   2630 C CE2 . TYR A 1 340 ? -11.785 59.646 -26.478 1.00 126.43 ? 424 TYR A CE2 1 
ATOM   2631 C CZ  . TYR A 1 340 ? -12.228 59.736 -27.782 1.00 129.26 ? 424 TYR A CZ  1 
ATOM   2632 O OH  . TYR A 1 340 ? -12.452 58.591 -28.512 1.00 132.32 ? 424 TYR A OH  1 
ATOM   2633 N N   . ILE A 1 341 ? -11.850 64.995 -22.975 1.00 124.68 ? 425 ILE A N   1 
ATOM   2634 C CA  . ILE A 1 341 ? -11.378 66.060 -22.098 1.00 125.40 ? 425 ILE A CA  1 
ATOM   2635 C C   . ILE A 1 341 ? -10.103 65.615 -21.405 1.00 128.19 ? 425 ILE A C   1 
ATOM   2636 O O   . ILE A 1 341 ? -10.097 64.606 -20.694 1.00 127.41 ? 425 ILE A O   1 
ATOM   2637 C CB  . ILE A 1 341 ? -12.414 66.419 -21.016 1.00 124.00 ? 425 ILE A CB  1 
ATOM   2638 C CG1 . ILE A 1 341 ? -13.620 67.125 -21.635 1.00 125.55 ? 425 ILE A CG1 1 
ATOM   2639 C CG2 . ILE A 1 341 ? -11.783 67.294 -19.939 1.00 122.08 ? 425 ILE A CG2 1 
ATOM   2640 C CD1 . ILE A 1 341 ? -14.681 67.512 -20.628 1.00 124.16 ? 425 ILE A CD1 1 
ATOM   2641 N N   . ALA A 1 342 ? -9.024  66.366 -21.612 1.00 131.42 ? 426 ALA A N   1 
ATOM   2642 C CA  . ALA A 1 342 ? -7.731  66.017 -21.029 1.00 131.79 ? 426 ALA A CA  1 
ATOM   2643 C C   . ALA A 1 342 ? -7.113  67.157 -20.228 1.00 131.12 ? 426 ALA A C   1 
ATOM   2644 O O   . ALA A 1 342 ? -7.534  68.311 -20.326 1.00 130.92 ? 426 ALA A O   1 
ATOM   2645 C CB  . ALA A 1 342 ? -6.767  65.539 -22.108 1.00 132.19 ? 426 ALA A CB  1 
ATOM   2646 N N   . THR A 1 343 ? -6.110  66.810 -19.428 1.00 132.33 ? 427 THR A N   1 
ATOM   2647 C CA  . THR A 1 343 ? -5.404  67.784 -18.610 1.00 138.06 ? 427 THR A CA  1 
ATOM   2648 C C   . THR A 1 343 ? -3.985  68.007 -19.139 1.00 140.85 ? 427 THR A C   1 
ATOM   2649 O O   . THR A 1 343 ? -3.249  67.050 -19.400 1.00 139.07 ? 427 THR A O   1 
ATOM   2650 C CB  . THR A 1 343 ? -5.362  67.349 -17.128 1.00 137.95 ? 427 THR A CB  1 
ATOM   2651 O OG1 . THR A 1 343 ? -6.699  67.242 -16.621 1.00 137.23 ? 427 THR A OG1 1 
ATOM   2652 C CG2 . THR A 1 343 ? -4.591  68.358 -16.288 1.00 140.10 ? 427 THR A CG2 1 
ATOM   2653 N N   . LEU A 1 344 ? -3.619  69.278 -19.306 1.00 142.29 ? 428 LEU A N   1 
ATOM   2654 C CA  . LEU A 1 344 ? -2.301  69.655 -19.810 1.00 142.67 ? 428 LEU A CA  1 
ATOM   2655 C C   . LEU A 1 344 ? -1.402  70.186 -18.693 1.00 146.12 ? 428 LEU A C   1 
ATOM   2656 O O   . LEU A 1 344 ? -1.858  70.916 -17.814 1.00 147.12 ? 428 LEU A O   1 
ATOM   2657 C CB  . LEU A 1 344 ? -2.434  70.694 -20.927 1.00 140.02 ? 428 LEU A CB  1 
ATOM   2658 C CG  . LEU A 1 344 ? -3.001  70.182 -22.254 1.00 140.97 ? 428 LEU A CG  1 
ATOM   2659 C CD1 . LEU A 1 344 ? -3.139  71.304 -23.268 1.00 137.64 ? 428 LEU A CD1 1 
ATOM   2660 C CD2 . LEU A 1 344 ? -2.126  69.074 -22.808 1.00 144.60 ? 428 LEU A CD2 1 
ATOM   2661 N N   . ILE A 1 345 ? -0.124  69.815 -18.738 1.00 148.62 ? 429 ILE A N   1 
ATOM   2662 C CA  . ILE A 1 345 ? 0.849   70.211 -17.718 1.00 151.31 ? 429 ILE A CA  1 
ATOM   2663 C C   . ILE A 1 345 ? 2.161   70.698 -18.356 1.00 154.60 ? 429 ILE A C   1 
ATOM   2664 O O   . ILE A 1 345 ? 2.526   70.269 -19.455 1.00 153.30 ? 429 ILE A O   1 
ATOM   2665 C CB  . ILE A 1 345 ? 1.139   69.037 -16.746 1.00 151.39 ? 429 ILE A CB  1 
ATOM   2666 C CG1 . ILE A 1 345 ? 2.014   69.478 -15.567 1.00 155.18 ? 429 ILE A CG1 1 
ATOM   2667 C CG2 . ILE A 1 345 ? 1.791   67.876 -17.488 1.00 148.60 ? 429 ILE A CG2 1 
ATOM   2668 C CD1 . ILE A 1 345 ? 1.325   70.379 -14.573 1.00 155.31 ? 429 ILE A CD1 1 
ATOM   2669 N N   . ASN A 1 346 ? 2.844   71.606 -17.656 1.00 157.17 ? 430 ASN A N   1 
ATOM   2670 C CA  . ASN A 1 346 ? 4.123   72.180 -18.073 1.00 157.37 ? 430 ASN A CA  1 
ATOM   2671 C C   . ASN A 1 346 ? 5.114   71.942 -16.939 1.00 158.74 ? 430 ASN A C   1 
ATOM   2672 O O   . ASN A 1 346 ? 5.889   70.980 -16.953 1.00 158.92 ? 430 ASN A O   1 
ATOM   2673 C CB  . ASN A 1 346 ? 3.953   73.687 -18.330 1.00 153.74 ? 430 ASN A CB  1 
ATOM   2674 C CG  . ASN A 1 346 ? 5.186   74.340 -18.958 1.00 150.79 ? 430 ASN A CG  1 
ATOM   2675 O OD1 . ASN A 1 346 ? 6.244   73.716 -19.084 1.00 152.15 ? 430 ASN A OD1 1 
ATOM   2676 N ND2 . ASN A 1 346 ? 5.015   75.608 -19.401 1.00 148.74 ? 430 ASN A ND2 1 
ATOM   2677 N N   . GLY A 1 347 ? 5.043   72.807 -15.932 1.00 160.09 ? 431 GLY A N   1 
ATOM   2678 C CA  . GLY A 1 347 ? 5.921   72.732 -14.781 1.00 164.35 ? 431 GLY A CA  1 
ATOM   2679 C C   . GLY A 1 347 ? 5.558   71.603 -13.836 1.00 168.32 ? 431 GLY A C   1 
ATOM   2680 O O   . GLY A 1 347 ? 5.641   70.427 -14.194 1.00 169.17 ? 431 GLY A O   1 
ATOM   2681 N N   . ASN A 1 353 ? 0.569   73.769 -12.326 1.00 156.23 ? 437 ASN A N   1 
ATOM   2682 C CA  . ASN A 1 353 ? 0.648   74.187 -13.722 1.00 156.69 ? 437 ASN A CA  1 
ATOM   2683 C C   . ASN A 1 353 ? -0.320  73.400 -14.603 1.00 154.62 ? 437 ASN A C   1 
ATOM   2684 O O   . ASN A 1 353 ? 0.023   73.021 -15.723 1.00 154.08 ? 437 ASN A O   1 
ATOM   2685 C CB  . ASN A 1 353 ? 2.075   74.016 -14.254 1.00 161.04 ? 437 ASN A CB  1 
ATOM   2686 C CG  . ASN A 1 353 ? 3.131   74.443 -13.252 1.00 165.61 ? 437 ASN A CG  1 
ATOM   2687 O OD1 . ASN A 1 353 ? 3.502   73.677 -12.360 1.00 165.98 ? 437 ASN A OD1 1 
ATOM   2688 N ND2 . ASN A 1 353 ? 3.631   75.668 -13.400 1.00 167.45 ? 437 ASN A ND2 1 
ATOM   2689 N N   . MET A 1 354 ? -1.528  73.159 -14.098 1.00 151.33 ? 438 MET A N   1 
ATOM   2690 C CA  . MET A 1 354 ? -2.502  72.320 -14.797 1.00 147.05 ? 438 MET A CA  1 
ATOM   2691 C C   . MET A 1 354 ? -3.639  73.114 -15.452 1.00 146.69 ? 438 MET A C   1 
ATOM   2692 O O   . MET A 1 354 ? -4.148  74.079 -14.880 1.00 146.64 ? 438 MET A O   1 
ATOM   2693 C CB  . MET A 1 354 ? -3.083  71.288 -13.833 1.00 144.35 ? 438 MET A CB  1 
ATOM   2694 C CG  . MET A 1 354 ? -2.044  70.528 -13.033 1.00 145.52 ? 438 MET A CG  1 
ATOM   2695 S SD  . MET A 1 354 ? -2.808  69.512 -11.759 1.00 139.45 ? 438 MET A SD  1 
ATOM   2696 C CE  . MET A 1 354 ? -1.390  68.702 -11.042 1.00 144.88 ? 438 MET A CE  1 
ATOM   2697 N N   . ARG A 1 355 ? -4.028  72.699 -16.658 1.00 146.02 ? 439 ARG A N   1 
ATOM   2698 C CA  . ARG A 1 355 ? -5.122  73.326 -17.407 1.00 143.60 ? 439 ARG A CA  1 
ATOM   2699 C C   . ARG A 1 355 ? -5.909  72.254 -18.178 1.00 140.79 ? 439 ARG A C   1 
ATOM   2700 O O   . ARG A 1 355 ? -5.377  71.186 -18.482 1.00 139.48 ? 439 ARG A O   1 
ATOM   2701 C CB  . ARG A 1 355 ? -4.580  74.386 -18.380 1.00 146.31 ? 439 ARG A CB  1 
ATOM   2702 C CG  . ARG A 1 355 ? -3.690  75.463 -17.748 1.00 148.17 ? 439 ARG A CG  1 
ATOM   2703 C CD  . ARG A 1 355 ? -2.998  76.332 -18.796 1.00 148.40 ? 439 ARG A CD  1 
ATOM   2704 N NE  . ARG A 1 355 ? -3.719  77.578 -19.047 1.00 153.11 ? 439 ARG A NE  1 
ATOM   2705 C CZ  . ARG A 1 355 ? -3.333  78.501 -19.922 1.00 155.93 ? 439 ARG A CZ  1 
ATOM   2706 N NH1 . ARG A 1 355 ? -2.233  78.315 -20.641 1.00 157.95 ? 439 ARG A NH1 1 
ATOM   2707 N NH2 . ARG A 1 355 ? -4.051  79.607 -20.085 1.00 153.10 ? 439 ARG A NH2 1 
ATOM   2708 N N   . SER A 1 356 ? -7.169  72.541 -18.500 1.00 139.41 ? 440 SER A N   1 
ATOM   2709 C CA  . SER A 1 356 ? -8.031  71.558 -19.164 1.00 136.22 ? 440 SER A CA  1 
ATOM   2710 C C   . SER A 1 356 ? -8.398  71.920 -20.605 1.00 134.87 ? 440 SER A C   1 
ATOM   2711 O O   . SER A 1 356 ? -8.733  73.068 -20.911 1.00 135.44 ? 440 SER A O   1 
ATOM   2712 C CB  . SER A 1 356 ? -9.312  71.337 -18.354 1.00 136.42 ? 440 SER A CB  1 
ATOM   2713 O OG  . SER A 1 356 ? -9.037  70.752 -17.093 1.00 137.35 ? 440 SER A OG  1 
ATOM   2714 N N   . VAL A 1 357 ? -8.355  70.922 -21.482 1.00 133.23 ? 441 VAL A N   1 
ATOM   2715 C CA  . VAL A 1 357 ? -8.674  71.127 -22.890 1.00 134.04 ? 441 VAL A CA  1 
ATOM   2716 C C   . VAL A 1 357 ? -9.707  70.131 -23.414 1.00 133.80 ? 441 VAL A C   1 
ATOM   2717 O O   . VAL A 1 357 ? -9.699  68.959 -23.041 1.00 134.40 ? 441 VAL A O   1 
ATOM   2718 C CB  . VAL A 1 357 ? -7.413  71.085 -23.778 1.00 133.21 ? 441 VAL A CB  1 
ATOM   2719 C CG1 . VAL A 1 357 ? -6.578  72.327 -23.548 1.00 135.52 ? 441 VAL A CG1 1 
ATOM   2720 C CG2 . VAL A 1 357 ? -6.607  69.828 -23.510 1.00 132.40 ? 441 VAL A CG2 1 
ATOM   2721 N N   . ILE A 1 358 ? -10.594 70.604 -24.283 1.00 132.40 ? 442 ILE A N   1 
ATOM   2722 C CA  . ILE A 1 358 ? -11.665 69.768 -24.807 1.00 132.64 ? 442 ILE A CA  1 
ATOM   2723 C C   . ILE A 1 358 ? -11.644 69.721 -26.337 1.00 134.95 ? 442 ILE A C   1 
ATOM   2724 O O   . ILE A 1 358 ? -11.323 70.705 -26.994 1.00 136.77 ? 442 ILE A O   1 
ATOM   2725 C CB  . ILE A 1 358 ? -13.043 70.252 -24.292 1.00 134.31 ? 442 ILE A CB  1 
ATOM   2726 C CG1 . ILE A 1 358 ? -14.143 69.235 -24.592 1.00 133.83 ? 442 ILE A CG1 1 
ATOM   2727 C CG2 . ILE A 1 358 ? -13.392 71.624 -24.858 1.00 137.82 ? 442 ILE A CG2 1 
ATOM   2728 C CD1 . ILE A 1 358 ? -15.435 69.521 -23.850 1.00 130.98 ? 442 ILE A CD1 1 
ATOM   2729 N N   . THR A 1 359 ? -11.963 68.562 -26.898 1.00 135.71 ? 443 THR A N   1 
ATOM   2730 C CA  . THR A 1 359 ? -12.050 68.416 -28.341 1.00 137.88 ? 443 THR A CA  1 
ATOM   2731 C C   . THR A 1 359 ? -13.377 67.786 -28.719 1.00 138.80 ? 443 THR A C   1 
ATOM   2732 O O   . THR A 1 359 ? -13.705 66.700 -28.238 1.00 137.89 ? 443 THR A O   1 
ATOM   2733 C CB  . THR A 1 359 ? -10.897 67.532 -28.881 1.00 138.52 ? 443 THR A CB  1 
ATOM   2734 O OG1 . THR A 1 359 ? -11.123 67.239 -30.266 1.00 139.73 ? 443 THR A OG1 1 
ATOM   2735 C CG2 . THR A 1 359 ? -10.767 66.218 -28.103 1.00 133.84 ? 443 THR A CG2 1 
ATOM   2736 N N   . PHE A 1 360 ? -14.167 68.428 -29.567 1.00 139.43 ? 444 PHE A N   1 
ATOM   2737 C CA  . PHE A 1 360 ? -15.346 67.709 -30.035 1.00 138.99 ? 444 PHE A CA  1 
ATOM   2738 C C   . PHE A 1 360 ? -15.025 66.822 -31.236 1.00 141.30 ? 444 PHE A C   1 
ATOM   2739 O O   . PHE A 1 360 ? -15.789 65.916 -31.553 1.00 142.37 ? 444 PHE A O   1 
ATOM   2740 C CB  . PHE A 1 360 ? -16.517 68.664 -30.244 1.00 144.20 ? 444 PHE A CB  1 
ATOM   2741 C CG  . PHE A 1 360 ? -16.665 69.712 -29.159 1.00 148.37 ? 444 PHE A CG  1 
ATOM   2742 C CD1 . PHE A 1 360 ? -17.008 71.006 -29.506 1.00 153.89 ? 444 PHE A CD1 1 
ATOM   2743 C CD2 . PHE A 1 360 ? -16.478 69.447 -27.837 1.00 142.58 ? 444 PHE A CD2 1 
ATOM   2744 C CE1 . PHE A 1 360 ? -17.148 72.012 -28.537 1.00 148.19 ? 444 PHE A CE1 1 
ATOM   2745 C CE2 . PHE A 1 360 ? -16.635 70.492 -26.906 1.00 138.72 ? 444 PHE A CE2 1 
ATOM   2746 C CZ  . PHE A 1 360 ? -16.970 71.766 -27.270 1.00 142.28 ? 444 PHE A CZ  1 
ATOM   2747 N N   . ASP A 1 361 ? -13.867 67.039 -31.860 1.00 143.08 ? 445 ASP A N   1 
ATOM   2748 C CA  . ASP A 1 361 ? -13.326 66.065 -32.820 1.00 141.13 ? 445 ASP A CA  1 
ATOM   2749 C C   . ASP A 1 361 ? -12.452 65.065 -32.080 1.00 140.89 ? 445 ASP A C   1 
ATOM   2750 O O   . ASP A 1 361 ? -11.958 65.345 -30.981 1.00 141.49 ? 445 ASP A O   1 
ATOM   2751 C CB  . ASP A 1 361 ? -12.494 66.757 -33.904 1.00 139.78 ? 445 ASP A CB  1 
ATOM   2752 C CG  . ASP A 1 361 ? -11.790 67.996 -33.388 1.00 143.54 ? 445 ASP A CG  1 
ATOM   2753 O OD1 . ASP A 1 361 ? -11.815 68.233 -32.161 1.00 143.51 ? 445 ASP A OD1 1 
ATOM   2754 O OD2 . ASP A 1 361 ? -11.212 68.735 -34.210 1.00 144.34 ? 445 ASP A OD2 1 
ATOM   2755 N N   . LYS A 1 362 ? -12.253 63.900 -32.681 1.00 137.00 ? 446 LYS A N   1 
ATOM   2756 C CA  . LYS A 1 362 ? -11.396 62.894 -32.075 1.00 138.58 ? 446 LYS A CA  1 
ATOM   2757 C C   . LYS A 1 362 ? -9.924  63.278 -32.186 1.00 141.97 ? 446 LYS A C   1 
ATOM   2758 O O   . LYS A 1 362 ? -9.153  62.608 -32.871 1.00 144.75 ? 446 LYS A O   1 
ATOM   2759 C CB  . LYS A 1 362 ? -11.645 61.518 -32.697 1.00 139.42 ? 446 LYS A CB  1 
ATOM   2760 C CG  . LYS A 1 362 ? -12.982 60.941 -32.335 1.00 138.98 ? 446 LYS A CG  1 
ATOM   2761 C CD  . LYS A 1 362 ? -13.236 59.561 -32.901 1.00 141.48 ? 446 LYS A CD  1 
ATOM   2762 C CE  . LYS A 1 362 ? -14.644 59.113 -32.507 1.00 143.27 ? 446 LYS A CE  1 
ATOM   2763 N NZ  . LYS A 1 362 ? -15.046 57.786 -33.054 1.00 143.41 ? 446 LYS A NZ  1 
ATOM   2764 N N   . GLY A 1 363 ? -9.543  64.354 -31.504 1.00 141.79 ? 447 GLY A N   1 
ATOM   2765 C CA  . GLY A 1 363 ? -8.162  64.799 -31.488 1.00 145.69 ? 447 GLY A CA  1 
ATOM   2766 C C   . GLY A 1 363 ? -7.758  65.595 -32.715 1.00 145.47 ? 447 GLY A C   1 
ATOM   2767 O O   . GLY A 1 363 ? -6.585  65.938 -32.885 1.00 145.26 ? 447 GLY A O   1 
ATOM   2768 N N   . GLY A 1 364 ? -8.733  65.892 -33.570 1.00 143.34 ? 448 GLY A N   1 
ATOM   2769 C CA  . GLY A 1 364 ? -8.489  66.713 -34.740 1.00 143.89 ? 448 GLY A CA  1 
ATOM   2770 C C   . GLY A 1 364 ? -8.102  68.131 -34.361 1.00 145.56 ? 448 GLY A C   1 
ATOM   2771 O O   . GLY A 1 364 ? -7.182  68.716 -34.937 1.00 148.72 ? 448 GLY A O   1 
ATOM   2772 N N   . THR A 1 365 ? -8.823  68.691 -33.394 1.00 143.82 ? 449 THR A N   1 
ATOM   2773 C CA  . THR A 1 365 ? -8.536  70.023 -32.865 1.00 142.91 ? 449 THR A CA  1 
ATOM   2774 C C   . THR A 1 365 ? -8.737  69.982 -31.360 1.00 142.03 ? 449 THR A C   1 
ATOM   2775 O O   . THR A 1 365 ? -9.437  69.116 -30.864 1.00 144.63 ? 449 THR A O   1 
ATOM   2776 C CB  . THR A 1 365 ? -9.472  71.111 -33.459 1.00 141.61 ? 449 THR A CB  1 
ATOM   2777 O OG1 . THR A 1 365 ? -10.823 70.881 -33.035 1.00 142.07 ? 449 THR A OG1 1 
ATOM   2778 C CG2 . THR A 1 365 ? -9.416  71.111 -34.983 1.00 142.11 ? 449 THR A CG2 1 
ATOM   2779 N N   . TRP A 1 366 ? -8.123  70.906 -30.632 1.00 138.79 ? 450 TRP A N   1 
ATOM   2780 C CA  . TRP A 1 366 ? -8.331  70.986 -29.191 1.00 137.52 ? 450 TRP A CA  1 
ATOM   2781 C C   . TRP A 1 366 ? -8.663  72.426 -28.824 1.00 137.56 ? 450 TRP A C   1 
ATOM   2782 O O   . TRP A 1 366 ? -8.508  73.319 -29.647 1.00 140.36 ? 450 TRP A O   1 
ATOM   2783 C CB  . TRP A 1 366 ? -7.106  70.475 -28.429 1.00 137.15 ? 450 TRP A CB  1 
ATOM   2784 C CG  . TRP A 1 366 ? -6.919  68.979 -28.514 1.00 139.98 ? 450 TRP A CG  1 
ATOM   2785 C CD1 . TRP A 1 366 ? -6.314  68.280 -29.521 1.00 141.12 ? 450 TRP A CD1 1 
ATOM   2786 C CD2 . TRP A 1 366 ? -7.339  68.003 -27.549 1.00 140.78 ? 450 TRP A CD2 1 
ATOM   2787 N NE1 . TRP A 1 366 ? -6.333  66.933 -29.244 1.00 140.83 ? 450 TRP A NE1 1 
ATOM   2788 C CE2 . TRP A 1 366 ? -6.957  66.737 -28.038 1.00 140.70 ? 450 TRP A CE2 1 
ATOM   2789 C CE3 . TRP A 1 366 ? -8.006  68.078 -26.320 1.00 137.77 ? 450 TRP A CE3 1 
ATOM   2790 C CZ2 . TRP A 1 366 ? -7.217  65.558 -27.343 1.00 138.37 ? 450 TRP A CZ2 1 
ATOM   2791 C CZ3 . TRP A 1 366 ? -8.263  66.907 -25.632 1.00 134.10 ? 450 TRP A CZ3 1 
ATOM   2792 C CH2 . TRP A 1 366 ? -7.868  65.664 -26.144 1.00 135.76 ? 450 TRP A CH2 1 
ATOM   2793 N N   . GLU A 1 367 ? -9.127  72.658 -27.602 1.00 136.51 ? 451 GLU A N   1 
ATOM   2794 C CA  . GLU A 1 367 ? -9.641  73.978 -27.248 1.00 138.70 ? 451 GLU A CA  1 
ATOM   2795 C C   . GLU A 1 367 ? -9.547  74.224 -25.750 1.00 139.14 ? 451 GLU A C   1 
ATOM   2796 O O   . GLU A 1 367 ? -9.317  73.300 -24.984 1.00 139.34 ? 451 GLU A O   1 
ATOM   2797 C CB  . GLU A 1 367 ? -11.100 74.093 -27.698 1.00 140.60 ? 451 GLU A CB  1 
ATOM   2798 C CG  . GLU A 1 367 ? -11.425 75.341 -28.497 1.00 145.11 ? 451 GLU A CG  1 
ATOM   2799 C CD  . GLU A 1 367 ? -12.778 75.250 -29.186 1.00 148.74 ? 451 GLU A CD  1 
ATOM   2800 O OE1 . GLU A 1 367 ? -13.771 74.890 -28.517 1.00 146.50 ? 451 GLU A OE1 1 
ATOM   2801 O OE2 . GLU A 1 367 ? -12.847 75.532 -30.402 1.00 152.52 ? 451 GLU A OE2 1 
ATOM   2802 N N   . PHE A 1 368 ? -9.728  75.470 -25.330 1.00 139.86 ? 452 PHE A N   1 
ATOM   2803 C CA  . PHE A 1 368 ? -9.781  75.782 -23.906 1.00 142.12 ? 452 PHE A CA  1 
ATOM   2804 C C   . PHE A 1 368 ? -11.230 75.797 -23.424 1.00 143.94 ? 452 PHE A C   1 
ATOM   2805 O O   . PHE A 1 368 ? -12.122 76.259 -24.140 1.00 143.44 ? 452 PHE A O   1 
ATOM   2806 C CB  . PHE A 1 368 ? -9.103  77.120 -23.622 1.00 144.83 ? 452 PHE A CB  1 
ATOM   2807 C CG  . PHE A 1 368 ? -7.666  76.993 -23.218 1.00 143.79 ? 452 PHE A CG  1 
ATOM   2808 C CD1 . PHE A 1 368 ? -6.781  76.247 -23.977 1.00 142.56 ? 452 PHE A CD1 1 
ATOM   2809 C CD2 . PHE A 1 368 ? -7.197  77.629 -22.084 1.00 146.46 ? 452 PHE A CD2 1 
ATOM   2810 C CE1 . PHE A 1 368 ? -5.457  76.132 -23.605 1.00 142.45 ? 452 PHE A CE1 1 
ATOM   2811 C CE2 . PHE A 1 368 ? -5.878  77.515 -21.705 1.00 148.20 ? 452 PHE A CE2 1 
ATOM   2812 C CZ  . PHE A 1 368 ? -5.004  76.769 -22.467 1.00 145.07 ? 452 PHE A CZ  1 
ATOM   2813 N N   . LEU A 1 369 ? -11.463 75.286 -22.215 1.00 143.87 ? 453 LEU A N   1 
ATOM   2814 C CA  . LEU A 1 369 ? -12.823 75.147 -21.688 1.00 142.20 ? 453 LEU A CA  1 
ATOM   2815 C C   . LEU A 1 369 ? -13.413 76.469 -21.209 1.00 141.89 ? 453 LEU A C   1 
ATOM   2816 O O   . LEU A 1 369 ? -13.012 77.005 -20.176 1.00 142.99 ? 453 LEU A O   1 
ATOM   2817 C CB  . LEU A 1 369 ? -12.882 74.109 -20.560 1.00 140.48 ? 453 LEU A CB  1 
ATOM   2818 C CG  . LEU A 1 369 ? -13.073 72.636 -20.928 1.00 134.87 ? 453 LEU A CG  1 
ATOM   2819 C CD1 . LEU A 1 369 ? -11.845 72.114 -21.615 1.00 136.81 ? 453 LEU A CD1 1 
ATOM   2820 C CD2 . LEU A 1 369 ? -13.370 71.811 -19.693 1.00 130.71 ? 453 LEU A CD2 1 
ATOM   2821 N N   . GLN A 1 370 ? -14.386 76.969 -21.963 1.00 140.13 ? 454 GLN A N   1 
ATOM   2822 C CA  . GLN A 1 370 ? -15.038 78.243 -21.676 1.00 140.50 ? 454 GLN A CA  1 
ATOM   2823 C C   . GLN A 1 370 ? -15.756 78.254 -20.330 1.00 138.42 ? 454 GLN A C   1 
ATOM   2824 O O   . GLN A 1 370 ? -16.731 77.538 -20.133 1.00 139.12 ? 454 GLN A O   1 
ATOM   2825 C CB  . GLN A 1 370 ? -16.012 78.609 -22.804 1.00 140.40 ? 454 GLN A CB  1 
ATOM   2826 C CG  . GLN A 1 370 ? -16.905 77.461 -23.291 1.00 141.22 ? 454 GLN A CG  1 
ATOM   2827 C CD  . GLN A 1 370 ? -16.200 76.491 -24.244 1.00 142.81 ? 454 GLN A CD  1 
ATOM   2828 O OE1 . GLN A 1 370 ? -15.045 76.114 -24.027 1.00 143.10 ? 454 GLN A OE1 1 
ATOM   2829 N NE2 . GLN A 1 370 ? -16.900 76.084 -25.303 1.00 140.77 ? 454 GLN A NE2 1 
ATOM   2830 N N   . ALA A 1 371 ? -15.260 79.076 -19.411 1.00 138.40 ? 455 ALA A N   1 
ATOM   2831 C CA  . ALA A 1 371 ? -15.847 79.209 -18.084 1.00 138.29 ? 455 ALA A CA  1 
ATOM   2832 C C   . ALA A 1 371 ? -17.298 79.676 -18.161 1.00 140.07 ? 455 ALA A C   1 
ATOM   2833 O O   . ALA A 1 371 ? -17.705 80.292 -19.147 1.00 140.12 ? 455 ALA A O   1 
ATOM   2834 C CB  . ALA A 1 371 ? -15.020 80.173 -17.244 1.00 142.34 ? 455 ALA A CB  1 
ATOM   2835 N N   . PRO A 1 372 ? -18.090 79.375 -17.120 1.00 141.01 ? 456 PRO A N   1 
ATOM   2836 C CA  . PRO A 1 372 ? -19.497 79.786 -17.085 1.00 142.86 ? 456 PRO A CA  1 
ATOM   2837 C C   . PRO A 1 372 ? -19.698 81.304 -17.133 1.00 147.33 ? 456 PRO A C   1 
ATOM   2838 O O   . PRO A 1 372 ? -18.743 82.070 -16.979 1.00 145.95 ? 456 PRO A O   1 
ATOM   2839 C CB  . PRO A 1 372 ? -19.993 79.222 -15.743 1.00 139.62 ? 456 PRO A CB  1 
ATOM   2840 C CG  . PRO A 1 372 ? -18.754 78.951 -14.945 1.00 136.36 ? 456 PRO A CG  1 
ATOM   2841 C CD  . PRO A 1 372 ? -17.739 78.543 -15.956 1.00 138.82 ? 456 PRO A CD  1 
ATOM   2842 N N   . ALA A 1 373 ? -20.944 81.720 -17.346 1.00 149.35 ? 457 ALA A N   1 
ATOM   2843 C CA  . ALA A 1 373 ? -21.283 83.132 -17.457 1.00 148.52 ? 457 ALA A CA  1 
ATOM   2844 C C   . ALA A 1 373 ? -21.717 83.717 -16.117 1.00 150.84 ? 457 ALA A C   1 
ATOM   2845 O O   . ALA A 1 373 ? -21.833 84.933 -15.973 1.00 153.92 ? 457 ALA A O   1 
ATOM   2846 C CB  . ALA A 1 373 ? -22.371 83.329 -18.501 1.00 145.08 ? 457 ALA A CB  1 
ATOM   2847 N N   . PHE A 1 374 ? -21.953 82.855 -15.134 1.00 150.75 ? 458 PHE A N   1 
ATOM   2848 C CA  . PHE A 1 374 ? -22.418 83.324 -13.834 1.00 151.67 ? 458 PHE A CA  1 
ATOM   2849 C C   . PHE A 1 374 ? -22.018 82.419 -12.674 1.00 149.55 ? 458 PHE A C   1 
ATOM   2850 O O   . PHE A 1 374 ? -21.264 81.466 -12.844 1.00 147.14 ? 458 PHE A O   1 
ATOM   2851 C CB  . PHE A 1 374 ? -23.938 83.531 -13.841 1.00 153.19 ? 458 PHE A CB  1 
ATOM   2852 C CG  . PHE A 1 374 ? -24.698 82.486 -14.614 1.00 155.89 ? 458 PHE A CG  1 
ATOM   2853 C CD1 . PHE A 1 374 ? -24.834 81.195 -14.123 1.00 154.97 ? 458 PHE A CD1 1 
ATOM   2854 C CD2 . PHE A 1 374 ? -25.294 82.803 -15.827 1.00 157.29 ? 458 PHE A CD2 1 
ATOM   2855 C CE1 . PHE A 1 374 ? -25.541 80.235 -14.837 1.00 151.10 ? 458 PHE A CE1 1 
ATOM   2856 C CE2 . PHE A 1 374 ? -26.001 81.849 -16.545 1.00 156.02 ? 458 PHE A CE2 1 
ATOM   2857 C CZ  . PHE A 1 374 ? -26.124 80.564 -16.049 1.00 152.19 ? 458 PHE A CZ  1 
ATOM   2858 N N   . THR A 1 375 ? -22.542 82.735 -11.496 1.00 146.98 ? 459 THR A N   1 
ATOM   2859 C CA  . THR A 1 375 ? -22.233 81.996 -10.284 1.00 142.50 ? 459 THR A CA  1 
ATOM   2860 C C   . THR A 1 375 ? -23.475 81.289 -9.753  1.00 145.03 ? 459 THR A C   1 
ATOM   2861 O O   . THR A 1 375 ? -23.413 80.138 -9.316  1.00 142.71 ? 459 THR A O   1 
ATOM   2862 C CB  . THR A 1 375 ? -21.690 82.943 -9.207  1.00 142.33 ? 459 THR A CB  1 
ATOM   2863 O OG1 . THR A 1 375 ? -20.648 83.748 -9.770  1.00 145.88 ? 459 THR A OG1 1 
ATOM   2864 C CG2 . THR A 1 375 ? -21.143 82.165 -8.023  1.00 141.56 ? 459 THR A CG2 1 
ATOM   2865 N N   . GLY A 1 376 ? -24.609 81.982 -9.804  1.00 146.28 ? 460 GLY A N   1 
ATOM   2866 C CA  . GLY A 1 376 ? -25.838 81.466 -9.235  1.00 141.57 ? 460 GLY A CA  1 
ATOM   2867 C C   . GLY A 1 376 ? -25.862 81.721 -7.742  1.00 142.29 ? 460 GLY A C   1 
ATOM   2868 O O   . GLY A 1 376 ? -25.145 82.591 -7.243  1.00 141.45 ? 460 GLY A O   1 
ATOM   2869 N N   . LYS A 1 380 ? -22.532 86.576 -10.664 1.00 145.48 ? 464 LYS A N   1 
ATOM   2870 C CA  . LYS A 1 380 ? -21.922 86.347 -11.972 1.00 150.86 ? 464 LYS A CA  1 
ATOM   2871 C C   . LYS A 1 380 ? -20.404 86.602 -11.925 1.00 154.47 ? 464 LYS A C   1 
ATOM   2872 O O   . LYS A 1 380 ? -19.910 87.244 -10.993 1.00 152.57 ? 464 LYS A O   1 
ATOM   2873 C CB  . LYS A 1 380 ? -22.607 87.209 -13.041 1.00 151.18 ? 464 LYS A CB  1 
ATOM   2874 C CG  . LYS A 1 380 ? -24.105 86.930 -13.217 1.00 149.13 ? 464 LYS A CG  1 
ATOM   2875 C CD  . LYS A 1 380 ? -24.735 87.825 -14.293 1.00 152.93 ? 464 LYS A CD  1 
ATOM   2876 C CE  . LYS A 1 380 ? -26.253 87.601 -14.419 1.00 154.07 ? 464 LYS A CE  1 
ATOM   2877 N NZ  . LYS A 1 380 ? -26.960 88.678 -15.190 1.00 146.55 ? 464 LYS A NZ  1 
ATOM   2878 N N   . ILE A 1 381 ? -19.666 86.098 -12.917 1.00 155.03 ? 465 ILE A N   1 
ATOM   2879 C CA  . ILE A 1 381 ? -18.198 86.144 -12.868 1.00 155.48 ? 465 ILE A CA  1 
ATOM   2880 C C   . ILE A 1 381 ? -17.519 86.350 -14.235 1.00 154.27 ? 465 ILE A C   1 
ATOM   2881 O O   . ILE A 1 381 ? -18.070 85.994 -15.278 1.00 151.17 ? 465 ILE A O   1 
ATOM   2882 C CB  . ILE A 1 381 ? -17.619 84.888 -12.148 1.00 157.75 ? 465 ILE A CB  1 
ATOM   2883 C CG1 . ILE A 1 381 ? -16.199 85.155 -11.632 1.00 158.51 ? 465 ILE A CG1 1 
ATOM   2884 C CG2 . ILE A 1 381 ? -17.680 83.654 -13.053 1.00 153.72 ? 465 ILE A CG2 1 
ATOM   2885 C CD1 . ILE A 1 381 ? -16.095 86.346 -10.683 1.00 155.30 ? 465 ILE A CD1 1 
ATOM   2886 N N   . ASN A 1 382 ? -16.319 86.929 -14.203 1.00 156.76 ? 466 ASN A N   1 
ATOM   2887 C CA  . ASN A 1 382 ? -15.574 87.301 -15.403 1.00 158.12 ? 466 ASN A CA  1 
ATOM   2888 C C   . ASN A 1 382 ? -14.421 86.353 -15.721 1.00 158.40 ? 466 ASN A C   1 
ATOM   2889 O O   . ASN A 1 382 ? -13.540 86.122 -14.890 1.00 157.12 ? 466 ASN A O   1 
ATOM   2890 C CB  . ASN A 1 382 ? -15.019 88.716 -15.242 1.00 157.98 ? 466 ASN A CB  1 
ATOM   2891 C CG  . ASN A 1 382 ? -14.181 88.868 -13.983 1.00 158.83 ? 466 ASN A CG  1 
ATOM   2892 O OD1 . ASN A 1 382 ? -14.297 88.075 -13.047 1.00 156.31 ? 466 ASN A OD1 1 
ATOM   2893 N ND2 . ASN A 1 382 ? -13.333 89.889 -13.953 1.00 160.51 ? 466 ASN A ND2 1 
ATOM   2894 N N   . CYS A 1 383 ? -14.426 85.814 -16.934 1.00 158.41 ? 467 CYS A N   1 
ATOM   2895 C CA  . CYS A 1 383 ? -13.334 84.963 -17.391 1.00 161.16 ? 467 CYS A CA  1 
ATOM   2896 C C   . CYS A 1 383 ? -13.273 84.939 -18.913 1.00 163.54 ? 467 CYS A C   1 
ATOM   2897 O O   . CYS A 1 383 ? -14.305 84.872 -19.591 1.00 161.61 ? 467 CYS A O   1 
ATOM   2898 C CB  . CYS A 1 383 ? -13.472 83.543 -16.834 1.00 160.55 ? 467 CYS A CB  1 
ATOM   2899 S SG  . CYS A 1 383 ? -12.104 82.427 -17.260 1.00 159.17 ? 467 CYS A SG  1 
ATOM   2900 N N   . GLU A 1 384 ? -12.054 84.991 -19.443 1.00 164.67 ? 468 GLU A N   1 
ATOM   2901 C CA  . GLU A 1 384 ? -11.856 85.107 -20.880 1.00 163.05 ? 468 GLU A CA  1 
ATOM   2902 C C   . GLU A 1 384 ? -10.613 84.369 -21.383 1.00 161.86 ? 468 GLU A C   1 
ATOM   2903 O O   . GLU A 1 384 ? -9.544  84.434 -20.774 1.00 161.15 ? 468 GLU A O   1 
ATOM   2904 C CB  . GLU A 1 384 ? -11.806 86.582 -21.279 1.00 162.87 ? 468 GLU A CB  1 
ATOM   2905 C CG  . GLU A 1 384 ? -11.938 86.807 -22.765 1.00 164.75 ? 468 GLU A CG  1 
ATOM   2906 C CD  . GLU A 1 384 ? -13.053 85.981 -23.371 1.00 165.57 ? 468 GLU A CD  1 
ATOM   2907 O OE1 . GLU A 1 384 ? -14.169 85.980 -22.808 1.00 170.07 ? 468 GLU A OE1 1 
ATOM   2908 O OE2 . GLU A 1 384 ? -12.810 85.323 -24.404 1.00 164.10 1 468 GLU A OE2 1 
ATOM   2909 N N   . LEU A 1 385 ? -10.773 83.673 -22.506 1.00 161.14 ? 469 LEU A N   1 
ATOM   2910 C CA  . LEU A 1 385 ? -9.698  82.888 -23.110 1.00 162.93 ? 469 LEU A CA  1 
ATOM   2911 C C   . LEU A 1 385 ? -8.524  83.755 -23.562 1.00 162.89 ? 469 LEU A C   1 
ATOM   2912 O O   . LEU A 1 385 ? -7.361  83.368 -23.421 1.00 160.25 ? 469 LEU A O   1 
ATOM   2913 C CB  . LEU A 1 385 ? -10.240 82.086 -24.296 1.00 163.31 ? 469 LEU A CB  1 
ATOM   2914 C CG  . LEU A 1 385 ? -9.218  81.472 -25.256 1.00 162.72 ? 469 LEU A CG  1 
ATOM   2915 C CD1 . LEU A 1 385 ? -8.279  80.515 -24.530 1.00 158.21 ? 469 LEU A CD1 1 
ATOM   2916 C CD2 . LEU A 1 385 ? -9.927  80.766 -26.400 1.00 161.50 ? 469 LEU A CD2 1 
ATOM   2917 N N   . SER A 1 386 ? -8.842  84.922 -24.114 1.00 163.79 ? 470 SER A N   1 
ATOM   2918 C CA  . SER A 1 386 ? -7.834  85.867 -24.574 1.00 162.13 ? 470 SER A CA  1 
ATOM   2919 C C   . SER A 1 386 ? -6.960  86.321 -23.411 1.00 164.02 ? 470 SER A C   1 
ATOM   2920 O O   . SER A 1 386 ? -5.742  86.449 -23.547 1.00 164.05 ? 470 SER A O   1 
ATOM   2921 C CB  . SER A 1 386 ? -8.502  87.080 -25.216 1.00 158.13 ? 470 SER A CB  1 
ATOM   2922 O OG  . SER A 1 386 ? -9.171  87.858 -24.241 1.00 156.13 ? 470 SER A OG  1 
ATOM   2923 N N   . GLN A 1 387 ? -7.593  86.565 -22.267 1.00 163.03 ? 471 GLN A N   1 
ATOM   2924 C CA  . GLN A 1 387 ? -6.869  86.933 -21.058 1.00 162.98 ? 471 GLN A CA  1 
ATOM   2925 C C   . GLN A 1 387 ? -5.989  85.769 -20.609 1.00 164.03 ? 471 GLN A C   1 
ATOM   2926 O O   . GLN A 1 387 ? -4.895  85.972 -20.082 1.00 163.34 ? 471 GLN A O   1 
ATOM   2927 C CB  . GLN A 1 387 ? -7.842  87.334 -19.948 1.00 163.63 ? 471 GLN A CB  1 
ATOM   2928 C CG  . GLN A 1 387 ? -7.171  87.907 -18.709 1.00 164.34 ? 471 GLN A CG  1 
ATOM   2929 C CD  . GLN A 1 387 ? -6.448  89.211 -18.984 1.00 162.72 ? 471 GLN A CD  1 
ATOM   2930 O OE1 . GLN A 1 387 ? -7.001  90.126 -19.593 1.00 162.28 ? 471 GLN A OE1 1 
ATOM   2931 N NE2 . GLN A 1 387 ? -5.201  89.301 -18.539 1.00 163.64 ? 471 GLN A NE2 1 
ATOM   2932 N N   . GLY A 1 388 ? -6.475  84.549 -20.830 1.00 163.97 ? 472 GLY A N   1 
ATOM   2933 C CA  . GLY A 1 388 ? -5.693  83.354 -20.568 1.00 163.23 ? 472 GLY A CA  1 
ATOM   2934 C C   . GLY A 1 388 ? -6.357  82.334 -19.660 1.00 162.96 ? 472 GLY A C   1 
ATOM   2935 O O   . GLY A 1 388 ? -5.795  81.264 -19.399 1.00 159.82 ? 472 GLY A O   1 
ATOM   2936 N N   . CYS A 1 389 ? -7.555  82.651 -19.179 1.00 162.72 ? 473 CYS A N   1 
ATOM   2937 C CA  . CYS A 1 389 ? -8.235  81.777 -18.228 1.00 159.30 ? 473 CYS A CA  1 
ATOM   2938 C C   . CYS A 1 389 ? -9.387  80.985 -18.854 1.00 157.83 ? 473 CYS A C   1 
ATOM   2939 O O   . CYS A 1 389 ? -10.102 81.477 -19.730 1.00 158.56 ? 473 CYS A O   1 
ATOM   2940 C CB  . CYS A 1 389 ? -8.726  82.576 -17.017 1.00 158.24 ? 473 CYS A CB  1 
ATOM   2941 S SG  . CYS A 1 389 ? -10.319 83.400 -17.236 1.00 168.28 ? 473 CYS A SG  1 
ATOM   2942 N N   . SER A 1 390 ? -9.553  79.751 -18.392 1.00 153.53 ? 474 SER A N   1 
ATOM   2943 C CA  . SER A 1 390 ? -10.603 78.875 -18.888 1.00 149.46 ? 474 SER A CA  1 
ATOM   2944 C C   . SER A 1 390 ? -11.025 77.940 -17.764 1.00 147.13 ? 474 SER A C   1 
ATOM   2945 O O   . SER A 1 390 ? -10.357 77.870 -16.734 1.00 148.84 ? 474 SER A O   1 
ATOM   2946 C CB  . SER A 1 390 ? -10.099 78.076 -20.092 1.00 148.30 ? 474 SER A CB  1 
ATOM   2947 O OG  . SER A 1 390 ? -8.997  77.259 -19.742 1.00 149.04 ? 474 SER A OG  1 
ATOM   2948 N N   . LEU A 1 391 ? -12.133 77.228 -17.950 1.00 144.26 ? 475 LEU A N   1 
ATOM   2949 C CA  . LEU A 1 391 ? -12.587 76.279 -16.937 1.00 142.49 ? 475 LEU A CA  1 
ATOM   2950 C C   . LEU A 1 391 ? -11.642 75.088 -16.873 1.00 139.43 ? 475 LEU A C   1 
ATOM   2951 O O   . LEU A 1 391 ? -11.249 74.536 -17.900 1.00 139.48 ? 475 LEU A O   1 
ATOM   2952 C CB  . LEU A 1 391 ? -14.018 75.814 -17.210 1.00 140.21 ? 475 LEU A CB  1 
ATOM   2953 C CG  . LEU A 1 391 ? -14.634 74.918 -16.130 1.00 134.13 ? 475 LEU A CG  1 
ATOM   2954 C CD1 . LEU A 1 391 ? -14.572 75.578 -14.758 1.00 133.33 ? 475 LEU A CD1 1 
ATOM   2955 C CD2 . LEU A 1 391 ? -16.064 74.567 -16.486 1.00 130.39 ? 475 LEU A CD2 1 
ATOM   2956 N N   . HIS A 1 392 ? -11.276 74.706 -15.658 1.00 137.23 ? 476 HIS A N   1 
ATOM   2957 C CA  . HIS A 1 392 ? -10.277 73.666 -15.449 1.00 138.95 ? 476 HIS A CA  1 
ATOM   2958 C C   . HIS A 1 392 ? -10.830 72.554 -14.560 1.00 136.51 ? 476 HIS A C   1 
ATOM   2959 O O   . HIS A 1 392 ? -11.155 72.795 -13.399 1.00 134.47 ? 476 HIS A O   1 
ATOM   2960 C CB  . HIS A 1 392 ? -9.022  74.272 -14.813 1.00 144.15 ? 476 HIS A CB  1 
ATOM   2961 C CG  . HIS A 1 392 ? -8.354  75.316 -15.656 1.00 145.37 ? 476 HIS A CG  1 
ATOM   2962 N ND1 . HIS A 1 392 ? -8.276  75.230 -17.030 1.00 144.60 ? 476 HIS A ND1 1 
ATOM   2963 C CD2 . HIS A 1 392 ? -7.733  76.472 -15.316 1.00 146.54 ? 476 HIS A CD2 1 
ATOM   2964 C CE1 . HIS A 1 392 ? -7.633  76.285 -17.499 1.00 145.90 ? 476 HIS A CE1 1 
ATOM   2965 N NE2 . HIS A 1 392 ? -7.299  77.057 -16.481 1.00 147.58 ? 476 HIS A NE2 1 
ATOM   2966 N N   . LEU A 1 393 ? -10.923 71.340 -15.104 1.00 135.81 ? 477 LEU A N   1 
ATOM   2967 C CA  . LEU A 1 393 ? -11.572 70.224 -14.407 1.00 131.03 ? 477 LEU A CA  1 
ATOM   2968 C C   . LEU A 1 393 ? -10.583 69.240 -13.785 1.00 129.21 ? 477 LEU A C   1 
ATOM   2969 O O   . LEU A 1 393 ? -9.713  68.704 -14.470 1.00 130.65 ? 477 LEU A O   1 
ATOM   2970 C CB  . LEU A 1 393 ? -12.510 69.473 -15.354 1.00 125.72 ? 477 LEU A CB  1 
ATOM   2971 C CG  . LEU A 1 393 ? -13.520 70.319 -16.125 1.00 121.88 ? 477 LEU A CG  1 
ATOM   2972 C CD1 . LEU A 1 393 ? -14.405 69.433 -16.980 1.00 118.87 ? 477 LEU A CD1 1 
ATOM   2973 C CD2 . LEU A 1 393 ? -14.341 71.162 -15.171 1.00 123.38 ? 477 LEU A CD2 1 
ATOM   2974 N N   . ALA A 1 394 ? -10.739 68.999 -12.486 1.00 126.63 ? 478 ALA A N   1 
ATOM   2975 C CA  . ALA A 1 394 ? -9.891  68.065 -11.761 1.00 128.62 ? 478 ALA A CA  1 
ATOM   2976 C C   . ALA A 1 394 ? -10.261 66.621 -12.073 1.00 130.20 ? 478 ALA A C   1 
ATOM   2977 O O   . ALA A 1 394 ? -11.424 66.240 -11.991 1.00 130.84 ? 478 ALA A O   1 
ATOM   2978 C CB  . ALA A 1 394 ? -9.988  68.323 -10.272 1.00 130.88 ? 478 ALA A CB  1 
ATOM   2979 N N   . GLN A 1 395 ? -9.264  65.822 -12.434 1.00 133.06 ? 479 GLN A N   1 
ATOM   2980 C CA  . GLN A 1 395 ? -9.477  64.414 -12.733 1.00 132.46 ? 479 GLN A CA  1 
ATOM   2981 C C   . GLN A 1 395 ? -8.646  63.534 -11.820 1.00 137.50 ? 479 GLN A C   1 
ATOM   2982 O O   . GLN A 1 395 ? -7.933  64.030 -10.958 1.00 138.46 ? 479 GLN A O   1 
ATOM   2983 C CB  . GLN A 1 395 ? -9.112  64.101 -14.179 1.00 132.08 ? 479 GLN A CB  1 
ATOM   2984 C CG  . GLN A 1 395 ? -10.018 64.722 -15.211 1.00 129.75 ? 479 GLN A CG  1 
ATOM   2985 C CD  . GLN A 1 395 ? -9.805  64.124 -16.590 1.00 131.11 ? 479 GLN A CD  1 
ATOM   2986 O OE1 . GLN A 1 395 ? -9.491  62.938 -16.726 1.00 131.95 ? 479 GLN A OE1 1 
ATOM   2987 N NE2 . GLN A 1 395 ? -9.967  64.944 -17.621 1.00 129.61 ? 479 GLN A NE2 1 
ATOM   2988 N N   . ARG A 1 396 ? -8.735  62.227 -12.046 1.00 140.04 ? 480 ARG A N   1 
ATOM   2989 C CA  . ARG A 1 396 ? -8.107  61.211 -11.202 1.00 141.94 ? 480 ARG A CA  1 
ATOM   2990 C C   . ARG A 1 396 ? -6.687  61.545 -10.747 1.00 141.53 ? 480 ARG A C   1 
ATOM   2991 O O   . ARG A 1 396 ? -6.371  61.470 -9.561  1.00 143.24 ? 480 ARG A O   1 
ATOM   2992 C CB  . ARG A 1 396 ? -8.120  59.863 -11.928 1.00 142.07 ? 480 ARG A CB  1 
ATOM   2993 C CG  . ARG A 1 396 ? -7.162  58.837 -11.364 1.00 143.68 ? 480 ARG A CG  1 
ATOM   2994 C CD  . ARG A 1 396 ? -7.588  58.362 -9.988  1.00 145.80 ? 480 ARG A CD  1 
ATOM   2995 N NE  . ARG A 1 396 ? -6.695  57.318 -9.498  1.00 146.87 ? 480 ARG A NE  1 
ATOM   2996 C CZ  . ARG A 1 396 ? -6.782  56.042 -9.858  1.00 148.10 ? 480 ARG A CZ  1 
ATOM   2997 N NH1 . ARG A 1 396 ? -7.724  55.657 -10.708 1.00 150.38 ? 480 ARG A NH1 1 
ATOM   2998 N NH2 . ARG A 1 396 ? -5.929  55.152 -9.370  1.00 147.90 ? 480 ARG A NH2 1 
ATOM   2999 N N   . LEU A 1 397 ? -5.840  61.929 -11.693 1.00 143.71 ? 481 LEU A N   1 
ATOM   3000 C CA  . LEU A 1 397 ? -4.423  62.148 -11.405 1.00 146.40 ? 481 LEU A CA  1 
ATOM   3001 C C   . LEU A 1 397 ? -4.160  63.448 -10.653 1.00 146.49 ? 481 LEU A C   1 
ATOM   3002 O O   . LEU A 1 397 ? -3.538  63.442 -9.589  1.00 146.89 ? 481 LEU A O   1 
ATOM   3003 C CB  . LEU A 1 397 ? -3.609  62.115 -12.701 1.00 144.50 ? 481 LEU A CB  1 
ATOM   3004 C CG  . LEU A 1 397 ? -2.091  62.233 -12.614 1.00 145.39 ? 481 LEU A CG  1 
ATOM   3005 C CD1 . LEU A 1 397 ? -1.541  61.329 -11.524 1.00 148.32 ? 481 LEU A CD1 1 
ATOM   3006 C CD2 . LEU A 1 397 ? -1.490  61.877 -13.963 1.00 145.49 ? 481 LEU A CD2 1 
ATOM   3007 N N   . SER A 1 398 ? -4.636  64.555 -11.217 1.00 145.33 ? 482 SER A N   1 
ATOM   3008 C CA  . SER A 1 398 ? -4.436  65.877 -10.633 1.00 146.21 ? 482 SER A CA  1 
ATOM   3009 C C   . SER A 1 398 ? -5.002  65.964 -9.225  1.00 147.99 ? 482 SER A C   1 
ATOM   3010 O O   . SER A 1 398 ? -4.533  66.750 -8.404  1.00 151.66 ? 482 SER A O   1 
ATOM   3011 C CB  . SER A 1 398 ? -5.072  66.953 -11.518 1.00 144.73 ? 482 SER A CB  1 
ATOM   3012 O OG  . SER A 1 398 ? -6.445  66.700 -11.739 1.00 141.73 ? 482 SER A OG  1 
ATOM   3013 N N   . GLN A 1 399 ? -6.011  65.144 -8.956  1.00 147.89 ? 483 GLN A N   1 
ATOM   3014 C CA  . GLN A 1 399 ? -6.659  65.123 -7.653  1.00 150.25 ? 483 GLN A CA  1 
ATOM   3015 C C   . GLN A 1 399 ? -5.774  64.506 -6.570  1.00 153.90 ? 483 GLN A C   1 
ATOM   3016 O O   . GLN A 1 399 ? -5.684  65.038 -5.465  1.00 156.68 ? 483 GLN A O   1 
ATOM   3017 C CB  . GLN A 1 399 ? -8.016  64.414 -7.740  1.00 148.86 ? 483 GLN A CB  1 
ATOM   3018 C CG  . GLN A 1 399 ? -9.084  65.254 -8.444  1.00 145.07 ? 483 GLN A CG  1 
ATOM   3019 C CD  . GLN A 1 399 ? -10.393 64.515 -8.665  1.00 142.38 ? 483 GLN A CD  1 
ATOM   3020 O OE1 . GLN A 1 399 ? -10.474 63.292 -8.504  1.00 142.93 ? 483 GLN A OE1 1 
ATOM   3021 N NE2 . GLN A 1 399 ? -11.430 65.259 -9.039  1.00 138.54 ? 483 GLN A NE2 1 
ATOM   3022 N N   . LEU A 1 400 ? -5.114  63.397 -6.889  1.00 153.58 ? 484 LEU A N   1 
ATOM   3023 C CA  . LEU A 1 400 ? -4.228  62.747 -5.929  1.00 155.24 ? 484 LEU A CA  1 
ATOM   3024 C C   . LEU A 1 400 ? -3.069  63.665 -5.549  1.00 157.19 ? 484 LEU A C   1 
ATOM   3025 O O   . LEU A 1 400 ? -2.605  63.657 -4.409  1.00 159.05 ? 484 LEU A O   1 
ATOM   3026 C CB  . LEU A 1 400 ? -3.697  61.428 -6.488  1.00 151.91 ? 484 LEU A CB  1 
ATOM   3027 C CG  . LEU A 1 400 ? -4.739  60.333 -6.699  1.00 152.20 ? 484 LEU A CG  1 
ATOM   3028 C CD1 . LEU A 1 400 ? -4.080  59.071 -7.232  1.00 153.94 ? 484 LEU A CD1 1 
ATOM   3029 C CD2 . LEU A 1 400 ? -5.476  60.057 -5.400  1.00 155.74 ? 484 LEU A CD2 1 
ATOM   3030 N N   . LEU A 1 401 ? -2.621  64.463 -6.513  1.00 155.76 ? 485 LEU A N   1 
ATOM   3031 C CA  . LEU A 1 401 ? -1.514  65.390 -6.312  1.00 156.06 ? 485 LEU A CA  1 
ATOM   3032 C C   . LEU A 1 401 ? -1.903  66.519 -5.365  1.00 158.26 ? 485 LEU A C   1 
ATOM   3033 O O   . LEU A 1 401 ? -1.111  66.948 -4.532  1.00 159.43 ? 485 LEU A O   1 
ATOM   3034 C CB  . LEU A 1 401 ? -1.060  65.949 -7.658  1.00 156.34 ? 485 LEU A CB  1 
ATOM   3035 C CG  . LEU A 1 401 ? -0.549  64.867 -8.611  1.00 154.72 ? 485 LEU A CG  1 
ATOM   3036 C CD1 . LEU A 1 401 ? -0.741  65.269 -10.066 1.00 151.02 ? 485 LEU A CD1 1 
ATOM   3037 C CD2 . LEU A 1 401 ? 0.913   64.571 -8.322  1.00 158.34 ? 485 LEU A CD2 1 
ATOM   3038 N N   . ASN A 1 402 ? -3.130  67.003 -5.496  1.00 159.23 ? 486 ASN A N   1 
ATOM   3039 C CA  . ASN A 1 402 ? -3.666  67.937 -4.522  1.00 160.79 ? 486 ASN A CA  1 
ATOM   3040 C C   . ASN A 1 402 ? -4.388  67.200 -3.418  1.00 162.67 ? 486 ASN A C   1 
ATOM   3041 O O   . ASN A 1 402 ? -5.214  67.782 -2.715  1.00 163.10 ? 486 ASN A O   1 
ATOM   3042 C CB  . ASN A 1 402 ? -4.622  68.922 -5.180  1.00 159.71 ? 486 ASN A CB  1 
ATOM   3043 C CG  . ASN A 1 402 ? -3.922  69.849 -6.133  1.00 161.11 ? 486 ASN A CG  1 
ATOM   3044 O OD1 . ASN A 1 402 ? -2.722  70.088 -6.005  1.00 163.48 ? 486 ASN A OD1 1 
ATOM   3045 N ND2 . ASN A 1 402 ? -4.663  70.381 -7.098  1.00 159.02 ? 486 ASN A ND2 1 
ATOM   3046 N N   . LEU A 1 403 ? -4.107  65.909 -3.300  1.00 163.36 ? 487 LEU A N   1 
ATOM   3047 C CA  . LEU A 1 403 ? -4.569  65.151 -2.154  1.00 165.79 ? 487 LEU A CA  1 
ATOM   3048 C C   . LEU A 1 403 ? -6.077  64.967 -2.154  1.00 163.28 ? 487 LEU A C   1 
ATOM   3049 O O   . LEU A 1 403 ? -6.670  64.660 -1.125  1.00 163.95 ? 487 LEU A O   1 
ATOM   3050 C CB  . LEU A 1 403 ? -4.158  65.843 -0.851  1.00 169.69 ? 487 LEU A CB  1 
ATOM   3051 C CG  . LEU A 1 403 ? -4.233  64.823 0.289   1.00 171.29 ? 487 LEU A CG  1 
ATOM   3052 C CD1 . LEU A 1 403 ? -3.475  63.592 -0.076  1.00 171.23 ? 487 LEU A CD1 1 
ATOM   3053 C CD2 . LEU A 1 403 ? -3.856  65.445 1.649   1.00 171.67 ? 487 LEU A CD2 1 
ATOM   3054 N N   . GLN A 1 404 ? -6.721  65.171 -3.290  1.00 160.49 ? 488 GLN A N   1 
ATOM   3055 C CA  . GLN A 1 404 ? -8.160  64.980 -3.320  1.00 157.88 ? 488 GLN A CA  1 
ATOM   3056 C C   . GLN A 1 404 ? -8.458  63.486 -3.452  1.00 157.33 ? 488 GLN A C   1 
ATOM   3057 O O   . GLN A 1 404 ? -8.839  63.007 -4.519  1.00 154.76 ? 488 GLN A O   1 
ATOM   3058 C CB  . GLN A 1 404 ? -8.779  65.804 -4.448  1.00 154.71 ? 488 GLN A CB  1 
ATOM   3059 C CG  . GLN A 1 404 ? -8.691  67.314 -4.215  1.00 154.21 ? 488 GLN A CG  1 
ATOM   3060 C CD  . GLN A 1 404 ? -9.295  68.121 -5.350  1.00 153.57 ? 488 GLN A CD  1 
ATOM   3061 O OE1 . GLN A 1 404 ? -9.478  67.615 -6.454  1.00 152.39 ? 488 GLN A OE1 1 
ATOM   3062 N NE2 . GLN A 1 404 ? -9.620  69.380 -5.078  1.00 150.90 ? 488 GLN A NE2 1 
ATOM   3063 N N   . LEU A 1 405 ? -8.269  62.753 -2.357  1.00 159.43 ? 489 LEU A N   1 
ATOM   3064 C CA  . LEU A 1 405 ? -8.304  61.291 -2.393  1.00 160.26 ? 489 LEU A CA  1 
ATOM   3065 C C   . LEU A 1 405 ? -9.678  60.756 -2.714  1.00 156.34 ? 489 LEU A C   1 
ATOM   3066 O O   . LEU A 1 405 ? -9.835  59.778 -3.443  1.00 156.48 ? 489 LEU A O   1 
ATOM   3067 C CB  . LEU A 1 405 ? -7.864  60.715 -1.052  1.00 160.22 ? 489 LEU A CB  1 
ATOM   3068 C CG  . LEU A 1 405 ? -6.369  60.429 -0.972  1.00 163.54 ? 489 LEU A CG  1 
ATOM   3069 C CD1 . LEU A 1 405 ? -5.501  61.566 -1.550  1.00 163.72 ? 489 LEU A CD1 1 
ATOM   3070 C CD2 . LEU A 1 405 ? -5.989  60.071 0.454   1.00 166.84 ? 489 LEU A CD2 1 
ATOM   3071 N N   . ARG A 1 406 ? -10.678 61.405 -2.147  1.00 151.82 ? 490 ARG A N   1 
ATOM   3072 C CA  . ARG A 1 406 ? -12.021 60.892 -2.204  1.00 147.47 ? 490 ARG A CA  1 
ATOM   3073 C C   . ARG A 1 406 ? -12.846 61.650 -3.228  1.00 146.07 ? 490 ARG A C   1 
ATOM   3074 O O   . ARG A 1 406 ? -14.009 61.324 -3.457  1.00 143.45 ? 490 ARG A O   1 
ATOM   3075 C CB  . ARG A 1 406 ? -12.651 61.023 -0.828  1.00 144.16 ? 490 ARG A CB  1 
ATOM   3076 C CG  . ARG A 1 406 ? -13.388 59.802 -0.376  1.00 140.25 ? 490 ARG A CG  1 
ATOM   3077 C CD  . ARG A 1 406 ? -14.155 60.116 0.878   1.00 135.48 ? 490 ARG A CD  1 
ATOM   3078 N NE  . ARG A 1 406 ? -13.326 59.999 2.075   1.00 141.07 ? 490 ARG A NE  1 
ATOM   3079 C CZ  . ARG A 1 406 ? -13.163 58.871 2.761   1.00 141.17 ? 490 ARG A CZ  1 
ATOM   3080 N NH1 . ARG A 1 406 ? -13.763 57.766 2.360   1.00 136.21 ? 490 ARG A NH1 1 
ATOM   3081 N NH2 . ARG A 1 406 ? -12.400 58.848 3.846   1.00 143.28 ? 490 ARG A NH2 1 
ATOM   3082 N N   . ARG A 1 407 ? -12.245 62.661 -3.847  1.00 145.60 ? 491 ARG A N   1 
ATOM   3083 C CA  . ARG A 1 407 ? -12.966 63.497 -4.805  1.00 141.51 ? 491 ARG A CA  1 
ATOM   3084 C C   . ARG A 1 407 ? -13.370 62.777 -6.089  1.00 135.44 ? 491 ARG A C   1 
ATOM   3085 O O   . ARG A 1 407 ? -12.817 61.738 -6.448  1.00 137.44 ? 491 ARG A O   1 
ATOM   3086 C CB  . ARG A 1 407 ? -12.178 64.760 -5.139  1.00 143.75 ? 491 ARG A CB  1 
ATOM   3087 C CG  . ARG A 1 407 ? -12.091 65.735 -3.990  1.00 144.79 ? 491 ARG A CG  1 
ATOM   3088 C CD  . ARG A 1 407 ? -12.436 67.146 -4.442  1.00 145.03 ? 491 ARG A CD  1 
ATOM   3089 N NE  . ARG A 1 407 ? -11.820 68.181 -3.614  1.00 144.92 ? 491 ARG A NE  1 
ATOM   3090 C CZ  . ARG A 1 407 ? -12.053 68.362 -2.316  1.00 144.54 ? 491 ARG A CZ  1 
ATOM   3091 N NH1 . ARG A 1 407 ? -11.436 69.342 -1.673  1.00 145.70 ? 491 ARG A NH1 1 
ATOM   3092 N NH2 . ARG A 1 407 ? -12.891 67.573 -1.654  1.00 140.98 ? 491 ARG A NH2 1 
ATOM   3093 N N   . MET A 1 408 ? -14.340 63.357 -6.780  1.00 130.22 ? 492 MET A N   1 
ATOM   3094 C CA  . MET A 1 408 ? -14.954 62.712 -7.923  1.00 128.06 ? 492 MET A CA  1 
ATOM   3095 C C   . MET A 1 408 ? -14.214 63.007 -9.211  1.00 126.82 ? 492 MET A C   1 
ATOM   3096 O O   . MET A 1 408 ? -13.888 64.157 -9.495  1.00 128.99 ? 492 MET A O   1 
ATOM   3097 C CB  . MET A 1 408 ? -16.410 63.168 -8.064  1.00 124.89 ? 492 MET A CB  1 
ATOM   3098 C CG  . MET A 1 408 ? -17.313 62.860 -6.866  1.00 123.56 ? 492 MET A CG  1 
ATOM   3099 S SD  . MET A 1 408 ? -18.196 61.282 -6.963  1.00 119.84 ? 492 MET A SD  1 
ATOM   3100 C CE  . MET A 1 408 ? -16.899 60.117 -6.521  1.00 126.53 ? 492 MET A CE  1 
ATOM   3101 N N   . PRO A 1 409 ? -13.972 61.966 -10.015 1.00 124.47 ? 493 PRO A N   1 
ATOM   3102 C CA  . PRO A 1 409 ? -13.444 62.198 -11.356 1.00 124.13 ? 493 PRO A CA  1 
ATOM   3103 C C   . PRO A 1 409 ? -14.558 62.809 -12.181 1.00 119.79 ? 493 PRO A C   1 
ATOM   3104 O O   . PRO A 1 409 ? -15.672 62.943 -11.678 1.00 118.21 ? 493 PRO A O   1 
ATOM   3105 C CB  . PRO A 1 409 ? -13.153 60.786 -11.852 1.00 124.20 ? 493 PRO A CB  1 
ATOM   3106 C CG  . PRO A 1 409 ? -14.191 59.959 -11.179 1.00 121.38 ? 493 PRO A CG  1 
ATOM   3107 C CD  . PRO A 1 409 ? -14.342 60.557 -9.806  1.00 124.13 ? 493 PRO A CD  1 
ATOM   3108 N N   . ILE A 1 410 ? -14.269 63.181 -13.420 1.00 120.49 ? 494 ILE A N   1 
ATOM   3109 C CA  . ILE A 1 410 ? -15.303 63.686 -14.309 1.00 117.64 ? 494 ILE A CA  1 
ATOM   3110 C C   . ILE A 1 410 ? -16.355 62.597 -14.465 1.00 116.79 ? 494 ILE A C   1 
ATOM   3111 O O   . ILE A 1 410 ? -16.019 61.415 -14.579 1.00 117.24 ? 494 ILE A O   1 
ATOM   3112 C CB  . ILE A 1 410 ? -14.726 64.061 -15.688 1.00 118.43 ? 494 ILE A CB  1 
ATOM   3113 C CG1 . ILE A 1 410 ? -13.685 65.172 -15.542 1.00 120.32 ? 494 ILE A CG1 1 
ATOM   3114 C CG2 . ILE A 1 410 ? -15.832 64.492 -16.639 1.00 117.35 ? 494 ILE A CG2 1 
ATOM   3115 C CD1 . ILE A 1 410 ? -13.122 65.644 -16.857 1.00 120.60 ? 494 ILE A CD1 1 
ATOM   3116 N N   . LEU A 1 411 ? -17.625 62.984 -14.436 1.00 112.47 ? 495 LEU A N   1 
ATOM   3117 C CA  . LEU A 1 411 ? -18.698 62.009 -14.599 1.00 111.07 ? 495 LEU A CA  1 
ATOM   3118 C C   . LEU A 1 411 ? -19.464 62.199 -15.909 1.00 110.94 ? 495 LEU A C   1 
ATOM   3119 O O   . LEU A 1 411 ? -19.978 63.281 -16.200 1.00 112.40 ? 495 LEU A O   1 
ATOM   3120 C CB  . LEU A 1 411 ? -19.650 62.041 -13.398 1.00 108.20 ? 495 LEU A CB  1 
ATOM   3121 C CG  . LEU A 1 411 ? -20.861 61.108 -13.456 1.00 103.07 ? 495 LEU A CG  1 
ATOM   3122 C CD1 . LEU A 1 411 ? -20.418 59.691 -13.727 1.00 103.94 ? 495 LEU A CD1 1 
ATOM   3123 C CD2 . LEU A 1 411 ? -21.656 61.185 -12.168 1.00 101.17 ? 495 LEU A CD2 1 
ATOM   3124 N N   . SER A 1 412 ? -19.520 61.138 -16.703 1.00 110.44 ? 496 SER A N   1 
ATOM   3125 C CA  . SER A 1 412 ? -20.334 61.121 -17.910 1.00 110.86 ? 496 SER A CA  1 
ATOM   3126 C C   . SER A 1 412 ? -20.722 59.677 -18.185 1.00 112.62 ? 496 SER A C   1 
ATOM   3127 O O   . SER A 1 412 ? -19.893 58.769 -18.069 1.00 112.23 ? 496 SER A O   1 
ATOM   3128 C CB  . SER A 1 412 ? -19.573 61.705 -19.101 1.00 113.22 ? 496 SER A CB  1 
ATOM   3129 O OG  . SER A 1 412 ? -18.661 60.761 -19.636 1.00 114.41 ? 496 SER A OG  1 
ATOM   3130 N N   . LYS A 1 413 ? -21.986 59.465 -18.532 1.00 112.10 ? 497 LYS A N   1 
ATOM   3131 C CA  . LYS A 1 413 ? -22.505 58.119 -18.728 1.00 110.72 ? 497 LYS A CA  1 
ATOM   3132 C C   . LYS A 1 413 ? -23.350 58.065 -19.993 1.00 112.00 ? 497 LYS A C   1 
ATOM   3133 O O   . LYS A 1 413 ? -23.926 59.075 -20.397 1.00 111.72 ? 497 LYS A O   1 
ATOM   3134 C CB  . LYS A 1 413 ? -23.352 57.707 -17.521 1.00 108.56 ? 497 LYS A CB  1 
ATOM   3135 C CG  . LYS A 1 413 ? -22.591 57.658 -16.211 1.00 104.38 ? 497 LYS A CG  1 
ATOM   3136 C CD  . LYS A 1 413 ? -21.485 56.634 -16.286 1.00 104.27 ? 497 LYS A CD  1 
ATOM   3137 C CE  . LYS A 1 413 ? -21.066 56.171 -14.909 1.00 103.17 ? 497 LYS A CE  1 
ATOM   3138 N NZ  . LYS A 1 413 ? -20.228 54.942 -14.988 1.00 103.56 ? 497 LYS A NZ  1 
ATOM   3139 N N   . GLU A 1 414 ? -23.430 56.889 -20.610 1.00 114.51 ? 498 GLU A N   1 
ATOM   3140 C CA  . GLU A 1 414 ? -24.228 56.719 -21.827 1.00 116.04 ? 498 GLU A CA  1 
ATOM   3141 C C   . GLU A 1 414 ? -25.731 56.868 -21.556 1.00 114.21 ? 498 GLU A C   1 
ATOM   3142 O O   . GLU A 1 414 ? -26.500 57.243 -22.443 1.00 114.24 ? 498 GLU A O   1 
ATOM   3143 C CB  . GLU A 1 414 ? -23.925 55.374 -22.501 1.00 116.61 ? 498 GLU A CB  1 
ATOM   3144 C CG  . GLU A 1 414 ? -24.323 54.147 -21.693 1.00 120.09 ? 498 GLU A CG  1 
ATOM   3145 C CD  . GLU A 1 414 ? -23.789 52.852 -22.294 1.00 127.98 ? 498 GLU A CD  1 
ATOM   3146 O OE1 . GLU A 1 414 ? -22.956 52.928 -23.225 1.00 126.91 ? 498 GLU A OE1 1 
ATOM   3147 O OE2 . GLU A 1 414 ? -24.199 51.758 -21.836 1.00 130.30 ? 498 GLU A OE2 1 
ATOM   3148 N N   . SER A 1 415 ? -26.134 56.585 -20.323 1.00 111.94 ? 499 SER A N   1 
ATOM   3149 C CA  . SER A 1 415 ? -27.519 56.725 -19.902 1.00 109.84 ? 499 SER A CA  1 
ATOM   3150 C C   . SER A 1 415 ? -28.002 58.168 -19.974 1.00 111.43 ? 499 SER A C   1 
ATOM   3151 O O   . SER A 1 415 ? -29.208 58.420 -19.992 1.00 111.46 ? 499 SER A O   1 
ATOM   3152 C CB  . SER A 1 415 ? -27.657 56.254 -18.465 1.00 108.57 ? 499 SER A CB  1 
ATOM   3153 O OG  . SER A 1 415 ? -26.857 57.058 -17.615 1.00 106.17 ? 499 SER A OG  1 
ATOM   3154 N N   . ALA A 1 416 ? -27.066 59.114 -19.985 1.00 110.14 ? 500 ALA A N   1 
ATOM   3155 C CA  . ALA A 1 416 ? -27.416 60.529 -20.090 1.00 109.24 ? 500 ALA A CA  1 
ATOM   3156 C C   . ALA A 1 416 ? -26.470 61.281 -21.027 1.00 111.69 ? 500 ALA A C   1 
ATOM   3157 O O   . ALA A 1 416 ? -25.625 62.051 -20.571 1.00 115.07 ? 500 ALA A O   1 
ATOM   3158 C CB  . ALA A 1 416 ? -27.425 61.172 -18.713 1.00 107.05 ? 500 ALA A CB  1 
ATOM   3159 N N   . PRO A 1 417 ? -26.623 61.071 -22.344 1.00 110.23 ? 501 PRO A N   1 
ATOM   3160 C CA  . PRO A 1 417 ? -25.709 61.604 -23.359 1.00 110.75 ? 501 PRO A CA  1 
ATOM   3161 C C   . PRO A 1 417 ? -25.575 63.118 -23.322 1.00 113.84 ? 501 PRO A C   1 
ATOM   3162 O O   . PRO A 1 417 ? -26.572 63.841 -23.295 1.00 112.38 ? 501 PRO A O   1 
ATOM   3163 C CB  . PRO A 1 417 ? -26.364 61.179 -24.672 1.00 113.76 ? 501 PRO A CB  1 
ATOM   3164 C CG  . PRO A 1 417 ? -27.183 59.998 -24.316 1.00 114.46 ? 501 PRO A CG  1 
ATOM   3165 C CD  . PRO A 1 417 ? -27.715 60.298 -22.955 1.00 113.68 ? 501 PRO A CD  1 
ATOM   3166 N N   . GLY A 1 418 ? -24.330 63.583 -23.324 1.00 115.68 ? 502 GLY A N   1 
ATOM   3167 C CA  . GLY A 1 418 ? -24.045 65.002 -23.357 1.00 116.16 ? 502 GLY A CA  1 
ATOM   3168 C C   . GLY A 1 418 ? -24.206 65.653 -22.002 1.00 115.09 ? 502 GLY A C   1 
ATOM   3169 O O   . GLY A 1 418 ? -24.141 66.878 -21.884 1.00 113.91 ? 502 GLY A O   1 
ATOM   3170 N N   . LEU A 1 419 ? -24.429 64.835 -20.977 1.00 113.50 ? 503 LEU A N   1 
ATOM   3171 C CA  . LEU A 1 419 ? -24.476 65.347 -19.613 1.00 113.58 ? 503 LEU A CA  1 
ATOM   3172 C C   . LEU A 1 419 ? -23.167 65.071 -18.877 1.00 114.38 ? 503 LEU A C   1 
ATOM   3173 O O   . LEU A 1 419 ? -22.752 63.915 -18.721 1.00 111.97 ? 503 LEU A O   1 
ATOM   3174 C CB  . LEU A 1 419 ? -25.657 64.780 -18.825 1.00 110.45 ? 503 LEU A CB  1 
ATOM   3175 C CG  . LEU A 1 419 ? -25.805 65.460 -17.459 1.00 108.05 ? 503 LEU A CG  1 
ATOM   3176 C CD1 . LEU A 1 419 ? -26.212 66.916 -17.629 1.00 106.95 ? 503 LEU A CD1 1 
ATOM   3177 C CD2 . LEU A 1 419 ? -26.777 64.722 -16.555 1.00 105.59 ? 503 LEU A CD2 1 
ATOM   3178 N N   . ILE A 1 420 ? -22.521 66.150 -18.438 1.00 114.74 ? 504 ILE A N   1 
ATOM   3179 C CA  . ILE A 1 420 ? -21.241 66.063 -17.748 1.00 114.51 ? 504 ILE A CA  1 
ATOM   3180 C C   . ILE A 1 420 ? -21.266 66.869 -16.451 1.00 113.38 ? 504 ILE A C   1 
ATOM   3181 O O   . ILE A 1 420 ? -21.664 68.033 -16.445 1.00 114.22 ? 504 ILE A O   1 
ATOM   3182 C CB  . ILE A 1 420 ? -20.086 66.582 -18.636 1.00 116.29 ? 504 ILE A CB  1 
ATOM   3183 C CG1 . ILE A 1 420 ? -20.120 65.913 -20.011 1.00 115.44 ? 504 ILE A CG1 1 
ATOM   3184 C CG2 . ILE A 1 420 ? -18.740 66.341 -17.960 1.00 115.79 ? 504 ILE A CG2 1 
ATOM   3185 C CD1 . ILE A 1 420 ? -19.154 66.503 -21.001 1.00 116.69 ? 504 ILE A CD1 1 
ATOM   3186 N N   . ILE A 1 421 ? -20.854 66.234 -15.357 1.00 111.26 ? 505 ILE A N   1 
ATOM   3187 C CA  . ILE A 1 421 ? -20.669 66.914 -14.077 1.00 111.94 ? 505 ILE A CA  1 
ATOM   3188 C C   . ILE A 1 421 ? -19.221 66.721 -13.668 1.00 112.64 ? 505 ILE A C   1 
ATOM   3189 O O   . ILE A 1 421 ? -18.673 65.627 -13.810 1.00 114.31 ? 505 ILE A O   1 
ATOM   3190 C CB  . ILE A 1 421 ? -21.565 66.325 -12.957 1.00 111.53 ? 505 ILE A CB  1 
ATOM   3191 C CG1 . ILE A 1 421 ? -23.012 66.177 -13.424 1.00 110.71 ? 505 ILE A CG1 1 
ATOM   3192 C CG2 . ILE A 1 421 ? -21.499 67.185 -11.699 1.00 108.63 ? 505 ILE A CG2 1 
ATOM   3193 C CD1 . ILE A 1 421 ? -23.941 65.698 -12.342 1.00 105.15 ? 505 ILE A CD1 1 
ATOM   3194 N N   . ALA A 1 422 ? -18.590 67.772 -13.161 1.00 113.22 ? 506 ALA A N   1 
ATOM   3195 C CA  . ALA A 1 422 ? -17.192 67.658 -12.772 1.00 114.28 ? 506 ALA A CA  1 
ATOM   3196 C C   . ALA A 1 422 ? -16.810 68.599 -11.648 1.00 116.62 ? 506 ALA A C   1 
ATOM   3197 O O   . ALA A 1 422 ? -17.521 69.555 -11.340 1.00 117.35 ? 506 ALA A O   1 
ATOM   3198 C CB  . ALA A 1 422 ? -16.286 67.875 -13.974 1.00 116.35 ? 506 ALA A CB  1 
ATOM   3199 N N   . THR A 1 423 ? -15.671 68.315 -11.037 1.00 119.52 ? 507 THR A N   1 
ATOM   3200 C CA  . THR A 1 423 ? -15.135 69.180 -10.006 1.00 122.64 ? 507 THR A CA  1 
ATOM   3201 C C   . THR A 1 423 ? -13.928 69.907 -10.572 1.00 127.26 ? 507 THR A C   1 
ATOM   3202 O O   . THR A 1 423 ? -13.036 69.279 -11.138 1.00 130.12 ? 507 THR A O   1 
ATOM   3203 C CB  . THR A 1 423 ? -14.727 68.378 -8.769  1.00 123.26 ? 507 THR A CB  1 
ATOM   3204 O OG1 . THR A 1 423 ? -15.896 67.809 -8.167  1.00 125.50 ? 507 THR A OG1 1 
ATOM   3205 C CG2 . THR A 1 423 ? -14.050 69.273 -7.762  1.00 127.32 ? 507 THR A CG2 1 
ATOM   3206 N N   . GLY A 1 424 ? -13.905 71.229 -10.440 1.00 129.44 ? 508 GLY A N   1 
ATOM   3207 C CA  . GLY A 1 424 ? -12.806 72.007 -10.980 1.00 132.10 ? 508 GLY A CA  1 
ATOM   3208 C C   . GLY A 1 424 ? -12.838 73.482 -10.637 1.00 133.72 ? 508 GLY A C   1 
ATOM   3209 O O   . GLY A 1 424 ? -13.677 73.922 -9.852  1.00 133.03 ? 508 GLY A O   1 
ATOM   3210 N N   . SER A 1 425 ? -11.920 74.244 -11.232 1.00 137.54 ? 509 SER A N   1 
ATOM   3211 C CA  . SER A 1 425 ? -11.787 75.676 -10.947 1.00 137.59 ? 509 SER A CA  1 
ATOM   3212 C C   . SER A 1 425 ? -11.834 76.568 -12.184 1.00 138.78 ? 509 SER A C   1 
ATOM   3213 O O   . SER A 1 425 ? -11.662 76.114 -13.315 1.00 140.32 ? 509 SER A O   1 
ATOM   3214 C CB  . SER A 1 425 ? -10.492 75.956 -10.182 1.00 138.17 ? 509 SER A CB  1 
ATOM   3215 O OG  . SER A 1 425 ? -10.686 75.817 -8.788  1.00 139.70 ? 509 SER A OG  1 
ATOM   3216 N N   . VAL A 1 426 ? -12.071 77.851 -11.948 1.00 140.94 ? 510 VAL A N   1 
ATOM   3217 C CA  . VAL A 1 426 ? -12.017 78.847 -13.007 1.00 143.22 ? 510 VAL A CA  1 
ATOM   3218 C C   . VAL A 1 426 ? -10.795 79.747 -12.785 1.00 143.83 ? 510 VAL A C   1 
ATOM   3219 O O   . VAL A 1 426 ? -10.523 80.189 -11.665 1.00 140.73 ? 510 VAL A O   1 
ATOM   3220 C CB  . VAL A 1 426 ? -13.337 79.660 -13.097 1.00 139.52 ? 510 VAL A CB  1 
ATOM   3221 C CG1 . VAL A 1 426 ? -13.709 80.255 -11.742 1.00 138.46 ? 510 VAL A CG1 1 
ATOM   3222 C CG2 . VAL A 1 426 ? -13.232 80.739 -14.154 1.00 143.51 ? 510 VAL A CG2 1 
ATOM   3223 N N   . GLY A 1 427 ? -10.048 79.986 -13.857 1.00 145.46 ? 511 GLY A N   1 
ATOM   3224 C CA  . GLY A 1 427 ? -8.812  80.739 -13.781 1.00 147.36 ? 511 GLY A CA  1 
ATOM   3225 C C   . GLY A 1 427 ? -7.823  80.216 -14.801 1.00 149.92 ? 511 GLY A C   1 
ATOM   3226 O O   . GLY A 1 427 ? -8.208  79.556 -15.765 1.00 150.79 ? 511 GLY A O   1 
ATOM   3227 N N   . LYS A 1 428 ? -6.546  80.509 -14.599 1.00 151.59 ? 512 LYS A N   1 
ATOM   3228 C CA  . LYS A 1 428 ? -5.516  80.034 -15.513 1.00 153.70 ? 512 LYS A CA  1 
ATOM   3229 C C   . LYS A 1 428 ? -4.960  78.689 -15.048 1.00 149.36 ? 512 LYS A C   1 
ATOM   3230 O O   . LYS A 1 428 ? -4.180  78.053 -15.755 1.00 147.97 ? 512 LYS A O   1 
ATOM   3231 C CB  . LYS A 1 428 ? -4.384  81.059 -15.623 1.00 157.53 ? 512 LYS A CB  1 
ATOM   3232 C CG  . LYS A 1 428 ? -4.831  82.470 -15.993 1.00 159.01 ? 512 LYS A CG  1 
ATOM   3233 C CD  . LYS A 1 428 ? -3.640  83.422 -16.026 1.00 163.35 ? 512 LYS A CD  1 
ATOM   3234 C CE  . LYS A 1 428 ? -4.054  84.842 -16.389 1.00 166.90 ? 512 LYS A CE  1 
ATOM   3235 N NZ  . LYS A 1 428 ? -2.882  85.767 -16.442 1.00 172.12 ? 512 LYS A NZ  1 
ATOM   3236 N N   . ASN A 1 429 ? -5.377  78.258 -13.860 1.00 147.99 ? 513 ASN A N   1 
ATOM   3237 C CA  . ASN A 1 429 ? -4.825  77.058 -13.240 1.00 147.53 ? 513 ASN A CA  1 
ATOM   3238 C C   . ASN A 1 429 ? -5.807  76.391 -12.265 1.00 147.81 ? 513 ASN A C   1 
ATOM   3239 O O   . ASN A 1 429 ? -6.580  77.075 -11.592 1.00 148.55 ? 513 ASN A O   1 
ATOM   3240 C CB  . ASN A 1 429 ? -3.526  77.420 -12.512 1.00 145.94 ? 513 ASN A CB  1 
ATOM   3241 C CG  . ASN A 1 429 ? -2.603  76.229 -12.323 1.00 150.00 ? 513 ASN A CG  1 
ATOM   3242 O OD1 . ASN A 1 429 ? -3.053  75.101 -12.114 1.00 149.77 ? 513 ASN A OD1 1 
ATOM   3243 N ND2 . ASN A 1 429 ? -1.299  76.476 -12.398 1.00 151.34 ? 513 ASN A ND2 1 
ATOM   3244 N N   . LEU A 1 430 ? -5.774  75.060 -12.198 1.00 145.51 ? 514 LEU A N   1 
ATOM   3245 C CA  . LEU A 1 430 ? -6.535  74.312 -11.193 1.00 144.32 ? 514 LEU A CA  1 
ATOM   3246 C C   . LEU A 1 430 ? -6.118  74.717 -9.791  1.00 143.99 ? 514 LEU A C   1 
ATOM   3247 O O   . LEU A 1 430 ? -5.008  74.411 -9.360  1.00 145.00 ? 514 LEU A O   1 
ATOM   3248 C CB  . LEU A 1 430 ? -6.288  72.806 -11.319 1.00 144.52 ? 514 LEU A CB  1 
ATOM   3249 C CG  . LEU A 1 430 ? -7.089  71.912 -12.263 1.00 139.36 ? 514 LEU A CG  1 
ATOM   3250 C CD1 . LEU A 1 430 ? -6.575  72.038 -13.686 1.00 142.36 ? 514 LEU A CD1 1 
ATOM   3251 C CD2 . LEU A 1 430 ? -6.989  70.471 -11.787 1.00 132.16 ? 514 LEU A CD2 1 
ATOM   3252 N N   . ALA A 1 431 ? -7.005  75.385 -9.067  1.00 145.16 ? 515 ALA A N   1 
ATOM   3253 C CA  . ALA A 1 431 ? -6.688  75.788 -7.704  1.00 147.67 ? 515 ALA A CA  1 
ATOM   3254 C C   . ALA A 1 431 ? -6.954  74.647 -6.734  1.00 147.25 ? 515 ALA A C   1 
ATOM   3255 O O   . ALA A 1 431 ? -7.507  73.612 -7.113  1.00 145.32 ? 515 ALA A O   1 
ATOM   3256 C CB  . ALA A 1 431 ? -7.489  77.027 -7.308  1.00 145.77 ? 515 ALA A CB  1 
ATOM   3257 N N   . SER A 1 432 ? -6.537  74.837 -5.486  1.00 147.08 ? 516 SER A N   1 
ATOM   3258 C CA  . SER A 1 432 ? -6.920  73.937 -4.410  1.00 147.21 ? 516 SER A CA  1 
ATOM   3259 C C   . SER A 1 432 ? -8.428  74.059 -4.219  1.00 146.32 ? 516 SER A C   1 
ATOM   3260 O O   . SER A 1 432 ? -9.133  73.055 -4.103  1.00 144.68 ? 516 SER A O   1 
ATOM   3261 C CB  . SER A 1 432 ? -6.185  74.302 -3.119  1.00 148.84 ? 516 SER A CB  1 
ATOM   3262 O OG  . SER A 1 432 ? -6.710  73.593 -2.009  1.00 151.08 ? 516 SER A OG  1 
ATOM   3263 N N   . LYS A 1 433 ? -8.908  75.302 -4.194  1.00 145.50 ? 517 LYS A N   1 
ATOM   3264 C CA  . LYS A 1 433 ? -10.339 75.593 -4.176  1.00 142.96 ? 517 LYS A CA  1 
ATOM   3265 C C   . LYS A 1 433 ? -11.001 75.034 -5.435  1.00 142.09 ? 517 LYS A C   1 
ATOM   3266 O O   . LYS A 1 433 ? -10.549 75.306 -6.550  1.00 141.66 ? 517 LYS A O   1 
ATOM   3267 C CB  . LYS A 1 433 ? -10.572 77.108 -4.072  1.00 141.38 ? 517 LYS A CB  1 
ATOM   3268 C CG  . LYS A 1 433 ? -11.843 77.612 -4.757  1.00 138.63 ? 517 LYS A CG  1 
ATOM   3269 C CD  . LYS A 1 433 ? -11.543 78.233 -6.119  1.00 137.93 ? 517 LYS A CD  1 
ATOM   3270 C CE  . LYS A 1 433 ? -12.802 78.344 -6.964  1.00 137.45 ? 517 LYS A CE  1 
ATOM   3271 N NZ  . LYS A 1 433 ? -12.496 78.580 -8.405  1.00 135.83 ? 517 LYS A NZ  1 
ATOM   3272 N N   . THR A 1 434 ? -12.061 74.247 -5.255  1.00 139.01 ? 518 THR A N   1 
ATOM   3273 C CA  . THR A 1 434 ? -12.756 73.622 -6.381  1.00 134.51 ? 518 THR A CA  1 
ATOM   3274 C C   . THR A 1 434 ? -14.270 73.637 -6.199  1.00 130.12 ? 518 THR A C   1 
ATOM   3275 O O   . THR A 1 434 ? -14.768 73.597 -5.075  1.00 128.90 ? 518 THR A O   1 
ATOM   3276 C CB  . THR A 1 434 ? -12.308 72.168 -6.576  1.00 135.00 ? 518 THR A CB  1 
ATOM   3277 O OG1 . THR A 1 434 ? -12.249 71.519 -5.300  1.00 138.80 ? 518 THR A OG1 1 
ATOM   3278 C CG2 . THR A 1 434 ? -10.937 72.101 -7.239  1.00 138.05 ? 518 THR A CG2 1 
ATOM   3279 N N   . ASN A 1 435 ? -14.998 73.694 -7.311  1.00 128.30 ? 519 ASN A N   1 
ATOM   3280 C CA  . ASN A 1 435 ? -16.458 73.700 -7.286  1.00 123.44 ? 519 ASN A CA  1 
ATOM   3281 C C   . ASN A 1 435 ? -17.040 72.567 -8.128  1.00 122.99 ? 519 ASN A C   1 
ATOM   3282 O O   . ASN A 1 435 ? -16.303 71.752 -8.681  1.00 124.93 ? 519 ASN A O   1 
ATOM   3283 C CB  . ASN A 1 435 ? -16.993 75.034 -7.806  1.00 126.11 ? 519 ASN A CB  1 
ATOM   3284 C CG  . ASN A 1 435 ? -16.317 76.234 -7.166  1.00 128.63 ? 519 ASN A CG  1 
ATOM   3285 O OD1 . ASN A 1 435 ? -16.133 77.266 -7.808  1.00 131.52 ? 519 ASN A OD1 1 
ATOM   3286 N ND2 . ASN A 1 435 ? -15.949 76.109 -5.898  1.00 128.20 ? 519 ASN A ND2 1 
ATOM   3287 N N   . VAL A 1 436 ? -18.365 72.519 -8.232  1.00 119.98 ? 520 VAL A N   1 
ATOM   3288 C CA  . VAL A 1 436 ? -19.024 71.539 -9.094  1.00 118.41 ? 520 VAL A CA  1 
ATOM   3289 C C   . VAL A 1 436 ? -19.589 72.229 -10.332 1.00 117.37 ? 520 VAL A C   1 
ATOM   3290 O O   . VAL A 1 436 ? -20.346 73.192 -10.226 1.00 118.49 ? 520 VAL A O   1 
ATOM   3291 C CB  . VAL A 1 436 ? -20.150 70.780 -8.351  1.00 114.17 ? 520 VAL A CB  1 
ATOM   3292 C CG1 . VAL A 1 436 ? -20.902 69.874 -9.296  1.00 111.90 ? 520 VAL A CG1 1 
ATOM   3293 C CG2 . VAL A 1 436 ? -19.580 69.977 -7.207  1.00 114.43 ? 520 VAL A CG2 1 
ATOM   3294 N N   . TYR A 1 437 ? -19.211 71.735 -11.505 1.00 116.92 ? 521 TYR A N   1 
ATOM   3295 C CA  . TYR A 1 437 ? -19.643 72.334 -12.762 1.00 118.89 ? 521 TYR A CA  1 
ATOM   3296 C C   . TYR A 1 437 ? -20.411 71.351 -13.641 1.00 116.62 ? 521 TYR A C   1 
ATOM   3297 O O   . TYR A 1 437 ? -20.048 70.180 -13.744 1.00 114.68 ? 521 TYR A O   1 
ATOM   3298 C CB  . TYR A 1 437 ? -18.438 72.890 -13.517 1.00 122.28 ? 521 TYR A CB  1 
ATOM   3299 C CG  . TYR A 1 437 ? -17.791 74.059 -12.818 1.00 124.78 ? 521 TYR A CG  1 
ATOM   3300 C CD1 . TYR A 1 437 ? -16.678 73.882 -12.002 1.00 125.79 ? 521 TYR A CD1 1 
ATOM   3301 C CD2 . TYR A 1 437 ? -18.303 75.340 -12.963 1.00 127.90 ? 521 TYR A CD2 1 
ATOM   3302 C CE1 . TYR A 1 437 ? -16.090 74.953 -11.359 1.00 126.67 ? 521 TYR A CE1 1 
ATOM   3303 C CE2 . TYR A 1 437 ? -17.722 76.416 -12.326 1.00 131.13 ? 521 TYR A CE2 1 
ATOM   3304 C CZ  . TYR A 1 437 ? -16.617 76.217 -11.524 1.00 131.10 ? 521 TYR A CZ  1 
ATOM   3305 O OH  . TYR A 1 437 ? -16.043 77.293 -10.890 1.00 136.13 ? 521 TYR A OH  1 
ATOM   3306 N N   . ILE A 1 438 ? -21.469 71.837 -14.280 1.00 117.29 ? 522 ILE A N   1 
ATOM   3307 C CA  . ILE A 1 438 ? -22.348 70.976 -15.063 1.00 117.53 ? 522 ILE A CA  1 
ATOM   3308 C C   . ILE A 1 438 ? -22.558 71.508 -16.479 1.00 119.89 ? 522 ILE A C   1 
ATOM   3309 O O   . ILE A 1 438 ? -22.685 72.715 -16.688 1.00 122.63 ? 522 ILE A O   1 
ATOM   3310 C CB  . ILE A 1 438 ? -23.728 70.809 -14.372 1.00 116.81 ? 522 ILE A CB  1 
ATOM   3311 C CG1 . ILE A 1 438 ? -23.571 70.152 -13.001 1.00 115.06 ? 522 ILE A CG1 1 
ATOM   3312 C CG2 . ILE A 1 438 ? -24.679 69.982 -15.220 1.00 114.24 ? 522 ILE A CG2 1 
ATOM   3313 C CD1 . ILE A 1 438 ? -24.878 69.947 -12.284 1.00 112.12 ? 522 ILE A CD1 1 
ATOM   3314 N N   . SER A 1 439 ? -22.587 70.597 -17.447 1.00 118.82 ? 523 SER A N   1 
ATOM   3315 C CA  . SER A 1 439 ? -22.902 70.942 -18.823 1.00 119.20 ? 523 SER A CA  1 
ATOM   3316 C C   . SER A 1 439 ? -23.777 69.862 -19.441 1.00 119.73 ? 523 SER A C   1 
ATOM   3317 O O   . SER A 1 439 ? -23.415 68.682 -19.436 1.00 119.14 ? 523 SER A O   1 
ATOM   3318 C CB  . SER A 1 439 ? -21.617 71.091 -19.642 1.00 122.90 ? 523 SER A CB  1 
ATOM   3319 O OG  . SER A 1 439 ? -21.903 71.270 -21.021 1.00 124.12 ? 523 SER A OG  1 
ATOM   3320 N N   . SER A 1 440 ? -24.932 70.260 -19.966 1.00 119.57 ? 524 SER A N   1 
ATOM   3321 C CA  . SER A 1 440 ? -25.758 69.340 -20.742 1.00 121.06 ? 524 SER A CA  1 
ATOM   3322 C C   . SER A 1 440 ? -25.534 69.615 -22.219 1.00 122.60 ? 524 SER A C   1 
ATOM   3323 O O   . SER A 1 440 ? -26.433 69.453 -23.049 1.00 121.43 ? 524 SER A O   1 
ATOM   3324 C CB  . SER A 1 440 ? -27.233 69.505 -20.400 1.00 119.99 ? 524 SER A CB  1 
ATOM   3325 O OG  . SER A 1 440 ? -27.750 70.710 -20.931 1.00 121.44 ? 524 SER A OG  1 
ATOM   3326 N N   . SER A 1 441 ? -24.310 70.026 -22.526 1.00 124.93 ? 525 SER A N   1 
ATOM   3327 C CA  . SER A 1 441 ? -23.947 70.534 -23.837 1.00 128.35 ? 525 SER A CA  1 
ATOM   3328 C C   . SER A 1 441 ? -22.683 69.833 -24.335 1.00 129.50 ? 525 SER A C   1 
ATOM   3329 O O   . SER A 1 441 ? -21.959 70.360 -25.179 1.00 132.01 ? 525 SER A O   1 
ATOM   3330 C CB  . SER A 1 441 ? -23.716 72.046 -23.736 1.00 129.21 ? 525 SER A CB  1 
ATOM   3331 O OG  . SER A 1 441 ? -23.271 72.599 -24.959 1.00 134.96 ? 525 SER A OG  1 
ATOM   3332 N N   . ALA A 1 442 ? -22.427 68.643 -23.794 1.00 126.90 ? 526 ALA A N   1 
ATOM   3333 C CA  . ALA A 1 442 ? -21.206 67.882 -24.065 1.00 123.72 ? 526 ALA A CA  1 
ATOM   3334 C C   . ALA A 1 442 ? -19.927 68.642 -23.706 1.00 126.29 ? 526 ALA A C   1 
ATOM   3335 O O   . ALA A 1 442 ? -18.840 68.265 -24.134 1.00 131.02 ? 526 ALA A O   1 
ATOM   3336 C CB  . ALA A 1 442 ? -21.168 67.401 -25.511 1.00 120.93 ? 526 ALA A CB  1 
ATOM   3337 N N   . GLY A 1 443 ? -20.058 69.703 -22.914 1.00 126.50 ? 527 GLY A N   1 
ATOM   3338 C CA  . GLY A 1 443 ? -18.907 70.467 -22.461 1.00 127.86 ? 527 GLY A CA  1 
ATOM   3339 C C   . GLY A 1 443 ? -18.781 71.832 -23.115 1.00 129.68 ? 527 GLY A C   1 
ATOM   3340 O O   . GLY A 1 443 ? -18.065 72.704 -22.619 1.00 128.42 ? 527 GLY A O   1 
ATOM   3341 N N   . ALA A 1 444 ? -19.488 72.017 -24.227 1.00 130.25 ? 528 ALA A N   1 
ATOM   3342 C CA  . ALA A 1 444 ? -19.425 73.258 -24.995 1.00 128.97 ? 528 ALA A CA  1 
ATOM   3343 C C   . ALA A 1 444 ? -19.822 74.498 -24.200 1.00 128.53 ? 528 ALA A C   1 
ATOM   3344 O O   . ALA A 1 444 ? -19.345 75.589 -24.482 1.00 132.85 ? 528 ALA A O   1 
ATOM   3345 C CB  . ALA A 1 444 ? -20.273 73.146 -26.253 1.00 129.11 ? 528 ALA A CB  1 
ATOM   3346 N N   . ARG A 1 445 ? -20.705 74.333 -23.220 1.00 128.79 ? 529 ARG A N   1 
ATOM   3347 C CA  . ARG A 1 445 ? -21.165 75.446 -22.393 1.00 129.24 ? 529 ARG A CA  1 
ATOM   3348 C C   . ARG A 1 445 ? -21.331 74.971 -20.952 1.00 127.99 ? 529 ARG A C   1 
ATOM   3349 O O   . ARG A 1 445 ? -22.033 73.998 -20.701 1.00 129.81 ? 529 ARG A O   1 
ATOM   3350 C CB  . ARG A 1 445 ? -22.505 75.984 -22.912 1.00 132.75 ? 529 ARG A CB  1 
ATOM   3351 C CG  . ARG A 1 445 ? -22.508 76.377 -24.382 1.00 137.88 ? 529 ARG A CG  1 
ATOM   3352 C CD  . ARG A 1 445 ? -23.915 76.539 -24.928 1.00 145.10 ? 529 ARG A CD  1 
ATOM   3353 N NE  . ARG A 1 445 ? -23.899 76.880 -26.349 1.00 156.64 ? 529 ARG A NE  1 
ATOM   3354 C CZ  . ARG A 1 445 ? -24.976 77.216 -27.057 1.00 164.31 ? 529 ARG A CZ  1 
ATOM   3355 N NH1 . ARG A 1 445 ? -26.172 77.259 -26.479 1.00 162.78 ? 529 ARG A NH1 1 
ATOM   3356 N NH2 . ARG A 1 445 ? -24.858 77.513 -28.346 1.00 167.76 ? 529 ARG A NH2 1 
ATOM   3357 N N   . TRP A 1 446 ? -20.701 75.654 -20.003 1.00 126.10 ? 530 TRP A N   1 
ATOM   3358 C CA  . TRP A 1 446 ? -20.786 75.232 -18.606 1.00 126.09 ? 530 TRP A CA  1 
ATOM   3359 C C   . TRP A 1 446 ? -21.545 76.214 -17.712 1.00 128.30 ? 530 TRP A C   1 
ATOM   3360 O O   . TRP A 1 446 ? -21.654 77.403 -18.019 1.00 130.05 ? 530 TRP A O   1 
ATOM   3361 C CB  . TRP A 1 446 ? -19.385 74.987 -18.033 1.00 126.52 ? 530 TRP A CB  1 
ATOM   3362 C CG  . TRP A 1 446 ? -18.663 73.852 -18.688 1.00 126.04 ? 530 TRP A CG  1 
ATOM   3363 C CD1 . TRP A 1 446 ? -18.052 73.864 -19.905 1.00 126.33 ? 530 TRP A CD1 1 
ATOM   3364 C CD2 . TRP A 1 446 ? -18.476 72.534 -18.159 1.00 124.00 ? 530 TRP A CD2 1 
ATOM   3365 N NE1 . TRP A 1 446 ? -17.500 72.635 -20.172 1.00 124.82 ? 530 TRP A NE1 1 
ATOM   3366 C CE2 . TRP A 1 446 ? -17.746 71.800 -19.115 1.00 123.36 ? 530 TRP A CE2 1 
ATOM   3367 C CE3 . TRP A 1 446 ? -18.859 71.902 -16.973 1.00 121.39 ? 530 TRP A CE3 1 
ATOM   3368 C CZ2 . TRP A 1 446 ? -17.391 70.469 -18.921 1.00 122.40 ? 530 TRP A CZ2 1 
ATOM   3369 C CZ3 . TRP A 1 446 ? -18.507 70.584 -16.783 1.00 120.49 ? 530 TRP A CZ3 1 
ATOM   3370 C CH2 . TRP A 1 446 ? -17.779 69.880 -17.752 1.00 121.28 ? 530 TRP A CH2 1 
ATOM   3371 N N   . ARG A 1 447 ? -22.071 75.702 -16.603 1.00 125.79 ? 531 ARG A N   1 
ATOM   3372 C CA  . ARG A 1 447 ? -22.627 76.550 -15.558 1.00 125.61 ? 531 ARG A CA  1 
ATOM   3373 C C   . ARG A 1 447 ? -22.005 76.173 -14.217 1.00 125.04 ? 531 ARG A C   1 
ATOM   3374 O O   . ARG A 1 447 ? -21.522 75.052 -14.042 1.00 123.09 ? 531 ARG A O   1 
ATOM   3375 C CB  . ARG A 1 447 ? -24.151 76.424 -15.500 1.00 122.49 ? 531 ARG A CB  1 
ATOM   3376 C CG  . ARG A 1 447 ? -24.676 75.579 -14.351 1.00 121.41 ? 531 ARG A CG  1 
ATOM   3377 C CD  . ARG A 1 447 ? -26.196 75.640 -14.260 1.00 119.73 ? 531 ARG A CD  1 
ATOM   3378 N NE  . ARG A 1 447 ? -26.847 74.956 -15.377 1.00 117.99 ? 531 ARG A NE  1 
ATOM   3379 C CZ  . ARG A 1 447 ? -27.740 75.518 -16.190 1.00 117.49 ? 531 ARG A CZ  1 
ATOM   3380 N NH1 . ARG A 1 447 ? -28.107 76.789 -16.017 1.00 113.22 ? 531 ARG A NH1 1 
ATOM   3381 N NH2 . ARG A 1 447 ? -28.271 74.802 -17.178 1.00 117.09 ? 531 ARG A NH2 1 
ATOM   3382 N N   . GLU A 1 448 ? -21.999 77.111 -13.277 1.00 125.93 ? 532 GLU A N   1 
ATOM   3383 C CA  . GLU A 1 448 ? -21.523 76.822 -11.933 1.00 126.10 ? 532 GLU A CA  1 
ATOM   3384 C C   . GLU A 1 448 ? -22.690 76.296 -11.110 1.00 125.76 ? 532 GLU A C   1 
ATOM   3385 O O   . GLU A 1 448 ? -23.656 77.015 -10.854 1.00 126.78 ? 532 GLU A O   1 
ATOM   3386 C CB  . GLU A 1 448 ? -20.933 78.072 -11.285 1.00 131.52 ? 532 GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 448 ? -20.220 77.827 -9.961  1.00 131.07 ? 532 GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 448 ? -19.601 79.090 -9.402  1.00 135.06 ? 532 GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 448 ? -19.709 80.137 -10.068 1.00 141.04 ? 532 GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 448 ? -19.011 79.042 -8.303  1.00 132.56 ? 532 GLU A OE2 1 
ATOM   3391 N N   . ALA A 1 449 ? -22.596 75.035 -10.706 1.00 121.90 ? 533 ALA A N   1 
ATOM   3392 C CA  . ALA A 1 449 ? -23.691 74.372 -10.027 1.00 114.25 ? 533 ALA A CA  1 
ATOM   3393 C C   . ALA A 1 449 ? -23.532 74.427 -8.520  1.00 113.41 ? 533 ALA A C   1 
ATOM   3394 O O   . ALA A 1 449 ? -24.425 74.874 -7.816  1.00 115.33 ? 533 ALA A O   1 
ATOM   3395 C CB  . ALA A 1 449 ? -23.788 72.942 -10.486 1.00 114.33 ? 533 ALA A CB  1 
ATOM   3396 N N   . LEU A 1 450 ? -22.400 73.959 -8.020  1.00 113.82 ? 534 LEU A N   1 
ATOM   3397 C CA  . LEU A 1 450 ? -22.198 73.913 -6.582  1.00 113.99 ? 534 LEU A CA  1 
ATOM   3398 C C   . LEU A 1 450 ? -20.838 74.466 -6.214  1.00 118.60 ? 534 LEU A C   1 
ATOM   3399 O O   . LEU A 1 450 ? -19.836 74.140 -6.853  1.00 121.15 ? 534 LEU A O   1 
ATOM   3400 C CB  . LEU A 1 450 ? -22.348 72.487 -6.061  1.00 114.77 ? 534 LEU A CB  1 
ATOM   3401 C CG  . LEU A 1 450 ? -23.729 71.858 -6.237  1.00 112.52 ? 534 LEU A CG  1 
ATOM   3402 C CD1 . LEU A 1 450 ? -23.664 70.398 -5.870  1.00 110.19 ? 534 LEU A CD1 1 
ATOM   3403 C CD2 . LEU A 1 450 ? -24.774 72.583 -5.401  1.00 108.05 ? 534 LEU A CD2 1 
ATOM   3404 N N   . PRO A 1 451 ? -20.800 75.300 -5.167  1.00 119.75 ? 535 PRO A N   1 
ATOM   3405 C CA  . PRO A 1 451 ? -19.611 76.051 -4.758  1.00 121.02 ? 535 PRO A CA  1 
ATOM   3406 C C   . PRO A 1 451 ? -18.522 75.159 -4.183  1.00 121.83 ? 535 PRO A C   1 
ATOM   3407 O O   . PRO A 1 451 ? -17.350 75.345 -4.501  1.00 126.47 ? 535 PRO A O   1 
ATOM   3408 C CB  . PRO A 1 451 ? -20.152 76.981 -3.672  1.00 122.90 ? 535 PRO A CB  1 
ATOM   3409 C CG  . PRO A 1 451 ? -21.293 76.232 -3.087  1.00 122.40 ? 535 PRO A CG  1 
ATOM   3410 C CD  . PRO A 1 451 ? -21.931 75.525 -4.250  1.00 121.23 ? 535 PRO A CD  1 
ATOM   3411 N N   . GLY A 1 452 ? -18.900 74.209 -3.338  1.00 117.60 ? 536 GLY A N   1 
ATOM   3412 C CA  . GLY A 1 452 ? -17.915 73.358 -2.701  1.00 119.81 ? 536 GLY A CA  1 
ATOM   3413 C C   . GLY A 1 452 ? -17.613 72.149 -3.553  1.00 119.69 ? 536 GLY A C   1 
ATOM   3414 O O   . GLY A 1 452 ? -18.025 72.078 -4.713  1.00 120.70 ? 536 GLY A O   1 
ATOM   3415 N N   . PRO A 1 453 ? -16.863 71.197 -2.996  1.00 119.73 ? 537 PRO A N   1 
ATOM   3416 C CA  . PRO A 1 453 ? -16.780 69.883 -3.629  1.00 120.60 ? 537 PRO A CA  1 
ATOM   3417 C C   . PRO A 1 453 ? -17.901 68.981 -3.104  1.00 118.37 ? 537 PRO A C   1 
ATOM   3418 O O   . PRO A 1 453 ? -18.254 69.050 -1.923  1.00 116.96 ? 537 PRO A O   1 
ATOM   3419 C CB  . PRO A 1 453 ? -15.412 69.383 -3.182  1.00 121.92 ? 537 PRO A CB  1 
ATOM   3420 C CG  . PRO A 1 453 ? -15.212 70.003 -1.856  1.00 122.40 ? 537 PRO A CG  1 
ATOM   3421 C CD  . PRO A 1 453 ? -15.873 71.357 -1.920  1.00 122.53 ? 537 PRO A CD  1 
ATOM   3422 N N   . HIS A 1 454 ? -18.473 68.165 -3.982  1.00 116.43 ? 538 HIS A N   1 
ATOM   3423 C CA  . HIS A 1 454 ? -19.590 67.304 -3.610  1.00 112.70 ? 538 HIS A CA  1 
ATOM   3424 C C   . HIS A 1 454 ? -19.426 65.914 -4.187  1.00 111.87 ? 538 HIS A C   1 
ATOM   3425 O O   . HIS A 1 454 ? -18.765 65.736 -5.210  1.00 113.46 ? 538 HIS A O   1 
ATOM   3426 C CB  . HIS A 1 454 ? -20.905 67.856 -4.161  1.00 110.60 ? 538 HIS A CB  1 
ATOM   3427 C CG  . HIS A 1 454 ? -21.365 69.121 -3.511  1.00 110.21 ? 538 HIS A CG  1 
ATOM   3428 N ND1 . HIS A 1 454 ? -20.649 70.295 -3.574  1.00 111.70 ? 538 HIS A ND1 1 
ATOM   3429 C CD2 . HIS A 1 454 ? -22.488 69.403 -2.810  1.00 110.49 ? 538 HIS A CD2 1 
ATOM   3430 C CE1 . HIS A 1 454 ? -21.304 71.242 -2.928  1.00 113.26 ? 538 HIS A CE1 1 
ATOM   3431 N NE2 . HIS A 1 454 ? -22.424 70.727 -2.457  1.00 108.65 ? 538 HIS A NE2 1 
ATOM   3432 N N   . TYR A 1 455 ? -20.040 64.929 -3.541  1.00 109.95 ? 539 TYR A N   1 
ATOM   3433 C CA  . TYR A 1 455 ? -20.294 63.665 -4.210  1.00 107.33 ? 539 TYR A CA  1 
ATOM   3434 C C   . TYR A 1 455 ? -21.438 63.972 -5.159  1.00 106.75 ? 539 TYR A C   1 
ATOM   3435 O O   . TYR A 1 455 ? -22.305 64.796 -4.847  1.00 105.91 ? 539 TYR A O   1 
ATOM   3436 C CB  . TYR A 1 455 ? -20.754 62.589 -3.233  1.00 103.74 ? 539 TYR A CB  1 
ATOM   3437 C CG  . TYR A 1 455 ? -19.801 62.245 -2.115  1.00 104.17 ? 539 TYR A CG  1 
ATOM   3438 C CD1 . TYR A 1 455 ? -18.787 61.320 -2.303  1.00 106.41 ? 539 TYR A CD1 1 
ATOM   3439 C CD2 . TYR A 1 455 ? -19.948 62.809 -0.855  1.00 107.57 ? 539 TYR A CD2 1 
ATOM   3440 C CE1 . TYR A 1 455 ? -17.930 60.985 -1.279  1.00 107.04 ? 539 TYR A CE1 1 
ATOM   3441 C CE2 . TYR A 1 455 ? -19.094 62.480 0.176   1.00 107.24 ? 539 TYR A CE2 1 
ATOM   3442 C CZ  . TYR A 1 455 ? -18.088 61.567 -0.045  1.00 106.42 ? 539 TYR A CZ  1 
ATOM   3443 O OH  . TYR A 1 455 ? -17.232 61.233 0.973   1.00 112.19 ? 539 TYR A OH  1 
ATOM   3444 N N   . TYR A 1 456 ? -21.448 63.331 -6.319  1.00 105.17 ? 540 TYR A N   1 
ATOM   3445 C CA  . TYR A 1 456 ? -22.553 63.511 -7.250  1.00 103.79 ? 540 TYR A CA  1 
ATOM   3446 C C   . TYR A 1 456 ? -22.744 62.285 -8.129  1.00 103.92 ? 540 TYR A C   1 
ATOM   3447 O O   . TYR A 1 456 ? -21.826 61.483 -8.330  1.00 105.00 ? 540 TYR A O   1 
ATOM   3448 C CB  . TYR A 1 456 ? -22.383 64.782 -8.097  1.00 103.92 ? 540 TYR A CB  1 
ATOM   3449 C CG  . TYR A 1 456 ? -20.997 64.950 -8.672  1.00 107.07 ? 540 TYR A CG  1 
ATOM   3450 C CD1 . TYR A 1 456 ? -20.640 64.340 -9.865  1.00 108.68 ? 540 TYR A CD1 1 
ATOM   3451 C CD2 . TYR A 1 456 ? -20.041 65.708 -8.016  1.00 109.18 ? 540 TYR A CD2 1 
ATOM   3452 C CE1 . TYR A 1 456 ? -19.372 64.482 -10.388 1.00 109.49 ? 540 TYR A CE1 1 
ATOM   3453 C CE2 . TYR A 1 456 ? -18.769 65.852 -8.529  1.00 111.74 ? 540 TYR A CE2 1 
ATOM   3454 C CZ  . TYR A 1 456 ? -18.443 65.241 -9.718  1.00 112.44 ? 540 TYR A CZ  1 
ATOM   3455 O OH  . TYR A 1 456 ? -17.179 65.384 -10.232 1.00 115.50 ? 540 TYR A OH  1 
ATOM   3456 N N   . THR A 1 457 ? -23.963 62.152 -8.631  1.00 103.25 ? 541 THR A N   1 
ATOM   3457 C CA  . THR A 1 457 ? -24.360 61.045 -9.481  1.00 104.06 ? 541 THR A CA  1 
ATOM   3458 C C   . THR A 1 457 ? -25.714 61.432 -10.044 1.00 102.29 ? 541 THR A C   1 
ATOM   3459 O O   . THR A 1 457 ? -26.208 62.526 -9.766  1.00 103.05 ? 541 THR A O   1 
ATOM   3460 C CB  . THR A 1 457 ? -24.504 59.745 -8.686  1.00 99.13  ? 541 THR A CB  1 
ATOM   3461 O OG1 . THR A 1 457 ? -24.854 58.681 -9.576  1.00 96.92  ? 541 THR A OG1 1 
ATOM   3462 C CG2 . THR A 1 457 ? -25.589 59.892 -7.646  1.00 98.38  ? 541 THR A CG2 1 
ATOM   3463 N N   . TRP A 1 458 ? -26.321 60.558 -10.836 1.00 99.64  ? 542 TRP A N   1 
ATOM   3464 C CA  . TRP A 1 458 ? -27.646 60.864 -11.356 1.00 100.85 ? 542 TRP A CA  1 
ATOM   3465 C C   . TRP A 1 458 ? -28.473 59.616 -11.661 1.00 101.13 ? 542 TRP A C   1 
ATOM   3466 O O   . TRP A 1 458 ? -27.939 58.508 -11.768 1.00 101.61 ? 542 TRP A O   1 
ATOM   3467 C CB  . TRP A 1 458 ? -27.575 61.827 -12.557 1.00 100.53 ? 542 TRP A CB  1 
ATOM   3468 C CG  . TRP A 1 458 ? -26.959 61.268 -13.807 1.00 101.53 ? 542 TRP A CG  1 
ATOM   3469 C CD1 . TRP A 1 458 ? -27.476 60.295 -14.614 1.00 101.85 ? 542 TRP A CD1 1 
ATOM   3470 C CD2 . TRP A 1 458 ? -25.732 61.686 -14.417 1.00 103.36 ? 542 TRP A CD2 1 
ATOM   3471 N NE1 . TRP A 1 458 ? -26.635 60.066 -15.676 1.00 103.64 ? 542 TRP A NE1 1 
ATOM   3472 C CE2 . TRP A 1 458 ? -25.561 60.907 -15.581 1.00 104.01 ? 542 TRP A CE2 1 
ATOM   3473 C CE3 . TRP A 1 458 ? -24.758 62.632 -14.092 1.00 105.48 ? 542 TRP A CE3 1 
ATOM   3474 C CZ2 . TRP A 1 458 ? -24.454 61.048 -16.411 1.00 106.15 ? 542 TRP A CZ2 1 
ATOM   3475 C CZ3 . TRP A 1 458 ? -23.663 62.770 -14.918 1.00 105.33 ? 542 TRP A CZ3 1 
ATOM   3476 C CH2 . TRP A 1 458 ? -23.520 61.981 -16.064 1.00 106.32 ? 542 TRP A CH2 1 
ATOM   3477 N N   . GLY A 1 459 ? -29.784 59.802 -11.771 1.00 96.88  ? 543 GLY A N   1 
ATOM   3478 C CA  . GLY A 1 459 ? -30.677 58.702 -12.058 1.00 96.92  ? 543 GLY A CA  1 
ATOM   3479 C C   . GLY A 1 459 ? -31.714 59.090 -13.085 1.00 98.86  ? 543 GLY A C   1 
ATOM   3480 O O   . GLY A 1 459 ? -31.792 60.244 -13.509 1.00 99.61  ? 543 GLY A O   1 
ATOM   3481 N N   . ASP A 1 460 ? -32.516 58.112 -13.481 1.00 99.13  ? 544 ASP A N   1 
ATOM   3482 C CA  . ASP A 1 460 ? -33.565 58.312 -14.472 1.00 100.34 ? 544 ASP A CA  1 
ATOM   3483 C C   . ASP A 1 460 ? -33.063 58.877 -15.786 1.00 100.56 ? 544 ASP A C   1 
ATOM   3484 O O   . ASP A 1 460 ? -33.661 59.808 -16.329 1.00 100.34 ? 544 ASP A O   1 
ATOM   3485 C CB  . ASP A 1 460 ? -34.664 59.217 -13.942 1.00 98.89  ? 544 ASP A CB  1 
ATOM   3486 C CG  . ASP A 1 460 ? -35.984 58.908 -14.568 1.00 100.33 ? 544 ASP A CG  1 
ATOM   3487 O OD1 . ASP A 1 460 ? -36.399 57.729 -14.455 1.00 100.77 ? 544 ASP A OD1 1 
ATOM   3488 O OD2 . ASP A 1 460 ? -36.576 59.817 -15.192 1.00 98.73  ? 544 ASP A OD2 1 
ATOM   3489 N N   . HIS A 1 461 ? -31.969 58.304 -16.282 1.00 100.43 ? 545 HIS A N   1 
ATOM   3490 C CA  . HIS A 1 461 ? -31.404 58.674 -17.572 1.00 102.78 ? 545 HIS A CA  1 
ATOM   3491 C C   . HIS A 1 461 ? -31.113 60.170 -17.606 1.00 103.71 ? 545 HIS A C   1 
ATOM   3492 O O   . HIS A 1 461 ? -31.448 60.868 -18.569 1.00 104.48 ? 545 HIS A O   1 
ATOM   3493 C CB  . HIS A 1 461 ? -32.341 58.242 -18.707 1.00 103.27 ? 545 HIS A CB  1 
ATOM   3494 C CG  . HIS A 1 461 ? -32.828 56.833 -18.575 1.00 103.15 ? 545 HIS A CG  1 
ATOM   3495 N ND1 . HIS A 1 461 ? -33.869 56.477 -17.740 1.00 103.06 ? 545 HIS A ND1 1 
ATOM   3496 C CD2 . HIS A 1 461 ? -32.404 55.680 -19.146 1.00 104.31 ? 545 HIS A CD2 1 
ATOM   3497 C CE1 . HIS A 1 461 ? -34.070 55.177 -17.812 1.00 101.95 ? 545 HIS A CE1 1 
ATOM   3498 N NE2 . HIS A 1 461 ? -33.194 54.667 -18.660 1.00 103.68 ? 545 HIS A NE2 1 
ATOM   3499 N N   . GLY A 1 462 ? -30.512 60.649 -16.519 1.00 99.29  ? 546 GLY A N   1 
ATOM   3500 C CA  . GLY A 1 462 ? -30.066 62.023 -16.414 1.00 96.72  ? 546 GLY A CA  1 
ATOM   3501 C C   . GLY A 1 462 ? -31.160 62.964 -15.972 1.00 97.51  ? 546 GLY A C   1 
ATOM   3502 O O   . GLY A 1 462 ? -30.917 64.148 -15.758 1.00 98.24  ? 546 GLY A O   1 
ATOM   3503 N N   . GLY A 1 463 ? -32.370 62.437 -15.834 1.00 98.17  ? 547 GLY A N   1 
ATOM   3504 C CA  . GLY A 1 463 ? -33.508 63.248 -15.447 1.00 96.34  ? 547 GLY A CA  1 
ATOM   3505 C C   . GLY A 1 463 ? -33.360 63.922 -14.093 1.00 95.48  ? 547 GLY A C   1 
ATOM   3506 O O   . GLY A 1 463 ? -33.916 64.991 -13.865 1.00 95.53  ? 547 GLY A O   1 
ATOM   3507 N N   . ILE A 1 464 ? -32.614 63.302 -13.185 1.00 95.87  ? 548 ILE A N   1 
ATOM   3508 C CA  . ILE A 1 464 ? -32.454 63.855 -11.842 1.00 94.96  ? 548 ILE A CA  1 
ATOM   3509 C C   . ILE A 1 464 ? -31.016 63.729 -11.304 1.00 98.35  ? 548 ILE A C   1 
ATOM   3510 O O   . ILE A 1 464 ? -30.372 62.682 -11.430 1.00 96.71  ? 548 ILE A O   1 
ATOM   3511 C CB  . ILE A 1 464 ? -33.478 63.241 -10.859 1.00 92.42  ? 548 ILE A CB  1 
ATOM   3512 C CG1 . ILE A 1 464 ? -33.519 64.029 -9.555  1.00 93.82  ? 548 ILE A CG1 1 
ATOM   3513 C CG2 . ILE A 1 464 ? -33.180 61.775 -10.589 1.00 95.21  ? 548 ILE A CG2 1 
ATOM   3514 C CD1 . ILE A 1 464 ? -34.499 63.476 -8.564  1.00 94.28  ? 548 ILE A CD1 1 
ATOM   3515 N N   . ILE A 1 465 ? -30.516 64.811 -10.713 1.00 97.25  ? 549 ILE A N   1 
ATOM   3516 C CA  . ILE A 1 465 ? -29.141 64.854 -10.228 1.00 97.58  ? 549 ILE A CA  1 
ATOM   3517 C C   . ILE A 1 465 ? -29.078 65.092 -8.729  1.00 97.61  ? 549 ILE A C   1 
ATOM   3518 O O   . ILE A 1 465 ? -29.624 66.066 -8.225  1.00 100.80 ? 549 ILE A O   1 
ATOM   3519 C CB  . ILE A 1 465 ? -28.340 65.973 -10.925 1.00 100.80 ? 549 ILE A CB  1 
ATOM   3520 C CG1 . ILE A 1 465 ? -28.167 65.657 -12.413 1.00 102.87 ? 549 ILE A CG1 1 
ATOM   3521 C CG2 . ILE A 1 465 ? -26.985 66.172 -10.246 1.00 99.84  ? 549 ILE A CG2 1 
ATOM   3522 C CD1 . ILE A 1 465 ? -27.373 66.701 -13.167 1.00 103.77 ? 549 ILE A CD1 1 
ATOM   3523 N N   . THR A 1 466 ? -28.406 64.209 -8.008  1.00 98.14  ? 550 THR A N   1 
ATOM   3524 C CA  . THR A 1 466 ? -28.244 64.416 -6.578  1.00 99.84  ? 550 THR A CA  1 
ATOM   3525 C C   . THR A 1 466 ? -26.807 64.764 -6.251  1.00 100.09 ? 550 THR A C   1 
ATOM   3526 O O   . THR A 1 466 ? -25.874 64.270 -6.882  1.00 101.73 ? 550 THR A O   1 
ATOM   3527 C CB  . THR A 1 466 ? -28.628 63.169 -5.772  1.00 96.36  ? 550 THR A CB  1 
ATOM   3528 O OG1 . THR A 1 466 ? -27.675 62.130 -6.028  1.00 96.40  ? 550 THR A OG1 1 
ATOM   3529 C CG2 . THR A 1 466 ? -30.019 62.701 -6.154  1.00 94.33  ? 550 THR A CG2 1 
ATOM   3530 N N   . ALA A 1 467 ? -26.629 65.612 -5.253  1.00 97.92  ? 551 ALA A N   1 
ATOM   3531 C CA  . ALA A 1 467 ? -25.298 65.878 -4.756  1.00 101.59 ? 551 ALA A CA  1 
ATOM   3532 C C   . ALA A 1 467 ? -25.304 65.926 -3.235  1.00 104.53 ? 551 ALA A C   1 
ATOM   3533 O O   . ALA A 1 467 ? -26.336 66.210 -2.618  1.00 102.53 ? 551 ALA A O   1 
ATOM   3534 C CB  . ALA A 1 467 ? -24.777 67.163 -5.328  1.00 104.51 ? 551 ALA A CB  1 
ATOM   3535 N N   . ILE A 1 468 ? -24.152 65.630 -2.639  1.00 104.82 ? 552 ILE A N   1 
ATOM   3536 C CA  . ILE A 1 468 ? -23.973 65.724 -1.193  1.00 107.17 ? 552 ILE A CA  1 
ATOM   3537 C C   . ILE A 1 468 ? -22.613 66.345 -0.891  1.00 107.12 ? 552 ILE A C   1 
ATOM   3538 O O   . ILE A 1 468 ? -21.630 66.026 -1.556  1.00 107.81 ? 552 ILE A O   1 
ATOM   3539 C CB  . ILE A 1 468 ? -24.085 64.338 -0.521  1.00 106.89 ? 552 ILE A CB  1 
ATOM   3540 C CG1 . ILE A 1 468 ? -25.480 63.755 -0.742  1.00 101.95 ? 552 ILE A CG1 1 
ATOM   3541 C CG2 . ILE A 1 468 ? -23.775 64.424 0.973   1.00 107.99 ? 552 ILE A CG2 1 
ATOM   3542 C CD1 . ILE A 1 468 ? -25.730 62.477 0.015   1.00 103.02 ? 552 ILE A CD1 1 
ATOM   3543 N N   . ALA A 1 469 ? -22.566 67.230 0.105   1.00 108.02 ? 553 ALA A N   1 
ATOM   3544 C CA  . ALA A 1 469 ? -21.357 67.999 0.414   1.00 110.59 ? 553 ALA A CA  1 
ATOM   3545 C C   . ALA A 1 469 ? -20.237 67.162 1.033   1.00 113.95 ? 553 ALA A C   1 
ATOM   3546 O O   . ALA A 1 469 ? -20.466 66.378 1.956   1.00 117.15 ? 553 ALA A O   1 
ATOM   3547 C CB  . ALA A 1 469 ? -21.699 69.174 1.313   1.00 109.96 ? 553 ALA A CB  1 
ATOM   3548 N N   . GLN A 1 470 ? -19.026 67.328 0.514   1.00 114.27 ? 554 GLN A N   1 
ATOM   3549 C CA  . GLN A 1 470 ? -17.864 66.645 1.064   1.00 115.85 ? 554 GLN A CA  1 
ATOM   3550 C C   . GLN A 1 470 ? -17.317 67.413 2.268   1.00 119.93 ? 554 GLN A C   1 
ATOM   3551 O O   . GLN A 1 470 ? -17.513 68.625 2.384   1.00 118.54 ? 554 GLN A O   1 
ATOM   3552 C CB  . GLN A 1 470 ? -16.773 66.519 0.002   1.00 118.91 ? 554 GLN A CB  1 
ATOM   3553 C CG  . GLN A 1 470 ? -17.137 65.667 -1.209  1.00 117.80 ? 554 GLN A CG  1 
ATOM   3554 C CD  . GLN A 1 470 ? -16.039 65.665 -2.266  1.00 127.47 ? 554 GLN A CD  1 
ATOM   3555 O OE1 . GLN A 1 470 ? -15.224 66.582 -2.331  1.00 134.76 ? 554 GLN A OE1 1 
ATOM   3556 N NE2 . GLN A 1 470 ? -16.008 64.627 -3.091  1.00 123.97 ? 554 GLN A NE2 1 
ATOM   3557 N N   . GLY A 1 471 ? -16.625 66.705 3.157   1.00 121.72 ? 555 GLY A N   1 
ATOM   3558 C CA  . GLY A 1 471 ? -16.004 67.325 4.315   1.00 119.91 ? 555 GLY A CA  1 
ATOM   3559 C C   . GLY A 1 471 ? -16.831 67.191 5.576   1.00 123.52 ? 555 GLY A C   1 
ATOM   3560 O O   . GLY A 1 471 ? -16.985 66.102 6.117   1.00 128.74 ? 555 GLY A O   1 
ATOM   3561 N N   . MET A 1 472 ? -17.371 68.306 6.044   1.00 125.29 ? 556 MET A N   1 
ATOM   3562 C CA  . MET A 1 472 ? -18.165 68.307 7.261   1.00 127.76 ? 556 MET A CA  1 
ATOM   3563 C C   . MET A 1 472 ? -19.341 67.356 7.104   1.00 123.95 ? 556 MET A C   1 
ATOM   3564 O O   . MET A 1 472 ? -19.854 67.180 6.002   1.00 122.69 ? 556 MET A O   1 
ATOM   3565 C CB  . MET A 1 472 ? -18.667 69.722 7.559   1.00 132.81 ? 556 MET A CB  1 
ATOM   3566 C CG  . MET A 1 472 ? -17.607 70.817 7.382   1.00 140.66 ? 556 MET A CG  1 
ATOM   3567 S SD  . MET A 1 472 ? -16.073 70.537 8.312   1.00 154.93 ? 556 MET A SD  1 
ATOM   3568 C CE  . MET A 1 472 ? -16.717 70.392 9.982   1.00 144.97 ? 556 MET A CE  1 
ATOM   3569 N N   . GLU A 1 473 ? -19.753 66.730 8.200   1.00 122.07 ? 557 GLU A N   1 
ATOM   3570 C CA  . GLU A 1 473 ? -20.919 65.859 8.168   1.00 122.06 ? 557 GLU A CA  1 
ATOM   3571 C C   . GLU A 1 473 ? -22.168 66.657 7.815   1.00 119.96 ? 557 GLU A C   1 
ATOM   3572 O O   . GLU A 1 473 ? -22.364 67.757 8.322   1.00 121.93 ? 557 GLU A O   1 
ATOM   3573 C CB  . GLU A 1 473 ? -21.114 65.145 9.510   1.00 124.15 ? 557 GLU A CB  1 
ATOM   3574 C CG  . GLU A 1 473 ? -21.474 66.040 10.690  1.00 125.92 ? 557 GLU A CG  1 
ATOM   3575 C CD  . GLU A 1 473 ? -20.257 66.599 11.403  1.00 134.36 ? 557 GLU A CD  1 
ATOM   3576 O OE1 . GLU A 1 473 ? -19.145 66.534 10.826  1.00 135.44 ? 557 GLU A OE1 1 
ATOM   3577 O OE2 . GLU A 1 473 ? -20.417 67.096 12.545  1.00 134.35 ? 557 GLU A OE2 1 
ATOM   3578 N N   . THR A 1 474 ? -22.999 66.117 6.929   1.00 118.26 ? 558 THR A N   1 
ATOM   3579 C CA  . THR A 1 474 ? -24.260 66.768 6.591   1.00 117.48 ? 558 THR A CA  1 
ATOM   3580 C C   . THR A 1 474 ? -25.443 65.841 6.780   1.00 116.33 ? 558 THR A C   1 
ATOM   3581 O O   . THR A 1 474 ? -25.294 64.671 7.135   1.00 117.72 ? 558 THR A O   1 
ATOM   3582 C CB  . THR A 1 474 ? -24.293 67.285 5.136   1.00 116.73 ? 558 THR A CB  1 
ATOM   3583 O OG1 . THR A 1 474 ? -23.986 66.213 4.237   1.00 115.79 ? 558 THR A OG1 1 
ATOM   3584 C CG2 . THR A 1 474 ? -23.291 68.416 4.943   1.00 121.95 ? 558 THR A CG2 1 
ATOM   3585 N N   . ASN A 1 475 ? -26.626 66.392 6.553   1.00 113.47 ? 559 ASN A N   1 
ATOM   3586 C CA  . ASN A 1 475 ? -27.839 65.605 6.480   1.00 110.55 ? 559 ASN A CA  1 
ATOM   3587 C C   . ASN A 1 475 ? -28.649 66.206 5.352   1.00 109.79 ? 559 ASN A C   1 
ATOM   3588 O O   . ASN A 1 475 ? -29.861 66.011 5.249   1.00 109.21 ? 559 ASN A O   1 
ATOM   3589 C CB  . ASN A 1 475 ? -28.596 65.635 7.805   1.00 112.04 ? 559 ASN A CB  1 
ATOM   3590 C CG  . ASN A 1 475 ? -29.085 67.019 8.170   1.00 112.51 ? 559 ASN A CG  1 
ATOM   3591 O OD1 . ASN A 1 475 ? -28.583 68.022 7.668   1.00 113.21 ? 559 ASN A OD1 1 
ATOM   3592 N ND2 . ASN A 1 475 ? -30.068 67.081 9.057   1.00 113.98 ? 559 ASN A ND2 1 
ATOM   3593 N N   . GLU A 1 476 ? -27.948 66.952 4.504   1.00 109.91 ? 560 GLU A N   1 
ATOM   3594 C CA  . GLU A 1 476 ? -28.566 67.584 3.350   1.00 109.38 ? 560 GLU A CA  1 
ATOM   3595 C C   . GLU A 1 476 ? -28.226 66.864 2.053   1.00 106.10 ? 560 GLU A C   1 
ATOM   3596 O O   . GLU A 1 476 ? -27.058 66.607 1.745   1.00 103.42 ? 560 GLU A O   1 
ATOM   3597 C CB  . GLU A 1 476 ? -28.145 69.046 3.245   1.00 111.21 ? 560 GLU A CB  1 
ATOM   3598 C CG  . GLU A 1 476 ? -28.662 69.926 4.359   1.00 114.07 ? 560 GLU A CG  1 
ATOM   3599 C CD  . GLU A 1 476 ? -28.381 71.392 4.097   1.00 114.45 ? 560 GLU A CD  1 
ATOM   3600 O OE1 . GLU A 1 476 ? -28.711 71.865 2.988   1.00 115.21 ? 560 GLU A OE1 1 
ATOM   3601 O OE2 . GLU A 1 476 ? -27.823 72.065 4.992   1.00 113.28 ? 560 GLU A OE2 1 
ATOM   3602 N N   . LEU A 1 477 ? -29.270 66.541 1.302   1.00 103.56 ? 561 LEU A N   1 
ATOM   3603 C CA  . LEU A 1 477 ? -29.126 65.958 -0.015  1.00 100.90 ? 561 LEU A CA  1 
ATOM   3604 C C   . LEU A 1 477 ? -29.600 66.991 -1.022  1.00 102.06 ? 561 LEU A C   1 
ATOM   3605 O O   . LEU A 1 477 ? -30.799 67.193 -1.197  1.00 104.92 ? 561 LEU A O   1 
ATOM   3606 C CB  . LEU A 1 477 ? -29.976 64.696 -0.122  1.00 99.80  ? 561 LEU A CB  1 
ATOM   3607 C CG  . LEU A 1 477 ? -30.132 64.101 -1.519  1.00 99.37  ? 561 LEU A CG  1 
ATOM   3608 C CD1 . LEU A 1 477 ? -28.878 63.382 -1.941  1.00 100.69 ? 561 LEU A CD1 1 
ATOM   3609 C CD2 . LEU A 1 477 ? -31.299 63.157 -1.546  1.00 102.79 ? 561 LEU A CD2 1 
ATOM   3610 N N   . LYS A 1 478 ? -28.665 67.674 -1.664  1.00 101.02 ? 562 LYS A N   1 
ATOM   3611 C CA  . LYS A 1 478 ? -29.035 68.625 -2.700  1.00 101.41 ? 562 LYS A CA  1 
ATOM   3612 C C   . LYS A 1 478 ? -29.415 67.843 -3.954  1.00 102.49 ? 562 LYS A C   1 
ATOM   3613 O O   . LYS A 1 478 ? -28.732 66.881 -4.324  1.00 103.50 ? 562 LYS A O   1 
ATOM   3614 C CB  . LYS A 1 478 ? -27.879 69.589 -2.989  1.00 103.84 ? 562 LYS A CB  1 
ATOM   3615 C CG  . LYS A 1 478 ? -27.515 70.499 -1.826  1.00 101.99 ? 562 LYS A CG  1 
ATOM   3616 C CD  . LYS A 1 478 ? -26.170 71.174 -2.046  1.00 107.03 ? 562 LYS A CD  1 
ATOM   3617 C CE  . LYS A 1 478 ? -25.476 71.445 -0.711  1.00 111.13 ? 562 LYS A CE  1 
ATOM   3618 N NZ  . LYS A 1 478 ? -24.224 72.248 -0.839  1.00 109.63 ? 562 LYS A NZ  1 
ATOM   3619 N N   . TYR A 1 479 ? -30.510 68.239 -4.597  1.00 98.85  ? 563 TYR A N   1 
ATOM   3620 C CA  . TYR A 1 479 ? -30.940 67.581 -5.826  1.00 96.36  ? 563 TYR A CA  1 
ATOM   3621 C C   . TYR A 1 479 ? -31.434 68.585 -6.864  1.00 98.65  ? 563 TYR A C   1 
ATOM   3622 O O   . TYR A 1 479 ? -31.763 69.720 -6.536  1.00 101.16 ? 563 TYR A O   1 
ATOM   3623 C CB  . TYR A 1 479 ? -31.995 66.504 -5.536  1.00 98.69  ? 563 TYR A CB  1 
ATOM   3624 C CG  . TYR A 1 479 ? -33.334 67.010 -5.001  1.00 101.06 ? 563 TYR A CG  1 
ATOM   3625 C CD1 . TYR A 1 479 ? -33.486 67.389 -3.667  1.00 99.49  ? 563 TYR A CD1 1 
ATOM   3626 C CD2 . TYR A 1 479 ? -34.454 67.075 -5.827  1.00 98.22  ? 563 TYR A CD2 1 
ATOM   3627 C CE1 . TYR A 1 479 ? -34.705 67.839 -3.184  1.00 97.26  ? 563 TYR A CE1 1 
ATOM   3628 C CE2 . TYR A 1 479 ? -35.671 67.519 -5.351  1.00 96.16  ? 563 TYR A CE2 1 
ATOM   3629 C CZ  . TYR A 1 479 ? -35.792 67.900 -4.032  1.00 97.36  ? 563 TYR A CZ  1 
ATOM   3630 O OH  . TYR A 1 479 ? -37.012 68.345 -3.566  1.00 100.35 ? 563 TYR A OH  1 
ATOM   3631 N N   . SER A 1 480 ? -31.471 68.168 -8.124  1.00 98.70  ? 564 SER A N   1 
ATOM   3632 C CA  . SER A 1 480 ? -31.871 69.063 -9.203  1.00 98.69  ? 564 SER A CA  1 
ATOM   3633 C C   . SER A 1 480 ? -32.494 68.318 -10.376 1.00 100.36 ? 564 SER A C   1 
ATOM   3634 O O   . SER A 1 480 ? -32.019 67.248 -10.770 1.00 97.78  ? 564 SER A O   1 
ATOM   3635 C CB  . SER A 1 480 ? -30.679 69.867 -9.702  1.00 99.73  ? 564 SER A CB  1 
ATOM   3636 O OG  . SER A 1 480 ? -31.040 70.630 -10.841 1.00 102.16 ? 564 SER A OG  1 
ATOM   3637 N N   . THR A 1 481 ? -33.545 68.910 -10.939 1.00 100.53 ? 565 THR A N   1 
ATOM   3638 C CA  . THR A 1 481 ? -34.294 68.310 -12.032 1.00 98.37  ? 565 THR A CA  1 
ATOM   3639 C C   . THR A 1 481 ? -34.124 69.095 -13.329 1.00 101.90 ? 565 THR A C   1 
ATOM   3640 O O   . THR A 1 481 ? -34.632 68.693 -14.377 1.00 102.83 ? 565 THR A O   1 
ATOM   3641 C CB  . THR A 1 481 ? -35.794 68.274 -11.707 1.00 101.45 ? 565 THR A CB  1 
ATOM   3642 O OG1 . THR A 1 481 ? -36.263 69.614 -11.490 1.00 102.08 ? 565 THR A OG1 1 
ATOM   3643 C CG2 . THR A 1 481 ? -36.066 67.421 -10.466 1.00 97.36  ? 565 THR A CG2 1 
ATOM   3644 N N   . ASN A 1 482 ? -33.432 70.228 -13.260 1.00 103.77 ? 566 ASN A N   1 
ATOM   3645 C CA  . ASN A 1 482 ? -33.235 71.061 -14.443 1.00 103.37 ? 566 ASN A CA  1 
ATOM   3646 C C   . ASN A 1 482 ? -31.767 71.236 -14.821 1.00 106.21 ? 566 ASN A C   1 
ATOM   3647 O O   . ASN A 1 482 ? -31.335 72.338 -15.155 1.00 107.58 ? 566 ASN A O   1 
ATOM   3648 C CB  . ASN A 1 482 ? -33.898 72.420 -14.253 1.00 100.46 ? 566 ASN A CB  1 
ATOM   3649 C CG  . ASN A 1 482 ? -33.542 73.055 -12.931 1.00 101.86 ? 566 ASN A CG  1 
ATOM   3650 O OD1 . ASN A 1 482 ? -32.775 72.493 -12.146 1.00 101.96 ? 566 ASN A OD1 1 
ATOM   3651 N ND2 . ASN A 1 482 ? -34.089 74.242 -12.678 1.00 102.50 ? 566 ASN A ND2 1 
ATOM   3652 N N   . GLU A 1 483 ? -31.014 70.139 -14.762 1.00 107.43 ? 567 GLU A N   1 
ATOM   3653 C CA  . GLU A 1 483 ? -29.606 70.110 -15.165 1.00 108.90 ? 567 GLU A CA  1 
ATOM   3654 C C   . GLU A 1 483 ? -28.725 71.075 -14.369 1.00 110.81 ? 567 GLU A C   1 
ATOM   3655 O O   . GLU A 1 483 ? -27.832 71.726 -14.922 1.00 112.68 ? 567 GLU A O   1 
ATOM   3656 C CB  . GLU A 1 483 ? -29.465 70.357 -16.669 1.00 110.01 ? 567 GLU A CB  1 
ATOM   3657 C CG  . GLU A 1 483 ? -30.205 69.351 -17.528 1.00 107.81 ? 567 GLU A CG  1 
ATOM   3658 C CD  . GLU A 1 483 ? -30.178 69.715 -18.999 1.00 114.65 ? 567 GLU A CD  1 
ATOM   3659 O OE1 . GLU A 1 483 ? -29.848 70.880 -19.319 1.00 114.19 ? 567 GLU A OE1 1 
ATOM   3660 O OE2 . GLU A 1 483 ? -30.474 68.832 -19.839 1.00 119.62 ? 567 GLU A OE2 1 
ATOM   3661 N N   . GLY A 1 484 ? -28.990 71.163 -13.068 1.00 110.60 ? 568 GLY A N   1 
ATOM   3662 C CA  . GLY A 1 484 ? -28.152 71.926 -12.158 1.00 109.47 ? 568 GLY A CA  1 
ATOM   3663 C C   . GLY A 1 484 ? -28.461 73.409 -12.116 1.00 109.37 ? 568 GLY A C   1 
ATOM   3664 O O   . GLY A 1 484 ? -27.805 74.151 -11.386 1.00 112.84 ? 568 GLY A O   1 
ATOM   3665 N N   . GLU A 1 485 ? -29.451 73.845 -12.892 1.00 106.59 ? 569 GLU A N   1 
ATOM   3666 C CA  . GLU A 1 485 ? -29.803 75.260 -12.936 1.00 106.61 ? 569 GLU A CA  1 
ATOM   3667 C C   . GLU A 1 485 ? -30.295 75.753 -11.580 1.00 104.93 ? 569 GLU A C   1 
ATOM   3668 O O   . GLU A 1 485 ? -29.942 76.847 -11.140 1.00 106.83 ? 569 GLU A O   1 
ATOM   3669 C CB  . GLU A 1 485 ? -30.847 75.539 -14.014 1.00 105.23 ? 569 GLU A CB  1 
ATOM   3670 C CG  . GLU A 1 485 ? -31.325 76.975 -14.028 1.00 104.11 ? 569 GLU A CG  1 
ATOM   3671 C CD  . GLU A 1 485 ? -32.121 77.294 -15.265 1.00 108.19 ? 569 GLU A CD  1 
ATOM   3672 O OE1 . GLU A 1 485 ? -32.368 76.345 -16.047 1.00 107.18 ? 569 GLU A OE1 1 
ATOM   3673 O OE2 . GLU A 1 485 ? -32.492 78.484 -15.453 1.00 106.24 ? 569 GLU A OE2 1 
ATOM   3674 N N   . THR A 1 486 ? -31.107 74.939 -10.921 1.00 102.51 ? 570 THR A N   1 
ATOM   3675 C CA  . THR A 1 486 ? -31.516 75.230 -9.555  1.00 103.35 ? 570 THR A CA  1 
ATOM   3676 C C   . THR A 1 486 ? -31.393 73.981 -8.715  1.00 103.09 ? 570 THR A C   1 
ATOM   3677 O O   . THR A 1 486 ? -31.394 72.870 -9.235  1.00 104.05 ? 570 THR A O   1 
ATOM   3678 C CB  . THR A 1 486 ? -32.960 75.722 -9.474  1.00 102.56 ? 570 THR A CB  1 
ATOM   3679 O OG1 . THR A 1 486 ? -33.809 74.823 -10.197 1.00 105.14 ? 570 THR A OG1 1 
ATOM   3680 C CG2 . THR A 1 486 ? -33.078 77.112 -10.059 1.00 101.89 ? 570 THR A CG2 1 
ATOM   3681 N N   . TRP A 1 487 ? -31.293 74.169 -7.407  1.00 103.07 ? 571 TRP A N   1 
ATOM   3682 C CA  . TRP A 1 487 ? -31.158 73.047 -6.499  1.00 101.96 ? 571 TRP A CA  1 
ATOM   3683 C C   . TRP A 1 487 ? -32.162 73.143 -5.359  1.00 102.60 ? 571 TRP A C   1 
ATOM   3684 O O   . TRP A 1 487 ? -32.604 74.231 -5.002  1.00 105.13 ? 571 TRP A O   1 
ATOM   3685 C CB  . TRP A 1 487 ? -29.733 72.980 -5.959  1.00 102.57 ? 571 TRP A CB  1 
ATOM   3686 C CG  . TRP A 1 487 ? -28.723 72.698 -7.023  1.00 103.43 ? 571 TRP A CG  1 
ATOM   3687 C CD1 . TRP A 1 487 ? -28.107 73.608 -7.832  1.00 105.64 ? 571 TRP A CD1 1 
ATOM   3688 C CD2 . TRP A 1 487 ? -28.214 71.417 -7.400  1.00 103.35 ? 571 TRP A CD2 1 
ATOM   3689 N NE1 . TRP A 1 487 ? -27.243 72.971 -8.691  1.00 104.72 ? 571 TRP A NE1 1 
ATOM   3690 C CE2 . TRP A 1 487 ? -27.290 71.623 -8.446  1.00 105.30 ? 571 TRP A CE2 1 
ATOM   3691 C CE3 . TRP A 1 487 ? -28.448 70.113 -6.957  1.00 99.87  ? 571 TRP A CE3 1 
ATOM   3692 C CZ2 . TRP A 1 487 ? -26.601 70.576 -9.054  1.00 104.53 ? 571 TRP A CZ2 1 
ATOM   3693 C CZ3 . TRP A 1 487 ? -27.762 69.074 -7.564  1.00 100.48 ? 571 TRP A CZ3 1 
ATOM   3694 C CH2 . TRP A 1 487 ? -26.849 69.312 -8.598  1.00 99.84  ? 571 TRP A CH2 1 
ATOM   3695 N N   . LYS A 1 488 ? -32.541 71.994 -4.814  1.00 100.57 ? 572 LYS A N   1 
ATOM   3696 C CA  . LYS A 1 488 ? -33.402 71.945 -3.645  1.00 100.44 ? 572 LYS A CA  1 
ATOM   3697 C C   . LYS A 1 488 ? -32.738 71.049 -2.615  1.00 99.82  ? 572 LYS A C   1 
ATOM   3698 O O   . LYS A 1 488 ? -31.942 70.178 -2.962  1.00 100.21 ? 572 LYS A O   1 
ATOM   3699 C CB  . LYS A 1 488 ? -34.795 71.414 -4.002  1.00 99.44  ? 572 LYS A CB  1 
ATOM   3700 C CG  . LYS A 1 488 ? -35.593 72.312 -4.946  1.00 99.69  ? 572 LYS A CG  1 
ATOM   3701 C CD  . LYS A 1 488 ? -36.961 71.718 -5.301  1.00 99.81  ? 572 LYS A CD  1 
ATOM   3702 C CE  . LYS A 1 488 ? -38.028 72.073 -4.267  1.00 105.22 ? 572 LYS A CE  1 
ATOM   3703 N NZ  . LYS A 1 488 ? -39.368 71.493 -4.608  1.00 108.26 ? 572 LYS A NZ  1 
ATOM   3704 N N   . THR A 1 489 ? -33.051 71.267 -1.347  1.00 101.20 ? 573 THR A N   1 
ATOM   3705 C CA  . THR A 1 489 ? -32.457 70.460 -0.299  1.00 100.28 ? 573 THR A CA  1 
ATOM   3706 C C   . THR A 1 489 ? -33.460 69.474 0.267   1.00 103.14 ? 573 THR A C   1 
ATOM   3707 O O   . THR A 1 489 ? -34.600 69.832 0.575   1.00 105.86 ? 573 THR A O   1 
ATOM   3708 C CB  . THR A 1 489 ? -31.905 71.334 0.830   1.00 102.36 ? 573 THR A CB  1 
ATOM   3709 O OG1 . THR A 1 489 ? -30.755 72.043 0.356   1.00 107.24 ? 573 THR A OG1 1 
ATOM   3710 C CG2 . THR A 1 489 ? -31.494 70.482 2.008   1.00 104.71 ? 573 THR A CG2 1 
ATOM   3711 N N   . PHE A 1 490 ? -33.039 68.221 0.374   1.00 102.30 ? 574 PHE A N   1 
ATOM   3712 C CA  . PHE A 1 490 ? -33.796 67.240 1.124   1.00 101.98 ? 574 PHE A CA  1 
ATOM   3713 C C   . PHE A 1 490 ? -33.004 66.779 2.345   1.00 102.56 ? 574 PHE A C   1 
ATOM   3714 O O   . PHE A 1 490 ? -31.857 66.340 2.235   1.00 100.80 ? 574 PHE A O   1 
ATOM   3715 C CB  . PHE A 1 490 ? -34.168 66.048 0.253   1.00 101.73 ? 574 PHE A CB  1 
ATOM   3716 C CG  . PHE A 1 490 ? -34.770 64.916 1.027   1.00 104.05 ? 574 PHE A CG  1 
ATOM   3717 C CD1 . PHE A 1 490 ? -36.048 65.029 1.555   1.00 103.14 ? 574 PHE A CD1 1 
ATOM   3718 C CD2 . PHE A 1 490 ? -34.051 63.748 1.249   1.00 103.06 ? 574 PHE A CD2 1 
ATOM   3719 C CE1 . PHE A 1 490 ? -36.604 64.005 2.278   1.00 102.39 ? 574 PHE A CE1 1 
ATOM   3720 C CE2 . PHE A 1 490 ? -34.601 62.711 1.971   1.00 102.47 ? 574 PHE A CE2 1 
ATOM   3721 C CZ  . PHE A 1 490 ? -35.883 62.837 2.486   1.00 103.02 ? 574 PHE A CZ  1 
ATOM   3722 N N   . ILE A 1 491 ? -33.620 66.899 3.515   1.00 104.59 ? 575 ILE A N   1 
ATOM   3723 C CA  . ILE A 1 491 ? -32.996 66.423 4.742   1.00 106.77 ? 575 ILE A CA  1 
ATOM   3724 C C   . ILE A 1 491 ? -33.259 64.934 4.882   1.00 105.87 ? 575 ILE A C   1 
ATOM   3725 O O   . ILE A 1 491 ? -34.402 64.522 5.096   1.00 107.13 ? 575 ILE A O   1 
ATOM   3726 C CB  . ILE A 1 491 ? -33.541 67.157 5.984   1.00 106.60 ? 575 ILE A CB  1 
ATOM   3727 C CG1 . ILE A 1 491 ? -33.422 68.669 5.804   1.00 100.62 ? 575 ILE A CG1 1 
ATOM   3728 C CG2 . ILE A 1 491 ? -32.793 66.706 7.233   1.00 105.38 ? 575 ILE A CG2 1 
ATOM   3729 C CD1 . ILE A 1 491 ? -31.990 69.137 5.682   1.00 104.88 ? 575 ILE A CD1 1 
ATOM   3730 N N   . PHE A 1 492 ? -32.209 64.128 4.757   1.00 104.88 ? 576 PHE A N   1 
ATOM   3731 C CA  . PHE A 1 492 ? -32.374 62.676 4.744   1.00 106.78 ? 576 PHE A CA  1 
ATOM   3732 C C   . PHE A 1 492 ? -32.169 62.029 6.107   1.00 110.17 ? 576 PHE A C   1 
ATOM   3733 O O   . PHE A 1 492 ? -32.517 60.862 6.307   1.00 113.51 ? 576 PHE A O   1 
ATOM   3734 C CB  . PHE A 1 492 ? -31.470 62.017 3.691   1.00 107.16 ? 576 PHE A CB  1 
ATOM   3735 C CG  . PHE A 1 492 ? -29.994 62.278 3.887   1.00 106.60 ? 576 PHE A CG  1 
ATOM   3736 C CD1 . PHE A 1 492 ? -29.242 61.499 4.751   1.00 107.23 ? 576 PHE A CD1 1 
ATOM   3737 C CD2 . PHE A 1 492 ? -29.356 63.284 3.181   1.00 105.28 ? 576 PHE A CD2 1 
ATOM   3738 C CE1 . PHE A 1 492 ? -27.886 61.732 4.922   1.00 107.78 ? 576 PHE A CE1 1 
ATOM   3739 C CE2 . PHE A 1 492 ? -28.007 63.519 3.346   1.00 105.80 ? 576 PHE A CE2 1 
ATOM   3740 C CZ  . PHE A 1 492 ? -27.270 62.741 4.218   1.00 107.20 ? 576 PHE A CZ  1 
ATOM   3741 N N   . SER A 1 493 ? -31.604 62.786 7.040   1.00 109.78 ? 577 SER A N   1 
ATOM   3742 C CA  . SER A 1 493 ? -31.353 62.275 8.382   1.00 112.88 ? 577 SER A CA  1 
ATOM   3743 C C   . SER A 1 493 ? -31.544 63.361 9.429   1.00 116.60 ? 577 SER A C   1 
ATOM   3744 O O   . SER A 1 493 ? -31.172 64.510 9.211   1.00 116.99 ? 577 SER A O   1 
ATOM   3745 C CB  . SER A 1 493 ? -29.944 61.700 8.483   1.00 113.67 ? 577 SER A CB  1 
ATOM   3746 O OG  . SER A 1 493 ? -29.637 61.381 9.826   1.00 119.25 ? 577 SER A OG  1 
ATOM   3747 N N   . GLU A 1 494 ? -32.132 62.994 10.563  1.00 121.59 ? 578 GLU A N   1 
ATOM   3748 C CA  . GLU A 1 494 ? -32.377 63.951 11.638  1.00 123.47 ? 578 GLU A CA  1 
ATOM   3749 C C   . GLU A 1 494 ? -31.052 64.422 12.231  1.00 123.72 ? 578 GLU A C   1 
ATOM   3750 O O   . GLU A 1 494 ? -30.899 65.588 12.594  1.00 124.37 ? 578 GLU A O   1 
ATOM   3751 C CB  . GLU A 1 494 ? -33.280 63.334 12.709  1.00 124.11 ? 578 GLU A CB  1 
ATOM   3752 C CG  . GLU A 1 494 ? -33.660 64.276 13.843  1.00 130.72 ? 578 GLU A CG  1 
ATOM   3753 C CD  . GLU A 1 494 ? -34.870 63.788 14.631  1.00 135.71 ? 578 GLU A CD  1 
ATOM   3754 O OE1 . GLU A 1 494 ? -35.077 64.258 15.775  1.00 135.83 ? 578 GLU A OE1 1 
ATOM   3755 O OE2 . GLU A 1 494 ? -35.619 62.939 14.098  1.00 134.33 ? 578 GLU A OE2 1 
ATOM   3756 N N   . LYS A 1 495 ? -30.092 63.505 12.307  1.00 123.83 ? 579 LYS A N   1 
ATOM   3757 C CA  . LYS A 1 495 ? -28.744 63.825 12.761  1.00 126.27 ? 579 LYS A CA  1 
ATOM   3758 C C   . LYS A 1 495 ? -27.790 63.812 11.574  1.00 126.14 ? 579 LYS A C   1 
ATOM   3759 O O   . LYS A 1 495 ? -27.819 62.878 10.769  1.00 126.61 ? 579 LYS A O   1 
ATOM   3760 C CB  . LYS A 1 495 ? -28.279 62.801 13.803  1.00 130.95 ? 579 LYS A CB  1 
ATOM   3761 C CG  . LYS A 1 495 ? -26.769 62.787 14.076  1.00 134.08 ? 579 LYS A CG  1 
ATOM   3762 C CD  . LYS A 1 495 ? -26.412 63.507 15.376  1.00 138.00 ? 579 LYS A CD  1 
ATOM   3763 C CE  . LYS A 1 495 ? -24.934 63.341 15.708  1.00 144.37 ? 579 LYS A CE  1 
ATOM   3764 N NZ  . LYS A 1 495 ? -24.576 63.951 17.021  1.00 150.37 ? 579 LYS A NZ  1 
ATOM   3765 N N   . PRO A 1 496 ? -26.936 64.843 11.462  1.00 125.10 ? 580 PRO A N   1 
ATOM   3766 C CA  . PRO A 1 496 ? -25.942 64.887 10.385  1.00 120.37 ? 580 PRO A CA  1 
ATOM   3767 C C   . PRO A 1 496 ? -24.970 63.722 10.496  1.00 120.13 ? 580 PRO A C   1 
ATOM   3768 O O   . PRO A 1 496 ? -24.565 63.356 11.599  1.00 122.13 ? 580 PRO A O   1 
ATOM   3769 C CB  . PRO A 1 496 ? -25.212 66.209 10.638  1.00 121.24 ? 580 PRO A CB  1 
ATOM   3770 C CG  . PRO A 1 496 ? -25.409 66.478 12.089  1.00 126.89 ? 580 PRO A CG  1 
ATOM   3771 C CD  . PRO A 1 496 ? -26.795 65.979 12.387  1.00 126.81 ? 580 PRO A CD  1 
ATOM   3772 N N   . VAL A 1 497 ? -24.613 63.140 9.357   1.00 118.88 ? 581 VAL A N   1 
ATOM   3773 C CA  . VAL A 1 497 ? -23.696 62.010 9.332   1.00 118.78 ? 581 VAL A CA  1 
ATOM   3774 C C   . VAL A 1 497 ? -22.522 62.273 8.391   1.00 117.49 ? 581 VAL A C   1 
ATOM   3775 O O   . VAL A 1 497 ? -22.639 63.045 7.443   1.00 116.64 ? 581 VAL A O   1 
ATOM   3776 C CB  . VAL A 1 497 ? -24.420 60.724 8.898   1.00 119.50 ? 581 VAL A CB  1 
ATOM   3777 C CG1 . VAL A 1 497 ? -25.664 60.512 9.746   1.00 120.90 ? 581 VAL A CG1 1 
ATOM   3778 C CG2 . VAL A 1 497 ? -24.797 60.792 7.430   1.00 117.22 ? 581 VAL A CG2 1 
ATOM   3779 N N   . PHE A 1 498 ? -21.381 61.654 8.671   1.00 120.34 ? 582 PHE A N   1 
ATOM   3780 C CA  . PHE A 1 498 ? -20.270 61.687 7.734   1.00 119.73 ? 582 PHE A CA  1 
ATOM   3781 C C   . PHE A 1 498 ? -20.754 60.910 6.515   1.00 118.03 ? 582 PHE A C   1 
ATOM   3782 O O   . PHE A 1 498 ? -21.504 59.943 6.658   1.00 119.18 ? 582 PHE A O   1 
ATOM   3783 C CB  . PHE A 1 498 ? -19.026 61.009 8.324   1.00 125.27 ? 582 PHE A CB  1 
ATOM   3784 C CG  . PHE A 1 498 ? -18.664 61.466 9.727   1.00 133.19 ? 582 PHE A CG  1 
ATOM   3785 C CD1 . PHE A 1 498 ? -18.824 62.789 10.115  1.00 132.26 ? 582 PHE A CD1 1 
ATOM   3786 C CD2 . PHE A 1 498 ? -18.149 60.561 10.656  1.00 138.10 ? 582 PHE A CD2 1 
ATOM   3787 C CE1 . PHE A 1 498 ? -18.493 63.203 11.403  1.00 134.62 ? 582 PHE A CE1 1 
ATOM   3788 C CE2 . PHE A 1 498 ? -17.811 60.968 11.946  1.00 140.79 ? 582 PHE A CE2 1 
ATOM   3789 C CZ  . PHE A 1 498 ? -17.985 62.290 12.317  1.00 139.93 ? 582 PHE A CZ  1 
ATOM   3790 N N   . VAL A 1 499 ? -20.356 61.329 5.320   1.00 113.10 ? 583 VAL A N   1 
ATOM   3791 C CA  . VAL A 1 499 ? -20.778 60.633 4.107   1.00 108.91 ? 583 VAL A CA  1 
ATOM   3792 C C   . VAL A 1 499 ? -19.574 60.141 3.308   1.00 109.67 ? 583 VAL A C   1 
ATOM   3793 O O   . VAL A 1 499 ? -18.674 60.916 3.003   1.00 111.47 ? 583 VAL A O   1 
ATOM   3794 C CB  . VAL A 1 499 ? -21.666 61.526 3.222   1.00 105.38 ? 583 VAL A CB  1 
ATOM   3795 C CG1 . VAL A 1 499 ? -21.962 60.847 1.899   1.00 104.39 ? 583 VAL A CG1 1 
ATOM   3796 C CG2 . VAL A 1 499 ? -22.954 61.852 3.938   1.00 110.07 ? 583 VAL A CG2 1 
ATOM   3797 N N   . TYR A 1 500 ? -19.561 58.854 2.969   1.00 108.96 ? 584 TYR A N   1 
ATOM   3798 C CA  . TYR A 1 500 ? -18.434 58.259 2.255   1.00 108.94 ? 584 TYR A CA  1 
ATOM   3799 C C   . TYR A 1 500 ? -18.711 58.006 0.777   1.00 106.06 ? 584 TYR A C   1 
ATOM   3800 O O   . TYR A 1 500 ? -17.793 57.728 0.009   1.00 110.60 ? 584 TYR A O   1 
ATOM   3801 C CB  . TYR A 1 500 ? -17.992 56.964 2.937   1.00 111.34 ? 584 TYR A CB  1 
ATOM   3802 C CG  . TYR A 1 500 ? -17.538 57.188 4.355   1.00 117.40 ? 584 TYR A CG  1 
ATOM   3803 C CD1 . TYR A 1 500 ? -16.214 57.488 4.640   1.00 123.46 ? 584 TYR A CD1 1 
ATOM   3804 C CD2 . TYR A 1 500 ? -18.439 57.128 5.410   1.00 120.01 ? 584 TYR A CD2 1 
ATOM   3805 C CE1 . TYR A 1 500 ? -15.798 57.714 5.939   1.00 125.89 ? 584 TYR A CE1 1 
ATOM   3806 C CE2 . TYR A 1 500 ? -18.032 57.351 6.715   1.00 122.50 ? 584 TYR A CE2 1 
ATOM   3807 C CZ  . TYR A 1 500 ? -16.713 57.650 6.972   1.00 124.90 ? 584 TYR A CZ  1 
ATOM   3808 O OH  . TYR A 1 500 ? -16.304 57.864 8.271   1.00 129.97 ? 584 TYR A OH  1 
ATOM   3809 N N   . GLY A 1 501 ? -19.972 58.099 0.377   1.00 101.65 ? 585 GLY A N   1 
ATOM   3810 C CA  . GLY A 1 501 ? -20.311 57.882 -1.014  1.00 102.28 ? 585 GLY A CA  1 
ATOM   3811 C C   . GLY A 1 501 ? -21.777 58.050 -1.344  1.00 100.31 ? 585 GLY A C   1 
ATOM   3812 O O   . GLY A 1 501 ? -22.636 57.871 -0.490  1.00 102.22 ? 585 GLY A O   1 
ATOM   3813 N N   . LEU A 1 502 ? -22.054 58.391 -2.598  1.00 96.87  ? 586 LEU A N   1 
ATOM   3814 C CA  . LEU A 1 502 ? -23.412 58.563 -3.092  1.00 96.59  ? 586 LEU A CA  1 
ATOM   3815 C C   . LEU A 1 502 ? -23.497 57.840 -4.433  1.00 98.01  ? 586 LEU A C   1 
ATOM   3816 O O   . LEU A 1 502 ? -22.798 58.202 -5.375  1.00 101.50 ? 586 LEU A O   1 
ATOM   3817 C CB  . LEU A 1 502 ? -23.724 60.054 -3.252  1.00 95.98  ? 586 LEU A CB  1 
ATOM   3818 C CG  . LEU A 1 502 ? -24.977 60.461 -4.035  1.00 95.48  ? 586 LEU A CG  1 
ATOM   3819 C CD1 . LEU A 1 502 ? -26.248 60.203 -3.244  1.00 94.29  ? 586 LEU A CD1 1 
ATOM   3820 C CD2 . LEU A 1 502 ? -24.901 61.914 -4.458  1.00 97.12  ? 586 LEU A CD2 1 
ATOM   3821 N N   . LEU A 1 503 ? -24.331 56.807 -4.517  1.00 95.77  ? 587 LEU A N   1 
ATOM   3822 C CA  . LEU A 1 503 ? -24.334 55.933 -5.690  1.00 96.07  ? 587 LEU A CA  1 
ATOM   3823 C C   . LEU A 1 503 ? -25.736 55.595 -6.191  1.00 97.42  ? 587 LEU A C   1 
ATOM   3824 O O   . LEU A 1 503 ? -26.733 55.800 -5.501  1.00 98.13  ? 587 LEU A O   1 
ATOM   3825 C CB  . LEU A 1 503 ? -23.601 54.628 -5.376  1.00 95.78  ? 587 LEU A CB  1 
ATOM   3826 C CG  . LEU A 1 503 ? -22.248 54.699 -4.672  1.00 94.90  ? 587 LEU A CG  1 
ATOM   3827 C CD1 . LEU A 1 503 ? -21.806 53.310 -4.277  1.00 92.22  ? 587 LEU A CD1 1 
ATOM   3828 C CD2 . LEU A 1 503 ? -21.225 55.356 -5.576  1.00 98.01  ? 587 LEU A CD2 1 
ATOM   3829 N N   . THR A 1 504 ? -25.796 55.063 -7.403  1.00 96.42  ? 588 THR A N   1 
ATOM   3830 C CA  . THR A 1 504 ? -27.039 54.571 -7.966  1.00 95.57  ? 588 THR A CA  1 
ATOM   3831 C C   . THR A 1 504 ? -26.775 53.169 -8.456  1.00 97.53  ? 588 THR A C   1 
ATOM   3832 O O   . THR A 1 504 ? -25.629 52.756 -8.588  1.00 98.52  ? 588 THR A O   1 
ATOM   3833 C CB  . THR A 1 504 ? -27.495 55.446 -9.146  1.00 94.22  ? 588 THR A CB  1 
ATOM   3834 O OG1 . THR A 1 504 ? -27.595 56.794 -8.698  1.00 99.07  ? 588 THR A OG1 1 
ATOM   3835 C CG2 . THR A 1 504 ? -28.860 55.020 -9.693  1.00 96.77  ? 588 THR A CG2 1 
ATOM   3836 N N   . GLU A 1 505 ? -27.836 52.416 -8.696  1.00 99.70  ? 589 GLU A N   1 
ATOM   3837 C CA  . GLU A 1 505 ? -27.705 51.197 -9.456  1.00 99.41  ? 589 GLU A CA  1 
ATOM   3838 C C   . GLU A 1 505 ? -27.149 51.626 -10.794 1.00 96.65  ? 589 GLU A C   1 
ATOM   3839 O O   . GLU A 1 505 ? -27.638 52.607 -11.361 1.00 97.63  ? 589 GLU A O   1 
ATOM   3840 C CB  . GLU A 1 505 ? -29.081 50.594 -9.669  1.00 101.56 ? 589 GLU A CB  1 
ATOM   3841 C CG  . GLU A 1 505 ? -29.064 49.099 -9.866  1.00 100.03 ? 589 GLU A CG  1 
ATOM   3842 C CD  . GLU A 1 505 ? -30.349 48.611 -10.475 1.00 103.16 ? 589 GLU A CD  1 
ATOM   3843 O OE1 . GLU A 1 505 ? -31.425 49.015 -9.983  1.00 103.50 ? 589 GLU A OE1 1 
ATOM   3844 O OE2 . GLU A 1 505 ? -30.283 47.851 -11.465 1.00 105.80 ? 589 GLU A OE2 1 
ATOM   3845 N N   . PRO A 1 506 ? -26.120 50.898 -11.300 1.00 94.92  ? 590 PRO A N   1 
ATOM   3846 C CA  . PRO A 1 506 ? -25.515 51.292 -12.583 1.00 94.14  ? 590 PRO A CA  1 
ATOM   3847 C C   . PRO A 1 506 ? -26.538 51.347 -13.701 1.00 95.13  ? 590 PRO A C   1 
ATOM   3848 O O   . PRO A 1 506 ? -27.484 50.567 -13.685 1.00 97.80  ? 590 PRO A O   1 
ATOM   3849 C CB  . PRO A 1 506 ? -24.510 50.176 -12.864 1.00 88.55  ? 590 PRO A CB  1 
ATOM   3850 C CG  . PRO A 1 506 ? -24.159 49.624 -11.534 1.00 89.13  ? 590 PRO A CG  1 
ATOM   3851 C CD  . PRO A 1 506 ? -25.420 49.740 -10.700 1.00 92.43  ? 590 PRO A CD  1 
ATOM   3852 N N   . GLY A 1 507 ? -26.346 52.250 -14.657 1.00 96.99  ? 591 GLY A N   1 
ATOM   3853 C CA  . GLY A 1 507 ? -27.304 52.449 -15.731 1.00 96.22  ? 591 GLY A CA  1 
ATOM   3854 C C   . GLY A 1 507 ? -28.181 53.640 -15.425 1.00 97.22  ? 591 GLY A C   1 
ATOM   3855 O O   . GLY A 1 507 ? -28.759 54.244 -16.321 1.00 99.84  ? 591 GLY A O   1 
ATOM   3856 N N   . GLU A 1 508 ? -28.275 53.975 -14.145 1.00 96.83  ? 592 GLU A N   1 
ATOM   3857 C CA  . GLU A 1 508 ? -28.913 55.211 -13.728 1.00 99.71  ? 592 GLU A CA  1 
ATOM   3858 C C   . GLU A 1 508 ? -30.340 55.361 -14.269 1.00 100.28 ? 592 GLU A C   1 
ATOM   3859 O O   . GLU A 1 508 ? -30.736 56.439 -14.715 1.00 101.30 ? 592 GLU A O   1 
ATOM   3860 C CB  . GLU A 1 508 ? -28.049 56.402 -14.159 1.00 100.30 ? 592 GLU A CB  1 
ATOM   3861 C CG  . GLU A 1 508 ? -26.589 56.301 -13.719 1.00 100.47 ? 592 GLU A CG  1 
ATOM   3862 C CD  . GLU A 1 508 ? -25.719 55.544 -14.710 1.00 103.02 ? 592 GLU A CD  1 
ATOM   3863 O OE1 . GLU A 1 508 ? -26.056 55.543 -15.913 1.00 107.23 ? 592 GLU A OE1 1 
ATOM   3864 O OE2 . GLU A 1 508 ? -24.698 54.950 -14.289 1.00 98.97  ? 592 GLU A OE2 1 
ATOM   3865 N N   . LYS A 1 509 ? -31.108 54.278 -14.236 1.00 97.50  ? 593 LYS A N   1 
ATOM   3866 C CA  . LYS A 1 509 ? -32.469 54.307 -14.758 1.00 98.10  ? 593 LYS A CA  1 
ATOM   3867 C C   . LYS A 1 509 ? -33.465 54.557 -13.638 1.00 98.59  ? 593 LYS A C   1 
ATOM   3868 O O   . LYS A 1 509 ? -34.498 55.214 -13.832 1.00 99.43  ? 593 LYS A O   1 
ATOM   3869 C CB  . LYS A 1 509 ? -32.807 52.979 -15.421 1.00 98.58  ? 593 LYS A CB  1 
ATOM   3870 C CG  . LYS A 1 509 ? -31.801 52.515 -16.439 1.00 97.08  ? 593 LYS A CG  1 
ATOM   3871 C CD  . LYS A 1 509 ? -31.421 51.082 -16.159 1.00 94.75  ? 593 LYS A CD  1 
ATOM   3872 C CE  . LYS A 1 509 ? -30.737 50.459 -17.353 1.00 99.30  ? 593 LYS A CE  1 
ATOM   3873 N NZ  . LYS A 1 509 ? -30.450 49.012 -17.111 1.00 103.09 ? 593 LYS A NZ  1 
ATOM   3874 N N   . SER A 1 510 ? -33.152 54.011 -12.467 1.00 96.08  ? 594 SER A N   1 
ATOM   3875 C CA  . SER A 1 510 ? -34.008 54.170 -11.304 1.00 94.64  ? 594 SER A CA  1 
ATOM   3876 C C   . SER A 1 510 ? -33.930 55.592 -10.763 1.00 97.21  ? 594 SER A C   1 
ATOM   3877 O O   . SER A 1 510 ? -33.169 56.428 -11.261 1.00 95.93  ? 594 SER A O   1 
ATOM   3878 C CB  . SER A 1 510 ? -33.606 53.201 -10.206 1.00 91.12  ? 594 SER A CB  1 
ATOM   3879 O OG  . SER A 1 510 ? -32.416 53.647 -9.596  1.00 93.91  ? 594 SER A OG  1 
ATOM   3880 N N   . THR A 1 511 ? -34.741 55.865 -9.748  1.00 96.28  ? 595 THR A N   1 
ATOM   3881 C CA  . THR A 1 511 ? -34.690 57.146 -9.070  1.00 92.23  ? 595 THR A CA  1 
ATOM   3882 C C   . THR A 1 511 ? -34.367 56.905 -7.604  1.00 93.46  ? 595 THR A C   1 
ATOM   3883 O O   . THR A 1 511 ? -34.585 57.768 -6.758  1.00 95.48  ? 595 THR A O   1 
ATOM   3884 C CB  . THR A 1 511 ? -35.997 57.938 -9.219  1.00 92.01  ? 595 THR A CB  1 
ATOM   3885 O OG1 . THR A 1 511 ? -37.061 57.233 -8.580  1.00 94.07  ? 595 THR A OG1 1 
ATOM   3886 C CG2 . THR A 1 511 ? -36.337 58.132 -10.682 1.00 94.28  ? 595 THR A CG2 1 
ATOM   3887 N N   . VAL A 1 512 ? -33.844 55.719 -7.314  1.00 93.04  ? 596 VAL A N   1 
ATOM   3888 C CA  . VAL A 1 512 ? -33.334 55.408 -5.983  1.00 95.19  ? 596 VAL A CA  1 
ATOM   3889 C C   . VAL A 1 512 ? -31.845 55.749 -5.901  1.00 94.23  ? 596 VAL A C   1 
ATOM   3890 O O   . VAL A 1 512 ? -31.059 55.396 -6.787  1.00 92.75  ? 596 VAL A O   1 
ATOM   3891 C CB  . VAL A 1 512 ? -33.540 53.911 -5.612  1.00 96.25  ? 596 VAL A CB  1 
ATOM   3892 C CG1 . VAL A 1 512 ? -32.893 53.589 -4.264  1.00 95.79  ? 596 VAL A CG1 1 
ATOM   3893 C CG2 . VAL A 1 512 ? -35.015 53.556 -5.603  1.00 95.71  ? 596 VAL A CG2 1 
ATOM   3894 N N   . PHE A 1 513 ? -31.465 56.443 -4.835  1.00 94.98  ? 597 PHE A N   1 
ATOM   3895 C CA  . PHE A 1 513 ? -30.070 56.792 -4.602  1.00 95.34  ? 597 PHE A CA  1 
ATOM   3896 C C   . PHE A 1 513 ? -29.617 56.245 -3.260  1.00 96.55  ? 597 PHE A C   1 
ATOM   3897 O O   . PHE A 1 513 ? -30.308 56.398 -2.258  1.00 100.96 ? 597 PHE A O   1 
ATOM   3898 C CB  . PHE A 1 513 ? -29.891 58.311 -4.641  1.00 93.99  ? 597 PHE A CB  1 
ATOM   3899 C CG  . PHE A 1 513 ? -30.222 58.920 -5.972  1.00 93.91  ? 597 PHE A CG  1 
ATOM   3900 C CD1 . PHE A 1 513 ? -29.293 58.912 -7.001  1.00 91.81  ? 597 PHE A CD1 1 
ATOM   3901 C CD2 . PHE A 1 513 ? -31.466 59.484 -6.198  1.00 93.83  ? 597 PHE A CD2 1 
ATOM   3902 C CE1 . PHE A 1 513 ? -29.589 59.455 -8.222  1.00 91.94  ? 597 PHE A CE1 1 
ATOM   3903 C CE2 . PHE A 1 513 ? -31.773 60.035 -7.422  1.00 93.64  ? 597 PHE A CE2 1 
ATOM   3904 C CZ  . PHE A 1 513 ? -30.829 60.019 -8.437  1.00 95.07  ? 597 PHE A CZ  1 
ATOM   3905 N N   . THR A 1 514 ? -28.461 55.600 -3.235  1.00 91.74  ? 598 THR A N   1 
ATOM   3906 C CA  . THR A 1 514 ? -27.951 55.062 -1.990  1.00 94.46  ? 598 THR A CA  1 
ATOM   3907 C C   . THR A 1 514 ? -26.925 55.999 -1.375  1.00 99.17  ? 598 THR A C   1 
ATOM   3908 O O   . THR A 1 514 ? -25.941 56.359 -2.018  1.00 101.84 ? 598 THR A O   1 
ATOM   3909 C CB  . THR A 1 514 ? -27.290 53.708 -2.207  1.00 96.68  ? 598 THR A CB  1 
ATOM   3910 O OG1 . THR A 1 514 ? -28.211 52.835 -2.873  1.00 100.04 ? 598 THR A OG1 1 
ATOM   3911 C CG2 . THR A 1 514 ? -26.888 53.105 -0.876  1.00 97.35  ? 598 THR A CG2 1 
ATOM   3912 N N   . ILE A 1 515 ? -27.154 56.395 -0.129  1.00 99.02  ? 599 ILE A N   1 
ATOM   3913 C CA  . ILE A 1 515 ? -26.174 57.179 0.604   1.00 98.16  ? 599 ILE A CA  1 
ATOM   3914 C C   . ILE A 1 515 ? -25.394 56.279 1.548   1.00 99.38  ? 599 ILE A C   1 
ATOM   3915 O O   . ILE A 1 515 ? -25.967 55.698 2.467   1.00 99.81  ? 599 ILE A O   1 
ATOM   3916 C CB  . ILE A 1 515 ? -26.848 58.258 1.446   1.00 99.24  ? 599 ILE A CB  1 
ATOM   3917 C CG1 . ILE A 1 515 ? -27.712 59.163 0.569   1.00 97.05  ? 599 ILE A CG1 1 
ATOM   3918 C CG2 . ILE A 1 515 ? -25.804 59.058 2.206   1.00 101.66 ? 599 ILE A CG2 1 
ATOM   3919 C CD1 . ILE A 1 515 ? -28.416 60.250 1.347   1.00 99.96  ? 599 ILE A CD1 1 
ATOM   3920 N N   . PHE A 1 516 ? -24.093 56.145 1.316   1.00 100.97 ? 600 PHE A N   1 
ATOM   3921 C CA  . PHE A 1 516 ? -23.232 55.433 2.256   1.00 105.19 ? 600 PHE A CA  1 
ATOM   3922 C C   . PHE A 1 516 ? -22.633 56.425 3.221   1.00 107.42 ? 600 PHE A C   1 
ATOM   3923 O O   . PHE A 1 516 ? -22.244 57.517 2.827   1.00 110.22 ? 600 PHE A O   1 
ATOM   3924 C CB  . PHE A 1 516 ? -22.112 54.699 1.537   1.00 103.43 ? 600 PHE A CB  1 
ATOM   3925 C CG  . PHE A 1 516 ? -22.588 53.580 0.689   1.00 102.94 ? 600 PHE A CG  1 
ATOM   3926 C CD1 . PHE A 1 516 ? -23.105 53.827 -0.571  1.00 99.55  ? 600 PHE A CD1 1 
ATOM   3927 C CD2 . PHE A 1 516 ? -22.530 52.278 1.153   1.00 104.17 ? 600 PHE A CD2 1 
ATOM   3928 C CE1 . PHE A 1 516 ? -23.545 52.799 -1.359  1.00 99.45  ? 600 PHE A CE1 1 
ATOM   3929 C CE2 . PHE A 1 516 ? -22.969 51.239 0.371   1.00 103.43 ? 600 PHE A CE2 1 
ATOM   3930 C CZ  . PHE A 1 516 ? -23.480 51.500 -0.891  1.00 102.91 ? 600 PHE A CZ  1 
ATOM   3931 N N   . GLY A 1 517 ? -22.559 56.049 4.489   1.00 109.67 ? 601 GLY A N   1 
ATOM   3932 C CA  . GLY A 1 517 ? -22.026 56.945 5.492   1.00 113.27 ? 601 GLY A CA  1 
ATOM   3933 C C   . GLY A 1 517 ? -21.894 56.267 6.832   1.00 117.33 ? 601 GLY A C   1 
ATOM   3934 O O   . GLY A 1 517 ? -22.118 55.066 6.956   1.00 116.79 ? 601 GLY A O   1 
ATOM   3935 N N   . SER A 1 518 ? -21.517 57.040 7.841   1.00 122.35 ? 602 SER A N   1 
ATOM   3936 C CA  . SER A 1 518 ? -21.442 56.521 9.195   1.00 126.77 ? 602 SER A CA  1 
ATOM   3937 C C   . SER A 1 518 ? -22.033 57.511 10.172  1.00 130.17 ? 602 SER A C   1 
ATOM   3938 O O   . SER A 1 518 ? -21.943 58.722 9.972   1.00 128.16 ? 602 SER A O   1 
ATOM   3939 C CB  . SER A 1 518 ? -19.996 56.229 9.587   1.00 129.32 ? 602 SER A CB  1 
ATOM   3940 O OG  . SER A 1 518 ? -19.914 55.923 10.968  1.00 132.50 ? 602 SER A OG  1 
ATOM   3941 N N   . ASN A 1 519 ? -22.632 56.992 11.238  1.00 135.00 ? 603 ASN A N   1 
ATOM   3942 C CA  . ASN A 1 519 ? -23.130 57.855 12.295  1.00 139.34 ? 603 ASN A CA  1 
ATOM   3943 C C   . ASN A 1 519 ? -21.961 58.572 12.971  1.00 145.31 ? 603 ASN A C   1 
ATOM   3944 O O   . ASN A 1 519 ? -20.809 58.139 12.870  1.00 146.77 ? 603 ASN A O   1 
ATOM   3945 C CB  . ASN A 1 519 ? -23.992 57.070 13.307  1.00 142.98 ? 603 ASN A CB  1 
ATOM   3946 C CG  . ASN A 1 519 ? -23.166 56.220 14.285  1.00 149.07 ? 603 ASN A CG  1 
ATOM   3947 O OD1 . ASN A 1 519 ? -22.019 55.854 14.011  1.00 145.96 ? 603 ASN A OD1 1 
ATOM   3948 N ND2 . ASN A 1 519 ? -23.765 55.897 15.432  1.00 149.22 ? 603 ASN A ND2 1 
ATOM   3949 N N   . LYS A 1 520 ? -22.254 59.674 13.651  1.00 150.24 ? 604 LYS A N   1 
ATOM   3950 C CA  . LYS A 1 520 ? -21.267 60.331 14.502  1.00 155.82 ? 604 LYS A CA  1 
ATOM   3951 C C   . LYS A 1 520 ? -20.921 59.337 15.611  1.00 157.58 ? 604 LYS A C   1 
ATOM   3952 O O   . LYS A 1 520 ? -21.562 58.288 15.704  1.00 155.13 ? 604 LYS A O   1 
ATOM   3953 C CB  . LYS A 1 520 ? -21.852 61.613 15.097  1.00 156.76 ? 604 LYS A CB  1 
ATOM   3954 C CG  . LYS A 1 520 ? -20.808 62.597 15.582  1.00 158.20 ? 604 LYS A CG  1 
ATOM   3955 C CD  . LYS A 1 520 ? -21.444 63.756 16.322  1.00 158.47 ? 604 LYS A CD  1 
ATOM   3956 C CE  . LYS A 1 520 ? -20.386 64.572 17.037  1.00 158.20 ? 604 LYS A CE  1 
ATOM   3957 N NZ  . LYS A 1 520 ? -20.930 65.829 17.615  1.00 157.51 ? 604 LYS A NZ  1 
ATOM   3958 N N   . GLU A 1 521 ? -19.927 59.642 16.447  1.00 160.12 ? 605 GLU A N   1 
ATOM   3959 C CA  . GLU A 1 521 ? -19.530 58.696 17.499  1.00 162.08 ? 605 GLU A CA  1 
ATOM   3960 C C   . GLU A 1 521 ? -20.720 58.142 18.292  1.00 161.39 ? 605 GLU A C   1 
ATOM   3961 O O   . GLU A 1 521 ? -21.654 58.885 18.592  1.00 158.50 ? 605 GLU A O   1 
ATOM   3962 C CB  . GLU A 1 521 ? -18.461 59.258 18.446  1.00 162.78 ? 605 GLU A CB  1 
ATOM   3963 C CG  . GLU A 1 521 ? -18.957 60.307 19.410  1.00 164.77 ? 605 GLU A CG  1 
ATOM   3964 C CD  . GLU A 1 521 ? -19.125 61.655 18.746  1.00 165.97 ? 605 GLU A CD  1 
ATOM   3965 O OE1 . GLU A 1 521 ? -18.738 61.788 17.565  1.00 165.81 ? 605 GLU A OE1 1 
ATOM   3966 O OE2 . GLU A 1 521 ? -19.629 62.585 19.407  1.00 165.57 ? 605 GLU A OE2 1 
ATOM   3967 N N   . ASN A 1 522 ? -20.709 56.842 18.603  1.00 163.26 ? 606 ASN A N   1 
ATOM   3968 C CA  . ASN A 1 522 ? -19.603 55.921 18.291  1.00 163.47 ? 606 ASN A CA  1 
ATOM   3969 C C   . ASN A 1 522 ? -19.244 55.804 16.800  1.00 159.18 ? 606 ASN A C   1 
ATOM   3970 O O   . ASN A 1 522 ? -20.101 55.530 15.952  1.00 155.06 ? 606 ASN A O   1 
ATOM   3971 C CB  . ASN A 1 522 ? -19.857 54.536 18.904  1.00 166.08 ? 606 ASN A CB  1 
ATOM   3972 C CG  . ASN A 1 522 ? -19.548 54.484 20.401  1.00 167.78 ? 606 ASN A CG  1 
ATOM   3973 O OD1 . ASN A 1 522 ? -19.999 55.330 21.178  1.00 167.88 ? 606 ASN A OD1 1 
ATOM   3974 N ND2 . ASN A 1 522 ? -18.768 53.485 20.807  1.00 164.76 ? 606 ASN A ND2 1 
ATOM   3975 N N   . VAL A 1 523 ? -17.970 56.065 16.509  1.00 157.66 ? 607 VAL A N   1 
ATOM   3976 C CA  . VAL A 1 523 ? -17.526 56.351 15.150  1.00 151.97 ? 607 VAL A CA  1 
ATOM   3977 C C   . VAL A 1 523 ? -17.444 55.122 14.266  1.00 144.70 ? 607 VAL A C   1 
ATOM   3978 O O   . VAL A 1 523 ? -17.297 53.990 14.734  1.00 140.60 ? 607 VAL A O   1 
ATOM   3979 C CB  . VAL A 1 523 ? -16.158 57.080 15.116  1.00 152.56 ? 607 VAL A CB  1 
ATOM   3980 C CG1 . VAL A 1 523 ? -16.008 57.874 13.816  1.00 147.59 ? 607 VAL A CG1 1 
ATOM   3981 C CG2 . VAL A 1 523 ? -16.012 57.999 16.309  1.00 153.72 ? 607 VAL A CG2 1 
ATOM   3982 N N   . HIS A 1 524 ? -17.557 55.376 12.973  1.00 143.43 ? 608 HIS A N   1 
ATOM   3983 C CA  . HIS A 1 524 ? -17.407 54.355 11.957  1.00 138.03 ? 608 HIS A CA  1 
ATOM   3984 C C   . HIS A 1 524 ? -18.268 53.098 12.161  1.00 132.96 ? 608 HIS A C   1 
ATOM   3985 O O   . HIS A 1 524 ? -17.771 51.970 12.180  1.00 130.31 ? 608 HIS A O   1 
ATOM   3986 C CB  . HIS A 1 524 ? -15.938 53.992 11.757  1.00 135.46 ? 608 HIS A CB  1 
ATOM   3987 C CG  . HIS A 1 524 ? -15.732 52.975 10.684  1.00 133.73 ? 608 HIS A CG  1 
ATOM   3988 N ND1 . HIS A 1 524 ? -16.423 53.007 9.493   1.00 128.69 ? 608 HIS A ND1 1 
ATOM   3989 C CD2 . HIS A 1 524 ? -14.972 51.853 10.652  1.00 132.49 ? 608 HIS A CD2 1 
ATOM   3990 C CE1 . HIS A 1 524 ? -16.059 51.980 8.750   1.00 128.24 ? 608 HIS A CE1 1 
ATOM   3991 N NE2 . HIS A 1 524 ? -15.180 51.262 9.427   1.00 130.26 ? 608 HIS A NE2 1 
ATOM   3992 N N   . SER A 1 525 ? -19.567 53.298 12.318  1.00 129.79 ? 609 SER A N   1 
ATOM   3993 C CA  . SER A 1 525 ? -20.493 52.204 12.121  1.00 125.12 ? 609 SER A CA  1 
ATOM   3994 C C   . SER A 1 525 ? -21.144 52.451 10.774  1.00 124.20 ? 609 SER A C   1 
ATOM   3995 O O   . SER A 1 525 ? -21.830 53.460 10.597  1.00 127.20 ? 609 SER A O   1 
ATOM   3996 C CB  . SER A 1 525 ? -21.542 52.159 13.227  1.00 126.83 ? 609 SER A CB  1 
ATOM   3997 O OG  . SER A 1 525 ? -22.643 51.354 12.841  1.00 122.47 ? 609 SER A OG  1 
ATOM   3998 N N   . TRP A 1 526 ? -20.900 51.551 9.820   1.00 120.52 ? 610 TRP A N   1 
ATOM   3999 C CA  . TRP A 1 526 ? -21.454 51.674 8.471   1.00 117.32 ? 610 TRP A CA  1 
ATOM   4000 C C   . TRP A 1 526 ? -22.954 51.930 8.501   1.00 115.69 ? 610 TRP A C   1 
ATOM   4001 O O   . TRP A 1 526 ? -23.663 51.413 9.364   1.00 115.68 ? 610 TRP A O   1 
ATOM   4002 C CB  . TRP A 1 526 ? -21.174 50.421 7.632   1.00 116.29 ? 610 TRP A CB  1 
ATOM   4003 C CG  . TRP A 1 526 ? -19.857 50.433 6.928   1.00 114.64 ? 610 TRP A CG  1 
ATOM   4004 C CD1 . TRP A 1 526 ? -18.808 49.590 7.143   1.00 116.53 ? 610 TRP A CD1 1 
ATOM   4005 C CD2 . TRP A 1 526 ? -19.443 51.334 5.894   1.00 115.44 ? 610 TRP A CD2 1 
ATOM   4006 N NE1 . TRP A 1 526 ? -17.765 49.909 6.307   1.00 118.08 ? 610 TRP A NE1 1 
ATOM   4007 C CE2 . TRP A 1 526 ? -18.129 50.978 5.531   1.00 116.14 ? 610 TRP A CE2 1 
ATOM   4008 C CE3 . TRP A 1 526 ? -20.055 52.406 5.240   1.00 115.04 ? 610 TRP A CE3 1 
ATOM   4009 C CZ2 . TRP A 1 526 ? -17.416 51.656 4.548   1.00 113.80 ? 610 TRP A CZ2 1 
ATOM   4010 C CZ3 . TRP A 1 526 ? -19.343 53.078 4.261   1.00 114.62 ? 610 TRP A CZ3 1 
ATOM   4011 C CH2 . TRP A 1 526 ? -18.039 52.699 3.926   1.00 113.41 ? 610 TRP A CH2 1 
ATOM   4012 N N   . LEU A 1 527 ? -23.426 52.720 7.542   1.00 113.97 ? 611 LEU A N   1 
ATOM   4013 C CA  . LEU A 1 527 ? -24.818 53.146 7.495   1.00 110.65 ? 611 LEU A CA  1 
ATOM   4014 C C   . LEU A 1 527 ? -25.265 53.238 6.033   1.00 108.22 ? 611 LEU A C   1 
ATOM   4015 O O   . LEU A 1 527 ? -24.614 53.892 5.217   1.00 107.82 ? 611 LEU A O   1 
ATOM   4016 C CB  . LEU A 1 527 ? -24.952 54.502 8.196   1.00 112.78 ? 611 LEU A CB  1 
ATOM   4017 C CG  . LEU A 1 527 ? -26.310 55.113 8.537   1.00 109.95 ? 611 LEU A CG  1 
ATOM   4018 C CD1 . LEU A 1 527 ? -27.033 54.265 9.552   1.00 109.07 ? 611 LEU A CD1 1 
ATOM   4019 C CD2 . LEU A 1 527 ? -26.112 56.521 9.073   1.00 116.30 ? 611 LEU A CD2 1 
ATOM   4020 N N   . ILE A 1 528 ? -26.362 52.568 5.693   1.00 105.27 ? 612 ILE A N   1 
ATOM   4021 C CA  . ILE A 1 528 ? -26.833 52.574 4.312   1.00 102.04 ? 612 ILE A CA  1 
ATOM   4022 C C   . ILE A 1 528 ? -28.241 53.135 4.163   1.00 103.34 ? 612 ILE A C   1 
ATOM   4023 O O   . ILE A 1 528 ? -29.236 52.456 4.441   1.00 102.94 ? 612 ILE A O   1 
ATOM   4024 C CB  . ILE A 1 528 ? -26.764 51.182 3.682   1.00 99.23  ? 612 ILE A CB  1 
ATOM   4025 C CG1 . ILE A 1 528 ? -25.339 50.642 3.778   1.00 99.23  ? 612 ILE A CG1 1 
ATOM   4026 C CG2 . ILE A 1 528 ? -27.243 51.230 2.236   1.00 95.51  ? 612 ILE A CG2 1 
ATOM   4027 C CD1 . ILE A 1 528 ? -25.107 49.393 2.977   1.00 99.42  ? 612 ILE A CD1 1 
ATOM   4028 N N   . LEU A 1 529 ? -28.312 54.383 3.711   1.00 103.38 ? 613 LEU A N   1 
ATOM   4029 C CA  . LEU A 1 529 ? -29.585 55.072 3.547   1.00 101.54 ? 613 LEU A CA  1 
ATOM   4030 C C   . LEU A 1 529 ? -30.063 54.942 2.116   1.00 100.52 ? 613 LEU A C   1 
ATOM   4031 O O   . LEU A 1 529 ? -29.306 55.154 1.170   1.00 99.76  ? 613 LEU A O   1 
ATOM   4032 C CB  . LEU A 1 529 ? -29.455 56.539 3.941   1.00 100.75 ? 613 LEU A CB  1 
ATOM   4033 C CG  . LEU A 1 529 ? -29.046 56.727 5.401   1.00 101.83 ? 613 LEU A CG  1 
ATOM   4034 C CD1 . LEU A 1 529 ? -28.552 58.137 5.666   1.00 103.87 ? 613 LEU A CD1 1 
ATOM   4035 C CD2 . LEU A 1 529 ? -30.223 56.390 6.286   1.00 105.56 ? 613 LEU A CD2 1 
ATOM   4036 N N   . GLN A 1 530 ? -31.325 54.569 1.969   1.00 102.13 ? 614 GLN A N   1 
ATOM   4037 C CA  . GLN A 1 530 ? -31.891 54.322 0.662   1.00 100.74 ? 614 GLN A CA  1 
ATOM   4038 C C   . GLN A 1 530 ? -32.919 55.393 0.395   1.00 100.61 ? 614 GLN A C   1 
ATOM   4039 O O   . GLN A 1 530 ? -34.001 55.375 0.961   1.00 103.78 ? 614 GLN A O   1 
ATOM   4040 C CB  . GLN A 1 530 ? -32.517 52.928 0.610   1.00 102.65 ? 614 GLN A CB  1 
ATOM   4041 C CG  . GLN A 1 530 ? -32.672 52.363 -0.796  1.00 103.75 ? 614 GLN A CG  1 
ATOM   4042 C CD  . GLN A 1 530 ? -31.341 52.008 -1.446  1.00 102.88 ? 614 GLN A CD  1 
ATOM   4043 O OE1 . GLN A 1 530 ? -30.282 52.470 -1.022  1.00 103.02 ? 614 GLN A OE1 1 
ATOM   4044 N NE2 . GLN A 1 530 ? -31.392 51.178 -2.485  1.00 104.42 ? 614 GLN A NE2 1 
ATOM   4045 N N   . VAL A 1 531 ? -32.560 56.339 -0.460  1.00 99.61  ? 615 VAL A N   1 
ATOM   4046 C CA  . VAL A 1 531 ? -33.384 57.511 -0.724  1.00 99.42  ? 615 VAL A CA  1 
ATOM   4047 C C   . VAL A 1 531 ? -34.168 57.335 -2.024  1.00 98.49  ? 615 VAL A C   1 
ATOM   4048 O O   . VAL A 1 531 ? -33.625 56.869 -3.020  1.00 100.34 ? 615 VAL A O   1 
ATOM   4049 C CB  . VAL A 1 531 ? -32.493 58.768 -0.795  1.00 101.13 ? 615 VAL A CB  1 
ATOM   4050 C CG1 . VAL A 1 531 ? -33.195 59.902 -1.495  1.00 101.20 ? 615 VAL A CG1 1 
ATOM   4051 C CG2 . VAL A 1 531 ? -32.043 59.181 0.601   1.00 103.33 ? 615 VAL A CG2 1 
ATOM   4052 N N   . ASN A 1 532 ? -35.442 57.703 -2.016  1.00 98.77  ? 616 ASN A N   1 
ATOM   4053 C CA  . ASN A 1 532 ? -36.314 57.450 -3.153  1.00 97.02  ? 616 ASN A CA  1 
ATOM   4054 C C   . ASN A 1 532 ? -36.901 58.739 -3.676  1.00 100.07 ? 616 ASN A C   1 
ATOM   4055 O O   . ASN A 1 532 ? -37.774 59.330 -3.035  1.00 102.67 ? 616 ASN A O   1 
ATOM   4056 C CB  . ASN A 1 532 ? -37.454 56.534 -2.714  1.00 102.52 ? 616 ASN A CB  1 
ATOM   4057 C CG  . ASN A 1 532 ? -38.277 55.997 -3.880  1.00 106.31 ? 616 ASN A CG  1 
ATOM   4058 O OD1 . ASN A 1 532 ? -38.291 56.561 -4.981  1.00 101.97 ? 616 ASN A OD1 1 
ATOM   4059 N ND2 . ASN A 1 532 ? -38.995 54.901 -3.633  1.00 109.98 ? 616 ASN A ND2 1 
ATOM   4060 N N   . ALA A 1 533 ? -36.467 59.147 -4.865  1.00 97.68  ? 617 ALA A N   1 
ATOM   4061 C CA  . ALA A 1 533 ? -36.758 60.491 -5.348  1.00 97.96  ? 617 ALA A CA  1 
ATOM   4062 C C   . ALA A 1 533 ? -37.744 60.601 -6.511  1.00 97.37  ? 617 ALA A C   1 
ATOM   4063 O O   . ALA A 1 533 ? -37.746 61.608 -7.210  1.00 98.17  ? 617 ALA A O   1 
ATOM   4064 C CB  . ALA A 1 533 ? -35.453 61.223 -5.678  1.00 94.94  ? 617 ALA A CB  1 
ATOM   4065 N N   . THR A 1 534 ? -38.599 59.601 -6.705  1.00 100.48 ? 618 THR A N   1 
ATOM   4066 C CA  . THR A 1 534 ? -39.523 59.627 -7.845  1.00 102.07 ? 618 THR A CA  1 
ATOM   4067 C C   . THR A 1 534 ? -40.434 60.850 -7.814  1.00 99.75  ? 618 THR A C   1 
ATOM   4068 O O   . THR A 1 534 ? -40.685 61.466 -8.850  1.00 98.95  ? 618 THR A O   1 
ATOM   4069 C CB  . THR A 1 534 ? -40.417 58.361 -7.934  1.00 101.32 ? 618 THR A CB  1 
ATOM   4070 O OG1 . THR A 1 534 ? -39.624 57.179 -7.781  1.00 99.10  ? 618 THR A OG1 1 
ATOM   4071 C CG2 . THR A 1 534 ? -41.124 58.308 -9.272  1.00 97.89  ? 618 THR A CG2 1 
ATOM   4072 N N   . ASP A 1 535 ? -40.910 61.202 -6.621  1.00 101.55 ? 619 ASP A N   1 
ATOM   4073 C CA  . ASP A 1 535 ? -41.889 62.282 -6.466  1.00 103.14 ? 619 ASP A CA  1 
ATOM   4074 C C   . ASP A 1 535 ? -41.330 63.678 -6.742  1.00 100.82 ? 619 ASP A C   1 
ATOM   4075 O O   . ASP A 1 535 ? -42.082 64.647 -6.801  1.00 99.46  ? 619 ASP A O   1 
ATOM   4076 C CB  . ASP A 1 535 ? -42.546 62.237 -5.080  1.00 107.27 ? 619 ASP A CB  1 
ATOM   4077 C CG  . ASP A 1 535 ? -43.547 61.109 -4.949  1.00 108.74 ? 619 ASP A CG  1 
ATOM   4078 O OD1 . ASP A 1 535 ? -44.030 60.636 -5.999  1.00 107.59 ? 619 ASP A OD1 1 
ATOM   4079 O OD2 . ASP A 1 535 ? -43.851 60.700 -3.805  1.00 113.96 ? 619 ASP A OD2 1 
ATOM   4080 N N   . ALA A 1 536 ? -40.015 63.785 -6.898  1.00 100.70 ? 620 ALA A N   1 
ATOM   4081 C CA  . ALA A 1 536 ? -39.423 65.031 -7.369  1.00 98.77  ? 620 ALA A CA  1 
ATOM   4082 C C   . ALA A 1 536 ? -39.731 65.192 -8.854  1.00 99.26  ? 620 ALA A C   1 
ATOM   4083 O O   . ALA A 1 536 ? -39.978 66.302 -9.330  1.00 99.04  ? 620 ALA A O   1 
ATOM   4084 C CB  . ALA A 1 536 ? -37.918 65.049 -7.128  1.00 96.23  ? 620 ALA A CB  1 
ATOM   4085 N N   . LEU A 1 537 ? -39.713 64.070 -9.575  1.00 99.66  ? 621 LEU A N   1 
ATOM   4086 C CA  . LEU A 1 537 ? -40.017 64.032 -11.008 1.00 98.57  ? 621 LEU A CA  1 
ATOM   4087 C C   . LEU A 1 537 ? -41.532 64.057 -11.208 1.00 99.59  ? 621 LEU A C   1 
ATOM   4088 O O   . LEU A 1 537 ? -42.051 64.702 -12.120 1.00 97.76  ? 621 LEU A O   1 
ATOM   4089 C CB  . LEU A 1 537 ? -39.398 62.796 -11.678 1.00 98.63  ? 621 LEU A CB  1 
ATOM   4090 C CG  . LEU A 1 537 ? -37.912 62.863 -12.070 1.00 96.94  ? 621 LEU A CG  1 
ATOM   4091 C CD1 . LEU A 1 537 ? -37.090 63.266 -10.865 1.00 99.52  ? 621 LEU A CD1 1 
ATOM   4092 C CD2 . LEU A 1 537 ? -37.380 61.549 -12.658 1.00 98.95  ? 621 LEU A CD2 1 
ATOM   4093 N N   . GLY A 1 538 ? -42.239 63.349 -10.339 1.00 100.07 ? 622 GLY A N   1 
ATOM   4094 C CA  . GLY A 1 538 ? -43.683 63.439 -10.291 1.00 101.03 ? 622 GLY A CA  1 
ATOM   4095 C C   . GLY A 1 538 ? -44.470 62.615 -11.290 1.00 100.62 ? 622 GLY A C   1 
ATOM   4096 O O   . GLY A 1 538 ? -45.236 61.745 -10.896 1.00 100.89 ? 622 GLY A O   1 
ATOM   4097 N N   . VAL A 1 539 ? -44.307 62.894 -12.580 1.00 99.94  ? 623 VAL A N   1 
ATOM   4098 C CA  . VAL A 1 539 ? -45.209 62.339 -13.586 1.00 100.22 ? 623 VAL A CA  1 
ATOM   4099 C C   . VAL A 1 539 ? -44.475 61.693 -14.763 1.00 102.69 ? 623 VAL A C   1 
ATOM   4100 O O   . VAL A 1 539 ? -43.344 62.061 -15.066 1.00 105.73 ? 623 VAL A O   1 
ATOM   4101 C CB  . VAL A 1 539 ? -46.153 63.437 -14.126 1.00 102.07 ? 623 VAL A CB  1 
ATOM   4102 C CG1 . VAL A 1 539 ? -46.832 64.161 -12.978 1.00 103.04 ? 623 VAL A CG1 1 
ATOM   4103 C CG2 . VAL A 1 539 ? -45.386 64.423 -14.991 1.00 102.00 ? 623 VAL A CG2 1 
ATOM   4104 N N   . PRO A 1 540 ? -45.116 60.729 -15.447 1.00 102.88 ? 624 PRO A N   1 
ATOM   4105 C CA  . PRO A 1 540 ? -44.420 60.154 -16.600 1.00 104.54 ? 624 PRO A CA  1 
ATOM   4106 C C   . PRO A 1 540 ? -44.331 61.167 -17.744 1.00 105.67 ? 624 PRO A C   1 
ATOM   4107 O O   . PRO A 1 540 ? -45.306 61.867 -18.033 1.00 105.58 ? 624 PRO A O   1 
ATOM   4108 C CB  . PRO A 1 540 ? -45.318 58.980 -16.990 1.00 100.97 ? 624 PRO A CB  1 
ATOM   4109 C CG  . PRO A 1 540 ? -46.656 59.397 -16.568 1.00 97.83  ? 624 PRO A CG  1 
ATOM   4110 C CD  . PRO A 1 540 ? -46.475 60.182 -15.307 1.00 101.58 ? 624 PRO A CD  1 
ATOM   4111 N N   . CYS A 1 541 ? -43.161 61.250 -18.369 1.00 104.96 ? 625 CYS A N   1 
ATOM   4112 C CA  . CYS A 1 541 ? -42.950 62.177 -19.473 1.00 107.08 ? 625 CYS A CA  1 
ATOM   4113 C C   . CYS A 1 541 ? -43.797 61.795 -20.682 1.00 108.85 ? 625 CYS A C   1 
ATOM   4114 O O   . CYS A 1 541 ? -44.104 60.620 -20.900 1.00 108.91 ? 625 CYS A O   1 
ATOM   4115 C CB  . CYS A 1 541 ? -41.469 62.229 -19.860 1.00 107.05 ? 625 CYS A CB  1 
ATOM   4116 S SG  . CYS A 1 541 ? -40.385 62.948 -18.598 1.00 104.32 ? 625 CYS A SG  1 
ATOM   4117 N N   . THR A 1 542 ? -44.184 62.805 -21.454 1.00 109.46 ? 626 THR A N   1 
ATOM   4118 C CA  . THR A 1 542 ? -44.881 62.594 -22.713 1.00 109.42 ? 626 THR A CA  1 
ATOM   4119 C C   . THR A 1 542 ? -43.972 63.136 -23.804 1.00 113.03 ? 626 THR A C   1 
ATOM   4120 O O   . THR A 1 542 ? -42.896 63.654 -23.503 1.00 113.84 ? 626 THR A O   1 
ATOM   4121 C CB  . THR A 1 542 ? -46.240 63.320 -22.737 1.00 108.31 ? 626 THR A CB  1 
ATOM   4122 O OG1 . THR A 1 542 ? -46.057 64.707 -23.061 1.00 107.37 ? 626 THR A OG1 1 
ATOM   4123 C CG2 . THR A 1 542 ? -46.928 63.196 -21.386 1.00 104.84 ? 626 THR A CG2 1 
ATOM   4124 N N   . GLU A 1 543 ? -44.391 63.026 -25.060 1.00 113.51 ? 627 GLU A N   1 
ATOM   4125 C CA  . GLU A 1 543 ? -43.560 63.479 -26.175 1.00 114.08 ? 627 GLU A CA  1 
ATOM   4126 C C   . GLU A 1 543 ? -43.295 64.985 -26.135 1.00 114.12 ? 627 GLU A C   1 
ATOM   4127 O O   . GLU A 1 543 ? -42.298 65.457 -26.684 1.00 115.11 ? 627 GLU A O   1 
ATOM   4128 C CB  . GLU A 1 543 ? -44.187 63.086 -27.514 1.00 117.73 ? 627 GLU A CB  1 
ATOM   4129 C CG  . GLU A 1 543 ? -44.499 61.601 -27.634 1.00 124.20 ? 627 GLU A CG  1 
ATOM   4130 C CD  . GLU A 1 543 ? -43.261 60.726 -27.501 1.00 126.11 ? 627 GLU A CD  1 
ATOM   4131 O OE1 . GLU A 1 543 ? -42.222 61.061 -28.109 1.00 127.79 ? 627 GLU A OE1 1 
ATOM   4132 O OE2 . GLU A 1 543 ? -43.324 59.702 -26.786 1.00 129.66 ? 627 GLU A OE2 1 
ATOM   4133 N N   . ASN A 1 544 ? -44.188 65.725 -25.476 1.00 114.16 ? 628 ASN A N   1 
ATOM   4134 C CA  . ASN A 1 544 ? -44.062 67.178 -25.321 1.00 114.10 ? 628 ASN A CA  1 
ATOM   4135 C C   . ASN A 1 544 ? -42.795 67.617 -24.612 1.00 113.24 ? 628 ASN A C   1 
ATOM   4136 O O   . ASN A 1 544 ? -42.383 68.773 -24.722 1.00 111.89 ? 628 ASN A O   1 
ATOM   4137 C CB  . ASN A 1 544 ? -45.246 67.733 -24.537 1.00 114.38 ? 628 ASN A CB  1 
ATOM   4138 C CG  . ASN A 1 544 ? -46.454 67.960 -25.399 1.00 117.48 ? 628 ASN A CG  1 
ATOM   4139 O OD1 . ASN A 1 544 ? -46.335 68.194 -26.602 1.00 120.68 ? 628 ASN A OD1 1 
ATOM   4140 N ND2 . ASN A 1 544 ? -47.632 67.903 -24.789 1.00 116.60 ? 628 ASN A ND2 1 
ATOM   4141 N N   . ASP A 1 545 ? -42.201 66.695 -23.864 1.00 111.75 ? 629 ASP A N   1 
ATOM   4142 C CA  . ASP A 1 545 ? -41.015 66.985 -23.082 1.00 110.61 ? 629 ASP A CA  1 
ATOM   4143 C C   . ASP A 1 545 ? -39.781 66.391 -23.747 1.00 112.45 ? 629 ASP A C   1 
ATOM   4144 O O   . ASP A 1 545 ? -38.786 66.108 -23.081 1.00 113.16 ? 629 ASP A O   1 
ATOM   4145 C CB  . ASP A 1 545 ? -41.163 66.399 -21.683 1.00 110.27 ? 629 ASP A CB  1 
ATOM   4146 C CG  . ASP A 1 545 ? -42.586 66.458 -21.179 1.00 112.59 ? 629 ASP A CG  1 
ATOM   4147 O OD1 . ASP A 1 545 ? -43.259 67.490 -21.423 1.00 113.78 ? 629 ASP A OD1 1 
ATOM   4148 O OD2 . ASP A 1 545 ? -43.031 65.467 -20.550 1.00 110.53 ? 629 ASP A OD2 1 
ATOM   4149 N N   . TYR A 1 546 ? -39.841 66.184 -25.056 1.00 111.93 ? 630 TYR A N   1 
ATOM   4150 C CA  . TYR A 1 546 ? -38.683 65.650 -25.752 1.00 112.41 ? 630 TYR A CA  1 
ATOM   4151 C C   . TYR A 1 546 ? -38.282 66.496 -26.947 1.00 115.17 ? 630 TYR A C   1 
ATOM   4152 O O   . TYR A 1 546 ? -39.124 67.051 -27.655 1.00 115.08 ? 630 TYR A O   1 
ATOM   4153 C CB  . TYR A 1 546 ? -38.899 64.194 -26.168 1.00 113.39 ? 630 TYR A CB  1 
ATOM   4154 C CG  . TYR A 1 546 ? -38.831 63.210 -25.022 1.00 111.67 ? 630 TYR A CG  1 
ATOM   4155 C CD1 . TYR A 1 546 ? -37.610 62.764 -24.532 1.00 111.95 ? 630 TYR A CD1 1 
ATOM   4156 C CD2 . TYR A 1 546 ? -39.989 62.722 -24.437 1.00 112.42 ? 630 TYR A CD2 1 
ATOM   4157 C CE1 . TYR A 1 546 ? -37.549 61.859 -23.489 1.00 112.00 ? 630 TYR A CE1 1 
ATOM   4158 C CE2 . TYR A 1 546 ? -39.941 61.823 -23.395 1.00 110.14 ? 630 TYR A CE2 1 
ATOM   4159 C CZ  . TYR A 1 546 ? -38.723 61.392 -22.926 1.00 111.92 ? 630 TYR A CZ  1 
ATOM   4160 O OH  . TYR A 1 546 ? -38.689 60.493 -21.889 1.00 109.74 ? 630 TYR A OH  1 
ATOM   4161 N N   . LYS A 1 547 ? -36.972 66.579 -27.147 1.00 117.22 ? 631 LYS A N   1 
ATOM   4162 C CA  . LYS A 1 547 ? -36.373 67.336 -28.229 1.00 118.36 ? 631 LYS A CA  1 
ATOM   4163 C C   . LYS A 1 547 ? -35.365 66.422 -28.906 1.00 122.62 ? 631 LYS A C   1 
ATOM   4164 O O   . LYS A 1 547 ? -34.911 65.445 -28.305 1.00 122.70 ? 631 LYS A O   1 
ATOM   4165 C CB  . LYS A 1 547 ? -35.662 68.565 -27.661 1.00 117.62 ? 631 LYS A CB  1 
ATOM   4166 C CG  . LYS A 1 547 ? -35.069 69.492 -28.710 1.00 125.02 ? 631 LYS A CG  1 
ATOM   4167 C CD  . LYS A 1 547 ? -34.549 70.785 -28.098 1.00 125.56 ? 631 LYS A CD  1 
ATOM   4168 C CE  . LYS A 1 547 ? -34.024 71.717 -29.177 1.00 127.12 ? 631 LYS A CE  1 
ATOM   4169 N NZ  . LYS A 1 547 ? -33.635 73.045 -28.630 1.00 130.87 ? 631 LYS A NZ  1 
ATOM   4170 N N   . LEU A 1 548 ? -35.026 66.711 -30.158 1.00 123.75 ? 632 LEU A N   1 
ATOM   4171 C CA  . LEU A 1 548 ? -33.927 66.008 -30.801 1.00 121.91 ? 632 LEU A CA  1 
ATOM   4172 C C   . LEU A 1 548 ? -32.656 66.815 -30.629 1.00 124.64 ? 632 LEU A C   1 
ATOM   4173 O O   . LEU A 1 548 ? -32.683 68.046 -30.642 1.00 127.69 ? 632 LEU A O   1 
ATOM   4174 C CB  . LEU A 1 548 ? -34.221 65.747 -32.273 1.00 119.58 ? 632 LEU A CB  1 
ATOM   4175 C CG  . LEU A 1 548 ? -35.206 64.599 -32.481 1.00 121.45 ? 632 LEU A CG  1 
ATOM   4176 C CD1 . LEU A 1 548 ? -35.341 64.270 -33.953 1.00 121.50 ? 632 LEU A CD1 1 
ATOM   4177 C CD2 . LEU A 1 548 ? -34.774 63.368 -31.688 1.00 122.15 ? 632 LEU A CD2 1 
ATOM   4178 N N   . TRP A 1 549 ? -31.542 66.120 -30.455 1.00 126.24 ? 633 TRP A N   1 
ATOM   4179 C CA  . TRP A 1 549 ? -30.293 66.796 -30.156 1.00 128.92 ? 633 TRP A CA  1 
ATOM   4180 C C   . TRP A 1 549 ? -29.078 65.978 -30.560 1.00 131.88 ? 633 TRP A C   1 
ATOM   4181 O O   . TRP A 1 549 ? -28.981 64.788 -30.258 1.00 130.71 ? 633 TRP A O   1 
ATOM   4182 C CB  . TRP A 1 549 ? -30.232 67.118 -28.671 1.00 126.71 ? 633 TRP A CB  1 
ATOM   4183 C CG  . TRP A 1 549 ? -28.966 67.759 -28.240 1.00 128.78 ? 633 TRP A CG  1 
ATOM   4184 C CD1 . TRP A 1 549 ? -28.698 69.093 -28.208 1.00 131.45 ? 633 TRP A CD1 1 
ATOM   4185 C CD2 . TRP A 1 549 ? -27.791 67.100 -27.753 1.00 128.21 ? 633 TRP A CD2 1 
ATOM   4186 N NE1 . TRP A 1 549 ? -27.426 69.307 -27.735 1.00 132.33 ? 633 TRP A NE1 1 
ATOM   4187 C CE2 . TRP A 1 549 ? -26.850 68.098 -27.449 1.00 129.44 ? 633 TRP A CE2 1 
ATOM   4188 C CE3 . TRP A 1 549 ? -27.442 65.762 -27.552 1.00 127.77 ? 633 TRP A CE3 1 
ATOM   4189 C CZ2 . TRP A 1 549 ? -25.586 67.801 -26.951 1.00 129.72 ? 633 TRP A CZ2 1 
ATOM   4190 C CZ3 . TRP A 1 549 ? -26.191 65.471 -27.051 1.00 126.10 ? 633 TRP A CZ3 1 
ATOM   4191 C CH2 . TRP A 1 549 ? -25.278 66.483 -26.760 1.00 127.92 ? 633 TRP A CH2 1 
ATOM   4192 N N   . SER A 1 550 ? -28.155 66.636 -31.253 1.00 136.39 ? 634 SER A N   1 
ATOM   4193 C CA  . SER A 1 550 ? -26.899 66.027 -31.655 1.00 138.94 ? 634 SER A CA  1 
ATOM   4194 C C   . SER A 1 550 ? -25.787 66.967 -31.222 1.00 140.58 ? 634 SER A C   1 
ATOM   4195 O O   . SER A 1 550 ? -26.003 68.177 -31.156 1.00 140.59 ? 634 SER A O   1 
ATOM   4196 C CB  . SER A 1 550 ? -26.869 65.844 -33.172 1.00 144.08 ? 634 SER A CB  1 
ATOM   4197 O OG  . SER A 1 550 ? -25.913 64.864 -33.545 1.00 145.56 ? 634 SER A OG  1 
ATOM   4198 N N   . PRO A 1 551 ? -24.595 66.422 -30.913 1.00 142.01 ? 635 PRO A N   1 
ATOM   4199 C CA  . PRO A 1 551 ? -23.453 67.281 -30.570 1.00 143.69 ? 635 PRO A CA  1 
ATOM   4200 C C   . PRO A 1 551 ? -23.154 68.242 -31.717 1.00 149.28 ? 635 PRO A C   1 
ATOM   4201 O O   . PRO A 1 551 ? -22.582 69.313 -31.505 1.00 151.08 ? 635 PRO A O   1 
ATOM   4202 C CB  . PRO A 1 551 ? -22.302 66.285 -30.389 1.00 139.23 ? 635 PRO A CB  1 
ATOM   4203 C CG  . PRO A 1 551 ? -22.965 64.995 -30.047 1.00 137.37 ? 635 PRO A CG  1 
ATOM   4204 C CD  . PRO A 1 551 ? -24.256 64.990 -30.820 1.00 139.08 ? 635 PRO A CD  1 
ATOM   4205 N N   . SER A 1 552 ? -23.553 67.840 -32.923 1.00 149.87 ? 636 SER A N   1 
ATOM   4206 C CA  . SER A 1 552 ? -23.524 68.698 -34.098 1.00 153.38 ? 636 SER A CA  1 
ATOM   4207 C C   . SER A 1 552 ? -24.238 70.021 -33.825 1.00 156.22 ? 636 SER A C   1 
ATOM   4208 O O   . SER A 1 552 ? -23.728 71.086 -34.168 1.00 160.25 ? 636 SER A O   1 
ATOM   4209 C CB  . SER A 1 552 ? -24.183 67.987 -35.284 1.00 157.38 ? 636 SER A CB  1 
ATOM   4210 O OG  . SER A 1 552 ? -23.608 66.710 -35.501 1.00 154.51 ? 636 SER A OG  1 
ATOM   4211 N N   . ASP A 1 553 ? -25.414 69.947 -33.203 1.00 152.28 ? 637 ASP A N   1 
ATOM   4212 C CA  . ASP A 1 553 ? -26.192 71.143 -32.885 1.00 150.96 ? 637 ASP A CA  1 
ATOM   4213 C C   . ASP A 1 553 ? -25.387 72.133 -32.050 1.00 151.91 ? 637 ASP A C   1 
ATOM   4214 O O   . ASP A 1 553 ? -25.481 73.343 -32.249 1.00 155.27 ? 637 ASP A O   1 
ATOM   4215 C CB  . ASP A 1 553 ? -27.483 70.781 -32.142 1.00 146.59 ? 637 ASP A CB  1 
ATOM   4216 C CG  . ASP A 1 553 ? -28.456 69.999 -33.002 1.00 147.94 ? 637 ASP A CG  1 
ATOM   4217 O OD1 . ASP A 1 553 ? -28.221 69.898 -34.224 1.00 152.49 ? 637 ASP A OD1 1 
ATOM   4218 O OD2 . ASP A 1 553 ? -29.462 69.497 -32.455 1.00 143.99 ? 637 ASP A OD2 1 
ATOM   4219 N N   . GLU A 1 554 ? -24.593 71.609 -31.121 1.00 150.93 ? 638 GLU A N   1 
ATOM   4220 C CA  . GLU A 1 554 ? -23.846 72.439 -30.179 1.00 153.14 ? 638 GLU A CA  1 
ATOM   4221 C C   . GLU A 1 554 ? -22.700 73.196 -30.832 1.00 157.74 ? 638 GLU A C   1 
ATOM   4222 O O   . GLU A 1 554 ? -22.577 74.411 -30.676 1.00 156.85 ? 638 GLU A O   1 
ATOM   4223 C CB  . GLU A 1 554 ? -23.287 71.579 -29.049 1.00 147.17 ? 638 GLU A CB  1 
ATOM   4224 C CG  . GLU A 1 554 ? -24.332 70.984 -28.139 1.00 143.65 ? 638 GLU A CG  1 
ATOM   4225 C CD  . GLU A 1 554 ? -25.053 72.035 -27.321 1.00 141.92 ? 638 GLU A CD  1 
ATOM   4226 O OE1 . GLU A 1 554 ? -24.404 73.021 -26.900 1.00 144.67 ? 638 GLU A OE1 1 
ATOM   4227 O OE2 . GLU A 1 554 ? -26.272 71.876 -27.103 1.00 138.05 ? 638 GLU A OE2 1 
ATOM   4228 N N   . ARG A 1 555 ? -21.845 72.475 -31.543 1.00 160.97 ? 639 ARG A N   1 
ATOM   4229 C CA  . ARG A 1 555 ? -20.766 73.127 -32.267 1.00 164.67 ? 639 ARG A CA  1 
ATOM   4230 C C   . ARG A 1 555 ? -20.761 72.766 -33.745 1.00 167.39 ? 639 ARG A C   1 
ATOM   4231 O O   . ARG A 1 555 ? -20.015 71.886 -34.183 1.00 170.08 ? 639 ARG A O   1 
ATOM   4232 C CB  . ARG A 1 555 ? -19.411 72.774 -31.662 1.00 164.18 ? 639 ARG A CB  1 
ATOM   4233 C CG  . ARG A 1 555 ? -18.322 73.653 -32.236 1.00 165.48 ? 639 ARG A CG  1 
ATOM   4234 C CD  . ARG A 1 555 ? -16.945 73.023 -32.216 1.00 165.92 ? 639 ARG A CD  1 
ATOM   4235 N NE  . ARG A 1 555 ? -16.921 71.576 -32.376 1.00 169.22 ? 639 ARG A NE  1 
ATOM   4236 C CZ  . ARG A 1 555 ? -16.037 70.909 -33.121 1.00 167.43 ? 639 ARG A CZ  1 
ATOM   4237 N NH1 . ARG A 1 555 ? -15.137 71.550 -33.844 1.00 166.70 ? 639 ARG A NH1 1 
ATOM   4238 N NH2 . ARG A 1 555 ? -16.071 69.581 -33.197 1.00 164.95 ? 639 ARG A NH2 1 
ATOM   4239 N N   . GLY A 1 556 ? -21.582 73.466 -34.513 1.00 169.33 ? 640 GLY A N   1 
ATOM   4240 C CA  . GLY A 1 556 ? -21.673 73.206 -35.928 1.00 173.60 ? 640 GLY A CA  1 
ATOM   4241 C C   . GLY A 1 556 ? -22.828 73.936 -36.572 1.00 175.29 ? 640 GLY A C   1 
ATOM   4242 O O   . GLY A 1 556 ? -23.089 75.091 -36.228 1.00 174.99 ? 640 GLY A O   1 
ATOM   4243 N N   . ASN A 1 557 ? -23.545 73.274 -37.481 1.00 176.22 ? 641 ASN A N   1 
ATOM   4244 C CA  . ASN A 1 557 ? -23.416 71.837 -37.760 1.00 176.20 ? 641 ASN A CA  1 
ATOM   4245 C C   . ASN A 1 557 ? -22.054 71.348 -38.263 1.00 179.36 ? 641 ASN A C   1 
ATOM   4246 O O   . ASN A 1 557 ? -21.353 72.046 -38.997 1.00 181.99 ? 641 ASN A O   1 
ATOM   4247 C CB  . ASN A 1 557 ? -24.509 71.402 -38.742 1.00 179.62 ? 641 ASN A CB  1 
ATOM   4248 C CG  . ASN A 1 557 ? -25.912 71.597 -38.185 1.00 176.18 ? 641 ASN A CG  1 
ATOM   4249 O OD1 . ASN A 1 557 ? -26.094 72.203 -37.130 1.00 172.33 ? 641 ASN A OD1 1 
ATOM   4250 N ND2 . ASN A 1 557 ? -26.912 71.083 -38.899 1.00 173.19 ? 641 ASN A ND2 1 
ATOM   4251 N N   . GLU A 1 558 ? -21.688 70.150 -37.823 1.00 177.21 ? 642 GLU A N   1 
ATOM   4252 C CA  . GLU A 1 558 ? -20.404 69.554 -38.148 1.00 180.39 ? 642 GLU A CA  1 
ATOM   4253 C C   . GLU A 1 558 ? -20.539 68.044 -38.056 1.00 181.66 ? 642 GLU A C   1 
ATOM   4254 O O   . GLU A 1 558 ? -21.333 67.539 -37.266 1.00 178.28 ? 642 GLU A O   1 
ATOM   4255 C CB  . GLU A 1 558 ? -19.336 70.039 -37.174 1.00 182.67 ? 642 GLU A CB  1 
ATOM   4256 C CG  . GLU A 1 558 ? -17.940 69.504 -37.449 1.00 187.03 ? 642 GLU A CG  1 
ATOM   4257 C CD  . GLU A 1 558 ? -16.962 69.970 -36.405 1.00 183.74 ? 642 GLU A CD  1 
ATOM   4258 O OE1 . GLU A 1 558 ? -17.435 70.632 -35.462 1.00 179.75 ? 642 GLU A OE1 1 
ATOM   4259 O OE2 . GLU A 1 558 ? -15.748 69.689 -36.522 1.00 185.23 ? 642 GLU A OE2 1 
ATOM   4260 N N   . CYS A 1 559 ? -19.770 67.326 -38.867 1.00 184.84 ? 643 CYS A N   1 
ATOM   4261 C CA  . CYS A 1 559 ? -19.832 65.871 -38.882 1.00 183.64 ? 643 CYS A CA  1 
ATOM   4262 C C   . CYS A 1 559 ? -18.459 65.250 -39.082 1.00 181.99 ? 643 CYS A C   1 
ATOM   4263 O O   . CYS A 1 559 ? -18.298 64.039 -38.943 1.00 181.04 ? 643 CYS A O   1 
ATOM   4264 C CB  . CYS A 1 559 ? -20.791 65.385 -39.971 1.00 183.08 ? 643 CYS A CB  1 
ATOM   4265 S SG  . CYS A 1 559 ? -22.537 65.752 -39.651 1.00 180.25 ? 643 CYS A SG  1 
ATOM   4266 N N   . LYS A 1 564 ? -23.649 61.960 -38.394 1.00 156.07 ? 648 LYS A N   1 
ATOM   4267 C CA  . LYS A 1 564 ? -23.856 62.365 -37.007 1.00 155.17 ? 648 LYS A CA  1 
ATOM   4268 C C   . LYS A 1 564 ? -24.863 61.470 -36.278 1.00 153.92 ? 648 LYS A C   1 
ATOM   4269 O O   . LYS A 1 564 ? -25.617 60.720 -36.905 1.00 152.31 ? 648 LYS A O   1 
ATOM   4270 C CB  . LYS A 1 564 ? -24.326 63.817 -36.940 1.00 155.08 ? 648 LYS A CB  1 
ATOM   4271 C CG  . LYS A 1 564 ? -25.725 64.030 -37.486 1.00 153.94 ? 648 LYS A CG  1 
ATOM   4272 C CD  . LYS A 1 564 ? -26.193 65.453 -37.241 1.00 154.28 ? 648 LYS A CD  1 
ATOM   4273 C CE  . LYS A 1 564 ? -27.538 65.708 -37.891 1.00 153.13 ? 648 LYS A CE  1 
ATOM   4274 N NZ  . LYS A 1 564 ? -27.969 67.119 -37.697 1.00 156.02 ? 648 LYS A NZ  1 
ATOM   4275 N N   . THR A 1 565 ? -24.862 61.561 -34.948 1.00 152.22 ? 649 THR A N   1 
ATOM   4276 C CA  . THR A 1 565 ? -25.804 60.825 -34.107 1.00 146.57 ? 649 THR A CA  1 
ATOM   4277 C C   . THR A 1 565 ? -26.806 61.800 -33.495 1.00 142.51 ? 649 THR A C   1 
ATOM   4278 O O   . THR A 1 565 ? -26.415 62.820 -32.928 1.00 140.39 ? 649 THR A O   1 
ATOM   4279 C CB  . THR A 1 565 ? -25.084 60.077 -32.954 1.00 141.63 ? 649 THR A CB  1 
ATOM   4280 O OG1 . THR A 1 565 ? -24.037 59.251 -33.477 1.00 139.61 ? 649 THR A OG1 1 
ATOM   4281 C CG2 . THR A 1 565 ? -26.066 59.211 -32.183 1.00 139.89 ? 649 THR A CG2 1 
ATOM   4282 N N   . VAL A 1 566 ? -28.095 61.491 -33.608 1.00 140.54 ? 650 VAL A N   1 
ATOM   4283 C CA  . VAL A 1 566 ? -29.123 62.343 -33.013 1.00 136.37 ? 650 VAL A CA  1 
ATOM   4284 C C   . VAL A 1 566 ? -29.865 61.643 -31.880 1.00 134.72 ? 650 VAL A C   1 
ATOM   4285 O O   . VAL A 1 566 ? -30.386 60.534 -32.042 1.00 134.01 ? 650 VAL A O   1 
ATOM   4286 C CB  . VAL A 1 566 ? -30.121 62.863 -34.056 1.00 134.57 ? 650 VAL A CB  1 
ATOM   4287 C CG1 . VAL A 1 566 ? -31.331 63.480 -33.372 1.00 128.77 ? 650 VAL A CG1 1 
ATOM   4288 C CG2 . VAL A 1 566 ? -29.441 63.874 -34.963 1.00 138.93 ? 650 VAL A CG2 1 
ATOM   4289 N N   . PHE A 1 567 ? -29.903 62.313 -30.732 1.00 132.03 ? 651 PHE A N   1 
ATOM   4290 C CA  . PHE A 1 567 ? -30.467 61.753 -29.516 1.00 127.25 ? 651 PHE A CA  1 
ATOM   4291 C C   . PHE A 1 567 ? -31.787 62.421 -29.169 1.00 125.48 ? 651 PHE A C   1 
ATOM   4292 O O   . PHE A 1 567 ? -31.929 63.639 -29.302 1.00 125.62 ? 651 PHE A O   1 
ATOM   4293 C CB  . PHE A 1 567 ? -29.509 61.986 -28.349 1.00 127.33 ? 651 PHE A CB  1 
ATOM   4294 C CG  . PHE A 1 567 ? -28.124 61.434 -28.563 1.00 129.66 ? 651 PHE A CG  1 
ATOM   4295 C CD1 . PHE A 1 567 ? -27.162 62.170 -29.236 1.00 130.74 ? 651 PHE A CD1 1 
ATOM   4296 C CD2 . PHE A 1 567 ? -27.774 60.195 -28.055 1.00 129.55 ? 651 PHE A CD2 1 
ATOM   4297 C CE1 . PHE A 1 567 ? -25.888 61.669 -29.418 1.00 130.32 ? 651 PHE A CE1 1 
ATOM   4298 C CE2 . PHE A 1 567 ? -26.502 59.688 -28.236 1.00 130.19 ? 651 PHE A CE2 1 
ATOM   4299 C CZ  . PHE A 1 567 ? -25.557 60.429 -28.916 1.00 130.15 ? 651 PHE A CZ  1 
ATOM   4300 N N   . LYS A 1 568 ? -32.752 61.632 -28.712 1.00 123.60 ? 652 LYS A N   1 
ATOM   4301 C CA  . LYS A 1 568 ? -33.922 62.221 -28.077 1.00 121.38 ? 652 LYS A CA  1 
ATOM   4302 C C   . LYS A 1 568 ? -33.593 62.479 -26.607 1.00 118.08 ? 652 LYS A C   1 
ATOM   4303 O O   . LYS A 1 568 ? -33.206 61.567 -25.873 1.00 116.28 ? 652 LYS A O   1 
ATOM   4304 C CB  . LYS A 1 568 ? -35.158 61.329 -28.219 1.00 117.57 ? 652 LYS A CB  1 
ATOM   4305 C CG  . LYS A 1 568 ? -36.459 62.095 -28.037 1.00 117.62 ? 652 LYS A CG  1 
ATOM   4306 C CD  . LYS A 1 568 ? -37.682 61.269 -28.393 1.00 117.02 ? 652 LYS A CD  1 
ATOM   4307 C CE  . LYS A 1 568 ? -38.051 60.321 -27.273 1.00 117.08 ? 652 LYS A CE  1 
ATOM   4308 N NZ  . LYS A 1 568 ? -39.347 59.640 -27.547 1.00 118.07 ? 652 LYS A NZ  1 
ATOM   4309 N N   . ARG A 1 569 ? -33.719 63.731 -26.189 1.00 115.17 ? 653 ARG A N   1 
ATOM   4310 C CA  . ARG A 1 569 ? -33.435 64.095 -24.811 1.00 115.26 ? 653 ARG A CA  1 
ATOM   4311 C C   . ARG A 1 569 ? -34.629 64.785 -24.188 1.00 114.29 ? 653 ARG A C   1 
ATOM   4312 O O   . ARG A 1 569 ? -35.335 65.540 -24.853 1.00 113.84 ? 653 ARG A O   1 
ATOM   4313 C CB  . ARG A 1 569 ? -32.242 65.039 -24.744 1.00 116.39 ? 653 ARG A CB  1 
ATOM   4314 C CG  . ARG A 1 569 ? -30.958 64.460 -25.269 1.00 119.27 ? 653 ARG A CG  1 
ATOM   4315 C CD  . ARG A 1 569 ? -29.916 65.545 -25.377 1.00 119.17 ? 653 ARG A CD  1 
ATOM   4316 N NE  . ARG A 1 569 ? -29.268 65.848 -24.108 1.00 119.44 ? 653 ARG A NE  1 
ATOM   4317 C CZ  . ARG A 1 569 ? -28.636 66.990 -23.858 1.00 121.83 ? 653 ARG A CZ  1 
ATOM   4318 N NH1 . ARG A 1 569 ? -28.587 67.932 -24.786 1.00 124.67 ? 653 ARG A NH1 1 
ATOM   4319 N NH2 . ARG A 1 569 ? -28.067 67.200 -22.678 1.00 119.76 ? 653 ARG A NH2 1 
ATOM   4320 N N   . ARG A 1 570 ? -34.854 64.526 -22.907 1.00 113.77 ? 654 ARG A N   1 
ATOM   4321 C CA  . ARG A 1 570 ? -35.844 65.283 -22.171 1.00 109.71 ? 654 ARG A CA  1 
ATOM   4322 C C   . ARG A 1 570 ? -35.380 66.728 -22.111 1.00 107.05 ? 654 ARG A C   1 
ATOM   4323 O O   . ARG A 1 570 ? -34.231 66.986 -21.753 1.00 110.07 ? 654 ARG A O   1 
ATOM   4324 C CB  . ARG A 1 570 ? -36.003 64.734 -20.756 1.00 106.99 ? 654 ARG A CB  1 
ATOM   4325 C CG  . ARG A 1 570 ? -36.676 65.724 -19.844 1.00 103.67 ? 654 ARG A CG  1 
ATOM   4326 C CD  . ARG A 1 570 ? -37.279 65.082 -18.620 1.00 103.28 ? 654 ARG A CD  1 
ATOM   4327 N NE  . ARG A 1 570 ? -36.379 65.065 -17.468 1.00 103.89 ? 654 ARG A NE  1 
ATOM   4328 C CZ  . ARG A 1 570 ? -35.895 66.146 -16.853 1.00 102.79 ? 654 ARG A CZ  1 
ATOM   4329 N NH1 . ARG A 1 570 ? -36.185 67.372 -17.272 1.00 102.63 ? 654 ARG A NH1 1 
ATOM   4330 N NH2 . ARG A 1 570 ? -35.097 65.998 -15.809 1.00 102.82 ? 654 ARG A NH2 1 
ATOM   4331 N N   . THR A 1 571 ? -36.254 67.664 -22.476 1.00 105.53 ? 655 THR A N   1 
ATOM   4332 C CA  . THR A 1 571 ? -35.924 69.082 -22.358 1.00 106.79 ? 655 THR A CA  1 
ATOM   4333 C C   . THR A 1 571 ? -35.608 69.373 -20.898 1.00 107.06 ? 655 THR A C   1 
ATOM   4334 O O   . THR A 1 571 ? -36.295 68.868 -20.014 1.00 108.22 ? 655 THR A O   1 
ATOM   4335 C CB  . THR A 1 571 ? -37.071 70.002 -22.829 1.00 105.84 ? 655 THR A CB  1 
ATOM   4336 O OG1 . THR A 1 571 ? -38.193 69.865 -21.955 1.00 107.31 ? 655 THR A OG1 1 
ATOM   4337 C CG2 . THR A 1 571 ? -37.500 69.652 -24.235 1.00 108.57 ? 655 THR A CG2 1 
ATOM   4338 N N   . PRO A 1 572 ? -34.549 70.162 -20.641 1.00 108.24 ? 656 PRO A N   1 
ATOM   4339 C CA  . PRO A 1 572 ? -34.058 70.474 -19.290 1.00 107.86 ? 656 PRO A CA  1 
ATOM   4340 C C   . PRO A 1 572 ? -35.128 70.888 -18.264 1.00 107.05 ? 656 PRO A C   1 
ATOM   4341 O O   . PRO A 1 572 ? -35.077 70.406 -17.128 1.00 106.16 ? 656 PRO A O   1 
ATOM   4342 C CB  . PRO A 1 572 ? -33.061 71.623 -19.527 1.00 106.78 ? 656 PRO A CB  1 
ATOM   4343 C CG  . PRO A 1 572 ? -33.206 72.004 -20.979 1.00 108.83 ? 656 PRO A CG  1 
ATOM   4344 C CD  . PRO A 1 572 ? -33.700 70.779 -21.670 1.00 108.84 ? 656 PRO A CD  1 
ATOM   4345 N N   . HIS A 1 573 ? -36.075 71.740 -18.653 1.00 105.35 ? 657 HIS A N   1 
ATOM   4346 C CA  . HIS A 1 573 ? -37.062 72.264 -17.711 1.00 104.05 ? 657 HIS A CA  1 
ATOM   4347 C C   . HIS A 1 573 ? -38.288 71.374 -17.503 1.00 104.55 ? 657 HIS A C   1 
ATOM   4348 O O   . HIS A 1 573 ? -39.219 71.748 -16.788 1.00 104.30 ? 657 HIS A O   1 
ATOM   4349 C CB  . HIS A 1 573 ? -37.512 73.651 -18.151 1.00 105.97 ? 657 HIS A CB  1 
ATOM   4350 C CG  . HIS A 1 573 ? -36.461 74.699 -17.985 1.00 105.57 ? 657 HIS A CG  1 
ATOM   4351 N ND1 . HIS A 1 573 ? -36.503 75.907 -18.646 1.00 106.40 ? 657 HIS A ND1 1 
ATOM   4352 C CD2 . HIS A 1 573 ? -35.343 74.721 -17.224 1.00 104.86 ? 657 HIS A CD2 1 
ATOM   4353 C CE1 . HIS A 1 573 ? -35.453 76.629 -18.299 1.00 107.20 ? 657 HIS A CE1 1 
ATOM   4354 N NE2 . HIS A 1 573 ? -34.733 75.933 -17.437 1.00 105.17 ? 657 HIS A NE2 1 
ATOM   4355 N N   . ALA A 1 574 ? -38.294 70.202 -18.123 1.00 104.18 ? 658 ALA A N   1 
ATOM   4356 C CA  . ALA A 1 574 ? -39.413 69.280 -17.979 1.00 102.24 ? 658 ALA A CA  1 
ATOM   4357 C C   . ALA A 1 574 ? -39.349 68.503 -16.666 1.00 103.66 ? 658 ALA A C   1 
ATOM   4358 O O   . ALA A 1 574 ? -38.521 67.608 -16.515 1.00 104.61 ? 658 ALA A O   1 
ATOM   4359 C CB  . ALA A 1 574 ? -39.446 68.320 -19.147 1.00 103.11 ? 658 ALA A CB  1 
ATOM   4360 N N   . THR A 1 575 ? -40.219 68.832 -15.714 1.00 103.43 ? 659 THR A N   1 
ATOM   4361 C CA  . THR A 1 575 ? -40.308 68.025 -14.498 1.00 100.94 ? 659 THR A CA  1 
ATOM   4362 C C   . THR A 1 575 ? -41.209 66.826 -14.731 1.00 102.15 ? 659 THR A C   1 
ATOM   4363 O O   . THR A 1 575 ? -42.435 66.944 -14.686 1.00 103.62 ? 659 THR A O   1 
ATOM   4364 C CB  . THR A 1 575 ? -40.880 68.790 -13.305 1.00 98.70  ? 659 THR A CB  1 
ATOM   4365 O OG1 . THR A 1 575 ? -40.253 70.070 -13.200 1.00 98.42  ? 659 THR A OG1 1 
ATOM   4366 C CG2 . THR A 1 575 ? -40.638 68.013 -12.026 1.00 99.84  ? 659 THR A CG2 1 
ATOM   4367 N N   . CYS A 1 576 ? -40.590 65.679 -14.974 1.00 101.06 ? 660 CYS A N   1 
ATOM   4368 C CA  . CYS A 1 576 ? -41.298 64.426 -15.191 1.00 100.91 ? 660 CYS A CA  1 
ATOM   4369 C C   . CYS A 1 576 ? -40.273 63.288 -15.226 1.00 102.94 ? 660 CYS A C   1 
ATOM   4370 O O   . CYS A 1 576 ? -39.068 63.527 -15.133 1.00 103.77 ? 660 CYS A O   1 
ATOM   4371 C CB  . CYS A 1 576 ? -42.070 64.478 -16.507 1.00 103.40 ? 660 CYS A CB  1 
ATOM   4372 S SG  . CYS A 1 576 ? -41.028 64.778 -17.960 1.00 109.11 ? 660 CYS A SG  1 
ATOM   4373 N N   . PHE A 1 577 ? -40.731 62.050 -15.357 1.00 101.43 ? 661 PHE A N   1 
ATOM   4374 C CA  . PHE A 1 577 ? -39.773 60.963 -15.526 1.00 102.16 ? 661 PHE A CA  1 
ATOM   4375 C C   . PHE A 1 577 ? -39.988 60.148 -16.787 1.00 104.92 ? 661 PHE A C   1 
ATOM   4376 O O   . PHE A 1 577 ? -41.113 59.746 -17.099 1.00 104.82 ? 661 PHE A O   1 
ATOM   4377 C CB  . PHE A 1 577 ? -39.706 60.037 -14.303 1.00 100.02 ? 661 PHE A CB  1 
ATOM   4378 C CG  . PHE A 1 577 ? -41.012 59.408 -13.928 1.00 101.76 ? 661 PHE A CG  1 
ATOM   4379 C CD1 . PHE A 1 577 ? -41.413 58.201 -14.482 1.00 102.41 ? 661 PHE A CD1 1 
ATOM   4380 C CD2 . PHE A 1 577 ? -41.832 60.012 -12.995 1.00 102.70 ? 661 PHE A CD2 1 
ATOM   4381 C CE1 . PHE A 1 577 ? -42.626 57.622 -14.130 1.00 100.70 ? 661 PHE A CE1 1 
ATOM   4382 C CE2 . PHE A 1 577 ? -43.042 59.440 -12.636 1.00 102.03 ? 661 PHE A CE2 1 
ATOM   4383 C CZ  . PHE A 1 577 ? -43.439 58.241 -13.204 1.00 101.27 ? 661 PHE A CZ  1 
ATOM   4384 N N   . ASN A 1 578 ? -38.903 59.930 -17.525 1.00 103.78 ? 662 ASN A N   1 
ATOM   4385 C CA  . ASN A 1 578 ? -38.882 58.842 -18.472 1.00 104.09 ? 662 ASN A CA  1 
ATOM   4386 C C   . ASN A 1 578 ? -38.786 57.622 -17.580 1.00 104.23 ? 662 ASN A C   1 
ATOM   4387 O O   . ASN A 1 578 ? -38.198 57.689 -16.502 1.00 106.70 ? 662 ASN A O   1 
ATOM   4388 C CB  . ASN A 1 578 ? -37.706 58.960 -19.450 1.00 107.26 ? 662 ASN A CB  1 
ATOM   4389 C CG  . ASN A 1 578 ? -36.358 59.047 -18.755 1.00 107.94 ? 662 ASN A CG  1 
ATOM   4390 O OD1 . ASN A 1 578 ? -36.066 58.282 -17.836 1.00 109.73 ? 662 ASN A OD1 1 
ATOM   4391 N ND2 . ASN A 1 578 ? -35.520 59.976 -19.203 1.00 106.44 ? 662 ASN A ND2 1 
ATOM   4392 N N   . GLY A 1 579 ? -39.393 56.521 -17.989 1.00 105.72 ? 663 GLY A N   1 
ATOM   4393 C CA  . GLY A 1 579 ? -39.446 55.359 -17.123 1.00 106.99 ? 663 GLY A CA  1 
ATOM   4394 C C   . GLY A 1 579 ? -38.084 54.755 -16.845 1.00 105.63 ? 663 GLY A C   1 
ATOM   4395 O O   . GLY A 1 579 ? -37.069 55.196 -17.382 1.00 103.03 ? 663 GLY A O   1 
ATOM   4396 N N   . GLU A 1 580 ? -38.068 53.745 -15.986 1.00 106.53 ? 664 GLU A N   1 
ATOM   4397 C CA  . GLU A 1 580 ? -36.882 52.936 -15.778 1.00 102.42 ? 664 GLU A CA  1 
ATOM   4398 C C   . GLU A 1 580 ? -36.607 52.147 -17.054 1.00 104.63 ? 664 GLU A C   1 
ATOM   4399 O O   . GLU A 1 580 ? -35.454 51.911 -17.421 1.00 104.60 ? 664 GLU A O   1 
ATOM   4400 C CB  . GLU A 1 580 ? -37.114 51.993 -14.604 1.00 100.88 ? 664 GLU A CB  1 
ATOM   4401 C CG  . GLU A 1 580 ? -35.929 51.119 -14.247 1.00 103.44 ? 664 GLU A CG  1 
ATOM   4402 C CD  . GLU A 1 580 ? -36.104 50.447 -12.896 1.00 107.46 ? 664 GLU A CD  1 
ATOM   4403 O OE1 . GLU A 1 580 ? -36.807 51.034 -12.039 1.00 107.21 ? 664 GLU A OE1 1 
ATOM   4404 O OE2 . GLU A 1 580 ? -35.549 49.340 -12.693 1.00 108.53 ? 664 GLU A OE2 1 
ATOM   4405 N N   . ASP A 1 581 ? -37.683 51.758 -17.738 1.00 106.67 ? 665 ASP A N   1 
ATOM   4406 C CA  . ASP A 1 581 ? -37.586 51.021 -19.000 1.00 107.17 ? 665 ASP A CA  1 
ATOM   4407 C C   . ASP A 1 581 ? -37.444 51.958 -20.186 1.00 108.25 ? 665 ASP A C   1 
ATOM   4408 O O   . ASP A 1 581 ? -37.733 51.581 -21.325 1.00 108.02 ? 665 ASP A O   1 
ATOM   4409 C CB  . ASP A 1 581 ? -38.819 50.144 -19.217 1.00 109.66 ? 665 ASP A CB  1 
ATOM   4410 C CG  . ASP A 1 581 ? -38.866 48.956 -18.276 1.00 110.97 ? 665 ASP A CG  1 
ATOM   4411 O OD1 . ASP A 1 581 ? -37.794 48.394 -17.966 1.00 105.47 ? 665 ASP A OD1 1 
ATOM   4412 O OD2 . ASP A 1 581 ? -39.980 48.582 -17.843 1.00 113.44 ? 665 ASP A OD2 1 
ATOM   4413 N N   . PHE A 1 582 ? -37.023 53.185 -19.913 1.00 109.51 ? 666 PHE A N   1 
ATOM   4414 C CA  . PHE A 1 582 ? -36.744 54.121 -20.977 1.00 109.52 ? 666 PHE A CA  1 
ATOM   4415 C C   . PHE A 1 582 ? -35.705 53.505 -21.886 1.00 111.73 ? 666 PHE A C   1 
ATOM   4416 O O   . PHE A 1 582 ? -34.689 52.955 -21.437 1.00 108.19 ? 666 PHE A O   1 
ATOM   4417 C CB  . PHE A 1 582 ? -36.221 55.447 -20.433 1.00 108.24 ? 666 PHE A CB  1 
ATOM   4418 C CG  . PHE A 1 582 ? -36.055 56.507 -21.486 1.00 108.93 ? 666 PHE A CG  1 
ATOM   4419 C CD1 . PHE A 1 582 ? -36.877 56.529 -22.596 1.00 111.69 ? 666 PHE A CD1 1 
ATOM   4420 C CD2 . PHE A 1 582 ? -35.072 57.475 -21.374 1.00 108.89 ? 666 PHE A CD2 1 
ATOM   4421 C CE1 . PHE A 1 582 ? -36.732 57.503 -23.569 1.00 112.50 ? 666 PHE A CE1 1 
ATOM   4422 C CE2 . PHE A 1 582 ? -34.923 58.452 -22.349 1.00 108.89 ? 666 PHE A CE2 1 
ATOM   4423 C CZ  . PHE A 1 582 ? -35.756 58.463 -23.445 1.00 109.33 ? 666 PHE A CZ  1 
ATOM   4424 N N   . ASP A 1 583 ? -35.992 53.585 -23.173 1.00 116.18 ? 667 ASP A N   1 
ATOM   4425 C CA  . ASP A 1 583 ? -35.066 53.152 -24.191 1.00 118.59 ? 667 ASP A CA  1 
ATOM   4426 C C   . ASP A 1 583 ? -34.790 54.341 -25.088 1.00 116.81 ? 667 ASP A C   1 
ATOM   4427 O O   . ASP A 1 583 ? -35.586 54.664 -25.969 1.00 115.14 ? 667 ASP A O   1 
ATOM   4428 C CB  . ASP A 1 583 ? -35.684 52.017 -24.992 1.00 120.26 ? 667 ASP A CB  1 
ATOM   4429 C CG  . ASP A 1 583 ? -34.679 51.314 -25.860 1.00 125.59 ? 667 ASP A CG  1 
ATOM   4430 O OD1 . ASP A 1 583 ? -33.885 50.513 -25.317 1.00 128.02 ? 667 ASP A OD1 1 
ATOM   4431 O OD2 . ASP A 1 583 ? -34.691 51.557 -27.086 1.00 128.77 ? 667 ASP A OD2 1 
ATOM   4432 N N   . ARG A 1 584 ? -33.668 55.002 -24.843 1.00 118.26 ? 668 ARG A N   1 
ATOM   4433 C CA  . ARG A 1 584 ? -33.306 56.190 -25.602 1.00 117.90 ? 668 ARG A CA  1 
ATOM   4434 C C   . ARG A 1 584 ? -33.163 55.870 -27.077 1.00 121.41 ? 668 ARG A C   1 
ATOM   4435 O O   . ARG A 1 584 ? -32.380 55.000 -27.460 1.00 124.64 ? 668 ARG A O   1 
ATOM   4436 C CB  . ARG A 1 584 ? -31.995 56.768 -25.085 1.00 115.72 ? 668 ARG A CB  1 
ATOM   4437 C CG  . ARG A 1 584 ? -31.928 58.274 -25.139 1.00 112.77 ? 668 ARG A CG  1 
ATOM   4438 C CD  . ARG A 1 584 ? -30.968 58.789 -24.093 1.00 110.02 ? 668 ARG A CD  1 
ATOM   4439 N NE  . ARG A 1 584 ? -31.500 59.964 -23.416 1.00 111.11 ? 668 ARG A NE  1 
ATOM   4440 C CZ  . ARG A 1 584 ? -31.287 60.231 -22.134 1.00 111.60 ? 668 ARG A CZ  1 
ATOM   4441 N NH1 . ARG A 1 584 ? -30.557 59.396 -21.410 1.00 111.34 ? 668 ARG A NH1 1 
ATOM   4442 N NH2 . ARG A 1 584 ? -31.799 61.322 -21.576 1.00 111.13 ? 668 ARG A NH2 1 
ATOM   4443 N N   . PRO A 1 585 ? -33.936 56.566 -27.912 1.00 119.53 ? 669 PRO A N   1 
ATOM   4444 C CA  . PRO A 1 585 ? -33.801 56.388 -29.359 1.00 121.98 ? 669 PRO A CA  1 
ATOM   4445 C C   . PRO A 1 585 ? -32.650 57.197 -29.960 1.00 126.88 ? 669 PRO A C   1 
ATOM   4446 O O   . PRO A 1 585 ? -32.693 58.431 -29.970 1.00 125.97 ? 669 PRO A O   1 
ATOM   4447 C CB  . PRO A 1 585 ? -35.145 56.881 -29.896 1.00 121.85 ? 669 PRO A CB  1 
ATOM   4448 C CG  . PRO A 1 585 ? -35.663 57.809 -28.851 1.00 119.13 ? 669 PRO A CG  1 
ATOM   4449 C CD  . PRO A 1 585 ? -35.151 57.312 -27.542 1.00 117.97 ? 669 PRO A CD  1 
ATOM   4450 N N   . VAL A 1 586 ? -31.630 56.494 -30.453 1.00 132.05 ? 670 VAL A N   1 
ATOM   4451 C CA  . VAL A 1 586 ? -30.519 57.130 -31.164 1.00 132.83 ? 670 VAL A CA  1 
ATOM   4452 C C   . VAL A 1 586 ? -30.575 56.829 -32.660 1.00 137.22 ? 670 VAL A C   1 
ATOM   4453 O O   . VAL A 1 586 ? -30.699 55.675 -33.078 1.00 138.25 ? 670 VAL A O   1 
ATOM   4454 C CB  . VAL A 1 586 ? -29.138 56.715 -30.601 1.00 127.46 ? 670 VAL A CB  1 
ATOM   4455 C CG1 . VAL A 1 586 ? -28.965 57.246 -29.202 1.00 126.98 ? 670 VAL A CG1 1 
ATOM   4456 C CG2 . VAL A 1 586 ? -28.972 55.201 -30.615 1.00 128.02 ? 670 VAL A CG2 1 
ATOM   4457 N N   . VAL A 1 587 ? -30.496 57.880 -33.465 1.00 140.42 ? 671 VAL A N   1 
ATOM   4458 C CA  . VAL A 1 587 ? -30.559 57.733 -34.911 1.00 142.59 ? 671 VAL A CA  1 
ATOM   4459 C C   . VAL A 1 587 ? -29.227 58.135 -35.528 1.00 145.44 ? 671 VAL A C   1 
ATOM   4460 O O   . VAL A 1 587 ? -28.769 59.267 -35.351 1.00 145.63 ? 671 VAL A O   1 
ATOM   4461 C CB  . VAL A 1 587 ? -31.696 58.589 -35.515 1.00 140.95 ? 671 VAL A CB  1 
ATOM   4462 C CG1 . VAL A 1 587 ? -31.712 58.465 -37.031 1.00 141.73 ? 671 VAL A CG1 1 
ATOM   4463 C CG2 . VAL A 1 587 ? -33.044 58.186 -34.920 1.00 136.87 ? 671 VAL A CG2 1 
ATOM   4464 N N   . VAL A 1 588 ? -28.605 57.200 -36.242 1.00 147.48 ? 672 VAL A N   1 
ATOM   4465 C CA  . VAL A 1 588 ? -27.323 57.450 -36.900 1.00 151.92 ? 672 VAL A CA  1 
ATOM   4466 C C   . VAL A 1 588 ? -27.537 57.736 -38.388 1.00 152.18 ? 672 VAL A C   1 
ATOM   4467 O O   . VAL A 1 588 ? -28.216 56.972 -39.073 1.00 152.11 ? 672 VAL A O   1 
ATOM   4468 C CB  . VAL A 1 588 ? -26.377 56.245 -36.745 1.00 151.76 ? 672 VAL A CB  1 
ATOM   4469 C CG1 . VAL A 1 588 ? -24.937 56.668 -36.979 1.00 149.65 ? 672 VAL A CG1 1 
ATOM   4470 C CG2 . VAL A 1 588 ? -26.537 55.621 -35.364 1.00 149.00 ? 672 VAL A CG2 1 
ATOM   4471 N N   . SER A 1 589 ? -26.960 58.829 -38.888 1.00 152.87 ? 673 SER A N   1 
ATOM   4472 C CA  . SER A 1 589 ? -27.242 59.275 -40.256 1.00 154.41 ? 673 SER A CA  1 
ATOM   4473 C C   . SER A 1 589 ? -26.059 59.922 -40.974 1.00 155.35 ? 673 SER A C   1 
ATOM   4474 O O   . SER A 1 589 ? -25.202 60.546 -40.346 1.00 157.86 ? 673 SER A O   1 
ATOM   4475 C CB  . SER A 1 589 ? -28.415 60.257 -40.258 1.00 154.72 ? 673 SER A CB  1 
ATOM   4476 O OG  . SER A 1 589 ? -28.098 61.422 -39.514 1.00 155.12 ? 673 SER A OG  1 
ATOM   4477 N N   . ASN A 1 590 ? -26.038 59.786 -42.299 1.00 154.39 ? 674 ASN A N   1 
ATOM   4478 C CA  . ASN A 1 590 ? -25.024 60.420 -43.138 1.00 153.61 ? 674 ASN A CA  1 
ATOM   4479 C C   . ASN A 1 590 ? -25.437 61.820 -43.571 1.00 157.90 ? 674 ASN A C   1 
ATOM   4480 O O   . ASN A 1 590 ? -26.128 61.997 -44.574 1.00 159.18 ? 674 ASN A O   1 
ATOM   4481 C CB  . ASN A 1 590 ? -24.738 59.559 -44.367 1.00 147.36 ? 674 ASN A CB  1 
ATOM   4482 C CG  . ASN A 1 590 ? -24.244 58.181 -43.999 1.00 140.42 ? 674 ASN A CG  1 
ATOM   4483 O OD1 . ASN A 1 590 ? -23.201 58.042 -43.356 1.00 137.10 ? 674 ASN A OD1 1 
ATOM   4484 N ND2 . ASN A 1 590 ? -24.994 57.145 -44.390 1.00 138.22 ? 674 ASN A ND2 1 
ATOM   4485 N N   . CYS A 1 591 ? -24.993 62.814 -42.814 1.00 162.01 ? 675 CYS A N   1 
ATOM   4486 C CA  . CYS A 1 591 ? -25.421 64.189 -43.024 1.00 165.32 ? 675 CYS A CA  1 
ATOM   4487 C C   . CYS A 1 591 ? -24.910 64.785 -44.337 1.00 169.65 ? 675 CYS A C   1 
ATOM   4488 O O   . CYS A 1 591 ? -24.182 64.141 -45.093 1.00 168.18 ? 675 CYS A O   1 
ATOM   4489 C CB  . CYS A 1 591 ? -24.996 65.053 -41.833 1.00 167.40 ? 675 CYS A CB  1 
ATOM   4490 S SG  . CYS A 1 591 ? -23.336 64.701 -41.196 1.00 173.07 ? 675 CYS A SG  1 
ATOM   4491 N N   . ALA B 2 4   ? -13.264 54.353 8.764   1.00 129.42 ? 9   ALA C N   1 
ATOM   4492 C CA  . ALA B 2 4   ? -13.954 54.243 7.483   1.00 131.03 ? 9   ALA C CA  1 
ATOM   4493 C C   . ALA B 2 4   ? -13.170 54.906 6.350   1.00 133.97 ? 9   ALA C C   1 
ATOM   4494 O O   . ALA B 2 4   ? -12.511 55.933 6.535   1.00 138.23 ? 9   ALA C O   1 
ATOM   4495 C CB  . ALA B 2 4   ? -15.369 54.810 7.574   1.00 131.44 ? 9   ALA C CB  1 
ATOM   4496 N N   . ALA B 2 5   ? -13.192 54.271 5.187   1.00 132.46 ? 10  ALA C N   1 
ATOM   4497 C CA  . ALA B 2 5   ? -12.508 54.814 4.032   1.00 133.94 ? 10  ALA C CA  1 
ATOM   4498 C C   . ALA B 2 5   ? -13.473 54.911 2.868   1.00 132.31 ? 10  ALA C C   1 
ATOM   4499 O O   . ALA B 2 5   ? -14.166 55.907 2.740   1.00 132.15 ? 10  ALA C O   1 
ATOM   4500 C CB  . ALA B 2 5   ? -11.307 53.973 3.669   1.00 135.23 ? 10  ALA C CB  1 
ATOM   4501 N N   . ALA B 2 6   ? -13.560 53.875 2.040   1.00 129.86 ? 11  ALA C N   1 
ATOM   4502 C CA  . ALA B 2 6   ? -14.243 54.037 0.760   1.00 127.44 ? 11  ALA C CA  1 
ATOM   4503 C C   . ALA B 2 6   ? -15.288 52.978 0.396   1.00 123.85 ? 11  ALA C C   1 
ATOM   4504 O O   . ALA B 2 6   ? -15.364 51.925 1.019   1.00 121.65 ? 11  ALA C O   1 
ATOM   4505 C CB  . ALA B 2 6   ? -13.217 54.141 -0.324  1.00 128.06 ? 11  ALA C CB  1 
ATOM   4506 N N   . ALA B 2 7   ? -16.095 53.278 -0.619  1.00 123.88 ? 12  ALA C N   1 
ATOM   4507 C CA  . ALA B 2 7   ? -17.090 52.345 -1.134  1.00 117.07 ? 12  ALA C CA  1 
ATOM   4508 C C   . ALA B 2 7   ? -16.856 52.144 -2.628  1.00 114.51 ? 12  ALA C C   1 
ATOM   4509 O O   . ALA B 2 7   ? -16.534 53.091 -3.341  1.00 114.84 ? 12  ALA C O   1 
ATOM   4510 C CB  . ALA B 2 7   ? -18.470 52.879 -0.879  1.00 110.59 ? 12  ALA C CB  1 
ATOM   4511 N N   . ALA B 2 8   ? -16.991 50.908 -3.096  1.00 114.32 ? 13  ALA C N   1 
ATOM   4512 C CA  . ALA B 2 8   ? -16.707 50.587 -4.493  1.00 113.72 ? 13  ALA C CA  1 
ATOM   4513 C C   . ALA B 2 8   ? -17.858 49.823 -5.150  1.00 110.88 ? 13  ALA C C   1 
ATOM   4514 O O   . ALA B 2 8   ? -18.601 49.132 -4.464  1.00 109.80 ? 13  ALA C O   1 
ATOM   4515 C CB  . ALA B 2 8   ? -15.425 49.777 -4.581  1.00 111.21 ? 13  ALA C CB  1 
ATOM   4516 N N   . ALA B 2 9   ? -18.019 49.955 -6.466  1.00 110.13 ? 14  ALA C N   1 
ATOM   4517 C CA  . ALA B 2 9   ? -18.890 49.038 -7.209  1.00 114.27 ? 14  ALA C CA  1 
ATOM   4518 C C   . ALA B 2 9   ? -18.117 47.750 -7.551  1.00 116.90 ? 14  ALA C C   1 
ATOM   4519 O O   . ALA B 2 9   ? -17.070 47.511 -6.942  1.00 113.41 ? 14  ALA C O   1 
ATOM   4520 C CB  . ALA B 2 9   ? -19.412 49.694 -8.446  1.00 111.68 ? 14  ALA C CB  1 
ATOM   4521 N N   . ALA B 2 10  ? -18.632 46.941 -8.494  1.00 118.70 ? 15  ALA C N   1 
ATOM   4522 C CA  . ALA B 2 10  ? -18.048 45.631 -8.888  1.00 116.84 ? 15  ALA C CA  1 
ATOM   4523 C C   . ALA B 2 10  ? -18.368 44.408 -7.995  1.00 110.32 ? 15  ALA C C   1 
ATOM   4524 O O   . ALA B 2 10  ? -18.541 44.511 -6.780  1.00 107.49 ? 15  ALA C O   1 
ATOM   4525 C CB  . ALA B 2 10  ? -16.541 45.744 -9.113  1.00 114.61 ? 15  ALA C CB  1 
HETATM 4526 C C1  . NAG C 3 .   ? -10.789 24.896 8.102   1.00 137.01 ? 801 NAG A C1  1 
HETATM 4527 C C2  . NAG C 3 .   ? -9.509  24.420 8.813   1.00 138.19 ? 801 NAG A C2  1 
HETATM 4528 C C3  . NAG C 3 .   ? -8.251  24.793 8.022   1.00 140.64 ? 801 NAG A C3  1 
HETATM 4529 C C4  . NAG C 3 .   ? -8.374  24.441 6.547   1.00 141.18 ? 801 NAG A C4  1 
HETATM 4530 C C5  . NAG C 3 .   ? -9.653  25.014 5.952   1.00 134.34 ? 801 NAG A C5  1 
HETATM 4531 C C6  . NAG C 3 .   ? -9.820  24.518 4.517   1.00 133.73 ? 801 NAG A C6  1 
HETATM 4532 C C7  . NAG C 3 .   ? -8.513  24.634 11.071  1.00 143.05 ? 801 NAG A C7  1 
HETATM 4533 C C8  . NAG C 3 .   ? -8.923  24.690 12.520  1.00 143.40 ? 801 NAG A C8  1 
HETATM 4534 N N2  . NAG C 3 .   ? -9.455  24.942 10.176  1.00 139.33 ? 801 NAG A N2  1 
HETATM 4535 O O3  . NAG C 3 .   ? -7.123  24.104 8.532   1.00 143.92 ? 801 NAG A O3  1 
HETATM 4536 O O4  . NAG C 3 .   ? -7.256  24.917 5.815   1.00 142.19 ? 801 NAG A O4  1 
HETATM 4537 O O5  . NAG C 3 .   ? -10.787 24.632 6.702   1.00 133.54 ? 801 NAG A O5  1 
HETATM 4538 O O6  . NAG C 3 .   ? -10.985 23.730 4.404   1.00 129.09 ? 801 NAG A O6  1 
HETATM 4539 O O7  . NAG C 3 .   ? -7.360  24.335 10.753  1.00 145.99 ? 801 NAG A O7  1 
HETATM 4540 C C1  . NAG D 3 .   ? 6.115   76.554 -19.452 1.00 150.57 ? 802 NAG A C1  1 
HETATM 4541 C C2  . NAG D 3 .   ? 5.641   77.100 -20.813 1.00 153.63 ? 802 NAG A C2  1 
HETATM 4542 C C3  . NAG D 3 .   ? 6.368   78.389 -21.188 1.00 155.75 ? 802 NAG A C3  1 
HETATM 4543 C C4  . NAG D 3 .   ? 6.341   79.405 -20.047 1.00 158.45 ? 802 NAG A C4  1 
HETATM 4544 C C5  . NAG D 3 .   ? 6.725   78.748 -18.714 1.00 155.31 ? 802 NAG A C5  1 
HETATM 4545 C C6  . NAG D 3 .   ? 6.511   79.736 -17.565 1.00 151.54 ? 802 NAG A C6  1 
HETATM 4546 C C7  . NAG D 3 .   ? 4.738   75.599 -22.516 1.00 153.80 ? 802 NAG A C7  1 
HETATM 4547 C C8  . NAG D 3 .   ? 5.020   74.437 -23.424 1.00 148.40 ? 802 NAG A C8  1 
HETATM 4548 N N2  . NAG D 3 .   ? 5.794   76.110 -21.873 1.00 154.44 ? 802 NAG A N2  1 
HETATM 4549 O O3  . NAG D 3 .   ? 5.745   78.937 -22.333 1.00 156.14 ? 802 NAG A O3  1 
HETATM 4550 O O4  . NAG D 3 .   ? 7.233   80.473 -20.330 1.00 161.85 ? 802 NAG A O4  1 
HETATM 4551 O O5  . NAG D 3 .   ? 6.001   77.555 -18.450 1.00 151.54 ? 802 NAG A O5  1 
HETATM 4552 O O6  . NAG D 3 .   ? 6.101   79.056 -16.396 1.00 146.99 ? 802 NAG A O6  1 
HETATM 4553 O O7  . NAG D 3 .   ? 3.587   76.031 -22.391 1.00 154.55 ? 802 NAG A O7  1 
HETATM 4554 C C1  . NAG E 3 .   ? -40.034 54.851 -4.659  1.00 112.99 ? 803 NAG A C1  1 
HETATM 4555 C C2  . NAG E 3 .   ? -40.736 53.554 -5.080  1.00 116.05 ? 803 NAG A C2  1 
HETATM 4556 C C3  . NAG E 3 .   ? -41.804 53.757 -6.167  1.00 113.66 ? 803 NAG A C3  1 
HETATM 4557 C C4  . NAG E 3 .   ? -42.685 54.949 -5.831  1.00 109.96 ? 803 NAG A C4  1 
HETATM 4558 C C5  . NAG E 3 .   ? -41.861 56.193 -5.538  1.00 111.71 ? 803 NAG A C5  1 
HETATM 4559 C C6  . NAG E 3 .   ? -42.751 57.371 -5.137  1.00 112.90 ? 803 NAG A C6  1 
HETATM 4560 C C7  . NAG E 3 .   ? -39.134 51.754 -4.706  1.00 116.83 ? 803 NAG A C7  1 
HETATM 4561 C C8  . NAG E 3 .   ? -38.015 50.912 -5.266  1.00 112.22 ? 803 NAG A C8  1 
HETATM 4562 N N2  . NAG E 3 .   ? -39.748 52.590 -5.549  1.00 116.61 ? 803 NAG A N2  1 
HETATM 4563 O O3  . NAG E 3 .   ? -42.593 52.595 -6.304  1.00 115.57 ? 803 NAG A O3  1 
HETATM 4564 O O4  . NAG E 3 .   ? -43.505 55.215 -6.940  1.00 110.25 ? 803 NAG A O4  1 
HETATM 4565 O O5  . NAG E 3 .   ? -40.944 55.934 -4.488  1.00 113.84 ? 803 NAG A O5  1 
HETATM 4566 O O6  . NAG E 3 .   ? -42.839 57.439 -3.727  1.00 117.93 ? 803 NAG A O6  1 
HETATM 4567 O O7  . NAG E 3 .   ? -39.456 51.669 -3.516  1.00 114.10 ? 803 NAG A O7  1 
HETATM 4568 C C1  . NAG F 3 .   ? -24.171 55.941 -44.452 1.00 137.74 ? 804 NAG A C1  1 
HETATM 4569 C C2  . NAG F 3 .   ? -24.706 54.511 -44.608 1.00 136.17 ? 804 NAG A C2  1 
HETATM 4570 C C3  . NAG F 3 .   ? -23.616 53.441 -44.480 1.00 137.23 ? 804 NAG A C3  1 
HETATM 4571 C C4  . NAG F 3 .   ? -22.390 53.818 -45.308 1.00 137.30 ? 804 NAG A C4  1 
HETATM 4572 C C5  . NAG F 3 .   ? -21.968 55.255 -45.018 1.00 138.53 ? 804 NAG A C5  1 
HETATM 4573 C C6  . NAG F 3 .   ? -20.773 55.666 -45.873 1.00 139.27 ? 804 NAG A C6  1 
HETATM 4574 C C7  . NAG F 3 .   ? -26.809 53.452 -43.965 1.00 135.82 ? 804 NAG A C7  1 
HETATM 4575 C C8  . NAG F 3 .   ? -27.889 53.280 -42.926 1.00 129.31 ? 804 NAG A C8  1 
HETATM 4576 N N2  . NAG F 3 .   ? -25.771 54.238 -43.652 1.00 135.21 ? 804 NAG A N2  1 
HETATM 4577 O O3  . NAG F 3 .   ? -24.134 52.201 -44.925 1.00 137.51 ? 804 NAG A O3  1 
HETATM 4578 O O4  . NAG F 3 .   ? -21.315 52.938 -45.038 1.00 134.17 ? 804 NAG A O4  1 
HETATM 4579 O O5  . NAG F 3 .   ? -23.046 56.132 -45.296 1.00 139.19 ? 804 NAG A O5  1 
HETATM 4580 O O6  . NAG F 3 .   ? -21.028 56.941 -46.433 1.00 144.22 ? 804 NAG A O6  1 
HETATM 4581 O O7  . NAG F 3 .   ? -26.897 52.876 -45.058 1.00 137.98 ? 804 NAG A O7  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   85  ?   ?   ?   A . n 
A 1 2   GLN 2   86  ?   ?   ?   A . n 
A 1 3   PRO 3   87  ?   ?   ?   A . n 
A 1 4   GLU 4   88  88  GLU GLU A . n 
A 1 5   PRO 5   89  89  PRO PRO A . n 
A 1 6   ILE 6   90  90  ILE ILE A . n 
A 1 7   LYS 7   91  91  LYS LYS A . n 
A 1 8   VAL 8   92  92  VAL VAL A . n 
A 1 9   TYR 9   93  93  TYR TYR A . n 
A 1 10  GLY 10  94  94  GLY GLY A . n 
A 1 11  GLN 11  95  95  GLN GLN A . n 
A 1 12  VAL 12  96  96  VAL VAL A . n 
A 1 13  SER 13  97  97  SER SER A . n 
A 1 14  LEU 14  98  98  LEU LEU A . n 
A 1 15  ASN 15  99  99  ASN ASN A . n 
A 1 16  ASP 16  100 100 ASP ASP A . n 
A 1 17  SER 17  101 101 SER SER A . n 
A 1 18  HIS 18  102 102 HIS HIS A . n 
A 1 19  ASN 19  103 103 ASN ASN A . n 
A 1 20  GLN 20  104 104 GLN GLN A . n 
A 1 21  MET 21  105 105 MET MET A . n 
A 1 22  VAL 22  106 106 VAL VAL A . n 
A 1 23  VAL 23  107 107 VAL VAL A . n 
A 1 24  HIS 24  108 108 HIS HIS A . n 
A 1 25  TRP 25  109 109 TRP TRP A . n 
A 1 26  ALA 26  110 110 ALA ALA A . n 
A 1 27  GLY 27  111 111 GLY GLY A . n 
A 1 28  GLU 28  112 112 GLU GLU A . n 
A 1 29  LYS 29  113 113 LYS LYS A . n 
A 1 30  SER 30  114 114 SER SER A . n 
A 1 31  ASN 31  115 115 ASN ASN A . n 
A 1 32  VAL 32  116 116 VAL VAL A . n 
A 1 33  ILE 33  117 117 ILE ILE A . n 
A 1 34  VAL 34  118 118 VAL VAL A . n 
A 1 35  ALA 35  119 119 ALA ALA A . n 
A 1 36  LEU 36  120 120 LEU LEU A . n 
A 1 37  ALA 37  121 121 ALA ALA A . n 
A 1 38  ARG 38  122 122 ARG ARG A . n 
A 1 39  ASP 39  123 123 ASP ASP A . n 
A 1 40  SER 40  124 124 SER SER A . n 
A 1 41  LEU 41  125 125 LEU LEU A . n 
A 1 42  ALA 42  126 ?   ?   ?   A . n 
A 1 43  LEU 43  127 ?   ?   ?   A . n 
A 1 44  ALA 44  128 ?   ?   ?   A . n 
A 1 45  ARG 45  129 ?   ?   ?   A . n 
A 1 46  PRO 46  130 130 PRO PRO A . n 
A 1 47  LYS 47  131 131 LYS LYS A . n 
A 1 48  SER 48  132 132 SER SER A . n 
A 1 49  SER 49  133 133 SER SER A . n 
A 1 50  ASP 50  134 134 ASP ASP A . n 
A 1 51  VAL 51  135 135 VAL VAL A . n 
A 1 52  TYR 52  136 136 TYR TYR A . n 
A 1 53  VAL 53  137 137 VAL VAL A . n 
A 1 54  SER 54  138 138 SER SER A . n 
A 1 55  TYR 55  139 139 TYR TYR A . n 
A 1 56  ASP 56  140 140 ASP ASP A . n 
A 1 57  TYR 57  141 141 TYR TYR A . n 
A 1 58  GLY 58  142 142 GLY GLY A . n 
A 1 59  LYS 59  143 143 LYS LYS A . n 
A 1 60  SER 60  144 144 SER SER A . n 
A 1 61  PHE 61  145 145 PHE PHE A . n 
A 1 62  LYS 62  146 146 LYS LYS A . n 
A 1 63  LYS 63  147 147 LYS LYS A . n 
A 1 64  ILE 64  148 148 ILE ILE A . n 
A 1 65  SER 65  149 149 SER SER A . n 
A 1 66  ASP 66  150 150 ASP ASP A . n 
A 1 67  LYS 67  151 151 LYS LYS A . n 
A 1 68  LEU 68  152 152 LEU LEU A . n 
A 1 69  ASN 69  153 153 ASN ASN A . n 
A 1 70  PHE 70  154 154 PHE PHE A . n 
A 1 71  GLY 71  155 155 GLY GLY A . n 
A 1 72  LEU 72  156 156 LEU LEU A . n 
A 1 73  GLY 73  157 157 GLY GLY A . n 
A 1 74  ASN 74  158 158 ASN ASN A . n 
A 1 75  ARG 75  159 159 ARG ARG A . n 
A 1 76  SER 76  160 160 SER SER A . n 
A 1 77  GLU 77  161 161 GLU GLU A . n 
A 1 78  ALA 78  162 162 ALA ALA A . n 
A 1 79  VAL 79  163 163 VAL VAL A . n 
A 1 80  ILE 80  164 164 ILE ILE A . n 
A 1 81  ALA 81  165 165 ALA ALA A . n 
A 1 82  GLN 82  166 166 GLN GLN A . n 
A 1 83  PHE 83  167 167 PHE PHE A . n 
A 1 84  TYR 84  168 168 TYR TYR A . n 
A 1 85  HIS 85  169 169 HIS HIS A . n 
A 1 86  SER 86  170 170 SER SER A . n 
A 1 87  PRO 87  171 171 PRO PRO A . n 
A 1 88  ALA 88  172 172 ALA ALA A . n 
A 1 89  ASP 89  173 173 ASP ASP A . n 
A 1 90  ASN 90  174 174 ASN ASN A . n 
A 1 91  LYS 91  175 175 LYS LYS A . n 
A 1 92  ARG 92  176 176 ARG ARG A . n 
A 1 93  TYR 93  177 177 TYR TYR A . n 
A 1 94  ILE 94  178 178 ILE ILE A . n 
A 1 95  PHE 95  179 179 PHE PHE A . n 
A 1 96  ALA 96  180 180 ALA ALA A . n 
A 1 97  ASP 97  181 181 ASP ASP A . n 
A 1 98  ALA 98  182 182 ALA ALA A . n 
A 1 99  TYR 99  183 183 TYR TYR A . n 
A 1 100 ALA 100 184 184 ALA ALA A . n 
A 1 101 GLN 101 185 185 GLN GLN A . n 
A 1 102 TYR 102 186 186 TYR TYR A . n 
A 1 103 LEU 103 187 187 LEU LEU A . n 
A 1 104 TRP 104 188 188 TRP TRP A . n 
A 1 105 ILE 105 189 189 ILE ILE A . n 
A 1 106 THR 106 190 190 THR THR A . n 
A 1 107 PHE 107 191 191 PHE PHE A . n 
A 1 108 ASP 108 192 192 ASP ASP A . n 
A 1 109 PHE 109 193 193 PHE PHE A . n 
A 1 110 CYS 110 194 194 CYS CYS A . n 
A 1 111 ASN 111 195 195 ASN ASN A . n 
A 1 112 THR 112 196 196 THR THR A . n 
A 1 113 LEU 113 197 197 LEU LEU A . n 
A 1 114 GLN 114 198 198 GLN GLN A . n 
A 1 115 GLY 115 199 199 GLY GLY A . n 
A 1 116 PHE 116 200 200 PHE PHE A . n 
A 1 117 SER 117 201 201 SER SER A . n 
A 1 118 ILE 118 202 202 ILE ILE A . n 
A 1 119 PRO 119 203 203 PRO PRO A . n 
A 1 120 PHE 120 204 204 PHE PHE A . n 
A 1 121 ARG 121 205 205 ARG ARG A . n 
A 1 122 ALA 122 206 206 ALA ALA A . n 
A 1 123 ALA 123 207 207 ALA ALA A . n 
A 1 124 ASP 124 208 208 ASP ASP A . n 
A 1 125 LEU 125 209 209 LEU LEU A . n 
A 1 126 LEU 126 210 210 LEU LEU A . n 
A 1 127 LEU 127 211 211 LEU LEU A . n 
A 1 128 HIS 128 212 212 HIS HIS A . n 
A 1 129 SER 129 213 213 SER SER A . n 
A 1 130 LYS 130 214 214 LYS LYS A . n 
A 1 131 ALA 131 215 215 ALA ALA A . n 
A 1 132 SER 132 216 216 SER SER A . n 
A 1 133 ASN 133 217 217 ASN ASN A . n 
A 1 134 LEU 134 218 218 LEU LEU A . n 
A 1 135 LEU 135 219 219 LEU LEU A . n 
A 1 136 LEU 136 220 220 LEU LEU A . n 
A 1 137 GLY 137 221 221 GLY GLY A . n 
A 1 138 PHE 138 222 222 PHE PHE A . n 
A 1 139 ASP 139 223 223 ASP ASP A . n 
A 1 140 ARG 140 224 224 ARG ARG A . n 
A 1 141 SER 141 225 225 SER SER A . n 
A 1 142 HIS 142 226 226 HIS HIS A . n 
A 1 143 PRO 143 227 227 PRO PRO A . n 
A 1 144 ASN 144 228 228 ASN ASN A . n 
A 1 145 LYS 145 229 229 LYS LYS A . n 
A 1 146 GLN 146 230 230 GLN GLN A . n 
A 1 147 LEU 147 231 231 LEU LEU A . n 
A 1 148 TRP 148 232 232 TRP TRP A . n 
A 1 149 LYS 149 233 233 LYS LYS A . n 
A 1 150 SER 150 234 234 SER SER A . n 
A 1 151 ASP 151 235 235 ASP ASP A . n 
A 1 152 ASP 152 236 236 ASP ASP A . n 
A 1 153 PHE 153 237 237 PHE PHE A . n 
A 1 154 GLY 154 238 238 GLY GLY A . n 
A 1 155 GLN 155 239 239 GLN GLN A . n 
A 1 156 THR 156 240 240 THR THR A . n 
A 1 157 TRP 157 241 241 TRP TRP A . n 
A 1 158 ILE 158 242 242 ILE ILE A . n 
A 1 159 MET 159 243 243 MET MET A . n 
A 1 160 ILE 160 244 244 ILE ILE A . n 
A 1 161 GLN 161 245 245 GLN GLN A . n 
A 1 162 GLU 162 246 246 GLU GLU A . n 
A 1 163 HIS 163 247 247 HIS HIS A . n 
A 1 164 VAL 164 248 248 VAL VAL A . n 
A 1 165 LYS 165 249 249 LYS LYS A . n 
A 1 166 SER 166 250 250 SER SER A . n 
A 1 167 PHE 167 251 251 PHE PHE A . n 
A 1 168 SER 168 252 252 SER SER A . n 
A 1 169 TRP 169 253 253 TRP TRP A . n 
A 1 170 GLY 170 254 254 GLY GLY A . n 
A 1 171 ILE 171 255 255 ILE ILE A . n 
A 1 172 ASP 172 256 256 ASP ASP A . n 
A 1 173 PRO 173 257 257 PRO PRO A . n 
A 1 174 TYR 174 258 258 TYR TYR A . n 
A 1 175 ASP 175 259 259 ASP ASP A . n 
A 1 176 LYS 176 260 260 LYS LYS A . n 
A 1 177 PRO 177 261 261 PRO PRO A . n 
A 1 178 ASN 178 262 262 ASN ASN A . n 
A 1 179 THR 179 263 263 THR THR A . n 
A 1 180 ILE 180 264 264 ILE ILE A . n 
A 1 181 TYR 181 265 265 TYR TYR A . n 
A 1 182 ILE 182 266 266 ILE ILE A . n 
A 1 183 GLU 183 267 267 GLU GLU A . n 
A 1 184 ARG 184 268 268 ARG ARG A . n 
A 1 185 HIS 185 269 269 HIS HIS A . n 
A 1 186 GLU 186 270 270 GLU GLU A . n 
A 1 187 PRO 187 271 271 PRO PRO A . n 
A 1 188 SER 188 272 272 SER SER A . n 
A 1 189 GLY 189 273 273 GLY GLY A . n 
A 1 190 TYR 190 274 274 TYR TYR A . n 
A 1 191 SER 191 275 275 SER SER A . n 
A 1 192 THR 192 276 276 THR THR A . n 
A 1 193 VAL 193 277 277 VAL VAL A . n 
A 1 194 PHE 194 278 278 PHE PHE A . n 
A 1 195 ARG 195 279 279 ARG ARG A . n 
A 1 196 SER 196 280 280 SER SER A . n 
A 1 197 THR 197 281 281 THR THR A . n 
A 1 198 ASP 198 282 282 ASP ASP A . n 
A 1 199 PHE 199 283 283 PHE PHE A . n 
A 1 200 PHE 200 284 284 PHE PHE A . n 
A 1 201 GLN 201 285 285 GLN GLN A . n 
A 1 202 SER 202 286 286 SER SER A . n 
A 1 203 ARG 203 287 287 ARG ARG A . n 
A 1 204 GLU 204 288 288 GLU GLU A . n 
A 1 205 ASN 205 289 289 ASN ASN A . n 
A 1 206 GLN 206 290 290 GLN GLN A . n 
A 1 207 GLU 207 291 291 GLU GLU A . n 
A 1 208 VAL 208 292 292 VAL VAL A . n 
A 1 209 ILE 209 293 293 ILE ILE A . n 
A 1 210 LEU 210 294 294 LEU LEU A . n 
A 1 211 GLU 211 295 295 GLU GLU A . n 
A 1 212 GLU 212 296 296 GLU GLU A . n 
A 1 213 VAL 213 297 297 VAL VAL A . n 
A 1 214 ARG 214 298 298 ARG ARG A . n 
A 1 215 ASP 215 299 299 ASP ASP A . n 
A 1 216 PHE 216 300 300 PHE PHE A . n 
A 1 217 GLN 217 301 301 GLN GLN A . n 
A 1 218 LEU 218 302 302 LEU LEU A . n 
A 1 219 ARG 219 303 303 ARG ARG A . n 
A 1 220 ASP 220 304 304 ASP ASP A . n 
A 1 221 LYS 221 305 305 LYS LYS A . n 
A 1 222 TYR 222 306 306 TYR TYR A . n 
A 1 223 MET 223 307 307 MET MET A . n 
A 1 224 PHE 224 308 308 PHE PHE A . n 
A 1 225 ALA 225 309 309 ALA ALA A . n 
A 1 226 THR 226 310 310 THR THR A . n 
A 1 227 LYS 227 311 311 LYS LYS A . n 
A 1 228 VAL 228 312 312 VAL VAL A . n 
A 1 229 VAL 229 313 313 VAL VAL A . n 
A 1 230 HIS 230 314 314 HIS HIS A . n 
A 1 231 LEU 231 315 315 LEU LEU A . n 
A 1 232 LEU 232 316 316 LEU LEU A . n 
A 1 233 GLY 233 317 317 GLY GLY A . n 
A 1 234 SER 234 318 318 SER SER A . n 
A 1 235 GLU 235 319 ?   ?   ?   A . n 
A 1 236 GLN 236 320 ?   ?   ?   A . n 
A 1 237 GLN 237 321 ?   ?   ?   A . n 
A 1 238 SER 238 322 ?   ?   ?   A . n 
A 1 239 SER 239 323 ?   ?   ?   A . n 
A 1 240 VAL 240 324 ?   ?   ?   A . n 
A 1 241 GLN 241 325 ?   ?   ?   A . n 
A 1 242 LEU 242 326 326 LEU LEU A . n 
A 1 243 TRP 243 327 327 TRP TRP A . n 
A 1 244 VAL 244 328 328 VAL VAL A . n 
A 1 245 SER 245 329 329 SER SER A . n 
A 1 246 PHE 246 330 330 PHE PHE A . n 
A 1 247 GLY 247 331 331 GLY GLY A . n 
A 1 248 ARG 248 332 332 ARG ARG A . n 
A 1 249 LYS 249 333 333 LYS LYS A . n 
A 1 250 PRO 250 334 334 PRO PRO A . n 
A 1 251 MET 251 335 335 MET MET A . n 
A 1 252 ARG 252 336 336 ARG ARG A . n 
A 1 253 ALA 253 337 337 ALA ALA A . n 
A 1 254 ALA 254 338 338 ALA ALA A . n 
A 1 255 GLN 255 339 339 GLN GLN A . n 
A 1 256 PHE 256 340 340 PHE PHE A . n 
A 1 257 VAL 257 341 341 VAL VAL A . n 
A 1 258 THR 258 342 342 THR THR A . n 
A 1 259 ARG 259 343 343 ARG ARG A . n 
A 1 260 HIS 260 344 344 HIS HIS A . n 
A 1 261 PRO 261 345 345 PRO PRO A . n 
A 1 262 ILE 262 346 346 ILE ILE A . n 
A 1 263 ASN 263 347 347 ASN ASN A . n 
A 1 264 GLU 264 348 348 GLU GLU A . n 
A 1 265 TYR 265 349 349 TYR TYR A . n 
A 1 266 TYR 266 350 350 TYR TYR A . n 
A 1 267 ILE 267 351 351 ILE ILE A . n 
A 1 268 ALA 268 352 352 ALA ALA A . n 
A 1 269 ASP 269 353 353 ASP ASP A . n 
A 1 270 ALA 270 354 354 ALA ALA A . n 
A 1 271 SER 271 355 355 SER SER A . n 
A 1 272 GLU 272 356 356 GLU GLU A . n 
A 1 273 ASP 273 357 357 ASP ASP A . n 
A 1 274 GLN 274 358 358 GLN GLN A . n 
A 1 275 VAL 275 359 359 VAL VAL A . n 
A 1 276 PHE 276 360 360 PHE PHE A . n 
A 1 277 VAL 277 361 361 VAL VAL A . n 
A 1 278 CYS 278 362 362 CYS CYS A . n 
A 1 279 VAL 279 363 363 VAL VAL A . n 
A 1 280 SER 280 364 364 SER SER A . n 
A 1 281 HIS 281 365 365 HIS HIS A . n 
A 1 282 SER 282 366 366 SER SER A . n 
A 1 283 ASN 283 367 367 ASN ASN A . n 
A 1 284 ASN 284 368 368 ASN ASN A . n 
A 1 285 ARG 285 369 369 ARG ARG A . n 
A 1 286 THR 286 370 370 THR THR A . n 
A 1 287 ASN 287 371 371 ASN ASN A . n 
A 1 288 LEU 288 372 372 LEU LEU A . n 
A 1 289 TYR 289 373 373 TYR TYR A . n 
A 1 290 ILE 290 374 374 ILE ILE A . n 
A 1 291 SER 291 375 375 SER SER A . n 
A 1 292 GLU 292 376 376 GLU GLU A . n 
A 1 293 ALA 293 377 ?   ?   ?   A . n 
A 1 294 GLU 294 378 ?   ?   ?   A . n 
A 1 295 GLY 295 379 ?   ?   ?   A . n 
A 1 296 LEU 296 380 ?   ?   ?   A . n 
A 1 297 LYS 297 381 381 LYS LYS A . n 
A 1 298 PHE 298 382 382 PHE PHE A . n 
A 1 299 SER 299 383 383 SER SER A . n 
A 1 300 LEU 300 384 384 LEU LEU A . n 
A 1 301 SER 301 385 385 SER SER A . n 
A 1 302 LEU 302 386 386 LEU LEU A . n 
A 1 303 GLU 303 387 387 GLU GLU A . n 
A 1 304 ASN 304 388 388 ASN ASN A . n 
A 1 305 VAL 305 389 389 VAL VAL A . n 
A 1 306 LEU 306 390 390 LEU LEU A . n 
A 1 307 TYR 307 391 391 TYR TYR A . n 
A 1 308 TYR 308 392 392 TYR TYR A . n 
A 1 309 SER 309 393 393 SER SER A . n 
A 1 310 PRO 310 394 394 PRO PRO A . n 
A 1 311 GLY 311 395 395 GLY GLY A . n 
A 1 312 GLY 312 396 396 GLY GLY A . n 
A 1 313 ALA 313 397 397 ALA ALA A . n 
A 1 314 GLY 314 398 398 GLY GLY A . n 
A 1 315 SER 315 399 399 SER SER A . n 
A 1 316 ASP 316 400 400 ASP ASP A . n 
A 1 317 THR 317 401 401 THR THR A . n 
A 1 318 LEU 318 402 402 LEU LEU A . n 
A 1 319 VAL 319 403 403 VAL VAL A . n 
A 1 320 ARG 320 404 404 ARG ARG A . n 
A 1 321 TYR 321 405 405 TYR TYR A . n 
A 1 322 PHE 322 406 406 PHE PHE A . n 
A 1 323 ALA 323 407 407 ALA ALA A . n 
A 1 324 ASN 324 408 408 ASN ASN A . n 
A 1 325 GLU 325 409 409 GLU GLU A . n 
A 1 326 PRO 326 410 410 PRO PRO A . n 
A 1 327 PHE 327 411 411 PHE PHE A . n 
A 1 328 ALA 328 412 412 ALA ALA A . n 
A 1 329 ASP 329 413 413 ASP ASP A . n 
A 1 330 PHE 330 414 414 PHE PHE A . n 
A 1 331 HIS 331 415 415 HIS HIS A . n 
A 1 332 ARG 332 416 416 ARG ARG A . n 
A 1 333 VAL 333 417 417 VAL VAL A . n 
A 1 334 GLU 334 418 418 GLU GLU A . n 
A 1 335 GLY 335 419 419 GLY GLY A . n 
A 1 336 LEU 336 420 420 LEU LEU A . n 
A 1 337 GLN 337 421 421 GLN GLN A . n 
A 1 338 GLY 338 422 422 GLY GLY A . n 
A 1 339 VAL 339 423 423 VAL VAL A . n 
A 1 340 TYR 340 424 424 TYR TYR A . n 
A 1 341 ILE 341 425 425 ILE ILE A . n 
A 1 342 ALA 342 426 426 ALA ALA A . n 
A 1 343 THR 343 427 427 THR THR A . n 
A 1 344 LEU 344 428 428 LEU LEU A . n 
A 1 345 ILE 345 429 429 ILE ILE A . n 
A 1 346 ASN 346 430 430 ASN ASN A . n 
A 1 347 GLY 347 431 431 GLY GLY A . n 
A 1 348 SER 348 432 ?   ?   ?   A . n 
A 1 349 MET 349 433 ?   ?   ?   A . n 
A 1 350 ASN 350 434 ?   ?   ?   A . n 
A 1 351 GLU 351 435 ?   ?   ?   A . n 
A 1 352 GLU 352 436 ?   ?   ?   A . n 
A 1 353 ASN 353 437 437 ASN ASN A . n 
A 1 354 MET 354 438 438 MET MET A . n 
A 1 355 ARG 355 439 439 ARG ARG A . n 
A 1 356 SER 356 440 440 SER SER A . n 
A 1 357 VAL 357 441 441 VAL VAL A . n 
A 1 358 ILE 358 442 442 ILE ILE A . n 
A 1 359 THR 359 443 443 THR THR A . n 
A 1 360 PHE 360 444 444 PHE PHE A . n 
A 1 361 ASP 361 445 445 ASP ASP A . n 
A 1 362 LYS 362 446 446 LYS LYS A . n 
A 1 363 GLY 363 447 447 GLY GLY A . n 
A 1 364 GLY 364 448 448 GLY GLY A . n 
A 1 365 THR 365 449 449 THR THR A . n 
A 1 366 TRP 366 450 450 TRP TRP A . n 
A 1 367 GLU 367 451 451 GLU GLU A . n 
A 1 368 PHE 368 452 452 PHE PHE A . n 
A 1 369 LEU 369 453 453 LEU LEU A . n 
A 1 370 GLN 370 454 454 GLN GLN A . n 
A 1 371 ALA 371 455 455 ALA ALA A . n 
A 1 372 PRO 372 456 456 PRO PRO A . n 
A 1 373 ALA 373 457 457 ALA ALA A . n 
A 1 374 PHE 374 458 458 PHE PHE A . n 
A 1 375 THR 375 459 459 THR THR A . n 
A 1 376 GLY 376 460 460 GLY GLY A . n 
A 1 377 TYR 377 461 ?   ?   ?   A . n 
A 1 378 GLY 378 462 ?   ?   ?   A . n 
A 1 379 GLU 379 463 ?   ?   ?   A . n 
A 1 380 LYS 380 464 464 LYS LYS A . n 
A 1 381 ILE 381 465 465 ILE ILE A . n 
A 1 382 ASN 382 466 466 ASN ASN A . n 
A 1 383 CYS 383 467 467 CYS CYS A . n 
A 1 384 GLU 384 468 468 GLU GLU A . n 
A 1 385 LEU 385 469 469 LEU LEU A . n 
A 1 386 SER 386 470 470 SER SER A . n 
A 1 387 GLN 387 471 471 GLN GLN A . n 
A 1 388 GLY 388 472 472 GLY GLY A . n 
A 1 389 CYS 389 473 473 CYS CYS A . n 
A 1 390 SER 390 474 474 SER SER A . n 
A 1 391 LEU 391 475 475 LEU LEU A . n 
A 1 392 HIS 392 476 476 HIS HIS A . n 
A 1 393 LEU 393 477 477 LEU LEU A . n 
A 1 394 ALA 394 478 478 ALA ALA A . n 
A 1 395 GLN 395 479 479 GLN GLN A . n 
A 1 396 ARG 396 480 480 ARG ARG A . n 
A 1 397 LEU 397 481 481 LEU LEU A . n 
A 1 398 SER 398 482 482 SER SER A . n 
A 1 399 GLN 399 483 483 GLN GLN A . n 
A 1 400 LEU 400 484 484 LEU LEU A . n 
A 1 401 LEU 401 485 485 LEU LEU A . n 
A 1 402 ASN 402 486 486 ASN ASN A . n 
A 1 403 LEU 403 487 487 LEU LEU A . n 
A 1 404 GLN 404 488 488 GLN GLN A . n 
A 1 405 LEU 405 489 489 LEU LEU A . n 
A 1 406 ARG 406 490 490 ARG ARG A . n 
A 1 407 ARG 407 491 491 ARG ARG A . n 
A 1 408 MET 408 492 492 MET MET A . n 
A 1 409 PRO 409 493 493 PRO PRO A . n 
A 1 410 ILE 410 494 494 ILE ILE A . n 
A 1 411 LEU 411 495 495 LEU LEU A . n 
A 1 412 SER 412 496 496 SER SER A . n 
A 1 413 LYS 413 497 497 LYS LYS A . n 
A 1 414 GLU 414 498 498 GLU GLU A . n 
A 1 415 SER 415 499 499 SER SER A . n 
A 1 416 ALA 416 500 500 ALA ALA A . n 
A 1 417 PRO 417 501 501 PRO PRO A . n 
A 1 418 GLY 418 502 502 GLY GLY A . n 
A 1 419 LEU 419 503 503 LEU LEU A . n 
A 1 420 ILE 420 504 504 ILE ILE A . n 
A 1 421 ILE 421 505 505 ILE ILE A . n 
A 1 422 ALA 422 506 506 ALA ALA A . n 
A 1 423 THR 423 507 507 THR THR A . n 
A 1 424 GLY 424 508 508 GLY GLY A . n 
A 1 425 SER 425 509 509 SER SER A . n 
A 1 426 VAL 426 510 510 VAL VAL A . n 
A 1 427 GLY 427 511 511 GLY GLY A . n 
A 1 428 LYS 428 512 512 LYS LYS A . n 
A 1 429 ASN 429 513 513 ASN ASN A . n 
A 1 430 LEU 430 514 514 LEU LEU A . n 
A 1 431 ALA 431 515 515 ALA ALA A . n 
A 1 432 SER 432 516 516 SER SER A . n 
A 1 433 LYS 433 517 517 LYS LYS A . n 
A 1 434 THR 434 518 518 THR THR A . n 
A 1 435 ASN 435 519 519 ASN ASN A . n 
A 1 436 VAL 436 520 520 VAL VAL A . n 
A 1 437 TYR 437 521 521 TYR TYR A . n 
A 1 438 ILE 438 522 522 ILE ILE A . n 
A 1 439 SER 439 523 523 SER SER A . n 
A 1 440 SER 440 524 524 SER SER A . n 
A 1 441 SER 441 525 525 SER SER A . n 
A 1 442 ALA 442 526 526 ALA ALA A . n 
A 1 443 GLY 443 527 527 GLY GLY A . n 
A 1 444 ALA 444 528 528 ALA ALA A . n 
A 1 445 ARG 445 529 529 ARG ARG A . n 
A 1 446 TRP 446 530 530 TRP TRP A . n 
A 1 447 ARG 447 531 531 ARG ARG A . n 
A 1 448 GLU 448 532 532 GLU GLU A . n 
A 1 449 ALA 449 533 533 ALA ALA A . n 
A 1 450 LEU 450 534 534 LEU LEU A . n 
A 1 451 PRO 451 535 535 PRO PRO A . n 
A 1 452 GLY 452 536 536 GLY GLY A . n 
A 1 453 PRO 453 537 537 PRO PRO A . n 
A 1 454 HIS 454 538 538 HIS HIS A . n 
A 1 455 TYR 455 539 539 TYR TYR A . n 
A 1 456 TYR 456 540 540 TYR TYR A . n 
A 1 457 THR 457 541 541 THR THR A . n 
A 1 458 TRP 458 542 542 TRP TRP A . n 
A 1 459 GLY 459 543 543 GLY GLY A . n 
A 1 460 ASP 460 544 544 ASP ASP A . n 
A 1 461 HIS 461 545 545 HIS HIS A . n 
A 1 462 GLY 462 546 546 GLY GLY A . n 
A 1 463 GLY 463 547 547 GLY GLY A . n 
A 1 464 ILE 464 548 548 ILE ILE A . n 
A 1 465 ILE 465 549 549 ILE ILE A . n 
A 1 466 THR 466 550 550 THR THR A . n 
A 1 467 ALA 467 551 551 ALA ALA A . n 
A 1 468 ILE 468 552 552 ILE ILE A . n 
A 1 469 ALA 469 553 553 ALA ALA A . n 
A 1 470 GLN 470 554 554 GLN GLN A . n 
A 1 471 GLY 471 555 555 GLY GLY A . n 
A 1 472 MET 472 556 556 MET MET A . n 
A 1 473 GLU 473 557 557 GLU GLU A . n 
A 1 474 THR 474 558 558 THR THR A . n 
A 1 475 ASN 475 559 559 ASN ASN A . n 
A 1 476 GLU 476 560 560 GLU GLU A . n 
A 1 477 LEU 477 561 561 LEU LEU A . n 
A 1 478 LYS 478 562 562 LYS LYS A . n 
A 1 479 TYR 479 563 563 TYR TYR A . n 
A 1 480 SER 480 564 564 SER SER A . n 
A 1 481 THR 481 565 565 THR THR A . n 
A 1 482 ASN 482 566 566 ASN ASN A . n 
A 1 483 GLU 483 567 567 GLU GLU A . n 
A 1 484 GLY 484 568 568 GLY GLY A . n 
A 1 485 GLU 485 569 569 GLU GLU A . n 
A 1 486 THR 486 570 570 THR THR A . n 
A 1 487 TRP 487 571 571 TRP TRP A . n 
A 1 488 LYS 488 572 572 LYS LYS A . n 
A 1 489 THR 489 573 573 THR THR A . n 
A 1 490 PHE 490 574 574 PHE PHE A . n 
A 1 491 ILE 491 575 575 ILE ILE A . n 
A 1 492 PHE 492 576 576 PHE PHE A . n 
A 1 493 SER 493 577 577 SER SER A . n 
A 1 494 GLU 494 578 578 GLU GLU A . n 
A 1 495 LYS 495 579 579 LYS LYS A . n 
A 1 496 PRO 496 580 580 PRO PRO A . n 
A 1 497 VAL 497 581 581 VAL VAL A . n 
A 1 498 PHE 498 582 582 PHE PHE A . n 
A 1 499 VAL 499 583 583 VAL VAL A . n 
A 1 500 TYR 500 584 584 TYR TYR A . n 
A 1 501 GLY 501 585 585 GLY GLY A . n 
A 1 502 LEU 502 586 586 LEU LEU A . n 
A 1 503 LEU 503 587 587 LEU LEU A . n 
A 1 504 THR 504 588 588 THR THR A . n 
A 1 505 GLU 505 589 589 GLU GLU A . n 
A 1 506 PRO 506 590 590 PRO PRO A . n 
A 1 507 GLY 507 591 591 GLY GLY A . n 
A 1 508 GLU 508 592 592 GLU GLU A . n 
A 1 509 LYS 509 593 593 LYS LYS A . n 
A 1 510 SER 510 594 594 SER SER A . n 
A 1 511 THR 511 595 595 THR THR A . n 
A 1 512 VAL 512 596 596 VAL VAL A . n 
A 1 513 PHE 513 597 597 PHE PHE A . n 
A 1 514 THR 514 598 598 THR THR A . n 
A 1 515 ILE 515 599 599 ILE ILE A . n 
A 1 516 PHE 516 600 600 PHE PHE A . n 
A 1 517 GLY 517 601 601 GLY GLY A . n 
A 1 518 SER 518 602 602 SER SER A . n 
A 1 519 ASN 519 603 603 ASN ASN A . n 
A 1 520 LYS 520 604 604 LYS LYS A . n 
A 1 521 GLU 521 605 605 GLU GLU A . n 
A 1 522 ASN 522 606 606 ASN ASN A . n 
A 1 523 VAL 523 607 607 VAL VAL A . n 
A 1 524 HIS 524 608 608 HIS HIS A . n 
A 1 525 SER 525 609 609 SER SER A . n 
A 1 526 TRP 526 610 610 TRP TRP A . n 
A 1 527 LEU 527 611 611 LEU LEU A . n 
A 1 528 ILE 528 612 612 ILE ILE A . n 
A 1 529 LEU 529 613 613 LEU LEU A . n 
A 1 530 GLN 530 614 614 GLN GLN A . n 
A 1 531 VAL 531 615 615 VAL VAL A . n 
A 1 532 ASN 532 616 616 ASN ASN A . n 
A 1 533 ALA 533 617 617 ALA ALA A . n 
A 1 534 THR 534 618 618 THR THR A . n 
A 1 535 ASP 535 619 619 ASP ASP A . n 
A 1 536 ALA 536 620 620 ALA ALA A . n 
A 1 537 LEU 537 621 621 LEU LEU A . n 
A 1 538 GLY 538 622 622 GLY GLY A . n 
A 1 539 VAL 539 623 623 VAL VAL A . n 
A 1 540 PRO 540 624 624 PRO PRO A . n 
A 1 541 CYS 541 625 625 CYS CYS A . n 
A 1 542 THR 542 626 626 THR THR A . n 
A 1 543 GLU 543 627 627 GLU GLU A . n 
A 1 544 ASN 544 628 628 ASN ASN A . n 
A 1 545 ASP 545 629 629 ASP ASP A . n 
A 1 546 TYR 546 630 630 TYR TYR A . n 
A 1 547 LYS 547 631 631 LYS LYS A . n 
A 1 548 LEU 548 632 632 LEU LEU A . n 
A 1 549 TRP 549 633 633 TRP TRP A . n 
A 1 550 SER 550 634 634 SER SER A . n 
A 1 551 PRO 551 635 635 PRO PRO A . n 
A 1 552 SER 552 636 636 SER SER A . n 
A 1 553 ASP 553 637 637 ASP ASP A . n 
A 1 554 GLU 554 638 638 GLU GLU A . n 
A 1 555 ARG 555 639 639 ARG ARG A . n 
A 1 556 GLY 556 640 640 GLY GLY A . n 
A 1 557 ASN 557 641 641 ASN ASN A . n 
A 1 558 GLU 558 642 642 GLU GLU A . n 
A 1 559 CYS 559 643 643 CYS CYS A . n 
A 1 560 LEU 560 644 ?   ?   ?   A . n 
A 1 561 LEU 561 645 ?   ?   ?   A . n 
A 1 562 GLY 562 646 ?   ?   ?   A . n 
A 1 563 HIS 563 647 ?   ?   ?   A . n 
A 1 564 LYS 564 648 648 LYS LYS A . n 
A 1 565 THR 565 649 649 THR THR A . n 
A 1 566 VAL 566 650 650 VAL VAL A . n 
A 1 567 PHE 567 651 651 PHE PHE A . n 
A 1 568 LYS 568 652 652 LYS LYS A . n 
A 1 569 ARG 569 653 653 ARG ARG A . n 
A 1 570 ARG 570 654 654 ARG ARG A . n 
A 1 571 THR 571 655 655 THR THR A . n 
A 1 572 PRO 572 656 656 PRO PRO A . n 
A 1 573 HIS 573 657 657 HIS HIS A . n 
A 1 574 ALA 574 658 658 ALA ALA A . n 
A 1 575 THR 575 659 659 THR THR A . n 
A 1 576 CYS 576 660 660 CYS CYS A . n 
A 1 577 PHE 577 661 661 PHE PHE A . n 
A 1 578 ASN 578 662 662 ASN ASN A . n 
A 1 579 GLY 579 663 663 GLY GLY A . n 
A 1 580 GLU 580 664 664 GLU GLU A . n 
A 1 581 ASP 581 665 665 ASP ASP A . n 
A 1 582 PHE 582 666 666 PHE PHE A . n 
A 1 583 ASP 583 667 667 ASP ASP A . n 
A 1 584 ARG 584 668 668 ARG ARG A . n 
A 1 585 PRO 585 669 669 PRO PRO A . n 
A 1 586 VAL 586 670 670 VAL VAL A . n 
A 1 587 VAL 587 671 671 VAL VAL A . n 
A 1 588 VAL 588 672 672 VAL VAL A . n 
A 1 589 SER 589 673 673 SER SER A . n 
A 1 590 ASN 590 674 674 ASN ASN A . n 
A 1 591 CYS 591 675 675 CYS CYS A . n 
A 1 592 SER 592 676 ?   ?   ?   A . n 
A 1 593 CYS 593 677 ?   ?   ?   A . n 
A 1 594 THR 594 678 ?   ?   ?   A . n 
A 1 595 ARG 595 679 ?   ?   ?   A . n 
A 1 596 GLU 596 680 ?   ?   ?   A . n 
A 1 597 ASP 597 681 ?   ?   ?   A . n 
A 1 598 TYR 598 682 ?   ?   ?   A . n 
A 1 599 GLU 599 683 ?   ?   ?   A . n 
A 1 600 CYS 600 684 ?   ?   ?   A . n 
A 1 601 ASP 601 685 ?   ?   ?   A . n 
A 1 602 PHE 602 686 ?   ?   ?   A . n 
A 1 603 GLY 603 687 ?   ?   ?   A . n 
A 1 604 PHE 604 688 ?   ?   ?   A . n 
A 1 605 LYS 605 689 ?   ?   ?   A . n 
A 1 606 MET 606 690 ?   ?   ?   A . n 
A 1 607 SER 607 691 ?   ?   ?   A . n 
A 1 608 GLU 608 692 ?   ?   ?   A . n 
A 1 609 ASP 609 693 ?   ?   ?   A . n 
A 1 610 LEU 610 694 ?   ?   ?   A . n 
A 1 611 SER 611 695 ?   ?   ?   A . n 
A 1 612 LEU 612 696 ?   ?   ?   A . n 
A 1 613 GLU 613 697 ?   ?   ?   A . n 
A 1 614 VAL 614 698 ?   ?   ?   A . n 
A 1 615 CYS 615 699 ?   ?   ?   A . n 
A 1 616 VAL 616 700 ?   ?   ?   A . n 
A 1 617 PRO 617 701 ?   ?   ?   A . n 
A 1 618 ASP 618 702 ?   ?   ?   A . n 
A 1 619 PRO 619 703 ?   ?   ?   A . n 
A 1 620 GLU 620 704 ?   ?   ?   A . n 
A 1 621 PHE 621 705 ?   ?   ?   A . n 
A 1 622 SER 622 706 ?   ?   ?   A . n 
A 1 623 GLY 623 707 ?   ?   ?   A . n 
A 1 624 LYS 624 708 ?   ?   ?   A . n 
A 1 625 SER 625 709 ?   ?   ?   A . n 
A 1 626 TYR 626 710 ?   ?   ?   A . n 
A 1 627 SER 627 711 ?   ?   ?   A . n 
A 1 628 PRO 628 712 ?   ?   ?   A . n 
A 1 629 PRO 629 713 ?   ?   ?   A . n 
A 1 630 VAL 630 714 ?   ?   ?   A . n 
A 1 631 PRO 631 715 ?   ?   ?   A . n 
A 1 632 CYS 632 716 ?   ?   ?   A . n 
A 1 633 PRO 633 717 ?   ?   ?   A . n 
A 1 634 VAL 634 718 ?   ?   ?   A . n 
A 1 635 GLY 635 719 ?   ?   ?   A . n 
A 1 636 SER 636 720 ?   ?   ?   A . n 
A 1 637 THR 637 721 ?   ?   ?   A . n 
A 1 638 TYR 638 722 ?   ?   ?   A . n 
A 1 639 ARG 639 723 ?   ?   ?   A . n 
A 1 640 ARG 640 724 ?   ?   ?   A . n 
A 1 641 THR 641 725 ?   ?   ?   A . n 
A 1 642 ARG 642 726 ?   ?   ?   A . n 
A 1 643 GLY 643 727 ?   ?   ?   A . n 
A 1 644 TYR 644 728 ?   ?   ?   A . n 
A 1 645 ARG 645 729 ?   ?   ?   A . n 
A 1 646 LYS 646 730 ?   ?   ?   A . n 
A 1 647 ILE 647 731 ?   ?   ?   A . n 
A 1 648 SER 648 732 ?   ?   ?   A . n 
A 1 649 GLY 649 733 ?   ?   ?   A . n 
A 1 650 ASP 650 734 ?   ?   ?   A . n 
A 1 651 THR 651 735 ?   ?   ?   A . n 
A 1 652 CYS 652 736 ?   ?   ?   A . n 
A 1 653 SER 653 737 ?   ?   ?   A . n 
A 1 654 GLY 654 738 ?   ?   ?   A . n 
A 1 655 GLY 655 739 ?   ?   ?   A . n 
A 1 656 ASP 656 740 ?   ?   ?   A . n 
A 1 657 VAL 657 741 ?   ?   ?   A . n 
A 1 658 GLU 658 742 ?   ?   ?   A . n 
A 1 659 ALA 659 743 ?   ?   ?   A . n 
A 1 660 ARG 660 744 ?   ?   ?   A . n 
A 1 661 LEU 661 745 ?   ?   ?   A . n 
A 1 662 GLU 662 746 ?   ?   ?   A . n 
A 1 663 GLY 663 747 ?   ?   ?   A . n 
A 1 664 GLU 664 748 ?   ?   ?   A . n 
A 1 665 LEU 665 749 ?   ?   ?   A . n 
A 1 666 VAL 666 750 ?   ?   ?   A . n 
A 1 667 PRO 667 751 ?   ?   ?   A . n 
A 1 668 CYS 668 752 ?   ?   ?   A . n 
A 1 669 PRO 669 753 ?   ?   ?   A . n 
A 1 670 SER 670 754 ?   ?   ?   A . n 
A 1 671 ARG 671 755 ?   ?   ?   A . n 
A 1 672 LEU 672 756 ?   ?   ?   A . n 
A 1 673 GLU 673 757 ?   ?   ?   A . n 
A 1 674 ASN 674 758 ?   ?   ?   A . n 
A 1 675 LEU 675 759 ?   ?   ?   A . n 
A 1 676 TYR 676 760 ?   ?   ?   A . n 
A 1 677 PHE 677 761 ?   ?   ?   A . n 
A 1 678 GLN 678 762 ?   ?   ?   A . n 
B 2 1   ALA 1   6   ?   ?   ?   C . n 
B 2 2   ALA 2   7   ?   ?   ?   C . n 
B 2 3   ALA 3   8   ?   ?   ?   C . n 
B 2 4   ALA 4   9   9   ALA ALA C . n 
B 2 5   ALA 5   10  10  ALA ALA C . n 
B 2 6   ALA 6   11  11  ALA ALA C . n 
B 2 7   ALA 7   12  12  ALA ALA C . n 
B 2 8   ALA 8   13  13  ALA ALA C . n 
B 2 9   ALA 9   14  14  ALA ALA C . n 
B 2 10  ALA 10  15  15  ALA ALA C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1 801 800 NAG NAG A . 
D 3 NAG 1 802 802 NAG NAG A . 
E 3 NAG 1 803 803 NAG NAG A . 
F 3 NAG 1 804 804 NAG NAG A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 74  A ASN 158 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 346 A ASN 430 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 590 A ASN 674 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 532 A ASN 616 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1790  ? 
1 MORE         9     ? 
1 'SSA (A^2)'  27100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-04 
2 'Structure model' 1 1 2020-01-01 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' 'Derived calculations' 
3 3 'Structure model' 'Data collection'      
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation                  
2  2 'Structure model' struct_conn               
3  2 'Structure model' struct_ref_seq_dif        
4  3 'Structure model' chem_comp                 
5  3 'Structure model' entity                    
6  3 'Structure model' pdbx_chem_comp_identifier 
7  3 'Structure model' pdbx_entity_nonpoly       
8  3 'Structure model' struct_conn               
9  3 'Structure model' struct_site               
10 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'            
2  2 'Structure model' '_citation.page_first'                
3  2 'Structure model' '_citation.page_last'                 
4  2 'Structure model' '_citation.pdbx_database_id_PubMed'   
5  2 'Structure model' '_citation.title'                     
6  2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
7  2 'Structure model' '_struct_ref_seq_dif.details'         
8  3 'Structure model' '_chem_comp.name'                     
9  3 'Structure model' '_chem_comp.type'                     
10 3 'Structure model' '_entity.pdbx_description'            
11 3 'Structure model' '_pdbx_entity_nonpoly.name'           
12 3 'Structure model' '_struct_conn.pdbx_dist_value'        
13 3 'Structure model' '_struct_conn.pdbx_role'              
14 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
15 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
16 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
17 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
UGUIS    'data collection' .                             ? 1 
PHASER   phasing           .                             ? 2 
PHENIX   refinement        '(phenix.refine: 1.8.1_1168)' ? 3 
HKL-2000 'data reduction'  .                             ? 4 
HKL-2000 'data scaling'    .                             ? 5 
# 
_pdbx_entry_details.entry_id                 3WSZ 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'THIS RESIDUE BELONGS TO PROTEIN SEQUENCE, 29TH GLU OF Q92673.' 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 490 ? ? O   C ALA 10  ? ? 1.94 
2 1 ND2 A ASN 519 ? ? O   A PRO 535 ? ? 2.12 
3 1 ND2 A ASN 430 ? ? C2  A NAG 802 ? ? 2.15 
4 1 O   A PRO 345 ? ? ND1 A HIS 365 ? ? 2.17 
5 1 O   A SER 499 ? ? NH1 A ARG 668 ? ? 2.19 
6 1 OG1 A THR 443 ? ? O   A ASP 445 ? ? 2.19 
7 1 OG  A SER 634 ? ? O   A THR 649 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 ND2 A ASN 228 ? ? 1_555 O7  A NAG 801 ? ? 11_555 2.14 
2 1 OG1 A THR 659 ? ? 1_555 OG1 A THR 659 ? ? 4_565  2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 115 ? ? -89.21  34.68   
2  1 SER A 160 ? ? -35.52  135.35  
3  1 ASN A 262 ? ? 69.53   -0.02   
4  1 ASP A 304 ? ? 56.01   -126.42 
5  1 ALA A 309 ? ? -171.83 144.03  
6  1 ASP A 357 ? ? 82.27   -16.91  
7  1 ASN A 430 ? ? -124.79 -81.12  
8  1 ALA A 526 ? ? 58.14   16.22   
9  1 ASN A 559 ? ? -140.28 19.12   
10 1 ALA C 10  ? ? -126.58 -91.08  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLU 85  ? A GLU 1   
2   1 Y 1 A GLN 86  ? A GLN 2   
3   1 Y 1 A PRO 87  ? A PRO 3   
4   1 Y 1 A ALA 126 ? A ALA 42  
5   1 Y 1 A LEU 127 ? A LEU 43  
6   1 Y 1 A ALA 128 ? A ALA 44  
7   1 Y 1 A ARG 129 ? A ARG 45  
8   1 Y 1 A GLU 319 ? A GLU 235 
9   1 Y 1 A GLN 320 ? A GLN 236 
10  1 Y 1 A GLN 321 ? A GLN 237 
11  1 Y 1 A SER 322 ? A SER 238 
12  1 Y 1 A SER 323 ? A SER 239 
13  1 Y 1 A VAL 324 ? A VAL 240 
14  1 Y 1 A GLN 325 ? A GLN 241 
15  1 Y 1 A ALA 377 ? A ALA 293 
16  1 Y 1 A GLU 378 ? A GLU 294 
17  1 Y 1 A GLY 379 ? A GLY 295 
18  1 Y 1 A LEU 380 ? A LEU 296 
19  1 Y 1 A SER 432 ? A SER 348 
20  1 Y 1 A MET 433 ? A MET 349 
21  1 Y 1 A ASN 434 ? A ASN 350 
22  1 Y 1 A GLU 435 ? A GLU 351 
23  1 Y 1 A GLU 436 ? A GLU 352 
24  1 Y 1 A TYR 461 ? A TYR 377 
25  1 Y 1 A GLY 462 ? A GLY 378 
26  1 Y 1 A GLU 463 ? A GLU 379 
27  1 Y 1 A LEU 644 ? A LEU 560 
28  1 Y 1 A LEU 645 ? A LEU 561 
29  1 Y 1 A GLY 646 ? A GLY 562 
30  1 Y 1 A HIS 647 ? A HIS 563 
31  1 Y 1 A SER 676 ? A SER 592 
32  1 Y 1 A CYS 677 ? A CYS 593 
33  1 Y 1 A THR 678 ? A THR 594 
34  1 Y 1 A ARG 679 ? A ARG 595 
35  1 Y 1 A GLU 680 ? A GLU 596 
36  1 Y 1 A ASP 681 ? A ASP 597 
37  1 Y 1 A TYR 682 ? A TYR 598 
38  1 Y 1 A GLU 683 ? A GLU 599 
39  1 Y 1 A CYS 684 ? A CYS 600 
40  1 Y 1 A ASP 685 ? A ASP 601 
41  1 Y 1 A PHE 686 ? A PHE 602 
42  1 Y 1 A GLY 687 ? A GLY 603 
43  1 Y 1 A PHE 688 ? A PHE 604 
44  1 Y 1 A LYS 689 ? A LYS 605 
45  1 Y 1 A MET 690 ? A MET 606 
46  1 Y 1 A SER 691 ? A SER 607 
47  1 Y 1 A GLU 692 ? A GLU 608 
48  1 Y 1 A ASP 693 ? A ASP 609 
49  1 Y 1 A LEU 694 ? A LEU 610 
50  1 Y 1 A SER 695 ? A SER 611 
51  1 Y 1 A LEU 696 ? A LEU 612 
52  1 Y 1 A GLU 697 ? A GLU 613 
53  1 Y 1 A VAL 698 ? A VAL 614 
54  1 Y 1 A CYS 699 ? A CYS 615 
55  1 Y 1 A VAL 700 ? A VAL 616 
56  1 Y 1 A PRO 701 ? A PRO 617 
57  1 Y 1 A ASP 702 ? A ASP 618 
58  1 Y 1 A PRO 703 ? A PRO 619 
59  1 Y 1 A GLU 704 ? A GLU 620 
60  1 Y 1 A PHE 705 ? A PHE 621 
61  1 Y 1 A SER 706 ? A SER 622 
62  1 Y 1 A GLY 707 ? A GLY 623 
63  1 Y 1 A LYS 708 ? A LYS 624 
64  1 Y 1 A SER 709 ? A SER 625 
65  1 Y 1 A TYR 710 ? A TYR 626 
66  1 Y 1 A SER 711 ? A SER 627 
67  1 Y 1 A PRO 712 ? A PRO 628 
68  1 Y 1 A PRO 713 ? A PRO 629 
69  1 Y 1 A VAL 714 ? A VAL 630 
70  1 Y 1 A PRO 715 ? A PRO 631 
71  1 Y 1 A CYS 716 ? A CYS 632 
72  1 Y 1 A PRO 717 ? A PRO 633 
73  1 Y 1 A VAL 718 ? A VAL 634 
74  1 Y 1 A GLY 719 ? A GLY 635 
75  1 Y 1 A SER 720 ? A SER 636 
76  1 Y 1 A THR 721 ? A THR 637 
77  1 Y 1 A TYR 722 ? A TYR 638 
78  1 Y 1 A ARG 723 ? A ARG 639 
79  1 Y 1 A ARG 724 ? A ARG 640 
80  1 Y 1 A THR 725 ? A THR 641 
81  1 Y 1 A ARG 726 ? A ARG 642 
82  1 Y 1 A GLY 727 ? A GLY 643 
83  1 Y 1 A TYR 728 ? A TYR 644 
84  1 Y 1 A ARG 729 ? A ARG 645 
85  1 Y 1 A LYS 730 ? A LYS 646 
86  1 Y 1 A ILE 731 ? A ILE 647 
87  1 Y 1 A SER 732 ? A SER 648 
88  1 Y 1 A GLY 733 ? A GLY 649 
89  1 Y 1 A ASP 734 ? A ASP 650 
90  1 Y 1 A THR 735 ? A THR 651 
91  1 Y 1 A CYS 736 ? A CYS 652 
92  1 Y 1 A SER 737 ? A SER 653 
93  1 Y 1 A GLY 738 ? A GLY 654 
94  1 Y 1 A GLY 739 ? A GLY 655 
95  1 Y 1 A ASP 740 ? A ASP 656 
96  1 Y 1 A VAL 741 ? A VAL 657 
97  1 Y 1 A GLU 742 ? A GLU 658 
98  1 Y 1 A ALA 743 ? A ALA 659 
99  1 Y 1 A ARG 744 ? A ARG 660 
100 1 Y 1 A LEU 745 ? A LEU 661 
101 1 Y 1 A GLU 746 ? A GLU 662 
102 1 Y 1 A GLY 747 ? A GLY 663 
103 1 Y 1 A GLU 748 ? A GLU 664 
104 1 Y 1 A LEU 749 ? A LEU 665 
105 1 Y 1 A VAL 750 ? A VAL 666 
106 1 Y 1 A PRO 751 ? A PRO 667 
107 1 Y 1 A CYS 752 ? A CYS 668 
108 1 Y 1 A PRO 753 ? A PRO 669 
109 1 Y 1 A SER 754 ? A SER 670 
110 1 Y 1 A ARG 755 ? A ARG 671 
111 1 Y 1 A LEU 756 ? A LEU 672 
112 1 Y 1 A GLU 757 ? A GLU 673 
113 1 Y 1 A ASN 758 ? A ASN 674 
114 1 Y 1 A LEU 759 ? A LEU 675 
115 1 Y 1 A TYR 760 ? A TYR 676 
116 1 Y 1 A PHE 761 ? A PHE 677 
117 1 Y 1 A GLN 762 ? A GLN 678 
118 1 Y 1 C ALA 6   ? B ALA 1   
119 1 Y 1 C ALA 7   ? B ALA 2   
120 1 Y 1 C ALA 8   ? B ALA 3   
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        2-acetamido-2-deoxy-beta-D-glucopyranose 
_pdbx_entity_nonpoly.comp_id     NAG 
#