data_3ZUU
# 
_entry.id   3ZUU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ZUU         
PDBE  EBI-49122    
WWPDB D_1290049122 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3ZUT 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'THE STRUCTURE OF OST1 (D160A) KINASE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ZUU 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-20 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yunta, C.'           1 ? 
'Martinez-Ripoll, M.' 2 ? 
'Albert, A.'          3 ? 
# 
_citation.id                        primary 
_citation.title                     
'The structure of Arabidopsis thaliana OST1 provides insights into the kinase regulation mechanism in response to osmotic stress.' 
_citation.journal_abbrev            'J. Mol. Biol.' 
_citation.journal_volume            414 
_citation.page_first                135 
_citation.page_last                 144 
_citation.year                      2011 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21983340 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2011.09.041 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yunta, C.'           1 ? 
primary 'Martinez-Ripoll, M.' 2 ? 
primary 'Zhu, J.K.'           3 ? 
primary 'Albert, A.'          4 ? 
# 
_cell.entry_id           3ZUU 
_cell.length_a           77.570 
_cell.length_b           99.017 
_cell.length_c           108.451 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3ZUU 
_symmetry.space_group_name_H-M             'P 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                17 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase SRK2E' 41080.504 2  2.7.11.1 YES ? ? 
2 non-polymer syn 1,2-ETHANEDIOL                          62.068    2  ?        ?   ? ? 
3 non-polymer syn 'GOLD ION'                              196.967   1  ?        ?   ? ? 
4 water       nat water                                   18.015    48 ?        ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein OPEN STOMATA 1,SNF1-related kinase 2.6,SnRK2.6,Serine/threonine-protein kinase OST1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRPAVSGPMDLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICA
FGYSKSSVLHSQPKDTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATVPPA
GTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSSGEIVYAM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRPAVSGPMDLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICA
FGYSKSSVLHSQPKDTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATVPPA
GTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSSGEIVYAM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ARG n 
1 4   PRO n 
1 5   ALA n 
1 6   VAL n 
1 7   SER n 
1 8   GLY n 
1 9   PRO n 
1 10  MET n 
1 11  ASP n 
1 12  LEU n 
1 13  PRO n 
1 14  ILE n 
1 15  MET n 
1 16  HIS n 
1 17  ASP n 
1 18  SER n 
1 19  ASP n 
1 20  ARG n 
1 21  TYR n 
1 22  GLU n 
1 23  LEU n 
1 24  VAL n 
1 25  LYS n 
1 26  ASP n 
1 27  ILE n 
1 28  GLY n 
1 29  SER n 
1 30  GLY n 
1 31  ASN n 
1 32  PHE n 
1 33  GLY n 
1 34  VAL n 
1 35  ALA n 
1 36  ARG n 
1 37  LEU n 
1 38  MET n 
1 39  ARG n 
1 40  ASP n 
1 41  LYS n 
1 42  GLN n 
1 43  SER n 
1 44  ASN n 
1 45  GLU n 
1 46  LEU n 
1 47  VAL n 
1 48  ALA n 
1 49  VAL n 
1 50  LYS n 
1 51  TYR n 
1 52  ILE n 
1 53  GLU n 
1 54  ARG n 
1 55  GLY n 
1 56  GLU n 
1 57  LYS n 
1 58  ILE n 
1 59  ASP n 
1 60  GLU n 
1 61  ASN n 
1 62  VAL n 
1 63  LYS n 
1 64  ARG n 
1 65  GLU n 
1 66  ILE n 
1 67  ILE n 
1 68  ASN n 
1 69  HIS n 
1 70  ARG n 
1 71  SER n 
1 72  LEU n 
1 73  ARG n 
1 74  HIS n 
1 75  PRO n 
1 76  ASN n 
1 77  ILE n 
1 78  VAL n 
1 79  ARG n 
1 80  PHE n 
1 81  LYS n 
1 82  GLU n 
1 83  VAL n 
1 84  ILE n 
1 85  LEU n 
1 86  THR n 
1 87  PRO n 
1 88  THR n 
1 89  HIS n 
1 90  LEU n 
1 91  ALA n 
1 92  ILE n 
1 93  VAL n 
1 94  MET n 
1 95  GLU n 
1 96  TYR n 
1 97  ALA n 
1 98  SER n 
1 99  GLY n 
1 100 GLY n 
1 101 GLU n 
1 102 LEU n 
1 103 PHE n 
1 104 GLU n 
1 105 ARG n 
1 106 ILE n 
1 107 CYS n 
1 108 ASN n 
1 109 ALA n 
1 110 GLY n 
1 111 ARG n 
1 112 PHE n 
1 113 SER n 
1 114 GLU n 
1 115 ASP n 
1 116 GLU n 
1 117 ALA n 
1 118 ARG n 
1 119 PHE n 
1 120 PHE n 
1 121 PHE n 
1 122 GLN n 
1 123 GLN n 
1 124 LEU n 
1 125 ILE n 
1 126 SER n 
1 127 GLY n 
1 128 VAL n 
1 129 SER n 
1 130 TYR n 
1 131 CYS n 
1 132 HIS n 
1 133 ALA n 
1 134 MET n 
1 135 GLN n 
1 136 VAL n 
1 137 CYS n 
1 138 HIS n 
1 139 ARG n 
1 140 ASP n 
1 141 LEU n 
1 142 LYS n 
1 143 LEU n 
1 144 GLU n 
1 145 ASN n 
1 146 THR n 
1 147 LEU n 
1 148 LEU n 
1 149 ASP n 
1 150 GLY n 
1 151 SER n 
1 152 PRO n 
1 153 ALA n 
1 154 PRO n 
1 155 ARG n 
1 156 LEU n 
1 157 LYS n 
1 158 ILE n 
1 159 CYS n 
1 160 ALA n 
1 161 PHE n 
1 162 GLY n 
1 163 TYR n 
1 164 SER n 
1 165 LYS n 
1 166 SER n 
1 167 SER n 
1 168 VAL n 
1 169 LEU n 
1 170 HIS n 
1 171 SER n 
1 172 GLN n 
1 173 PRO n 
1 174 LYS n 
1 175 ASP n 
1 176 THR n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 ALA n 
1 182 TYR n 
1 183 ILE n 
1 184 ALA n 
1 185 PRO n 
1 186 GLU n 
1 187 VAL n 
1 188 LEU n 
1 189 LEU n 
1 190 LYS n 
1 191 LYS n 
1 192 GLU n 
1 193 TYR n 
1 194 ASP n 
1 195 GLY n 
1 196 LYS n 
1 197 VAL n 
1 198 ALA n 
1 199 ASP n 
1 200 VAL n 
1 201 TRP n 
1 202 SER n 
1 203 CYS n 
1 204 GLY n 
1 205 VAL n 
1 206 THR n 
1 207 LEU n 
1 208 TYR n 
1 209 VAL n 
1 210 MET n 
1 211 LEU n 
1 212 VAL n 
1 213 GLY n 
1 214 ALA n 
1 215 TYR n 
1 216 PRO n 
1 217 PHE n 
1 218 GLU n 
1 219 ASP n 
1 220 PRO n 
1 221 GLU n 
1 222 GLU n 
1 223 PRO n 
1 224 LYS n 
1 225 ASN n 
1 226 PHE n 
1 227 ARG n 
1 228 LYS n 
1 229 THR n 
1 230 ILE n 
1 231 HIS n 
1 232 ARG n 
1 233 ILE n 
1 234 LEU n 
1 235 ASN n 
1 236 VAL n 
1 237 GLN n 
1 238 TYR n 
1 239 ALA n 
1 240 ILE n 
1 241 PRO n 
1 242 ASP n 
1 243 TYR n 
1 244 VAL n 
1 245 HIS n 
1 246 ILE n 
1 247 SER n 
1 248 PRO n 
1 249 GLU n 
1 250 CYS n 
1 251 ARG n 
1 252 HIS n 
1 253 LEU n 
1 254 ILE n 
1 255 SER n 
1 256 ARG n 
1 257 ILE n 
1 258 PHE n 
1 259 VAL n 
1 260 ALA n 
1 261 ASP n 
1 262 PRO n 
1 263 ALA n 
1 264 LYS n 
1 265 ARG n 
1 266 ILE n 
1 267 SER n 
1 268 ILE n 
1 269 PRO n 
1 270 GLU n 
1 271 ILE n 
1 272 ARG n 
1 273 ASN n 
1 274 HIS n 
1 275 GLU n 
1 276 TRP n 
1 277 PHE n 
1 278 LEU n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 PRO n 
1 283 ALA n 
1 284 ASP n 
1 285 LEU n 
1 286 MET n 
1 287 ASN n 
1 288 ASP n 
1 289 ASN n 
1 290 THR n 
1 291 MET n 
1 292 THR n 
1 293 THR n 
1 294 GLN n 
1 295 PHE n 
1 296 ASP n 
1 297 GLU n 
1 298 SER n 
1 299 ASP n 
1 300 GLN n 
1 301 PRO n 
1 302 GLY n 
1 303 GLN n 
1 304 SER n 
1 305 ILE n 
1 306 GLU n 
1 307 GLU n 
1 308 ILE n 
1 309 MET n 
1 310 GLN n 
1 311 ILE n 
1 312 ILE n 
1 313 ALA n 
1 314 GLU n 
1 315 ALA n 
1 316 THR n 
1 317 VAL n 
1 318 PRO n 
1 319 PRO n 
1 320 ALA n 
1 321 GLY n 
1 322 THR n 
1 323 GLN n 
1 324 ASN n 
1 325 LEU n 
1 326 ASN n 
1 327 HIS n 
1 328 TYR n 
1 329 LEU n 
1 330 THR n 
1 331 GLY n 
1 332 SER n 
1 333 LEU n 
1 334 ASP n 
1 335 ILE n 
1 336 ASP n 
1 337 ASP n 
1 338 ASP n 
1 339 MET n 
1 340 GLU n 
1 341 GLU n 
1 342 ASP n 
1 343 LEU n 
1 344 GLU n 
1 345 SER n 
1 346 ASP n 
1 347 LEU n 
1 348 ASP n 
1 349 ASP n 
1 350 LEU n 
1 351 ASP n 
1 352 ILE n 
1 353 ASP n 
1 354 SER n 
1 355 SER n 
1 356 GLY n 
1 357 GLU n 
1 358 ILE n 
1 359 VAL n 
1 360 TYR n 
1 361 ALA n 
1 362 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   362 
_entity_src_gen.gene_src_common_name               'Mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SRK2E, OST1, SNRK2.6, At4g33950, F17I5.140' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'Rosetta pLysS' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SRK2E_ARATH 
_struct_ref.pdbx_db_accession          Q940H6 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDRPAVSGPMDLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICD
FGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATVPPA
GTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSSGEIVYAM
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ZUU A 1 ? 362 ? Q940H6 1 ? 362 ? 1 362 
2 1 3ZUU B 1 ? 362 ? Q940H6 1 ? 362 ? 1 362 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3ZUU ALA A 160 ? UNP Q940H6 ASP 160 conflict 160 1 
1 3ZUU ASP A 175 ? UNP Q940H6 SER 175 conflict 175 2 
2 3ZUU ALA B 160 ? UNP Q940H6 ASP 160 conflict 160 3 
2 3ZUU ASP B 175 ? UNP Q940H6 SER 175 conflict 175 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
AU  non-polymer         . 'GOLD ION'      ?                 'Au 1'           196.967 
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ZUU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   52 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH 7.0, 14% PEG 10000, AND 12% ETHYLENE GLYCOL.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.04 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.04 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3ZUU 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             77.57 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   23628 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.60 
_reflns.B_iso_Wilson_estimate        63.78 
_reflns.pdbx_redundancy              14.2 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.80 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.10 
_reflns_shell.pdbx_redundancy        14.7 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3ZUU 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     23608 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.225 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    99.94 
_refine.ls_R_factor_obs                          0.2399 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2383 
_refine.ls_R_factor_R_free                       0.2790 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.8 
_refine.ls_number_reflns_R_free                  902 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.0899 
_refine.aniso_B[2][2]                            -6.6089 
_refine.aniso_B[3][3]                            6.5189 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.335 
_refine.solvent_model_param_bsol                 53.610 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.95 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.72 
_refine.pdbx_overall_phase_error                 27.98 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4522 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             48 
_refine_hist.number_atoms_total               4579 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        54.225 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 4633 'X-RAY DIFFRACTION' ? 
f_angle_d          1.153  ? ? 6264 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.593 ? ? 1756 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 687  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 812  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1064 ?     ? POSITIONAL 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 1064 0.059 ? POSITIONAL 1 2 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.7001 2.8692  3731 0.3216 100.00 0.3338 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.8692 3.0907  3730 0.2872 100.00 0.3331 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.0907 3.4017  3718 0.2772 100.00 0.3228 . . 160 . . . . 
'X-RAY DIFFRACTION' . 3.4017 3.8939  3753 0.2459 100.00 0.2836 . . 146 . . . . 
'X-RAY DIFFRACTION' . 3.8939 4.9053  3798 0.1998 100.00 0.2501 . . 160 . . . . 
'X-RAY DIFFRACTION' . 4.9053 54.2364 3976 0.2260 100.00 0.2641 . . 135 . . . . 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.615400 
_struct_ncs_oper.matrix[1][2]   0.330400 
_struct_ncs_oper.matrix[1][3]   0.715600 
_struct_ncs_oper.matrix[2][1]   0.329400 
_struct_ncs_oper.matrix[2][2]   -0.932600 
_struct_ncs_oper.matrix[2][3]   0.147300 
_struct_ncs_oper.matrix[3][1]   0.716100 
_struct_ncs_oper.matrix[3][2]   0.145000 
_struct_ncs_oper.matrix[3][3]   -0.682800 
_struct_ncs_oper.vector[1]      -14.28000 
_struct_ncs_oper.vector[2]      30.77000 
_struct_ncs_oper.vector[3]      17.56000 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN A AND (RESSEQ 90:132 OR RESSEQ 156:159 OR RESSEQ 194:220 OR RESSEQ 228:286)' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN B AND (RESSEQ 90:132 OR RESSEQ 156:159 OR RESSEQ 194:220 OR RESSEQ 228:286)' 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3ZUU 
_struct.title                     'The structure of OST1 (D160A, S175D) kinase in complex with gold' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE SRK2E (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ZUU 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, KINASE REGULATION, SIGNALING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 59  ? LEU A 72  ? ASP A 59  LEU A 72  1 ? 14 
HELX_P HELX_P2  2  GLU A 101 ? GLY A 110 ? GLU A 101 GLY A 110 1 ? 10 
HELX_P HELX_P3  3  SER A 113 ? MET A 134 ? SER A 113 MET A 134 1 ? 22 
HELX_P HELX_P4  4  CYS A 137 ? ASP A 140 ? CYS A 137 ASP A 140 5 ? 4  
HELX_P HELX_P5  5  THR A 179 ? ILE A 183 ? THR A 179 ILE A 183 5 ? 5  
HELX_P HELX_P6  6  ALA A 184 ? LYS A 190 ? ALA A 184 LYS A 190 1 ? 7  
HELX_P HELX_P7  7  ASP A 194 ? GLY A 213 ? ASP A 194 GLY A 213 1 ? 20 
HELX_P HELX_P8  8  ASN A 225 ? ASN A 235 ? ASN A 225 ASN A 235 1 ? 11 
HELX_P HELX_P9  9  SER A 247 ? PHE A 258 ? SER A 247 PHE A 258 1 ? 12 
HELX_P HELX_P10 10 SER A 267 ? ASN A 273 ? SER A 267 ASN A 273 1 ? 7  
HELX_P HELX_P11 11 HIS A 274 ? LYS A 279 ? HIS A 274 LYS A 279 1 ? 6  
HELX_P HELX_P12 12 SER A 304 ? ALA A 315 ? SER A 304 ALA A 315 1 ? 12 
HELX_P HELX_P13 13 ASP B 59  ? SER B 71  ? ASP B 59  SER B 71  1 ? 13 
HELX_P HELX_P14 14 LEU B 102 ? GLY B 110 ? LEU B 102 GLY B 110 1 ? 9  
HELX_P HELX_P15 15 SER B 113 ? MET B 134 ? SER B 113 MET B 134 1 ? 22 
HELX_P HELX_P16 16 CYS B 137 ? ASP B 140 ? CYS B 137 ASP B 140 5 ? 4  
HELX_P HELX_P17 17 THR B 179 ? ILE B 183 ? THR B 179 ILE B 183 5 ? 5  
HELX_P HELX_P18 18 ALA B 184 ? LYS B 190 ? ALA B 184 LYS B 190 1 ? 7  
HELX_P HELX_P19 19 ASP B 194 ? GLY B 213 ? ASP B 194 GLY B 213 1 ? 20 
HELX_P HELX_P20 20 ASN B 225 ? ASN B 235 ? ASN B 225 ASN B 235 1 ? 11 
HELX_P HELX_P21 21 SER B 247 ? PHE B 258 ? SER B 247 PHE B 258 1 ? 12 
HELX_P HELX_P22 22 SER B 267 ? ASN B 273 ? SER B 267 ASN B 273 1 ? 7  
HELX_P HELX_P23 23 HIS B 274 ? LYS B 279 ? HIS B 274 LYS B 279 1 ? 6  
HELX_P HELX_P24 24 SER B 304 ? VAL B 317 ? SER B 304 VAL B 317 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           D 
_struct_conn.ptnr1_label_comp_id           AU 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           AU 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           G 
_struct_conn.ptnr2_label_comp_id           HOH 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           O 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            AU 
_struct_conn.ptnr1_auth_seq_id             1321 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            HOH 
_struct_conn.ptnr2_auth_seq_id             2008 
_struct_conn.ptnr2_symmetry                3_655 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.596 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
BA ? 5 ? 
BB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 21  ? ILE A 27  ? TYR A 21  ILE A 27  
AA 2 ALA A 35  ? ASP A 40  ? ALA A 35  ASP A 40  
AA 3 LEU A 46  ? GLU A 53  ? LEU A 46  GLU A 53  
AA 4 HIS A 89  ? GLU A 95  ? HIS A 89  GLU A 95  
AA 5 PHE A 80  ? LEU A 85  ? PHE A 80  LEU A 85  
AB 1 LEU A 147 ? LEU A 148 ? LEU A 147 LEU A 148 
AB 2 LEU A 156 ? LYS A 157 ? LEU A 156 LYS A 157 
BA 1 TYR B 21  ? ILE B 27  ? TYR B 21  ILE B 27  
BA 2 ALA B 35  ? ASP B 40  ? ALA B 35  ASP B 40  
BA 3 LEU B 46  ? GLU B 53  ? LEU B 46  GLU B 53  
BA 4 HIS B 89  ? GLU B 95  ? HIS B 89  GLU B 95  
BA 5 PHE B 80  ? LEU B 85  ? PHE B 80  LEU B 85  
BB 1 GLY B 100 ? GLU B 101 ? GLY B 100 GLU B 101 
BB 2 LEU B 147 ? LEU B 148 ? LEU B 147 LEU B 148 
BB 3 LEU B 156 ? LYS B 157 ? LEU B 156 LYS B 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 27  ? N ILE A 27  O ALA A 35  ? O ALA A 35  
AA 2 3 N MET A 38  ? N MET A 38  O VAL A 47  ? O VAL A 47  
AA 3 4 N ILE A 52  ? N ILE A 52  O LEU A 90  ? O LEU A 90  
AA 4 5 O VAL A 93  ? O VAL A 93  N LYS A 81  ? N LYS A 81  
AB 1 2 N LEU A 147 ? N LEU A 147 O LYS A 157 ? O LYS A 157 
BA 1 2 N ILE B 27  ? N ILE B 27  O ALA B 35  ? O ALA B 35  
BA 2 3 N MET B 38  ? N MET B 38  O VAL B 47  ? O VAL B 47  
BA 3 4 N ILE B 52  ? N ILE B 52  O LEU B 90  ? O LEU B 90  
BA 4 5 O VAL B 93  ? O VAL B 93  N LYS B 81  ? N LYS B 81  
BB 1 2 O GLY B 100 ? O GLY B 100 N LEU B 148 ? N LEU B 148 
BB 2 3 N LEU B 147 ? N LEU B 147 O LYS B 157 ? O LYS B 157 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 1320' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO B 1320' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE AU A 1321'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ILE A 183 ? ILE A 183  . ? 1_555 ? 
2  AC1 5 VAL A 187 ? VAL A 187  . ? 1_555 ? 
3  AC1 5 HOH F .   ? HOH A 2031 . ? 1_555 ? 
4  AC1 5 ASN B 225 ? ASN B 225  . ? 3_655 ? 
5  AC1 5 ARG B 227 ? ARG B 227  . ? 3_655 ? 
6  AC2 3 GLU B 222 ? GLU B 222  . ? 1_555 ? 
7  AC2 3 LYS B 224 ? LYS B 224  . ? 1_555 ? 
8  AC2 3 ASN B 225 ? ASN B 225  . ? 1_555 ? 
9  AC3 2 HIS A 231 ? HIS A 231  . ? 1_555 ? 
10 AC3 2 HOH G .   ? HOH B 2008 . ? 3_655 ? 
# 
_database_PDB_matrix.entry_id          3ZUU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ZUU 
_atom_sites.fract_transf_matrix[1][1]   0.012892 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010099 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009221 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AU 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 10  ? 32.002 44.473  25.507  1.00 129.98 ? 10   MET A N   1 
ATOM   2    C  CA  . MET A 1 10  ? 31.586 44.390  26.902  1.00 129.72 ? 10   MET A CA  1 
ATOM   3    C  C   . MET A 1 10  ? 30.077 44.589  27.047  1.00 128.74 ? 10   MET A C   1 
ATOM   4    O  O   . MET A 1 10  ? 29.305 44.193  26.168  1.00 125.19 ? 10   MET A O   1 
ATOM   5    C  CB  . MET A 1 10  ? 32.348 45.399  27.748  1.00 127.60 ? 10   MET A CB  1 
ATOM   6    N  N   . ASP A 1 11  ? 29.668 45.218  28.148  1.00 126.43 ? 11   ASP A N   1 
ATOM   7    C  CA  . ASP A 1 11  ? 28.255 45.279  28.533  1.00 122.04 ? 11   ASP A CA  1 
ATOM   8    C  C   . ASP A 1 11  ? 27.355 46.082  27.585  1.00 116.41 ? 11   ASP A C   1 
ATOM   9    O  O   . ASP A 1 11  ? 27.778 47.063  26.974  1.00 118.21 ? 11   ASP A O   1 
ATOM   10   C  CB  . ASP A 1 11  ? 28.106 45.789  29.973  1.00 122.64 ? 11   ASP A CB  1 
ATOM   11   C  CG  . ASP A 1 11  ? 26.792 45.354  30.616  1.00 124.93 ? 11   ASP A CG  1 
ATOM   12   O  OD1 . ASP A 1 11  ? 26.732 44.219  31.140  1.00 127.95 ? 11   ASP A OD1 1 
ATOM   13   O  OD2 . ASP A 1 11  ? 25.820 46.142  30.595  1.00 119.34 ? 11   ASP A OD2 1 
ATOM   14   N  N   . LEU A 1 12  ? 26.102 45.648  27.488  1.00 108.66 ? 12   LEU A N   1 
ATOM   15   C  CA  . LEU A 1 12  ? 25.129 46.241  26.579  1.00 104.30 ? 12   LEU A CA  1 
ATOM   16   C  C   . LEU A 1 12  ? 24.520 47.522  27.132  1.00 102.93 ? 12   LEU A C   1 
ATOM   17   O  O   . LEU A 1 12  ? 24.555 47.758  28.337  1.00 104.73 ? 12   LEU A O   1 
ATOM   18   C  CB  . LEU A 1 12  ? 23.977 45.261  26.324  1.00 98.57  ? 12   LEU A CB  1 
ATOM   19   C  CG  . LEU A 1 12  ? 24.240 43.786  26.000  1.00 99.30  ? 12   LEU A CG  1 
ATOM   20   C  CD1 . LEU A 1 12  ? 24.563 42.977  27.258  1.00 103.47 ? 12   LEU A CD1 1 
ATOM   21   C  CD2 . LEU A 1 12  ? 23.031 43.195  25.293  1.00 85.74  ? 12   LEU A CD2 1 
ATOM   22   N  N   . PRO A 1 13  ? 23.953 48.350  26.238  1.00 99.48  ? 13   PRO A N   1 
ATOM   23   C  CA  . PRO A 1 13  ? 23.006 49.410  26.600  1.00 93.34  ? 13   PRO A CA  1 
ATOM   24   C  C   . PRO A 1 13  ? 21.694 48.792  27.051  1.00 84.52  ? 13   PRO A C   1 
ATOM   25   O  O   . PRO A 1 13  ? 21.538 47.571  27.010  1.00 87.37  ? 13   PRO A O   1 
ATOM   26   C  CB  . PRO A 1 13  ? 22.802 50.172  25.284  1.00 92.98  ? 13   PRO A CB  1 
ATOM   27   C  CG  . PRO A 1 13  ? 23.165 49.200  24.218  1.00 87.55  ? 13   PRO A CG  1 
ATOM   28   C  CD  . PRO A 1 13  ? 24.288 48.381  24.804  1.00 91.71  ? 13   PRO A CD  1 
ATOM   29   N  N   . ILE A 1 14  ? 20.754 49.629  27.456  1.00 81.54  ? 14   ILE A N   1 
ATOM   30   C  CA  . ILE A 1 14  ? 19.602 49.152  28.203  1.00 82.72  ? 14   ILE A CA  1 
ATOM   31   C  C   . ILE A 1 14  ? 18.385 48.932  27.331  1.00 79.72  ? 14   ILE A C   1 
ATOM   32   O  O   . ILE A 1 14  ? 18.222 49.570  26.302  1.00 79.46  ? 14   ILE A O   1 
ATOM   33   C  CB  . ILE A 1 14  ? 19.259 50.092  29.399  1.00 85.70  ? 14   ILE A CB  1 
ATOM   34   C  CG1 . ILE A 1 14  ? 17.924 50.818  29.181  1.00 81.56  ? 14   ILE A CG1 1 
ATOM   35   C  CG2 . ILE A 1 14  ? 20.402 51.075  29.649  1.00 83.62  ? 14   ILE A CG2 1 
ATOM   36   C  CD1 . ILE A 1 14  ? 18.046 52.124  28.425  1.00 73.32  ? 14   ILE A CD1 1 
ATOM   37   N  N   . MET A 1 15  ? 17.534 48.013  27.761  1.00 79.66  ? 15   MET A N   1 
ATOM   38   C  CA  . MET A 1 15  ? 16.353 47.672  26.997  1.00 80.12  ? 15   MET A CA  1 
ATOM   39   C  C   . MET A 1 15  ? 15.683 48.927  26.466  1.00 81.72  ? 15   MET A C   1 
ATOM   40   O  O   . MET A 1 15  ? 15.546 49.924  27.175  1.00 83.96  ? 15   MET A O   1 
ATOM   41   C  CB  . MET A 1 15  ? 15.377 46.845  27.838  1.00 77.03  ? 15   MET A CB  1 
ATOM   42   C  CG  . MET A 1 15  ? 14.070 46.483  27.125  1.00 78.26  ? 15   MET A CG  1 
ATOM   43   S  SD  . MET A 1 15  ? 14.238 45.459  25.640  1.00 73.83  ? 15   MET A SD  1 
ATOM   44   C  CE  . MET A 1 15  ? 12.548 45.452  25.014  1.00 71.02  ? 15   MET A CE  1 
ATOM   45   N  N   . HIS A 1 16  ? 15.282 48.863  25.204  1.00 78.70  ? 16   HIS A N   1 
ATOM   46   C  CA  . HIS A 1 16  ? 14.655 49.983  24.535  1.00 80.41  ? 16   HIS A CA  1 
ATOM   47   C  C   . HIS A 1 16  ? 13.422 49.519  23.777  1.00 79.16  ? 16   HIS A C   1 
ATOM   48   O  O   . HIS A 1 16  ? 13.064 48.352  23.815  1.00 83.48  ? 16   HIS A O   1 
ATOM   49   C  CB  . HIS A 1 16  ? 15.650 50.601  23.569  1.00 77.04  ? 16   HIS A CB  1 
ATOM   50   C  CG  . HIS A 1 16  ? 16.396 49.590  22.753  1.00 82.84  ? 16   HIS A CG  1 
ATOM   51   N  ND1 . HIS A 1 16  ? 15.772 48.752  21.851  1.00 79.49  ? 16   HIS A ND1 1 
ATOM   52   C  CD2 . HIS A 1 16  ? 17.712 49.273  22.708  1.00 82.91  ? 16   HIS A CD2 1 
ATOM   53   C  CE1 . HIS A 1 16  ? 16.669 47.970  21.284  1.00 76.54  ? 16   HIS A CE1 1 
ATOM   54   N  NE2 . HIS A 1 16  ? 17.858 48.265  21.786  1.00 80.31  ? 16   HIS A NE2 1 
ATOM   55   N  N   . ASP A 1 17  ? 12.773 50.439  23.084  1.00 78.02  ? 17   ASP A N   1 
ATOM   56   C  CA  . ASP A 1 17  ? 11.594 50.115  22.286  1.00 82.49  ? 17   ASP A CA  1 
ATOM   57   C  C   . ASP A 1 17  ? 10.666 49.113  22.964  1.00 81.79  ? 17   ASP A C   1 
ATOM   58   O  O   . ASP A 1 17  ? 10.099 48.223  22.319  1.00 79.04  ? 17   ASP A O   1 
ATOM   59   C  CB  . ASP A 1 17  ? 12.023 49.632  20.911  1.00 79.96  ? 17   ASP A CB  1 
ATOM   60   C  CG  . ASP A 1 17  ? 12.663 50.729  20.108  1.00 83.90  ? 17   ASP A CG  1 
ATOM   61   O  OD1 . ASP A 1 17  ? 13.858 51.036  20.350  1.00 80.23  ? 17   ASP A OD1 1 
ATOM   62   O  OD2 . ASP A 1 17  ? 11.953 51.315  19.261  1.00 84.77  ? 17   ASP A OD2 1 
ATOM   63   N  N   . SER A 1 18  ? 10.493 49.321  24.266  1.00 81.59  ? 18   SER A N   1 
ATOM   64   C  CA  . SER A 1 18  ? 9.876  48.374  25.175  1.00 80.01  ? 18   SER A CA  1 
ATOM   65   C  C   . SER A 1 18  ? 8.406  48.137  24.876  1.00 82.41  ? 18   SER A C   1 
ATOM   66   O  O   . SER A 1 18  ? 7.701  47.463  25.635  1.00 80.09  ? 18   SER A O   1 
ATOM   67   C  CB  . SER A 1 18  ? 10.045 48.887  26.597  1.00 84.32  ? 18   SER A CB  1 
ATOM   68   O  OG  . SER A 1 18  ? 10.760 50.115  26.598  1.00 86.95  ? 18   SER A OG  1 
ATOM   69   N  N   . ASP A 1 19  ? 7.960  48.677  23.747  1.00 82.20  ? 19   ASP A N   1 
ATOM   70   C  CA  . ASP A 1 19  ? 6.563  48.616  23.356  1.00 81.29  ? 19   ASP A CA  1 
ATOM   71   C  C   . ASP A 1 19  ? 6.355  47.742  22.117  1.00 84.00  ? 19   ASP A C   1 
ATOM   72   O  O   . ASP A 1 19  ? 5.245  47.264  21.851  1.00 82.25  ? 19   ASP A O   1 
ATOM   73   C  CB  . ASP A 1 19  ? 6.036  50.030  23.117  1.00 85.07  ? 19   ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 19  ? 7.023  50.900  22.359  1.00 87.40  ? 19   ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 19  ? 8.141  51.157  22.878  1.00 82.75  ? 19   ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 19  ? 6.667  51.333  21.241  1.00 85.94  ? 19   ASP A OD2 1 
ATOM   77   N  N   . ARG A 1 20  ? 7.426  47.533  21.356  1.00 84.96  ? 20   ARG A N   1 
ATOM   78   C  CA  . ARG A 1 20  ? 7.370  46.620  20.216  1.00 87.12  ? 20   ARG A CA  1 
ATOM   79   C  C   . ARG A 1 20  ? 7.970  45.277  20.607  1.00 80.32  ? 20   ARG A C   1 
ATOM   80   O  O   . ARG A 1 20  ? 7.544  44.225  20.136  1.00 79.20  ? 20   ARG A O   1 
ATOM   81   C  CB  . ARG A 1 20  ? 8.090  47.226  19.011  1.00 82.23  ? 20   ARG A CB  1 
ATOM   82   C  CG  . ARG A 1 20  ? 7.463  48.546  18.594  1.00 79.96  ? 20   ARG A CG  1 
ATOM   83   C  CD  . ARG A 1 20  ? 7.975  49.051  17.265  1.00 80.73  ? 20   ARG A CD  1 
ATOM   84   N  NE  . ARG A 1 20  ? 9.380  49.426  17.318  1.00 83.51  ? 20   ARG A NE  1 
ATOM   85   C  CZ  . ARG A 1 20  ? 10.330 48.878  16.562  1.00 80.70  ? 20   ARG A CZ  1 
ATOM   86   N  NH1 . ARG A 1 20  ? 10.024 47.915  15.681  1.00 74.29  ? 20   ARG A NH1 1 
ATOM   87   N  NH2 . ARG A 1 20  ? 11.588 49.302  16.688  1.00 76.20  ? 20   ARG A NH2 1 
ATOM   88   N  N   . TYR A 1 21  ? 8.931  45.337  21.513  1.00 77.66  ? 21   TYR A N   1 
ATOM   89   C  CA  . TYR A 1 21  ? 9.735  44.189  21.839  1.00 79.44  ? 21   TYR A CA  1 
ATOM   90   C  C   . TYR A 1 21  ? 9.664  43.866  23.312  1.00 78.46  ? 21   TYR A C   1 
ATOM   91   O  O   . TYR A 1 21  ? 9.699  44.750  24.170  1.00 80.51  ? 21   TYR A O   1 
ATOM   92   C  CB  . TYR A 1 21  ? 11.186 44.429  21.432  1.00 75.36  ? 21   TYR A CB  1 
ATOM   93   C  CG  . TYR A 1 21  ? 11.400 44.391  19.942  1.00 77.60  ? 21   TYR A CG  1 
ATOM   94   C  CD1 . TYR A 1 21  ? 10.971 43.305  19.192  1.00 75.47  ? 21   TYR A CD1 1 
ATOM   95   C  CD2 . TYR A 1 21  ? 12.017 45.452  19.276  1.00 79.83  ? 21   TYR A CD2 1 
ATOM   96   C  CE1 . TYR A 1 21  ? 11.159 43.265  17.817  1.00 75.95  ? 21   TYR A CE1 1 
ATOM   97   C  CE2 . TYR A 1 21  ? 12.214 45.424  17.903  1.00 75.51  ? 21   TYR A CE2 1 
ATOM   98   C  CZ  . TYR A 1 21  ? 11.781 44.326  17.175  1.00 77.03  ? 21   TYR A CZ  1 
ATOM   99   O  OH  . TYR A 1 21  ? 11.963 44.279  15.806  1.00 70.76  ? 21   TYR A OH  1 
ATOM   100  N  N   . GLU A 1 22  ? 9.558  42.575  23.589  1.00 76.60  ? 22   GLU A N   1 
ATOM   101  C  CA  . GLU A 1 22  ? 9.682  42.058  24.935  1.00 77.18  ? 22   GLU A CA  1 
ATOM   102  C  C   . GLU A 1 22  ? 11.079 41.481  25.067  1.00 74.57  ? 22   GLU A C   1 
ATOM   103  O  O   . GLU A 1 22  ? 11.466 40.616  24.274  1.00 71.13  ? 22   GLU A O   1 
ATOM   104  C  CB  . GLU A 1 22  ? 8.646  40.967  25.171  1.00 73.58  ? 22   GLU A CB  1 
ATOM   105  C  CG  . GLU A 1 22  ? 8.989  40.048  26.323  1.00 75.90  ? 22   GLU A CG  1 
ATOM   106  C  CD  . GLU A 1 22  ? 8.021  38.883  26.454  1.00 78.82  ? 22   GLU A CD  1 
ATOM   107  O  OE1 . GLU A 1 22  ? 7.317  38.554  25.475  1.00 81.86  ? 22   GLU A OE1 1 
ATOM   108  O  OE2 . GLU A 1 22  ? 7.962  38.295  27.548  1.00 79.26  ? 22   GLU A OE2 1 
ATOM   109  N  N   . LEU A 1 23  ? 11.842 41.982  26.038  1.00 68.37  ? 23   LEU A N   1 
ATOM   110  C  CA  . LEU A 1 23  ? 13.168 41.447  26.317  1.00 69.27  ? 23   LEU A CA  1 
ATOM   111  C  C   . LEU A 1 23  ? 13.098 39.967  26.697  1.00 71.14  ? 23   LEU A C   1 
ATOM   112  O  O   . LEU A 1 23  ? 12.411 39.591  27.647  1.00 71.17  ? 23   LEU A O   1 
ATOM   113  C  CB  . LEU A 1 23  ? 13.862 42.249  27.426  1.00 64.92  ? 23   LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 23  ? 15.156 41.684  28.017  1.00 62.18  ? 23   LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 23  ? 15.915 40.892  27.016  1.00 65.99  ? 23   LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 23  ? 16.055 42.772  28.498  1.00 66.50  ? 23   LEU A CD2 1 
ATOM   117  N  N   . VAL A 1 24  ? 13.814 39.127  25.950  1.00 68.07  ? 24   VAL A N   1 
ATOM   118  C  CA  . VAL A 1 24  ? 13.871 37.711  26.274  1.00 64.00  ? 24   VAL A CA  1 
ATOM   119  C  C   . VAL A 1 24  ? 15.078 37.331  27.130  1.00 63.33  ? 24   VAL A C   1 
ATOM   120  O  O   . VAL A 1 24  ? 14.934 36.581  28.100  1.00 65.46  ? 24   VAL A O   1 
ATOM   121  C  CB  . VAL A 1 24  ? 13.808 36.813  25.037  1.00 63.81  ? 24   VAL A CB  1 
ATOM   122  C  CG1 . VAL A 1 24  ? 14.354 35.451  25.384  1.00 61.32  ? 24   VAL A CG1 1 
ATOM   123  C  CG2 . VAL A 1 24  ? 12.391 36.689  24.573  1.00 61.01  ? 24   VAL A CG2 1 
ATOM   124  N  N   . LYS A 1 25  ? 16.257 37.838  26.789  1.00 59.61  ? 25   LYS A N   1 
ATOM   125  C  CA  . LYS A 1 25  ? 17.447 37.449  27.534  1.00 62.52  ? 25   LYS A CA  1 
ATOM   126  C  C   . LYS A 1 25  ? 18.679 38.181  27.082  1.00 62.16  ? 25   LYS A C   1 
ATOM   127  O  O   . LYS A 1 25  ? 18.775 38.589  25.933  1.00 67.01  ? 25   LYS A O   1 
ATOM   128  C  CB  . LYS A 1 25  ? 17.699 35.948  27.381  1.00 64.03  ? 25   LYS A CB  1 
ATOM   129  C  CG  . LYS A 1 25  ? 18.803 35.427  28.268  1.00 62.96  ? 25   LYS A CG  1 
ATOM   130  C  CD  . LYS A 1 25  ? 18.317 35.265  29.696  1.00 61.47  ? 25   LYS A CD  1 
ATOM   131  C  CE  . LYS A 1 25  ? 19.482 35.318  30.676  1.00 61.82  ? 25   LYS A CE  1 
ATOM   132  N  NZ  . LYS A 1 25  ? 20.713 34.667  30.138  1.00 66.60  ? 25   LYS A NZ  1 
ATOM   133  N  N   . ASP A 1 26  ? 19.626 38.353  27.989  1.00 63.99  ? 26   ASP A N   1 
ATOM   134  C  CA  . ASP A 1 26  ? 20.900 38.936  27.617  1.00 70.32  ? 26   ASP A CA  1 
ATOM   135  C  C   . ASP A 1 26  ? 21.910 37.833  27.529  1.00 75.08  ? 26   ASP A C   1 
ATOM   136  O  O   . ASP A 1 26  ? 22.074 37.061  28.470  1.00 74.99  ? 26   ASP A O   1 
ATOM   137  C  CB  . ASP A 1 26  ? 21.369 39.959  28.651  1.00 75.90  ? 26   ASP A CB  1 
ATOM   138  C  CG  . ASP A 1 26  ? 20.966 41.368  28.295  1.00 79.01  ? 26   ASP A CG  1 
ATOM   139  O  OD1 . ASP A 1 26  ? 19.846 41.559  27.773  1.00 74.46  ? 26   ASP A OD1 1 
ATOM   140  O  OD2 . ASP A 1 26  ? 21.781 42.280  28.536  1.00 79.91  ? 26   ASP A OD2 1 
ATOM   141  N  N   . ILE A 1 27  ? 22.596 37.739  26.402  1.00 79.56  ? 27   ILE A N   1 
ATOM   142  C  CA  . ILE A 1 27  ? 23.587 36.682  26.278  1.00 81.67  ? 27   ILE A CA  1 
ATOM   143  C  C   . ILE A 1 27  ? 24.963 37.232  25.949  1.00 89.60  ? 27   ILE A C   1 
ATOM   144  O  O   . ILE A 1 27  ? 25.091 38.282  25.340  1.00 95.23  ? 27   ILE A O   1 
ATOM   145  C  CB  . ILE A 1 27  ? 23.144 35.551  25.307  1.00 82.96  ? 27   ILE A CB  1 
ATOM   146  C  CG1 . ILE A 1 27  ? 23.190 35.987  23.854  1.00 84.55  ? 27   ILE A CG1 1 
ATOM   147  C  CG2 . ILE A 1 27  ? 21.733 35.078  25.629  1.00 70.93  ? 27   ILE A CG2 1 
ATOM   148  C  CD1 . ILE A 1 27  ? 22.183 35.230  23.010  1.00 77.10  ? 27   ILE A CD1 1 
ATOM   149  N  N   . GLY A 1 28  ? 25.993 36.518  26.377  1.00 97.02  ? 28   GLY A N   1 
ATOM   150  C  CA  . GLY A 1 28  ? 27.345 37.025  26.285  1.00 101.88 ? 28   GLY A CA  1 
ATOM   151  C  C   . GLY A 1 28  ? 28.314 36.312  25.353  1.00 109.30 ? 28   GLY A C   1 
ATOM   152  O  O   . GLY A 1 28  ? 29.482 36.704  25.274  1.00 109.30 ? 28   GLY A O   1 
ATOM   153  N  N   . SER A 1 29  ? 27.863 35.273  24.650  1.00 108.50 ? 29   SER A N   1 
ATOM   154  C  CA  . SER A 1 29  ? 28.744 34.578  23.702  1.00 114.02 ? 29   SER A CA  1 
ATOM   155  C  C   . SER A 1 29  ? 28.028 33.674  22.690  1.00 113.76 ? 29   SER A C   1 
ATOM   156  O  O   . SER A 1 29  ? 26.813 33.772  22.476  1.00 107.52 ? 29   SER A O   1 
ATOM   157  C  CB  . SER A 1 29  ? 29.841 33.783  24.442  1.00 115.30 ? 29   SER A CB  1 
ATOM   158  O  OG  . SER A 1 29  ? 29.358 32.565  24.994  1.00 113.92 ? 29   SER A OG  1 
ATOM   159  N  N   . GLY A 1 30  ? 28.810 32.807  22.056  1.00 114.37 ? 30   GLY A N   1 
ATOM   160  C  CA  . GLY A 1 30  ? 28.263 31.785  21.190  1.00 112.14 ? 30   GLY A CA  1 
ATOM   161  C  C   . GLY A 1 30  ? 28.489 32.047  19.721  1.00 109.71 ? 30   GLY A C   1 
ATOM   162  O  O   . GLY A 1 30  ? 29.621 32.210  19.277  1.00 113.56 ? 30   GLY A O   1 
ATOM   163  N  N   . ASN A 1 31  ? 27.397 32.071  18.966  1.00 109.87 ? 31   ASN A N   1 
ATOM   164  C  CA  . ASN A 1 31  ? 27.455 32.252  17.517  1.00 108.89 ? 31   ASN A CA  1 
ATOM   165  C  C   . ASN A 1 31  ? 26.861 33.592  17.121  1.00 106.18 ? 31   ASN A C   1 
ATOM   166  O  O   . ASN A 1 31  ? 27.267 34.199  16.129  1.00 105.21 ? 31   ASN A O   1 
ATOM   167  C  CB  . ASN A 1 31  ? 26.734 31.107  16.780  1.00 97.48  ? 31   ASN A CB  1 
ATOM   168  C  CG  . ASN A 1 31  ? 26.005 30.152  17.730  1.00 96.16  ? 31   ASN A CG  1 
ATOM   169  O  OD1 . ASN A 1 31  ? 26.628 29.338  18.415  1.00 90.73  ? 31   ASN A OD1 1 
ATOM   170  N  ND2 . ASN A 1 31  ? 24.679 30.238  17.756  1.00 93.32  ? 31   ASN A ND2 1 
ATOM   171  N  N   . PHE A 1 32  ? 25.878 34.033  17.901  1.00 103.22 ? 32   PHE A N   1 
ATOM   172  C  CA  . PHE A 1 32  ? 25.331 35.371  17.760  1.00 103.63 ? 32   PHE A CA  1 
ATOM   173  C  C   . PHE A 1 32  ? 26.126 36.320  18.677  1.00 103.66 ? 32   PHE A C   1 
ATOM   174  O  O   . PHE A 1 32  ? 25.615 37.347  19.133  1.00 97.38  ? 32   PHE A O   1 
ATOM   175  C  CB  . PHE A 1 32  ? 23.827 35.384  18.078  1.00 93.16  ? 32   PHE A CB  1 
ATOM   176  C  CG  . PHE A 1 32  ? 22.935 34.891  16.934  1.00 86.55  ? 32   PHE A CG  1 
ATOM   177  C  CD1 . PHE A 1 32  ? 22.483 35.773  15.942  1.00 79.53  ? 32   PHE A CD1 1 
ATOM   178  C  CD2 . PHE A 1 32  ? 22.525 33.556  16.865  1.00 80.27  ? 32   PHE A CD2 1 
ATOM   179  C  CE1 . PHE A 1 32  ? 21.639 35.334  14.897  1.00 66.92  ? 32   PHE A CE1 1 
ATOM   180  C  CE2 . PHE A 1 32  ? 21.677 33.111  15.818  1.00 73.19  ? 32   PHE A CE2 1 
ATOM   181  C  CZ  . PHE A 1 32  ? 21.233 34.005  14.837  1.00 62.45  ? 32   PHE A CZ  1 
ATOM   182  N  N   . GLY A 1 33  ? 27.385 35.954  18.933  1.00 107.20 ? 33   GLY A N   1 
ATOM   183  C  CA  . GLY A 1 33  ? 28.289 36.747  19.753  1.00 105.11 ? 33   GLY A CA  1 
ATOM   184  C  C   . GLY A 1 33  ? 27.702 37.107  21.104  1.00 106.02 ? 33   GLY A C   1 
ATOM   185  O  O   . GLY A 1 33  ? 26.964 36.311  21.692  1.00 104.96 ? 33   GLY A O   1 
ATOM   186  N  N   . VAL A 1 34  ? 28.053 38.293  21.605  1.00 105.51 ? 34   VAL A N   1 
ATOM   187  C  CA  . VAL A 1 34  ? 27.377 38.894  22.757  1.00 102.76 ? 34   VAL A CA  1 
ATOM   188  C  C   . VAL A 1 34  ? 26.190 39.677  22.211  1.00 95.82  ? 34   VAL A C   1 
ATOM   189  O  O   . VAL A 1 34  ? 26.353 40.565  21.382  1.00 96.20  ? 34   VAL A O   1 
ATOM   190  C  CB  . VAL A 1 34  ? 28.289 39.865  23.554  1.00 103.07 ? 34   VAL A CB  1 
ATOM   191  C  CG1 . VAL A 1 34  ? 27.689 40.159  24.939  1.00 100.25 ? 34   VAL A CG1 1 
ATOM   192  C  CG2 . VAL A 1 34  ? 29.697 39.302  23.686  1.00 104.82 ? 34   VAL A CG2 1 
ATOM   193  N  N   . ALA A 1 35  ? 24.991 39.355  22.668  1.00 90.69  ? 35   ALA A N   1 
ATOM   194  C  CA  . ALA A 1 35  ? 23.818 39.910  22.040  1.00 84.30  ? 35   ALA A CA  1 
ATOM   195  C  C   . ALA A 1 35  ? 22.590 39.942  22.925  1.00 77.49  ? 35   ALA A C   1 
ATOM   196  O  O   . ALA A 1 35  ? 22.618 39.606  24.116  1.00 76.59  ? 35   ALA A O   1 
ATOM   197  C  CB  . ALA A 1 35  ? 23.518 39.132  20.781  1.00 80.09  ? 35   ALA A CB  1 
ATOM   198  N  N   . ARG A 1 36  ? 21.491 40.361  22.328  1.00 67.54  ? 36   ARG A N   1 
ATOM   199  C  CA  . ARG A 1 36  ? 20.270 40.367  23.081  1.00 64.43  ? 36   ARG A CA  1 
ATOM   200  C  C   . ARG A 1 36  ? 19.124 39.698  22.354  1.00 61.41  ? 36   ARG A C   1 
ATOM   201  O  O   . ARG A 1 36  ? 18.900 39.920  21.178  1.00 60.00  ? 36   ARG A O   1 
ATOM   202  C  CB  . ARG A 1 36  ? 19.910 41.787  23.499  1.00 68.65  ? 36   ARG A CB  1 
ATOM   203  C  CG  . ARG A 1 36  ? 18.434 42.091  23.382  1.00 69.71  ? 36   ARG A CG  1 
ATOM   204  C  CD  . ARG A 1 36  ? 18.011 42.988  24.498  1.00 71.29  ? 36   ARG A CD  1 
ATOM   205  N  NE  . ARG A 1 36  ? 19.159 43.580  25.172  1.00 74.41  ? 36   ARG A NE  1 
ATOM   206  C  CZ  . ARG A 1 36  ? 19.104 44.739  25.810  1.00 77.41  ? 36   ARG A CZ  1 
ATOM   207  N  NH1 . ARG A 1 36  ? 17.956 45.399  25.809  1.00 78.28  ? 36   ARG A NH1 1 
ATOM   208  N  NH2 . ARG A 1 36  ? 20.179 45.244  26.422  1.00 76.81  ? 36   ARG A NH2 1 
ATOM   209  N  N   . LEU A 1 37  ? 18.418 38.852  23.087  1.00 58.79  ? 37   LEU A N   1 
ATOM   210  C  CA  . LEU A 1 37  ? 17.303 38.122  22.542  1.00 61.42  ? 37   LEU A CA  1 
ATOM   211  C  C   . LEU A 1 37  ? 16.069 38.843  22.989  1.00 59.69  ? 37   LEU A C   1 
ATOM   212  O  O   . LEU A 1 37  ? 15.927 39.133  24.170  1.00 61.20  ? 37   LEU A O   1 
ATOM   213  C  CB  . LEU A 1 37  ? 17.283 36.700  23.106  1.00 59.72  ? 37   LEU A CB  1 
ATOM   214  C  CG  . LEU A 1 37  ? 17.794 35.566  22.217  1.00 57.43  ? 37   LEU A CG  1 
ATOM   215  C  CD1 . LEU A 1 37  ? 19.048 35.958  21.477  1.00 53.54  ? 37   LEU A CD1 1 
ATOM   216  C  CD2 . LEU A 1 37  ? 18.026 34.325  23.030  1.00 55.27  ? 37   LEU A CD2 1 
ATOM   217  N  N   . MET A 1 38  ? 15.158 39.138  22.077  1.00 59.06  ? 38   MET A N   1 
ATOM   218  C  CA  . MET A 1 38  ? 13.924 39.754  22.516  1.00 62.65  ? 38   MET A CA  1 
ATOM   219  C  C   . MET A 1 38  ? 12.777 39.358  21.627  1.00 65.47  ? 38   MET A C   1 
ATOM   220  O  O   . MET A 1 38  ? 12.993 38.781  20.570  1.00 62.77  ? 38   MET A O   1 
ATOM   221  C  CB  . MET A 1 38  ? 14.084 41.273  22.620  1.00 67.36  ? 38   MET A CB  1 
ATOM   222  C  CG  . MET A 1 38  ? 14.743 41.910  21.430  1.00 66.68  ? 38   MET A CG  1 
ATOM   223  S  SD  . MET A 1 38  ? 14.518 43.692  21.419  1.00 75.08  ? 38   MET A SD  1 
ATOM   224  C  CE  . MET A 1 38  ? 15.650 44.139  22.716  1.00 66.42  ? 38   MET A CE  1 
ATOM   225  N  N   . ARG A 1 39  ? 11.553 39.624  22.070  1.00 68.66  ? 39   ARG A N   1 
ATOM   226  C  CA  . ARG A 1 39  ? 10.411 39.228  21.262  1.00 72.78  ? 39   ARG A CA  1 
ATOM   227  C  C   . ARG A 1 39  ? 9.563  40.389  20.721  1.00 77.23  ? 39   ARG A C   1 
ATOM   228  O  O   . ARG A 1 39  ? 9.114  41.270  21.460  1.00 77.35  ? 39   ARG A O   1 
ATOM   229  C  CB  . ARG A 1 39  ? 9.532  38.186  21.973  1.00 71.23  ? 39   ARG A CB  1 
ATOM   230  C  CG  . ARG A 1 39  ? 8.666  37.429  20.999  1.00 72.17  ? 39   ARG A CG  1 
ATOM   231  C  CD  . ARG A 1 39  ? 7.587  36.632  21.682  1.00 74.20  ? 39   ARG A CD  1 
ATOM   232  N  NE  . ARG A 1 39  ? 6.282  37.005  21.148  1.00 82.56  ? 39   ARG A NE  1 
ATOM   233  C  CZ  . ARG A 1 39  ? 5.340  37.641  21.837  1.00 82.91  ? 39   ARG A CZ  1 
ATOM   234  N  NH1 . ARG A 1 39  ? 5.535  37.962  23.113  1.00 79.71  ? 39   ARG A NH1 1 
ATOM   235  N  NH2 . ARG A 1 39  ? 4.192  37.941  21.252  1.00 78.04  ? 39   ARG A NH2 1 
ATOM   236  N  N   . ASP A 1 40  ? 9.359  40.365  19.409  1.00 76.95  ? 40   ASP A N   1 
ATOM   237  C  CA  . ASP A 1 40  ? 8.406  41.240  18.754  1.00 78.78  ? 40   ASP A CA  1 
ATOM   238  C  C   . ASP A 1 40  ? 6.960  40.831  19.072  1.00 80.32  ? 40   ASP A C   1 
ATOM   239  O  O   . ASP A 1 40  ? 6.500  39.740  18.717  1.00 76.22  ? 40   ASP A O   1 
ATOM   240  C  CB  . ASP A 1 40  ? 8.655  41.240  17.248  1.00 80.69  ? 40   ASP A CB  1 
ATOM   241  C  CG  . ASP A 1 40  ? 7.487  41.778  16.471  1.00 83.88  ? 40   ASP A CG  1 
ATOM   242  O  OD1 . ASP A 1 40  ? 6.548  40.994  16.215  1.00 86.57  ? 40   ASP A OD1 1 
ATOM   243  O  OD2 . ASP A 1 40  ? 7.502  42.978  16.123  1.00 84.40  ? 40   ASP A OD2 1 
ATOM   244  N  N   . LYS A 1 41  ? 6.250  41.733  19.739  1.00 83.84  ? 41   LYS A N   1 
ATOM   245  C  CA  . LYS A 1 41  ? 4.899  41.463  20.206  1.00 83.94  ? 41   LYS A CA  1 
ATOM   246  C  C   . LYS A 1 41  ? 3.867  41.404  19.075  1.00 81.84  ? 41   LYS A C   1 
ATOM   247  O  O   . LYS A 1 41  ? 2.733  40.972  19.282  1.00 80.11  ? 41   LYS A O   1 
ATOM   248  C  CB  . LYS A 1 41  ? 4.504  42.516  21.230  1.00 78.57  ? 41   LYS A CB  1 
ATOM   249  C  CG  . LYS A 1 41  ? 5.429  42.572  22.419  1.00 80.72  ? 41   LYS A CG  1 
ATOM   250  C  CD  . LYS A 1 41  ? 5.678  44.007  22.878  1.00 78.84  ? 41   LYS A CD  1 
ATOM   251  C  CE  . LYS A 1 41  ? 5.769  44.090  24.400  1.00 75.98  ? 41   LYS A CE  1 
ATOM   252  N  NZ  . LYS A 1 41  ? 7.066  44.593  24.902  1.00 80.10  ? 41   LYS A NZ  1 
ATOM   253  N  N   . GLN A 1 42  ? 4.273  41.812  17.876  1.00 82.19  ? 42   GLN A N   1 
ATOM   254  C  CA  . GLN A 1 42  ? 3.349  41.958  16.750  1.00 83.73  ? 42   GLN A CA  1 
ATOM   255  C  C   . GLN A 1 42  ? 3.496  40.841  15.728  1.00 86.58  ? 42   GLN A C   1 
ATOM   256  O  O   . GLN A 1 42  ? 2.801  40.822  14.714  1.00 88.89  ? 42   GLN A O   1 
ATOM   257  C  CB  . GLN A 1 42  ? 3.542  43.318  16.068  1.00 84.67  ? 42   GLN A CB  1 
ATOM   258  C  CG  . GLN A 1 42  ? 3.127  44.520  16.922  1.00 87.14  ? 42   GLN A CG  1 
ATOM   259  C  CD  . GLN A 1 42  ? 3.940  44.670  18.211  1.00 91.14  ? 42   GLN A CD  1 
ATOM   260  O  OE1 . GLN A 1 42  ? 4.989  44.038  18.389  1.00 88.11  ? 42   GLN A OE1 1 
ATOM   261  N  NE2 . GLN A 1 42  ? 3.454  45.516  19.117  1.00 88.33  ? 42   GLN A NE2 1 
ATOM   262  N  N   . SER A 1 43  ? 4.421  39.925  15.988  1.00 84.44  ? 43   SER A N   1 
ATOM   263  C  CA  . SER A 1 43  ? 4.555  38.731  15.167  1.00 80.58  ? 43   SER A CA  1 
ATOM   264  C  C   . SER A 1 43  ? 4.693  37.514  16.054  1.00 80.47  ? 43   SER A C   1 
ATOM   265  O  O   . SER A 1 43  ? 4.502  36.389  15.589  1.00 82.23  ? 43   SER A O   1 
ATOM   266  C  CB  . SER A 1 43  ? 5.752  38.823  14.208  1.00 77.33  ? 43   SER A CB  1 
ATOM   267  O  OG  . SER A 1 43  ? 6.986  38.963  14.893  1.00 76.71  ? 43   SER A OG  1 
ATOM   268  N  N   . ASN A 1 44  ? 5.025  37.738  17.325  1.00 77.12  ? 44   ASN A N   1 
ATOM   269  C  CA  . ASN A 1 44  ? 5.311  36.630  18.218  1.00 78.48  ? 44   ASN A CA  1 
ATOM   270  C  C   . ASN A 1 44  ? 6.765  36.138  18.013  1.00 77.51  ? 44   ASN A C   1 
ATOM   271  O  O   . ASN A 1 44  ? 7.360  35.496  18.884  1.00 77.49  ? 44   ASN A O   1 
ATOM   272  C  CB  . ASN A 1 44  ? 4.297  35.511  17.941  1.00 80.89  ? 44   ASN A CB  1 
ATOM   273  C  CG  . ASN A 1 44  ? 4.072  34.609  19.124  1.00 80.96  ? 44   ASN A CG  1 
ATOM   274  O  OD1 . ASN A 1 44  ? 4.420  34.951  20.252  1.00 81.87  ? 44   ASN A OD1 1 
ATOM   275  N  ND2 . ASN A 1 44  ? 3.475  33.446  18.875  1.00 75.08  ? 44   ASN A ND2 1 
ATOM   276  N  N   . GLU A 1 45  ? 7.331  36.476  16.859  1.00 73.05  ? 45   GLU A N   1 
ATOM   277  C  CA  . GLU A 1 45  ? 8.660  36.030  16.447  1.00 72.85  ? 45   GLU A CA  1 
ATOM   278  C  C   . GLU A 1 45  ? 9.809  36.474  17.359  1.00 70.87  ? 45   GLU A C   1 
ATOM   279  O  O   . GLU A 1 45  ? 9.788  37.573  17.917  1.00 66.06  ? 45   GLU A O   1 
ATOM   280  C  CB  . GLU A 1 45  ? 8.915  36.480  15.008  1.00 71.56  ? 45   GLU A CB  1 
ATOM   281  C  CG  . GLU A 1 45  ? 10.365 36.537  14.610  1.00 69.11  ? 45   GLU A CG  1 
ATOM   282  C  CD  . GLU A 1 45  ? 10.585 37.359  13.363  1.00 74.50  ? 45   GLU A CD  1 
ATOM   283  O  OE1 . GLU A 1 45  ? 9.585  37.785  12.730  1.00 71.48  ? 45   GLU A OE1 1 
ATOM   284  O  OE2 . GLU A 1 45  ? 11.766 37.589  13.026  1.00 71.96  ? 45   GLU A OE2 1 
ATOM   285  N  N   . LEU A 1 46  ? 10.812 35.603  17.491  1.00 69.28  ? 46   LEU A N   1 
ATOM   286  C  CA  . LEU A 1 46  ? 11.943 35.831  18.395  1.00 66.18  ? 46   LEU A CA  1 
ATOM   287  C  C   . LEU A 1 46  ? 13.189 36.353  17.665  1.00 61.06  ? 46   LEU A C   1 
ATOM   288  O  O   . LEU A 1 46  ? 13.582 35.851  16.603  1.00 59.98  ? 46   LEU A O   1 
ATOM   289  C  CB  . LEU A 1 46  ? 12.261 34.546  19.173  1.00 62.68  ? 46   LEU A CB  1 
ATOM   290  C  CG  . LEU A 1 46  ? 13.159 34.631  20.413  1.00 63.62  ? 46   LEU A CG  1 
ATOM   291  C  CD1 . LEU A 1 46  ? 12.466 35.288  21.620  1.00 59.97  ? 46   LEU A CD1 1 
ATOM   292  C  CD2 . LEU A 1 46  ? 13.654 33.242  20.760  1.00 59.47  ? 46   LEU A CD2 1 
ATOM   293  N  N   . VAL A 1 47  ? 13.813 37.379  18.222  1.00 57.70  ? 47   VAL A N   1 
ATOM   294  C  CA  . VAL A 1 47  ? 14.858 38.081  17.469  1.00 58.25  ? 47   VAL A CA  1 
ATOM   295  C  C   . VAL A 1 47  ? 16.152 38.347  18.225  1.00 53.79  ? 47   VAL A C   1 
ATOM   296  O  O   . VAL A 1 47  ? 16.210 38.314  19.455  1.00 50.34  ? 47   VAL A O   1 
ATOM   297  C  CB  . VAL A 1 47  ? 14.349 39.417  16.826  1.00 57.53  ? 47   VAL A CB  1 
ATOM   298  C  CG1 . VAL A 1 47  ? 13.189 39.159  15.873  1.00 58.52  ? 47   VAL A CG1 1 
ATOM   299  C  CG2 . VAL A 1 47  ? 13.985 40.438  17.882  1.00 55.71  ? 47   VAL A CG2 1 
ATOM   300  N  N   . ALA A 1 48  ? 17.203 38.609  17.469  1.00 53.29  ? 48   ALA A N   1 
ATOM   301  C  CA  . ALA A 1 48  ? 18.470 38.914  18.121  1.00 55.71  ? 48   ALA A CA  1 
ATOM   302  C  C   . ALA A 1 48  ? 19.019 40.254  17.686  1.00 52.96  ? 48   ALA A C   1 
ATOM   303  O  O   . ALA A 1 48  ? 18.840 40.673  16.548  1.00 60.06  ? 48   ALA A O   1 
ATOM   304  C  CB  . ALA A 1 48  ? 19.494 37.799  17.892  1.00 58.35  ? 48   ALA A CB  1 
ATOM   305  N  N   . VAL A 1 49  ? 19.687 40.916  18.613  1.00 52.84  ? 49   VAL A N   1 
ATOM   306  C  CA  . VAL A 1 49  ? 20.095 42.288  18.467  1.00 60.50  ? 49   VAL A CA  1 
ATOM   307  C  C   . VAL A 1 49  ? 21.563 42.421  18.757  1.00 64.46  ? 49   VAL A C   1 
ATOM   308  O  O   . VAL A 1 49  ? 22.049 41.967  19.806  1.00 66.63  ? 49   VAL A O   1 
ATOM   309  C  CB  . VAL A 1 49  ? 19.327 43.207  19.433  1.00 60.82  ? 49   VAL A CB  1 
ATOM   310  C  CG1 . VAL A 1 49  ? 19.623 44.653  19.120  1.00 63.82  ? 49   VAL A CG1 1 
ATOM   311  C  CG2 . VAL A 1 49  ? 17.840 42.933  19.332  1.00 58.58  ? 49   VAL A CG2 1 
ATOM   312  N  N   . LYS A 1 50  ? 22.258 43.040  17.804  1.00 65.28  ? 50   LYS A N   1 
ATOM   313  C  CA  . LYS A 1 50  ? 23.659 43.414  17.972  1.00 69.67  ? 50   LYS A CA  1 
ATOM   314  C  C   . LYS A 1 50  ? 23.813 44.922  18.105  1.00 70.50  ? 50   LYS A C   1 
ATOM   315  O  O   . LYS A 1 50  ? 23.042 45.699  17.507  1.00 71.23  ? 50   LYS A O   1 
ATOM   316  C  CB  . LYS A 1 50  ? 24.498 42.953  16.785  1.00 69.05  ? 50   LYS A CB  1 
ATOM   317  C  CG  . LYS A 1 50  ? 24.730 41.454  16.688  1.00 75.80  ? 50   LYS A CG  1 
ATOM   318  C  CD  . LYS A 1 50  ? 25.461 40.910  17.902  1.00 78.57  ? 50   LYS A CD  1 
ATOM   319  C  CE  . LYS A 1 50  ? 26.921 40.625  17.612  1.00 87.97  ? 50   LYS A CE  1 
ATOM   320  N  NZ  . LYS A 1 50  ? 27.403 39.471  18.416  1.00 94.85  ? 50   LYS A NZ  1 
ATOM   321  N  N   . TYR A 1 51  ? 24.834 45.320  18.864  1.00 69.30  ? 51   TYR A N   1 
ATOM   322  C  CA  . TYR A 1 51  ? 25.082 46.731  19.197  1.00 73.65  ? 51   TYR A CA  1 
ATOM   323  C  C   . TYR A 1 51  ? 26.480 47.207  18.852  1.00 74.56  ? 51   TYR A C   1 
ATOM   324  O  O   . TYR A 1 51  ? 27.452 46.640  19.345  1.00 69.95  ? 51   TYR A O   1 
ATOM   325  C  CB  . TYR A 1 51  ? 24.861 46.986  20.691  1.00 72.54  ? 51   TYR A CB  1 
ATOM   326  C  CG  . TYR A 1 51  ? 23.445 46.727  21.147  1.00 75.31  ? 51   TYR A CG  1 
ATOM   327  C  CD1 . TYR A 1 51  ? 22.444 47.656  20.922  1.00 76.28  ? 51   TYR A CD1 1 
ATOM   328  C  CD2 . TYR A 1 51  ? 23.110 45.551  21.805  1.00 73.36  ? 51   TYR A CD2 1 
ATOM   329  C  CE1 . TYR A 1 51  ? 21.150 47.422  21.347  1.00 75.78  ? 51   TYR A CE1 1 
ATOM   330  C  CE2 . TYR A 1 51  ? 21.820 45.310  22.230  1.00 70.31  ? 51   TYR A CE2 1 
ATOM   331  C  CZ  . TYR A 1 51  ? 20.843 46.243  22.005  1.00 71.01  ? 51   TYR A CZ  1 
ATOM   332  O  OH  . TYR A 1 51  ? 19.544 45.985  22.425  1.00 69.28  ? 51   TYR A OH  1 
ATOM   333  N  N   . ILE A 1 52  ? 26.571 48.245  18.011  1.00 77.53  ? 52   ILE A N   1 
ATOM   334  C  CA  . ILE A 1 52  ? 27.824 48.974  17.806  1.00 78.35  ? 52   ILE A CA  1 
ATOM   335  C  C   . ILE A 1 52  ? 27.714 50.400  18.321  1.00 80.54  ? 52   ILE A C   1 
ATOM   336  O  O   . ILE A 1 52  ? 26.654 51.058  18.199  1.00 82.38  ? 52   ILE A O   1 
ATOM   337  C  CB  . ILE A 1 52  ? 28.272 48.993  16.341  1.00 77.83  ? 52   ILE A CB  1 
ATOM   338  C  CG1 . ILE A 1 52  ? 27.787 47.731  15.638  1.00 73.52  ? 52   ILE A CG1 1 
ATOM   339  C  CG2 . ILE A 1 52  ? 29.794 49.149  16.237  1.00 76.74  ? 52   ILE A CG2 1 
ATOM   340  C  CD1 . ILE A 1 52  ? 28.472 47.467  14.339  1.00 72.18  ? 52   ILE A CD1 1 
ATOM   341  N  N   . GLU A 1 53  ? 28.829 50.849  18.898  1.00 83.33  ? 53   GLU A N   1 
ATOM   342  C  CA  . GLU A 1 53  ? 28.949 52.172  19.492  1.00 86.40  ? 53   GLU A CA  1 
ATOM   343  C  C   . GLU A 1 53  ? 28.940 53.285  18.457  1.00 90.20  ? 53   GLU A C   1 
ATOM   344  O  O   . GLU A 1 53  ? 29.767 53.297  17.538  1.00 88.86  ? 53   GLU A O   1 
ATOM   345  C  CB  . GLU A 1 53  ? 30.246 52.296  20.291  1.00 86.95  ? 53   GLU A CB  1 
ATOM   346  C  CG  . GLU A 1 53  ? 30.918 51.003  20.684  1.00 94.49  ? 53   GLU A CG  1 
ATOM   347  C  CD  . GLU A 1 53  ? 31.815 51.196  21.905  1.00 101.22 ? 53   GLU A CD  1 
ATOM   348  O  OE1 . GLU A 1 53  ? 31.405 51.956  22.816  1.00 99.40  ? 53   GLU A OE1 1 
ATOM   349  O  OE2 . GLU A 1 53  ? 32.925 50.614  21.955  1.00 103.30 ? 53   GLU A OE2 1 
ATOM   350  N  N   . ARG A 1 54  ? 28.014 54.225  18.641  1.00 90.04  ? 54   ARG A N   1 
ATOM   351  C  CA  . ARG A 1 54  ? 27.927 55.426  17.827  1.00 88.14  ? 54   ARG A CA  1 
ATOM   352  C  C   . ARG A 1 54  ? 29.314 56.012  17.512  1.00 90.94  ? 54   ARG A C   1 
ATOM   353  O  O   . ARG A 1 54  ? 30.271 55.846  18.286  1.00 83.41  ? 54   ARG A O   1 
ATOM   354  C  CB  . ARG A 1 54  ? 27.059 56.463  18.532  1.00 87.62  ? 54   ARG A CB  1 
ATOM   355  C  CG  . ARG A 1 54  ? 25.570 56.259  18.387  1.00 87.47  ? 54   ARG A CG  1 
ATOM   356  C  CD  . ARG A 1 54  ? 24.955 57.601  18.081  1.00 90.33  ? 54   ARG A CD  1 
ATOM   357  N  NE  . ARG A 1 54  ? 23.521 57.658  18.319  1.00 88.68  ? 54   ARG A NE  1 
ATOM   358  C  CZ  . ARG A 1 54  ? 22.781 58.747  18.124  1.00 88.17  ? 54   ARG A CZ  1 
ATOM   359  N  NH1 . ARG A 1 54  ? 23.334 59.876  17.689  1.00 90.24  ? 54   ARG A NH1 1 
ATOM   360  N  NH2 . ARG A 1 54  ? 21.484 58.711  18.375  1.00 84.69  ? 54   ARG A NH2 1 
ATOM   361  N  N   . GLY A 1 55  ? 29.415 56.666  16.354  1.00 90.68  ? 55   GLY A N   1 
ATOM   362  C  CA  . GLY A 1 55  ? 30.652 57.298  15.943  1.00 91.26  ? 55   GLY A CA  1 
ATOM   363  C  C   . GLY A 1 55  ? 31.584 56.461  15.091  1.00 89.53  ? 55   GLY A C   1 
ATOM   364  O  O   . GLY A 1 55  ? 31.161 55.577  14.354  1.00 91.94  ? 55   GLY A O   1 
ATOM   365  N  N   . GLU A 1 56  ? 32.872 56.750  15.219  1.00 93.68  ? 56   GLU A N   1 
ATOM   366  C  CA  . GLU A 1 56  ? 33.926 56.173  14.378  1.00 97.98  ? 56   GLU A CA  1 
ATOM   367  C  C   . GLU A 1 56  ? 33.786 54.696  14.000  1.00 93.43  ? 56   GLU A C   1 
ATOM   368  O  O   . GLU A 1 56  ? 34.104 54.316  12.877  1.00 90.36  ? 56   GLU A O   1 
ATOM   369  C  CB  . GLU A 1 56  ? 35.317 56.436  14.983  1.00 97.29  ? 56   GLU A CB  1 
ATOM   370  C  CG  . GLU A 1 56  ? 35.415 56.247  16.495  1.00 102.57 ? 56   GLU A CG  1 
ATOM   371  C  CD  . GLU A 1 56  ? 35.174 57.540  17.284  1.00 108.85 ? 56   GLU A CD  1 
ATOM   372  O  OE1 . GLU A 1 56  ? 34.250 58.309  16.932  1.00 106.23 ? 56   GLU A OE1 1 
ATOM   373  O  OE2 . GLU A 1 56  ? 35.908 57.781  18.269  1.00 107.83 ? 56   GLU A OE2 1 
ATOM   374  N  N   . LYS A 1 57  ? 33.330 53.865  14.931  1.00 97.47  ? 57   LYS A N   1 
ATOM   375  C  CA  . LYS A 1 57  ? 33.209 52.433  14.654  1.00 95.96  ? 57   LYS A CA  1 
ATOM   376  C  C   . LYS A 1 57  ? 32.188 52.146  13.552  1.00 91.30  ? 57   LYS A C   1 
ATOM   377  O  O   . LYS A 1 57  ? 32.283 51.147  12.841  1.00 86.50  ? 57   LYS A O   1 
ATOM   378  C  CB  . LYS A 1 57  ? 32.873 51.657  15.924  1.00 96.85  ? 57   LYS A CB  1 
ATOM   379  C  CG  . LYS A 1 57  ? 34.014 50.782  16.406  1.00 96.46  ? 57   LYS A CG  1 
ATOM   380  C  CD  . LYS A 1 57  ? 33.936 50.553  17.896  1.00 100.20 ? 57   LYS A CD  1 
ATOM   381  C  CE  . LYS A 1 57  ? 35.326 50.388  18.483  1.00 102.01 ? 57   LYS A CE  1 
ATOM   382  N  NZ  . LYS A 1 57  ? 35.301 50.534  19.966  1.00 104.79 ? 57   LYS A NZ  1 
ATOM   383  N  N   . ILE A 1 58  ? 31.215 53.041  13.420  1.00 89.33  ? 58   ILE A N   1 
ATOM   384  C  CA  . ILE A 1 58  ? 30.246 52.986  12.335  1.00 87.67  ? 58   ILE A CA  1 
ATOM   385  C  C   . ILE A 1 58  ? 30.903 53.281  10.983  1.00 87.44  ? 58   ILE A C   1 
ATOM   386  O  O   . ILE A 1 58  ? 30.597 54.286  10.341  1.00 91.18  ? 58   ILE A O   1 
ATOM   387  C  CB  . ILE A 1 58  ? 29.133 53.996  12.586  1.00 87.23  ? 58   ILE A CB  1 
ATOM   388  C  CG1 . ILE A 1 58  ? 28.629 53.855  14.024  1.00 88.93  ? 58   ILE A CG1 1 
ATOM   389  C  CG2 . ILE A 1 58  ? 28.012 53.838  11.559  1.00 83.31  ? 58   ILE A CG2 1 
ATOM   390  C  CD1 . ILE A 1 58  ? 27.883 52.564  14.300  1.00 87.72  ? 58   ILE A CD1 1 
ATOM   391  N  N   . ASP A 1 59  ? 31.796 52.392  10.551  1.00 87.12  ? 59   ASP A N   1 
ATOM   392  C  CA  . ASP A 1 59  ? 32.578 52.611  9.336   1.00 84.11  ? 59   ASP A CA  1 
ATOM   393  C  C   . ASP A 1 59  ? 31.938 52.056  8.058   1.00 84.35  ? 59   ASP A C   1 
ATOM   394  O  O   . ASP A 1 59  ? 30.834 51.519  8.064   1.00 79.19  ? 59   ASP A O   1 
ATOM   395  C  CB  . ASP A 1 59  ? 33.997 52.051  9.499   1.00 78.51  ? 59   ASP A CB  1 
ATOM   396  C  CG  . ASP A 1 59  ? 34.035 50.528  9.471   1.00 86.07  ? 59   ASP A CG  1 
ATOM   397  O  OD1 . ASP A 1 59  ? 33.012 49.911  9.102   1.00 84.84  ? 59   ASP A OD1 1 
ATOM   398  O  OD2 . ASP A 1 59  ? 35.091 49.945  9.806   1.00 86.55  ? 59   ASP A OD2 1 
ATOM   399  N  N   . GLU A 1 60  ? 32.670 52.181  6.961   1.00 85.63  ? 60   GLU A N   1 
ATOM   400  C  CA  . GLU A 1 60  ? 32.146 51.864  5.648   1.00 85.29  ? 60   GLU A CA  1 
ATOM   401  C  C   . GLU A 1 60  ? 31.866 50.372  5.512   1.00 82.42  ? 60   GLU A C   1 
ATOM   402  O  O   . GLU A 1 60  ? 30.957 49.957  4.788   1.00 80.63  ? 60   GLU A O   1 
ATOM   403  C  CB  . GLU A 1 60  ? 33.134 52.324  4.577   1.00 84.75  ? 60   GLU A CB  1 
ATOM   404  C  CG  . GLU A 1 60  ? 32.503 52.534  3.217   1.00 86.87  ? 60   GLU A CG  1 
ATOM   405  C  CD  . GLU A 1 60  ? 31.692 53.809  3.154   1.00 91.04  ? 60   GLU A CD  1 
ATOM   406  O  OE1 . GLU A 1 60  ? 31.703 54.568  4.153   1.00 90.92  ? 60   GLU A OE1 1 
ATOM   407  O  OE2 . GLU A 1 60  ? 31.053 54.053  2.106   1.00 90.86  ? 60   GLU A OE2 1 
ATOM   408  N  N   . ASN A 1 61  ? 32.652 49.557  6.203   1.00 82.56  ? 61   ASN A N   1 
ATOM   409  C  CA  . ASN A 1 61  ? 32.425 48.120  6.190   1.00 81.98  ? 61   ASN A CA  1 
ATOM   410  C  C   . ASN A 1 61  ? 31.110 47.779  6.875   1.00 78.19  ? 61   ASN A C   1 
ATOM   411  O  O   . ASN A 1 61  ? 30.454 46.811  6.512   1.00 76.14  ? 61   ASN A O   1 
ATOM   412  C  CB  . ASN A 1 61  ? 33.576 47.385  6.881   1.00 85.66  ? 61   ASN A CB  1 
ATOM   413  C  CG  . ASN A 1 61  ? 34.935 47.785  6.336   1.00 88.87  ? 61   ASN A CG  1 
ATOM   414  O  OD1 . ASN A 1 61  ? 35.437 47.191  5.378   1.00 91.22  ? 61   ASN A OD1 1 
ATOM   415  N  ND2 . ASN A 1 61  ? 35.542 48.794  6.950   1.00 87.21  ? 61   ASN A ND2 1 
ATOM   416  N  N   . VAL A 1 62  ? 30.749 48.588  7.870   1.00 77.26  ? 62   VAL A N   1 
ATOM   417  C  CA  . VAL A 1 62  ? 29.518 48.430  8.631   1.00 74.61  ? 62   VAL A CA  1 
ATOM   418  C  C   . VAL A 1 62  ? 28.339 48.814  7.759   1.00 73.77  ? 62   VAL A C   1 
ATOM   419  O  O   . VAL A 1 62  ? 27.352 48.083  7.676   1.00 70.46  ? 62   VAL A O   1 
ATOM   420  C  CB  . VAL A 1 62  ? 29.523 49.325  9.877   1.00 78.58  ? 62   VAL A CB  1 
ATOM   421  C  CG1 . VAL A 1 62  ? 28.140 49.366  10.522  1.00 75.13  ? 62   VAL A CG1 1 
ATOM   422  C  CG2 . VAL A 1 62  ? 30.585 48.856  10.872  1.00 76.49  ? 62   VAL A CG2 1 
ATOM   423  N  N   . LYS A 1 63  ? 28.454 49.966  7.106   1.00 75.14  ? 63   LYS A N   1 
ATOM   424  C  CA  . LYS A 1 63  ? 27.482 50.381  6.108   1.00 71.91  ? 63   LYS A CA  1 
ATOM   425  C  C   . LYS A 1 63  ? 27.243 49.251  5.084   1.00 67.04  ? 63   LYS A C   1 
ATOM   426  O  O   . LYS A 1 63  ? 26.117 48.781  4.898   1.00 64.61  ? 63   LYS A O   1 
ATOM   427  C  CB  . LYS A 1 63  ? 27.980 51.649  5.407   1.00 72.88  ? 63   LYS A CB  1 
ATOM   428  C  CG  . LYS A 1 63  ? 26.888 52.650  4.964   1.00 72.27  ? 63   LYS A CG  1 
ATOM   429  C  CD  . LYS A 1 63  ? 27.481 53.813  4.116   1.00 75.75  ? 63   LYS A CD  1 
ATOM   430  C  CE  . LYS A 1 63  ? 26.462 54.928  3.775   1.00 77.54  ? 63   LYS A CE  1 
ATOM   431  N  NZ  . LYS A 1 63  ? 26.531 56.150  4.660   1.00 77.12  ? 63   LYS A NZ  1 
ATOM   432  N  N   . ARG A 1 64  ? 28.317 48.812  4.439   1.00 68.85  ? 64   ARG A N   1 
ATOM   433  C  CA  . ARG A 1 64  ? 28.250 47.817  3.372   1.00 71.33  ? 64   ARG A CA  1 
ATOM   434  C  C   . ARG A 1 64  ? 27.660 46.505  3.856   1.00 67.77  ? 64   ARG A C   1 
ATOM   435  O  O   . ARG A 1 64  ? 26.882 45.845  3.157   1.00 64.84  ? 64   ARG A O   1 
ATOM   436  C  CB  . ARG A 1 64  ? 29.659 47.567  2.830   1.00 73.96  ? 64   ARG A CB  1 
ATOM   437  C  CG  . ARG A 1 64  ? 29.768 46.502  1.737   1.00 74.47  ? 64   ARG A CG  1 
ATOM   438  C  CD  . ARG A 1 64  ? 31.163 45.871  1.757   1.00 81.11  ? 64   ARG A CD  1 
ATOM   439  N  NE  . ARG A 1 64  ? 31.442 45.308  3.081   1.00 86.40  ? 64   ARG A NE  1 
ATOM   440  C  CZ  . ARG A 1 64  ? 32.640 45.260  3.663   1.00 87.33  ? 64   ARG A CZ  1 
ATOM   441  N  NH1 . ARG A 1 64  ? 33.714 45.742  3.047   1.00 86.04  ? 64   ARG A NH1 1 
ATOM   442  N  NH2 . ARG A 1 64  ? 32.762 44.729  4.876   1.00 84.50  ? 64   ARG A NH2 1 
ATOM   443  N  N   . GLU A 1 65  ? 28.054 46.137  5.067   1.00 67.69  ? 65   GLU A N   1 
ATOM   444  C  CA  . GLU A 1 65  ? 27.637 44.893  5.689   1.00 66.83  ? 65   GLU A CA  1 
ATOM   445  C  C   . GLU A 1 65  ? 26.143 44.886  5.980   1.00 62.71  ? 65   GLU A C   1 
ATOM   446  O  O   . GLU A 1 65  ? 25.443 43.949  5.629   1.00 60.00  ? 65   GLU A O   1 
ATOM   447  C  CB  . GLU A 1 65  ? 28.427 44.706  6.979   1.00 71.15  ? 65   GLU A CB  1 
ATOM   448  C  CG  . GLU A 1 65  ? 28.746 43.274  7.316   1.00 76.10  ? 65   GLU A CG  1 
ATOM   449  C  CD  . GLU A 1 65  ? 30.214 43.068  7.552   1.00 82.85  ? 65   GLU A CD  1 
ATOM   450  O  OE1 . GLU A 1 65  ? 30.658 43.271  8.704   1.00 91.87  ? 65   GLU A OE1 1 
ATOM   451  O  OE2 . GLU A 1 65  ? 30.922 42.715  6.584   1.00 79.52  ? 65   GLU A OE2 1 
ATOM   452  N  N   . ILE A 1 66  ? 25.663 45.928  6.638   1.00 58.85  ? 66   ILE A N   1 
ATOM   453  C  CA  . ILE A 1 66  ? 24.241 46.087  6.874   1.00 58.61  ? 66   ILE A CA  1 
ATOM   454  C  C   . ILE A 1 66  ? 23.397 46.198  5.593   1.00 57.04  ? 66   ILE A C   1 
ATOM   455  O  O   . ILE A 1 66  ? 22.254 45.739  5.554   1.00 53.37  ? 66   ILE A O   1 
ATOM   456  C  CB  . ILE A 1 66  ? 23.995 47.317  7.768   1.00 61.17  ? 66   ILE A CB  1 
ATOM   457  C  CG1 . ILE A 1 66  ? 24.676 47.109  9.116   1.00 64.21  ? 66   ILE A CG1 1 
ATOM   458  C  CG2 . ILE A 1 66  ? 22.504 47.595  7.943   1.00 57.10  ? 66   ILE A CG2 1 
ATOM   459  C  CD1 . ILE A 1 66  ? 24.679 48.328  9.993   1.00 65.72  ? 66   ILE A CD1 1 
ATOM   460  N  N   . ILE A 1 67  ? 23.939 46.821  4.556   1.00 57.82  ? 67   ILE A N   1 
ATOM   461  C  CA  . ILE A 1 67  ? 23.165 47.041  3.342   1.00 57.86  ? 67   ILE A CA  1 
ATOM   462  C  C   . ILE A 1 67  ? 23.014 45.711  2.678   1.00 54.11  ? 67   ILE A C   1 
ATOM   463  O  O   . ILE A 1 67  ? 21.922 45.280  2.254   1.00 51.76  ? 67   ILE A O   1 
ATOM   464  C  CB  . ILE A 1 67  ? 23.902 47.997  2.366   1.00 60.65  ? 67   ILE A CB  1 
ATOM   465  C  CG1 . ILE A 1 67  ? 23.987 49.399  2.967   1.00 61.74  ? 67   ILE A CG1 1 
ATOM   466  C  CG2 . ILE A 1 67  ? 23.234 48.014  0.991   1.00 52.36  ? 67   ILE A CG2 1 
ATOM   467  C  CD1 . ILE A 1 67  ? 22.659 49.969  3.409   1.00 65.97  ? 67   ILE A CD1 1 
ATOM   468  N  N   . ASN A 1 68  ? 24.154 45.051  2.585   1.00 56.99  ? 68   ASN A N   1 
ATOM   469  C  CA  . ASN A 1 68  ? 24.206 43.741  1.974   1.00 58.03  ? 68   ASN A CA  1 
ATOM   470  C  C   . ASN A 1 68  ? 23.376 42.758  2.714   1.00 53.11  ? 68   ASN A C   1 
ATOM   471  O  O   . ASN A 1 68  ? 22.694 41.966  2.105   1.00 51.52  ? 68   ASN A O   1 
ATOM   472  C  CB  . ASN A 1 68  ? 25.637 43.270  1.792   1.00 58.90  ? 68   ASN A CB  1 
ATOM   473  C  CG  . ASN A 1 68  ? 26.106 43.497  0.392   1.00 65.38  ? 68   ASN A CG  1 
ATOM   474  O  OD1 . ASN A 1 68  ? 25.822 42.692  -0.501  1.00 64.13  ? 68   ASN A OD1 1 
ATOM   475  N  ND2 . ASN A 1 68  ? 26.760 44.624  0.161   1.00 63.90  ? 68   ASN A ND2 1 
ATOM   476  N  N   . HIS A 1 69  ? 23.384 42.867  4.029   1.00 52.35  ? 69   HIS A N   1 
ATOM   477  C  CA  . HIS A 1 69  ? 22.570 42.013  4.851   1.00 53.43  ? 69   HIS A CA  1 
ATOM   478  C  C   . HIS A 1 69  ? 21.108 42.243  4.565   1.00 53.73  ? 69   HIS A C   1 
ATOM   479  O  O   . HIS A 1 69  ? 20.366 41.286  4.341   1.00 54.34  ? 69   HIS A O   1 
ATOM   480  C  CB  . HIS A 1 69  ? 22.862 42.221  6.340   1.00 57.40  ? 69   HIS A CB  1 
ATOM   481  C  CG  . HIS A 1 69  ? 22.252 41.172  7.225   1.00 57.21  ? 69   HIS A CG  1 
ATOM   482  N  ND1 . HIS A 1 69  ? 22.179 41.302  8.597   1.00 58.44  ? 69   HIS A ND1 1 
ATOM   483  C  CD2 . HIS A 1 69  ? 21.684 39.978  6.928   1.00 53.73  ? 69   HIS A CD2 1 
ATOM   484  C  CE1 . HIS A 1 69  ? 21.590 40.232  9.105   1.00 58.09  ? 69   HIS A CE1 1 
ATOM   485  N  NE2 . HIS A 1 69  ? 21.285 39.414  8.114   1.00 52.32  ? 69   HIS A NE2 1 
ATOM   486  N  N   . ARG A 1 70  ? 20.695 43.509  4.583   1.00 53.37  ? 70   ARG A N   1 
ATOM   487  C  CA  . ARG A 1 70  ? 19.295 43.868  4.325   1.00 52.42  ? 70   ARG A CA  1 
ATOM   488  C  C   . ARG A 1 70  ? 18.816 43.339  2.981   1.00 51.97  ? 70   ARG A C   1 
ATOM   489  O  O   . ARG A 1 70  ? 17.659 42.994  2.810   1.00 54.18  ? 70   ARG A O   1 
ATOM   490  C  CB  . ARG A 1 70  ? 19.085 45.388  4.438   1.00 56.99  ? 70   ARG A CB  1 
ATOM   491  C  CG  . ARG A 1 70  ? 17.828 45.943  3.751   1.00 58.18  ? 70   ARG A CG  1 
ATOM   492  C  CD  . ARG A 1 70  ? 16.558 45.652  4.510   1.00 56.87  ? 70   ARG A CD  1 
ATOM   493  N  NE  . ARG A 1 70  ? 15.370 46.245  3.890   1.00 65.63  ? 70   ARG A NE  1 
ATOM   494  C  CZ  . ARG A 1 70  ? 14.630 45.650  2.951   1.00 67.46  ? 70   ARG A CZ  1 
ATOM   495  N  NH1 . ARG A 1 70  ? 14.961 44.456  2.505   1.00 58.21  ? 70   ARG A NH1 1 
ATOM   496  N  NH2 . ARG A 1 70  ? 13.557 46.242  2.441   1.00 69.80  ? 70   ARG A NH2 1 
ATOM   497  N  N   . SER A 1 71  ? 19.723 43.238  2.031   1.00 54.03  ? 71   SER A N   1 
ATOM   498  C  CA  . SER A 1 71  ? 19.350 42.751  0.714   1.00 54.86  ? 71   SER A CA  1 
ATOM   499  C  C   . SER A 1 71  ? 18.832 41.309  0.658   1.00 59.22  ? 71   SER A C   1 
ATOM   500  O  O   . SER A 1 71  ? 18.050 40.977  -0.239  1.00 62.60  ? 71   SER A O   1 
ATOM   501  C  CB  . SER A 1 71  ? 20.519 42.920  -0.256  1.00 58.87  ? 71   SER A CB  1 
ATOM   502  O  OG  . SER A 1 71  ? 21.635 42.147  0.155   1.00 56.74  ? 71   SER A OG  1 
ATOM   503  N  N   . LEU A 1 72  ? 19.253 40.452  1.590   1.00 55.81  ? 72   LEU A N   1 
ATOM   504  C  CA  . LEU A 1 72  ? 18.991 39.002  1.452   1.00 57.34  ? 72   LEU A CA  1 
ATOM   505  C  C   . LEU A 1 72  ? 17.667 38.501  2.011   1.00 59.40  ? 72   LEU A C   1 
ATOM   506  O  O   . LEU A 1 72  ? 17.358 38.711  3.185   1.00 59.13  ? 72   LEU A O   1 
ATOM   507  C  CB  . LEU A 1 72  ? 20.116 38.167  2.063   1.00 55.77  ? 72   LEU A CB  1 
ATOM   508  C  CG  . LEU A 1 72  ? 21.522 38.596  1.649   1.00 55.13  ? 72   LEU A CG  1 
ATOM   509  C  CD1 . LEU A 1 72  ? 22.572 38.091  2.603   1.00 51.17  ? 72   LEU A CD1 1 
ATOM   510  C  CD2 . LEU A 1 72  ? 21.802 38.214  0.205   1.00 54.05  ? 72   LEU A CD2 1 
ATOM   511  N  N   . ARG A 1 73  ? 16.930 37.788  1.158   1.00 59.18  ? 73   ARG A N   1 
ATOM   512  C  CA  . ARG A 1 73  ? 15.643 37.202  1.486   1.00 60.17  ? 73   ARG A CA  1 
ATOM   513  C  C   . ARG A 1 73  ? 15.514 35.763  0.981   1.00 59.95  ? 73   ARG A C   1 
ATOM   514  O  O   . ARG A 1 73  ? 14.984 35.518  -0.099  1.00 64.85  ? 73   ARG A O   1 
ATOM   515  C  CB  . ARG A 1 73  ? 14.538 38.042  0.861   1.00 65.52  ? 73   ARG A CB  1 
ATOM   516  C  CG  . ARG A 1 73  ? 14.472 39.442  1.401   1.00 72.92  ? 73   ARG A CG  1 
ATOM   517  C  CD  . ARG A 1 73  ? 13.144 39.686  2.085   1.00 86.30  ? 73   ARG A CD  1 
ATOM   518  N  NE  . ARG A 1 73  ? 12.029 39.741  1.143   1.00 93.53  ? 73   ARG A NE  1 
ATOM   519  C  CZ  . ARG A 1 73  ? 11.002 40.574  1.272   1.00 96.98  ? 73   ARG A CZ  1 
ATOM   520  N  NH1 . ARG A 1 73  ? 10.961 41.413  2.299   1.00 91.56  ? 73   ARG A NH1 1 
ATOM   521  N  NH2 . ARG A 1 73  ? 10.021 40.573  0.378   1.00 102.03 ? 73   ARG A NH2 1 
ATOM   522  N  N   . HIS A 1 74  ? 15.999 34.820  1.778   1.00 59.18  ? 74   HIS A N   1 
ATOM   523  C  CA  . HIS A 1 74  ? 15.892 33.395  1.488   1.00 54.53  ? 74   HIS A CA  1 
ATOM   524  C  C   . HIS A 1 74  ? 15.590 32.706  2.815   1.00 53.81  ? 74   HIS A C   1 
ATOM   525  O  O   . HIS A 1 74  ? 16.119 33.106  3.857   1.00 55.25  ? 74   HIS A O   1 
ATOM   526  C  CB  . HIS A 1 74  ? 17.204 32.894  0.873   1.00 56.68  ? 74   HIS A CB  1 
ATOM   527  C  CG  . HIS A 1 74  ? 17.208 31.439  0.521   1.00 54.02  ? 74   HIS A CG  1 
ATOM   528  N  ND1 . HIS A 1 74  ? 17.168 30.444  1.473   1.00 54.03  ? 74   HIS A ND1 1 
ATOM   529  C  CD2 . HIS A 1 74  ? 17.274 30.810  -0.674  1.00 54.62  ? 74   HIS A CD2 1 
ATOM   530  C  CE1 . HIS A 1 74  ? 17.187 29.264  0.881   1.00 52.80  ? 74   HIS A CE1 1 
ATOM   531  N  NE2 . HIS A 1 74  ? 17.257 29.456  -0.427  1.00 53.05  ? 74   HIS A NE2 1 
ATOM   532  N  N   . PRO A 1 75  ? 14.721 31.685  2.790   1.00 55.04  ? 75   PRO A N   1 
ATOM   533  C  CA  . PRO A 1 75  ? 14.324 31.007  4.032   1.00 55.51  ? 75   PRO A CA  1 
ATOM   534  C  C   . PRO A 1 75  ? 15.473 30.224  4.725   1.00 51.99  ? 75   PRO A C   1 
ATOM   535  O  O   . PRO A 1 75  ? 15.373 29.850  5.888   1.00 52.04  ? 75   PRO A O   1 
ATOM   536  C  CB  . PRO A 1 75  ? 13.188 30.082  3.580   1.00 48.64  ? 75   PRO A CB  1 
ATOM   537  C  CG  . PRO A 1 75  ? 13.391 29.876  2.125   1.00 48.47  ? 75   PRO A CG  1 
ATOM   538  C  CD  . PRO A 1 75  ? 14.149 31.047  1.587   1.00 51.95  ? 75   PRO A CD  1 
ATOM   539  N  N   . ASN A 1 76  ? 16.577 30.010  4.030   1.00 48.93  ? 76   ASN A N   1 
ATOM   540  C  CA  . ASN A 1 76  ? 17.707 29.372  4.683   1.00 49.76  ? 76   ASN A CA  1 
ATOM   541  C  C   . ASN A 1 76  ? 18.793 30.292  5.190   1.00 51.28  ? 76   ASN A C   1 
ATOM   542  O  O   . ASN A 1 76  ? 19.794 29.836  5.728   1.00 49.75  ? 76   ASN A O   1 
ATOM   543  C  CB  . ASN A 1 76  ? 18.286 28.265  3.814   1.00 48.15  ? 76   ASN A CB  1 
ATOM   544  C  CG  . ASN A 1 76  ? 17.370 27.090  3.728   1.00 46.04  ? 76   ASN A CG  1 
ATOM   545  O  OD1 . ASN A 1 76  ? 16.984 26.689  2.640   1.00 45.82  ? 76   ASN A OD1 1 
ATOM   546  N  ND2 . ASN A 1 76  ? 16.970 26.560  4.877   1.00 40.58  ? 76   ASN A ND2 1 
ATOM   547  N  N   . ILE A 1 77  ? 18.565 31.589  5.036   1.00 50.46  ? 77   ILE A N   1 
ATOM   548  C  CA  . ILE A 1 77  ? 19.523 32.585  5.455   1.00 51.12  ? 77   ILE A CA  1 
ATOM   549  C  C   . ILE A 1 77  ? 18.996 33.326  6.658   1.00 50.96  ? 77   ILE A C   1 
ATOM   550  O  O   . ILE A 1 77  ? 17.812 33.606  6.742   1.00 55.52  ? 77   ILE A O   1 
ATOM   551  C  CB  . ILE A 1 77  ? 19.814 33.588  4.341   1.00 53.73  ? 77   ILE A CB  1 
ATOM   552  C  CG1 . ILE A 1 77  ? 20.047 32.866  3.023   1.00 52.34  ? 77   ILE A CG1 1 
ATOM   553  C  CG2 . ILE A 1 77  ? 21.055 34.380  4.665   1.00 50.50  ? 77   ILE A CG2 1 
ATOM   554  C  CD1 . ILE A 1 77  ? 21.326 32.098  2.987   1.00 48.96  ? 77   ILE A CD1 1 
ATOM   555  N  N   . VAL A 1 78  ? 19.882 33.643  7.593   1.00 50.76  ? 78   VAL A N   1 
ATOM   556  C  CA  . VAL A 1 78  ? 19.496 34.393  8.788   1.00 55.12  ? 78   VAL A CA  1 
ATOM   557  C  C   . VAL A 1 78  ? 19.155 35.837  8.436   1.00 54.52  ? 78   VAL A C   1 
ATOM   558  O  O   . VAL A 1 78  ? 20.018 36.607  8.028   1.00 56.01  ? 78   VAL A O   1 
ATOM   559  C  CB  . VAL A 1 78  ? 20.585 34.364  9.878   1.00 52.38  ? 78   VAL A CB  1 
ATOM   560  C  CG1 . VAL A 1 78  ? 20.304 35.450  10.933  1.00 53.83  ? 78   VAL A CG1 1 
ATOM   561  C  CG2 . VAL A 1 78  ? 20.633 33.013  10.510  1.00 50.02  ? 78   VAL A CG2 1 
ATOM   562  N  N   . ARG A 1 79  ? 17.897 36.208  8.604   1.00 56.05  ? 79   ARG A N   1 
ATOM   563  C  CA  . ARG A 1 79  ? 17.418 37.434  7.974   1.00 55.71  ? 79   ARG A CA  1 
ATOM   564  C  C   . ARG A 1 79  ? 17.505 38.752  8.759   1.00 54.80  ? 79   ARG A C   1 
ATOM   565  O  O   . ARG A 1 79  ? 17.295 38.809  9.974   1.00 56.21  ? 79   ARG A O   1 
ATOM   566  C  CB  . ARG A 1 79  ? 16.032 37.209  7.365   1.00 55.89  ? 79   ARG A CB  1 
ATOM   567  C  CG  . ARG A 1 79  ? 16.152 36.492  6.025   1.00 63.04  ? 79   ARG A CG  1 
ATOM   568  C  CD  . ARG A 1 79  ? 14.833 36.305  5.308   1.00 67.60  ? 79   ARG A CD  1 
ATOM   569  N  NE  . ARG A 1 79  ? 13.956 35.392  6.026   1.00 75.87  ? 79   ARG A NE  1 
ATOM   570  C  CZ  . ARG A 1 79  ? 13.051 34.625  5.435   1.00 69.75  ? 79   ARG A CZ  1 
ATOM   571  N  NH1 . ARG A 1 79  ? 12.924 34.667  4.116   1.00 67.18  ? 79   ARG A NH1 1 
ATOM   572  N  NH2 . ARG A 1 79  ? 12.282 33.815  6.155   1.00 69.91  ? 79   ARG A NH2 1 
ATOM   573  N  N   . PHE A 1 80  ? 17.860 39.799  8.028   1.00 52.46  ? 80   PHE A N   1 
ATOM   574  C  CA  . PHE A 1 80  ? 17.811 41.168  8.522   1.00 54.83  ? 80   PHE A CA  1 
ATOM   575  C  C   . PHE A 1 80  ? 16.364 41.622  8.783   1.00 53.28  ? 80   PHE A C   1 
ATOM   576  O  O   . PHE A 1 80  ? 15.471 41.464  7.951   1.00 52.67  ? 80   PHE A O   1 
ATOM   577  C  CB  . PHE A 1 80  ? 18.499 42.108  7.515   1.00 55.34  ? 80   PHE A CB  1 
ATOM   578  C  CG  . PHE A 1 80  ? 18.594 43.527  7.977   1.00 55.13  ? 80   PHE A CG  1 
ATOM   579  C  CD1 . PHE A 1 80  ? 19.668 43.954  8.732   1.00 55.94  ? 80   PHE A CD1 1 
ATOM   580  C  CD2 . PHE A 1 80  ? 17.612 44.437  7.659   1.00 54.87  ? 80   PHE A CD2 1 
ATOM   581  C  CE1 . PHE A 1 80  ? 19.753 45.246  9.173   1.00 52.67  ? 80   PHE A CE1 1 
ATOM   582  C  CE2 . PHE A 1 80  ? 17.700 45.746  8.097   1.00 54.25  ? 80   PHE A CE2 1 
ATOM   583  C  CZ  . PHE A 1 80  ? 18.772 46.143  8.856   1.00 53.24  ? 80   PHE A CZ  1 
ATOM   584  N  N   . LYS A 1 81  ? 16.156 42.177  9.968   1.00 56.53  ? 81   LYS A N   1 
ATOM   585  C  CA  . LYS A 1 81  ? 14.860 42.679  10.401  1.00 60.33  ? 81   LYS A CA  1 
ATOM   586  C  C   . LYS A 1 81  ? 14.893 44.196  10.317  1.00 59.80  ? 81   LYS A C   1 
ATOM   587  O  O   . LYS A 1 81  ? 14.286 44.830  9.441   1.00 61.59  ? 81   LYS A O   1 
ATOM   588  C  CB  . LYS A 1 81  ? 14.593 42.275  11.849  1.00 61.00  ? 81   LYS A CB  1 
ATOM   589  C  CG  . LYS A 1 81  ? 13.290 41.561  12.063  1.00 61.03  ? 81   LYS A CG  1 
ATOM   590  C  CD  . LYS A 1 81  ? 13.222 40.339  11.147  1.00 65.02  ? 81   LYS A CD  1 
ATOM   591  C  CE  . LYS A 1 81  ? 11.799 39.880  10.889  1.00 65.49  ? 81   LYS A CE  1 
ATOM   592  N  NZ  . LYS A 1 81  ? 11.835 38.544  10.231  1.00 70.34  ? 81   LYS A NZ  1 
ATOM   593  N  N   . GLU A 1 82  ? 15.618 44.808  11.226  1.00 58.66  ? 82   GLU A N   1 
ATOM   594  C  CA  . GLU A 1 82  ? 15.609 46.234  11.187  1.00 60.46  ? 82   GLU A CA  1 
ATOM   595  C  C   . GLU A 1 82  ? 16.775 46.824  11.905  1.00 59.68  ? 82   GLU A C   1 
ATOM   596  O  O   . GLU A 1 82  ? 17.520 46.158  12.606  1.00 57.54  ? 82   GLU A O   1 
ATOM   597  C  CB  . GLU A 1 82  ? 14.316 46.762  11.772  1.00 63.07  ? 82   GLU A CB  1 
ATOM   598  C  CG  . GLU A 1 82  ? 14.354 46.943  13.265  1.00 62.99  ? 82   GLU A CG  1 
ATOM   599  C  CD  . GLU A 1 82  ? 12.994 47.298  13.819  1.00 70.02  ? 82   GLU A CD  1 
ATOM   600  O  OE1 . GLU A 1 82  ? 12.040 47.510  13.031  1.00 69.24  ? 82   GLU A OE1 1 
ATOM   601  O  OE2 . GLU A 1 82  ? 12.883 47.357  15.052  1.00 73.67  ? 82   GLU A OE2 1 
ATOM   602  N  N   . VAL A 1 83  ? 16.949 48.109  11.693  1.00 66.58  ? 83   VAL A N   1 
ATOM   603  C  CA  . VAL A 1 83  ? 18.026 48.798  12.339  1.00 66.28  ? 83   VAL A CA  1 
ATOM   604  C  C   . VAL A 1 83  ? 17.370 49.932  13.111  1.00 65.20  ? 83   VAL A C   1 
ATOM   605  O  O   . VAL A 1 83  ? 16.295 50.412  12.731  1.00 64.65  ? 83   VAL A O   1 
ATOM   606  C  CB  . VAL A 1 83  ? 19.042 49.265  11.317  1.00 62.61  ? 83   VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 83  ? 18.573 50.575  10.689  1.00 68.35  ? 83   VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 83  ? 20.429 49.368  11.945  1.00 66.32  ? 83   VAL A CG2 1 
ATOM   609  N  N   . ILE A 1 84  ? 18.004 50.309  14.216  1.00 67.77  ? 84   ILE A N   1 
ATOM   610  C  CA  . ILE A 1 84  ? 17.428 51.206  15.217  1.00 71.60  ? 84   ILE A CA  1 
ATOM   611  C  C   . ILE A 1 84  ? 18.541 52.023  15.866  1.00 72.01  ? 84   ILE A C   1 
ATOM   612  O  O   . ILE A 1 84  ? 19.647 51.532  16.081  1.00 69.78  ? 84   ILE A O   1 
ATOM   613  C  CB  . ILE A 1 84  ? 16.695 50.412  16.322  1.00 69.58  ? 84   ILE A CB  1 
ATOM   614  C  CG1 . ILE A 1 84  ? 15.546 49.606  15.737  1.00 69.49  ? 84   ILE A CG1 1 
ATOM   615  C  CG2 . ILE A 1 84  ? 16.158 51.327  17.385  1.00 62.24  ? 84   ILE A CG2 1 
ATOM   616  C  CD1 . ILE A 1 84  ? 14.940 48.642  16.722  1.00 67.85  ? 84   ILE A CD1 1 
ATOM   617  N  N   . LEU A 1 85  ? 18.245 53.274  16.187  1.00 76.39  ? 85   LEU A N   1 
ATOM   618  C  CA  . LEU A 1 85  ? 19.246 54.152  16.773  1.00 76.30  ? 85   LEU A CA  1 
ATOM   619  C  C   . LEU A 1 85  ? 19.056 54.245  18.282  1.00 72.52  ? 85   LEU A C   1 
ATOM   620  O  O   . LEU A 1 85  ? 17.941 54.365  18.749  1.00 68.92  ? 85   LEU A O   1 
ATOM   621  C  CB  . LEU A 1 85  ? 19.131 55.534  16.132  1.00 75.35  ? 85   LEU A CB  1 
ATOM   622  C  CG  . LEU A 1 85  ? 20.030 56.671  16.586  1.00 79.39  ? 85   LEU A CG  1 
ATOM   623  C  CD1 . LEU A 1 85  ? 21.215 56.806  15.664  1.00 78.51  ? 85   LEU A CD1 1 
ATOM   624  C  CD2 . LEU A 1 85  ? 19.184 57.938  16.594  1.00 81.88  ? 85   LEU A CD2 1 
ATOM   625  N  N   . THR A 1 86  ? 20.137 54.153  19.043  1.00 77.00  ? 86   THR A N   1 
ATOM   626  C  CA  . THR A 1 86  ? 20.087 54.491  20.461  1.00 82.94  ? 86   THR A CA  1 
ATOM   627  C  C   . THR A 1 86  ? 21.035 55.663  20.717  1.00 86.88  ? 86   THR A C   1 
ATOM   628  O  O   . THR A 1 86  ? 21.879 55.982  19.877  1.00 86.31  ? 86   THR A O   1 
ATOM   629  C  CB  . THR A 1 86  ? 20.476 53.293  21.375  1.00 84.91  ? 86   THR A CB  1 
ATOM   630  O  OG1 . THR A 1 86  ? 21.864 52.966  21.205  1.00 79.78  ? 86   THR A OG1 1 
ATOM   631  C  CG2 . THR A 1 86  ? 19.584 52.054  21.096  1.00 76.67  ? 86   THR A CG2 1 
ATOM   632  N  N   . PRO A 1 87  ? 20.875 56.338  21.862  1.00 89.88  ? 87   PRO A N   1 
ATOM   633  C  CA  . PRO A 1 87  ? 21.843 57.352  22.276  1.00 87.32  ? 87   PRO A CA  1 
ATOM   634  C  C   . PRO A 1 87  ? 23.283 56.857  22.178  1.00 87.66  ? 87   PRO A C   1 
ATOM   635  O  O   . PRO A 1 87  ? 24.165 57.585  21.718  1.00 93.05  ? 87   PRO A O   1 
ATOM   636  C  CB  . PRO A 1 87  ? 21.461 57.584  23.732  1.00 87.02  ? 87   PRO A CB  1 
ATOM   637  C  CG  . PRO A 1 87  ? 19.968 57.468  23.716  1.00 87.22  ? 87   PRO A CG  1 
ATOM   638  C  CD  . PRO A 1 87  ? 19.652 56.392  22.683  1.00 87.94  ? 87   PRO A CD  1 
ATOM   639  N  N   . THR A 1 88  ? 23.504 55.618  22.595  1.00 83.15  ? 88   THR A N   1 
ATOM   640  C  CA  . THR A 1 88  ? 24.848 55.043  22.644  1.00 88.31  ? 88   THR A CA  1 
ATOM   641  C  C   . THR A 1 88  ? 25.229 54.132  21.464  1.00 84.62  ? 88   THR A C   1 
ATOM   642  O  O   . THR A 1 88  ? 26.408 54.027  21.115  1.00 79.18  ? 88   THR A O   1 
ATOM   643  C  CB  . THR A 1 88  ? 25.035 54.234  23.941  1.00 89.54  ? 88   THR A CB  1 
ATOM   644  O  OG1 . THR A 1 88  ? 23.748 53.848  24.450  1.00 88.00  ? 88   THR A OG1 1 
ATOM   645  C  CG2 . THR A 1 88  ? 25.791 55.056  24.985  1.00 84.26  ? 88   THR A CG2 1 
ATOM   646  N  N   . HIS A 1 89  ? 24.233 53.478  20.866  1.00 85.49  ? 89   HIS A N   1 
ATOM   647  C  CA  . HIS A 1 89  ? 24.470 52.413  19.891  1.00 83.95  ? 89   HIS A CA  1 
ATOM   648  C  C   . HIS A 1 89  ? 23.441 52.409  18.748  1.00 79.68  ? 89   HIS A C   1 
ATOM   649  O  O   . HIS A 1 89  ? 22.297 52.839  18.914  1.00 75.27  ? 89   HIS A O   1 
ATOM   650  C  CB  . HIS A 1 89  ? 24.402 51.048  20.602  1.00 81.73  ? 89   HIS A CB  1 
ATOM   651  C  CG  . HIS A 1 89  ? 25.504 50.811  21.594  1.00 82.81  ? 89   HIS A CG  1 
ATOM   652  N  ND1 . HIS A 1 89  ? 25.373 51.063  22.945  1.00 84.67  ? 89   HIS A ND1 1 
ATOM   653  C  CD2 . HIS A 1 89  ? 26.759 50.322  21.429  1.00 84.28  ? 89   HIS A CD2 1 
ATOM   654  C  CE1 . HIS A 1 89  ? 26.500 50.751  23.563  1.00 85.91  ? 89   HIS A CE1 1 
ATOM   655  N  NE2 . HIS A 1 89  ? 27.355 50.300  22.667  1.00 84.07  ? 89   HIS A NE2 1 
ATOM   656  N  N   . LEU A 1 90  ? 23.843 51.909  17.589  1.00 82.47  ? 90   LEU A N   1 
ATOM   657  C  CA  . LEU A 1 90  ? 22.896 51.509  16.540  1.00 82.31  ? 90   LEU A CA  1 
ATOM   658  C  C   . LEU A 1 90  ? 22.449 50.076  16.843  1.00 80.11  ? 90   LEU A C   1 
ATOM   659  O  O   . LEU A 1 90  ? 23.292 49.220  17.069  1.00 75.23  ? 90   LEU A O   1 
ATOM   660  C  CB  . LEU A 1 90  ? 23.588 51.541  15.174  1.00 81.97  ? 90   LEU A CB  1 
ATOM   661  C  CG  . LEU A 1 90  ? 22.803 51.041  13.961  1.00 74.96  ? 90   LEU A CG  1 
ATOM   662  C  CD1 . LEU A 1 90  ? 21.641 51.956  13.634  1.00 74.09  ? 90   LEU A CD1 1 
ATOM   663  C  CD2 . LEU A 1 90  ? 23.726 50.917  12.768  1.00 78.76  ? 90   LEU A CD2 1 
ATOM   664  N  N   . ALA A 1 91  ? 21.144 49.814  16.855  1.00 79.27  ? 91   ALA A N   1 
ATOM   665  C  CA  . ALA A 1 91  ? 20.647 48.472  17.118  1.00 74.97  ? 91   ALA A CA  1 
ATOM   666  C  C   . ALA A 1 91  ? 20.282 47.739  15.829  1.00 73.50  ? 91   ALA A C   1 
ATOM   667  O  O   . ALA A 1 91  ? 19.350 48.132  15.124  1.00 73.52  ? 91   ALA A O   1 
ATOM   668  C  CB  . ALA A 1 91  ? 19.450 48.512  18.067  1.00 72.77  ? 91   ALA A CB  1 
ATOM   669  N  N   . ILE A 1 92  ? 21.013 46.666  15.522  1.00 72.52  ? 92   ILE A N   1 
ATOM   670  C  CA  . ILE A 1 92  ? 20.649 45.819  14.380  1.00 69.97  ? 92   ILE A CA  1 
ATOM   671  C  C   . ILE A 1 92  ? 19.880 44.578  14.826  1.00 66.93  ? 92   ILE A C   1 
ATOM   672  O  O   . ILE A 1 92  ? 20.362 43.793  15.636  1.00 64.59  ? 92   ILE A O   1 
ATOM   673  C  CB  . ILE A 1 92  ? 21.868 45.409  13.580  1.00 71.43  ? 92   ILE A CB  1 
ATOM   674  C  CG1 . ILE A 1 92  ? 22.825 46.591  13.509  1.00 73.57  ? 92   ILE A CG1 1 
ATOM   675  C  CG2 . ILE A 1 92  ? 21.469 44.944  12.184  1.00 67.19  ? 92   ILE A CG2 1 
ATOM   676  C  CD1 . ILE A 1 92  ? 24.256 46.185  13.435  1.00 75.39  ? 92   ILE A CD1 1 
ATOM   677  N  N   . VAL A 1 93  ? 18.685 44.428  14.273  1.00 64.88  ? 93   VAL A N   1 
ATOM   678  C  CA  . VAL A 1 93  ? 17.747 43.408  14.681  1.00 62.08  ? 93   VAL A CA  1 
ATOM   679  C  C   . VAL A 1 93  ? 17.636 42.426  13.538  1.00 61.74  ? 93   VAL A C   1 
ATOM   680  O  O   . VAL A 1 93  ? 17.450 42.823  12.392  1.00 61.06  ? 93   VAL A O   1 
ATOM   681  C  CB  . VAL A 1 93  ? 16.377 44.044  14.968  1.00 63.00  ? 93   VAL A CB  1 
ATOM   682  C  CG1 . VAL A 1 93  ? 15.312 42.987  15.111  1.00 59.50  ? 93   VAL A CG1 1 
ATOM   683  C  CG2 . VAL A 1 93  ? 16.454 44.983  16.188  1.00 62.36  ? 93   VAL A CG2 1 
ATOM   684  N  N   . MET A 1 94  ? 17.797 41.143  13.837  1.00 61.68  ? 94   MET A N   1 
ATOM   685  C  CA  . MET A 1 94  ? 17.661 40.130  12.804  1.00 60.95  ? 94   MET A CA  1 
ATOM   686  C  C   . MET A 1 94  ? 16.943 38.914  13.344  1.00 59.66  ? 94   MET A C   1 
ATOM   687  O  O   . MET A 1 94  ? 16.670 38.837  14.550  1.00 56.77  ? 94   MET A O   1 
ATOM   688  C  CB  . MET A 1 94  ? 19.025 39.734  12.259  1.00 57.59  ? 94   MET A CB  1 
ATOM   689  C  CG  . MET A 1 94  ? 20.010 39.427  13.349  1.00 61.62  ? 94   MET A CG  1 
ATOM   690  S  SD  . MET A 1 94  ? 21.759 39.410  12.884  1.00 65.30  ? 94   MET A SD  1 
ATOM   691  C  CE  . MET A 1 94  ? 22.395 40.516  14.134  1.00 70.32  ? 94   MET A CE  1 
ATOM   692  N  N   . GLU A 1 95  ? 16.633 37.985  12.435  1.00 57.54  ? 95   GLU A N   1 
ATOM   693  C  CA  . GLU A 1 95  ? 16.171 36.645  12.786  1.00 58.16  ? 95   GLU A CA  1 
ATOM   694  C  C   . GLU A 1 95  ? 17.119 35.971  13.766  1.00 59.80  ? 95   GLU A C   1 
ATOM   695  O  O   . GLU A 1 95  ? 18.334 36.158  13.695  1.00 57.70  ? 95   GLU A O   1 
ATOM   696  C  CB  . GLU A 1 95  ? 16.076 35.766  11.549  1.00 57.81  ? 95   GLU A CB  1 
ATOM   697  C  CG  . GLU A 1 95  ? 14.808 35.929  10.746  1.00 63.70  ? 95   GLU A CG  1 
ATOM   698  C  CD  . GLU A 1 95  ? 14.735 34.943  9.572   1.00 69.71  ? 95   GLU A CD  1 
ATOM   699  O  OE1 . GLU A 1 95  ? 15.798 34.594  8.999   1.00 62.92  ? 95   GLU A OE1 1 
ATOM   700  O  OE2 . GLU A 1 95  ? 13.608 34.513  9.230   1.00 71.94  ? 95   GLU A OE2 1 
ATOM   701  N  N   . TYR A 1 96  ? 16.554 35.177  14.670  1.00 57.80  ? 96   TYR A N   1 
ATOM   702  C  CA  . TYR A 1 96  ? 17.338 34.352  15.589  1.00 55.62  ? 96   TYR A CA  1 
ATOM   703  C  C   . TYR A 1 96  ? 16.988 32.886  15.446  1.00 50.91  ? 96   TYR A C   1 
ATOM   704  O  O   . TYR A 1 96  ? 15.825 32.517  15.617  1.00 50.46  ? 96   TYR A O   1 
ATOM   705  C  CB  . TYR A 1 96  ? 17.114 34.784  17.032  1.00 52.75  ? 96   TYR A CB  1 
ATOM   706  C  CG  . TYR A 1 96  ? 17.718 33.875  18.061  1.00 53.98  ? 96   TYR A CG  1 
ATOM   707  C  CD1 . TYR A 1 96  ? 19.105 33.817  18.240  1.00 57.64  ? 96   TYR A CD1 1 
ATOM   708  C  CD2 . TYR A 1 96  ? 16.921 33.095  18.883  1.00 54.86  ? 96   TYR A CD2 1 
ATOM   709  C  CE1 . TYR A 1 96  ? 19.695 32.987  19.194  1.00 52.71  ? 96   TYR A CE1 1 
ATOM   710  C  CE2 . TYR A 1 96  ? 17.496 32.263  19.854  1.00 55.16  ? 96   TYR A CE2 1 
ATOM   711  C  CZ  . TYR A 1 96  ? 18.886 32.213  20.001  1.00 54.53  ? 96   TYR A CZ  1 
ATOM   712  O  OH  . TYR A 1 96  ? 19.446 31.386  20.963  1.00 51.94  ? 96   TYR A OH  1 
ATOM   713  N  N   . ALA A 1 97  ? 18.001 32.075  15.117  1.00 51.70  ? 97   ALA A N   1 
ATOM   714  C  CA  . ALA A 1 97  ? 17.908 30.610  15.072  1.00 52.38  ? 97   ALA A CA  1 
ATOM   715  C  C   . ALA A 1 97  ? 17.980 30.036  16.475  1.00 50.00  ? 97   ALA A C   1 
ATOM   716  O  O   . ALA A 1 97  ? 19.063 29.969  17.079  1.00 48.97  ? 97   ALA A O   1 
ATOM   717  C  CB  . ALA A 1 97  ? 19.028 30.022  14.221  1.00 48.60  ? 97   ALA A CB  1 
ATOM   718  N  N   . SER A 1 98  ? 16.818 29.612  16.970  1.00 48.92  ? 98   SER A N   1 
ATOM   719  C  CA  . SER A 1 98  ? 16.655 29.167  18.343  1.00 52.38  ? 98   SER A CA  1 
ATOM   720  C  C   . SER A 1 98  ? 16.866 27.659  18.499  1.00 52.31  ? 98   SER A C   1 
ATOM   721  O  O   . SER A 1 98  ? 16.706 27.112  19.588  1.00 48.51  ? 98   SER A O   1 
ATOM   722  C  CB  . SER A 1 98  ? 15.258 29.524  18.812  1.00 54.69  ? 98   SER A CB  1 
ATOM   723  O  OG  . SER A 1 98  ? 14.287 28.928  17.966  1.00 55.64  ? 98   SER A OG  1 
ATOM   724  N  N   . GLY A 1 99  ? 17.225 27.003  17.398  1.00 50.45  ? 99   GLY A N   1 
ATOM   725  C  CA  . GLY A 1 99  ? 17.388 25.570  17.376  1.00 48.64  ? 99   GLY A CA  1 
ATOM   726  C  C   . GLY A 1 99  ? 18.809 25.130  17.666  1.00 49.85  ? 99   GLY A C   1 
ATOM   727  O  O   . GLY A 1 99  ? 19.076 23.935  17.758  1.00 45.96  ? 99   GLY A O   1 
ATOM   728  N  N   . GLY A 1 100 ? 19.712 26.098  17.811  1.00 48.58  ? 100  GLY A N   1 
ATOM   729  C  CA  . GLY A 1 100 ? 21.106 25.827  18.113  1.00 45.38  ? 100  GLY A CA  1 
ATOM   730  C  C   . GLY A 1 100 ? 21.911 25.441  16.888  1.00 45.61  ? 100  GLY A C   1 
ATOM   731  O  O   . GLY A 1 100 ? 21.431 25.551  15.764  1.00 44.30  ? 100  GLY A O   1 
ATOM   732  N  N   . GLU A 1 101 ? 23.136 24.977  17.100  1.00 45.26  ? 101  GLU A N   1 
ATOM   733  C  CA  . GLU A 1 101 ? 23.987 24.583  15.986  1.00 45.80  ? 101  GLU A CA  1 
ATOM   734  C  C   . GLU A 1 101 ? 23.624 23.215  15.416  1.00 44.65  ? 101  GLU A C   1 
ATOM   735  O  O   . GLU A 1 101 ? 23.327 22.285  16.147  1.00 44.51  ? 101  GLU A O   1 
ATOM   736  C  CB  . GLU A 1 101 ? 25.454 24.587  16.404  1.00 47.05  ? 101  GLU A CB  1 
ATOM   737  C  CG  . GLU A 1 101 ? 25.935 25.889  16.975  1.00 50.92  ? 101  GLU A CG  1 
ATOM   738  C  CD  . GLU A 1 101 ? 27.374 25.814  17.490  1.00 57.71  ? 101  GLU A CD  1 
ATOM   739  O  OE1 . GLU A 1 101 ? 28.025 24.760  17.314  1.00 59.63  ? 101  GLU A OE1 1 
ATOM   740  O  OE2 . GLU A 1 101 ? 27.861 26.809  18.076  1.00 66.23  ? 101  GLU A OE2 1 
ATOM   741  N  N   . LEU A 1 102 ? 23.628 23.130  14.096  1.00 43.97  ? 102  LEU A N   1 
ATOM   742  C  CA  . LEU A 1 102 ? 23.576 21.863  13.367  1.00 43.82  ? 102  LEU A CA  1 
ATOM   743  C  C   . LEU A 1 102 ? 24.584 20.796  13.869  1.00 44.90  ? 102  LEU A C   1 
ATOM   744  O  O   . LEU A 1 102 ? 24.293 19.588  13.875  1.00 45.11  ? 102  LEU A O   1 
ATOM   745  C  CB  . LEU A 1 102 ? 23.826 22.116  11.881  1.00 44.43  ? 102  LEU A CB  1 
ATOM   746  C  CG  . LEU A 1 102 ? 23.894 20.862  11.037  1.00 44.51  ? 102  LEU A CG  1 
ATOM   747  C  CD1 . LEU A 1 102 ? 22.520 20.170  10.893  1.00 46.24  ? 102  LEU A CD1 1 
ATOM   748  C  CD2 . LEU A 1 102 ? 24.464 21.180  9.695   1.00 45.66  ? 102  LEU A CD2 1 
ATOM   749  N  N   . PHE A 1 103 ? 25.766 21.247  14.278  1.00 43.06  ? 103  PHE A N   1 
ATOM   750  C  CA  . PHE A 1 103 ? 26.779 20.366  14.801  1.00 44.15  ? 103  PHE A CA  1 
ATOM   751  C  C   . PHE A 1 103 ? 26.338 19.673  16.104  1.00 43.84  ? 103  PHE A C   1 
ATOM   752  O  O   . PHE A 1 103 ? 26.677 18.534  16.382  1.00 43.66  ? 103  PHE A O   1 
ATOM   753  C  CB  . PHE A 1 103 ? 28.062 21.150  15.039  1.00 41.89  ? 103  PHE A CB  1 
ATOM   754  C  CG  . PHE A 1 103 ? 29.217 20.297  15.542  1.00 43.65  ? 103  PHE A CG  1 
ATOM   755  C  CD1 . PHE A 1 103 ? 29.779 19.325  14.723  1.00 48.30  ? 103  PHE A CD1 1 
ATOM   756  C  CD2 . PHE A 1 103 ? 29.737 20.467  16.824  1.00 42.86  ? 103  PHE A CD2 1 
ATOM   757  C  CE1 . PHE A 1 103 ? 30.842 18.544  15.166  1.00 49.13  ? 103  PHE A CE1 1 
ATOM   758  C  CE2 . PHE A 1 103 ? 30.791 19.695  17.268  1.00 45.72  ? 103  PHE A CE2 1 
ATOM   759  C  CZ  . PHE A 1 103 ? 31.349 18.731  16.435  1.00 48.07  ? 103  PHE A CZ  1 
ATOM   760  N  N   . GLU A 1 104 ? 25.600 20.399  16.904  1.00 44.25  ? 104  GLU A N   1 
ATOM   761  C  CA  . GLU A 1 104 ? 25.188 19.919  18.184  1.00 46.51  ? 104  GLU A CA  1 
ATOM   762  C  C   . GLU A 1 104 ? 24.161 18.821  17.989  1.00 48.19  ? 104  GLU A C   1 
ATOM   763  O  O   . GLU A 1 104 ? 24.140 17.839  18.733  1.00 44.34  ? 104  GLU A O   1 
ATOM   764  C  CB  . GLU A 1 104 ? 24.619 21.074  18.998  1.00 45.63  ? 104  GLU A CB  1 
ATOM   765  C  CG  . GLU A 1 104 ? 25.662 21.769  19.840  1.00 49.16  ? 104  GLU A CG  1 
ATOM   766  C  CD  . GLU A 1 104 ? 26.447 20.771  20.692  1.00 70.74  ? 104  GLU A CD  1 
ATOM   767  O  OE1 . GLU A 1 104 ? 25.807 19.920  21.376  1.00 66.35  ? 104  GLU A OE1 1 
ATOM   768  O  OE2 . GLU A 1 104 ? 27.702 20.833  20.673  1.00 70.81  ? 104  GLU A OE2 1 
ATOM   769  N  N   . ARG A 1 105 ? 23.337 18.992  16.961  1.00 43.65  ? 105  ARG A N   1 
ATOM   770  C  CA  . ARG A 1 105 ? 22.332 18.022  16.591  1.00 43.72  ? 105  ARG A CA  1 
ATOM   771  C  C   . ARG A 1 105 ? 22.967 16.750  16.032  1.00 45.24  ? 105  ARG A C   1 
ATOM   772  O  O   . ARG A 1 105 ? 22.527 15.645  16.352  1.00 44.65  ? 105  ARG A O   1 
ATOM   773  C  CB  . ARG A 1 105 ? 21.363 18.618  15.572  1.00 43.69  ? 105  ARG A CB  1 
ATOM   774  C  CG  . ARG A 1 105 ? 20.240 17.687  15.213  1.00 45.10  ? 105  ARG A CG  1 
ATOM   775  C  CD  . ARG A 1 105 ? 19.314 18.236  14.157  1.00 49.37  ? 105  ARG A CD  1 
ATOM   776  N  NE  . ARG A 1 105 ? 18.316 17.253  13.715  1.00 53.77  ? 105  ARG A NE  1 
ATOM   777  C  CZ  . ARG A 1 105 ? 17.093 17.126  14.234  1.00 57.94  ? 105  ARG A CZ  1 
ATOM   778  N  NH1 . ARG A 1 105 ? 16.695 17.918  15.221  1.00 53.85  ? 105  ARG A NH1 1 
ATOM   779  N  NH2 . ARG A 1 105 ? 16.266 16.204  13.768  1.00 52.81  ? 105  ARG A NH2 1 
ATOM   780  N  N   . ILE A 1 106 ? 23.995 16.914  15.198  1.00 44.09  ? 106  ILE A N   1 
ATOM   781  C  CA  . ILE A 1 106 ? 24.833 15.792  14.821  1.00 43.65  ? 106  ILE A CA  1 
ATOM   782  C  C   . ILE A 1 106 ? 25.387 15.036  16.034  1.00 44.09  ? 106  ILE A C   1 
ATOM   783  O  O   . ILE A 1 106 ? 25.214 13.838  16.127  1.00 43.41  ? 106  ILE A O   1 
ATOM   784  C  CB  . ILE A 1 106 ? 25.982 16.202  13.864  1.00 46.36  ? 106  ILE A CB  1 
ATOM   785  C  CG1 . ILE A 1 106 ? 25.420 16.879  12.633  1.00 45.17  ? 106  ILE A CG1 1 
ATOM   786  C  CG2 . ILE A 1 106 ? 26.779 14.974  13.420  1.00 43.77  ? 106  ILE A CG2 1 
ATOM   787  C  CD1 . ILE A 1 106 ? 26.434 17.338  11.705  1.00 41.41  ? 106  ILE A CD1 1 
ATOM   788  N  N   . CYS A 1 107 ? 26.039 15.727  16.955  1.00 42.56  ? 107  CYS A N   1 
ATOM   789  C  CA  . CYS A 1 107 ? 26.622 15.068  18.119  1.00 43.14  ? 107  CYS A CA  1 
ATOM   790  C  C   . CYS A 1 107 ? 25.592 14.311  18.958  1.00 47.19  ? 107  CYS A C   1 
ATOM   791  O  O   . CYS A 1 107 ? 25.806 13.170  19.412  1.00 49.24  ? 107  CYS A O   1 
ATOM   792  C  CB  . CYS A 1 107 ? 27.367 16.073  18.989  1.00 46.74  ? 107  CYS A CB  1 
ATOM   793  S  SG  . CYS A 1 107 ? 28.931 16.605  18.260  1.00 53.05  ? 107  CYS A SG  1 
ATOM   794  N  N   . ASN A 1 108 ? 24.466 14.967  19.161  1.00 44.71  ? 108  ASN A N   1 
ATOM   795  C  CA  . ASN A 1 108 ? 23.310 14.353  19.778  1.00 44.82  ? 108  ASN A CA  1 
ATOM   796  C  C   . ASN A 1 108 ? 22.830 13.076  19.066  1.00 50.59  ? 108  ASN A C   1 
ATOM   797  O  O   . ASN A 1 108 ? 22.411 12.124  19.717  1.00 48.29  ? 108  ASN A O   1 
ATOM   798  C  CB  . ASN A 1 108 ? 22.178 15.383  19.867  1.00 46.06  ? 108  ASN A CB  1 
ATOM   799  C  CG  . ASN A 1 108 ? 22.402 16.395  20.975  1.00 49.28  ? 108  ASN A CG  1 
ATOM   800  O  OD1 . ASN A 1 108 ? 23.264 16.218  21.837  1.00 51.67  ? 108  ASN A OD1 1 
ATOM   801  N  ND2 . ASN A 1 108 ? 21.629 17.467  20.952  1.00 49.42  ? 108  ASN A ND2 1 
ATOM   802  N  N   . ALA A 1 109 ? 22.889 13.070  17.736  1.00 48.72  ? 109  ALA A N   1 
ATOM   803  C  CA  . ALA A 1 109 ? 22.476 11.915  16.944  1.00 43.81  ? 109  ALA A CA  1 
ATOM   804  C  C   . ALA A 1 109 ? 23.539 10.798  16.847  1.00 47.37  ? 109  ALA A C   1 
ATOM   805  O  O   . ALA A 1 109 ? 23.212 9.662   16.495  1.00 49.01  ? 109  ALA A O   1 
ATOM   806  C  CB  . ALA A 1 109 ? 22.086 12.365  15.546  1.00 43.14  ? 109  ALA A CB  1 
ATOM   807  N  N   . GLY A 1 110 ? 24.796 11.109  17.164  1.00 44.14  ? 110  GLY A N   1 
ATOM   808  C  CA  . GLY A 1 110 ? 25.895 10.254  16.773  1.00 49.27  ? 110  GLY A CA  1 
ATOM   809  C  C   . GLY A 1 110 ? 26.300 10.516  15.329  1.00 48.28  ? 110  GLY A C   1 
ATOM   810  O  O   . GLY A 1 110 ? 27.422 10.942  15.057  1.00 46.04  ? 110  GLY A O   1 
ATOM   811  N  N   . ARG A 1 111 ? 25.377 10.222  14.414  1.00 44.90  ? 111  ARG A N   1 
ATOM   812  C  CA  . ARG A 1 111 ? 25.442 10.624  13.008  1.00 46.18  ? 111  ARG A CA  1 
ATOM   813  C  C   . ARG A 1 111 ? 24.038 10.577  12.395  1.00 47.76  ? 111  ARG A C   1 
ATOM   814  O  O   . ARG A 1 111 ? 23.109 10.101  13.019  1.00 44.83  ? 111  ARG A O   1 
ATOM   815  C  CB  . ARG A 1 111 ? 26.432 9.779   12.203  1.00 49.03  ? 111  ARG A CB  1 
ATOM   816  C  CG  . ARG A 1 111 ? 25.987 8.355   11.896  1.00 49.50  ? 111  ARG A CG  1 
ATOM   817  C  CD  . ARG A 1 111 ? 27.204 7.438   11.718  1.00 54.71  ? 111  ARG A CD  1 
ATOM   818  N  NE  . ARG A 1 111 ? 26.881 6.034   11.959  1.00 61.15  ? 111  ARG A NE  1 
ATOM   819  C  CZ  . ARG A 1 111 ? 26.291 5.245   11.070  1.00 62.82  ? 111  ARG A CZ  1 
ATOM   820  N  NH1 . ARG A 1 111 ? 25.954 5.724   9.877   1.00 57.61  ? 111  ARG A NH1 1 
ATOM   821  N  NH2 . ARG A 1 111 ? 26.032 3.982   11.377  1.00 64.94  ? 111  ARG A NH2 1 
ATOM   822  N  N   . PHE A 1 112 ? 23.876 11.122  11.192  1.00 48.63  ? 112  PHE A N   1 
ATOM   823  C  CA  . PHE A 1 112 ? 22.558 11.170  10.561  1.00 48.85  ? 112  PHE A CA  1 
ATOM   824  C  C   . PHE A 1 112 ? 22.418 10.034  9.591   1.00 52.21  ? 112  PHE A C   1 
ATOM   825  O  O   . PHE A 1 112 ? 23.400 9.469   9.112   1.00 50.27  ? 112  PHE A O   1 
ATOM   826  C  CB  . PHE A 1 112 ? 22.304 12.478  9.791   1.00 49.80  ? 112  PHE A CB  1 
ATOM   827  C  CG  . PHE A 1 112 ? 22.132 13.700  10.663  1.00 50.09  ? 112  PHE A CG  1 
ATOM   828  C  CD1 . PHE A 1 112 ? 22.005 13.594  12.037  1.00 49.25  ? 112  PHE A CD1 1 
ATOM   829  C  CD2 . PHE A 1 112 ? 22.087 14.967  10.090  1.00 47.61  ? 112  PHE A CD2 1 
ATOM   830  C  CE1 . PHE A 1 112 ? 21.858 14.738  12.818  1.00 48.82  ? 112  PHE A CE1 1 
ATOM   831  C  CE2 . PHE A 1 112 ? 21.940 16.097  10.861  1.00 45.46  ? 112  PHE A CE2 1 
ATOM   832  C  CZ  . PHE A 1 112 ? 21.828 15.992  12.220  1.00 44.07  ? 112  PHE A CZ  1 
ATOM   833  N  N   . SER A 1 113 ? 21.171 9.702   9.310   1.00 52.29  ? 113  SER A N   1 
ATOM   834  C  CA  . SER A 1 113 ? 20.878 8.777   8.255   1.00 47.99  ? 113  SER A CA  1 
ATOM   835  C  C   . SER A 1 113 ? 21.149 9.552   6.980   1.00 51.18  ? 113  SER A C   1 
ATOM   836  O  O   . SER A 1 113 ? 21.180 10.779  6.985   1.00 51.25  ? 113  SER A O   1 
ATOM   837  C  CB  . SER A 1 113 ? 19.420 8.345   8.329   1.00 46.22  ? 113  SER A CB  1 
ATOM   838  O  OG  . SER A 1 113 ? 18.558 9.432   8.092   1.00 51.38  ? 113  SER A OG  1 
ATOM   839  N  N   . GLU A 1 114 ? 21.345 8.832   5.892   1.00 50.65  ? 114  GLU A N   1 
ATOM   840  C  CA  . GLU A 1 114 ? 21.650 9.435   4.618   1.00 51.52  ? 114  GLU A CA  1 
ATOM   841  C  C   . GLU A 1 114 ? 20.512 10.332  4.174   1.00 52.63  ? 114  GLU A C   1 
ATOM   842  O  O   . GLU A 1 114 ? 20.733 11.340  3.508   1.00 54.15  ? 114  GLU A O   1 
ATOM   843  C  CB  . GLU A 1 114 ? 21.936 8.350   3.572   1.00 48.91  ? 114  GLU A CB  1 
ATOM   844  C  CG  . GLU A 1 114 ? 22.107 8.873   2.170   1.00 58.13  ? 114  GLU A CG  1 
ATOM   845  C  CD  . GLU A 1 114 ? 22.781 7.884   1.253   1.00 62.48  ? 114  GLU A CD  1 
ATOM   846  O  OE1 . GLU A 1 114 ? 23.398 6.938   1.772   1.00 62.20  ? 114  GLU A OE1 1 
ATOM   847  O  OE2 . GLU A 1 114 ? 22.696 8.048   0.017   1.00 62.80  ? 114  GLU A OE2 1 
ATOM   848  N  N   . ASP A 1 115 ? 19.297 9.980   4.570   1.00 52.55  ? 115  ASP A N   1 
ATOM   849  C  CA  . ASP A 1 115 ? 18.136 10.773  4.213   1.00 53.74  ? 115  ASP A CA  1 
ATOM   850  C  C   . ASP A 1 115 ? 18.024 12.095  4.960   1.00 53.55  ? 115  ASP A C   1 
ATOM   851  O  O   . ASP A 1 115 ? 17.660 13.104  4.371   1.00 50.64  ? 115  ASP A O   1 
ATOM   852  C  CB  . ASP A 1 115 ? 16.857 9.955   4.334   1.00 56.19  ? 115  ASP A CB  1 
ATOM   853  C  CG  . ASP A 1 115 ? 16.368 9.460   2.990   1.00 66.15  ? 115  ASP A CG  1 
ATOM   854  O  OD1 . ASP A 1 115 ? 15.790 10.257  2.219   1.00 73.48  ? 115  ASP A OD1 1 
ATOM   855  O  OD2 . ASP A 1 115 ? 16.563 8.274   2.695   1.00 67.24  ? 115  ASP A OD2 1 
ATOM   856  N  N   . GLU A 1 116 ? 18.344 12.077  6.249   1.00 52.81  ? 116  GLU A N   1 
ATOM   857  C  CA  . GLU A 1 116 ? 18.373 13.277  7.069   1.00 51.32  ? 116  GLU A CA  1 
ATOM   858  C  C   . GLU A 1 116 ? 19.509 14.211  6.634   1.00 51.35  ? 116  GLU A C   1 
ATOM   859  O  O   . GLU A 1 116 ? 19.312 15.423  6.447   1.00 51.96  ? 116  GLU A O   1 
ATOM   860  C  CB  . GLU A 1 116 ? 18.502 12.898  8.537   1.00 50.42  ? 116  GLU A CB  1 
ATOM   861  C  CG  . GLU A 1 116 ? 18.181 14.018  9.495   1.00 55.01  ? 116  GLU A CG  1 
ATOM   862  C  CD  . GLU A 1 116 ? 18.198 13.577  10.942  1.00 60.71  ? 116  GLU A CD  1 
ATOM   863  O  OE1 . GLU A 1 116 ? 18.158 12.353  11.185  1.00 66.41  ? 116  GLU A OE1 1 
ATOM   864  O  OE2 . GLU A 1 116 ? 18.257 14.447  11.838  1.00 56.27  ? 116  GLU A OE2 1 
ATOM   865  N  N   . ALA A 1 117 ? 20.694 13.639  6.458   1.00 49.13  ? 117  ALA A N   1 
ATOM   866  C  CA  . ALA A 1 117 ? 21.818 14.361  5.866   1.00 49.03  ? 117  ALA A CA  1 
ATOM   867  C  C   . ALA A 1 117 ? 21.474 14.998  4.502   1.00 51.33  ? 117  ALA A C   1 
ATOM   868  O  O   . ALA A 1 117 ? 21.872 16.129  4.219   1.00 48.05  ? 117  ALA A O   1 
ATOM   869  C  CB  . ALA A 1 117 ? 23.078 13.443  5.764   1.00 46.17  ? 117  ALA A CB  1 
ATOM   870  N  N   . ARG A 1 118 ? 20.733 14.277  3.663   1.00 51.92  ? 118  ARG A N   1 
ATOM   871  C  CA  . ARG A 1 118 ? 20.265 14.852  2.404   1.00 52.79  ? 118  ARG A CA  1 
ATOM   872  C  C   . ARG A 1 118 ? 19.255 15.974  2.625   1.00 51.87  ? 118  ARG A C   1 
ATOM   873  O  O   . ARG A 1 118 ? 19.250 16.960  1.910   1.00 50.32  ? 118  ARG A O   1 
ATOM   874  C  CB  . ARG A 1 118 ? 19.679 13.794  1.463   1.00 56.05  ? 118  ARG A CB  1 
ATOM   875  C  CG  . ARG A 1 118 ? 19.228 14.387  0.152   1.00 55.81  ? 118  ARG A CG  1 
ATOM   876  C  CD  . ARG A 1 118 ? 19.010 13.335  -0.861  1.00 61.46  ? 118  ARG A CD  1 
ATOM   877  N  NE  . ARG A 1 118 ? 18.220 12.256  -0.295  1.00 68.45  ? 118  ARG A NE  1 
ATOM   878  C  CZ  . ARG A 1 118 ? 18.477 10.970  -0.475  1.00 66.22  ? 118  ARG A CZ  1 
ATOM   879  N  NH1 . ARG A 1 118 ? 19.509 10.587  -1.214  1.00 61.82  ? 118  ARG A NH1 1 
ATOM   880  N  NH2 . ARG A 1 118 ? 17.696 10.072  0.092   1.00 66.97  ? 118  ARG A NH2 1 
ATOM   881  N  N   . PHE A 1 119 ? 18.409 15.824  3.628   1.00 50.69  ? 119  PHE A N   1 
ATOM   882  C  CA  . PHE A 1 119 ? 17.400 16.816  3.923   1.00 51.24  ? 119  PHE A CA  1 
ATOM   883  C  C   . PHE A 1 119 ? 18.041 18.142  4.287   1.00 53.19  ? 119  PHE A C   1 
ATOM   884  O  O   . PHE A 1 119 ? 17.615 19.200  3.812   1.00 52.11  ? 119  PHE A O   1 
ATOM   885  C  CB  . PHE A 1 119 ? 16.483 16.309  5.036   1.00 52.66  ? 119  PHE A CB  1 
ATOM   886  C  CG  . PHE A 1 119 ? 15.651 17.375  5.683   1.00 55.70  ? 119  PHE A CG  1 
ATOM   887  C  CD1 . PHE A 1 119 ? 14.547 17.890  5.040   1.00 52.02  ? 119  PHE A CD1 1 
ATOM   888  C  CD2 . PHE A 1 119 ? 15.954 17.837  6.959   1.00 53.04  ? 119  PHE A CD2 1 
ATOM   889  C  CE1 . PHE A 1 119 ? 13.769 18.867  5.646   1.00 53.65  ? 119  PHE A CE1 1 
ATOM   890  C  CE2 . PHE A 1 119 ? 15.172 18.798  7.565   1.00 54.73  ? 119  PHE A CE2 1 
ATOM   891  C  CZ  . PHE A 1 119 ? 14.086 19.322  6.909   1.00 56.92  ? 119  PHE A CZ  1 
ATOM   892  N  N   . PHE A 1 120 ? 19.079 18.102  5.111   1.00 49.94  ? 120  PHE A N   1 
ATOM   893  C  CA  . PHE A 1 120 ? 19.722 19.357  5.480   1.00 49.32  ? 120  PHE A CA  1 
ATOM   894  C  C   . PHE A 1 120 ? 20.621 19.890  4.373   1.00 48.52  ? 120  PHE A C   1 
ATOM   895  O  O   . PHE A 1 120 ? 20.636 21.092  4.101   1.00 49.02  ? 120  PHE A O   1 
ATOM   896  C  CB  . PHE A 1 120 ? 20.506 19.208  6.764   1.00 46.72  ? 120  PHE A CB  1 
ATOM   897  C  CG  . PHE A 1 120 ? 19.657 19.027  7.964   1.00 46.93  ? 120  PHE A CG  1 
ATOM   898  C  CD1 . PHE A 1 120 ? 18.862 20.072  8.427   1.00 49.04  ? 120  PHE A CD1 1 
ATOM   899  C  CD2 . PHE A 1 120 ? 19.653 17.818  8.650   1.00 47.90  ? 120  PHE A CD2 1 
ATOM   900  C  CE1 . PHE A 1 120 ? 18.075 19.916  9.571   1.00 51.40  ? 120  PHE A CE1 1 
ATOM   901  C  CE2 . PHE A 1 120 ? 18.873 17.645  9.786   1.00 47.37  ? 120  PHE A CE2 1 
ATOM   902  C  CZ  . PHE A 1 120 ? 18.082 18.702  10.254  1.00 47.28  ? 120  PHE A CZ  1 
ATOM   903  N  N   . PHE A 1 121 ? 21.352 18.987  3.734   1.00 46.93  ? 121  PHE A N   1 
ATOM   904  C  CA  . PHE A 1 121 ? 22.241 19.351  2.656   1.00 48.47  ? 121  PHE A CA  1 
ATOM   905  C  C   . PHE A 1 121 ? 21.536 20.051  1.497   1.00 50.72  ? 121  PHE A C   1 
ATOM   906  O  O   . PHE A 1 121 ? 22.094 20.959  0.852   1.00 46.79  ? 121  PHE A O   1 
ATOM   907  C  CB  . PHE A 1 121 ? 22.967 18.113  2.157   1.00 47.74  ? 121  PHE A CB  1 
ATOM   908  C  CG  . PHE A 1 121 ? 24.069 18.405  1.190   1.00 47.32  ? 121  PHE A CG  1 
ATOM   909  C  CD1 . PHE A 1 121 ? 25.294 18.916  1.627   1.00 46.60  ? 121  PHE A CD1 1 
ATOM   910  C  CD2 . PHE A 1 121 ? 23.892 18.167  -0.158  1.00 46.12  ? 121  PHE A CD2 1 
ATOM   911  C  CE1 . PHE A 1 121 ? 26.333 19.181  0.717   1.00 44.76  ? 121  PHE A CE1 1 
ATOM   912  C  CE2 . PHE A 1 121 ? 24.919 18.432  -1.079  1.00 45.58  ? 121  PHE A CE2 1 
ATOM   913  C  CZ  . PHE A 1 121 ? 26.137 18.933  -0.642  1.00 45.34  ? 121  PHE A CZ  1 
ATOM   914  N  N   . GLN A 1 122 ? 20.308 19.616  1.231   1.00 50.93  ? 122  GLN A N   1 
ATOM   915  C  CA  . GLN A 1 122 ? 19.476 20.292  0.241   1.00 53.50  ? 122  GLN A CA  1 
ATOM   916  C  C   . GLN A 1 122 ? 19.305 21.784  0.553   1.00 54.00  ? 122  GLN A C   1 
ATOM   917  O  O   . GLN A 1 122 ? 19.615 22.634  -0.284  1.00 52.78  ? 122  GLN A O   1 
ATOM   918  C  CB  . GLN A 1 122 ? 18.143 19.567  0.068   1.00 54.89  ? 122  GLN A CB  1 
ATOM   919  C  CG  . GLN A 1 122 ? 18.251 18.438  -0.954  1.00 57.39  ? 122  GLN A CG  1 
ATOM   920  C  CD  . GLN A 1 122 ? 17.114 17.418  -0.898  1.00 59.55  ? 122  GLN A CD  1 
ATOM   921  O  OE1 . GLN A 1 122 ? 16.244 17.466  -0.032  1.00 59.99  ? 122  GLN A OE1 1 
ATOM   922  N  NE2 . GLN A 1 122 ? 17.132 16.487  -1.833  1.00 61.83  ? 122  GLN A NE2 1 
ATOM   923  N  N   . GLN A 1 123 ? 18.841 22.076  1.767   1.00 50.21  ? 123  GLN A N   1 
ATOM   924  C  CA  . GLN A 1 123 ? 18.731 23.440  2.268   1.00 48.86  ? 123  GLN A CA  1 
ATOM   925  C  C   . GLN A 1 123 ? 20.053 24.219  2.199   1.00 50.38  ? 123  GLN A C   1 
ATOM   926  O  O   . GLN A 1 123 ? 20.090 25.377  1.779   1.00 49.42  ? 123  GLN A O   1 
ATOM   927  C  CB  . GLN A 1 123 ? 18.219 23.422  3.703   1.00 48.79  ? 123  GLN A CB  1 
ATOM   928  C  CG  . GLN A 1 123 ? 16.789 23.004  3.845   1.00 49.00  ? 123  GLN A CG  1 
ATOM   929  C  CD  . GLN A 1 123 ? 16.414 22.806  5.282   1.00 52.64  ? 123  GLN A CD  1 
ATOM   930  O  OE1 . GLN A 1 123 ? 16.294 23.763  6.021   1.00 54.33  ? 123  GLN A OE1 1 
ATOM   931  N  NE2 . GLN A 1 123 ? 16.228 21.564  5.696   1.00 52.03  ? 123  GLN A NE2 1 
ATOM   932  N  N   . LEU A 1 124 ? 21.130 23.574  2.631   1.00 49.03  ? 124  LEU A N   1 
ATOM   933  C  CA  . LEU A 1 124 ? 22.466 24.134  2.522   1.00 48.26  ? 124  LEU A CA  1 
ATOM   934  C  C   . LEU A 1 124 ? 22.777 24.648  1.120   1.00 48.49  ? 124  LEU A C   1 
ATOM   935  O  O   . LEU A 1 124 ? 23.185 25.796  0.929   1.00 49.73  ? 124  LEU A O   1 
ATOM   936  C  CB  . LEU A 1 124 ? 23.504 23.088  2.936   1.00 47.34  ? 124  LEU A CB  1 
ATOM   937  C  CG  . LEU A 1 124 ? 24.970 23.521  2.886   1.00 43.32  ? 124  LEU A CG  1 
ATOM   938  C  CD1 . LEU A 1 124 ? 25.222 24.630  3.895   1.00 46.26  ? 124  LEU A CD1 1 
ATOM   939  C  CD2 . LEU A 1 124 ? 25.873 22.397  3.169   1.00 42.34  ? 124  LEU A CD2 1 
ATOM   940  N  N   . ILE A 1 125 ? 22.588 23.788  0.134   1.00 49.00  ? 125  ILE A N   1 
ATOM   941  C  CA  . ILE A 1 125 ? 22.912 24.148  -1.235  1.00 49.79  ? 125  ILE A CA  1 
ATOM   942  C  C   . ILE A 1 125 ? 21.977 25.228  -1.748  1.00 53.13  ? 125  ILE A C   1 
ATOM   943  O  O   . ILE A 1 125 ? 22.413 26.137  -2.461  1.00 54.28  ? 125  ILE A O   1 
ATOM   944  C  CB  . ILE A 1 125 ? 22.890 22.942  -2.194  1.00 52.83  ? 125  ILE A CB  1 
ATOM   945  C  CG1 . ILE A 1 125 ? 23.917 21.893  -1.761  1.00 49.30  ? 125  ILE A CG1 1 
ATOM   946  C  CG2 . ILE A 1 125 ? 23.138 23.401  -3.642  1.00 51.53  ? 125  ILE A CG2 1 
ATOM   947  C  CD1 . ILE A 1 125 ? 25.320 22.435  -1.482  1.00 44.87  ? 125  ILE A CD1 1 
ATOM   948  N  N   . SER A 1 126 ? 20.702 25.149  -1.376  1.00 51.97  ? 126  SER A N   1 
ATOM   949  C  CA  . SER A 1 126 ? 19.750 26.171  -1.775  1.00 52.86  ? 126  SER A CA  1 
ATOM   950  C  C   . SER A 1 126 ? 20.222 27.566  -1.325  1.00 54.30  ? 126  SER A C   1 
ATOM   951  O  O   . SER A 1 126 ? 20.359 28.499  -2.139  1.00 55.94  ? 126  SER A O   1 
ATOM   952  C  CB  . SER A 1 126 ? 18.353 25.851  -1.244  1.00 56.08  ? 126  SER A CB  1 
ATOM   953  O  OG  . SER A 1 126 ? 17.377 26.592  -1.936  1.00 65.68  ? 126  SER A OG  1 
ATOM   954  N  N   . GLY A 1 127 ? 20.506 27.693  -0.034  1.00 53.54  ? 127  GLY A N   1 
ATOM   955  C  CA  . GLY A 1 127 ? 21.000 28.940  0.521   1.00 54.09  ? 127  GLY A CA  1 
ATOM   956  C  C   . GLY A 1 127 ? 22.342 29.429  -0.033  1.00 53.35  ? 127  GLY A C   1 
ATOM   957  O  O   . GLY A 1 127 ? 22.512 30.616  -0.309  1.00 52.65  ? 127  GLY A O   1 
ATOM   958  N  N   . VAL A 1 128 ? 23.301 28.525  -0.202  1.00 52.98  ? 128  VAL A N   1 
ATOM   959  C  CA  . VAL A 1 128 ? 24.611 28.908  -0.750  1.00 56.26  ? 128  VAL A CA  1 
ATOM   960  C  C   . VAL A 1 128 ? 24.486 29.392  -2.202  1.00 57.74  ? 128  VAL A C   1 
ATOM   961  O  O   . VAL A 1 128 ? 25.035 30.432  -2.566  1.00 56.28  ? 128  VAL A O   1 
ATOM   962  C  CB  . VAL A 1 128 ? 25.636 27.740  -0.659  1.00 50.18  ? 128  VAL A CB  1 
ATOM   963  C  CG1 . VAL A 1 128 ? 26.885 28.056  -1.403  1.00 49.68  ? 128  VAL A CG1 1 
ATOM   964  C  CG2 . VAL A 1 128 ? 25.958 27.415  0.776   1.00 48.10  ? 128  VAL A CG2 1 
ATOM   965  N  N   . SER A 1 129 ? 23.779 28.609  -3.017  1.00 57.51  ? 129  SER A N   1 
ATOM   966  C  CA  . SER A 1 129 ? 23.422 28.978  -4.383  1.00 57.32  ? 129  SER A CA  1 
ATOM   967  C  C   . SER A 1 129 ? 22.842 30.406  -4.449  1.00 58.95  ? 129  SER A C   1 
ATOM   968  O  O   . SER A 1 129 ? 23.337 31.268  -5.202  1.00 57.60  ? 129  SER A O   1 
ATOM   969  C  CB  . SER A 1 129 ? 22.452 27.922  -4.939  1.00 56.09  ? 129  SER A CB  1 
ATOM   970  O  OG  . SER A 1 129 ? 21.928 28.236  -6.212  1.00 65.78  ? 129  SER A OG  1 
ATOM   971  N  N   . TYR A 1 130 ? 21.819 30.657  -3.639  1.00 56.45  ? 130  TYR A N   1 
ATOM   972  C  CA  . TYR A 1 130 ? 21.210 31.982  -3.577  1.00 57.48  ? 130  TYR A CA  1 
ATOM   973  C  C   . TYR A 1 130 ? 22.193 33.082  -3.218  1.00 59.26  ? 130  TYR A C   1 
ATOM   974  O  O   . TYR A 1 130 ? 22.200 34.131  -3.842  1.00 59.47  ? 130  TYR A O   1 
ATOM   975  C  CB  . TYR A 1 130 ? 20.072 31.986  -2.564  1.00 57.66  ? 130  TYR A CB  1 
ATOM   976  C  CG  . TYR A 1 130 ? 19.479 33.354  -2.305  1.00 61.64  ? 130  TYR A CG  1 
ATOM   977  C  CD1 . TYR A 1 130 ? 20.029 34.211  -1.341  1.00 59.63  ? 130  TYR A CD1 1 
ATOM   978  C  CD2 . TYR A 1 130 ? 18.350 33.787  -3.004  1.00 59.19  ? 130  TYR A CD2 1 
ATOM   979  C  CE1 . TYR A 1 130 ? 19.468 35.456  -1.090  1.00 63.10  ? 130  TYR A CE1 1 
ATOM   980  C  CE2 . TYR A 1 130 ? 17.790 35.031  -2.757  1.00 61.06  ? 130  TYR A CE2 1 
ATOM   981  C  CZ  . TYR A 1 130 ? 18.347 35.863  -1.807  1.00 63.12  ? 130  TYR A CZ  1 
ATOM   982  O  OH  . TYR A 1 130 ? 17.764 37.089  -1.594  1.00 59.47  ? 130  TYR A OH  1 
ATOM   983  N  N   . CYS A 1 131 ? 23.007 32.837  -2.195  1.00 58.23  ? 131  CYS A N   1 
ATOM   984  C  CA  . CYS A 1 131 ? 24.011 33.802  -1.751  1.00 61.01  ? 131  CYS A CA  1 
ATOM   985  C  C   . CYS A 1 131 ? 25.049 34.095  -2.814  1.00 61.29  ? 131  CYS A C   1 
ATOM   986  O  O   . CYS A 1 131 ? 25.543 35.199  -2.921  1.00 60.28  ? 131  CYS A O   1 
ATOM   987  C  CB  . CYS A 1 131 ? 24.714 33.298  -0.501  1.00 60.28  ? 131  CYS A CB  1 
ATOM   988  S  SG  . CYS A 1 131 ? 23.771 33.566  0.968   1.00 53.77  ? 131  CYS A SG  1 
ATOM   989  N  N   . HIS A 1 132 ? 25.389 33.080  -3.587  1.00 60.80  ? 132  HIS A N   1 
ATOM   990  C  CA  . HIS A 1 132 ? 26.356 33.225  -4.648  1.00 62.44  ? 132  HIS A CA  1 
ATOM   991  C  C   . HIS A 1 132 ? 25.796 34.116  -5.740  1.00 64.34  ? 132  HIS A C   1 
ATOM   992  O  O   . HIS A 1 132 ? 26.481 35.007  -6.238  1.00 62.93  ? 132  HIS A O   1 
ATOM   993  C  CB  . HIS A 1 132 ? 26.742 31.850  -5.206  1.00 58.81  ? 132  HIS A CB  1 
ATOM   994  C  CG  . HIS A 1 132 ? 27.740 31.116  -4.362  1.00 60.54  ? 132  HIS A CG  1 
ATOM   995  N  ND1 . HIS A 1 132 ? 28.337 29.943  -4.761  1.00 59.78  ? 132  HIS A ND1 1 
ATOM   996  C  CD2 . HIS A 1 132 ? 28.239 31.395  -3.131  1.00 59.66  ? 132  HIS A CD2 1 
ATOM   997  C  CE1 . HIS A 1 132 ? 29.170 29.531  -3.810  1.00 53.72  ? 132  HIS A CE1 1 
ATOM   998  N  NE2 . HIS A 1 132 ? 29.118 30.388  -2.821  1.00 55.91  ? 132  HIS A NE2 1 
ATOM   999  N  N   . ALA A 1 133 ? 24.550 33.852  -6.117  1.00 61.55  ? 133  ALA A N   1 
ATOM   1000 C  CA  . ALA A 1 133 ? 23.839 34.665  -7.093  1.00 58.00  ? 133  ALA A CA  1 
ATOM   1001 C  C   . ALA A 1 133 ? 23.786 36.137  -6.700  1.00 61.10  ? 133  ALA A C   1 
ATOM   1002 O  O   . ALA A 1 133 ? 23.676 37.008  -7.557  1.00 65.33  ? 133  ALA A O   1 
ATOM   1003 C  CB  . ALA A 1 133 ? 22.451 34.148  -7.250  1.00 52.92  ? 133  ALA A CB  1 
ATOM   1004 N  N   . MET A 1 134 ? 23.849 36.401  -5.402  1.00 58.79  ? 134  MET A N   1 
ATOM   1005 C  CA  . MET A 1 134 ? 23.896 37.753  -4.877  1.00 59.02  ? 134  MET A CA  1 
ATOM   1006 C  C   . MET A 1 134 ? 25.343 38.274  -4.662  1.00 63.97  ? 134  MET A C   1 
ATOM   1007 O  O   . MET A 1 134 ? 25.568 39.368  -4.118  1.00 62.99  ? 134  MET A O   1 
ATOM   1008 C  CB  . MET A 1 134 ? 23.097 37.816  -3.584  1.00 59.11  ? 134  MET A CB  1 
ATOM   1009 C  CG  . MET A 1 134 ? 21.677 37.356  -3.728  1.00 60.16  ? 134  MET A CG  1 
ATOM   1010 S  SD  . MET A 1 134 ? 20.666 38.433  -4.741  1.00 58.79  ? 134  MET A SD  1 
ATOM   1011 C  CE  . MET A 1 134 ? 20.523 39.871  -3.677  1.00 60.28  ? 134  MET A CE  1 
ATOM   1012 N  N   . GLN A 1 135 ? 26.308 37.491  -5.135  1.00 65.62  ? 135  GLN A N   1 
ATOM   1013 C  CA  . GLN A 1 135 ? 27.741 37.760  -4.974  1.00 65.83  ? 135  GLN A CA  1 
ATOM   1014 C  C   . GLN A 1 135 ? 28.114 37.859  -3.498  1.00 66.77  ? 135  GLN A C   1 
ATOM   1015 O  O   . GLN A 1 135 ? 28.805 38.790  -3.077  1.00 67.68  ? 135  GLN A O   1 
ATOM   1016 C  CB  . GLN A 1 135 ? 28.205 39.004  -5.765  1.00 68.55  ? 135  GLN A CB  1 
ATOM   1017 C  CG  . GLN A 1 135 ? 27.855 39.028  -7.275  1.00 69.02  ? 135  GLN A CG  1 
ATOM   1018 C  CD  . GLN A 1 135 ? 28.178 37.737  -8.028  1.00 72.17  ? 135  GLN A CD  1 
ATOM   1019 O  OE1 . GLN A 1 135 ? 29.317 37.268  -8.032  1.00 69.70  ? 135  GLN A OE1 1 
ATOM   1020 N  NE2 . GLN A 1 135 ? 27.167 37.168  -8.683  1.00 67.17  ? 135  GLN A NE2 1 
ATOM   1021 N  N   . VAL A 1 136 ? 27.634 36.892  -2.719  1.00 68.08  ? 136  VAL A N   1 
ATOM   1022 C  CA  . VAL A 1 136 ? 28.021 36.749  -1.317  1.00 69.61  ? 136  VAL A CA  1 
ATOM   1023 C  C   . VAL A 1 136 ? 28.709 35.381  -1.178  1.00 69.75  ? 136  VAL A C   1 
ATOM   1024 O  O   . VAL A 1 136 ? 28.051 34.339  -1.085  1.00 67.03  ? 136  VAL A O   1 
ATOM   1025 C  CB  . VAL A 1 136 ? 26.792 36.860  -0.348  1.00 66.92  ? 136  VAL A CB  1 
ATOM   1026 C  CG1 . VAL A 1 136 ? 27.240 37.238  1.037   1.00 65.22  ? 136  VAL A CG1 1 
ATOM   1027 C  CG2 . VAL A 1 136 ? 25.790 37.884  -0.836  1.00 62.43  ? 136  VAL A CG2 1 
ATOM   1028 N  N   . CYS A 1 137 ? 30.036 35.373  -1.221  1.00 71.34  ? 137  CYS A N   1 
ATOM   1029 C  CA  . CYS A 1 137 ? 30.767 34.111  -1.161  1.00 64.75  ? 137  CYS A CA  1 
ATOM   1030 C  C   . CYS A 1 137 ? 31.485 34.008  0.158   1.00 62.77  ? 137  CYS A C   1 
ATOM   1031 O  O   . CYS A 1 137 ? 31.654 34.993  0.895   1.00 60.54  ? 137  CYS A O   1 
ATOM   1032 C  CB  . CYS A 1 137 ? 31.828 33.974  -2.284  1.00 55.66  ? 137  CYS A CB  1 
ATOM   1033 S  SG  . CYS A 1 137 ? 31.897 35.293  -3.515  1.00 71.74  ? 137  CYS A SG  1 
ATOM   1034 N  N   . HIS A 1 138 ? 31.892 32.784  0.440   1.00 61.39  ? 138  HIS A N   1 
ATOM   1035 C  CA  . HIS A 1 138 ? 33.097 32.539  1.194   1.00 57.50  ? 138  HIS A CA  1 
ATOM   1036 C  C   . HIS A 1 138 ? 33.061 33.151  2.593   1.00 59.78  ? 138  HIS A C   1 
ATOM   1037 O  O   . HIS A 1 138 ? 32.334 32.676  3.451   1.00 59.84  ? 138  HIS A O   1 
ATOM   1038 C  CB  . HIS A 1 138 ? 34.277 33.034  0.361   1.00 53.39  ? 138  HIS A CB  1 
ATOM   1039 C  CG  . HIS A 1 138 ? 35.619 32.641  0.888   1.00 59.30  ? 138  HIS A CG  1 
ATOM   1040 N  ND1 . HIS A 1 138 ? 35.959 31.329  1.185   1.00 61.35  ? 138  HIS A ND1 1 
ATOM   1041 C  CD2 . HIS A 1 138 ? 36.724 33.374  1.145   1.00 61.44  ? 138  HIS A CD2 1 
ATOM   1042 C  CE1 . HIS A 1 138 ? 37.203 31.289  1.618   1.00 55.26  ? 138  HIS A CE1 1 
ATOM   1043 N  NE2 . HIS A 1 138 ? 37.693 32.518  1.604   1.00 60.55  ? 138  HIS A NE2 1 
ATOM   1044 N  N   . ARG A 1 139 ? 33.845 34.197  2.821   1.00 62.99  ? 139  ARG A N   1 
ATOM   1045 C  CA  . ARG A 1 139 ? 33.963 34.763  4.152   1.00 63.06  ? 139  ARG A CA  1 
ATOM   1046 C  C   . ARG A 1 139 ? 32.748 35.549  4.588   1.00 63.67  ? 139  ARG A C   1 
ATOM   1047 O  O   . ARG A 1 139 ? 32.654 35.939  5.750   1.00 62.66  ? 139  ARG A O   1 
ATOM   1048 C  CB  . ARG A 1 139 ? 35.199 35.629  4.243   1.00 67.09  ? 139  ARG A CB  1 
ATOM   1049 C  CG  . ARG A 1 139 ? 36.465 34.811  4.178   1.00 72.35  ? 139  ARG A CG  1 
ATOM   1050 C  CD  . ARG A 1 139 ? 37.099 34.664  5.548   1.00 83.87  ? 139  ARG A CD  1 
ATOM   1051 N  NE  . ARG A 1 139 ? 37.801 35.888  5.932   1.00 95.03  ? 139  ARG A NE  1 
ATOM   1052 C  CZ  . ARG A 1 139 ? 38.930 36.306  5.367   1.00 95.34  ? 139  ARG A CZ  1 
ATOM   1053 N  NH1 . ARG A 1 139 ? 39.487 35.600  4.386   1.00 88.91  ? 139  ARG A NH1 1 
ATOM   1054 N  NH2 . ARG A 1 139 ? 39.500 37.430  5.779   1.00 91.63  ? 139  ARG A NH2 1 
ATOM   1055 N  N   . ASP A 1 140 ? 31.825 35.798  3.662   1.00 62.42  ? 140  ASP A N   1 
ATOM   1056 C  CA  . ASP A 1 140 ? 30.580 36.463  4.028   1.00 63.52  ? 140  ASP A CA  1 
ATOM   1057 C  C   . ASP A 1 140 ? 29.651 35.446  4.692   1.00 62.56  ? 140  ASP A C   1 
ATOM   1058 O  O   . ASP A 1 140 ? 28.741 35.810  5.430   1.00 65.42  ? 140  ASP A O   1 
ATOM   1059 C  CB  . ASP A 1 140 ? 29.874 37.101  2.816   1.00 66.63  ? 140  ASP A CB  1 
ATOM   1060 C  CG  . ASP A 1 140 ? 30.731 38.148  2.077   1.00 69.47  ? 140  ASP A CG  1 
ATOM   1061 O  OD1 . ASP A 1 140 ? 31.486 38.910  2.719   1.00 60.83  ? 140  ASP A OD1 1 
ATOM   1062 O  OD2 . ASP A 1 140 ? 30.613 38.214  0.828   1.00 68.05  ? 140  ASP A OD2 1 
ATOM   1063 N  N   . LEU A 1 141 ? 29.896 34.167  4.421   1.00 61.39  ? 141  LEU A N   1 
ATOM   1064 C  CA  . LEU A 1 141 ? 29.076 33.079  4.949   1.00 59.42  ? 141  LEU A CA  1 
ATOM   1065 C  C   . LEU A 1 141 ? 29.775 32.347  6.090   1.00 57.48  ? 141  LEU A C   1 
ATOM   1066 O  O   . LEU A 1 141 ? 30.942 32.010  5.986   1.00 58.18  ? 141  LEU A O   1 
ATOM   1067 C  CB  . LEU A 1 141 ? 28.732 32.106  3.827   1.00 54.80  ? 141  LEU A CB  1 
ATOM   1068 C  CG  . LEU A 1 141 ? 27.996 32.722  2.633   1.00 58.65  ? 141  LEU A CG  1 
ATOM   1069 C  CD1 . LEU A 1 141 ? 27.820 31.701  1.534   1.00 57.76  ? 141  LEU A CD1 1 
ATOM   1070 C  CD2 . LEU A 1 141 ? 26.636 33.320  3.032   1.00 59.69  ? 141  LEU A CD2 1 
ATOM   1071 N  N   . LYS A 1 142 ? 29.081 32.123  7.195   1.00 54.62  ? 142  LYS A N   1 
ATOM   1072 C  CA  . LYS A 1 142 ? 29.668 31.321  8.266   1.00 54.18  ? 142  LYS A CA  1 
ATOM   1073 C  C   . LYS A 1 142 ? 29.212 29.861  8.106   1.00 54.31  ? 142  LYS A C   1 
ATOM   1074 O  O   . LYS A 1 142 ? 28.364 29.343  8.854   1.00 47.70  ? 142  LYS A O   1 
ATOM   1075 C  CB  . LYS A 1 142 ? 29.360 31.871  9.673   1.00 55.79  ? 142  LYS A CB  1 
ATOM   1076 C  CG  . LYS A 1 142 ? 29.274 33.390  9.784   1.00 59.70  ? 142  LYS A CG  1 
ATOM   1077 C  CD  . LYS A 1 142 ? 30.459 34.092  9.138   1.00 66.74  ? 142  LYS A CD  1 
ATOM   1078 C  CE  . LYS A 1 142 ? 30.082 35.504  8.701   1.00 69.85  ? 142  LYS A CE  1 
ATOM   1079 N  NZ  . LYS A 1 142 ? 31.235 36.243  8.115   1.00 66.40  ? 142  LYS A NZ  1 
ATOM   1080 N  N   . LEU A 1 143 ? 29.816 29.220  7.108   1.00 54.59  ? 143  LEU A N   1 
ATOM   1081 C  CA  . LEU A 1 143 ? 29.419 27.913  6.615   1.00 49.12  ? 143  LEU A CA  1 
ATOM   1082 C  C   . LEU A 1 143 ? 29.897 26.763  7.489   1.00 47.72  ? 143  LEU A C   1 
ATOM   1083 O  O   . LEU A 1 143 ? 29.391 25.661  7.361   1.00 44.98  ? 143  LEU A O   1 
ATOM   1084 C  CB  . LEU A 1 143 ? 29.905 27.744  5.188   1.00 50.84  ? 143  LEU A CB  1 
ATOM   1085 C  CG  . LEU A 1 143 ? 29.134 28.556  4.147   1.00 51.78  ? 143  LEU A CG  1 
ATOM   1086 C  CD1 . LEU A 1 143 ? 29.385 27.972  2.744   1.00 49.00  ? 143  LEU A CD1 1 
ATOM   1087 C  CD2 . LEU A 1 143 ? 27.655 28.548  4.500   1.00 42.81  ? 143  LEU A CD2 1 
ATOM   1088 N  N   . GLU A 1 144 ? 30.840 27.064  8.388   1.00 47.99  ? 144  GLU A N   1 
ATOM   1089 C  CA  . GLU A 1 144 ? 31.394 26.151  9.388   1.00 47.24  ? 144  GLU A CA  1 
ATOM   1090 C  C   . GLU A 1 144 ? 30.537 26.064  10.648  1.00 47.99  ? 144  GLU A C   1 
ATOM   1091 O  O   . GLU A 1 144 ? 30.761 25.213  11.508  1.00 47.73  ? 144  GLU A O   1 
ATOM   1092 C  CB  . GLU A 1 144 ? 32.812 26.586  9.756   1.00 48.69  ? 144  GLU A CB  1 
ATOM   1093 C  CG  . GLU A 1 144 ? 32.943 28.086  10.049  1.00 56.75  ? 144  GLU A CG  1 
ATOM   1094 C  CD  . GLU A 1 144 ? 32.908 28.973  8.791   1.00 61.35  ? 144  GLU A CD  1 
ATOM   1095 O  OE1 . GLU A 1 144 ? 33.237 28.481  7.684   1.00 65.31  ? 144  GLU A OE1 1 
ATOM   1096 O  OE2 . GLU A 1 144 ? 32.561 30.166  8.916   1.00 56.72  ? 144  GLU A OE2 1 
ATOM   1097 N  N   . ASN A 1 145 ? 29.541 26.937  10.753  1.00 46.48  ? 145  ASN A N   1 
ATOM   1098 C  CA  . ASN A 1 145 ? 28.683 26.917  11.923  1.00 44.08  ? 145  ASN A CA  1 
ATOM   1099 C  C   . ASN A 1 145 ? 27.220 27.251  11.627  1.00 41.86  ? 145  ASN A C   1 
ATOM   1100 O  O   . ASN A 1 145 ? 26.632 28.114  12.211  1.00 44.10  ? 145  ASN A O   1 
ATOM   1101 C  CB  . ASN A 1 145 ? 29.282 27.750  13.075  1.00 47.59  ? 145  ASN A CB  1 
ATOM   1102 C  CG  . ASN A 1 145 ? 28.703 27.368  14.451  1.00 57.55  ? 145  ASN A CG  1 
ATOM   1103 O  OD1 . ASN A 1 145 ? 28.129 26.291  14.635  1.00 52.76  ? 145  ASN A OD1 1 
ATOM   1104 N  ND2 . ASN A 1 145 ? 28.864 28.256  15.422  1.00 65.08  ? 145  ASN A ND2 1 
ATOM   1105 N  N   . THR A 1 146 ? 26.625 26.515  10.724  1.00 40.74  ? 146  THR A N   1 
ATOM   1106 C  CA  . THR A 1 146 ? 25.222 26.686  10.463  1.00 41.83  ? 146  THR A CA  1 
ATOM   1107 C  C   . THR A 1 146 ? 24.319 26.256  11.625  1.00 44.77  ? 146  THR A C   1 
ATOM   1108 O  O   . THR A 1 146 ? 24.725 25.527  12.528  1.00 43.64  ? 146  THR A O   1 
ATOM   1109 C  CB  . THR A 1 146 ? 24.826 25.991  9.171   1.00 43.91  ? 146  THR A CB  1 
ATOM   1110 O  OG1 . THR A 1 146 ? 25.088 24.587  9.255   1.00 44.31  ? 146  THR A OG1 1 
ATOM   1111 C  CG2 . THR A 1 146 ? 25.635 26.573  8.038   1.00 44.94  ? 146  THR A CG2 1 
ATOM   1112 N  N   . LEU A 1 147 ? 23.078 26.727  11.576  1.00 46.18  ? 147  LEU A N   1 
ATOM   1113 C  CA  . LEU A 1 147 ? 22.188 26.653  12.709  1.00 43.79  ? 147  LEU A CA  1 
ATOM   1114 C  C   . LEU A 1 147 ? 20.817 26.161  12.282  1.00 43.51  ? 147  LEU A C   1 
ATOM   1115 O  O   . LEU A 1 147 ? 20.531 26.001  11.094  1.00 40.94  ? 147  LEU A O   1 
ATOM   1116 C  CB  . LEU A 1 147 ? 22.077 28.019  13.366  1.00 43.72  ? 147  LEU A CB  1 
ATOM   1117 C  CG  . LEU A 1 147 ? 23.300 28.927  13.502  1.00 48.35  ? 147  LEU A CG  1 
ATOM   1118 C  CD1 . LEU A 1 147 ? 22.892 30.263  14.044  1.00 56.32  ? 147  LEU A CD1 1 
ATOM   1119 C  CD2 . LEU A 1 147 ? 24.368 28.325  14.400  1.00 50.52  ? 147  LEU A CD2 1 
ATOM   1120 N  N   . LEU A 1 148 ? 19.981 25.887  13.275  1.00 44.32  ? 148  LEU A N   1 
ATOM   1121 C  CA  . LEU A 1 148 ? 18.600 25.506  13.038  1.00 46.12  ? 148  LEU A CA  1 
ATOM   1122 C  C   . LEU A 1 148 ? 17.615 26.526  13.637  1.00 48.53  ? 148  LEU A C   1 
ATOM   1123 O  O   . LEU A 1 148 ? 17.873 27.109  14.692  1.00 48.83  ? 148  LEU A O   1 
ATOM   1124 C  CB  . LEU A 1 148 ? 18.353 24.107  13.608  1.00 45.42  ? 148  LEU A CB  1 
ATOM   1125 C  CG  . LEU A 1 148 ? 19.418 23.049  13.260  1.00 45.13  ? 148  LEU A CG  1 
ATOM   1126 C  CD1 . LEU A 1 148 ? 19.318 21.739  14.065  1.00 46.06  ? 148  LEU A CD1 1 
ATOM   1127 C  CD2 . LEU A 1 148 ? 19.423 22.751  11.760  1.00 46.58  ? 148  LEU A CD2 1 
ATOM   1128 N  N   . ASP A 1 149 ? 16.492 26.752  12.965  1.00 48.73  ? 149  ASP A N   1 
ATOM   1129 C  CA  . ASP A 1 149 ? 15.373 27.443  13.625  1.00 53.48  ? 149  ASP A CA  1 
ATOM   1130 C  C   . ASP A 1 149 ? 14.729 26.574  14.715  1.00 55.58  ? 149  ASP A C   1 
ATOM   1131 O  O   . ASP A 1 149 ? 15.098 25.425  14.922  1.00 55.61  ? 149  ASP A O   1 
ATOM   1132 C  CB  . ASP A 1 149 ? 14.291 27.868  12.616  1.00 54.16  ? 149  ASP A CB  1 
ATOM   1133 C  CG  . ASP A 1 149 ? 13.527 26.670  12.020  1.00 55.15  ? 149  ASP A CG  1 
ATOM   1134 O  OD1 . ASP A 1 149 ? 13.682 25.535  12.517  1.00 53.85  ? 149  ASP A OD1 1 
ATOM   1135 O  OD2 . ASP A 1 149 ? 12.784 26.869  11.038  1.00 58.72  ? 149  ASP A OD2 1 
ATOM   1136 N  N   . GLY A 1 150 ? 13.720 27.120  15.376  1.00 60.24  ? 150  GLY A N   1 
ATOM   1137 C  CA  . GLY A 1 150 ? 12.986 26.384  16.393  1.00 56.31  ? 150  GLY A CA  1 
ATOM   1138 C  C   . GLY A 1 150 ? 11.968 25.368  15.891  1.00 58.71  ? 150  GLY A C   1 
ATOM   1139 O  O   . GLY A 1 150 ? 11.381 24.660  16.698  1.00 66.45  ? 150  GLY A O   1 
ATOM   1140 N  N   . SER A 1 151 ? 11.768 25.291  14.576  1.00 54.24  ? 151  SER A N   1 
ATOM   1141 C  CA  . SER A 1 151 ? 10.831 24.348  13.979  1.00 59.93  ? 151  SER A CA  1 
ATOM   1142 C  C   . SER A 1 151 ? 11.027 22.945  14.516  1.00 65.22  ? 151  SER A C   1 
ATOM   1143 O  O   . SER A 1 151 ? 12.144 22.438  14.568  1.00 64.45  ? 151  SER A O   1 
ATOM   1144 C  CB  . SER A 1 151 ? 10.974 24.299  12.450  1.00 63.81  ? 151  SER A CB  1 
ATOM   1145 O  OG  . SER A 1 151 ? 10.334 25.380  11.791  1.00 66.78  ? 151  SER A OG  1 
ATOM   1146 N  N   . PRO A 1 152 ? 9.923  22.300  14.904  1.00 71.08  ? 152  PRO A N   1 
ATOM   1147 C  CA  . PRO A 1 152 ? 9.941  20.885  15.263  1.00 69.27  ? 152  PRO A CA  1 
ATOM   1148 C  C   . PRO A 1 152 ? 10.586 20.088  14.143  1.00 69.11  ? 152  PRO A C   1 
ATOM   1149 O  O   . PRO A 1 152 ? 11.237 19.089  14.419  1.00 72.81  ? 152  PRO A O   1 
ATOM   1150 C  CB  . PRO A 1 152 ? 8.463  20.548  15.352  1.00 68.18  ? 152  PRO A CB  1 
ATOM   1151 C  CG  . PRO A 1 152 ? 7.818  21.851  15.745  1.00 70.60  ? 152  PRO A CG  1 
ATOM   1152 C  CD  . PRO A 1 152 ? 8.571  22.880  14.993  1.00 68.72  ? 152  PRO A CD  1 
ATOM   1153 N  N   . ALA A 1 153 ? 10.394 20.523  12.898  1.00 66.98  ? 153  ALA A N   1 
ATOM   1154 C  CA  . ALA A 1 153 ? 11.128 19.963  11.757  1.00 68.26  ? 153  ALA A CA  1 
ATOM   1155 C  C   . ALA A 1 153 ? 12.148 20.984  11.261  1.00 66.23  ? 153  ALA A C   1 
ATOM   1156 O  O   . ALA A 1 153 ? 11.898 21.674  10.282  1.00 66.61  ? 153  ALA A O   1 
ATOM   1157 C  CB  . ALA A 1 153 ? 10.177 19.587  10.639  1.00 66.72  ? 153  ALA A CB  1 
ATOM   1158 N  N   . PRO A 1 154 ? 13.310 21.058  11.928  1.00 63.75  ? 154  PRO A N   1 
ATOM   1159 C  CA  . PRO A 1 154 ? 14.204 22.211  11.850  1.00 59.19  ? 154  PRO A CA  1 
ATOM   1160 C  C   . PRO A 1 154 ? 14.583 22.608  10.450  1.00 57.01  ? 154  PRO A C   1 
ATOM   1161 O  O   . PRO A 1 154 ? 14.889 21.769  9.603   1.00 53.93  ? 154  PRO A O   1 
ATOM   1162 C  CB  . PRO A 1 154 ? 15.451 21.746  12.597  1.00 52.82  ? 154  PRO A CB  1 
ATOM   1163 C  CG  . PRO A 1 154 ? 15.022 20.631  13.442  1.00 57.28  ? 154  PRO A CG  1 
ATOM   1164 C  CD  . PRO A 1 154 ? 13.910 19.963  12.703  1.00 61.09  ? 154  PRO A CD  1 
ATOM   1165 N  N   . ARG A 1 155 ? 14.558 23.919  10.233  1.00 56.05  ? 155  ARG A N   1 
ATOM   1166 C  CA  . ARG A 1 155 ? 15.092 24.526  9.032   1.00 52.70  ? 155  ARG A CA  1 
ATOM   1167 C  C   . ARG A 1 155 ? 16.504 24.996  9.290   1.00 50.77  ? 155  ARG A C   1 
ATOM   1168 O  O   . ARG A 1 155 ? 16.796 25.619  10.324  1.00 48.31  ? 155  ARG A O   1 
ATOM   1169 C  CB  . ARG A 1 155 ? 14.228 25.700  8.622   1.00 54.69  ? 155  ARG A CB  1 
ATOM   1170 C  CG  . ARG A 1 155 ? 12.833 25.282  8.215   1.00 61.17  ? 155  ARG A CG  1 
ATOM   1171 C  CD  . ARG A 1 155 ? 12.769 25.029  6.723   1.00 58.05  ? 155  ARG A CD  1 
ATOM   1172 N  NE  . ARG A 1 155 ? 12.725 23.614  6.382   1.00 53.15  ? 155  ARG A NE  1 
ATOM   1173 C  CZ  . ARG A 1 155 ? 12.901 23.146  5.147   1.00 57.07  ? 155  ARG A CZ  1 
ATOM   1174 N  NH1 . ARG A 1 155 ? 13.149 23.976  4.141   1.00 48.50  ? 155  ARG A NH1 1 
ATOM   1175 N  NH2 . ARG A 1 155 ? 12.852 21.839  4.913   1.00 59.20  ? 155  ARG A NH2 1 
ATOM   1176 N  N   . LEU A 1 156 ? 17.371 24.665  8.343   1.00 50.06  ? 156  LEU A N   1 
ATOM   1177 C  CA  . LEU A 1 156 ? 18.737 25.146  8.312   1.00 47.29  ? 156  LEU A CA  1 
ATOM   1178 C  C   . LEU A 1 156 ? 18.821 26.678  8.164   1.00 49.14  ? 156  LEU A C   1 
ATOM   1179 O  O   . LEU A 1 156 ? 18.069 27.281  7.394   1.00 48.31  ? 156  LEU A O   1 
ATOM   1180 C  CB  . LEU A 1 156 ? 19.477 24.471  7.169   1.00 47.41  ? 156  LEU A CB  1 
ATOM   1181 C  CG  . LEU A 1 156 ? 20.979 24.687  7.276   1.00 49.20  ? 156  LEU A CG  1 
ATOM   1182 C  CD1 . LEU A 1 156 ? 21.644 23.630  8.166   1.00 46.07  ? 156  LEU A CD1 1 
ATOM   1183 C  CD2 . LEU A 1 156 ? 21.581 24.702  5.916   1.00 49.30  ? 156  LEU A CD2 1 
ATOM   1184 N  N   . LYS A 1 157 ? 19.728 27.302  8.914   1.00 49.69  ? 157  LYS A N   1 
ATOM   1185 C  CA  . LYS A 1 157 ? 19.865 28.764  8.930   1.00 50.18  ? 157  LYS A CA  1 
ATOM   1186 C  C   . LYS A 1 157 ? 21.338 29.152  8.866   1.00 51.72  ? 157  LYS A C   1 
ATOM   1187 O  O   . LYS A 1 157 ? 22.114 28.832  9.759   1.00 49.96  ? 157  LYS A O   1 
ATOM   1188 C  CB  . LYS A 1 157 ? 19.222 29.386  10.175  1.00 49.85  ? 157  LYS A CB  1 
ATOM   1189 C  CG  . LYS A 1 157 ? 17.744 29.074  10.390  1.00 51.64  ? 157  LYS A CG  1 
ATOM   1190 C  CD  . LYS A 1 157 ? 16.818 29.594  9.298   1.00 53.34  ? 157  LYS A CD  1 
ATOM   1191 C  CE  . LYS A 1 157 ? 16.647 31.098  9.372   1.00 58.39  ? 157  LYS A CE  1 
ATOM   1192 N  NZ  . LYS A 1 157 ? 15.380 31.641  8.772   1.00 61.20  ? 157  LYS A NZ  1 
ATOM   1193 N  N   . ILE A 1 158 ? 21.718 29.836  7.791   1.00 52.77  ? 158  ILE A N   1 
ATOM   1194 C  CA  . ILE A 1 158 ? 23.095 30.259  7.590   1.00 51.43  ? 158  ILE A CA  1 
ATOM   1195 C  C   . ILE A 1 158 ? 23.278 31.730  7.938   1.00 53.10  ? 158  ILE A C   1 
ATOM   1196 O  O   . ILE A 1 158 ? 22.536 32.578  7.469   1.00 51.06  ? 158  ILE A O   1 
ATOM   1197 C  CB  . ILE A 1 158 ? 23.516 30.027  6.137   1.00 50.44  ? 158  ILE A CB  1 
ATOM   1198 C  CG1 . ILE A 1 158 ? 23.090 28.640  5.678   1.00 51.24  ? 158  ILE A CG1 1 
ATOM   1199 C  CG2 . ILE A 1 158 ? 25.009 30.222  5.963   1.00 49.14  ? 158  ILE A CG2 1 
ATOM   1200 C  CD1 . ILE A 1 158 ? 23.137 28.465  4.163   1.00 49.14  ? 158  ILE A CD1 1 
ATOM   1201 N  N   . CYS A 1 159 ? 24.266 32.019  8.776   1.00 56.23  ? 159  CYS A N   1 
ATOM   1202 C  CA  . CYS A 1 159 ? 24.617 33.394  9.126   1.00 58.01  ? 159  CYS A CA  1 
ATOM   1203 C  C   . CYS A 1 159 ? 25.430 34.042  7.997   1.00 63.41  ? 159  CYS A C   1 
ATOM   1204 O  O   . CYS A 1 159 ? 26.473 33.513  7.604   1.00 64.20  ? 159  CYS A O   1 
ATOM   1205 C  CB  . CYS A 1 159 ? 25.423 33.424  10.425  1.00 58.04  ? 159  CYS A CB  1 
ATOM   1206 S  SG  . CYS A 1 159 ? 24.476 33.058  11.892  1.00 59.40  ? 159  CYS A SG  1 
ATOM   1207 N  N   . ALA A 1 160 ? 24.937 35.156  7.454   1.00 64.30  ? 160  ALA A N   1 
ATOM   1208 C  CA  . ALA A 1 160 ? 25.704 35.961  6.497   1.00 65.76  ? 160  ALA A CA  1 
ATOM   1209 C  C   . ALA A 1 160 ? 26.082 37.322  7.105   1.00 70.31  ? 160  ALA A C   1 
ATOM   1210 O  O   . ALA A 1 160 ? 25.217 38.076  7.539   1.00 70.27  ? 160  ALA A O   1 
ATOM   1211 C  CB  . ALA A 1 160 ? 24.939 36.145  5.185   1.00 60.11  ? 160  ALA A CB  1 
ATOM   1212 N  N   . PHE A 1 161 ? 27.376 37.631  7.139   1.00 71.56  ? 161  PHE A N   1 
ATOM   1213 C  CA  . PHE A 1 161 ? 27.869 38.884  7.718   1.00 77.43  ? 161  PHE A CA  1 
ATOM   1214 C  C   . PHE A 1 161 ? 27.794 38.780  9.227   1.00 86.85  ? 161  PHE A C   1 
ATOM   1215 O  O   . PHE A 1 161 ? 26.756 38.415  9.785   1.00 83.27  ? 161  PHE A O   1 
ATOM   1216 C  CB  . PHE A 1 161 ? 27.094 40.112  7.197   1.00 73.56  ? 161  PHE A CB  1 
ATOM   1217 C  CG  . PHE A 1 161 ? 27.009 40.177  5.692   1.00 70.48  ? 161  PHE A CG  1 
ATOM   1218 C  CD1 . PHE A 1 161 ? 28.140 40.461  4.934   1.00 69.35  ? 161  PHE A CD1 1 
ATOM   1219 C  CD2 . PHE A 1 161 ? 25.806 39.919  5.029   1.00 64.97  ? 161  PHE A CD2 1 
ATOM   1220 C  CE1 . PHE A 1 161 ? 28.080 40.503  3.543   1.00 67.85  ? 161  PHE A CE1 1 
ATOM   1221 C  CE2 . PHE A 1 161 ? 25.738 39.950  3.637   1.00 60.69  ? 161  PHE A CE2 1 
ATOM   1222 C  CZ  . PHE A 1 161 ? 26.880 40.248  2.894   1.00 63.24  ? 161  PHE A CZ  1 
ATOM   1223 N  N   . GLY A 1 162 ? 28.900 39.100  9.889   1.00 92.18  ? 162  GLY A N   1 
ATOM   1224 C  CA  . GLY A 1 162 ? 29.026 38.819  11.308  1.00 100.01 ? 162  GLY A CA  1 
ATOM   1225 C  C   . GLY A 1 162 ? 29.109 40.006  12.254  1.00 107.01 ? 162  GLY A C   1 
ATOM   1226 O  O   . GLY A 1 162 ? 28.790 39.866  13.440  1.00 105.37 ? 162  GLY A O   1 
ATOM   1227 N  N   . TYR A 1 163 ? 29.533 41.166  11.747  1.00 102.86 ? 163  TYR A N   1 
ATOM   1228 C  CA  . TYR A 1 163 ? 29.728 42.344  12.593  1.00 108.60 ? 163  TYR A CA  1 
ATOM   1229 C  C   . TYR A 1 163 ? 30.665 42.026  13.764  1.00 115.88 ? 163  TYR A C   1 
ATOM   1230 O  O   . TYR A 1 163 ? 31.866 42.304  13.722  1.00 119.43 ? 163  TYR A O   1 
ATOM   1231 C  CB  . TYR A 1 163 ? 28.389 42.846  13.140  1.00 101.08 ? 163  TYR A CB  1 
ATOM   1232 C  CG  . TYR A 1 163 ? 27.276 42.903  12.118  1.00 98.34  ? 163  TYR A CG  1 
ATOM   1233 C  CD1 . TYR A 1 163 ? 27.444 43.559  10.901  1.00 91.26  ? 163  TYR A CD1 1 
ATOM   1234 C  CD2 . TYR A 1 163 ? 26.056 42.284  12.368  1.00 89.29  ? 163  TYR A CD2 1 
ATOM   1235 C  CE1 . TYR A 1 163 ? 26.413 43.608  9.967   1.00 82.02  ? 163  TYR A CE1 1 
ATOM   1236 C  CE2 . TYR A 1 163 ? 25.026 42.322  11.441  1.00 84.66  ? 163  TYR A CE2 1 
ATOM   1237 C  CZ  . TYR A 1 163 ? 25.206 42.984  10.239  1.00 80.34  ? 163  TYR A CZ  1 
ATOM   1238 O  OH  . TYR A 1 163 ? 24.178 43.025  9.318   1.00 71.32  ? 163  TYR A OH  1 
ATOM   1239 N  N   . GLY A 1 178 ? 37.781 27.974  14.012  1.00 62.92  ? 178  GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 178 ? 37.658 26.583  14.430  1.00 62.11  ? 178  GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 178 ? 38.512 25.538  13.705  1.00 71.34  ? 178  GLY A C   1 
ATOM   1242 O  O   . GLY A 1 178 ? 39.748 25.696  13.553  1.00 63.64  ? 178  GLY A O   1 
ATOM   1243 N  N   . THR A 1 179 ? 37.849 24.451  13.284  1.00 64.48  ? 179  THR A N   1 
ATOM   1244 C  CA  . THR A 1 179 ? 38.513 23.369  12.546  1.00 57.23  ? 179  THR A CA  1 
ATOM   1245 C  C   . THR A 1 179 ? 39.006 23.823  11.166  1.00 57.97  ? 179  THR A C   1 
ATOM   1246 O  O   . THR A 1 179 ? 38.237 24.380  10.350  1.00 57.60  ? 179  THR A O   1 
ATOM   1247 C  CB  . THR A 1 179 ? 37.648 22.021  12.440  1.00 63.69  ? 179  THR A CB  1 
ATOM   1248 O  OG1 . THR A 1 179 ? 38.449 20.943  11.917  1.00 59.76  ? 179  THR A OG1 1 
ATOM   1249 C  CG2 . THR A 1 179 ? 36.423 22.179  11.547  1.00 57.25  ? 179  THR A CG2 1 
ATOM   1250 N  N   . PRO A 1 180 ? 40.302 23.600  10.904  1.00 56.05  ? 180  PRO A N   1 
ATOM   1251 C  CA  . PRO A 1 180 ? 40.791 23.861  9.550   1.00 53.08  ? 180  PRO A CA  1 
ATOM   1252 C  C   . PRO A 1 180 ? 40.168 22.887  8.537   1.00 51.26  ? 180  PRO A C   1 
ATOM   1253 O  O   . PRO A 1 180 ? 40.371 23.077  7.357   1.00 52.10  ? 180  PRO A O   1 
ATOM   1254 C  CB  . PRO A 1 180 ? 42.311 23.693  9.681   1.00 52.06  ? 180  PRO A CB  1 
ATOM   1255 C  CG  . PRO A 1 180 ? 42.494 22.843  10.903  1.00 57.67  ? 180  PRO A CG  1 
ATOM   1256 C  CD  . PRO A 1 180 ? 41.360 23.122  11.812  1.00 56.13  ? 180  PRO A CD  1 
ATOM   1257 N  N   . ALA A 1 181 ? 39.389 21.909  8.988   1.00 52.84  ? 181  ALA A N   1 
ATOM   1258 C  CA  . ALA A 1 181 ? 38.701 20.990  8.072   1.00 53.96  ? 181  ALA A CA  1 
ATOM   1259 C  C   . ALA A 1 181 ? 37.945 21.690  6.959   1.00 49.83  ? 181  ALA A C   1 
ATOM   1260 O  O   . ALA A 1 181 ? 37.961 21.233  5.821   1.00 52.20  ? 181  ALA A O   1 
ATOM   1261 C  CB  . ALA A 1 181 ? 37.763 20.043  8.823   1.00 53.12  ? 181  ALA A CB  1 
ATOM   1262 N  N   . TYR A 1 182 ? 37.287 22.795  7.285   1.00 49.83  ? 182  TYR A N   1 
ATOM   1263 C  CA  . TYR A 1 182 ? 36.498 23.542  6.293   1.00 51.56  ? 182  TYR A CA  1 
ATOM   1264 C  C   . TYR A 1 182 ? 37.309 24.248  5.200   1.00 47.58  ? 182  TYR A C   1 
ATOM   1265 O  O   . TYR A 1 182 ? 36.795 24.529  4.127   1.00 44.48  ? 182  TYR A O   1 
ATOM   1266 C  CB  . TYR A 1 182 ? 35.575 24.536  6.991   1.00 48.32  ? 182  TYR A CB  1 
ATOM   1267 C  CG  . TYR A 1 182 ? 34.443 23.888  7.731   1.00 47.14  ? 182  TYR A CG  1 
ATOM   1268 C  CD1 . TYR A 1 182 ? 33.267 23.554  7.085   1.00 45.99  ? 182  TYR A CD1 1 
ATOM   1269 C  CD2 . TYR A 1 182 ? 34.552 23.595  9.088   1.00 49.61  ? 182  TYR A CD2 1 
ATOM   1270 C  CE1 . TYR A 1 182 ? 32.218 22.947  7.783   1.00 47.07  ? 182  TYR A CE1 1 
ATOM   1271 C  CE2 . TYR A 1 182 ? 33.506 22.993  9.794   1.00 48.38  ? 182  TYR A CE2 1 
ATOM   1272 C  CZ  . TYR A 1 182 ? 32.348 22.675  9.145   1.00 49.35  ? 182  TYR A CZ  1 
ATOM   1273 O  OH  . TYR A 1 182 ? 31.329 22.074  9.861   1.00 56.50  ? 182  TYR A OH  1 
ATOM   1274 N  N   . ILE A 1 183 ? 38.577 24.514  5.473   1.00 45.83  ? 183  ILE A N   1 
ATOM   1275 C  CA  . ILE A 1 183 ? 39.417 25.229  4.529   1.00 47.44  ? 183  ILE A CA  1 
ATOM   1276 C  C   . ILE A 1 183 ? 39.821 24.352  3.357   1.00 48.64  ? 183  ILE A C   1 
ATOM   1277 O  O   . ILE A 1 183 ? 40.326 23.264  3.542   1.00 46.72  ? 183  ILE A O   1 
ATOM   1278 C  CB  . ILE A 1 183 ? 40.679 25.770  5.209   1.00 47.55  ? 183  ILE A CB  1 
ATOM   1279 C  CG1 . ILE A 1 183 ? 40.325 26.403  6.554   1.00 45.74  ? 183  ILE A CG1 1 
ATOM   1280 C  CG2 . ILE A 1 183 ? 41.439 26.712  4.278   1.00 48.41  ? 183  ILE A CG2 1 
ATOM   1281 C  CD1 . ILE A 1 183 ? 41.517 26.929  7.301   1.00 47.07  ? 183  ILE A CD1 1 
ATOM   1282 N  N   . ALA A 1 184 ? 39.629 24.870  2.152   1.00 46.03  ? 184  ALA A N   1 
ATOM   1283 C  CA  . ALA A 1 184 ? 39.942 24.169  0.916   1.00 47.93  ? 184  ALA A CA  1 
ATOM   1284 C  C   . ALA A 1 184 ? 41.437 24.228  0.591   1.00 51.35  ? 184  ALA A C   1 
ATOM   1285 O  O   . ALA A 1 184 ? 42.110 25.205  0.906   1.00 47.93  ? 184  ALA A O   1 
ATOM   1286 C  CB  . ALA A 1 184 ? 39.125 24.775  -0.208  1.00 47.66  ? 184  ALA A CB  1 
ATOM   1287 N  N   . PRO A 1 185 ? 41.970 23.185  -0.058  1.00 51.85  ? 185  PRO A N   1 
ATOM   1288 C  CA  . PRO A 1 185 ? 43.433 23.184  -0.292  1.00 52.70  ? 185  PRO A CA  1 
ATOM   1289 C  C   . PRO A 1 185 ? 43.971 24.470  -0.968  1.00 50.49  ? 185  PRO A C   1 
ATOM   1290 O  O   . PRO A 1 185 ? 45.033 24.986  -0.601  1.00 49.06  ? 185  PRO A O   1 
ATOM   1291 C  CB  . PRO A 1 185 ? 43.650 21.941  -1.178  1.00 50.50  ? 185  PRO A CB  1 
ATOM   1292 C  CG  . PRO A 1 185 ? 42.498 21.038  -0.847  1.00 49.57  ? 185  PRO A CG  1 
ATOM   1293 C  CD  . PRO A 1 185 ? 41.308 21.995  -0.628  1.00 46.56  ? 185  PRO A CD  1 
ATOM   1294 N  N   . GLU A 1 186 ? 43.223 24.983  -1.937  1.00 50.40  ? 186  GLU A N   1 
ATOM   1295 C  CA  . GLU A 1 186 ? 43.625 26.183  -2.659  1.00 54.96  ? 186  GLU A CA  1 
ATOM   1296 C  C   . GLU A 1 186 ? 43.641 27.421  -1.770  1.00 53.50  ? 186  GLU A C   1 
ATOM   1297 O  O   . GLU A 1 186 ? 44.514 28.247  -1.907  1.00 53.85  ? 186  GLU A O   1 
ATOM   1298 C  CB  . GLU A 1 186 ? 42.756 26.417  -3.904  1.00 54.15  ? 186  GLU A CB  1 
ATOM   1299 C  CG  . GLU A 1 186 ? 41.346 26.909  -3.630  1.00 53.41  ? 186  GLU A CG  1 
ATOM   1300 C  CD  . GLU A 1 186 ? 40.379 25.792  -3.449  1.00 51.33  ? 186  GLU A CD  1 
ATOM   1301 O  OE1 . GLU A 1 186 ? 40.824 24.718  -3.022  1.00 50.12  ? 186  GLU A OE1 1 
ATOM   1302 O  OE2 . GLU A 1 186 ? 39.189 25.979  -3.753  1.00 50.05  ? 186  GLU A OE2 1 
ATOM   1303 N  N   . VAL A 1 187 ? 42.675 27.539  -0.866  1.00 52.20  ? 187  VAL A N   1 
ATOM   1304 C  CA  . VAL A 1 187 ? 42.662 28.632  0.099   1.00 51.75  ? 187  VAL A CA  1 
ATOM   1305 C  C   . VAL A 1 187 ? 43.914 28.622  0.991   1.00 53.98  ? 187  VAL A C   1 
ATOM   1306 O  O   . VAL A 1 187 ? 44.379 29.657  1.432   1.00 53.43  ? 187  VAL A O   1 
ATOM   1307 C  CB  . VAL A 1 187 ? 41.374 28.598  0.974   1.00 51.63  ? 187  VAL A CB  1 
ATOM   1308 C  CG1 . VAL A 1 187 ? 41.472 29.574  2.152   1.00 49.80  ? 187  VAL A CG1 1 
ATOM   1309 C  CG2 . VAL A 1 187 ? 40.120 28.876  0.126   1.00 50.54  ? 187  VAL A CG2 1 
ATOM   1310 N  N   . LEU A 1 188 ? 44.464 27.447  1.253   1.00 53.77  ? 188  LEU A N   1 
ATOM   1311 C  CA  . LEU A 1 188 ? 45.698 27.346  2.010   1.00 54.67  ? 188  LEU A CA  1 
ATOM   1312 C  C   . LEU A 1 188 ? 46.928 27.682  1.146   1.00 59.22  ? 188  LEU A C   1 
ATOM   1313 O  O   . LEU A 1 188 ? 47.897 28.304  1.617   1.00 56.60  ? 188  LEU A O   1 
ATOM   1314 C  CB  . LEU A 1 188 ? 45.842 25.924  2.554   1.00 53.81  ? 188  LEU A CB  1 
ATOM   1315 C  CG  . LEU A 1 188 ? 44.932 25.459  3.689   1.00 49.99  ? 188  LEU A CG  1 
ATOM   1316 C  CD1 . LEU A 1 188 ? 45.024 23.965  3.927   1.00 47.03  ? 188  LEU A CD1 1 
ATOM   1317 C  CD2 . LEU A 1 188 ? 45.287 26.206  4.951   1.00 54.31  ? 188  LEU A CD2 1 
ATOM   1318 N  N   . LEU A 1 189 ? 46.875 27.263  -0.119  1.00 57.57  ? 189  LEU A N   1 
ATOM   1319 C  CA  . LEU A 1 189 ? 48.062 27.245  -0.966  1.00 58.26  ? 189  LEU A CA  1 
ATOM   1320 C  C   . LEU A 1 189 ? 48.180 28.384  -1.953  1.00 63.02  ? 189  LEU A C   1 
ATOM   1321 O  O   . LEU A 1 189 ? 49.201 29.062  -1.994  1.00 64.79  ? 189  LEU A O   1 
ATOM   1322 C  CB  . LEU A 1 189 ? 48.160 25.928  -1.738  1.00 54.98  ? 189  LEU A CB  1 
ATOM   1323 C  CG  . LEU A 1 189 ? 48.739 24.764  -0.945  1.00 58.48  ? 189  LEU A CG  1 
ATOM   1324 C  CD1 . LEU A 1 189 ? 48.922 23.576  -1.860  1.00 48.79  ? 189  LEU A CD1 1 
ATOM   1325 C  CD2 . LEU A 1 189 ? 50.051 25.191  -0.289  1.00 58.53  ? 189  LEU A CD2 1 
ATOM   1326 N  N   . LYS A 1 190 ? 47.155 28.568  -2.775  1.00 63.83  ? 190  LYS A N   1 
ATOM   1327 C  CA  . LYS A 1 190 ? 47.219 29.530  -3.867  1.00 61.89  ? 190  LYS A CA  1 
ATOM   1328 C  C   . LYS A 1 190 ? 47.035 30.967  -3.380  1.00 64.92  ? 190  LYS A C   1 
ATOM   1329 O  O   . LYS A 1 190 ? 46.585 31.200  -2.260  1.00 62.04  ? 190  LYS A O   1 
ATOM   1330 C  CB  . LYS A 1 190 ? 46.186 29.179  -4.931  1.00 56.76  ? 190  LYS A CB  1 
ATOM   1331 C  CG  . LYS A 1 190 ? 45.815 27.702  -4.969  1.00 63.59  ? 190  LYS A CG  1 
ATOM   1332 C  CD  . LYS A 1 190 ? 47.002 26.778  -5.178  1.00 64.68  ? 190  LYS A CD  1 
ATOM   1333 C  CE  . LYS A 1 190 ? 47.593 26.943  -6.551  1.00 72.46  ? 190  LYS A CE  1 
ATOM   1334 N  NZ  . LYS A 1 190 ? 48.770 27.841  -6.503  1.00 70.82  ? 190  LYS A NZ  1 
ATOM   1335 N  N   . LYS A 1 191 ? 47.402 31.920  -4.235  1.00 70.15  ? 191  LYS A N   1 
ATOM   1336 C  CA  . LYS A 1 191 ? 47.351 33.347  -3.918  1.00 70.09  ? 191  LYS A CA  1 
ATOM   1337 C  C   . LYS A 1 191 ? 46.012 33.892  -4.362  1.00 67.65  ? 191  LYS A C   1 
ATOM   1338 O  O   . LYS A 1 191 ? 45.338 34.611  -3.630  1.00 65.77  ? 191  LYS A O   1 
ATOM   1339 C  CB  . LYS A 1 191 ? 48.460 34.091  -4.659  1.00 70.82  ? 191  LYS A CB  1 
ATOM   1340 C  CG  . LYS A 1 191 ? 49.857 33.511  -4.462  1.00 76.76  ? 191  LYS A CG  1 
ATOM   1341 C  CD  . LYS A 1 191 ? 50.308 32.625  -5.638  1.00 75.62  ? 191  LYS A CD  1 
ATOM   1342 C  CE  . LYS A 1 191 ? 49.794 31.185  -5.535  1.00 68.83  ? 191  LYS A CE  1 
ATOM   1343 N  NZ  . LYS A 1 191 ? 48.833 30.864  -6.620  1.00 70.11  ? 191  LYS A NZ  1 
ATOM   1344 N  N   . GLU A 1 192 ? 45.650 33.536  -5.585  1.00 66.97  ? 192  GLU A N   1 
ATOM   1345 C  CA  . GLU A 1 192 ? 44.340 33.813  -6.118  1.00 69.84  ? 192  GLU A CA  1 
ATOM   1346 C  C   . GLU A 1 192 ? 43.494 32.552  -5.984  1.00 64.79  ? 192  GLU A C   1 
ATOM   1347 O  O   . GLU A 1 192 ? 43.971 31.467  -6.302  1.00 63.04  ? 192  GLU A O   1 
ATOM   1348 C  CB  . GLU A 1 192 ? 44.462 34.196  -7.591  1.00 73.13  ? 192  GLU A CB  1 
ATOM   1349 C  CG  . GLU A 1 192 ? 45.232 35.473  -7.827  1.00 73.51  ? 192  GLU A CG  1 
ATOM   1350 C  CD  . GLU A 1 192 ? 44.481 36.692  -7.325  1.00 84.77  ? 192  GLU A CD  1 
ATOM   1351 O  OE1 . GLU A 1 192 ? 43.347 36.930  -7.803  1.00 83.61  ? 192  GLU A OE1 1 
ATOM   1352 O  OE2 . GLU A 1 192 ? 45.018 37.407  -6.449  1.00 83.96  ? 192  GLU A OE2 1 
ATOM   1353 N  N   . TYR A 1 193 ? 42.258 32.692  -5.491  1.00 62.52  ? 193  TYR A N   1 
ATOM   1354 C  CA  . TYR A 1 193 ? 41.258 31.614  -5.575  1.00 58.55  ? 193  TYR A CA  1 
ATOM   1355 C  C   . TYR A 1 193 ? 39.852 32.161  -5.676  1.00 54.33  ? 193  TYR A C   1 
ATOM   1356 O  O   . TYR A 1 193 ? 39.584 33.280  -5.267  1.00 58.53  ? 193  TYR A O   1 
ATOM   1357 C  CB  . TYR A 1 193 ? 41.323 30.636  -4.389  1.00 56.39  ? 193  TYR A CB  1 
ATOM   1358 C  CG  . TYR A 1 193 ? 41.039 31.291  -3.062  1.00 55.11  ? 193  TYR A CG  1 
ATOM   1359 C  CD1 . TYR A 1 193 ? 39.742 31.468  -2.604  1.00 52.36  ? 193  TYR A CD1 1 
ATOM   1360 C  CD2 . TYR A 1 193 ? 42.068 31.746  -2.279  1.00 54.70  ? 193  TYR A CD2 1 
ATOM   1361 C  CE1 . TYR A 1 193 ? 39.483 32.080  -1.388  1.00 50.82  ? 193  TYR A CE1 1 
ATOM   1362 C  CE2 . TYR A 1 193 ? 41.826 32.354  -1.073  1.00 53.68  ? 193  TYR A CE2 1 
ATOM   1363 C  CZ  . TYR A 1 193 ? 40.537 32.520  -0.623  1.00 54.67  ? 193  TYR A CZ  1 
ATOM   1364 O  OH  . TYR A 1 193 ? 40.370 33.125  0.606   1.00 56.77  ? 193  TYR A OH  1 
ATOM   1365 N  N   . ASP A 1 194 ? 38.973 31.339  -6.234  1.00 54.94  ? 194  ASP A N   1 
ATOM   1366 C  CA  . ASP A 1 194 ? 37.528 31.559  -6.262  1.00 56.01  ? 194  ASP A CA  1 
ATOM   1367 C  C   . ASP A 1 194 ? 36.866 31.151  -4.938  1.00 56.37  ? 194  ASP A C   1 
ATOM   1368 O  O   . ASP A 1 194 ? 36.943 30.005  -4.541  1.00 54.96  ? 194  ASP A O   1 
ATOM   1369 C  CB  . ASP A 1 194 ? 36.929 30.717  -7.393  1.00 53.70  ? 194  ASP A CB  1 
ATOM   1370 C  CG  . ASP A 1 194 ? 35.494 31.094  -7.714  1.00 58.77  ? 194  ASP A CG  1 
ATOM   1371 O  OD1 . ASP A 1 194 ? 34.885 31.893  -6.966  1.00 57.35  ? 194  ASP A OD1 1 
ATOM   1372 O  OD2 . ASP A 1 194 ? 34.970 30.578  -8.727  1.00 61.69  ? 194  ASP A OD2 1 
ATOM   1373 N  N   . GLY A 1 195 ? 36.202 32.085  -4.274  1.00 54.21  ? 195  GLY A N   1 
ATOM   1374 C  CA  . GLY A 1 195 ? 35.544 31.818  -3.012  1.00 55.99  ? 195  GLY A CA  1 
ATOM   1375 C  C   . GLY A 1 195 ? 34.340 30.892  -3.093  1.00 56.14  ? 195  GLY A C   1 
ATOM   1376 O  O   . GLY A 1 195 ? 34.025 30.170  -2.145  1.00 53.69  ? 195  GLY A O   1 
ATOM   1377 N  N   . LYS A 1 196 ? 33.667 30.912  -4.234  1.00 54.31  ? 196  LYS A N   1 
ATOM   1378 C  CA  . LYS A 1 196 ? 32.541 30.033  -4.464  1.00 54.54  ? 196  LYS A CA  1 
ATOM   1379 C  C   . LYS A 1 196 ? 32.928 28.539  -4.466  1.00 55.31  ? 196  LYS A C   1 
ATOM   1380 O  O   . LYS A 1 196 ? 32.261 27.703  -3.832  1.00 54.00  ? 196  LYS A O   1 
ATOM   1381 C  CB  . LYS A 1 196 ? 31.819 30.458  -5.742  1.00 55.59  ? 196  LYS A CB  1 
ATOM   1382 C  CG  . LYS A 1 196 ? 31.402 31.919  -5.694  1.00 58.65  ? 196  LYS A CG  1 
ATOM   1383 C  CD  . LYS A 1 196 ? 30.537 32.326  -6.874  1.00 62.58  ? 196  LYS A CD  1 
ATOM   1384 C  CE  . LYS A 1 196 ? 30.146 33.806  -6.816  1.00 68.46  ? 196  LYS A CE  1 
ATOM   1385 N  NZ  . LYS A 1 196 ? 28.934 34.116  -7.639  1.00 69.07  ? 196  LYS A NZ  1 
ATOM   1386 N  N   . VAL A 1 197 ? 34.023 28.218  -5.145  1.00 51.75  ? 197  VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 197 ? 34.538 26.850  -5.198  1.00 50.02  ? 197  VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 197 ? 34.973 26.376  -3.805  1.00 49.87  ? 197  VAL A C   1 
ATOM   1389 O  O   . VAL A 1 197 ? 34.629 25.254  -3.357  1.00 49.30  ? 197  VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 197 ? 35.689 26.767  -6.226  1.00 53.00  ? 197  VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 197 ? 36.390 25.381  -6.226  1.00 47.60  ? 197  VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 197 ? 35.153 27.128  -7.584  1.00 50.40  ? 197  VAL A CG2 1 
ATOM   1393 N  N   . ALA A 1 198 ? 35.694 27.256  -3.115  1.00 49.10  ? 198  ALA A N   1 
ATOM   1394 C  CA  . ALA A 1 198 ? 36.068 27.025  -1.725  1.00 50.34  ? 198  ALA A CA  1 
ATOM   1395 C  C   . ALA A 1 198 ? 34.847 26.655  -0.897  1.00 49.26  ? 198  ALA A C   1 
ATOM   1396 O  O   . ALA A 1 198 ? 34.843 25.668  -0.151  1.00 47.52  ? 198  ALA A O   1 
ATOM   1397 C  CB  . ALA A 1 198 ? 36.727 28.249  -1.144  1.00 48.98  ? 198  ALA A CB  1 
ATOM   1398 N  N   . ASP A 1 199 ? 33.803 27.447  -1.067  1.00 46.26  ? 199  ASP A N   1 
ATOM   1399 C  CA  . ASP A 1 199 ? 32.522 27.151  -0.455  1.00 48.59  ? 199  ASP A CA  1 
ATOM   1400 C  C   . ASP A 1 199 ? 32.016 25.735  -0.749  1.00 49.06  ? 199  ASP A C   1 
ATOM   1401 O  O   . ASP A 1 199 ? 31.550 25.036  0.162   1.00 46.23  ? 199  ASP A O   1 
ATOM   1402 C  CB  . ASP A 1 199 ? 31.479 28.201  -0.850  1.00 50.57  ? 199  ASP A CB  1 
ATOM   1403 C  CG  . ASP A 1 199 ? 31.607 29.474  -0.043  1.00 51.76  ? 199  ASP A CG  1 
ATOM   1404 O  OD1 . ASP A 1 199 ? 32.332 29.473  0.967   1.00 51.70  ? 199  ASP A OD1 1 
ATOM   1405 O  OD2 . ASP A 1 199 ? 30.974 30.472  -0.410  1.00 53.77  ? 199  ASP A OD2 1 
ATOM   1406 N  N   . VAL A 1 200 ? 32.098 25.304  -2.008  1.00 48.09  ? 200  VAL A N   1 
ATOM   1407 C  CA  . VAL A 1 200 ? 31.742 23.920  -2.323  1.00 47.31  ? 200  VAL A CA  1 
ATOM   1408 C  C   . VAL A 1 200 ? 32.493 22.935  -1.392  1.00 46.49  ? 200  VAL A C   1 
ATOM   1409 O  O   . VAL A 1 200 ? 31.888 22.046  -0.765  1.00 44.67  ? 200  VAL A O   1 
ATOM   1410 C  CB  . VAL A 1 200 ? 31.959 23.566  -3.829  1.00 48.09  ? 200  VAL A CB  1 
ATOM   1411 C  CG1 . VAL A 1 200 ? 31.710 22.089  -4.066  1.00 48.13  ? 200  VAL A CG1 1 
ATOM   1412 C  CG2 . VAL A 1 200 ? 31.049 24.378  -4.710  1.00 45.00  ? 200  VAL A CG2 1 
ATOM   1413 N  N   . TRP A 1 201 ? 33.810 23.117  -1.277  1.00 47.01  ? 201  TRP A N   1 
ATOM   1414 C  CA  . TRP A 1 201 ? 34.613 22.264  -0.386  1.00 47.80  ? 201  TRP A CA  1 
ATOM   1415 C  C   . TRP A 1 201 ? 34.025 22.218  1.027   1.00 45.99  ? 201  TRP A C   1 
ATOM   1416 O  O   . TRP A 1 201 ? 33.795 21.160  1.622   1.00 43.23  ? 201  TRP A O   1 
ATOM   1417 C  CB  . TRP A 1 201 ? 36.061 22.743  -0.332  1.00 47.71  ? 201  TRP A CB  1 
ATOM   1418 C  CG  . TRP A 1 201 ? 36.945 21.974  0.612   1.00 48.85  ? 201  TRP A CG  1 
ATOM   1419 C  CD1 . TRP A 1 201 ? 37.109 22.200  1.944   1.00 45.60  ? 201  TRP A CD1 1 
ATOM   1420 C  CD2 . TRP A 1 201 ? 37.809 20.879  0.283   1.00 49.23  ? 201  TRP A CD2 1 
ATOM   1421 N  NE1 . TRP A 1 201 ? 38.001 21.295  2.471   1.00 46.71  ? 201  TRP A NE1 1 
ATOM   1422 C  CE2 . TRP A 1 201 ? 38.455 20.483  1.468   1.00 46.80  ? 201  TRP A CE2 1 
ATOM   1423 C  CE3 . TRP A 1 201 ? 38.088 20.182  -0.902  1.00 48.95  ? 201  TRP A CE3 1 
ATOM   1424 C  CZ2 . TRP A 1 201 ? 39.364 19.433  1.508   1.00 47.73  ? 201  TRP A CZ2 1 
ATOM   1425 C  CZ3 . TRP A 1 201 ? 38.999 19.140  -0.869  1.00 47.80  ? 201  TRP A CZ3 1 
ATOM   1426 C  CH2 . TRP A 1 201 ? 39.617 18.771  0.328   1.00 50.44  ? 201  TRP A CH2 1 
ATOM   1427 N  N   . SER A 1 202 ? 33.820 23.405  1.570   1.00 46.62  ? 202  SER A N   1 
ATOM   1428 C  CA  . SER A 1 202 ? 33.185 23.595  2.868   1.00 45.94  ? 202  SER A CA  1 
ATOM   1429 C  C   . SER A 1 202 ? 31.902 22.745  3.021   1.00 45.85  ? 202  SER A C   1 
ATOM   1430 O  O   . SER A 1 202 ? 31.697 22.044  4.022   1.00 45.86  ? 202  SER A O   1 
ATOM   1431 C  CB  . SER A 1 202 ? 32.893 25.090  3.058   1.00 47.37  ? 202  SER A CB  1 
ATOM   1432 O  OG  . SER A 1 202 ? 32.659 25.417  4.402   1.00 53.94  ? 202  SER A OG  1 
ATOM   1433 N  N   . CYS A 1 203 ? 31.033 22.820  2.024   1.00 43.60  ? 203  CYS A N   1 
ATOM   1434 C  CA  . CYS A 1 203 ? 29.763 22.115  2.070   1.00 42.80  ? 203  CYS A CA  1 
ATOM   1435 C  C   . CYS A 1 203 ? 29.978 20.613  2.107   1.00 46.29  ? 203  CYS A C   1 
ATOM   1436 O  O   . CYS A 1 203 ? 29.231 19.890  2.769   1.00 44.94  ? 203  CYS A O   1 
ATOM   1437 C  CB  . CYS A 1 203 ? 28.914 22.459  0.855   1.00 41.50  ? 203  CYS A CB  1 
ATOM   1438 S  SG  . CYS A 1 203 ? 28.355 24.132  0.792   1.00 51.81  ? 203  CYS A SG  1 
ATOM   1439 N  N   . GLY A 1 204 ? 30.979 20.149  1.358   1.00 44.46  ? 204  GLY A N   1 
ATOM   1440 C  CA  . GLY A 1 204 ? 31.422 18.777  1.459   1.00 43.13  ? 204  GLY A CA  1 
ATOM   1441 C  C   . GLY A 1 204 ? 31.778 18.388  2.882   1.00 43.26  ? 204  GLY A C   1 
ATOM   1442 O  O   . GLY A 1 204 ? 31.335 17.346  3.349   1.00 43.93  ? 204  GLY A O   1 
ATOM   1443 N  N   . VAL A 1 205 ? 32.567 19.217  3.570   1.00 45.95  ? 205  VAL A N   1 
ATOM   1444 C  CA  . VAL A 1 205 ? 32.893 18.976  4.980   1.00 44.75  ? 205  VAL A CA  1 
ATOM   1445 C  C   . VAL A 1 205 ? 31.646 18.755  5.826   1.00 42.90  ? 205  VAL A C   1 
ATOM   1446 O  O   . VAL A 1 205 ? 31.549 17.819  6.640   1.00 40.98  ? 205  VAL A O   1 
ATOM   1447 C  CB  . VAL A 1 205 ? 33.705 20.140  5.595   1.00 45.47  ? 205  VAL A CB  1 
ATOM   1448 C  CG1 . VAL A 1 205 ? 33.895 19.941  7.085   1.00 42.65  ? 205  VAL A CG1 1 
ATOM   1449 C  CG2 . VAL A 1 205 ? 35.049 20.270  4.902   1.00 46.13  ? 205  VAL A CG2 1 
ATOM   1450 N  N   . THR A 1 206 ? 30.680 19.646  5.631   1.00 43.69  ? 206  THR A N   1 
ATOM   1451 C  CA  . THR A 1 206 ? 29.433 19.573  6.385   1.00 45.14  ? 206  THR A CA  1 
ATOM   1452 C  C   . THR A 1 206 ? 28.641 18.286  6.122   1.00 44.81  ? 206  THR A C   1 
ATOM   1453 O  O   . THR A 1 206 ? 28.152 17.624  7.060   1.00 44.00  ? 206  THR A O   1 
ATOM   1454 C  CB  . THR A 1 206 ? 28.613 20.834  6.167   1.00 43.55  ? 206  THR A CB  1 
ATOM   1455 O  OG1 . THR A 1 206 ? 29.365 21.942  6.665   1.00 46.16  ? 206  THR A OG1 1 
ATOM   1456 C  CG2 . THR A 1 206 ? 27.299 20.779  6.917   1.00 40.24  ? 206  THR A CG2 1 
ATOM   1457 N  N   . LEU A 1 207 ? 28.521 17.941  4.848   1.00 40.16  ? 207  LEU A N   1 
ATOM   1458 C  CA  . LEU A 1 207 ? 27.928 16.668  4.457   1.00 44.85  ? 207  LEU A CA  1 
ATOM   1459 C  C   . LEU A 1 207 ? 28.620 15.452  5.151   1.00 46.99  ? 207  LEU A C   1 
ATOM   1460 O  O   . LEU A 1 207 ? 27.981 14.655  5.869   1.00 42.70  ? 207  LEU A O   1 
ATOM   1461 C  CB  . LEU A 1 207 ? 27.960 16.526  2.931   1.00 46.51  ? 207  LEU A CB  1 
ATOM   1462 C  CG  . LEU A 1 207 ? 27.326 15.296  2.273   1.00 45.23  ? 207  LEU A CG  1 
ATOM   1463 C  CD1 . LEU A 1 207 ? 25.943 15.064  2.839   1.00 47.11  ? 207  LEU A CD1 1 
ATOM   1464 C  CD2 . LEU A 1 207 ? 27.311 15.421  0.756   1.00 44.60  ? 207  LEU A CD2 1 
ATOM   1465 N  N   . TYR A 1 208 ? 29.922 15.323  4.931   1.00 42.29  ? 208  TYR A N   1 
ATOM   1466 C  CA  . TYR A 1 208 ? 30.717 14.322  5.613   1.00 43.36  ? 208  TYR A CA  1 
ATOM   1467 C  C   . TYR A 1 208 ? 30.395 14.213  7.094   1.00 44.38  ? 208  TYR A C   1 
ATOM   1468 O  O   . TYR A 1 208 ? 30.036 13.167  7.563   1.00 45.55  ? 208  TYR A O   1 
ATOM   1469 C  CB  . TYR A 1 208 ? 32.224 14.607  5.418   1.00 44.95  ? 208  TYR A CB  1 
ATOM   1470 C  CG  . TYR A 1 208 ? 33.148 13.520  5.960   1.00 46.64  ? 208  TYR A CG  1 
ATOM   1471 C  CD1 . TYR A 1 208 ? 33.450 13.453  7.317   1.00 44.89  ? 208  TYR A CD1 1 
ATOM   1472 C  CD2 . TYR A 1 208 ? 33.710 12.557  5.110   1.00 48.10  ? 208  TYR A CD2 1 
ATOM   1473 C  CE1 . TYR A 1 208 ? 34.268 12.473  7.818   1.00 47.69  ? 208  TYR A CE1 1 
ATOM   1474 C  CE2 . TYR A 1 208 ? 34.556 11.556  5.607   1.00 52.36  ? 208  TYR A CE2 1 
ATOM   1475 C  CZ  . TYR A 1 208 ? 34.825 11.515  6.963   1.00 52.43  ? 208  TYR A CZ  1 
ATOM   1476 O  OH  . TYR A 1 208 ? 35.662 10.545  7.475   1.00 54.31  ? 208  TYR A OH  1 
ATOM   1477 N  N   . VAL A 1 209 ? 30.560 15.299  7.827   1.00 42.06  ? 209  VAL A N   1 
ATOM   1478 C  CA  . VAL A 1 209 ? 30.375 15.300  9.274   1.00 45.24  ? 209  VAL A CA  1 
ATOM   1479 C  C   . VAL A 1 209 ? 28.981 14.876  9.667   1.00 44.47  ? 209  VAL A C   1 
ATOM   1480 O  O   . VAL A 1 209 ? 28.811 14.185  10.641  1.00 45.33  ? 209  VAL A O   1 
ATOM   1481 C  CB  . VAL A 1 209 ? 30.729 16.684  9.912   1.00 47.70  ? 209  VAL A CB  1 
ATOM   1482 C  CG1 . VAL A 1 209 ? 29.732 17.739  9.487   1.00 48.54  ? 209  VAL A CG1 1 
ATOM   1483 C  CG2 . VAL A 1 209 ? 30.747 16.618  11.418  1.00 43.67  ? 209  VAL A CG2 1 
ATOM   1484 N  N   . MET A 1 210 ? 27.980 15.282  8.906   1.00 41.82  ? 210  MET A N   1 
ATOM   1485 C  CA  . MET A 1 210 ? 26.619 14.788  9.109   1.00 42.49  ? 210  MET A CA  1 
ATOM   1486 C  C   . MET A 1 210 ? 26.515 13.259  8.996   1.00 47.77  ? 210  MET A C   1 
ATOM   1487 O  O   . MET A 1 210 ? 25.864 12.609  9.818   1.00 46.93  ? 210  MET A O   1 
ATOM   1488 C  CB  . MET A 1 210 ? 25.668 15.454  8.124   1.00 43.01  ? 210  MET A CB  1 
ATOM   1489 C  CG  . MET A 1 210 ? 25.082 16.854  8.562   1.00 43.18  ? 210  MET A CG  1 
ATOM   1490 S  SD  . MET A 1 210 ? 23.695 17.465  7.527   1.00 47.76  ? 210  MET A SD  1 
ATOM   1491 C  CE  . MET A 1 210 ? 24.531 17.488  5.947   1.00 40.85  ? 210  MET A CE  1 
ATOM   1492 N  N   . LEU A 1 211 ? 27.174 12.705  7.985   1.00 45.66  ? 211  LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 211 ? 27.108 11.286  7.717   1.00 44.65  ? 211  LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 211 ? 27.980 10.392  8.631   1.00 48.31  ? 211  LEU A C   1 
ATOM   1495 O  O   . LEU A 1 211 ? 27.647 9.238   8.892   1.00 47.07  ? 211  LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 211 ? 27.457 11.037  6.255   1.00 44.75  ? 211  LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 211 ? 26.471 11.523  5.216   1.00 46.33  ? 211  LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 211 ? 27.117 11.613  3.859   1.00 44.14  ? 211  LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 211 ? 25.210 10.649  5.181   1.00 47.05  ? 211  LEU A CD2 1 
ATOM   1500 N  N   . VAL A 1 212 ? 29.088 10.938  9.104   1.00 48.41  ? 212  VAL A N   1 
ATOM   1501 C  CA  . VAL A 1 212 ? 30.125 10.178  9.773   1.00 48.01  ? 212  VAL A CA  1 
ATOM   1502 C  C   . VAL A 1 212 ? 30.101 10.509  11.256  1.00 49.08  ? 212  VAL A C   1 
ATOM   1503 O  O   . VAL A 1 212 ? 30.446 9.674   12.097  1.00 49.51  ? 212  VAL A O   1 
ATOM   1504 C  CB  . VAL A 1 212 ? 31.501 10.563  9.179   1.00 46.41  ? 212  VAL A CB  1 
ATOM   1505 C  CG1 . VAL A 1 212 ? 32.653 10.095  10.055  1.00 44.52  ? 212  VAL A CG1 1 
ATOM   1506 C  CG2 . VAL A 1 212 ? 31.620 10.080  7.742   1.00 44.68  ? 212  VAL A CG2 1 
ATOM   1507 N  N   . GLY A 1 213 ? 29.678 11.732  11.572  1.00 45.36  ? 213  GLY A N   1 
ATOM   1508 C  CA  . GLY A 1 213 ? 29.637 12.206  12.941  1.00 45.01  ? 213  GLY A CA  1 
ATOM   1509 C  C   . GLY A 1 213 ? 30.971 12.738  13.397  1.00 44.63  ? 213  GLY A C   1 
ATOM   1510 O  O   . GLY A 1 213 ? 31.156 13.048  14.562  1.00 43.11  ? 213  GLY A O   1 
ATOM   1511 N  N   . ALA A 1 214 ? 31.908 12.830  12.467  1.00 45.64  ? 214  ALA A N   1 
ATOM   1512 C  CA  . ALA A 1 214 ? 33.200 13.430  12.734  1.00 46.45  ? 214  ALA A CA  1 
ATOM   1513 C  C   . ALA A 1 214 ? 33.688 14.156  11.477  1.00 48.86  ? 214  ALA A C   1 
ATOM   1514 O  O   . ALA A 1 214 ? 33.195 13.895  10.365  1.00 46.26  ? 214  ALA A O   1 
ATOM   1515 C  CB  . ALA A 1 214 ? 34.190 12.395  13.172  1.00 42.11  ? 214  ALA A CB  1 
ATOM   1516 N  N   . TYR A 1 215 ? 34.630 15.086  11.679  1.00 48.53  ? 215  TYR A N   1 
ATOM   1517 C  CA  . TYR A 1 215 ? 35.223 15.871  10.597  1.00 48.51  ? 215  TYR A CA  1 
ATOM   1518 C  C   . TYR A 1 215 ? 36.168 15.010  9.782   1.00 50.59  ? 215  TYR A C   1 
ATOM   1519 O  O   . TYR A 1 215 ? 36.806 14.105  10.309  1.00 51.36  ? 215  TYR A O   1 
ATOM   1520 C  CB  . TYR A 1 215 ? 35.974 17.092  11.139  1.00 48.37  ? 215  TYR A CB  1 
ATOM   1521 C  CG  . TYR A 1 215 ? 35.095 18.140  11.770  1.00 49.23  ? 215  TYR A CG  1 
ATOM   1522 C  CD1 . TYR A 1 215 ? 34.047 18.718  11.060  1.00 50.25  ? 215  TYR A CD1 1 
ATOM   1523 C  CD2 . TYR A 1 215 ? 35.327 18.586  13.063  1.00 49.82  ? 215  TYR A CD2 1 
ATOM   1524 C  CE1 . TYR A 1 215 ? 33.227 19.688  11.631  1.00 49.99  ? 215  TYR A CE1 1 
ATOM   1525 C  CE2 . TYR A 1 215 ? 34.503 19.554  13.650  1.00 50.15  ? 215  TYR A CE2 1 
ATOM   1526 C  CZ  . TYR A 1 215 ? 33.458 20.100  12.926  1.00 54.53  ? 215  TYR A CZ  1 
ATOM   1527 O  OH  . TYR A 1 215 ? 32.656 21.072  13.508  1.00 59.50  ? 215  TYR A OH  1 
ATOM   1528 N  N   . PRO A 1 216 ? 36.235 15.263  8.477   1.00 50.82  ? 216  PRO A N   1 
ATOM   1529 C  CA  . PRO A 1 216 ? 37.202 14.523  7.651   1.00 51.87  ? 216  PRO A CA  1 
ATOM   1530 C  C   . PRO A 1 216 ? 38.613 15.082  7.876   1.00 52.27  ? 216  PRO A C   1 
ATOM   1531 O  O   . PRO A 1 216 ? 38.741 16.140  8.492   1.00 54.75  ? 216  PRO A O   1 
ATOM   1532 C  CB  . PRO A 1 216 ? 36.715 14.771  6.219   1.00 48.55  ? 216  PRO A CB  1 
ATOM   1533 C  CG  . PRO A 1 216 ? 35.873 16.045  6.299   1.00 48.60  ? 216  PRO A CG  1 
ATOM   1534 C  CD  . PRO A 1 216 ? 35.384 16.196  7.709   1.00 47.35  ? 216  PRO A CD  1 
ATOM   1535 N  N   . PHE A 1 217 ? 39.655 14.401  7.432   1.00 50.13  ? 217  PHE A N   1 
ATOM   1536 C  CA  . PHE A 1 217 ? 40.992 14.998  7.512   1.00 55.88  ? 217  PHE A CA  1 
ATOM   1537 C  C   . PHE A 1 217 ? 41.502 15.128  8.947   1.00 58.38  ? 217  PHE A C   1 
ATOM   1538 O  O   . PHE A 1 217 ? 42.559 14.622  9.278   1.00 63.36  ? 217  PHE A O   1 
ATOM   1539 C  CB  . PHE A 1 217 ? 41.009 16.363  6.779   1.00 53.21  ? 217  PHE A CB  1 
ATOM   1540 C  CG  . PHE A 1 217 ? 40.373 16.309  5.411   1.00 52.05  ? 217  PHE A CG  1 
ATOM   1541 C  CD1 . PHE A 1 217 ? 40.919 15.492  4.422   1.00 51.65  ? 217  PHE A CD1 1 
ATOM   1542 C  CD2 . PHE A 1 217 ? 39.211 17.022  5.128   1.00 49.98  ? 217  PHE A CD2 1 
ATOM   1543 C  CE1 . PHE A 1 217 ? 40.340 15.408  3.163   1.00 52.47  ? 217  PHE A CE1 1 
ATOM   1544 C  CE2 . PHE A 1 217 ? 38.611 16.939  3.873   1.00 48.26  ? 217  PHE A CE2 1 
ATOM   1545 C  CZ  . PHE A 1 217 ? 39.181 16.127  2.887   1.00 52.45  ? 217  PHE A CZ  1 
ATOM   1546 N  N   . GLU A 1 218 ? 40.745 15.816  9.790   1.00 58.87  ? 218  GLU A N   1 
ATOM   1547 C  CA  . GLU A 1 218 ? 41.076 15.913  11.199  1.00 60.31  ? 218  GLU A CA  1 
ATOM   1548 C  C   . GLU A 1 218 ? 41.175 14.522  11.827  1.00 67.32  ? 218  GLU A C   1 
ATOM   1549 O  O   . GLU A 1 218 ? 40.251 13.723  11.718  1.00 67.96  ? 218  GLU A O   1 
ATOM   1550 C  CB  . GLU A 1 218 ? 40.034 16.759  11.943  1.00 57.54  ? 218  GLU A CB  1 
ATOM   1551 C  CG  . GLU A 1 218 ? 40.443 17.106  13.369  1.00 62.93  ? 218  GLU A CG  1 
ATOM   1552 C  CD  . GLU A 1 218 ? 39.687 18.290  13.941  1.00 67.02  ? 218  GLU A CD  1 
ATOM   1553 O  OE1 . GLU A 1 218 ? 39.905 19.440  13.472  1.00 64.35  ? 218  GLU A OE1 1 
ATOM   1554 O  OE2 . GLU A 1 218 ? 38.889 18.062  14.877  1.00 68.34  ? 218  GLU A OE2 1 
ATOM   1555 N  N   . ASP A 1 219 ? 42.309 14.228  12.459  1.00 72.61  ? 219  ASP A N   1 
ATOM   1556 C  CA  . ASP A 1 219 ? 42.437 13.037  13.286  1.00 71.01  ? 219  ASP A CA  1 
ATOM   1557 C  C   . ASP A 1 219 ? 41.640 13.274  14.570  1.00 74.54  ? 219  ASP A C   1 
ATOM   1558 O  O   . ASP A 1 219 ? 41.889 14.235  15.305  1.00 74.78  ? 219  ASP A O   1 
ATOM   1559 C  CB  . ASP A 1 219 ? 43.907 12.767  13.599  1.00 75.09  ? 219  ASP A CB  1 
ATOM   1560 C  CG  . ASP A 1 219 ? 44.112 11.523  14.443  1.00 78.50  ? 219  ASP A CG  1 
ATOM   1561 O  OD1 . ASP A 1 219 ? 43.181 11.143  15.179  1.00 77.77  ? 219  ASP A OD1 1 
ATOM   1562 O  OD2 . ASP A 1 219 ? 45.207 10.928  14.367  1.00 77.64  ? 219  ASP A OD2 1 
ATOM   1563 N  N   . PRO A 1 220 ? 40.657 12.405  14.841  1.00 78.29  ? 220  PRO A N   1 
ATOM   1564 C  CA  . PRO A 1 220 ? 39.734 12.632  15.964  1.00 75.64  ? 220  PRO A CA  1 
ATOM   1565 C  C   . PRO A 1 220 ? 40.428 12.548  17.317  1.00 79.38  ? 220  PRO A C   1 
ATOM   1566 O  O   . PRO A 1 220 ? 39.967 13.164  18.282  1.00 80.47  ? 220  PRO A O   1 
ATOM   1567 C  CB  . PRO A 1 220 ? 38.730 11.486  15.832  1.00 73.66  ? 220  PRO A CB  1 
ATOM   1568 C  CG  . PRO A 1 220 ? 38.921 10.941  14.459  1.00 75.34  ? 220  PRO A CG  1 
ATOM   1569 C  CD  . PRO A 1 220 ? 40.349 11.163  14.116  1.00 75.67  ? 220  PRO A CD  1 
ATOM   1570 N  N   . GLU A 1 221 ? 41.505 11.766  17.382  1.00 80.68  ? 221  GLU A N   1 
ATOM   1571 C  CA  . GLU A 1 221 ? 42.277 11.591  18.607  1.00 84.86  ? 221  GLU A CA  1 
ATOM   1572 C  C   . GLU A 1 221 ? 43.330 12.698  18.711  1.00 86.37  ? 221  GLU A C   1 
ATOM   1573 O  O   . GLU A 1 221 ? 43.908 12.936  19.775  1.00 86.44  ? 221  GLU A O   1 
ATOM   1574 C  CB  . GLU A 1 221 ? 42.935 10.200  18.638  1.00 88.98  ? 221  GLU A CB  1 
ATOM   1575 C  CG  . GLU A 1 221 ? 41.959 9.003   18.628  1.00 93.79  ? 221  GLU A CG  1 
ATOM   1576 C  CD  . GLU A 1 221 ? 41.502 8.557   20.030  1.00 104.52 ? 221  GLU A CD  1 
ATOM   1577 O  OE1 . GLU A 1 221 ? 42.271 7.839   20.714  1.00 106.44 ? 221  GLU A OE1 1 
ATOM   1578 O  OE2 . GLU A 1 221 ? 40.367 8.907   20.439  1.00 103.46 ? 221  GLU A OE2 1 
ATOM   1579 N  N   . GLU A 1 222 ? 43.567 13.382  17.597  1.00 83.15  ? 222  GLU A N   1 
ATOM   1580 C  CA  . GLU A 1 222 ? 44.469 14.524  17.591  1.00 78.81  ? 222  GLU A CA  1 
ATOM   1581 C  C   . GLU A 1 222 ? 43.855 15.718  16.870  1.00 75.04  ? 222  GLU A C   1 
ATOM   1582 O  O   . GLU A 1 222 ? 44.329 16.136  15.809  1.00 74.45  ? 222  GLU A O   1 
ATOM   1583 C  CB  . GLU A 1 222 ? 45.778 14.151  16.917  1.00 78.88  ? 222  GLU A CB  1 
ATOM   1584 C  CG  . GLU A 1 222 ? 46.533 13.028  17.566  1.00 79.26  ? 222  GLU A CG  1 
ATOM   1585 C  CD  . GLU A 1 222 ? 47.957 12.997  17.086  1.00 80.99  ? 222  GLU A CD  1 
ATOM   1586 O  OE1 . GLU A 1 222 ? 48.734 13.885  17.507  1.00 77.82  ? 222  GLU A OE1 1 
ATOM   1587 O  OE2 . GLU A 1 222 ? 48.288 12.109  16.271  1.00 76.99  ? 222  GLU A OE2 1 
ATOM   1588 N  N   . PRO A 1 223 ? 42.804 16.283  17.453  1.00 75.30  ? 223  PRO A N   1 
ATOM   1589 C  CA  . PRO A 1 223 ? 42.066 17.363  16.807  1.00 74.29  ? 223  PRO A CA  1 
ATOM   1590 C  C   . PRO A 1 223 ? 42.855 18.673  16.805  1.00 70.97  ? 223  PRO A C   1 
ATOM   1591 O  O   . PRO A 1 223 ? 42.641 19.533  15.954  1.00 68.70  ? 223  PRO A O   1 
ATOM   1592 C  CB  . PRO A 1 223 ? 40.818 17.487  17.681  1.00 73.55  ? 223  PRO A CB  1 
ATOM   1593 C  CG  . PRO A 1 223 ? 41.280 17.067  19.037  1.00 76.49  ? 223  PRO A CG  1 
ATOM   1594 C  CD  . PRO A 1 223 ? 42.313 15.999  18.811  1.00 76.10  ? 223  PRO A CD  1 
ATOM   1595 N  N   . LYS A 1 224 ? 43.759 18.826  17.761  1.00 74.71  ? 224  LYS A N   1 
ATOM   1596 C  CA  . LYS A 1 224 ? 44.547 20.044  17.856  1.00 73.30  ? 224  LYS A CA  1 
ATOM   1597 C  C   . LYS A 1 224 ? 45.858 19.895  17.112  1.00 69.97  ? 224  LYS A C   1 
ATOM   1598 O  O   . LYS A 1 224 ? 46.724 20.759  17.210  1.00 67.95  ? 224  LYS A O   1 
ATOM   1599 C  CB  . LYS A 1 224 ? 44.810 20.409  19.316  1.00 80.13  ? 224  LYS A CB  1 
ATOM   1600 C  CG  . LYS A 1 224 ? 43.629 21.068  20.027  1.00 83.49  ? 224  LYS A CG  1 
ATOM   1601 C  CD  . LYS A 1 224 ? 43.946 21.295  21.504  1.00 93.90  ? 224  LYS A CD  1 
ATOM   1602 C  CE  . LYS A 1 224 ? 43.022 22.322  22.143  1.00 94.52  ? 224  LYS A CE  1 
ATOM   1603 N  NZ  . LYS A 1 224 ? 43.535 22.754  23.477  1.00 92.69  ? 224  LYS A NZ  1 
ATOM   1604 N  N   . ASN A 1 225 ? 46.004 18.791  16.382  1.00 67.91  ? 225  ASN A N   1 
ATOM   1605 C  CA  . ASN A 1 225 ? 47.149 18.615  15.515  1.00 65.97  ? 225  ASN A CA  1 
ATOM   1606 C  C   . ASN A 1 225 ? 46.862 19.157  14.122  1.00 62.68  ? 225  ASN A C   1 
ATOM   1607 O  O   . ASN A 1 225 ? 46.613 18.415  13.168  1.00 59.60  ? 225  ASN A O   1 
ATOM   1608 C  CB  . ASN A 1 225 ? 47.577 17.158  15.439  1.00 68.21  ? 225  ASN A CB  1 
ATOM   1609 C  CG  . ASN A 1 225 ? 49.022 17.009  14.999  1.00 68.05  ? 225  ASN A CG  1 
ATOM   1610 O  OD1 . ASN A 1 225 ? 49.647 17.970  14.542  1.00 63.13  ? 225  ASN A OD1 1 
ATOM   1611 N  ND2 . ASN A 1 225 ? 49.558 15.807  15.139  1.00 67.58  ? 225  ASN A ND2 1 
ATOM   1612 N  N   . PHE A 1 226 ? 46.913 20.478  14.037  1.00 61.67  ? 226  PHE A N   1 
ATOM   1613 C  CA  . PHE A 1 226 ? 46.621 21.225  12.830  1.00 60.85  ? 226  PHE A CA  1 
ATOM   1614 C  C   . PHE A 1 226 ? 47.599 20.944  11.694  1.00 58.42  ? 226  PHE A C   1 
ATOM   1615 O  O   . PHE A 1 226 ? 47.236 21.040  10.526  1.00 54.67  ? 226  PHE A O   1 
ATOM   1616 C  CB  . PHE A 1 226 ? 46.640 22.709  13.174  1.00 60.09  ? 226  PHE A CB  1 
ATOM   1617 C  CG  . PHE A 1 226 ? 45.654 23.093  14.229  1.00 60.54  ? 226  PHE A CG  1 
ATOM   1618 C  CD1 . PHE A 1 226 ? 44.385 22.527  14.256  1.00 60.64  ? 226  PHE A CD1 1 
ATOM   1619 C  CD2 . PHE A 1 226 ? 45.993 24.010  15.210  1.00 63.62  ? 226  PHE A CD2 1 
ATOM   1620 C  CE1 . PHE A 1 226 ? 43.457 22.883  15.237  1.00 62.46  ? 226  PHE A CE1 1 
ATOM   1621 C  CE2 . PHE A 1 226 ? 45.077 24.367  16.197  1.00 65.54  ? 226  PHE A CE2 1 
ATOM   1622 C  CZ  . PHE A 1 226 ? 43.805 23.801  16.208  1.00 63.91  ? 226  PHE A CZ  1 
ATOM   1623 N  N   . ARG A 1 227 ? 48.843 20.635  12.043  1.00 59.44  ? 227  ARG A N   1 
ATOM   1624 C  CA  . ARG A 1 227 ? 49.817 20.184  11.050  1.00 59.55  ? 227  ARG A CA  1 
ATOM   1625 C  C   . ARG A 1 227 ? 49.315 18.956  10.284  1.00 59.94  ? 227  ARG A C   1 
ATOM   1626 O  O   . ARG A 1 227 ? 49.120 18.986  9.068   1.00 56.81  ? 227  ARG A O   1 
ATOM   1627 C  CB  . ARG A 1 227 ? 51.155 19.852  11.703  1.00 58.03  ? 227  ARG A CB  1 
ATOM   1628 C  CG  . ARG A 1 227 ? 52.124 19.177  10.747  1.00 58.36  ? 227  ARG A CG  1 
ATOM   1629 C  CD  . ARG A 1 227 ? 53.280 18.571  11.492  1.00 58.14  ? 227  ARG A CD  1 
ATOM   1630 N  NE  . ARG A 1 227 ? 53.036 18.678  12.930  1.00 67.82  ? 227  ARG A NE  1 
ATOM   1631 C  CZ  . ARG A 1 227 ? 52.721 17.656  13.722  1.00 69.90  ? 227  ARG A CZ  1 
ATOM   1632 N  NH1 . ARG A 1 227 ? 52.631 16.422  13.234  1.00 71.02  ? 227  ARG A NH1 1 
ATOM   1633 N  NH2 . ARG A 1 227 ? 52.506 17.868  15.012  1.00 64.68  ? 227  ARG A NH2 1 
ATOM   1634 N  N   . LYS A 1 228 ? 49.122 17.871  11.021  1.00 60.01  ? 228  LYS A N   1 
ATOM   1635 C  CA  . LYS A 1 228 ? 48.639 16.611  10.463  1.00 62.23  ? 228  LYS A CA  1 
ATOM   1636 C  C   . LYS A 1 228 ? 47.327 16.799  9.694   1.00 59.04  ? 228  LYS A C   1 
ATOM   1637 O  O   . LYS A 1 228 ? 47.191 16.368  8.549   1.00 57.91  ? 228  LYS A O   1 
ATOM   1638 C  CB  . LYS A 1 228 ? 48.497 15.590  11.589  1.00 64.97  ? 228  LYS A CB  1 
ATOM   1639 C  CG  . LYS A 1 228 ? 47.803 14.307  11.204  1.00 66.97  ? 228  LYS A CG  1 
ATOM   1640 C  CD  . LYS A 1 228 ? 47.629 13.396  12.423  1.00 72.10  ? 228  LYS A CD  1 
ATOM   1641 C  CE  . LYS A 1 228 ? 47.951 11.953  12.066  1.00 79.53  ? 228  LYS A CE  1 
ATOM   1642 N  NZ  . LYS A 1 228 ? 48.239 11.137  13.268  1.00 81.09  ? 228  LYS A NZ  1 
ATOM   1643 N  N   . THR A 1 229 ? 46.369 17.462  10.336  1.00 58.99  ? 229  THR A N   1 
ATOM   1644 C  CA  . THR A 1 229 ? 45.134 17.859  9.678   1.00 59.02  ? 229  THR A CA  1 
ATOM   1645 C  C   . THR A 1 229 ? 45.393 18.496  8.305   1.00 57.42  ? 229  THR A C   1 
ATOM   1646 O  O   . THR A 1 229 ? 44.950 17.985  7.282   1.00 56.81  ? 229  THR A O   1 
ATOM   1647 C  CB  . THR A 1 229 ? 44.281 18.785  10.593  1.00 57.16  ? 229  THR A CB  1 
ATOM   1648 O  OG1 . THR A 1 229 ? 43.928 18.087  11.793  1.00 59.34  ? 229  THR A OG1 1 
ATOM   1649 C  CG2 . THR A 1 229 ? 42.998 19.228  9.909   1.00 54.81  ? 229  THR A CG2 1 
ATOM   1650 N  N   . ILE A 1 230 ? 46.115 19.608  8.288   1.00 56.42  ? 230  ILE A N   1 
ATOM   1651 C  CA  . ILE A 1 230 ? 46.453 20.304  7.049   1.00 56.42  ? 230  ILE A CA  1 
ATOM   1652 C  C   . ILE A 1 230 ? 47.072 19.401  5.982   1.00 54.98  ? 230  ILE A C   1 
ATOM   1653 O  O   . ILE A 1 230 ? 46.696 19.428  4.814   1.00 52.50  ? 230  ILE A O   1 
ATOM   1654 C  CB  . ILE A 1 230 ? 47.378 21.475  7.352   1.00 57.48  ? 230  ILE A CB  1 
ATOM   1655 C  CG1 . ILE A 1 230 ? 46.560 22.564  8.040   1.00 55.47  ? 230  ILE A CG1 1 
ATOM   1656 C  CG2 . ILE A 1 230 ? 48.016 22.012  6.077   1.00 52.84  ? 230  ILE A CG2 1 
ATOM   1657 C  CD1 . ILE A 1 230 ? 47.354 23.719  8.540   1.00 55.53  ? 230  ILE A CD1 1 
ATOM   1658 N  N   . HIS A 1 231 ? 48.042 18.606  6.404   1.00 55.41  ? 231  HIS A N   1 
ATOM   1659 C  CA  . HIS A 1 231 ? 48.606 17.591  5.556   1.00 56.79  ? 231  HIS A CA  1 
ATOM   1660 C  C   . HIS A 1 231 ? 47.491 16.802  4.870   1.00 55.62  ? 231  HIS A C   1 
ATOM   1661 O  O   . HIS A 1 231 ? 47.420 16.758  3.650   1.00 54.34  ? 231  HIS A O   1 
ATOM   1662 C  CB  . HIS A 1 231 ? 49.511 16.683  6.391   1.00 55.68  ? 231  HIS A CB  1 
ATOM   1663 C  CG  . HIS A 1 231 ? 50.352 15.773  5.569   1.00 62.91  ? 231  HIS A CG  1 
ATOM   1664 N  ND1 . HIS A 1 231 ? 49.876 14.567  5.089   1.00 67.17  ? 231  HIS A ND1 1 
ATOM   1665 C  CD2 . HIS A 1 231 ? 51.603 15.905  5.091   1.00 62.76  ? 231  HIS A CD2 1 
ATOM   1666 C  CE1 . HIS A 1 231 ? 50.812 13.995  4.361   1.00 66.31  ? 231  HIS A CE1 1 
ATOM   1667 N  NE2 . HIS A 1 231 ? 51.874 14.791  4.340   1.00 63.17  ? 231  HIS A NE2 1 
ATOM   1668 N  N   . ARG A 1 232 ? 46.612 16.185  5.655   1.00 55.95  ? 232  ARG A N   1 
ATOM   1669 C  CA  . ARG A 1 232 ? 45.538 15.366  5.090   1.00 56.44  ? 232  ARG A CA  1 
ATOM   1670 C  C   . ARG A 1 232 ? 44.596 16.147  4.166   1.00 54.83  ? 232  ARG A C   1 
ATOM   1671 O  O   . ARG A 1 232 ? 44.084 15.607  3.192   1.00 55.56  ? 232  ARG A O   1 
ATOM   1672 C  CB  . ARG A 1 232 ? 44.768 14.663  6.199   1.00 57.35  ? 232  ARG A CB  1 
ATOM   1673 C  CG  . ARG A 1 232 ? 45.641 13.843  7.096   1.00 61.42  ? 232  ARG A CG  1 
ATOM   1674 C  CD  . ARG A 1 232 ? 44.840 12.893  7.946   1.00 64.75  ? 232  ARG A CD  1 
ATOM   1675 N  NE  . ARG A 1 232 ? 45.691 11.963  8.688   1.00 75.81  ? 232  ARG A NE  1 
ATOM   1676 C  CZ  . ARG A 1 232 ? 45.270 11.192  9.690   1.00 82.55  ? 232  ARG A CZ  1 
ATOM   1677 N  NH1 . ARG A 1 232 ? 44.001 11.238  10.087  1.00 81.28  ? 232  ARG A NH1 1 
ATOM   1678 N  NH2 . ARG A 1 232 ? 46.122 10.374  10.302  1.00 81.85  ? 232  ARG A NH2 1 
ATOM   1679 N  N   . ILE A 1 233 ? 44.384 17.427  4.462   1.00 53.41  ? 233  ILE A N   1 
ATOM   1680 C  CA  . ILE A 1 233 ? 43.614 18.298  3.569   1.00 54.31  ? 233  ILE A CA  1 
ATOM   1681 C  C   . ILE A 1 233 ? 44.278 18.473  2.200   1.00 55.43  ? 233  ILE A C   1 
ATOM   1682 O  O   . ILE A 1 233 ? 43.641 18.341  1.155   1.00 51.88  ? 233  ILE A O   1 
ATOM   1683 C  CB  . ILE A 1 233 ? 43.393 19.693  4.176   1.00 52.88  ? 233  ILE A CB  1 
ATOM   1684 C  CG1 . ILE A 1 233 ? 42.432 19.597  5.350   1.00 51.71  ? 233  ILE A CG1 1 
ATOM   1685 C  CG2 . ILE A 1 233 ? 42.851 20.661  3.113   1.00 50.52  ? 233  ILE A CG2 1 
ATOM   1686 C  CD1 . ILE A 1 233 ? 42.225 20.847  6.089   1.00 46.14  ? 233  ILE A CD1 1 
ATOM   1687 N  N   . LEU A 1 234 ? 45.565 18.785  2.220   1.00 56.37  ? 234  LEU A N   1 
ATOM   1688 C  CA  . LEU A 1 234 ? 46.325 19.005  1.003   1.00 55.76  ? 234  LEU A CA  1 
ATOM   1689 C  C   . LEU A 1 234 ? 46.403 17.762  0.116   1.00 55.18  ? 234  LEU A C   1 
ATOM   1690 O  O   . LEU A 1 234 ? 46.415 17.858  -1.101  1.00 54.22  ? 234  LEU A O   1 
ATOM   1691 C  CB  . LEU A 1 234 ? 47.717 19.501  1.356   1.00 56.88  ? 234  LEU A CB  1 
ATOM   1692 C  CG  . LEU A 1 234 ? 47.757 20.884  2.013   1.00 53.45  ? 234  LEU A CG  1 
ATOM   1693 C  CD1 . LEU A 1 234 ? 49.170 21.200  2.459   1.00 52.30  ? 234  LEU A CD1 1 
ATOM   1694 C  CD2 . LEU A 1 234 ? 47.216 22.000  1.103   1.00 51.64  ? 234  LEU A CD2 1 
ATOM   1695 N  N   . ASN A 1 235 ? 46.422 16.596  0.744   1.00 56.42  ? 235  ASN A N   1 
ATOM   1696 C  CA  . ASN A 1 235 ? 46.513 15.328  0.038   1.00 55.70  ? 235  ASN A CA  1 
ATOM   1697 C  C   . ASN A 1 235 ? 45.183 14.623  -0.020  1.00 57.92  ? 235  ASN A C   1 
ATOM   1698 O  O   . ASN A 1 235 ? 45.103 13.453  -0.404  1.00 60.64  ? 235  ASN A O   1 
ATOM   1699 C  CB  . ASN A 1 235 ? 47.573 14.443  0.700   1.00 58.72  ? 235  ASN A CB  1 
ATOM   1700 C  CG  . ASN A 1 235 ? 48.972 15.008  0.531   1.00 62.28  ? 235  ASN A CG  1 
ATOM   1701 O  OD1 . ASN A 1 235 ? 49.597 15.465  1.486   1.00 61.09  ? 235  ASN A OD1 1 
ATOM   1702 N  ND2 . ASN A 1 235 ? 49.452 15.017  -0.706  1.00 63.27  ? 235  ASN A ND2 1 
ATOM   1703 N  N   . VAL A 1 236 ? 44.146 15.359  0.374   1.00 56.51  ? 236  VAL A N   1 
ATOM   1704 C  CA  . VAL A 1 236 ? 42.765 14.902  0.303   1.00 54.30  ? 236  VAL A CA  1 
ATOM   1705 C  C   . VAL A 1 236 ? 42.602 13.496  0.900   1.00 55.42  ? 236  VAL A C   1 
ATOM   1706 O  O   . VAL A 1 236 ? 41.894 12.661  0.357   1.00 58.62  ? 236  VAL A O   1 
ATOM   1707 C  CB  . VAL A 1 236 ? 42.248 14.977  -1.130  1.00 51.48  ? 236  VAL A CB  1 
ATOM   1708 C  CG1 . VAL A 1 236 ? 40.760 14.712  -1.163  1.00 51.71  ? 236  VAL A CG1 1 
ATOM   1709 C  CG2 . VAL A 1 236 ? 42.546 16.339  -1.705  1.00 49.68  ? 236  VAL A CG2 1 
ATOM   1710 N  N   . GLN A 1 237 ? 43.269 13.250  2.025   1.00 54.42  ? 237  GLN A N   1 
ATOM   1711 C  CA  . GLN A 1 237 ? 43.224 11.953  2.666   1.00 56.52  ? 237  GLN A CA  1 
ATOM   1712 C  C   . GLN A 1 237 ? 42.020 11.872  3.598   1.00 54.03  ? 237  GLN A C   1 
ATOM   1713 O  O   . GLN A 1 237 ? 42.049 12.376  4.713   1.00 53.76  ? 237  GLN A O   1 
ATOM   1714 C  CB  . GLN A 1 237 ? 44.521 11.667  3.427   1.00 56.01  ? 237  GLN A CB  1 
ATOM   1715 C  CG  . GLN A 1 237 ? 45.773 11.675  2.566   1.00 61.64  ? 237  GLN A CG  1 
ATOM   1716 C  CD  . GLN A 1 237 ? 47.062 11.528  3.392   1.00 74.36  ? 237  GLN A CD  1 
ATOM   1717 O  OE1 . GLN A 1 237 ? 47.030 11.468  4.628   1.00 76.42  ? 237  GLN A OE1 1 
ATOM   1718 N  NE2 . GLN A 1 237 ? 48.202 11.464  2.704   1.00 73.64  ? 237  GLN A NE2 1 
ATOM   1719 N  N   . TYR A 1 238 ? 40.954 11.240  3.126   1.00 55.30  ? 238  TYR A N   1 
ATOM   1720 C  CA  . TYR A 1 238 ? 39.812 10.953  3.974   1.00 56.83  ? 238  TYR A CA  1 
ATOM   1721 C  C   . TYR A 1 238 ? 39.396 9.501   3.769   1.00 58.44  ? 238  TYR A C   1 
ATOM   1722 O  O   . TYR A 1 238 ? 39.753 8.872   2.768   1.00 58.21  ? 238  TYR A O   1 
ATOM   1723 C  CB  . TYR A 1 238 ? 38.650 11.910  3.688   1.00 52.20  ? 238  TYR A CB  1 
ATOM   1724 C  CG  . TYR A 1 238 ? 37.939 11.659  2.383   1.00 53.84  ? 238  TYR A CG  1 
ATOM   1725 C  CD1 . TYR A 1 238 ? 38.479 12.093  1.186   1.00 52.51  ? 238  TYR A CD1 1 
ATOM   1726 C  CD2 . TYR A 1 238 ? 36.722 10.972  2.346   1.00 53.28  ? 238  TYR A CD2 1 
ATOM   1727 C  CE1 . TYR A 1 238 ? 37.830 11.862  -0.009  1.00 50.84  ? 238  TYR A CE1 1 
ATOM   1728 C  CE2 . TYR A 1 238 ? 36.065 10.737  1.150   1.00 48.63  ? 238  TYR A CE2 1 
ATOM   1729 C  CZ  . TYR A 1 238 ? 36.627 11.186  -0.021  1.00 48.47  ? 238  TYR A CZ  1 
ATOM   1730 O  OH  . TYR A 1 238 ? 36.001 10.961  -1.209  1.00 48.32  ? 238  TYR A OH  1 
ATOM   1731 N  N   . ALA A 1 239 ? 38.625 8.985   4.720   1.00 62.10  ? 239  ALA A N   1 
ATOM   1732 C  CA  . ALA A 1 239 ? 38.243 7.583   4.727   1.00 63.13  ? 239  ALA A CA  1 
ATOM   1733 C  C   . ALA A 1 239 ? 36.913 7.369   5.447   1.00 64.00  ? 239  ALA A C   1 
ATOM   1734 O  O   . ALA A 1 239 ? 36.869 7.328   6.681   1.00 64.59  ? 239  ALA A O   1 
ATOM   1735 C  CB  . ALA A 1 239 ? 39.333 6.762   5.403   1.00 62.10  ? 239  ALA A CB  1 
ATOM   1736 N  N   . ILE A 1 240 ? 35.838 7.220   4.677   1.00 61.20  ? 240  ILE A N   1 
ATOM   1737 C  CA  . ILE A 1 240 ? 34.551 6.834   5.241   1.00 64.21  ? 240  ILE A CA  1 
ATOM   1738 C  C   . ILE A 1 240 ? 34.611 5.513   6.013   1.00 68.02  ? 240  ILE A C   1 
ATOM   1739 O  O   . ILE A 1 240 ? 34.855 4.456   5.422   1.00 70.14  ? 240  ILE A O   1 
ATOM   1740 C  CB  . ILE A 1 240 ? 33.502 6.692   4.149   1.00 64.65  ? 240  ILE A CB  1 
ATOM   1741 C  CG1 . ILE A 1 240 ? 33.431 7.970   3.317   1.00 62.01  ? 240  ILE A CG1 1 
ATOM   1742 C  CG2 . ILE A 1 240 ? 32.136 6.322   4.762   1.00 62.97  ? 240  ILE A CG2 1 
ATOM   1743 C  CD1 . ILE A 1 240 ? 32.501 7.851   2.135   1.00 66.14  ? 240  ILE A CD1 1 
ATOM   1744 N  N   . PRO A 1 241 ? 34.370 5.571   7.337   1.00 69.04  ? 241  PRO A N   1 
ATOM   1745 C  CA  . PRO A 1 241 ? 34.403 4.407   8.231   1.00 68.09  ? 241  PRO A CA  1 
ATOM   1746 C  C   . PRO A 1 241 ? 33.617 3.212   7.694   1.00 69.14  ? 241  PRO A C   1 
ATOM   1747 O  O   . PRO A 1 241 ? 32.579 3.353   7.036   1.00 65.73  ? 241  PRO A O   1 
ATOM   1748 C  CB  . PRO A 1 241 ? 33.770 4.940   9.520   1.00 66.52  ? 241  PRO A CB  1 
ATOM   1749 C  CG  . PRO A 1 241 ? 34.131 6.367   9.533   1.00 65.13  ? 241  PRO A CG  1 
ATOM   1750 C  CD  . PRO A 1 241 ? 34.079 6.811   8.076   1.00 64.04  ? 241  PRO A CD  1 
ATOM   1751 N  N   . ASP A 1 242 ? 34.146 2.029   7.980   1.00 71.22  ? 242  ASP A N   1 
ATOM   1752 C  CA  . ASP A 1 242 ? 33.569 0.781   7.513   1.00 72.26  ? 242  ASP A CA  1 
ATOM   1753 C  C   . ASP A 1 242 ? 32.127 0.616   7.987   1.00 71.64  ? 242  ASP A C   1 
ATOM   1754 O  O   . ASP A 1 242 ? 31.284 0.071   7.268   1.00 69.68  ? 242  ASP A O   1 
ATOM   1755 C  CB  . ASP A 1 242 ? 34.428 -0.398  7.979   1.00 76.79  ? 242  ASP A CB  1 
ATOM   1756 C  CG  . ASP A 1 242 ? 35.741 -0.489  7.235   1.00 82.95  ? 242  ASP A CG  1 
ATOM   1757 O  OD1 . ASP A 1 242 ? 35.793 -0.016  6.077   1.00 82.20  ? 242  ASP A OD1 1 
ATOM   1758 O  OD2 . ASP A 1 242 ? 36.712 -1.030  7.807   1.00 83.16  ? 242  ASP A OD2 1 
ATOM   1759 N  N   . TYR A 1 243 ? 31.839 1.098   9.191   1.00 68.44  ? 243  TYR A N   1 
ATOM   1760 C  CA  . TYR A 1 243 ? 30.504 0.928   9.754   1.00 68.29  ? 243  TYR A CA  1 
ATOM   1761 C  C   . TYR A 1 243 ? 29.516 1.985   9.289   1.00 67.63  ? 243  TYR A C   1 
ATOM   1762 O  O   . TYR A 1 243 ? 28.318 1.917   9.590   1.00 68.89  ? 243  TYR A O   1 
ATOM   1763 C  CB  . TYR A 1 243 ? 30.555 0.905   11.270  1.00 67.45  ? 243  TYR A CB  1 
ATOM   1764 C  CG  . TYR A 1 243 ? 31.022 2.185   11.883  1.00 68.16  ? 243  TYR A CG  1 
ATOM   1765 C  CD1 . TYR A 1 243 ? 30.130 3.212   12.167  1.00 65.77  ? 243  TYR A CD1 1 
ATOM   1766 C  CD2 . TYR A 1 243 ? 32.359 2.365   12.196  1.00 68.02  ? 243  TYR A CD2 1 
ATOM   1767 C  CE1 . TYR A 1 243 ? 30.562 4.385   12.740  1.00 65.21  ? 243  TYR A CE1 1 
ATOM   1768 C  CE2 . TYR A 1 243 ? 32.807 3.535   12.769  1.00 69.17  ? 243  TYR A CE2 1 
ATOM   1769 C  CZ  . TYR A 1 243 ? 31.904 4.541   13.041  1.00 70.32  ? 243  TYR A CZ  1 
ATOM   1770 O  OH  . TYR A 1 243 ? 32.347 5.712   13.615  1.00 75.54  ? 243  TYR A OH  1 
ATOM   1771 N  N   . VAL A 1 244 ? 30.024 2.965   8.557   1.00 65.29  ? 244  VAL A N   1 
ATOM   1772 C  CA  . VAL A 1 244 ? 29.163 3.927   7.897   1.00 65.72  ? 244  VAL A CA  1 
ATOM   1773 C  C   . VAL A 1 244 ? 28.860 3.446   6.480   1.00 62.02  ? 244  VAL A C   1 
ATOM   1774 O  O   . VAL A 1 244 ? 29.770 3.205   5.676   1.00 62.09  ? 244  VAL A O   1 
ATOM   1775 C  CB  . VAL A 1 244 ? 29.806 5.325   7.850   1.00 65.08  ? 244  VAL A CB  1 
ATOM   1776 C  CG1 . VAL A 1 244 ? 28.834 6.316   7.246   1.00 58.95  ? 244  VAL A CG1 1 
ATOM   1777 C  CG2 . VAL A 1 244 ? 30.230 5.763   9.234   1.00 60.02  ? 244  VAL A CG2 1 
ATOM   1778 N  N   . HIS A 1 245 ? 27.579 3.295   6.179   1.00 58.34  ? 245  HIS A N   1 
ATOM   1779 C  CA  . HIS A 1 245 ? 27.202 2.781   4.876   1.00 62.00  ? 245  HIS A CA  1 
ATOM   1780 C  C   . HIS A 1 245 ? 26.338 3.764   4.116   1.00 64.05  ? 245  HIS A C   1 
ATOM   1781 O  O   . HIS A 1 245 ? 25.239 4.114   4.550   1.00 64.50  ? 245  HIS A O   1 
ATOM   1782 C  CB  . HIS A 1 245 ? 26.527 1.415   5.013   1.00 63.02  ? 245  HIS A CB  1 
ATOM   1783 C  CG  . HIS A 1 245 ? 27.310 0.463   5.856   1.00 69.21  ? 245  HIS A CG  1 
ATOM   1784 N  ND1 . HIS A 1 245 ? 26.837 -0.051  7.046   1.00 69.93  ? 245  HIS A ND1 1 
ATOM   1785 C  CD2 . HIS A 1 245 ? 28.570 -0.013  5.716   1.00 67.38  ? 245  HIS A CD2 1 
ATOM   1786 C  CE1 . HIS A 1 245 ? 27.761 -0.821  7.585   1.00 68.25  ? 245  HIS A CE1 1 
ATOM   1787 N  NE2 . HIS A 1 245 ? 28.823 -0.809  6.805   1.00 68.69  ? 245  HIS A NE2 1 
ATOM   1788 N  N   . ILE A 1 246 ? 26.854 4.225   2.983   1.00 61.76  ? 246  ILE A N   1 
ATOM   1789 C  CA  . ILE A 1 246 ? 26.135 5.203   2.188   1.00 63.01  ? 246  ILE A CA  1 
ATOM   1790 C  C   . ILE A 1 246 ? 25.987 4.737   0.751   1.00 61.83  ? 246  ILE A C   1 
ATOM   1791 O  O   . ILE A 1 246 ? 26.831 4.013   0.232   1.00 59.56  ? 246  ILE A O   1 
ATOM   1792 C  CB  . ILE A 1 246 ? 26.852 6.568   2.196   1.00 63.54  ? 246  ILE A CB  1 
ATOM   1793 C  CG1 . ILE A 1 246 ? 28.307 6.406   1.748   1.00 62.82  ? 246  ILE A CG1 1 
ATOM   1794 C  CG2 . ILE A 1 246 ? 26.794 7.205   3.574   1.00 60.52  ? 246  ILE A CG2 1 
ATOM   1795 C  CD1 . ILE A 1 246 ? 28.929 7.678   1.259   1.00 61.11  ? 246  ILE A CD1 1 
ATOM   1796 N  N   . SER A 1 247 ? 24.910 5.170   0.112   1.00 60.24  ? 247  SER A N   1 
ATOM   1797 C  CA  . SER A 1 247 ? 24.687 4.870   -1.287  1.00 60.17  ? 247  SER A CA  1 
ATOM   1798 C  C   . SER A 1 247 ? 25.929 5.202   -2.103  1.00 62.28  ? 247  SER A C   1 
ATOM   1799 O  O   . SER A 1 247 ? 26.733 6.039   -1.705  1.00 62.28  ? 247  SER A O   1 
ATOM   1800 C  CB  . SER A 1 247 ? 23.495 5.670   -1.807  1.00 59.60  ? 247  SER A CB  1 
ATOM   1801 O  OG  . SER A 1 247 ? 23.809 7.037   -1.966  1.00 62.30  ? 247  SER A OG  1 
ATOM   1802 N  N   . PRO A 1 248 ? 26.092 4.540   -3.251  1.00 65.21  ? 248  PRO A N   1 
ATOM   1803 C  CA  . PRO A 1 248 ? 27.196 4.816   -4.171  1.00 65.32  ? 248  PRO A CA  1 
ATOM   1804 C  C   . PRO A 1 248 ? 27.115 6.229   -4.766  1.00 60.56  ? 248  PRO A C   1 
ATOM   1805 O  O   . PRO A 1 248 ? 28.155 6.825   -5.025  1.00 59.51  ? 248  PRO A O   1 
ATOM   1806 C  CB  . PRO A 1 248 ? 27.005 3.753   -5.266  1.00 66.70  ? 248  PRO A CB  1 
ATOM   1807 C  CG  . PRO A 1 248 ? 26.194 2.699   -4.637  1.00 65.81  ? 248  PRO A CG  1 
ATOM   1808 C  CD  . PRO A 1 248 ? 25.279 3.402   -3.699  1.00 67.74  ? 248  PRO A CD  1 
ATOM   1809 N  N   . GLU A 1 249 ? 25.896 6.723   -4.986  1.00 61.34  ? 249  GLU A N   1 
ATOM   1810 C  CA  . GLU A 1 249 ? 25.626 8.097   -5.432  1.00 63.14  ? 249  GLU A CA  1 
ATOM   1811 C  C   . GLU A 1 249 ? 26.220 9.140   -4.483  1.00 60.85  ? 249  GLU A C   1 
ATOM   1812 O  O   . GLU A 1 249 ? 26.918 10.076  -4.896  1.00 59.21  ? 249  GLU A O   1 
ATOM   1813 C  CB  . GLU A 1 249 ? 24.115 8.327   -5.513  1.00 62.61  ? 249  GLU A CB  1 
ATOM   1814 C  CG  . GLU A 1 249 ? 23.378 7.455   -6.510  1.00 70.82  ? 249  GLU A CG  1 
ATOM   1815 C  CD  . GLU A 1 249 ? 23.182 6.016   -6.046  1.00 74.85  ? 249  GLU A CD  1 
ATOM   1816 O  OE1 . GLU A 1 249 ? 23.583 5.673   -4.918  1.00 69.37  ? 249  GLU A OE1 1 
ATOM   1817 O  OE2 . GLU A 1 249 ? 22.615 5.221   -6.824  1.00 76.27  ? 249  GLU A OE2 1 
ATOM   1818 N  N   . CYS A 1 250 ? 25.904 8.962   -3.207  1.00 58.03  ? 250  CYS A N   1 
ATOM   1819 C  CA  . CYS A 1 250 ? 26.414 9.770   -2.120  1.00 57.39  ? 250  CYS A CA  1 
ATOM   1820 C  C   . CYS A 1 250 ? 27.935 9.762   -2.089  1.00 56.48  ? 250  CYS A C   1 
ATOM   1821 O  O   . CYS A 1 250 ? 28.576 10.817  -2.083  1.00 54.44  ? 250  CYS A O   1 
ATOM   1822 C  CB  . CYS A 1 250 ? 25.849 9.225   -0.809  1.00 59.10  ? 250  CYS A CB  1 
ATOM   1823 S  SG  . CYS A 1 250 ? 26.096 10.254  0.647   1.00 57.92  ? 250  CYS A SG  1 
ATOM   1824 N  N   . ARG A 1 251 ? 28.508 8.567   -2.075  1.00 55.83  ? 251  ARG A N   1 
ATOM   1825 C  CA  . ARG A 1 251 ? 29.953 8.409   -2.065  1.00 55.83  ? 251  ARG A CA  1 
ATOM   1826 C  C   . ARG A 1 251 ? 30.636 9.113   -3.259  1.00 55.97  ? 251  ARG A C   1 
ATOM   1827 O  O   . ARG A 1 251 ? 31.701 9.739   -3.122  1.00 51.31  ? 251  ARG A O   1 
ATOM   1828 C  CB  . ARG A 1 251 ? 30.302 6.929   -2.038  1.00 56.94  ? 251  ARG A CB  1 
ATOM   1829 C  CG  . ARG A 1 251 ? 31.786 6.638   -1.788  1.00 60.87  ? 251  ARG A CG  1 
ATOM   1830 C  CD  . ARG A 1 251 ? 32.046 5.132   -1.668  1.00 64.64  ? 251  ARG A CD  1 
ATOM   1831 N  NE  . ARG A 1 251 ? 31.327 4.519   -0.548  1.00 66.30  ? 251  ARG A NE  1 
ATOM   1832 C  CZ  . ARG A 1 251 ? 31.887 4.207   0.614   1.00 68.86  ? 251  ARG A CZ  1 
ATOM   1833 N  NH1 . ARG A 1 251 ? 33.176 4.430   0.821   1.00 63.37  ? 251  ARG A NH1 1 
ATOM   1834 N  NH2 . ARG A 1 251 ? 31.155 3.668   1.573   1.00 70.16  ? 251  ARG A NH2 1 
ATOM   1835 N  N   . HIS A 1 252 ? 30.010 8.981   -4.428  1.00 55.92  ? 252  HIS A N   1 
ATOM   1836 C  CA  . HIS A 1 252 ? 30.432 9.678   -5.635  1.00 55.01  ? 252  HIS A CA  1 
ATOM   1837 C  C   . HIS A 1 252 ? 30.452 11.195  -5.439  1.00 55.36  ? 252  HIS A C   1 
ATOM   1838 O  O   . HIS A 1 252 ? 31.481 11.834  -5.651  1.00 52.09  ? 252  HIS A O   1 
ATOM   1839 C  CB  . HIS A 1 252 ? 29.520 9.324   -6.812  1.00 54.85  ? 252  HIS A CB  1 
ATOM   1840 C  CG  . HIS A 1 252 ? 29.779 10.141  -8.042  1.00 56.62  ? 252  HIS A CG  1 
ATOM   1841 N  ND1 . HIS A 1 252 ? 28.954 11.172  -8.442  1.00 56.49  ? 252  HIS A ND1 1 
ATOM   1842 C  CD2 . HIS A 1 252 ? 30.785 10.097  -8.946  1.00 53.84  ? 252  HIS A CD2 1 
ATOM   1843 C  CE1 . HIS A 1 252 ? 29.435 11.712  -9.547  1.00 55.75  ? 252  HIS A CE1 1 
ATOM   1844 N  NE2 . HIS A 1 252 ? 30.545 11.077  -9.877  1.00 55.30  ? 252  HIS A NE2 1 
ATOM   1845 N  N   . LEU A 1 253 ? 29.306 11.760  -5.056  1.00 54.79  ? 253  LEU A N   1 
ATOM   1846 C  CA  . LEU A 1 253 ? 29.211 13.187  -4.770  1.00 55.89  ? 253  LEU A CA  1 
ATOM   1847 C  C   . LEU A 1 253 ? 30.353 13.664  -3.864  1.00 54.09  ? 253  LEU A C   1 
ATOM   1848 O  O   . LEU A 1 253 ? 31.097 14.580  -4.196  1.00 50.40  ? 253  LEU A O   1 
ATOM   1849 C  CB  . LEU A 1 253 ? 27.856 13.499  -4.140  1.00 52.47  ? 253  LEU A CB  1 
ATOM   1850 C  CG  . LEU A 1 253 ? 27.576 14.966  -3.834  1.00 52.33  ? 253  LEU A CG  1 
ATOM   1851 C  CD1 . LEU A 1 253 ? 27.738 15.806  -5.088  1.00 53.95  ? 253  LEU A CD1 1 
ATOM   1852 C  CD2 . LEU A 1 253 ? 26.187 15.125  -3.266  1.00 54.07  ? 253  LEU A CD2 1 
ATOM   1853 N  N   . ILE A 1 254 ? 30.506 13.020  -2.726  1.00 52.44  ? 254  ILE A N   1 
ATOM   1854 C  CA  . ILE A 1 254 ? 31.614 13.330  -1.858  1.00 49.35  ? 254  ILE A CA  1 
ATOM   1855 C  C   . ILE A 1 254 ? 32.966 13.279  -2.574  1.00 51.37  ? 254  ILE A C   1 
ATOM   1856 O  O   . ILE A 1 254 ? 33.791 14.167  -2.373  1.00 52.10  ? 254  ILE A O   1 
ATOM   1857 C  CB  . ILE A 1 254 ? 31.602 12.417  -0.628  1.00 51.70  ? 254  ILE A CB  1 
ATOM   1858 C  CG1 . ILE A 1 254 ? 30.304 12.634  0.143   1.00 50.96  ? 254  ILE A CG1 1 
ATOM   1859 C  CG2 . ILE A 1 254 ? 32.814 12.670  0.257   1.00 44.83  ? 254  ILE A CG2 1 
ATOM   1860 C  CD1 . ILE A 1 254 ? 29.998 11.580  1.139   1.00 46.94  ? 254  ILE A CD1 1 
ATOM   1861 N  N   . SER A 1 255 ? 33.206 12.256  -3.397  1.00 52.48  ? 255  SER A N   1 
ATOM   1862 C  CA  . SER A 1 255 ? 34.485 12.142  -4.133  1.00 53.88  ? 255  SER A CA  1 
ATOM   1863 C  C   . SER A 1 255 ? 34.687 13.299  -5.116  1.00 52.54  ? 255  SER A C   1 
ATOM   1864 O  O   . SER A 1 255 ? 35.819 13.684  -5.444  1.00 51.48  ? 255  SER A O   1 
ATOM   1865 C  CB  . SER A 1 255 ? 34.559 10.831  -4.911  1.00 52.07  ? 255  SER A CB  1 
ATOM   1866 O  OG  . SER A 1 255 ? 33.701 10.883  -6.045  1.00 53.73  ? 255  SER A OG  1 
ATOM   1867 N  N   . ARG A 1 256 ? 33.562 13.839  -5.577  1.00 51.90  ? 256  ARG A N   1 
ATOM   1868 C  CA  . ARG A 1 256 ? 33.522 14.929  -6.540  1.00 52.90  ? 256  ARG A CA  1 
ATOM   1869 C  C   . ARG A 1 256 ? 33.706 16.294  -5.882  1.00 53.40  ? 256  ARG A C   1 
ATOM   1870 O  O   . ARG A 1 256 ? 34.119 17.253  -6.538  1.00 52.71  ? 256  ARG A O   1 
ATOM   1871 C  CB  . ARG A 1 256 ? 32.214 14.900  -7.333  1.00 54.57  ? 256  ARG A CB  1 
ATOM   1872 C  CG  . ARG A 1 256 ? 32.215 13.941  -8.520  1.00 57.51  ? 256  ARG A CG  1 
ATOM   1873 C  CD  . ARG A 1 256 ? 33.186 14.355  -9.614  1.00 57.63  ? 256  ARG A CD  1 
ATOM   1874 N  NE  . ARG A 1 256 ? 32.724 15.495  -10.416 1.00 61.84  ? 256  ARG A NE  1 
ATOM   1875 C  CZ  . ARG A 1 256 ? 33.450 16.592  -10.643 1.00 62.85  ? 256  ARG A CZ  1 
ATOM   1876 N  NH1 . ARG A 1 256 ? 34.672 16.705  -10.124 1.00 59.40  ? 256  ARG A NH1 1 
ATOM   1877 N  NH2 . ARG A 1 256 ? 32.965 17.577  -11.392 1.00 57.91  ? 256  ARG A NH2 1 
ATOM   1878 N  N   . ILE A 1 257 ? 33.396 16.385  -4.592  1.00 51.82  ? 257  ILE A N   1 
ATOM   1879 C  CA  . ILE A 1 257 ? 33.635 17.621  -3.875  1.00 49.55  ? 257  ILE A CA  1 
ATOM   1880 C  C   . ILE A 1 257 ? 35.057 17.653  -3.343  1.00 48.52  ? 257  ILE A C   1 
ATOM   1881 O  O   . ILE A 1 257 ? 35.752 18.653  -3.486  1.00 47.03  ? 257  ILE A O   1 
ATOM   1882 C  CB  . ILE A 1 257 ? 32.648 17.840  -2.714  1.00 48.97  ? 257  ILE A CB  1 
ATOM   1883 C  CG1 . ILE A 1 257 ? 31.209 17.938  -3.237  1.00 48.21  ? 257  ILE A CG1 1 
ATOM   1884 C  CG2 . ILE A 1 257 ? 33.052 19.072  -1.903  1.00 44.27  ? 257  ILE A CG2 1 
ATOM   1885 C  CD1 . ILE A 1 257 ? 30.134 18.018  -2.148  1.00 43.62  ? 257  ILE A CD1 1 
ATOM   1886 N  N   . PHE A 1 258 ? 35.486 16.558  -2.728  1.00 49.45  ? 258  PHE A N   1 
ATOM   1887 C  CA  . PHE A 1 258 ? 36.816 16.512  -2.145  1.00 51.83  ? 258  PHE A CA  1 
ATOM   1888 C  C   . PHE A 1 258 ? 37.885 16.350  -3.218  1.00 51.26  ? 258  PHE A C   1 
ATOM   1889 O  O   . PHE A 1 258 ? 38.625 15.381  -3.218  1.00 50.90  ? 258  PHE A O   1 
ATOM   1890 C  CB  . PHE A 1 258 ? 36.932 15.415  -1.078  1.00 48.90  ? 258  PHE A CB  1 
ATOM   1891 C  CG  . PHE A 1 258 ? 36.188 15.725  0.193   1.00 50.93  ? 258  PHE A CG  1 
ATOM   1892 C  CD1 . PHE A 1 258 ? 35.790 17.031  0.480   1.00 50.04  ? 258  PHE A CD1 1 
ATOM   1893 C  CD2 . PHE A 1 258 ? 35.869 14.714  1.107   1.00 48.80  ? 258  PHE A CD2 1 
ATOM   1894 C  CE1 . PHE A 1 258 ? 35.078 17.332  1.654   1.00 50.04  ? 258  PHE A CE1 1 
ATOM   1895 C  CE2 . PHE A 1 258 ? 35.164 15.013  2.294   1.00 50.20  ? 258  PHE A CE2 1 
ATOM   1896 C  CZ  . PHE A 1 258 ? 34.764 16.329  2.559   1.00 48.76  ? 258  PHE A CZ  1 
ATOM   1897 N  N   . VAL A 1 259 ? 37.960 17.328  -4.116  1.00 51.98  ? 259  VAL A N   1 
ATOM   1898 C  CA  . VAL A 1 259 ? 38.977 17.400  -5.168  1.00 52.69  ? 259  VAL A CA  1 
ATOM   1899 C  C   . VAL A 1 259 ? 39.884 18.591  -4.902  1.00 52.76  ? 259  VAL A C   1 
ATOM   1900 O  O   . VAL A 1 259 ? 39.412 19.722  -4.819  1.00 51.73  ? 259  VAL A O   1 
ATOM   1901 C  CB  . VAL A 1 259 ? 38.332 17.595  -6.558  1.00 54.03  ? 259  VAL A CB  1 
ATOM   1902 C  CG1 . VAL A 1 259 ? 39.401 17.807  -7.614  1.00 54.49  ? 259  VAL A CG1 1 
ATOM   1903 C  CG2 . VAL A 1 259 ? 37.444 16.422  -6.922  1.00 52.90  ? 259  VAL A CG2 1 
ATOM   1904 N  N   . ALA A 1 260 ? 41.184 18.335  -4.775  1.00 51.27  ? 260  ALA A N   1 
ATOM   1905 C  CA  . ALA A 1 260 ? 42.158 19.381  -4.439  1.00 51.50  ? 260  ALA A CA  1 
ATOM   1906 C  C   . ALA A 1 260 ? 42.243 20.532  -5.455  1.00 52.66  ? 260  ALA A C   1 
ATOM   1907 O  O   . ALA A 1 260 ? 42.343 21.716  -5.088  1.00 53.38  ? 260  ALA A O   1 
ATOM   1908 C  CB  . ALA A 1 260 ? 43.530 18.763  -4.240  1.00 50.74  ? 260  ALA A CB  1 
ATOM   1909 N  N   . ASP A 1 261 ? 42.231 20.171  -6.731  1.00 52.52  ? 261  ASP A N   1 
ATOM   1910 C  CA  . ASP A 1 261 ? 42.180 21.151  -7.787  1.00 53.82  ? 261  ASP A CA  1 
ATOM   1911 C  C   . ASP A 1 261 ? 40.789 21.798  -7.898  1.00 54.59  ? 261  ASP A C   1 
ATOM   1912 O  O   . ASP A 1 261 ? 39.822 21.150  -8.266  1.00 54.03  ? 261  ASP A O   1 
ATOM   1913 C  CB  . ASP A 1 261 ? 42.551 20.491  -9.101  1.00 58.69  ? 261  ASP A CB  1 
ATOM   1914 C  CG  . ASP A 1 261 ? 42.749 21.487  -10.201 1.00 61.28  ? 261  ASP A CG  1 
ATOM   1915 O  OD1 . ASP A 1 261 ? 42.536 22.694  -9.969  1.00 57.72  ? 261  ASP A OD1 1 
ATOM   1916 O  OD2 . ASP A 1 261 ? 43.109 21.059  -11.304 1.00 64.81  ? 261  ASP A OD2 1 
ATOM   1917 N  N   . PRO A 1 262 ? 40.692 23.087  -7.578  1.00 54.98  ? 262  PRO A N   1 
ATOM   1918 C  CA  . PRO A 1 262 ? 39.435 23.827  -7.694  1.00 56.00  ? 262  PRO A CA  1 
ATOM   1919 C  C   . PRO A 1 262 ? 38.856 23.780  -9.100  1.00 57.87  ? 262  PRO A C   1 
ATOM   1920 O  O   . PRO A 1 262 ? 37.642 23.849  -9.271  1.00 57.33  ? 262  PRO A O   1 
ATOM   1921 C  CB  . PRO A 1 262 ? 39.828 25.262  -7.323  1.00 50.50  ? 262  PRO A CB  1 
ATOM   1922 C  CG  . PRO A 1 262 ? 41.294 25.304  -7.359  1.00 51.52  ? 262  PRO A CG  1 
ATOM   1923 C  CD  . PRO A 1 262 ? 41.777 23.927  -7.060  1.00 51.99  ? 262  PRO A CD  1 
ATOM   1924 N  N   . ALA A 1 263 ? 39.720 23.662  -10.095 1.00 57.77  ? 263  ALA A N   1 
ATOM   1925 C  CA  . ALA A 1 263 ? 39.269 23.645  -11.472 1.00 59.79  ? 263  ALA A CA  1 
ATOM   1926 C  C   . ALA A 1 263 ? 38.420 22.403  -11.711 1.00 60.01  ? 263  ALA A C   1 
ATOM   1927 O  O   . ALA A 1 263 ? 37.469 22.418  -12.487 1.00 57.95  ? 263  ALA A O   1 
ATOM   1928 C  CB  . ALA A 1 263 ? 40.465 23.686  -12.415 1.00 54.96  ? 263  ALA A CB  1 
ATOM   1929 N  N   . LYS A 1 264 ? 38.763 21.332  -11.013 1.00 58.90  ? 264  LYS A N   1 
ATOM   1930 C  CA  . LYS A 1 264 ? 38.126 20.052  -11.234 1.00 59.44  ? 264  LYS A CA  1 
ATOM   1931 C  C   . LYS A 1 264 ? 37.022 19.711  -10.222 1.00 59.69  ? 264  LYS A C   1 
ATOM   1932 O  O   . LYS A 1 264 ? 36.296 18.729  -10.398 1.00 61.35  ? 264  LYS A O   1 
ATOM   1933 C  CB  . LYS A 1 264 ? 39.185 18.957  -11.263 1.00 60.87  ? 264  LYS A CB  1 
ATOM   1934 C  CG  . LYS A 1 264 ? 40.396 19.279  -12.117 1.00 62.79  ? 264  LYS A CG  1 
ATOM   1935 C  CD  . LYS A 1 264 ? 41.136 17.987  -12.438 1.00 70.70  ? 264  LYS A CD  1 
ATOM   1936 C  CE  . LYS A 1 264 ? 42.507 18.234  -13.036 1.00 76.41  ? 264  LYS A CE  1 
ATOM   1937 N  NZ  . LYS A 1 264 ? 43.481 18.625  -11.981 1.00 74.54  ? 264  LYS A NZ  1 
ATOM   1938 N  N   . ARG A 1 265 ? 36.881 20.528  -9.181  1.00 56.22  ? 265  ARG A N   1 
ATOM   1939 C  CA  . ARG A 1 265 ? 35.841 20.318  -8.176  1.00 57.38  ? 265  ARG A CA  1 
ATOM   1940 C  C   . ARG A 1 265 ? 34.451 20.533  -8.761  1.00 55.00  ? 265  ARG A C   1 
ATOM   1941 O  O   . ARG A 1 265 ? 34.229 21.442  -9.543  1.00 54.84  ? 265  ARG A O   1 
ATOM   1942 C  CB  . ARG A 1 265 ? 36.066 21.222  -6.947  1.00 55.67  ? 265  ARG A CB  1 
ATOM   1943 C  CG  . ARG A 1 265 ? 35.117 20.955  -5.727  1.00 52.36  ? 265  ARG A CG  1 
ATOM   1944 C  CD  . ARG A 1 265 ? 35.582 21.680  -4.454  1.00 50.17  ? 265  ARG A CD  1 
ATOM   1945 N  NE  . ARG A 1 265 ? 37.024 21.515  -4.274  1.00 52.10  ? 265  ARG A NE  1 
ATOM   1946 C  CZ  . ARG A 1 265 ? 37.878 22.474  -3.921  1.00 50.25  ? 265  ARG A CZ  1 
ATOM   1947 N  NH1 . ARG A 1 265 ? 37.452 23.701  -3.673  1.00 48.20  ? 265  ARG A NH1 1 
ATOM   1948 N  NH2 . ARG A 1 265 ? 39.173 22.198  -3.816  1.00 51.58  ? 265  ARG A NH2 1 
ATOM   1949 N  N   . ILE A 1 266 ? 33.514 19.684  -8.366  1.00 54.23  ? 266  ILE A N   1 
ATOM   1950 C  CA  . ILE A 1 266 ? 32.125 19.836  -8.783  1.00 57.49  ? 266  ILE A CA  1 
ATOM   1951 C  C   . ILE A 1 266 ? 31.608 21.223  -8.397  1.00 56.47  ? 266  ILE A C   1 
ATOM   1952 O  O   . ILE A 1 266 ? 31.991 21.780  -7.372  1.00 54.86  ? 266  ILE A O   1 
ATOM   1953 C  CB  . ILE A 1 266 ? 31.213 18.705  -8.230  1.00 55.78  ? 266  ILE A CB  1 
ATOM   1954 C  CG1 . ILE A 1 266 ? 29.822 18.780  -8.850  1.00 54.35  ? 266  ILE A CG1 1 
ATOM   1955 C  CG2 . ILE A 1 266 ? 31.125 18.749  -6.720  1.00 52.38  ? 266  ILE A CG2 1 
ATOM   1956 C  CD1 . ILE A 1 266 ? 28.990 17.588  -8.567  1.00 52.57  ? 266  ILE A CD1 1 
ATOM   1957 N  N   . SER A 1 267 ? 30.758 21.790  -9.240  1.00 56.09  ? 267  SER A N   1 
ATOM   1958 C  CA  . SER A 1 267 ? 30.301 23.149  -9.038  1.00 56.21  ? 267  SER A CA  1 
ATOM   1959 C  C   . SER A 1 267 ? 28.924 23.076  -8.423  1.00 56.62  ? 267  SER A C   1 
ATOM   1960 O  O   . SER A 1 267 ? 28.312 22.012  -8.436  1.00 56.14  ? 267  SER A O   1 
ATOM   1961 C  CB  . SER A 1 267 ? 30.224 23.877  -10.372 1.00 53.10  ? 267  SER A CB  1 
ATOM   1962 O  OG  . SER A 1 267 ? 29.059 23.479  -11.086 1.00 54.73  ? 267  SER A OG  1 
ATOM   1963 N  N   . ILE A 1 268 ? 28.432 24.196  -7.899  1.00 55.13  ? 268  ILE A N   1 
ATOM   1964 C  CA  . ILE A 1 268 ? 27.113 24.229  -7.264  1.00 56.26  ? 268  ILE A CA  1 
ATOM   1965 C  C   . ILE A 1 268 ? 25.996 23.763  -8.189  1.00 56.72  ? 268  ILE A C   1 
ATOM   1966 O  O   . ILE A 1 268 ? 25.175 22.972  -7.787  1.00 55.06  ? 268  ILE A O   1 
ATOM   1967 C  CB  . ILE A 1 268 ? 26.760 25.645  -6.728  1.00 55.02  ? 268  ILE A CB  1 
ATOM   1968 C  CG1 . ILE A 1 268 ? 27.663 26.052  -5.554  1.00 55.00  ? 268  ILE A CG1 1 
ATOM   1969 C  CG2 . ILE A 1 268 ? 25.307 25.716  -6.341  1.00 51.53  ? 268  ILE A CG2 1 
ATOM   1970 C  CD1 . ILE A 1 268 ? 27.272 25.466  -4.219  1.00 55.32  ? 268  ILE A CD1 1 
ATOM   1971 N  N   . PRO A 1 269 ? 25.954 24.275  -9.427  1.00 59.09  ? 269  PRO A N   1 
ATOM   1972 C  CA  . PRO A 1 269 ? 24.907 23.868  -10.375 1.00 60.32  ? 269  PRO A CA  1 
ATOM   1973 C  C   . PRO A 1 269 ? 25.012 22.384  -10.688 1.00 58.21  ? 269  PRO A C   1 
ATOM   1974 O  O   . PRO A 1 269 ? 24.005 21.652  -10.736 1.00 58.18  ? 269  PRO A O   1 
ATOM   1975 C  CB  . PRO A 1 269 ? 25.224 24.693  -11.627 1.00 56.24  ? 269  PRO A CB  1 
ATOM   1976 C  CG  . PRO A 1 269 ? 26.002 25.845  -11.125 1.00 56.68  ? 269  PRO A CG  1 
ATOM   1977 C  CD  . PRO A 1 269 ? 26.812 25.329  -9.987  1.00 57.87  ? 269  PRO A CD  1 
ATOM   1978 N  N   . GLU A 1 270 ? 26.243 21.932  -10.891 1.00 57.02  ? 270  GLU A N   1 
ATOM   1979 C  CA  . GLU A 1 270 ? 26.473 20.506  -11.081 1.00 59.18  ? 270  GLU A CA  1 
ATOM   1980 C  C   . GLU A 1 270 ? 25.861 19.667  -9.945  1.00 59.29  ? 270  GLU A C   1 
ATOM   1981 O  O   . GLU A 1 270 ? 25.245 18.638  -10.190 1.00 59.77  ? 270  GLU A O   1 
ATOM   1982 C  CB  . GLU A 1 270 ? 27.970 20.245  -11.248 1.00 56.25  ? 270  GLU A CB  1 
ATOM   1983 C  CG  . GLU A 1 270 ? 28.505 20.880  -12.514 1.00 57.65  ? 270  GLU A CG  1 
ATOM   1984 C  CD  . GLU A 1 270 ? 30.019 20.925  -12.594 1.00 63.46  ? 270  GLU A CD  1 
ATOM   1985 O  OE1 . GLU A 1 270 ? 30.705 20.189  -11.859 1.00 61.60  ? 270  GLU A OE1 1 
ATOM   1986 O  OE2 . GLU A 1 270 ? 30.526 21.713  -13.412 1.00 68.15  ? 270  GLU A OE2 1 
ATOM   1987 N  N   . ILE A 1 271 ? 26.045 20.121  -8.713  1.00 56.66  ? 271  ILE A N   1 
ATOM   1988 C  CA  . ILE A 1 271 ? 25.462 19.488  -7.546  1.00 56.86  ? 271  ILE A CA  1 
ATOM   1989 C  C   . ILE A 1 271 ? 23.939 19.549  -7.613  1.00 58.68  ? 271  ILE A C   1 
ATOM   1990 O  O   . ILE A 1 271 ? 23.244 18.562  -7.347  1.00 57.91  ? 271  ILE A O   1 
ATOM   1991 C  CB  . ILE A 1 271 ? 25.978 20.160  -6.260  1.00 57.71  ? 271  ILE A CB  1 
ATOM   1992 C  CG1 . ILE A 1 271 ? 27.501 20.042  -6.180  1.00 55.51  ? 271  ILE A CG1 1 
ATOM   1993 C  CG2 . ILE A 1 271 ? 25.284 19.609  -5.026  1.00 48.86  ? 271  ILE A CG2 1 
ATOM   1994 C  CD1 . ILE A 1 271 ? 28.129 20.917  -5.148  1.00 51.85  ? 271  ILE A CD1 1 
ATOM   1995 N  N   . ARG A 1 272 ? 23.426 20.710  -7.989  1.00 59.90  ? 272  ARG A N   1 
ATOM   1996 C  CA  . ARG A 1 272 ? 21.986 20.914  -8.113  1.00 61.25  ? 272  ARG A CA  1 
ATOM   1997 C  C   . ARG A 1 272 ? 21.374 19.895  -9.065  1.00 63.59  ? 272  ARG A C   1 
ATOM   1998 O  O   . ARG A 1 272 ? 20.187 19.563  -8.973  1.00 64.07  ? 272  ARG A O   1 
ATOM   1999 C  CB  . ARG A 1 272 ? 21.685 22.347  -8.561  1.00 61.37  ? 272  ARG A CB  1 
ATOM   2000 C  CG  . ARG A 1 272 ? 21.524 23.308  -7.401  1.00 65.58  ? 272  ARG A CG  1 
ATOM   2001 C  CD  . ARG A 1 272 ? 21.449 24.747  -7.867  1.00 74.18  ? 272  ARG A CD  1 
ATOM   2002 N  NE  . ARG A 1 272 ? 20.129 25.113  -8.379  1.00 85.49  ? 272  ARG A NE  1 
ATOM   2003 C  CZ  . ARG A 1 272 ? 19.114 25.533  -7.620  1.00 93.49  ? 272  ARG A CZ  1 
ATOM   2004 N  NH1 . ARG A 1 272 ? 19.249 25.627  -6.296  1.00 86.87  ? 272  ARG A NH1 1 
ATOM   2005 N  NH2 . ARG A 1 272 ? 17.953 25.857  -8.184  1.00 97.44  ? 272  ARG A NH2 1 
ATOM   2006 N  N   . ASN A 1 273 ? 22.195 19.383  -9.976  1.00 62.29  ? 273  ASN A N   1 
ATOM   2007 C  CA  . ASN A 1 273 ? 21.724 18.336  -10.891 1.00 64.81  ? 273  ASN A CA  1 
ATOM   2008 C  C   . ASN A 1 273 ? 22.184 16.918  -10.581 1.00 64.16  ? 273  ASN A C   1 
ATOM   2009 O  O   . ASN A 1 273 ? 21.930 16.012  -11.353 1.00 63.26  ? 273  ASN A O   1 
ATOM   2010 C  CB  . ASN A 1 273 ? 22.058 18.691  -12.340 1.00 64.36  ? 273  ASN A CB  1 
ATOM   2011 C  CG  . ASN A 1 273 ? 21.356 19.940  -12.786 1.00 72.85  ? 273  ASN A CG  1 
ATOM   2012 O  OD1 . ASN A 1 273 ? 20.139 20.081  -12.591 1.00 71.65  ? 273  ASN A OD1 1 
ATOM   2013 N  ND2 . ASN A 1 273 ? 22.113 20.876  -13.358 1.00 68.44  ? 273  ASN A ND2 1 
ATOM   2014 N  N   . HIS A 1 274 ? 22.836 16.720  -9.446  1.00 62.69  ? 274  HIS A N   1 
ATOM   2015 C  CA  . HIS A 1 274 ? 23.344 15.396  -9.097  1.00 59.31  ? 274  HIS A CA  1 
ATOM   2016 C  C   . HIS A 1 274 ? 22.223 14.536  -8.540  1.00 62.58  ? 274  HIS A C   1 
ATOM   2017 O  O   . HIS A 1 274 ? 21.322 15.039  -7.860  1.00 61.86  ? 274  HIS A O   1 
ATOM   2018 C  CB  . HIS A 1 274 ? 24.499 15.529  -8.096  1.00 58.25  ? 274  HIS A CB  1 
ATOM   2019 C  CG  . HIS A 1 274 ? 25.214 14.252  -7.796  1.00 57.96  ? 274  HIS A CG  1 
ATOM   2020 N  ND1 . HIS A 1 274 ? 24.615 13.201  -7.109  1.00 59.13  ? 274  HIS A ND1 1 
ATOM   2021 C  CD2 . HIS A 1 274 ? 26.477 13.847  -8.054  1.00 54.23  ? 274  HIS A CD2 1 
ATOM   2022 C  CE1 . HIS A 1 274 ? 25.476 12.219  -6.989  1.00 58.94  ? 274  HIS A CE1 1 
ATOM   2023 N  NE2 . HIS A 1 274 ? 26.621 12.574  -7.552  1.00 55.88  ? 274  HIS A NE2 1 
ATOM   2024 N  N   . GLU A 1 275 ? 22.279 13.240  -8.841  1.00 63.52  ? 275  GLU A N   1 
ATOM   2025 C  CA  . GLU A 1 275 ? 21.173 12.326  -8.548  1.00 67.92  ? 275  GLU A CA  1 
ATOM   2026 C  C   . GLU A 1 275 ? 20.850 12.243  -7.056  1.00 66.17  ? 275  GLU A C   1 
ATOM   2027 O  O   . GLU A 1 275 ? 19.679 12.246  -6.666  1.00 63.93  ? 275  GLU A O   1 
ATOM   2028 C  CB  . GLU A 1 275 ? 21.443 10.930  -9.128  1.00 69.96  ? 275  GLU A CB  1 
ATOM   2029 C  CG  . GLU A 1 275 ? 22.672 10.236  -8.529  1.00 73.41  ? 275  GLU A CG  1 
ATOM   2030 C  CD  . GLU A 1 275 ? 23.210 9.095   -9.390  1.00 82.37  ? 275  GLU A CD  1 
ATOM   2031 O  OE1 . GLU A 1 275 ? 22.429 8.161   -9.677  1.00 84.54  ? 275  GLU A OE1 1 
ATOM   2032 O  OE2 . GLU A 1 275 ? 24.416 9.132   -9.762  1.00 77.52  ? 275  GLU A OE2 1 
ATOM   2033 N  N   . TRP A 1 276 ? 21.892 12.176  -6.231  1.00 64.10  ? 276  TRP A N   1 
ATOM   2034 C  CA  . TRP A 1 276 ? 21.725 12.160  -4.785  1.00 63.02  ? 276  TRP A CA  1 
ATOM   2035 C  C   . TRP A 1 276 ? 21.000 13.410  -4.305  1.00 63.02  ? 276  TRP A C   1 
ATOM   2036 O  O   . TRP A 1 276 ? 20.114 13.341  -3.446  1.00 61.26  ? 276  TRP A O   1 
ATOM   2037 C  CB  . TRP A 1 276 ? 23.080 12.062  -4.094  1.00 59.22  ? 276  TRP A CB  1 
ATOM   2038 C  CG  . TRP A 1 276 ? 22.966 11.683  -2.657  1.00 60.82  ? 276  TRP A CG  1 
ATOM   2039 C  CD1 . TRP A 1 276 ? 22.828 10.430  -2.162  1.00 60.53  ? 276  TRP A CD1 1 
ATOM   2040 C  CD2 . TRP A 1 276 ? 22.964 12.563  -1.522  1.00 61.17  ? 276  TRP A CD2 1 
ATOM   2041 N  NE1 . TRP A 1 276 ? 22.744 10.463  -0.798  1.00 58.20  ? 276  TRP A NE1 1 
ATOM   2042 C  CE2 . TRP A 1 276 ? 22.828 11.763  -0.375  1.00 59.08  ? 276  TRP A CE2 1 
ATOM   2043 C  CE3 . TRP A 1 276 ? 23.075 13.948  -1.366  1.00 57.10  ? 276  TRP A CE3 1 
ATOM   2044 C  CZ2 . TRP A 1 276 ? 22.801 12.298  0.914   1.00 56.21  ? 276  TRP A CZ2 1 
ATOM   2045 C  CZ3 . TRP A 1 276 ? 23.054 14.473  -0.089  1.00 55.17  ? 276  TRP A CZ3 1 
ATOM   2046 C  CH2 . TRP A 1 276 ? 22.920 13.655  1.034   1.00 53.92  ? 276  TRP A CH2 1 
ATOM   2047 N  N   . PHE A 1 277 ? 21.374 14.546  -4.884  1.00 61.48  ? 277  PHE A N   1 
ATOM   2048 C  CA  . PHE A 1 277 ? 20.816 15.826  -4.486  1.00 62.29  ? 277  PHE A CA  1 
ATOM   2049 C  C   . PHE A 1 277 ? 19.322 15.896  -4.797  1.00 62.87  ? 277  PHE A C   1 
ATOM   2050 O  O   . PHE A 1 277 ? 18.528 16.442  -4.023  1.00 61.37  ? 277  PHE A O   1 
ATOM   2051 C  CB  . PHE A 1 277 ? 21.560 16.988  -5.165  1.00 60.19  ? 277  PHE A CB  1 
ATOM   2052 C  CG  . PHE A 1 277 ? 21.032 18.336  -4.774  1.00 61.16  ? 277  PHE A CG  1 
ATOM   2053 C  CD1 . PHE A 1 277 ? 21.468 18.954  -3.612  1.00 56.38  ? 277  PHE A CD1 1 
ATOM   2054 C  CD2 . PHE A 1 277 ? 20.059 18.959  -5.540  1.00 62.15  ? 277  PHE A CD2 1 
ATOM   2055 C  CE1 . PHE A 1 277 ? 20.959 20.173  -3.234  1.00 58.72  ? 277  PHE A CE1 1 
ATOM   2056 C  CE2 . PHE A 1 277 ? 19.543 20.191  -5.166  1.00 62.91  ? 277  PHE A CE2 1 
ATOM   2057 C  CZ  . PHE A 1 277 ? 19.996 20.801  -4.016  1.00 62.38  ? 277  PHE A CZ  1 
ATOM   2058 N  N   . LEU A 1 278 ? 18.955 15.325  -5.935  1.00 63.60  ? 278  LEU A N   1 
ATOM   2059 C  CA  . LEU A 1 278 ? 17.614 15.484  -6.468  1.00 65.77  ? 278  LEU A CA  1 
ATOM   2060 C  C   . LEU A 1 278 ? 16.580 14.599  -5.780  1.00 62.94  ? 278  LEU A C   1 
ATOM   2061 O  O   . LEU A 1 278 ? 15.394 14.919  -5.758  1.00 63.88  ? 278  LEU A O   1 
ATOM   2062 C  CB  . LEU A 1 278 ? 17.627 15.239  -7.973  1.00 67.86  ? 278  LEU A CB  1 
ATOM   2063 C  CG  . LEU A 1 278 ? 18.354 16.319  -8.770  1.00 68.30  ? 278  LEU A CG  1 
ATOM   2064 C  CD1 . LEU A 1 278 ? 18.876 15.758  -10.082 1.00 64.97  ? 278  LEU A CD1 1 
ATOM   2065 C  CD2 . LEU A 1 278 ? 17.430 17.527  -8.976  1.00 61.66  ? 278  LEU A CD2 1 
ATOM   2066 N  N   . LYS A 1 279 ? 17.042 13.501  -5.197  1.00 61.27  ? 279  LYS A N   1 
ATOM   2067 C  CA  . LYS A 1 279 ? 16.157 12.598  -4.480  1.00 65.30  ? 279  LYS A CA  1 
ATOM   2068 C  C   . LYS A 1 279 ? 15.347 13.262  -3.363  1.00 66.09  ? 279  LYS A C   1 
ATOM   2069 O  O   . LYS A 1 279 ? 15.904 13.869  -2.453  1.00 64.90  ? 279  LYS A O   1 
ATOM   2070 C  CB  . LYS A 1 279 ? 16.932 11.415  -3.915  1.00 66.07  ? 279  LYS A CB  1 
ATOM   2071 C  CG  . LYS A 1 279 ? 16.010 10.353  -3.335  1.00 69.10  ? 279  LYS A CG  1 
ATOM   2072 C  CD  . LYS A 1 279 ? 16.675 9.001   -3.226  1.00 73.25  ? 279  LYS A CD  1 
ATOM   2073 C  CE  . LYS A 1 279 ? 15.720 7.987   -2.614  1.00 78.63  ? 279  LYS A CE  1 
ATOM   2074 N  NZ  . LYS A 1 279 ? 16.427 6.868   -1.917  1.00 79.32  ? 279  LYS A NZ  1 
ATOM   2075 N  N   . ASN A 1 280 ? 14.027 13.112  -3.437  1.00 65.66  ? 280  ASN A N   1 
ATOM   2076 C  CA  . ASN A 1 280 ? 13.112 13.691  -2.458  1.00 65.85  ? 280  ASN A CA  1 
ATOM   2077 C  C   . ASN A 1 280 ? 13.238 15.203  -2.351  1.00 67.23  ? 280  ASN A C   1 
ATOM   2078 O  O   . ASN A 1 280 ? 12.787 15.793  -1.373  1.00 70.93  ? 280  ASN A O   1 
ATOM   2079 C  CB  . ASN A 1 280 ? 13.297 13.046  -1.077  1.00 65.81  ? 280  ASN A CB  1 
ATOM   2080 C  CG  . ASN A 1 280 ? 13.134 11.526  -1.106  1.00 70.73  ? 280  ASN A CG  1 
ATOM   2081 O  OD1 . ASN A 1 280 ? 12.362 10.987  -1.902  1.00 73.33  ? 280  ASN A OD1 1 
ATOM   2082 N  ND2 . ASN A 1 280 ? 13.867 10.832  -0.237  1.00 68.01  ? 280  ASN A ND2 1 
ATOM   2083 N  N   . LEU A 1 281 ? 13.844 15.833  -3.354  1.00 65.70  ? 281  LEU A N   1 
ATOM   2084 C  CA  . LEU A 1 281 ? 14.012 17.284  -3.323  1.00 68.63  ? 281  LEU A CA  1 
ATOM   2085 C  C   . LEU A 1 281 ? 12.666 17.990  -3.395  1.00 73.42  ? 281  LEU A C   1 
ATOM   2086 O  O   . LEU A 1 281 ? 11.952 17.847  -4.381  1.00 73.94  ? 281  LEU A O   1 
ATOM   2087 C  CB  . LEU A 1 281 ? 14.920 17.765  -4.461  1.00 69.02  ? 281  LEU A CB  1 
ATOM   2088 C  CG  . LEU A 1 281 ? 15.113 19.283  -4.613  1.00 70.92  ? 281  LEU A CG  1 
ATOM   2089 C  CD1 . LEU A 1 281 ? 15.956 19.878  -3.485  1.00 65.81  ? 281  LEU A CD1 1 
ATOM   2090 C  CD2 . LEU A 1 281 ? 15.743 19.605  -5.946  1.00 66.16  ? 281  LEU A CD2 1 
ATOM   2091 N  N   . PRO A 1 282 ? 12.310 18.737  -2.337  1.00 77.25  ? 282  PRO A N   1 
ATOM   2092 C  CA  . PRO A 1 282 ? 11.137 19.617  -2.362  1.00 81.71  ? 282  PRO A CA  1 
ATOM   2093 C  C   . PRO A 1 282 ? 11.283 20.636  -3.498  1.00 89.53  ? 282  PRO A C   1 
ATOM   2094 O  O   . PRO A 1 282 ? 12.395 21.127  -3.723  1.00 87.03  ? 282  PRO A O   1 
ATOM   2095 C  CB  . PRO A 1 282 ? 11.207 20.317  -1.000  1.00 81.49  ? 282  PRO A CB  1 
ATOM   2096 C  CG  . PRO A 1 282 ? 11.939 19.349  -0.126  1.00 76.72  ? 282  PRO A CG  1 
ATOM   2097 C  CD  . PRO A 1 282 ? 12.959 18.718  -1.016  1.00 73.76  ? 282  PRO A CD  1 
ATOM   2098 N  N   . ALA A 1 283 ? 10.194 20.949  -4.199  1.00 91.63  ? 283  ALA A N   1 
ATOM   2099 C  CA  . ALA A 1 283 ? 10.263 21.843  -5.363  1.00 95.19  ? 283  ALA A CA  1 
ATOM   2100 C  C   . ALA A 1 283 ? 10.423 23.333  -5.029  1.00 98.20  ? 283  ALA A C   1 
ATOM   2101 O  O   . ALA A 1 283 ? 10.939 24.107  -5.838  1.00 97.71  ? 283  ALA A O   1 
ATOM   2102 C  CB  . ALA A 1 283 ? 9.070  21.631  -6.265  1.00 91.34  ? 283  ALA A CB  1 
ATOM   2103 N  N   . ASP A 1 284 ? 9.979  23.726  -3.842  1.00 95.18  ? 284  ASP A N   1 
ATOM   2104 C  CA  . ASP A 1 284 ? 10.170 25.090  -3.365  1.00 100.14 ? 284  ASP A CA  1 
ATOM   2105 C  C   . ASP A 1 284 ? 11.633 25.531  -3.444  1.00 101.56 ? 284  ASP A C   1 
ATOM   2106 O  O   . ASP A 1 284 ? 11.927 26.726  -3.448  1.00 104.91 ? 284  ASP A O   1 
ATOM   2107 C  CB  . ASP A 1 284 ? 9.658  25.224  -1.928  1.00 103.55 ? 284  ASP A CB  1 
ATOM   2108 C  CG  . ASP A 1 284 ? 9.541  23.879  -1.220  1.00 103.73 ? 284  ASP A CG  1 
ATOM   2109 O  OD1 . ASP A 1 284 ? 8.857  22.974  -1.759  1.00 99.06  ? 284  ASP A OD1 1 
ATOM   2110 O  OD2 . ASP A 1 284 ? 10.128 23.732  -0.122  1.00 104.58 ? 284  ASP A OD2 1 
ATOM   2111 N  N   . LEU A 1 285 ? 12.544 24.561  -3.507  1.00 99.66  ? 285  LEU A N   1 
ATOM   2112 C  CA  . LEU A 1 285 ? 13.977 24.842  -3.582  1.00 98.35  ? 285  LEU A CA  1 
ATOM   2113 C  C   . LEU A 1 285 ? 14.481 24.756  -5.020  1.00 97.33  ? 285  LEU A C   1 
ATOM   2114 O  O   . LEU A 1 285 ? 15.170 25.653  -5.509  1.00 95.82  ? 285  LEU A O   1 
ATOM   2115 C  CB  . LEU A 1 285 ? 14.761 23.868  -2.694  1.00 92.62  ? 285  LEU A CB  1 
ATOM   2116 C  CG  . LEU A 1 285 ? 14.431 23.754  -1.200  1.00 88.82  ? 285  LEU A CG  1 
ATOM   2117 C  CD1 . LEU A 1 285 ? 15.365 22.760  -0.543  1.00 70.46  ? 285  LEU A CD1 1 
ATOM   2118 C  CD2 . LEU A 1 285 ? 14.517 25.102  -0.500  1.00 87.83  ? 285  LEU A CD2 1 
ATOM   2119 N  N   . PRO A 1 301 ? 7.497  43.334  3.112   1.00 98.39  ? 301  PRO A N   1 
ATOM   2120 C  CA  . PRO A 1 301 ? 7.245  44.401  4.090   1.00 97.02  ? 301  PRO A CA  1 
ATOM   2121 C  C   . PRO A 1 301 ? 8.513  44.860  4.827   1.00 95.24  ? 301  PRO A C   1 
ATOM   2122 O  O   . PRO A 1 301 ? 8.431  45.256  5.991   1.00 90.70  ? 301  PRO A O   1 
ATOM   2123 C  CB  . PRO A 1 301 ? 6.264  43.747  5.071   1.00 98.19  ? 301  PRO A CB  1 
ATOM   2124 C  CG  . PRO A 1 301 ? 6.564  42.280  4.984   1.00 102.70 ? 301  PRO A CG  1 
ATOM   2125 C  CD  . PRO A 1 301 ? 6.954  42.033  3.548   1.00 102.22 ? 301  PRO A CD  1 
ATOM   2126 N  N   . GLY A 1 302 ? 9.660  44.827  4.156   1.00 89.15  ? 302  GLY A N   1 
ATOM   2127 C  CA  . GLY A 1 302 ? 10.910 45.211  4.782   1.00 78.36  ? 302  GLY A CA  1 
ATOM   2128 C  C   . GLY A 1 302 ? 11.010 46.668  5.211   1.00 76.49  ? 302  GLY A C   1 
ATOM   2129 O  O   . GLY A 1 302 ? 10.128 47.476  4.919   1.00 81.43  ? 302  GLY A O   1 
ATOM   2130 N  N   . GLN A 1 303 ? 12.090 47.011  5.913   1.00 67.42  ? 303  GLN A N   1 
ATOM   2131 C  CA  . GLN A 1 303 ? 12.334 48.400  6.304   1.00 69.01  ? 303  GLN A CA  1 
ATOM   2132 C  C   . GLN A 1 303 ? 13.012 49.194  5.179   1.00 69.81  ? 303  GLN A C   1 
ATOM   2133 O  O   . GLN A 1 303 ? 13.936 48.689  4.551   1.00 66.75  ? 303  GLN A O   1 
ATOM   2134 C  CB  . GLN A 1 303 ? 13.188 48.436  7.554   1.00 67.56  ? 303  GLN A CB  1 
ATOM   2135 C  CG  . GLN A 1 303 ? 13.878 49.734  7.788   1.00 64.70  ? 303  GLN A CG  1 
ATOM   2136 C  CD  . GLN A 1 303 ? 14.543 49.759  9.133   1.00 67.76  ? 303  GLN A CD  1 
ATOM   2137 O  OE1 . GLN A 1 303 ? 15.554 49.098  9.345   1.00 64.46  ? 303  GLN A OE1 1 
ATOM   2138 N  NE2 . GLN A 1 303 ? 13.976 50.515  10.061  1.00 71.90  ? 303  GLN A NE2 1 
ATOM   2139 N  N   . SER A 1 304 ? 12.560 50.428  4.932   1.00 72.39  ? 304  SER A N   1 
ATOM   2140 C  CA  . SER A 1 304 ? 12.993 51.201  3.751   1.00 68.62  ? 304  SER A CA  1 
ATOM   2141 C  C   . SER A 1 304 ? 14.478 51.504  3.734   1.00 65.03  ? 304  SER A C   1 
ATOM   2142 O  O   . SER A 1 304 ? 15.082 51.787  4.774   1.00 62.83  ? 304  SER A O   1 
ATOM   2143 C  CB  . SER A 1 304 ? 12.235 52.521  3.627   1.00 68.33  ? 304  SER A CB  1 
ATOM   2144 O  OG  . SER A 1 304 ? 12.940 53.561  4.283   1.00 68.31  ? 304  SER A OG  1 
ATOM   2145 N  N   . ILE A 1 305 ? 15.061 51.458  2.541   1.00 63.43  ? 305  ILE A N   1 
ATOM   2146 C  CA  . ILE A 1 305 ? 16.492 51.675  2.407   1.00 65.16  ? 305  ILE A CA  1 
ATOM   2147 C  C   . ILE A 1 305 ? 16.863 53.022  2.964   1.00 64.54  ? 305  ILE A C   1 
ATOM   2148 O  O   . ILE A 1 305 ? 17.939 53.181  3.533   1.00 62.79  ? 305  ILE A O   1 
ATOM   2149 C  CB  . ILE A 1 305 ? 16.965 51.592  0.958   1.00 65.63  ? 305  ILE A CB  1 
ATOM   2150 C  CG1 . ILE A 1 305 ? 18.420 52.048  0.870   1.00 61.12  ? 305  ILE A CG1 1 
ATOM   2151 C  CG2 . ILE A 1 305 ? 16.112 52.461  0.060   1.00 70.25  ? 305  ILE A CG2 1 
ATOM   2152 C  CD1 . ILE A 1 305 ? 19.414 50.985  1.259   1.00 66.59  ? 305  ILE A CD1 1 
ATOM   2153 N  N   . GLU A 1 306 ? 15.950 53.981  2.809   1.00 65.86  ? 306  GLU A N   1 
ATOM   2154 C  CA  . GLU A 1 306 ? 16.165 55.351  3.249   1.00 65.89  ? 306  GLU A CA  1 
ATOM   2155 C  C   . GLU A 1 306 ? 16.265 55.472  4.760   1.00 63.91  ? 306  GLU A C   1 
ATOM   2156 O  O   . GLU A 1 306 ? 17.213 56.061  5.271   1.00 59.82  ? 306  GLU A O   1 
ATOM   2157 C  CB  . GLU A 1 306 ? 15.054 56.272  2.733   1.00 70.55  ? 306  GLU A CB  1 
ATOM   2158 C  CG  . GLU A 1 306 ? 14.965 56.396  1.214   1.00 70.57  ? 306  GLU A CG  1 
ATOM   2159 C  CD  . GLU A 1 306 ? 13.767 55.663  0.657   1.00 79.46  ? 306  GLU A CD  1 
ATOM   2160 O  OE1 . GLU A 1 306 ? 13.574 54.469  0.995   1.00 75.13  ? 306  GLU A OE1 1 
ATOM   2161 O  OE2 . GLU A 1 306 ? 13.012 56.291  -0.111  1.00 83.24  ? 306  GLU A OE2 1 
ATOM   2162 N  N   . GLU A 1 307 ? 15.274 54.944  5.467   1.00 63.27  ? 307  GLU A N   1 
ATOM   2163 C  CA  . GLU A 1 307 ? 15.307 54.879  6.921   1.00 63.14  ? 307  GLU A CA  1 
ATOM   2164 C  C   . GLU A 1 307 ? 16.660 54.357  7.356   1.00 64.20  ? 307  GLU A C   1 
ATOM   2165 O  O   . GLU A 1 307 ? 17.361 54.975  8.158   1.00 63.40  ? 307  GLU A O   1 
ATOM   2166 C  CB  . GLU A 1 307 ? 14.249 53.891  7.366   1.00 65.72  ? 307  GLU A CB  1 
ATOM   2167 C  CG  . GLU A 1 307 ? 13.314 54.328  8.467   1.00 69.83  ? 307  GLU A CG  1 
ATOM   2168 C  CD  . GLU A 1 307 ? 12.124 53.385  8.540   1.00 76.18  ? 307  GLU A CD  1 
ATOM   2169 O  OE1 . GLU A 1 307 ? 11.609 53.023  7.452   1.00 72.89  ? 307  GLU A OE1 1 
ATOM   2170 O  OE2 . GLU A 1 307 ? 11.729 52.985  9.663   1.00 73.01  ? 307  GLU A OE2 1 
ATOM   2171 N  N   . ILE A 1 308 ? 17.020 53.203  6.801   1.00 63.46  ? 308  ILE A N   1 
ATOM   2172 C  CA  . ILE A 1 308 ? 18.280 52.536  7.123   1.00 64.86  ? 308  ILE A CA  1 
ATOM   2173 C  C   . ILE A 1 308 ? 19.520 53.421  6.938   1.00 64.04  ? 308  ILE A C   1 
ATOM   2174 O  O   . ILE A 1 308 ? 20.280 53.643  7.878   1.00 64.03  ? 308  ILE A O   1 
ATOM   2175 C  CB  . ILE A 1 308 ? 18.447 51.219  6.310   1.00 65.65  ? 308  ILE A CB  1 
ATOM   2176 C  CG1 . ILE A 1 308 ? 17.395 50.177  6.724   1.00 65.92  ? 308  ILE A CG1 1 
ATOM   2177 C  CG2 . ILE A 1 308 ? 19.835 50.653  6.507   1.00 62.40  ? 308  ILE A CG2 1 
ATOM   2178 C  CD1 . ILE A 1 308 ? 17.084 49.131  5.641   1.00 64.11  ? 308  ILE A CD1 1 
ATOM   2179 N  N   . MET A 1 309 ? 19.730 53.897  5.715   1.00 66.11  ? 309  MET A N   1 
ATOM   2180 C  CA  . MET A 1 309 ? 20.880 54.735  5.408   1.00 68.83  ? 309  MET A CA  1 
ATOM   2181 C  C   . MET A 1 309 ? 20.906 55.980  6.292   1.00 66.86  ? 309  MET A C   1 
ATOM   2182 O  O   . MET A 1 309 ? 21.964 56.404  6.772   1.00 65.30  ? 309  MET A O   1 
ATOM   2183 C  CB  . MET A 1 309 ? 20.842 55.150  3.943   1.00 67.91  ? 309  MET A CB  1 
ATOM   2184 C  CG  . MET A 1 309 ? 21.214 54.057  2.965   1.00 68.22  ? 309  MET A CG  1 
ATOM   2185 S  SD  . MET A 1 309 ? 22.946 53.611  3.165   1.00 80.24  ? 309  MET A SD  1 
ATOM   2186 C  CE  . MET A 1 309 ? 23.490 53.428  1.463   1.00 65.26  ? 309  MET A CE  1 
ATOM   2187 N  N   . GLN A 1 310 ? 19.721 56.552  6.488   1.00 64.25  ? 310  GLN A N   1 
ATOM   2188 C  CA  . GLN A 1 310 ? 19.514 57.715  7.328   1.00 66.81  ? 310  GLN A CA  1 
ATOM   2189 C  C   . GLN A 1 310 ? 20.085 57.471  8.703   1.00 70.85  ? 310  GLN A C   1 
ATOM   2190 O  O   . GLN A 1 310 ? 20.905 58.269  9.194   1.00 69.58  ? 310  GLN A O   1 
ATOM   2191 C  CB  . GLN A 1 310 ? 18.014 57.997  7.429   1.00 70.67  ? 310  GLN A CB  1 
ATOM   2192 C  CG  . GLN A 1 310 ? 17.631 59.320  8.086   1.00 71.75  ? 310  GLN A CG  1 
ATOM   2193 C  CD  . GLN A 1 310 ? 17.649 59.246  9.608   1.00 79.71  ? 310  GLN A CD  1 
ATOM   2194 O  OE1 . GLN A 1 310 ? 16.786 58.605  10.222  1.00 79.19  ? 310  GLN A OE1 1 
ATOM   2195 N  NE2 . GLN A 1 310 ? 18.636 59.900  10.227  1.00 75.92  ? 310  GLN A NE2 1 
ATOM   2196 N  N   . ILE A 1 311 ? 19.650 56.355  9.306   1.00 71.96  ? 311  ILE A N   1 
ATOM   2197 C  CA  . ILE A 1 311 ? 20.058 55.951  10.659  1.00 69.47  ? 311  ILE A CA  1 
ATOM   2198 C  C   . ILE A 1 311 ? 21.523 55.565  10.803  1.00 68.45  ? 311  ILE A C   1 
ATOM   2199 O  O   . ILE A 1 311 ? 22.158 55.888  11.813  1.00 69.04  ? 311  ILE A O   1 
ATOM   2200 C  CB  . ILE A 1 311 ? 19.216 54.794  11.184  1.00 68.72  ? 311  ILE A CB  1 
ATOM   2201 C  CG1 . ILE A 1 311 ? 17.728 55.073  10.976  1.00 65.99  ? 311  ILE A CG1 1 
ATOM   2202 C  CG2 . ILE A 1 311 ? 19.538 54.561  12.641  1.00 70.13  ? 311  ILE A CG2 1 
ATOM   2203 C  CD1 . ILE A 1 311 ? 16.825 53.926  11.433  1.00 64.87  ? 311  ILE A CD1 1 
ATOM   2204 N  N   . ILE A 1 312 ? 22.060 54.868  9.808   1.00 68.48  ? 312  ILE A N   1 
ATOM   2205 C  CA  . ILE A 1 312 ? 23.486 54.538  9.830   1.00 73.80  ? 312  ILE A CA  1 
ATOM   2206 C  C   . ILE A 1 312 ? 24.281 55.843  9.826   1.00 76.65  ? 312  ILE A C   1 
ATOM   2207 O  O   . ILE A 1 312 ? 25.285 55.982  10.532  1.00 78.40  ? 312  ILE A O   1 
ATOM   2208 C  CB  . ILE A 1 312 ? 23.914 53.643  8.627   1.00 69.84  ? 312  ILE A CB  1 
ATOM   2209 C  CG1 . ILE A 1 312 ? 23.202 52.299  8.655   1.00 72.16  ? 312  ILE A CG1 1 
ATOM   2210 C  CG2 . ILE A 1 312 ? 25.408 53.379  8.630   1.00 67.32  ? 312  ILE A CG2 1 
ATOM   2211 C  CD1 . ILE A 1 312 ? 23.744 51.340  7.615   1.00 71.23  ? 312  ILE A CD1 1 
ATOM   2212 N  N   . ALA A 1 313 ? 23.815 56.801  9.029   1.00 77.55  ? 313  ALA A N   1 
ATOM   2213 C  CA  . ALA A 1 313 ? 24.417 58.123  9.001   1.00 78.43  ? 313  ALA A CA  1 
ATOM   2214 C  C   . ALA A 1 313 ? 24.324 58.833  10.369  1.00 78.03  ? 313  ALA A C   1 
ATOM   2215 O  O   . ALA A 1 313 ? 25.340 59.261  10.916  1.00 77.54  ? 313  ALA A O   1 
ATOM   2216 C  CB  . ALA A 1 313 ? 23.786 58.957  7.892   1.00 72.73  ? 313  ALA A CB  1 
ATOM   2217 N  N   . GLU A 1 314 ? 23.114 58.945  10.920  1.00 74.65  ? 314  GLU A N   1 
ATOM   2218 C  CA  . GLU A 1 314 ? 22.909 59.608  12.219  1.00 79.23  ? 314  GLU A CA  1 
ATOM   2219 C  C   . GLU A 1 314 ? 23.770 59.009  13.348  1.00 81.41  ? 314  GLU A C   1 
ATOM   2220 O  O   . GLU A 1 314 ? 24.391 59.733  14.119  1.00 84.10  ? 314  GLU A O   1 
ATOM   2221 C  CB  . GLU A 1 314 ? 21.421 59.593  12.611  1.00 77.94  ? 314  GLU A CB  1 
ATOM   2222 C  CG  . GLU A 1 314 ? 21.022 60.682  13.594  1.00 77.33  ? 314  GLU A CG  1 
ATOM   2223 C  CD  . GLU A 1 314 ? 19.579 60.573  14.060  1.00 85.17  ? 314  GLU A CD  1 
ATOM   2224 O  OE1 . GLU A 1 314 ? 18.762 59.969  13.328  1.00 85.98  ? 314  GLU A OE1 1 
ATOM   2225 O  OE2 . GLU A 1 314 ? 19.267 61.093  15.163  1.00 85.70  ? 314  GLU A OE2 1 
ATOM   2226 N  N   . ALA A 1 315 ? 23.809 57.684  13.437  1.00 80.03  ? 315  ALA A N   1 
ATOM   2227 C  CA  . ALA A 1 315 ? 24.599 57.028  14.472  1.00 83.88  ? 315  ALA A CA  1 
ATOM   2228 C  C   . ALA A 1 315 ? 26.104 57.114  14.192  1.00 85.66  ? 315  ALA A C   1 
ATOM   2229 O  O   . ALA A 1 315 ? 26.895 56.357  14.750  1.00 86.34  ? 315  ALA A O   1 
ATOM   2230 C  CB  . ALA A 1 315 ? 24.161 55.584  14.638  1.00 83.61  ? 315  ALA A CB  1 
ATOM   2231 N  N   . THR A 1 316 ? 26.505 58.039  13.331  1.00 86.86  ? 316  THR A N   1 
ATOM   2232 C  CA  . THR A 1 316 ? 27.926 58.255  13.116  1.00 89.03  ? 316  THR A CA  1 
ATOM   2233 C  C   . THR A 1 316 ? 28.451 59.206  14.183  1.00 90.59  ? 316  THR A C   1 
ATOM   2234 O  O   . THR A 1 316 ? 29.658 59.307  14.390  1.00 88.86  ? 316  THR A O   1 
ATOM   2235 C  CB  . THR A 1 316 ? 28.222 58.840  11.724  1.00 87.05  ? 316  THR A CB  1 
ATOM   2236 O  OG1 . THR A 1 316 ? 27.161 58.507  10.821  1.00 84.93  ? 316  THR A OG1 1 
ATOM   2237 C  CG2 . THR A 1 316 ? 29.540 58.292  11.195  1.00 84.99  ? 316  THR A CG2 1 
ATOM   2238 N  N   . VAL A 1 317 ? 27.529 59.889  14.865  1.00 89.84  ? 317  VAL A N   1 
ATOM   2239 C  CA  . VAL A 1 317 ? 27.884 60.893  15.868  1.00 96.00  ? 317  VAL A CA  1 
ATOM   2240 C  C   . VAL A 1 317 ? 27.642 60.445  17.318  1.00 96.75  ? 317  VAL A C   1 
ATOM   2241 O  O   . VAL A 1 317 ? 26.516 60.107  17.707  1.00 91.67  ? 317  VAL A O   1 
ATOM   2242 C  CB  . VAL A 1 317 ? 27.179 62.241  15.596  1.00 94.07  ? 317  VAL A CB  1 
ATOM   2243 C  CG1 . VAL A 1 317 ? 27.675 62.826  14.287  1.00 91.20  ? 317  VAL A CG1 1 
ATOM   2244 C  CG2 . VAL A 1 317 ? 25.662 62.071  15.580  1.00 90.47  ? 317  VAL A CG2 1 
ATOM   2245 N  N   . PRO A 1 318 ? 28.718 60.441  18.120  1.00 97.58  ? 318  PRO A N   1 
ATOM   2246 C  CA  . PRO A 1 318 ? 28.663 59.887  19.474  1.00 100.19 ? 318  PRO A CA  1 
ATOM   2247 C  C   . PRO A 1 318 ? 28.237 60.813  20.603  1.00 101.35 ? 318  PRO A C   1 
ATOM   2248 O  O   . PRO A 1 318 ? 29.060 61.568  21.113  1.00 107.35 ? 318  PRO A O   1 
ATOM   2249 C  CB  . PRO A 1 318 ? 30.111 59.450  19.720  1.00 99.85  ? 318  PRO A CB  1 
ATOM   2250 C  CG  . PRO A 1 318 ? 30.924 60.360  18.888  1.00 94.23  ? 318  PRO A CG  1 
ATOM   2251 C  CD  . PRO A 1 318 ? 30.107 60.610  17.654  1.00 95.27  ? 318  PRO A CD  1 
ATOM   2252 N  N   . PRO A 1 319 ? 26.966 60.754  21.004  1.00 103.76 ? 319  PRO A N   1 
ATOM   2253 C  CA  . PRO A 1 319 ? 26.828 61.039  22.429  1.00 107.03 ? 319  PRO A CA  1 
ATOM   2254 C  C   . PRO A 1 319 ? 27.457 59.873  23.181  1.00 105.79 ? 319  PRO A C   1 
ATOM   2255 O  O   . PRO A 1 319 ? 27.647 58.816  22.568  1.00 99.45  ? 319  PRO A O   1 
ATOM   2256 C  CB  . PRO A 1 319 ? 25.315 61.041  22.636  1.00 108.88 ? 319  PRO A CB  1 
ATOM   2257 C  CG  . PRO A 1 319 ? 24.768 61.486  21.319  1.00 107.35 ? 319  PRO A CG  1 
ATOM   2258 C  CD  . PRO A 1 319 ? 25.694 60.902  20.277  1.00 103.24 ? 319  PRO A CD  1 
ATOM   2259 N  N   . LEU B 1 12  ? 37.132 0.251   24.257  1.00 101.61 ? 12   LEU B N   1 
ATOM   2260 C  CA  . LEU B 1 12  ? 35.730 -0.150  24.131  1.00 103.86 ? 12   LEU B CA  1 
ATOM   2261 C  C   . LEU B 1 12  ? 35.602 -1.376  23.207  1.00 104.76 ? 12   LEU B C   1 
ATOM   2262 O  O   . LEU B 1 12  ? 36.113 -1.363  22.081  1.00 103.57 ? 12   LEU B O   1 
ATOM   2263 C  CB  . LEU B 1 12  ? 34.878 1.028   23.629  1.00 99.03  ? 12   LEU B CB  1 
ATOM   2264 C  CG  . LEU B 1 12  ? 33.350 1.006   23.820  1.00 94.68  ? 12   LEU B CG  1 
ATOM   2265 C  CD1 . LEU B 1 12  ? 32.913 1.682   25.123  1.00 90.84  ? 12   LEU B CD1 1 
ATOM   2266 C  CD2 . LEU B 1 12  ? 32.650 1.662   22.643  1.00 87.82  ? 12   LEU B CD2 1 
ATOM   2267 N  N   . PRO B 1 13  ? 34.910 -2.436  23.687  1.00 104.39 ? 13   PRO B N   1 
ATOM   2268 C  CA  . PRO B 1 13  ? 34.851 -3.775  23.070  1.00 103.39 ? 13   PRO B CA  1 
ATOM   2269 C  C   . PRO B 1 13  ? 34.048 -3.796  21.776  1.00 105.86 ? 13   PRO B C   1 
ATOM   2270 O  O   . PRO B 1 13  ? 33.042 -3.086  21.675  1.00 103.66 ? 13   PRO B O   1 
ATOM   2271 C  CB  . PRO B 1 13  ? 34.141 -4.614  24.128  1.00 99.26  ? 13   PRO B CB  1 
ATOM   2272 C  CG  . PRO B 1 13  ? 33.266 -3.634  24.839  1.00 97.09  ? 13   PRO B CG  1 
ATOM   2273 C  CD  . PRO B 1 13  ? 34.003 -2.324  24.845  1.00 97.92  ? 13   PRO B CD  1 
ATOM   2274 N  N   . ILE B 1 14  ? 34.466 -4.618  20.815  1.00 105.97 ? 14   ILE B N   1 
ATOM   2275 C  CA  . ILE B 1 14  ? 33.960 -4.486  19.446  1.00 104.74 ? 14   ILE B CA  1 
ATOM   2276 C  C   . ILE B 1 14  ? 32.512 -4.934  19.201  1.00 104.60 ? 14   ILE B C   1 
ATOM   2277 O  O   . ILE B 1 14  ? 31.829 -5.456  20.096  1.00 102.10 ? 14   ILE B O   1 
ATOM   2278 C  CB  . ILE B 1 14  ? 34.910 -5.102  18.388  1.00 108.63 ? 14   ILE B CB  1 
ATOM   2279 C  CG1 . ILE B 1 14  ? 34.413 -6.476  17.947  1.00 107.37 ? 14   ILE B CG1 1 
ATOM   2280 C  CG2 . ILE B 1 14  ? 36.347 -5.131  18.905  1.00 108.95 ? 14   ILE B CG2 1 
ATOM   2281 C  CD1 . ILE B 1 14  ? 34.637 -6.740  16.475  1.00 106.62 ? 14   ILE B CD1 1 
ATOM   2282 N  N   . MET B 1 15  ? 32.085 -4.724  17.956  1.00 104.59 ? 15   MET B N   1 
ATOM   2283 C  CA  . MET B 1 15  ? 30.678 -4.663  17.568  1.00 104.98 ? 15   MET B CA  1 
ATOM   2284 C  C   . MET B 1 15  ? 29.955 -6.009  17.450  1.00 107.10 ? 15   MET B C   1 
ATOM   2285 O  O   . MET B 1 15  ? 30.351 -6.886  16.678  1.00 107.21 ? 15   MET B O   1 
ATOM   2286 C  CB  . MET B 1 15  ? 30.542 -3.862  16.273  1.00 100.53 ? 15   MET B CB  1 
ATOM   2287 C  CG  . MET B 1 15  ? 29.134 -3.762  15.776  1.00 96.75  ? 15   MET B CG  1 
ATOM   2288 S  SD  . MET B 1 15  ? 28.018 -3.317  17.108  1.00 98.43  ? 15   MET B SD  1 
ATOM   2289 C  CE  . MET B 1 15  ? 26.457 -3.787  16.355  1.00 86.32  ? 15   MET B CE  1 
ATOM   2290 N  N   . HIS B 1 16  ? 28.858 -6.125  18.194  1.00 102.94 ? 16   HIS B N   1 
ATOM   2291 C  CA  . HIS B 1 16  ? 28.212 -7.404  18.469  1.00 104.29 ? 16   HIS B CA  1 
ATOM   2292 C  C   . HIS B 1 16  ? 26.731 -7.426  18.076  1.00 108.70 ? 16   HIS B C   1 
ATOM   2293 O  O   . HIS B 1 16  ? 26.004 -6.442  18.274  1.00 104.90 ? 16   HIS B O   1 
ATOM   2294 C  CB  . HIS B 1 16  ? 28.348 -7.716  19.965  1.00 104.12 ? 16   HIS B CB  1 
ATOM   2295 C  CG  . HIS B 1 16  ? 28.087 -6.535  20.848  1.00 103.97 ? 16   HIS B CG  1 
ATOM   2296 N  ND1 . HIS B 1 16  ? 26.814 -6.104  21.161  1.00 101.38 ? 16   HIS B ND1 1 
ATOM   2297 C  CD2 . HIS B 1 16  ? 28.935 -5.672  21.458  1.00 104.38 ? 16   HIS B CD2 1 
ATOM   2298 C  CE1 . HIS B 1 16  ? 26.891 -5.036  21.935  1.00 96.21  ? 16   HIS B CE1 1 
ATOM   2299 N  NE2 . HIS B 1 16  ? 28.165 -4.752  22.130  1.00 97.58  ? 16   HIS B NE2 1 
ATOM   2300 N  N   . ASP B 1 17  ? 26.288 -8.562  17.541  1.00 107.04 ? 17   ASP B N   1 
ATOM   2301 C  CA  . ASP B 1 17  ? 24.892 -8.745  17.160  1.00 103.03 ? 17   ASP B CA  1 
ATOM   2302 C  C   . ASP B 1 17  ? 24.518 -7.863  15.988  1.00 94.57  ? 17   ASP B C   1 
ATOM   2303 O  O   . ASP B 1 17  ? 23.462 -7.242  15.989  1.00 91.04  ? 17   ASP B O   1 
ATOM   2304 C  CB  . ASP B 1 17  ? 23.955 -8.468  18.338  1.00 106.46 ? 17   ASP B CB  1 
ATOM   2305 C  CG  . ASP B 1 17  ? 24.037 -9.534  19.410  1.00 108.42 ? 17   ASP B CG  1 
ATOM   2306 O  OD1 . ASP B 1 17  ? 25.018 -9.515  20.185  1.00 106.03 ? 17   ASP B OD1 1 
ATOM   2307 O  OD2 . ASP B 1 17  ? 23.124 -10.389 19.472  1.00 109.54 ? 17   ASP B OD2 1 
ATOM   2308 N  N   . SER B 1 18  ? 25.401 -7.822  14.997  1.00 97.91  ? 18   SER B N   1 
ATOM   2309 C  CA  . SER B 1 18  ? 25.157 -7.116  13.743  1.00 98.26  ? 18   SER B CA  1 
ATOM   2310 C  C   . SER B 1 18  ? 23.745 -7.388  13.222  1.00 98.04  ? 18   SER B C   1 
ATOM   2311 O  O   . SER B 1 18  ? 23.157 -6.552  12.528  1.00 95.37  ? 18   SER B O   1 
ATOM   2312 C  CB  . SER B 1 18  ? 26.196 -7.526  12.690  1.00 95.51  ? 18   SER B CB  1 
ATOM   2313 O  OG  . SER B 1 18  ? 27.522 -7.320  13.157  1.00 98.49  ? 18   SER B OG  1 
ATOM   2314 N  N   . ASP B 1 19  ? 23.212 -8.561  13.569  1.00 98.28  ? 19   ASP B N   1 
ATOM   2315 C  CA  . ASP B 1 19  ? 21.859 -8.968  13.184  1.00 94.01  ? 19   ASP B CA  1 
ATOM   2316 C  C   . ASP B 1 19  ? 20.781 -8.083  13.831  1.00 94.90  ? 19   ASP B C   1 
ATOM   2317 O  O   . ASP B 1 19  ? 19.744 -7.813  13.221  1.00 94.08  ? 19   ASP B O   1 
ATOM   2318 C  CB  . ASP B 1 19  ? 21.639 -10.444 13.538  1.00 93.84  ? 19   ASP B CB  1 
ATOM   2319 C  CG  . ASP B 1 19  ? 22.557 -10.912 14.646  1.00 99.07  ? 19   ASP B CG  1 
ATOM   2320 O  OD1 . ASP B 1 19  ? 23.671 -11.367 14.333  1.00 96.68  ? 19   ASP B OD1 1 
ATOM   2321 O  OD2 . ASP B 1 19  ? 22.178 -10.807 15.831  1.00 101.40 ? 19   ASP B OD2 1 
ATOM   2322 N  N   . ARG B 1 20  ? 21.033 -7.624  15.056  1.00 91.50  ? 20   ARG B N   1 
ATOM   2323 C  CA  . ARG B 1 20  ? 20.062 -6.795  15.769  1.00 92.80  ? 20   ARG B CA  1 
ATOM   2324 C  C   . ARG B 1 20  ? 20.361 -5.291  15.766  1.00 89.96  ? 20   ARG B C   1 
ATOM   2325 O  O   . ARG B 1 20  ? 19.481 -4.464  15.494  1.00 84.69  ? 20   ARG B O   1 
ATOM   2326 C  CB  . ARG B 1 20  ? 19.919 -7.266  17.208  1.00 92.31  ? 20   ARG B CB  1 
ATOM   2327 C  CG  . ARG B 1 20  ? 18.552 -7.828  17.490  1.00 96.35  ? 20   ARG B CG  1 
ATOM   2328 C  CD  . ARG B 1 20  ? 18.042 -7.410  18.852  1.00 94.42  ? 20   ARG B CD  1 
ATOM   2329 N  NE  . ARG B 1 20  ? 18.757 -8.002  19.991  1.00 97.12  ? 20   ARG B NE  1 
ATOM   2330 C  CZ  . ARG B 1 20  ? 19.569 -9.067  19.968  1.00 102.63 ? 20   ARG B CZ  1 
ATOM   2331 N  NH1 . ARG B 1 20  ? 19.819 -9.741  18.849  1.00 104.10 ? 20   ARG B NH1 1 
ATOM   2332 N  NH2 . ARG B 1 20  ? 20.139 -9.470  21.100  1.00 99.99  ? 20   ARG B NH2 1 
ATOM   2333 N  N   . TYR B 1 21  ? 21.603 -4.950  16.091  1.00 88.69  ? 21   TYR B N   1 
ATOM   2334 C  CA  . TYR B 1 21  ? 21.997 -3.568  16.290  1.00 81.59  ? 21   TYR B CA  1 
ATOM   2335 C  C   . TYR B 1 21  ? 23.049 -3.113  15.311  1.00 80.65  ? 21   TYR B C   1 
ATOM   2336 O  O   . TYR B 1 21  ? 23.992 -3.846  15.031  1.00 81.75  ? 21   TYR B O   1 
ATOM   2337 C  CB  . TYR B 1 21  ? 22.560 -3.390  17.689  1.00 79.19  ? 21   TYR B CB  1 
ATOM   2338 C  CG  . TYR B 1 21  ? 21.535 -3.592  18.748  1.00 80.61  ? 21   TYR B CG  1 
ATOM   2339 C  CD1 . TYR B 1 21  ? 20.415 -2.783  18.806  1.00 79.79  ? 21   TYR B CD1 1 
ATOM   2340 C  CD2 . TYR B 1 21  ? 21.678 -4.587  19.697  1.00 86.56  ? 21   TYR B CD2 1 
ATOM   2341 C  CE1 . TYR B 1 21  ? 19.458 -2.958  19.783  1.00 83.70  ? 21   TYR B CE1 1 
ATOM   2342 C  CE2 . TYR B 1 21  ? 20.722 -4.772  20.681  1.00 86.61  ? 21   TYR B CE2 1 
ATOM   2343 C  CZ  . TYR B 1 21  ? 19.614 -3.954  20.716  1.00 83.11  ? 21   TYR B CZ  1 
ATOM   2344 O  OH  . TYR B 1 21  ? 18.663 -4.131  21.685  1.00 80.44  ? 21   TYR B OH  1 
ATOM   2345 N  N   . GLU B 1 22  ? 22.889 -1.888  14.812  1.00 76.79  ? 22   GLU B N   1 
ATOM   2346 C  CA  . GLU B 1 22  ? 23.929 -1.243  14.020  1.00 69.72  ? 22   GLU B CA  1 
ATOM   2347 C  C   . GLU B 1 22  ? 24.752 -0.300  14.879  1.00 67.80  ? 22   GLU B C   1 
ATOM   2348 O  O   . GLU B 1 22  ? 24.202 0.480   15.656  1.00 66.63  ? 22   GLU B O   1 
ATOM   2349 C  CB  . GLU B 1 22  ? 23.359 -0.471  12.838  1.00 70.49  ? 22   GLU B CB  1 
ATOM   2350 C  CG  . GLU B 1 22  ? 24.467 0.236   12.063  1.00 74.86  ? 22   GLU B CG  1 
ATOM   2351 C  CD  . GLU B 1 22  ? 24.025 0.751   10.712  1.00 77.47  ? 22   GLU B CD  1 
ATOM   2352 O  OE1 . GLU B 1 22  ? 22.830 0.602   10.388  1.00 79.83  ? 22   GLU B OE1 1 
ATOM   2353 O  OE2 . GLU B 1 22  ? 24.874 1.304   9.975   1.00 74.84  ? 22   GLU B OE2 1 
ATOM   2354 N  N   . LEU B 1 23  ? 26.073 -0.363  14.751  1.00 66.49  ? 23   LEU B N   1 
ATOM   2355 C  CA  . LEU B 1 23  ? 26.897 0.622   15.423  1.00 62.96  ? 23   LEU B CA  1 
ATOM   2356 C  C   . LEU B 1 23  ? 26.655 1.969   14.756  1.00 63.31  ? 23   LEU B C   1 
ATOM   2357 O  O   . LEU B 1 23  ? 26.942 2.152   13.574  1.00 63.40  ? 23   LEU B O   1 
ATOM   2358 C  CB  . LEU B 1 23  ? 28.378 0.261   15.362  1.00 62.21  ? 23   LEU B CB  1 
ATOM   2359 C  CG  . LEU B 1 23  ? 29.376 1.308   15.861  1.00 67.76  ? 23   LEU B CG  1 
ATOM   2360 C  CD1 . LEU B 1 23  ? 29.139 1.669   17.313  1.00 67.20  ? 23   LEU B CD1 1 
ATOM   2361 C  CD2 . LEU B 1 23  ? 30.798 0.844   15.665  1.00 72.84  ? 23   LEU B CD2 1 
ATOM   2362 N  N   . VAL B 1 24  ? 26.097 2.898   15.524  1.00 61.28  ? 24   VAL B N   1 
ATOM   2363 C  CA  . VAL B 1 24  ? 25.980 4.277   15.103  1.00 57.63  ? 24   VAL B CA  1 
ATOM   2364 C  C   . VAL B 1 24  ? 27.262 5.077   15.353  1.00 57.70  ? 24   VAL B C   1 
ATOM   2365 O  O   . VAL B 1 24  ? 27.799 5.691   14.431  1.00 59.84  ? 24   VAL B O   1 
ATOM   2366 C  CB  . VAL B 1 24  ? 24.764 4.953   15.760  1.00 57.87  ? 24   VAL B CB  1 
ATOM   2367 C  CG1 . VAL B 1 24  ? 24.859 6.467   15.623  1.00 57.10  ? 24   VAL B CG1 1 
ATOM   2368 C  CG2 . VAL B 1 24  ? 23.486 4.417   15.140  1.00 53.17  ? 24   VAL B CG2 1 
ATOM   2369 N  N   . LYS B 1 25  ? 27.772 5.045   16.582  1.00 57.70  ? 25   LYS B N   1 
ATOM   2370 C  CA  . LYS B 1 25  ? 28.877 5.918   16.958  1.00 58.34  ? 25   LYS B CA  1 
ATOM   2371 C  C   . LYS B 1 25  ? 29.333 5.636   18.363  1.00 59.80  ? 25   LYS B C   1 
ATOM   2372 O  O   . LYS B 1 25  ? 28.522 5.583   19.269  1.00 63.96  ? 25   LYS B O   1 
ATOM   2373 C  CB  . LYS B 1 25  ? 28.413 7.375   16.894  1.00 59.41  ? 25   LYS B CB  1 
ATOM   2374 C  CG  . LYS B 1 25  ? 29.519 8.427   17.075  1.00 56.82  ? 25   LYS B CG  1 
ATOM   2375 C  CD  . LYS B 1 25  ? 30.378 8.548   15.814  1.00 58.33  ? 25   LYS B CD  1 
ATOM   2376 C  CE  . LYS B 1 25  ? 31.634 9.400   16.042  1.00 56.23  ? 25   LYS B CE  1 
ATOM   2377 N  NZ  . LYS B 1 25  ? 31.528 10.231  17.262  1.00 57.42  ? 25   LYS B NZ  1 
ATOM   2378 N  N   . ASP B 1 26  ? 30.630 5.486   18.566  1.00 62.26  ? 26   ASP B N   1 
ATOM   2379 C  CA  . ASP B 1 26  ? 31.134 5.387   19.926  1.00 68.60  ? 26   ASP B CA  1 
ATOM   2380 C  C   . ASP B 1 26  ? 31.255 6.764   20.579  1.00 69.94  ? 26   ASP B C   1 
ATOM   2381 O  O   . ASP B 1 26  ? 31.948 7.641   20.066  1.00 70.22  ? 26   ASP B O   1 
ATOM   2382 C  CB  . ASP B 1 26  ? 32.467 4.648   19.945  1.00 66.95  ? 26   ASP B CB  1 
ATOM   2383 C  CG  . ASP B 1 26  ? 32.325 3.186   19.544  1.00 72.96  ? 26   ASP B CG  1 
ATOM   2384 O  OD1 . ASP B 1 26  ? 31.239 2.603   19.775  1.00 71.58  ? 26   ASP B OD1 1 
ATOM   2385 O  OD2 . ASP B 1 26  ? 33.300 2.632   18.995  1.00 77.54  ? 26   ASP B OD2 1 
ATOM   2386 N  N   . ILE B 1 27  ? 30.568 6.974   21.700  1.00 76.82  ? 27   ILE B N   1 
ATOM   2387 C  CA  . ILE B 1 27  ? 30.697 8.253   22.417  1.00 82.15  ? 27   ILE B CA  1 
ATOM   2388 C  C   . ILE B 1 27  ? 31.375 8.099   23.764  1.00 85.62  ? 27   ILE B C   1 
ATOM   2389 O  O   . ILE B 1 27  ? 31.510 6.999   24.279  1.00 88.33  ? 27   ILE B O   1 
ATOM   2390 C  CB  . ILE B 1 27  ? 29.340 8.958   22.642  1.00 79.20  ? 27   ILE B CB  1 
ATOM   2391 C  CG1 . ILE B 1 27  ? 28.443 8.129   23.572  1.00 81.55  ? 27   ILE B CG1 1 
ATOM   2392 C  CG2 . ILE B 1 27  ? 28.678 9.282   21.301  1.00 68.51  ? 27   ILE B CG2 1 
ATOM   2393 C  CD1 . ILE B 1 27  ? 27.335 8.919   24.252  1.00 78.18  ? 27   ILE B CD1 1 
ATOM   2394 N  N   . GLY B 1 28  ? 31.782 9.213   24.351  1.00 93.95  ? 28   GLY B N   1 
ATOM   2395 C  CA  . GLY B 1 28  ? 32.493 9.140   25.612  1.00 104.76 ? 28   GLY B CA  1 
ATOM   2396 C  C   . GLY B 1 28  ? 32.446 10.365  26.503  1.00 109.62 ? 28   GLY B C   1 
ATOM   2397 O  O   . GLY B 1 28  ? 33.309 10.529  27.363  1.00 111.47 ? 28   GLY B O   1 
ATOM   2398 N  N   . SER B 1 29  ? 31.441 11.216  26.328  1.00 112.49 ? 29   SER B N   1 
ATOM   2399 C  CA  . SER B 1 29  ? 31.401 12.465  27.083  1.00 119.83 ? 29   SER B CA  1 
ATOM   2400 C  C   . SER B 1 29  ? 30.010 13.088  27.235  1.00 124.07 ? 29   SER B C   1 
ATOM   2401 O  O   . SER B 1 29  ? 29.773 14.228  26.817  1.00 125.57 ? 29   SER B O   1 
ATOM   2402 C  CB  . SER B 1 29  ? 32.378 13.472  26.475  1.00 120.87 ? 29   SER B CB  1 
ATOM   2403 O  OG  . SER B 1 29  ? 32.549 13.231  25.089  1.00 122.01 ? 29   SER B OG  1 
ATOM   2404 N  N   . GLY B 1 30  ? 29.101 12.332  27.842  1.00 118.47 ? 30   GLY B N   1 
ATOM   2405 C  CA  . GLY B 1 30  ? 27.817 12.861  28.254  1.00 113.67 ? 30   GLY B CA  1 
ATOM   2406 C  C   . GLY B 1 30  ? 27.565 12.434  29.680  1.00 110.36 ? 30   GLY B C   1 
ATOM   2407 O  O   . GLY B 1 30  ? 28.480 12.420  30.503  1.00 111.82 ? 30   GLY B O   1 
ATOM   2408 N  N   . ASN B 1 31  ? 26.318 12.088  29.973  1.00 106.38 ? 31   ASN B N   1 
ATOM   2409 C  CA  . ASN B 1 31  ? 25.972 11.464  31.249  1.00 105.42 ? 31   ASN B CA  1 
ATOM   2410 C  C   . ASN B 1 31  ? 25.482 10.036  31.005  1.00 100.37 ? 31   ASN B C   1 
ATOM   2411 O  O   . ASN B 1 31  ? 25.229 9.264   31.945  1.00 94.53  ? 31   ASN B O   1 
ATOM   2412 C  CB  . ASN B 1 31  ? 24.968 12.307  32.048  1.00 98.48  ? 31   ASN B CB  1 
ATOM   2413 C  CG  . ASN B 1 31  ? 23.863 12.872  31.189  1.00 87.55  ? 31   ASN B CG  1 
ATOM   2414 O  OD1 . ASN B 1 31  ? 22.684 12.685  31.485  1.00 83.25  ? 31   ASN B OD1 1 
ATOM   2415 N  ND2 . ASN B 1 31  ? 24.238 13.579  30.120  1.00 89.63  ? 31   ASN B ND2 1 
ATOM   2416 N  N   . PHE B 1 32  ? 25.364 9.696   29.723  1.00 98.05  ? 32   PHE B N   1 
ATOM   2417 C  CA  . PHE B 1 32  ? 25.271 8.297   29.310  1.00 99.02  ? 32   PHE B CA  1 
ATOM   2418 C  C   . PHE B 1 32  ? 26.670 7.681   29.419  1.00 101.34 ? 32   PHE B C   1 
ATOM   2419 O  O   . PHE B 1 32  ? 26.881 6.509   29.089  1.00 95.87  ? 32   PHE B O   1 
ATOM   2420 C  CB  . PHE B 1 32  ? 24.717 8.167   27.882  1.00 88.74  ? 32   PHE B CB  1 
ATOM   2421 C  CG  . PHE B 1 32  ? 23.208 8.166   27.806  1.00 80.66  ? 32   PHE B CG  1 
ATOM   2422 C  CD1 . PHE B 1 32  ? 22.486 7.027   28.134  1.00 76.83  ? 32   PHE B CD1 1 
ATOM   2423 C  CD2 . PHE B 1 32  ? 22.515 9.296   27.401  1.00 74.11  ? 32   PHE B CD2 1 
ATOM   2424 C  CE1 . PHE B 1 32  ? 21.098 7.017   28.064  1.00 64.67  ? 32   PHE B CE1 1 
ATOM   2425 C  CE2 . PHE B 1 32  ? 21.123 9.297   27.321  1.00 66.57  ? 32   PHE B CE2 1 
ATOM   2426 C  CZ  . PHE B 1 32  ? 20.418 8.165   27.651  1.00 62.34  ? 32   PHE B CZ  1 
ATOM   2427 N  N   . GLY B 1 33  ? 27.616 8.508   29.874  1.00 105.77 ? 33   GLY B N   1 
ATOM   2428 C  CA  . GLY B 1 33  ? 28.976 8.096   30.186  1.00 103.56 ? 33   GLY B CA  1 
ATOM   2429 C  C   . GLY B 1 33  ? 29.872 7.912   28.980  1.00 103.01 ? 33   GLY B C   1 
ATOM   2430 O  O   . GLY B 1 33  ? 29.770 8.657   27.996  1.00 103.98 ? 33   GLY B O   1 
ATOM   2431 N  N   . VAL B 1 34  ? 30.777 6.937   29.088  1.00 101.68 ? 34   VAL B N   1 
ATOM   2432 C  CA  . VAL B 1 34  ? 31.480 6.391   27.936  1.00 100.97 ? 34   VAL B CA  1 
ATOM   2433 C  C   . VAL B 1 34  ? 30.580 5.266   27.464  1.00 97.88  ? 34   VAL B C   1 
ATOM   2434 O  O   . VAL B 1 34  ? 30.264 4.356   28.239  1.00 94.54  ? 34   VAL B O   1 
ATOM   2435 C  CB  . VAL B 1 34  ? 32.849 5.783   28.307  1.00 102.55 ? 34   VAL B CB  1 
ATOM   2436 C  CG1 . VAL B 1 34  ? 33.865 6.033   27.196  1.00 98.05  ? 34   VAL B CG1 1 
ATOM   2437 C  CG2 . VAL B 1 34  ? 33.346 6.320   29.649  1.00 103.78 ? 34   VAL B CG2 1 
ATOM   2438 N  N   . ALA B 1 35  ? 30.141 5.325   26.211  1.00 93.24  ? 35   ALA B N   1 
ATOM   2439 C  CA  . ALA B 1 35  ? 29.148 4.373   25.743  1.00 84.34  ? 35   ALA B CA  1 
ATOM   2440 C  C   . ALA B 1 35  ? 29.209 4.113   24.258  1.00 78.12  ? 35   ALA B C   1 
ATOM   2441 O  O   . ALA B 1 35  ? 29.924 4.776   23.509  1.00 78.42  ? 35   ALA B O   1 
ATOM   2442 C  CB  . ALA B 1 35  ? 27.750 4.834   26.133  1.00 79.73  ? 35   ALA B CB  1 
ATOM   2443 N  N   . ARG B 1 36  ? 28.447 3.120   23.833  1.00 75.96  ? 36   ARG B N   1 
ATOM   2444 C  CA  . ARG B 1 36  ? 28.267 2.873   22.415  1.00 72.38  ? 36   ARG B CA  1 
ATOM   2445 C  C   . ARG B 1 36  ? 26.852 3.229   21.945  1.00 66.60  ? 36   ARG B C   1 
ATOM   2446 O  O   . ARG B 1 36  ? 25.850 2.853   22.544  1.00 66.06  ? 36   ARG B O   1 
ATOM   2447 C  CB  . ARG B 1 36  ? 28.632 1.435   22.053  1.00 71.96  ? 36   ARG B CB  1 
ATOM   2448 C  CG  . ARG B 1 36  ? 28.349 1.095   20.608  1.00 73.06  ? 36   ARG B CG  1 
ATOM   2449 C  CD  . ARG B 1 36  ? 29.000 -0.219  20.225  1.00 78.88  ? 36   ARG B CD  1 
ATOM   2450 N  NE  . ARG B 1 36  ? 30.451 -0.089  20.148  1.00 83.23  ? 36   ARG B NE  1 
ATOM   2451 C  CZ  . ARG B 1 36  ? 31.302 -1.111  20.174  1.00 88.27  ? 36   ARG B CZ  1 
ATOM   2452 N  NH1 . ARG B 1 36  ? 30.843 -2.351  20.294  1.00 92.64  ? 36   ARG B NH1 1 
ATOM   2453 N  NH2 . ARG B 1 36  ? 32.612 -0.889  20.095  1.00 91.26  ? 36   ARG B NH2 1 
ATOM   2454 N  N   . LEU B 1 37  ? 26.796 3.980   20.858  1.00 62.72  ? 37   LEU B N   1 
ATOM   2455 C  CA  . LEU B 1 37  ? 25.537 4.417   20.306  1.00 61.74  ? 37   LEU B CA  1 
ATOM   2456 C  C   . LEU B 1 37  ? 25.159 3.535   19.128  1.00 58.14  ? 37   LEU B C   1 
ATOM   2457 O  O   . LEU B 1 37  ? 25.916 3.428   18.159  1.00 58.33  ? 37   LEU B O   1 
ATOM   2458 C  CB  . LEU B 1 37  ? 25.652 5.873   19.877  1.00 59.02  ? 37   LEU B CB  1 
ATOM   2459 C  CG  . LEU B 1 37  ? 24.645 6.818   20.511  1.00 59.48  ? 37   LEU B CG  1 
ATOM   2460 C  CD1 . LEU B 1 37  ? 24.729 6.714   22.011  1.00 56.10  ? 37   LEU B CD1 1 
ATOM   2461 C  CD2 . LEU B 1 37  ? 24.955 8.222   20.047  1.00 58.99  ? 37   LEU B CD2 1 
ATOM   2462 N  N   . MET B 1 38  ? 23.982 2.918   19.225  1.00 56.60  ? 38   MET B N   1 
ATOM   2463 C  CA  . MET B 1 38  ? 23.576 1.844   18.312  1.00 62.12  ? 38   MET B CA  1 
ATOM   2464 C  C   . MET B 1 38  ? 22.119 1.972   17.886  1.00 58.27  ? 38   MET B C   1 
ATOM   2465 O  O   . MET B 1 38  ? 21.296 2.397   18.678  1.00 55.67  ? 38   MET B O   1 
ATOM   2466 C  CB  . MET B 1 38  ? 23.772 0.499   19.016  1.00 63.96  ? 38   MET B CB  1 
ATOM   2467 C  CG  . MET B 1 38  ? 24.678 -0.484  18.293  1.00 68.30  ? 38   MET B CG  1 
ATOM   2468 S  SD  . MET B 1 38  ? 25.357 -1.738  19.418  1.00 84.74  ? 38   MET B SD  1 
ATOM   2469 C  CE  . MET B 1 38  ? 25.783 -0.654  20.768  1.00 77.57  ? 38   MET B CE  1 
ATOM   2470 N  N   . ARG B 1 39  ? 21.801 1.597   16.648  1.00 60.06  ? 39   ARG B N   1 
ATOM   2471 C  CA  . ARG B 1 39  ? 20.404 1.521   16.200  1.00 66.93  ? 39   ARG B CA  1 
ATOM   2472 C  C   . ARG B 1 39  ? 19.904 0.090   16.166  1.00 74.66  ? 39   ARG B C   1 
ATOM   2473 O  O   . ARG B 1 39  ? 20.608 -0.803  15.684  1.00 70.72  ? 39   ARG B O   1 
ATOM   2474 C  CB  . ARG B 1 39  ? 20.236 2.129   14.813  1.00 66.95  ? 39   ARG B CB  1 
ATOM   2475 C  CG  . ARG B 1 39  ? 18.781 2.267   14.323  1.00 71.79  ? 39   ARG B CG  1 
ATOM   2476 C  CD  . ARG B 1 39  ? 18.751 2.848   12.896  1.00 76.95  ? 39   ARG B CD  1 
ATOM   2477 N  NE  . ARG B 1 39  ? 19.713 2.168   12.026  1.00 86.79  ? 39   ARG B NE  1 
ATOM   2478 C  CZ  . ARG B 1 39  ? 19.454 1.061   11.331  1.00 83.93  ? 39   ARG B CZ  1 
ATOM   2479 N  NH1 . ARG B 1 39  ? 18.252 0.496   11.384  1.00 80.29  ? 39   ARG B NH1 1 
ATOM   2480 N  NH2 . ARG B 1 39  ? 20.398 0.511   10.580  1.00 80.48  ? 39   ARG B NH2 1 
ATOM   2481 N  N   . ASP B 1 40  ? 18.691 -0.121  16.682  1.00 77.64  ? 40   ASP B N   1 
ATOM   2482 C  CA  . ASP B 1 40  ? 18.004 -1.406  16.552  1.00 78.31  ? 40   ASP B CA  1 
ATOM   2483 C  C   . ASP B 1 40  ? 17.417 -1.554  15.144  1.00 79.84  ? 40   ASP B C   1 
ATOM   2484 O  O   . ASP B 1 40  ? 16.513 -0.815  14.746  1.00 78.61  ? 40   ASP B O   1 
ATOM   2485 C  CB  . ASP B 1 40  ? 16.911 -1.548  17.606  1.00 82.09  ? 40   ASP B CB  1 
ATOM   2486 C  CG  . ASP B 1 40  ? 16.166 -2.862  17.494  1.00 85.46  ? 40   ASP B CG  1 
ATOM   2487 O  OD1 . ASP B 1 40  ? 15.440 -3.041  16.492  1.00 85.20  ? 40   ASP B OD1 1 
ATOM   2488 O  OD2 . ASP B 1 40  ? 16.300 -3.712  18.402  1.00 85.33  ? 40   ASP B OD2 1 
ATOM   2489 N  N   . LYS B 1 41  ? 17.939 -2.520  14.398  1.00 81.92  ? 41   LYS B N   1 
ATOM   2490 C  CA  . LYS B 1 41  ? 17.640 -2.631  12.978  1.00 80.44  ? 41   LYS B CA  1 
ATOM   2491 C  C   . LYS B 1 41  ? 16.197 -3.040  12.703  1.00 84.79  ? 41   LYS B C   1 
ATOM   2492 O  O   . LYS B 1 41  ? 15.846 -3.372  11.579  1.00 84.77  ? 41   LYS B O   1 
ATOM   2493 C  CB  . LYS B 1 41  ? 18.616 -3.598  12.317  1.00 83.73  ? 41   LYS B CB  1 
ATOM   2494 C  CG  . LYS B 1 41  ? 20.062 -3.302  12.663  1.00 82.35  ? 41   LYS B CG  1 
ATOM   2495 C  CD  . LYS B 1 41  ? 20.988 -4.436  12.260  1.00 86.06  ? 41   LYS B CD  1 
ATOM   2496 C  CE  . LYS B 1 41  ? 21.171 -4.509  10.756  1.00 88.34  ? 41   LYS B CE  1 
ATOM   2497 N  NZ  . LYS B 1 41  ? 22.170 -5.543  10.375  1.00 87.93  ? 41   LYS B NZ  1 
ATOM   2498 N  N   . GLN B 1 42  ? 15.353 -2.992  13.727  1.00 88.02  ? 42   GLN B N   1 
ATOM   2499 C  CA  . GLN B 1 42  ? 13.943 -3.332  13.566  1.00 88.79  ? 42   GLN B CA  1 
ATOM   2500 C  C   . GLN B 1 42  ? 13.060 -2.147  13.958  1.00 85.71  ? 42   GLN B C   1 
ATOM   2501 O  O   . GLN B 1 42  ? 12.167 -1.740  13.206  1.00 82.89  ? 42   GLN B O   1 
ATOM   2502 C  CB  . GLN B 1 42  ? 13.596 -4.556  14.412  1.00 88.55  ? 42   GLN B CB  1 
ATOM   2503 C  CG  . GLN B 1 42  ? 14.709 -5.600  14.453  1.00 92.84  ? 42   GLN B CG  1 
ATOM   2504 C  CD  . GLN B 1 42  ? 15.184 -5.910  15.870  1.00 94.49  ? 42   GLN B CD  1 
ATOM   2505 O  OE1 . GLN B 1 42  ? 16.376 -5.805  16.176  1.00 89.40  ? 42   GLN B OE1 1 
ATOM   2506 N  NE2 . GLN B 1 42  ? 14.251 -6.306  16.737  1.00 92.31  ? 42   GLN B NE2 1 
ATOM   2507 N  N   . SER B 1 43  ? 13.317 -1.601  15.143  1.00 82.04  ? 43   SER B N   1 
ATOM   2508 C  CA  . SER B 1 43  ? 12.601 -0.421  15.608  1.00 82.80  ? 43   SER B CA  1 
ATOM   2509 C  C   . SER B 1 43  ? 13.229 0.846   15.029  1.00 80.68  ? 43   SER B C   1 
ATOM   2510 O  O   . SER B 1 43  ? 12.647 1.930   15.087  1.00 76.34  ? 43   SER B O   1 
ATOM   2511 C  CB  . SER B 1 43  ? 12.588 -0.356  17.148  1.00 80.74  ? 43   SER B CB  1 
ATOM   2512 O  OG  . SER B 1 43  ? 13.894 -0.371  17.690  1.00 80.03  ? 43   SER B OG  1 
ATOM   2513 N  N   . ASN B 1 44  ? 14.411 0.689   14.446  1.00 79.08  ? 44   ASN B N   1 
ATOM   2514 C  CA  . ASN B 1 44  ? 15.276 1.828   14.193  1.00 81.34  ? 44   ASN B CA  1 
ATOM   2515 C  C   . ASN B 1 44  ? 15.531 2.627   15.454  1.00 78.47  ? 44   ASN B C   1 
ATOM   2516 O  O   . ASN B 1 44  ? 16.065 3.722   15.394  1.00 79.36  ? 44   ASN B O   1 
ATOM   2517 C  CB  . ASN B 1 44  ? 14.730 2.734   13.084  1.00 81.61  ? 44   ASN B CB  1 
ATOM   2518 C  CG  . ASN B 1 44  ? 15.253 2.345   11.718  1.00 85.27  ? 44   ASN B CG  1 
ATOM   2519 O  OD1 . ASN B 1 44  ? 15.292 1.156   11.370  1.00 86.49  ? 44   ASN B OD1 1 
ATOM   2520 N  ND2 . ASN B 1 44  ? 15.697 3.334   10.949  1.00 82.36  ? 44   ASN B ND2 1 
ATOM   2521 N  N   . GLU B 1 45  ? 15.167 2.068   16.599  1.00 76.63  ? 45   GLU B N   1 
ATOM   2522 C  CA  . GLU B 1 45  ? 15.372 2.755   17.867  1.00 74.25  ? 45   GLU B CA  1 
ATOM   2523 C  C   . GLU B 1 45  ? 16.848 3.005   18.195  1.00 71.23  ? 45   GLU B C   1 
ATOM   2524 O  O   . GLU B 1 45  ? 17.698 2.129   18.018  1.00 68.83  ? 45   GLU B O   1 
ATOM   2525 C  CB  . GLU B 1 45  ? 14.717 1.970   19.003  1.00 76.79  ? 45   GLU B CB  1 
ATOM   2526 C  CG  . GLU B 1 45  ? 13.860 2.813   19.938  1.00 75.64  ? 45   GLU B CG  1 
ATOM   2527 C  CD  . GLU B 1 45  ? 14.463 2.930   21.325  1.00 79.23  ? 45   GLU B CD  1 
ATOM   2528 O  OE1 . GLU B 1 45  ? 14.859 1.883   21.881  1.00 72.93  ? 45   GLU B OE1 1 
ATOM   2529 O  OE2 . GLU B 1 45  ? 14.535 4.063   21.857  1.00 79.51  ? 45   GLU B OE2 1 
ATOM   2530 N  N   . LEU B 1 46  ? 17.138 4.212   18.676  1.00 66.71  ? 46   LEU B N   1 
ATOM   2531 C  CA  . LEU B 1 46  ? 18.468 4.538   19.171  1.00 60.47  ? 46   LEU B CA  1 
ATOM   2532 C  C   . LEU B 1 46  ? 18.680 4.114   20.611  1.00 59.28  ? 46   LEU B C   1 
ATOM   2533 O  O   . LEU B 1 46  ? 17.871 4.397   21.493  1.00 63.96  ? 46   LEU B O   1 
ATOM   2534 C  CB  . LEU B 1 46  ? 18.743 6.026   19.066  1.00 55.90  ? 46   LEU B CB  1 
ATOM   2535 C  CG  . LEU B 1 46  ? 20.128 6.360   18.530  1.00 57.23  ? 46   LEU B CG  1 
ATOM   2536 C  CD1 . LEU B 1 46  ? 20.449 5.491   17.308  1.00 54.04  ? 46   LEU B CD1 1 
ATOM   2537 C  CD2 . LEU B 1 46  ? 20.168 7.819   18.182  1.00 55.52  ? 46   LEU B CD2 1 
ATOM   2538 N  N   . VAL B 1 47  ? 19.807 3.468   20.848  1.00 55.30  ? 47   VAL B N   1 
ATOM   2539 C  CA  . VAL B 1 47  ? 20.103 2.950   22.156  1.00 60.00  ? 47   VAL B CA  1 
ATOM   2540 C  C   . VAL B 1 47  ? 21.557 3.157   22.543  1.00 58.50  ? 47   VAL B C   1 
ATOM   2541 O  O   . VAL B 1 47  ? 22.459 3.195   21.694  1.00 58.52  ? 47   VAL B O   1 
ATOM   2542 C  CB  . VAL B 1 47  ? 19.747 1.455   22.235  1.00 62.58  ? 47   VAL B CB  1 
ATOM   2543 C  CG1 . VAL B 1 47  ? 18.326 1.244   21.765  1.00 60.84  ? 47   VAL B CG1 1 
ATOM   2544 C  CG2 . VAL B 1 47  ? 20.730 0.608   21.399  1.00 59.33  ? 47   VAL B CG2 1 
ATOM   2545 N  N   . ALA B 1 48  ? 21.761 3.273   23.851  1.00 60.66  ? 48   ALA B N   1 
ATOM   2546 C  CA  . ALA B 1 48  ? 23.081 3.420   24.439  1.00 61.80  ? 48   ALA B CA  1 
ATOM   2547 C  C   . ALA B 1 48  ? 23.501 2.081   25.018  1.00 63.43  ? 48   ALA B C   1 
ATOM   2548 O  O   . ALA B 1 48  ? 22.659 1.354   25.496  1.00 61.26  ? 48   ALA B O   1 
ATOM   2549 C  CB  . ALA B 1 48  ? 23.023 4.462   25.521  1.00 63.04  ? 48   ALA B CB  1 
ATOM   2550 N  N   . VAL B 1 49  ? 24.793 1.763   24.970  1.00 65.07  ? 49   VAL B N   1 
ATOM   2551 C  CA  . VAL B 1 49  ? 25.338 0.496   25.465  1.00 67.84  ? 49   VAL B CA  1 
ATOM   2552 C  C   . VAL B 1 49  ? 26.606 0.716   26.284  1.00 69.71  ? 49   VAL B C   1 
ATOM   2553 O  O   . VAL B 1 49  ? 27.654 1.048   25.739  1.00 73.57  ? 49   VAL B O   1 
ATOM   2554 C  CB  . VAL B 1 49  ? 25.699 -0.472  24.307  1.00 67.85  ? 49   VAL B CB  1 
ATOM   2555 C  CG1 . VAL B 1 49  ? 26.365 -1.712  24.846  1.00 72.56  ? 49   VAL B CG1 1 
ATOM   2556 C  CG2 . VAL B 1 49  ? 24.466 -0.854  23.528  1.00 62.04  ? 49   VAL B CG2 1 
ATOM   2557 N  N   . LYS B 1 50  ? 26.498 0.534   27.595  1.00 70.21  ? 50   LYS B N   1 
ATOM   2558 C  CA  . LYS B 1 50  ? 27.642 0.574   28.499  1.00 77.75  ? 50   LYS B CA  1 
ATOM   2559 C  C   . LYS B 1 50  ? 28.357 -0.781  28.600  1.00 80.14  ? 50   LYS B C   1 
ATOM   2560 O  O   . LYS B 1 50  ? 27.865 -1.787  28.088  1.00 77.37  ? 50   LYS B O   1 
ATOM   2561 C  CB  . LYS B 1 50  ? 27.211 1.064   29.882  1.00 77.84  ? 50   LYS B CB  1 
ATOM   2562 C  CG  . LYS B 1 50  ? 26.969 2.571   29.946  1.00 83.47  ? 50   LYS B CG  1 
ATOM   2563 C  CD  . LYS B 1 50  ? 27.313 3.161   31.316  1.00 93.59  ? 50   LYS B CD  1 
ATOM   2564 C  CE  . LYS B 1 50  ? 28.000 4.522   31.160  1.00 96.24  ? 50   LYS B CE  1 
ATOM   2565 N  NZ  . LYS B 1 50  ? 28.202 5.220   32.455  1.00 99.79  ? 50   LYS B NZ  1 
ATOM   2566 N  N   . TYR B 1 51  ? 29.526 -0.816  29.234  1.00 82.89  ? 51   TYR B N   1 
ATOM   2567 C  CA  . TYR B 1 51  ? 30.292 -2.061  29.322  1.00 81.76  ? 51   TYR B CA  1 
ATOM   2568 C  C   . TYR B 1 51  ? 31.109 -2.127  30.618  1.00 85.07  ? 51   TYR B C   1 
ATOM   2569 O  O   . TYR B 1 51  ? 31.694 -1.129  31.040  1.00 88.22  ? 51   TYR B O   1 
ATOM   2570 C  CB  . TYR B 1 51  ? 31.243 -2.201  28.129  1.00 81.93  ? 51   TYR B CB  1 
ATOM   2571 C  CG  . TYR B 1 51  ? 30.591 -2.343  26.765  1.00 84.15  ? 51   TYR B CG  1 
ATOM   2572 C  CD1 . TYR B 1 51  ? 30.225 -1.224  26.026  1.00 82.54  ? 51   TYR B CD1 1 
ATOM   2573 C  CD2 . TYR B 1 51  ? 30.385 -3.592  26.197  1.00 84.38  ? 51   TYR B CD2 1 
ATOM   2574 C  CE1 . TYR B 1 51  ? 29.646 -1.343  24.768  1.00 81.93  ? 51   TYR B CE1 1 
ATOM   2575 C  CE2 . TYR B 1 51  ? 29.808 -3.724  24.939  1.00 86.73  ? 51   TYR B CE2 1 
ATOM   2576 C  CZ  . TYR B 1 51  ? 29.438 -2.597  24.228  1.00 86.27  ? 51   TYR B CZ  1 
ATOM   2577 O  OH  . TYR B 1 51  ? 28.859 -2.733  22.980  1.00 83.76  ? 51   TYR B OH  1 
ATOM   2578 N  N   . ILE B 1 52  ? 31.147 -3.311  31.230  1.00 89.84  ? 52   ILE B N   1 
ATOM   2579 C  CA  . ILE B 1 52  ? 31.927 -3.564  32.436  1.00 91.94  ? 52   ILE B CA  1 
ATOM   2580 C  C   . ILE B 1 52  ? 32.673 -4.875  32.243  1.00 94.14  ? 52   ILE B C   1 
ATOM   2581 O  O   . ILE B 1 52  ? 32.028 -5.920  32.292  1.00 94.30  ? 52   ILE B O   1 
ATOM   2582 C  CB  . ILE B 1 52  ? 31.017 -3.821  33.673  1.00 94.24  ? 52   ILE B CB  1 
ATOM   2583 C  CG1 . ILE B 1 52  ? 29.834 -2.867  33.744  1.00 86.04  ? 52   ILE B CG1 1 
ATOM   2584 C  CG2 . ILE B 1 52  ? 31.835 -3.773  34.975  1.00 96.64  ? 52   ILE B CG2 1 
ATOM   2585 C  CD1 . ILE B 1 52  ? 29.508 -2.461  35.174  1.00 87.22  ? 52   ILE B CD1 1 
ATOM   2586 N  N   . GLU B 1 53  ? 33.996 -4.851  32.061  1.00 97.24  ? 53   GLU B N   1 
ATOM   2587 C  CA  . GLU B 1 53  ? 34.757 -6.097  31.911  1.00 98.25  ? 53   GLU B CA  1 
ATOM   2588 C  C   . GLU B 1 53  ? 34.179 -7.283  32.696  1.00 100.69 ? 53   GLU B C   1 
ATOM   2589 O  O   . GLU B 1 53  ? 33.727 -7.126  33.838  1.00 101.42 ? 53   GLU B O   1 
ATOM   2590 C  CB  . GLU B 1 53  ? 36.200 -5.897  32.344  1.00 99.45  ? 53   GLU B CB  1 
ATOM   2591 C  CG  . GLU B 1 53  ? 36.957 -4.862  31.551  1.00 103.73 ? 53   GLU B CG  1 
ATOM   2592 C  CD  . GLU B 1 53  ? 38.379 -4.725  32.031  1.00 107.46 ? 53   GLU B CD  1 
ATOM   2593 O  OE1 . GLU B 1 53  ? 38.605 -3.927  32.963  1.00 107.09 ? 53   GLU B OE1 1 
ATOM   2594 O  OE2 . GLU B 1 53  ? 39.265 -5.415  31.478  1.00 109.49 ? 53   GLU B OE2 1 
ATOM   2595 N  N   . ARG B 1 54  ? 34.193 -8.469  32.087  1.00 102.92 ? 54   ARG B N   1 
ATOM   2596 C  CA  . ARG B 1 54  ? 33.826 -9.694  32.812  1.00 106.60 ? 54   ARG B CA  1 
ATOM   2597 C  C   . ARG B 1 54  ? 34.864 -10.001 33.903  1.00 110.16 ? 54   ARG B C   1 
ATOM   2598 O  O   . ARG B 1 54  ? 36.066 -9.814  33.703  1.00 105.23 ? 54   ARG B O   1 
ATOM   2599 C  CB  . ARG B 1 54  ? 33.701 -10.903 31.864  1.00 104.76 ? 54   ARG B CB  1 
ATOM   2600 C  CG  . ARG B 1 54  ? 32.314 -11.145 31.272  1.00 103.11 ? 54   ARG B CG  1 
ATOM   2601 C  CD  . ARG B 1 54  ? 32.341 -12.188 30.143  1.00 104.10 ? 54   ARG B CD  1 
ATOM   2602 N  NE  . ARG B 1 54  ? 32.863 -13.497 30.551  1.00 108.29 ? 54   ARG B NE  1 
ATOM   2603 C  CZ  . ARG B 1 54  ? 32.493 -14.656 30.008  1.00 108.14 ? 54   ARG B CZ  1 
ATOM   2604 N  NH1 . ARG B 1 54  ? 31.587 -14.679 29.040  1.00 104.10 ? 54   ARG B NH1 1 
ATOM   2605 N  NH2 . ARG B 1 54  ? 33.019 -15.799 30.438  1.00 113.43 ? 54   ARG B NH2 1 
ATOM   2606 N  N   . GLY B 1 55  ? 34.408 -10.485 35.053  1.00 112.96 ? 55   GLY B N   1 
ATOM   2607 C  CA  . GLY B 1 55  ? 35.331 -10.830 36.116  1.00 112.77 ? 55   GLY B CA  1 
ATOM   2608 C  C   . GLY B 1 55  ? 34.852 -10.375 37.474  1.00 114.65 ? 55   GLY B C   1 
ATOM   2609 O  O   . GLY B 1 55  ? 33.677 -10.535 37.807  1.00 114.66 ? 55   GLY B O   1 
ATOM   2610 N  N   . GLU B 1 56  ? 35.766 -9.800  38.253  1.00 117.67 ? 56   GLU B N   1 
ATOM   2611 C  CA  . GLU B 1 56  ? 35.479 -9.409  39.635  1.00 122.48 ? 56   GLU B CA  1 
ATOM   2612 C  C   . GLU B 1 56  ? 34.493 -8.239  39.732  1.00 120.25 ? 56   GLU B C   1 
ATOM   2613 O  O   . GLU B 1 56  ? 33.852 -8.028  40.767  1.00 117.56 ? 56   GLU B O   1 
ATOM   2614 C  CB  . GLU B 1 56  ? 36.779 -9.076  40.380  1.00 123.57 ? 56   GLU B CB  1 
ATOM   2615 C  CG  . GLU B 1 56  ? 37.357 -7.691  40.079  1.00 124.17 ? 56   GLU B CG  1 
ATOM   2616 C  CD  . GLU B 1 56  ? 37.176 -6.705  41.231  1.00 127.03 ? 56   GLU B CD  1 
ATOM   2617 O  OE1 . GLU B 1 56  ? 36.477 -7.047  42.214  1.00 125.89 ? 56   GLU B OE1 1 
ATOM   2618 O  OE2 . GLU B 1 56  ? 37.736 -5.589  41.149  1.00 125.96 ? 56   GLU B OE2 1 
ATOM   2619 N  N   . LYS B 1 57  ? 34.376 -7.483  38.648  1.00 116.45 ? 57   LYS B N   1 
ATOM   2620 C  CA  . LYS B 1 57  ? 33.477 -6.345  38.617  1.00 114.86 ? 57   LYS B CA  1 
ATOM   2621 C  C   . LYS B 1 57  ? 32.012 -6.764  38.690  1.00 115.33 ? 57   LYS B C   1 
ATOM   2622 O  O   . LYS B 1 57  ? 31.224 -6.167  39.424  1.00 115.77 ? 57   LYS B O   1 
ATOM   2623 C  CB  . LYS B 1 57  ? 33.766 -5.504  37.384  1.00 112.94 ? 57   LYS B CB  1 
ATOM   2624 C  CG  . LYS B 1 57  ? 35.077 -4.772  37.526  1.00 112.64 ? 57   LYS B CG  1 
ATOM   2625 C  CD  . LYS B 1 57  ? 35.636 -4.291  36.214  1.00 107.94 ? 57   LYS B CD  1 
ATOM   2626 C  CE  . LYS B 1 57  ? 37.099 -3.945  36.397  1.00 108.53 ? 57   LYS B CE  1 
ATOM   2627 N  NZ  . LYS B 1 57  ? 37.652 -3.236  35.220  1.00 107.75 ? 57   LYS B NZ  1 
ATOM   2628 N  N   . ILE B 1 58  ? 31.657 -7.807  37.946  1.00 115.44 ? 58   ILE B N   1 
ATOM   2629 C  CA  . ILE B 1 58  ? 30.287 -8.310  37.936  1.00 115.92 ? 58   ILE B CA  1 
ATOM   2630 C  C   . ILE B 1 58  ? 29.840 -8.677  39.346  1.00 117.65 ? 58   ILE B C   1 
ATOM   2631 O  O   . ILE B 1 58  ? 29.594 -9.849  39.640  1.00 118.06 ? 58   ILE B O   1 
ATOM   2632 C  CB  . ILE B 1 58  ? 30.152 -9.564  37.052  1.00 113.85 ? 58   ILE B CB  1 
ATOM   2633 C  CG1 . ILE B 1 58  ? 31.170 -9.534  35.900  1.00 111.26 ? 58   ILE B CG1 1 
ATOM   2634 C  CG2 . ILE B 1 58  ? 28.702 -9.739  36.580  1.00 107.21 ? 58   ILE B CG2 1 
ATOM   2635 C  CD1 . ILE B 1 58  ? 30.730 -8.751  34.688  1.00 104.67 ? 58   ILE B CD1 1 
ATOM   2636 N  N   . ASP B 1 59  ? 29.723 -7.678  40.214  1.00 117.67 ? 59   ASP B N   1 
ATOM   2637 C  CA  . ASP B 1 59  ? 29.436 -7.942  41.619  1.00 118.45 ? 59   ASP B CA  1 
ATOM   2638 C  C   . ASP B 1 59  ? 27.962 -7.827  41.988  1.00 117.97 ? 59   ASP B C   1 
ATOM   2639 O  O   . ASP B 1 59  ? 27.081 -7.901  41.133  1.00 118.83 ? 59   ASP B O   1 
ATOM   2640 C  CB  . ASP B 1 59  ? 30.264 -7.024  42.520  1.00 119.20 ? 59   ASP B CB  1 
ATOM   2641 C  CG  . ASP B 1 59  ? 29.787 -5.584  42.486  1.00 119.32 ? 59   ASP B CG  1 
ATOM   2642 O  OD1 . ASP B 1 59  ? 28.832 -5.248  43.221  1.00 119.77 ? 59   ASP B OD1 1 
ATOM   2643 O  OD2 . ASP B 1 59  ? 30.375 -4.785  41.730  1.00 118.79 ? 59   ASP B OD2 1 
ATOM   2644 N  N   . GLU B 1 60  ? 27.711 -7.641  43.280  1.00 122.24 ? 60   GLU B N   1 
ATOM   2645 C  CA  . GLU B 1 60  ? 26.358 -7.591  43.830  1.00 122.98 ? 60   GLU B CA  1 
ATOM   2646 C  C   . GLU B 1 60  ? 25.678 -6.244  43.605  1.00 121.13 ? 60   GLU B C   1 
ATOM   2647 O  O   . GLU B 1 60  ? 24.484 -6.182  43.323  1.00 116.74 ? 60   GLU B O   1 
ATOM   2648 C  CB  . GLU B 1 60  ? 26.385 -7.904  45.332  1.00 122.70 ? 60   GLU B CB  1 
ATOM   2649 C  CG  . GLU B 1 60  ? 25.719 -9.229  45.710  1.00 124.25 ? 60   GLU B CG  1 
ATOM   2650 C  CD  . GLU B 1 60  ? 24.189 -9.200  45.596  1.00 127.14 ? 60   GLU B CD  1 
ATOM   2651 O  OE1 . GLU B 1 60  ? 23.588 -8.096  45.611  1.00 123.27 ? 60   GLU B OE1 1 
ATOM   2652 O  OE2 . GLU B 1 60  ? 23.587 -10.296 45.494  1.00 124.93 ? 60   GLU B OE2 1 
ATOM   2653 N  N   . ASN B 1 61  ? 26.442 -5.168  43.742  1.00 122.34 ? 61   ASN B N   1 
ATOM   2654 C  CA  . ASN B 1 61  ? 25.887 -3.828  43.634  1.00 122.08 ? 61   ASN B CA  1 
ATOM   2655 C  C   . ASN B 1 61  ? 25.511 -3.492  42.199  1.00 118.72 ? 61   ASN B C   1 
ATOM   2656 O  O   . ASN B 1 61  ? 24.561 -2.751  41.961  1.00 114.84 ? 61   ASN B O   1 
ATOM   2657 C  CB  . ASN B 1 61  ? 26.869 -2.828  44.214  1.00 121.54 ? 61   ASN B CB  1 
ATOM   2658 C  CG  . ASN B 1 61  ? 27.549 -3.367  45.452  1.00 123.51 ? 61   ASN B CG  1 
ATOM   2659 O  OD1 . ASN B 1 61  ? 27.013 -3.288  46.559  1.00 123.02 ? 61   ASN B OD1 1 
ATOM   2660 N  ND2 . ASN B 1 61  ? 28.724 -3.957  45.265  1.00 123.63 ? 61   ASN B ND2 1 
ATOM   2661 N  N   . VAL B 1 62  ? 26.269 -4.048  41.256  1.00 117.23 ? 62   VAL B N   1 
ATOM   2662 C  CA  . VAL B 1 62  ? 25.905 -4.056  39.845  1.00 113.07 ? 62   VAL B CA  1 
ATOM   2663 C  C   . VAL B 1 62  ? 24.565 -4.749  39.649  1.00 112.14 ? 62   VAL B C   1 
ATOM   2664 O  O   . VAL B 1 62  ? 23.592 -4.123  39.269  1.00 111.20 ? 62   VAL B O   1 
ATOM   2665 C  CB  . VAL B 1 62  ? 26.950 -4.818  39.017  1.00 112.52 ? 62   VAL B CB  1 
ATOM   2666 C  CG1 . VAL B 1 62  ? 26.359 -5.272  37.684  1.00 107.46 ? 62   VAL B CG1 1 
ATOM   2667 C  CG2 . VAL B 1 62  ? 28.191 -3.969  38.826  1.00 112.43 ? 62   VAL B CG2 1 
ATOM   2668 N  N   . LYS B 1 63  ? 24.535 -6.052  39.912  1.00 113.12 ? 63   LYS B N   1 
ATOM   2669 C  CA  . LYS B 1 63  ? 23.328 -6.860  39.769  1.00 112.40 ? 63   LYS B CA  1 
ATOM   2670 C  C   . LYS B 1 63  ? 22.154 -6.100  40.358  1.00 107.60 ? 63   LYS B C   1 
ATOM   2671 O  O   . LYS B 1 63  ? 21.052 -6.070  39.805  1.00 103.22 ? 63   LYS B O   1 
ATOM   2672 C  CB  . LYS B 1 63  ? 23.523 -8.178  40.517  1.00 116.41 ? 63   LYS B CB  1 
ATOM   2673 C  CG  . LYS B 1 63  ? 22.445 -9.226  40.313  1.00 115.35 ? 63   LYS B CG  1 
ATOM   2674 C  CD  . LYS B 1 63  ? 22.837 -10.528 41.012  1.00 118.90 ? 63   LYS B CD  1 
ATOM   2675 C  CE  . LYS B 1 63  ? 23.131 -10.309 42.485  1.00 121.41 ? 63   LYS B CE  1 
ATOM   2676 N  NZ  . LYS B 1 63  ? 23.235 -11.593 43.218  1.00 122.93 ? 63   LYS B NZ  1 
ATOM   2677 N  N   . ARG B 1 64  ? 22.419 -5.500  41.507  1.00 109.72 ? 64   ARG B N   1 
ATOM   2678 C  CA  . ARG B 1 64  ? 21.492 -4.618  42.177  1.00 111.98 ? 64   ARG B CA  1 
ATOM   2679 C  C   . ARG B 1 64  ? 21.017 -3.575  41.189  1.00 108.95 ? 64   ARG B C   1 
ATOM   2680 O  O   . ARG B 1 64  ? 19.875 -3.605  40.743  1.00 102.62 ? 64   ARG B O   1 
ATOM   2681 C  CB  . ARG B 1 64  ? 22.207 -3.939  43.348  1.00 116.79 ? 64   ARG B CB  1 
ATOM   2682 C  CG  . ARG B 1 64  ? 22.003 -4.596  44.707  1.00 119.46 ? 64   ARG B CG  1 
ATOM   2683 C  CD  . ARG B 1 64  ? 22.977 -4.031  45.729  1.00 123.48 ? 64   ARG B CD  1 
ATOM   2684 N  NE  . ARG B 1 64  ? 23.089 -2.577  45.638  1.00 127.35 ? 64   ARG B NE  1 
ATOM   2685 C  CZ  . ARG B 1 64  ? 23.876 -1.844  46.420  1.00 129.49 ? 64   ARG B CZ  1 
ATOM   2686 N  NH1 . ARG B 1 64  ? 24.618 -2.428  47.353  1.00 129.63 ? 64   ARG B NH1 1 
ATOM   2687 N  NH2 . ARG B 1 64  ? 23.924 -0.528  46.273  1.00 131.55 ? 64   ARG B NH2 1 
ATOM   2688 N  N   . GLU B 1 65  ? 21.902 -2.655  40.828  1.00 110.97 ? 65   GLU B N   1 
ATOM   2689 C  CA  . GLU B 1 65  ? 21.547 -1.614  39.882  1.00 105.56 ? 65   GLU B CA  1 
ATOM   2690 C  C   . GLU B 1 65  ? 20.749 -2.151  38.701  1.00 101.65 ? 65   GLU B C   1 
ATOM   2691 O  O   . GLU B 1 65  ? 19.745 -1.563  38.340  1.00 100.64 ? 65   GLU B O   1 
ATOM   2692 C  CB  . GLU B 1 65  ? 22.788 -0.860  39.422  1.00 106.23 ? 65   GLU B CB  1 
ATOM   2693 C  CG  . GLU B 1 65  ? 23.076 0.364   40.265  1.00 108.47 ? 65   GLU B CG  1 
ATOM   2694 C  CD  . GLU B 1 65  ? 24.256 1.138   39.740  1.00 113.75 ? 65   GLU B CD  1 
ATOM   2695 O  OE1 . GLU B 1 65  ? 25.398 0.687   39.966  1.00 115.02 ? 65   GLU B OE1 1 
ATOM   2696 O  OE2 . GLU B 1 65  ? 24.040 2.178   39.081  1.00 111.38 ? 65   GLU B OE2 1 
ATOM   2697 N  N   . ILE B 1 66  ? 21.160 -3.272  38.120  1.00 99.15  ? 66   ILE B N   1 
ATOM   2698 C  CA  . ILE B 1 66  ? 20.496 -3.761  36.927  1.00 97.44  ? 66   ILE B CA  1 
ATOM   2699 C  C   . ILE B 1 66  ? 19.041 -4.084  37.240  1.00 96.28  ? 66   ILE B C   1 
ATOM   2700 O  O   . ILE B 1 66  ? 18.127 -3.583  36.582  1.00 93.26  ? 66   ILE B O   1 
ATOM   2701 C  CB  . ILE B 1 66  ? 21.252 -4.941  36.262  1.00 98.49  ? 66   ILE B CB  1 
ATOM   2702 C  CG1 . ILE B 1 66  ? 22.652 -4.486  35.831  1.00 99.58  ? 66   ILE B CG1 1 
ATOM   2703 C  CG2 . ILE B 1 66  ? 20.481 -5.481  35.063  1.00 93.82  ? 66   ILE B CG2 1 
ATOM   2704 C  CD1 . ILE B 1 66  ? 23.471 -5.533  35.119  1.00 96.52  ? 66   ILE B CD1 1 
ATOM   2705 N  N   . ILE B 1 67  ? 18.821 -4.886  38.274  1.00 100.82 ? 67   ILE B N   1 
ATOM   2706 C  CA  . ILE B 1 67  ? 17.468 -5.316  38.615  1.00 100.87 ? 67   ILE B CA  1 
ATOM   2707 C  C   . ILE B 1 67  ? 16.619 -4.110  38.993  1.00 94.18  ? 67   ILE B C   1 
ATOM   2708 O  O   . ILE B 1 67  ? 15.525 -3.910  38.468  1.00 92.30  ? 67   ILE B O   1 
ATOM   2709 C  CB  . ILE B 1 67  ? 17.495 -6.285  39.797  1.00 101.95 ? 67   ILE B CB  1 
ATOM   2710 C  CG1 . ILE B 1 67  ? 18.462 -7.433  39.506  1.00 99.93  ? 67   ILE B CG1 1 
ATOM   2711 C  CG2 . ILE B 1 67  ? 16.085 -6.770  40.122  1.00 94.71  ? 67   ILE B CG2 1 
ATOM   2712 C  CD1 . ILE B 1 67  ? 18.137 -8.211  38.249  1.00 100.45 ? 67   ILE B CD1 1 
ATOM   2713 N  N   . ASN B 1 68  ? 17.153 -3.343  39.939  1.00 94.51  ? 68   ASN B N   1 
ATOM   2714 C  CA  . ASN B 1 68  ? 16.620 -2.068  40.377  1.00 97.87  ? 68   ASN B CA  1 
ATOM   2715 C  C   . ASN B 1 68  ? 16.100 -1.228  39.210  1.00 93.20  ? 68   ASN B C   1 
ATOM   2716 O  O   . ASN B 1 68  ? 14.985 -0.722  39.247  1.00 88.99  ? 68   ASN B O   1 
ATOM   2717 C  CB  . ASN B 1 68  ? 17.738 -1.298  41.076  1.00 102.06 ? 68   ASN B CB  1 
ATOM   2718 C  CG  . ASN B 1 68  ? 17.402 -0.947  42.512  1.00 104.80 ? 68   ASN B CG  1 
ATOM   2719 O  OD1 . ASN B 1 68  ? 16.278 -0.553  42.814  1.00 105.10 ? 68   ASN B OD1 1 
ATOM   2720 N  ND2 . ASN B 1 68  ? 18.377 -1.092  43.407  1.00 102.62 ? 68   ASN B ND2 1 
ATOM   2721 N  N   . HIS B 1 69  ? 16.936 -1.102  38.179  1.00 95.33  ? 69   HIS B N   1 
ATOM   2722 C  CA  . HIS B 1 69  ? 16.693 -0.266  37.008  1.00 88.16  ? 69   HIS B CA  1 
ATOM   2723 C  C   . HIS B 1 69  ? 15.549 -0.841  36.220  1.00 84.84  ? 69   HIS B C   1 
ATOM   2724 O  O   . HIS B 1 69  ? 14.592 -0.142  35.906  1.00 84.02  ? 69   HIS B O   1 
ATOM   2725 C  CB  . HIS B 1 69  ? 17.956 -0.245  36.131  1.00 90.90  ? 69   HIS B CB  1 
ATOM   2726 C  CG  . HIS B 1 69  ? 17.961 0.810   35.056  1.00 92.72  ? 69   HIS B CG  1 
ATOM   2727 N  ND1 . HIS B 1 69  ? 18.908 1.817   35.007  1.00 90.41  ? 69   HIS B ND1 1 
ATOM   2728 C  CD2 . HIS B 1 69  ? 17.168 0.995   33.977  1.00 85.88  ? 69   HIS B CD2 1 
ATOM   2729 C  CE1 . HIS B 1 69  ? 18.681 2.581   33.955  1.00 87.13  ? 69   HIS B CE1 1 
ATOM   2730 N  NE2 . HIS B 1 69  ? 17.630 2.104   33.310  1.00 79.89  ? 69   HIS B NE2 1 
ATOM   2731 N  N   . ARG B 1 70  ? 15.662 -2.121  35.891  1.00 86.70  ? 70   ARG B N   1 
ATOM   2732 C  CA  . ARG B 1 70  ? 14.653 -2.775  35.080  1.00 85.02  ? 70   ARG B CA  1 
ATOM   2733 C  C   . ARG B 1 70  ? 13.256 -2.494  35.618  1.00 82.95  ? 70   ARG B C   1 
ATOM   2734 O  O   . ARG B 1 70  ? 12.302 -2.368  34.846  1.00 76.40  ? 70   ARG B O   1 
ATOM   2735 C  CB  . ARG B 1 70  ? 14.912 -4.269  35.031  1.00 86.51  ? 70   ARG B CB  1 
ATOM   2736 C  CG  . ARG B 1 70  ? 13.875 -5.018  34.247  1.00 91.29  ? 70   ARG B CG  1 
ATOM   2737 C  CD  . ARG B 1 70  ? 14.402 -6.369  33.849  1.00 96.54  ? 70   ARG B CD  1 
ATOM   2738 N  NE  . ARG B 1 70  ? 13.370 -7.186  33.236  1.00 107.76 ? 70   ARG B NE  1 
ATOM   2739 C  CZ  . ARG B 1 70  ? 12.720 -8.148  33.875  1.00 109.39 ? 70   ARG B CZ  1 
ATOM   2740 N  NH1 . ARG B 1 70  ? 13.005 -8.406  35.143  1.00 105.71 ? 70   ARG B NH1 1 
ATOM   2741 N  NH2 . ARG B 1 70  ? 11.791 -8.853  33.247  1.00 110.70 ? 70   ARG B NH2 1 
ATOM   2742 N  N   . SER B 1 71  ? 13.151 -2.377  36.943  1.00 83.51  ? 71   SER B N   1 
ATOM   2743 C  CA  . SER B 1 71  ? 11.873 -2.082  37.598  1.00 83.71  ? 71   SER B CA  1 
ATOM   2744 C  C   . SER B 1 71  ? 11.226 -0.804  37.049  1.00 84.25  ? 71   SER B C   1 
ATOM   2745 O  O   . SER B 1 71  ? 9.993  -0.688  37.003  1.00 84.31  ? 71   SER B O   1 
ATOM   2746 C  CB  . SER B 1 71  ? 12.047 -1.977  39.123  1.00 84.83  ? 71   SER B CB  1 
ATOM   2747 O  OG  . SER B 1 71  ? 12.786 -0.831  39.514  1.00 84.70  ? 71   SER B OG  1 
ATOM   2748 N  N   . LEU B 1 72  ? 12.070 0.143   36.631  1.00 81.76  ? 72   LEU B N   1 
ATOM   2749 C  CA  . LEU B 1 72  ? 11.628 1.442   36.139  1.00 75.39  ? 72   LEU B CA  1 
ATOM   2750 C  C   . LEU B 1 72  ? 11.070 1.355   34.726  1.00 73.36  ? 72   LEU B C   1 
ATOM   2751 O  O   . LEU B 1 72  ? 11.720 0.839   33.830  1.00 72.65  ? 72   LEU B O   1 
ATOM   2752 C  CB  . LEU B 1 72  ? 12.772 2.439   36.223  1.00 77.65  ? 72   LEU B CB  1 
ATOM   2753 C  CG  . LEU B 1 72  ? 13.222 2.612   37.668  1.00 79.92  ? 72   LEU B CG  1 
ATOM   2754 C  CD1 . LEU B 1 72  ? 14.395 3.564   37.771  1.00 77.22  ? 72   LEU B CD1 1 
ATOM   2755 C  CD2 . LEU B 1 72  ? 12.054 3.091   38.525  1.00 75.21  ? 72   LEU B CD2 1 
ATOM   2756 N  N   . ARG B 1 73  ? 9.862  1.880   34.542  1.00 71.98  ? 73   ARG B N   1 
ATOM   2757 C  CA  . ARG B 1 73  ? 9.050  1.562   33.379  1.00 73.79  ? 73   ARG B CA  1 
ATOM   2758 C  C   . ARG B 1 73  ? 8.296  2.787   32.891  1.00 72.79  ? 73   ARG B C   1 
ATOM   2759 O  O   . ARG B 1 73  ? 7.659  2.757   31.833  1.00 72.65  ? 73   ARG B O   1 
ATOM   2760 C  CB  . ARG B 1 73  ? 8.050  0.473   33.757  1.00 78.72  ? 73   ARG B CB  1 
ATOM   2761 C  CG  . ARG B 1 73  ? 8.671  -0.774  34.391  1.00 80.69  ? 73   ARG B CG  1 
ATOM   2762 C  CD  . ARG B 1 73  ? 8.935  -1.851  33.346  1.00 90.90  ? 73   ARG B CD  1 
ATOM   2763 N  NE  . ARG B 1 73  ? 7.798  -1.966  32.432  1.00 103.62 ? 73   ARG B NE  1 
ATOM   2764 C  CZ  . ARG B 1 73  ? 7.446  -3.071  31.775  1.00 110.36 ? 73   ARG B CZ  1 
ATOM   2765 N  NH1 . ARG B 1 73  ? 8.136  -4.198  31.919  1.00 109.12 ? 73   ARG B NH1 1 
ATOM   2766 N  NH2 . ARG B 1 73  ? 6.387  -3.049  30.971  1.00 109.89 ? 73   ARG B NH2 1 
ATOM   2767 N  N   . HIS B 1 74  ? 8.357  3.855   33.682  1.00 66.40  ? 74   HIS B N   1 
ATOM   2768 C  CA  . HIS B 1 74  ? 7.757  5.133   33.328  1.00 63.41  ? 74   HIS B CA  1 
ATOM   2769 C  C   . HIS B 1 74  ? 8.504  5.691   32.125  1.00 65.33  ? 74   HIS B C   1 
ATOM   2770 O  O   . HIS B 1 74  ? 9.732  5.684   32.096  1.00 64.38  ? 74   HIS B O   1 
ATOM   2771 C  CB  . HIS B 1 74  ? 7.893  6.087   34.508  1.00 62.76  ? 74   HIS B CB  1 
ATOM   2772 C  CG  . HIS B 1 74  ? 7.171  7.383   34.333  1.00 63.93  ? 74   HIS B CG  1 
ATOM   2773 N  ND1 . HIS B 1 74  ? 7.596  8.361   33.456  1.00 65.18  ? 74   HIS B ND1 1 
ATOM   2774 C  CD2 . HIS B 1 74  ? 6.071  7.880   34.941  1.00 62.54  ? 74   HIS B CD2 1 
ATOM   2775 C  CE1 . HIS B 1 74  ? 6.773  9.389   33.518  1.00 65.18  ? 74   HIS B CE1 1 
ATOM   2776 N  NE2 . HIS B 1 74  ? 5.836  9.124   34.408  1.00 63.77  ? 74   HIS B NE2 1 
ATOM   2777 N  N   . PRO B 1 75  ? 7.771  6.184   31.123  1.00 65.57  ? 75   PRO B N   1 
ATOM   2778 C  CA  . PRO B 1 75  ? 8.396  6.642   29.874  1.00 65.56  ? 75   PRO B CA  1 
ATOM   2779 C  C   . PRO B 1 75  ? 9.359  7.833   30.027  1.00 63.93  ? 75   PRO B C   1 
ATOM   2780 O  O   . PRO B 1 75  ? 10.323 7.939   29.268  1.00 63.69  ? 75   PRO B O   1 
ATOM   2781 C  CB  . PRO B 1 75  ? 7.190  7.049   29.018  1.00 62.74  ? 75   PRO B CB  1 
ATOM   2782 C  CG  . PRO B 1 75  ? 6.137  7.423   30.010  1.00 64.24  ? 75   PRO B CG  1 
ATOM   2783 C  CD  . PRO B 1 75  ? 6.319  6.425   31.134  1.00 63.87  ? 75   PRO B CD  1 
ATOM   2784 N  N   . ASN B 1 76  ? 9.085  8.725   30.973  1.00 61.15  ? 76   ASN B N   1 
ATOM   2785 C  CA  . ASN B 1 76  ? 9.917  9.900   31.167  1.00 58.62  ? 76   ASN B CA  1 
ATOM   2786 C  C   . ASN B 1 76  ? 11.214 9.553   31.877  1.00 57.62  ? 76   ASN B C   1 
ATOM   2787 O  O   . ASN B 1 76  ? 11.846 10.415  32.496  1.00 56.78  ? 76   ASN B O   1 
ATOM   2788 C  CB  . ASN B 1 76  ? 9.161  10.988  31.923  1.00 58.64  ? 76   ASN B CB  1 
ATOM   2789 C  CG  . ASN B 1 76  ? 8.179  11.738  31.045  1.00 62.30  ? 76   ASN B CG  1 
ATOM   2790 O  OD1 . ASN B 1 76  ? 7.001  11.846  31.368  1.00 68.38  ? 76   ASN B OD1 1 
ATOM   2791 N  ND2 . ASN B 1 76  ? 8.658  12.256  29.932  1.00 56.46  ? 76   ASN B ND2 1 
ATOM   2792 N  N   . ILE B 1 77  ? 11.593 8.279   31.781  1.00 57.69  ? 77   ILE B N   1 
ATOM   2793 C  CA  . ILE B 1 77  ? 12.808 7.760   32.386  1.00 57.60  ? 77   ILE B CA  1 
ATOM   2794 C  C   . ILE B 1 77  ? 13.597 7.091   31.293  1.00 59.28  ? 77   ILE B C   1 
ATOM   2795 O  O   . ILE B 1 77  ? 13.025 6.505   30.370  1.00 61.75  ? 77   ILE B O   1 
ATOM   2796 C  CB  . ILE B 1 77  ? 12.524 6.685   33.464  1.00 62.48  ? 77   ILE B CB  1 
ATOM   2797 C  CG1 . ILE B 1 77  ? 11.541 7.187   34.532  1.00 60.24  ? 77   ILE B CG1 1 
ATOM   2798 C  CG2 . ILE B 1 77  ? 13.824 6.224   34.111  1.00 58.19  ? 77   ILE B CG2 1 
ATOM   2799 C  CD1 . ILE B 1 77  ? 12.179 8.084   35.601  1.00 57.21  ? 77   ILE B CD1 1 
ATOM   2800 N  N   . VAL B 1 78  ? 14.917 7.177   31.411  1.00 60.07  ? 78   VAL B N   1 
ATOM   2801 C  CA  . VAL B 1 78  ? 15.826 6.419   30.559  1.00 64.02  ? 78   VAL B CA  1 
ATOM   2802 C  C   . VAL B 1 78  ? 15.775 4.937   30.960  1.00 65.24  ? 78   VAL B C   1 
ATOM   2803 O  O   . VAL B 1 78  ? 16.387 4.530   31.946  1.00 69.86  ? 78   VAL B O   1 
ATOM   2804 C  CB  . VAL B 1 78  ? 17.276 6.985   30.645  1.00 62.69  ? 78   VAL B CB  1 
ATOM   2805 C  CG1 . VAL B 1 78  ? 18.206 6.252   29.688  1.00 57.05  ? 78   VAL B CG1 1 
ATOM   2806 C  CG2 . VAL B 1 78  ? 17.279 8.491   30.341  1.00 61.19  ? 78   VAL B CG2 1 
ATOM   2807 N  N   . ARG B 1 79  ? 15.039 4.138   30.195  1.00 62.42  ? 79   ARG B N   1 
ATOM   2808 C  CA  . ARG B 1 79  ? 14.738 2.775   30.604  1.00 66.34  ? 79   ARG B CA  1 
ATOM   2809 C  C   . ARG B 1 79  ? 15.769 1.752   30.147  1.00 69.60  ? 79   ARG B C   1 
ATOM   2810 O  O   . ARG B 1 79  ? 16.279 1.811   29.026  1.00 65.25  ? 79   ARG B O   1 
ATOM   2811 C  CB  . ARG B 1 79  ? 13.332 2.378   30.145  1.00 64.33  ? 79   ARG B CB  1 
ATOM   2812 C  CG  . ARG B 1 79  ? 12.243 3.120   30.900  1.00 66.81  ? 79   ARG B CG  1 
ATOM   2813 C  CD  . ARG B 1 79  ? 10.874 2.937   30.292  1.00 66.09  ? 79   ARG B CD  1 
ATOM   2814 N  NE  . ARG B 1 79  ? 10.841 3.343   28.892  1.00 71.68  ? 79   ARG B NE  1 
ATOM   2815 C  CZ  . ARG B 1 79  ? 9.749  3.755   28.255  1.00 70.35  ? 79   ARG B CZ  1 
ATOM   2816 N  NH1 . ARG B 1 79  ? 8.590  3.829   28.898  1.00 68.74  ? 79   ARG B NH1 1 
ATOM   2817 N  NH2 . ARG B 1 79  ? 9.815  4.096   26.971  1.00 64.86  ? 79   ARG B NH2 1 
ATOM   2818 N  N   . PHE B 1 80  ? 16.082 0.828   31.048  1.00 77.17  ? 80   PHE B N   1 
ATOM   2819 C  CA  . PHE B 1 80  ? 16.850 -0.369  30.721  1.00 73.85  ? 80   PHE B CA  1 
ATOM   2820 C  C   . PHE B 1 80  ? 16.161 -1.139  29.585  1.00 70.42  ? 80   PHE B C   1 
ATOM   2821 O  O   . PHE B 1 80  ? 14.933 -1.148  29.479  1.00 70.10  ? 80   PHE B O   1 
ATOM   2822 C  CB  . PHE B 1 80  ? 16.986 -1.233  31.984  1.00 76.29  ? 80   PHE B CB  1 
ATOM   2823 C  CG  . PHE B 1 80  ? 17.422 -2.636  31.730  1.00 80.57  ? 80   PHE B CG  1 
ATOM   2824 C  CD1 . PHE B 1 80  ? 16.499 -3.604  31.354  1.00 78.42  ? 80   PHE B CD1 1 
ATOM   2825 C  CD2 . PHE B 1 80  ? 18.752 -3.001  31.892  1.00 79.60  ? 80   PHE B CD2 1 
ATOM   2826 C  CE1 . PHE B 1 80  ? 16.904 -4.916  31.110  1.00 80.08  ? 80   PHE B CE1 1 
ATOM   2827 C  CE2 . PHE B 1 80  ? 19.168 -4.303  31.657  1.00 77.95  ? 80   PHE B CE2 1 
ATOM   2828 C  CZ  . PHE B 1 80  ? 18.241 -5.266  31.269  1.00 82.73  ? 80   PHE B CZ  1 
ATOM   2829 N  N   . LYS B 1 81  ? 16.952 -1.767  28.724  1.00 67.15  ? 81   LYS B N   1 
ATOM   2830 C  CA  . LYS B 1 81  ? 16.385 -2.526  27.617  1.00 72.85  ? 81   LYS B CA  1 
ATOM   2831 C  C   . LYS B 1 81  ? 16.687 -4.029  27.742  1.00 79.81  ? 81   LYS B C   1 
ATOM   2832 O  O   . LYS B 1 81  ? 15.801 -4.885  27.580  1.00 80.32  ? 81   LYS B O   1 
ATOM   2833 C  CB  . LYS B 1 81  ? 16.916 -2.000  26.279  1.00 72.02  ? 81   LYS B CB  1 
ATOM   2834 C  CG  . LYS B 1 81  ? 16.247 -0.736  25.803  1.00 70.71  ? 81   LYS B CG  1 
ATOM   2835 C  CD  . LYS B 1 81  ? 15.273 -1.016  24.678  1.00 73.45  ? 81   LYS B CD  1 
ATOM   2836 C  CE  . LYS B 1 81  ? 14.071 -0.068  24.751  1.00 78.57  ? 81   LYS B CE  1 
ATOM   2837 N  NZ  . LYS B 1 81  ? 13.840 0.647   23.460  1.00 79.61  ? 81   LYS B NZ  1 
ATOM   2838 N  N   . GLU B 1 82  ? 17.940 -4.343  28.057  1.00 74.10  ? 82   GLU B N   1 
ATOM   2839 C  CA  . GLU B 1 82  ? 18.414 -5.697  27.934  1.00 77.03  ? 82   GLU B CA  1 
ATOM   2840 C  C   . GLU B 1 82  ? 19.872 -5.798  28.352  1.00 78.85  ? 82   GLU B C   1 
ATOM   2841 O  O   . GLU B 1 82  ? 20.574 -4.798  28.450  1.00 77.24  ? 82   GLU B O   1 
ATOM   2842 C  CB  . GLU B 1 82  ? 18.224 -6.157  26.496  1.00 76.81  ? 82   GLU B CB  1 
ATOM   2843 C  CG  . GLU B 1 82  ? 19.453 -6.739  25.836  1.00 81.92  ? 82   GLU B CG  1 
ATOM   2844 C  CD  . GLU B 1 82  ? 19.310 -6.813  24.321  1.00 86.55  ? 82   GLU B CD  1 
ATOM   2845 O  OE1 . GLU B 1 82  ? 18.567 -5.976  23.749  1.00 84.19  ? 82   GLU B OE1 1 
ATOM   2846 O  OE2 . GLU B 1 82  ? 19.939 -7.704  23.705  1.00 88.68  ? 82   GLU B OE2 1 
ATOM   2847 N  N   . VAL B 1 83  ? 20.304 -7.020  28.636  1.00 83.04  ? 83   VAL B N   1 
ATOM   2848 C  CA  . VAL B 1 83  ? 21.682 -7.291  29.008  1.00 82.54  ? 83   VAL B CA  1 
ATOM   2849 C  C   . VAL B 1 83  ? 22.242 -8.347  28.059  1.00 86.11  ? 83   VAL B C   1 
ATOM   2850 O  O   . VAL B 1 83  ? 21.542 -9.271  27.651  1.00 87.78  ? 83   VAL B O   1 
ATOM   2851 C  CB  . VAL B 1 83  ? 21.782 -7.759  30.468  1.00 79.44  ? 83   VAL B CB  1 
ATOM   2852 C  CG1 . VAL B 1 83  ? 22.833 -8.829  30.613  1.00 87.15  ? 83   VAL B CG1 1 
ATOM   2853 C  CG2 . VAL B 1 83  ? 22.093 -6.597  31.376  1.00 76.65  ? 83   VAL B CG2 1 
ATOM   2854 N  N   . ILE B 1 84  ? 23.502 -8.200  27.685  1.00 84.97  ? 84   ILE B N   1 
ATOM   2855 C  CA  . ILE B 1 84  ? 24.108 -9.130  26.747  1.00 86.41  ? 84   ILE B CA  1 
ATOM   2856 C  C   . ILE B 1 84  ? 25.455 -9.618  27.285  1.00 88.31  ? 84   ILE B C   1 
ATOM   2857 O  O   . ILE B 1 84  ? 26.089 -8.946  28.100  1.00 86.23  ? 84   ILE B O   1 
ATOM   2858 C  CB  . ILE B 1 84  ? 24.286 -8.467  25.344  1.00 90.76  ? 84   ILE B CB  1 
ATOM   2859 C  CG1 . ILE B 1 84  ? 22.930 -7.993  24.800  1.00 88.70  ? 84   ILE B CG1 1 
ATOM   2860 C  CG2 . ILE B 1 84  ? 24.987 -9.419  24.356  1.00 88.24  ? 84   ILE B CG2 1 
ATOM   2861 C  CD1 . ILE B 1 84  ? 22.935 -7.654  23.314  1.00 87.21  ? 84   ILE B CD1 1 
ATOM   2862 N  N   . LEU B 1 85  ? 25.883 -10.795 26.842  1.00 92.05  ? 85   LEU B N   1 
ATOM   2863 C  CA  . LEU B 1 85  ? 27.176 -11.314 27.252  1.00 92.05  ? 85   LEU B CA  1 
ATOM   2864 C  C   . LEU B 1 85  ? 28.153 -11.399 26.080  1.00 93.21  ? 85   LEU B C   1 
ATOM   2865 O  O   . LEU B 1 85  ? 27.856 -11.993 25.039  1.00 88.16  ? 85   LEU B O   1 
ATOM   2866 C  CB  . LEU B 1 85  ? 27.029 -12.679 27.930  1.00 97.89  ? 85   LEU B CB  1 
ATOM   2867 C  CG  . LEU B 1 85  ? 28.314 -13.317 28.484  1.00 101.18 ? 85   LEU B CG  1 
ATOM   2868 C  CD1 . LEU B 1 85  ? 28.489 -12.994 29.957  1.00 102.50 ? 85   LEU B CD1 1 
ATOM   2869 C  CD2 . LEU B 1 85  ? 28.306 -14.818 28.271  1.00 100.26 ? 85   LEU B CD2 1 
ATOM   2870 N  N   . THR B 1 86  ? 29.312 -10.771 26.261  1.00 95.79  ? 86   THR B N   1 
ATOM   2871 C  CA  . THR B 1 86  ? 30.435 -10.932 25.348  1.00 98.04  ? 86   THR B CA  1 
ATOM   2872 C  C   . THR B 1 86  ? 31.516 -11.747 26.036  1.00 97.65  ? 86   THR B C   1 
ATOM   2873 O  O   . THR B 1 86  ? 31.511 -11.880 27.256  1.00 95.90  ? 86   THR B O   1 
ATOM   2874 C  CB  . THR B 1 86  ? 31.057 -9.571  24.897  1.00 95.94  ? 86   THR B CB  1 
ATOM   2875 O  OG1 . THR B 1 86  ? 31.165 -8.675  26.013  1.00 92.99  ? 86   THR B OG1 1 
ATOM   2876 C  CG2 . THR B 1 86  ? 30.224 -8.927  23.800  1.00 93.99  ? 86   THR B CG2 1 
ATOM   2877 N  N   . PRO B 1 87  ? 32.448 -12.299 25.249  1.00 98.65  ? 87   PRO B N   1 
ATOM   2878 C  CA  . PRO B 1 87  ? 33.648 -12.917 25.818  1.00 99.53  ? 87   PRO B CA  1 
ATOM   2879 C  C   . PRO B 1 87  ? 34.331 -11.994 26.828  1.00 101.62 ? 87   PRO B C   1 
ATOM   2880 O  O   . PRO B 1 87  ? 34.843 -12.460 27.847  1.00 104.95 ? 87   PRO B O   1 
ATOM   2881 C  CB  . PRO B 1 87  ? 34.554 -13.088 24.597  1.00 100.32 ? 87   PRO B CB  1 
ATOM   2882 C  CG  . PRO B 1 87  ? 33.607 -13.268 23.455  1.00 98.37  ? 87   PRO B CG  1 
ATOM   2883 C  CD  . PRO B 1 87  ? 32.415 -12.398 23.777  1.00 95.56  ? 87   PRO B CD  1 
ATOM   2884 N  N   . THR B 1 88  ? 34.320 -10.694 26.546  1.00 99.85  ? 88   THR B N   1 
ATOM   2885 C  CA  . THR B 1 88  ? 35.106 -9.719  27.301  1.00 97.36  ? 88   THR B CA  1 
ATOM   2886 C  C   . THR B 1 88  ? 34.328 -9.036  28.415  1.00 94.56  ? 88   THR B C   1 
ATOM   2887 O  O   . THR B 1 88  ? 34.824 -8.845  29.535  1.00 93.31  ? 88   THR B O   1 
ATOM   2888 C  CB  . THR B 1 88  ? 35.658 -8.600  26.363  1.00 98.39  ? 88   THR B CB  1 
ATOM   2889 O  OG1 . THR B 1 88  ? 34.644 -8.195  25.428  1.00 99.81  ? 88   THR B OG1 1 
ATOM   2890 C  CG2 . THR B 1 88  ? 36.900 -9.060  25.600  1.00 93.62  ? 88   THR B CG2 1 
ATOM   2891 N  N   . HIS B 1 89  ? 33.103 -8.643  28.104  1.00 94.00  ? 89   HIS B N   1 
ATOM   2892 C  CA  . HIS B 1 89  ? 32.438 -7.664  28.952  1.00 92.20  ? 89   HIS B CA  1 
ATOM   2893 C  C   . HIS B 1 89  ? 30.994 -7.965  29.273  1.00 90.72  ? 89   HIS B C   1 
ATOM   2894 O  O   . HIS B 1 89  ? 30.355 -8.844  28.665  1.00 88.52  ? 89   HIS B O   1 
ATOM   2895 C  CB  . HIS B 1 89  ? 32.466 -6.285  28.300  1.00 90.01  ? 89   HIS B CB  1 
ATOM   2896 C  CG  . HIS B 1 89  ? 33.839 -5.737  28.081  1.00 93.38  ? 89   HIS B CG  1 
ATOM   2897 N  ND1 . HIS B 1 89  ? 34.574 -6.004  26.947  1.00 93.14  ? 89   HIS B ND1 1 
ATOM   2898 C  CD2 . HIS B 1 89  ? 34.604 -4.917  28.843  1.00 92.54  ? 89   HIS B CD2 1 
ATOM   2899 C  CE1 . HIS B 1 89  ? 35.740 -5.383  27.022  1.00 96.58  ? 89   HIS B CE1 1 
ATOM   2900 N  NE2 . HIS B 1 89  ? 35.779 -4.715  28.162  1.00 98.49  ? 89   HIS B NE2 1 
ATOM   2901 N  N   . LEU B 1 90  ? 30.491 -7.181  30.225  1.00 84.97  ? 90   LEU B N   1 
ATOM   2902 C  CA  . LEU B 1 90  ? 29.058 -7.086  30.370  1.00 82.50  ? 90   LEU B CA  1 
ATOM   2903 C  C   . LEU B 1 90  ? 28.574 -5.825  29.660  1.00 81.74  ? 90   LEU B C   1 
ATOM   2904 O  O   . LEU B 1 90  ? 28.957 -4.714  30.031  1.00 79.11  ? 90   LEU B O   1 
ATOM   2905 C  CB  . LEU B 1 90  ? 28.642 -7.037  31.834  1.00 84.00  ? 90   LEU B CB  1 
ATOM   2906 C  CG  . LEU B 1 90  ? 27.115 -6.997  32.023  1.00 77.00  ? 90   LEU B CG  1 
ATOM   2907 C  CD1 . LEU B 1 90  ? 26.489 -8.275  31.534  1.00 74.80  ? 90   LEU B CD1 1 
ATOM   2908 C  CD2 . LEU B 1 90  ? 26.724 -6.738  33.467  1.00 80.25  ? 90   LEU B CD2 1 
ATOM   2909 N  N   . ALA B 1 91  ? 27.731 -5.999  28.644  1.00 80.65  ? 91   ALA B N   1 
ATOM   2910 C  CA  . ALA B 1 91  ? 27.132 -4.873  27.927  1.00 77.53  ? 91   ALA B CA  1 
ATOM   2911 C  C   . ALA B 1 91  ? 25.720 -4.522  28.429  1.00 75.68  ? 91   ALA B C   1 
ATOM   2912 O  O   . ALA B 1 91  ? 24.780 -5.317  28.285  1.00 73.78  ? 91   ALA B O   1 
ATOM   2913 C  CB  . ALA B 1 91  ? 27.109 -5.160  26.432  1.00 74.97  ? 91   ALA B CB  1 
ATOM   2914 N  N   . ILE B 1 92  ? 25.568 -3.319  28.984  1.00 74.64  ? 92   ILE B N   1 
ATOM   2915 C  CA  . ILE B 1 92  ? 24.247 -2.879  29.414  1.00 70.89  ? 92   ILE B CA  1 
ATOM   2916 C  C   . ILE B 1 92  ? 23.632 -1.940  28.388  1.00 68.49  ? 92   ILE B C   1 
ATOM   2917 O  O   . ILE B 1 92  ? 24.184 -0.898  28.044  1.00 67.82  ? 92   ILE B O   1 
ATOM   2918 C  CB  . ILE B 1 92  ? 24.280 -2.228  30.795  1.00 73.04  ? 92   ILE B CB  1 
ATOM   2919 C  CG1 . ILE B 1 92  ? 25.234 -2.992  31.702  1.00 75.20  ? 92   ILE B CG1 1 
ATOM   2920 C  CG2 . ILE B 1 92  ? 22.870 -2.173  31.387  1.00 68.54  ? 92   ILE B CG2 1 
ATOM   2921 C  CD1 . ILE B 1 92  ? 25.983 -2.114  32.669  1.00 79.01  ? 92   ILE B CD1 1 
ATOM   2922 N  N   . VAL B 1 93  ? 22.468 -2.334  27.903  1.00 65.15  ? 93   VAL B N   1 
ATOM   2923 C  CA  . VAL B 1 93  ? 21.824 -1.641  26.811  1.00 63.79  ? 93   VAL B CA  1 
ATOM   2924 C  C   . VAL B 1 93  ? 20.594 -0.912  27.346  1.00 64.73  ? 93   VAL B C   1 
ATOM   2925 O  O   . VAL B 1 93  ? 19.748 -1.521  27.996  1.00 64.74  ? 93   VAL B O   1 
ATOM   2926 C  CB  . VAL B 1 93  ? 21.417 -2.641  25.705  1.00 62.62  ? 93   VAL B CB  1 
ATOM   2927 C  CG1 . VAL B 1 93  ? 20.564 -1.970  24.654  1.00 59.16  ? 93   VAL B CG1 1 
ATOM   2928 C  CG2 . VAL B 1 93  ? 22.662 -3.292  25.071  1.00 63.74  ? 93   VAL B CG2 1 
ATOM   2929 N  N   . MET B 1 94  ? 20.488 0.385   27.076  1.00 62.74  ? 94   MET B N   1 
ATOM   2930 C  CA  . MET B 1 94  ? 19.339 1.144   27.521  1.00 60.86  ? 94   MET B CA  1 
ATOM   2931 C  C   . MET B 1 94  ? 18.864 2.100   26.428  1.00 62.21  ? 94   MET B C   1 
ATOM   2932 O  O   . MET B 1 94  ? 19.493 2.224   25.361  1.00 59.46  ? 94   MET B O   1 
ATOM   2933 C  CB  . MET B 1 94  ? 19.673 1.915   28.805  1.00 58.78  ? 94   MET B CB  1 
ATOM   2934 C  CG  . MET B 1 94  ? 20.932 2.737   28.708  1.00 62.44  ? 94   MET B CG  1 
ATOM   2935 S  SD  . MET B 1 94  ? 21.631 3.067   30.317  1.00 70.74  ? 94   MET B SD  1 
ATOM   2936 C  CE  . MET B 1 94  ? 23.329 2.564   30.033  1.00 72.33  ? 94   MET B CE  1 
ATOM   2937 N  N   . GLU B 1 95  ? 17.742 2.762   26.703  1.00 60.86  ? 95   GLU B N   1 
ATOM   2938 C  CA  . GLU B 1 95  ? 17.271 3.875   25.890  1.00 59.70  ? 95   GLU B CA  1 
ATOM   2939 C  C   . GLU B 1 95  ? 18.349 4.947   25.782  1.00 60.39  ? 95   GLU B C   1 
ATOM   2940 O  O   . GLU B 1 95  ? 19.176 5.089   26.686  1.00 57.37  ? 95   GLU B O   1 
ATOM   2941 C  CB  . GLU B 1 95  ? 16.020 4.489   26.506  1.00 58.81  ? 95   GLU B CB  1 
ATOM   2942 C  CG  . GLU B 1 95  ? 14.746 3.744   26.219  1.00 63.70  ? 95   GLU B CG  1 
ATOM   2943 C  CD  . GLU B 1 95  ? 13.524 4.446   26.768  1.00 67.45  ? 95   GLU B CD  1 
ATOM   2944 O  OE1 . GLU B 1 95  ? 13.595 5.009   27.878  1.00 62.45  ? 95   GLU B OE1 1 
ATOM   2945 O  OE2 . GLU B 1 95  ? 12.488 4.436   26.080  1.00 68.54  ? 95   GLU B OE2 1 
ATOM   2946 N  N   . TYR B 1 96  ? 18.332 5.685   24.669  1.00 59.12  ? 96   TYR B N   1 
ATOM   2947 C  CA  . TYR B 1 96  ? 19.195 6.849   24.482  1.00 56.19  ? 96   TYR B CA  1 
ATOM   2948 C  C   . TYR B 1 96  ? 18.369 8.058   24.106  1.00 50.88  ? 96   TYR B C   1 
ATOM   2949 O  O   . TYR B 1 96  ? 17.636 8.016   23.118  1.00 51.28  ? 96   TYR B O   1 
ATOM   2950 C  CB  . TYR B 1 96  ? 20.247 6.580   23.410  1.00 53.15  ? 96   TYR B CB  1 
ATOM   2951 C  CG  . TYR B 1 96  ? 21.040 7.774   23.016  1.00 54.80  ? 96   TYR B CG  1 
ATOM   2952 C  CD1 . TYR B 1 96  ? 21.974 8.321   23.880  1.00 58.20  ? 96   TYR B CD1 1 
ATOM   2953 C  CD2 . TYR B 1 96  ? 20.870 8.368   21.767  1.00 55.17  ? 96   TYR B CD2 1 
ATOM   2954 C  CE1 . TYR B 1 96  ? 22.734 9.447   23.516  1.00 53.54  ? 96   TYR B CE1 1 
ATOM   2955 C  CE2 . TYR B 1 96  ? 21.613 9.498   21.397  1.00 55.25  ? 96   TYR B CE2 1 
ATOM   2956 C  CZ  . TYR B 1 96  ? 22.548 10.026  22.281  1.00 53.75  ? 96   TYR B CZ  1 
ATOM   2957 O  OH  . TYR B 1 96  ? 23.303 11.120  21.930  1.00 52.59  ? 96   TYR B OH  1 
ATOM   2958 N  N   . ALA B 1 97  ? 18.484 9.114   24.915  1.00 52.17  ? 97   ALA B N   1 
ATOM   2959 C  CA  . ALA B 1 97  ? 17.895 10.436  24.631  1.00 53.53  ? 97   ALA B CA  1 
ATOM   2960 C  C   . ALA B 1 97  ? 18.749 11.202  23.628  1.00 50.70  ? 97   ALA B C   1 
ATOM   2961 O  O   . ALA B 1 97  ? 19.809 11.727  23.961  1.00 50.37  ? 97   ALA B O   1 
ATOM   2962 C  CB  . ALA B 1 97  ? 17.699 11.280  25.935  1.00 47.57  ? 97   ALA B CB  1 
ATOM   2963 N  N   . SER B 1 98  ? 18.260 11.256  22.400  1.00 48.46  ? 98   SER B N   1 
ATOM   2964 C  CA  . SER B 1 98  ? 18.969 11.840  21.283  1.00 52.74  ? 98   SER B CA  1 
ATOM   2965 C  C   . SER B 1 98  ? 18.682 13.340  21.086  1.00 52.86  ? 98   SER B C   1 
ATOM   2966 O  O   . SER B 1 98  ? 19.119 13.945  20.113  1.00 48.82  ? 98   SER B O   1 
ATOM   2967 C  CB  . SER B 1 98  ? 18.562 11.099  20.022  1.00 54.82  ? 98   SER B CB  1 
ATOM   2968 O  OG  . SER B 1 98  ? 17.167 11.233  19.809  1.00 57.46  ? 98   SER B OG  1 
ATOM   2969 N  N   . GLY B 1 99  ? 17.937 13.926  22.012  1.00 51.83  ? 99   GLY B N   1 
ATOM   2970 C  CA  . GLY B 1 99  ? 17.503 15.299  21.890  1.00 48.78  ? 99   GLY B CA  1 
ATOM   2971 C  C   . GLY B 1 99  ? 18.389 16.236  22.669  1.00 49.96  ? 99   GLY B C   1 
ATOM   2972 O  O   . GLY B 1 99  ? 18.209 17.434  22.612  1.00 45.99  ? 99   GLY B O   1 
ATOM   2973 N  N   . GLY B 1 100 ? 19.354 15.690  23.391  1.00 49.30  ? 100  GLY B N   1 
ATOM   2974 C  CA  . GLY B 1 100 ? 20.310 16.511  24.099  1.00 45.36  ? 100  GLY B CA  1 
ATOM   2975 C  C   . GLY B 1 100 ? 19.810 16.928  25.462  1.00 45.43  ? 100  GLY B C   1 
ATOM   2976 O  O   . GLY B 1 100 ? 18.773 16.468  25.901  1.00 45.89  ? 100  GLY B O   1 
ATOM   2977 N  N   . GLU B 1 101 ? 20.544 17.800  26.134  1.00 44.22  ? 101  GLU B N   1 
ATOM   2978 C  CA  . GLU B 1 101 ? 20.129 18.245  27.456  1.00 45.62  ? 101  GLU B CA  1 
ATOM   2979 C  C   . GLU B 1 101 ? 19.038 19.309  27.399  1.00 46.61  ? 101  GLU B C   1 
ATOM   2980 O  O   . GLU B 1 101 ? 19.064 20.206  26.555  1.00 45.81  ? 101  GLU B O   1 
ATOM   2981 C  CB  . GLU B 1 101 ? 21.312 18.792  28.256  1.00 47.30  ? 101  GLU B CB  1 
ATOM   2982 C  CG  . GLU B 1 101 ? 22.483 17.856  28.365  1.00 50.37  ? 101  GLU B CG  1 
ATOM   2983 C  CD  . GLU B 1 101 ? 23.686 18.512  29.024  1.00 57.52  ? 101  GLU B CD  1 
ATOM   2984 O  OE1 . GLU B 1 101 ? 23.558 19.690  29.431  1.00 59.94  ? 101  GLU B OE1 1 
ATOM   2985 O  OE2 . GLU B 1 101 ? 24.751 17.857  29.129  1.00 67.52  ? 101  GLU B OE2 1 
ATOM   2986 N  N   . LEU B 1 102 ? 18.086 19.200  28.315  1.00 46.19  ? 102  LEU B N   1 
ATOM   2987 C  CA  . LEU B 1 102 ? 17.078 20.225  28.535  1.00 44.02  ? 102  LEU B CA  1 
ATOM   2988 C  C   . LEU B 1 102 ? 17.658 21.627  28.746  1.00 44.77  ? 102  LEU B C   1 
ATOM   2989 O  O   . LEU B 1 102 ? 17.058 22.633  28.344  1.00 45.14  ? 102  LEU B O   1 
ATOM   2990 C  CB  . LEU B 1 102 ? 16.247 19.856  29.763  1.00 45.56  ? 102  LEU B CB  1 
ATOM   2991 C  CG  . LEU B 1 102 ? 15.263 20.952  30.202  1.00 45.98  ? 102  LEU B CG  1 
ATOM   2992 C  CD1 . LEU B 1 102 ? 14.059 21.117  29.215  1.00 45.74  ? 102  LEU B CD1 1 
ATOM   2993 C  CD2 . LEU B 1 102 ? 14.798 20.701  31.590  1.00 45.42  ? 102  LEU B CD2 1 
ATOM   2994 N  N   . PHE B 1 103 ? 18.813 21.685  29.395  1.00 42.94  ? 103  PHE B N   1 
ATOM   2995 C  CA  . PHE B 1 103 ? 19.508 22.938  29.640  1.00 44.22  ? 103  PHE B CA  1 
ATOM   2996 C  C   . PHE B 1 103 ? 19.941 23.639  28.334  1.00 44.16  ? 103  PHE B C   1 
ATOM   2997 O  O   . PHE B 1 103 ? 19.908 24.866  28.194  1.00 44.33  ? 103  PHE B O   1 
ATOM   2998 C  CB  . PHE B 1 103 ? 20.733 22.685  30.517  1.00 41.98  ? 103  PHE B CB  1 
ATOM   2999 C  CG  . PHE B 1 103 ? 21.485 23.944  30.871  1.00 44.59  ? 103  PHE B CG  1 
ATOM   3000 C  CD1 . PHE B 1 103 ? 20.884 24.929  31.637  1.00 49.35  ? 103  PHE B CD1 1 
ATOM   3001 C  CD2 . PHE B 1 103 ? 22.782 24.160  30.425  1.00 44.61  ? 103  PHE B CD2 1 
ATOM   3002 C  CE1 . PHE B 1 103 ? 21.565 26.113  31.960  1.00 49.68  ? 103  PHE B CE1 1 
ATOM   3003 C  CE2 . PHE B 1 103 ? 23.466 25.331  30.751  1.00 45.89  ? 103  PHE B CE2 1 
ATOM   3004 C  CZ  . PHE B 1 103 ? 22.858 26.305  31.525  1.00 47.22  ? 103  PHE B CZ  1 
ATOM   3005 N  N   . GLU B 1 104 ? 20.356 22.822  27.388  1.00 44.59  ? 104  GLU B N   1 
ATOM   3006 C  CA  . GLU B 1 104 ? 20.823 23.318  26.126  1.00 47.95  ? 104  GLU B CA  1 
ATOM   3007 C  C   . GLU B 1 104 ? 19.679 23.985  25.367  1.00 48.37  ? 104  GLU B C   1 
ATOM   3008 O  O   . GLU B 1 104 ? 19.856 25.045  24.746  1.00 43.50  ? 104  GLU B O   1 
ATOM   3009 C  CB  . GLU B 1 104 ? 21.446 22.167  25.328  1.00 46.13  ? 104  GLU B CB  1 
ATOM   3010 C  CG  . GLU B 1 104 ? 22.932 22.007  25.596  1.00 49.18  ? 104  GLU B CG  1 
ATOM   3011 C  CD  . GLU B 1 104 ? 23.675 23.342  25.431  1.00 70.74  ? 104  GLU B CD  1 
ATOM   3012 O  OE1 . GLU B 1 104 ? 23.513 24.008  24.373  1.00 66.59  ? 104  GLU B OE1 1 
ATOM   3013 O  OE2 . GLU B 1 104 ? 24.415 23.729  26.365  1.00 72.71  ? 104  GLU B OE2 1 
ATOM   3014 N  N   . ARG B 1 105 ? 18.516 23.341  25.440  1.00 44.49  ? 105  ARG B N   1 
ATOM   3015 C  CA  . ARG B 1 105 ? 17.283 23.872  24.870  1.00 44.50  ? 105  ARG B CA  1 
ATOM   3016 C  C   . ARG B 1 105 ? 16.873 25.181  25.542  1.00 44.94  ? 105  ARG B C   1 
ATOM   3017 O  O   . ARG B 1 105 ? 16.459 26.119  24.888  1.00 45.08  ? 105  ARG B O   1 
ATOM   3018 C  CB  . ARG B 1 105 ? 16.151 22.858  24.973  1.00 43.37  ? 105  ARG B CB  1 
ATOM   3019 C  CG  . ARG B 1 105 ? 14.886 23.318  24.298  1.00 46.06  ? 105  ARG B CG  1 
ATOM   3020 C  CD  . ARG B 1 105 ? 13.788 22.280  24.389  1.00 49.55  ? 105  ARG B CD  1 
ATOM   3021 N  NE  . ARG B 1 105 ? 12.537 22.774  23.827  1.00 53.23  ? 105  ARG B NE  1 
ATOM   3022 C  CZ  . ARG B 1 105 ? 12.099 22.494  22.602  1.00 58.07  ? 105  ARG B CZ  1 
ATOM   3023 N  NH1 . ARG B 1 105 ? 12.818 21.710  21.810  1.00 55.30  ? 105  ARG B NH1 1 
ATOM   3024 N  NH2 . ARG B 1 105 ? 10.939 22.983  22.167  1.00 53.15  ? 105  ARG B NH2 1 
ATOM   3025 N  N   . ILE B 1 106 ? 16.996 25.238  26.856  1.00 44.14  ? 106  ILE B N   1 
ATOM   3026 C  CA  . ILE B 1 106 ? 16.800 26.495  27.533  1.00 43.84  ? 106  ILE B CA  1 
ATOM   3027 C  C   . ILE B 1 106 ? 17.690 27.614  26.994  1.00 45.24  ? 106  ILE B C   1 
ATOM   3028 O  O   . ILE B 1 106 ? 17.189 28.673  26.662  1.00 45.20  ? 106  ILE B O   1 
ATOM   3029 C  CB  . ILE B 1 106 ? 16.959 26.360  29.074  1.00 46.17  ? 106  ILE B CB  1 
ATOM   3030 C  CG1 . ILE B 1 106 ? 15.972 25.335  29.618  1.00 46.66  ? 106  ILE B CG1 1 
ATOM   3031 C  CG2 . ILE B 1 106 ? 16.731 27.716  29.768  1.00 43.21  ? 106  ILE B CG2 1 
ATOM   3032 C  CD1 . ILE B 1 106 ? 16.053 25.145  31.105  1.00 41.04  ? 106  ILE B CD1 1 
ATOM   3033 N  N   . CYS B 1 107 ? 19.000 27.384  26.939  1.00 43.65  ? 107  CYS B N   1 
ATOM   3034 C  CA  . CYS B 1 107 ? 19.952 28.373  26.462  1.00 42.75  ? 107  CYS B CA  1 
ATOM   3035 C  C   . CYS B 1 107 ? 19.671 28.810  25.026  1.00 46.72  ? 107  CYS B C   1 
ATOM   3036 O  O   . CYS B 1 107 ? 19.771 29.981  24.678  1.00 47.86  ? 107  CYS B O   1 
ATOM   3037 C  CB  . CYS B 1 107 ? 21.361 27.812  26.555  1.00 46.51  ? 107  CYS B CB  1 
ATOM   3038 S  SG  . CYS B 1 107 ? 22.017 27.781  28.245  1.00 52.26  ? 107  CYS B SG  1 
ATOM   3039 N  N   . ASN B 1 108 ? 19.317 27.845  24.198  1.00 44.83  ? 108  ASN B N   1 
ATOM   3040 C  CA  . ASN B 1 108 ? 18.887 28.091  22.844  1.00 44.52  ? 108  ASN B CA  1 
ATOM   3041 C  C   . ASN B 1 108 ? 17.666 29.009  22.794  1.00 51.27  ? 108  ASN B C   1 
ATOM   3042 O  O   . ASN B 1 108 ? 17.546 29.853  21.886  1.00 49.66  ? 108  ASN B O   1 
ATOM   3043 C  CB  . ASN B 1 108 ? 18.626 26.756  22.126  1.00 46.18  ? 108  ASN B CB  1 
ATOM   3044 C  CG  . ASN B 1 108 ? 19.926 26.070  21.684  1.00 49.50  ? 108  ASN B CG  1 
ATOM   3045 O  OD1 . ASN B 1 108 ? 21.001 26.663  21.706  1.00 51.81  ? 108  ASN B OD1 1 
ATOM   3046 N  ND2 . ASN B 1 108 ? 19.821 24.825  21.287  1.00 49.30  ? 108  ASN B ND2 1 
ATOM   3047 N  N   . ALA B 1 109 ? 16.769 28.843  23.770  1.00 50.22  ? 109  ALA B N   1 
ATOM   3048 C  CA  . ALA B 1 109 ? 15.531 29.618  23.838  1.00 44.69  ? 109  ALA B CA  1 
ATOM   3049 C  C   . ALA B 1 109 ? 15.707 30.990  24.492  1.00 48.88  ? 109  ALA B C   1 
ATOM   3050 O  O   . ALA B 1 109 ? 14.864 31.882  24.317  1.00 51.91  ? 109  ALA B O   1 
ATOM   3051 C  CB  . ALA B 1 109 ? 14.414 28.831  24.549  1.00 42.73  ? 109  ALA B CB  1 
ATOM   3052 N  N   . GLY B 1 110 ? 16.802 31.184  25.211  1.00 44.74  ? 110  GLY B N   1 
ATOM   3053 C  CA  . GLY B 1 110 ? 16.892 32.328  26.090  1.00 48.52  ? 110  GLY B CA  1 
ATOM   3054 C  C   . GLY B 1 110 ? 16.179 32.001  27.385  1.00 49.03  ? 110  GLY B C   1 
ATOM   3055 O  O   . GLY B 1 110 ? 16.818 31.922  28.440  1.00 47.84  ? 110  GLY B O   1 
ATOM   3056 N  N   . ARG B 1 111 ? 14.856 31.831  27.294  1.00 44.93  ? 111  ARG B N   1 
ATOM   3057 C  CA  . ARG B 1 111 ? 14.021 31.256  28.361  1.00 46.53  ? 111  ARG B CA  1 
ATOM   3058 C  C   . ARG B 1 111 ? 12.721 30.688  27.788  1.00 48.75  ? 111  ARG B C   1 
ATOM   3059 O  O   . ARG B 1 111 ? 12.394 30.930  26.634  1.00 47.11  ? 111  ARG B O   1 
ATOM   3060 C  CB  . ARG B 1 111 ? 13.743 32.248  29.495  1.00 49.02  ? 111  ARG B CB  1 
ATOM   3061 C  CG  . ARG B 1 111 ? 12.822 33.369  29.140  1.00 49.12  ? 111  ARG B CG  1 
ATOM   3062 C  CD  . ARG B 1 111 ? 13.076 34.560  30.050  1.00 55.16  ? 111  ARG B CD  1 
ATOM   3063 N  NE  . ARG B 1 111 ? 12.576 35.808  29.470  1.00 61.54  ? 111  ARG B NE  1 
ATOM   3064 C  CZ  . ARG B 1 111 ? 11.298 36.190  29.476  1.00 63.90  ? 111  ARG B CZ  1 
ATOM   3065 N  NH1 . ARG B 1 111 ? 10.368 35.418  30.033  1.00 57.42  ? 111  ARG B NH1 1 
ATOM   3066 N  NH2 . ARG B 1 111 ? 10.948 37.343  28.914  1.00 65.85  ? 111  ARG B NH2 1 
ATOM   3067 N  N   . PHE B 1 112 ? 12.003 29.894  28.573  1.00 48.10  ? 112  PHE B N   1 
ATOM   3068 C  CA  . PHE B 1 112 ? 10.762 29.332  28.083  1.00 49.06  ? 112  PHE B CA  1 
ATOM   3069 C  C   . PHE B 1 112 ? 9.586  30.223  28.436  1.00 51.73  ? 112  PHE B C   1 
ATOM   3070 O  O   . PHE B 1 112 ? 9.648  31.047  29.350  1.00 50.41  ? 112  PHE B O   1 
ATOM   3071 C  CB  . PHE B 1 112 ? 10.495 27.922  28.638  1.00 51.04  ? 112  PHE B CB  1 
ATOM   3072 C  CG  . PHE B 1 112 ? 11.431 26.859  28.122  1.00 50.63  ? 112  PHE B CG  1 
ATOM   3073 C  CD1 . PHE B 1 112 ? 12.309 27.120  27.074  1.00 50.95  ? 112  PHE B CD1 1 
ATOM   3074 C  CD2 . PHE B 1 112 ? 11.443 25.588  28.694  1.00 48.40  ? 112  PHE B CD2 1 
ATOM   3075 C  CE1 . PHE B 1 112 ? 13.183 26.134  26.604  1.00 48.50  ? 112  PHE B CE1 1 
ATOM   3076 C  CE2 . PHE B 1 112 ? 12.313 24.606  28.227  1.00 46.70  ? 112  PHE B CE2 1 
ATOM   3077 C  CZ  . PHE B 1 112 ? 13.181 24.876  27.188  1.00 44.96  ? 112  PHE B CZ  1 
ATOM   3078 N  N   . SER B 1 113 ? 8.509  30.038  27.684  1.00 52.02  ? 113  SER B N   1 
ATOM   3079 C  CA  . SER B 1 113 ? 7.231  30.589  28.054  1.00 48.64  ? 113  SER B CA  1 
ATOM   3080 C  C   . SER B 1 113 ? 6.716  29.742  29.225  1.00 52.16  ? 113  SER B C   1 
ATOM   3081 O  O   . SER B 1 113 ? 7.091  28.563  29.396  1.00 52.40  ? 113  SER B O   1 
ATOM   3082 C  CB  . SER B 1 113 ? 6.268  30.501  26.888  1.00 47.26  ? 113  SER B CB  1 
ATOM   3083 O  OG  . SER B 1 113 ? 5.907  29.145  26.645  1.00 54.82  ? 113  SER B OG  1 
ATOM   3084 N  N   . GLU B 1 114 ? 5.862  30.348  30.034  1.00 51.10  ? 114  GLU B N   1 
ATOM   3085 C  CA  . GLU B 1 114 ? 5.331  29.684  31.199  1.00 51.77  ? 114  GLU B CA  1 
ATOM   3086 C  C   . GLU B 1 114 ? 4.652  28.400  30.794  1.00 52.80  ? 114  GLU B C   1 
ATOM   3087 O  O   . GLU B 1 114 ? 4.650  27.437  31.549  1.00 57.07  ? 114  GLU B O   1 
ATOM   3088 C  CB  . GLU B 1 114 ? 4.364  30.614  31.932  1.00 50.50  ? 114  GLU B CB  1 
ATOM   3089 C  CG  . GLU B 1 114 ? 3.672  29.967  33.113  1.00 59.14  ? 114  GLU B CG  1 
ATOM   3090 C  CD  . GLU B 1 114 ? 3.027  30.979  34.038  1.00 63.80  ? 114  GLU B CD  1 
ATOM   3091 O  OE1 . GLU B 1 114 ? 3.428  32.165  33.989  1.00 61.39  ? 114  GLU B OE1 1 
ATOM   3092 O  OE2 . GLU B 1 114 ? 2.124  30.585  34.810  1.00 64.52  ? 114  GLU B OE2 1 
ATOM   3093 N  N   . ASP B 1 115 ? 4.092  28.367  29.592  1.00 52.65  ? 115  ASP B N   1 
ATOM   3094 C  CA  . ASP B 1 115 ? 3.370  27.171  29.155  1.00 55.11  ? 115  ASP B CA  1 
ATOM   3095 C  C   . ASP B 1 115 ? 4.290  26.016  28.760  1.00 55.03  ? 115  ASP B C   1 
ATOM   3096 O  O   . ASP B 1 115 ? 3.994  24.847  29.035  1.00 51.64  ? 115  ASP B O   1 
ATOM   3097 C  CB  . ASP B 1 115 ? 2.394  27.502  28.035  1.00 57.86  ? 115  ASP B CB  1 
ATOM   3098 C  CG  . ASP B 1 115 ? 0.951  27.546  28.524  1.00 67.30  ? 115  ASP B CG  1 
ATOM   3099 O  OD1 . ASP B 1 115 ? 0.348  26.462  28.744  1.00 71.22  ? 115  ASP B OD1 1 
ATOM   3100 O  OD2 . ASP B 1 115 ? 0.423  28.666  28.705  1.00 68.91  ? 115  ASP B OD2 1 
ATOM   3101 N  N   . GLU B 1 116 ? 5.412  26.362  28.132  1.00 53.99  ? 116  GLU B N   1 
ATOM   3102 C  CA  . GLU B 1 116 ? 6.434  25.385  27.779  1.00 52.92  ? 116  GLU B CA  1 
ATOM   3103 C  C   . GLU B 1 116 ? 7.138  24.847  29.036  1.00 51.73  ? 116  GLU B C   1 
ATOM   3104 O  O   . GLU B 1 116 ? 7.291  23.626  29.219  1.00 50.65  ? 116  GLU B O   1 
ATOM   3105 C  CB  . GLU B 1 116 ? 7.443  26.020  26.832  1.00 53.10  ? 116  GLU B CB  1 
ATOM   3106 C  CG  . GLU B 1 116 ? 8.336  25.012  26.117  1.00 56.87  ? 116  GLU B CG  1 
ATOM   3107 C  CD  . GLU B 1 116 ? 9.230  25.665  25.077  1.00 62.04  ? 116  GLU B CD  1 
ATOM   3108 O  OE1 . GLU B 1 116 ? 8.944  26.828  24.695  1.00 66.08  ? 116  GLU B OE1 1 
ATOM   3109 O  OE2 . GLU B 1 116 ? 10.210 25.014  24.649  1.00 56.64  ? 116  GLU B OE2 1 
ATOM   3110 N  N   . ALA B 1 117 ? 7.564  25.773  29.896  1.00 50.10  ? 117  ALA B N   1 
ATOM   3111 C  CA  . ALA B 1 117 ? 8.030  25.436  31.239  1.00 49.09  ? 117  ALA B CA  1 
ATOM   3112 C  C   . ALA B 1 117 ? 7.053  24.496  31.970  1.00 52.40  ? 117  ALA B C   1 
ATOM   3113 O  O   . ALA B 1 117 ? 7.476  23.482  32.555  1.00 49.86  ? 117  ALA B O   1 
ATOM   3114 C  CB  . ALA B 1 117 ? 8.289  26.712  32.049  1.00 46.01  ? 117  ALA B CB  1 
ATOM   3115 N  N   . ARG B 1 118 ? 5.754  24.802  31.917  1.00 51.78  ? 118  ARG B N   1 
ATOM   3116 C  CA  . ARG B 1 118 ? 4.780  23.896  32.510  1.00 53.29  ? 118  ARG B CA  1 
ATOM   3117 C  C   . ARG B 1 118 ? 4.738  22.526  31.847  1.00 52.57  ? 118  ARG B C   1 
ATOM   3118 O  O   . ARG B 1 118 ? 4.635  21.496  32.518  1.00 51.22  ? 118  ARG B O   1 
ATOM   3119 C  CB  . ARG B 1 118 ? 3.381  24.503  32.556  1.00 57.22  ? 118  ARG B CB  1 
ATOM   3120 C  CG  . ARG B 1 118 ? 2.349  23.525  33.165  1.00 57.85  ? 118  ARG B CG  1 
ATOM   3121 C  CD  . ARG B 1 118 ? 1.065  24.214  33.528  1.00 62.50  ? 118  ARG B CD  1 
ATOM   3122 N  NE  . ARG B 1 118 ? 0.631  25.072  32.439  1.00 67.02  ? 118  ARG B NE  1 
ATOM   3123 C  CZ  . ARG B 1 118 ? 0.290  26.345  32.582  1.00 67.15  ? 118  ARG B CZ  1 
ATOM   3124 N  NH1 . ARG B 1 118 ? 0.311  26.929  33.779  1.00 65.32  ? 118  ARG B NH1 1 
ATOM   3125 N  NH2 . ARG B 1 118 ? -0.094 27.028  31.519  1.00 66.75  ? 118  ARG B NH2 1 
ATOM   3126 N  N   . PHE B 1 119 ? 4.818  22.526  30.528  1.00 51.17  ? 119  PHE B N   1 
ATOM   3127 C  CA  . PHE B 1 119 ? 4.793  21.290  29.765  1.00 51.97  ? 119  PHE B CA  1 
ATOM   3128 C  C   . PHE B 1 119 ? 5.909  20.340  30.198  1.00 53.09  ? 119  PHE B C   1 
ATOM   3129 O  O   . PHE B 1 119 ? 5.682  19.142  30.386  1.00 53.58  ? 119  PHE B O   1 
ATOM   3130 C  CB  . PHE B 1 119 ? 4.891  21.618  28.277  1.00 53.87  ? 119  PHE B CB  1 
ATOM   3131 C  CG  . PHE B 1 119 ? 5.222  20.438  27.402  1.00 56.37  ? 119  PHE B CG  1 
ATOM   3132 C  CD1 . PHE B 1 119 ? 4.281  19.448  27.161  1.00 53.78  ? 119  PHE B CD1 1 
ATOM   3133 C  CD2 . PHE B 1 119 ? 6.469  20.333  26.791  1.00 53.96  ? 119  PHE B CD2 1 
ATOM   3134 C  CE1 . PHE B 1 119 ? 4.572  18.360  26.341  1.00 56.52  ? 119  PHE B CE1 1 
ATOM   3135 C  CE2 . PHE B 1 119 ? 6.761  19.252  25.970  1.00 56.23  ? 119  PHE B CE2 1 
ATOM   3136 C  CZ  . PHE B 1 119 ? 5.808  18.262  25.751  1.00 59.21  ? 119  PHE B CZ  1 
ATOM   3137 N  N   . PHE B 1 120 ? 7.120  20.861  30.358  1.00 50.11  ? 120  PHE B N   1 
ATOM   3138 C  CA  . PHE B 1 120 ? 8.217  19.976  30.751  1.00 50.33  ? 120  PHE B CA  1 
ATOM   3139 C  C   . PHE B 1 120 ? 8.137  19.610  32.215  1.00 47.38  ? 120  PHE B C   1 
ATOM   3140 O  O   . PHE B 1 120 ? 8.350  18.459  32.588  1.00 47.94  ? 120  PHE B O   1 
ATOM   3141 C  CB  . PHE B 1 120 ? 9.590  20.589  30.444  1.00 48.60  ? 120  PHE B CB  1 
ATOM   3142 C  CG  . PHE B 1 120 ? 9.899  20.655  28.986  1.00 47.75  ? 120  PHE B CG  1 
ATOM   3143 C  CD1 . PHE B 1 120 ? 10.108 19.501  28.265  1.00 47.82  ? 120  PHE B CD1 1 
ATOM   3144 C  CD2 . PHE B 1 120 ? 9.956  21.879  28.328  1.00 48.59  ? 120  PHE B CD2 1 
ATOM   3145 C  CE1 . PHE B 1 120 ? 10.377 19.563  26.908  1.00 51.53  ? 120  PHE B CE1 1 
ATOM   3146 C  CE2 . PHE B 1 120 ? 10.223 21.946  26.980  1.00 47.57  ? 120  PHE B CE2 1 
ATOM   3147 C  CZ  . PHE B 1 120 ? 10.435 20.788  26.270  1.00 47.02  ? 120  PHE B CZ  1 
ATOM   3148 N  N   . PHE B 1 121 ? 7.847  20.615  33.033  1.00 46.68  ? 121  PHE B N   1 
ATOM   3149 C  CA  . PHE B 1 121 ? 7.718  20.430  34.470  1.00 49.41  ? 121  PHE B CA  1 
ATOM   3150 C  C   . PHE B 1 121 ? 6.684  19.358  34.885  1.00 51.89  ? 121  PHE B C   1 
ATOM   3151 O  O   . PHE B 1 121 ? 6.860  18.652  35.900  1.00 48.55  ? 121  PHE B O   1 
ATOM   3152 C  CB  . PHE B 1 121 ? 7.403  21.766  35.133  1.00 48.29  ? 121  PHE B CB  1 
ATOM   3153 C  CG  . PHE B 1 121 ? 7.451  21.716  36.626  1.00 49.76  ? 121  PHE B CG  1 
ATOM   3154 C  CD1 . PHE B 1 121 ? 8.670  21.755  37.290  1.00 47.53  ? 121  PHE B CD1 1 
ATOM   3155 C  CD2 . PHE B 1 121 ? 6.282  21.626  37.379  1.00 47.41  ? 121  PHE B CD2 1 
ATOM   3156 C  CE1 . PHE B 1 121 ? 8.733  21.715  38.690  1.00 45.98  ? 121  PHE B CE1 1 
ATOM   3157 C  CE2 . PHE B 1 121 ? 6.330  21.599  38.773  1.00 46.73  ? 121  PHE B CE2 1 
ATOM   3158 C  CZ  . PHE B 1 121 ? 7.558  21.637  39.429  1.00 46.40  ? 121  PHE B CZ  1 
ATOM   3159 N  N   . GLN B 1 122 ? 5.615  19.248  34.099  1.00 49.29  ? 122  GLN B N   1 
ATOM   3160 C  CA  . GLN B 1 122 ? 4.640  18.186  34.312  1.00 52.86  ? 122  GLN B CA  1 
ATOM   3161 C  C   . GLN B 1 122 ? 5.277  16.806  34.187  1.00 54.49  ? 122  GLN B C   1 
ATOM   3162 O  O   . GLN B 1 122 ? 5.183  15.994  35.111  1.00 54.78  ? 122  GLN B O   1 
ATOM   3163 C  CB  . GLN B 1 122 ? 3.421  18.357  33.384  1.00 55.96  ? 122  GLN B CB  1 
ATOM   3164 C  CG  . GLN B 1 122 ? 2.401  19.364  33.951  1.00 58.74  ? 122  GLN B CG  1 
ATOM   3165 C  CD  . GLN B 1 122 ? 1.429  19.934  32.926  1.00 61.12  ? 122  GLN B CD  1 
ATOM   3166 O  OE1 . GLN B 1 122 ? 1.596  19.767  31.723  1.00 61.23  ? 122  GLN B OE1 1 
ATOM   3167 N  NE2 . GLN B 1 122 ? 0.404  20.620  33.412  1.00 62.85  ? 122  GLN B NE2 1 
ATOM   3168 N  N   . GLN B 1 123 ? 5.939  16.559  33.055  1.00 50.97  ? 123  GLN B N   1 
ATOM   3169 C  CA  . GLN B 1 123 ? 6.712  15.336  32.854  1.00 50.90  ? 123  GLN B CA  1 
ATOM   3170 C  C   . GLN B 1 123 ? 7.731  15.079  33.966  1.00 50.39  ? 123  GLN B C   1 
ATOM   3171 O  O   . GLN B 1 123 ? 7.875  13.946  34.449  1.00 51.03  ? 123  GLN B O   1 
ATOM   3172 C  CB  . GLN B 1 123 ? 7.435  15.389  31.513  1.00 51.71  ? 123  GLN B CB  1 
ATOM   3173 C  CG  . GLN B 1 123 ? 6.521  15.345  30.335  1.00 51.83  ? 123  GLN B CG  1 
ATOM   3174 C  CD  . GLN B 1 123 ? 7.234  15.628  29.066  1.00 55.28  ? 123  GLN B CD  1 
ATOM   3175 O  OE1 . GLN B 1 123 ? 7.973  14.786  28.557  1.00 55.55  ? 123  GLN B OE1 1 
ATOM   3176 N  NE2 . GLN B 1 123 ? 7.009  16.818  28.521  1.00 53.38  ? 123  GLN B NE2 1 
ATOM   3177 N  N   . LEU B 1 124 ? 8.450  16.127  34.349  1.00 48.33  ? 124  LEU B N   1 
ATOM   3178 C  CA  . LEU B 1 124 ? 9.405  16.057  35.446  1.00 49.31  ? 124  LEU B CA  1 
ATOM   3179 C  C   . LEU B 1 124 ? 8.780  15.489  36.719  1.00 50.52  ? 124  LEU B C   1 
ATOM   3180 O  O   . LEU B 1 124 ? 9.302  14.535  37.322  1.00 50.63  ? 124  LEU B O   1 
ATOM   3181 C  CB  . LEU B 1 124 ? 9.964  17.463  35.743  1.00 48.30  ? 124  LEU B CB  1 
ATOM   3182 C  CG  . LEU B 1 124 ? 11.010 17.606  36.868  1.00 44.94  ? 124  LEU B CG  1 
ATOM   3183 C  CD1 . LEU B 1 124 ? 12.267 16.862  36.537  1.00 44.94  ? 124  LEU B CD1 1 
ATOM   3184 C  CD2 . LEU B 1 124 ? 11.333 19.043  37.198  1.00 43.38  ? 124  LEU B CD2 1 
ATOM   3185 N  N   . ILE B 1 125 ? 7.673  16.092  37.146  1.00 50.46  ? 125  ILE B N   1 
ATOM   3186 C  CA  . ILE B 1 125 ? 7.005  15.636  38.361  1.00 50.26  ? 125  ILE B CA  1 
ATOM   3187 C  C   . ILE B 1 125 ? 6.456  14.219  38.212  1.00 52.54  ? 125  ILE B C   1 
ATOM   3188 O  O   . ILE B 1 125 ? 6.549  13.419  39.134  1.00 53.14  ? 125  ILE B O   1 
ATOM   3189 C  CB  . ILE B 1 125 ? 5.887  16.585  38.790  1.00 53.06  ? 125  ILE B CB  1 
ATOM   3190 C  CG1 . ILE B 1 125 ? 6.475  17.966  39.059  1.00 49.21  ? 125  ILE B CG1 1 
ATOM   3191 C  CG2 . ILE B 1 125 ? 5.166  16.026  40.023  1.00 52.33  ? 125  ILE B CG2 1 
ATOM   3192 C  CD1 . ILE B 1 125 ? 7.635  17.941  39.988  1.00 44.34  ? 125  ILE B CD1 1 
ATOM   3193 N  N   . SER B 1 126 ? 5.903  13.911  37.046  1.00 52.37  ? 126  SER B N   1 
ATOM   3194 C  CA  . SER B 1 126 ? 5.385  12.582  36.804  1.00 53.25  ? 126  SER B CA  1 
ATOM   3195 C  C   . SER B 1 126 ? 6.491  11.537  37.057  1.00 54.78  ? 126  SER B C   1 
ATOM   3196 O  O   . SER B 1 126 ? 6.319  10.613  37.867  1.00 55.74  ? 126  SER B O   1 
ATOM   3197 C  CB  . SER B 1 126 ? 4.781  12.496  35.398  1.00 56.98  ? 126  SER B CB  1 
ATOM   3198 O  OG  . SER B 1 126 ? 3.912  11.383  35.269  1.00 69.72  ? 126  SER B OG  1 
ATOM   3199 N  N   . GLY B 1 127 ? 7.640  11.719  36.402  1.00 55.66  ? 127  GLY B N   1 
ATOM   3200 C  CA  . GLY B 1 127 ? 8.763  10.799  36.532  1.00 54.72  ? 127  GLY B CA  1 
ATOM   3201 C  C   . GLY B 1 127 ? 9.374  10.724  37.926  1.00 52.01  ? 127  GLY B C   1 
ATOM   3202 O  O   . GLY B 1 127 ? 9.762  9.650   38.393  1.00 52.23  ? 127  GLY B O   1 
ATOM   3203 N  N   . VAL B 1 128 ? 9.459  11.862  38.607  1.00 52.29  ? 128  VAL B N   1 
ATOM   3204 C  CA  . VAL B 1 128 ? 9.992  11.887  39.972  1.00 54.69  ? 128  VAL B CA  1 
ATOM   3205 C  C   . VAL B 1 128 ? 9.071  11.187  40.961  1.00 57.73  ? 128  VAL B C   1 
ATOM   3206 O  O   . VAL B 1 128 ? 9.507  10.368  41.757  1.00 58.31  ? 128  VAL B O   1 
ATOM   3207 C  CB  . VAL B 1 128 ? 10.260 13.328  40.460  1.00 50.46  ? 128  VAL B CB  1 
ATOM   3208 C  CG1 . VAL B 1 128 ? 10.669 13.307  41.906  1.00 51.56  ? 128  VAL B CG1 1 
ATOM   3209 C  CG2 . VAL B 1 128 ? 11.358 13.984  39.637  1.00 49.51  ? 128  VAL B CG2 1 
ATOM   3210 N  N   . SER B 1 129 ? 7.793  11.531  40.895  1.00 58.29  ? 129  SER B N   1 
ATOM   3211 C  CA  . SER B 1 129 ? 6.729  10.829  41.611  1.00 57.19  ? 129  SER B CA  1 
ATOM   3212 C  C   . SER B 1 129 ? 6.837  9.305   41.448  1.00 58.61  ? 129  SER B C   1 
ATOM   3213 O  O   . SER B 1 129 ? 6.898  8.563   42.436  1.00 58.34  ? 129  SER B O   1 
ATOM   3214 C  CB  . SER B 1 129 ? 5.373  11.367  41.113  1.00 57.53  ? 129  SER B CB  1 
ATOM   3215 O  OG  . SER B 1 129 ? 4.253  10.660  41.589  1.00 69.06  ? 129  SER B OG  1 
ATOM   3216 N  N   . TYR B 1 130 ? 6.875  8.847   40.197  1.00 57.18  ? 130  TYR B N   1 
ATOM   3217 C  CA  . TYR B 1 130 ? 6.993  7.412   39.915  1.00 57.77  ? 130  TYR B CA  1 
ATOM   3218 C  C   . TYR B 1 130 ? 8.229  6.800   40.563  1.00 60.36  ? 130  TYR B C   1 
ATOM   3219 O  O   . TYR B 1 130 ? 8.167  5.727   41.197  1.00 61.83  ? 130  TYR B O   1 
ATOM   3220 C  CB  . TYR B 1 130 ? 7.026  7.165   38.413  1.00 58.26  ? 130  TYR B CB  1 
ATOM   3221 C  CG  . TYR B 1 130 ? 7.348  5.734   38.016  1.00 61.61  ? 130  TYR B CG  1 
ATOM   3222 C  CD1 . TYR B 1 130 ? 8.667  5.294   37.893  1.00 62.35  ? 130  TYR B CD1 1 
ATOM   3223 C  CD2 . TYR B 1 130 ? 6.333  4.831   37.736  1.00 57.99  ? 130  TYR B CD2 1 
ATOM   3224 C  CE1 . TYR B 1 130 ? 8.951  3.985   37.509  1.00 65.56  ? 130  TYR B CE1 1 
ATOM   3225 C  CE2 . TYR B 1 130 ? 6.609  3.548   37.353  1.00 61.00  ? 130  TYR B CE2 1 
ATOM   3226 C  CZ  . TYR B 1 130 ? 7.909  3.119   37.244  1.00 63.99  ? 130  TYR B CZ  1 
ATOM   3227 O  OH  . TYR B 1 130 ? 8.156  1.817   36.857  1.00 63.81  ? 130  TYR B OH  1 
ATOM   3228 N  N   . CYS B 1 131 ? 9.356  7.492   40.397  1.00 59.69  ? 131  CYS B N   1 
ATOM   3229 C  CA  . CYS B 1 131 ? 10.631 7.035   40.957  1.00 62.75  ? 131  CYS B CA  1 
ATOM   3230 C  C   . CYS B 1 131 ? 10.619 6.952   42.470  1.00 62.50  ? 131  CYS B C   1 
ATOM   3231 O  O   . CYS B 1 131 ? 11.215 6.071   43.060  1.00 63.03  ? 131  CYS B O   1 
ATOM   3232 C  CB  . CYS B 1 131 ? 11.781 7.941   40.509  1.00 61.88  ? 131  CYS B CB  1 
ATOM   3233 S  SG  . CYS B 1 131 ? 12.414 7.551   38.857  1.00 59.04  ? 131  CYS B SG  1 
ATOM   3234 N  N   . HIS B 1 132 ? 9.959  7.907   43.093  1.00 61.21  ? 132  HIS B N   1 
ATOM   3235 C  CA  . HIS B 1 132 ? 9.804  7.900   44.528  1.00 62.93  ? 132  HIS B CA  1 
ATOM   3236 C  C   . HIS B 1 132 ? 8.967  6.709   44.964  1.00 66.66  ? 132  HIS B C   1 
ATOM   3237 O  O   . HIS B 1 132 ? 9.302  6.029   45.934  1.00 66.04  ? 132  HIS B O   1 
ATOM   3238 C  CB  . HIS B 1 132 ? 9.157  9.207   44.968  1.00 58.26  ? 132  HIS B CB  1 
ATOM   3239 C  CG  . HIS B 1 132 ? 10.116 10.349  45.006  1.00 60.76  ? 132  HIS B CG  1 
ATOM   3240 N  ND1 . HIS B 1 132 ? 9.784  11.586  45.512  1.00 60.39  ? 132  HIS B ND1 1 
ATOM   3241 C  CD2 . HIS B 1 132 ? 11.406 10.432  44.611  1.00 60.34  ? 132  HIS B CD2 1 
ATOM   3242 C  CE1 . HIS B 1 132 ? 10.830 12.393  45.418  1.00 54.88  ? 132  HIS B CE1 1 
ATOM   3243 N  NE2 . HIS B 1 132 ? 11.827 11.713  44.874  1.00 57.95  ? 132  HIS B NE2 1 
ATOM   3244 N  N   . ALA B 1 133 ? 7.884  6.467   44.228  1.00 66.86  ? 133  ALA B N   1 
ATOM   3245 C  CA  . ALA B 1 133 ? 7.005  5.343   44.496  1.00 65.55  ? 133  ALA B CA  1 
ATOM   3246 C  C   . ALA B 1 133 ? 7.717  4.013   44.258  1.00 69.96  ? 133  ALA B C   1 
ATOM   3247 O  O   . ALA B 1 133 ? 7.223  2.968   44.660  1.00 76.73  ? 133  ALA B O   1 
ATOM   3248 C  CB  . ALA B 1 133 ? 5.722  5.442   43.670  1.00 60.33  ? 133  ALA B CB  1 
ATOM   3249 N  N   . MET B 1 134 ? 8.873  4.027   43.608  1.00 67.13  ? 134  MET B N   1 
ATOM   3250 C  CA  . MET B 1 134 ? 9.713  2.829   43.671  1.00 70.24  ? 134  MET B CA  1 
ATOM   3251 C  C   . MET B 1 134 ? 10.955 3.029   44.570  1.00 72.96  ? 134  MET B C   1 
ATOM   3252 O  O   . MET B 1 134 ? 11.973 2.350   44.412  1.00 71.10  ? 134  MET B O   1 
ATOM   3253 C  CB  . MET B 1 134 ? 10.083 2.334   42.270  1.00 69.32  ? 134  MET B CB  1 
ATOM   3254 C  CG  . MET B 1 134 ? 8.967  2.524   41.249  1.00 72.39  ? 134  MET B CG  1 
ATOM   3255 S  SD  . MET B 1 134 ? 8.014  1.058   40.764  1.00 82.11  ? 134  MET B SD  1 
ATOM   3256 C  CE  . MET B 1 134 ? 9.217  0.154   39.788  1.00 71.21  ? 134  MET B CE  1 
ATOM   3257 N  N   . GLN B 1 135 ? 10.846 3.978   45.504  1.00 74.90  ? 135  GLN B N   1 
ATOM   3258 C  CA  . GLN B 1 135 ? 11.860 4.263   46.547  1.00 77.96  ? 135  GLN B CA  1 
ATOM   3259 C  C   . GLN B 1 135 ? 13.241 4.761   46.091  1.00 80.47  ? 135  GLN B C   1 
ATOM   3260 O  O   . GLN B 1 135 ? 14.225 4.614   46.822  1.00 84.44  ? 135  GLN B O   1 
ATOM   3261 C  CB  . GLN B 1 135 ? 12.001 3.088   47.536  1.00 77.87  ? 135  GLN B CB  1 
ATOM   3262 C  CG  . GLN B 1 135 ? 10.667 2.611   48.119  1.00 81.74  ? 135  GLN B CG  1 
ATOM   3263 C  CD  . GLN B 1 135 ? 9.783  3.763   48.608  1.00 83.08  ? 135  GLN B CD  1 
ATOM   3264 O  OE1 . GLN B 1 135 ? 10.262 4.692   49.267  1.00 85.91  ? 135  GLN B OE1 1 
ATOM   3265 N  NE2 . GLN B 1 135 ? 8.487  3.707   48.278  1.00 75.42  ? 135  GLN B NE2 1 
ATOM   3266 N  N   . VAL B 1 136 ? 13.292 5.374   44.905  1.00 79.08  ? 136  VAL B N   1 
ATOM   3267 C  CA  . VAL B 1 136 ? 14.529 5.950   44.347  1.00 78.49  ? 136  VAL B CA  1 
ATOM   3268 C  C   . VAL B 1 136 ? 14.610 7.474   44.584  1.00 76.27  ? 136  VAL B C   1 
ATOM   3269 O  O   . VAL B 1 136 ? 14.020 8.271   43.857  1.00 70.97  ? 136  VAL B O   1 
ATOM   3270 C  CB  . VAL B 1 136 ? 14.690 5.641   42.831  1.00 77.42  ? 136  VAL B CB  1 
ATOM   3271 C  CG1 . VAL B 1 136 ? 16.147 5.706   42.433  1.00 78.09  ? 136  VAL B CG1 1 
ATOM   3272 C  CG2 . VAL B 1 136 ? 14.124 4.277   42.501  1.00 76.47  ? 136  VAL B CG2 1 
ATOM   3273 N  N   . CYS B 1 137 ? 15.340 7.868   45.619  1.00 83.01  ? 137  CYS B N   1 
ATOM   3274 C  CA  . CYS B 1 137 ? 15.414 9.269   45.996  1.00 71.60  ? 137  CYS B CA  1 
ATOM   3275 C  C   . CYS B 1 137 ? 16.724 9.884   45.528  1.00 71.60  ? 137  CYS B C   1 
ATOM   3276 O  O   . CYS B 1 137 ? 17.736 9.201   45.351  1.00 73.16  ? 137  CYS B O   1 
ATOM   3277 C  CB  . CYS B 1 137 ? 15.286 9.429   47.519  1.00 66.75  ? 137  CYS B CB  1 
ATOM   3278 S  SG  . CYS B 1 137 ? 14.506 8.020   48.407  1.00 85.97  ? 137  CYS B SG  1 
ATOM   3279 N  N   . HIS B 1 138 ? 16.681 11.181  45.280  1.00 67.13  ? 138  HIS B N   1 
ATOM   3280 C  CA  . HIS B 1 138 ? 17.866 11.983  45.421  1.00 65.78  ? 138  HIS B CA  1 
ATOM   3281 C  C   . HIS B 1 138 ? 18.986 11.640  44.457  1.00 69.35  ? 138  HIS B C   1 
ATOM   3282 O  O   . HIS B 1 138 ? 18.964 12.014  43.273  1.00 68.17  ? 138  HIS B O   1 
ATOM   3283 C  CB  . HIS B 1 138 ? 18.370 11.794  46.843  1.00 63.55  ? 138  HIS B CB  1 
ATOM   3284 C  CG  . HIS B 1 138 ? 19.287 12.877  47.310  1.00 66.65  ? 138  HIS B CG  1 
ATOM   3285 N  ND1 . HIS B 1 138 ? 19.011 14.214  47.136  1.00 68.22  ? 138  HIS B ND1 1 
ATOM   3286 C  CD2 . HIS B 1 138 ? 20.464 12.816  47.973  1.00 68.99  ? 138  HIS B CD2 1 
ATOM   3287 C  CE1 . HIS B 1 138 ? 19.988 14.933  47.664  1.00 68.87  ? 138  HIS B CE1 1 
ATOM   3288 N  NE2 . HIS B 1 138 ? 20.881 14.109  48.176  1.00 68.24  ? 138  HIS B NE2 1 
ATOM   3289 N  N   . ARG B 1 139 ? 19.971 10.935  45.000  1.00 72.29  ? 139  ARG B N   1 
ATOM   3290 C  CA  . ARG B 1 139 ? 21.273 10.790  44.373  1.00 69.06  ? 139  ARG B CA  1 
ATOM   3291 C  C   . ARG B 1 139 ? 21.302 9.614   43.400  1.00 66.78  ? 139  ARG B C   1 
ATOM   3292 O  O   . ARG B 1 139 ? 22.318 9.300   42.802  1.00 66.82  ? 139  ARG B O   1 
ATOM   3293 C  CB  . ARG B 1 139 ? 22.376 10.706  45.453  1.00 72.64  ? 139  ARG B CB  1 
ATOM   3294 C  CG  . ARG B 1 139 ? 23.120 12.049  45.705  1.00 68.01  ? 139  ARG B CG  1 
ATOM   3295 C  CD  . ARG B 1 139 ? 23.597 12.282  47.169  1.00 70.54  ? 139  ARG B CD  1 
ATOM   3296 N  NE  . ARG B 1 139 ? 25.052 12.311  47.302  1.00 74.97  ? 139  ARG B NE  1 
ATOM   3297 C  CZ  . ARG B 1 139 ? 25.750 11.435  48.026  1.00 82.61  ? 139  ARG B CZ  1 
ATOM   3298 N  NH1 . ARG B 1 139 ? 25.115 10.489  48.704  1.00 78.08  ? 139  ARG B NH1 1 
ATOM   3299 N  NH2 . ARG B 1 139 ? 27.079 11.515  48.088  1.00 78.63  ? 139  ARG B NH2 1 
ATOM   3300 N  N   . ASP B 1 140 ? 20.157 8.987   43.227  1.00 69.58  ? 140  ASP B N   1 
ATOM   3301 C  CA  . ASP B 1 140 ? 20.024 7.954   42.222  1.00 76.14  ? 140  ASP B CA  1 
ATOM   3302 C  C   . ASP B 1 140 ? 19.489 8.636   40.957  1.00 75.01  ? 140  ASP B C   1 
ATOM   3303 O  O   . ASP B 1 140 ? 19.577 8.110   39.842  1.00 75.53  ? 140  ASP B O   1 
ATOM   3304 C  CB  . ASP B 1 140 ? 19.070 6.859   42.717  1.00 82.76  ? 140  ASP B CB  1 
ATOM   3305 C  CG  . ASP B 1 140 ? 19.376 6.392   44.148  1.00 84.51  ? 140  ASP B CG  1 
ATOM   3306 O  OD1 . ASP B 1 140 ? 20.498 5.893   44.405  1.00 76.04  ? 140  ASP B OD1 1 
ATOM   3307 O  OD2 . ASP B 1 140 ? 18.472 6.497   45.006  1.00 84.81  ? 140  ASP B OD2 1 
ATOM   3308 N  N   . LEU B 1 141 ? 18.969 9.844   41.159  1.00 69.23  ? 141  LEU B N   1 
ATOM   3309 C  CA  . LEU B 1 141 ? 18.319 10.640  40.121  1.00 68.20  ? 141  LEU B CA  1 
ATOM   3310 C  C   . LEU B 1 141 ? 19.139 11.855  39.694  1.00 64.22  ? 141  LEU B C   1 
ATOM   3311 O  O   . LEU B 1 141 ? 19.486 12.715  40.523  1.00 65.04  ? 141  LEU B O   1 
ATOM   3312 C  CB  . LEU B 1 141 ? 16.962 11.126  40.618  1.00 65.60  ? 141  LEU B CB  1 
ATOM   3313 C  CG  . LEU B 1 141 ? 15.962 10.037  40.928  1.00 63.53  ? 141  LEU B CG  1 
ATOM   3314 C  CD1 . LEU B 1 141 ? 14.680 10.653  41.392  1.00 60.21  ? 141  LEU B CD1 1 
ATOM   3315 C  CD2 . LEU B 1 141 ? 15.738 9.177   39.685  1.00 61.97  ? 141  LEU B CD2 1 
ATOM   3316 N  N   . LYS B 1 142 ? 19.413 11.928  38.393  1.00 60.45  ? 142  LYS B N   1 
ATOM   3317 C  CA  . LYS B 1 142 ? 20.226 13.006  37.834  1.00 62.03  ? 142  LYS B CA  1 
ATOM   3318 C  C   . LYS B 1 142 ? 19.324 14.177  37.436  1.00 56.70  ? 142  LYS B C   1 
ATOM   3319 O  O   . LYS B 1 142 ? 19.217 14.534  36.270  1.00 53.09  ? 142  LYS B O   1 
ATOM   3320 C  CB  . LYS B 1 142 ? 21.063 12.500  36.648  1.00 63.67  ? 142  LYS B CB  1 
ATOM   3321 C  CG  . LYS B 1 142 ? 22.276 11.647  37.031  1.00 65.04  ? 142  LYS B CG  1 
ATOM   3322 C  CD  . LYS B 1 142 ? 22.940 10.993  35.809  1.00 78.77  ? 142  LYS B CD  1 
ATOM   3323 C  CE  . LYS B 1 142 ? 23.189 9.489   36.016  1.00 87.11  ? 142  LYS B CE  1 
ATOM   3324 N  NZ  . LYS B 1 142 ? 23.639 8.784   34.765  1.00 86.55  ? 142  LYS B NZ  1 
ATOM   3325 N  N   . LEU B 1 143 ? 18.667 14.762  38.430  1.00 56.21  ? 143  LEU B N   1 
ATOM   3326 C  CA  . LEU B 1 143 ? 17.630 15.756  38.184  1.00 53.89  ? 143  LEU B CA  1 
ATOM   3327 C  C   . LEU B 1 143 ? 18.195 17.110  37.846  1.00 53.28  ? 143  LEU B C   1 
ATOM   3328 O  O   . LEU B 1 143 ? 17.457 18.035  37.537  1.00 56.24  ? 143  LEU B O   1 
ATOM   3329 C  CB  . LEU B 1 143 ? 16.714 15.889  39.387  1.00 51.03  ? 143  LEU B CB  1 
ATOM   3330 C  CG  . LEU B 1 143 ? 15.842 14.680  39.647  1.00 53.71  ? 143  LEU B CG  1 
ATOM   3331 C  CD1 . LEU B 1 143 ? 14.901 14.946  40.797  1.00 53.44  ? 143  LEU B CD1 1 
ATOM   3332 C  CD2 . LEU B 1 143 ? 15.097 14.329  38.390  1.00 49.79  ? 143  LEU B CD2 1 
ATOM   3333 N  N   . GLU B 1 144 ? 19.510 17.223  37.934  1.00 53.78  ? 144  GLU B N   1 
ATOM   3334 C  CA  . GLU B 1 144 ? 20.210 18.449  37.610  1.00 50.74  ? 144  GLU B CA  1 
ATOM   3335 C  C   . GLU B 1 144 ? 20.588 18.446  36.134  1.00 50.46  ? 144  GLU B C   1 
ATOM   3336 O  O   . GLU B 1 144 ? 20.831 19.479  35.548  1.00 52.55  ? 144  GLU B O   1 
ATOM   3337 C  CB  . GLU B 1 144 ? 21.425 18.626  38.525  1.00 49.36  ? 144  GLU B CB  1 
ATOM   3338 C  CG  . GLU B 1 144 ? 22.291 17.400  38.659  1.00 53.79  ? 144  GLU B CG  1 
ATOM   3339 C  CD  . GLU B 1 144 ? 21.708 16.318  39.576  1.00 64.97  ? 144  GLU B CD  1 
ATOM   3340 O  OE1 . GLU B 1 144 ? 21.223 16.630  40.689  1.00 70.18  ? 144  GLU B OE1 1 
ATOM   3341 O  OE2 . GLU B 1 144 ? 21.757 15.140  39.177  1.00 63.69  ? 144  GLU B OE2 1 
ATOM   3342 N  N   . ASN B 1 145 ? 20.592 17.282  35.517  1.00 46.10  ? 145  ASN B N   1 
ATOM   3343 C  CA  . ASN B 1 145 ? 20.837 17.225  34.095  1.00 46.71  ? 145  ASN B CA  1 
ATOM   3344 C  C   . ASN B 1 145 ? 19.862 16.310  33.331  1.00 46.52  ? 145  ASN B C   1 
ATOM   3345 O  O   . ASN B 1 145 ? 20.245 15.292  32.766  1.00 48.24  ? 145  ASN B O   1 
ATOM   3346 C  CB  . ASN B 1 145 ? 22.309 16.846  33.842  1.00 50.37  ? 145  ASN B CB  1 
ATOM   3347 C  CG  . ASN B 1 145 ? 22.780 17.191  32.439  1.00 54.66  ? 145  ASN B CG  1 
ATOM   3348 O  OD1 . ASN B 1 145 ? 22.313 18.151  31.832  1.00 53.30  ? 145  ASN B OD1 1 
ATOM   3349 N  ND2 . ASN B 1 145 ? 23.713 16.410  31.923  1.00 61.09  ? 145  ASN B ND2 1 
ATOM   3350 N  N   . THR B 1 146 ? 18.600 16.695  33.298  1.00 47.51  ? 146  THR B N   1 
ATOM   3351 C  CA  . THR B 1 146 ? 17.620 15.944  32.531  1.00 47.86  ? 146  THR B CA  1 
ATOM   3352 C  C   . THR B 1 146 ? 17.760 16.198  31.026  1.00 48.37  ? 146  THR B C   1 
ATOM   3353 O  O   . THR B 1 146 ? 18.349 17.198  30.588  1.00 47.21  ? 146  THR B O   1 
ATOM   3354 C  CB  . THR B 1 146 ? 16.207 16.216  33.048  1.00 49.77  ? 146  THR B CB  1 
ATOM   3355 O  OG1 . THR B 1 146 ? 15.640 17.353  32.384  1.00 46.74  ? 146  THR B OG1 1 
ATOM   3356 C  CG2 . THR B 1 146 ? 16.293 16.512  34.527  1.00 51.12  ? 146  THR B CG2 1 
ATOM   3357 N  N   . LEU B 1 147 ? 17.226 15.283  30.237  1.00 43.11  ? 147  LEU B N   1 
ATOM   3358 C  CA  . LEU B 1 147 ? 17.534 15.261  28.832  1.00 44.66  ? 147  LEU B CA  1 
ATOM   3359 C  C   . LEU B 1 147 ? 16.252 15.252  28.050  1.00 46.74  ? 147  LEU B C   1 
ATOM   3360 O  O   . LEU B 1 147 ? 15.174 15.318  28.614  1.00 50.80  ? 147  LEU B O   1 
ATOM   3361 C  CB  . LEU B 1 147 ? 18.339 14.010  28.502  1.00 50.36  ? 147  LEU B CB  1 
ATOM   3362 C  CG  . LEU B 1 147 ? 19.587 13.665  29.327  1.00 53.18  ? 147  LEU B CG  1 
ATOM   3363 C  CD1 . LEU B 1 147 ? 20.232 12.463  28.713  1.00 50.24  ? 147  LEU B CD1 1 
ATOM   3364 C  CD2 . LEU B 1 147 ? 20.558 14.856  29.401  1.00 46.13  ? 147  LEU B CD2 1 
ATOM   3365 N  N   . LEU B 1 148 ? 16.375 15.201  26.736  1.00 47.62  ? 148  LEU B N   1 
ATOM   3366 C  CA  . LEU B 1 148 ? 15.225 15.170  25.837  1.00 50.64  ? 148  LEU B CA  1 
ATOM   3367 C  C   . LEU B 1 148 ? 15.410 14.037  24.810  1.00 53.85  ? 148  LEU B C   1 
ATOM   3368 O  O   . LEU B 1 148 ? 16.522 13.769  24.368  1.00 51.39  ? 148  LEU B O   1 
ATOM   3369 C  CB  . LEU B 1 148 ? 15.072 16.532  25.151  1.00 50.42  ? 148  LEU B CB  1 
ATOM   3370 C  CG  . LEU B 1 148 ? 15.159 17.802  26.032  1.00 52.41  ? 148  LEU B CG  1 
ATOM   3371 C  CD1 . LEU B 1 148 ? 15.211 19.113  25.203  1.00 45.81  ? 148  LEU B CD1 1 
ATOM   3372 C  CD2 . LEU B 1 148 ? 14.017 17.874  27.093  1.00 50.27  ? 148  LEU B CD2 1 
ATOM   3373 N  N   . ASP B 1 149 ? 14.330 13.333  24.490  1.00 54.25  ? 149  ASP B N   1 
ATOM   3374 C  CA  . ASP B 1 149 ? 14.347 12.327  23.422  1.00 58.93  ? 149  ASP B CA  1 
ATOM   3375 C  C   . ASP B 1 149 ? 14.459 13.064  22.083  1.00 65.45  ? 149  ASP B C   1 
ATOM   3376 O  O   . ASP B 1 149 ? 14.548 14.306  22.047  1.00 61.32  ? 149  ASP B O   1 
ATOM   3377 C  CB  . ASP B 1 149 ? 13.074 11.442  23.463  1.00 62.29  ? 149  ASP B CB  1 
ATOM   3378 C  CG  . ASP B 1 149 ? 11.829 12.142  22.873  1.00 68.26  ? 149  ASP B CG  1 
ATOM   3379 O  OD1 . ASP B 1 149 ? 11.894 13.356  22.577  1.00 63.70  ? 149  ASP B OD1 1 
ATOM   3380 O  OD2 . ASP B 1 149 ? 10.782 11.476  22.687  1.00 77.51  ? 149  ASP B OD2 1 
ATOM   3381 N  N   . GLY B 1 150 ? 14.423 12.320  20.985  1.00 67.42  ? 150  GLY B N   1 
ATOM   3382 C  CA  . GLY B 1 150 ? 14.609 12.926  19.680  1.00 67.90  ? 150  GLY B CA  1 
ATOM   3383 C  C   . GLY B 1 150 ? 13.360 13.510  19.041  1.00 75.61  ? 150  GLY B C   1 
ATOM   3384 O  O   . GLY B 1 150 ? 13.453 14.296  18.099  1.00 77.37  ? 150  GLY B O   1 
ATOM   3385 N  N   . SER B 1 151 ? 12.193 13.135  19.551  1.00 74.97  ? 151  SER B N   1 
ATOM   3386 C  CA  . SER B 1 151 ? 10.937 13.399  18.849  1.00 77.90  ? 151  SER B CA  1 
ATOM   3387 C  C   . SER B 1 151 ? 10.742 14.868  18.483  1.00 79.89  ? 151  SER B C   1 
ATOM   3388 O  O   . SER B 1 151 ? 11.220 15.751  19.194  1.00 76.77  ? 151  SER B O   1 
ATOM   3389 C  CB  . SER B 1 151 ? 9.737  12.865  19.645  1.00 78.77  ? 151  SER B CB  1 
ATOM   3390 O  OG  . SER B 1 151 ? 9.649  13.456  20.930  1.00 77.68  ? 151  SER B OG  1 
ATOM   3391 N  N   . PRO B 1 152 ? 10.058 15.124  17.348  1.00 84.51  ? 152  PRO B N   1 
ATOM   3392 C  CA  . PRO B 1 152 ? 9.649  16.463  16.903  1.00 79.80  ? 152  PRO B CA  1 
ATOM   3393 C  C   . PRO B 1 152 ? 8.868  17.194  17.986  1.00 82.02  ? 152  PRO B C   1 
ATOM   3394 O  O   . PRO B 1 152 ? 8.814  18.420  18.017  1.00 85.59  ? 152  PRO B O   1 
ATOM   3395 C  CB  . PRO B 1 152 ? 8.755  16.162  15.704  1.00 80.08  ? 152  PRO B CB  1 
ATOM   3396 C  CG  . PRO B 1 152 ? 9.377  14.927  15.122  1.00 88.29  ? 152  PRO B CG  1 
ATOM   3397 C  CD  . PRO B 1 152 ? 9.788  14.103  16.319  1.00 82.72  ? 152  PRO B CD  1 
ATOM   3398 N  N   . ALA B 1 153 ? 8.257  16.423  18.871  1.00 83.42  ? 153  ALA B N   1 
ATOM   3399 C  CA  . ALA B 1 153 ? 7.722  16.956  20.113  1.00 79.98  ? 153  ALA B CA  1 
ATOM   3400 C  C   . ALA B 1 153 ? 8.482  16.259  21.231  1.00 78.11  ? 153  ALA B C   1 
ATOM   3401 O  O   . ALA B 1 153 ? 8.311  15.059  21.459  1.00 78.65  ? 153  ALA B O   1 
ATOM   3402 C  CB  . ALA B 1 153 ? 6.233  16.687  20.214  1.00 80.28  ? 153  ALA B CB  1 
ATOM   3403 N  N   . PRO B 1 154 ? 9.345  17.008  21.923  1.00 73.69  ? 154  PRO B N   1 
ATOM   3404 C  CA  . PRO B 1 154 ? 10.337 16.440  22.845  1.00 70.63  ? 154  PRO B CA  1 
ATOM   3405 C  C   . PRO B 1 154 ? 9.753  15.868  24.139  1.00 68.98  ? 154  PRO B C   1 
ATOM   3406 O  O   . PRO B 1 154 ? 8.985  16.535  24.846  1.00 65.37  ? 154  PRO B O   1 
ATOM   3407 C  CB  . PRO B 1 154 ? 11.249 17.635  23.166  1.00 64.59  ? 154  PRO B CB  1 
ATOM   3408 C  CG  . PRO B 1 154 ? 10.901 18.698  22.155  1.00 69.40  ? 154  PRO B CG  1 
ATOM   3409 C  CD  . PRO B 1 154 ? 9.467  18.467  21.808  1.00 69.66  ? 154  PRO B CD  1 
ATOM   3410 N  N   . ARG B 1 155 ? 10.124 14.627  24.441  1.00 67.87  ? 155  ARG B N   1 
ATOM   3411 C  CA  . ARG B 1 155 ? 9.845  14.068  25.755  1.00 62.25  ? 155  ARG B CA  1 
ATOM   3412 C  C   . ARG B 1 155 ? 11.019 14.281  26.704  1.00 55.60  ? 155  ARG B C   1 
ATOM   3413 O  O   . ARG B 1 155 ? 12.170 14.161  26.313  1.00 54.14  ? 155  ARG B O   1 
ATOM   3414 C  CB  . ARG B 1 155 ? 9.462  12.594  25.682  1.00 61.38  ? 155  ARG B CB  1 
ATOM   3415 C  CG  . ARG B 1 155 ? 8.028  12.351  26.141  1.00 74.35  ? 155  ARG B CG  1 
ATOM   3416 C  CD  . ARG B 1 155 ? 7.046  13.075  25.198  1.00 81.97  ? 155  ARG B CD  1 
ATOM   3417 N  NE  . ARG B 1 155 ? 5.921  13.788  25.830  1.00 79.04  ? 155  ARG B NE  1 
ATOM   3418 C  CZ  . ARG B 1 155 ? 5.188  13.326  26.844  1.00 82.58  ? 155  ARG B CZ  1 
ATOM   3419 N  NH1 . ARG B 1 155 ? 5.449  12.135  27.383  1.00 81.04  ? 155  ARG B NH1 1 
ATOM   3420 N  NH2 . ARG B 1 155 ? 4.192  14.064  27.326  1.00 79.09  ? 155  ARG B NH2 1 
ATOM   3421 N  N   . LEU B 1 156 ? 10.702 14.650  27.939  1.00 51.50  ? 156  LEU B N   1 
ATOM   3422 C  CA  . LEU B 1 156 ? 11.675 14.704  29.003  1.00 48.17  ? 156  LEU B CA  1 
ATOM   3423 C  C   . LEU B 1 156 ? 12.152 13.289  29.365  1.00 49.72  ? 156  LEU B C   1 
ATOM   3424 O  O   . LEU B 1 156 ? 11.379 12.351  29.357  1.00 50.60  ? 156  LEU B O   1 
ATOM   3425 C  CB  . LEU B 1 156 ? 11.080 15.404  30.216  1.00 48.53  ? 156  LEU B CB  1 
ATOM   3426 C  CG  . LEU B 1 156 ? 12.135 15.757  31.258  1.00 50.17  ? 156  LEU B CG  1 
ATOM   3427 C  CD1 . LEU B 1 156 ? 12.772 17.116  30.949  1.00 47.13  ? 156  LEU B CD1 1 
ATOM   3428 C  CD2 . LEU B 1 156 ? 11.535 15.757  32.624  1.00 48.80  ? 156  LEU B CD2 1 
ATOM   3429 N  N   . LYS B 1 157 ? 13.439 13.148  29.667  1.00 50.85  ? 157  LYS B N   1 
ATOM   3430 C  CA  . LYS B 1 157 ? 14.042 11.850  29.964  1.00 51.30  ? 157  LYS B CA  1 
ATOM   3431 C  C   . LYS B 1 157 ? 15.028 11.984  31.118  1.00 51.82  ? 157  LYS B C   1 
ATOM   3432 O  O   . LYS B 1 157 ? 16.026 12.686  31.026  1.00 51.37  ? 157  LYS B O   1 
ATOM   3433 C  CB  . LYS B 1 157 ? 14.746 11.284  28.739  1.00 51.45  ? 157  LYS B CB  1 
ATOM   3434 C  CG  . LYS B 1 157 ? 13.873 11.139  27.501  1.00 52.93  ? 157  LYS B CG  1 
ATOM   3435 C  CD  . LYS B 1 157 ? 12.738 10.098  27.639  1.00 55.02  ? 157  LYS B CD  1 
ATOM   3436 C  CE  . LYS B 1 157 ? 13.272 8.665   27.695  1.00 58.84  ? 157  LYS B CE  1 
ATOM   3437 N  NZ  . LYS B 1 157 ? 12.259 7.635   27.303  1.00 61.77  ? 157  LYS B NZ  1 
ATOM   3438 N  N   . ILE B 1 158 ? 14.723 11.317  32.220  1.00 53.02  ? 158  ILE B N   1 
ATOM   3439 C  CA  . ILE B 1 158 ? 15.556 11.383  33.413  1.00 52.99  ? 158  ILE B CA  1 
ATOM   3440 C  C   . ILE B 1 158 ? 16.432 10.142  33.512  1.00 55.18  ? 158  ILE B C   1 
ATOM   3441 O  O   . ILE B 1 158 ? 15.958 9.020   33.351  1.00 54.57  ? 158  ILE B O   1 
ATOM   3442 C  CB  . ILE B 1 158 ? 14.692 11.507  34.677  1.00 50.93  ? 158  ILE B CB  1 
ATOM   3443 C  CG1 . ILE B 1 158 ? 13.585 12.523  34.453  1.00 52.25  ? 158  ILE B CG1 1 
ATOM   3444 C  CG2 . ILE B 1 158 ? 15.521 11.866  35.891  1.00 49.50  ? 158  ILE B CG2 1 
ATOM   3445 C  CD1 . ILE B 1 158 ? 12.485 12.496  35.517  1.00 50.19  ? 158  ILE B CD1 1 
ATOM   3446 N  N   . CYS B 1 159 ? 17.715 10.368  33.756  1.00 57.64  ? 159  CYS B N   1 
ATOM   3447 C  CA  . CYS B 1 159 ? 18.671 9.295   33.939  1.00 60.44  ? 159  CYS B CA  1 
ATOM   3448 C  C   . CYS B 1 159 ? 18.629 8.810   35.371  1.00 65.19  ? 159  CYS B C   1 
ATOM   3449 O  O   . CYS B 1 159 ? 18.651 9.622   36.301  1.00 64.58  ? 159  CYS B O   1 
ATOM   3450 C  CB  . CYS B 1 159 ? 20.088 9.777   33.613  1.00 61.09  ? 159  CYS B CB  1 
ATOM   3451 S  SG  . CYS B 1 159 ? 20.432 9.963   31.845  1.00 63.29  ? 159  CYS B SG  1 
ATOM   3452 N  N   . ALA B 1 160 ? 18.584 7.492   35.542  1.00 75.47  ? 160  ALA B N   1 
ATOM   3453 C  CA  . ALA B 1 160 ? 18.672 6.884   36.866  1.00 81.62  ? 160  ALA B CA  1 
ATOM   3454 C  C   . ALA B 1 160 ? 19.761 5.802   36.906  1.00 89.33  ? 160  ALA B C   1 
ATOM   3455 O  O   . ALA B 1 160 ? 19.725 4.831   36.128  1.00 89.37  ? 160  ALA B O   1 
ATOM   3456 C  CB  . ALA B 1 160 ? 17.319 6.316   37.280  1.00 75.77  ? 160  ALA B CB  1 
ATOM   3457 N  N   . PHE B 1 161 ? 20.728 5.979   37.805  1.00 90.04  ? 161  PHE B N   1 
ATOM   3458 C  CA  . PHE B 1 161 ? 21.864 5.064   37.902  1.00 99.95  ? 161  PHE B CA  1 
ATOM   3459 C  C   . PHE B 1 161 ? 22.756 5.118   36.657  1.00 105.13 ? 161  PHE B C   1 
ATOM   3460 O  O   . PHE B 1 161 ? 22.378 4.616   35.587  1.00 105.14 ? 161  PHE B O   1 
ATOM   3461 C  CB  . PHE B 1 161 ? 21.379 3.625   38.102  1.00 103.13 ? 161  PHE B CB  1 
ATOM   3462 C  CG  . PHE B 1 161 ? 20.534 3.432   39.329  1.00 105.99 ? 161  PHE B CG  1 
ATOM   3463 C  CD1 . PHE B 1 161 ? 20.883 4.043   40.534  1.00 100.47 ? 161  PHE B CD1 1 
ATOM   3464 C  CD2 . PHE B 1 161 ? 19.385 2.643   39.279  1.00 100.71 ? 161  PHE B CD2 1 
ATOM   3465 C  CE1 . PHE B 1 161 ? 20.106 3.863   41.672  1.00 96.90  ? 161  PHE B CE1 1 
ATOM   3466 C  CE2 . PHE B 1 161 ? 18.601 2.466   40.406  1.00 101.63 ? 161  PHE B CE2 1 
ATOM   3467 C  CZ  . PHE B 1 161 ? 18.961 3.077   41.607  1.00 100.37 ? 161  PHE B CZ  1 
ATOM   3468 N  N   . GLY B 1 162 ? 23.942 5.710   36.801  1.00 106.83 ? 162  GLY B N   1 
ATOM   3469 C  CA  . GLY B 1 162 ? 24.906 5.766   35.714  1.00 108.32 ? 162  GLY B CA  1 
ATOM   3470 C  C   . GLY B 1 162 ? 25.963 4.679   35.816  1.00 112.40 ? 162  GLY B C   1 
ATOM   3471 O  O   . GLY B 1 162 ? 26.956 4.699   35.081  1.00 110.58 ? 162  GLY B O   1 
ATOM   3472 N  N   . TYR B 1 163 ? 25.731 3.725   36.723  1.00 114.77 ? 163  TYR B N   1 
ATOM   3473 C  CA  . TYR B 1 163 ? 26.675 2.642   37.032  1.00 111.84 ? 163  TYR B CA  1 
ATOM   3474 C  C   . TYR B 1 163 ? 28.098 3.164   37.244  1.00 111.75 ? 163  TYR B C   1 
ATOM   3475 O  O   . TYR B 1 163 ? 29.053 2.658   36.654  1.00 108.56 ? 163  TYR B O   1 
ATOM   3476 C  CB  . TYR B 1 163 ? 26.663 1.556   35.949  1.00 105.94 ? 163  TYR B CB  1 
ATOM   3477 C  CG  . TYR B 1 163 ? 25.291 1.001   35.607  1.00 108.59 ? 163  TYR B CG  1 
ATOM   3478 C  CD1 . TYR B 1 163 ? 24.235 1.036   36.519  1.00 109.61 ? 163  TYR B CD1 1 
ATOM   3479 C  CD2 . TYR B 1 163 ? 25.053 0.433   34.363  1.00 103.62 ? 163  TYR B CD2 1 
ATOM   3480 C  CE1 . TYR B 1 163 ? 22.974 0.514   36.191  1.00 106.18 ? 163  TYR B CE1 1 
ATOM   3481 C  CE2 . TYR B 1 163 ? 23.802 -0.089  34.027  1.00 98.55  ? 163  TYR B CE2 1 
ATOM   3482 C  CZ  . TYR B 1 163 ? 22.769 -0.048  34.938  1.00 100.60 ? 163  TYR B CZ  1 
ATOM   3483 O  OH  . TYR B 1 163 ? 21.545 -0.570  34.575  1.00 98.32  ? 163  TYR B OH  1 
ATOM   3484 N  N   . ASP B 1 175 ? 33.588 18.059  30.588  1.00 105.47 ? 175  ASP B N   1 
ATOM   3485 C  CA  . ASP B 1 175 ? 32.260 17.848  30.017  1.00 108.90 ? 175  ASP B CA  1 
ATOM   3486 C  C   . ASP B 1 175 ? 31.210 18.737  30.684  1.00 106.78 ? 175  ASP B C   1 
ATOM   3487 O  O   . ASP B 1 175 ? 31.331 19.967  30.669  1.00 105.85 ? 175  ASP B O   1 
ATOM   3488 C  CB  . ASP B 1 175 ? 31.849 16.355  30.059  1.00 115.52 ? 175  ASP B CB  1 
ATOM   3489 N  N   . THR B 1 176 ? 30.200 18.102  31.279  1.00 104.73 ? 176  THR B N   1 
ATOM   3490 C  CA  . THR B 1 176 ? 29.006 18.787  31.785  1.00 102.03 ? 176  THR B CA  1 
ATOM   3491 C  C   . THR B 1 176 ? 29.193 19.456  33.163  1.00 96.01  ? 176  THR B C   1 
ATOM   3492 O  O   . THR B 1 176 ? 29.661 18.818  34.122  1.00 91.01  ? 176  THR B O   1 
ATOM   3493 C  CB  . THR B 1 176 ? 27.781 17.823  31.812  1.00 102.24 ? 176  THR B CB  1 
ATOM   3494 O  OG1 . THR B 1 176 ? 27.834 16.985  32.976  1.00 102.75 ? 176  THR B OG1 1 
ATOM   3495 C  CG2 . THR B 1 176 ? 27.747 16.946  30.549  1.00 101.46 ? 176  THR B CG2 1 
ATOM   3496 N  N   . VAL B 1 177 ? 28.816 20.739  33.240  1.00 86.41  ? 177  VAL B N   1 
ATOM   3497 C  CA  . VAL B 1 177 ? 28.924 21.552  34.459  1.00 80.81  ? 177  VAL B CA  1 
ATOM   3498 C  C   . VAL B 1 177 ? 27.717 21.401  35.375  1.00 82.19  ? 177  VAL B C   1 
ATOM   3499 O  O   . VAL B 1 177 ? 26.584 21.637  34.959  1.00 79.36  ? 177  VAL B O   1 
ATOM   3500 C  CB  . VAL B 1 177 ? 28.976 23.059  34.144  1.00 77.43  ? 177  VAL B CB  1 
ATOM   3501 C  CG1 . VAL B 1 177 ? 29.258 23.847  35.426  1.00 72.86  ? 177  VAL B CG1 1 
ATOM   3502 C  CG2 . VAL B 1 177 ? 29.984 23.361  33.042  1.00 83.46  ? 177  VAL B CG2 1 
ATOM   3503 N  N   . GLY B 1 178 ? 27.958 21.041  36.630  1.00 74.56  ? 178  GLY B N   1 
ATOM   3504 C  CA  . GLY B 1 178 ? 26.875 20.910  37.581  1.00 66.25  ? 178  GLY B CA  1 
ATOM   3505 C  C   . GLY B 1 178 ? 26.945 21.995  38.631  1.00 62.04  ? 178  GLY B C   1 
ATOM   3506 O  O   . GLY B 1 178 ? 27.887 22.042  39.424  1.00 61.74  ? 178  GLY B O   1 
ATOM   3507 N  N   . THR B 1 179 ? 25.952 22.875  38.649  1.00 60.49  ? 179  THR B N   1 
ATOM   3508 C  CA  . THR B 1 179 ? 25.937 23.936  39.644  1.00 55.34  ? 179  THR B CA  1 
ATOM   3509 C  C   . THR B 1 179 ? 25.542 23.397  41.000  1.00 51.38  ? 179  THR B C   1 
ATOM   3510 O  O   . THR B 1 179 ? 24.727 22.470  41.078  1.00 51.86  ? 179  THR B O   1 
ATOM   3511 C  CB  . THR B 1 179 ? 24.966 25.086  39.265  1.00 53.70  ? 179  THR B CB  1 
ATOM   3512 O  OG1 . THR B 1 179 ? 24.970 26.057  40.316  1.00 53.96  ? 179  THR B OG1 1 
ATOM   3513 C  CG2 . THR B 1 179 ? 23.527 24.584  39.040  1.00 48.26  ? 179  THR B CG2 1 
ATOM   3514 N  N   . PRO B 1 180 ? 26.131 23.965  42.070  1.00 52.42  ? 180  PRO B N   1 
ATOM   3515 C  CA  . PRO B 1 180 ? 25.726 23.709  43.461  1.00 54.36  ? 180  PRO B CA  1 
ATOM   3516 C  C   . PRO B 1 180 ? 24.316 24.208  43.811  1.00 49.29  ? 180  PRO B C   1 
ATOM   3517 O  O   . PRO B 1 180 ? 23.791 23.851  44.852  1.00 51.60  ? 180  PRO B O   1 
ATOM   3518 C  CB  . PRO B 1 180 ? 26.778 24.472  44.284  1.00 48.10  ? 180  PRO B CB  1 
ATOM   3519 C  CG  . PRO B 1 180 ? 27.453 25.380  43.336  1.00 53.15  ? 180  PRO B CG  1 
ATOM   3520 C  CD  . PRO B 1 180 ? 27.391 24.723  42.006  1.00 53.32  ? 180  PRO B CD  1 
ATOM   3521 N  N   . ALA B 1 181 ? 23.726 25.039  42.962  1.00 49.89  ? 181  ALA B N   1 
ATOM   3522 C  CA  . ALA B 1 181 ? 22.365 25.546  43.163  1.00 52.05  ? 181  ALA B CA  1 
ATOM   3523 C  C   . ALA B 1 181 ? 21.308 24.439  43.393  1.00 50.14  ? 181  ALA B C   1 
ATOM   3524 O  O   . ALA B 1 181 ? 20.289 24.664  44.072  1.00 47.89  ? 181  ALA B O   1 
ATOM   3525 C  CB  . ALA B 1 181 ? 21.974 26.424  41.997  1.00 47.26  ? 181  ALA B CB  1 
ATOM   3526 N  N   . TYR B 1 182 ? 21.587 23.253  42.847  1.00 47.56  ? 182  TYR B N   1 
ATOM   3527 C  CA  . TYR B 1 182 ? 20.717 22.093  42.946  1.00 46.76  ? 182  TYR B CA  1 
ATOM   3528 C  C   . TYR B 1 182 ? 20.662 21.502  44.356  1.00 49.09  ? 182  TYR B C   1 
ATOM   3529 O  O   . TYR B 1 182 ? 19.728 20.784  44.716  1.00 52.57  ? 182  TYR B O   1 
ATOM   3530 C  CB  . TYR B 1 182 ? 21.127 21.056  41.908  1.00 48.16  ? 182  TYR B CB  1 
ATOM   3531 C  CG  . TYR B 1 182 ? 20.410 21.256  40.612  1.00 50.66  ? 182  TYR B CG  1 
ATOM   3532 C  CD1 . TYR B 1 182 ? 19.062 20.944  40.502  1.00 49.78  ? 182  TYR B CD1 1 
ATOM   3533 C  CD2 . TYR B 1 182 ? 21.048 21.818  39.507  1.00 48.46  ? 182  TYR B CD2 1 
ATOM   3534 C  CE1 . TYR B 1 182 ? 18.374 21.153  39.330  1.00 47.48  ? 182  TYR B CE1 1 
ATOM   3535 C  CE2 . TYR B 1 182 ? 20.363 22.036  38.321  1.00 50.26  ? 182  TYR B CE2 1 
ATOM   3536 C  CZ  . TYR B 1 182 ? 19.022 21.687  38.232  1.00 51.74  ? 182  TYR B CZ  1 
ATOM   3537 O  OH  . TYR B 1 182 ? 18.331 21.882  37.043  1.00 52.69  ? 182  TYR B OH  1 
ATOM   3538 N  N   . ILE B 1 183 ? 21.654 21.849  45.161  1.00 46.08  ? 183  ILE B N   1 
ATOM   3539 C  CA  . ILE B 1 183 ? 21.752 21.350  46.515  1.00 47.87  ? 183  ILE B CA  1 
ATOM   3540 C  C   . ILE B 1 183 ? 20.827 22.092  47.490  1.00 51.84  ? 183  ILE B C   1 
ATOM   3541 O  O   . ILE B 1 183 ? 21.018 23.274  47.771  1.00 49.51  ? 183  ILE B O   1 
ATOM   3542 C  CB  . ILE B 1 183 ? 23.200 21.441  47.046  1.00 51.91  ? 183  ILE B CB  1 
ATOM   3543 C  CG1 . ILE B 1 183 ? 24.182 20.928  46.006  1.00 52.10  ? 183  ILE B CG1 1 
ATOM   3544 C  CG2 . ILE B 1 183 ? 23.331 20.726  48.397  1.00 50.16  ? 183  ILE B CG2 1 
ATOM   3545 C  CD1 . ILE B 1 183 ? 25.636 21.049  46.405  1.00 54.62  ? 183  ILE B CD1 1 
ATOM   3546 N  N   . ALA B 1 184 ? 19.856 21.351  48.020  1.00 50.63  ? 184  ALA B N   1 
ATOM   3547 C  CA  . ALA B 1 184 ? 18.952 21.836  49.048  1.00 50.52  ? 184  ALA B CA  1 
ATOM   3548 C  C   . ALA B 1 184 ? 19.696 22.225  50.329  1.00 51.97  ? 184  ALA B C   1 
ATOM   3549 O  O   . ALA B 1 184 ? 20.671 21.590  50.675  1.00 51.97  ? 184  ALA B O   1 
ATOM   3550 C  CB  . ALA B 1 184 ? 17.898 20.789  49.329  1.00 49.18  ? 184  ALA B CB  1 
ATOM   3551 N  N   . PRO B 1 185 ? 19.242 23.298  51.014  1.00 53.58  ? 185  PRO B N   1 
ATOM   3552 C  CA  . PRO B 1 185 ? 19.911 23.834  52.215  1.00 54.52  ? 185  PRO B CA  1 
ATOM   3553 C  C   . PRO B 1 185 ? 20.199 22.775  53.291  1.00 57.70  ? 185  PRO B C   1 
ATOM   3554 O  O   . PRO B 1 185 ? 21.250 22.840  53.938  1.00 59.04  ? 185  PRO B O   1 
ATOM   3555 C  CB  . PRO B 1 185 ? 18.906 24.854  52.753  1.00 52.30  ? 185  PRO B CB  1 
ATOM   3556 C  CG  . PRO B 1 185 ? 18.146 25.304  51.551  1.00 53.50  ? 185  PRO B CG  1 
ATOM   3557 C  CD  . PRO B 1 185 ? 18.103 24.139  50.590  1.00 50.47  ? 185  PRO B CD  1 
ATOM   3558 N  N   . GLU B 1 186 ? 19.276 21.831  53.494  1.00 53.69  ? 186  GLU B N   1 
ATOM   3559 C  CA  . GLU B 1 186 ? 19.415 20.844  54.569  1.00 56.42  ? 186  GLU B CA  1 
ATOM   3560 C  C   . GLU B 1 186 ? 20.518 19.881  54.209  1.00 57.47  ? 186  GLU B C   1 
ATOM   3561 O  O   . GLU B 1 186 ? 21.191 19.350  55.064  1.00 59.39  ? 186  GLU B O   1 
ATOM   3562 C  CB  . GLU B 1 186 ? 18.093 20.094  54.862  1.00 52.23  ? 186  GLU B CB  1 
ATOM   3563 C  CG  . GLU B 1 186 ? 17.526 19.161  53.750  1.00 54.49  ? 186  GLU B CG  1 
ATOM   3564 C  CD  . GLU B 1 186 ? 16.662 19.886  52.710  1.00 56.23  ? 186  GLU B CD  1 
ATOM   3565 O  OE1 . GLU B 1 186 ? 16.696 21.135  52.645  1.00 49.87  ? 186  GLU B OE1 1 
ATOM   3566 O  OE2 . GLU B 1 186 ? 15.948 19.200  51.953  1.00 54.23  ? 186  GLU B OE2 1 
ATOM   3567 N  N   . VAL B 1 187 ? 20.694 19.676  52.918  1.00 55.85  ? 187  VAL B N   1 
ATOM   3568 C  CA  . VAL B 1 187 ? 21.749 18.853  52.413  1.00 55.79  ? 187  VAL B CA  1 
ATOM   3569 C  C   . VAL B 1 187 ? 23.088 19.541  52.647  1.00 56.11  ? 187  VAL B C   1 
ATOM   3570 O  O   . VAL B 1 187 ? 24.060 18.896  52.984  1.00 55.43  ? 187  VAL B O   1 
ATOM   3571 C  CB  . VAL B 1 187 ? 21.495 18.556  50.933  1.00 55.21  ? 187  VAL B CB  1 
ATOM   3572 C  CG1 . VAL B 1 187 ? 22.571 17.664  50.379  1.00 51.48  ? 187  VAL B CG1 1 
ATOM   3573 C  CG2 . VAL B 1 187 ? 20.107 17.919  50.775  1.00 55.98  ? 187  VAL B CG2 1 
ATOM   3574 N  N   . LEU B 1 188 ? 23.126 20.858  52.478  1.00 56.91  ? 188  LEU B N   1 
ATOM   3575 C  CA  . LEU B 1 188 ? 24.290 21.677  52.835  1.00 57.61  ? 188  LEU B CA  1 
ATOM   3576 C  C   . LEU B 1 188 ? 24.639 21.584  54.312  1.00 60.29  ? 188  LEU B C   1 
ATOM   3577 O  O   . LEU B 1 188 ? 25.807 21.500  54.675  1.00 62.64  ? 188  LEU B O   1 
ATOM   3578 C  CB  . LEU B 1 188 ? 24.034 23.156  52.518  1.00 56.40  ? 188  LEU B CB  1 
ATOM   3579 C  CG  . LEU B 1 188 ? 23.931 23.586  51.059  1.00 54.42  ? 188  LEU B CG  1 
ATOM   3580 C  CD1 . LEU B 1 188 ? 23.945 25.092  50.936  1.00 51.18  ? 188  LEU B CD1 1 
ATOM   3581 C  CD2 . LEU B 1 188 ? 25.058 22.975  50.229  1.00 57.22  ? 188  LEU B CD2 1 
ATOM   3582 N  N   . LEU B 1 189 ? 23.604 21.611  55.148  1.00 62.44  ? 189  LEU B N   1 
ATOM   3583 C  CA  . LEU B 1 189 ? 23.725 21.757  56.599  1.00 61.18  ? 189  LEU B CA  1 
ATOM   3584 C  C   . LEU B 1 189 ? 23.823 20.460  57.372  1.00 63.30  ? 189  LEU B C   1 
ATOM   3585 O  O   . LEU B 1 189 ? 24.195 20.470  58.534  1.00 66.02  ? 189  LEU B O   1 
ATOM   3586 C  CB  . LEU B 1 189 ? 22.494 22.478  57.142  1.00 61.83  ? 189  LEU B CB  1 
ATOM   3587 C  CG  . LEU B 1 189 ? 22.301 23.946  56.792  1.00 64.45  ? 189  LEU B CG  1 
ATOM   3588 C  CD1 . LEU B 1 189 ? 21.006 24.476  57.398  1.00 58.35  ? 189  LEU B CD1 1 
ATOM   3589 C  CD2 . LEU B 1 189 ? 23.488 24.718  57.288  1.00 56.60  ? 189  LEU B CD2 1 
ATOM   3590 N  N   . LYS B 1 190 ? 23.447 19.349  56.748  1.00 64.46  ? 190  LYS B N   1 
ATOM   3591 C  CA  . LYS B 1 190 ? 23.235 18.114  57.495  1.00 68.78  ? 190  LYS B CA  1 
ATOM   3592 C  C   . LYS B 1 190 ? 23.713 16.853  56.782  1.00 73.09  ? 190  LYS B C   1 
ATOM   3593 O  O   . LYS B 1 190 ? 23.737 16.782  55.559  1.00 70.72  ? 190  LYS B O   1 
ATOM   3594 C  CB  . LYS B 1 190 ? 21.762 17.965  57.891  1.00 69.07  ? 190  LYS B CB  1 
ATOM   3595 C  CG  . LYS B 1 190 ? 21.216 19.165  58.642  1.00 66.85  ? 190  LYS B CG  1 
ATOM   3596 C  CD  . LYS B 1 190 ? 20.086 18.799  59.590  1.00 78.41  ? 190  LYS B CD  1 
ATOM   3597 C  CE  . LYS B 1 190 ? 19.620 20.023  60.368  1.00 79.14  ? 190  LYS B CE  1 
ATOM   3598 N  NZ  . LYS B 1 190 ? 18.694 19.698  61.481  1.00 78.97  ? 190  LYS B NZ  1 
ATOM   3599 N  N   . LYS B 1 191 ? 24.090 15.856  57.579  1.00 79.29  ? 191  LYS B N   1 
ATOM   3600 C  CA  . LYS B 1 191 ? 24.553 14.567  57.069  1.00 85.08  ? 191  LYS B CA  1 
ATOM   3601 C  C   . LYS B 1 191 ? 23.367 13.659  56.750  1.00 84.00  ? 191  LYS B C   1 
ATOM   3602 O  O   . LYS B 1 191 ? 23.471 12.789  55.895  1.00 84.43  ? 191  LYS B O   1 
ATOM   3603 C  CB  . LYS B 1 191 ? 25.516 13.865  58.057  1.00 86.29  ? 191  LYS B CB  1 
ATOM   3604 C  CG  . LYS B 1 191 ? 25.868 14.656  59.328  1.00 89.80  ? 191  LYS B CG  1 
ATOM   3605 C  CD  . LYS B 1 191 ? 25.216 14.058  60.579  1.00 95.64  ? 191  LYS B CD  1 
ATOM   3606 C  CE  . LYS B 1 191 ? 23.688 14.063  60.496  1.00 94.70  ? 191  LYS B CE  1 
ATOM   3607 N  NZ  . LYS B 1 191 ? 23.089 15.432  60.494  1.00 82.04  ? 191  LYS B NZ  1 
ATOM   3608 N  N   . GLU B 1 192 ? 22.246 13.859  57.440  1.00 83.73  ? 192  GLU B N   1 
ATOM   3609 C  CA  . GLU B 1 192 ? 21.027 13.089  57.168  1.00 82.01  ? 192  GLU B CA  1 
ATOM   3610 C  C   . GLU B 1 192 ? 19.775 13.938  56.873  1.00 76.33  ? 192  GLU B C   1 
ATOM   3611 O  O   . GLU B 1 192 ? 19.486 14.936  57.554  1.00 72.68  ? 192  GLU B O   1 
ATOM   3612 C  CB  . GLU B 1 192 ? 20.744 12.100  58.299  1.00 88.54  ? 192  GLU B CB  1 
ATOM   3613 C  CG  . GLU B 1 192 ? 21.437 10.744  58.143  1.00 97.07  ? 192  GLU B CG  1 
ATOM   3614 C  CD  . GLU B 1 192 ? 21.301 9.871   59.384  1.00 109.78 ? 192  GLU B CD  1 
ATOM   3615 O  OE1 . GLU B 1 192 ? 20.175 9.423   59.686  1.00 110.37 ? 192  GLU B OE1 1 
ATOM   3616 O  OE2 . GLU B 1 192 ? 22.321 9.634   60.063  1.00 113.21 ? 192  GLU B OE2 1 
ATOM   3617 N  N   . TYR B 1 193 ? 19.028 13.510  55.857  1.00 72.60  ? 193  TYR B N   1 
ATOM   3618 C  CA  . TYR B 1 193 ? 17.853 14.245  55.384  1.00 69.18  ? 193  TYR B CA  1 
ATOM   3619 C  C   . TYR B 1 193 ? 16.968 13.326  54.539  1.00 63.77  ? 193  TYR B C   1 
ATOM   3620 O  O   . TYR B 1 193 ? 17.433 12.280  54.056  1.00 58.63  ? 193  TYR B O   1 
ATOM   3621 C  CB  . TYR B 1 193 ? 18.299 15.441  54.537  1.00 66.70  ? 193  TYR B CB  1 
ATOM   3622 C  CG  . TYR B 1 193 ? 19.368 15.081  53.504  1.00 66.53  ? 193  TYR B CG  1 
ATOM   3623 C  CD1 . TYR B 1 193 ? 19.014 14.529  52.271  1.00 60.50  ? 193  TYR B CD1 1 
ATOM   3624 C  CD2 . TYR B 1 193 ? 20.737 15.281  53.770  1.00 65.54  ? 193  TYR B CD2 1 
ATOM   3625 C  CE1 . TYR B 1 193 ? 19.977 14.179  51.343  1.00 64.58  ? 193  TYR B CE1 1 
ATOM   3626 C  CE2 . TYR B 1 193 ? 21.708 14.936  52.835  1.00 61.77  ? 193  TYR B CE2 1 
ATOM   3627 C  CZ  . TYR B 1 193 ? 21.317 14.385  51.620  1.00 63.75  ? 193  TYR B CZ  1 
ATOM   3628 O  OH  . TYR B 1 193 ? 22.236 14.025  50.662  1.00 64.20  ? 193  TYR B OH  1 
ATOM   3629 N  N   . ASP B 1 194 ? 15.698 13.704  54.374  1.00 56.35  ? 194  ASP B N   1 
ATOM   3630 C  CA  . ASP B 1 194 ? 14.832 13.051  53.384  1.00 58.01  ? 194  ASP B CA  1 
ATOM   3631 C  C   . ASP B 1 194 ? 15.223 13.380  51.905  1.00 57.46  ? 194  ASP B C   1 
ATOM   3632 O  O   . ASP B 1 194 ? 15.131 14.524  51.457  1.00 55.11  ? 194  ASP B O   1 
ATOM   3633 C  CB  . ASP B 1 194 ? 13.370 13.429  53.629  1.00 53.52  ? 194  ASP B CB  1 
ATOM   3634 C  CG  . ASP B 1 194 ? 12.410 12.562  52.839  1.00 59.57  ? 194  ASP B CG  1 
ATOM   3635 O  OD1 . ASP B 1 194 ? 12.859 11.716  52.025  1.00 57.75  ? 194  ASP B OD1 1 
ATOM   3636 O  OD2 . ASP B 1 194 ? 11.192 12.725  53.039  1.00 64.43  ? 194  ASP B OD2 1 
ATOM   3637 N  N   . GLY B 1 195 ? 15.636 12.369  51.150  1.00 55.73  ? 195  GLY B N   1 
ATOM   3638 C  CA  . GLY B 1 195 ? 16.040 12.561  49.765  1.00 58.60  ? 195  GLY B CA  1 
ATOM   3639 C  C   . GLY B 1 195 ? 14.950 13.041  48.821  1.00 58.79  ? 195  GLY B C   1 
ATOM   3640 O  O   . GLY B 1 195 ? 15.216 13.796  47.867  1.00 54.75  ? 195  GLY B O   1 
ATOM   3641 N  N   . LYS B 1 196 ? 13.724 12.588  49.089  1.00 57.75  ? 196  LYS B N   1 
ATOM   3642 C  CA  . LYS B 1 196 ? 12.542 12.993  48.321  1.00 55.71  ? 196  LYS B CA  1 
ATOM   3643 C  C   . LYS B 1 196 ? 12.238 14.511  48.386  1.00 55.98  ? 196  LYS B C   1 
ATOM   3644 O  O   . LYS B 1 196 ? 11.972 15.147  47.354  1.00 55.58  ? 196  LYS B O   1 
ATOM   3645 C  CB  . LYS B 1 196 ? 11.344 12.139  48.734  1.00 56.42  ? 196  LYS B CB  1 
ATOM   3646 C  CG  . LYS B 1 196 ? 11.659 10.657  48.652  1.00 59.81  ? 196  LYS B CG  1 
ATOM   3647 C  CD  . LYS B 1 196 ? 10.439 9.773   48.894  1.00 62.81  ? 196  LYS B CD  1 
ATOM   3648 C  CE  . LYS B 1 196 ? 10.797 8.270   48.805  1.00 68.10  ? 196  LYS B CE  1 
ATOM   3649 N  NZ  . LYS B 1 196 ? 9.595  7.419   48.540  1.00 70.26  ? 196  LYS B NZ  1 
ATOM   3650 N  N   . VAL B 1 197 ? 12.324 15.085  49.586  1.00 52.54  ? 197  VAL B N   1 
ATOM   3651 C  CA  . VAL B 1 197 ? 12.145 16.530  49.786  1.00 49.79  ? 197  VAL B CA  1 
ATOM   3652 C  C   . VAL B 1 197 ? 13.243 17.333  49.065  1.00 50.20  ? 197  VAL B C   1 
ATOM   3653 O  O   . VAL B 1 197 ? 12.980 18.327  48.331  1.00 50.45  ? 197  VAL B O   1 
ATOM   3654 C  CB  . VAL B 1 197 ? 12.088 16.861  51.305  1.00 52.14  ? 197  VAL B CB  1 
ATOM   3655 C  CG1 . VAL B 1 197 ? 12.079 18.369  51.573  1.00 47.75  ? 197  VAL B CG1 1 
ATOM   3656 C  CG2 . VAL B 1 197 ? 10.876 16.202  51.908  1.00 50.65  ? 197  VAL B CG2 1 
ATOM   3657 N  N   . ALA B 1 198 ? 14.477 16.863  49.242  1.00 50.94  ? 198  ALA B N   1 
ATOM   3658 C  CA  . ALA B 1 198 ? 15.611 17.449  48.550  1.00 50.66  ? 198  ALA B CA  1 
ATOM   3659 C  C   . ALA B 1 198 ? 15.302 17.504  47.067  1.00 49.39  ? 198  ALA B C   1 
ATOM   3660 O  O   . ALA B 1 198 ? 15.391 18.557  46.426  1.00 47.08  ? 198  ALA B O   1 
ATOM   3661 C  CB  . ALA B 1 198 ? 16.880 16.651  48.822  1.00 49.20  ? 198  ALA B CB  1 
ATOM   3662 N  N   . ASP B 1 199 ? 14.887 16.362  46.535  1.00 47.19  ? 199  ASP B N   1 
ATOM   3663 C  CA  . ASP B 1 199 ? 14.453 16.288  45.139  1.00 49.00  ? 199  ASP B CA  1 
ATOM   3664 C  C   . ASP B 1 199 ? 13.448 17.407  44.785  1.00 50.49  ? 199  ASP B C   1 
ATOM   3665 O  O   . ASP B 1 199 ? 13.602 18.083  43.763  1.00 47.92  ? 199  ASP B O   1 
ATOM   3666 C  CB  . ASP B 1 199 ? 13.896 14.892  44.839  1.00 51.59  ? 199  ASP B CB  1 
ATOM   3667 C  CG  . ASP B 1 199 ? 14.989 13.874  44.582  1.00 53.53  ? 199  ASP B CG  1 
ATOM   3668 O  OD1 . ASP B 1 199 ? 16.166 14.282  44.446  1.00 54.71  ? 199  ASP B OD1 1 
ATOM   3669 O  OD2 . ASP B 1 199 ? 14.679 12.669  44.477  1.00 56.33  ? 199  ASP B OD2 1 
ATOM   3670 N  N   . VAL B 1 200 ? 12.431 17.615  45.626  1.00 48.75  ? 200  VAL B N   1 
ATOM   3671 C  CA  . VAL B 1 200 ? 11.492 18.702  45.368  1.00 46.91  ? 200  VAL B CA  1 
ATOM   3672 C  C   . VAL B 1 200 ? 12.257 20.013  45.124  1.00 46.68  ? 200  VAL B C   1 
ATOM   3673 O  O   . VAL B 1 200 ? 12.037 20.701  44.123  1.00 47.90  ? 200  VAL B O   1 
ATOM   3674 C  CB  . VAL B 1 200 ? 10.418 18.876  46.505  1.00 48.93  ? 200  VAL B CB  1 
ATOM   3675 C  CG1 . VAL B 1 200 ? 9.542  20.096  46.233  1.00 47.39  ? 200  VAL B CG1 1 
ATOM   3676 C  CG2 . VAL B 1 200 ? 9.531  17.653  46.639  1.00 47.04  ? 200  VAL B CG2 1 
ATOM   3677 N  N   . TRP B 1 201 ? 13.171 20.356  46.030  1.00 47.28  ? 201  TRP B N   1 
ATOM   3678 C  CA  . TRP B 1 201 ? 14.031 21.548  45.848  1.00 48.25  ? 201  TRP B CA  1 
ATOM   3679 C  C   . TRP B 1 201 ? 14.689 21.594  44.459  1.00 46.44  ? 201  TRP B C   1 
ATOM   3680 O  O   . TRP B 1 201 ? 14.602 22.579  43.703  1.00 43.28  ? 201  TRP B O   1 
ATOM   3681 C  CB  . TRP B 1 201 ? 15.129 21.596  46.910  1.00 47.32  ? 201  TRP B CB  1 
ATOM   3682 C  CG  . TRP B 1 201 ? 16.058 22.765  46.769  1.00 49.85  ? 201  TRP B CG  1 
ATOM   3683 C  CD1 . TRP B 1 201 ? 17.180 22.833  45.987  1.00 44.85  ? 201  TRP B CD1 1 
ATOM   3684 C  CD2 . TRP B 1 201 ? 15.954 24.035  47.438  1.00 50.62  ? 201  TRP B CD2 1 
ATOM   3685 N  NE1 . TRP B 1 201 ? 17.786 24.065  46.137  1.00 47.01  ? 201  TRP B NE1 1 
ATOM   3686 C  CE2 . TRP B 1 201 ? 17.057 24.822  47.017  1.00 47.94  ? 201  TRP B CE2 1 
ATOM   3687 C  CE3 . TRP B 1 201 ? 15.048 24.577  48.362  1.00 49.62  ? 201  TRP B CE3 1 
ATOM   3688 C  CZ2 . TRP B 1 201 ? 17.270 26.120  47.487  1.00 48.66  ? 201  TRP B CZ2 1 
ATOM   3689 C  CZ3 . TRP B 1 201 ? 15.260 25.865  48.827  1.00 48.34  ? 201  TRP B CZ3 1 
ATOM   3690 C  CH2 . TRP B 1 201 ? 16.362 26.623  48.389  1.00 50.78  ? 201  TRP B CH2 1 
ATOM   3691 N  N   . SER B 1 202 ? 15.358 20.503  44.139  1.00 46.95  ? 202  SER B N   1 
ATOM   3692 C  CA  . SER B 1 202 ? 15.965 20.315  42.835  1.00 46.20  ? 202  SER B CA  1 
ATOM   3693 C  C   . SER B 1 202 ? 15.017 20.704  41.680  1.00 46.81  ? 202  SER B C   1 
ATOM   3694 O  O   . SER B 1 202 ? 15.383 21.445  40.742  1.00 48.00  ? 202  SER B O   1 
ATOM   3695 C  CB  . SER B 1 202 ? 16.403 18.860  42.723  1.00 47.35  ? 202  SER B CB  1 
ATOM   3696 O  OG  . SER B 1 202 ? 17.270 18.659  41.642  1.00 54.72  ? 202  SER B OG  1 
ATOM   3697 N  N   . CYS B 1 203 ? 13.787 20.201  41.750  1.00 44.63  ? 203  CYS B N   1 
ATOM   3698 C  CA  . CYS B 1 203 ? 12.793 20.408  40.698  1.00 42.96  ? 203  CYS B CA  1 
ATOM   3699 C  C   . CYS B 1 203 ? 12.435 21.874  40.611  1.00 46.54  ? 203  CYS B C   1 
ATOM   3700 O  O   . CYS B 1 203 ? 12.202 22.426  39.521  1.00 44.84  ? 203  CYS B O   1 
ATOM   3701 C  CB  . CYS B 1 203 ? 11.538 19.595  40.989  1.00 41.83  ? 203  CYS B CB  1 
ATOM   3702 S  SG  . CYS B 1 203 ? 11.692 17.817  40.844  1.00 51.88  ? 203  CYS B SG  1 
ATOM   3703 N  N   . GLY B 1 204 ? 12.380 22.501  41.783  1.00 44.57  ? 204  GLY B N   1 
ATOM   3704 C  CA  . GLY B 1 204 ? 12.257 23.939  41.847  1.00 43.78  ? 204  GLY B CA  1 
ATOM   3705 C  C   . GLY B 1 204 ? 13.337 24.652  41.041  1.00 45.10  ? 204  GLY B C   1 
ATOM   3706 O  O   . GLY B 1 204 ? 13.031 25.550  40.259  1.00 46.20  ? 204  GLY B O   1 
ATOM   3707 N  N   . VAL B 1 205 ? 14.598 24.258  41.234  1.00 47.65  ? 205  VAL B N   1 
ATOM   3708 C  CA  . VAL B 1 205 ? 15.716 24.823  40.484  1.00 45.13  ? 205  VAL B CA  1 
ATOM   3709 C  C   . VAL B 1 205 ? 15.495 24.729  38.998  1.00 42.75  ? 205  VAL B C   1 
ATOM   3710 O  O   . VAL B 1 205 ? 15.669 25.699  38.263  1.00 41.84  ? 205  VAL B O   1 
ATOM   3711 C  CB  . VAL B 1 205 ? 17.068 24.129  40.833  1.00 46.75  ? 205  VAL B CB  1 
ATOM   3712 C  CG1 . VAL B 1 205 ? 18.210 24.622  39.931  1.00 43.85  ? 205  VAL B CG1 1 
ATOM   3713 C  CG2 . VAL B 1 205 ? 17.435 24.357  42.278  1.00 46.27  ? 205  VAL B CG2 1 
ATOM   3714 N  N   . THR B 1 206 ? 15.143 23.534  38.551  1.00 41.60  ? 206  THR B N   1 
ATOM   3715 C  CA  . THR B 1 206 ? 14.868 23.302  37.126  1.00 43.73  ? 206  THR B CA  1 
ATOM   3716 C  C   . THR B 1 206 ? 13.738 24.183  36.552  1.00 45.91  ? 206  THR B C   1 
ATOM   3717 O  O   . THR B 1 206 ? 13.891 24.789  35.480  1.00 45.83  ? 206  THR B O   1 
ATOM   3718 C  CB  . THR B 1 206 ? 14.584 21.827  36.883  1.00 42.76  ? 206  THR B CB  1 
ATOM   3719 O  OG1 . THR B 1 206 ? 15.706 21.073  37.325  1.00 46.21  ? 206  THR B OG1 1 
ATOM   3720 C  CG2 . THR B 1 206 ? 14.307 21.537  35.424  1.00 39.63  ? 206  THR B CG2 1 
ATOM   3721 N  N   . LEU B 1 207 ? 12.615 24.256  37.265  1.00 43.24  ? 207  LEU B N   1 
ATOM   3722 C  CA  . LEU B 1 207 ? 11.534 25.175  36.906  1.00 45.80  ? 207  LEU B CA  1 
ATOM   3723 C  C   . LEU B 1 207 ? 12.058 26.613  36.755  1.00 46.49  ? 207  LEU B C   1 
ATOM   3724 O  O   . LEU B 1 207 ? 11.929 27.233  35.691  1.00 43.99  ? 207  LEU B O   1 
ATOM   3725 C  CB  . LEU B 1 207 ? 10.408 25.094  37.946  1.00 46.93  ? 207  LEU B CB  1 
ATOM   3726 C  CG  . LEU B 1 207 ? 9.112  25.883  37.746  1.00 46.83  ? 207  LEU B CG  1 
ATOM   3727 C  CD1 . LEU B 1 207 ? 8.557  25.710  36.340  1.00 49.86  ? 207  LEU B CD1 1 
ATOM   3728 C  CD2 . LEU B 1 207 ? 8.068  25.519  38.797  1.00 45.67  ? 207  LEU B CD2 1 
ATOM   3729 N  N   . TYR B 1 208 ? 12.659 27.128  37.816  1.00 41.65  ? 208  TYR B N   1 
ATOM   3730 C  CA  . TYR B 1 208 ? 13.216 28.472  37.792  1.00 43.77  ? 208  TYR B CA  1 
ATOM   3731 C  C   . TYR B 1 208 ? 14.066 28.726  36.552  1.00 47.22  ? 208  TYR B C   1 
ATOM   3732 O  O   . TYR B 1 208 ? 13.818 29.685  35.810  1.00 45.37  ? 208  TYR B O   1 
ATOM   3733 C  CB  . TYR B 1 208 ? 14.071 28.711  39.031  1.00 44.23  ? 208  TYR B CB  1 
ATOM   3734 C  CG  . TYR B 1 208 ? 14.646 30.100  39.139  1.00 45.97  ? 208  TYR B CG  1 
ATOM   3735 C  CD1 . TYR B 1 208 ? 15.744 30.476  38.397  1.00 46.27  ? 208  TYR B CD1 1 
ATOM   3736 C  CD2 . TYR B 1 208 ? 14.097 31.035  39.997  1.00 48.44  ? 208  TYR B CD2 1 
ATOM   3737 C  CE1 . TYR B 1 208 ? 16.280 31.753  38.489  1.00 48.68  ? 208  TYR B CE1 1 
ATOM   3738 C  CE2 . TYR B 1 208 ? 14.629 32.329  40.105  1.00 52.27  ? 208  TYR B CE2 1 
ATOM   3739 C  CZ  . TYR B 1 208 ? 15.725 32.691  39.344  1.00 52.41  ? 208  TYR B CZ  1 
ATOM   3740 O  OH  . TYR B 1 208 ? 16.274 33.975  39.430  1.00 52.95  ? 208  TYR B OH  1 
ATOM   3741 N  N   . VAL B 1 209 ? 15.081 27.877  36.349  1.00 45.01  ? 209  VAL B N   1 
ATOM   3742 C  CA  . VAL B 1 209 ? 15.995 28.020  35.219  1.00 45.59  ? 209  VAL B CA  1 
ATOM   3743 C  C   . VAL B 1 209 ? 15.235 28.030  33.887  1.00 46.25  ? 209  VAL B C   1 
ATOM   3744 O  O   . VAL B 1 209 ? 15.540 28.850  33.030  1.00 46.13  ? 209  VAL B O   1 
ATOM   3745 C  CB  . VAL B 1 209 ? 17.138 26.941  35.238  1.00 48.05  ? 209  VAL B CB  1 
ATOM   3746 C  CG1 . VAL B 1 209 ? 16.594 25.568  34.930  1.00 46.51  ? 209  VAL B CG1 1 
ATOM   3747 C  CG2 . VAL B 1 209 ? 18.233 27.259  34.234  1.00 44.79  ? 209  VAL B CG2 1 
ATOM   3748 N  N   . MET B 1 210 ? 14.251 27.133  33.719  1.00 41.80  ? 210  MET B N   1 
ATOM   3749 C  CA  . MET B 1 210 ? 13.378 27.162  32.524  1.00 42.46  ? 210  MET B CA  1 
ATOM   3750 C  C   . MET B 1 210 ? 12.724 28.552  32.302  1.00 48.56  ? 210  MET B C   1 
ATOM   3751 O  O   . MET B 1 210 ? 12.664 29.072  31.173  1.00 47.47  ? 210  MET B O   1 
ATOM   3752 C  CB  . MET B 1 210 ? 12.312 26.073  32.601  1.00 42.92  ? 210  MET B CB  1 
ATOM   3753 C  CG  . MET B 1 210 ? 12.780 24.663  32.180  1.00 42.03  ? 210  MET B CG  1 
ATOM   3754 S  SD  . MET B 1 210 ? 11.432 23.472  32.001  1.00 51.80  ? 210  MET B SD  1 
ATOM   3755 C  CE  . MET B 1 210 ? 10.724 23.592  33.651  1.00 42.57  ? 210  MET B CE  1 
ATOM   3756 N  N   . LEU B 1 211 ? 12.250 29.151  33.396  1.00 47.40  ? 211  LEU B N   1 
ATOM   3757 C  CA  . LEU B 1 211 ? 11.494 30.395  33.306  1.00 45.40  ? 211  LEU B CA  1 
ATOM   3758 C  C   . LEU B 1 211 ? 12.356 31.662  33.173  1.00 49.78  ? 211  LEU B C   1 
ATOM   3759 O  O   . LEU B 1 211 ? 11.934 32.661  32.580  1.00 49.61  ? 211  LEU B O   1 
ATOM   3760 C  CB  . LEU B 1 211 ? 10.540 30.527  34.494  1.00 45.42  ? 211  LEU B CB  1 
ATOM   3761 C  CG  . LEU B 1 211 ? 9.392  29.525  34.544  1.00 48.16  ? 211  LEU B CG  1 
ATOM   3762 C  CD1 . LEU B 1 211 ? 8.827  29.417  35.941  1.00 43.81  ? 211  LEU B CD1 1 
ATOM   3763 C  CD2 . LEU B 1 211 ? 8.315  29.867  33.538  1.00 48.50  ? 211  LEU B CD2 1 
ATOM   3764 N  N   . VAL B 1 212 ? 13.561 31.598  33.721  1.00 49.70  ? 212  VAL B N   1 
ATOM   3765 C  CA  . VAL B 1 212 ? 14.412 32.753  33.875  1.00 48.05  ? 212  VAL B CA  1 
ATOM   3766 C  C   . VAL B 1 212 ? 15.568 32.649  32.882  1.00 49.79  ? 212  VAL B C   1 
ATOM   3767 O  O   . VAL B 1 212 ? 16.108 33.656  32.406  1.00 51.41  ? 212  VAL B O   1 
ATOM   3768 C  CB  . VAL B 1 212 ? 14.944 32.800  35.332  1.00 47.50  ? 212  VAL B CB  1 
ATOM   3769 C  CG1 . VAL B 1 212 ? 16.045 33.837  35.521  1.00 45.04  ? 212  VAL B CG1 1 
ATOM   3770 C  CG2 . VAL B 1 212 ? 13.812 33.066  36.304  1.00 46.13  ? 212  VAL B CG2 1 
ATOM   3771 N  N   . GLY B 1 213 ? 15.944 31.415  32.564  1.00 47.01  ? 213  GLY B N   1 
ATOM   3772 C  CA  . GLY B 1 213 ? 17.056 31.151  31.673  1.00 46.27  ? 213  GLY B CA  1 
ATOM   3773 C  C   . GLY B 1 213 ? 18.389 31.184  32.410  1.00 46.49  ? 213  GLY B C   1 
ATOM   3774 O  O   . GLY B 1 213 ? 19.449 31.139  31.796  1.00 43.32  ? 213  GLY B O   1 
ATOM   3775 N  N   . ALA B 1 214 ? 18.322 31.282  33.734  1.00 46.89  ? 214  ALA B N   1 
ATOM   3776 C  CA  . ALA B 1 214 ? 19.514 31.274  34.564  1.00 46.64  ? 214  ALA B CA  1 
ATOM   3777 C  C   . ALA B 1 214 ? 19.197 30.582  35.879  1.00 49.29  ? 214  ALA B C   1 
ATOM   3778 O  O   . ALA B 1 214 ? 18.037 30.499  36.272  1.00 48.71  ? 214  ALA B O   1 
ATOM   3779 C  CB  . ALA B 1 214 ? 20.000 32.682  34.807  1.00 41.02  ? 214  ALA B CB  1 
ATOM   3780 N  N   . TYR B 1 215 ? 20.229 30.075  36.546  1.00 48.48  ? 215  TYR B N   1 
ATOM   3781 C  CA  . TYR B 1 215 ? 20.059 29.382  37.825  1.00 49.84  ? 215  TYR B CA  1 
ATOM   3782 C  C   . TYR B 1 215 ? 19.771 30.366  38.935  1.00 51.69  ? 215  TYR B C   1 
ATOM   3783 O  O   . TYR B 1 215 ? 20.268 31.487  38.924  1.00 51.90  ? 215  TYR B O   1 
ATOM   3784 C  CB  . TYR B 1 215 ? 21.307 28.565  38.210  1.00 49.79  ? 215  TYR B CB  1 
ATOM   3785 C  CG  . TYR B 1 215 ? 21.585 27.382  37.308  1.00 49.03  ? 215  TYR B CG  1 
ATOM   3786 C  CD1 . TYR B 1 215 ? 20.648 26.372  37.142  1.00 49.94  ? 215  TYR B CD1 1 
ATOM   3787 C  CD2 . TYR B 1 215 ? 22.785 27.273  36.627  1.00 49.79  ? 215  TYR B CD2 1 
ATOM   3788 C  CE1 . TYR B 1 215 ? 20.895 25.270  36.309  1.00 50.65  ? 215  TYR B CE1 1 
ATOM   3789 C  CE2 . TYR B 1 215 ? 23.047 26.183  35.796  1.00 50.98  ? 215  TYR B CE2 1 
ATOM   3790 C  CZ  . TYR B 1 215 ? 22.098 25.180  35.640  1.00 54.53  ? 215  TYR B CZ  1 
ATOM   3791 O  OH  . TYR B 1 215 ? 22.375 24.106  34.819  1.00 58.23  ? 215  TYR B OH  1 
ATOM   3792 N  N   . PRO B 1 216 ? 18.966 29.943  39.909  1.00 52.05  ? 216  PRO B N   1 
ATOM   3793 C  CA  . PRO B 1 216 ? 18.714 30.832  41.045  1.00 52.11  ? 216  PRO B CA  1 
ATOM   3794 C  C   . PRO B 1 216 ? 19.936 30.826  41.971  1.00 51.52  ? 216  PRO B C   1 
ATOM   3795 O  O   . PRO B 1 216 ? 20.806 29.994  41.779  1.00 52.14  ? 216  PRO B O   1 
ATOM   3796 C  CB  . PRO B 1 216 ? 17.460 30.218  41.701  1.00 49.39  ? 216  PRO B CB  1 
ATOM   3797 C  CG  . PRO B 1 216 ? 17.410 28.785  41.215  1.00 48.50  ? 216  PRO B CG  1 
ATOM   3798 C  CD  . PRO B 1 216 ? 18.164 28.700  39.936  1.00 47.95  ? 216  PRO B CD  1 
ATOM   3799 N  N   . PHE B 1 217 ? 20.027 31.741  42.929  1.00 50.41  ? 217  PHE B N   1 
ATOM   3800 C  CA  . PHE B 1 217 ? 21.083 31.652  43.948  1.00 54.80  ? 217  PHE B CA  1 
ATOM   3801 C  C   . PHE B 1 217 ? 22.476 31.914  43.394  1.00 59.15  ? 217  PHE B C   1 
ATOM   3802 O  O   . PHE B 1 217 ? 23.186 32.803  43.875  1.00 62.65  ? 217  PHE B O   1 
ATOM   3803 C  CB  . PHE B 1 217 ? 21.025 30.291  44.651  1.00 51.90  ? 217  PHE B CB  1 
ATOM   3804 C  CG  . PHE B 1 217 ? 19.649 29.935  45.119  1.00 52.05  ? 217  PHE B CG  1 
ATOM   3805 C  CD1 . PHE B 1 217 ? 18.985 30.747  46.046  1.00 53.28  ? 217  PHE B CD1 1 
ATOM   3806 C  CD2 . PHE B 1 217 ? 18.991 28.830  44.609  1.00 49.88  ? 217  PHE B CD2 1 
ATOM   3807 C  CE1 . PHE B 1 217 ? 17.704 30.444  46.480  1.00 52.78  ? 217  PHE B CE1 1 
ATOM   3808 C  CE2 . PHE B 1 217 ? 17.687 28.519  45.028  1.00 50.58  ? 217  PHE B CE2 1 
ATOM   3809 C  CZ  . PHE B 1 217 ? 17.050 29.330  45.975  1.00 53.75  ? 217  PHE B CZ  1 
ATOM   3810 N  N   . GLU B 1 218 ? 22.857 31.148  42.376  1.00 59.05  ? 218  GLU B N   1 
ATOM   3811 C  CA  . GLU B 1 218 ? 24.086 31.429  41.641  1.00 59.93  ? 218  GLU B CA  1 
ATOM   3812 C  C   . GLU B 1 218 ? 24.098 32.849  41.057  1.00 66.37  ? 218  GLU B C   1 
ATOM   3813 O  O   . GLU B 1 218 ? 23.190 33.235  40.323  1.00 65.85  ? 218  GLU B O   1 
ATOM   3814 C  CB  . GLU B 1 218 ? 24.296 30.400  40.528  1.00 57.13  ? 218  GLU B CB  1 
ATOM   3815 C  CG  . GLU B 1 218 ? 25.681 30.436  39.900  1.00 62.26  ? 218  GLU B CG  1 
ATOM   3816 C  CD  . GLU B 1 218 ? 26.027 29.167  39.115  1.00 66.03  ? 218  GLU B CD  1 
ATOM   3817 O  OE1 . GLU B 1 218 ? 26.222 28.110  39.746  1.00 63.68  ? 218  GLU B OE1 1 
ATOM   3818 O  OE2 . GLU B 1 218 ? 26.126 29.228  37.872  1.00 67.50  ? 218  GLU B OE2 1 
ATOM   3819 N  N   . ASP B 1 219 ? 25.124 33.625  41.408  1.00 72.58  ? 219  ASP B N   1 
ATOM   3820 C  CA  . ASP B 1 219 ? 25.393 34.907  40.754  1.00 71.75  ? 219  ASP B CA  1 
ATOM   3821 C  C   . ASP B 1 219 ? 25.920 34.629  39.343  1.00 74.29  ? 219  ASP B C   1 
ATOM   3822 O  O   . ASP B 1 219 ? 26.962 33.988  39.175  1.00 72.32  ? 219  ASP B O   1 
ATOM   3823 C  CB  . ASP B 1 219 ? 26.409 35.707  41.562  1.00 73.74  ? 219  ASP B CB  1 
ATOM   3824 C  CG  . ASP B 1 219 ? 26.726 37.032  40.939  1.00 76.09  ? 219  ASP B CG  1 
ATOM   3825 O  OD1 . ASP B 1 219 ? 26.500 37.174  39.727  1.00 74.38  ? 219  ASP B OD1 1 
ATOM   3826 O  OD2 . ASP B 1 219 ? 27.195 37.932  41.661  1.00 76.16  ? 219  ASP B OD2 1 
ATOM   3827 N  N   . PRO B 1 220 ? 25.194 35.097  38.315  1.00 77.37  ? 220  PRO B N   1 
ATOM   3828 C  CA  . PRO B 1 220 ? 25.525 34.745  36.929  1.00 74.09  ? 220  PRO B CA  1 
ATOM   3829 C  C   . PRO B 1 220 ? 26.908 35.235  36.519  1.00 77.90  ? 220  PRO B C   1 
ATOM   3830 O  O   . PRO B 1 220 ? 27.499 34.686  35.588  1.00 78.38  ? 220  PRO B O   1 
ATOM   3831 C  CB  . PRO B 1 220 ? 24.446 35.461  36.114  1.00 73.08  ? 220  PRO B CB  1 
ATOM   3832 C  CG  . PRO B 1 220 ? 23.369 35.784  37.078  1.00 74.83  ? 220  PRO B CG  1 
ATOM   3833 C  CD  . PRO B 1 220 ? 24.045 36.009  38.388  1.00 75.12  ? 220  PRO B CD  1 
ATOM   3834 N  N   . GLU B 1 221 ? 27.429 36.231  37.232  1.00 77.31  ? 221  GLU B N   1 
ATOM   3835 C  CA  . GLU B 1 221 ? 28.687 36.872  36.862  1.00 75.09  ? 221  GLU B CA  1 
ATOM   3836 C  C   . GLU B 1 221 ? 29.879 36.398  37.700  1.00 76.19  ? 221  GLU B C   1 
ATOM   3837 O  O   . GLU B 1 221 ? 31.025 36.730  37.408  1.00 77.50  ? 221  GLU B O   1 
ATOM   3838 C  CB  . GLU B 1 221 ? 28.532 38.388  36.928  1.00 74.30  ? 221  GLU B CB  1 
ATOM   3839 C  CG  . GLU B 1 221 ? 27.329 38.885  36.139  1.00 77.16  ? 221  GLU B CG  1 
ATOM   3840 C  CD  . GLU B 1 221 ? 27.346 38.417  34.683  1.00 84.20  ? 221  GLU B CD  1 
ATOM   3841 O  OE1 . GLU B 1 221 ? 28.455 38.335  34.099  1.00 82.54  ? 221  GLU B OE1 1 
ATOM   3842 O  OE2 . GLU B 1 221 ? 26.257 38.131  34.122  1.00 76.65  ? 221  GLU B OE2 1 
ATOM   3843 N  N   . GLU B 1 222 ? 29.604 35.634  38.749  1.00 74.72  ? 222  GLU B N   1 
ATOM   3844 C  CA  . GLU B 1 222 ? 30.658 34.907  39.449  1.00 73.24  ? 222  GLU B CA  1 
ATOM   3845 C  C   . GLU B 1 222 ? 30.141 33.545  39.881  1.00 70.60  ? 222  GLU B C   1 
ATOM   3846 O  O   . GLU B 1 222 ? 29.971 33.281  41.082  1.00 66.24  ? 222  GLU B O   1 
ATOM   3847 C  CB  . GLU B 1 222 ? 31.129 35.639  40.689  1.00 70.80  ? 222  GLU B CB  1 
ATOM   3848 C  CG  . GLU B 1 222 ? 30.886 37.098  40.712  1.00 73.82  ? 222  GLU B CG  1 
ATOM   3849 C  CD  . GLU B 1 222 ? 30.996 37.607  42.124  1.00 78.46  ? 222  GLU B CD  1 
ATOM   3850 O  OE1 . GLU B 1 222 ? 32.087 37.468  42.716  1.00 76.13  ? 222  GLU B OE1 1 
ATOM   3851 O  OE2 . GLU B 1 222 ? 29.984 38.112  42.652  1.00 83.05  ? 222  GLU B OE2 1 
ATOM   3852 N  N   . PRO B 1 223 ? 29.887 32.680  38.894  1.00 69.19  ? 223  PRO B N   1 
ATOM   3853 C  CA  . PRO B 1 223 ? 29.349 31.338  39.115  1.00 65.79  ? 223  PRO B CA  1 
ATOM   3854 C  C   . PRO B 1 223 ? 30.325 30.488  39.927  1.00 63.47  ? 223  PRO B C   1 
ATOM   3855 O  O   . PRO B 1 223 ? 29.885 29.556  40.605  1.00 60.39  ? 223  PRO B O   1 
ATOM   3856 C  CB  . PRO B 1 223 ? 29.216 30.792  37.699  1.00 67.03  ? 223  PRO B CB  1 
ATOM   3857 C  CG  . PRO B 1 223 ? 30.264 31.538  36.920  1.00 65.34  ? 223  PRO B CG  1 
ATOM   3858 C  CD  . PRO B 1 223 ? 30.235 32.914  37.482  1.00 66.92  ? 223  PRO B CD  1 
ATOM   3859 N  N   . LYS B 1 224 ? 31.617 30.823  39.874  1.00 60.70  ? 224  LYS B N   1 
ATOM   3860 C  CA  . LYS B 1 224 ? 32.627 30.086  40.615  1.00 58.84  ? 224  LYS B CA  1 
ATOM   3861 C  C   . LYS B 1 224 ? 32.913 30.708  41.982  1.00 59.92  ? 224  LYS B C   1 
ATOM   3862 O  O   . LYS B 1 224 ? 33.931 30.411  42.630  1.00 58.01  ? 224  LYS B O   1 
ATOM   3863 C  CB  . LYS B 1 224 ? 33.907 29.960  39.793  1.00 59.16  ? 224  LYS B CB  1 
ATOM   3864 C  CG  . LYS B 1 224 ? 33.734 29.184  38.488  1.00 60.92  ? 224  LYS B CG  1 
ATOM   3865 C  CD  . LYS B 1 224 ? 34.456 27.838  38.510  1.00 62.48  ? 224  LYS B CD  1 
ATOM   3866 C  CE  . LYS B 1 224 ? 35.961 27.959  38.221  1.00 68.18  ? 224  LYS B CE  1 
ATOM   3867 N  NZ  . LYS B 1 224 ? 36.781 26.958  38.972  1.00 62.35  ? 224  LYS B NZ  1 
ATOM   3868 N  N   . ASN B 1 225 ? 32.014 31.583  42.414  1.00 61.29  ? 225  ASN B N   1 
ATOM   3869 C  CA  . ASN B 1 225 ? 32.075 32.099  43.765  1.00 61.61  ? 225  ASN B CA  1 
ATOM   3870 C  C   . ASN B 1 225 ? 31.136 31.251  44.566  1.00 59.13  ? 225  ASN B C   1 
ATOM   3871 O  O   . ASN B 1 225 ? 30.024 31.647  44.869  1.00 59.46  ? 225  ASN B O   1 
ATOM   3872 C  CB  . ASN B 1 225 ? 31.672 33.564  43.841  1.00 62.92  ? 225  ASN B CB  1 
ATOM   3873 C  CG  . ASN B 1 225 ? 31.987 34.181  45.194  1.00 64.76  ? 225  ASN B CG  1 
ATOM   3874 O  OD1 . ASN B 1 225 ? 32.242 33.472  46.180  1.00 59.84  ? 225  ASN B OD1 1 
ATOM   3875 N  ND2 . ASN B 1 225 ? 31.974 35.510  45.249  1.00 68.29  ? 225  ASN B ND2 1 
ATOM   3876 N  N   . PHE B 1 226 ? 31.604 30.066  44.908  1.00 57.81  ? 226  PHE B N   1 
ATOM   3877 C  CA  . PHE B 1 226 ? 30.744 29.059  45.511  1.00 57.51  ? 226  PHE B CA  1 
ATOM   3878 C  C   . PHE B 1 226 ? 30.248 29.471  46.879  1.00 56.98  ? 226  PHE B C   1 
ATOM   3879 O  O   . PHE B 1 226 ? 29.134 29.125  47.267  1.00 56.97  ? 226  PHE B O   1 
ATOM   3880 C  CB  . PHE B 1 226 ? 31.472 27.717  45.569  1.00 51.80  ? 226  PHE B CB  1 
ATOM   3881 C  CG  . PHE B 1 226 ? 31.947 27.254  44.238  1.00 52.77  ? 226  PHE B CG  1 
ATOM   3882 C  CD1 . PHE B 1 226 ? 31.046 27.018  43.219  1.00 55.08  ? 226  PHE B CD1 1 
ATOM   3883 C  CD2 . PHE B 1 226 ? 33.292 27.068  43.992  1.00 54.26  ? 226  PHE B CD2 1 
ATOM   3884 C  CE1 . PHE B 1 226 ? 31.473 26.601  41.980  1.00 54.72  ? 226  PHE B CE1 1 
ATOM   3885 C  CE2 . PHE B 1 226 ? 33.727 26.642  42.749  1.00 57.54  ? 226  PHE B CE2 1 
ATOM   3886 C  CZ  . PHE B 1 226 ? 32.813 26.406  41.748  1.00 57.96  ? 226  PHE B CZ  1 
ATOM   3887 N  N   . ARG B 1 227 ? 31.082 30.203  47.609  1.00 57.21  ? 227  ARG B N   1 
ATOM   3888 C  CA  . ARG B 1 227 ? 30.702 30.624  48.940  1.00 56.28  ? 227  ARG B CA  1 
ATOM   3889 C  C   . ARG B 1 227 ? 29.438 31.483  48.835  1.00 57.75  ? 227  ARG B C   1 
ATOM   3890 O  O   . ARG B 1 227 ? 28.450 31.263  49.548  1.00 58.84  ? 227  ARG B O   1 
ATOM   3891 C  CB  . ARG B 1 227 ? 31.865 31.323  49.654  1.00 52.64  ? 227  ARG B CB  1 
ATOM   3892 C  CG  . ARG B 1 227 ? 31.444 32.498  50.536  1.00 56.70  ? 227  ARG B CG  1 
ATOM   3893 C  CD  . ARG B 1 227 ? 32.533 32.971  51.519  1.00 57.04  ? 227  ARG B CD  1 
ATOM   3894 N  NE  . ARG B 1 227 ? 32.417 32.304  52.818  1.00 58.70  ? 227  ARG B NE  1 
ATOM   3895 C  CZ  . ARG B 1 227 ? 32.332 32.915  53.998  1.00 57.36  ? 227  ARG B CZ  1 
ATOM   3896 N  NH1 . ARG B 1 227 ? 32.338 34.233  54.076  1.00 57.77  ? 227  ARG B NH1 1 
ATOM   3897 N  NH2 . ARG B 1 227 ? 32.229 32.187  55.102  1.00 58.73  ? 227  ARG B NH2 1 
ATOM   3898 N  N   . LYS B 1 228 ? 29.463 32.427  47.901  1.00 58.80  ? 228  LYS B N   1 
ATOM   3899 C  CA  . LYS B 1 228 ? 28.336 33.317  47.661  1.00 60.78  ? 228  LYS B CA  1 
ATOM   3900 C  C   . LYS B 1 228 ? 27.066 32.549  47.277  1.00 58.38  ? 228  LYS B C   1 
ATOM   3901 O  O   . LYS B 1 228 ? 26.010 32.718  47.902  1.00 58.60  ? 228  LYS B O   1 
ATOM   3902 C  CB  . LYS B 1 228 ? 28.711 34.333  46.583  1.00 65.02  ? 228  LYS B CB  1 
ATOM   3903 C  CG  . LYS B 1 228 ? 27.594 35.273  46.183  1.00 67.10  ? 228  LYS B CG  1 
ATOM   3904 C  CD  . LYS B 1 228 ? 28.064 36.259  45.131  1.00 71.24  ? 228  LYS B CD  1 
ATOM   3905 C  CE  . LYS B 1 228 ? 27.487 37.636  45.383  1.00 78.30  ? 228  LYS B CE  1 
ATOM   3906 N  NZ  . LYS B 1 228 ? 28.199 38.670  44.595  1.00 79.56  ? 228  LYS B NZ  1 
ATOM   3907 N  N   . THR B 1 229 ? 27.176 31.718  46.246  1.00 57.47  ? 229  THR B N   1 
ATOM   3908 C  CA  . THR B 1 229 ? 26.112 30.793  45.867  1.00 58.32  ? 229  THR B CA  1 
ATOM   3909 C  C   . THR B 1 229 ? 25.491 30.066  47.067  1.00 57.60  ? 229  THR B C   1 
ATOM   3910 O  O   . THR B 1 229 ? 24.283 30.154  47.303  1.00 56.84  ? 229  THR B O   1 
ATOM   3911 C  CB  . THR B 1 229 ? 26.614 29.762  44.817  1.00 56.96  ? 229  THR B CB  1 
ATOM   3912 O  OG1 . THR B 1 229 ? 27.068 30.464  43.651  1.00 58.69  ? 229  THR B OG1 1 
ATOM   3913 C  CG2 . THR B 1 229 ? 25.503 28.810  44.413  1.00 53.79  ? 229  THR B CG2 1 
ATOM   3914 N  N   . ILE B 1 230 ? 26.324 29.360  47.824  1.00 56.70  ? 230  ILE B N   1 
ATOM   3915 C  CA  . ILE B 1 230 ? 25.874 28.601  48.986  1.00 56.19  ? 230  ILE B CA  1 
ATOM   3916 C  C   . ILE B 1 230 ? 25.176 29.452  50.021  1.00 55.23  ? 230  ILE B C   1 
ATOM   3917 O  O   . ILE B 1 230 ? 24.128 29.079  50.561  1.00 53.43  ? 230  ILE B O   1 
ATOM   3918 C  CB  . ILE B 1 230 ? 27.044 27.853  49.639  1.00 57.58  ? 230  ILE B CB  1 
ATOM   3919 C  CG1 . ILE B 1 230 ? 27.373 26.618  48.800  1.00 55.55  ? 230  ILE B CG1 1 
ATOM   3920 C  CG2 . ILE B 1 230 ? 26.709 27.449  51.067  1.00 52.48  ? 230  ILE B CG2 1 
ATOM   3921 C  CD1 . ILE B 1 230 ? 28.670 25.984  49.165  1.00 55.91  ? 230  ILE B CD1 1 
ATOM   3922 N  N   . HIS B 1 231 ? 25.776 30.595  50.303  1.00 56.04  ? 231  HIS B N   1 
ATOM   3923 C  CA  . HIS B 1 231 ? 25.143 31.588  51.131  1.00 57.50  ? 231  HIS B CA  1 
ATOM   3924 C  C   . HIS B 1 231 ? 23.696 31.844  50.672  1.00 56.54  ? 231  HIS B C   1 
ATOM   3925 O  O   . HIS B 1 231 ? 22.757 31.680  51.445  1.00 55.07  ? 231  HIS B O   1 
ATOM   3926 C  CB  . HIS B 1 231 ? 25.956 32.870  51.084  1.00 55.30  ? 231  HIS B CB  1 
ATOM   3927 C  CG  . HIS B 1 231 ? 25.518 33.871  52.094  1.00 63.73  ? 231  HIS B CG  1 
ATOM   3928 N  ND1 . HIS B 1 231 ? 24.490 34.772  51.864  1.00 65.77  ? 231  HIS B ND1 1 
ATOM   3929 C  CD2 . HIS B 1 231 ? 25.933 34.100  53.363  1.00 64.79  ? 231  HIS B CD2 1 
ATOM   3930 C  CE1 . HIS B 1 231 ? 24.313 35.514  52.936  1.00 64.08  ? 231  HIS B CE1 1 
ATOM   3931 N  NE2 . HIS B 1 231 ? 25.169 35.130  53.861  1.00 63.91  ? 231  HIS B NE2 1 
ATOM   3932 N  N   . ARG B 1 232 ? 23.519 32.242  49.412  1.00 54.96  ? 232  ARG B N   1 
ATOM   3933 C  CA  . ARG B 1 232 ? 22.180 32.540  48.901  1.00 56.72  ? 232  ARG B CA  1 
ATOM   3934 C  C   . ARG B 1 232 ? 21.234 31.333  48.967  1.00 56.53  ? 232  ARG B C   1 
ATOM   3935 O  O   . ARG B 1 232 ? 20.033 31.491  49.192  1.00 56.58  ? 232  ARG B O   1 
ATOM   3936 C  CB  . ARG B 1 232 ? 22.240 33.118  47.487  1.00 57.05  ? 232  ARG B CB  1 
ATOM   3937 C  CG  . ARG B 1 232 ? 23.158 34.307  47.352  1.00 61.16  ? 232  ARG B CG  1 
ATOM   3938 C  CD  . ARG B 1 232 ? 22.890 35.070  46.069  1.00 65.19  ? 232  ARG B CD  1 
ATOM   3939 N  NE  . ARG B 1 232 ? 23.620 36.333  46.027  1.00 74.84  ? 232  ARG B NE  1 
ATOM   3940 C  CZ  . ARG B 1 232 ? 23.844 37.037  44.919  1.00 82.48  ? 232  ARG B CZ  1 
ATOM   3941 N  NH1 . ARG B 1 232 ? 23.396 36.606  43.748  1.00 81.46  ? 232  ARG B NH1 1 
ATOM   3942 N  NH2 . ARG B 1 232 ? 24.525 38.176  44.978  1.00 82.87  ? 232  ARG B NH2 1 
ATOM   3943 N  N   . ILE B 1 233 ? 21.766 30.125  48.778  1.00 54.30  ? 233  ILE B N   1 
ATOM   3944 C  CA  . ILE B 1 233 ? 20.962 28.913  48.975  1.00 55.22  ? 233  ILE B CA  1 
ATOM   3945 C  C   . ILE B 1 233 ? 20.460 28.779  50.413  1.00 56.38  ? 233  ILE B C   1 
ATOM   3946 O  O   . ILE B 1 233 ? 19.296 28.492  50.650  1.00 53.27  ? 233  ILE B O   1 
ATOM   3947 C  CB  . ILE B 1 233 ? 21.745 27.643  48.645  1.00 53.15  ? 233  ILE B CB  1 
ATOM   3948 C  CG1 . ILE B 1 233 ? 21.973 27.534  47.138  1.00 52.42  ? 233  ILE B CG1 1 
ATOM   3949 C  CG2 . ILE B 1 233 ? 20.987 26.406  49.136  1.00 50.99  ? 233  ILE B CG2 1 
ATOM   3950 C  CD1 . ILE B 1 233 ? 22.839 26.371  46.697  1.00 47.00  ? 233  ILE B CD1 1 
ATOM   3951 N  N   . LEU B 1 234 ? 21.361 28.976  51.368  1.00 57.09  ? 234  LEU B N   1 
ATOM   3952 C  CA  . LEU B 1 234 ? 21.029 28.838  52.775  1.00 56.00  ? 234  LEU B CA  1 
ATOM   3953 C  C   . LEU B 1 234 ? 19.993 29.847  53.229  1.00 56.84  ? 234  LEU B C   1 
ATOM   3954 O  O   . LEU B 1 234 ? 19.118 29.523  54.031  1.00 56.38  ? 234  LEU B O   1 
ATOM   3955 C  CB  . LEU B 1 234 ? 22.291 28.923  53.622  1.00 56.68  ? 234  LEU B CB  1 
ATOM   3956 C  CG  . LEU B 1 234 ? 23.243 27.726  53.434  1.00 54.13  ? 234  LEU B CG  1 
ATOM   3957 C  CD1 . LEU B 1 234 ? 24.520 27.997  54.191  1.00 53.17  ? 234  LEU B CD1 1 
ATOM   3958 C  CD2 . LEU B 1 234 ? 22.626 26.397  53.876  1.00 51.53  ? 234  LEU B CD2 1 
ATOM   3959 N  N   . ASN B 1 235 ? 20.073 31.054  52.676  1.00 57.79  ? 235  ASN B N   1 
ATOM   3960 C  CA  . ASN B 1 235 ? 19.157 32.131  53.017  1.00 55.44  ? 235  ASN B CA  1 
ATOM   3961 C  C   . ASN B 1 235 ? 18.063 32.312  51.984  1.00 58.42  ? 235  ASN B C   1 
ATOM   3962 O  O   . ASN B 1 235 ? 17.322 33.311  52.000  1.00 59.76  ? 235  ASN B O   1 
ATOM   3963 C  CB  . ASN B 1 235 ? 19.938 33.417  53.199  1.00 59.24  ? 235  ASN B CB  1 
ATOM   3964 C  CG  . ASN B 1 235 ? 20.857 33.354  54.382  1.00 63.54  ? 235  ASN B CG  1 
ATOM   3965 O  OD1 . ASN B 1 235 ? 22.078 33.321  54.223  1.00 64.47  ? 235  ASN B OD1 1 
ATOM   3966 N  ND2 . ASN B 1 235 ? 20.283 33.313  55.584  1.00 61.36  ? 235  ASN B ND2 1 
ATOM   3967 N  N   . VAL B 1 236 ? 17.977 31.329  51.087  1.00 57.51  ? 236  VAL B N   1 
ATOM   3968 C  CA  . VAL B 1 236 ? 16.927 31.263  50.077  1.00 54.43  ? 236  VAL B CA  1 
ATOM   3969 C  C   . VAL B 1 236 ? 16.759 32.608  49.339  1.00 56.46  ? 236  VAL B C   1 
ATOM   3970 O  O   . VAL B 1 236 ? 15.647 33.032  49.041  1.00 60.15  ? 236  VAL B O   1 
ATOM   3971 C  CB  . VAL B 1 236 ? 15.592 30.781  50.711  1.00 52.15  ? 236  VAL B CB  1 
ATOM   3972 C  CG1 . VAL B 1 236 ? 14.537 30.511  49.659  1.00 51.95  ? 236  VAL B CG1 1 
ATOM   3973 C  CG2 . VAL B 1 236 ? 15.827 29.527  51.512  1.00 51.13  ? 236  VAL B CG2 1 
ATOM   3974 N  N   . GLN B 1 237 ? 17.875 33.267  49.037  1.00 55.17  ? 237  GLN B N   1 
ATOM   3975 C  CA  . GLN B 1 237 ? 17.841 34.557  48.374  1.00 56.44  ? 237  GLN B CA  1 
ATOM   3976 C  C   . GLN B 1 237 ? 17.776 34.400  46.866  1.00 56.10  ? 237  GLN B C   1 
ATOM   3977 O  O   . GLN B 1 237 ? 18.798 34.210  46.204  1.00 56.64  ? 237  GLN B O   1 
ATOM   3978 C  CB  . GLN B 1 237 ? 19.069 35.384  48.746  1.00 56.81  ? 237  GLN B CB  1 
ATOM   3979 C  CG  . GLN B 1 237 ? 19.275 35.562  50.246  1.00 60.63  ? 237  GLN B CG  1 
ATOM   3980 C  CD  . GLN B 1 237 ? 20.515 36.369  50.565  1.00 71.64  ? 237  GLN B CD  1 
ATOM   3981 O  OE1 . GLN B 1 237 ? 21.343 36.627  49.692  1.00 75.15  ? 237  GLN B OE1 1 
ATOM   3982 N  NE2 . GLN B 1 237 ? 20.648 36.780  51.817  1.00 71.83  ? 237  GLN B NE2 1 
ATOM   3983 N  N   . TYR B 1 238 ? 16.566 34.481  46.324  1.00 57.11  ? 238  TYR B N   1 
ATOM   3984 C  CA  . TYR B 1 238 ? 16.376 34.487  44.875  1.00 57.21  ? 238  TYR B CA  1 
ATOM   3985 C  C   . TYR B 1 238 ? 15.453 35.629  44.486  1.00 60.51  ? 238  TYR B C   1 
ATOM   3986 O  O   . TYR B 1 238 ? 14.750 36.179  45.327  1.00 60.55  ? 238  TYR B O   1 
ATOM   3987 C  CB  . TYR B 1 238 ? 15.809 33.160  44.383  1.00 53.56  ? 238  TYR B CB  1 
ATOM   3988 C  CG  . TYR B 1 238 ? 14.352 32.943  44.732  1.00 55.80  ? 238  TYR B CG  1 
ATOM   3989 C  CD1 . TYR B 1 238 ? 13.967 32.529  46.007  1.00 54.50  ? 238  TYR B CD1 1 
ATOM   3990 C  CD2 . TYR B 1 238 ? 13.353 33.157  43.785  1.00 55.27  ? 238  TYR B CD2 1 
ATOM   3991 C  CE1 . TYR B 1 238 ? 12.627 32.333  46.323  1.00 52.24  ? 238  TYR B CE1 1 
ATOM   3992 C  CE2 . TYR B 1 238 ? 12.017 32.957  44.090  1.00 50.77  ? 238  TYR B CE2 1 
ATOM   3993 C  CZ  . TYR B 1 238 ? 11.657 32.550  45.353  1.00 50.80  ? 238  TYR B CZ  1 
ATOM   3994 O  OH  . TYR B 1 238 ? 10.327 32.351  45.634  1.00 50.98  ? 238  TYR B OH  1 
ATOM   3995 N  N   . ALA B 1 239 ? 15.456 35.980  43.205  1.00 63.77  ? 239  ALA B N   1 
ATOM   3996 C  CA  . ALA B 1 239 ? 14.765 37.177  42.741  1.00 63.42  ? 239  ALA B CA  1 
ATOM   3997 C  C   . ALA B 1 239 ? 14.394 37.066  41.271  1.00 64.38  ? 239  ALA B C   1 
ATOM   3998 O  O   . ALA B 1 239 ? 15.223 37.314  40.396  1.00 65.76  ? 239  ALA B O   1 
ATOM   3999 C  CB  . ALA B 1 239 ? 15.644 38.403  42.963  1.00 62.15  ? 239  ALA B CB  1 
ATOM   4000 N  N   . ILE B 1 240 ? 13.151 36.702  40.999  1.00 61.48  ? 240  ILE B N   1 
ATOM   4001 C  CA  . ILE B 1 240 ? 12.659 36.692  39.633  1.00 63.86  ? 240  ILE B CA  1 
ATOM   4002 C  C   . ILE B 1 240 ? 12.801 38.043  38.936  1.00 67.07  ? 240  ILE B C   1 
ATOM   4003 O  O   . ILE B 1 240 ? 12.145 39.004  39.315  1.00 70.98  ? 240  ILE B O   1 
ATOM   4004 C  CB  . ILE B 1 240 ? 11.186 36.295  39.594  1.00 64.14  ? 240  ILE B CB  1 
ATOM   4005 C  CG1 . ILE B 1 240 ? 10.998 34.949  40.278  1.00 62.76  ? 240  ILE B CG1 1 
ATOM   4006 C  CG2 . ILE B 1 240 ? 10.671 36.248  38.142  1.00 63.38  ? 240  ILE B CG2 1 
ATOM   4007 C  CD1 . ILE B 1 240 ? 9.550  34.564  40.403  1.00 67.16  ? 240  ILE B CD1 1 
ATOM   4008 N  N   . PRO B 1 241 ? 13.641 38.106  37.892  1.00 69.49  ? 241  PRO B N   1 
ATOM   4009 C  CA  . PRO B 1 241 ? 13.884 39.328  37.114  1.00 68.01  ? 241  PRO B CA  1 
ATOM   4010 C  C   . PRO B 1 241 ? 12.613 40.084  36.725  1.00 69.34  ? 241  PRO B C   1 
ATOM   4011 O  O   . PRO B 1 241 ? 11.559 39.505  36.421  1.00 65.12  ? 241  PRO B O   1 
ATOM   4012 C  CB  . PRO B 1 241 ? 14.595 38.797  35.858  1.00 67.51  ? 241  PRO B CB  1 
ATOM   4013 C  CG  . PRO B 1 241 ? 15.366 37.615  36.359  1.00 66.02  ? 241  PRO B CG  1 
ATOM   4014 C  CD  . PRO B 1 241 ? 14.423 36.966  37.368  1.00 66.23  ? 241  PRO B CD  1 
ATOM   4015 N  N   . ASP B 1 242 ? 12.739 41.403  36.729  1.00 71.50  ? 242  ASP B N   1 
ATOM   4016 C  CA  . ASP B 1 242 ? 11.625 42.282  36.433  1.00 72.22  ? 242  ASP B CA  1 
ATOM   4017 C  C   . ASP B 1 242 ? 11.017 42.034  35.061  1.00 72.86  ? 242  ASP B C   1 
ATOM   4018 O  O   . ASP B 1 242 ? 9.798  42.151  34.888  1.00 72.35  ? 242  ASP B O   1 
ATOM   4019 C  CB  . ASP B 1 242 ? 12.061 43.741  36.555  1.00 77.21  ? 242  ASP B CB  1 
ATOM   4020 C  CG  . ASP B 1 242 ? 12.300 44.162  37.997  1.00 83.73  ? 242  ASP B CG  1 
ATOM   4021 O  OD1 . ASP B 1 242 ? 11.653 43.594  38.911  1.00 82.01  ? 242  ASP B OD1 1 
ATOM   4022 O  OD2 . ASP B 1 242 ? 13.134 45.068  38.214  1.00 83.97  ? 242  ASP B OD2 1 
ATOM   4023 N  N   . TYR B 1 243 ? 11.861 41.692  34.089  1.00 69.60  ? 243  TYR B N   1 
ATOM   4024 C  CA  . TYR B 1 243 ? 11.384 41.451  32.727  1.00 68.34  ? 243  TYR B CA  1 
ATOM   4025 C  C   . TYR B 1 243 ? 10.792 40.065  32.524  1.00 68.66  ? 243  TYR B C   1 
ATOM   4026 O  O   . TYR B 1 243 ? 10.210 39.775  31.474  1.00 68.55  ? 243  TYR B O   1 
ATOM   4027 C  CB  . TYR B 1 243 ? 12.483 41.693  31.710  1.00 67.57  ? 243  TYR B CB  1 
ATOM   4028 C  CG  . TYR B 1 243 ? 13.658 40.768  31.833  1.00 68.37  ? 243  TYR B CG  1 
ATOM   4029 C  CD1 . TYR B 1 243 ? 13.676 39.548  31.175  1.00 65.78  ? 243  TYR B CD1 1 
ATOM   4030 C  CD2 . TYR B 1 243 ? 14.765 41.130  32.593  1.00 68.07  ? 243  TYR B CD2 1 
ATOM   4031 C  CE1 . TYR B 1 243 ? 14.761 38.703  31.279  1.00 66.32  ? 243  TYR B CE1 1 
ATOM   4032 C  CE2 . TYR B 1 243 ? 15.857 40.300  32.704  1.00 69.98  ? 243  TYR B CE2 1 
ATOM   4033 C  CZ  . TYR B 1 243 ? 15.856 39.081  32.045  1.00 70.30  ? 243  TYR B CZ  1 
ATOM   4034 O  OH  . TYR B 1 243 ? 16.960 38.248  32.158  1.00 75.16  ? 243  TYR B OH  1 
ATOM   4035 N  N   . VAL B 1 244 ? 10.938 39.213  33.533  1.00 67.15  ? 244  VAL B N   1 
ATOM   4036 C  CA  . VAL B 1 244 ? 10.291 37.921  33.496  1.00 66.11  ? 244  VAL B CA  1 
ATOM   4037 C  C   . VAL B 1 244 ? 8.938  38.056  34.169  1.00 64.06  ? 244  VAL B C   1 
ATOM   4038 O  O   . VAL B 1 244 ? 8.825  38.530  35.313  1.00 65.57  ? 244  VAL B O   1 
ATOM   4039 C  CB  . VAL B 1 244 ? 11.133 36.814  34.181  1.00 64.63  ? 244  VAL B CB  1 
ATOM   4040 C  CG1 . VAL B 1 244 ? 10.441 35.458  34.034  1.00 58.23  ? 244  VAL B CG1 1 
ATOM   4041 C  CG2 . VAL B 1 244 ? 12.528 36.762  33.601  1.00 60.70  ? 244  VAL B CG2 1 
ATOM   4042 N  N   . HIS B 1 245 ? 7.901  37.644  33.459  1.00 58.96  ? 245  HIS B N   1 
ATOM   4043 C  CA  . HIS B 1 245 ? 6.561  37.805  33.994  1.00 63.08  ? 245  HIS B CA  1 
ATOM   4044 C  C   . HIS B 1 245 ? 5.832  36.482  34.038  1.00 65.99  ? 245  HIS B C   1 
ATOM   4045 O  O   . HIS B 1 245 ? 5.572  35.854  33.002  1.00 65.08  ? 245  HIS B O   1 
ATOM   4046 C  CB  . HIS B 1 245 ? 5.774  38.856  33.192  1.00 64.25  ? 245  HIS B CB  1 
ATOM   4047 C  CG  . HIS B 1 245 ? 6.505  40.154  33.053  1.00 70.92  ? 245  HIS B CG  1 
ATOM   4048 N  ND1 . HIS B 1 245 ? 6.880  40.667  31.828  1.00 72.91  ? 245  HIS B ND1 1 
ATOM   4049 C  CD2 . HIS B 1 245 ? 6.976  41.016  33.986  1.00 69.58  ? 245  HIS B CD2 1 
ATOM   4050 C  CE1 . HIS B 1 245 ? 7.531  41.804  32.013  1.00 71.72  ? 245  HIS B CE1 1 
ATOM   4051 N  NE2 . HIS B 1 245 ? 7.608  42.035  33.317  1.00 71.83  ? 245  HIS B NE2 1 
ATOM   4052 N  N   . ILE B 1 246 ? 5.513  36.054  35.253  1.00 63.97  ? 246  ILE B N   1 
ATOM   4053 C  CA  . ILE B 1 246 ? 4.833  34.783  35.430  1.00 63.28  ? 246  ILE B CA  1 
ATOM   4054 C  C   . ILE B 1 246 ? 3.549  34.940  36.213  1.00 62.77  ? 246  ILE B C   1 
ATOM   4055 O  O   . ILE B 1 246 ? 3.410  35.855  37.024  1.00 62.14  ? 246  ILE B O   1 
ATOM   4056 C  CB  . ILE B 1 246 ? 5.720  33.754  36.146  1.00 64.11  ? 246  ILE B CB  1 
ATOM   4057 C  CG1 . ILE B 1 246 ? 6.254  34.332  37.457  1.00 62.32  ? 246  ILE B CG1 1 
ATOM   4058 C  CG2 . ILE B 1 246 ? 6.864  33.321  35.237  1.00 61.53  ? 246  ILE B CG2 1 
ATOM   4059 C  CD1 . ILE B 1 246 ? 6.713  33.260  38.431  1.00 61.48  ? 246  ILE B CD1 1 
ATOM   4060 N  N   . SER B 1 247 ? 2.613  34.032  35.962  1.00 60.85  ? 247  SER B N   1 
ATOM   4061 C  CA  . SER B 1 247 ? 1.352  34.017  36.683  1.00 60.71  ? 247  SER B CA  1 
ATOM   4062 C  C   . SER B 1 247 ? 1.607  33.987  38.185  1.00 62.80  ? 247  SER B C   1 
ATOM   4063 O  O   . SER B 1 247 ? 2.653  33.509  38.640  1.00 62.41  ? 247  SER B O   1 
ATOM   4064 C  CB  . SER B 1 247 ? 0.518  32.814  36.272  1.00 59.25  ? 247  SER B CB  1 
ATOM   4065 O  OG  . SER B 1 247 ? 1.019  31.627  36.858  1.00 63.49  ? 247  SER B OG  1 
ATOM   4066 N  N   . PRO B 1 248 ? 0.654  34.516  38.963  1.00 66.39  ? 248  PRO B N   1 
ATOM   4067 C  CA  . PRO B 1 248 ? 0.772  34.513  40.427  1.00 65.87  ? 248  PRO B CA  1 
ATOM   4068 C  C   . PRO B 1 248 ? 0.775  33.091  40.995  1.00 61.11  ? 248  PRO B C   1 
ATOM   4069 O  O   . PRO B 1 248 ? 1.413  32.851  42.020  1.00 60.17  ? 248  PRO B O   1 
ATOM   4070 C  CB  . PRO B 1 248 ? -0.474 35.280  40.876  1.00 68.38  ? 248  PRO B CB  1 
ATOM   4071 C  CG  . PRO B 1 248 ? -0.872 36.101  39.669  1.00 67.86  ? 248  PRO B CG  1 
ATOM   4072 C  CD  . PRO B 1 248 ? -0.531 35.259  38.496  1.00 68.48  ? 248  PRO B CD  1 
ATOM   4073 N  N   . GLU B 1 249 ? 0.068  32.175  40.332  1.00 61.71  ? 249  GLU B N   1 
ATOM   4074 C  CA  . GLU B 1 249 ? 0.057  30.743  40.680  1.00 63.07  ? 249  GLU B CA  1 
ATOM   4075 C  C   . GLU B 1 249 ? 1.453  30.122  40.628  1.00 62.45  ? 249  GLU B C   1 
ATOM   4076 O  O   . GLU B 1 249 ? 1.884  29.441  41.560  1.00 61.33  ? 249  GLU B O   1 
ATOM   4077 C  CB  . GLU B 1 249 ? -0.830 29.976  39.707  1.00 63.23  ? 249  GLU B CB  1 
ATOM   4078 C  CG  . GLU B 1 249 ? -2.290 30.389  39.705  1.00 71.34  ? 249  GLU B CG  1 
ATOM   4079 C  CD  . GLU B 1 249 ? -2.570 31.720  39.012  1.00 74.88  ? 249  GLU B CD  1 
ATOM   4080 O  OE1 . GLU B 1 249 ? -1.632 32.361  38.490  1.00 71.28  ? 249  GLU B OE1 1 
ATOM   4081 O  OE2 . GLU B 1 249 ? -3.754 32.117  38.995  1.00 76.08  ? 249  GLU B OE2 1 
ATOM   4082 N  N   . CYS B 1 250 ? 2.118  30.347  39.495  1.00 60.42  ? 250  CYS B N   1 
ATOM   4083 C  CA  . CYS B 1 250 ? 3.491  29.951  39.242  1.00 58.71  ? 250  CYS B CA  1 
ATOM   4084 C  C   . CYS B 1 250 ? 4.413  30.522  40.322  1.00 56.61  ? 250  CYS B C   1 
ATOM   4085 O  O   . CYS B 1 250 ? 5.173  29.779  40.958  1.00 55.09  ? 250  CYS B O   1 
ATOM   4086 C  CB  . CYS B 1 250 ? 3.899  30.448  37.845  1.00 62.15  ? 250  CYS B CB  1 
ATOM   4087 S  SG  . CYS B 1 250 ? 5.451  29.822  37.119  1.00 60.02  ? 250  CYS B SG  1 
ATOM   4088 N  N   . ARG B 1 251 ? 4.330  31.836  40.539  1.00 55.63  ? 251  ARG B N   1 
ATOM   4089 C  CA  . ARG B 1 251 ? 5.162  32.500  41.544  1.00 57.06  ? 251  ARG B CA  1 
ATOM   4090 C  C   . ARG B 1 251 ? 4.992  31.881  42.934  1.00 57.85  ? 251  ARG B C   1 
ATOM   4091 O  O   . ARG B 1 251 ? 5.961  31.679  43.685  1.00 54.01  ? 251  ARG B O   1 
ATOM   4092 C  CB  . ARG B 1 251 ? 4.853  33.994  41.591  1.00 55.75  ? 251  ARG B CB  1 
ATOM   4093 C  CG  . ARG B 1 251 ? 5.871  34.807  42.408  1.00 61.71  ? 251  ARG B CG  1 
ATOM   4094 C  CD  . ARG B 1 251 ? 5.647  36.320  42.293  1.00 62.75  ? 251  ARG B CD  1 
ATOM   4095 N  NE  . ARG B 1 251 ? 5.787  36.812  40.924  1.00 66.38  ? 251  ARG B NE  1 
ATOM   4096 C  CZ  . ARG B 1 251 ? 6.841  37.495  40.471  1.00 70.53  ? 251  ARG B CZ  1 
ATOM   4097 N  NH1 . ARG B 1 251 ? 7.856  37.781  41.284  1.00 64.33  ? 251  ARG B NH1 1 
ATOM   4098 N  NH2 . ARG B 1 251 ? 6.880  37.897  39.201  1.00 72.56  ? 251  ARG B NH2 1 
ATOM   4099 N  N   . HIS B 1 252 ? 3.738  31.592  43.258  1.00 57.45  ? 252  HIS B N   1 
ATOM   4100 C  CA  . HIS B 1 252 ? 3.378  30.915  44.493  1.00 55.77  ? 252  HIS B CA  1 
ATOM   4101 C  C   . HIS B 1 252 ? 4.049  29.550  44.629  1.00 55.76  ? 252  HIS B C   1 
ATOM   4102 O  O   . HIS B 1 252 ? 4.705  29.278  45.638  1.00 54.69  ? 252  HIS B O   1 
ATOM   4103 C  CB  . HIS B 1 252 ? 1.850  30.746  44.587  1.00 56.80  ? 252  HIS B CB  1 
ATOM   4104 C  CG  . HIS B 1 252 ? 1.402  29.879  45.731  1.00 56.96  ? 252  HIS B CG  1 
ATOM   4105 N  ND1 . HIS B 1 252 ? 0.967  28.581  45.559  1.00 56.62  ? 252  HIS B ND1 1 
ATOM   4106 C  CD2 . HIS B 1 252 ? 1.349  30.122  47.061  1.00 54.16  ? 252  HIS B CD2 1 
ATOM   4107 C  CE1 . HIS B 1 252 ? 0.659  28.061  46.737  1.00 55.32  ? 252  HIS B CE1 1 
ATOM   4108 N  NE2 . HIS B 1 252 ? 0.883  28.976  47.663  1.00 57.18  ? 252  HIS B NE2 1 
ATOM   4109 N  N   . LEU B 1 253 ? 3.837  28.686  43.635  1.00 56.71  ? 253  LEU B N   1 
ATOM   4110 C  CA  . LEU B 1 253 ? 4.465  27.360  43.593  1.00 56.17  ? 253  LEU B CA  1 
ATOM   4111 C  C   . LEU B 1 253 ? 5.977  27.445  43.848  1.00 55.50  ? 253  LEU B C   1 
ATOM   4112 O  O   . LEU B 1 253 ? 6.521  26.773  44.730  1.00 51.10  ? 253  LEU B O   1 
ATOM   4113 C  CB  . LEU B 1 253 ? 4.182  26.696  42.254  1.00 52.54  ? 253  LEU B CB  1 
ATOM   4114 C  CG  . LEU B 1 253 ? 4.748  25.296  42.045  1.00 54.45  ? 253  LEU B CG  1 
ATOM   4115 C  CD1 . LEU B 1 253 ? 4.307  24.352  43.150  1.00 54.79  ? 253  LEU B CD1 1 
ATOM   4116 C  CD2 . LEU B 1 253 ? 4.339  24.761  40.682  1.00 53.69  ? 253  LEU B CD2 1 
ATOM   4117 N  N   . ILE B 1 254 ? 6.646  28.310  43.097  1.00 54.97  ? 254  ILE B N   1 
ATOM   4118 C  CA  . ILE B 1 254 ? 8.052  28.584  43.349  1.00 51.49  ? 254  ILE B CA  1 
ATOM   4119 C  C   . ILE B 1 254 ? 8.340  28.978  44.794  1.00 52.25  ? 254  ILE B C   1 
ATOM   4120 O  O   . ILE B 1 254 ? 9.265  28.458  45.393  1.00 53.42  ? 254  ILE B O   1 
ATOM   4121 C  CB  . ILE B 1 254 ? 8.609  29.625  42.355  1.00 52.55  ? 254  ILE B CB  1 
ATOM   4122 C  CG1 . ILE B 1 254 ? 8.449  29.082  40.930  1.00 52.05  ? 254  ILE B CG1 1 
ATOM   4123 C  CG2 . ILE B 1 254 ? 10.071 29.961  42.668  1.00 45.31  ? 254  ILE B CG2 1 
ATOM   4124 C  CD1 . ILE B 1 254 ? 8.573  30.095  39.868  1.00 48.09  ? 254  ILE B CD1 1 
ATOM   4125 N  N   . SER B 1 255 ? 7.559  29.884  45.362  1.00 52.72  ? 255  SER B N   1 
ATOM   4126 C  CA  . SER B 1 255 ? 7.780  30.294  46.756  1.00 55.19  ? 255  SER B CA  1 
ATOM   4127 C  C   . SER B 1 255 ? 7.596  29.127  47.738  1.00 54.45  ? 255  SER B C   1 
ATOM   4128 O  O   . SER B 1 255 ? 8.170  29.116  48.831  1.00 53.31  ? 255  SER B O   1 
ATOM   4129 C  CB  . SER B 1 255 ? 6.817  31.424  47.141  1.00 53.87  ? 255  SER B CB  1 
ATOM   4130 O  OG  . SER B 1 255 ? 5.483  30.951  47.205  1.00 55.12  ? 255  SER B OG  1 
ATOM   4131 N  N   . ARG B 1 256 ? 6.776  28.162  47.326  1.00 52.17  ? 256  ARG B N   1 
ATOM   4132 C  CA  . ARG B 1 256 ? 6.438  27.016  48.139  1.00 52.72  ? 256  ARG B CA  1 
ATOM   4133 C  C   . ARG B 1 256 ? 7.484  25.911  48.027  1.00 54.87  ? 256  ARG B C   1 
ATOM   4134 O  O   . ARG B 1 256 ? 7.546  25.022  48.891  1.00 55.07  ? 256  ARG B O   1 
ATOM   4135 C  CB  . ARG B 1 256 ? 5.057  26.478  47.747  1.00 55.45  ? 256  ARG B CB  1 
ATOM   4136 C  CG  . ARG B 1 256 ? 3.889  27.184  48.427  1.00 57.58  ? 256  ARG B CG  1 
ATOM   4137 C  CD  . ARG B 1 256 ? 3.862  26.935  49.936  1.00 59.14  ? 256  ARG B CD  1 
ATOM   4138 N  NE  . ARG B 1 256 ? 3.388  25.593  50.303  1.00 61.97  ? 256  ARG B NE  1 
ATOM   4139 C  CZ  . ARG B 1 256 ? 4.045  24.766  51.122  1.00 63.64  ? 256  ARG B CZ  1 
ATOM   4140 N  NH1 . ARG B 1 256 ? 5.206  25.155  51.652  1.00 60.97  ? 256  ARG B NH1 1 
ATOM   4141 N  NH2 . ARG B 1 256 ? 3.552  23.553  51.417  1.00 59.06  ? 256  ARG B NH2 1 
ATOM   4142 N  N   . ILE B 1 257 ? 8.289  25.949  46.962  1.00 52.95  ? 257  ILE B N   1 
ATOM   4143 C  CA  . ILE B 1 257 ? 9.355  24.965  46.813  1.00 49.56  ? 257  ILE B CA  1 
ATOM   4144 C  C   . ILE B 1 257 ? 10.616 25.483  47.451  1.00 48.30  ? 257  ILE B C   1 
ATOM   4145 O  O   . ILE B 1 257 ? 11.274 24.770  48.199  1.00 48.25  ? 257  ILE B O   1 
ATOM   4146 C  CB  . ILE B 1 257 ? 9.644  24.568  45.345  1.00 49.54  ? 257  ILE B CB  1 
ATOM   4147 C  CG1 . ILE B 1 257 ? 8.431  23.885  44.712  1.00 48.94  ? 257  ILE B CG1 1 
ATOM   4148 C  CG2 . ILE B 1 257 ? 10.880 23.656  45.268  1.00 46.18  ? 257  ILE B CG2 1 
ATOM   4149 C  CD1 . ILE B 1 257 ? 8.542  23.646  43.207  1.00 44.62  ? 257  ILE B CD1 1 
ATOM   4150 N  N   . PHE B 1 258 ? 10.949 26.735  47.179  1.00 49.26  ? 258  PHE B N   1 
ATOM   4151 C  CA  . PHE B 1 258 ? 12.158 27.317  47.744  1.00 51.25  ? 258  PHE B CA  1 
ATOM   4152 C  C   . PHE B 1 258 ? 11.987 27.647  49.210  1.00 51.23  ? 258  PHE B C   1 
ATOM   4153 O  O   . PHE B 1 258 ? 12.096 28.793  49.603  1.00 50.22  ? 258  PHE B O   1 
ATOM   4154 C  CB  . PHE B 1 258 ? 12.627 28.543  46.950  1.00 49.40  ? 258  PHE B CB  1 
ATOM   4155 C  CG  . PHE B 1 258 ? 13.183 28.202  45.586  1.00 50.93  ? 258  PHE B CG  1 
ATOM   4156 C  CD1 . PHE B 1 258 ? 13.565 26.903  45.286  1.00 49.87  ? 258  PHE B CD1 1 
ATOM   4157 C  CD2 . PHE B 1 258 ? 13.305 29.170  44.593  1.00 51.06  ? 258  PHE B CD2 1 
ATOM   4158 C  CE1 . PHE B 1 258 ? 14.080 26.575  44.019  1.00 51.34  ? 258  PHE B CE1 1 
ATOM   4159 C  CE2 . PHE B 1 258 ? 13.814 28.844  43.325  1.00 51.33  ? 258  PHE B CE2 1 
ATOM   4160 C  CZ  . PHE B 1 258 ? 14.199 27.537  43.039  1.00 49.32  ? 258  PHE B CZ  1 
ATOM   4161 N  N   . VAL B 1 259 ? 11.756 26.612  50.016  1.00 51.95  ? 259  VAL B N   1 
ATOM   4162 C  CA  . VAL B 1 259 ? 11.596 26.745  51.466  1.00 53.75  ? 259  VAL B CA  1 
ATOM   4163 C  C   . VAL B 1 259 ? 12.746 26.028  52.139  1.00 53.49  ? 259  VAL B C   1 
ATOM   4164 O  O   . VAL B 1 259 ? 12.917 24.835  51.919  1.00 52.44  ? 259  VAL B O   1 
ATOM   4165 C  CB  . VAL B 1 259 ? 10.246 26.125  51.954  1.00 54.56  ? 259  VAL B CB  1 
ATOM   4166 C  CG1 . VAL B 1 259 ? 10.180 26.093  53.488  1.00 54.56  ? 259  VAL B CG1 1 
ATOM   4167 C  CG2 . VAL B 1 259 ? 9.060  26.899  51.360  1.00 52.85  ? 259  VAL B CG2 1 
ATOM   4168 N  N   . ALA B 1 260 ? 13.530 26.751  52.946  1.00 52.48  ? 260  ALA B N   1 
ATOM   4169 C  CA  . ALA B 1 260 ? 14.725 26.187  53.596  1.00 51.24  ? 260  ALA B CA  1 
ATOM   4170 C  C   . ALA B 1 260 ? 14.420 24.994  54.514  1.00 52.79  ? 260  ALA B C   1 
ATOM   4171 O  O   . ALA B 1 260 ? 15.162 24.001  54.555  1.00 53.63  ? 260  ALA B O   1 
ATOM   4172 C  CB  . ALA B 1 260 ? 15.465 27.259  54.357  1.00 50.73  ? 260  ALA B CB  1 
ATOM   4173 N  N   . ASP B 1 261 ? 13.330 25.110  55.262  1.00 52.30  ? 261  ASP B N   1 
ATOM   4174 C  CA  . ASP B 1 261 ? 12.891 24.036  56.120  1.00 53.43  ? 261  ASP B CA  1 
ATOM   4175 C  C   . ASP B 1 261 ? 12.208 22.917  55.336  1.00 55.82  ? 261  ASP B C   1 
ATOM   4176 O  O   . ASP B 1 261 ? 11.109 23.088  54.815  1.00 55.59  ? 261  ASP B O   1 
ATOM   4177 C  CB  . ASP B 1 261 ? 11.938 24.580  57.166  1.00 58.04  ? 261  ASP B CB  1 
ATOM   4178 C  CG  . ASP B 1 261 ? 11.610 23.563  58.222  1.00 62.24  ? 261  ASP B CG  1 
ATOM   4179 O  OD1 . ASP B 1 261 ? 12.056 22.396  58.091  1.00 58.79  ? 261  ASP B OD1 1 
ATOM   4180 O  OD2 . ASP B 1 261 ? 10.902 23.935  59.176  1.00 65.14  ? 261  ASP B OD2 1 
ATOM   4181 N  N   . PRO B 1 262 ? 12.854 21.752  55.264  1.00 54.70  ? 262  PRO B N   1 
ATOM   4182 C  CA  . PRO B 1 262 ? 12.279 20.614  54.545  1.00 55.79  ? 262  PRO B CA  1 
ATOM   4183 C  C   . PRO B 1 262 ? 10.907 20.226  55.076  1.00 58.70  ? 262  PRO B C   1 
ATOM   4184 O  O   . PRO B 1 262 ? 10.075 19.723  54.331  1.00 59.92  ? 262  PRO B O   1 
ATOM   4185 C  CB  . PRO B 1 262 ? 13.291 19.484  54.794  1.00 51.86  ? 262  PRO B CB  1 
ATOM   4186 C  CG  . PRO B 1 262 ? 14.184 19.956  55.903  1.00 52.52  ? 262  PRO B CG  1 
ATOM   4187 C  CD  . PRO B 1 262 ? 14.171 21.448  55.845  1.00 52.09  ? 262  PRO B CD  1 
ATOM   4188 N  N   . ALA B 1 263 ? 10.674 20.464  56.358  1.00 59.13  ? 263  ALA B N   1 
ATOM   4189 C  CA  . ALA B 1 263 ? 9.384  20.154  56.961  1.00 59.97  ? 263  ALA B CA  1 
ATOM   4190 C  C   . ALA B 1 263 ? 8.271  20.976  56.309  1.00 60.56  ? 263  ALA B C   1 
ATOM   4191 O  O   . ALA B 1 263 ? 7.148  20.503  56.121  1.00 57.91  ? 263  ALA B O   1 
ATOM   4192 C  CB  . ALA B 1 263 ? 9.432  20.404  58.463  1.00 54.62  ? 263  ALA B CB  1 
ATOM   4193 N  N   . LYS B 1 264 ? 8.601  22.209  55.947  1.00 60.17  ? 264  LYS B N   1 
ATOM   4194 C  CA  . LYS B 1 264 ? 7.615  23.127  55.418  1.00 59.08  ? 264  LYS B CA  1 
ATOM   4195 C  C   . LYS B 1 264 ? 7.571  23.208  53.882  1.00 60.51  ? 264  LYS B C   1 
ATOM   4196 O  O   . LYS B 1 264 ? 6.668  23.824  53.320  1.00 62.62  ? 264  LYS B O   1 
ATOM   4197 C  CB  . LYS B 1 264 ? 7.844  24.499  56.024  1.00 60.46  ? 264  LYS B CB  1 
ATOM   4198 C  CG  . LYS B 1 264 ? 8.106  24.470  57.514  1.00 63.29  ? 264  LYS B CG  1 
ATOM   4199 C  CD  . LYS B 1 264 ? 7.916  25.871  58.080  1.00 70.55  ? 264  LYS B CD  1 
ATOM   4200 C  CE  . LYS B 1 264 ? 8.386  25.998  59.515  1.00 76.37  ? 264  LYS B CE  1 
ATOM   4201 N  NZ  . LYS B 1 264 ? 9.865  26.149  59.588  1.00 74.68  ? 264  LYS B NZ  1 
ATOM   4202 N  N   . ARG B 1 265 ? 8.537  22.592  53.208  1.00 57.05  ? 265  ARG B N   1 
ATOM   4203 C  CA  . ARG B 1 265 ? 8.550  22.568  51.746  1.00 57.60  ? 265  ARG B CA  1 
ATOM   4204 C  C   . ARG B 1 265 ? 7.366  21.783  51.173  1.00 56.49  ? 265  ARG B C   1 
ATOM   4205 O  O   . ARG B 1 265 ? 7.007  20.711  51.680  1.00 57.33  ? 265  ARG B O   1 
ATOM   4206 C  CB  . ARG B 1 265 ? 9.868  21.987  51.222  1.00 55.26  ? 265  ARG B CB  1 
ATOM   4207 C  CG  . ARG B 1 265 ? 10.041 22.034  49.678  1.00 51.98  ? 265  ARG B CG  1 
ATOM   4208 C  CD  . ARG B 1 265 ? 11.500 21.765  49.247  1.00 50.41  ? 265  ARG B CD  1 
ATOM   4209 N  NE  . ARG B 1 265 ? 12.435 22.479  50.119  1.00 52.25  ? 265  ARG B NE  1 
ATOM   4210 C  CZ  . ARG B 1 265 ? 13.556 21.964  50.601  1.00 50.67  ? 265  ARG B CZ  1 
ATOM   4211 N  NH1 . ARG B 1 265 ? 13.902 20.727  50.264  1.00 47.42  ? 265  ARG B NH1 1 
ATOM   4212 N  NH2 . ARG B 1 265 ? 14.322 22.689  51.415  1.00 50.90  ? 265  ARG B NH2 1 
ATOM   4213 N  N   . ILE B 1 266 ? 6.774  22.312  50.104  1.00 54.81  ? 266  ILE B N   1 
ATOM   4214 C  CA  . ILE B 1 266 ? 5.678  21.623  49.436  1.00 57.10  ? 266  ILE B CA  1 
ATOM   4215 C  C   . ILE B 1 266 ? 6.119  20.212  49.041  1.00 56.65  ? 266  ILE B C   1 
ATOM   4216 O  O   . ILE B 1 266 ? 7.281  19.976  48.767  1.00 54.94  ? 266  ILE B O   1 
ATOM   4217 C  CB  . ILE B 1 266 ? 5.127  22.421  48.214  1.00 57.38  ? 266  ILE B CB  1 
ATOM   4218 C  CG1 . ILE B 1 266 ? 3.893  21.731  47.626  1.00 54.38  ? 266  ILE B CG1 1 
ATOM   4219 C  CG2 . ILE B 1 266 ? 6.200  22.619  47.137  1.00 53.42  ? 266  ILE B CG2 1 
ATOM   4220 C  CD1 . ILE B 1 266 ? 3.112  22.594  46.682  1.00 53.18  ? 266  ILE B CD1 1 
ATOM   4221 N  N   . SER B 1 267 ? 5.192  19.269  49.047  1.00 57.04  ? 267  SER B N   1 
ATOM   4222 C  CA  . SER B 1 267 ? 5.537  17.889  48.770  1.00 56.67  ? 267  SER B CA  1 
ATOM   4223 C  C   . SER B 1 267 ? 5.132  17.584  47.339  1.00 57.28  ? 267  SER B C   1 
ATOM   4224 O  O   . SER B 1 267 ? 4.421  18.368  46.707  1.00 54.57  ? 267  SER B O   1 
ATOM   4225 C  CB  . SER B 1 267 ? 4.810  16.954  49.741  1.00 53.49  ? 267  SER B CB  1 
ATOM   4226 O  OG  . SER B 1 267 ? 3.456  16.779  49.356  1.00 56.24  ? 267  SER B OG  1 
ATOM   4227 N  N   . ILE B 1 268 ? 5.575  16.438  46.831  1.00 56.07  ? 268  ILE B N   1 
ATOM   4228 C  CA  . ILE B 1 268 ? 5.254  16.035  45.456  1.00 55.93  ? 268  ILE B CA  1 
ATOM   4229 C  C   . ILE B 1 268 ? 3.748  15.935  45.202  1.00 58.22  ? 268  ILE B C   1 
ATOM   4230 O  O   . ILE B 1 268 ? 3.249  16.535  44.254  1.00 59.11  ? 268  ILE B O   1 
ATOM   4231 C  CB  . ILE B 1 268 ? 5.921  14.690  45.051  1.00 56.94  ? 268  ILE B CB  1 
ATOM   4232 C  CG1 . ILE B 1 268 ? 7.451  14.820  44.971  1.00 56.46  ? 268  ILE B CG1 1 
ATOM   4233 C  CG2 . ILE B 1 268 ? 5.381  14.204  43.720  1.00 53.68  ? 268  ILE B CG2 1 
ATOM   4234 C  CD1 . ILE B 1 268 ? 7.953  15.456  43.706  1.00 56.69  ? 268  ILE B CD1 1 
ATOM   4235 N  N   . PRO B 1 269 ? 3.023  15.176  46.051  1.00 61.23  ? 269  PRO B N   1 
ATOM   4236 C  CA  . PRO B 1 269 ? 1.560  15.106  45.926  1.00 59.60  ? 269  PRO B CA  1 
ATOM   4237 C  C   . PRO B 1 269 ? 0.932  16.503  45.988  1.00 57.50  ? 269  PRO B C   1 
ATOM   4238 O  O   . PRO B 1 269 ? 0.067  16.840  45.168  1.00 59.69  ? 269  PRO B O   1 
ATOM   4239 C  CB  . PRO B 1 269 ? 1.154  14.290  47.152  1.00 58.01  ? 269  PRO B CB  1 
ATOM   4240 C  CG  . PRO B 1 269 ? 2.393  13.539  47.553  1.00 57.03  ? 269  PRO B CG  1 
ATOM   4241 C  CD  . PRO B 1 269 ? 3.508  14.456  47.246  1.00 58.90  ? 269  PRO B CD  1 
ATOM   4242 N  N   . GLU B 1 270 ? 1.375  17.315  46.938  1.00 56.04  ? 270  GLU B N   1 
ATOM   4243 C  CA  . GLU B 1 270 ? 0.866  18.679  47.026  1.00 58.76  ? 270  GLU B CA  1 
ATOM   4244 C  C   . GLU B 1 270 ? 0.995  19.443  45.689  1.00 60.62  ? 270  GLU B C   1 
ATOM   4245 O  O   . GLU B 1 270 ? 0.073  20.139  45.258  1.00 60.55  ? 270  GLU B O   1 
ATOM   4246 C  CB  . GLU B 1 270 ? 1.536  19.424  48.184  1.00 56.49  ? 270  GLU B CB  1 
ATOM   4247 C  CG  . GLU B 1 270 ? 1.210  18.815  49.516  1.00 57.34  ? 270  GLU B CG  1 
ATOM   4248 C  CD  . GLU B 1 270 ? 2.082  19.315  50.645  1.00 63.39  ? 270  GLU B CD  1 
ATOM   4249 O  OE1 . GLU B 1 270 ? 2.726  20.362  50.508  1.00 62.05  ? 270  GLU B OE1 1 
ATOM   4250 O  OE2 . GLU B 1 270 ? 2.117  18.647  51.691  1.00 69.41  ? 270  GLU B OE2 1 
ATOM   4251 N  N   . ILE B 1 271 ? 2.149  19.289  45.046  1.00 59.22  ? 271  ILE B N   1 
ATOM   4252 C  CA  . ILE B 1 271 ? 2.411  19.842  43.723  1.00 58.83  ? 271  ILE B CA  1 
ATOM   4253 C  C   . ILE B 1 271 ? 1.482  19.227  42.668  1.00 59.85  ? 271  ILE B C   1 
ATOM   4254 O  O   . ILE B 1 271 ? 0.947  19.920  41.799  1.00 59.00  ? 271  ILE B O   1 
ATOM   4255 C  CB  . ILE B 1 271 ? 3.894  19.572  43.328  1.00 58.95  ? 271  ILE B CB  1 
ATOM   4256 C  CG1 . ILE B 1 271 ? 4.837  20.220  44.352  1.00 58.21  ? 271  ILE B CG1 1 
ATOM   4257 C  CG2 . ILE B 1 271 ? 4.205  20.023  41.882  1.00 50.05  ? 271  ILE B CG2 1 
ATOM   4258 C  CD1 . ILE B 1 271 ? 6.287  19.791  44.239  1.00 52.22  ? 271  ILE B CD1 1 
ATOM   4259 N  N   . ARG B 1 272 ? 1.316  17.915  42.738  1.00 58.84  ? 272  ARG B N   1 
ATOM   4260 C  CA  . ARG B 1 272 ? 0.404  17.214  41.852  1.00 61.45  ? 272  ARG B CA  1 
ATOM   4261 C  C   . ARG B 1 272 ? -1.009 17.804  41.918  1.00 64.69  ? 272  ARG B C   1 
ATOM   4262 O  O   . ARG B 1 272 ? -1.771 17.729  40.949  1.00 65.42  ? 272  ARG B O   1 
ATOM   4263 C  CB  . ARG B 1 272 ? 0.398  15.719  42.167  1.00 61.01  ? 272  ARG B CB  1 
ATOM   4264 C  CG  . ARG B 1 272 ? 1.439  14.953  41.402  1.00 63.87  ? 272  ARG B CG  1 
ATOM   4265 C  CD  . ARG B 1 272 ? 1.577  13.519  41.890  1.00 73.49  ? 272  ARG B CD  1 
ATOM   4266 N  NE  . ARG B 1 272 ? 0.544  12.630  41.356  1.00 84.72  ? 272  ARG B NE  1 
ATOM   4267 C  CZ  . ARG B 1 272 ? 0.617  11.993  40.186  1.00 92.70  ? 272  ARG B CZ  1 
ATOM   4268 N  NH1 . ARG B 1 272 ? 1.677  12.149  39.401  1.00 87.03  ? 272  ARG B NH1 1 
ATOM   4269 N  NH2 . ARG B 1 272 ? -0.374 11.201  39.791  1.00 96.61  ? 272  ARG B NH2 1 
ATOM   4270 N  N   . ASN B 1 273 ? -1.357 18.409  43.049  1.00 63.31  ? 273  ASN B N   1 
ATOM   4271 C  CA  . ASN B 1 273 ? -2.663 19.056  43.145  1.00 64.97  ? 273  ASN B CA  1 
ATOM   4272 C  C   . ASN B 1 273 ? -2.649 20.572  43.055  1.00 64.48  ? 273  ASN B C   1 
ATOM   4273 O  O   . ASN B 1 273 ? -3.678 21.206  43.275  1.00 64.87  ? 273  ASN B O   1 
ATOM   4274 C  CB  . ASN B 1 273 ? -3.386 18.614  44.410  1.00 65.48  ? 273  ASN B CB  1 
ATOM   4275 C  CG  . ASN B 1 273 ? -3.656 17.121  44.418  1.00 73.34  ? 273  ASN B CG  1 
ATOM   4276 O  OD1 . ASN B 1 273 ? -4.150 16.557  43.431  1.00 72.77  ? 273  ASN B OD1 1 
ATOM   4277 N  ND2 . ASN B 1 273 ? -3.314 16.466  45.521  1.00 69.13  ? 273  ASN B ND2 1 
ATOM   4278 N  N   . HIS B 1 274 ? -1.500 21.152  42.726  1.00 62.02  ? 274  HIS B N   1 
ATOM   4279 C  CA  . HIS B 1 274 ? -1.392 22.606  42.654  1.00 61.44  ? 274  HIS B CA  1 
ATOM   4280 C  C   . HIS B 1 274 ? -1.976 23.118  41.332  1.00 64.19  ? 274  HIS B C   1 
ATOM   4281 O  O   . HIS B 1 274 ? -1.872 22.454  40.300  1.00 62.47  ? 274  HIS B O   1 
ATOM   4282 C  CB  . HIS B 1 274 ? 0.057  23.035  42.849  1.00 58.76  ? 274  HIS B CB  1 
ATOM   4283 C  CG  . HIS B 1 274 ? 0.252  24.517  42.961  1.00 55.86  ? 274  HIS B CG  1 
ATOM   4284 N  ND1 . HIS B 1 274 ? 0.031  25.372  41.901  1.00 57.87  ? 274  HIS B ND1 1 
ATOM   4285 C  CD2 . HIS B 1 274 ? 0.685  25.276  43.979  1.00 53.32  ? 274  HIS B CD2 1 
ATOM   4286 C  CE1 . HIS B 1 274 ? 0.314  26.604  42.274  1.00 59.49  ? 274  HIS B CE1 1 
ATOM   4287 N  NE2 . HIS B 1 274 ? 0.710  26.581  43.538  1.00 57.11  ? 274  HIS B NE2 1 
ATOM   4288 N  N   . GLU B 1 275 ? -2.610 24.288  41.382  1.00 64.73  ? 275  GLU B N   1 
ATOM   4289 C  CA  . GLU B 1 275 ? -3.395 24.788  40.255  1.00 68.13  ? 275  GLU B CA  1 
ATOM   4290 C  C   . GLU B 1 275 ? -2.550 24.985  38.998  1.00 66.68  ? 275  GLU B C   1 
ATOM   4291 O  O   . GLU B 1 275 ? -2.978 24.642  37.893  1.00 64.60  ? 275  GLU B O   1 
ATOM   4292 C  CB  . GLU B 1 275 ? -4.137 26.081  40.638  1.00 69.51  ? 275  GLU B CB  1 
ATOM   4293 C  CG  . GLU B 1 275 ? -3.209 27.261  40.984  1.00 73.49  ? 275  GLU B CG  1 
ATOM   4294 C  CD  . GLU B 1 275 ? -3.894 28.357  41.808  1.00 82.87  ? 275  GLU B CD  1 
ATOM   4295 O  OE1 . GLU B 1 275 ? -4.905 28.927  41.322  1.00 84.30  ? 275  GLU B OE1 1 
ATOM   4296 O  OE2 . GLU B 1 275 ? -3.400 28.653  42.931  1.00 77.56  ? 275  GLU B OE2 1 
ATOM   4297 N  N   . TRP B 1 276 ? -1.349 25.532  39.176  1.00 66.11  ? 276  TRP B N   1 
ATOM   4298 C  CA  . TRP B 1 276 ? -0.407 25.727  38.068  1.00 63.83  ? 276  TRP B CA  1 
ATOM   4299 C  C   . TRP B 1 276 ? -0.037 24.401  37.430  1.00 63.80  ? 276  TRP B C   1 
ATOM   4300 O  O   . TRP B 1 276 ? 0.092  24.298  36.209  1.00 63.23  ? 276  TRP B O   1 
ATOM   4301 C  CB  . TRP B 1 276 ? 0.861  26.416  38.549  1.00 59.34  ? 276  TRP B CB  1 
ATOM   4302 C  CG  . TRP B 1 276 ? 1.689  26.945  37.433  1.00 61.83  ? 276  TRP B CG  1 
ATOM   4303 C  CD1 . TRP B 1 276 ? 1.540  28.148  36.811  1.00 63.48  ? 276  TRP B CD1 1 
ATOM   4304 C  CD2 . TRP B 1 276 ? 2.809  26.299  36.799  1.00 61.83  ? 276  TRP B CD2 1 
ATOM   4305 N  NE1 . TRP B 1 276 ? 2.497  28.297  35.833  1.00 61.47  ? 276  TRP B NE1 1 
ATOM   4306 C  CE2 . TRP B 1 276 ? 3.281  27.177  35.802  1.00 62.37  ? 276  TRP B CE2 1 
ATOM   4307 C  CE3 . TRP B 1 276 ? 3.458  25.073  36.984  1.00 59.16  ? 276  TRP B CE3 1 
ATOM   4308 C  CZ2 . TRP B 1 276 ? 4.381  26.852  34.984  1.00 58.56  ? 276  TRP B CZ2 1 
ATOM   4309 C  CZ3 . TRP B 1 276 ? 4.547  24.759  36.167  1.00 55.76  ? 276  TRP B CZ3 1 
ATOM   4310 C  CH2 . TRP B 1 276 ? 4.996  25.646  35.187  1.00 55.01  ? 276  TRP B CH2 1 
ATOM   4311 N  N   . PHE B 1 277 ? 0.131  23.384  38.269  1.00 62.30  ? 277  PHE B N   1 
ATOM   4312 C  CA  . PHE B 1 277 ? 0.530  22.078  37.793  1.00 62.29  ? 277  PHE B CA  1 
ATOM   4313 C  C   . PHE B 1 277 ? -0.575 21.440  36.964  1.00 63.84  ? 277  PHE B C   1 
ATOM   4314 O  O   . PHE B 1 277 ? -0.315 20.738  35.981  1.00 62.21  ? 277  PHE B O   1 
ATOM   4315 C  CB  . PHE B 1 277 ? 0.896  21.157  38.964  1.00 60.43  ? 277  PHE B CB  1 
ATOM   4316 C  CG  . PHE B 1 277 ? 1.308  19.785  38.524  1.00 60.53  ? 277  PHE B CG  1 
ATOM   4317 C  CD1 . PHE B 1 277 ? 2.615  19.545  38.102  1.00 56.78  ? 277  PHE B CD1 1 
ATOM   4318 C  CD2 . PHE B 1 277 ? 0.379  18.746  38.462  1.00 62.13  ? 277  PHE B CD2 1 
ATOM   4319 C  CE1 . PHE B 1 277 ? 2.993  18.285  37.652  1.00 58.55  ? 277  PHE B CE1 1 
ATOM   4320 C  CE2 . PHE B 1 277 ? 0.745  17.472  38.015  1.00 62.24  ? 277  PHE B CE2 1 
ATOM   4321 C  CZ  . PHE B 1 277 ? 2.051  17.239  37.611  1.00 62.57  ? 277  PHE B CZ  1 
ATOM   4322 N  N   . LEU B 1 278 ? -1.815 21.680  37.371  1.00 66.29  ? 278  LEU B N   1 
ATOM   4323 C  CA  . LEU B 1 278 ? -2.934 20.957  36.793  1.00 66.76  ? 278  LEU B CA  1 
ATOM   4324 C  C   . LEU B 1 278 ? -3.338 21.510  35.435  1.00 63.62  ? 278  LEU B C   1 
ATOM   4325 O  O   . LEU B 1 278 ? -3.877 20.778  34.617  1.00 63.58  ? 278  LEU B O   1 
ATOM   4326 C  CB  . LEU B 1 278 ? -4.108 20.952  37.767  1.00 68.65  ? 278  LEU B CB  1 
ATOM   4327 C  CG  . LEU B 1 278 ? -3.866 20.084  39.003  1.00 68.93  ? 278  LEU B CG  1 
ATOM   4328 C  CD1 . LEU B 1 278 ? -4.696 20.595  40.171  1.00 66.74  ? 278  LEU B CD1 1 
ATOM   4329 C  CD2 . LEU B 1 278 ? -4.170 18.621  38.692  1.00 62.46  ? 278  LEU B CD2 1 
ATOM   4330 N  N   . LYS B 1 279 ? -3.046 22.789  35.196  1.00 60.57  ? 279  LYS B N   1 
ATOM   4331 C  CA  . LYS B 1 279 ? -3.415 23.434  33.946  1.00 64.24  ? 279  LYS B CA  1 
ATOM   4332 C  C   . LYS B 1 279 ? -2.892 22.699  32.703  1.00 66.67  ? 279  LYS B C   1 
ATOM   4333 O  O   . LYS B 1 279 ? -1.694 22.426  32.586  1.00 66.92  ? 279  LYS B O   1 
ATOM   4334 C  CB  . LYS B 1 279 ? -2.979 24.897  33.939  1.00 65.73  ? 279  LYS B CB  1 
ATOM   4335 C  CG  . LYS B 1 279 ? -3.555 25.657  32.758  1.00 68.83  ? 279  LYS B CG  1 
ATOM   4336 C  CD  . LYS B 1 279 ? -3.445 27.157  32.916  1.00 74.70  ? 279  LYS B CD  1 
ATOM   4337 C  CE  . LYS B 1 279 ? -3.949 27.853  31.653  1.00 79.87  ? 279  LYS B CE  1 
ATOM   4338 N  NZ  . LYS B 1 279 ? -3.457 29.254  31.513  1.00 80.69  ? 279  LYS B NZ  1 
ATOM   4339 N  N   . ASN B 1 280 ? -3.798 22.390  31.777  1.00 65.55  ? 280  ASN B N   1 
ATOM   4340 C  CA  . ASN B 1 280 ? -3.458 21.683  30.541  1.00 65.25  ? 280  ASN B CA  1 
ATOM   4341 C  C   . ASN B 1 280 ? -2.745 20.352  30.787  1.00 67.41  ? 280  ASN B C   1 
ATOM   4342 O  O   . ASN B 1 280 ? -2.109 19.810  29.884  1.00 69.86  ? 280  ASN B O   1 
ATOM   4343 C  CB  . ASN B 1 280 ? -2.600 22.556  29.616  1.00 65.72  ? 280  ASN B CB  1 
ATOM   4344 C  CG  . ASN B 1 280 ? -3.263 23.882  29.278  1.00 70.29  ? 280  ASN B CG  1 
ATOM   4345 O  OD1 . ASN B 1 280 ? -4.486 23.959  29.171  1.00 70.19  ? 280  ASN B OD1 1 
ATOM   4346 N  ND2 . ASN B 1 280 ? -2.452 24.941  29.113  1.00 69.45  ? 280  ASN B ND2 1 
ATOM   4347 N  N   . LEU B 1 281 ? -2.842 19.831  32.006  1.00 65.67  ? 281  LEU B N   1 
ATOM   4348 C  CA  . LEU B 1 281 ? -2.245 18.535  32.317  1.00 67.89  ? 281  LEU B CA  1 
ATOM   4349 C  C   . LEU B 1 281 ? -2.870 17.407  31.507  1.00 73.15  ? 281  LEU B C   1 
ATOM   4350 O  O   . LEU B 1 281 ? -4.059 17.129  31.633  1.00 75.40  ? 281  LEU B O   1 
ATOM   4351 C  CB  . LEU B 1 281 ? -2.373 18.212  33.807  1.00 69.78  ? 281  LEU B CB  1 
ATOM   4352 C  CG  . LEU B 1 281 ? -1.816 16.859  34.284  1.00 70.50  ? 281  LEU B CG  1 
ATOM   4353 C  CD1 . LEU B 1 281 ? -0.302 16.815  34.224  1.00 66.20  ? 281  LEU B CD1 1 
ATOM   4354 C  CD2 . LEU B 1 281 ? -2.258 16.562  35.704  1.00 67.70  ? 281  LEU B CD2 1 
ATOM   4355 N  N   . PRO B 1 282 ? -2.065 16.757  30.660  1.00 76.22  ? 282  PRO B N   1 
ATOM   4356 C  CA  . PRO B 1 282 ? -2.476 15.525  29.983  1.00 81.71  ? 282  PRO B CA  1 
ATOM   4357 C  C   . PRO B 1 282 ? -2.828 14.454  31.016  1.00 89.64  ? 282  PRO B C   1 
ATOM   4358 O  O   . PRO B 1 282 ? -2.123 14.336  32.026  1.00 86.73  ? 282  PRO B O   1 
ATOM   4359 C  CB  . PRO B 1 282 ? -1.219 15.120  29.217  1.00 80.86  ? 282  PRO B CB  1 
ATOM   4360 C  CG  . PRO B 1 282 ? -0.494 16.389  29.001  1.00 76.98  ? 282  PRO B CG  1 
ATOM   4361 C  CD  . PRO B 1 282 ? -0.741 17.216  30.217  1.00 74.31  ? 282  PRO B CD  1 
ATOM   4362 N  N   . ALA B 1 283 ? -3.894 13.690  30.776  1.00 92.17  ? 283  ALA B N   1 
ATOM   4363 C  CA  . ALA B 1 283 ? -4.378 12.732  31.772  1.00 94.44  ? 283  ALA B CA  1 
ATOM   4364 C  C   . ALA B 1 283 ? -3.529 11.458  31.874  1.00 98.29  ? 283  ALA B C   1 
ATOM   4365 O  O   . ALA B 1 283 ? -3.508 10.804  32.919  1.00 97.62  ? 283  ALA B O   1 
ATOM   4366 C  CB  . ALA B 1 283 ? -5.843 12.388  31.535  1.00 90.12  ? 283  ALA B CB  1 
ATOM   4367 N  N   . ASP B 1 284 ? -2.836 11.110  30.793  1.00 95.23  ? 284  ASP B N   1 
ATOM   4368 C  CA  . ASP B 1 284 ? -1.924 9.974   30.805  1.00 99.83  ? 284  ASP B CA  1 
ATOM   4369 C  C   . ASP B 1 284 ? -0.937 10.062  31.971  1.00 100.81 ? 284  ASP B C   1 
ATOM   4370 O  O   . ASP B 1 284 ? -0.340 9.063   32.366  1.00 104.62 ? 284  ASP B O   1 
ATOM   4371 C  CB  . ASP B 1 284 ? -1.170 9.892   29.477  1.00 102.95 ? 284  ASP B CB  1 
ATOM   4372 C  CG  . ASP B 1 284 ? -1.193 11.205  28.715  1.00 103.21 ? 284  ASP B CG  1 
ATOM   4373 O  OD1 . ASP B 1 284 ? -2.301 11.739  28.479  1.00 98.67  ? 284  ASP B OD1 1 
ATOM   4374 O  OD2 . ASP B 1 284 ? -0.104 11.704  28.356  1.00 104.50 ? 284  ASP B OD2 1 
ATOM   4375 N  N   . LEU B 1 285 ? -0.776 11.264  32.518  1.00 98.56  ? 285  LEU B N   1 
ATOM   4376 C  CA  . LEU B 1 285 ? 0.132  11.496  33.639  1.00 98.56  ? 285  LEU B CA  1 
ATOM   4377 C  C   . LEU B 1 285 ? -0.636 11.538  34.965  1.00 97.29  ? 285  LEU B C   1 
ATOM   4378 O  O   . LEU B 1 285 ? -0.285 10.863  35.936  1.00 95.87  ? 285  LEU B O   1 
ATOM   4379 C  CB  . LEU B 1 285 ? 0.910  12.808  33.442  1.00 93.09  ? 285  LEU B CB  1 
ATOM   4380 C  CG  . LEU B 1 285 ? 1.753  13.038  32.178  1.00 88.93  ? 285  LEU B CG  1 
ATOM   4381 C  CD1 . LEU B 1 285 ? 2.461  14.378  32.267  1.00 69.70  ? 285  LEU B CD1 1 
ATOM   4382 C  CD2 . LEU B 1 285 ? 2.760  11.915  31.955  1.00 87.96  ? 285  LEU B CD2 1 
ATOM   4383 N  N   . PRO B 1 301 ? 7.969  -7.107  27.104  1.00 135.59 ? 301  PRO B N   1 
ATOM   4384 C  CA  . PRO B 1 301 ? 8.358  -8.443  26.641  1.00 134.17 ? 301  PRO B CA  1 
ATOM   4385 C  C   . PRO B 1 301 ? 9.874  -8.588  26.598  1.00 132.42 ? 301  PRO B C   1 
ATOM   4386 O  O   . PRO B 1 301 ? 10.413 -9.124  25.630  1.00 131.08 ? 301  PRO B O   1 
ATOM   4387 C  CB  . PRO B 1 301 ? 7.792  -8.489  25.221  1.00 133.49 ? 301  PRO B CB  1 
ATOM   4388 C  CG  . PRO B 1 301 ? 7.814  -7.070  24.773  1.00 133.06 ? 301  PRO B CG  1 
ATOM   4389 C  CD  . PRO B 1 301 ? 7.494  -6.257  25.998  1.00 134.23 ? 301  PRO B CD  1 
ATOM   4390 N  N   . GLY B 1 302 ? 10.549 -8.117  27.642  1.00 130.03 ? 302  GLY B N   1 
ATOM   4391 C  CA  . GLY B 1 302 ? 11.998 -8.043  27.641  1.00 124.98 ? 302  GLY B CA  1 
ATOM   4392 C  C   . GLY B 1 302 ? 12.688 -9.342  27.993  1.00 123.07 ? 302  GLY B C   1 
ATOM   4393 O  O   . GLY B 1 302 ? 12.720 -10.280 27.201  1.00 121.38 ? 302  GLY B O   1 
ATOM   4394 N  N   . GLN B 1 303 ? 13.262 -9.386  29.188  1.00 119.57 ? 303  GLN B N   1 
ATOM   4395 C  CA  . GLN B 1 303 ? 13.931 -10.587 29.664  1.00 116.52 ? 303  GLN B CA  1 
ATOM   4396 C  C   . GLN B 1 303 ? 13.297 -11.106 30.948  1.00 118.61 ? 303  GLN B C   1 
ATOM   4397 O  O   . GLN B 1 303 ? 12.791 -10.332 31.764  1.00 117.78 ? 303  GLN B O   1 
ATOM   4398 C  CB  . GLN B 1 303 ? 15.411 -10.310 29.932  1.00 113.32 ? 303  GLN B CB  1 
ATOM   4399 C  CG  . GLN B 1 303 ? 16.305 -10.204 28.708  1.00 109.45 ? 303  GLN B CG  1 
ATOM   4400 C  CD  . GLN B 1 303 ? 17.611 -9.520  29.048  1.00 98.24  ? 303  GLN B CD  1 
ATOM   4401 O  OE1 . GLN B 1 303 ? 17.612 -8.388  29.518  1.00 90.76  ? 303  GLN B OE1 1 
ATOM   4402 N  NE2 . GLN B 1 303 ? 18.725 -10.211 28.842  1.00 93.97  ? 303  GLN B NE2 1 
ATOM   4403 N  N   . SER B 1 304 ? 13.328 -12.423 31.118  1.00 119.24 ? 304  SER B N   1 
ATOM   4404 C  CA  . SER B 1 304 ? 13.021 -13.027 32.400  1.00 115.99 ? 304  SER B CA  1 
ATOM   4405 C  C   . SER B 1 304 ? 14.123 -12.591 33.353  1.00 113.86 ? 304  SER B C   1 
ATOM   4406 O  O   . SER B 1 304 ? 15.303 -12.636 33.005  1.00 112.96 ? 304  SER B O   1 
ATOM   4407 C  CB  . SER B 1 304 ? 12.991 -14.550 32.273  1.00 116.30 ? 304  SER B CB  1 
ATOM   4408 O  OG  . SER B 1 304 ? 14.213 -15.057 31.760  1.00 113.78 ? 304  SER B OG  1 
ATOM   4409 N  N   . ILE B 1 305 ? 13.747 -12.144 34.545  1.00 111.84 ? 305  ILE B N   1 
ATOM   4410 C  CA  . ILE B 1 305 ? 14.743 -11.776 35.544  1.00 111.93 ? 305  ILE B CA  1 
ATOM   4411 C  C   . ILE B 1 305 ? 15.651 -12.979 35.800  1.00 115.47 ? 305  ILE B C   1 
ATOM   4412 O  O   . ILE B 1 305 ? 16.819 -12.847 36.181  1.00 113.35 ? 305  ILE B O   1 
ATOM   4413 C  CB  . ILE B 1 305 ? 14.074 -11.308 36.847  1.00 111.34 ? 305  ILE B CB  1 
ATOM   4414 C  CG1 . ILE B 1 305 ? 15.095 -10.650 37.779  1.00 110.15 ? 305  ILE B CG1 1 
ATOM   4415 C  CG2 . ILE B 1 305 ? 13.345 -12.462 37.519  1.00 114.21 ? 305  ILE B CG2 1 
ATOM   4416 C  CD1 . ILE B 1 305 ? 14.464 -9.906  38.947  1.00 105.97 ? 305  ILE B CD1 1 
ATOM   4417 N  N   . GLU B 1 306 ? 15.096 -14.158 35.549  1.00 117.08 ? 306  GLU B N   1 
ATOM   4418 C  CA  . GLU B 1 306 ? 15.814 -15.417 35.688  1.00 117.38 ? 306  GLU B CA  1 
ATOM   4419 C  C   . GLU B 1 306 ? 17.039 -15.489 34.755  1.00 115.20 ? 306  GLU B C   1 
ATOM   4420 O  O   . GLU B 1 306 ? 18.174 -15.698 35.205  1.00 112.40 ? 306  GLU B O   1 
ATOM   4421 C  CB  . GLU B 1 306 ? 14.847 -16.585 35.422  1.00 119.20 ? 306  GLU B CB  1 
ATOM   4422 C  CG  . GLU B 1 306 ? 13.450 -16.386 36.036  1.00 120.75 ? 306  GLU B CG  1 
ATOM   4423 C  CD  . GLU B 1 306 ? 12.330 -16.313 34.994  1.00 121.28 ? 306  GLU B CD  1 
ATOM   4424 O  OE1 . GLU B 1 306 ? 12.541 -16.793 33.860  1.00 119.23 ? 306  GLU B OE1 1 
ATOM   4425 O  OE2 . GLU B 1 306 ? 11.238 -15.782 35.311  1.00 121.30 ? 306  GLU B OE2 1 
ATOM   4426 N  N   . GLU B 1 307 ? 16.795 -15.305 33.458  1.00 116.51 ? 307  GLU B N   1 
ATOM   4427 C  CA  . GLU B 1 307 ? 17.854 -15.374 32.447  1.00 117.38 ? 307  GLU B CA  1 
ATOM   4428 C  C   . GLU B 1 307 ? 18.817 -14.194 32.573  1.00 113.30 ? 307  GLU B C   1 
ATOM   4429 O  O   . GLU B 1 307 ? 20.007 -14.316 32.285  1.00 110.77 ? 307  GLU B O   1 
ATOM   4430 C  CB  . GLU B 1 307 ? 17.263 -15.455 31.032  1.00 116.11 ? 307  GLU B CB  1 
ATOM   4431 C  CG  . GLU B 1 307 ? 17.356 -14.175 30.227  1.00 115.10 ? 307  GLU B CG  1 
ATOM   4432 C  CD  . GLU B 1 307 ? 16.257 -14.060 29.176  1.00 120.65 ? 307  GLU B CD  1 
ATOM   4433 O  OE1 . GLU B 1 307 ? 15.173 -14.669 29.359  1.00 117.08 ? 307  GLU B OE1 1 
ATOM   4434 O  OE2 . GLU B 1 307 ? 16.476 -13.345 28.169  1.00 123.11 ? 307  GLU B OE2 1 
ATOM   4435 N  N   . ILE B 1 308 ? 18.289 -13.058 33.016  1.00 109.68 ? 308  ILE B N   1 
ATOM   4436 C  CA  . ILE B 1 308 ? 19.122 -11.921 33.375  1.00 110.48 ? 308  ILE B CA  1 
ATOM   4437 C  C   . ILE B 1 308 ? 20.160 -12.349 34.405  1.00 107.73 ? 308  ILE B C   1 
ATOM   4438 O  O   . ILE B 1 308 ? 21.368 -12.175 34.203  1.00 104.43 ? 308  ILE B O   1 
ATOM   4439 C  CB  . ILE B 1 308 ? 18.262 -10.735 33.886  1.00 112.02 ? 308  ILE B CB  1 
ATOM   4440 C  CG1 . ILE B 1 308 ? 17.668 -9.973  32.686  1.00 109.21 ? 308  ILE B CG1 1 
ATOM   4441 C  CG2 . ILE B 1 308 ? 19.080 -9.822  34.794  1.00 109.99 ? 308  ILE B CG2 1 
ATOM   4442 C  CD1 . ILE B 1 308 ? 16.833 -8.741  33.052  1.00 107.00 ? 308  ILE B CD1 1 
ATOM   4443 N  N   . MET B 1 309 ? 19.685 -12.945 35.493  1.00 111.32 ? 309  MET B N   1 
ATOM   4444 C  CA  . MET B 1 309 ? 20.584 -13.480 36.514  1.00 110.70 ? 309  MET B CA  1 
ATOM   4445 C  C   . MET B 1 309 ? 21.532 -14.544 35.944  1.00 106.84 ? 309  MET B C   1 
ATOM   4446 O  O   . MET B 1 309 ? 22.707 -14.616 36.335  1.00 105.24 ? 309  MET B O   1 
ATOM   4447 C  CB  . MET B 1 309 ? 19.787 -14.022 37.707  1.00 111.05 ? 309  MET B CB  1 
ATOM   4448 C  CG  . MET B 1 309 ? 18.715 -13.068 38.223  1.00 111.90 ? 309  MET B CG  1 
ATOM   4449 S  SD  . MET B 1 309 ? 19.336 -11.611 39.095  1.00 117.43 ? 309  MET B SD  1 
ATOM   4450 C  CE  . MET B 1 309 ? 19.020 -12.064 40.796  1.00 108.63 ? 309  MET B CE  1 
ATOM   4451 N  N   . GLN B 1 310 ? 21.039 -15.354 35.009  1.00 104.52 ? 310  GLN B N   1 
ATOM   4452 C  CA  . GLN B 1 310 ? 21.899 -16.338 34.341  1.00 109.38 ? 310  GLN B CA  1 
ATOM   4453 C  C   . GLN B 1 310 ? 23.084 -15.700 33.628  1.00 110.56 ? 310  GLN B C   1 
ATOM   4454 O  O   . GLN B 1 310 ? 24.217 -16.186 33.729  1.00 107.64 ? 310  GLN B O   1 
ATOM   4455 C  CB  . GLN B 1 310 ? 21.129 -17.233 33.356  1.00 113.25 ? 310  GLN B CB  1 
ATOM   4456 C  CG  . GLN B 1 310 ? 22.033 -18.265 32.676  1.00 112.07 ? 310  GLN B CG  1 
ATOM   4457 C  CD  . GLN B 1 310 ? 22.813 -19.098 33.685  1.00 115.15 ? 310  GLN B CD  1 
ATOM   4458 O  OE1 . GLN B 1 310 ? 22.392 -19.253 34.835  1.00 113.04 ? 310  GLN B OE1 1 
ATOM   4459 N  NE2 . GLN B 1 310 ? 23.958 -19.631 33.261  1.00 112.89 ? 310  GLN B NE2 1 
ATOM   4460 N  N   . ILE B 1 311 ? 22.823 -14.610 32.910  1.00 111.84 ? 311  ILE B N   1 
ATOM   4461 C  CA  . ILE B 1 311 ? 23.881 -13.915 32.180  1.00 107.87 ? 311  ILE B CA  1 
ATOM   4462 C  C   . ILE B 1 311 ? 24.824 -13.146 33.093  1.00 104.85 ? 311  ILE B C   1 
ATOM   4463 O  O   . ILE B 1 311 ? 26.027 -13.094 32.844  1.00 103.49 ? 311  ILE B O   1 
ATOM   4464 C  CB  . ILE B 1 311 ? 23.339 -12.964 31.118  1.00 105.04 ? 311  ILE B CB  1 
ATOM   4465 C  CG1 . ILE B 1 311 ? 21.819 -13.064 31.032  1.00 103.93 ? 311  ILE B CG1 1 
ATOM   4466 C  CG2 . ILE B 1 311 ? 23.974 -13.275 29.776  1.00 102.02 ? 311  ILE B CG2 1 
ATOM   4467 C  CD1 . ILE B 1 311 ? 21.213 -12.098 30.055  1.00 101.77 ? 311  ILE B CD1 1 
ATOM   4468 N  N   . ILE B 1 312 ? 24.288 -12.543 34.146  1.00 102.99 ? 312  ILE B N   1 
ATOM   4469 C  CA  . ILE B 1 312 ? 25.149 -11.901 35.130  1.00 106.52 ? 312  ILE B CA  1 
ATOM   4470 C  C   . ILE B 1 312 ? 26.138 -12.911 35.699  1.00 109.47 ? 312  ILE B C   1 
ATOM   4471 O  O   . ILE B 1 312 ? 27.362 -12.652 35.776  1.00 104.60 ? 312  ILE B O   1 
ATOM   4472 C  CB  . ILE B 1 312 ? 24.356 -11.299 36.293  1.00 106.64 ? 312  ILE B CB  1 
ATOM   4473 C  CG1 . ILE B 1 312 ? 23.279 -10.346 35.757  1.00 109.61 ? 312  ILE B CG1 1 
ATOM   4474 C  CG2 . ILE B 1 312 ? 25.312 -10.594 37.259  1.00 106.79 ? 312  ILE B CG2 1 
ATOM   4475 C  CD1 . ILE B 1 312 ? 22.541 -9.577  36.837  1.00 109.65 ? 312  ILE B CD1 1 
ATOM   4476 N  N   . ALA B 1 313 ? 25.595 -14.061 36.102  1.00 109.85 ? 313  ALA B N   1 
ATOM   4477 C  CA  . ALA B 1 313 ? 26.407 -15.157 36.607  1.00 106.62 ? 313  ALA B CA  1 
ATOM   4478 C  C   . ALA B 1 313 ? 27.478 -15.513 35.586  1.00 106.71 ? 313  ALA B C   1 
ATOM   4479 O  O   . ALA B 1 313 ? 28.668 -15.282 35.812  1.00 106.62 ? 313  ALA B O   1 
ATOM   4480 C  CB  . ALA B 1 313 ? 25.541 -16.357 36.888  1.00 109.26 ? 313  ALA B CB  1 
ATOM   4481 N  N   . GLU B 1 314 ? 27.038 -16.073 34.462  1.00 105.14 ? 314  GLU B N   1 
ATOM   4482 C  CA  . GLU B 1 314 ? 27.925 -16.436 33.362  1.00 109.24 ? 314  GLU B CA  1 
ATOM   4483 C  C   . GLU B 1 314 ? 29.005 -15.376 33.127  1.00 110.17 ? 314  GLU B C   1 
ATOM   4484 O  O   . GLU B 1 314 ? 30.102 -15.682 32.654  1.00 107.89 ? 314  GLU B O   1 
ATOM   4485 C  CB  . GLU B 1 314 ? 27.099 -16.598 32.092  1.00 109.45 ? 314  GLU B CB  1 
ATOM   4486 C  CG  . GLU B 1 314 ? 27.281 -17.901 31.346  1.00 109.55 ? 314  GLU B CG  1 
ATOM   4487 C  CD  . GLU B 1 314 ? 26.149 -18.148 30.356  1.00 114.60 ? 314  GLU B CD  1 
ATOM   4488 O  OE1 . GLU B 1 314 ? 25.002 -17.733 30.636  1.00 114.78 ? 314  GLU B OE1 1 
ATOM   4489 O  OE2 . GLU B 1 314 ? 26.402 -18.763 29.299  1.00 116.32 ? 314  GLU B OE2 1 
ATOM   4490 N  N   . ALA B 1 315 ? 28.679 -14.131 33.464  1.00 111.08 ? 315  ALA B N   1 
ATOM   4491 C  CA  . ALA B 1 315 ? 29.563 -12.994 33.226  1.00 108.72 ? 315  ALA B CA  1 
ATOM   4492 C  C   . ALA B 1 315 ? 30.584 -12.747 34.339  1.00 110.18 ? 315  ALA B C   1 
ATOM   4493 O  O   . ALA B 1 315 ? 31.615 -12.111 34.102  1.00 106.46 ? 315  ALA B O   1 
ATOM   4494 C  CB  . ALA B 1 315 ? 28.737 -11.741 32.990  1.00 107.04 ? 315  ALA B CB  1 
ATOM   4495 N  N   . THR B 1 316 ? 30.300 -13.222 35.551  1.00 112.10 ? 316  THR B N   1 
ATOM   4496 C  CA  . THR B 1 316 ? 31.227 -12.995 36.668  1.00 111.85 ? 316  THR B CA  1 
ATOM   4497 C  C   . THR B 1 316 ? 32.588 -13.697 36.529  1.00 112.89 ? 316  THR B C   1 
ATOM   4498 O  O   . THR B 1 316 ? 33.522 -13.408 37.287  1.00 107.93 ? 316  THR B O   1 
ATOM   4499 C  CB  . THR B 1 316 ? 30.613 -13.364 38.029  1.00 111.10 ? 316  THR B CB  1 
ATOM   4500 O  OG1 . THR B 1 316 ? 29.193 -13.162 37.998  1.00 108.43 ? 316  THR B OG1 1 
ATOM   4501 C  CG2 . THR B 1 316 ? 31.233 -12.501 39.120  1.00 110.21 ? 316  THR B CG2 1 
ATOM   4502 N  N   . VAL B 1 317 ? 32.700 -14.609 35.566  1.00 111.39 ? 317  VAL B N   1 
ATOM   4503 C  CA  . VAL B 1 317 ? 33.970 -15.286 35.304  1.00 113.31 ? 317  VAL B CA  1 
ATOM   4504 C  C   . VAL B 1 317 ? 34.574 -14.861 33.962  1.00 113.76 ? 317  VAL B C   1 
ATOM   4505 O  O   . VAL B 1 317 ? 33.887 -14.872 32.938  1.00 112.36 ? 317  VAL B O   1 
ATOM   4506 C  CB  . VAL B 1 317 ? 33.817 -16.821 35.358  1.00 113.63 ? 317  VAL B CB  1 
ATOM   4507 C  CG1 . VAL B 1 317 ? 32.882 -17.207 36.497  1.00 110.74 ? 317  VAL B CG1 1 
ATOM   4508 C  CG2 . VAL B 1 317 ? 33.324 -17.380 34.021  1.00 109.75 ? 317  VAL B CG2 1 
ATOM   4509 N  N   . PRO B 1 318 ? 35.863 -14.473 33.970  1.00 114.96 ? 318  PRO B N   1 
ATOM   4510 C  CA  . PRO B 1 318 ? 36.604 -13.978 32.798  1.00 117.20 ? 318  PRO B CA  1 
ATOM   4511 C  C   . PRO B 1 318 ? 37.520 -14.997 32.108  1.00 120.40 ? 318  PRO B C   1 
ATOM   4512 O  O   . PRO B 1 318 ? 38.515 -15.413 32.698  1.00 123.33 ? 318  PRO B O   1 
ATOM   4513 C  CB  . PRO B 1 318 ? 37.464 -12.860 33.392  1.00 115.76 ? 318  PRO B CB  1 
ATOM   4514 C  CG  . PRO B 1 318 ? 37.610 -13.207 34.875  1.00 115.90 ? 318  PRO B CG  1 
ATOM   4515 C  CD  . PRO B 1 318 ? 36.646 -14.324 35.208  1.00 114.74 ? 318  PRO B CD  1 
ATOM   4516 N  N   . PRO B 1 319 ? 37.197 -15.383 30.861  1.00 121.08 ? 319  PRO B N   1 
ATOM   4517 C  CA  . PRO B 1 319 ? 38.098 -16.228 30.067  1.00 124.55 ? 319  PRO B CA  1 
ATOM   4518 C  C   . PRO B 1 319 ? 39.500 -15.637 29.981  1.00 121.52 ? 319  PRO B C   1 
ATOM   4519 O  O   . PRO B 1 319 ? 39.619 -14.417 30.042  1.00 121.18 ? 319  PRO B O   1 
ATOM   4520 C  CB  . PRO B 1 319 ? 37.441 -16.222 28.686  1.00 124.61 ? 319  PRO B CB  1 
ATOM   4521 C  CG  . PRO B 1 319 ? 35.986 -16.099 28.983  1.00 120.26 ? 319  PRO B CG  1 
ATOM   4522 C  CD  . PRO B 1 319 ? 35.895 -15.195 30.195  1.00 119.82 ? 319  PRO B CD  1 
HETATM 4523 C  C1  . EDO C 2 .   ? 40.744 30.443  6.640   1.00 51.24  ? 1320 EDO A C1  1 
HETATM 4524 O  O1  . EDO C 2 .   ? 40.028 30.478  5.359   1.00 49.69  ? 1320 EDO A O1  1 
HETATM 4525 C  C2  . EDO C 2 .   ? 42.245 30.415  6.398   1.00 49.42  ? 1320 EDO A C2  1 
HETATM 4526 O  O2  . EDO C 2 .   ? 42.652 31.813  6.497   1.00 60.24  ? 1320 EDO A O2  1 
HETATM 4527 AU AU  . AU  D 3 .   ? 52.970 15.822  8.284   1.00 118.44 ? 1321 AU  A AU  1 
HETATM 4528 C  C1  . EDO E 2 .   ? 33.980 34.422  40.681  1.00 59.36  ? 1320 EDO B C1  1 
HETATM 4529 O  O1  . EDO E 2 .   ? 33.845 33.380  39.678  1.00 57.85  ? 1320 EDO B O1  1 
HETATM 4530 C  C2  . EDO E 2 .   ? 35.102 34.025  41.600  1.00 58.10  ? 1320 EDO B C2  1 
HETATM 4531 O  O2  . EDO E 2 .   ? 34.628 34.500  42.919  1.00 59.91  ? 1320 EDO B O2  1 
HETATM 4532 O  O   . HOH F 4 .   ? 4.585  34.719  14.163  1.00 69.61  ? 2001 HOH A O   1 
HETATM 4533 O  O   . HOH F 4 .   ? 34.030 24.554  13.276  1.00 57.05  ? 2002 HOH A O   1 
HETATM 4534 O  O   . HOH F 4 .   ? 17.685 39.840  4.958   1.00 47.53  ? 2003 HOH A O   1 
HETATM 4535 O  O   . HOH F 4 .   ? 15.592 54.441  15.409  1.00 63.93  ? 2004 HOH A O   1 
HETATM 4536 O  O   . HOH F 4 .   ? 15.728 55.184  18.272  1.00 64.81  ? 2005 HOH A O   1 
HETATM 4537 O  O   . HOH F 4 .   ? 28.864 15.095  -11.214 1.00 59.64  ? 2006 HOH A O   1 
HETATM 4538 O  O   . HOH F 4 .   ? 21.236 22.097  17.961  1.00 45.15  ? 2007 HOH A O   1 
HETATM 4539 O  O   . HOH F 4 .   ? 26.899 23.974  13.116  1.00 39.10  ? 2008 HOH A O   1 
HETATM 4540 O  O   . HOH F 4 .   ? 21.683 8.981   15.147  1.00 47.93  ? 2009 HOH A O   1 
HETATM 4541 O  O   . HOH F 4 .   ? 28.691 12.685  16.262  1.00 48.50  ? 2010 HOH A O   1 
HETATM 4542 O  O   . HOH F 4 .   ? 25.184 8.489   8.246   1.00 51.50  ? 2011 HOH A O   1 
HETATM 4543 O  O   . HOH F 4 .   ? 19.066 10.184  11.172  1.00 51.52  ? 2012 HOH A O   1 
HETATM 4544 O  O   . HOH F 4 .   ? 25.751 28.707  -8.027  1.00 53.50  ? 2013 HOH A O   1 
HETATM 4545 O  O   . HOH F 4 .   ? 31.262 36.186  -5.639  1.00 62.71  ? 2014 HOH A O   1 
HETATM 4546 O  O   . HOH F 4 .   ? 31.904 29.921  3.742   1.00 52.36  ? 2015 HOH A O   1 
HETATM 4547 O  O   . HOH F 4 .   ? 33.342 31.613  6.330   1.00 57.98  ? 2016 HOH A O   1 
HETATM 4548 O  O   . HOH F 4 .   ? 40.778 33.255  3.932   1.00 65.21  ? 2017 HOH A O   1 
HETATM 4549 O  O   . HOH F 4 .   ? 26.064 30.112  9.782   1.00 43.08  ? 2018 HOH A O   1 
HETATM 4550 O  O   . HOH F 4 .   ? 29.563 24.002  5.264   1.00 45.73  ? 2019 HOH A O   1 
HETATM 4551 O  O   . HOH F 4 .   ? 27.928 24.059  9.597   1.00 42.64  ? 2020 HOH A O   1 
HETATM 4552 O  O   . HOH F 4 .   ? 35.959 25.506  12.213  1.00 57.82  ? 2021 HOH A O   1 
HETATM 4553 O  O   . HOH F 4 .   ? 36.924 26.729  2.177   1.00 46.50  ? 2022 HOH A O   1 
HETATM 4554 O  O   . HOH F 4 .   ? 28.188 21.498  11.138  1.00 50.24  ? 2023 HOH A O   1 
HETATM 4555 O  O   . HOH F 4 .   ? 38.588 28.036  -4.947  1.00 50.13  ? 2024 HOH A O   1 
HETATM 4556 O  O   . HOH F 4 .   ? 42.509 19.621  13.597  1.00 59.24  ? 2025 HOH A O   1 
HETATM 4557 O  O   . HOH F 4 .   ? 33.896 9.520   -1.345  1.00 46.13  ? 2026 HOH A O   1 
HETATM 4558 O  O   . HOH F 4 .   ? 32.482 6.039   16.663  1.00 56.44  ? 2027 HOH A O   1 
HETATM 4559 O  O   . HOH F 4 .   ? 30.830 16.700  -11.854 1.00 56.81  ? 2028 HOH A O   1 
HETATM 4560 O  O   . HOH F 4 .   ? 42.387 15.807  -5.346  1.00 52.63  ? 2029 HOH A O   1 
HETATM 4561 O  O   . HOH F 4 .   ? 35.547 24.216  -9.569  1.00 54.02  ? 2030 HOH A O   1 
HETATM 4562 O  O   . HOH F 4 .   ? 37.948 29.110  4.294   1.00 49.15  ? 2031 HOH A O   1 
HETATM 4563 O  O   . HOH G 4 .   ? 14.390 0.626   33.764  1.00 76.63  ? 2001 HOH B O   1 
HETATM 4564 O  O   . HOH G 4 .   ? 18.769 19.995  24.152  1.00 40.36  ? 2002 HOH B O   1 
HETATM 4565 O  O   . HOH G 4 .   ? 19.678 19.220  31.214  1.00 45.34  ? 2003 HOH B O   1 
HETATM 4566 O  O   . HOH G 4 .   ? 21.570 22.458  20.430  1.00 51.19  ? 2004 HOH B O   1 
HETATM 4567 O  O   . HOH G 4 .   ? 19.385 31.197  28.905  1.00 53.35  ? 2005 HOH B O   1 
HETATM 4568 O  O   . HOH G 4 .   ? 9.997  32.732  31.018  1.00 52.47  ? 2006 HOH B O   1 
HETATM 4569 O  O   . HOH G 4 .   ? 9.066  28.935  25.519  1.00 49.24  ? 2007 HOH B O   1 
HETATM 4570 O  O   . HOH G 4 .   ? 26.745 14.409  45.566  1.00 62.39  ? 2008 HOH B O   1 
HETATM 4571 O  O   . HOH G 4 .   ? 18.621 12.840  34.236  1.00 49.59  ? 2009 HOH B O   1 
HETATM 4572 O  O   . HOH G 4 .   ? 14.977 16.751  52.533  1.00 53.34  ? 2010 HOH B O   1 
HETATM 4573 O  O   . HOH G 4 .   ? 27.283 19.069  56.100  1.00 57.55  ? 2011 HOH B O   1 
HETATM 4574 O  O   . HOH G 4 .   ? 14.776 15.929  54.981  1.00 60.08  ? 2012 HOH B O   1 
HETATM 4575 O  O   . HOH G 4 .   ? 17.784 35.471  41.616  1.00 58.06  ? 2013 HOH B O   1 
HETATM 4576 O  O   . HOH G 4 .   ? 28.067 28.496  41.954  1.00 58.19  ? 2014 HOH B O   1 
HETATM 4577 O  O   . HOH G 4 .   ? 8.328  33.117  44.005  1.00 56.46  ? 2015 HOH B O   1 
HETATM 4578 O  O   . HOH G 4 .   ? 16.133 38.819  39.024  1.00 64.73  ? 2016 HOH B O   1 
HETATM 4579 O  O   . HOH G 4 .   ? 3.315  35.871  39.620  1.00 61.51  ? 2017 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   PRO 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   VAL 6   6   ?   ?   ?   A . n 
A 1 7   SER 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   PRO 9   9   ?   ?   ?   A . n 
A 1 10  MET 10  10  10  MET MET A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  HIS 16  16  16  HIS HIS A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  TYR 51  51  51  TYR TYR A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 CYS 131 131 131 CYS CYS A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 MET 134 134 134 MET MET A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 CYS 137 137 137 CYS CYS A . n 
A 1 138 HIS 138 138 138 HIS HIS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 ASP 140 140 140 ASP ASP A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 SER 164 164 ?   ?   ?   A . n 
A 1 165 LYS 165 165 ?   ?   ?   A . n 
A 1 166 SER 166 166 ?   ?   ?   A . n 
A 1 167 SER 167 167 ?   ?   ?   A . n 
A 1 168 VAL 168 168 ?   ?   ?   A . n 
A 1 169 LEU 169 169 ?   ?   ?   A . n 
A 1 170 HIS 170 170 ?   ?   ?   A . n 
A 1 171 SER 171 171 ?   ?   ?   A . n 
A 1 172 GLN 172 172 ?   ?   ?   A . n 
A 1 173 PRO 173 173 ?   ?   ?   A . n 
A 1 174 LYS 174 174 ?   ?   ?   A . n 
A 1 175 ASP 175 175 ?   ?   ?   A . n 
A 1 176 THR 176 176 ?   ?   ?   A . n 
A 1 177 VAL 177 177 ?   ?   ?   A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 ALA 181 181 181 ALA ALA A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 ASP 199 199 199 ASP ASP A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 TRP 201 201 201 TRP TRP A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 CYS 203 203 203 CYS CYS A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 TYR 208 208 208 TYR TYR A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 MET 210 210 210 MET MET A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 PHE 226 226 226 PHE PHE A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 HIS 231 231 231 HIS HIS A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 ASN 235 235 235 ASN ASN A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 GLN 237 237 237 GLN GLN A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 ILE 240 240 240 ILE ILE A . n 
A 1 241 PRO 241 241 241 PRO PRO A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 TYR 243 243 243 TYR TYR A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 CYS 250 250 250 CYS CYS A . n 
A 1 251 ARG 251 251 251 ARG ARG A . n 
A 1 252 HIS 252 252 252 HIS HIS A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 ILE 254 254 254 ILE ILE A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ALA 260 260 260 ALA ALA A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 PRO 262 262 262 PRO PRO A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 LYS 264 264 264 LYS LYS A . n 
A 1 265 ARG 265 265 265 ARG ARG A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 HIS 274 274 274 HIS HIS A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 TRP 276 276 276 TRP TRP A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 ALA 283 283 283 ALA ALA A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 MET 286 286 ?   ?   ?   A . n 
A 1 287 ASN 287 287 ?   ?   ?   A . n 
A 1 288 ASP 288 288 ?   ?   ?   A . n 
A 1 289 ASN 289 289 ?   ?   ?   A . n 
A 1 290 THR 290 290 ?   ?   ?   A . n 
A 1 291 MET 291 291 ?   ?   ?   A . n 
A 1 292 THR 292 292 ?   ?   ?   A . n 
A 1 293 THR 293 293 ?   ?   ?   A . n 
A 1 294 GLN 294 294 ?   ?   ?   A . n 
A 1 295 PHE 295 295 ?   ?   ?   A . n 
A 1 296 ASP 296 296 ?   ?   ?   A . n 
A 1 297 GLU 297 297 ?   ?   ?   A . n 
A 1 298 SER 298 298 ?   ?   ?   A . n 
A 1 299 ASP 299 299 ?   ?   ?   A . n 
A 1 300 GLN 300 300 ?   ?   ?   A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 GLU 307 307 307 GLU GLU A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 MET 309 309 309 MET MET A . n 
A 1 310 GLN 310 310 310 GLN GLN A . n 
A 1 311 ILE 311 311 311 ILE ILE A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 GLU 314 314 314 GLU GLU A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 THR 316 316 316 THR THR A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 PRO 318 318 318 PRO PRO A . n 
A 1 319 PRO 319 319 319 PRO PRO A . n 
A 1 320 ALA 320 320 ?   ?   ?   A . n 
A 1 321 GLY 321 321 ?   ?   ?   A . n 
A 1 322 THR 322 322 ?   ?   ?   A . n 
A 1 323 GLN 323 323 ?   ?   ?   A . n 
A 1 324 ASN 324 324 ?   ?   ?   A . n 
A 1 325 LEU 325 325 ?   ?   ?   A . n 
A 1 326 ASN 326 326 ?   ?   ?   A . n 
A 1 327 HIS 327 327 ?   ?   ?   A . n 
A 1 328 TYR 328 328 ?   ?   ?   A . n 
A 1 329 LEU 329 329 ?   ?   ?   A . n 
A 1 330 THR 330 330 ?   ?   ?   A . n 
A 1 331 GLY 331 331 ?   ?   ?   A . n 
A 1 332 SER 332 332 ?   ?   ?   A . n 
A 1 333 LEU 333 333 ?   ?   ?   A . n 
A 1 334 ASP 334 334 ?   ?   ?   A . n 
A 1 335 ILE 335 335 ?   ?   ?   A . n 
A 1 336 ASP 336 336 ?   ?   ?   A . n 
A 1 337 ASP 337 337 ?   ?   ?   A . n 
A 1 338 ASP 338 338 ?   ?   ?   A . n 
A 1 339 MET 339 339 ?   ?   ?   A . n 
A 1 340 GLU 340 340 ?   ?   ?   A . n 
A 1 341 GLU 341 341 ?   ?   ?   A . n 
A 1 342 ASP 342 342 ?   ?   ?   A . n 
A 1 343 LEU 343 343 ?   ?   ?   A . n 
A 1 344 GLU 344 344 ?   ?   ?   A . n 
A 1 345 SER 345 345 ?   ?   ?   A . n 
A 1 346 ASP 346 346 ?   ?   ?   A . n 
A 1 347 LEU 347 347 ?   ?   ?   A . n 
A 1 348 ASP 348 348 ?   ?   ?   A . n 
A 1 349 ASP 349 349 ?   ?   ?   A . n 
A 1 350 LEU 350 350 ?   ?   ?   A . n 
A 1 351 ASP 351 351 ?   ?   ?   A . n 
A 1 352 ILE 352 352 ?   ?   ?   A . n 
A 1 353 ASP 353 353 ?   ?   ?   A . n 
A 1 354 SER 354 354 ?   ?   ?   A . n 
A 1 355 SER 355 355 ?   ?   ?   A . n 
A 1 356 GLY 356 356 ?   ?   ?   A . n 
A 1 357 GLU 357 357 ?   ?   ?   A . n 
A 1 358 ILE 358 358 ?   ?   ?   A . n 
A 1 359 VAL 359 359 ?   ?   ?   A . n 
A 1 360 TYR 360 360 ?   ?   ?   A . n 
A 1 361 ALA 361 361 ?   ?   ?   A . n 
A 1 362 MET 362 362 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ASP 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   PRO 4   4   ?   ?   ?   B . n 
B 1 5   ALA 5   5   ?   ?   ?   B . n 
B 1 6   VAL 6   6   ?   ?   ?   B . n 
B 1 7   SER 7   7   ?   ?   ?   B . n 
B 1 8   GLY 8   8   ?   ?   ?   B . n 
B 1 9   PRO 9   9   ?   ?   ?   B . n 
B 1 10  MET 10  10  ?   ?   ?   B . n 
B 1 11  ASP 11  11  ?   ?   ?   B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  PRO 13  13  13  PRO PRO B . n 
B 1 14  ILE 14  14  14  ILE ILE B . n 
B 1 15  MET 15  15  15  MET MET B . n 
B 1 16  HIS 16  16  16  HIS HIS B . n 
B 1 17  ASP 17  17  17  ASP ASP B . n 
B 1 18  SER 18  18  18  SER SER B . n 
B 1 19  ASP 19  19  19  ASP ASP B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  TYR 21  21  21  TYR TYR B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  LYS 25  25  25  LYS LYS B . n 
B 1 26  ASP 26  26  26  ASP ASP B . n 
B 1 27  ILE 27  27  27  ILE ILE B . n 
B 1 28  GLY 28  28  28  GLY GLY B . n 
B 1 29  SER 29  29  29  SER SER B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  VAL 34  34  34  VAL VAL B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  ARG 39  39  39  ARG ARG B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  SER 43  43  43  SER SER B . n 
B 1 44  ASN 44  44  44  ASN ASN B . n 
B 1 45  GLU 45  45  45  GLU GLU B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  VAL 49  49  49  VAL VAL B . n 
B 1 50  LYS 50  50  50  LYS LYS B . n 
B 1 51  TYR 51  51  51  TYR TYR B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  GLU 53  53  53  GLU GLU B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  GLU 56  56  56  GLU GLU B . n 
B 1 57  LYS 57  57  57  LYS LYS B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  ASN 61  61  61  ASN ASN B . n 
B 1 62  VAL 62  62  62  VAL VAL B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  ARG 64  64  64  ARG ARG B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  ARG 73  73  73  ARG ARG B . n 
B 1 74  HIS 74  74  74  HIS HIS B . n 
B 1 75  PRO 75  75  75  PRO PRO B . n 
B 1 76  ASN 76  76  76  ASN ASN B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  VAL 78  78  78  VAL VAL B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  VAL 83  83  83  VAL VAL B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  THR 86  86  86  THR THR B . n 
B 1 87  PRO 87  87  87  PRO PRO B . n 
B 1 88  THR 88  88  88  THR THR B . n 
B 1 89  HIS 89  89  89  HIS HIS B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  MET 94  94  94  MET MET B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  TYR 96  96  96  TYR TYR B . n 
B 1 97  ALA 97  97  97  ALA ALA B . n 
B 1 98  SER 98  98  98  SER SER B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 GLU 101 101 101 GLU GLU B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 PHE 103 103 103 PHE PHE B . n 
B 1 104 GLU 104 104 104 GLU GLU B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 CYS 107 107 107 CYS CYS B . n 
B 1 108 ASN 108 108 108 ASN ASN B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 PHE 112 112 112 PHE PHE B . n 
B 1 113 SER 113 113 113 SER SER B . n 
B 1 114 GLU 114 114 114 GLU GLU B . n 
B 1 115 ASP 115 115 115 ASP ASP B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 PHE 121 121 121 PHE PHE B . n 
B 1 122 GLN 122 122 122 GLN GLN B . n 
B 1 123 GLN 123 123 123 GLN GLN B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 CYS 131 131 131 CYS CYS B . n 
B 1 132 HIS 132 132 132 HIS HIS B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 MET 134 134 134 MET MET B . n 
B 1 135 GLN 135 135 135 GLN GLN B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 CYS 137 137 137 CYS CYS B . n 
B 1 138 HIS 138 138 138 HIS HIS B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 ASP 140 140 140 ASP ASP B . n 
B 1 141 LEU 141 141 141 LEU LEU B . n 
B 1 142 LYS 142 142 142 LYS LYS B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 THR 146 146 146 THR THR B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 ASP 149 149 149 ASP ASP B . n 
B 1 150 GLY 150 150 150 GLY GLY B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 PRO 152 152 152 PRO PRO B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 PRO 154 154 154 PRO PRO B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 LYS 157 157 157 LYS LYS B . n 
B 1 158 ILE 158 158 158 ILE ILE B . n 
B 1 159 CYS 159 159 159 CYS CYS B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 TYR 163 163 163 TYR TYR B . n 
B 1 164 SER 164 164 ?   ?   ?   B . n 
B 1 165 LYS 165 165 ?   ?   ?   B . n 
B 1 166 SER 166 166 ?   ?   ?   B . n 
B 1 167 SER 167 167 ?   ?   ?   B . n 
B 1 168 VAL 168 168 ?   ?   ?   B . n 
B 1 169 LEU 169 169 ?   ?   ?   B . n 
B 1 170 HIS 170 170 ?   ?   ?   B . n 
B 1 171 SER 171 171 ?   ?   ?   B . n 
B 1 172 GLN 172 172 ?   ?   ?   B . n 
B 1 173 PRO 173 173 ?   ?   ?   B . n 
B 1 174 LYS 174 174 ?   ?   ?   B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 THR 176 176 176 THR THR B . n 
B 1 177 VAL 177 177 177 VAL VAL B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 PRO 180 180 180 PRO PRO B . n 
B 1 181 ALA 181 181 181 ALA ALA B . n 
B 1 182 TYR 182 182 182 TYR TYR B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 PRO 185 185 185 PRO PRO B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 VAL 187 187 187 VAL VAL B . n 
B 1 188 LEU 188 188 188 LEU LEU B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 LYS 190 190 190 LYS LYS B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 GLU 192 192 192 GLU GLU B . n 
B 1 193 TYR 193 193 193 TYR TYR B . n 
B 1 194 ASP 194 194 194 ASP ASP B . n 
B 1 195 GLY 195 195 195 GLY GLY B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 ALA 198 198 198 ALA ALA B . n 
B 1 199 ASP 199 199 199 ASP ASP B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 TRP 201 201 201 TRP TRP B . n 
B 1 202 SER 202 202 202 SER SER B . n 
B 1 203 CYS 203 203 203 CYS CYS B . n 
B 1 204 GLY 204 204 204 GLY GLY B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 THR 206 206 206 THR THR B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 TYR 208 208 208 TYR TYR B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 MET 210 210 210 MET MET B . n 
B 1 211 LEU 211 211 211 LEU LEU B . n 
B 1 212 VAL 212 212 212 VAL VAL B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 ALA 214 214 214 ALA ALA B . n 
B 1 215 TYR 215 215 215 TYR TYR B . n 
B 1 216 PRO 216 216 216 PRO PRO B . n 
B 1 217 PHE 217 217 217 PHE PHE B . n 
B 1 218 GLU 218 218 218 GLU GLU B . n 
B 1 219 ASP 219 219 219 ASP ASP B . n 
B 1 220 PRO 220 220 220 PRO PRO B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 GLU 222 222 222 GLU GLU B . n 
B 1 223 PRO 223 223 223 PRO PRO B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 PHE 226 226 226 PHE PHE B . n 
B 1 227 ARG 227 227 227 ARG ARG B . n 
B 1 228 LYS 228 228 228 LYS LYS B . n 
B 1 229 THR 229 229 229 THR THR B . n 
B 1 230 ILE 230 230 230 ILE ILE B . n 
B 1 231 HIS 231 231 231 HIS HIS B . n 
B 1 232 ARG 232 232 232 ARG ARG B . n 
B 1 233 ILE 233 233 233 ILE ILE B . n 
B 1 234 LEU 234 234 234 LEU LEU B . n 
B 1 235 ASN 235 235 235 ASN ASN B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 GLN 237 237 237 GLN GLN B . n 
B 1 238 TYR 238 238 238 TYR TYR B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 ILE 240 240 240 ILE ILE B . n 
B 1 241 PRO 241 241 241 PRO PRO B . n 
B 1 242 ASP 242 242 242 ASP ASP B . n 
B 1 243 TYR 243 243 243 TYR TYR B . n 
B 1 244 VAL 244 244 244 VAL VAL B . n 
B 1 245 HIS 245 245 245 HIS HIS B . n 
B 1 246 ILE 246 246 246 ILE ILE B . n 
B 1 247 SER 247 247 247 SER SER B . n 
B 1 248 PRO 248 248 248 PRO PRO B . n 
B 1 249 GLU 249 249 249 GLU GLU B . n 
B 1 250 CYS 250 250 250 CYS CYS B . n 
B 1 251 ARG 251 251 251 ARG ARG B . n 
B 1 252 HIS 252 252 252 HIS HIS B . n 
B 1 253 LEU 253 253 253 LEU LEU B . n 
B 1 254 ILE 254 254 254 ILE ILE B . n 
B 1 255 SER 255 255 255 SER SER B . n 
B 1 256 ARG 256 256 256 ARG ARG B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 PHE 258 258 258 PHE PHE B . n 
B 1 259 VAL 259 259 259 VAL VAL B . n 
B 1 260 ALA 260 260 260 ALA ALA B . n 
B 1 261 ASP 261 261 261 ASP ASP B . n 
B 1 262 PRO 262 262 262 PRO PRO B . n 
B 1 263 ALA 263 263 263 ALA ALA B . n 
B 1 264 LYS 264 264 264 LYS LYS B . n 
B 1 265 ARG 265 265 265 ARG ARG B . n 
B 1 266 ILE 266 266 266 ILE ILE B . n 
B 1 267 SER 267 267 267 SER SER B . n 
B 1 268 ILE 268 268 268 ILE ILE B . n 
B 1 269 PRO 269 269 269 PRO PRO B . n 
B 1 270 GLU 270 270 270 GLU GLU B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 ARG 272 272 272 ARG ARG B . n 
B 1 273 ASN 273 273 273 ASN ASN B . n 
B 1 274 HIS 274 274 274 HIS HIS B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 TRP 276 276 276 TRP TRP B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 LYS 279 279 279 LYS LYS B . n 
B 1 280 ASN 280 280 280 ASN ASN B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 PRO 282 282 282 PRO PRO B . n 
B 1 283 ALA 283 283 283 ALA ALA B . n 
B 1 284 ASP 284 284 284 ASP ASP B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 MET 286 286 ?   ?   ?   B . n 
B 1 287 ASN 287 287 ?   ?   ?   B . n 
B 1 288 ASP 288 288 ?   ?   ?   B . n 
B 1 289 ASN 289 289 ?   ?   ?   B . n 
B 1 290 THR 290 290 ?   ?   ?   B . n 
B 1 291 MET 291 291 ?   ?   ?   B . n 
B 1 292 THR 292 292 ?   ?   ?   B . n 
B 1 293 THR 293 293 ?   ?   ?   B . n 
B 1 294 GLN 294 294 ?   ?   ?   B . n 
B 1 295 PHE 295 295 ?   ?   ?   B . n 
B 1 296 ASP 296 296 ?   ?   ?   B . n 
B 1 297 GLU 297 297 ?   ?   ?   B . n 
B 1 298 SER 298 298 ?   ?   ?   B . n 
B 1 299 ASP 299 299 ?   ?   ?   B . n 
B 1 300 GLN 300 300 ?   ?   ?   B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 GLY 302 302 302 GLY GLY B . n 
B 1 303 GLN 303 303 303 GLN GLN B . n 
B 1 304 SER 304 304 304 SER SER B . n 
B 1 305 ILE 305 305 305 ILE ILE B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 GLU 307 307 307 GLU GLU B . n 
B 1 308 ILE 308 308 308 ILE ILE B . n 
B 1 309 MET 309 309 309 MET MET B . n 
B 1 310 GLN 310 310 310 GLN GLN B . n 
B 1 311 ILE 311 311 311 ILE ILE B . n 
B 1 312 ILE 312 312 312 ILE ILE B . n 
B 1 313 ALA 313 313 313 ALA ALA B . n 
B 1 314 GLU 314 314 314 GLU GLU B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 THR 316 316 316 THR THR B . n 
B 1 317 VAL 317 317 317 VAL VAL B . n 
B 1 318 PRO 318 318 318 PRO PRO B . n 
B 1 319 PRO 319 319 319 PRO PRO B . n 
B 1 320 ALA 320 320 ?   ?   ?   B . n 
B 1 321 GLY 321 321 ?   ?   ?   B . n 
B 1 322 THR 322 322 ?   ?   ?   B . n 
B 1 323 GLN 323 323 ?   ?   ?   B . n 
B 1 324 ASN 324 324 ?   ?   ?   B . n 
B 1 325 LEU 325 325 ?   ?   ?   B . n 
B 1 326 ASN 326 326 ?   ?   ?   B . n 
B 1 327 HIS 327 327 ?   ?   ?   B . n 
B 1 328 TYR 328 328 ?   ?   ?   B . n 
B 1 329 LEU 329 329 ?   ?   ?   B . n 
B 1 330 THR 330 330 ?   ?   ?   B . n 
B 1 331 GLY 331 331 ?   ?   ?   B . n 
B 1 332 SER 332 332 ?   ?   ?   B . n 
B 1 333 LEU 333 333 ?   ?   ?   B . n 
B 1 334 ASP 334 334 ?   ?   ?   B . n 
B 1 335 ILE 335 335 ?   ?   ?   B . n 
B 1 336 ASP 336 336 ?   ?   ?   B . n 
B 1 337 ASP 337 337 ?   ?   ?   B . n 
B 1 338 ASP 338 338 ?   ?   ?   B . n 
B 1 339 MET 339 339 ?   ?   ?   B . n 
B 1 340 GLU 340 340 ?   ?   ?   B . n 
B 1 341 GLU 341 341 ?   ?   ?   B . n 
B 1 342 ASP 342 342 ?   ?   ?   B . n 
B 1 343 LEU 343 343 ?   ?   ?   B . n 
B 1 344 GLU 344 344 ?   ?   ?   B . n 
B 1 345 SER 345 345 ?   ?   ?   B . n 
B 1 346 ASP 346 346 ?   ?   ?   B . n 
B 1 347 LEU 347 347 ?   ?   ?   B . n 
B 1 348 ASP 348 348 ?   ?   ?   B . n 
B 1 349 ASP 349 349 ?   ?   ?   B . n 
B 1 350 LEU 350 350 ?   ?   ?   B . n 
B 1 351 ASP 351 351 ?   ?   ?   B . n 
B 1 352 ILE 352 352 ?   ?   ?   B . n 
B 1 353 ASP 353 353 ?   ?   ?   B . n 
B 1 354 SER 354 354 ?   ?   ?   B . n 
B 1 355 SER 355 355 ?   ?   ?   B . n 
B 1 356 GLY 356 356 ?   ?   ?   B . n 
B 1 357 GLU 357 357 ?   ?   ?   B . n 
B 1 358 ILE 358 358 ?   ?   ?   B . n 
B 1 359 VAL 359 359 ?   ?   ?   B . n 
B 1 360 TYR 360 360 ?   ?   ?   B . n 
B 1 361 ALA 361 361 ?   ?   ?   B . n 
B 1 362 MET 362 362 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 EDO 1  1320 1320 EDO EDO A . 
D 3 AU  1  1321 1321 AU  AU  A . 
E 2 EDO 1  1320 1320 EDO EDO B . 
F 4 HOH 1  2001 2001 HOH HOH A . 
F 4 HOH 2  2002 2002 HOH HOH A . 
F 4 HOH 3  2003 2003 HOH HOH A . 
F 4 HOH 4  2004 2004 HOH HOH A . 
F 4 HOH 5  2005 2005 HOH HOH A . 
F 4 HOH 6  2006 2006 HOH HOH A . 
F 4 HOH 7  2007 2007 HOH HOH A . 
F 4 HOH 8  2008 2008 HOH HOH A . 
F 4 HOH 9  2009 2009 HOH HOH A . 
F 4 HOH 10 2010 2010 HOH HOH A . 
F 4 HOH 11 2011 2011 HOH HOH A . 
F 4 HOH 12 2012 2012 HOH HOH A . 
F 4 HOH 13 2013 2013 HOH HOH A . 
F 4 HOH 14 2014 2014 HOH HOH A . 
F 4 HOH 15 2015 2015 HOH HOH A . 
F 4 HOH 16 2016 2016 HOH HOH A . 
F 4 HOH 17 2017 2017 HOH HOH A . 
F 4 HOH 18 2018 2018 HOH HOH A . 
F 4 HOH 19 2019 2019 HOH HOH A . 
F 4 HOH 20 2020 2020 HOH HOH A . 
F 4 HOH 21 2021 2021 HOH HOH A . 
F 4 HOH 22 2022 2022 HOH HOH A . 
F 4 HOH 23 2023 2023 HOH HOH A . 
F 4 HOH 24 2024 2024 HOH HOH A . 
F 4 HOH 25 2025 2025 HOH HOH A . 
F 4 HOH 26 2026 2026 HOH HOH A . 
F 4 HOH 27 2027 2027 HOH HOH A . 
F 4 HOH 28 2028 2028 HOH HOH A . 
F 4 HOH 29 2029 2029 HOH HOH A . 
F 4 HOH 30 2030 2030 HOH HOH A . 
F 4 HOH 31 2031 2031 HOH HOH A . 
G 4 HOH 1  2001 2001 HOH HOH B . 
G 4 HOH 2  2002 2002 HOH HOH B . 
G 4 HOH 3  2003 2003 HOH HOH B . 
G 4 HOH 4  2004 2004 HOH HOH B . 
G 4 HOH 5  2005 2005 HOH HOH B . 
G 4 HOH 6  2006 2006 HOH HOH B . 
G 4 HOH 7  2007 2007 HOH HOH B . 
G 4 HOH 8  2008 2008 HOH HOH B . 
G 4 HOH 9  2009 2009 HOH HOH B . 
G 4 HOH 10 2010 2010 HOH HOH B . 
G 4 HOH 11 2011 2011 HOH HOH B . 
G 4 HOH 12 2012 2012 HOH HOH B . 
G 4 HOH 13 2013 2013 HOH HOH B . 
G 4 HOH 14 2014 2014 HOH HOH B . 
G 4 HOH 15 2015 2015 HOH HOH B . 
G 4 HOH 16 2016 2016 HOH HOH B . 
G 4 HOH 17 2017 2017 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1460  ? 
1 MORE         -10.5 ? 
1 'SSA (A^2)'  32010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-12 
2 'Structure model' 1 1 2011-11-23 
3 'Structure model' 1 2 2018-10-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' 'Source and taxonomy' 
5 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation           
2 3 'Structure model' entity             
3 3 'Structure model' entity_name_com    
4 3 'Structure model' entity_src_gen     
5 3 'Structure model' entity_src_nat     
6 3 'Structure model' struct_ref         
7 3 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_abbrev'             
2  3 'Structure model' '_citation.journal_id_ISSN'            
3  3 'Structure model' '_citation.page_last'                  
4  3 'Structure model' '_citation.pdbx_database_id_DOI'       
5  3 'Structure model' '_citation.title'                      
6  3 'Structure model' '_entity.pdbx_description'             
7  3 'Structure model' '_entity.src_method'                   
8  3 'Structure model' '_entity_name_com.name'                
9  3 'Structure model' '_struct_ref.pdbx_align_begin'         
10 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 
11 3 'Structure model' '_struct_ref_seq_dif.details'          
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX        refinement       '(PHENIX.REFINE)' ? 1 
XDS           'data reduction' .                 ? 2 
SCALA         'data scaling'   .                 ? 3 
Auto-Rickshaw phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id             3ZUU 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, ASP 160 TO ALA
ENGINEERED RESIDUE IN CHAIN B, ASP 160 TO ALA
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'MUTATIONS D160A S175D ENGINEERED.' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A ALA 313 ? ? OG1 A THR 316  ? ? 1.97 
2 1 O  A LEU 72  ? ? O   A HOH 2003 ? ? 2.13 
3 1 O  A PRO 262 ? ? O   A HOH 2030 ? ? 2.15 
4 1 O  A ALA 109 ? ? O   A HOH 2009 ? ? 2.15 
5 1 OG B SER 151 ? ? O   B ALA 153  ? ? 2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     190 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NH2 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     227 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_655 
_pdbx_validate_symm_contact.dist              2.11 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 17  ? ? 39.74   41.51   
2  1 SER A 18  ? ? -65.67  8.58    
3  1 SER A 29  ? ? -163.85 -164.37 
4  1 ASN A 44  ? ? 81.36   -19.93  
5  1 ARG A 54  ? ? -40.29  150.11  
6  1 GLU A 56  ? ? -38.78  -39.12  
7  1 ILE A 58  ? ? -68.16  65.79   
8  1 LYS A 81  ? ? -104.25 -72.28  
9  1 HIS A 138 ? ? 60.19   -109.28 
10 1 ASN A 145 ? ? -144.22 55.68   
11 1 PHE A 161 ? ? 74.86   129.63  
12 1 PHE A 217 ? ? 68.99   -56.77  
13 1 SER A 247 ? ? -49.89  154.93  
14 1 ASN A 280 ? ? 58.21   17.81   
15 1 LYS B 25  ? ? -176.36 131.64  
16 1 SER B 29  ? ? -157.10 59.30   
17 1 LYS B 41  ? ? -69.09  12.42   
18 1 GLN B 42  ? ? -120.92 -50.86  
19 1 ASN B 44  ? ? 54.06   12.13   
20 1 GLU B 53  ? ? -31.89  139.90  
21 1 ILE B 58  ? ? -56.88  66.08   
22 1 ASP B 59  ? ? -96.64  -159.66 
23 1 ARG B 64  ? ? -51.38  -71.18  
24 1 ARG B 73  ? ? -142.02 -8.53   
25 1 ASN B 76  ? ? -76.37  22.54   
26 1 GLU B 82  ? ? 179.99  161.95  
27 1 HIS B 138 ? ? 64.51   -102.84 
28 1 PHE B 161 ? ? 66.13   107.74  
29 1 PHE B 217 ? ? 69.16   -55.71  
30 1 ASN B 280 ? ? 55.38   17.71   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 CYS A 137 ? ? HIS A 138 ? ? 147.62 
2 1 PRO A 318 ? ? PRO A 319 ? ? 147.93 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A MET 10  ? CG  ? A MET 10  CG  
2 1 Y 1 A MET 10  ? SD  ? A MET 10  SD  
3 1 Y 1 A MET 10  ? CE  ? A MET 10  CE  
4 1 Y 1 B ASP 175 ? CG  ? B ASP 175 CG  
5 1 Y 1 B ASP 175 ? OD1 ? B ASP 175 OD1 
6 1 Y 1 B ASP 175 ? OD2 ? B ASP 175 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ASP 2   ? A ASP 2   
3   1 Y 1 A ARG 3   ? A ARG 3   
4   1 Y 1 A PRO 4   ? A PRO 4   
5   1 Y 1 A ALA 5   ? A ALA 5   
6   1 Y 1 A VAL 6   ? A VAL 6   
7   1 Y 1 A SER 7   ? A SER 7   
8   1 Y 1 A GLY 8   ? A GLY 8   
9   1 Y 1 A PRO 9   ? A PRO 9   
10  1 Y 1 A SER 164 ? A SER 164 
11  1 Y 1 A LYS 165 ? A LYS 165 
12  1 Y 1 A SER 166 ? A SER 166 
13  1 Y 1 A SER 167 ? A SER 167 
14  1 Y 1 A VAL 168 ? A VAL 168 
15  1 Y 1 A LEU 169 ? A LEU 169 
16  1 Y 1 A HIS 170 ? A HIS 170 
17  1 Y 1 A SER 171 ? A SER 171 
18  1 Y 1 A GLN 172 ? A GLN 172 
19  1 Y 1 A PRO 173 ? A PRO 173 
20  1 Y 1 A LYS 174 ? A LYS 174 
21  1 Y 1 A ASP 175 ? A ASP 175 
22  1 Y 1 A THR 176 ? A THR 176 
23  1 Y 1 A VAL 177 ? A VAL 177 
24  1 Y 1 A MET 286 ? A MET 286 
25  1 Y 1 A ASN 287 ? A ASN 287 
26  1 Y 1 A ASP 288 ? A ASP 288 
27  1 Y 1 A ASN 289 ? A ASN 289 
28  1 Y 1 A THR 290 ? A THR 290 
29  1 Y 1 A MET 291 ? A MET 291 
30  1 Y 1 A THR 292 ? A THR 292 
31  1 Y 1 A THR 293 ? A THR 293 
32  1 Y 1 A GLN 294 ? A GLN 294 
33  1 Y 1 A PHE 295 ? A PHE 295 
34  1 Y 1 A ASP 296 ? A ASP 296 
35  1 Y 1 A GLU 297 ? A GLU 297 
36  1 Y 1 A SER 298 ? A SER 298 
37  1 Y 1 A ASP 299 ? A ASP 299 
38  1 Y 1 A GLN 300 ? A GLN 300 
39  1 Y 1 A ALA 320 ? A ALA 320 
40  1 Y 1 A GLY 321 ? A GLY 321 
41  1 Y 1 A THR 322 ? A THR 322 
42  1 Y 1 A GLN 323 ? A GLN 323 
43  1 Y 1 A ASN 324 ? A ASN 324 
44  1 Y 1 A LEU 325 ? A LEU 325 
45  1 Y 1 A ASN 326 ? A ASN 326 
46  1 Y 1 A HIS 327 ? A HIS 327 
47  1 Y 1 A TYR 328 ? A TYR 328 
48  1 Y 1 A LEU 329 ? A LEU 329 
49  1 Y 1 A THR 330 ? A THR 330 
50  1 Y 1 A GLY 331 ? A GLY 331 
51  1 Y 1 A SER 332 ? A SER 332 
52  1 Y 1 A LEU 333 ? A LEU 333 
53  1 Y 1 A ASP 334 ? A ASP 334 
54  1 Y 1 A ILE 335 ? A ILE 335 
55  1 Y 1 A ASP 336 ? A ASP 336 
56  1 Y 1 A ASP 337 ? A ASP 337 
57  1 Y 1 A ASP 338 ? A ASP 338 
58  1 Y 1 A MET 339 ? A MET 339 
59  1 Y 1 A GLU 340 ? A GLU 340 
60  1 Y 1 A GLU 341 ? A GLU 341 
61  1 Y 1 A ASP 342 ? A ASP 342 
62  1 Y 1 A LEU 343 ? A LEU 343 
63  1 Y 1 A GLU 344 ? A GLU 344 
64  1 Y 1 A SER 345 ? A SER 345 
65  1 Y 1 A ASP 346 ? A ASP 346 
66  1 Y 1 A LEU 347 ? A LEU 347 
67  1 Y 1 A ASP 348 ? A ASP 348 
68  1 Y 1 A ASP 349 ? A ASP 349 
69  1 Y 1 A LEU 350 ? A LEU 350 
70  1 Y 1 A ASP 351 ? A ASP 351 
71  1 Y 1 A ILE 352 ? A ILE 352 
72  1 Y 1 A ASP 353 ? A ASP 353 
73  1 Y 1 A SER 354 ? A SER 354 
74  1 Y 1 A SER 355 ? A SER 355 
75  1 Y 1 A GLY 356 ? A GLY 356 
76  1 Y 1 A GLU 357 ? A GLU 357 
77  1 Y 1 A ILE 358 ? A ILE 358 
78  1 Y 1 A VAL 359 ? A VAL 359 
79  1 Y 1 A TYR 360 ? A TYR 360 
80  1 Y 1 A ALA 361 ? A ALA 361 
81  1 Y 1 A MET 362 ? A MET 362 
82  1 Y 1 B MET 1   ? B MET 1   
83  1 Y 1 B ASP 2   ? B ASP 2   
84  1 Y 1 B ARG 3   ? B ARG 3   
85  1 Y 1 B PRO 4   ? B PRO 4   
86  1 Y 1 B ALA 5   ? B ALA 5   
87  1 Y 1 B VAL 6   ? B VAL 6   
88  1 Y 1 B SER 7   ? B SER 7   
89  1 Y 1 B GLY 8   ? B GLY 8   
90  1 Y 1 B PRO 9   ? B PRO 9   
91  1 Y 1 B MET 10  ? B MET 10  
92  1 Y 1 B ASP 11  ? B ASP 11  
93  1 Y 1 B SER 164 ? B SER 164 
94  1 Y 1 B LYS 165 ? B LYS 165 
95  1 Y 1 B SER 166 ? B SER 166 
96  1 Y 1 B SER 167 ? B SER 167 
97  1 Y 1 B VAL 168 ? B VAL 168 
98  1 Y 1 B LEU 169 ? B LEU 169 
99  1 Y 1 B HIS 170 ? B HIS 170 
100 1 Y 1 B SER 171 ? B SER 171 
101 1 Y 1 B GLN 172 ? B GLN 172 
102 1 Y 1 B PRO 173 ? B PRO 173 
103 1 Y 1 B LYS 174 ? B LYS 174 
104 1 Y 1 B MET 286 ? B MET 286 
105 1 Y 1 B ASN 287 ? B ASN 287 
106 1 Y 1 B ASP 288 ? B ASP 288 
107 1 Y 1 B ASN 289 ? B ASN 289 
108 1 Y 1 B THR 290 ? B THR 290 
109 1 Y 1 B MET 291 ? B MET 291 
110 1 Y 1 B THR 292 ? B THR 292 
111 1 Y 1 B THR 293 ? B THR 293 
112 1 Y 1 B GLN 294 ? B GLN 294 
113 1 Y 1 B PHE 295 ? B PHE 295 
114 1 Y 1 B ASP 296 ? B ASP 296 
115 1 Y 1 B GLU 297 ? B GLU 297 
116 1 Y 1 B SER 298 ? B SER 298 
117 1 Y 1 B ASP 299 ? B ASP 299 
118 1 Y 1 B GLN 300 ? B GLN 300 
119 1 Y 1 B ALA 320 ? B ALA 320 
120 1 Y 1 B GLY 321 ? B GLY 321 
121 1 Y 1 B THR 322 ? B THR 322 
122 1 Y 1 B GLN 323 ? B GLN 323 
123 1 Y 1 B ASN 324 ? B ASN 324 
124 1 Y 1 B LEU 325 ? B LEU 325 
125 1 Y 1 B ASN 326 ? B ASN 326 
126 1 Y 1 B HIS 327 ? B HIS 327 
127 1 Y 1 B TYR 328 ? B TYR 328 
128 1 Y 1 B LEU 329 ? B LEU 329 
129 1 Y 1 B THR 330 ? B THR 330 
130 1 Y 1 B GLY 331 ? B GLY 331 
131 1 Y 1 B SER 332 ? B SER 332 
132 1 Y 1 B LEU 333 ? B LEU 333 
133 1 Y 1 B ASP 334 ? B ASP 334 
134 1 Y 1 B ILE 335 ? B ILE 335 
135 1 Y 1 B ASP 336 ? B ASP 336 
136 1 Y 1 B ASP 337 ? B ASP 337 
137 1 Y 1 B ASP 338 ? B ASP 338 
138 1 Y 1 B MET 339 ? B MET 339 
139 1 Y 1 B GLU 340 ? B GLU 340 
140 1 Y 1 B GLU 341 ? B GLU 341 
141 1 Y 1 B ASP 342 ? B ASP 342 
142 1 Y 1 B LEU 343 ? B LEU 343 
143 1 Y 1 B GLU 344 ? B GLU 344 
144 1 Y 1 B SER 345 ? B SER 345 
145 1 Y 1 B ASP 346 ? B ASP 346 
146 1 Y 1 B LEU 347 ? B LEU 347 
147 1 Y 1 B ASP 348 ? B ASP 348 
148 1 Y 1 B ASP 349 ? B ASP 349 
149 1 Y 1 B LEU 350 ? B LEU 350 
150 1 Y 1 B ASP 351 ? B ASP 351 
151 1 Y 1 B ILE 352 ? B ILE 352 
152 1 Y 1 B ASP 353 ? B ASP 353 
153 1 Y 1 B SER 354 ? B SER 354 
154 1 Y 1 B SER 355 ? B SER 355 
155 1 Y 1 B GLY 356 ? B GLY 356 
156 1 Y 1 B GLU 357 ? B GLU 357 
157 1 Y 1 B ILE 358 ? B ILE 358 
158 1 Y 1 B VAL 359 ? B VAL 359 
159 1 Y 1 B TYR 360 ? B TYR 360 
160 1 Y 1 B ALA 361 ? B ALA 361 
161 1 Y 1 B MET 362 ? B MET 362 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 'GOLD ION'     AU  
4 water          HOH 
#