data_4AY1
# 
_entry.id   4AY1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4AY1         
PDBE  EBI-52930    
WWPDB D_1290052930 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4AY1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-06-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schimpl, M.'        1 
'Rush, C.L.'         2 
'Betou, M.'          3 
'Eggleston, I.M.'    4 
'Penman, G.A.'       5 
'Recklies, A.D.'     6 
'van Aalten, D.M.F.' 7 
# 
_citation.id                        primary 
_citation.title                     'Human Ykl-39 is a Pseudo-Chitinase with Retained Chitooligosaccharide-Binding Properties.' 
_citation.journal_abbrev            Biochem.J. 
_citation.journal_volume            446 
_citation.page_first                149 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           BIJOAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0264-6021 
_citation.journal_id_CSD            0043 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22742450 
_citation.pdbx_database_id_DOI      10.1042/BJ20120377 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schimpl, M.'        1 ? 
primary 'Rush, C.L.'         2 ? 
primary 'Betou, M.'          3 ? 
primary 'Eggleston, I.M.'    4 ? 
primary 'Recklies, A.D.'     5 ? 
primary 'Van Aalten, D.M.F.' 6 ? 
# 
_cell.entry_id           4AY1 
_cell.length_a           255.686 
_cell.length_b           152.543 
_cell.length_c           138.186 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.62 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4AY1 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  man 'CHITINASE-3-LIKE PROTEIN 2' 40987.535 12   ? ? ? ? 
2 branched man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
830.786   12   ? ? ? ? 
3 water    nat water 18.015    1893 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CHONDROCYTE PROTEIN 39, YKL-39' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYL
FGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVS
AGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMG
IPTYGHSFTLASAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETK
VQFLKNLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYL
FGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVS
AGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMG
IPTYGHSFTLASAETTVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETK
VQFLKNLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   TYR n 
1 3   LYS n 
1 4   LEU n 
1 5   VAL n 
1 6   CYS n 
1 7   TYR n 
1 8   PHE n 
1 9   THR n 
1 10  ASN n 
1 11  TRP n 
1 12  SER n 
1 13  GLN n 
1 14  ASP n 
1 15  ARG n 
1 16  GLN n 
1 17  GLU n 
1 18  PRO n 
1 19  GLY n 
1 20  LYS n 
1 21  PHE n 
1 22  THR n 
1 23  PRO n 
1 24  GLU n 
1 25  ASN n 
1 26  ILE n 
1 27  ASP n 
1 28  PRO n 
1 29  PHE n 
1 30  LEU n 
1 31  CYS n 
1 32  SER n 
1 33  HIS n 
1 34  LEU n 
1 35  ILE n 
1 36  TYR n 
1 37  SER n 
1 38  PHE n 
1 39  ALA n 
1 40  SER n 
1 41  ILE n 
1 42  GLU n 
1 43  ASN n 
1 44  ASN n 
1 45  LYS n 
1 46  VAL n 
1 47  ILE n 
1 48  ILE n 
1 49  LYS n 
1 50  ASP n 
1 51  LYS n 
1 52  SER n 
1 53  GLU n 
1 54  VAL n 
1 55  MET n 
1 56  LEU n 
1 57  TYR n 
1 58  GLN n 
1 59  THR n 
1 60  ILE n 
1 61  ASN n 
1 62  SER n 
1 63  LEU n 
1 64  LYS n 
1 65  THR n 
1 66  LYS n 
1 67  ASN n 
1 68  PRO n 
1 69  LYS n 
1 70  LEU n 
1 71  LYS n 
1 72  ILE n 
1 73  LEU n 
1 74  LEU n 
1 75  SER n 
1 76  ILE n 
1 77  GLY n 
1 78  GLY n 
1 79  TYR n 
1 80  LEU n 
1 81  PHE n 
1 82  GLY n 
1 83  SER n 
1 84  LYS n 
1 85  GLY n 
1 86  PHE n 
1 87  HIS n 
1 88  PRO n 
1 89  MET n 
1 90  VAL n 
1 91  ASP n 
1 92  SER n 
1 93  SER n 
1 94  THR n 
1 95  SER n 
1 96  ARG n 
1 97  LEU n 
1 98  GLU n 
1 99  PHE n 
1 100 ILE n 
1 101 ASN n 
1 102 SER n 
1 103 ILE n 
1 104 ILE n 
1 105 LEU n 
1 106 PHE n 
1 107 LEU n 
1 108 ARG n 
1 109 ASN n 
1 110 HIS n 
1 111 ASN n 
1 112 PHE n 
1 113 ASP n 
1 114 GLY n 
1 115 LEU n 
1 116 ASP n 
1 117 VAL n 
1 118 SER n 
1 119 TRP n 
1 120 ILE n 
1 121 TYR n 
1 122 PRO n 
1 123 ASP n 
1 124 GLN n 
1 125 LYS n 
1 126 GLU n 
1 127 ASN n 
1 128 THR n 
1 129 HIS n 
1 130 PHE n 
1 131 THR n 
1 132 VAL n 
1 133 LEU n 
1 134 ILE n 
1 135 HIS n 
1 136 GLU n 
1 137 LEU n 
1 138 ALA n 
1 139 GLU n 
1 140 ALA n 
1 141 PHE n 
1 142 GLN n 
1 143 LYS n 
1 144 ASP n 
1 145 PHE n 
1 146 THR n 
1 147 LYS n 
1 148 SER n 
1 149 THR n 
1 150 LYS n 
1 151 GLU n 
1 152 ARG n 
1 153 LEU n 
1 154 LEU n 
1 155 LEU n 
1 156 THR n 
1 157 ALA n 
1 158 GLY n 
1 159 VAL n 
1 160 SER n 
1 161 ALA n 
1 162 GLY n 
1 163 ARG n 
1 164 GLN n 
1 165 MET n 
1 166 ILE n 
1 167 ASP n 
1 168 ASN n 
1 169 SER n 
1 170 TYR n 
1 171 GLN n 
1 172 VAL n 
1 173 GLU n 
1 174 LYS n 
1 175 LEU n 
1 176 ALA n 
1 177 LYS n 
1 178 ASP n 
1 179 LEU n 
1 180 ASP n 
1 181 PHE n 
1 182 ILE n 
1 183 ASN n 
1 184 LEU n 
1 185 LEU n 
1 186 SER n 
1 187 PHE n 
1 188 ASP n 
1 189 PHE n 
1 190 HIS n 
1 191 GLY n 
1 192 SER n 
1 193 TRP n 
1 194 GLU n 
1 195 LYS n 
1 196 PRO n 
1 197 LEU n 
1 198 ILE n 
1 199 THR n 
1 200 GLY n 
1 201 HIS n 
1 202 ASN n 
1 203 SER n 
1 204 PRO n 
1 205 LEU n 
1 206 SER n 
1 207 LYS n 
1 208 GLY n 
1 209 TRP n 
1 210 GLN n 
1 211 ASP n 
1 212 ARG n 
1 213 GLY n 
1 214 PRO n 
1 215 SER n 
1 216 SER n 
1 217 TYR n 
1 218 TYR n 
1 219 ASN n 
1 220 VAL n 
1 221 GLU n 
1 222 TYR n 
1 223 ALA n 
1 224 VAL n 
1 225 GLY n 
1 226 TYR n 
1 227 TRP n 
1 228 ILE n 
1 229 HIS n 
1 230 LYS n 
1 231 GLY n 
1 232 MET n 
1 233 PRO n 
1 234 SER n 
1 235 GLU n 
1 236 LYS n 
1 237 VAL n 
1 238 VAL n 
1 239 MET n 
1 240 GLY n 
1 241 ILE n 
1 242 PRO n 
1 243 THR n 
1 244 TYR n 
1 245 GLY n 
1 246 HIS n 
1 247 SER n 
1 248 PHE n 
1 249 THR n 
1 250 LEU n 
1 251 ALA n 
1 252 SER n 
1 253 ALA n 
1 254 GLU n 
1 255 THR n 
1 256 THR n 
1 257 VAL n 
1 258 GLY n 
1 259 ALA n 
1 260 PRO n 
1 261 ALA n 
1 262 SER n 
1 263 GLY n 
1 264 PRO n 
1 265 GLY n 
1 266 ALA n 
1 267 ALA n 
1 268 GLY n 
1 269 PRO n 
1 270 ILE n 
1 271 THR n 
1 272 GLU n 
1 273 SER n 
1 274 SER n 
1 275 GLY n 
1 276 PHE n 
1 277 LEU n 
1 278 ALA n 
1 279 TYR n 
1 280 TYR n 
1 281 GLU n 
1 282 ILE n 
1 283 CYS n 
1 284 GLN n 
1 285 PHE n 
1 286 LEU n 
1 287 LYS n 
1 288 GLY n 
1 289 ALA n 
1 290 LYS n 
1 291 ILE n 
1 292 THR n 
1 293 ARG n 
1 294 LEU n 
1 295 GLN n 
1 296 ASP n 
1 297 GLN n 
1 298 GLN n 
1 299 VAL n 
1 300 PRO n 
1 301 TYR n 
1 302 ALA n 
1 303 VAL n 
1 304 LYS n 
1 305 GLY n 
1 306 ASN n 
1 307 GLN n 
1 308 TRP n 
1 309 VAL n 
1 310 GLY n 
1 311 TYR n 
1 312 ASP n 
1 313 ASP n 
1 314 VAL n 
1 315 LYS n 
1 316 SER n 
1 317 MET n 
1 318 GLU n 
1 319 THR n 
1 320 LYS n 
1 321 VAL n 
1 322 GLN n 
1 323 PHE n 
1 324 LEU n 
1 325 LYS n 
1 326 ASN n 
1 327 LEU n 
1 328 ASN n 
1 329 LEU n 
1 330 GLY n 
1 331 GLY n 
1 332 ALA n 
1 333 MET n 
1 334 ILE n 
1 335 TRP n 
1 336 SER n 
1 337 ILE n 
1 338 ASP n 
1 339 MET n 
1 340 ASP n 
1 341 ASP n 
1 342 PHE n 
1 343 THR n 
1 344 GLY n 
1 345 LYS n 
1 346 SER n 
1 347 CYS n 
1 348 ASN n 
1 349 GLN n 
1 350 GLY n 
1 351 PRO n 
1 352 TYR n 
1 353 PRO n 
1 354 LEU n 
1 355 VAL n 
1 356 GLN n 
1 357 ALA n 
1 358 VAL n 
1 359 LYS n 
1 360 ARG n 
1 361 SER n 
1 362 LEU n 
1 363 GLY n 
1 364 SER n 
1 365 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'KOMAGATAELLA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     644223 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               GS115 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CH3L2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q15782 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4AY1 A 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
2  1 4AY1 B 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
3  1 4AY1 C 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
4  1 4AY1 D 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
5  1 4AY1 E 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
6  1 4AY1 F 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
7  1 4AY1 G 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
8  1 4AY1 H 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
9  1 4AY1 I 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
10 1 4AY1 J 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
11 1 4AY1 K 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
12 1 4AY1 L 1 ? 365 ? Q15782 26 ? 390 ? 26 390 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4AY1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.8 
_exptl_crystal.density_percent_sol   56 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '23% PEG 3000, 0.1 M SODIUM CITRATE PH 6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.873 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             0.873 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4AY1 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   383206 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4AY1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     379115 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             137.36 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    99.32 
_refine.ls_R_factor_obs                          0.19151 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19128 
_refine.ls_R_factor_R_free                       0.23899 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.5 
_refine.ls_number_reflns_R_free                  1898 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.B_iso_mean                               27.271 
_refine.aniso_B[1][1]                            1.26 
_refine.aniso_B[2][2]                            -0.88 
_refine.aniso_B[3][3]                            -0.39 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.07 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.150 
_refine.pdbx_overall_ESU_R_Free                  0.146 
_refine.overall_SU_ML                            0.098 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.734 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        34527 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         684 
_refine_hist.number_atoms_solvent             1893 
_refine_hist.number_atoms_total               37104 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        137.36 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 36180 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.356  1.981  ? 49094 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.835  5.000  ? 4356  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.107 24.713 ? 1566  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.696 15.000 ? 6005  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.947 15.000 ? 96    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.097  0.200  ? 5398  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 27092 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.538  1.500  ? 21680 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.990  2.000  ? 34970 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.693  3.000  ? 14500 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.713  4.500  ? 14124 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  A 2830 0.33 0.50 'medium positional' 1 1  'X-RAY DIFFRACTION' ? ? ? 
2  B 2830 0.36 0.50 'medium positional' 1 2  'X-RAY DIFFRACTION' ? ? ? 
3  C 2830 0.38 0.50 'medium positional' 1 3  'X-RAY DIFFRACTION' ? ? ? 
4  D 2830 0.47 0.50 'medium positional' 1 4  'X-RAY DIFFRACTION' ? ? ? 
5  E 2830 0.41 0.50 'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? 
6  F 2830 0.39 0.50 'medium positional' 1 6  'X-RAY DIFFRACTION' ? ? ? 
7  G 2830 0.37 0.50 'medium positional' 1 7  'X-RAY DIFFRACTION' ? ? ? 
8  H 2830 0.36 0.50 'medium positional' 1 8  'X-RAY DIFFRACTION' ? ? ? 
9  I 2830 0.36 0.50 'medium positional' 1 9  'X-RAY DIFFRACTION' ? ? ? 
10 J 2830 0.37 0.50 'medium positional' 1 10 'X-RAY DIFFRACTION' ? ? ? 
11 K 2830 0.36 0.50 'medium positional' 1 11 'X-RAY DIFFRACTION' ? ? ? 
12 L 2830 0.37 0.50 'medium positional' 1 12 'X-RAY DIFFRACTION' ? ? ? 
1  A 2830 0.84 2.00 'medium thermal'    1 13 'X-RAY DIFFRACTION' ? ? ? 
2  B 2830 0.74 2.00 'medium thermal'    1 14 'X-RAY DIFFRACTION' ? ? ? 
3  C 2830 0.81 2.00 'medium thermal'    1 15 'X-RAY DIFFRACTION' ? ? ? 
4  D 2830 0.72 2.00 'medium thermal'    1 16 'X-RAY DIFFRACTION' ? ? ? 
5  E 2830 0.78 2.00 'medium thermal'    1 17 'X-RAY DIFFRACTION' ? ? ? 
6  F 2830 0.73 2.00 'medium thermal'    1 18 'X-RAY DIFFRACTION' ? ? ? 
7  G 2830 0.77 2.00 'medium thermal'    1 19 'X-RAY DIFFRACTION' ? ? ? 
8  H 2830 0.75 2.00 'medium thermal'    1 20 'X-RAY DIFFRACTION' ? ? ? 
9  I 2830 0.71 2.00 'medium thermal'    1 21 'X-RAY DIFFRACTION' ? ? ? 
10 J 2830 0.70 2.00 'medium thermal'    1 22 'X-RAY DIFFRACTION' ? ? ? 
11 K 2830 0.79 2.00 'medium thermal'    1 23 'X-RAY DIFFRACTION' ? ? ? 
12 L 2830 0.71 2.00 'medium thermal'    1 24 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.949 
_refine_ls_shell.d_res_low                        2.000 
_refine_ls_shell.number_reflns_R_work             27123 
_refine_ls_shell.R_factor_R_work                  0.244 
_refine_ls_shell.percent_reflns_obs               96.09 
_refine_ls_shell.R_factor_R_free                  0.284 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             119 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1  A 1 
2  B 1 
3  C 1 
4  D 1 
5  E 1 
6  F 1 
7  G 1 
8  H 1 
9  I 1 
10 J 1 
11 K 1 
12 L 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  A 21 A 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
2  B 21 B 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
3  C 21 C 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
4  D 21 D 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
5  E 21 E 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
6  F 21 F 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
7  G 21 G 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
8  H 21 H 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
9  I 21 I 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
10 J 21 J 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
11 K 21 K 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
12 L 21 L 384 1 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4AY1 
_struct.title                     'Human YKL-39 is a pseudo-chitinase with retained chitooligosaccharide binding properties' 
_struct.pdbx_descriptor           'CHITINASE-3-LIKE PROTEIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4AY1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'CHILECTIN, LECTIN, CHITOOLIGOSACCHARIDE, PSEUDOCHITINASE, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 TRP A 11  ? ARG A 15  ? TRP A 36  ARG A 40  5 ? 5  
HELX_P HELX_P2   AA2 THR A 22  ? ILE A 26  ? THR A 47  ILE A 51  5 ? 5  
HELX_P HELX_P3   AA3 SER A 52  ? ASN A 67  ? SER A 77  ASN A 92  1 ? 16 
HELX_P HELX_P4   AA4 SER A 83  ? HIS A 87  ? SER A 108 HIS A 112 5 ? 5  
HELX_P HELX_P5   AA5 PRO A 88  ? ASP A 91  ? PRO A 113 ASP A 116 5 ? 4  
HELX_P HELX_P6   AA6 SER A 92  ? HIS A 110 ? SER A 117 HIS A 135 1 ? 19 
HELX_P HELX_P7   AA7 PRO A 122 ? LYS A 147 ? PRO A 147 LYS A 172 1 ? 26 
HELX_P HELX_P8   AA8 GLY A 162 ? TYR A 170 ? GLY A 187 TYR A 195 1 ? 9  
HELX_P HELX_P9   AA9 GLN A 171 ? LEU A 179 ? GLN A 196 LEU A 204 1 ? 9  
HELX_P HELX_P10  AB1 ARG A 212 ? TYR A 218 ? ARG A 237 TYR A 243 5 ? 7  
HELX_P HELX_P11  AB2 ASN A 219 ? LYS A 230 ? ASN A 244 LYS A 255 1 ? 12 
HELX_P HELX_P12  AB3 PRO A 233 ? GLU A 235 ? PRO A 258 GLU A 260 5 ? 3  
HELX_P HELX_P13  AB4 TYR A 279 ? LYS A 287 ? TYR A 304 LYS A 312 1 ? 9  
HELX_P HELX_P14  AB5 ASP A 313 ? LEU A 327 ? ASP A 338 LEU A 352 1 ? 15 
HELX_P HELX_P15  AB6 SER A 336 ? ASP A 340 ? SER A 361 ASP A 365 5 ? 5  
HELX_P HELX_P16  AB7 TYR A 352 ? SER A 364 ? TYR A 377 SER A 389 1 ? 13 
HELX_P HELX_P17  AB8 TRP B 11  ? ARG B 15  ? TRP B 36  ARG B 40  5 ? 5  
HELX_P HELX_P18  AB9 THR B 22  ? ILE B 26  ? THR B 47  ILE B 51  5 ? 5  
HELX_P HELX_P19  AC1 SER B 52  ? ASN B 67  ? SER B 77  ASN B 92  1 ? 16 
HELX_P HELX_P20  AC2 SER B 83  ? HIS B 87  ? SER B 108 HIS B 112 5 ? 5  
HELX_P HELX_P21  AC3 PRO B 88  ? ASP B 91  ? PRO B 113 ASP B 116 5 ? 4  
HELX_P HELX_P22  AC4 SER B 92  ? HIS B 110 ? SER B 117 HIS B 135 1 ? 19 
HELX_P HELX_P23  AC5 PRO B 122 ? LYS B 147 ? PRO B 147 LYS B 172 1 ? 26 
HELX_P HELX_P24  AC6 GLY B 162 ? TYR B 170 ? GLY B 187 TYR B 195 1 ? 9  
HELX_P HELX_P25  AC7 GLN B 171 ? LEU B 179 ? GLN B 196 LEU B 204 1 ? 9  
HELX_P HELX_P26  AC8 ARG B 212 ? TYR B 218 ? ARG B 237 TYR B 243 5 ? 7  
HELX_P HELX_P27  AC9 ASN B 219 ? LYS B 230 ? ASN B 244 LYS B 255 1 ? 12 
HELX_P HELX_P28  AD1 PRO B 233 ? GLU B 235 ? PRO B 258 GLU B 260 5 ? 3  
HELX_P HELX_P29  AD2 TYR B 279 ? LEU B 286 ? TYR B 304 LEU B 311 1 ? 8  
HELX_P HELX_P30  AD3 ASP B 313 ? LEU B 327 ? ASP B 338 LEU B 352 1 ? 15 
HELX_P HELX_P31  AD4 SER B 336 ? ASP B 340 ? SER B 361 ASP B 365 5 ? 5  
HELX_P HELX_P32  AD5 TYR B 352 ? GLY B 363 ? TYR B 377 GLY B 388 1 ? 12 
HELX_P HELX_P33  AD6 TRP C 11  ? ARG C 15  ? TRP C 36  ARG C 40  5 ? 5  
HELX_P HELX_P34  AD7 THR C 22  ? ILE C 26  ? THR C 47  ILE C 51  5 ? 5  
HELX_P HELX_P35  AD8 SER C 52  ? ASN C 67  ? SER C 77  ASN C 92  1 ? 16 
HELX_P HELX_P36  AD9 SER C 83  ? HIS C 87  ? SER C 108 HIS C 112 5 ? 5  
HELX_P HELX_P37  AE1 PRO C 88  ? ASP C 91  ? PRO C 113 ASP C 116 5 ? 4  
HELX_P HELX_P38  AE2 SER C 92  ? HIS C 110 ? SER C 117 HIS C 135 1 ? 19 
HELX_P HELX_P39  AE3 PRO C 122 ? LYS C 147 ? PRO C 147 LYS C 172 1 ? 26 
HELX_P HELX_P40  AE4 GLY C 162 ? TYR C 170 ? GLY C 187 TYR C 195 1 ? 9  
HELX_P HELX_P41  AE5 GLN C 171 ? LEU C 179 ? GLN C 196 LEU C 204 1 ? 9  
HELX_P HELX_P42  AE6 ARG C 212 ? TYR C 218 ? ARG C 237 TYR C 243 5 ? 7  
HELX_P HELX_P43  AE7 ASN C 219 ? GLY C 231 ? ASN C 244 GLY C 256 1 ? 13 
HELX_P HELX_P44  AE8 PRO C 233 ? GLU C 235 ? PRO C 258 GLU C 260 5 ? 3  
HELX_P HELX_P45  AE9 TYR C 279 ? LYS C 287 ? TYR C 304 LYS C 312 1 ? 9  
HELX_P HELX_P46  AF1 ASP C 313 ? LEU C 327 ? ASP C 338 LEU C 352 1 ? 15 
HELX_P HELX_P47  AF2 SER C 336 ? ASP C 340 ? SER C 361 ASP C 365 5 ? 5  
HELX_P HELX_P48  AF3 TYR C 352 ? SER C 364 ? TYR C 377 SER C 389 1 ? 13 
HELX_P HELX_P49  AF4 TRP D 11  ? ARG D 15  ? TRP D 36  ARG D 40  5 ? 5  
HELX_P HELX_P50  AF5 THR D 22  ? ILE D 26  ? THR D 47  ILE D 51  5 ? 5  
HELX_P HELX_P51  AF6 SER D 52  ? ASN D 67  ? SER D 77  ASN D 92  1 ? 16 
HELX_P HELX_P52  AF7 SER D 83  ? HIS D 87  ? SER D 108 HIS D 112 5 ? 5  
HELX_P HELX_P53  AF8 PRO D 88  ? ASP D 91  ? PRO D 113 ASP D 116 5 ? 4  
HELX_P HELX_P54  AF9 SER D 92  ? HIS D 110 ? SER D 117 HIS D 135 1 ? 19 
HELX_P HELX_P55  AG1 PRO D 122 ? SER D 148 ? PRO D 147 SER D 173 1 ? 27 
HELX_P HELX_P56  AG2 GLY D 162 ? TYR D 170 ? GLY D 187 TYR D 195 1 ? 9  
HELX_P HELX_P57  AG3 GLN D 171 ? LEU D 179 ? GLN D 196 LEU D 204 1 ? 9  
HELX_P HELX_P58  AG4 ARG D 212 ? TYR D 218 ? ARG D 237 TYR D 243 5 ? 7  
HELX_P HELX_P59  AG5 ASN D 219 ? LYS D 230 ? ASN D 244 LYS D 255 1 ? 12 
HELX_P HELX_P60  AG6 PRO D 233 ? GLU D 235 ? PRO D 258 GLU D 260 5 ? 3  
HELX_P HELX_P61  AG7 TYR D 279 ? LEU D 286 ? TYR D 304 LEU D 311 1 ? 8  
HELX_P HELX_P62  AG8 ASP D 313 ? LEU D 327 ? ASP D 338 LEU D 352 1 ? 15 
HELX_P HELX_P63  AG9 SER D 336 ? ASP D 340 ? SER D 361 ASP D 365 5 ? 5  
HELX_P HELX_P64  AH1 TYR D 352 ? GLY D 363 ? TYR D 377 GLY D 388 1 ? 12 
HELX_P HELX_P65  AH2 TRP E 11  ? ARG E 15  ? TRP E 36  ARG E 40  5 ? 5  
HELX_P HELX_P66  AH3 THR E 22  ? ILE E 26  ? THR E 47  ILE E 51  5 ? 5  
HELX_P HELX_P67  AH4 SER E 52  ? ASN E 67  ? SER E 77  ASN E 92  1 ? 16 
HELX_P HELX_P68  AH5 SER E 83  ? HIS E 87  ? SER E 108 HIS E 112 5 ? 5  
HELX_P HELX_P69  AH6 PRO E 88  ? ASP E 91  ? PRO E 113 ASP E 116 5 ? 4  
HELX_P HELX_P70  AH7 SER E 92  ? HIS E 110 ? SER E 117 HIS E 135 1 ? 19 
HELX_P HELX_P71  AH8 PRO E 122 ? SER E 148 ? PRO E 147 SER E 173 1 ? 27 
HELX_P HELX_P72  AH9 GLY E 162 ? TYR E 170 ? GLY E 187 TYR E 195 1 ? 9  
HELX_P HELX_P73  AI1 GLN E 171 ? LEU E 179 ? GLN E 196 LEU E 204 1 ? 9  
HELX_P HELX_P74  AI2 ARG E 212 ? TYR E 218 ? ARG E 237 TYR E 243 5 ? 7  
HELX_P HELX_P75  AI3 ASN E 219 ? LYS E 230 ? ASN E 244 LYS E 255 1 ? 12 
HELX_P HELX_P76  AI4 PRO E 233 ? GLU E 235 ? PRO E 258 GLU E 260 5 ? 3  
HELX_P HELX_P77  AI5 TYR E 279 ? LEU E 286 ? TYR E 304 LEU E 311 1 ? 8  
HELX_P HELX_P78  AI6 ASP E 313 ? LEU E 327 ? ASP E 338 LEU E 352 1 ? 15 
HELX_P HELX_P79  AI7 SER E 336 ? ASP E 340 ? SER E 361 ASP E 365 5 ? 5  
HELX_P HELX_P80  AI8 TYR E 352 ? GLY E 363 ? TYR E 377 GLY E 388 1 ? 12 
HELX_P HELX_P81  AI9 TRP F 11  ? ARG F 15  ? TRP F 36  ARG F 40  5 ? 5  
HELX_P HELX_P82  AJ1 THR F 22  ? ILE F 26  ? THR F 47  ILE F 51  5 ? 5  
HELX_P HELX_P83  AJ2 SER F 52  ? ASN F 67  ? SER F 77  ASN F 92  1 ? 16 
HELX_P HELX_P84  AJ3 SER F 83  ? HIS F 87  ? SER F 108 HIS F 112 5 ? 5  
HELX_P HELX_P85  AJ4 PRO F 88  ? ASP F 91  ? PRO F 113 ASP F 116 5 ? 4  
HELX_P HELX_P86  AJ5 SER F 92  ? HIS F 110 ? SER F 117 HIS F 135 1 ? 19 
HELX_P HELX_P87  AJ6 PRO F 122 ? LYS F 147 ? PRO F 147 LYS F 172 1 ? 26 
HELX_P HELX_P88  AJ7 GLY F 162 ? TYR F 170 ? GLY F 187 TYR F 195 1 ? 9  
HELX_P HELX_P89  AJ8 GLN F 171 ? LEU F 179 ? GLN F 196 LEU F 204 1 ? 9  
HELX_P HELX_P90  AJ9 ARG F 212 ? TYR F 218 ? ARG F 237 TYR F 243 5 ? 7  
HELX_P HELX_P91  AK1 ASN F 219 ? LYS F 230 ? ASN F 244 LYS F 255 1 ? 12 
HELX_P HELX_P92  AK2 PRO F 233 ? GLU F 235 ? PRO F 258 GLU F 260 5 ? 3  
HELX_P HELX_P93  AK3 TYR F 279 ? LEU F 286 ? TYR F 304 LEU F 311 1 ? 8  
HELX_P HELX_P94  AK4 ASP F 313 ? LEU F 327 ? ASP F 338 LEU F 352 1 ? 15 
HELX_P HELX_P95  AK5 SER F 336 ? ASP F 340 ? SER F 361 ASP F 365 5 ? 5  
HELX_P HELX_P96  AK6 TYR F 352 ? SER F 364 ? TYR F 377 SER F 389 1 ? 13 
HELX_P HELX_P97  AK7 TRP G 11  ? ARG G 15  ? TRP G 36  ARG G 40  5 ? 5  
HELX_P HELX_P98  AK8 THR G 22  ? ILE G 26  ? THR G 47  ILE G 51  5 ? 5  
HELX_P HELX_P99  AK9 SER G 52  ? ASN G 67  ? SER G 77  ASN G 92  1 ? 16 
HELX_P HELX_P100 AL1 SER G 83  ? HIS G 87  ? SER G 108 HIS G 112 5 ? 5  
HELX_P HELX_P101 AL2 PRO G 88  ? ASP G 91  ? PRO G 113 ASP G 116 5 ? 4  
HELX_P HELX_P102 AL3 SER G 92  ? HIS G 110 ? SER G 117 HIS G 135 1 ? 19 
HELX_P HELX_P103 AL4 PRO G 122 ? THR G 146 ? PRO G 147 THR G 171 1 ? 25 
HELX_P HELX_P104 AL5 GLY G 162 ? TYR G 170 ? GLY G 187 TYR G 195 1 ? 9  
HELX_P HELX_P105 AL6 GLN G 171 ? LEU G 179 ? GLN G 196 LEU G 204 1 ? 9  
HELX_P HELX_P106 AL7 ARG G 212 ? TYR G 218 ? ARG G 237 TYR G 243 5 ? 7  
HELX_P HELX_P107 AL8 ASN G 219 ? LYS G 230 ? ASN G 244 LYS G 255 1 ? 12 
HELX_P HELX_P108 AL9 PRO G 233 ? GLU G 235 ? PRO G 258 GLU G 260 5 ? 3  
HELX_P HELX_P109 AM1 TYR G 279 ? LEU G 286 ? TYR G 304 LEU G 311 1 ? 8  
HELX_P HELX_P110 AM2 ASP G 313 ? LEU G 327 ? ASP G 338 LEU G 352 1 ? 15 
HELX_P HELX_P111 AM3 SER G 336 ? ASP G 340 ? SER G 361 ASP G 365 5 ? 5  
HELX_P HELX_P112 AM4 TYR G 352 ? SER G 364 ? TYR G 377 SER G 389 1 ? 13 
HELX_P HELX_P113 AM5 TRP H 11  ? ARG H 15  ? TRP H 36  ARG H 40  5 ? 5  
HELX_P HELX_P114 AM6 THR H 22  ? ILE H 26  ? THR H 47  ILE H 51  5 ? 5  
HELX_P HELX_P115 AM7 SER H 52  ? ASN H 67  ? SER H 77  ASN H 92  1 ? 16 
HELX_P HELX_P116 AM8 SER H 83  ? HIS H 87  ? SER H 108 HIS H 112 5 ? 5  
HELX_P HELX_P117 AM9 PRO H 88  ? ASP H 91  ? PRO H 113 ASP H 116 5 ? 4  
HELX_P HELX_P118 AN1 SER H 92  ? HIS H 110 ? SER H 117 HIS H 135 1 ? 19 
HELX_P HELX_P119 AN2 PRO H 122 ? LYS H 147 ? PRO H 147 LYS H 172 1 ? 26 
HELX_P HELX_P120 AN3 GLY H 162 ? TYR H 170 ? GLY H 187 TYR H 195 1 ? 9  
HELX_P HELX_P121 AN4 GLN H 171 ? LEU H 179 ? GLN H 196 LEU H 204 1 ? 9  
HELX_P HELX_P122 AN5 ARG H 212 ? TYR H 218 ? ARG H 237 TYR H 243 5 ? 7  
HELX_P HELX_P123 AN6 ASN H 219 ? LYS H 230 ? ASN H 244 LYS H 255 1 ? 12 
HELX_P HELX_P124 AN7 PRO H 233 ? GLU H 235 ? PRO H 258 GLU H 260 5 ? 3  
HELX_P HELX_P125 AN8 TYR H 279 ? LEU H 286 ? TYR H 304 LEU H 311 1 ? 8  
HELX_P HELX_P126 AN9 ASP H 313 ? LEU H 327 ? ASP H 338 LEU H 352 1 ? 15 
HELX_P HELX_P127 AO1 SER H 336 ? ASP H 340 ? SER H 361 ASP H 365 5 ? 5  
HELX_P HELX_P128 AO2 TYR H 352 ? SER H 364 ? TYR H 377 SER H 389 1 ? 13 
HELX_P HELX_P129 AO3 TRP I 11  ? ARG I 15  ? TRP I 36  ARG I 40  5 ? 5  
HELX_P HELX_P130 AO4 THR I 22  ? ILE I 26  ? THR I 47  ILE I 51  5 ? 5  
HELX_P HELX_P131 AO5 SER I 52  ? ASN I 67  ? SER I 77  ASN I 92  1 ? 16 
HELX_P HELX_P132 AO6 SER I 83  ? HIS I 87  ? SER I 108 HIS I 112 5 ? 5  
HELX_P HELX_P133 AO7 PRO I 88  ? ASP I 91  ? PRO I 113 ASP I 116 5 ? 4  
HELX_P HELX_P134 AO8 SER I 92  ? HIS I 110 ? SER I 117 HIS I 135 1 ? 19 
HELX_P HELX_P135 AO9 PRO I 122 ? LYS I 147 ? PRO I 147 LYS I 172 1 ? 26 
HELX_P HELX_P136 AP1 GLY I 162 ? TYR I 170 ? GLY I 187 TYR I 195 1 ? 9  
HELX_P HELX_P137 AP2 GLN I 171 ? LEU I 179 ? GLN I 196 LEU I 204 1 ? 9  
HELX_P HELX_P138 AP3 ARG I 212 ? TYR I 218 ? ARG I 237 TYR I 243 5 ? 7  
HELX_P HELX_P139 AP4 ASN I 219 ? GLY I 231 ? ASN I 244 GLY I 256 1 ? 13 
HELX_P HELX_P140 AP5 PRO I 233 ? GLU I 235 ? PRO I 258 GLU I 260 5 ? 3  
HELX_P HELX_P141 AP6 TYR I 279 ? LEU I 286 ? TYR I 304 LEU I 311 1 ? 8  
HELX_P HELX_P142 AP7 ASP I 313 ? LEU I 327 ? ASP I 338 LEU I 352 1 ? 15 
HELX_P HELX_P143 AP8 SER I 336 ? ASP I 340 ? SER I 361 ASP I 365 5 ? 5  
HELX_P HELX_P144 AP9 TYR I 352 ? SER I 364 ? TYR I 377 SER I 389 1 ? 13 
HELX_P HELX_P145 AQ1 TRP J 11  ? ARG J 15  ? TRP J 36  ARG J 40  5 ? 5  
HELX_P HELX_P146 AQ2 THR J 22  ? ILE J 26  ? THR J 47  ILE J 51  5 ? 5  
HELX_P HELX_P147 AQ3 SER J 52  ? ASN J 67  ? SER J 77  ASN J 92  1 ? 16 
HELX_P HELX_P148 AQ4 SER J 83  ? HIS J 87  ? SER J 108 HIS J 112 5 ? 5  
HELX_P HELX_P149 AQ5 PRO J 88  ? ASP J 91  ? PRO J 113 ASP J 116 5 ? 4  
HELX_P HELX_P150 AQ6 SER J 92  ? HIS J 110 ? SER J 117 HIS J 135 1 ? 19 
HELX_P HELX_P151 AQ7 PRO J 122 ? SER J 148 ? PRO J 147 SER J 173 1 ? 27 
HELX_P HELX_P152 AQ8 GLY J 162 ? TYR J 170 ? GLY J 187 TYR J 195 1 ? 9  
HELX_P HELX_P153 AQ9 GLN J 171 ? LEU J 179 ? GLN J 196 LEU J 204 1 ? 9  
HELX_P HELX_P154 AR1 ARG J 212 ? TYR J 218 ? ARG J 237 TYR J 243 5 ? 7  
HELX_P HELX_P155 AR2 ASN J 219 ? GLY J 231 ? ASN J 244 GLY J 256 1 ? 13 
HELX_P HELX_P156 AR3 PRO J 233 ? GLU J 235 ? PRO J 258 GLU J 260 5 ? 3  
HELX_P HELX_P157 AR4 TYR J 279 ? LEU J 286 ? TYR J 304 LEU J 311 1 ? 8  
HELX_P HELX_P158 AR5 ASP J 313 ? LEU J 327 ? ASP J 338 LEU J 352 1 ? 15 
HELX_P HELX_P159 AR6 SER J 336 ? ASP J 340 ? SER J 361 ASP J 365 5 ? 5  
HELX_P HELX_P160 AR7 TYR J 352 ? SER J 364 ? TYR J 377 SER J 389 1 ? 13 
HELX_P HELX_P161 AR8 TRP K 11  ? ARG K 15  ? TRP K 36  ARG K 40  5 ? 5  
HELX_P HELX_P162 AR9 THR K 22  ? ILE K 26  ? THR K 47  ILE K 51  5 ? 5  
HELX_P HELX_P163 AS1 SER K 52  ? ASN K 67  ? SER K 77  ASN K 92  1 ? 16 
HELX_P HELX_P164 AS2 SER K 83  ? HIS K 87  ? SER K 108 HIS K 112 5 ? 5  
HELX_P HELX_P165 AS3 PRO K 88  ? ASP K 91  ? PRO K 113 ASP K 116 5 ? 4  
HELX_P HELX_P166 AS4 SER K 92  ? HIS K 110 ? SER K 117 HIS K 135 1 ? 19 
HELX_P HELX_P167 AS5 PRO K 122 ? LYS K 147 ? PRO K 147 LYS K 172 1 ? 26 
HELX_P HELX_P168 AS6 GLY K 162 ? TYR K 170 ? GLY K 187 TYR K 195 1 ? 9  
HELX_P HELX_P169 AS7 GLN K 171 ? LEU K 179 ? GLN K 196 LEU K 204 1 ? 9  
HELX_P HELX_P170 AS8 ARG K 212 ? TYR K 218 ? ARG K 237 TYR K 243 5 ? 7  
HELX_P HELX_P171 AS9 ASN K 219 ? LYS K 230 ? ASN K 244 LYS K 255 1 ? 12 
HELX_P HELX_P172 AT1 PRO K 233 ? GLU K 235 ? PRO K 258 GLU K 260 5 ? 3  
HELX_P HELX_P173 AT2 TYR K 279 ? LEU K 286 ? TYR K 304 LEU K 311 1 ? 8  
HELX_P HELX_P174 AT3 ASP K 313 ? LEU K 327 ? ASP K 338 LEU K 352 1 ? 15 
HELX_P HELX_P175 AT4 SER K 336 ? ASP K 340 ? SER K 361 ASP K 365 5 ? 5  
HELX_P HELX_P176 AT5 TYR K 352 ? SER K 364 ? TYR K 377 SER K 389 1 ? 13 
HELX_P HELX_P177 AT6 TRP L 11  ? ARG L 15  ? TRP L 36  ARG L 40  5 ? 5  
HELX_P HELX_P178 AT7 THR L 22  ? ILE L 26  ? THR L 47  ILE L 51  5 ? 5  
HELX_P HELX_P179 AT8 SER L 52  ? ASN L 67  ? SER L 77  ASN L 92  1 ? 16 
HELX_P HELX_P180 AT9 SER L 83  ? HIS L 87  ? SER L 108 HIS L 112 5 ? 5  
HELX_P HELX_P181 AU1 PRO L 88  ? ASP L 91  ? PRO L 113 ASP L 116 5 ? 4  
HELX_P HELX_P182 AU2 SER L 92  ? HIS L 110 ? SER L 117 HIS L 135 1 ? 19 
HELX_P HELX_P183 AU3 PRO L 122 ? SER L 148 ? PRO L 147 SER L 173 1 ? 27 
HELX_P HELX_P184 AU4 GLY L 162 ? TYR L 170 ? GLY L 187 TYR L 195 1 ? 9  
HELX_P HELX_P185 AU5 GLN L 171 ? LEU L 179 ? GLN L 196 LEU L 204 1 ? 9  
HELX_P HELX_P186 AU6 ARG L 212 ? TYR L 218 ? ARG L 237 TYR L 243 5 ? 7  
HELX_P HELX_P187 AU7 ASN L 219 ? GLY L 231 ? ASN L 244 GLY L 256 1 ? 13 
HELX_P HELX_P188 AU8 PRO L 233 ? GLU L 235 ? PRO L 258 GLU L 260 5 ? 3  
HELX_P HELX_P189 AU9 TYR L 279 ? LEU L 286 ? TYR L 304 LEU L 311 1 ? 8  
HELX_P HELX_P190 AV1 ASP L 313 ? LEU L 327 ? ASP L 338 LEU L 352 1 ? 15 
HELX_P HELX_P191 AV2 SER L 336 ? ASP L 340 ? SER L 361 ASP L 365 5 ? 5  
HELX_P HELX_P192 AV3 TYR L 352 ? GLY L 363 ? TYR L 377 GLY L 388 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 6   SG ? ? ? 1_555 A CYS 31  SG ? ? A CYS 31  A CYS 56  1_555 ? ? ? ? ? ? ? 2.060 ? ? 
disulf2  disulf ?    ? A CYS 283 SG ? ? ? 1_555 A CYS 347 SG ? ? A CYS 308 A CYS 372 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
disulf3  disulf ?    ? B CYS 6   SG ? ? ? 1_555 B CYS 31  SG ? ? B CYS 31  B CYS 56  1_555 ? ? ? ? ? ? ? 2.051 ? ? 
disulf4  disulf ?    ? B CYS 283 SG ? ? ? 1_555 B CYS 347 SG ? ? B CYS 308 B CYS 372 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
disulf5  disulf ?    ? C CYS 6   SG ? ? ? 1_555 C CYS 31  SG ? ? C CYS 31  C CYS 56  1_555 ? ? ? ? ? ? ? 2.017 ? ? 
disulf6  disulf ?    ? C CYS 283 SG ? ? ? 1_555 C CYS 347 SG ? ? C CYS 308 C CYS 372 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
disulf7  disulf ?    ? D CYS 6   SG ? ? ? 1_555 D CYS 31  SG ? ? D CYS 31  D CYS 56  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf8  disulf ?    ? D CYS 283 SG ? ? ? 1_555 D CYS 347 SG ? ? D CYS 308 D CYS 372 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
disulf9  disulf ?    ? E CYS 6   SG ? ? ? 1_555 E CYS 31  SG ? ? E CYS 31  E CYS 56  1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf10 disulf ?    ? E CYS 283 SG ? ? ? 1_555 E CYS 347 SG ? ? E CYS 308 E CYS 372 1_555 ? ? ? ? ? ? ? 2.096 ? ? 
disulf11 disulf ?    ? F CYS 6   SG ? ? ? 1_555 F CYS 31  SG ? ? F CYS 31  F CYS 56  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf12 disulf ?    ? F CYS 283 SG ? ? ? 1_555 F CYS 347 SG ? ? F CYS 308 F CYS 372 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
disulf13 disulf ?    ? G CYS 6   SG ? ? ? 1_555 G CYS 31  SG ? ? G CYS 31  G CYS 56  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf14 disulf ?    ? G CYS 283 SG ? ? ? 1_555 G CYS 347 SG ? ? G CYS 308 G CYS 372 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
disulf15 disulf ?    ? H CYS 6   SG ? ? ? 1_555 H CYS 31  SG ? ? H CYS 31  H CYS 56  1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf16 disulf ?    ? H CYS 283 SG ? ? ? 1_555 H CYS 347 SG ? ? H CYS 308 H CYS 372 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
disulf17 disulf ?    ? I CYS 6   SG ? ? ? 1_555 I CYS 31  SG ? ? I CYS 31  I CYS 56  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf18 disulf ?    ? I CYS 283 SG ? ? ? 1_555 I CYS 347 SG ? ? I CYS 308 I CYS 372 1_555 ? ? ? ? ? ? ? 2.052 ? ? 
disulf19 disulf ?    ? J CYS 6   SG ? ? ? 1_555 J CYS 31  SG ? ? J CYS 31  J CYS 56  1_555 ? ? ? ? ? ? ? 2.045 ? ? 
disulf20 disulf ?    ? J CYS 283 SG ? ? ? 1_555 J CYS 347 SG ? ? J CYS 308 J CYS 372 1_555 ? ? ? ? ? ? ? 2.063 ? ? 
disulf21 disulf ?    ? K CYS 6   SG ? ? ? 1_555 K CYS 31  SG ? ? K CYS 31  K CYS 56  1_555 ? ? ? ? ? ? ? 2.054 ? ? 
disulf22 disulf ?    ? K CYS 283 SG ? ? ? 1_555 K CYS 347 SG ? ? K CYS 308 K CYS 372 1_555 ? ? ? ? ? ? ? 2.059 ? ? 
disulf23 disulf ?    ? L CYS 6   SG ? ? ? 1_555 L CYS 31  SG ? ? L CYS 31  L CYS 56  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf24 disulf ?    ? L CYS 283 SG ? ? ? 1_555 L CYS 347 SG ? ? L CYS 308 L CYS 372 1_555 ? ? ? ? ? ? ? 2.084 ? ? 
covale1  covale both ? M NAG .   O4 ? ? ? 1_555 M NAG .   C1 ? ? M NAG 1   M NAG 2   1_555 ? ? ? ? ? ? ? 1.429 ? ? 
covale2  covale both ? M NAG .   O4 ? ? ? 1_555 M NAG .   C1 ? ? M NAG 2   M NAG 3   1_555 ? ? ? ? ? ? ? 1.425 ? ? 
covale3  covale both ? M NAG .   O4 ? ? ? 1_555 M NAG .   C1 ? ? M NAG 3   M NAG 4   1_555 ? ? ? ? ? ? ? 1.424 ? ? 
covale4  covale both ? N NAG .   O4 ? ? ? 1_555 N NAG .   C1 ? ? N NAG 1   N NAG 2   1_555 ? ? ? ? ? ? ? 1.422 ? ? 
covale5  covale both ? N NAG .   O4 ? ? ? 1_555 N NAG .   C1 ? ? N NAG 2   N NAG 3   1_555 ? ? ? ? ? ? ? 1.450 ? ? 
covale6  covale both ? N NAG .   O4 ? ? ? 1_555 N NAG .   C1 ? ? N NAG 3   N NAG 4   1_555 ? ? ? ? ? ? ? 1.424 ? ? 
covale7  covale both ? O NAG .   O4 ? ? ? 1_555 O NAG .   C1 ? ? O NAG 1   O NAG 2   1_555 ? ? ? ? ? ? ? 1.446 ? ? 
covale8  covale both ? O NAG .   O4 ? ? ? 1_555 O NAG .   C1 ? ? O NAG 2   O NAG 3   1_555 ? ? ? ? ? ? ? 1.452 ? ? 
covale9  covale both ? O NAG .   O4 ? ? ? 1_555 O NAG .   C1 ? ? O NAG 3   O NAG 4   1_555 ? ? ? ? ? ? ? 1.405 ? ? 
covale10 covale both ? P NAG .   O4 ? ? ? 1_555 P NAG .   C1 ? ? P NAG 1   P NAG 2   1_555 ? ? ? ? ? ? ? 1.455 ? ? 
covale11 covale both ? P NAG .   O4 ? ? ? 1_555 P NAG .   C1 ? ? P NAG 2   P NAG 3   1_555 ? ? ? ? ? ? ? 1.445 ? ? 
covale12 covale both ? P NAG .   O4 ? ? ? 1_555 P NAG .   C1 ? ? P NAG 3   P NAG 4   1_555 ? ? ? ? ? ? ? 1.417 ? ? 
covale13 covale both ? Q NAG .   O4 ? ? ? 1_555 Q NAG .   C1 ? ? Q NAG 1   Q NAG 2   1_555 ? ? ? ? ? ? ? 1.417 ? ? 
covale14 covale both ? Q NAG .   O4 ? ? ? 1_555 Q NAG .   C1 ? ? Q NAG 2   Q NAG 3   1_555 ? ? ? ? ? ? ? 1.452 ? ? 
covale15 covale both ? Q NAG .   O4 ? ? ? 1_555 Q NAG .   C1 ? ? Q NAG 3   Q NAG 4   1_555 ? ? ? ? ? ? ? 1.408 ? ? 
covale16 covale both ? R NAG .   O4 ? ? ? 1_555 R NAG .   C1 ? ? R NAG 1   R NAG 2   1_555 ? ? ? ? ? ? ? 1.416 ? ? 
covale17 covale both ? R NAG .   O4 ? ? ? 1_555 R NAG .   C1 ? ? R NAG 2   R NAG 3   1_555 ? ? ? ? ? ? ? 1.460 ? ? 
covale18 covale both ? R NAG .   O4 ? ? ? 1_555 R NAG .   C1 ? ? R NAG 3   R NAG 4   1_555 ? ? ? ? ? ? ? 1.418 ? ? 
covale19 covale both ? S NAG .   O4 ? ? ? 1_555 S NAG .   C1 ? ? S NAG 1   S NAG 2   1_555 ? ? ? ? ? ? ? 1.412 ? ? 
covale20 covale both ? S NAG .   O4 ? ? ? 1_555 S NAG .   C1 ? ? S NAG 2   S NAG 3   1_555 ? ? ? ? ? ? ? 1.466 ? ? 
covale21 covale both ? S NAG .   O4 ? ? ? 1_555 S NAG .   C1 ? ? S NAG 3   S NAG 4   1_555 ? ? ? ? ? ? ? 1.408 ? ? 
covale22 covale both ? T NAG .   O4 ? ? ? 1_555 T NAG .   C1 ? ? T NAG 1   T NAG 2   1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale23 covale both ? T NAG .   O4 ? ? ? 1_555 T NAG .   C1 ? ? T NAG 2   T NAG 3   1_555 ? ? ? ? ? ? ? 1.432 ? ? 
covale24 covale both ? T NAG .   O4 ? ? ? 1_555 T NAG .   C1 ? ? T NAG 3   T NAG 4   1_555 ? ? ? ? ? ? ? 1.390 ? ? 
covale25 covale both ? U NAG .   O4 ? ? ? 1_555 U NAG .   C1 ? ? U NAG 1   U NAG 2   1_555 ? ? ? ? ? ? ? 1.410 ? ? 
covale26 covale both ? U NAG .   O4 ? ? ? 1_555 U NAG .   C1 ? ? U NAG 2   U NAG 3   1_555 ? ? ? ? ? ? ? 1.448 ? ? 
covale27 covale both ? U NAG .   O4 ? ? ? 1_555 U NAG .   C1 ? ? U NAG 3   U NAG 4   1_555 ? ? ? ? ? ? ? 1.410 ? ? 
covale28 covale both ? V NAG .   O4 ? ? ? 1_555 V NAG .   C1 ? ? V NAG 1   V NAG 2   1_555 ? ? ? ? ? ? ? 1.430 ? ? 
covale29 covale both ? V NAG .   O4 ? ? ? 1_555 V NAG .   C1 ? ? V NAG 2   V NAG 3   1_555 ? ? ? ? ? ? ? 1.473 ? ? 
covale30 covale both ? V NAG .   O4 ? ? ? 1_555 V NAG .   C1 ? ? V NAG 3   V NAG 4   1_555 ? ? ? ? ? ? ? 1.426 ? ? 
covale31 covale both ? W NAG .   O4 ? ? ? 1_555 W NAG .   C1 ? ? W NAG 1   W NAG 2   1_555 ? ? ? ? ? ? ? 1.415 ? ? 
covale32 covale both ? W NAG .   O4 ? ? ? 1_555 W NAG .   C1 ? ? W NAG 2   W NAG 3   1_555 ? ? ? ? ? ? ? 1.406 ? ? 
covale33 covale both ? W NAG .   O4 ? ? ? 1_555 W NAG .   C1 ? ? W NAG 3   W NAG 4   1_555 ? ? ? ? ? ? ? 1.439 ? ? 
covale34 covale both ? X NAG .   O4 ? ? ? 1_555 X NAG .   C1 ? ? X NAG 1   X NAG 2   1_555 ? ? ? ? ? ? ? 1.419 ? ? 
covale35 covale both ? X NAG .   O4 ? ? ? 1_555 X NAG .   C1 ? ? X NAG 2   X NAG 3   1_555 ? ? ? ? ? ? ? 1.441 ? ? 
covale36 covale both ? X NAG .   O4 ? ? ? 1_555 X NAG .   C1 ? ? X NAG 3   X NAG 4   1_555 ? ? ? ? ? ? ? 1.436 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 17  A . ? GLU 42  A PRO 18  A ? PRO 43  A 1 5.91   
2  SER 37  A . ? SER 62  A PHE 38  A ? PHE 63  A 1 -3.44  
3  HIS 87  A . ? HIS 112 A PRO 88  A ? PRO 113 A 1 4.84   
4  ILE 120 A . ? ILE 145 A TYR 121 A ? TYR 146 A 1 -11.39 
5  LYS 195 A . ? LYS 220 A PRO 196 A ? PRO 221 A 1 0.11   
6  TRP 335 A . ? TRP 360 A SER 336 A ? SER 361 A 1 -4.18  
7  GLU 17  B . ? GLU 42  B PRO 18  B ? PRO 43  B 1 3.02   
8  SER 37  B . ? SER 62  B PHE 38  B ? PHE 63  B 1 -1.78  
9  HIS 87  B . ? HIS 112 B PRO 88  B ? PRO 113 B 1 8.72   
10 ILE 120 B . ? ILE 145 B TYR 121 B ? TYR 146 B 1 -8.93  
11 LYS 195 B . ? LYS 220 B PRO 196 B ? PRO 221 B 1 0.36   
12 TRP 335 B . ? TRP 360 B SER 336 B ? SER 361 B 1 -4.32  
13 GLU 17  C . ? GLU 42  C PRO 18  C ? PRO 43  C 1 0.98   
14 SER 37  C . ? SER 62  C PHE 38  C ? PHE 63  C 1 -4.39  
15 HIS 87  C . ? HIS 112 C PRO 88  C ? PRO 113 C 1 5.19   
16 ILE 120 C . ? ILE 145 C TYR 121 C ? TYR 146 C 1 -9.43  
17 LYS 195 C . ? LYS 220 C PRO 196 C ? PRO 221 C 1 0.93   
18 TRP 335 C . ? TRP 360 C SER 336 C ? SER 361 C 1 -6.69  
19 GLU 17  D . ? GLU 42  D PRO 18  D ? PRO 43  D 1 4.21   
20 SER 37  D . ? SER 62  D PHE 38  D ? PHE 63  D 1 -3.06  
21 HIS 87  D . ? HIS 112 D PRO 88  D ? PRO 113 D 1 4.26   
22 ILE 120 D . ? ILE 145 D TYR 121 D ? TYR 146 D 1 -7.46  
23 SER 148 D . ? SER 173 D THR 149 D ? THR 174 D 1 -10.11 
24 LYS 195 D . ? LYS 220 D PRO 196 D ? PRO 221 D 1 3.90   
25 TRP 335 D . ? TRP 360 D SER 336 D ? SER 361 D 1 -6.97  
26 GLU 17  E . ? GLU 42  E PRO 18  E ? PRO 43  E 1 6.44   
27 SER 37  E . ? SER 62  E PHE 38  E ? PHE 63  E 1 -5.17  
28 HIS 87  E . ? HIS 112 E PRO 88  E ? PRO 113 E 1 7.66   
29 ILE 120 E . ? ILE 145 E TYR 121 E ? TYR 146 E 1 -4.00  
30 LYS 195 E . ? LYS 220 E PRO 196 E ? PRO 221 E 1 1.34   
31 TRP 335 E . ? TRP 360 E SER 336 E ? SER 361 E 1 -3.24  
32 GLU 17  F . ? GLU 42  F PRO 18  F ? PRO 43  F 1 5.78   
33 SER 37  F . ? SER 62  F PHE 38  F ? PHE 63  F 1 -0.51  
34 HIS 87  F . ? HIS 112 F PRO 88  F ? PRO 113 F 1 6.71   
35 ILE 120 F . ? ILE 145 F TYR 121 F ? TYR 146 F 1 -5.85  
36 LYS 195 F . ? LYS 220 F PRO 196 F ? PRO 221 F 1 -2.09  
37 TRP 335 F . ? TRP 360 F SER 336 F ? SER 361 F 1 -7.18  
38 GLU 17  G . ? GLU 42  G PRO 18  G ? PRO 43  G 1 4.09   
39 SER 37  G . ? SER 62  G PHE 38  G ? PHE 63  G 1 -3.70  
40 HIS 87  G . ? HIS 112 G PRO 88  G ? PRO 113 G 1 7.88   
41 ILE 120 G . ? ILE 145 G TYR 121 G ? TYR 146 G 1 -7.55  
42 LYS 195 G . ? LYS 220 G PRO 196 G ? PRO 221 G 1 0.28   
43 TRP 335 G . ? TRP 360 G SER 336 G ? SER 361 G 1 -7.37  
44 GLU 17  H . ? GLU 42  H PRO 18  H ? PRO 43  H 1 -2.74  
45 SER 37  H . ? SER 62  H PHE 38  H ? PHE 63  H 1 -3.10  
46 HIS 87  H . ? HIS 112 H PRO 88  H ? PRO 113 H 1 6.11   
47 ILE 120 H . ? ILE 145 H TYR 121 H ? TYR 146 H 1 -7.05  
48 LYS 195 H . ? LYS 220 H PRO 196 H ? PRO 221 H 1 2.69   
49 TRP 335 H . ? TRP 360 H SER 336 H ? SER 361 H 1 -10.50 
50 GLU 17  I . ? GLU 42  I PRO 18  I ? PRO 43  I 1 1.95   
51 SER 37  I . ? SER 62  I PHE 38  I ? PHE 63  I 1 -3.01  
52 HIS 87  I . ? HIS 112 I PRO 88  I ? PRO 113 I 1 3.57   
53 ILE 120 I . ? ILE 145 I TYR 121 I ? TYR 146 I 1 -9.99  
54 LYS 195 I . ? LYS 220 I PRO 196 I ? PRO 221 I 1 2.14   
55 TRP 335 I . ? TRP 360 I SER 336 I ? SER 361 I 1 -5.14  
56 GLU 17  J . ? GLU 42  J PRO 18  J ? PRO 43  J 1 5.23   
57 SER 37  J . ? SER 62  J PHE 38  J ? PHE 63  J 1 -7.11  
58 HIS 87  J . ? HIS 112 J PRO 88  J ? PRO 113 J 1 2.06   
59 ILE 120 J . ? ILE 145 J TYR 121 J ? TYR 146 J 1 -3.75  
60 LYS 195 J . ? LYS 220 J PRO 196 J ? PRO 221 J 1 5.14   
61 TRP 335 J . ? TRP 360 J SER 336 J ? SER 361 J 1 -7.44  
62 GLU 17  K . ? GLU 42  K PRO 18  K ? PRO 43  K 1 2.29   
63 SER 37  K . ? SER 62  K PHE 38  K ? PHE 63  K 1 -1.43  
64 HIS 87  K . ? HIS 112 K PRO 88  K ? PRO 113 K 1 6.82   
65 ILE 120 K . ? ILE 145 K TYR 121 K ? TYR 146 K 1 -6.11  
66 LYS 195 K . ? LYS 220 K PRO 196 K ? PRO 221 K 1 2.95   
67 TRP 335 K . ? TRP 360 K SER 336 K ? SER 361 K 1 -8.29  
68 GLU 17  L . ? GLU 42  L PRO 18  L ? PRO 43  L 1 3.63   
69 SER 37  L . ? SER 62  L PHE 38  L ? PHE 63  L 1 -5.01  
70 HIS 87  L . ? HIS 112 L PRO 88  L ? PRO 113 L 1 11.67  
71 ILE 120 L . ? ILE 145 L TYR 121 L ? TYR 146 L 1 -10.41 
72 LYS 195 L . ? LYS 220 L PRO 196 L ? PRO 221 L 1 2.67   
73 TRP 335 L . ? TRP 360 L SER 336 L ? SER 361 L 1 -8.57  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 3  ? 
AA3 ? 5  ? 
AA4 ? 10 ? 
AA5 ? 3  ? 
AA6 ? 5  ? 
AA7 ? 10 ? 
AA8 ? 3  ? 
AA9 ? 5  ? 
AB1 ? 10 ? 
AB2 ? 3  ? 
AB3 ? 5  ? 
AB4 ? 10 ? 
AB5 ? 3  ? 
AB6 ? 5  ? 
AB7 ? 10 ? 
AB8 ? 3  ? 
AB9 ? 5  ? 
AC1 ? 10 ? 
AC2 ? 3  ? 
AC3 ? 5  ? 
AC4 ? 10 ? 
AC5 ? 3  ? 
AC6 ? 5  ? 
AC7 ? 10 ? 
AC8 ? 3  ? 
AC9 ? 5  ? 
AD1 ? 10 ? 
AD2 ? 3  ? 
AD3 ? 5  ? 
AD4 ? 10 ? 
AD5 ? 3  ? 
AD6 ? 5  ? 
AD7 ? 10 ? 
AD8 ? 3  ? 
AD9 ? 5  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? parallel      
AA1 5 6  ? parallel      
AA1 6 7  ? parallel      
AA1 7 8  ? parallel      
AA1 8 9  ? parallel      
AA1 9 10 ? parallel      
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
AA3 3 4  ? anti-parallel 
AA3 4 5  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA4 2 3  ? parallel      
AA4 3 4  ? parallel      
AA4 4 5  ? parallel      
AA4 5 6  ? parallel      
AA4 6 7  ? parallel      
AA4 7 8  ? parallel      
AA4 8 9  ? parallel      
AA4 9 10 ? parallel      
AA5 1 2  ? anti-parallel 
AA5 2 3  ? anti-parallel 
AA6 1 2  ? anti-parallel 
AA6 2 3  ? anti-parallel 
AA6 3 4  ? anti-parallel 
AA6 4 5  ? anti-parallel 
AA7 1 2  ? anti-parallel 
AA7 2 3  ? parallel      
AA7 3 4  ? parallel      
AA7 4 5  ? parallel      
AA7 5 6  ? parallel      
AA7 6 7  ? parallel      
AA7 7 8  ? parallel      
AA7 8 9  ? parallel      
AA7 9 10 ? parallel      
AA8 1 2  ? anti-parallel 
AA8 2 3  ? anti-parallel 
AA9 1 2  ? anti-parallel 
AA9 2 3  ? anti-parallel 
AA9 3 4  ? anti-parallel 
AA9 4 5  ? anti-parallel 
AB1 1 2  ? anti-parallel 
AB1 2 3  ? parallel      
AB1 3 4  ? parallel      
AB1 4 5  ? parallel      
AB1 5 6  ? parallel      
AB1 6 7  ? parallel      
AB1 7 8  ? parallel      
AB1 8 9  ? parallel      
AB1 9 10 ? parallel      
AB2 1 2  ? anti-parallel 
AB2 2 3  ? anti-parallel 
AB3 1 2  ? anti-parallel 
AB3 2 3  ? anti-parallel 
AB3 3 4  ? anti-parallel 
AB3 4 5  ? anti-parallel 
AB4 1 2  ? anti-parallel 
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? parallel      
AB4 5 6  ? parallel      
AB4 6 7  ? parallel      
AB4 7 8  ? parallel      
AB4 8 9  ? parallel      
AB4 9 10 ? parallel      
AB5 1 2  ? anti-parallel 
AB5 2 3  ? anti-parallel 
AB6 1 2  ? anti-parallel 
AB6 2 3  ? anti-parallel 
AB6 3 4  ? anti-parallel 
AB6 4 5  ? anti-parallel 
AB7 1 2  ? anti-parallel 
AB7 2 3  ? parallel      
AB7 3 4  ? parallel      
AB7 4 5  ? parallel      
AB7 5 6  ? parallel      
AB7 6 7  ? parallel      
AB7 7 8  ? parallel      
AB7 8 9  ? parallel      
AB7 9 10 ? parallel      
AB8 1 2  ? anti-parallel 
AB8 2 3  ? anti-parallel 
AB9 1 2  ? anti-parallel 
AB9 2 3  ? anti-parallel 
AB9 3 4  ? anti-parallel 
AB9 4 5  ? anti-parallel 
AC1 1 2  ? anti-parallel 
AC1 2 3  ? parallel      
AC1 3 4  ? parallel      
AC1 4 5  ? parallel      
AC1 5 6  ? parallel      
AC1 6 7  ? parallel      
AC1 7 8  ? parallel      
AC1 8 9  ? parallel      
AC1 9 10 ? parallel      
AC2 1 2  ? anti-parallel 
AC2 2 3  ? anti-parallel 
AC3 1 2  ? anti-parallel 
AC3 2 3  ? anti-parallel 
AC3 3 4  ? anti-parallel 
AC3 4 5  ? anti-parallel 
AC4 1 2  ? anti-parallel 
AC4 2 3  ? parallel      
AC4 3 4  ? parallel      
AC4 4 5  ? parallel      
AC4 5 6  ? parallel      
AC4 6 7  ? parallel      
AC4 7 8  ? parallel      
AC4 8 9  ? parallel      
AC4 9 10 ? parallel      
AC5 1 2  ? anti-parallel 
AC5 2 3  ? anti-parallel 
AC6 1 2  ? anti-parallel 
AC6 2 3  ? anti-parallel 
AC6 3 4  ? anti-parallel 
AC6 4 5  ? anti-parallel 
AC7 1 2  ? anti-parallel 
AC7 2 3  ? parallel      
AC7 3 4  ? parallel      
AC7 4 5  ? parallel      
AC7 5 6  ? parallel      
AC7 6 7  ? parallel      
AC7 7 8  ? parallel      
AC7 8 9  ? parallel      
AC7 9 10 ? parallel      
AC8 1 2  ? anti-parallel 
AC8 2 3  ? anti-parallel 
AC9 1 2  ? anti-parallel 
AC9 2 3  ? anti-parallel 
AC9 3 4  ? anti-parallel 
AC9 4 5  ? anti-parallel 
AD1 1 2  ? anti-parallel 
AD1 2 3  ? parallel      
AD1 3 4  ? parallel      
AD1 4 5  ? parallel      
AD1 5 6  ? parallel      
AD1 6 7  ? parallel      
AD1 7 8  ? parallel      
AD1 8 9  ? parallel      
AD1 9 10 ? parallel      
AD2 1 2  ? anti-parallel 
AD2 2 3  ? anti-parallel 
AD3 1 2  ? anti-parallel 
AD3 2 3  ? anti-parallel 
AD3 3 4  ? anti-parallel 
AD3 4 5  ? anti-parallel 
AD4 1 2  ? anti-parallel 
AD4 2 3  ? parallel      
AD4 3 4  ? parallel      
AD4 4 5  ? parallel      
AD4 5 6  ? parallel      
AD4 6 7  ? parallel      
AD4 7 8  ? parallel      
AD4 8 9  ? parallel      
AD4 9 10 ? parallel      
AD5 1 2  ? anti-parallel 
AD5 2 3  ? anti-parallel 
AD6 1 2  ? anti-parallel 
AD6 2 3  ? anti-parallel 
AD6 3 4  ? anti-parallel 
AD6 4 5  ? anti-parallel 
AD7 1 2  ? anti-parallel 
AD7 2 3  ? parallel      
AD7 3 4  ? parallel      
AD7 4 5  ? parallel      
AD7 5 6  ? parallel      
AD7 6 7  ? parallel      
AD7 7 8  ? parallel      
AD7 8 9  ? parallel      
AD7 9 10 ? parallel      
AD8 1 2  ? anti-parallel 
AD8 2 3  ? anti-parallel 
AD9 1 2  ? anti-parallel 
AD9 2 3  ? anti-parallel 
AD9 3 4  ? anti-parallel 
AD9 4 5  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LYS A 45  ? ILE A 47  ? LYS A 70  ILE A 72  
AA1 2  HIS A 33  ? GLU A 42  ? HIS A 58  GLU A 67  
AA1 3  LYS A 71  ? GLY A 78  ? LYS A 96  GLY A 103 
AA1 4  GLY A 114 ? TRP A 119 ? GLY A 139 TRP A 144 
AA1 5  LEU A 154 ? SER A 160 ? LEU A 179 SER A 185 
AA1 6  PHE A 181 ? LEU A 185 ? PHE A 206 LEU A 210 
AA1 7  VAL A 237 ? PRO A 242 ? VAL A 262 PRO A 267 
AA1 8  GLY A 331 ? TRP A 335 ? GLY A 356 TRP A 360 
AA1 9  LYS A 3   ? THR A 9   ? LYS A 28  THR A 34  
AA1 10 HIS A 33  ? GLU A 42  ? HIS A 58  GLU A 67  
AA2 1  ALA A 261 ? PRO A 264 ? ALA A 286 PRO A 289 
AA2 2  TYR A 244 ? LEU A 250 ? TYR A 269 LEU A 275 
AA2 3  PHE A 276 ? ALA A 278 ? PHE A 301 ALA A 303 
AA3 1  ALA A 261 ? PRO A 264 ? ALA A 286 PRO A 289 
AA3 2  TYR A 244 ? LEU A 250 ? TYR A 269 LEU A 275 
AA3 3  GLN A 307 ? GLY A 310 ? GLN A 332 GLY A 335 
AA3 4  PRO A 300 ? LYS A 304 ? PRO A 325 LYS A 329 
AA3 5  LYS A 290 ? ARG A 293 ? LYS A 315 ARG A 318 
AA4 1  LYS B 45  ? ILE B 47  ? LYS B 70  ILE B 72  
AA4 2  HIS B 33  ? GLU B 42  ? HIS B 58  GLU B 67  
AA4 3  LYS B 71  ? GLY B 78  ? LYS B 96  GLY B 103 
AA4 4  GLY B 114 ? TRP B 119 ? GLY B 139 TRP B 144 
AA4 5  LEU B 154 ? SER B 160 ? LEU B 179 SER B 185 
AA4 6  PHE B 181 ? LEU B 185 ? PHE B 206 LEU B 210 
AA4 7  VAL B 237 ? PRO B 242 ? VAL B 262 PRO B 267 
AA4 8  GLY B 331 ? TRP B 335 ? GLY B 356 TRP B 360 
AA4 9  LYS B 3   ? THR B 9   ? LYS B 28  THR B 34  
AA4 10 HIS B 33  ? GLU B 42  ? HIS B 58  GLU B 67  
AA5 1  ALA B 261 ? PRO B 264 ? ALA B 286 PRO B 289 
AA5 2  TYR B 244 ? LEU B 250 ? TYR B 269 LEU B 275 
AA5 3  PHE B 276 ? ALA B 278 ? PHE B 301 ALA B 303 
AA6 1  ALA B 261 ? PRO B 264 ? ALA B 286 PRO B 289 
AA6 2  TYR B 244 ? LEU B 250 ? TYR B 269 LEU B 275 
AA6 3  GLN B 307 ? GLY B 310 ? GLN B 332 GLY B 335 
AA6 4  PRO B 300 ? LYS B 304 ? PRO B 325 LYS B 329 
AA6 5  LYS B 290 ? ARG B 293 ? LYS B 315 ARG B 318 
AA7 1  LYS C 45  ? ILE C 47  ? LYS C 70  ILE C 72  
AA7 2  HIS C 33  ? GLU C 42  ? HIS C 58  GLU C 67  
AA7 3  LYS C 71  ? GLY C 77  ? LYS C 96  GLY C 102 
AA7 4  GLY C 114 ? SER C 118 ? GLY C 139 SER C 143 
AA7 5  LEU C 154 ? SER C 160 ? LEU C 179 SER C 185 
AA7 6  PHE C 181 ? LEU C 185 ? PHE C 206 LEU C 210 
AA7 7  VAL C 237 ? PRO C 242 ? VAL C 262 PRO C 267 
AA7 8  GLY C 331 ? TRP C 335 ? GLY C 356 TRP C 360 
AA7 9  LYS C 3   ? THR C 9   ? LYS C 28  THR C 34  
AA7 10 HIS C 33  ? GLU C 42  ? HIS C 58  GLU C 67  
AA8 1  ALA C 261 ? PRO C 264 ? ALA C 286 PRO C 289 
AA8 2  TYR C 244 ? LEU C 250 ? TYR C 269 LEU C 275 
AA8 3  PHE C 276 ? ALA C 278 ? PHE C 301 ALA C 303 
AA9 1  ALA C 261 ? PRO C 264 ? ALA C 286 PRO C 289 
AA9 2  TYR C 244 ? LEU C 250 ? TYR C 269 LEU C 275 
AA9 3  GLN C 307 ? GLY C 310 ? GLN C 332 GLY C 335 
AA9 4  PRO C 300 ? LYS C 304 ? PRO C 325 LYS C 329 
AA9 5  LYS C 290 ? ARG C 293 ? LYS C 315 ARG C 318 
AB1 1  LYS D 45  ? ILE D 47  ? LYS D 70  ILE D 72  
AB1 2  HIS D 33  ? GLU D 42  ? HIS D 58  GLU D 67  
AB1 3  LYS D 71  ? GLY D 78  ? LYS D 96  GLY D 103 
AB1 4  GLY D 114 ? TRP D 119 ? GLY D 139 TRP D 144 
AB1 5  LEU D 154 ? SER D 160 ? LEU D 179 SER D 185 
AB1 6  PHE D 181 ? LEU D 185 ? PHE D 206 LEU D 210 
AB1 7  VAL D 237 ? PRO D 242 ? VAL D 262 PRO D 267 
AB1 8  GLY D 331 ? TRP D 335 ? GLY D 356 TRP D 360 
AB1 9  LYS D 3   ? THR D 9   ? LYS D 28  THR D 34  
AB1 10 HIS D 33  ? GLU D 42  ? HIS D 58  GLU D 67  
AB2 1  ALA D 261 ? PRO D 264 ? ALA D 286 PRO D 289 
AB2 2  TYR D 244 ? LEU D 250 ? TYR D 269 LEU D 275 
AB2 3  PHE D 276 ? ALA D 278 ? PHE D 301 ALA D 303 
AB3 1  ALA D 261 ? PRO D 264 ? ALA D 286 PRO D 289 
AB3 2  TYR D 244 ? LEU D 250 ? TYR D 269 LEU D 275 
AB3 3  GLN D 307 ? GLY D 310 ? GLN D 332 GLY D 335 
AB3 4  PRO D 300 ? LYS D 304 ? PRO D 325 LYS D 329 
AB3 5  LYS D 290 ? ARG D 293 ? LYS D 315 ARG D 318 
AB4 1  LYS E 45  ? ILE E 47  ? LYS E 70  ILE E 72  
AB4 2  HIS E 33  ? GLU E 42  ? HIS E 58  GLU E 67  
AB4 3  LYS E 71  ? GLY E 78  ? LYS E 96  GLY E 103 
AB4 4  GLY E 114 ? TRP E 119 ? GLY E 139 TRP E 144 
AB4 5  LEU E 154 ? SER E 160 ? LEU E 179 SER E 185 
AB4 6  PHE E 181 ? LEU E 185 ? PHE E 206 LEU E 210 
AB4 7  VAL E 237 ? PRO E 242 ? VAL E 262 PRO E 267 
AB4 8  GLY E 331 ? TRP E 335 ? GLY E 356 TRP E 360 
AB4 9  LYS E 3   ? THR E 9   ? LYS E 28  THR E 34  
AB4 10 HIS E 33  ? GLU E 42  ? HIS E 58  GLU E 67  
AB5 1  ALA E 261 ? PRO E 264 ? ALA E 286 PRO E 289 
AB5 2  TYR E 244 ? LEU E 250 ? TYR E 269 LEU E 275 
AB5 3  PHE E 276 ? ALA E 278 ? PHE E 301 ALA E 303 
AB6 1  ALA E 261 ? PRO E 264 ? ALA E 286 PRO E 289 
AB6 2  TYR E 244 ? LEU E 250 ? TYR E 269 LEU E 275 
AB6 3  GLN E 307 ? GLY E 310 ? GLN E 332 GLY E 335 
AB6 4  PRO E 300 ? LYS E 304 ? PRO E 325 LYS E 329 
AB6 5  LYS E 290 ? ARG E 293 ? LYS E 315 ARG E 318 
AB7 1  LYS F 45  ? ILE F 47  ? LYS F 70  ILE F 72  
AB7 2  HIS F 33  ? GLU F 42  ? HIS F 58  GLU F 67  
AB7 3  LYS F 71  ? GLY F 78  ? LYS F 96  GLY F 103 
AB7 4  GLY F 114 ? TRP F 119 ? GLY F 139 TRP F 144 
AB7 5  LEU F 154 ? SER F 160 ? LEU F 179 SER F 185 
AB7 6  PHE F 181 ? LEU F 185 ? PHE F 206 LEU F 210 
AB7 7  VAL F 237 ? PRO F 242 ? VAL F 262 PRO F 267 
AB7 8  GLY F 331 ? TRP F 335 ? GLY F 356 TRP F 360 
AB7 9  LYS F 3   ? THR F 9   ? LYS F 28  THR F 34  
AB7 10 HIS F 33  ? GLU F 42  ? HIS F 58  GLU F 67  
AB8 1  ALA F 261 ? PRO F 264 ? ALA F 286 PRO F 289 
AB8 2  TYR F 244 ? LEU F 250 ? TYR F 269 LEU F 275 
AB8 3  PHE F 276 ? ALA F 278 ? PHE F 301 ALA F 303 
AB9 1  ALA F 261 ? PRO F 264 ? ALA F 286 PRO F 289 
AB9 2  TYR F 244 ? LEU F 250 ? TYR F 269 LEU F 275 
AB9 3  GLN F 307 ? GLY F 310 ? GLN F 332 GLY F 335 
AB9 4  VAL F 299 ? LYS F 304 ? VAL F 324 LYS F 329 
AB9 5  LYS F 290 ? LEU F 294 ? LYS F 315 LEU F 319 
AC1 1  LYS G 45  ? ILE G 47  ? LYS G 70  ILE G 72  
AC1 2  HIS G 33  ? GLU G 42  ? HIS G 58  GLU G 67  
AC1 3  LYS G 71  ? GLY G 77  ? LYS G 96  GLY G 102 
AC1 4  GLY G 114 ? SER G 118 ? GLY G 139 SER G 143 
AC1 5  LEU G 154 ? SER G 160 ? LEU G 179 SER G 185 
AC1 6  PHE G 181 ? LEU G 185 ? PHE G 206 LEU G 210 
AC1 7  VAL G 237 ? PRO G 242 ? VAL G 262 PRO G 267 
AC1 8  GLY G 331 ? TRP G 335 ? GLY G 356 TRP G 360 
AC1 9  LYS G 3   ? THR G 9   ? LYS G 28  THR G 34  
AC1 10 HIS G 33  ? GLU G 42  ? HIS G 58  GLU G 67  
AC2 1  ALA G 261 ? PRO G 264 ? ALA G 286 PRO G 289 
AC2 2  TYR G 244 ? LEU G 250 ? TYR G 269 LEU G 275 
AC2 3  PHE G 276 ? ALA G 278 ? PHE G 301 ALA G 303 
AC3 1  ALA G 261 ? PRO G 264 ? ALA G 286 PRO G 289 
AC3 2  TYR G 244 ? LEU G 250 ? TYR G 269 LEU G 275 
AC3 3  GLN G 307 ? GLY G 310 ? GLN G 332 GLY G 335 
AC3 4  PRO G 300 ? LYS G 304 ? PRO G 325 LYS G 329 
AC3 5  LYS G 290 ? ARG G 293 ? LYS G 315 ARG G 318 
AC4 1  LYS H 45  ? ILE H 47  ? LYS H 70  ILE H 72  
AC4 2  HIS H 33  ? GLU H 42  ? HIS H 58  GLU H 67  
AC4 3  LYS H 71  ? GLY H 78  ? LYS H 96  GLY H 103 
AC4 4  GLY H 114 ? TRP H 119 ? GLY H 139 TRP H 144 
AC4 5  LEU H 154 ? SER H 160 ? LEU H 179 SER H 185 
AC4 6  PHE H 181 ? LEU H 185 ? PHE H 206 LEU H 210 
AC4 7  VAL H 237 ? PRO H 242 ? VAL H 262 PRO H 267 
AC4 8  GLY H 331 ? TRP H 335 ? GLY H 356 TRP H 360 
AC4 9  LYS H 3   ? THR H 9   ? LYS H 28  THR H 34  
AC4 10 HIS H 33  ? GLU H 42  ? HIS H 58  GLU H 67  
AC5 1  ALA H 261 ? PRO H 264 ? ALA H 286 PRO H 289 
AC5 2  TYR H 244 ? LEU H 250 ? TYR H 269 LEU H 275 
AC5 3  PHE H 276 ? ALA H 278 ? PHE H 301 ALA H 303 
AC6 1  ALA H 261 ? PRO H 264 ? ALA H 286 PRO H 289 
AC6 2  TYR H 244 ? LEU H 250 ? TYR H 269 LEU H 275 
AC6 3  GLN H 307 ? GLY H 310 ? GLN H 332 GLY H 335 
AC6 4  PRO H 300 ? LYS H 304 ? PRO H 325 LYS H 329 
AC6 5  LYS H 290 ? ARG H 293 ? LYS H 315 ARG H 318 
AC7 1  LYS I 45  ? ILE I 47  ? LYS I 70  ILE I 72  
AC7 2  HIS I 33  ? GLU I 42  ? HIS I 58  GLU I 67  
AC7 3  LYS I 71  ? GLY I 77  ? LYS I 96  GLY I 102 
AC7 4  GLY I 114 ? SER I 118 ? GLY I 139 SER I 143 
AC7 5  LEU I 154 ? SER I 160 ? LEU I 179 SER I 185 
AC7 6  PHE I 181 ? LEU I 185 ? PHE I 206 LEU I 210 
AC7 7  VAL I 237 ? PRO I 242 ? VAL I 262 PRO I 267 
AC7 8  GLY I 331 ? TRP I 335 ? GLY I 356 TRP I 360 
AC7 9  LYS I 3   ? THR I 9   ? LYS I 28  THR I 34  
AC7 10 HIS I 33  ? GLU I 42  ? HIS I 58  GLU I 67  
AC8 1  ALA I 261 ? PRO I 264 ? ALA I 286 PRO I 289 
AC8 2  TYR I 244 ? LEU I 250 ? TYR I 269 LEU I 275 
AC8 3  PHE I 276 ? ALA I 278 ? PHE I 301 ALA I 303 
AC9 1  ALA I 261 ? PRO I 264 ? ALA I 286 PRO I 289 
AC9 2  TYR I 244 ? LEU I 250 ? TYR I 269 LEU I 275 
AC9 3  GLN I 307 ? GLY I 310 ? GLN I 332 GLY I 335 
AC9 4  PRO I 300 ? LYS I 304 ? PRO I 325 LYS I 329 
AC9 5  LYS I 290 ? ARG I 293 ? LYS I 315 ARG I 318 
AD1 1  LYS J 45  ? ILE J 47  ? LYS J 70  ILE J 72  
AD1 2  HIS J 33  ? GLU J 42  ? HIS J 58  GLU J 67  
AD1 3  LYS J 71  ? GLY J 78  ? LYS J 96  GLY J 103 
AD1 4  GLY J 114 ? TRP J 119 ? GLY J 139 TRP J 144 
AD1 5  LEU J 154 ? SER J 160 ? LEU J 179 SER J 185 
AD1 6  PHE J 181 ? LEU J 185 ? PHE J 206 LEU J 210 
AD1 7  VAL J 237 ? PRO J 242 ? VAL J 262 PRO J 267 
AD1 8  GLY J 331 ? TRP J 335 ? GLY J 356 TRP J 360 
AD1 9  LYS J 3   ? THR J 9   ? LYS J 28  THR J 34  
AD1 10 HIS J 33  ? GLU J 42  ? HIS J 58  GLU J 67  
AD2 1  ALA J 261 ? PRO J 264 ? ALA J 286 PRO J 289 
AD2 2  TYR J 244 ? LEU J 250 ? TYR J 269 LEU J 275 
AD2 3  PHE J 276 ? ALA J 278 ? PHE J 301 ALA J 303 
AD3 1  ALA J 261 ? PRO J 264 ? ALA J 286 PRO J 289 
AD3 2  TYR J 244 ? LEU J 250 ? TYR J 269 LEU J 275 
AD3 3  GLN J 307 ? GLY J 310 ? GLN J 332 GLY J 335 
AD3 4  PRO J 300 ? LYS J 304 ? PRO J 325 LYS J 329 
AD3 5  LYS J 290 ? ARG J 293 ? LYS J 315 ARG J 318 
AD4 1  LYS K 45  ? ILE K 47  ? LYS K 70  ILE K 72  
AD4 2  HIS K 33  ? GLU K 42  ? HIS K 58  GLU K 67  
AD4 3  LYS K 71  ? GLY K 78  ? LYS K 96  GLY K 103 
AD4 4  GLY K 114 ? TRP K 119 ? GLY K 139 TRP K 144 
AD4 5  LEU K 154 ? SER K 160 ? LEU K 179 SER K 185 
AD4 6  PHE K 181 ? LEU K 185 ? PHE K 206 LEU K 210 
AD4 7  VAL K 237 ? PRO K 242 ? VAL K 262 PRO K 267 
AD4 8  GLY K 331 ? TRP K 335 ? GLY K 356 TRP K 360 
AD4 9  LYS K 3   ? THR K 9   ? LYS K 28  THR K 34  
AD4 10 HIS K 33  ? GLU K 42  ? HIS K 58  GLU K 67  
AD5 1  ALA K 261 ? PRO K 264 ? ALA K 286 PRO K 289 
AD5 2  TYR K 244 ? LEU K 250 ? TYR K 269 LEU K 275 
AD5 3  PHE K 276 ? ALA K 278 ? PHE K 301 ALA K 303 
AD6 1  ALA K 261 ? PRO K 264 ? ALA K 286 PRO K 289 
AD6 2  TYR K 244 ? LEU K 250 ? TYR K 269 LEU K 275 
AD6 3  GLN K 307 ? GLY K 310 ? GLN K 332 GLY K 335 
AD6 4  PRO K 300 ? LYS K 304 ? PRO K 325 LYS K 329 
AD6 5  LYS K 290 ? ARG K 293 ? LYS K 315 ARG K 318 
AD7 1  LYS L 45  ? ILE L 47  ? LYS L 70  ILE L 72  
AD7 2  HIS L 33  ? GLU L 42  ? HIS L 58  GLU L 67  
AD7 3  LYS L 71  ? GLY L 78  ? LYS L 96  GLY L 103 
AD7 4  GLY L 114 ? TRP L 119 ? GLY L 139 TRP L 144 
AD7 5  LEU L 154 ? SER L 160 ? LEU L 179 SER L 185 
AD7 6  PHE L 181 ? LEU L 185 ? PHE L 206 LEU L 210 
AD7 7  VAL L 237 ? PRO L 242 ? VAL L 262 PRO L 267 
AD7 8  GLY L 331 ? TRP L 335 ? GLY L 356 TRP L 360 
AD7 9  LYS L 3   ? THR L 9   ? LYS L 28  THR L 34  
AD7 10 HIS L 33  ? GLU L 42  ? HIS L 58  GLU L 67  
AD8 1  ALA L 261 ? PRO L 264 ? ALA L 286 PRO L 289 
AD8 2  TYR L 244 ? LEU L 250 ? TYR L 269 LEU L 275 
AD8 3  PHE L 276 ? ALA L 278 ? PHE L 301 ALA L 303 
AD9 1  ALA L 261 ? PRO L 264 ? ALA L 286 PRO L 289 
AD9 2  TYR L 244 ? LEU L 250 ? TYR L 269 LEU L 275 
AD9 3  GLN L 307 ? GLY L 310 ? GLN L 332 GLY L 335 
AD9 4  VAL L 299 ? LYS L 304 ? VAL L 324 LYS L 329 
AD9 5  LYS L 290 ? LEU L 294 ? LYS L 315 LEU L 319 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O ILE A 47  ? O ILE A 72  N SER A 40  ? N SER A 65  
AA1 2 3  N LEU A 34  ? N LEU A 59  O LEU A 73  ? O LEU A 98  
AA1 3 4  N LEU A 74  ? N LEU A 99  O ASP A 116 ? O ASP A 141 
AA1 4 5  N LEU A 115 ? N LEU A 140 O THR A 156 ? O THR A 181 
AA1 5 6  N VAL A 159 ? N VAL A 184 O LEU A 185 ? O LEU A 210 
AA1 6 7  N ILE A 182 ? N ILE A 207 O VAL A 238 ? O VAL A 263 
AA1 7 8  N MET A 239 ? N MET A 264 O MET A 333 ? O MET A 358 
AA1 8 9  O ALA A 332 ? O ALA A 357 N VAL A 5   ? N VAL A 30  
AA1 9 10 N CYS A 6   ? N CYS A 31  O HIS A 33  ? O HIS A 58  
AA2 1 2  O GLY A 263 ? O GLY A 288 N THR A 249 ? N THR A 274 
AA2 2 3  N GLY A 245 ? N GLY A 270 O LEU A 277 ? O LEU A 302 
AA3 1 2  O GLY A 263 ? O GLY A 288 N THR A 249 ? N THR A 274 
AA3 2 3  N HIS A 246 ? N HIS A 271 O GLY A 310 ? O GLY A 335 
AA3 3 4  O VAL A 309 ? O VAL A 334 N ALA A 302 ? N ALA A 327 
AA3 4 5  O VAL A 303 ? O VAL A 328 N LYS A 290 ? N LYS A 315 
AA4 1 2  O ILE B 47  ? O ILE B 72  N SER B 40  ? N SER B 65  
AA4 2 3  N ALA B 39  ? N ALA B 64  O SER B 75  ? O SER B 100 
AA4 3 4  N GLY B 78  ? N GLY B 103 O SER B 118 ? O SER B 143 
AA4 4 5  N LEU B 115 ? N LEU B 140 O LEU B 154 ? O LEU B 179 
AA4 5 6  N ALA B 157 ? N ALA B 182 O ASN B 183 ? O ASN B 208 
AA4 6 7  N LEU B 184 ? N LEU B 209 O VAL B 238 ? O VAL B 263 
AA4 7 8  N MET B 239 ? N MET B 264 O MET B 333 ? O MET B 358 
AA4 8 9  O ILE B 334 ? O ILE B 359 N VAL B 5   ? N VAL B 30  
AA4 9 10 N CYS B 6   ? N CYS B 31  O HIS B 33  ? O HIS B 58  
AA5 1 2  O GLY B 263 ? O GLY B 288 N THR B 249 ? N THR B 274 
AA5 2 3  N GLY B 245 ? N GLY B 270 O LEU B 277 ? O LEU B 302 
AA6 1 2  O GLY B 263 ? O GLY B 288 N THR B 249 ? N THR B 274 
AA6 2 3  N PHE B 248 ? N PHE B 273 O TRP B 308 ? O TRP B 333 
AA6 3 4  O VAL B 309 ? O VAL B 334 N ALA B 302 ? N ALA B 327 
AA6 4 5  O TYR B 301 ? O TYR B 326 N THR B 292 ? N THR B 317 
AA7 1 2  O ILE C 47  ? O ILE C 72  N SER C 40  ? N SER C 65  
AA7 2 3  N LEU C 34  ? N LEU C 59  O LEU C 73  ? O LEU C 98  
AA7 3 4  N LEU C 74  ? N LEU C 99  O ASP C 116 ? O ASP C 141 
AA7 4 5  N VAL C 117 ? N VAL C 142 O THR C 156 ? O THR C 181 
AA7 5 6  N ALA C 157 ? N ALA C 182 O ASN C 183 ? O ASN C 208 
AA7 6 7  N LEU C 184 ? N LEU C 209 O VAL C 238 ? O VAL C 263 
AA7 7 8  N MET C 239 ? N MET C 264 O MET C 333 ? O MET C 358 
AA7 8 9  O ALA C 332 ? O ALA C 357 N VAL C 5   ? N VAL C 30  
AA7 9 10 N CYS C 6   ? N CYS C 31  O HIS C 33  ? O HIS C 58  
AA8 1 2  O GLY C 263 ? O GLY C 288 N THR C 249 ? N THR C 274 
AA8 2 3  N GLY C 245 ? N GLY C 270 O LEU C 277 ? O LEU C 302 
AA9 1 2  O GLY C 263 ? O GLY C 288 N THR C 249 ? N THR C 274 
AA9 2 3  N PHE C 248 ? N PHE C 273 O TRP C 308 ? O TRP C 333 
AA9 3 4  O VAL C 309 ? O VAL C 334 N ALA C 302 ? N ALA C 327 
AA9 4 5  O TYR C 301 ? O TYR C 326 N THR C 292 ? N THR C 317 
AB1 1 2  O LYS D 45  ? O LYS D 70  N GLU D 42  ? N GLU D 67  
AB1 2 3  N ALA D 39  ? N ALA D 64  O SER D 75  ? O SER D 100 
AB1 3 4  N GLY D 78  ? N GLY D 103 O SER D 118 ? O SER D 143 
AB1 4 5  N VAL D 117 ? N VAL D 142 O THR D 156 ? O THR D 181 
AB1 5 6  N ALA D 157 ? N ALA D 182 O ASN D 183 ? O ASN D 208 
AB1 6 7  N ILE D 182 ? N ILE D 207 O VAL D 238 ? O VAL D 263 
AB1 7 8  N MET D 239 ? N MET D 264 O MET D 333 ? O MET D 358 
AB1 8 9  O ILE D 334 ? O ILE D 359 N VAL D 5   ? N VAL D 30  
AB1 9 10 N CYS D 6   ? N CYS D 31  O HIS D 33  ? O HIS D 58  
AB2 1 2  O GLY D 263 ? O GLY D 288 N THR D 249 ? N THR D 274 
AB2 2 3  N GLY D 245 ? N GLY D 270 O LEU D 277 ? O LEU D 302 
AB3 1 2  O GLY D 263 ? O GLY D 288 N THR D 249 ? N THR D 274 
AB3 2 3  N HIS D 246 ? N HIS D 271 O GLY D 310 ? O GLY D 335 
AB3 3 4  O VAL D 309 ? O VAL D 334 N ALA D 302 ? N ALA D 327 
AB3 4 5  O TYR D 301 ? O TYR D 326 N THR D 292 ? N THR D 317 
AB4 1 2  O ILE E 47  ? O ILE E 72  N SER E 40  ? N SER E 65  
AB4 2 3  N ALA E 39  ? N ALA E 64  O SER E 75  ? O SER E 100 
AB4 3 4  N GLY E 78  ? N GLY E 103 O SER E 118 ? O SER E 143 
AB4 4 5  N VAL E 117 ? N VAL E 142 O THR E 156 ? O THR E 181 
AB4 5 6  N ALA E 157 ? N ALA E 182 O ASN E 183 ? O ASN E 208 
AB4 6 7  N ILE E 182 ? N ILE E 207 O VAL E 238 ? O VAL E 263 
AB4 7 8  N MET E 239 ? N MET E 264 O MET E 333 ? O MET E 358 
AB4 8 9  O ALA E 332 ? O ALA E 357 N VAL E 5   ? N VAL E 30  
AB4 9 10 N CYS E 6   ? N CYS E 31  O HIS E 33  ? O HIS E 58  
AB5 1 2  O SER E 262 ? O SER E 287 N THR E 249 ? N THR E 274 
AB5 2 3  N GLY E 245 ? N GLY E 270 O LEU E 277 ? O LEU E 302 
AB6 1 2  O SER E 262 ? O SER E 287 N THR E 249 ? N THR E 274 
AB6 2 3  N PHE E 248 ? N PHE E 273 O TRP E 308 ? O TRP E 333 
AB6 3 4  O VAL E 309 ? O VAL E 334 N ALA E 302 ? N ALA E 327 
AB6 4 5  O TYR E 301 ? O TYR E 326 N THR E 292 ? N THR E 317 
AB7 1 2  O ILE F 47  ? O ILE F 72  N SER F 40  ? N SER F 65  
AB7 2 3  N LEU F 34  ? N LEU F 59  O LEU F 73  ? O LEU F 98  
AB7 3 4  N GLY F 78  ? N GLY F 103 O SER F 118 ? O SER F 143 
AB7 4 5  N LEU F 115 ? N LEU F 140 O LEU F 154 ? O LEU F 179 
AB7 5 6  N VAL F 159 ? N VAL F 184 O LEU F 185 ? O LEU F 210 
AB7 6 7  N LEU F 184 ? N LEU F 209 O VAL F 238 ? O VAL F 263 
AB7 7 8  N MET F 239 ? N MET F 264 O GLY F 331 ? O GLY F 356 
AB7 8 9  O ILE F 334 ? O ILE F 359 N VAL F 5   ? N VAL F 30  
AB7 9 10 N CYS F 6   ? N CYS F 31  O HIS F 33  ? O HIS F 58  
AB8 1 2  O SER F 262 ? O SER F 287 N THR F 249 ? N THR F 274 
AB8 2 3  N GLY F 245 ? N GLY F 270 O LEU F 277 ? O LEU F 302 
AB9 1 2  O SER F 262 ? O SER F 287 N THR F 249 ? N THR F 274 
AB9 2 3  N PHE F 248 ? N PHE F 273 O TRP F 308 ? O TRP F 333 
AB9 3 4  O VAL F 309 ? O VAL F 334 N ALA F 302 ? N ALA F 327 
AB9 4 5  O TYR F 301 ? O TYR F 326 N THR F 292 ? N THR F 317 
AC1 1 2  O ILE G 47  ? O ILE G 72  N SER G 40  ? N SER G 65  
AC1 2 3  N LEU G 34  ? N LEU G 59  O LEU G 73  ? O LEU G 98  
AC1 3 4  N LEU G 74  ? N LEU G 99  O ASP G 116 ? O ASP G 141 
AC1 4 5  N LEU G 115 ? N LEU G 140 O LEU G 154 ? O LEU G 179 
AC1 5 6  N VAL G 159 ? N VAL G 184 O LEU G 185 ? O LEU G 210 
AC1 6 7  N LEU G 184 ? N LEU G 209 O VAL G 238 ? O VAL G 263 
AC1 7 8  N MET G 239 ? N MET G 264 O GLY G 331 ? O GLY G 356 
AC1 8 9  O ILE G 334 ? O ILE G 359 N VAL G 5   ? N VAL G 30  
AC1 9 10 N CYS G 6   ? N CYS G 31  O HIS G 33  ? O HIS G 58  
AC2 1 2  O GLY G 263 ? O GLY G 288 N THR G 249 ? N THR G 274 
AC2 2 3  N GLY G 245 ? N GLY G 270 O LEU G 277 ? O LEU G 302 
AC3 1 2  O GLY G 263 ? O GLY G 288 N THR G 249 ? N THR G 274 
AC3 2 3  N PHE G 248 ? N PHE G 273 O TRP G 308 ? O TRP G 333 
AC3 3 4  O VAL G 309 ? O VAL G 334 N ALA G 302 ? N ALA G 327 
AC3 4 5  O TYR G 301 ? O TYR G 326 N THR G 292 ? N THR G 317 
AC4 1 2  O ILE H 47  ? O ILE H 72  N SER H 40  ? N SER H 65  
AC4 2 3  N ALA H 39  ? N ALA H 64  O SER H 75  ? O SER H 100 
AC4 3 4  N GLY H 78  ? N GLY H 103 O SER H 118 ? O SER H 143 
AC4 4 5  N LEU H 115 ? N LEU H 140 O THR H 156 ? O THR H 181 
AC4 5 6  N ALA H 157 ? N ALA H 182 O ASN H 183 ? O ASN H 208 
AC4 6 7  N LEU H 184 ? N LEU H 209 O VAL H 238 ? O VAL H 263 
AC4 7 8  N MET H 239 ? N MET H 264 O MET H 333 ? O MET H 358 
AC4 8 9  O ALA H 332 ? O ALA H 357 N VAL H 5   ? N VAL H 30  
AC4 9 10 N CYS H 6   ? N CYS H 31  O HIS H 33  ? O HIS H 58  
AC5 1 2  O SER H 262 ? O SER H 287 N THR H 249 ? N THR H 274 
AC5 2 3  N GLY H 245 ? N GLY H 270 O LEU H 277 ? O LEU H 302 
AC6 1 2  O SER H 262 ? O SER H 287 N THR H 249 ? N THR H 274 
AC6 2 3  N PHE H 248 ? N PHE H 273 O TRP H 308 ? O TRP H 333 
AC6 3 4  O VAL H 309 ? O VAL H 334 N ALA H 302 ? N ALA H 327 
AC6 4 5  O TYR H 301 ? O TYR H 326 N THR H 292 ? N THR H 317 
AC7 1 2  O ILE I 47  ? O ILE I 72  N SER I 40  ? N SER I 65  
AC7 2 3  N LEU I 34  ? N LEU I 59  O LEU I 73  ? O LEU I 98  
AC7 3 4  N LEU I 74  ? N LEU I 99  O ASP I 116 ? O ASP I 141 
AC7 4 5  N LEU I 115 ? N LEU I 140 O THR I 156 ? O THR I 181 
AC7 5 6  N ALA I 157 ? N ALA I 182 O ASN I 183 ? O ASN I 208 
AC7 6 7  N LEU I 184 ? N LEU I 209 O VAL I 238 ? O VAL I 263 
AC7 7 8  N MET I 239 ? N MET I 264 O MET I 333 ? O MET I 358 
AC7 8 9  O ILE I 334 ? O ILE I 359 N VAL I 5   ? N VAL I 30  
AC7 9 10 N CYS I 6   ? N CYS I 31  O HIS I 33  ? O HIS I 58  
AC8 1 2  O SER I 262 ? O SER I 287 N THR I 249 ? N THR I 274 
AC8 2 3  N GLY I 245 ? N GLY I 270 O LEU I 277 ? O LEU I 302 
AC9 1 2  O SER I 262 ? O SER I 287 N THR I 249 ? N THR I 274 
AC9 2 3  N PHE I 248 ? N PHE I 273 O TRP I 308 ? O TRP I 333 
AC9 3 4  O VAL I 309 ? O VAL I 334 N ALA I 302 ? N ALA I 327 
AC9 4 5  O TYR I 301 ? O TYR I 326 N THR I 292 ? N THR I 317 
AD1 1 2  O ILE J 47  ? O ILE J 72  N SER J 40  ? N SER J 65  
AD1 2 3  N LEU J 34  ? N LEU J 59  O LEU J 73  ? O LEU J 98  
AD1 3 4  N LEU J 74  ? N LEU J 99  O ASP J 116 ? O ASP J 141 
AD1 4 5  N VAL J 117 ? N VAL J 142 O THR J 156 ? O THR J 181 
AD1 5 6  N ALA J 157 ? N ALA J 182 O ASN J 183 ? O ASN J 208 
AD1 6 7  N LEU J 184 ? N LEU J 209 O VAL J 238 ? O VAL J 263 
AD1 7 8  N MET J 239 ? N MET J 264 O MET J 333 ? O MET J 358 
AD1 8 9  O ILE J 334 ? O ILE J 359 N VAL J 5   ? N VAL J 30  
AD1 9 10 N CYS J 6   ? N CYS J 31  O HIS J 33  ? O HIS J 58  
AD2 1 2  O GLY J 263 ? O GLY J 288 N THR J 249 ? N THR J 274 
AD2 2 3  N GLY J 245 ? N GLY J 270 O LEU J 277 ? O LEU J 302 
AD3 1 2  O GLY J 263 ? O GLY J 288 N THR J 249 ? N THR J 274 
AD3 2 3  N PHE J 248 ? N PHE J 273 O TRP J 308 ? O TRP J 333 
AD3 3 4  O VAL J 309 ? O VAL J 334 N ALA J 302 ? N ALA J 327 
AD3 4 5  O VAL J 303 ? O VAL J 328 N LYS J 290 ? N LYS J 315 
AD4 1 2  O ILE K 47  ? O ILE K 72  N SER K 40  ? N SER K 65  
AD4 2 3  N LEU K 34  ? N LEU K 59  O LEU K 73  ? O LEU K 98  
AD4 3 4  N LEU K 74  ? N LEU K 99  O ASP K 116 ? O ASP K 141 
AD4 4 5  N VAL K 117 ? N VAL K 142 O THR K 156 ? O THR K 181 
AD4 5 6  N VAL K 159 ? N VAL K 184 O LEU K 185 ? O LEU K 210 
AD4 6 7  N LEU K 184 ? N LEU K 209 O VAL K 238 ? O VAL K 263 
AD4 7 8  N MET K 239 ? N MET K 264 O MET K 333 ? O MET K 358 
AD4 8 9  O ILE K 334 ? O ILE K 359 N VAL K 5   ? N VAL K 30  
AD4 9 10 N CYS K 6   ? N CYS K 31  O HIS K 33  ? O HIS K 58  
AD5 1 2  O GLY K 263 ? O GLY K 288 N THR K 249 ? N THR K 274 
AD5 2 3  N GLY K 245 ? N GLY K 270 O LEU K 277 ? O LEU K 302 
AD6 1 2  O GLY K 263 ? O GLY K 288 N THR K 249 ? N THR K 274 
AD6 2 3  N PHE K 248 ? N PHE K 273 O TRP K 308 ? O TRP K 333 
AD6 3 4  O VAL K 309 ? O VAL K 334 N ALA K 302 ? N ALA K 327 
AD6 4 5  O TYR K 301 ? O TYR K 326 N THR K 292 ? N THR K 317 
AD7 1 2  O ILE L 47  ? O ILE L 72  N SER L 40  ? N SER L 65  
AD7 2 3  N LEU L 34  ? N LEU L 59  O LEU L 73  ? O LEU L 98  
AD7 3 4  N LEU L 74  ? N LEU L 99  O ASP L 116 ? O ASP L 141 
AD7 4 5  N LEU L 115 ? N LEU L 140 O THR L 156 ? O THR L 181 
AD7 5 6  N ALA L 157 ? N ALA L 182 O ASN L 183 ? O ASN L 208 
AD7 6 7  N ILE L 182 ? N ILE L 207 O VAL L 238 ? O VAL L 263 
AD7 7 8  N MET L 239 ? N MET L 264 O MET L 333 ? O MET L 358 
AD7 8 9  O ALA L 332 ? O ALA L 357 N VAL L 5   ? N VAL L 30  
AD7 9 10 N CYS L 6   ? N CYS L 31  O HIS L 33  ? O HIS L 58  
AD8 1 2  O SER L 262 ? O SER L 287 N THR L 249 ? N THR L 274 
AD8 2 3  N GLY L 245 ? N GLY L 270 O LEU L 277 ? O LEU L 302 
AD9 1 2  O SER L 262 ? O SER L 287 N THR L 249 ? N THR L 274 
AD9 2 3  N PHE L 248 ? N PHE L 273 O TRP L 308 ? O TRP L 333 
AD9 3 4  O VAL L 309 ? O VAL L 334 N ALA L 302 ? N ALA L 327 
AD9 4 5  O VAL L 303 ? O VAL L 328 N LYS L 290 ? N LYS L 315 
# 
_database_PDB_matrix.entry_id          4AY1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4AY1 
_atom_sites.fract_transf_matrix[1][1]   0.003911 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000316 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006556 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007260 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A  1 1   ? 72.607  156.100 37.589  1.00 31.47 ? 26  ALA A N   1 
ATOM   2     C CA  . ALA A  1 1   ? 72.534  154.651 37.987  1.00 29.51 ? 26  ALA A CA  1 
ATOM   3     C C   . ALA A  1 1   ? 73.482  154.344 39.144  1.00 27.76 ? 26  ALA A C   1 
ATOM   4     O O   . ALA A  1 1   ? 74.589  154.892 39.214  1.00 27.49 ? 26  ALA A O   1 
ATOM   5     C CB  . ALA A  1 1   ? 72.851  153.762 36.794  1.00 30.58 ? 26  ALA A CB  1 
ATOM   6     N N   . TYR A  1 2   ? 73.090  153.453 40.051  1.00 25.46 ? 27  TYR A N   1 
ATOM   7     C CA  . TYR A  1 2   ? 73.955  153.202 41.202  1.00 22.97 ? 27  TYR A CA  1 
ATOM   8     C C   . TYR A  1 2   ? 75.215  152.482 40.761  1.00 21.85 ? 27  TYR A C   1 
ATOM   9     O O   . TYR A  1 2   ? 75.124  151.605 39.914  1.00 21.42 ? 27  TYR A O   1 
ATOM   10    C CB  . TYR A  1 2   ? 73.213  152.355 42.234  1.00 22.39 ? 27  TYR A CB  1 
ATOM   11    C CG  . TYR A  1 2   ? 72.047  153.092 42.858  1.00 23.62 ? 27  TYR A CG  1 
ATOM   12    C CD1 . TYR A  1 2   ? 72.272  154.166 43.708  1.00 22.82 ? 27  TYR A CD1 1 
ATOM   13    C CD2 . TYR A  1 2   ? 70.722  152.731 42.582  1.00 25.39 ? 27  TYR A CD2 1 
ATOM   14    C CE1 . TYR A  1 2   ? 71.194  154.874 44.286  1.00 23.37 ? 27  TYR A CE1 1 
ATOM   15    C CE2 . TYR A  1 2   ? 69.637  153.421 43.167  1.00 26.69 ? 27  TYR A CE2 1 
ATOM   16    C CZ  . TYR A  1 2   ? 69.901  154.492 44.028  1.00 25.31 ? 27  TYR A CZ  1 
ATOM   17    O OH  . TYR A  1 2   ? 68.876  155.197 44.612  1.00 24.39 ? 27  TYR A OH  1 
ATOM   18    N N   . LYS A  1 3   ? 76.361  152.825 41.360  1.00 19.10 ? 28  LYS A N   1 
ATOM   19    C CA  . LYS A  1 3   ? 77.587  152.052 41.161  1.00 18.69 ? 28  LYS A CA  1 
ATOM   20    C C   . LYS A  1 3   ? 77.701  150.875 42.128  1.00 17.78 ? 28  LYS A C   1 
ATOM   21    O O   . LYS A  1 3   ? 77.184  150.921 43.257  1.00 16.55 ? 28  LYS A O   1 
ATOM   22    C CB  . LYS A  1 3   ? 78.828  152.947 41.307  1.00 17.64 ? 28  LYS A CB  1 
ATOM   23    C CG  . LYS A  1 3   ? 78.835  154.193 40.395  1.00 19.39 ? 28  LYS A CG  1 
ATOM   24    C CD  . LYS A  1 3   ? 79.849  155.235 40.987  1.00 20.87 ? 28  LYS A CD  1 
ATOM   25    C CE  . LYS A  1 3   ? 80.112  156.409 40.039  1.00 21.63 ? 28  LYS A CE  1 
ATOM   26    N NZ  . LYS A  1 3   ? 78.883  157.175 39.794  1.00 23.06 ? 28  LYS A NZ  1 
ATOM   27    N N   . LEU A  1 4   ? 78.386  149.820 41.683  1.00 17.20 ? 29  LEU A N   1 
ATOM   28    C CA  . LEU A  1 4   ? 78.790  148.731 42.571  1.00 16.60 ? 29  LEU A CA  1 
ATOM   29    C C   . LEU A  1 4   ? 80.306  148.573 42.397  1.00 16.52 ? 29  LEU A C   1 
ATOM   30    O O   . LEU A  1 4   ? 80.794  148.104 41.349  1.00 17.03 ? 29  LEU A O   1 
ATOM   31    C CB  . LEU A  1 4   ? 78.035  147.448 42.193  1.00 17.30 ? 29  LEU A CB  1 
ATOM   32    C CG  . LEU A  1 4   ? 78.410  146.208 43.023  1.00 17.69 ? 29  LEU A CG  1 
ATOM   33    C CD1 . LEU A  1 4   ? 78.405  146.512 44.533  1.00 15.69 ? 29  LEU A CD1 1 
ATOM   34    C CD2 . LEU A  1 4   ? 77.476  145.028 42.655  1.00 18.16 ? 29  LEU A CD2 1 
ATOM   35    N N   . VAL A  1 5   ? 81.050  148.992 43.408  1.00 15.69 ? 30  VAL A N   1 
ATOM   36    C CA  . VAL A  1 5   ? 82.479  149.197 43.260  1.00 15.73 ? 30  VAL A CA  1 
ATOM   37    C C   . VAL A  1 5   ? 83.118  148.087 44.069  1.00 15.22 ? 30  VAL A C   1 
ATOM   38    O O   . VAL A  1 5   ? 82.873  147.967 45.275  1.00 15.68 ? 30  VAL A O   1 
ATOM   39    C CB  . VAL A  1 5   ? 82.909  150.583 43.835  1.00 15.00 ? 30  VAL A CB  1 
ATOM   40    C CG1 . VAL A  1 5   ? 84.422  150.744 43.779  1.00 15.58 ? 30  VAL A CG1 1 
ATOM   41    C CG2 . VAL A  1 5   ? 82.230  151.743 43.084  1.00 14.96 ? 30  VAL A CG2 1 
ATOM   42    N N   . CYS A  1 6   ? 83.917  147.254 43.424  1.00 14.70 ? 31  CYS A N   1 
ATOM   43    C CA  . CYS A  1 6   ? 84.360  146.028 44.089  1.00 14.87 ? 31  CYS A CA  1 
ATOM   44    C C   . CYS A  1 6   ? 85.881  145.958 44.173  1.00 14.73 ? 31  CYS A C   1 
ATOM   45    O O   . CYS A  1 6   ? 86.553  145.821 43.131  1.00 14.82 ? 31  CYS A O   1 
ATOM   46    C CB  . CYS A  1 6   ? 83.830  144.827 43.290  1.00 15.45 ? 31  CYS A CB  1 
ATOM   47    S SG  . CYS A  1 6   ? 82.020  144.724 43.276  1.00 18.28 ? 31  CYS A SG  1 
ATOM   48    N N   . TYR A  1 7   ? 86.427  146.064 45.387  1.00 13.62 ? 32  TYR A N   1 
ATOM   49    C CA  . TYR A  1 7   ? 87.843  145.818 45.568  1.00 14.06 ? 32  TYR A CA  1 
ATOM   50    C C   . TYR A  1 7   ? 88.098  144.305 45.526  1.00 14.82 ? 32  TYR A C   1 
ATOM   51    O O   . TYR A  1 7   ? 87.298  143.509 46.041  1.00 14.02 ? 32  TYR A O   1 
ATOM   52    C CB  . TYR A  1 7   ? 88.352  146.339 46.903  1.00 13.04 ? 32  TYR A CB  1 
ATOM   53    C CG  . TYR A  1 7   ? 88.483  147.830 47.061  1.00 13.19 ? 32  TYR A CG  1 
ATOM   54    C CD1 . TYR A  1 7   ? 87.410  148.601 47.558  1.00 12.65 ? 32  TYR A CD1 1 
ATOM   55    C CD2 . TYR A  1 7   ? 89.688  148.473 46.772  1.00 14.07 ? 32  TYR A CD2 1 
ATOM   56    C CE1 . TYR A  1 7   ? 87.545  149.991 47.763  1.00 13.39 ? 32  TYR A CE1 1 
ATOM   57    C CE2 . TYR A  1 7   ? 89.838  149.873 46.974  1.00 13.41 ? 32  TYR A CE2 1 
ATOM   58    C CZ  . TYR A  1 7   ? 88.780  150.617 47.465  1.00 14.23 ? 32  TYR A CZ  1 
ATOM   59    O OH  . TYR A  1 7   ? 88.950  151.983 47.648  1.00 14.05 ? 32  TYR A OH  1 
ATOM   60    N N   . PHE A  1 8   ? 89.219  143.929 44.921  1.00 14.62 ? 33  PHE A N   1 
ATOM   61    C CA  . PHE A  1 8   ? 89.784  142.586 45.052  1.00 15.94 ? 33  PHE A CA  1 
ATOM   62    C C   . PHE A  1 8   ? 91.282  142.727 45.333  1.00 16.38 ? 33  PHE A C   1 
ATOM   63    O O   . PHE A  1 8   ? 91.890  143.780 45.038  1.00 15.81 ? 33  PHE A O   1 
ATOM   64    C CB  . PHE A  1 8   ? 89.528  141.718 43.813  1.00 16.42 ? 33  PHE A CB  1 
ATOM   65    C CG  . PHE A  1 8   ? 90.237  142.189 42.555  1.00 16.74 ? 33  PHE A CG  1 
ATOM   66    C CD1 . PHE A  1 8   ? 89.705  143.219 41.783  1.00 16.25 ? 33  PHE A CD1 1 
ATOM   67    C CD2 . PHE A  1 8   ? 91.400  141.567 42.120  1.00 19.74 ? 33  PHE A CD2 1 
ATOM   68    C CE1 . PHE A  1 8   ? 90.339  143.650 40.603  1.00 18.01 ? 33  PHE A CE1 1 
ATOM   69    C CE2 . PHE A  1 8   ? 92.042  141.985 40.923  1.00 20.29 ? 33  PHE A CE2 1 
ATOM   70    C CZ  . PHE A  1 8   ? 91.520  143.035 40.181  1.00 18.77 ? 33  PHE A CZ  1 
ATOM   71    N N   . THR A  1 9   ? 91.886  141.675 45.883  1.00 17.17 ? 34  THR A N   1 
ATOM   72    C CA  . THR A  1 9   ? 93.216  141.831 46.454  1.00 17.40 ? 34  THR A CA  1 
ATOM   73    C C   . THR A  1 9   ? 94.263  140.912 45.834  1.00 18.72 ? 34  THR A C   1 
ATOM   74    O O   . THR A  1 9   ? 93.960  139.817 45.382  1.00 18.92 ? 34  THR A O   1 
ATOM   75    C CB  . THR A  1 9   ? 93.210  141.588 47.971  1.00 17.27 ? 34  THR A CB  1 
ATOM   76    O OG1 . THR A  1 9   ? 92.992  140.188 48.232  1.00 18.57 ? 34  THR A OG1 1 
ATOM   77    C CG2 . THR A  1 9   ? 92.107  142.406 48.634  1.00 16.77 ? 34  THR A CG2 1 
ATOM   78    N N   . ASN A  1 10  ? 95.504  141.382 45.862  1.00 19.33 ? 35  ASN A N   1 
ATOM   79    C CA  . ASN A  1 10  ? 96.658  140.650 45.347  1.00 22.15 ? 35  ASN A CA  1 
ATOM   80    C C   . ASN A  1 10  ? 96.952  139.389 46.172  1.00 21.62 ? 35  ASN A C   1 
ATOM   81    O O   . ASN A  1 10  ? 97.358  138.355 45.629  1.00 23.59 ? 35  ASN A O   1 
ATOM   82    C CB  . ASN A  1 10  ? 97.831  141.649 45.361  1.00 23.03 ? 35  ASN A CB  1 
ATOM   83    C CG  . ASN A  1 10  ? 99.153  141.005 45.330  1.00 29.66 ? 35  ASN A CG  1 
ATOM   84    O OD1 . ASN A  1 10  ? 99.317  139.879 45.791  1.00 38.52 ? 35  ASN A OD1 1 
ATOM   85    N ND2 . ASN A  1 10  ? 100.147 141.721 44.808  1.00 35.94 ? 35  ASN A ND2 1 
ATOM   86    N N   . TRP A  1 11  ? 96.686  139.440 47.472  1.00 20.26 ? 36  TRP A N   1 
ATOM   87    C CA  . TRP A  1 11  ? 97.154  138.380 48.366  1.00 20.43 ? 36  TRP A CA  1 
ATOM   88    C C   . TRP A  1 11  ? 96.202  137.181 48.484  1.00 20.54 ? 36  TRP A C   1 
ATOM   89    O O   . TRP A  1 11  ? 96.614  136.125 48.985  1.00 20.30 ? 36  TRP A O   1 
ATOM   90    C CB  . TRP A  1 11  ? 97.545  138.938 49.757  1.00 20.60 ? 36  TRP A CB  1 
ATOM   91    C CG  . TRP A  1 11  ? 96.401  139.671 50.428  1.00 19.08 ? 36  TRP A CG  1 
ATOM   92    C CD1 . TRP A  1 11  ? 95.424  139.122 51.227  1.00 18.69 ? 36  TRP A CD1 1 
ATOM   93    C CD2 . TRP A  1 11  ? 96.091  141.075 50.319  1.00 19.43 ? 36  TRP A CD2 1 
ATOM   94    N NE1 . TRP A  1 11  ? 94.531  140.109 51.622  1.00 18.06 ? 36  TRP A NE1 1 
ATOM   95    C CE2 . TRP A  1 11  ? 94.917  141.310 51.083  1.00 17.62 ? 36  TRP A CE2 1 
ATOM   96    C CE3 . TRP A  1 11  ? 96.695  142.159 49.660  1.00 20.27 ? 36  TRP A CE3 1 
ATOM   97    C CZ2 . TRP A  1 11  ? 94.331  142.586 51.201  1.00 17.73 ? 36  TRP A CZ2 1 
ATOM   98    C CZ3 . TRP A  1 11  ? 96.100  143.438 49.773  1.00 18.12 ? 36  TRP A CZ3 1 
ATOM   99    C CH2 . TRP A  1 11  ? 94.934  143.633 50.547  1.00 17.28 ? 36  TRP A CH2 1 
ATOM   100   N N   . SER A  1 12  ? 94.952  137.316 48.019  1.00 18.58 ? 37  SER A N   1 
ATOM   101   C CA  . SER A  1 12  ? 94.039  136.176 48.027  1.00 19.43 ? 37  SER A CA  1 
ATOM   102   C C   . SER A  1 12  ? 94.538  135.021 47.137  1.00 20.39 ? 37  SER A C   1 
ATOM   103   O O   . SER A  1 12  ? 94.114  133.872 47.298  1.00 19.88 ? 37  SER A O   1 
ATOM   104   C CB  . SER A  1 12  ? 92.622  136.600 47.620  1.00 18.27 ? 37  SER A CB  1 
ATOM   105   O OG  . SER A  1 12  ? 92.653  137.196 46.334  1.00 19.41 ? 37  SER A OG  1 
ATOM   106   N N   . GLN A  1 13  ? 95.468  135.313 46.225  1.00 21.33 ? 38  GLN A N   1 
ATOM   107   C CA  . GLN A  1 13  ? 95.943  134.295 45.300  1.00 23.26 ? 38  GLN A CA  1 
ATOM   108   C C   . GLN A  1 13  ? 96.766  133.232 46.026  1.00 24.46 ? 38  GLN A C   1 
ATOM   109   O O   . GLN A  1 13  ? 96.937  132.118 45.516  1.00 24.41 ? 38  GLN A O   1 
ATOM   110   C CB  . GLN A  1 13  ? 96.760  134.910 44.145  1.00 24.10 ? 38  GLN A CB  1 
ATOM   111   C CG  . GLN A  1 13  ? 98.154  135.366 44.557  1.00 26.65 ? 38  GLN A CG  1 
ATOM   112   C CD  . GLN A  1 13  ? 98.876  136.059 43.417  1.00 28.61 ? 38  GLN A CD  1 
ATOM   113   O OE1 . GLN A  1 13  ? 99.371  135.410 42.494  1.00 31.27 ? 38  GLN A OE1 1 
ATOM   114   N NE2 . GLN A  1 13  ? 98.909  137.375 43.457  1.00 27.56 ? 38  GLN A NE2 1 
ATOM   115   N N   . ASP A  1 14  ? 97.263  133.573 47.213  1.00 23.76 ? 39  ASP A N   1 
ATOM   116   C CA  . ASP A  1 14  ? 98.098  132.643 47.995  1.00 26.03 ? 39  ASP A CA  1 
ATOM   117   C C   . ASP A  1 14  ? 97.284  131.723 48.929  1.00 25.62 ? 39  ASP A C   1 
ATOM   118   O O   . ASP A  1 14  ? 97.854  130.881 49.624  1.00 25.80 ? 39  ASP A O   1 
ATOM   119   C CB  . ASP A  1 14  ? 99.123  133.428 48.821  1.00 26.84 ? 39  ASP A CB  1 
ATOM   120   C CG  . ASP A  1 14  ? 100.195 134.070 47.952  1.00 29.87 ? 39  ASP A CG  1 
ATOM   121   O OD1 . ASP A  1 14  ? 100.469 133.538 46.854  1.00 31.95 ? 39  ASP A OD1 1 
ATOM   122   O OD2 . ASP A  1 14  ? 100.771 135.093 48.369  1.00 32.13 ? 39  ASP A OD2 1 
ATOM   123   N N   . ARG A  1 15  ? 95.959  131.891 48.950  1.00 23.75 ? 40  ARG A N   1 
ATOM   124   C CA  . ARG A  1 15  ? 95.108  131.128 49.874  1.00 23.54 ? 40  ARG A CA  1 
ATOM   125   C C   . ARG A  1 15  ? 94.714  129.756 49.342  1.00 24.62 ? 40  ARG A C   1 
ATOM   126   O O   . ARG A  1 15  ? 94.703  129.528 48.123  1.00 24.81 ? 40  ARG A O   1 
ATOM   127   C CB  . ARG A  1 15  ? 93.841  131.934 50.203  1.00 22.35 ? 40  ARG A CB  1 
ATOM   128   C CG  . ARG A  1 15  ? 94.093  133.046 51.202  1.00 21.08 ? 40  ARG A CG  1 
ATOM   129   C CD  . ARG A  1 15  ? 92.927  134.021 51.357  1.00 18.89 ? 40  ARG A CD  1 
ATOM   130   N NE  . ARG A  1 15  ? 93.293  135.122 52.242  1.00 17.79 ? 40  ARG A NE  1 
ATOM   131   C CZ  . ARG A  1 15  ? 92.699  136.316 52.249  1.00 19.46 ? 40  ARG A CZ  1 
ATOM   132   N NH1 . ARG A  1 15  ? 91.686  136.561 51.422  1.00 17.52 ? 40  ARG A NH1 1 
ATOM   133   N NH2 . ARG A  1 15  ? 93.108  137.261 53.092  1.00 17.25 ? 40  ARG A NH2 1 
ATOM   134   N N   . GLN A  1 16  ? 94.360  128.846 50.247  1.00 24.09 ? 41  GLN A N   1 
ATOM   135   C CA  . GLN A  1 16  ? 93.781  127.563 49.830  1.00 25.52 ? 41  GLN A CA  1 
ATOM   136   C C   . GLN A  1 16  ? 92.266  127.659 49.528  1.00 24.55 ? 41  GLN A C   1 
ATOM   137   O O   . GLN A  1 16  ? 91.568  128.552 50.036  1.00 23.12 ? 41  GLN A O   1 
ATOM   138   C CB  . GLN A  1 16  ? 94.053  126.461 50.874  1.00 26.73 ? 41  GLN A CB  1 
ATOM   139   C CG  . GLN A  1 16  ? 95.548  126.272 51.241  1.00 29.23 ? 41  GLN A CG  1 
ATOM   140   C CD  . GLN A  1 16  ? 96.448  126.182 50.022  1.00 32.24 ? 41  GLN A CD  1 
ATOM   141   O OE1 . GLN A  1 16  ? 96.383  125.227 49.256  1.00 35.46 ? 41  GLN A OE1 1 
ATOM   142   N NE2 . GLN A  1 16  ? 97.286  127.191 49.832  1.00 33.55 ? 41  GLN A NE2 1 
ATOM   143   N N   . GLU A  1 17  ? 91.764  126.749 48.696  1.00 25.67 ? 42  GLU A N   1 
ATOM   144   C CA  . GLU A  1 17  ? 90.320  126.673 48.441  1.00 26.58 ? 42  GLU A CA  1 
ATOM   145   C C   . GLU A  1 17  ? 89.596  126.518 49.775  1.00 25.67 ? 42  GLU A C   1 
ATOM   146   O O   . GLU A  1 17  ? 90.056  125.779 50.634  1.00 25.35 ? 42  GLU A O   1 
ATOM   147   C CB  . GLU A  1 17  ? 89.975  125.473 47.540  1.00 28.36 ? 42  GLU A CB  1 
ATOM   148   C CG  . GLU A  1 17  ? 90.385  125.644 46.085  1.00 33.92 ? 42  GLU A CG  1 
ATOM   149   C CD  . GLU A  1 17  ? 91.818  125.197 45.803  1.00 41.92 ? 42  GLU A CD  1 
ATOM   150   O OE1 . GLU A  1 17  ? 92.670  125.187 46.736  1.00 44.58 ? 42  GLU A OE1 1 
ATOM   151   O OE2 . GLU A  1 17  ? 92.103  124.851 44.632  1.00 45.26 ? 42  GLU A OE2 1 
ATOM   152   N N   . PRO A  1 18  ? 88.436  127.168 49.937  1.00 25.18 ? 43  PRO A N   1 
ATOM   153   C CA  . PRO A  1 18  ? 87.707  127.934 48.916  1.00 24.42 ? 43  PRO A CA  1 
ATOM   154   C C   . PRO A  1 18  ? 88.084  129.416 48.832  1.00 22.84 ? 43  PRO A C   1 
ATOM   155   O O   . PRO A  1 18  ? 87.283  130.225 48.337  1.00 22.28 ? 43  PRO A O   1 
ATOM   156   C CB  . PRO A  1 18  ? 86.251  127.836 49.404  1.00 24.76 ? 43  PRO A CB  1 
ATOM   157   C CG  . PRO A  1 18  ? 86.376  127.722 50.917  1.00 24.60 ? 43  PRO A CG  1 
ATOM   158   C CD  . PRO A  1 18  ? 87.573  126.813 51.086  1.00 25.33 ? 43  PRO A CD  1 
ATOM   159   N N   . GLY A  1 19  ? 89.261  129.784 49.334  1.00 22.84 ? 44  GLY A N   1 
ATOM   160   C CA  . GLY A  1 19  ? 89.678  131.195 49.348  1.00 20.91 ? 44  GLY A CA  1 
ATOM   161   C C   . GLY A  1 19  ? 90.682  131.550 48.258  1.00 21.08 ? 44  GLY A C   1 
ATOM   162   O O   . GLY A  1 19  ? 91.092  132.708 48.138  1.00 20.61 ? 44  GLY A O   1 
ATOM   163   N N   . LYS A  1 20  ? 91.096  130.563 47.462  1.00 21.19 ? 45  LYS A N   1 
ATOM   164   C CA  . LYS A  1 20  ? 92.081  130.819 46.412  1.00 21.52 ? 45  LYS A CA  1 
ATOM   165   C C   . LYS A  1 20  ? 91.428  131.624 45.290  1.00 21.89 ? 45  LYS A C   1 
ATOM   166   O O   . LYS A  1 20  ? 90.577  131.104 44.540  1.00 21.08 ? 45  LYS A O   1 
ATOM   167   C CB  . LYS A  1 20  ? 92.682  129.519 45.857  1.00 23.57 ? 45  LYS A CB  1 
ATOM   168   C CG  . LYS A  1 20  ? 93.771  129.763 44.806  1.00 22.61 ? 45  LYS A CG  1 
ATOM   169   C CD  . LYS A  1 20  ? 94.323  128.474 44.261  1.00 28.18 ? 45  LYS A CD  1 
ATOM   170   C CE  . LYS A  1 20  ? 95.247  128.741 43.073  1.00 29.46 ? 45  LYS A CE  1 
ATOM   171   N NZ  . LYS A  1 20  ? 96.090  127.570 42.741  1.00 29.67 ? 45  LYS A NZ  1 
ATOM   172   N N   . PHE A  1 21  ? 91.849  132.883 45.183  1.00 20.91 ? 46  PHE A N   1 
ATOM   173   C CA  . PHE A  1 21  ? 91.279  133.828 44.219  1.00 21.26 ? 46  PHE A CA  1 
ATOM   174   C C   . PHE A  1 21  ? 92.367  134.342 43.288  1.00 22.23 ? 46  PHE A C   1 
ATOM   175   O O   . PHE A  1 21  ? 93.437  134.767 43.734  1.00 21.58 ? 46  PHE A O   1 
ATOM   176   C CB  . PHE A  1 21  ? 90.666  135.013 44.983  1.00 19.40 ? 46  PHE A CB  1 
ATOM   177   C CG  . PHE A  1 21  ? 89.864  135.982 44.124  1.00 18.84 ? 46  PHE A CG  1 
ATOM   178   C CD1 . PHE A  1 21  ? 90.495  137.020 43.450  1.00 17.60 ? 46  PHE A CD1 1 
ATOM   179   C CD2 . PHE A  1 21  ? 88.465  135.892 44.055  1.00 18.59 ? 46  PHE A CD2 1 
ATOM   180   C CE1 . PHE A  1 21  ? 89.743  137.962 42.696  1.00 16.96 ? 46  PHE A CE1 1 
ATOM   181   C CE2 . PHE A  1 21  ? 87.702  136.818 43.308  1.00 17.15 ? 46  PHE A CE2 1 
ATOM   182   C CZ  . PHE A  1 21  ? 88.343  137.856 42.633  1.00 17.71 ? 46  PHE A CZ  1 
ATOM   183   N N   . THR A  1 22  ? 92.084  134.274 41.996  1.00 23.90 ? 47  THR A N   1 
ATOM   184   C CA  . THR A  1 22  ? 92.886  134.951 40.990  1.00 25.59 ? 47  THR A CA  1 
ATOM   185   C C   . THR A  1 22  ? 91.924  135.790 40.141  1.00 26.03 ? 47  THR A C   1 
ATOM   186   O O   . THR A  1 22  ? 90.707  135.634 40.240  1.00 25.48 ? 47  THR A O   1 
ATOM   187   C CB  . THR A  1 22  ? 93.701  133.944 40.142  1.00 27.08 ? 47  THR A CB  1 
ATOM   188   O OG1 . THR A  1 22  ? 92.843  133.306 39.187  1.00 28.46 ? 47  THR A OG1 1 
ATOM   189   C CG2 . THR A  1 22  ? 94.322  132.882 41.047  1.00 27.27 ? 47  THR A CG2 1 
ATOM   190   N N   . PRO A  1 23  ? 92.464  136.710 39.325  1.00 26.97 ? 48  PRO A N   1 
ATOM   191   C CA  . PRO A  1 23  ? 91.572  137.631 38.598  1.00 26.16 ? 48  PRO A CA  1 
ATOM   192   C C   . PRO A  1 23  ? 90.568  136.915 37.663  1.00 25.98 ? 48  PRO A C   1 
ATOM   193   O O   . PRO A  1 23  ? 89.471  137.417 37.467  1.00 24.75 ? 48  PRO A O   1 
ATOM   194   C CB  . PRO A  1 23  ? 92.559  138.526 37.821  1.00 27.01 ? 48  PRO A CB  1 
ATOM   195   C CG  . PRO A  1 23  ? 93.851  138.457 38.680  1.00 28.16 ? 48  PRO A CG  1 
ATOM   196   C CD  . PRO A  1 23  ? 93.890  136.996 39.067  1.00 27.22 ? 48  PRO A CD  1 
ATOM   197   N N   . GLU A  1 24  ? 90.926  135.745 37.132  1.00 26.63 ? 49  GLU A N   1 
ATOM   198   C CA  . GLU A  1 24  ? 89.970  134.944 36.354  1.00 27.64 ? 49  GLU A CA  1 
ATOM   199   C C   . GLU A  1 24  ? 88.727  134.506 37.138  1.00 26.74 ? 49  GLU A C   1 
ATOM   200   O O   . GLU A  1 24  ? 87.736  134.127 36.535  1.00 26.92 ? 49  GLU A O   1 
ATOM   201   C CB  . GLU A  1 24  ? 90.637  133.714 35.723  1.00 29.59 ? 49  GLU A CB  1 
ATOM   202   C CG  . GLU A  1 24  ? 91.564  134.066 34.563  1.00 32.74 ? 49  GLU A CG  1 
ATOM   203   C CD  . GLU A  1 24  ? 90.801  134.504 33.319  1.00 37.46 ? 49  GLU A CD  1 
ATOM   204   O OE1 . GLU A  1 24  ? 90.099  133.655 32.734  1.00 41.44 ? 49  GLU A OE1 1 
ATOM   205   O OE2 . GLU A  1 24  ? 90.915  135.679 32.909  1.00 38.15 ? 49  GLU A OE2 1 
ATOM   206   N N   . ASN A  1 25  ? 88.777  134.543 38.470  1.00 25.15 ? 50  ASN A N   1 
ATOM   207   C CA  . ASN A  1 25  ? 87.561  134.344 39.271  1.00 24.92 ? 50  ASN A CA  1 
ATOM   208   C C   . ASN A  1 25  ? 86.565  135.505 39.200  1.00 24.55 ? 50  ASN A C   1 
ATOM   209   O O   . ASN A  1 25  ? 85.423  135.390 39.683  1.00 24.99 ? 50  ASN A O   1 
ATOM   210   C CB  . ASN A  1 25  ? 87.895  134.083 40.748  1.00 23.16 ? 50  ASN A CB  1 
ATOM   211   C CG  . ASN A  1 25  ? 88.506  132.726 40.969  1.00 24.80 ? 50  ASN A CG  1 
ATOM   212   O OD1 . ASN A  1 25  ? 89.715  132.611 41.192  1.00 23.91 ? 50  ASN A OD1 1 
ATOM   213   N ND2 . ASN A  1 25  ? 87.685  131.674 40.878  1.00 24.21 ? 50  ASN A ND2 1 
ATOM   214   N N   . ILE A  1 26  ? 86.992  136.638 38.659  1.00 24.02 ? 51  ILE A N   1 
ATOM   215   C CA  . ILE A  1 26  ? 86.094  137.804 38.560  1.00 23.32 ? 51  ILE A CA  1 
ATOM   216   C C   . ILE A  1 26  ? 85.032  137.610 37.481  1.00 23.97 ? 51  ILE A C   1 
ATOM   217   O O   . ILE A  1 26  ? 85.341  137.224 36.346  1.00 24.32 ? 51  ILE A O   1 
ATOM   218   C CB  . ILE A  1 26  ? 86.879  139.077 38.204  1.00 23.10 ? 51  ILE A CB  1 
ATOM   219   C CG1 . ILE A  1 26  ? 87.799  139.464 39.361  1.00 21.90 ? 51  ILE A CG1 1 
ATOM   220   C CG2 . ILE A  1 26  ? 85.917  140.240 37.860  1.00 22.85 ? 51  ILE A CG2 1 
ATOM   221   C CD1 . ILE A  1 26  ? 88.939  140.404 38.937  1.00 24.24 ? 51  ILE A CD1 1 
ATOM   222   N N   . ASP A  1 27  ? 83.789  137.911 37.828  1.00 23.63 ? 52  ASP A N   1 
ATOM   223   C CA  . ASP A  1 27  ? 82.686  137.916 36.873  1.00 25.04 ? 52  ASP A CA  1 
ATOM   224   C C   . ASP A  1 27  ? 82.565  139.335 36.281  1.00 24.63 ? 52  ASP A C   1 
ATOM   225   O O   . ASP A  1 27  ? 82.402  140.308 37.021  1.00 24.14 ? 52  ASP A O   1 
ATOM   226   C CB  . ASP A  1 27  ? 81.415  137.515 37.628  1.00 25.41 ? 52  ASP A CB  1 
ATOM   227   C CG  . ASP A  1 27  ? 80.143  137.790 36.850  1.00 27.35 ? 52  ASP A CG  1 
ATOM   228   O OD1 . ASP A  1 27  ? 80.202  138.303 35.708  1.00 28.62 ? 52  ASP A OD1 1 
ATOM   229   O OD2 . ASP A  1 27  ? 79.067  137.468 37.406  1.00 29.58 ? 52  ASP A OD2 1 
ATOM   230   N N   . PRO A  1 28  ? 82.687  139.459 34.951  1.00 25.56 ? 53  PRO A N   1 
ATOM   231   C CA  . PRO A  1 28  ? 82.814  140.800 34.374  1.00 25.71 ? 53  PRO A CA  1 
ATOM   232   C C   . PRO A  1 28  ? 81.537  141.640 34.492  1.00 25.41 ? 53  PRO A C   1 
ATOM   233   O O   . PRO A  1 28  ? 81.600  142.860 34.328  1.00 24.67 ? 53  PRO A O   1 
ATOM   234   C CB  . PRO A  1 28  ? 83.144  140.532 32.901  1.00 26.46 ? 53  PRO A CB  1 
ATOM   235   C CG  . PRO A  1 28  ? 82.742  139.123 32.653  1.00 27.29 ? 53  PRO A CG  1 
ATOM   236   C CD  . PRO A  1 28  ? 82.848  138.392 33.947  1.00 26.57 ? 53  PRO A CD  1 
ATOM   237   N N   . PHE A  1 29  ? 80.404  140.997 34.765  1.00 25.56 ? 54  PHE A N   1 
ATOM   238   C CA  . PHE A  1 29  ? 79.118  141.716 34.817  1.00 25.69 ? 54  PHE A CA  1 
ATOM   239   C C   . PHE A  1 29  ? 78.607  141.862 36.240  1.00 24.98 ? 54  PHE A C   1 
ATOM   240   O O   . PHE A  1 29  ? 77.494  142.323 36.475  1.00 25.99 ? 54  PHE A O   1 
ATOM   241   C CB  . PHE A  1 29  ? 78.076  141.023 33.932  1.00 27.09 ? 54  PHE A CB  1 
ATOM   242   C CG  . PHE A  1 29  ? 78.349  141.183 32.466  1.00 27.96 ? 54  PHE A CG  1 
ATOM   243   C CD1 . PHE A  1 29  ? 77.974  142.342 31.813  1.00 27.39 ? 54  PHE A CD1 1 
ATOM   244   C CD2 . PHE A  1 29  ? 79.027  140.199 31.757  1.00 28.84 ? 54  PHE A CD2 1 
ATOM   245   C CE1 . PHE A  1 29  ? 78.241  142.525 30.471  1.00 30.87 ? 54  PHE A CE1 1 
ATOM   246   C CE2 . PHE A  1 29  ? 79.293  140.362 30.382  1.00 31.03 ? 54  PHE A CE2 1 
ATOM   247   C CZ  . PHE A  1 29  ? 78.900  141.523 29.746  1.00 31.66 ? 54  PHE A CZ  1 
ATOM   248   N N   . LEU A  1 30  ? 79.421  141.441 37.198  1.00 23.86 ? 55  LEU A N   1 
ATOM   249   C CA  . LEU A  1 30  ? 79.014  141.487 38.583  1.00 22.81 ? 55  LEU A CA  1 
ATOM   250   C C   . LEU A  1 30  ? 79.013  142.914 39.113  1.00 21.92 ? 55  LEU A C   1 
ATOM   251   O O   . LEU A  1 30  ? 78.053  143.331 39.758  1.00 21.43 ? 55  LEU A O   1 
ATOM   252   C CB  . LEU A  1 30  ? 79.967  140.647 39.403  1.00 22.41 ? 55  LEU A CB  1 
ATOM   253   C CG  . LEU A  1 30  ? 79.533  140.018 40.731  1.00 24.89 ? 55  LEU A CG  1 
ATOM   254   C CD1 . LEU A  1 30  ? 80.333  140.623 41.801  1.00 25.29 ? 55  LEU A CD1 1 
ATOM   255   C CD2 . LEU A  1 30  ? 78.039  140.055 41.036  1.00 26.04 ? 55  LEU A CD2 1 
ATOM   256   N N   . CYS A  1 31  ? 80.093  143.646 38.851  1.00 20.24 ? 56  CYS A N   1 
ATOM   257   C CA  . CYS A  1 31  ? 80.278  144.983 39.401  1.00 20.23 ? 56  CYS A CA  1 
ATOM   258   C C   . CYS A  1 31  ? 80.332  146.007 38.269  1.00 20.54 ? 56  CYS A C   1 
ATOM   259   O O   . CYS A  1 31  ? 80.595  145.659 37.106  1.00 20.98 ? 56  CYS A O   1 
ATOM   260   C CB  . CYS A  1 31  ? 81.590  145.027 40.228  1.00 19.48 ? 56  CYS A CB  1 
ATOM   261   S SG  . CYS A  1 31  ? 81.644  143.721 41.516  1.00 20.85 ? 56  CYS A SG  1 
ATOM   262   N N   . SER A  1 32  ? 80.107  147.275 38.604  1.00 19.89 ? 57  SER A N   1 
ATOM   263   C CA  . SER A  1 32  ? 80.307  148.355 37.627  1.00 19.60 ? 57  SER A CA  1 
ATOM   264   C C   . SER A  1 32  ? 81.785  148.797 37.583  1.00 18.96 ? 57  SER A C   1 
ATOM   265   O O   . SER A  1 32  ? 82.281  149.223 36.526  1.00 18.39 ? 57  SER A O   1 
ATOM   266   C CB  . SER A  1 32  ? 79.392  149.553 37.930  1.00 19.26 ? 57  SER A CB  1 
ATOM   267   O OG  . SER A  1 32  ? 79.718  150.131 39.189  1.00 18.68 ? 57  SER A OG  1 
ATOM   268   N N   . HIS A  1 33  ? 82.465  148.702 38.732  1.00 17.92 ? 58  HIS A N   1 
ATOM   269   C CA  . HIS A  1 33  ? 83.873  149.103 38.863  1.00 17.46 ? 58  HIS A CA  1 
ATOM   270   C C   . HIS A  1 33  ? 84.618  148.035 39.645  1.00 17.09 ? 58  HIS A C   1 
ATOM   271   O O   . HIS A  1 33  ? 84.096  147.518 40.635  1.00 17.44 ? 58  HIS A O   1 
ATOM   272   C CB  . HIS A  1 33  ? 84.032  150.406 39.644  1.00 17.37 ? 58  HIS A CB  1 
ATOM   273   C CG  . HIS A  1 33  ? 83.361  151.594 39.021  1.00 17.19 ? 58  HIS A CG  1 
ATOM   274   N ND1 . HIS A  1 33  ? 82.001  151.665 38.835  1.00 18.01 ? 58  HIS A ND1 1 
ATOM   275   C CD2 . HIS A  1 33  ? 83.862  152.779 38.599  1.00 17.94 ? 58  HIS A CD2 1 
ATOM   276   C CE1 . HIS A  1 33  ? 81.690  152.830 38.291  1.00 21.32 ? 58  HIS A CE1 1 
ATOM   277   N NE2 . HIS A  1 33  ? 82.806  153.527 38.139  1.00 18.94 ? 58  HIS A NE2 1 
ATOM   278   N N   . LEU A  1 34  ? 85.822  147.689 39.195  1.00 16.63 ? 59  LEU A N   1 
ATOM   279   C CA  . LEU A  1 34  ? 86.689  146.773 39.949  1.00 16.37 ? 59  LEU A CA  1 
ATOM   280   C C   . LEU A  1 34  ? 87.898  147.569 40.388  1.00 15.77 ? 59  LEU A C   1 
ATOM   281   O O   . LEU A  1 34  ? 88.344  148.458 39.671  1.00 17.43 ? 59  LEU A O   1 
ATOM   282   C CB  . LEU A  1 34  ? 87.147  145.608 39.075  1.00 16.74 ? 59  LEU A CB  1 
ATOM   283   C CG  . LEU A  1 34  ? 86.012  144.706 38.602  1.00 19.04 ? 59  LEU A CG  1 
ATOM   284   C CD1 . LEU A  1 34  ? 86.462  143.906 37.392  1.00 19.06 ? 59  LEU A CD1 1 
ATOM   285   C CD2 . LEU A  1 34  ? 85.611  143.803 39.776  1.00 18.47 ? 59  LEU A CD2 1 
ATOM   286   N N   . ILE A  1 35  ? 88.411  147.278 41.566  1.00 14.94 ? 60  ILE A N   1 
ATOM   287   C CA  . ILE A  1 35  ? 89.604  147.976 42.061  1.00 15.41 ? 60  ILE A CA  1 
ATOM   288   C C   . ILE A  1 35  ? 90.645  146.984 42.566  1.00 15.46 ? 60  ILE A C   1 
ATOM   289   O O   . ILE A  1 35  ? 90.395  146.228 43.503  1.00 15.33 ? 60  ILE A O   1 
ATOM   290   C CB  . ILE A  1 35  ? 89.282  148.992 43.188  1.00 14.11 ? 60  ILE A CB  1 
ATOM   291   C CG1 . ILE A  1 35  ? 88.122  149.927 42.790  1.00 14.11 ? 60  ILE A CG1 1 
ATOM   292   C CG2 . ILE A  1 35  ? 90.512  149.824 43.494  1.00 14.64 ? 60  ILE A CG2 1 
ATOM   293   C CD1 . ILE A  1 35  ? 87.818  151.081 43.818  1.00 14.23 ? 60  ILE A CD1 1 
ATOM   294   N N   . TYR A  1 36  ? 91.819  146.983 41.936  1.00 16.19 ? 61  TYR A N   1 
ATOM   295   C CA  . TYR A  1 36  ? 92.902  146.109 42.369  1.00 16.53 ? 61  TYR A CA  1 
ATOM   296   C C   . TYR A  1 36  ? 93.680  146.705 43.539  1.00 16.74 ? 61  TYR A C   1 
ATOM   297   O O   . TYR A  1 36  ? 94.152  147.844 43.463  1.00 16.58 ? 61  TYR A O   1 
ATOM   298   C CB  . TYR A  1 36  ? 93.850  145.882 41.206  1.00 17.96 ? 61  TYR A CB  1 
ATOM   299   C CG  . TYR A  1 36  ? 95.123  145.144 41.553  1.00 17.94 ? 61  TYR A CG  1 
ATOM   300   C CD1 . TYR A  1 36  ? 95.174  143.762 41.514  1.00 20.08 ? 61  TYR A CD1 1 
ATOM   301   C CD2 . TYR A  1 36  ? 96.280  145.841 41.891  1.00 19.70 ? 61  TYR A CD2 1 
ATOM   302   C CE1 . TYR A  1 36  ? 96.369  143.068 41.801  1.00 20.05 ? 61  TYR A CE1 1 
ATOM   303   C CE2 . TYR A  1 36  ? 97.482  145.164 42.161  1.00 19.99 ? 61  TYR A CE2 1 
ATOM   304   C CZ  . TYR A  1 36  ? 97.513  143.785 42.124  1.00 20.86 ? 61  TYR A CZ  1 
ATOM   305   O OH  . TYR A  1 36  ? 98.698  143.112 42.406  1.00 21.99 ? 61  TYR A OH  1 
ATOM   306   N N   . SER A  1 37  ? 93.880  145.899 44.582  1.00 16.23 ? 62  SER A N   1 
ATOM   307   C CA  . SER A  1 37  ? 94.591  146.298 45.786  1.00 16.89 ? 62  SER A CA  1 
ATOM   308   C C   . SER A  1 37  ? 95.810  145.405 46.021  1.00 17.49 ? 62  SER A C   1 
ATOM   309   O O   . SER A  1 37  ? 95.641  144.186 46.106  1.00 18.03 ? 62  SER A O   1 
ATOM   310   C CB  . SER A  1 37  ? 93.648  146.109 46.991  1.00 16.80 ? 62  SER A CB  1 
ATOM   311   O OG  . SER A  1 37  ? 92.432  146.741 46.731  1.00 18.45 ? 62  SER A OG  1 
ATOM   312   N N   . PHE A  1 38  ? 97.029  145.958 46.141  1.00 17.61 ? 63  PHE A N   1 
ATOM   313   C CA  . PHE A  1 38  ? 97.369  147.374 46.003  1.00 17.30 ? 63  PHE A CA  1 
ATOM   314   C C   . PHE A  1 38  ? 98.638  147.463 45.178  1.00 18.38 ? 63  PHE A C   1 
ATOM   315   O O   . PHE A  1 38  ? 99.471  146.551 45.258  1.00 17.47 ? 63  PHE A O   1 
ATOM   316   C CB  . PHE A  1 38  ? 97.720  147.994 47.379  1.00 17.15 ? 63  PHE A CB  1 
ATOM   317   C CG  . PHE A  1 38  ? 96.534  148.124 48.318  1.00 17.85 ? 63  PHE A CG  1 
ATOM   318   C CD1 . PHE A  1 38  ? 95.561  149.097 48.106  1.00 15.65 ? 63  PHE A CD1 1 
ATOM   319   C CD2 . PHE A  1 38  ? 96.399  147.258 49.405  1.00 18.22 ? 63  PHE A CD2 1 
ATOM   320   C CE1 . PHE A  1 38  ? 94.441  149.220 48.994  1.00 15.82 ? 63  PHE A CE1 1 
ATOM   321   C CE2 . PHE A  1 38  ? 95.294  147.357 50.281  1.00 16.82 ? 63  PHE A CE2 1 
ATOM   322   C CZ  . PHE A  1 38  ? 94.321  148.363 50.074  1.00 15.32 ? 63  PHE A CZ  1 
ATOM   323   N N   . ALA A  1 39  ? 98.794  148.555 44.427  1.00 18.16 ? 64  ALA A N   1 
ATOM   324   C CA  . ALA A  1 39  ? 100.069 148.880 43.779  1.00 20.45 ? 64  ALA A CA  1 
ATOM   325   C C   . ALA A  1 39  ? 100.998 149.471 44.828  1.00 21.20 ? 64  ALA A C   1 
ATOM   326   O O   . ALA A  1 39  ? 100.540 149.832 45.893  1.00 21.06 ? 64  ALA A O   1 
ATOM   327   C CB  . ALA A  1 39  ? 99.853  149.877 42.662  1.00 20.79 ? 64  ALA A CB  1 
ATOM   328   N N   . SER A  1 40  ? 102.294 149.546 44.536  1.00 22.21 ? 65  SER A N   1 
ATOM   329   C CA  . SER A  1 40  ? 103.212 150.250 45.425  1.00 23.44 ? 65  SER A CA  1 
ATOM   330   C C   . SER A  1 40  ? 103.976 151.330 44.648  1.00 23.50 ? 65  SER A C   1 
ATOM   331   O O   . SER A  1 40  ? 103.672 151.600 43.477  1.00 22.79 ? 65  SER A O   1 
ATOM   332   C CB  . SER A  1 40  ? 104.182 149.289 46.100  1.00 24.29 ? 65  SER A CB  1 
ATOM   333   O OG  . SER A  1 40  ? 104.579 148.318 45.169  1.00 28.74 ? 65  SER A OG  1 
ATOM   334   N N   . ILE A  1 41  ? 104.956 151.943 45.311  1.00 23.85 ? 66  ILE A N   1 
ATOM   335   C CA  . ILE A  1 41  ? 105.720 153.040 44.750  1.00 24.29 ? 66  ILE A CA  1 
ATOM   336   C C   . ILE A  1 41  ? 107.215 152.720 44.894  1.00 25.96 ? 66  ILE A C   1 
ATOM   337   O O   . ILE A  1 41  ? 107.696 152.379 45.982  1.00 27.16 ? 66  ILE A O   1 
ATOM   338   C CB  . ILE A  1 41  ? 105.406 154.372 45.494  1.00 24.20 ? 66  ILE A CB  1 
ATOM   339   C CG1 . ILE A  1 41  ? 103.927 154.754 45.368  1.00 22.78 ? 66  ILE A CG1 1 
ATOM   340   C CG2 . ILE A  1 41  ? 106.335 155.496 45.014  1.00 23.35 ? 66  ILE A CG2 1 
ATOM   341   C CD1 . ILE A  1 41  ? 103.518 155.922 46.271  1.00 23.89 ? 66  ILE A CD1 1 
ATOM   342   N N   . GLU A  1 42  ? 107.955 152.799 43.807  1.00 26.25 ? 67  GLU A N   1 
ATOM   343   C CA  . GLU A  1 42  ? 109.398 152.525 43.872  1.00 28.90 ? 67  GLU A CA  1 
ATOM   344   C C   . GLU A  1 42  ? 110.108 153.557 43.011  1.00 29.32 ? 67  GLU A C   1 
ATOM   345   O O   . GLU A  1 42  ? 109.761 153.750 41.839  1.00 28.84 ? 67  GLU A O   1 
ATOM   346   C CB  . GLU A  1 42  ? 109.670 151.095 43.408  1.00 29.54 ? 67  GLU A CB  1 
ATOM   347   C CG  . GLU A  1 42  ? 111.120 150.732 43.123  1.00 35.61 ? 67  GLU A CG  1 
ATOM   348   C CD  . GLU A  1 42  ? 111.216 149.346 42.482  1.00 40.11 ? 67  GLU A CD  1 
ATOM   349   O OE1 . GLU A  1 42  ? 110.872 148.347 43.159  1.00 41.24 ? 67  GLU A OE1 1 
ATOM   350   O OE2 . GLU A  1 42  ? 111.608 149.268 41.294  1.00 41.46 ? 67  GLU A OE2 1 
ATOM   351   N N   . ASN A  1 43  ? 111.071 154.262 43.603  1.00 30.51 ? 68  ASN A N   1 
ATOM   352   C CA  . ASN A  1 43  ? 111.736 155.355 42.897  1.00 31.52 ? 68  ASN A CA  1 
ATOM   353   C C   . ASN A  1 43  ? 110.721 156.388 42.381  1.00 30.31 ? 68  ASN A C   1 
ATOM   354   O O   . ASN A  1 43  ? 110.841 156.888 41.256  1.00 30.01 ? 68  ASN A O   1 
ATOM   355   C CB  . ASN A  1 43  ? 112.586 154.833 41.730  1.00 33.10 ? 68  ASN A CB  1 
ATOM   356   C CG  . ASN A  1 43  ? 113.751 153.960 42.180  1.00 36.51 ? 68  ASN A CG  1 
ATOM   357   O OD1 . ASN A  1 43  ? 114.058 153.842 43.367  1.00 37.71 ? 68  ASN A OD1 1 
ATOM   358   N ND2 . ASN A  1 43  ? 114.418 153.351 41.211  1.00 38.44 ? 68  ASN A ND2 1 
ATOM   359   N N   . ASN A  1 44  ? 109.734 156.699 43.220  1.00 28.71 ? 69  ASN A N   1 
ATOM   360   C CA  . ASN A  1 44  ? 108.682 157.658 42.914  1.00 28.58 ? 69  ASN A CA  1 
ATOM   361   C C   . ASN A  1 44  ? 107.721 157.241 41.813  1.00 28.34 ? 69  ASN A C   1 
ATOM   362   O O   . ASN A  1 44  ? 106.916 158.057 41.382  1.00 28.47 ? 69  ASN A O   1 
ATOM   363   C CB  . ASN A  1 44  ? 109.244 159.030 42.554  1.00 29.19 ? 69  ASN A CB  1 
ATOM   364   C CG  . ASN A  1 44  ? 109.997 159.664 43.689  1.00 30.62 ? 69  ASN A CG  1 
ATOM   365   O OD1 . ASN A  1 44  ? 109.773 159.343 44.854  1.00 31.26 ? 69  ASN A OD1 1 
ATOM   366   N ND2 . ASN A  1 44  ? 110.903 160.576 43.357  1.00 32.19 ? 69  ASN A ND2 1 
ATOM   367   N N   . LYS A  1 45  ? 107.816 156.004 41.338  1.00 28.14 ? 70  LYS A N   1 
ATOM   368   C CA  . LYS A  1 45  ? 106.948 155.569 40.251  1.00 27.87 ? 70  LYS A CA  1 
ATOM   369   C C   . LYS A  1 45  ? 106.047 154.424 40.694  1.00 26.36 ? 70  LYS A C   1 
ATOM   370   O O   . LYS A  1 45  ? 106.451 153.602 41.521  1.00 26.18 ? 70  LYS A O   1 
ATOM   371   C CB  . LYS A  1 45  ? 107.778 155.145 39.037  1.00 28.98 ? 70  LYS A CB  1 
ATOM   372   C CG  . LYS A  1 45  ? 108.596 156.281 38.386  1.00 32.38 ? 70  LYS A CG  1 
ATOM   373   C CD  . LYS A  1 45  ? 109.292 155.763 37.138  1.00 36.30 ? 70  LYS A CD  1 
ATOM   374   C CE  . LYS A  1 45  ? 110.675 156.383 36.948  1.00 40.13 ? 70  LYS A CE  1 
ATOM   375   N NZ  . LYS A  1 45  ? 110.620 157.863 36.694  1.00 42.25 ? 70  LYS A NZ  1 
ATOM   376   N N   . VAL A  1 46  ? 104.836 154.368 40.145  1.00 24.98 ? 71  VAL A N   1 
ATOM   377   C CA  . VAL A  1 46  ? 103.917 153.272 40.462  1.00 23.94 ? 71  VAL A CA  1 
ATOM   378   C C   . VAL A  1 46  ? 104.465 151.955 39.912  1.00 25.41 ? 71  VAL A C   1 
ATOM   379   O O   . VAL A  1 46  ? 105.064 151.916 38.826  1.00 25.43 ? 71  VAL A O   1 
ATOM   380   C CB  . VAL A  1 46  ? 102.477 153.527 39.931  1.00 23.18 ? 71  VAL A CB  1 
ATOM   381   C CG1 . VAL A  1 46  ? 102.467 153.666 38.402  1.00 24.54 ? 71  VAL A CG1 1 
ATOM   382   C CG2 . VAL A  1 46  ? 101.517 152.399 40.395  1.00 21.78 ? 71  VAL A CG2 1 
ATOM   383   N N   . ILE A  1 47  ? 104.300 150.887 40.683  1.00 25.16 ? 72  ILE A N   1 
ATOM   384   C CA  . ILE A  1 47  ? 104.676 149.545 40.241  1.00 27.12 ? 72  ILE A CA  1 
ATOM   385   C C   . ILE A  1 47  ? 103.724 148.544 40.881  1.00 26.59 ? 72  ILE A C   1 
ATOM   386   O O   . ILE A  1 47  ? 103.166 148.806 41.938  1.00 25.28 ? 72  ILE A O   1 
ATOM   387   C CB  . ILE A  1 47  ? 106.100 149.144 40.683  1.00 28.09 ? 72  ILE A CB  1 
ATOM   388   C CG1 . ILE A  1 47  ? 106.242 149.248 42.212  1.00 28.69 ? 72  ILE A CG1 1 
ATOM   389   C CG2 . ILE A  1 47  ? 107.155 149.953 39.928  1.00 31.40 ? 72  ILE A CG2 1 
ATOM   390   C CD1 . ILE A  1 47  ? 107.165 148.156 42.831  1.00 33.11 ? 72  ILE A CD1 1 
ATOM   391   N N   . ILE A  1 48  ? 103.571 147.387 40.249  1.00 27.61 ? 73  ILE A N   1 
ATOM   392   C CA  . ILE A  1 48  ? 102.809 146.295 40.849  1.00 28.02 ? 73  ILE A CA  1 
ATOM   393   C C   . ILE A  1 48  ? 103.792 145.185 41.255  1.00 29.39 ? 73  ILE A C   1 
ATOM   394   O O   . ILE A  1 48  ? 104.621 144.775 40.454  1.00 31.32 ? 73  ILE A O   1 
ATOM   395   C CB  . ILE A  1 48  ? 101.691 145.830 39.879  1.00 27.67 ? 73  ILE A CB  1 
ATOM   396   C CG1 . ILE A  1 48  ? 100.604 146.928 39.829  1.00 25.93 ? 73  ILE A CG1 1 
ATOM   397   C CG2 . ILE A  1 48  ? 101.090 144.480 40.317  1.00 27.65 ? 73  ILE A CG2 1 
ATOM   398   C CD1 . ILE A  1 48  ? 99.459  146.685 38.831  1.00 26.39 ? 73  ILE A CD1 1 
ATOM   399   N N   . LYS A  1 49  ? 103.758 144.759 42.515  1.00 29.88 ? 74  LYS A N   1 
ATOM   400   C CA  . LYS A  1 49  ? 104.545 143.593 42.925  1.00 32.24 ? 74  LYS A CA  1 
ATOM   401   C C   . LYS A  1 49  ? 103.621 142.405 43.195  1.00 31.64 ? 74  LYS A C   1 
ATOM   402   O O   . LYS A  1 49  ? 102.897 142.358 44.213  1.00 30.99 ? 74  LYS A O   1 
ATOM   403   C CB  . LYS A  1 49  ? 105.501 143.898 44.083  1.00 33.22 ? 74  LYS A CB  1 
ATOM   404   C CG  . LYS A  1 49  ? 104.874 144.606 45.257  1.00 34.06 ? 74  LYS A CG  1 
ATOM   405   C CD  . LYS A  1 49  ? 105.965 145.010 46.237  1.00 38.16 ? 74  LYS A CD  1 
ATOM   406   C CE  . LYS A  1 49  ? 105.375 145.601 47.506  1.00 38.48 ? 74  LYS A CE  1 
ATOM   407   N NZ  . LYS A  1 49  ? 106.384 146.464 48.147  1.00 39.08 ? 74  LYS A NZ  1 
ATOM   408   N N   . ASP A  1 50  ? 103.643 141.473 42.238  1.00 31.69 ? 75  ASP A N   1 
ATOM   409   C CA  . ASP A  1 50  ? 102.624 140.445 42.055  1.00 30.70 ? 75  ASP A CA  1 
ATOM   410   C C   . ASP A  1 50  ? 103.215 139.503 41.010  1.00 32.21 ? 75  ASP A C   1 
ATOM   411   O O   . ASP A  1 50  ? 103.376 139.886 39.837  1.00 32.07 ? 75  ASP A O   1 
ATOM   412   C CB  . ASP A  1 50  ? 101.336 141.082 41.509  1.00 29.85 ? 75  ASP A CB  1 
ATOM   413   C CG  . ASP A  1 50  ? 100.138 140.141 41.556  1.00 29.35 ? 75  ASP A CG  1 
ATOM   414   O OD1 . ASP A  1 50  ? 100.339 138.905 41.590  1.00 30.02 ? 75  ASP A OD1 1 
ATOM   415   O OD2 . ASP A  1 50  ? 98.985  140.641 41.549  1.00 30.65 ? 75  ASP A OD2 1 
ATOM   416   N N   . LYS A  1 51  ? 103.601 138.298 41.439  1.00 32.06 ? 76  LYS A N   1 
ATOM   417   C CA  . LYS A  1 51  ? 104.115 137.280 40.513  1.00 33.26 ? 76  LYS A CA  1 
ATOM   418   C C   . LYS A  1 51  ? 103.092 137.013 39.416  1.00 32.10 ? 76  LYS A C   1 
ATOM   419   O O   . LYS A  1 51  ? 103.430 136.491 38.372  1.00 32.89 ? 76  LYS A O   1 
ATOM   420   C CB  . LYS A  1 51  ? 104.357 135.971 41.251  1.00 34.20 ? 76  LYS A CB  1 
ATOM   421   C CG  . LYS A  1 51  ? 103.101 135.509 41.972  1.00 33.90 ? 76  LYS A CG  1 
ATOM   422   C CD  . LYS A  1 51  ? 103.397 134.403 42.939  1.00 38.18 ? 76  LYS A CD  1 
ATOM   423   C CE  . LYS A  1 51  ? 102.280 134.302 43.954  1.00 37.44 ? 76  LYS A CE  1 
ATOM   424   N NZ  . LYS A  1 51  ? 102.689 133.328 44.991  1.00 39.98 ? 76  LYS A NZ  1 
ATOM   425   N N   . SER A  1 52  ? 101.840 137.383 39.664  1.00 30.51 ? 77  SER A N   1 
ATOM   426   C CA  . SER A  1 52  ? 100.754 137.157 38.704  1.00 30.18 ? 77  SER A CA  1 
ATOM   427   C C   . SER A  1 52  ? 100.415 138.441 37.952  1.00 29.86 ? 77  SER A C   1 
ATOM   428   O O   . SER A  1 52  ? 99.330  138.569 37.353  1.00 27.84 ? 77  SER A O   1 
ATOM   429   C CB  . SER A  1 52  ? 99.508  136.627 39.416  1.00 29.52 ? 77  SER A CB  1 
ATOM   430   O OG  . SER A  1 52  ? 99.725  135.303 39.871  1.00 31.37 ? 77  SER A OG  1 
ATOM   431   N N   . GLU A  1 53  ? 101.361 139.377 37.981  1.00 29.19 ? 78  GLU A N   1 
ATOM   432   C CA  . GLU A  1 53  ? 101.185 140.652 37.315  1.00 29.90 ? 78  GLU A CA  1 
ATOM   433   C C   . GLU A  1 53  ? 100.692 140.463 35.854  1.00 29.95 ? 78  GLU A C   1 
ATOM   434   O O   . GLU A  1 53  ? 99.711  141.094 35.435  1.00 28.98 ? 78  GLU A O   1 
ATOM   435   C CB  . GLU A  1 53  ? 102.502 141.446 37.362  1.00 30.75 ? 78  GLU A CB  1 
ATOM   436   C CG  . GLU A  1 53  ? 102.386 142.851 36.807  1.00 32.91 ? 78  GLU A CG  1 
ATOM   437   C CD  . GLU A  1 53  ? 103.744 143.534 36.611  1.00 34.88 ? 78  GLU A CD  1 
ATOM   438   O OE1 . GLU A  1 53  ? 104.796 142.880 36.836  1.00 34.16 ? 78  GLU A OE1 1 
ATOM   439   O OE2 . GLU A  1 53  ? 103.739 144.734 36.239  1.00 34.06 ? 78  GLU A OE2 1 
ATOM   440   N N   . VAL A  1 54  ? 101.356 139.595 35.085  1.00 31.06 ? 79  VAL A N   1 
ATOM   441   C CA  . VAL A  1 54  ? 100.990 139.397 33.672  1.00 31.92 ? 79  VAL A CA  1 
ATOM   442   C C   . VAL A  1 54  ? 99.566  138.815 33.487  1.00 31.67 ? 79  VAL A C   1 
ATOM   443   O O   . VAL A  1 54  ? 98.867  139.168 32.522  1.00 30.83 ? 79  VAL A O   1 
ATOM   444   C CB  . VAL A  1 54  ? 102.035 138.552 32.880  1.00 34.55 ? 79  VAL A CB  1 
ATOM   445   C CG1 . VAL A  1 54  ? 101.499 138.174 31.497  1.00 35.35 ? 79  VAL A CG1 1 
ATOM   446   C CG2 . VAL A  1 54  ? 103.385 139.293 32.742  1.00 34.98 ? 79  VAL A CG2 1 
ATOM   447   N N   . MET A  1 55  ? 99.168  137.910 34.390  1.00 30.61 ? 80  MET A N   1 
ATOM   448   C CA  . MET A  1 55  ? 97.790  137.421 34.481  1.00 30.70 ? 80  MET A CA  1 
ATOM   449   C C   . MET A  1 55  ? 96.777  138.547 34.740  1.00 28.31 ? 80  MET A C   1 
ATOM   450   O O   . MET A  1 55  ? 95.709  138.587 34.119  1.00 28.26 ? 80  MET A O   1 
ATOM   451   C CB  . MET A  1 55  ? 97.642  136.393 35.615  1.00 30.82 ? 80  MET A CB  1 
ATOM   452   C CG  . MET A  1 55  ? 98.380  135.066 35.384  1.00 35.61 ? 80  MET A CG  1 
ATOM   453   S SD  . MET A  1 55  ? 98.719  134.198 36.957  1.00 40.43 ? 80  MET A SD  1 
ATOM   454   C CE  . MET A  1 55  ? 97.046  133.880 37.550  1.00 38.19 ? 80  MET A CE  1 
ATOM   455   N N   . LEU A  1 56  ? 97.087  139.437 35.678  1.00 25.83 ? 81  LEU A N   1 
ATOM   456   C CA  . LEU A  1 56  ? 96.196  140.574 35.951  1.00 23.62 ? 81  LEU A CA  1 
ATOM   457   C C   . LEU A  1 56  ? 95.948  141.380 34.659  1.00 23.83 ? 81  LEU A C   1 
ATOM   458   O O   . LEU A  1 56  ? 94.798  141.669 34.295  1.00 22.60 ? 81  LEU A O   1 
ATOM   459   C CB  . LEU A  1 56  ? 96.807  141.500 37.018  1.00 23.27 ? 81  LEU A CB  1 
ATOM   460   C CG  . LEU A  1 56  ? 96.057  142.812 37.304  1.00 21.39 ? 81  LEU A CG  1 
ATOM   461   C CD1 . LEU A  1 56  ? 94.655  142.553 37.946  1.00 19.78 ? 81  LEU A CD1 1 
ATOM   462   C CD2 . LEU A  1 56  ? 96.898  143.733 38.212  1.00 20.90 ? 81  LEU A CD2 1 
ATOM   463   N N   . TYR A  1 57  ? 97.027  141.737 33.966  1.00 23.85 ? 82  TYR A N   1 
ATOM   464   C CA  . TYR A  1 57  ? 96.890  142.482 32.709  1.00 24.89 ? 82  TYR A CA  1 
ATOM   465   C C   . TYR A  1 57  ? 96.052  141.769 31.649  1.00 25.71 ? 82  TYR A C   1 
ATOM   466   O O   . TYR A  1 57  ? 95.200  142.386 31.011  1.00 25.26 ? 82  TYR A O   1 
ATOM   467   C CB  . TYR A  1 57  ? 98.252  142.879 32.133  1.00 26.31 ? 82  TYR A CB  1 
ATOM   468   C CG  . TYR A  1 57  ? 99.090  143.686 33.096  1.00 25.56 ? 82  TYR A CG  1 
ATOM   469   C CD1 . TYR A  1 57  ? 98.494  144.581 33.973  1.00 26.48 ? 82  TYR A CD1 1 
ATOM   470   C CD2 . TYR A  1 57  ? 100.480 143.569 33.111  1.00 28.90 ? 82  TYR A CD2 1 
ATOM   471   C CE1 . TYR A  1 57  ? 99.252  145.332 34.860  1.00 26.15 ? 82  TYR A CE1 1 
ATOM   472   C CE2 . TYR A  1 57  ? 101.253 144.314 34.001  1.00 27.62 ? 82  TYR A CE2 1 
ATOM   473   C CZ  . TYR A  1 57  ? 100.627 145.199 34.866  1.00 25.73 ? 82  TYR A CZ  1 
ATOM   474   O OH  . TYR A  1 57  ? 101.360 145.938 35.758  1.00 26.38 ? 82  TYR A OH  1 
ATOM   475   N N   . GLN A  1 58  ? 96.298  140.474 31.456  1.00 26.12 ? 83  GLN A N   1 
ATOM   476   C CA  . GLN A  1 58  ? 95.547  139.686 30.487  1.00 27.15 ? 83  GLN A CA  1 
ATOM   477   C C   . GLN A  1 58  ? 94.063  139.667 30.873  1.00 26.16 ? 83  GLN A C   1 
ATOM   478   O O   . GLN A  1 58  ? 93.166  139.819 30.029  1.00 25.59 ? 83  GLN A O   1 
ATOM   479   C CB  . GLN A  1 58  ? 96.139  138.253 30.378  1.00 28.48 ? 83  GLN A CB  1 
ATOM   480   C CG  . GLN A  1 58  ? 97.579  138.250 29.851  1.00 31.30 ? 83  GLN A CG  1 
ATOM   481   C CD  . GLN A  1 58  ? 98.258  136.869 29.840  1.00 36.09 ? 83  GLN A CD  1 
ATOM   482   O OE1 . GLN A  1 58  ? 97.742  135.883 30.383  1.00 38.02 ? 83  GLN A OE1 1 
ATOM   483   N NE2 . GLN A  1 58  ? 99.421  136.808 29.237  1.00 35.02 ? 83  GLN A NE2 1 
ATOM   484   N N   . THR A  1 59  ? 93.816  139.510 32.165  1.00 24.44 ? 84  THR A N   1 
ATOM   485   C CA  . THR A  1 59  ? 92.460  139.429 32.683  1.00 24.08 ? 84  THR A CA  1 
ATOM   486   C C   . THR A  1 59  ? 91.710  140.756 32.564  1.00 23.02 ? 84  THR A C   1 
ATOM   487   O O   . THR A  1 59  ? 90.559  140.781 32.132  1.00 23.33 ? 84  THR A O   1 
ATOM   488   C CB  . THR A  1 59  ? 92.464  138.927 34.123  1.00 22.99 ? 84  THR A CB  1 
ATOM   489   O OG1 . THR A  1 59  ? 92.956  137.579 34.117  1.00 24.25 ? 84  THR A OG1 1 
ATOM   490   C CG2 . THR A  1 59  ? 91.061  138.944 34.685  1.00 22.45 ? 84  THR A CG2 1 
ATOM   491   N N   . ILE A  1 60  ? 92.364  141.855 32.923  1.00 23.16 ? 85  ILE A N   1 
ATOM   492   C CA  . ILE A  1 60  ? 91.835  143.206 32.637  1.00 22.42 ? 85  ILE A CA  1 
ATOM   493   C C   . ILE A  1 60  ? 91.322  143.355 31.176  1.00 23.78 ? 85  ILE A C   1 
ATOM   494   O O   . ILE A  1 60  ? 90.176  143.763 30.948  1.00 23.36 ? 85  ILE A O   1 
ATOM   495   C CB  . ILE A  1 60  ? 92.879  144.301 32.990  1.00 22.13 ? 85  ILE A CB  1 
ATOM   496   C CG1 . ILE A  1 60  ? 93.065  144.359 34.522  1.00 21.43 ? 85  ILE A CG1 1 
ATOM   497   C CG2 . ILE A  1 60  ? 92.441  145.671 32.454  1.00 21.57 ? 85  ILE A CG2 1 
ATOM   498   C CD1 . ILE A  1 60  ? 94.154  145.289 34.997  1.00 19.75 ? 85  ILE A CD1 1 
ATOM   499   N N   . ASN A  1 61  ? 92.142  142.993 30.198  1.00 24.83 ? 86  ASN A N   1 
ATOM   500   C CA  . ASN A  1 61  ? 91.745  143.151 28.807  1.00 27.19 ? 86  ASN A CA  1 
ATOM   501   C C   . ASN A  1 61  ? 90.590  142.229 28.445  1.00 28.17 ? 86  ASN A C   1 
ATOM   502   O O   . ASN A  1 61  ? 89.674  142.616 27.717  1.00 28.12 ? 86  ASN A O   1 
ATOM   503   C CB  . ASN A  1 61  ? 92.924  142.864 27.888  1.00 28.58 ? 86  ASN A CB  1 
ATOM   504   C CG  . ASN A  1 61  ? 94.002  143.893 28.038  1.00 29.86 ? 86  ASN A CG  1 
ATOM   505   O OD1 . ASN A  1 61  ? 93.745  144.991 28.532  1.00 28.23 ? 86  ASN A OD1 1 
ATOM   506   N ND2 . ASN A  1 61  ? 95.218  143.551 27.639  1.00 29.60 ? 86  ASN A ND2 1 
ATOM   507   N N   . SER A  1 62  ? 90.653  141.007 28.962  1.00 27.63 ? 87  SER A N   1 
ATOM   508   C CA  . SER A  1 62  ? 89.617  140.017 28.721  1.00 29.00 ? 87  SER A CA  1 
ATOM   509   C C   . SER A  1 62  ? 88.272  140.455 29.338  1.00 27.64 ? 87  SER A C   1 
ATOM   510   O O   . SER A  1 62  ? 87.228  140.349 28.703  1.00 28.17 ? 87  SER A O   1 
ATOM   511   C CB  . SER A  1 62  ? 90.063  138.665 29.309  1.00 29.37 ? 87  SER A CB  1 
ATOM   512   O OG  . SER A  1 62  ? 89.073  137.679 29.118  1.00 31.89 ? 87  SER A OG  1 
ATOM   513   N N   . LEU A  1 63  ? 88.296  140.911 30.586  1.00 26.12 ? 88  LEU A N   1 
ATOM   514   C CA  . LEU A  1 63  ? 87.079  141.389 31.263  1.00 25.58 ? 88  LEU A CA  1 
ATOM   515   C C   . LEU A  1 63  ? 86.437  142.559 30.519  1.00 26.00 ? 88  LEU A C   1 
ATOM   516   O O   . LEU A  1 63  ? 85.216  142.597 30.329  1.00 26.57 ? 88  LEU A O   1 
ATOM   517   C CB  . LEU A  1 63  ? 87.389  141.834 32.701  1.00 23.73 ? 88  LEU A CB  1 
ATOM   518   C CG  . LEU A  1 63  ? 87.732  140.684 33.660  1.00 24.20 ? 88  LEU A CG  1 
ATOM   519   C CD1 . LEU A  1 63  ? 88.262  141.180 35.021  1.00 22.54 ? 88  LEU A CD1 1 
ATOM   520   C CD2 . LEU A  1 63  ? 86.535  139.708 33.841  1.00 23.37 ? 88  LEU A CD2 1 
ATOM   521   N N   . LYS A  1 64  ? 87.262  143.516 30.126  1.00 25.62 ? 89  LYS A N   1 
ATOM   522   C CA  . LYS A  1 64  ? 86.785  144.734 29.467  1.00 26.43 ? 89  LYS A CA  1 
ATOM   523   C C   . LYS A  1 64  ? 86.335  144.454 28.034  1.00 28.37 ? 89  LYS A C   1 
ATOM   524   O O   . LYS A  1 64  ? 85.434  145.114 27.511  1.00 29.34 ? 89  LYS A O   1 
ATOM   525   C CB  . LYS A  1 64  ? 87.847  145.848 29.546  1.00 26.02 ? 89  LYS A CB  1 
ATOM   526   C CG  . LYS A  1 64  ? 88.023  146.362 31.000  1.00 23.79 ? 89  LYS A CG  1 
ATOM   527   C CD  . LYS A  1 64  ? 89.049  147.469 31.155  1.00 24.72 ? 89  LYS A CD  1 
ATOM   528   C CE  . LYS A  1 64  ? 88.639  148.730 30.392  1.00 25.71 ? 89  LYS A CE  1 
ATOM   529   N NZ  . LYS A  1 64  ? 89.557  149.827 30.764  1.00 24.09 ? 89  LYS A NZ  1 
ATOM   530   N N   . THR A  1 65  ? 86.946  143.465 27.395  1.00 29.28 ? 90  THR A N   1 
ATOM   531   C CA  . THR A  1 65  ? 86.465  143.017 26.099  1.00 31.51 ? 90  THR A CA  1 
ATOM   532   C C   . THR A  1 65  ? 85.058  142.432 26.226  1.00 31.97 ? 90  THR A C   1 
ATOM   533   O O   . THR A  1 65  ? 84.190  142.702 25.388  1.00 32.88 ? 90  THR A O   1 
ATOM   534   C CB  . THR A  1 65  ? 87.406  141.962 25.480  1.00 32.77 ? 90  THR A CB  1 
ATOM   535   O OG1 . THR A  1 65  ? 88.671  142.573 25.211  1.00 33.89 ? 90  THR A OG1 1 
ATOM   536   C CG2 . THR A  1 65  ? 86.841  141.426 24.172  1.00 34.84 ? 90  THR A CG2 1 
ATOM   537   N N   . LYS A  1 66  ? 84.849  141.617 27.260  1.00 30.65 ? 91  LYS A N   1 
ATOM   538   C CA  . LYS A  1 66  ? 83.550  140.995 27.522  1.00 31.58 ? 91  LYS A CA  1 
ATOM   539   C C   . LYS A  1 66  ? 82.467  141.997 27.953  1.00 31.09 ? 91  LYS A C   1 
ATOM   540   O O   . LYS A  1 66  ? 81.286  141.857 27.597  1.00 31.83 ? 91  LYS A O   1 
ATOM   541   C CB  . LYS A  1 66  ? 83.692  139.908 28.591  1.00 30.60 ? 91  LYS A CB  1 
ATOM   542   C CG  . LYS A  1 66  ? 84.394  138.657 28.065  1.00 34.47 ? 91  LYS A CG  1 
ATOM   543   C CD  . LYS A  1 66  ? 84.610  137.619 29.153  1.00 35.94 ? 91  LYS A CD  1 
ATOM   544   C CE  . LYS A  1 66  ? 85.265  136.377 28.564  1.00 38.94 ? 91  LYS A CE  1 
ATOM   545   N NZ  . LYS A  1 66  ? 85.210  135.247 29.541  1.00 40.34 ? 91  LYS A NZ  1 
ATOM   546   N N   . ASN A  1 67  ? 82.870  142.975 28.758  1.00 29.14 ? 92  ASN A N   1 
ATOM   547   C CA  . ASN A  1 67  ? 81.979  144.032 29.217  1.00 28.42 ? 92  ASN A CA  1 
ATOM   548   C C   . ASN A  1 67  ? 82.595  145.395 28.952  1.00 28.50 ? 92  ASN A C   1 
ATOM   549   O O   . ASN A  1 67  ? 83.269  145.956 29.836  1.00 27.13 ? 92  ASN A O   1 
ATOM   550   C CB  . ASN A  1 67  ? 81.723  143.904 30.718  1.00 26.93 ? 92  ASN A CB  1 
ATOM   551   C CG  . ASN A  1 67  ? 80.703  144.908 31.217  1.00 25.85 ? 92  ASN A CG  1 
ATOM   552   O OD1 . ASN A  1 67  ? 80.191  145.728 30.452  1.00 26.71 ? 92  ASN A OD1 1 
ATOM   553   N ND2 . ASN A  1 67  ? 80.410  144.852 32.495  1.00 22.40 ? 92  ASN A ND2 1 
ATOM   554   N N   . PRO A  1 68  ? 82.363  145.936 27.749  1.00 29.75 ? 93  PRO A N   1 
ATOM   555   C CA  . PRO A  1 68  ? 82.874  147.253 27.380  1.00 30.29 ? 93  PRO A CA  1 
ATOM   556   C C   . PRO A  1 68  ? 82.501  148.376 28.355  1.00 28.86 ? 93  PRO A C   1 
ATOM   557   O O   . PRO A  1 68  ? 83.154  149.400 28.334  1.00 29.25 ? 93  PRO A O   1 
ATOM   558   C CB  . PRO A  1 68  ? 82.256  147.510 25.993  1.00 31.73 ? 93  PRO A CB  1 
ATOM   559   C CG  . PRO A  1 68  ? 81.945  146.147 25.457  1.00 33.54 ? 93  PRO A CG  1 
ATOM   560   C CD  . PRO A  1 68  ? 81.627  145.288 26.646  1.00 31.72 ? 93  PRO A CD  1 
ATOM   561   N N   . LYS A  1 69  ? 81.496  148.208 29.213  1.00 28.32 ? 94  LYS A N   1 
ATOM   562   C CA  . LYS A  1 69  ? 81.172  149.286 30.195  1.00 27.04 ? 94  LYS A CA  1 
ATOM   563   C C   . LYS A  1 69  ? 81.966  149.235 31.519  1.00 25.08 ? 94  LYS A C   1 
ATOM   564   O O   . LYS A  1 69  ? 82.006  150.206 32.296  1.00 23.71 ? 94  LYS A O   1 
ATOM   565   C CB  . LYS A  1 69  ? 79.638  149.325 30.492  1.00 28.33 ? 94  LYS A CB  1 
ATOM   566   N N   . LEU A  1 70  ? 82.587  148.093 31.784  1.00 23.89 ? 95  LEU A N   1 
ATOM   567   C CA  . LEU A  1 70  ? 83.293  147.860 33.035  1.00 21.97 ? 95  LEU A CA  1 
ATOM   568   C C   . LEU A  1 70  ? 84.426  148.881 33.222  1.00 21.39 ? 95  LEU A C   1 
ATOM   569   O O   . LEU A  1 70  ? 85.124  149.201 32.273  1.00 21.58 ? 95  LEU A O   1 
ATOM   570   C CB  . LEU A  1 70  ? 83.863  146.442 33.000  1.00 22.21 ? 95  LEU A CB  1 
ATOM   571   C CG  . LEU A  1 70  ? 84.557  145.900 34.246  1.00 21.19 ? 95  LEU A CG  1 
ATOM   572   C CD1 . LEU A  1 70  ? 83.559  145.866 35.377  1.00 19.79 ? 95  LEU A CD1 1 
ATOM   573   C CD2 . LEU A  1 70  ? 85.105  144.483 33.913  1.00 21.55 ? 95  LEU A CD2 1 
ATOM   574   N N   . LYS A  1 71  ? 84.603  149.389 34.438  1.00 19.86 ? 96  LYS A N   1 
ATOM   575   C CA  . LYS A  1 71  ? 85.720  150.276 34.726  1.00 19.73 ? 96  LYS A CA  1 
ATOM   576   C C   . LYS A  1 71  ? 86.622  149.512 35.694  1.00 18.65 ? 96  LYS A C   1 
ATOM   577   O O   . LYS A  1 71  ? 86.129  148.844 36.607  1.00 18.40 ? 96  LYS A O   1 
ATOM   578   C CB  . LYS A  1 71  ? 85.266  151.584 35.384  1.00 19.07 ? 96  LYS A CB  1 
ATOM   579   C CG  . LYS A  1 71  ? 84.195  152.377 34.620  1.00 22.79 ? 96  LYS A CG  1 
ATOM   580   C CD  . LYS A  1 71  ? 84.695  152.867 33.286  1.00 26.20 ? 96  LYS A CD  1 
ATOM   581   C CE  . LYS A  1 71  ? 83.705  153.895 32.705  1.00 29.82 ? 96  LYS A CE  1 
ATOM   582   N NZ  . LYS A  1 71  ? 83.893  154.018 31.244  1.00 33.68 ? 96  LYS A NZ  1 
ATOM   583   N N   . ILE A  1 72  ? 87.926  149.580 35.481  1.00 18.11 ? 97  ILE A N   1 
ATOM   584   C CA  . ILE A  1 72  ? 88.856  148.893 36.380  1.00 17.15 ? 97  ILE A CA  1 
ATOM   585   C C   . ILE A  1 72  ? 89.901  149.915 36.842  1.00 17.51 ? 97  ILE A C   1 
ATOM   586   O O   . ILE A  1 72  ? 90.558  150.559 36.008  1.00 18.14 ? 97  ILE A O   1 
ATOM   587   C CB  . ILE A  1 72  ? 89.494  147.667 35.688  1.00 19.02 ? 97  ILE A CB  1 
ATOM   588   C CG1 . ILE A  1 72  ? 88.406  146.670 35.227  1.00 18.16 ? 97  ILE A CG1 1 
ATOM   589   C CG2 . ILE A  1 72  ? 90.519  146.953 36.614  1.00 16.86 ? 97  ILE A CG2 1 
ATOM   590   C CD1 . ILE A  1 72  ? 88.977  145.418 34.540  1.00 18.48 ? 97  ILE A CD1 1 
ATOM   591   N N   . LEU A  1 73  ? 90.022  150.084 38.161  1.00 16.63 ? 98  LEU A N   1 
ATOM   592   C CA  . LEU A  1 73  ? 90.927  151.070 38.742  1.00 16.50 ? 98  LEU A CA  1 
ATOM   593   C C   . LEU A  1 73  ? 92.080  150.393 39.464  1.00 16.54 ? 98  LEU A C   1 
ATOM   594   O O   . LEU A  1 73  ? 91.979  149.246 39.861  1.00 16.41 ? 98  LEU A O   1 
ATOM   595   C CB  . LEU A  1 73  ? 90.194  151.965 39.745  1.00 15.79 ? 98  LEU A CB  1 
ATOM   596   C CG  . LEU A  1 73  ? 89.187  152.991 39.186  1.00 19.23 ? 98  LEU A CG  1 
ATOM   597   C CD1 . LEU A  1 73  ? 87.919  152.255 38.803  1.00 20.54 ? 98  LEU A CD1 1 
ATOM   598   C CD2 . LEU A  1 73  ? 88.847  154.091 40.218  1.00 20.79 ? 98  LEU A CD2 1 
ATOM   599   N N   . LEU A  1 74  ? 93.167  151.137 39.649  1.00 16.90 ? 99  LEU A N   1 
ATOM   600   C CA  . LEU A  1 74  ? 94.288  150.662 40.430  1.00 16.82 ? 99  LEU A CA  1 
ATOM   601   C C   . LEU A  1 74  ? 94.265  151.377 41.782  1.00 16.16 ? 99  LEU A C   1 
ATOM   602   O O   . LEU A  1 74  ? 94.150  152.587 41.828  1.00 15.48 ? 99  LEU A O   1 
ATOM   603   C CB  . LEU A  1 74  ? 95.577  151.017 39.688  1.00 17.67 ? 99  LEU A CB  1 
ATOM   604   C CG  . LEU A  1 74  ? 96.836  150.632 40.436  1.00 18.88 ? 99  LEU A CG  1 
ATOM   605   C CD1 . LEU A  1 74  ? 96.820  149.141 40.594  1.00 21.15 ? 99  LEU A CD1 1 
ATOM   606   C CD2 . LEU A  1 74  ? 98.051  151.064 39.623  1.00 21.66 ? 99  LEU A CD2 1 
ATOM   607   N N   . SER A  1 75  ? 94.376  150.633 42.884  1.00 16.10 ? 100 SER A N   1 
ATOM   608   C CA  . SER A  1 75  ? 94.431  151.277 44.183  1.00 16.04 ? 100 SER A CA  1 
ATOM   609   C C   . SER A  1 75  ? 95.846  151.301 44.698  1.00 16.56 ? 100 SER A C   1 
ATOM   610   O O   . SER A  1 75  ? 96.598  150.325 44.562  1.00 15.96 ? 100 SER A O   1 
ATOM   611   C CB  . SER A  1 75  ? 93.561  150.553 45.210  1.00 15.65 ? 100 SER A CB  1 
ATOM   612   O OG  . SER A  1 75  ? 93.505  151.293 46.426  1.00 16.64 ? 100 SER A OG  1 
ATOM   613   N N   . ILE A  1 76  ? 96.219  152.417 45.308  1.00 16.70 ? 101 ILE A N   1 
ATOM   614   C CA  . ILE A  1 76  ? 97.410  152.384 46.105  1.00 17.72 ? 101 ILE A CA  1 
ATOM   615   C C   . ILE A  1 76  ? 97.177  152.876 47.550  1.00 17.00 ? 101 ILE A C   1 
ATOM   616   O O   . ILE A  1 76  ? 96.395  153.816 47.808  1.00 16.37 ? 101 ILE A O   1 
ATOM   617   C CB  . ILE A  1 76  ? 98.625  153.057 45.405  1.00 19.68 ? 101 ILE A CB  1 
ATOM   618   C CG1 . ILE A  1 76  ? 99.087  154.256 46.144  1.00 22.50 ? 101 ILE A CG1 1 
ATOM   619   C CG2 . ILE A  1 76  ? 98.517  153.244 43.903  1.00 21.22 ? 101 ILE A CG2 1 
ATOM   620   C CD1 . ILE A  1 76  ? 100.364 153.918 46.711  1.00 22.35 ? 101 ILE A CD1 1 
ATOM   621   N N   . GLY A  1 77  ? 97.803  152.197 48.501  1.00 17.42 ? 102 GLY A N   1 
ATOM   622   C CA  . GLY A  1 77  ? 97.562  152.504 49.905  1.00 17.36 ? 102 GLY A CA  1 
ATOM   623   C C   . GLY A  1 77  ? 97.148  151.261 50.683  1.00 17.20 ? 102 GLY A C   1 
ATOM   624   O O   . GLY A  1 77  ? 97.734  150.196 50.501  1.00 17.98 ? 102 GLY A O   1 
ATOM   625   N N   . GLY A  1 78  ? 96.157  151.410 51.560  1.00 15.82 ? 103 GLY A N   1 
ATOM   626   C CA  . GLY A  1 78  ? 95.740  150.339 52.481  1.00 16.04 ? 103 GLY A CA  1 
ATOM   627   C C   . GLY A  1 78  ? 96.415  150.486 53.827  1.00 17.20 ? 103 GLY A C   1 
ATOM   628   O O   . GLY A  1 78  ? 97.337  151.304 53.990  1.00 17.12 ? 103 GLY A O   1 
ATOM   629   N N   . TYR A  1 79  ? 95.989  149.660 54.780  1.00 17.07 ? 104 TYR A N   1 
ATOM   630   C CA  . TYR A  1 79  ? 96.408  149.769 56.164  1.00 17.41 ? 104 TYR A CA  1 
ATOM   631   C C   . TYR A  1 79  ? 97.909  149.505 56.339  1.00 18.42 ? 104 TYR A C   1 
ATOM   632   O O   . TYR A  1 79  ? 98.628  150.277 56.999  1.00 18.22 ? 104 TYR A O   1 
ATOM   633   C CB  . TYR A  1 79  ? 95.565  148.795 57.023  1.00 18.21 ? 104 TYR A CB  1 
ATOM   634   C CG  . TYR A  1 79  ? 95.929  148.839 58.494  1.00 19.88 ? 104 TYR A CG  1 
ATOM   635   C CD1 . TYR A  1 79  ? 95.583  149.943 59.275  1.00 21.96 ? 104 TYR A CD1 1 
ATOM   636   C CD2 . TYR A  1 79  ? 96.611  147.783 59.094  1.00 22.72 ? 104 TYR A CD2 1 
ATOM   637   C CE1 . TYR A  1 79  ? 95.922  150.006 60.632  1.00 24.85 ? 104 TYR A CE1 1 
ATOM   638   C CE2 . TYR A  1 79  ? 96.974  147.835 60.460  1.00 26.22 ? 104 TYR A CE2 1 
ATOM   639   C CZ  . TYR A  1 79  ? 96.621  148.964 61.208  1.00 26.94 ? 104 TYR A CZ  1 
ATOM   640   O OH  . TYR A  1 79  ? 96.949  149.041 62.541  1.00 30.09 ? 104 TYR A OH  1 
ATOM   641   N N   . LEU A  1 80  ? 98.400  148.440 55.719  1.00 18.15 ? 105 LEU A N   1 
ATOM   642   C CA  . LEU A  1 80  ? 99.812  148.073 55.910  1.00 19.78 ? 105 LEU A CA  1 
ATOM   643   C C   . LEU A  1 80  ? 100.774 149.081 55.258  1.00 19.95 ? 105 LEU A C   1 
ATOM   644   O O   . LEU A  1 80  ? 101.845 149.352 55.783  1.00 20.45 ? 105 LEU A O   1 
ATOM   645   C CB  . LEU A  1 80  ? 100.080 146.641 55.440  1.00 20.14 ? 105 LEU A CB  1 
ATOM   646   C CG  . LEU A  1 80  ? 99.477  145.493 56.292  1.00 22.37 ? 105 LEU A CG  1 
ATOM   647   C CD1 . LEU A  1 80  ? 100.126 144.165 55.913  1.00 25.04 ? 105 LEU A CD1 1 
ATOM   648   C CD2 . LEU A  1 80  ? 99.719  145.754 57.775  1.00 24.70 ? 105 LEU A CD2 1 
ATOM   649   N N   . PHE A  1 81  ? 100.395 149.614 54.104  1.00 19.04 ? 106 PHE A N   1 
ATOM   650   C CA  . PHE A  1 81  ? 101.218 150.614 53.404  1.00 19.55 ? 106 PHE A CA  1 
ATOM   651   C C   . PHE A  1 81  ? 101.347 151.860 54.286  1.00 19.87 ? 106 PHE A C   1 
ATOM   652   O O   . PHE A  1 81  ? 102.410 152.504 54.334  1.00 19.89 ? 106 PHE A O   1 
ATOM   653   C CB  . PHE A  1 81  ? 100.520 150.948 52.079  1.00 18.82 ? 106 PHE A CB  1 
ATOM   654   C CG  . PHE A  1 81  ? 101.366 151.713 51.062  1.00 20.37 ? 106 PHE A CG  1 
ATOM   655   C CD1 . PHE A  1 81  ? 102.405 151.077 50.366  1.00 21.16 ? 106 PHE A CD1 1 
ATOM   656   C CD2 . PHE A  1 81  ? 101.065 153.043 50.759  1.00 19.97 ? 106 PHE A CD2 1 
ATOM   657   C CE1 . PHE A  1 81  ? 103.131 151.753 49.392  1.00 20.30 ? 106 PHE A CE1 1 
ATOM   658   C CE2 . PHE A  1 81  ? 101.786 153.733 49.774  1.00 20.50 ? 106 PHE A CE2 1 
ATOM   659   C CZ  . PHE A  1 81  ? 102.808 153.078 49.081  1.00 21.41 ? 106 PHE A CZ  1 
ATOM   660   N N   . GLY A  1 82  ? 100.252 152.186 54.983  1.00 19.29 ? 107 GLY A N   1 
ATOM   661   C CA  . GLY A  1 82  ? 100.217 153.298 55.941  1.00 19.98 ? 107 GLY A CA  1 
ATOM   662   C C   . GLY A  1 82  ? 100.572 154.628 55.288  1.00 19.80 ? 107 GLY A C   1 
ATOM   663   O O   . GLY A  1 82  ? 100.298 154.826 54.106  1.00 18.37 ? 107 GLY A O   1 
ATOM   664   N N   . SER A  1 83  ? 101.141 155.549 56.070  1.00 19.96 ? 108 SER A N   1 
ATOM   665   C CA  . SER A  1 83  ? 101.651 156.803 55.517  1.00 20.76 ? 108 SER A CA  1 
ATOM   666   C C   . SER A  1 83  ? 103.073 156.634 54.994  1.00 21.75 ? 108 SER A C   1 
ATOM   667   O O   . SER A  1 83  ? 103.494 157.334 54.067  1.00 21.52 ? 108 SER A O   1 
ATOM   668   C CB  . SER A  1 83  ? 101.656 157.930 56.570  1.00 22.13 ? 108 SER A CB  1 
ATOM   669   O OG  . SER A  1 83  ? 100.340 158.300 56.948  1.00 21.84 ? 108 SER A OG  1 
ATOM   670   N N   . LYS A  1 84  ? 103.821 155.720 55.600  1.00 21.94 ? 109 LYS A N   1 
ATOM   671   C CA  . LYS A  1 84  ? 105.237 155.565 55.256  1.00 24.05 ? 109 LYS A CA  1 
ATOM   672   C C   . LYS A  1 84  ? 105.439 155.206 53.779  1.00 23.14 ? 109 LYS A C   1 
ATOM   673   O O   . LYS A  1 84  ? 106.442 155.588 53.168  1.00 23.31 ? 109 LYS A O   1 
ATOM   674   C CB  . LYS A  1 84  ? 105.866 154.497 56.139  1.00 25.18 ? 109 LYS A CB  1 
ATOM   675   C CG  . LYS A  1 84  ? 105.984 154.937 57.589  1.00 30.03 ? 109 LYS A CG  1 
ATOM   676   C CD  . LYS A  1 84  ? 106.159 153.729 58.522  1.00 35.28 ? 109 LYS A CD  1 
ATOM   677   C CE  . LYS A  1 84  ? 106.680 154.161 59.893  1.00 38.76 ? 109 LYS A CE  1 
ATOM   678   N NZ  . LYS A  1 84  ? 106.739 152.973 60.808  1.00 40.00 ? 109 LYS A NZ  1 
ATOM   679   N N   . GLY A  1 85  ? 104.498 154.463 53.220  1.00 20.89 ? 110 GLY A N   1 
ATOM   680   C CA  . GLY A  1 85  ? 104.586 154.080 51.809  1.00 20.97 ? 110 GLY A CA  1 
ATOM   681   C C   . GLY A  1 85  ? 104.585 155.258 50.837  1.00 20.80 ? 110 GLY A C   1 
ATOM   682   O O   . GLY A  1 85  ? 105.088 155.145 49.724  1.00 20.74 ? 110 GLY A O   1 
ATOM   683   N N   . PHE A  1 86  ? 104.004 156.394 51.248  1.00 19.69 ? 111 PHE A N   1 
ATOM   684   C CA  . PHE A  1 86  ? 103.897 157.559 50.374  1.00 19.88 ? 111 PHE A CA  1 
ATOM   685   C C   . PHE A  1 86  ? 105.142 158.452 50.425  1.00 21.19 ? 111 PHE A C   1 
ATOM   686   O O   . PHE A  1 86  ? 105.234 159.428 49.683  1.00 22.18 ? 111 PHE A O   1 
ATOM   687   C CB  . PHE A  1 86  ? 102.640 158.388 50.716  1.00 18.97 ? 111 PHE A CB  1 
ATOM   688   C CG  . PHE A  1 86  ? 101.353 157.692 50.360  1.00 18.26 ? 111 PHE A CG  1 
ATOM   689   C CD1 . PHE A  1 86  ? 100.867 157.736 49.067  1.00 17.01 ? 111 PHE A CD1 1 
ATOM   690   C CD2 . PHE A  1 86  ? 100.651 156.961 51.320  1.00 17.60 ? 111 PHE A CD2 1 
ATOM   691   C CE1 . PHE A  1 86  ? 99.690  157.088 48.730  1.00 17.56 ? 111 PHE A CE1 1 
ATOM   692   C CE2 . PHE A  1 86  ? 99.480  156.299 50.999  1.00 16.23 ? 111 PHE A CE2 1 
ATOM   693   C CZ  . PHE A  1 86  ? 98.992  156.362 49.703  1.00 17.16 ? 111 PHE A CZ  1 
ATOM   694   N N   . HIS A  1 87  ? 106.082 158.117 51.300  1.00 21.71 ? 112 HIS A N   1 
ATOM   695   C CA  . HIS A  1 87  ? 107.350 158.850 51.426  1.00 22.46 ? 112 HIS A CA  1 
ATOM   696   C C   . HIS A  1 87  ? 108.449 158.007 50.824  1.00 23.57 ? 112 HIS A C   1 
ATOM   697   O O   . HIS A  1 87  ? 108.451 156.789 51.026  1.00 22.73 ? 112 HIS A O   1 
ATOM   698   C CB  . HIS A  1 87  ? 107.676 159.121 52.900  1.00 23.04 ? 112 HIS A CB  1 
ATOM   699   C CG  . HIS A  1 87  ? 106.790 160.157 53.520  1.00 23.84 ? 112 HIS A CG  1 
ATOM   700   N ND1 . HIS A  1 87  ? 107.039 161.506 53.412  1.00 24.25 ? 112 HIS A ND1 1 
ATOM   701   C CD2 . HIS A  1 87  ? 105.642 160.040 54.229  1.00 25.39 ? 112 HIS A CD2 1 
ATOM   702   C CE1 . HIS A  1 87  ? 106.091 162.180 54.041  1.00 27.44 ? 112 HIS A CE1 1 
ATOM   703   N NE2 . HIS A  1 87  ? 105.224 161.314 54.539  1.00 27.30 ? 112 HIS A NE2 1 
ATOM   704   N N   . PRO A  1 88  ? 109.408 158.647 50.115  1.00 24.38 ? 113 PRO A N   1 
ATOM   705   C CA  . PRO A  1 88  ? 109.590 160.094 49.920  1.00 24.80 ? 113 PRO A CA  1 
ATOM   706   C C   . PRO A  1 88  ? 108.765 160.696 48.769  1.00 24.62 ? 113 PRO A C   1 
ATOM   707   O O   . PRO A  1 88  ? 108.893 161.896 48.484  1.00 24.92 ? 113 PRO A O   1 
ATOM   708   C CB  . PRO A  1 88  ? 111.089 160.204 49.586  1.00 26.70 ? 113 PRO A CB  1 
ATOM   709   C CG  . PRO A  1 88  ? 111.429 158.875 48.925  1.00 27.03 ? 113 PRO A CG  1 
ATOM   710   C CD  . PRO A  1 88  ? 110.358 157.863 49.305  1.00 24.97 ? 113 PRO A CD  1 
ATOM   711   N N   . MET A  1 89  ? 107.919 159.903 48.116  1.00 23.44 ? 114 MET A N   1 
ATOM   712   C CA  . MET A  1 89  ? 107.293 160.416 46.907  1.00 23.67 ? 114 MET A CA  1 
ATOM   713   C C   . MET A  1 89  ? 106.591 161.755 47.140  1.00 24.03 ? 114 MET A C   1 
ATOM   714   O O   . MET A  1 89  ? 106.653 162.645 46.276  1.00 24.51 ? 114 MET A O   1 
ATOM   715   C CB  . MET A  1 89  ? 106.291 159.427 46.293  1.00 22.84 ? 114 MET A CB  1 
ATOM   716   C CG  . MET A  1 89  ? 105.543 160.005 45.080  1.00 21.46 ? 114 MET A CG  1 
ATOM   717   S SD  . MET A  1 89  ? 104.037 160.920 45.443  1.00 22.30 ? 114 MET A SD  1 
ATOM   718   C CE  . MET A  1 89  ? 102.961 159.645 46.109  1.00 18.57 ? 114 MET A CE  1 
ATOM   719   N N   . VAL A  1 90  ? 105.893 161.892 48.267  1.00 23.48 ? 115 VAL A N   1 
ATOM   720   C CA  . VAL A  1 90  ? 105.052 163.102 48.480  1.00 23.67 ? 115 VAL A CA  1 
ATOM   721   C C   . VAL A  1 90  ? 105.782 164.359 48.916  1.00 25.25 ? 115 VAL A C   1 
ATOM   722   O O   . VAL A  1 90  ? 105.174 165.427 48.966  1.00 25.04 ? 115 VAL A O   1 
ATOM   723   C CB  . VAL A  1 90  ? 103.908 162.923 49.530  1.00 22.47 ? 115 VAL A CB  1 
ATOM   724   C CG1 . VAL A  1 90  ? 102.808 162.069 48.997  1.00 22.21 ? 115 VAL A CG1 1 
ATOM   725   C CG2 . VAL A  1 90  ? 104.439 162.444 50.873  1.00 22.03 ? 115 VAL A CG2 1 
ATOM   726   N N   . ASP A  1 91  ? 107.062 164.271 49.247  1.00 27.52 ? 116 ASP A N   1 
ATOM   727   C CA  . ASP A  1 91  ? 107.659 165.438 49.911  1.00 29.45 ? 116 ASP A CA  1 
ATOM   728   C C   . ASP A  1 91  ? 108.168 166.560 49.052  1.00 30.55 ? 116 ASP A C   1 
ATOM   729   O O   . ASP A  1 91  ? 108.678 167.541 49.588  1.00 31.97 ? 116 ASP A O   1 
ATOM   730   C CB  . ASP A  1 91  ? 108.688 165.125 51.017  1.00 30.95 ? 116 ASP A CB  1 
ATOM   731   C CG  . ASP A  1 91  ? 108.983 163.666 51.178  1.00 32.01 ? 116 ASP A CG  1 
ATOM   732   O OD1 . ASP A  1 91  ? 108.101 162.921 51.640  1.00 32.98 ? 116 ASP A OD1 1 
ATOM   733   O OD2 . ASP A  1 91  ? 110.143 163.285 50.919  1.00 36.12 ? 116 ASP A OD2 1 
ATOM   734   N N   . SER A  1 92  ? 108.071 166.429 47.735  1.00 30.86 ? 117 SER A N   1 
ATOM   735   C CA  . SER A  1 92  ? 108.387 167.558 46.873  1.00 31.95 ? 117 SER A CA  1 
ATOM   736   C C   . SER A  1 92  ? 107.572 167.575 45.595  1.00 32.08 ? 117 SER A C   1 
ATOM   737   O O   . SER A  1 92  ? 106.969 166.558 45.168  1.00 30.92 ? 117 SER A O   1 
ATOM   738   C CB  . SER A  1 92  ? 109.891 167.699 46.572  1.00 33.74 ? 117 SER A CB  1 
ATOM   739   O OG  . SER A  1 92  ? 110.390 166.651 45.756  1.00 33.87 ? 117 SER A OG  1 
ATOM   740   N N   . SER A  1 93  ? 107.555 168.760 45.006  1.00 32.47 ? 118 SER A N   1 
ATOM   741   C CA  . SER A  1 93  ? 106.879 169.018 43.767  1.00 32.56 ? 118 SER A CA  1 
ATOM   742   C C   . SER A  1 93  ? 107.427 168.121 42.668  1.00 31.59 ? 118 SER A C   1 
ATOM   743   O O   . SER A  1 93  ? 106.665 167.567 41.874  1.00 31.66 ? 118 SER A O   1 
ATOM   744   C CB  . SER A  1 93  ? 107.122 170.487 43.394  1.00 33.81 ? 118 SER A CB  1 
ATOM   745   O OG  . SER A  1 93  ? 105.895 171.092 43.062  1.00 35.89 ? 118 SER A OG  1 
ATOM   746   N N   . THR A  1 94  ? 108.746 167.964 42.625  1.00 32.29 ? 119 THR A N   1 
ATOM   747   C CA  . THR A  1 94  ? 109.372 167.205 41.544  1.00 31.84 ? 119 THR A CA  1 
ATOM   748   C C   . THR A  1 94  ? 109.101 165.707 41.702  1.00 30.25 ? 119 THR A C   1 
ATOM   749   O O   . THR A  1 94  ? 108.887 164.990 40.718  1.00 28.99 ? 119 THR A O   1 
ATOM   750   C CB  . THR A  1 94  ? 110.891 167.521 41.401  1.00 33.71 ? 119 THR A CB  1 
ATOM   751   O OG1 . THR A  1 94  ? 111.645 166.836 42.416  1.00 35.99 ? 119 THR A OG1 1 
ATOM   752   C CG2 . THR A  1 94  ? 111.146 169.037 41.510  1.00 34.00 ? 119 THR A CG2 1 
ATOM   753   N N   . SER A  1 95  ? 109.062 165.239 42.944  1.00 28.67 ? 120 SER A N   1 
ATOM   754   C CA  . SER A  1 95  ? 108.865 163.819 43.170  1.00 27.75 ? 120 SER A CA  1 
ATOM   755   C C   . SER A  1 95  ? 107.385 163.442 43.008  1.00 25.75 ? 120 SER A C   1 
ATOM   756   O O   . SER A  1 95  ? 107.071 162.334 42.556  1.00 25.52 ? 120 SER A O   1 
ATOM   757   C CB  . SER A  1 95  ? 109.442 163.394 44.533  1.00 28.36 ? 120 SER A CB  1 
ATOM   758   O OG  . SER A  1 95  ? 108.759 164.065 45.592  1.00 29.65 ? 120 SER A OG  1 
ATOM   759   N N   . ARG A  1 96  ? 106.468 164.353 43.325  1.00 24.21 ? 121 ARG A N   1 
ATOM   760   C CA  . ARG A  1 96  ? 105.041 164.089 43.043  1.00 23.93 ? 121 ARG A CA  1 
ATOM   761   C C   . ARG A  1 96  ? 104.786 164.103 41.524  1.00 23.85 ? 121 ARG A C   1 
ATOM   762   O O   . ARG A  1 96  ? 104.064 163.265 41.011  1.00 22.98 ? 121 ARG A O   1 
ATOM   763   C CB  . ARG A  1 96  ? 104.139 165.099 43.764  1.00 23.04 ? 121 ARG A CB  1 
ATOM   764   C CG  . ARG A  1 96  ? 104.134 164.928 45.307  1.00 23.02 ? 121 ARG A CG  1 
ATOM   765   C CD  . ARG A  1 96  ? 103.045 165.785 45.976  1.00 22.08 ? 121 ARG A CD  1 
ATOM   766   N NE  . ARG A  1 96  ? 103.193 167.209 45.640  1.00 22.76 ? 121 ARG A NE  1 
ATOM   767   C CZ  . ARG A  1 96  ? 103.843 168.108 46.379  1.00 24.18 ? 121 ARG A CZ  1 
ATOM   768   N NH1 . ARG A  1 96  ? 104.439 167.756 47.517  1.00 22.90 ? 121 ARG A NH1 1 
ATOM   769   N NH2 . ARG A  1 96  ? 103.901 169.368 45.977  1.00 23.15 ? 121 ARG A NH2 1 
ATOM   770   N N   . LEU A  1 97  ? 105.407 165.043 40.814  1.00 25.48 ? 122 LEU A N   1 
ATOM   771   C CA  . LEU A  1 97  ? 105.248 165.096 39.355  1.00 26.75 ? 122 LEU A CA  1 
ATOM   772   C C   . LEU A  1 97  ? 105.745 163.807 38.691  1.00 26.66 ? 122 LEU A C   1 
ATOM   773   O O   . LEU A  1 97  ? 105.120 163.286 37.775  1.00 26.15 ? 122 LEU A O   1 
ATOM   774   C CB  . LEU A  1 97  ? 105.992 166.287 38.773  1.00 28.55 ? 122 LEU A CB  1 
ATOM   775   C CG  . LEU A  1 97  ? 105.865 166.445 37.253  1.00 30.17 ? 122 LEU A CG  1 
ATOM   776   C CD1 . LEU A  1 97  ? 104.399 166.607 36.875  1.00 30.47 ? 122 LEU A CD1 1 
ATOM   777   C CD2 . LEU A  1 97  ? 106.713 167.629 36.785  1.00 32.61 ? 122 LEU A CD2 1 
ATOM   778   N N   . GLU A  1 98  ? 106.889 163.311 39.137  1.00 27.09 ? 123 GLU A N   1 
ATOM   779   C CA  . GLU A  1 98  ? 107.415 162.068 38.586  1.00 27.94 ? 123 GLU A CA  1 
ATOM   780   C C   . GLU A  1 98  ? 106.404 160.943 38.820  1.00 26.08 ? 123 GLU A C   1 
ATOM   781   O O   . GLU A  1 98  ? 106.077 160.183 37.898  1.00 25.86 ? 123 GLU A O   1 
ATOM   782   C CB  . GLU A  1 98  ? 108.773 161.750 39.213  1.00 29.22 ? 123 GLU A CB  1 
ATOM   783   C CG  . GLU A  1 98  ? 109.476 160.552 38.617  1.00 34.08 ? 123 GLU A CG  1 
ATOM   784   C CD  . GLU A  1 98  ? 110.861 160.362 39.196  1.00 40.05 ? 123 GLU A CD  1 
ATOM   785   O OE1 . GLU A  1 98  ? 111.291 161.234 39.990  1.00 41.04 ? 123 GLU A OE1 1 
ATOM   786   O OE2 . GLU A  1 98  ? 111.520 159.347 38.852  1.00 43.18 ? 123 GLU A OE2 1 
ATOM   787   N N   . PHE A  1 99  ? 105.873 160.856 40.047  1.00 24.12 ? 124 PHE A N   1 
ATOM   788   C CA  . PHE A  1 99  ? 104.869 159.865 40.373  1.00 22.84 ? 124 PHE A CA  1 
ATOM   789   C C   . PHE A  1 99  ? 103.629 159.988 39.498  1.00 22.38 ? 124 PHE A C   1 
ATOM   790   O O   . PHE A  1 99  ? 103.154 159.005 38.902  1.00 21.77 ? 124 PHE A O   1 
ATOM   791   C CB  . PHE A  1 99  ? 104.467 159.958 41.855  1.00 21.97 ? 124 PHE A CB  1 
ATOM   792   C CG  . PHE A  1 99  ? 103.305 159.077 42.219  1.00 22.82 ? 124 PHE A CG  1 
ATOM   793   C CD1 . PHE A  1 99  ? 103.440 157.695 42.243  1.00 24.03 ? 124 PHE A CD1 1 
ATOM   794   C CD2 . PHE A  1 99  ? 102.076 159.629 42.535  1.00 21.76 ? 124 PHE A CD2 1 
ATOM   795   C CE1 . PHE A  1 99  ? 102.354 156.881 42.595  1.00 23.26 ? 124 PHE A CE1 1 
ATOM   796   C CE2 . PHE A  1 99  ? 100.989 158.820 42.892  1.00 23.94 ? 124 PHE A CE2 1 
ATOM   797   C CZ  . PHE A  1 99  ? 101.135 157.439 42.914  1.00 23.15 ? 124 PHE A CZ  1 
ATOM   798   N N   . ILE A  1 100 ? 103.097 161.200 39.423  1.00 22.20 ? 125 ILE A N   1 
ATOM   799   C CA  . ILE A  1 100 ? 101.887 161.457 38.648  1.00 22.10 ? 125 ILE A CA  1 
ATOM   800   C C   . ILE A  1 100 ? 102.064 161.116 37.154  1.00 23.54 ? 125 ILE A C   1 
ATOM   801   O O   . ILE A  1 100 ? 101.214 160.433 36.563  1.00 22.67 ? 125 ILE A O   1 
ATOM   802   C CB  . ILE A  1 100 ? 101.411 162.903 38.835  1.00 22.27 ? 125 ILE A CB  1 
ATOM   803   C CG1 . ILE A  1 100 ? 100.974 163.132 40.297  1.00 21.83 ? 125 ILE A CG1 1 
ATOM   804   C CG2 . ILE A  1 100 ? 100.270 163.237 37.847  1.00 21.02 ? 125 ILE A CG2 1 
ATOM   805   C CD1 . ILE A  1 100 ? 100.744 164.611 40.618  1.00 23.42 ? 125 ILE A CD1 1 
ATOM   806   N N   . ASN A  1 101 ? 103.156 161.571 36.546  1.00 24.20 ? 126 ASN A N   1 
ATOM   807   C CA  . ASN A  1 101 ? 103.431 161.177 35.171  1.00 25.74 ? 126 ASN A CA  1 
ATOM   808   C C   . ASN A  1 101 ? 103.529 159.655 35.004  1.00 25.81 ? 126 ASN A C   1 
ATOM   809   O O   . ASN A  1 101 ? 103.036 159.099 34.018  1.00 26.02 ? 126 ASN A O   1 
ATOM   810   C CB  . ASN A  1 101 ? 104.702 161.868 34.633  1.00 26.95 ? 126 ASN A CB  1 
ATOM   811   C CG  . ASN A  1 101 ? 104.484 163.343 34.396  1.00 28.31 ? 126 ASN A CG  1 
ATOM   812   O OD1 . ASN A  1 101 ? 103.344 163.789 34.249  1.00 29.60 ? 126 ASN A OD1 1 
ATOM   813   N ND2 . ASN A  1 101 ? 105.553 164.111 34.400  1.00 29.30 ? 126 ASN A ND2 1 
ATOM   814   N N   . SER A  1 102 ? 104.174 158.978 35.947  1.00 25.77 ? 127 SER A N   1 
ATOM   815   C CA  . SER A  1 102 ? 104.272 157.518 35.873  1.00 26.16 ? 127 SER A CA  1 
ATOM   816   C C   . SER A  1 102 ? 102.890 156.858 35.963  1.00 24.77 ? 127 SER A C   1 
ATOM   817   O O   . SER A  1 102 ? 102.625 155.840 35.311  1.00 24.43 ? 127 SER A O   1 
ATOM   818   C CB  . SER A  1 102 ? 105.213 156.951 36.955  1.00 26.89 ? 127 SER A CB  1 
ATOM   819   O OG  . SER A  1 102 ? 104.529 156.808 38.193  1.00 26.45 ? 127 SER A OG  1 
ATOM   820   N N   . ILE A  1 103 ? 102.020 157.439 36.778  1.00 23.05 ? 128 ILE A N   1 
ATOM   821   C CA  . ILE A  1 103 ? 100.669 156.949 36.948  1.00 22.43 ? 128 ILE A CA  1 
ATOM   822   C C   . ILE A  1 103 ? 99.881  157.048 35.644  1.00 22.37 ? 128 ILE A C   1 
ATOM   823   O O   . ILE A  1 103 ? 99.249  156.089 35.216  1.00 22.50 ? 128 ILE A O   1 
ATOM   824   C CB  . ILE A  1 103 ? 99.940  157.767 38.040  1.00 21.58 ? 128 ILE A CB  1 
ATOM   825   C CG1 . ILE A  1 103 ? 100.409 157.302 39.428  1.00 21.62 ? 128 ILE A CG1 1 
ATOM   826   C CG2 . ILE A  1 103 ? 98.435  157.620 37.918  1.00 20.98 ? 128 ILE A CG2 1 
ATOM   827   C CD1 . ILE A  1 103 ? 99.850  155.919 39.819  1.00 23.50 ? 128 ILE A CD1 1 
ATOM   828   N N   . ILE A  1 104 ? 99.906  158.213 35.015  1.00 22.01 ? 129 ILE A N   1 
ATOM   829   C CA  . ILE A  1 104 ? 99.152  158.369 33.786  1.00 23.05 ? 129 ILE A CA  1 
ATOM   830   C C   . ILE A  1 104 ? 99.621  157.347 32.719  1.00 24.23 ? 129 ILE A C   1 
ATOM   831   O O   . ILE A  1 104 ? 98.800  156.650 32.105  1.00 23.19 ? 129 ILE A O   1 
ATOM   832   C CB  . ILE A  1 104 ? 99.256  159.809 33.269  1.00 23.82 ? 129 ILE A CB  1 
ATOM   833   C CG1 . ILE A  1 104 ? 98.516  160.761 34.231  1.00 21.88 ? 129 ILE A CG1 1 
ATOM   834   C CG2 . ILE A  1 104 ? 98.731  159.908 31.827  1.00 25.05 ? 129 ILE A CG2 1 
ATOM   835   C CD1 . ILE A  1 104 ? 98.728  162.255 33.904  1.00 22.41 ? 129 ILE A CD1 1 
ATOM   836   N N   . LEU A  1 105 ? 100.933 157.235 32.534  1.00 24.37 ? 130 LEU A N   1 
ATOM   837   C CA  . LEU A  1 105 ? 101.486 156.285 31.561  1.00 26.66 ? 130 LEU A CA  1 
ATOM   838   C C   . LEU A  1 105 ? 101.104 154.837 31.914  1.00 25.51 ? 130 LEU A C   1 
ATOM   839   O O   . LEU A  1 105 ? 100.679 154.074 31.055  1.00 25.69 ? 130 LEU A O   1 
ATOM   840   C CB  . LEU A  1 105 ? 103.011 156.383 31.523  1.00 27.73 ? 130 LEU A CB  1 
ATOM   841   C CG  . LEU A  1 105 ? 103.826 156.350 30.218  1.00 33.51 ? 130 LEU A CG  1 
ATOM   842   C CD1 . LEU A  1 105 ? 105.189 155.629 30.423  1.00 35.31 ? 130 LEU A CD1 1 
ATOM   843   C CD2 . LEU A  1 105 ? 103.072 155.806 28.971  1.00 35.21 ? 130 LEU A CD2 1 
ATOM   844   N N   . PHE A  1 106 ? 101.293 154.463 33.173  1.00 24.58 ? 131 PHE A N   1 
ATOM   845   C CA  . PHE A  1 106 ? 100.994 153.112 33.646  1.00 23.85 ? 131 PHE A CA  1 
ATOM   846   C C   . PHE A  1 106 ? 99.507  152.764 33.460  1.00 22.90 ? 131 PHE A C   1 
ATOM   847   O O   . PHE A  1 106 ? 99.154  151.694 32.941  1.00 22.06 ? 131 PHE A O   1 
ATOM   848   C CB  . PHE A  1 106 ? 101.358 153.003 35.127  1.00 23.63 ? 131 PHE A CB  1 
ATOM   849   C CG  . PHE A  1 106 ? 101.263 151.601 35.685  1.00 23.27 ? 131 PHE A CG  1 
ATOM   850   C CD1 . PHE A  1 106 ? 100.060 151.108 36.174  1.00 23.17 ? 131 PHE A CD1 1 
ATOM   851   C CD2 . PHE A  1 106 ? 102.404 150.784 35.740  1.00 27.47 ? 131 PHE A CD2 1 
ATOM   852   C CE1 . PHE A  1 106 ? 99.986  149.802 36.694  1.00 25.16 ? 131 PHE A CE1 1 
ATOM   853   C CE2 . PHE A  1 106 ? 102.340 149.488 36.259  1.00 26.21 ? 131 PHE A CE2 1 
ATOM   854   C CZ  . PHE A  1 106 ? 101.138 148.996 36.724  1.00 24.83 ? 131 PHE A CZ  1 
ATOM   855   N N   . LEU A  1 107 ? 98.630  153.659 33.893  1.00 21.30 ? 132 LEU A N   1 
ATOM   856   C CA  . LEU A  1 107 ? 97.190  153.399 33.766  1.00 20.99 ? 132 LEU A CA  1 
ATOM   857   C C   . LEU A  1 107 ? 96.782  153.229 32.299  1.00 22.29 ? 132 LEU A C   1 
ATOM   858   O O   . LEU A  1 107 ? 96.080  152.271 31.942  1.00 22.53 ? 132 LEU A O   1 
ATOM   859   C CB  . LEU A  1 107 ? 96.356  154.503 34.435  1.00 19.51 ? 132 LEU A CB  1 
ATOM   860   C CG  . LEU A  1 107 ? 96.451  154.699 35.959  1.00 19.19 ? 132 LEU A CG  1 
ATOM   861   C CD1 . LEU A  1 107 ? 95.454  155.767 36.408  1.00 17.36 ? 132 LEU A CD1 1 
ATOM   862   C CD2 . LEU A  1 107 ? 96.237  153.392 36.743  1.00 17.70 ? 132 LEU A CD2 1 
ATOM   863   N N   . ARG A  1 108 ? 97.229  154.142 31.439  1.00 23.84 ? 133 ARG A N   1 
ATOM   864   C CA  . ARG A  1 108 ? 96.942  154.033 30.007  1.00 25.69 ? 133 ARG A CA  1 
ATOM   865   C C   . ARG A  1 108 ? 97.511  152.758 29.380  1.00 26.96 ? 133 ARG A C   1 
ATOM   866   O O   . ARG A  1 108 ? 96.821  152.058 28.630  1.00 27.58 ? 133 ARG A O   1 
ATOM   867   C CB  . ARG A  1 108 ? 97.477  155.255 29.237  1.00 27.36 ? 133 ARG A CB  1 
ATOM   868   C CG  . ARG A  1 108 ? 96.793  156.590 29.601  1.00 27.49 ? 133 ARG A CG  1 
ATOM   869   C CD  . ARG A  1 108 ? 95.275  156.520 29.461  1.00 28.68 ? 133 ARG A CD  1 
ATOM   870   N NE  . ARG A  1 108 ? 94.688  157.866 29.455  1.00 29.28 ? 133 ARG A NE  1 
ATOM   871   C CZ  . ARG A  1 108 ? 93.391  158.119 29.550  1.00 27.89 ? 133 ARG A CZ  1 
ATOM   872   N NH1 . ARG A  1 108 ? 92.523  157.131 29.683  1.00 26.95 ? 133 ARG A NH1 1 
ATOM   873   N NH2 . ARG A  1 108 ? 92.963  159.367 29.528  1.00 28.74 ? 133 ARG A NH2 1 
ATOM   874   N N   . ASN A  1 109 ? 98.782  152.479 29.653  1.00 27.33 ? 134 ASN A N   1 
ATOM   875   C CA  . ASN A  1 109 ? 99.451  151.307 29.089  1.00 29.00 ? 134 ASN A CA  1 
ATOM   876   C C   . ASN A  1 109 ? 98.788  149.987 29.466  1.00 27.60 ? 134 ASN A C   1 
ATOM   877   O O   . ASN A  1 109 ? 98.806  149.036 28.683  1.00 28.17 ? 134 ASN A O   1 
ATOM   878   C CB  . ASN A  1 109 ? 100.932 151.252 29.499  1.00 29.29 ? 134 ASN A CB  1 
ATOM   879   C CG  . ASN A  1 109 ? 101.784 152.261 28.746  1.00 33.14 ? 134 ASN A CG  1 
ATOM   880   O OD1 . ASN A  1 109 ? 101.300 152.915 27.823  1.00 36.50 ? 134 ASN A OD1 1 
ATOM   881   N ND2 . ASN A  1 109 ? 103.050 152.409 29.147  1.00 32.59 ? 134 ASN A ND2 1 
ATOM   882   N N   . HIS A  1 110 ? 98.239  149.908 30.670  1.00 25.65 ? 135 HIS A N   1 
ATOM   883   C CA  . HIS A  1 110 ? 97.671  148.636 31.146  1.00 25.30 ? 135 HIS A CA  1 
ATOM   884   C C   . HIS A  1 110 ? 96.130  148.621 31.148  1.00 24.61 ? 135 HIS A C   1 
ATOM   885   O O   . HIS A  1 110 ? 95.496  147.720 31.707  1.00 23.65 ? 135 HIS A O   1 
ATOM   886   C CB  . HIS A  1 110 ? 98.240  148.283 32.520  1.00 24.22 ? 135 HIS A CB  1 
ATOM   887   C CG  . HIS A  1 110 ? 99.719  148.064 32.510  1.00 25.76 ? 135 HIS A CG  1 
ATOM   888   N ND1 . HIS A  1 110 ? 100.314 147.082 31.751  1.00 27.39 ? 135 HIS A ND1 1 
ATOM   889   C CD2 . HIS A  1 110 ? 100.727 148.709 33.149  1.00 27.08 ? 135 HIS A CD2 1 
ATOM   890   C CE1 . HIS A  1 110 ? 101.626 147.132 31.917  1.00 28.83 ? 135 HIS A CE1 1 
ATOM   891   N NE2 . HIS A  1 110 ? 101.901 148.100 32.770  1.00 27.58 ? 135 HIS A NE2 1 
ATOM   892   N N   . ASN A  1 111 ? 95.530  149.621 30.514  1.00 24.82 ? 136 ASN A N   1 
ATOM   893   C CA  . ASN A  1 111 ? 94.097  149.596 30.303  1.00 24.84 ? 136 ASN A CA  1 
ATOM   894   C C   . ASN A  1 111 ? 93.272  149.780 31.583  1.00 23.32 ? 136 ASN A C   1 
ATOM   895   O O   . ASN A  1 111 ? 92.149  149.273 31.673  1.00 22.74 ? 136 ASN A O   1 
ATOM   896   C CB  . ASN A  1 111 ? 93.701  148.274 29.611  1.00 26.18 ? 136 ASN A CB  1 
ATOM   897   C CG  . ASN A  1 111 ? 92.380  148.378 28.858  1.00 28.41 ? 136 ASN A CG  1 
ATOM   898   O OD1 . ASN A  1 111 ? 91.839  149.467 28.723  1.00 27.76 ? 136 ASN A OD1 1 
ATOM   899   N ND2 . ASN A  1 111 ? 91.854  147.237 28.364  1.00 29.39 ? 136 ASN A ND2 1 
ATOM   900   N N   . PHE A  1 112 ? 93.811  150.503 32.564  1.00 21.91 ? 137 PHE A N   1 
ATOM   901   C CA  . PHE A  1 112 ? 93.031  150.897 33.744  1.00 20.62 ? 137 PHE A CA  1 
ATOM   902   C C   . PHE A  1 112 ? 92.250  152.183 33.444  1.00 20.89 ? 137 PHE A C   1 
ATOM   903   O O   . PHE A  1 112 ? 92.685  153.014 32.640  1.00 22.21 ? 137 PHE A O   1 
ATOM   904   C CB  . PHE A  1 112 ? 93.928  151.185 34.950  1.00 19.39 ? 137 PHE A CB  1 
ATOM   905   C CG  . PHE A  1 112 ? 94.557  149.964 35.566  1.00 19.39 ? 137 PHE A CG  1 
ATOM   906   C CD1 . PHE A  1 112 ? 93.915  149.275 36.571  1.00 18.61 ? 137 PHE A CD1 1 
ATOM   907   C CD2 . PHE A  1 112 ? 95.816  149.529 35.156  1.00 21.42 ? 137 PHE A CD2 1 
ATOM   908   C CE1 . PHE A  1 112 ? 94.503  148.159 37.188  1.00 19.37 ? 137 PHE A CE1 1 
ATOM   909   C CE2 . PHE A  1 112 ? 96.413  148.399 35.759  1.00 21.26 ? 137 PHE A CE2 1 
ATOM   910   C CZ  . PHE A  1 112 ? 95.741  147.713 36.766  1.00 19.65 ? 137 PHE A CZ  1 
ATOM   911   N N   . ASP A  1 113 ? 91.137  152.383 34.136  1.00 19.76 ? 138 ASP A N   1 
ATOM   912   C CA  . ASP A  1 113 ? 90.334  153.585 33.920  1.00 20.10 ? 138 ASP A CA  1 
ATOM   913   C C   . ASP A  1 113 ? 90.560  154.682 34.944  1.00 19.39 ? 138 ASP A C   1 
ATOM   914   O O   . ASP A  1 113 ? 89.969  155.760 34.839  1.00 19.48 ? 138 ASP A O   1 
ATOM   915   C CB  . ASP A  1 113 ? 88.864  153.205 33.923  1.00 20.51 ? 138 ASP A CB  1 
ATOM   916   C CG  . ASP A  1 113 ? 88.551  152.197 32.862  1.00 21.27 ? 138 ASP A CG  1 
ATOM   917   O OD1 . ASP A  1 113 ? 88.396  152.615 31.707  1.00 22.98 ? 138 ASP A OD1 1 
ATOM   918   O OD2 . ASP A  1 113 ? 88.505  150.990 33.180  1.00 21.45 ? 138 ASP A OD2 1 
ATOM   919   N N   . GLY A  1 114 ? 91.400  154.419 35.946  1.00 18.66 ? 139 GLY A N   1 
ATOM   920   C CA  . GLY A  1 114 ? 91.632  155.417 36.976  1.00 17.80 ? 139 GLY A CA  1 
ATOM   921   C C   . GLY A  1 114 ? 92.390  154.905 38.186  1.00 17.18 ? 139 GLY A C   1 
ATOM   922   O O   . GLY A  1 114 ? 92.781  153.732 38.236  1.00 16.78 ? 139 GLY A O   1 
ATOM   923   N N   . LEU A  1 115 ? 92.571  155.794 39.163  1.00 16.57 ? 140 LEU A N   1 
ATOM   924   C CA  . LEU A  1 115 ? 93.397  155.531 40.333  1.00 16.25 ? 140 LEU A CA  1 
ATOM   925   C C   . LEU A  1 115 ? 92.568  155.761 41.584  1.00 16.07 ? 140 LEU A C   1 
ATOM   926   O O   . LEU A  1 115 ? 91.850  156.764 41.692  1.00 15.85 ? 140 LEU A O   1 
ATOM   927   C CB  . LEU A  1 115 ? 94.544  156.536 40.387  1.00 16.57 ? 140 LEU A CB  1 
ATOM   928   C CG  . LEU A  1 115 ? 95.413  156.427 41.648  1.00 16.82 ? 140 LEU A CG  1 
ATOM   929   C CD1 . LEU A  1 115 ? 96.200  155.113 41.588  1.00 18.29 ? 140 LEU A CD1 1 
ATOM   930   C CD2 . LEU A  1 115 ? 96.388  157.652 41.732  1.00 17.57 ? 140 LEU A CD2 1 
ATOM   931   N N   . ASP A  1 116 ? 92.695  154.836 42.522  1.00 15.43 ? 141 ASP A N   1 
ATOM   932   C CA  . ASP A  1 116 ? 92.107  154.963 43.833  1.00 15.63 ? 141 ASP A CA  1 
ATOM   933   C C   . ASP A  1 116 ? 93.248  155.209 44.822  1.00 15.75 ? 141 ASP A C   1 
ATOM   934   O O   . ASP A  1 116 ? 94.214  154.436 44.869  1.00 15.34 ? 141 ASP A O   1 
ATOM   935   C CB  . ASP A  1 116 ? 91.410  153.651 44.211  1.00 14.86 ? 141 ASP A CB  1 
ATOM   936   C CG  . ASP A  1 116 ? 90.795  153.719 45.610  1.00 17.05 ? 141 ASP A CG  1 
ATOM   937   O OD1 . ASP A  1 116 ? 89.909  154.605 45.807  1.00 16.84 ? 141 ASP A OD1 1 
ATOM   938   O OD2 . ASP A  1 116 ? 91.196  152.903 46.493  1.00 15.60 ? 141 ASP A OD2 1 
ATOM   939   N N   . VAL A  1 117 ? 93.178  156.298 45.585  1.00 15.59 ? 142 VAL A N   1 
ATOM   940   C CA  . VAL A  1 117 ? 94.220  156.546 46.588  1.00 16.14 ? 142 VAL A CA  1 
ATOM   941   C C   . VAL A  1 117 ? 93.592  156.244 47.952  1.00 16.51 ? 142 VAL A C   1 
ATOM   942   O O   . VAL A  1 117 ? 92.719  156.983 48.384  1.00 17.31 ? 142 VAL A O   1 
ATOM   943   C CB  . VAL A  1 117 ? 94.713  158.024 46.558  1.00 16.32 ? 142 VAL A CB  1 
ATOM   944   C CG1 . VAL A  1 117 ? 95.809  158.263 47.631  1.00 18.02 ? 142 VAL A CG1 1 
ATOM   945   C CG2 . VAL A  1 117 ? 95.261  158.399 45.166  1.00 16.80 ? 142 VAL A CG2 1 
ATOM   946   N N   . SER A  1 118 ? 93.994  155.165 48.613  1.00 16.18 ? 143 SER A N   1 
ATOM   947   C CA  . SER A  1 118 ? 93.445  154.842 49.919  1.00 16.35 ? 143 SER A CA  1 
ATOM   948   C C   . SER A  1 118 ? 94.502  154.998 50.967  1.00 16.50 ? 143 SER A C   1 
ATOM   949   O O   . SER A  1 118 ? 95.058  154.014 51.438  1.00 16.75 ? 143 SER A O   1 
ATOM   950   C CB  . SER A  1 118 ? 92.910  153.414 49.951  1.00 16.52 ? 143 SER A CB  1 
ATOM   951   O OG  . SER A  1 118 ? 91.792  153.351 49.116  1.00 18.92 ? 143 SER A OG  1 
ATOM   952   N N   . TRP A  1 119 ? 94.783  156.245 51.328  1.00 15.42 ? 144 TRP A N   1 
ATOM   953   C CA  . TRP A  1 119 ? 95.826  156.520 52.302  1.00 16.05 ? 144 TRP A CA  1 
ATOM   954   C C   . TRP A  1 119 ? 95.247  156.280 53.692  1.00 15.67 ? 144 TRP A C   1 
ATOM   955   O O   . TRP A  1 119 ? 94.285  156.949 54.111  1.00 14.94 ? 144 TRP A O   1 
ATOM   956   C CB  . TRP A  1 119 ? 96.237  157.976 52.150  1.00 16.15 ? 144 TRP A CB  1 
ATOM   957   C CG  . TRP A  1 119 ? 97.388  158.440 52.955  1.00 16.59 ? 144 TRP A CG  1 
ATOM   958   C CD1 . TRP A  1 119 ? 97.711  158.094 54.239  1.00 17.39 ? 144 TRP A CD1 1 
ATOM   959   C CD2 . TRP A  1 119 ? 98.363  159.390 52.530  1.00 14.69 ? 144 TRP A CD2 1 
ATOM   960   N NE1 . TRP A  1 119 ? 98.861  158.775 54.629  1.00 17.25 ? 144 TRP A NE1 1 
ATOM   961   C CE2 . TRP A  1 119 ? 99.270  159.572 53.593  1.00 16.44 ? 144 TRP A CE2 1 
ATOM   962   C CE3 . TRP A  1 119 ? 98.566  160.088 51.337  1.00 16.48 ? 144 TRP A CE3 1 
ATOM   963   C CZ2 . TRP A  1 119 ? 100.366 160.434 53.503  1.00 18.02 ? 144 TRP A CZ2 1 
ATOM   964   C CZ3 . TRP A  1 119 ? 99.651  160.932 51.236  1.00 18.51 ? 144 TRP A CZ3 1 
ATOM   965   C CH2 . TRP A  1 119 ? 100.542 161.108 52.324  1.00 19.63 ? 144 TRP A CH2 1 
ATOM   966   N N   . ILE A  1 120 ? 95.825  155.314 54.396  1.00 15.95 ? 145 ILE A N   1 
ATOM   967   C CA  . ILE A  1 120 ? 95.349  154.937 55.715  1.00 15.89 ? 145 ILE A CA  1 
ATOM   968   C C   . ILE A  1 120 ? 96.426  155.285 56.769  1.00 16.43 ? 145 ILE A C   1 
ATOM   969   O O   . ILE A  1 120 ? 97.359  154.497 56.956  1.00 17.64 ? 145 ILE A O   1 
ATOM   970   C CB  . ILE A  1 120 ? 95.045  153.397 55.767  1.00 15.61 ? 145 ILE A CB  1 
ATOM   971   C CG1 . ILE A  1 120 ? 94.150  152.939 54.585  1.00 14.47 ? 145 ILE A CG1 1 
ATOM   972   C CG2 . ILE A  1 120 ? 94.467  152.990 57.136  1.00 16.62 ? 145 ILE A CG2 1 
ATOM   973   C CD1 . ILE A  1 120 ? 92.780  153.691 54.460  1.00 13.59 ? 145 ILE A CD1 1 
ATOM   974   N N   . TYR A  1 121 ? 96.362  156.447 57.442  1.00 16.48 ? 146 TYR A N   1 
ATOM   975   C CA  . TYR A  1 121 ? 95.482  157.583 57.134  1.00 15.80 ? 146 TYR A CA  1 
ATOM   976   C C   . TYR A  1 121 ? 96.354  158.819 57.095  1.00 16.58 ? 146 TYR A C   1 
ATOM   977   O O   . TYR A  1 121 ? 97.444  158.838 57.680  1.00 17.19 ? 146 TYR A O   1 
ATOM   978   C CB  . TYR A  1 121 ? 94.517  157.839 58.283  1.00 15.99 ? 146 TYR A CB  1 
ATOM   979   C CG  . TYR A  1 121 ? 93.659  156.672 58.694  1.00 16.43 ? 146 TYR A CG  1 
ATOM   980   C CD1 . TYR A  1 121 ? 92.499  156.367 57.996  1.00 15.87 ? 146 TYR A CD1 1 
ATOM   981   C CD2 . TYR A  1 121 ? 94.012  155.883 59.797  1.00 17.75 ? 146 TYR A CD2 1 
ATOM   982   C CE1 . TYR A  1 121 ? 91.677  155.301 58.390  1.00 15.85 ? 146 TYR A CE1 1 
ATOM   983   C CE2 . TYR A  1 121 ? 93.209  154.799 60.192  1.00 18.10 ? 146 TYR A CE2 1 
ATOM   984   C CZ  . TYR A  1 121 ? 92.047  154.521 59.481  1.00 16.20 ? 146 TYR A CZ  1 
ATOM   985   O OH  . TYR A  1 121 ? 91.235  153.465 59.836  1.00 16.30 ? 146 TYR A OH  1 
ATOM   986   N N   . PRO A  1 122 ? 95.856  159.896 56.474  1.00 16.00 ? 147 PRO A N   1 
ATOM   987   C CA  . PRO A  1 122 ? 96.689  161.089 56.535  1.00 17.07 ? 147 PRO A CA  1 
ATOM   988   C C   . PRO A  1 122 ? 96.826  161.609 57.987  1.00 18.10 ? 147 PRO A C   1 
ATOM   989   O O   . PRO A  1 122 ? 97.913  162.046 58.422  1.00 19.30 ? 147 PRO A O   1 
ATOM   990   C CB  . PRO A  1 122 ? 95.926  162.084 55.646  1.00 16.81 ? 147 PRO A CB  1 
ATOM   991   C CG  . PRO A  1 122 ? 95.141  161.183 54.655  1.00 15.51 ? 147 PRO A CG  1 
ATOM   992   C CD  . PRO A  1 122 ? 94.712  160.029 55.542  1.00 15.05 ? 147 PRO A CD  1 
ATOM   993   N N   . ASP A  1 123 ? 95.731  161.563 58.727  1.00 18.11 ? 148 ASP A N   1 
ATOM   994   C CA  . ASP A  1 123 ? 95.710  162.148 60.075  1.00 19.46 ? 148 ASP A CA  1 
ATOM   995   C C   . ASP A  1 123 ? 96.128  163.607 60.034  1.00 19.58 ? 148 ASP A C   1 
ATOM   996   O O   . ASP A  1 123 ? 96.222  164.176 58.960  1.00 18.56 ? 148 ASP A O   1 
ATOM   997   C CB  . ASP A  1 123 ? 96.594  161.349 61.029  1.00 19.55 ? 148 ASP A CB  1 
ATOM   998   C CG  . ASP A  1 123 ? 96.072  161.380 62.452  1.00 22.77 ? 148 ASP A CG  1 
ATOM   999   O OD1 . ASP A  1 123 ? 95.475  162.396 62.871  1.00 22.00 ? 148 ASP A OD1 1 
ATOM   1000  O OD2 . ASP A  1 123 ? 96.251  160.371 63.139  1.00 23.66 ? 148 ASP A OD2 1 
ATOM   1001  N N   . GLN A  1 124 ? 96.356  164.219 61.194  1.00 20.79 ? 149 GLN A N   1 
ATOM   1002  C CA  . GLN A  1 124 ? 96.729  165.619 61.229  1.00 22.23 ? 149 GLN A CA  1 
ATOM   1003  C C   . GLN A  1 124 ? 98.039  165.851 60.502  1.00 22.61 ? 149 GLN A C   1 
ATOM   1004  O O   . GLN A  1 124 ? 98.181  166.835 59.779  1.00 22.95 ? 149 GLN A O   1 
ATOM   1005  C CB  . GLN A  1 124 ? 96.890  166.125 62.670  1.00 23.64 ? 149 GLN A CB  1 
ATOM   1006  C CG  . GLN A  1 124 ? 95.595  166.179 63.446  1.00 26.62 ? 149 GLN A CG  1 
ATOM   1007  C CD  . GLN A  1 124 ? 95.760  166.984 64.723  1.00 32.76 ? 149 GLN A CD  1 
ATOM   1008  O OE1 . GLN A  1 124 ? 95.150  168.031 64.885  1.00 36.28 ? 149 GLN A OE1 1 
ATOM   1009  N NE2 . GLN A  1 124 ? 96.626  166.522 65.607  1.00 34.90 ? 149 GLN A NE2 1 
ATOM   1010  N N   . LYS A  1 125 ? 99.012  164.979 60.758  1.00 22.53 ? 150 LYS A N   1 
ATOM   1011  C CA  . LYS A  1 125 ? 100.369 165.138 60.223  1.00 23.67 ? 150 LYS A CA  1 
ATOM   1012  C C   . LYS A  1 125 ? 100.459 165.183 58.691  1.00 22.10 ? 150 LYS A C   1 
ATOM   1013  O O   . LYS A  1 125 ? 101.250 165.940 58.131  1.00 21.54 ? 150 LYS A O   1 
ATOM   1014  C CB  . LYS A  1 125 ? 101.306 164.029 60.737  1.00 24.69 ? 150 LYS A CB  1 
ATOM   1015  C CG  . LYS A  1 125 ? 102.719 164.163 60.141  1.00 28.65 ? 150 LYS A CG  1 
ATOM   1016  C CD  . LYS A  1 125 ? 103.749 163.199 60.719  1.00 34.70 ? 150 LYS A CD  1 
ATOM   1017  C CE  . LYS A  1 125 ? 105.130 163.845 60.580  1.00 38.58 ? 150 LYS A CE  1 
ATOM   1018  N NZ  . LYS A  1 125 ? 106.220 163.001 61.117  1.00 42.52 ? 150 LYS A NZ  1 
ATOM   1019  N N   . GLU A  1 126 ? 99.692  164.350 58.004  1.00 20.90 ? 151 GLU A N   1 
ATOM   1020  C CA  . GLU A  1 126 ? 99.816  164.276 56.551  1.00 20.47 ? 151 GLU A CA  1 
ATOM   1021  C C   . GLU A  1 126 ? 98.603  164.851 55.811  1.00 19.71 ? 151 GLU A C   1 
ATOM   1022  O O   . GLU A  1 126 ? 98.464  164.670 54.584  1.00 17.77 ? 151 GLU A O   1 
ATOM   1023  C CB  . GLU A  1 126 ? 100.054 162.823 56.105  1.00 20.53 ? 151 GLU A CB  1 
ATOM   1024  C CG  . GLU A  1 126 ? 101.284 162.170 56.744  1.00 24.43 ? 151 GLU A CG  1 
ATOM   1025  C CD  . GLU A  1 126 ? 102.595 162.552 56.073  1.00 29.00 ? 151 GLU A CD  1 
ATOM   1026  O OE1 . GLU A  1 126 ? 102.583 163.170 54.985  1.00 30.24 ? 151 GLU A OE1 1 
ATOM   1027  O OE2 . GLU A  1 126 ? 103.654 162.246 56.643  1.00 32.25 ? 151 GLU A OE2 1 
ATOM   1028  N N   . ASN A  1 127 ? 97.714  165.503 56.559  1.00 19.10 ? 152 ASN A N   1 
ATOM   1029  C CA  . ASN A  1 127 ? 96.547  166.170 55.963  1.00 19.15 ? 152 ASN A CA  1 
ATOM   1030  C C   . ASN A  1 127 ? 97.015  166.977 54.724  1.00 18.76 ? 152 ASN A C   1 
ATOM   1031  O O   . ASN A  1 127 ? 96.508  166.809 53.622  1.00 18.26 ? 152 ASN A O   1 
ATOM   1032  C CB  . ASN A  1 127 ? 95.880  167.072 57.043  1.00 19.67 ? 152 ASN A CB  1 
ATOM   1033  C CG  . ASN A  1 127 ? 94.700  167.882 56.515  1.00 22.06 ? 152 ASN A CG  1 
ATOM   1034  O OD1 . ASN A  1 127 ? 94.825  168.575 55.504  1.00 22.78 ? 152 ASN A OD1 1 
ATOM   1035  N ND2 . ASN A  1 127 ? 93.552  167.841 57.236  1.00 17.36 ? 152 ASN A ND2 1 
ATOM   1036  N N   . THR A  1 128 ? 98.014  167.817 54.907  1.00 19.04 ? 153 THR A N   1 
ATOM   1037  C CA  . THR A  1 128 ? 98.450  168.702 53.821  1.00 20.43 ? 153 THR A CA  1 
ATOM   1038  C C   . THR A  1 128 ? 98.988  167.912 52.637  1.00 19.92 ? 153 THR A C   1 
ATOM   1039  O O   . THR A  1 128 ? 98.562  168.133 51.505  1.00 20.26 ? 153 THR A O   1 
ATOM   1040  C CB  . THR A  1 128 ? 99.469  169.699 54.300  1.00 20.85 ? 153 THR A CB  1 
ATOM   1041  O OG1 . THR A  1 128 ? 98.836  170.558 55.257  1.00 22.59 ? 153 THR A OG1 1 
ATOM   1042  C CG2 . THR A  1 128 ? 99.996  170.548 53.143  1.00 22.16 ? 153 THR A CG2 1 
ATOM   1043  N N   . HIS A  1 129 ? 99.884  166.968 52.903  1.00 19.41 ? 154 HIS A N   1 
ATOM   1044  C CA  . HIS A  1 129 ? 100.473 166.161 51.816  1.00 19.74 ? 154 HIS A CA  1 
ATOM   1045  C C   . HIS A  1 129 ? 99.419  165.436 51.021  1.00 18.83 ? 154 HIS A C   1 
ATOM   1046  O O   . HIS A  1 129 ? 99.514  165.351 49.796  1.00 18.37 ? 154 HIS A O   1 
ATOM   1047  C CB  . HIS A  1 129 ? 101.463 165.130 52.347  1.00 19.21 ? 154 HIS A CB  1 
ATOM   1048  C CG  . HIS A  1 129 ? 102.834 165.684 52.598  1.00 22.36 ? 154 HIS A CG  1 
ATOM   1049  N ND1 . HIS A  1 129 ? 103.609 165.290 53.665  1.00 24.61 ? 154 HIS A ND1 1 
ATOM   1050  C CD2 . HIS A  1 129 ? 103.575 166.584 51.909  1.00 24.40 ? 154 HIS A CD2 1 
ATOM   1051  C CE1 . HIS A  1 129 ? 104.767 165.928 53.631  1.00 24.96 ? 154 HIS A CE1 1 
ATOM   1052  N NE2 . HIS A  1 129 ? 104.770 166.724 52.576  1.00 25.98 ? 154 HIS A NE2 1 
ATOM   1053  N N   . PHE A  1 130 ? 98.442  164.861 51.724  1.00 17.84 ? 155 PHE A N   1 
ATOM   1054  C CA  . PHE A  1 130 ? 97.364  164.122 51.065  1.00 17.14 ? 155 PHE A CA  1 
ATOM   1055  C C   . PHE A  1 130 ? 96.522  165.080 50.222  1.00 17.23 ? 155 PHE A C   1 
ATOM   1056  O O   . PHE A  1 130 ? 96.244  164.808 49.052  1.00 17.29 ? 155 PHE A O   1 
ATOM   1057  C CB  . PHE A  1 130 ? 96.491  163.368 52.094  1.00 16.16 ? 155 PHE A CB  1 
ATOM   1058  C CG  . PHE A  1 130 ? 95.232  162.777 51.515  1.00 17.02 ? 155 PHE A CG  1 
ATOM   1059  C CD1 . PHE A  1 130 ? 95.254  161.545 50.852  1.00 15.93 ? 155 PHE A CD1 1 
ATOM   1060  C CD2 . PHE A  1 130 ? 94.012  163.452 51.639  1.00 17.22 ? 155 PHE A CD2 1 
ATOM   1061  C CE1 . PHE A  1 130 ? 94.078  160.999 50.327  1.00 15.92 ? 155 PHE A CE1 1 
ATOM   1062  C CE2 . PHE A  1 130 ? 92.837  162.908 51.095  1.00 15.96 ? 155 PHE A CE2 1 
ATOM   1063  C CZ  . PHE A  1 130 ? 92.874  161.691 50.446  1.00 17.98 ? 155 PHE A CZ  1 
ATOM   1064  N N   . THR A  1 131 ? 96.152  166.223 50.795  1.00 17.64 ? 156 THR A N   1 
ATOM   1065  C CA  . THR A  1 131 ? 95.311  167.192 50.075  1.00 17.13 ? 156 THR A CA  1 
ATOM   1066  C C   . THR A  1 131 ? 95.997  167.663 48.768  1.00 17.80 ? 156 THR A C   1 
ATOM   1067  O O   . THR A  1 131 ? 95.371  167.732 47.674  1.00 16.52 ? 156 THR A O   1 
ATOM   1068  C CB  . THR A  1 131 ? 94.984  168.382 50.982  1.00 18.77 ? 156 THR A CB  1 
ATOM   1069  O OG1 . THR A  1 131 ? 94.220  167.910 52.109  1.00 20.00 ? 156 THR A OG1 1 
ATOM   1070  C CG2 . THR A  1 131 ? 94.181  169.416 50.251  1.00 18.79 ? 156 THR A CG2 1 
ATOM   1071  N N   . VAL A  1 132 ? 97.290  167.957 48.883  1.00 17.13 ? 157 VAL A N   1 
ATOM   1072  C CA  . VAL A  1 132 ? 98.071  168.415 47.751  1.00 18.21 ? 157 VAL A CA  1 
ATOM   1073  C C   . VAL A  1 132 ? 98.192  167.299 46.680  1.00 17.89 ? 157 VAL A C   1 
ATOM   1074  O O   . VAL A  1 132 ? 98.027  167.545 45.480  1.00 17.57 ? 157 VAL A O   1 
ATOM   1075  C CB  . VAL A  1 132 ? 99.472  168.851 48.226  1.00 18.84 ? 157 VAL A CB  1 
ATOM   1076  C CG1 . VAL A  1 132 ? 100.412 169.035 47.054  1.00 21.02 ? 157 VAL A CG1 1 
ATOM   1077  C CG2 . VAL A  1 132 ? 99.386  170.147 49.065  1.00 19.58 ? 157 VAL A CG2 1 
ATOM   1078  N N   . LEU A  1 133 ? 98.492  166.081 47.123  1.00 16.92 ? 158 LEU A N   1 
ATOM   1079  C CA  . LEU A  1 133 ? 98.652  164.968 46.186  1.00 17.74 ? 158 LEU A CA  1 
ATOM   1080  C C   . LEU A  1 133 ? 97.375  164.744 45.361  1.00 17.47 ? 158 LEU A C   1 
ATOM   1081  O O   . LEU A  1 133 ? 97.424  164.572 44.126  1.00 17.96 ? 158 LEU A O   1 
ATOM   1082  C CB  . LEU A  1 133 ? 99.023  163.692 46.936  1.00 16.68 ? 158 LEU A CB  1 
ATOM   1083  C CG  . LEU A  1 133 ? 99.132  162.413 46.118  1.00 17.43 ? 158 LEU A CG  1 
ATOM   1084  C CD1 . LEU A  1 133 ? 100.269 162.564 45.083  1.00 16.54 ? 158 LEU A CD1 1 
ATOM   1085  C CD2 . LEU A  1 133 ? 99.367  161.197 47.061  1.00 17.26 ? 158 LEU A CD2 1 
ATOM   1086  N N   . ILE A  1 134 ? 96.251  164.708 46.055  1.00 16.73 ? 159 ILE A N   1 
ATOM   1087  C CA  . ILE A  1 134 ? 94.956  164.532 45.412  1.00 16.74 ? 159 ILE A CA  1 
ATOM   1088  C C   . ILE A  1 134 ? 94.713  165.670 44.431  1.00 18.11 ? 159 ILE A C   1 
ATOM   1089  O O   . ILE A  1 134 ? 94.284  165.438 43.301  1.00 18.05 ? 159 ILE A O   1 
ATOM   1090  C CB  . ILE A  1 134 ? 93.815  164.467 46.461  1.00 16.58 ? 159 ILE A CB  1 
ATOM   1091  C CG1 . ILE A  1 134 ? 93.946  163.184 47.290  1.00 16.04 ? 159 ILE A CG1 1 
ATOM   1092  C CG2 . ILE A  1 134 ? 92.415  164.516 45.797  1.00 16.00 ? 159 ILE A CG2 1 
ATOM   1093  C CD1 . ILE A  1 134 ? 93.825  161.910 46.467  1.00 15.29 ? 159 ILE A CD1 1 
ATOM   1094  N N   . HIS A  1 135 ? 94.975  166.903 44.865  1.00 18.14 ? 160 HIS A N   1 
ATOM   1095  C CA  . HIS A  1 135 ? 94.778  168.035 43.978  1.00 18.91 ? 160 HIS A CA  1 
ATOM   1096  C C   . HIS A  1 135 ? 95.645  167.975 42.729  1.00 19.35 ? 160 HIS A C   1 
ATOM   1097  O O   . HIS A  1 135 ? 95.166  168.247 41.626  1.00 19.54 ? 160 HIS A O   1 
ATOM   1098  C CB  . HIS A  1 135 ? 94.995  169.375 44.683  1.00 19.60 ? 160 HIS A CB  1 
ATOM   1099  C CG  . HIS A  1 135 ? 94.579  170.535 43.839  1.00 21.47 ? 160 HIS A CG  1 
ATOM   1100  N ND1 . HIS A  1 135 ? 93.256  170.831 43.600  1.00 24.11 ? 160 HIS A ND1 1 
ATOM   1101  C CD2 . HIS A  1 135 ? 95.301  171.424 43.119  1.00 23.22 ? 160 HIS A CD2 1 
ATOM   1102  C CE1 . HIS A  1 135 ? 93.180  171.888 42.805  1.00 25.31 ? 160 HIS A CE1 1 
ATOM   1103  N NE2 . HIS A  1 135 ? 94.406  172.261 42.494  1.00 26.30 ? 160 HIS A NE2 1 
ATOM   1104  N N   . GLU A  1 136 ? 96.920  167.640 42.889  1.00 18.51 ? 161 GLU A N   1 
ATOM   1105  C CA  . GLU A  1 136 ? 97.806  167.559 41.737  1.00 19.87 ? 161 GLU A CA  1 
ATOM   1106  C C   . GLU A  1 136 ? 97.426  166.408 40.800  1.00 19.61 ? 161 GLU A C   1 
ATOM   1107  O O   . GLU A  1 136 ? 97.539  166.543 39.587  1.00 20.79 ? 161 GLU A O   1 
ATOM   1108  C CB  . GLU A  1 136 ? 99.260  167.469 42.188  1.00 19.59 ? 161 GLU A CB  1 
ATOM   1109  C CG  . GLU A  1 136 ? 99.739  168.806 42.777  1.00 21.91 ? 161 GLU A CG  1 
ATOM   1110  C CD  . GLU A  1 136 ? 101.133 168.724 43.370  1.00 26.47 ? 161 GLU A CD  1 
ATOM   1111  O OE1 . GLU A  1 136 ? 101.733 167.617 43.326  1.00 25.56 ? 161 GLU A OE1 1 
ATOM   1112  O OE2 . GLU A  1 136 ? 101.616 169.760 43.894  1.00 27.38 ? 161 GLU A OE2 1 
ATOM   1113  N N   . LEU A  1 137 ? 96.995  165.286 41.356  1.00 18.94 ? 162 LEU A N   1 
ATOM   1114  C CA  . LEU A  1 137 ? 96.482  164.188 40.523  1.00 18.75 ? 162 LEU A CA  1 
ATOM   1115  C C   . LEU A  1 137 ? 95.263  164.630 39.718  1.00 19.29 ? 162 LEU A C   1 
ATOM   1116  O O   . LEU A  1 137 ? 95.223  164.456 38.493  1.00 20.36 ? 162 LEU A O   1 
ATOM   1117  C CB  . LEU A  1 137 ? 96.107  162.968 41.366  1.00 17.37 ? 162 LEU A CB  1 
ATOM   1118  C CG  . LEU A  1 137 ? 97.287  162.087 41.774  1.00 18.32 ? 162 LEU A CG  1 
ATOM   1119  C CD1 . LEU A  1 137 ? 96.908  161.308 43.041  1.00 16.81 ? 162 LEU A CD1 1 
ATOM   1120  C CD2 . LEU A  1 137 ? 97.703  161.135 40.640  1.00 16.62 ? 162 LEU A CD2 1 
ATOM   1121  N N   . ALA A  1 138 ? 94.259  165.173 40.395  1.00 18.71 ? 163 ALA A N   1 
ATOM   1122  C CA  . ALA A  1 138 ? 93.063  165.620 39.681  1.00 20.07 ? 163 ALA A CA  1 
ATOM   1123  C C   . ALA A  1 138 ? 93.453  166.571 38.539  1.00 21.84 ? 163 ALA A C   1 
ATOM   1124  O O   . ALA A  1 138 ? 92.958  166.463 37.414  1.00 22.13 ? 163 ALA A O   1 
ATOM   1125  C CB  . ALA A  1 138 ? 92.082  166.307 40.643  1.00 19.96 ? 163 ALA A CB  1 
ATOM   1126  N N   . GLU A  1 139 ? 94.336  167.520 38.825  1.00 22.93 ? 164 GLU A N   1 
ATOM   1127  C CA  . GLU A  1 139 ? 94.667  168.513 37.796  1.00 24.89 ? 164 GLU A CA  1 
ATOM   1128  C C   . GLU A  1 139 ? 95.326  167.834 36.616  1.00 24.90 ? 164 GLU A C   1 
ATOM   1129  O O   . GLU A  1 139 ? 95.060  168.179 35.455  1.00 25.72 ? 164 GLU A O   1 
ATOM   1130  C CB  . GLU A  1 139 ? 95.598  169.575 38.357  1.00 26.15 ? 164 GLU A CB  1 
ATOM   1131  C CG  . GLU A  1 139 ? 94.945  170.402 39.445  1.00 29.99 ? 164 GLU A CG  1 
ATOM   1132  C CD  . GLU A  1 139 ? 94.168  171.558 38.887  1.00 36.42 ? 164 GLU A CD  1 
ATOM   1133  O OE1 . GLU A  1 139 ? 94.801  172.498 38.354  1.00 41.53 ? 164 GLU A OE1 1 
ATOM   1134  O OE2 . GLU A  1 139 ? 92.925  171.529 38.980  1.00 38.17 ? 164 GLU A OE2 1 
ATOM   1135  N N   . ALA A  1 140 ? 96.210  166.883 36.917  1.00 23.80 ? 165 ALA A N   1 
ATOM   1136  C CA  . ALA A  1 140 ? 96.994  166.253 35.869  1.00 24.16 ? 165 ALA A CA  1 
ATOM   1137  C C   . ALA A  1 140 ? 96.076  165.365 35.024  1.00 23.93 ? 165 ALA A C   1 
ATOM   1138  O O   . ALA A  1 140 ? 96.203  165.335 33.796  1.00 23.98 ? 165 ALA A O   1 
ATOM   1139  C CB  . ALA A  1 140 ? 98.167  165.463 36.448  1.00 23.39 ? 165 ALA A CB  1 
ATOM   1140  N N   . PHE A  1 141 ? 95.143  164.673 35.682  1.00 22.63 ? 166 PHE A N   1 
ATOM   1141  C CA  . PHE A  1 141 ? 94.148  163.857 34.961  1.00 22.69 ? 166 PHE A CA  1 
ATOM   1142  C C   . PHE A  1 141 ? 93.299  164.749 34.044  1.00 23.75 ? 166 PHE A C   1 
ATOM   1143  O O   . PHE A  1 141 ? 92.981  164.375 32.901  1.00 24.04 ? 166 PHE A O   1 
ATOM   1144  C CB  . PHE A  1 141 ? 93.252  163.078 35.944  1.00 20.18 ? 166 PHE A CB  1 
ATOM   1145  C CG  . PHE A  1 141 ? 93.932  161.896 36.605  1.00 19.97 ? 166 PHE A CG  1 
ATOM   1146  C CD1 . PHE A  1 141 ? 95.303  161.694 36.474  1.00 19.98 ? 166 PHE A CD1 1 
ATOM   1147  C CD2 . PHE A  1 141 ? 93.194  161.002 37.379  1.00 17.76 ? 166 PHE A CD2 1 
ATOM   1148  C CE1 . PHE A  1 141 ? 95.929  160.624 37.091  1.00 19.03 ? 166 PHE A CE1 1 
ATOM   1149  C CE2 . PHE A  1 141 ? 93.798  159.919 38.019  1.00 18.41 ? 166 PHE A CE2 1 
ATOM   1150  C CZ  . PHE A  1 141 ? 95.184  159.722 37.877  1.00 19.82 ? 166 PHE A CZ  1 
ATOM   1151  N N   . GLN A  1 142 ? 92.930  165.934 34.533  1.00 24.58 ? 167 GLN A N   1 
ATOM   1152  C CA  . GLN A  1 142 ? 92.115  166.833 33.720  1.00 26.20 ? 167 GLN A CA  1 
ATOM   1153  C C   . GLN A  1 142 ? 92.936  167.310 32.516  1.00 28.35 ? 167 GLN A C   1 
ATOM   1154  O O   . GLN A  1 142 ? 92.455  167.310 31.371  1.00 28.63 ? 167 GLN A O   1 
ATOM   1155  C CB  . GLN A  1 142 ? 91.584  168.027 34.540  1.00 26.83 ? 167 GLN A CB  1 
ATOM   1156  C CG  . GLN A  1 142 ? 90.866  169.122 33.690  1.00 29.22 ? 167 GLN A CG  1 
ATOM   1157  C CD  . GLN A  1 142 ? 89.691  168.561 32.891  1.00 31.75 ? 167 GLN A CD  1 
ATOM   1158  O OE1 . GLN A  1 142 ? 89.090  167.542 33.263  1.00 30.47 ? 167 GLN A OE1 1 
ATOM   1159  N NE2 . GLN A  1 142 ? 89.363  169.215 31.789  1.00 32.35 ? 167 GLN A NE2 1 
ATOM   1160  N N   . LYS A  1 143 ? 94.185  167.681 32.771  1.00 28.69 ? 168 LYS A N   1 
ATOM   1161  C CA  . LYS A  1 143 ? 95.067  168.149 31.698  1.00 30.85 ? 168 LYS A CA  1 
ATOM   1162  C C   . LYS A  1 143 ? 95.297  167.039 30.668  1.00 31.69 ? 168 LYS A C   1 
ATOM   1163  O O   . LYS A  1 143 ? 95.225  167.274 29.457  1.00 32.69 ? 168 LYS A O   1 
ATOM   1164  C CB  . LYS A  1 143 ? 96.397  168.673 32.253  1.00 31.01 ? 168 LYS A CB  1 
ATOM   1165  C CG  . LYS A  1 143 ? 97.415  169.033 31.183  1.00 33.77 ? 168 LYS A CG  1 
ATOM   1166  C CD  . LYS A  1 143 ? 98.576  169.835 31.771  1.00 36.60 ? 168 LYS A CD  1 
ATOM   1167  C CE  . LYS A  1 143 ? 99.498  170.330 30.676  1.00 40.16 ? 168 LYS A CE  1 
ATOM   1168  N NZ  . LYS A  1 143 ? 100.479 171.319 31.212  1.00 42.79 ? 168 LYS A NZ  1 
ATOM   1169  N N   . ASP A  1 144 ? 95.544  165.826 31.146  1.00 31.07 ? 169 ASP A N   1 
ATOM   1170  C CA  . ASP A  1 144 ? 95.662  164.669 30.258  1.00 32.40 ? 169 ASP A CA  1 
ATOM   1171  C C   . ASP A  1 144 ? 94.410  164.481 29.383  1.00 33.39 ? 169 ASP A C   1 
ATOM   1172  O O   . ASP A  1 144 ? 94.510  164.188 28.187  1.00 34.39 ? 169 ASP A O   1 
ATOM   1173  C CB  . ASP A  1 144 ? 95.913  163.407 31.078  1.00 31.14 ? 169 ASP A CB  1 
ATOM   1174  C CG  . ASP A  1 144 ? 95.959  162.157 30.218  1.00 32.49 ? 169 ASP A CG  1 
ATOM   1175  O OD1 . ASP A  1 144 ? 96.891  162.039 29.391  1.00 32.87 ? 169 ASP A OD1 1 
ATOM   1176  O OD2 . ASP A  1 144 ? 95.064  161.296 30.378  1.00 32.24 ? 169 ASP A OD2 1 
ATOM   1177  N N   . PHE A  1 145 ? 93.238  164.661 29.981  1.00 33.20 ? 170 PHE A N   1 
ATOM   1178  C CA  . PHE A  1 145 ? 91.973  164.517 29.265  1.00 34.98 ? 170 PHE A CA  1 
ATOM   1179  C C   . PHE A  1 145 ? 91.904  165.451 28.055  1.00 37.48 ? 170 PHE A C   1 
ATOM   1180  O O   . PHE A  1 145 ? 91.648  165.011 26.932  1.00 38.15 ? 170 PHE A O   1 
ATOM   1181  C CB  . PHE A  1 145 ? 90.807  164.796 30.214  1.00 33.84 ? 170 PHE A CB  1 
ATOM   1182  C CG  . PHE A  1 145 ? 89.445  164.732 29.552  1.00 35.79 ? 170 PHE A CG  1 
ATOM   1183  C CD1 . PHE A  1 145 ? 89.081  163.635 28.777  1.00 34.90 ? 170 PHE A CD1 1 
ATOM   1184  C CD2 . PHE A  1 145 ? 88.522  165.763 29.725  1.00 36.97 ? 170 PHE A CD2 1 
ATOM   1185  C CE1 . PHE A  1 145 ? 87.819  163.569 28.178  1.00 37.07 ? 170 PHE A CE1 1 
ATOM   1186  C CE2 . PHE A  1 145 ? 87.255  165.704 29.122  1.00 37.97 ? 170 PHE A CE2 1 
ATOM   1187  C CZ  . PHE A  1 145 ? 86.909  164.603 28.349  1.00 37.84 ? 170 PHE A CZ  1 
ATOM   1188  N N   . THR A  1 146 ? 92.149  166.740 28.291  1.00 39.03 ? 171 THR A N   1 
ATOM   1189  C CA  . THR A  1 146 ? 92.064  167.762 27.236  1.00 41.82 ? 171 THR A CA  1 
ATOM   1190  C C   . THR A  1 146 ? 93.001  167.494 26.059  1.00 43.88 ? 171 THR A C   1 
ATOM   1191  O O   . THR A  1 146 ? 92.884  168.138 25.017  1.00 45.43 ? 171 THR A O   1 
ATOM   1192  C CB  . THR A  1 146 ? 92.341  169.206 27.781  1.00 42.48 ? 171 THR A CB  1 
ATOM   1193  O OG1 . THR A  1 146 ? 93.673  169.285 28.312  1.00 42.79 ? 171 THR A OG1 1 
ATOM   1194  C CG2 . THR A  1 146 ? 91.326  169.616 28.870  1.00 40.78 ? 171 THR A CG2 1 
ATOM   1195  N N   . LYS A  1 147 ? 93.938  166.563 26.216  1.00 44.51 ? 172 LYS A N   1 
ATOM   1196  C CA  . LYS A  1 147 ? 94.913  166.292 25.154  1.00 47.16 ? 172 LYS A CA  1 
ATOM   1197  C C   . LYS A  1 147 ? 94.766  164.895 24.584  1.00 47.79 ? 172 LYS A C   1 
ATOM   1198  O O   . LYS A  1 147 ? 95.562  164.461 23.760  1.00 49.22 ? 172 LYS A O   1 
ATOM   1199  C CB  . LYS A  1 147 ? 96.345  166.492 25.659  1.00 47.26 ? 172 LYS A CB  1 
ATOM   1200  C CG  . LYS A  1 147 ? 96.586  167.865 26.251  1.00 48.51 ? 172 LYS A CG  1 
ATOM   1201  C CD  . LYS A  1 147 ? 98.046  168.097 26.597  1.00 50.51 ? 172 LYS A CD  1 
ATOM   1202  C CE  . LYS A  1 147 ? 98.216  169.471 27.232  1.00 51.02 ? 172 LYS A CE  1 
ATOM   1203  N NZ  . LYS A  1 147 ? 99.643  169.918 27.299  1.00 52.33 ? 172 LYS A NZ  1 
ATOM   1204  N N   . SER A  1 148 ? 93.733  164.196 25.018  1.00 47.43 ? 173 SER A N   1 
ATOM   1205  C CA  . SER A  1 148 ? 93.563  162.807 24.650  1.00 47.96 ? 173 SER A CA  1 
ATOM   1206  C C   . SER A  1 148 ? 92.197  162.603 23.983  1.00 48.76 ? 173 SER A C   1 
ATOM   1207  O O   . SER A  1 148 ? 91.313  163.468 24.069  1.00 49.30 ? 173 SER A O   1 
ATOM   1208  C CB  . SER A  1 148 ? 93.732  161.936 25.902  1.00 46.16 ? 173 SER A CB  1 
ATOM   1209  O OG  . SER A  1 148 ? 93.195  160.637 25.728  1.00 47.28 ? 173 SER A OG  1 
ATOM   1210  N N   . THR A  1 149 ? 92.034  161.479 23.293  1.00 49.17 ? 174 THR A N   1 
ATOM   1211  C CA  . THR A  1 149 ? 90.755  161.150 22.676  1.00 49.43 ? 174 THR A CA  1 
ATOM   1212  C C   . THR A  1 149 ? 90.053  160.121 23.545  1.00 47.65 ? 174 THR A C   1 
ATOM   1213  O O   . THR A  1 149 ? 88.917  159.727 23.279  1.00 48.14 ? 174 THR A O   1 
ATOM   1214  C CB  . THR A  1 149 ? 90.917  160.611 21.229  1.00 51.51 ? 174 THR A CB  1 
ATOM   1215  O OG1 . THR A  1 149 ? 91.755  159.445 21.233  1.00 51.73 ? 174 THR A OG1 1 
ATOM   1216  C CG2 . THR A  1 149 ? 91.514  161.685 20.300  1.00 52.86 ? 174 THR A CG2 1 
ATOM   1217  N N   . LYS A  1 150 ? 90.742  159.688 24.595  1.00 45.35 ? 175 LYS A N   1 
ATOM   1218  C CA  . LYS A  1 150 ? 90.175  158.745 25.541  1.00 42.87 ? 175 LYS A CA  1 
ATOM   1219  C C   . LYS A  1 150 ? 89.452  159.478 26.673  1.00 40.76 ? 175 LYS A C   1 
ATOM   1220  O O   . LYS A  1 150 ? 89.580  160.699 26.835  1.00 40.98 ? 175 LYS A O   1 
ATOM   1221  C CB  . LYS A  1 150 ? 91.270  157.841 26.116  1.00 42.74 ? 175 LYS A CB  1 
ATOM   1222  C CG  . LYS A  1 150 ? 91.934  156.930 25.093  1.00 43.39 ? 175 LYS A CG  1 
ATOM   1223  C CD  . LYS A  1 150 ? 93.055  156.119 25.721  1.00 42.77 ? 175 LYS A CD  1 
ATOM   1224  C CE  . LYS A  1 150 ? 93.749  155.244 24.690  1.00 43.99 ? 175 LYS A CE  1 
ATOM   1225  N NZ  . LYS A  1 150 ? 94.864  154.460 25.288  1.00 43.48 ? 175 LYS A NZ  1 
ATOM   1226  N N   . GLU A  1 151 ? 88.684  158.733 27.447  1.00 37.93 ? 176 GLU A N   1 
ATOM   1227  C CA  . GLU A  1 151 ? 87.998  159.303 28.585  1.00 35.83 ? 176 GLU A CA  1 
ATOM   1228  C C   . GLU A  1 151 ? 88.974  159.731 29.685  1.00 33.00 ? 176 GLU A C   1 
ATOM   1229  O O   . GLU A  1 151 ? 90.084  159.204 29.798  1.00 32.04 ? 176 GLU A O   1 
ATOM   1230  C CB  . GLU A  1 151 ? 87.014  158.299 29.153  1.00 35.78 ? 176 GLU A CB  1 
ATOM   1231  C CG  . GLU A  1 151 ? 85.654  158.346 28.484  1.00 40.57 ? 176 GLU A CG  1 
ATOM   1232  C CD  . GLU A  1 151 ? 84.733  157.313 29.088  1.00 43.79 ? 176 GLU A CD  1 
ATOM   1233  O OE1 . GLU A  1 151 ? 84.870  156.132 28.704  1.00 46.81 ? 176 GLU A OE1 1 
ATOM   1234  O OE2 . GLU A  1 151 ? 83.910  157.662 29.972  1.00 44.77 ? 176 GLU A OE2 1 
ATOM   1235  N N   . ARG A  1 152 ? 88.547  160.690 30.496  1.00 30.47 ? 177 ARG A N   1 
ATOM   1236  C CA  . ARG A  1 152 ? 89.373  161.141 31.603  1.00 28.01 ? 177 ARG A CA  1 
ATOM   1237  C C   . ARG A  1 152 ? 89.587  159.997 32.597  1.00 25.07 ? 177 ARG A C   1 
ATOM   1238  O O   . ARG A  1 152 ? 88.651  159.279 32.959  1.00 24.36 ? 177 ARG A O   1 
ATOM   1239  C CB  . ARG A  1 152 ? 88.741  162.344 32.309  1.00 27.41 ? 177 ARG A CB  1 
ATOM   1240  C CG  . ARG A  1 152 ? 89.604  162.883 33.441  1.00 28.08 ? 177 ARG A CG  1 
ATOM   1241  C CD  . ARG A  1 152 ? 89.032  164.149 34.092  1.00 29.44 ? 177 ARG A CD  1 
ATOM   1242  N NE  . ARG A  1 152 ? 87.641  163.983 34.505  1.00 31.06 ? 177 ARG A NE  1 
ATOM   1243  C CZ  . ARG A  1 152 ? 87.239  163.228 35.530  1.00 31.89 ? 177 ARG A CZ  1 
ATOM   1244  N NH1 . ARG A  1 152 ? 88.112  162.521 36.236  1.00 31.15 ? 177 ARG A NH1 1 
ATOM   1245  N NH2 . ARG A  1 152 ? 85.947  163.157 35.839  1.00 33.35 ? 177 ARG A NH2 1 
ATOM   1246  N N   . LEU A  1 153 ? 90.819  159.852 33.054  1.00 23.17 ? 178 LEU A N   1 
ATOM   1247  C CA  . LEU A  1 153 ? 91.123  158.908 34.118  1.00 21.04 ? 178 LEU A CA  1 
ATOM   1248  C C   . LEU A  1 153 ? 90.342  159.306 35.366  1.00 20.27 ? 178 LEU A C   1 
ATOM   1249  O O   . LEU A  1 153 ? 90.272  160.480 35.723  1.00 18.86 ? 178 LEU A O   1 
ATOM   1250  C CB  . LEU A  1 153 ? 92.638  158.884 34.405  1.00 21.02 ? 178 LEU A CB  1 
ATOM   1251  C CG  . LEU A  1 153 ? 93.533  158.264 33.313  1.00 21.92 ? 178 LEU A CG  1 
ATOM   1252  C CD1 . LEU A  1 153 ? 95.010  158.566 33.527  1.00 21.13 ? 178 LEU A CD1 1 
ATOM   1253  C CD2 . LEU A  1 153 ? 93.295  156.747 33.219  1.00 20.75 ? 178 LEU A CD2 1 
ATOM   1254  N N   . LEU A  1 154 ? 89.730  158.323 36.012  1.00 19.01 ? 179 LEU A N   1 
ATOM   1255  C CA  . LEU A  1 154 ? 89.007  158.576 37.253  1.00 18.84 ? 179 LEU A CA  1 
ATOM   1256  C C   . LEU A  1 154 ? 89.969  158.680 38.434  1.00 17.52 ? 179 LEU A C   1 
ATOM   1257  O O   . LEU A  1 154 ? 91.016  158.047 38.442  1.00 17.27 ? 179 LEU A O   1 
ATOM   1258  C CB  . LEU A  1 154 ? 88.008  157.447 37.518  1.00 17.22 ? 179 LEU A CB  1 
ATOM   1259  C CG  . LEU A  1 154 ? 86.966  157.214 36.404  1.00 21.31 ? 179 LEU A CG  1 
ATOM   1260  C CD1 . LEU A  1 154 ? 86.229  155.898 36.649  1.00 21.23 ? 179 LEU A CD1 1 
ATOM   1261  C CD2 . LEU A  1 154 ? 85.978  158.387 36.265  1.00 23.40 ? 179 LEU A CD2 1 
ATOM   1262  N N   . LEU A  1 155 ? 89.582  159.438 39.451  1.00 17.32 ? 180 LEU A N   1 
ATOM   1263  C CA  . LEU A  1 155 ? 90.352  159.501 40.698  1.00 16.41 ? 180 LEU A CA  1 
ATOM   1264  C C   . LEU A  1 155 ? 89.426  159.326 41.880  1.00 16.25 ? 180 LEU A C   1 
ATOM   1265  O O   . LEU A  1 155 ? 88.486  160.105 42.054  1.00 16.47 ? 180 LEU A O   1 
ATOM   1266  C CB  . LEU A  1 155 ? 91.023  160.864 40.807  1.00 17.11 ? 180 LEU A CB  1 
ATOM   1267  C CG  . LEU A  1 155 ? 91.904  161.072 42.036  1.00 17.02 ? 180 LEU A CG  1 
ATOM   1268  C CD1 . LEU A  1 155 ? 93.067  160.108 41.979  1.00 17.50 ? 180 LEU A CD1 1 
ATOM   1269  C CD2 . LEU A  1 155 ? 92.394  162.554 42.016  1.00 18.95 ? 180 LEU A CD2 1 
ATOM   1270  N N   . THR A  1 156 ? 89.693  158.321 42.709  1.00 16.44 ? 181 THR A N   1 
ATOM   1271  C CA  . THR A  1 156 ? 88.826  158.048 43.836  1.00 15.87 ? 181 THR A CA  1 
ATOM   1272  C C   . THR A  1 156 ? 89.708  157.940 45.053  1.00 15.62 ? 181 THR A C   1 
ATOM   1273  O O   . THR A  1 156 ? 90.943  157.944 44.926  1.00 15.99 ? 181 THR A O   1 
ATOM   1274  C CB  . THR A  1 156 ? 88.026  156.729 43.632  1.00 15.52 ? 181 THR A CB  1 
ATOM   1275  O OG1 . THR A  1 156 ? 88.941  155.628 43.510  1.00 15.81 ? 181 THR A OG1 1 
ATOM   1276  C CG2 . THR A  1 156 ? 87.175  156.822 42.351  1.00 15.79 ? 181 THR A CG2 1 
ATOM   1277  N N   . ALA A  1 157 ? 89.082  157.852 46.225  1.00 14.68 ? 182 ALA A N   1 
ATOM   1278  C CA  . ALA A  1 157 ? 89.840  157.678 47.451  1.00 14.98 ? 182 ALA A CA  1 
ATOM   1279  C C   . ALA A  1 157 ? 89.040  156.829 48.443  1.00 14.02 ? 182 ALA A C   1 
ATOM   1280  O O   . ALA A  1 157 ? 87.885  157.114 48.716  1.00 14.94 ? 182 ALA A O   1 
ATOM   1281  C CB  . ALA A  1 157 ? 90.157  159.054 48.074  1.00 15.35 ? 182 ALA A CB  1 
ATOM   1282  N N   . GLY A  1 158 ? 89.659  155.808 48.995  1.00 14.32 ? 183 GLY A N   1 
ATOM   1283  C CA  . GLY A  1 158 ? 89.088  155.109 50.145  1.00 13.49 ? 183 GLY A CA  1 
ATOM   1284  C C   . GLY A  1 158 ? 89.366  155.953 51.388  1.00 13.94 ? 183 GLY A C   1 
ATOM   1285  O O   . GLY A  1 158 ? 90.525  156.260 51.688  1.00 14.72 ? 183 GLY A O   1 
ATOM   1286  N N   . VAL A  1 159 ? 88.320  156.320 52.130  1.00 12.82 ? 184 VAL A N   1 
ATOM   1287  C CA  . VAL A  1 159 ? 88.487  157.272 53.250  1.00 12.32 ? 184 VAL A CA  1 
ATOM   1288  C C   . VAL A  1 159 ? 87.885  156.743 54.562  1.00 12.42 ? 184 VAL A C   1 
ATOM   1289  O O   . VAL A  1 159 ? 86.956  155.955 54.534  1.00 12.59 ? 184 VAL A O   1 
ATOM   1290  C CB  . VAL A  1 159 ? 87.849  158.636 52.924  1.00 12.82 ? 184 VAL A CB  1 
ATOM   1291  C CG1 . VAL A  1 159 ? 88.562  159.286 51.719  1.00 13.13 ? 184 VAL A CG1 1 
ATOM   1292  C CG2 . VAL A  1 159 ? 86.328  158.457 52.597  1.00 11.57 ? 184 VAL A CG2 1 
ATOM   1293  N N   . SER A  1 160 ? 88.424  157.202 55.686  1.00 12.61 ? 185 SER A N   1 
ATOM   1294  C CA  . SER A  1 160 ? 87.948  156.815 57.019  1.00 13.62 ? 185 SER A CA  1 
ATOM   1295  C C   . SER A  1 160 ? 86.471  157.106 57.212  1.00 13.54 ? 185 SER A C   1 
ATOM   1296  O O   . SER A  1 160 ? 85.965  158.098 56.705  1.00 13.66 ? 185 SER A O   1 
ATOM   1297  C CB  . SER A  1 160 ? 88.740  157.564 58.092  1.00 13.43 ? 185 SER A CB  1 
ATOM   1298  O OG  . SER A  1 160 ? 88.259  157.297 59.402  1.00 14.76 ? 185 SER A OG  1 
ATOM   1299  N N   . ALA A  1 161 ? 85.810  156.249 57.986  1.00 13.40 ? 186 ALA A N   1 
ATOM   1300  C CA  . ALA A  1 161 ? 84.435  156.451 58.419  1.00 13.45 ? 186 ALA A CA  1 
ATOM   1301  C C   . ALA A  1 161 ? 84.355  156.867 59.895  1.00 14.75 ? 186 ALA A C   1 
ATOM   1302  O O   . ALA A  1 161 ? 83.268  156.923 60.453  1.00 14.95 ? 186 ALA A O   1 
ATOM   1303  C CB  . ALA A  1 161 ? 83.624  155.155 58.214  1.00 13.22 ? 186 ALA A CB  1 
ATOM   1304  N N   . GLY A  1 162 ? 85.506  157.139 60.507  1.00 14.89 ? 187 GLY A N   1 
ATOM   1305  C CA  . GLY A  1 162 ? 85.587  157.527 61.910  1.00 15.28 ? 187 GLY A CA  1 
ATOM   1306  C C   . GLY A  1 162 ? 85.651  159.031 62.064  1.00 17.01 ? 187 GLY A C   1 
ATOM   1307  O O   . GLY A  1 162 ? 86.589  159.687 61.588  1.00 16.07 ? 187 GLY A O   1 
ATOM   1308  N N   . ARG A  1 163 ? 84.675  159.578 62.777  1.00 17.21 ? 188 ARG A N   1 
ATOM   1309  C CA  . ARG A  1 163 ? 84.581  161.019 62.893  1.00 18.72 ? 188 ARG A CA  1 
ATOM   1310  C C   . ARG A  1 163 ? 85.895  161.710 63.231  1.00 18.85 ? 188 ARG A C   1 
ATOM   1311  O O   . ARG A  1 163 ? 86.250  162.678 62.576  1.00 18.76 ? 188 ARG A O   1 
ATOM   1312  C CB  . ARG A  1 163 ? 83.517  161.437 63.902  1.00 19.72 ? 188 ARG A CB  1 
ATOM   1313  C CG  . ARG A  1 163 ? 83.564  162.928 64.113  1.00 21.57 ? 188 ARG A CG  1 
ATOM   1314  C CD  . ARG A  1 163 ? 82.340  163.501 64.714  1.00 27.00 ? 188 ARG A CD  1 
ATOM   1315  N NE  . ARG A  1 163 ? 82.520  164.953 64.855  1.00 29.31 ? 188 ARG A NE  1 
ATOM   1316  C CZ  . ARG A  1 163 ? 81.614  165.746 65.398  1.00 31.86 ? 188 ARG A CZ  1 
ATOM   1317  N NH1 . ARG A  1 163 ? 80.494  165.222 65.860  1.00 32.91 ? 188 ARG A NH1 1 
ATOM   1318  N NH2 . ARG A  1 163 ? 81.828  167.049 65.497  1.00 32.16 ? 188 ARG A NH2 1 
ATOM   1319  N N   . GLN A  1 164 ? 86.603  161.256 64.271  1.00 19.52 ? 189 GLN A N   1 
ATOM   1320  C CA  . GLN A  1 164 ? 87.851  161.920 64.641  1.00 20.39 ? 189 GLN A CA  1 
ATOM   1321  C C   . GLN A  1 164 ? 88.885  161.886 63.508  1.00 19.11 ? 189 GLN A C   1 
ATOM   1322  O O   . GLN A  1 164 ? 89.518  162.888 63.230  1.00 18.90 ? 189 GLN A O   1 
ATOM   1323  C CB  . GLN A  1 164 ? 88.474  161.342 65.926  1.00 21.93 ? 189 GLN A CB  1 
ATOM   1324  C CG  . GLN A  1 164 ? 89.673  162.184 66.446  1.00 26.07 ? 189 GLN A CG  1 
ATOM   1325  C CD  . GLN A  1 164 ? 89.274  163.623 66.830  1.00 33.46 ? 189 GLN A CD  1 
ATOM   1326  O OE1 . GLN A  1 164 ? 89.628  164.608 66.147  1.00 35.27 ? 189 GLN A OE1 1 
ATOM   1327  N NE2 . GLN A  1 164 ? 88.548  163.750 67.938  1.00 35.07 ? 189 GLN A NE2 1 
ATOM   1328  N N   . MET A  1 165 ? 89.051  160.746 62.854  1.00 17.45 ? 190 MET A N   1 
ATOM   1329  C CA  . MET A  1 165 ? 90.062  160.647 61.794  1.00 16.78 ? 190 MET A CA  1 
ATOM   1330  C C   . MET A  1 165 ? 89.658  161.467 60.559  1.00 16.72 ? 190 MET A C   1 
ATOM   1331  O O   . MET A  1 165 ? 90.533  162.008 59.863  1.00 16.71 ? 190 MET A O   1 
ATOM   1332  C CB  . MET A  1 165 ? 90.280  159.195 61.404  1.00 15.73 ? 190 MET A CB  1 
ATOM   1333  C CG  . MET A  1 165 ? 91.442  158.966 60.485  1.00 15.67 ? 190 MET A CG  1 
ATOM   1334  S SD  . MET A  1 165 ? 93.016  159.587 61.107  1.00 18.38 ? 190 MET A SD  1 
ATOM   1335  C CE  . MET A  1 165 ? 93.351  158.540 62.545  1.00 21.44 ? 190 MET A CE  1 
ATOM   1336  N N   . ILE A  1 166 ? 88.351  161.537 60.284  1.00 15.71 ? 191 ILE A N   1 
ATOM   1337  C CA  . ILE A  1 166 ? 87.821  162.394 59.221  1.00 16.00 ? 191 ILE A CA  1 
ATOM   1338  C C   . ILE A  1 166 ? 88.156  163.864 59.490  1.00 17.37 ? 191 ILE A C   1 
ATOM   1339  O O   . ILE A  1 166 ? 88.728  164.555 58.616  1.00 17.00 ? 191 ILE A O   1 
ATOM   1340  C CB  . ILE A  1 166 ? 86.280  162.251 59.087  1.00 15.78 ? 191 ILE A CB  1 
ATOM   1341  C CG1 . ILE A  1 166 ? 85.909  160.830 58.614  1.00 14.74 ? 191 ILE A CG1 1 
ATOM   1342  C CG2 . ILE A  1 166 ? 85.710  163.305 58.128  1.00 14.97 ? 191 ILE A CG2 1 
ATOM   1343  C CD1 . ILE A  1 166 ? 84.405  160.498 58.881  1.00 14.45 ? 191 ILE A CD1 1 
ATOM   1344  N N   . ASP A  1 167 ? 87.805  164.349 60.686  1.00 17.85 ? 192 ASP A N   1 
ATOM   1345  C CA  . ASP A  1 167 ? 88.134  165.730 61.077  1.00 19.73 ? 192 ASP A CA  1 
ATOM   1346  C C   . ASP A  1 167 ? 89.643  165.989 60.945  1.00 19.66 ? 192 ASP A C   1 
ATOM   1347  O O   . ASP A  1 167 ? 90.044  167.050 60.487  1.00 19.17 ? 192 ASP A O   1 
ATOM   1348  C CB  . ASP A  1 167 ? 87.712  166.037 62.521  1.00 20.39 ? 192 ASP A CB  1 
ATOM   1349  C CG  . ASP A  1 167 ? 86.195  166.151 62.676  1.00 23.61 ? 192 ASP A CG  1 
ATOM   1350  O OD1 . ASP A  1 167 ? 85.497  166.328 61.656  1.00 23.96 ? 192 ASP A OD1 1 
ATOM   1351  O OD2 . ASP A  1 167 ? 85.707  166.061 63.819  1.00 24.94 ? 192 ASP A OD2 1 
ATOM   1352  N N   . ASN A  1 168 ? 90.459  165.031 61.374  1.00 19.30 ? 193 ASN A N   1 
ATOM   1353  C CA  . ASN A  1 168 ? 91.929  165.175 61.309  1.00 19.88 ? 193 ASN A CA  1 
ATOM   1354  C C   . ASN A  1 168 ? 92.532  165.182 59.884  1.00 18.59 ? 193 ASN A C   1 
ATOM   1355  O O   . ASN A  1 168 ? 93.393  166.006 59.573  1.00 18.64 ? 193 ASN A O   1 
ATOM   1356  C CB  . ASN A  1 168 ? 92.613  164.078 62.128  1.00 20.32 ? 193 ASN A CB  1 
ATOM   1357  C CG  . ASN A  1 168 ? 92.466  164.277 63.622  1.00 23.55 ? 193 ASN A CG  1 
ATOM   1358  O OD1 . ASN A  1 168 ? 91.914  165.271 64.080  1.00 25.05 ? 193 ASN A OD1 1 
ATOM   1359  N ND2 . ASN A  1 168 ? 92.981  163.327 64.391  1.00 25.57 ? 193 ASN A ND2 1 
ATOM   1360  N N   . SER A  1 169 ? 92.070  164.266 59.039  1.00 17.22 ? 194 SER A N   1 
ATOM   1361  C CA  . SER A  1 169 ? 92.773  163.895 57.817  1.00 16.57 ? 194 SER A CA  1 
ATOM   1362  C C   . SER A  1 169 ? 92.422  164.712 56.569  1.00 16.97 ? 194 SER A C   1 
ATOM   1363  O O   . SER A  1 169 ? 93.252  164.856 55.670  1.00 16.01 ? 194 SER A O   1 
ATOM   1364  C CB  . SER A  1 169 ? 92.472  162.419 57.481  1.00 15.32 ? 194 SER A CB  1 
ATOM   1365  O OG  . SER A  1 169 ? 92.898  161.529 58.514  1.00 16.02 ? 194 SER A OG  1 
ATOM   1366  N N   . TYR A  1 170 ? 91.171  165.170 56.480  1.00 16.79 ? 195 TYR A N   1 
ATOM   1367  C CA  . TYR A  1 170 ? 90.616  165.560 55.179  1.00 16.56 ? 195 TYR A CA  1 
ATOM   1368  C C   . TYR A  1 170 ? 90.133  167.012 55.106  1.00 16.95 ? 195 TYR A C   1 
ATOM   1369  O O   . TYR A  1 170 ? 89.535  167.528 56.050  1.00 16.71 ? 195 TYR A O   1 
ATOM   1370  C CB  . TYR A  1 170 ? 89.446  164.653 54.833  1.00 16.02 ? 195 TYR A CB  1 
ATOM   1371  C CG  . TYR A  1 170 ? 89.770  163.171 54.892  1.00 16.11 ? 195 TYR A CG  1 
ATOM   1372  C CD1 . TYR A  1 170 ? 90.816  162.636 54.141  1.00 14.40 ? 195 TYR A CD1 1 
ATOM   1373  C CD2 . TYR A  1 170 ? 89.027  162.314 55.693  1.00 13.41 ? 195 TYR A CD2 1 
ATOM   1374  C CE1 . TYR A  1 170 ? 91.113  161.277 54.198  1.00 13.67 ? 195 TYR A CE1 1 
ATOM   1375  C CE2 . TYR A  1 170 ? 89.296  160.967 55.740  1.00 15.58 ? 195 TYR A CE2 1 
ATOM   1376  C CZ  . TYR A  1 170 ? 90.359  160.454 55.004  1.00 15.20 ? 195 TYR A CZ  1 
ATOM   1377  O OH  . TYR A  1 170 ? 90.640  159.110 55.074  1.00 13.80 ? 195 TYR A OH  1 
ATOM   1378  N N   . GLN A  1 171 ? 90.354  167.636 53.953  1.00 16.92 ? 196 GLN A N   1 
ATOM   1379  C CA  . GLN A  1 171 ? 89.718  168.917 53.623  1.00 17.43 ? 196 GLN A CA  1 
ATOM   1380  C C   . GLN A  1 171 ? 88.545  168.593 52.687  1.00 17.85 ? 196 GLN A C   1 
ATOM   1381  O O   . GLN A  1 171 ? 88.697  168.437 51.454  1.00 17.82 ? 196 GLN A O   1 
ATOM   1382  C CB  . GLN A  1 171 ? 90.755  169.881 53.007  1.00 18.65 ? 196 GLN A CB  1 
ATOM   1383  C CG  . GLN A  1 171 ? 91.951  170.110 53.962  1.00 17.92 ? 196 GLN A CG  1 
ATOM   1384  C CD  . GLN A  1 171 ? 92.969  171.140 53.478  1.00 20.18 ? 196 GLN A CD  1 
ATOM   1385  O OE1 . GLN A  1 171 ? 92.616  172.120 52.832  1.00 19.74 ? 196 GLN A OE1 1 
ATOM   1386  N NE2 . GLN A  1 171 ? 94.250  170.918 53.812  1.00 18.75 ? 196 GLN A NE2 1 
ATOM   1387  N N   . VAL A  1 172 ? 87.382  168.404 53.285  1.00 17.27 ? 197 VAL A N   1 
ATOM   1388  C CA  . VAL A  1 172 ? 86.312  167.673 52.585  1.00 17.41 ? 197 VAL A CA  1 
ATOM   1389  C C   . VAL A  1 172 ? 85.719  168.400 51.364  1.00 18.10 ? 197 VAL A C   1 
ATOM   1390  O O   . VAL A  1 172 ? 85.521  167.784 50.308  1.00 18.11 ? 197 VAL A O   1 
ATOM   1391  C CB  . VAL A  1 172 ? 85.191  167.253 53.568  1.00 17.64 ? 197 VAL A CB  1 
ATOM   1392  C CG1 . VAL A  1 172 ? 84.072  166.536 52.823  1.00 16.24 ? 197 VAL A CG1 1 
ATOM   1393  C CG2 . VAL A  1 172 ? 85.775  166.389 54.697  1.00 16.01 ? 197 VAL A CG2 1 
ATOM   1394  N N   . GLU A  1 173 ? 85.441  169.694 51.492  1.00 19.53 ? 198 GLU A N   1 
ATOM   1395  C CA  . GLU A  1 173 ? 84.878  170.426 50.355  1.00 21.89 ? 198 GLU A CA  1 
ATOM   1396  C C   . GLU A  1 173 ? 85.826  170.400 49.166  1.00 22.53 ? 198 GLU A C   1 
ATOM   1397  O O   . GLU A  1 173 ? 85.394  170.263 48.013  1.00 22.37 ? 198 GLU A O   1 
ATOM   1398  C CB  . GLU A  1 173 ? 84.515  171.858 50.750  1.00 24.07 ? 198 GLU A CB  1 
ATOM   1399  C CG  . GLU A  1 173 ? 83.381  171.862 51.758  1.00 26.96 ? 198 GLU A CG  1 
ATOM   1400  C CD  . GLU A  1 173 ? 83.110  173.237 52.340  1.00 35.17 ? 198 GLU A CD  1 
ATOM   1401  O OE1 . GLU A  1 173 ? 83.908  173.718 53.178  1.00 38.23 ? 198 GLU A OE1 1 
ATOM   1402  O OE2 . GLU A  1 173 ? 82.092  173.832 51.964  1.00 36.62 ? 198 GLU A OE2 1 
ATOM   1403  N N   . LYS A  1 174 ? 87.123  170.500 49.451  1.00 21.95 ? 199 LYS A N   1 
ATOM   1404  C CA  . LYS A  1 174 ? 88.129  170.404 48.414  1.00 22.48 ? 199 LYS A CA  1 
ATOM   1405  C C   . LYS A  1 174 ? 88.173  169.019 47.779  1.00 21.18 ? 199 LYS A C   1 
ATOM   1406  O O   . LYS A  1 174 ? 88.312  168.876 46.557  1.00 20.78 ? 199 LYS A O   1 
ATOM   1407  C CB  . LYS A  1 174 ? 89.489  170.701 49.024  1.00 22.93 ? 199 LYS A CB  1 
ATOM   1408  C CG  . LYS A  1 174 ? 90.508  171.227 48.059  1.00 25.56 ? 199 LYS A CG  1 
ATOM   1409  C CD  . LYS A  1 174 ? 91.722  171.761 48.852  1.00 28.15 ? 199 LYS A CD  1 
ATOM   1410  C CE  . LYS A  1 174 ? 92.970  171.729 47.972  1.00 30.06 ? 199 LYS A CE  1 
ATOM   1411  N NZ  . LYS A  1 174 ? 92.851  172.799 46.941  1.00 29.81 ? 199 LYS A NZ  1 
ATOM   1412  N N   . LEU A  1 175 ? 88.109  167.993 48.625  1.00 20.24 ? 200 LEU A N   1 
ATOM   1413  C CA  . LEU A  1 175 ? 88.039  166.615 48.180  1.00 19.99 ? 200 LEU A CA  1 
ATOM   1414  C C   . LEU A  1 175 ? 86.838  166.380 47.247  1.00 19.65 ? 200 LEU A C   1 
ATOM   1415  O O   . LEU A  1 175 ? 86.953  165.668 46.263  1.00 20.16 ? 200 LEU A O   1 
ATOM   1416  C CB  . LEU A  1 175 ? 87.926  165.698 49.404  1.00 18.99 ? 200 LEU A CB  1 
ATOM   1417  C CG  . LEU A  1 175 ? 88.715  164.415 49.507  1.00 22.05 ? 200 LEU A CG  1 
ATOM   1418  C CD1 . LEU A  1 175 ? 90.178  164.580 49.030  1.00 19.64 ? 200 LEU A CD1 1 
ATOM   1419  C CD2 . LEU A  1 175 ? 88.653  163.808 50.928  1.00 20.10 ? 200 LEU A CD2 1 
ATOM   1420  N N   . ALA A  1 176 ? 85.695  166.973 47.575  1.00 19.99 ? 201 ALA A N   1 
ATOM   1421  C CA  . ALA A  1 176 ? 84.476  166.862 46.756  1.00 21.09 ? 201 ALA A CA  1 
ATOM   1422  C C   . ALA A  1 176 ? 84.661  167.385 45.329  1.00 22.55 ? 201 ALA A C   1 
ATOM   1423  O O   . ALA A  1 176 ? 83.995  166.929 44.392  1.00 23.22 ? 201 ALA A O   1 
ATOM   1424  C CB  . ALA A  1 176 ? 83.319  167.590 47.418  1.00 21.53 ? 201 ALA A CB  1 
ATOM   1425  N N   . LYS A  1 177 ? 85.539  168.359 45.159  1.00 22.90 ? 202 LYS A N   1 
ATOM   1426  C CA  . LYS A  1 177 ? 85.774  168.914 43.838  1.00 23.91 ? 202 LYS A CA  1 
ATOM   1427  C C   . LYS A  1 177 ? 86.813  168.128 43.069  1.00 23.20 ? 202 LYS A C   1 
ATOM   1428  O O   . LYS A  1 177 ? 86.745  168.027 41.862  1.00 23.96 ? 202 LYS A O   1 
ATOM   1429  C CB  . LYS A  1 177 ? 86.235  170.359 43.962  1.00 25.34 ? 202 LYS A CB  1 
ATOM   1430  C CG  . LYS A  1 177 ? 85.136  171.301 44.395  1.00 29.00 ? 202 LYS A CG  1 
ATOM   1431  C CD  . LYS A  1 177 ? 85.386  172.664 43.774  1.00 36.03 ? 202 LYS A CD  1 
ATOM   1432  C CE  . LYS A  1 177 ? 85.657  172.479 42.269  1.00 38.03 ? 202 LYS A CE  1 
ATOM   1433  N NZ  . LYS A  1 177 ? 86.147  173.708 41.602  1.00 40.98 ? 202 LYS A NZ  1 
ATOM   1434  N N   . ASP A  1 178 ? 87.786  167.567 43.776  1.00 22.04 ? 203 ASP A N   1 
ATOM   1435  C CA  . ASP A  1 178 ? 88.897  166.881 43.117  1.00 21.56 ? 203 ASP A CA  1 
ATOM   1436  C C   . ASP A  1 178 ? 88.569  165.409 42.826  1.00 20.85 ? 203 ASP A C   1 
ATOM   1437  O O   . ASP A  1 178 ? 89.135  164.831 41.900  1.00 20.67 ? 203 ASP A O   1 
ATOM   1438  C CB  . ASP A  1 178 ? 90.177  166.973 43.977  1.00 20.75 ? 203 ASP A CB  1 
ATOM   1439  C CG  . ASP A  1 178 ? 90.755  168.399 44.043  1.00 23.61 ? 203 ASP A CG  1 
ATOM   1440  O OD1 . ASP A  1 178 ? 90.422  169.235 43.181  1.00 26.13 ? 203 ASP A OD1 1 
ATOM   1441  O OD2 . ASP A  1 178 ? 91.538  168.699 44.962  1.00 23.12 ? 203 ASP A OD2 1 
ATOM   1442  N N   . LEU A  1 179 ? 87.669  164.791 43.612  1.00 19.61 ? 204 LEU A N   1 
ATOM   1443  C CA  . LEU A  1 179 ? 87.416  163.350 43.447  1.00 18.70 ? 204 LEU A CA  1 
ATOM   1444  C C   . LEU A  1 179 ? 86.208  163.053 42.604  1.00 19.14 ? 204 LEU A C   1 
ATOM   1445  O O   . LEU A  1 179 ? 85.215  163.782 42.642  1.00 19.30 ? 204 LEU A O   1 
ATOM   1446  C CB  . LEU A  1 179 ? 87.250  162.613 44.786  1.00 17.24 ? 204 LEU A CB  1 
ATOM   1447  C CG  . LEU A  1 179 ? 88.471  162.613 45.707  1.00 17.45 ? 204 LEU A CG  1 
ATOM   1448  C CD1 . LEU A  1 179 ? 88.129  161.886 47.027  1.00 16.13 ? 204 LEU A CD1 1 
ATOM   1449  C CD2 . LEU A  1 179 ? 89.673  161.970 45.022  1.00 16.27 ? 204 LEU A CD2 1 
ATOM   1450  N N   . ASP A  1 180 ? 86.274  161.951 41.860  1.00 18.54 ? 205 ASP A N   1 
ATOM   1451  C CA  . ASP A  1 180 ? 85.061  161.470 41.206  1.00 18.54 ? 205 ASP A CA  1 
ATOM   1452  C C   . ASP A  1 180 ? 84.078  160.900 42.225  1.00 17.95 ? 205 ASP A C   1 
ATOM   1453  O O   . ASP A  1 180 ? 82.879  161.123 42.132  1.00 17.81 ? 205 ASP A O   1 
ATOM   1454  C CB  . ASP A  1 180 ? 85.423  160.477 40.113  1.00 18.35 ? 205 ASP A CB  1 
ATOM   1455  C CG  . ASP A  1 180 ? 86.048  161.179 38.935  1.00 21.14 ? 205 ASP A CG  1 
ATOM   1456  O OD1 . ASP A  1 180 ? 85.287  161.874 38.231  1.00 21.76 ? 205 ASP A OD1 1 
ATOM   1457  O OD2 . ASP A  1 180 ? 87.290  161.106 38.751  1.00 19.51 ? 205 ASP A OD2 1 
ATOM   1458  N N   . PHE A  1 181 ? 84.602  160.165 43.200  1.00 16.48 ? 206 PHE A N   1 
ATOM   1459  C CA  . PHE A  1 181 ? 83.820  159.704 44.345  1.00 16.61 ? 206 PHE A CA  1 
ATOM   1460  C C   . PHE A  1 181 ? 84.721  159.230 45.475  1.00 15.51 ? 206 PHE A C   1 
ATOM   1461  O O   . PHE A  1 181 ? 85.904  158.962 45.262  1.00 15.23 ? 206 PHE A O   1 
ATOM   1462  C CB  . PHE A  1 181 ? 82.768  158.623 43.979  1.00 15.76 ? 206 PHE A CB  1 
ATOM   1463  C CG  . PHE A  1 181 ? 83.314  157.397 43.243  1.00 17.46 ? 206 PHE A CG  1 
ATOM   1464  C CD1 . PHE A  1 181 ? 83.773  156.280 43.937  1.00 14.95 ? 206 PHE A CD1 1 
ATOM   1465  C CD2 . PHE A  1 181 ? 83.266  157.331 41.852  1.00 17.93 ? 206 PHE A CD2 1 
ATOM   1466  C CE1 . PHE A  1 181 ? 84.203  155.134 43.247  1.00 17.06 ? 206 PHE A CE1 1 
ATOM   1467  C CE2 . PHE A  1 181 ? 83.705  156.207 41.169  1.00 18.61 ? 206 PHE A CE2 1 
ATOM   1468  C CZ  . PHE A  1 181 ? 84.169  155.114 41.856  1.00 17.50 ? 206 PHE A CZ  1 
ATOM   1469  N N   . ILE A  1 182 ? 84.146  159.124 46.674  1.00 14.94 ? 207 ILE A N   1 
ATOM   1470  C CA  . ILE A  1 182 ? 84.819  158.454 47.778  1.00 14.30 ? 207 ILE A CA  1 
ATOM   1471  C C   . ILE A  1 182 ? 84.280  157.023 47.940  1.00 13.91 ? 207 ILE A C   1 
ATOM   1472  O O   . ILE A  1 182 ? 83.081  156.760 47.757  1.00 14.89 ? 207 ILE A O   1 
ATOM   1473  C CB  . ILE A  1 182 ? 84.691  159.207 49.154  1.00 14.25 ? 207 ILE A CB  1 
ATOM   1474  C CG1 . ILE A  1 182 ? 83.216  159.414 49.572  1.00 13.35 ? 207 ILE A CG1 1 
ATOM   1475  C CG2 . ILE A  1 182 ? 85.426  160.537 49.125  1.00 14.10 ? 207 ILE A CG2 1 
ATOM   1476  C CD1 . ILE A  1 182 ? 83.114  159.728 51.085  1.00 15.37 ? 207 ILE A CD1 1 
ATOM   1477  N N   . ASN A  1 183 ? 85.204  156.124 48.234  1.00 13.71 ? 208 ASN A N   1 
ATOM   1478  C CA  . ASN A  1 183 ? 84.951  154.753 48.696  1.00 13.10 ? 208 ASN A CA  1 
ATOM   1479  C C   . ASN A  1 183 ? 85.025  154.809 50.220  1.00 12.70 ? 208 ASN A C   1 
ATOM   1480  O O   . ASN A  1 183 ? 86.108  154.736 50.819  1.00 12.04 ? 208 ASN A O   1 
ATOM   1481  C CB  . ASN A  1 183 ? 86.023  153.817 48.146  1.00 13.32 ? 208 ASN A CB  1 
ATOM   1482  C CG  . ASN A  1 183 ? 85.926  153.669 46.644  1.00 15.12 ? 208 ASN A CG  1 
ATOM   1483  O OD1 . ASN A  1 183 ? 86.910  153.891 45.912  1.00 19.33 ? 208 ASN A OD1 1 
ATOM   1484  N ND2 . ASN A  1 183 ? 84.735  153.359 46.163  1.00 10.70 ? 208 ASN A ND2 1 
ATOM   1485  N N   . LEU A  1 184 ? 83.857  154.984 50.841  1.00 12.65 ? 209 LEU A N   1 
ATOM   1486  C CA  . LEU A  1 184 ? 83.763  155.222 52.274  1.00 12.49 ? 209 LEU A CA  1 
ATOM   1487  C C   . LEU A  1 184 ? 84.002  153.893 52.965  1.00 12.18 ? 209 LEU A C   1 
ATOM   1488  O O   . LEU A  1 184 ? 83.279  152.913 52.720  1.00 12.70 ? 209 LEU A O   1 
ATOM   1489  C CB  . LEU A  1 184 ? 82.361  155.754 52.633  1.00 12.80 ? 209 LEU A CB  1 
ATOM   1490  C CG  . LEU A  1 184 ? 82.081  155.887 54.145  1.00 13.64 ? 209 LEU A CG  1 
ATOM   1491  C CD1 . LEU A  1 184 ? 83.056  156.867 54.766  1.00 12.74 ? 209 LEU A CD1 1 
ATOM   1492  C CD2 . LEU A  1 184 ? 80.638  156.320 54.390  1.00 13.78 ? 209 LEU A CD2 1 
ATOM   1493  N N   . LEU A  1 185 ? 85.034  153.845 53.801  1.00 11.73 ? 210 LEU A N   1 
ATOM   1494  C CA  . LEU A  1 185 ? 85.426  152.593 54.462  1.00 11.75 ? 210 LEU A CA  1 
ATOM   1495  C C   . LEU A  1 185 ? 84.564  152.380 55.721  1.00 11.83 ? 210 LEU A C   1 
ATOM   1496  O O   . LEU A  1 185 ? 85.076  152.402 56.861  1.00 12.24 ? 210 LEU A O   1 
ATOM   1497  C CB  . LEU A  1 185 ? 86.932  152.627 54.763  1.00 11.51 ? 210 LEU A CB  1 
ATOM   1498  C CG  . LEU A  1 185 ? 87.774  152.876 53.499  1.00 12.04 ? 210 LEU A CG  1 
ATOM   1499  C CD1 . LEU A  1 185 ? 89.264  153.170 53.860  1.00 13.35 ? 210 LEU A CD1 1 
ATOM   1500  C CD2 . LEU A  1 185 ? 87.688  151.656 52.545  1.00 12.00 ? 210 LEU A CD2 1 
ATOM   1501  N N   . SER A  1 186 ? 83.250  152.188 55.497  1.00 11.98 ? 211 SER A N   1 
ATOM   1502  C CA  . SER A  1 186 ? 82.288  152.084 56.582  1.00 12.47 ? 211 SER A CA  1 
ATOM   1503  C C   . SER A  1 186 ? 82.212  150.667 57.178  1.00 13.02 ? 211 SER A C   1 
ATOM   1504  O O   . SER A  1 186 ? 81.180  149.949 57.090  1.00 12.88 ? 211 SER A O   1 
ATOM   1505  C CB  . SER A  1 186 ? 80.904  152.612 56.142  1.00 12.46 ? 211 SER A CB  1 
ATOM   1506  O OG  . SER A  1 186 ? 80.675  152.359 54.749  1.00 10.54 ? 211 SER A OG  1 
ATOM   1507  N N   . PHE A  1 187 ? 83.330  150.291 57.800  1.00 13.30 ? 212 PHE A N   1 
ATOM   1508  C CA  . PHE A  1 187 ? 83.490  149.016 58.498  1.00 13.33 ? 212 PHE A CA  1 
ATOM   1509  C C   . PHE A  1 187 ? 84.719  149.189 59.402  1.00 13.78 ? 212 PHE A C   1 
ATOM   1510  O O   . PHE A  1 187 ? 85.261  150.298 59.507  1.00 14.28 ? 212 PHE A O   1 
ATOM   1511  C CB  . PHE A  1 187 ? 83.611  147.826 57.497  1.00 12.73 ? 212 PHE A CB  1 
ATOM   1512  C CG  . PHE A  1 187 ? 84.368  148.170 56.201  1.00 13.26 ? 212 PHE A CG  1 
ATOM   1513  C CD1 . PHE A  1 187 ? 85.737  148.384 56.224  1.00 13.25 ? 212 PHE A CD1 1 
ATOM   1514  C CD2 . PHE A  1 187 ? 83.703  148.262 54.971  1.00 12.66 ? 212 PHE A CD2 1 
ATOM   1515  C CE1 . PHE A  1 187 ? 86.445  148.710 55.038  1.00 12.60 ? 212 PHE A CE1 1 
ATOM   1516  C CE2 . PHE A  1 187 ? 84.409  148.596 53.773  1.00 12.16 ? 212 PHE A CE2 1 
ATOM   1517  C CZ  . PHE A  1 187 ? 85.784  148.812 53.815  1.00 12.60 ? 212 PHE A CZ  1 
ATOM   1518  N N   . ASP A  1 188 ? 85.142  148.128 60.081  1.00 13.24 ? 213 ASP A N   1 
ATOM   1519  C CA  . ASP A  1 188 ? 86.116  148.269 61.152  1.00 13.93 ? 213 ASP A CA  1 
ATOM   1520  C C   . ASP A  1 188 ? 85.664  149.296 62.191  1.00 14.32 ? 213 ASP A C   1 
ATOM   1521  O O   . ASP A  1 188 ? 86.486  150.002 62.756  1.00 14.01 ? 213 ASP A O   1 
ATOM   1522  C CB  . ASP A  1 188 ? 87.512  148.591 60.596  1.00 13.97 ? 213 ASP A CB  1 
ATOM   1523  C CG  . ASP A  1 188 ? 87.983  147.546 59.594  1.00 14.52 ? 213 ASP A CG  1 
ATOM   1524  O OD1 . ASP A  1 188 ? 87.785  146.344 59.863  1.00 16.02 ? 213 ASP A OD1 1 
ATOM   1525  O OD2 . ASP A  1 188 ? 88.532  147.921 58.540  1.00 14.51 ? 213 ASP A OD2 1 
ATOM   1526  N N   . PHE A  1 189 ? 84.353  149.392 62.457  1.00 14.42 ? 214 PHE A N   1 
ATOM   1527  C CA  . PHE A  1 189 ? 83.899  150.321 63.505  1.00 15.06 ? 214 PHE A CA  1 
ATOM   1528  C C   . PHE A  1 189 ? 84.275  149.793 64.892  1.00 16.65 ? 214 PHE A C   1 
ATOM   1529  O O   . PHE A  1 189 ? 84.479  150.573 65.840  1.00 16.68 ? 214 PHE A O   1 
ATOM   1530  C CB  . PHE A  1 189 ? 82.384  150.548 63.420  1.00 15.32 ? 214 PHE A CB  1 
ATOM   1531  C CG  . PHE A  1 189 ? 81.978  151.492 62.330  1.00 14.22 ? 214 PHE A CG  1 
ATOM   1532  C CD1 . PHE A  1 189 ? 82.256  152.854 62.439  1.00 13.87 ? 214 PHE A CD1 1 
ATOM   1533  C CD2 . PHE A  1 189 ? 81.327  151.026 61.201  1.00 13.63 ? 214 PHE A CD2 1 
ATOM   1534  C CE1 . PHE A  1 189 ? 81.883  153.746 61.425  1.00 14.13 ? 214 PHE A CE1 1 
ATOM   1535  C CE2 . PHE A  1 189 ? 80.940  151.919 60.178  1.00 16.08 ? 214 PHE A CE2 1 
ATOM   1536  C CZ  . PHE A  1 189 ? 81.218  153.282 60.303  1.00 14.77 ? 214 PHE A CZ  1 
ATOM   1537  N N   . HIS A  1 190 ? 84.370  148.463 64.986  1.00 15.79 ? 215 HIS A N   1 
ATOM   1538  C CA  . HIS A  1 190 ? 84.746  147.794 66.214  1.00 17.78 ? 215 HIS A CA  1 
ATOM   1539  C C   . HIS A  1 190 ? 85.636  146.595 65.870  1.00 18.04 ? 215 HIS A C   1 
ATOM   1540  O O   . HIS A  1 190 ? 85.499  145.977 64.806  1.00 17.60 ? 215 HIS A O   1 
ATOM   1541  C CB  . HIS A  1 190 ? 83.517  147.351 67.019  1.00 16.92 ? 215 HIS A CB  1 
ATOM   1542  C CG  . HIS A  1 190 ? 82.618  148.480 67.439  1.00 18.25 ? 215 HIS A CG  1 
ATOM   1543  N ND1 . HIS A  1 190 ? 82.978  149.404 68.404  1.00 18.64 ? 215 HIS A ND1 1 
ATOM   1544  C CD2 . HIS A  1 190 ? 81.379  148.841 67.014  1.00 16.53 ? 215 HIS A CD2 1 
ATOM   1545  C CE1 . HIS A  1 190 ? 81.990  150.276 68.564  1.00 18.75 ? 215 HIS A CE1 1 
ATOM   1546  N NE2 . HIS A  1 190 ? 81.016  149.968 67.723  1.00 18.32 ? 215 HIS A NE2 1 
ATOM   1547  N N   . GLY A  1 191 ? 86.532  146.265 66.779  1.00 18.99 ? 216 GLY A N   1 
ATOM   1548  C CA  . GLY A  1 191 ? 87.444  145.168 66.549  1.00 19.99 ? 216 GLY A CA  1 
ATOM   1549  C C   . GLY A  1 191 ? 88.339  144.994 67.757  1.00 21.95 ? 216 GLY A C   1 
ATOM   1550  O O   . GLY A  1 191 ? 88.240  145.736 68.754  1.00 22.05 ? 216 GLY A O   1 
ATOM   1551  N N   . SER A  1 192 ? 89.229  144.015 67.679  1.00 22.89 ? 217 SER A N   1 
ATOM   1552  C CA  . SER A  1 192 ? 90.016  143.646 68.866  1.00 25.79 ? 217 SER A CA  1 
ATOM   1553  C C   . SER A  1 192 ? 91.151  144.607 69.229  1.00 26.26 ? 217 SER A C   1 
ATOM   1554  O O   . SER A  1 192 ? 91.863  144.376 70.196  1.00 28.08 ? 217 SER A O   1 
ATOM   1555  C CB  . SER A  1 192 ? 90.534  142.213 68.753  1.00 26.08 ? 217 SER A CB  1 
ATOM   1556  O OG  . SER A  1 192 ? 91.288  142.076 67.567  1.00 27.77 ? 217 SER A OG  1 
ATOM   1557  N N   . TRP A  1 193 ? 91.308  145.686 68.469  1.00 25.78 ? 218 TRP A N   1 
ATOM   1558  C CA  . TRP A  1 193 ? 92.214  146.776 68.845  1.00 26.71 ? 218 TRP A CA  1 
ATOM   1559  C C   . TRP A  1 193 ? 91.627  147.656 69.974  1.00 27.74 ? 218 TRP A C   1 
ATOM   1560  O O   . TRP A  1 193 ? 92.355  148.398 70.638  1.00 28.27 ? 218 TRP A O   1 
ATOM   1561  C CB  . TRP A  1 193 ? 92.515  147.654 67.624  1.00 26.18 ? 218 TRP A CB  1 
ATOM   1562  C CG  . TRP A  1 193 ? 91.233  148.177 66.972  1.00 24.09 ? 218 TRP A CG  1 
ATOM   1563  C CD1 . TRP A  1 193 ? 90.490  149.274 67.357  1.00 23.28 ? 218 TRP A CD1 1 
ATOM   1564  C CD2 . TRP A  1 193 ? 90.543  147.595 65.868  1.00 22.07 ? 218 TRP A CD2 1 
ATOM   1565  N NE1 . TRP A  1 193 ? 89.390  149.409 66.542  1.00 22.27 ? 218 TRP A NE1 1 
ATOM   1566  C CE2 . TRP A  1 193 ? 89.401  148.395 65.617  1.00 22.45 ? 218 TRP A CE2 1 
ATOM   1567  C CE3 . TRP A  1 193 ? 90.789  146.485 65.044  1.00 22.79 ? 218 TRP A CE3 1 
ATOM   1568  C CZ2 . TRP A  1 193 ? 88.506  148.111 64.586  1.00 21.33 ? 218 TRP A CZ2 1 
ATOM   1569  C CZ3 . TRP A  1 193 ? 89.900  146.200 64.022  1.00 20.81 ? 218 TRP A CZ3 1 
ATOM   1570  C CH2 . TRP A  1 193 ? 88.761  147.003 63.808  1.00 21.72 ? 218 TRP A CH2 1 
ATOM   1571  N N   . GLU A  1 194 ? 90.319  147.579 70.202  1.00 27.52 ? 219 GLU A N   1 
ATOM   1572  C CA  . GLU A  1 194 ? 89.685  148.501 71.158  1.00 28.16 ? 219 GLU A CA  1 
ATOM   1573  C C   . GLU A  1 194 ? 90.090  148.284 72.609  1.00 29.92 ? 219 GLU A C   1 
ATOM   1574  O O   . GLU A  1 194 ? 90.377  147.164 73.040  1.00 30.06 ? 219 GLU A O   1 
ATOM   1575  C CB  . GLU A  1 194 ? 88.160  148.469 71.038  1.00 27.23 ? 219 GLU A CB  1 
ATOM   1576  C CG  . GLU A  1 194 ? 87.655  149.115 69.751  1.00 28.00 ? 219 GLU A CG  1 
ATOM   1577  C CD  . GLU A  1 194 ? 86.209  148.800 69.488  1.00 30.31 ? 219 GLU A CD  1 
ATOM   1578  O OE1 . GLU A  1 194 ? 85.909  147.622 69.200  1.00 32.88 ? 219 GLU A OE1 1 
ATOM   1579  O OE2 . GLU A  1 194 ? 85.371  149.712 69.572  1.00 31.35 ? 219 GLU A OE2 1 
ATOM   1580  N N   . LYS A  1 195 ? 90.081  149.377 73.362  1.00 31.31 ? 220 LYS A N   1 
ATOM   1581  C CA  . LYS A  1 195 ? 90.301  149.345 74.795  1.00 33.61 ? 220 LYS A CA  1 
ATOM   1582  C C   . LYS A  1 195 ? 89.264  150.247 75.427  1.00 33.92 ? 220 LYS A C   1 
ATOM   1583  O O   . LYS A  1 195 ? 89.108  151.392 75.010  1.00 34.37 ? 220 LYS A O   1 
ATOM   1584  C CB  . LYS A  1 195 ? 91.695  149.844 75.140  1.00 34.83 ? 220 LYS A CB  1 
ATOM   1585  C CG  . LYS A  1 195 ? 92.757  148.807 74.902  1.00 37.15 ? 220 LYS A CG  1 
ATOM   1586  C CD  . LYS A  1 195 ? 94.063  149.440 74.464  1.00 40.50 ? 220 LYS A CD  1 
ATOM   1587  C CE  . LYS A  1 195 ? 95.233  148.510 74.785  1.00 43.61 ? 220 LYS A CE  1 
ATOM   1588  N NZ  . LYS A  1 195 ? 95.193  147.266 73.953  1.00 43.84 ? 220 LYS A NZ  1 
ATOM   1589  N N   . PRO A  1 196 ? 88.518  149.719 76.411  1.00 34.26 ? 221 PRO A N   1 
ATOM   1590  C CA  . PRO A  1 196 ? 88.671  148.337 76.883  1.00 33.61 ? 221 PRO A CA  1 
ATOM   1591  C C   . PRO A  1 196 ? 88.169  147.313 75.842  1.00 31.53 ? 221 PRO A C   1 
ATOM   1592  O O   . PRO A  1 196 ? 87.389  147.648 74.934  1.00 30.71 ? 221 PRO A O   1 
ATOM   1593  C CB  . PRO A  1 196 ? 87.835  148.314 78.168  1.00 34.77 ? 221 PRO A CB  1 
ATOM   1594  C CG  . PRO A  1 196 ? 86.783  149.372 77.968  1.00 35.01 ? 221 PRO A CG  1 
ATOM   1595  C CD  . PRO A  1 196 ? 87.283  150.353 76.913  1.00 34.57 ? 221 PRO A CD  1 
ATOM   1596  N N   . LEU A  1 197 ? 88.645  146.077 75.937  1.00 30.69 ? 222 LEU A N   1 
ATOM   1597  C CA  . LEU A  1 197 ? 88.349  145.109 74.890  1.00 28.57 ? 222 LEU A CA  1 
ATOM   1598  C C   . LEU A  1 197 ? 86.992  144.439 75.154  1.00 27.49 ? 222 LEU A C   1 
ATOM   1599  O O   . LEU A  1 197 ? 86.855  143.628 76.069  1.00 27.60 ? 222 LEU A O   1 
ATOM   1600  C CB  . LEU A  1 197 ? 89.484  144.091 74.813  1.00 29.21 ? 222 LEU A CB  1 
ATOM   1601  C CG  . LEU A  1 197 ? 89.374  143.024 73.738  1.00 29.56 ? 222 LEU A CG  1 
ATOM   1602  C CD1 . LEU A  1 197 ? 89.039  143.626 72.392  1.00 28.35 ? 222 LEU A CD1 1 
ATOM   1603  C CD2 . LEU A  1 197 ? 90.709  142.265 73.713  1.00 32.63 ? 222 LEU A CD2 1 
ATOM   1604  N N   . ILE A  1 198 ? 85.987  144.829 74.380  1.00 24.84 ? 223 ILE A N   1 
ATOM   1605  C CA  . ILE A  1 198 ? 84.634  144.314 74.540  1.00 24.26 ? 223 ILE A CA  1 
ATOM   1606  C C   . ILE A  1 198 ? 84.099  144.019 73.140  1.00 22.65 ? 223 ILE A C   1 
ATOM   1607  O O   . ILE A  1 198 ? 84.584  144.578 72.171  1.00 21.53 ? 223 ILE A O   1 
ATOM   1608  C CB  . ILE A  1 198 ? 83.713  145.330 75.257  1.00 24.21 ? 223 ILE A CB  1 
ATOM   1609  C CG1 . ILE A  1 198 ? 83.642  146.651 74.475  1.00 24.55 ? 223 ILE A CG1 1 
ATOM   1610  C CG2 . ILE A  1 198 ? 84.152  145.539 76.751  1.00 25.78 ? 223 ILE A CG2 1 
ATOM   1611  C CD1 . ILE A  1 198 ? 82.699  147.698 75.093  1.00 24.54 ? 223 ILE A CD1 1 
ATOM   1612  N N   . THR A  1 199 ? 83.100  143.147 73.032  1.00 21.83 ? 224 THR A N   1 
ATOM   1613  C CA  . THR A  1 199 ? 82.581  142.799 71.716  1.00 19.86 ? 224 THR A CA  1 
ATOM   1614  C C   . THR A  1 199 ? 81.881  144.027 71.084  1.00 19.52 ? 224 THR A C   1 
ATOM   1615  O O   . THR A  1 199 ? 81.262  144.829 71.781  1.00 20.22 ? 224 THR A O   1 
ATOM   1616  C CB  . THR A  1 199 ? 81.582  141.621 71.803  1.00 20.19 ? 224 THR A CB  1 
ATOM   1617  O OG1 . THR A  1 199 ? 80.494  141.972 72.670  1.00 18.97 ? 224 THR A OG1 1 
ATOM   1618  C CG2 . THR A  1 199 ? 82.270  140.360 72.325  1.00 19.05 ? 224 THR A CG2 1 
ATOM   1619  N N   . GLY A  1 200 ? 81.969  144.150 69.766  1.00 18.18 ? 225 GLY A N   1 
ATOM   1620  C CA  . GLY A  1 200 ? 81.236  145.185 69.026  1.00 17.58 ? 225 GLY A CA  1 
ATOM   1621  C C   . GLY A  1 200 ? 81.187  144.784 67.562  1.00 16.75 ? 225 GLY A C   1 
ATOM   1622  O O   . GLY A  1 200 ? 82.040  144.018 67.098  1.00 15.52 ? 225 GLY A O   1 
ATOM   1623  N N   . HIS A  1 201 ? 80.220  145.312 66.818  1.00 16.27 ? 226 HIS A N   1 
ATOM   1624  C CA  . HIS A  1 201 ? 80.039  144.860 65.436  1.00 16.12 ? 226 HIS A CA  1 
ATOM   1625  C C   . HIS A  1 201 ? 80.984  145.576 64.468  1.00 15.49 ? 226 HIS A C   1 
ATOM   1626  O O   . HIS A  1 201 ? 81.257  146.768 64.624  1.00 16.61 ? 226 HIS A O   1 
ATOM   1627  C CB  . HIS A  1 201 ? 78.578  145.046 64.988  1.00 15.90 ? 226 HIS A CB  1 
ATOM   1628  C CG  . HIS A  1 201 ? 78.217  144.227 63.789  1.00 15.04 ? 226 HIS A CG  1 
ATOM   1629  N ND1 . HIS A  1 201 ? 78.551  144.603 62.501  1.00 15.27 ? 226 HIS A ND1 1 
ATOM   1630  C CD2 . HIS A  1 201 ? 77.543  143.052 63.682  1.00 12.74 ? 226 HIS A CD2 1 
ATOM   1631  C CE1 . HIS A  1 201 ? 78.113  143.686 61.654  1.00 14.18 ? 226 HIS A CE1 1 
ATOM   1632  N NE2 . HIS A  1 201 ? 77.507  142.729 62.346  1.00 13.68 ? 226 HIS A NE2 1 
ATOM   1633  N N   . ASN A  1 202 ? 81.489  144.832 63.488  1.00 14.88 ? 227 ASN A N   1 
ATOM   1634  C CA  . ASN A  1 202 ? 82.359  145.377 62.443  1.00 14.80 ? 227 ASN A CA  1 
ATOM   1635  C C   . ASN A  1 202 ? 81.720  146.574 61.737  1.00 14.09 ? 227 ASN A C   1 
ATOM   1636  O O   . ASN A  1 202 ? 82.367  147.599 61.508  1.00 14.24 ? 227 ASN A O   1 
ATOM   1637  C CB  . ASN A  1 202 ? 82.652  144.259 61.426  1.00 14.49 ? 227 ASN A CB  1 
ATOM   1638  C CG  . ASN A  1 202 ? 83.556  144.706 60.307  1.00 15.07 ? 227 ASN A CG  1 
ATOM   1639  O OD1 . ASN A  1 202 ? 84.453  145.510 60.515  1.00 12.49 ? 227 ASN A OD1 1 
ATOM   1640  N ND2 . ASN A  1 202 ? 83.333  144.166 59.107  1.00 13.82 ? 227 ASN A ND2 1 
ATOM   1641  N N   . SER A  1 203 ? 80.440  146.447 61.399  1.00 14.28 ? 228 SER A N   1 
ATOM   1642  C CA  . SER A  1 203 ? 79.799  147.402 60.503  1.00 13.80 ? 228 SER A CA  1 
ATOM   1643  C C   . SER A  1 203 ? 78.301  147.485 60.776  1.00 13.85 ? 228 SER A C   1 
ATOM   1644  O O   . SER A  1 203 ? 77.480  147.089 59.941  1.00 14.20 ? 228 SER A O   1 
ATOM   1645  C CB  . SER A  1 203 ? 80.047  146.958 59.064  1.00 13.70 ? 228 SER A CB  1 
ATOM   1646  O OG  . SER A  1 203 ? 79.755  147.988 58.140  1.00 14.94 ? 228 SER A OG  1 
ATOM   1647  N N   . PRO A  1 204 ? 77.934  148.026 61.946  1.00 14.40 ? 229 PRO A N   1 
ATOM   1648  C CA  . PRO A  1 204 ? 76.520  148.224 62.260  1.00 14.79 ? 229 PRO A CA  1 
ATOM   1649  C C   . PRO A  1 204 ? 75.972  149.371 61.410  1.00 14.65 ? 229 PRO A C   1 
ATOM   1650  O O   . PRO A  1 204 ? 76.661  150.365 61.202  1.00 14.24 ? 229 PRO A O   1 
ATOM   1651  C CB  . PRO A  1 204 ? 76.538  148.641 63.736  1.00 15.68 ? 229 PRO A CB  1 
ATOM   1652  C CG  . PRO A  1 204 ? 77.889  149.332 63.913  1.00 15.40 ? 229 PRO A CG  1 
ATOM   1653  C CD  . PRO A  1 204 ? 78.833  148.516 63.007  1.00 13.84 ? 229 PRO A CD  1 
ATOM   1654  N N   . LEU A  1 205 ? 74.753  149.227 60.907  1.00 14.81 ? 230 LEU A N   1 
ATOM   1655  C CA  . LEU A  1 205 ? 74.146  150.293 60.111  1.00 15.01 ? 230 LEU A CA  1 
ATOM   1656  C C   . LEU A  1 205 ? 73.844  151.515 60.977  1.00 15.72 ? 230 LEU A C   1 
ATOM   1657  O O   . LEU A  1 205 ? 74.134  152.652 60.586  1.00 16.24 ? 230 LEU A O   1 
ATOM   1658  C CB  . LEU A  1 205 ? 72.863  149.804 59.448  1.00 14.67 ? 230 LEU A CB  1 
ATOM   1659  C CG  . LEU A  1 205 ? 72.100  150.888 58.684  1.00 16.05 ? 230 LEU A CG  1 
ATOM   1660  C CD1 . LEU A  1 205 ? 72.927  151.584 57.557  1.00 15.51 ? 230 LEU A CD1 1 
ATOM   1661  C CD2 . LEU A  1 205 ? 70.798  150.288 58.128  1.00 18.17 ? 230 LEU A CD2 1 
ATOM   1662  N N   . SER A  1 206 ? 73.300  151.271 62.163  1.00 16.35 ? 231 SER A N   1 
ATOM   1663  C CA  . SER A  1 206 ? 72.875  152.352 63.042  1.00 18.19 ? 231 SER A CA  1 
ATOM   1664  C C   . SER A  1 206 ? 73.434  152.141 64.436  1.00 18.63 ? 231 SER A C   1 
ATOM   1665  O O   . SER A  1 206 ? 73.880  151.051 64.776  1.00 17.64 ? 231 SER A O   1 
ATOM   1666  C CB  . SER A  1 206 ? 71.348  152.371 63.121  1.00 19.07 ? 231 SER A CB  1 
ATOM   1667  O OG  . SER A  1 206 ? 70.823  152.422 61.815  1.00 20.53 ? 231 SER A OG  1 
ATOM   1668  N N   . LYS A  1 207 ? 73.380  153.183 65.248  1.00 19.55 ? 232 LYS A N   1 
ATOM   1669  C CA  . LYS A  1 207 ? 73.784  153.076 66.655  1.00 20.11 ? 232 LYS A CA  1 
ATOM   1670  C C   . LYS A  1 207 ? 72.890  152.130 67.468  1.00 21.07 ? 232 LYS A C   1 
ATOM   1671  O O   . LYS A  1 207 ? 71.712  151.876 67.119  1.00 20.89 ? 232 LYS A O   1 
ATOM   1672  C CB  . LYS A  1 207 ? 73.781  154.463 67.326  1.00 20.95 ? 232 LYS A CB  1 
ATOM   1673  C CG  . LYS A  1 207 ? 72.401  155.031 67.664  1.00 23.33 ? 232 LYS A CG  1 
ATOM   1674  C CD  . LYS A  1 207 ? 72.554  156.422 68.360  1.00 25.29 ? 232 LYS A CD  1 
ATOM   1675  C CE  . LYS A  1 207 ? 71.264  156.901 68.988  1.00 26.92 ? 232 LYS A CE  1 
ATOM   1676  N NZ  . LYS A  1 207 ? 70.831  155.957 70.111  1.00 29.44 ? 232 LYS A NZ  1 
ATOM   1677  N N   . GLY A  1 208 ? 73.452  151.634 68.570  1.00 20.62 ? 233 GLY A N   1 
ATOM   1678  C CA  . GLY A  1 208 ? 72.705  150.827 69.536  1.00 20.81 ? 233 GLY A CA  1 
ATOM   1679  C C   . GLY A  1 208 ? 71.739  151.711 70.317  1.00 22.06 ? 233 GLY A C   1 
ATOM   1680  O O   . GLY A  1 208 ? 71.997  152.898 70.508  1.00 21.74 ? 233 GLY A O   1 
ATOM   1681  N N   . TRP A  1 209 ? 70.612  151.156 70.754  1.00 22.67 ? 234 TRP A N   1 
ATOM   1682  C CA  . TRP A  1 209 ? 69.647  151.977 71.501  1.00 24.47 ? 234 TRP A CA  1 
ATOM   1683  C C   . TRP A  1 209 ? 70.282  152.603 72.747  1.00 26.43 ? 234 TRP A C   1 
ATOM   1684  O O   . TRP A  1 209 ? 69.858  153.670 73.179  1.00 25.89 ? 234 TRP A O   1 
ATOM   1685  C CB  . TRP A  1 209 ? 68.409  151.188 71.929  1.00 24.95 ? 234 TRP A CB  1 
ATOM   1686  C CG  . TRP A  1 209 ? 67.480  150.791 70.822  1.00 24.12 ? 234 TRP A CG  1 
ATOM   1687  C CD1 . TRP A  1 209 ? 67.212  151.474 69.661  1.00 22.18 ? 234 TRP A CD1 1 
ATOM   1688  C CD2 . TRP A  1 209 ? 66.642  149.629 70.807  1.00 24.41 ? 234 TRP A CD2 1 
ATOM   1689  N NE1 . TRP A  1 209 ? 66.272  150.787 68.915  1.00 21.50 ? 234 TRP A NE1 1 
ATOM   1690  C CE2 . TRP A  1 209 ? 65.909  149.654 69.596  1.00 23.32 ? 234 TRP A CE2 1 
ATOM   1691  C CE3 . TRP A  1 209 ? 66.453  148.559 71.696  1.00 23.42 ? 234 TRP A CE3 1 
ATOM   1692  C CZ2 . TRP A  1 209 ? 65.016  148.649 69.249  1.00 23.37 ? 234 TRP A CZ2 1 
ATOM   1693  C CZ3 . TRP A  1 209 ? 65.564  147.562 71.354  1.00 24.23 ? 234 TRP A CZ3 1 
ATOM   1694  C CH2 . TRP A  1 209 ? 64.852  147.613 70.144  1.00 25.72 ? 234 TRP A CH2 1 
ATOM   1695  N N   . GLN A  1 210 ? 71.264  151.924 73.338  1.00 27.23 ? 235 GLN A N   1 
ATOM   1696  C CA  . GLN A  1 210 ? 71.954  152.462 74.506  1.00 30.92 ? 235 GLN A CA  1 
ATOM   1697  C C   . GLN A  1 210 ? 73.162  153.352 74.217  1.00 31.14 ? 235 GLN A C   1 
ATOM   1698  O O   . GLN A  1 210 ? 73.763  153.880 75.153  1.00 32.42 ? 235 GLN A O   1 
ATOM   1699  C CB  . GLN A  1 210 ? 72.381  151.330 75.425  1.00 32.25 ? 235 GLN A CB  1 
ATOM   1700  C CG  . GLN A  1 210 ? 71.279  150.335 75.643  1.00 36.20 ? 235 GLN A CG  1 
ATOM   1701  C CD  . GLN A  1 210 ? 71.213  149.888 77.057  1.00 42.33 ? 235 GLN A CD  1 
ATOM   1702  O OE1 . GLN A  1 210 ? 70.994  148.711 77.336  1.00 44.64 ? 235 GLN A OE1 1 
ATOM   1703  N NE2 . GLN A  1 210 ? 71.408  150.824 77.978  1.00 44.52 ? 235 GLN A NE2 1 
ATOM   1704  N N   . ASP A  1 211 ? 73.506  153.536 72.945  1.00 30.44 ? 236 ASP A N   1 
ATOM   1705  C CA  . ASP A  1 211 ? 74.638  154.398 72.575  1.00 30.72 ? 236 ASP A CA  1 
ATOM   1706  C C   . ASP A  1 211 ? 74.321  155.894 72.701  1.00 31.94 ? 236 ASP A C   1 
ATOM   1707  O O   . ASP A  1 211 ? 73.419  156.381 72.034  1.00 31.80 ? 236 ASP A O   1 
ATOM   1708  C CB  . ASP A  1 211 ? 75.057  154.121 71.137  1.00 28.89 ? 236 ASP A CB  1 
ATOM   1709  C CG  . ASP A  1 211 ? 75.702  152.768 70.976  1.00 29.95 ? 236 ASP A CG  1 
ATOM   1710  O OD1 . ASP A  1 211 ? 76.275  152.281 71.963  1.00 32.44 ? 236 ASP A OD1 1 
ATOM   1711  O OD2 . ASP A  1 211 ? 75.633  152.191 69.873  1.00 29.39 ? 236 ASP A OD2 1 
ATOM   1712  N N   . ARG A  1 212 ? 75.068  156.610 73.543  1.00 33.25 ? 237 ARG A N   1 
ATOM   1713  C CA  . ARG A  1 212 ? 75.004  158.079 73.603  1.00 35.19 ? 237 ARG A CA  1 
ATOM   1714  C C   . ARG A  1 212 ? 76.390  158.724 73.452  1.00 34.85 ? 237 ARG A C   1 
ATOM   1715  O O   . ARG A  1 212 ? 77.414  158.071 73.657  1.00 34.58 ? 237 ARG A O   1 
ATOM   1716  C CB  . ARG A  1 212 ? 74.364  158.559 74.908  1.00 37.18 ? 237 ARG A CB  1 
ATOM   1717  C CG  . ARG A  1 212 ? 72.938  158.070 75.113  1.00 40.29 ? 237 ARG A CG  1 
ATOM   1718  C CD  . ARG A  1 212 ? 72.301  158.667 76.362  1.00 45.26 ? 237 ARG A CD  1 
ATOM   1719  N NE  . ARG A  1 212 ? 72.198  160.132 76.314  1.00 48.77 ? 237 ARG A NE  1 
ATOM   1720  C CZ  . ARG A  1 212 ? 71.225  160.814 75.701  1.00 49.87 ? 237 ARG A CZ  1 
ATOM   1721  N NH1 . ARG A  1 212 ? 70.253  160.177 75.058  1.00 49.95 ? 237 ARG A NH1 1 
ATOM   1722  N NH2 . ARG A  1 212 ? 71.216  162.142 75.736  1.00 49.68 ? 237 ARG A NH2 1 
ATOM   1723  N N   . GLY A  1 213 ? 76.418  160.011 73.117  1.00 35.38 ? 238 GLY A N   1 
ATOM   1724  C CA  . GLY A  1 213 ? 77.689  160.728 72.926  1.00 35.31 ? 238 GLY A CA  1 
ATOM   1725  C C   . GLY A  1 213 ? 78.546  160.109 71.827  1.00 33.72 ? 238 GLY A C   1 
ATOM   1726  O O   . GLY A  1 213 ? 78.030  159.723 70.777  1.00 32.66 ? 238 GLY A O   1 
ATOM   1727  N N   . PRO A  1 214 ? 79.867  160.008 72.056  1.00 33.60 ? 239 PRO A N   1 
ATOM   1728  C CA  . PRO A  1 214 ? 80.741  159.628 70.947  1.00 31.80 ? 239 PRO A CA  1 
ATOM   1729  C C   . PRO A  1 214 ? 80.538  158.195 70.531  1.00 29.98 ? 239 PRO A C   1 
ATOM   1730  O O   . PRO A  1 214 ? 80.787  157.871 69.378  1.00 28.43 ? 239 PRO A O   1 
ATOM   1731  C CB  . PRO A  1 214 ? 82.161  159.805 71.507  1.00 32.73 ? 239 PRO A CB  1 
ATOM   1732  C CG  . PRO A  1 214 ? 81.997  159.800 72.981  1.00 35.16 ? 239 PRO A CG  1 
ATOM   1733  C CD  . PRO A  1 214 ? 80.628  160.390 73.260  1.00 35.32 ? 239 PRO A CD  1 
ATOM   1734  N N   . SER A  1 215 ? 80.063  157.353 71.449  1.00 29.24 ? 240 SER A N   1 
ATOM   1735  C CA  . SER A  1 215 ? 79.736  155.969 71.091  1.00 28.19 ? 240 SER A CA  1 
ATOM   1736  C C   . SER A  1 215 ? 78.740  155.933 69.928  1.00 26.26 ? 240 SER A C   1 
ATOM   1737  O O   . SER A  1 215 ? 78.725  154.979 69.142  1.00 25.41 ? 240 SER A O   1 
ATOM   1738  C CB  . SER A  1 215 ? 79.179  155.195 72.292  1.00 29.34 ? 240 SER A CB  1 
ATOM   1739  O OG  . SER A  1 215 ? 77.871  155.649 72.598  1.00 32.26 ? 240 SER A OG  1 
ATOM   1740  N N   . SER A  1 216 ? 77.951  156.994 69.786  1.00 24.72 ? 241 SER A N   1 
ATOM   1741  C CA  . SER A  1 216 ? 76.937  157.057 68.729  1.00 24.30 ? 241 SER A CA  1 
ATOM   1742  C C   . SER A  1 216 ? 77.483  157.349 67.326  1.00 22.79 ? 241 SER A C   1 
ATOM   1743  O O   . SER A  1 216 ? 76.700  157.392 66.364  1.00 21.93 ? 241 SER A O   1 
ATOM   1744  C CB  . SER A  1 216 ? 75.859  158.097 69.089  1.00 26.14 ? 241 SER A CB  1 
ATOM   1745  O OG  . SER A  1 216 ? 76.379  159.388 68.865  1.00 28.07 ? 241 SER A OG  1 
ATOM   1746  N N   . TYR A  1 217 ? 78.803  157.548 67.193  1.00 20.49 ? 242 TYR A N   1 
ATOM   1747  C CA  . TYR A  1 217 ? 79.394  157.852 65.882  1.00 19.81 ? 242 TYR A CA  1 
ATOM   1748  C C   . TYR A  1 217 ? 79.833  156.593 65.125  1.00 18.53 ? 242 TYR A C   1 
ATOM   1749  O O   . TYR A  1 217 ? 80.133  156.656 63.928  1.00 17.50 ? 242 TYR A O   1 
ATOM   1750  C CB  . TYR A  1 217 ? 80.627  158.759 65.988  1.00 20.06 ? 242 TYR A CB  1 
ATOM   1751  C CG  . TYR A  1 217 ? 80.448  160.060 66.757  1.00 22.62 ? 242 TYR A CG  1 
ATOM   1752  C CD1 . TYR A  1 217 ? 79.206  160.657 66.875  1.00 24.69 ? 242 TYR A CD1 1 
ATOM   1753  C CD2 . TYR A  1 217 ? 81.540  160.694 67.333  1.00 24.88 ? 242 TYR A CD2 1 
ATOM   1754  C CE1 . TYR A  1 217 ? 79.043  161.838 67.568  1.00 28.29 ? 242 TYR A CE1 1 
ATOM   1755  C CE2 . TYR A  1 217 ? 81.385  161.898 68.038  1.00 28.40 ? 242 TYR A CE2 1 
ATOM   1756  C CZ  . TYR A  1 217 ? 80.132  162.452 68.133  1.00 28.64 ? 242 TYR A CZ  1 
ATOM   1757  O OH  . TYR A  1 217 ? 79.943  163.621 68.813  1.00 33.47 ? 242 TYR A OH  1 
ATOM   1758  N N   . TYR A  1 218 ? 79.890  155.464 65.828  1.00 18.17 ? 243 TYR A N   1 
ATOM   1759  C CA  . TYR A  1 218 ? 80.499  154.243 65.298  1.00 18.21 ? 243 TYR A CA  1 
ATOM   1760  C C   . TYR A  1 218 ? 79.538  153.353 64.497  1.00 17.17 ? 243 TYR A C   1 
ATOM   1761  O O   . TYR A  1 218 ? 79.329  152.187 64.839  1.00 17.31 ? 243 TYR A O   1 
ATOM   1762  C CB  . TYR A  1 218 ? 81.068  153.441 66.467  1.00 19.02 ? 243 TYR A CB  1 
ATOM   1763  C CG  . TYR A  1 218 ? 82.237  154.126 67.136  1.00 23.46 ? 243 TYR A CG  1 
ATOM   1764  C CD1 . TYR A  1 218 ? 82.050  155.208 68.000  1.00 28.02 ? 243 TYR A CD1 1 
ATOM   1765  C CD2 . TYR A  1 218 ? 83.531  153.700 66.889  1.00 26.48 ? 243 TYR A CD2 1 
ATOM   1766  C CE1 . TYR A  1 218 ? 83.144  155.833 68.611  1.00 29.43 ? 243 TYR A CE1 1 
ATOM   1767  C CE2 . TYR A  1 218 ? 84.625  154.317 67.480  1.00 28.85 ? 243 TYR A CE2 1 
ATOM   1768  C CZ  . TYR A  1 218 ? 84.430  155.371 68.334  1.00 29.91 ? 243 TYR A CZ  1 
ATOM   1769  O OH  . TYR A  1 218 ? 85.544  155.956 68.889  1.00 31.66 ? 243 TYR A OH  1 
ATOM   1770  N N   . ASN A  1 219 ? 78.983  153.893 63.425  1.00 16.06 ? 244 ASN A N   1 
ATOM   1771  C CA  . ASN A  1 219 ? 78.035  153.157 62.610  1.00 15.57 ? 244 ASN A CA  1 
ATOM   1772  C C   . ASN A  1 219 ? 77.949  153.775 61.217  1.00 14.57 ? 244 ASN A C   1 
ATOM   1773  O O   . ASN A  1 219 ? 78.330  154.934 61.003  1.00 14.33 ? 244 ASN A O   1 
ATOM   1774  C CB  . ASN A  1 219 ? 76.651  153.093 63.292  1.00 15.33 ? 244 ASN A CB  1 
ATOM   1775  C CG  . ASN A  1 219 ? 76.145  154.444 63.701  1.00 17.05 ? 244 ASN A CG  1 
ATOM   1776  O OD1 . ASN A  1 219 ? 76.324  154.864 64.858  1.00 21.20 ? 244 ASN A OD1 1 
ATOM   1777  N ND2 . ASN A  1 219 ? 75.517  155.143 62.777  1.00 13.44 ? 244 ASN A ND2 1 
ATOM   1778  N N   . VAL A  1 220 ? 77.468  152.990 60.277  1.00 13.30 ? 245 VAL A N   1 
ATOM   1779  C CA  . VAL A  1 220 ? 77.404  153.442 58.888  1.00 14.60 ? 245 VAL A CA  1 
ATOM   1780  C C   . VAL A  1 220 ? 76.549  154.710 58.709  1.00 15.23 ? 245 VAL A C   1 
ATOM   1781  O O   . VAL A  1 220 ? 76.948  155.688 58.041  1.00 15.08 ? 245 VAL A O   1 
ATOM   1782  C CB  . VAL A  1 220 ? 76.849  152.322 58.008  1.00 13.71 ? 245 VAL A CB  1 
ATOM   1783  C CG1 . VAL A  1 220 ? 76.582  152.829 56.569  1.00 14.22 ? 245 VAL A CG1 1 
ATOM   1784  C CG2 . VAL A  1 220 ? 77.778  151.113 58.058  1.00 13.89 ? 245 VAL A CG2 1 
ATOM   1785  N N   . GLU A  1 221 ? 75.363  154.685 59.292  1.00 16.89 ? 246 GLU A N   1 
ATOM   1786  C CA  . GLU A  1 221 ? 74.424  155.804 59.215  1.00 18.07 ? 246 GLU A CA  1 
ATOM   1787  C C   . GLU A  1 221 ? 75.089  157.126 59.619  1.00 18.56 ? 246 GLU A C   1 
ATOM   1788  O O   . GLU A  1 221 ? 74.995  158.141 58.898  1.00 19.16 ? 246 GLU A O   1 
ATOM   1789  C CB  . GLU A  1 221 ? 73.188  155.511 60.104  1.00 19.13 ? 246 GLU A CB  1 
ATOM   1790  C CG  . GLU A  1 221 ? 72.195  156.656 60.249  1.00 23.12 ? 246 GLU A CG  1 
ATOM   1791  C CD  . GLU A  1 221 ? 70.867  156.232 60.878  1.00 26.61 ? 246 GLU A CD  1 
ATOM   1792  O OE1 . GLU A  1 221 ? 70.821  155.198 61.576  1.00 28.44 ? 246 GLU A OE1 1 
ATOM   1793  O OE2 . GLU A  1 221 ? 69.849  156.941 60.683  1.00 31.91 ? 246 GLU A OE2 1 
ATOM   1794  N N   . TYR A  1 222 ? 75.757  157.127 60.771  1.00 17.86 ? 247 TYR A N   1 
ATOM   1795  C CA  . TYR A  1 222 ? 76.434  158.341 61.221  1.00 17.81 ? 247 TYR A CA  1 
ATOM   1796  C C   . TYR A  1 222 ? 77.574  158.776 60.259  1.00 16.61 ? 247 TYR A C   1 
ATOM   1797  O O   . TYR A  1 222 ? 77.659  159.939 59.871  1.00 16.78 ? 247 TYR A O   1 
ATOM   1798  C CB  . TYR A  1 222 ? 76.977  158.195 62.659  1.00 18.11 ? 247 TYR A CB  1 
ATOM   1799  C CG  . TYR A  1 222 ? 77.506  159.520 63.151  1.00 19.15 ? 247 TYR A CG  1 
ATOM   1800  C CD1 . TYR A  1 222 ? 76.640  160.467 63.721  1.00 21.54 ? 247 TYR A CD1 1 
ATOM   1801  C CD2 . TYR A  1 222 ? 78.842  159.864 62.980  1.00 17.84 ? 247 TYR A CD2 1 
ATOM   1802  C CE1 . TYR A  1 222 ? 77.108  161.718 64.143  1.00 23.70 ? 247 TYR A CE1 1 
ATOM   1803  C CE2 . TYR A  1 222 ? 79.330  161.095 63.394  1.00 20.01 ? 247 TYR A CE2 1 
ATOM   1804  C CZ  . TYR A  1 222 ? 78.457  162.024 63.980  1.00 22.99 ? 247 TYR A CZ  1 
ATOM   1805  O OH  . TYR A  1 222 ? 78.918  163.263 64.382  1.00 23.83 ? 247 TYR A OH  1 
ATOM   1806  N N   . ALA A  1 223 ? 78.433  157.845 59.874  1.00 15.41 ? 248 ALA A N   1 
ATOM   1807  C CA  . ALA A  1 223 ? 79.565  158.170 59.004  1.00 15.20 ? 248 ALA A CA  1 
ATOM   1808  C C   . ALA A  1 223 ? 79.099  158.776 57.678  1.00 15.53 ? 248 ALA A C   1 
ATOM   1809  O O   . ALA A  1 223 ? 79.673  159.760 57.210  1.00 15.53 ? 248 ALA A O   1 
ATOM   1810  C CB  . ALA A  1 223 ? 80.411  156.911 58.732  1.00 13.94 ? 248 ALA A CB  1 
ATOM   1811  N N   . VAL A  1 224 ? 78.076  158.178 57.071  1.00 14.82 ? 249 VAL A N   1 
ATOM   1812  C CA  . VAL A  1 224 ? 77.552  158.697 55.810  1.00 15.43 ? 249 VAL A CA  1 
ATOM   1813  C C   . VAL A  1 224 ? 77.002  160.124 56.025  1.00 16.18 ? 249 VAL A C   1 
ATOM   1814  O O   . VAL A  1 224 ? 77.279  161.035 55.236  1.00 16.16 ? 249 VAL A O   1 
ATOM   1815  C CB  . VAL A  1 224 ? 76.449  157.769 55.227  1.00 15.70 ? 249 VAL A CB  1 
ATOM   1816  C CG1 . VAL A  1 224 ? 75.662  158.470 54.117  1.00 15.14 ? 249 VAL A CG1 1 
ATOM   1817  C CG2 . VAL A  1 224 ? 77.038  156.437 54.717  1.00 13.95 ? 249 VAL A CG2 1 
ATOM   1818  N N   . GLY A  1 225 ? 76.222  160.310 57.088  1.00 16.33 ? 250 GLY A N   1 
ATOM   1819  C CA  . GLY A  1 225 ? 75.635  161.617 57.403  1.00 17.70 ? 250 GLY A CA  1 
ATOM   1820  C C   . GLY A  1 225 ? 76.742  162.647 57.624  1.00 17.97 ? 250 GLY A C   1 
ATOM   1821  O O   . GLY A  1 225 ? 76.639  163.801 57.182  1.00 18.05 ? 250 GLY A O   1 
ATOM   1822  N N   . TYR A  1 226 ? 77.809  162.231 58.300  1.00 17.28 ? 251 TYR A N   1 
ATOM   1823  C CA  . TYR A  1 226 ? 78.899  163.166 58.632  1.00 18.37 ? 251 TYR A CA  1 
ATOM   1824  C C   . TYR A  1 226 ? 79.651  163.661 57.386  1.00 18.07 ? 251 TYR A C   1 
ATOM   1825  O O   . TYR A  1 226 ? 79.929  164.867 57.250  1.00 19.10 ? 251 TYR A O   1 
ATOM   1826  C CB  . TYR A  1 226 ? 79.891  162.526 59.613  1.00 17.66 ? 251 TYR A CB  1 
ATOM   1827  C CG  . TYR A  1 226 ? 80.761  163.550 60.299  1.00 19.10 ? 251 TYR A CG  1 
ATOM   1828  C CD1 . TYR A  1 226 ? 80.196  164.455 61.193  1.00 21.31 ? 251 TYR A CD1 1 
ATOM   1829  C CD2 . TYR A  1 226 ? 82.130  163.607 60.067  1.00 17.10 ? 251 TYR A CD2 1 
ATOM   1830  C CE1 . TYR A  1 226 ? 80.963  165.401 61.823  1.00 23.17 ? 251 TYR A CE1 1 
ATOM   1831  C CE2 . TYR A  1 226 ? 82.907  164.570 60.690  1.00 19.52 ? 251 TYR A CE2 1 
ATOM   1832  C CZ  . TYR A  1 226 ? 82.307  165.460 61.570  1.00 20.40 ? 251 TYR A CZ  1 
ATOM   1833  O OH  . TYR A  1 226 ? 83.043  166.412 62.239  1.00 22.17 ? 251 TYR A OH  1 
ATOM   1834  N N   . TRP A  1 227 ? 80.006  162.733 56.498  1.00 17.78 ? 252 TRP A N   1 
ATOM   1835  C CA  . TRP A  1 227 ? 80.680  163.102 55.253  1.00 17.08 ? 252 TRP A CA  1 
ATOM   1836  C C   . TRP A  1 227 ? 79.834  164.046 54.443  1.00 17.94 ? 252 TRP A C   1 
ATOM   1837  O O   . TRP A  1 227 ? 80.338  165.017 53.858  1.00 18.21 ? 252 TRP A O   1 
ATOM   1838  C CB  . TRP A  1 227 ? 81.017  161.854 54.415  1.00 15.59 ? 252 TRP A CB  1 
ATOM   1839  C CG  . TRP A  1 227 ? 82.341  161.337 54.740  1.00 15.20 ? 252 TRP A CG  1 
ATOM   1840  C CD1 . TRP A  1 227 ? 82.645  160.325 55.627  1.00 14.24 ? 252 TRP A CD1 1 
ATOM   1841  C CD2 . TRP A  1 227 ? 83.594  161.796 54.205  1.00 14.68 ? 252 TRP A CD2 1 
ATOM   1842  N NE1 . TRP A  1 227 ? 84.011  160.144 55.669  1.00 15.16 ? 252 TRP A NE1 1 
ATOM   1843  C CE2 . TRP A  1 227 ? 84.611  161.033 54.812  1.00 13.19 ? 252 TRP A CE2 1 
ATOM   1844  C CE3 . TRP A  1 227 ? 83.948  162.797 53.287  1.00 14.78 ? 252 TRP A CE3 1 
ATOM   1845  C CZ2 . TRP A  1 227 ? 85.963  161.217 54.517  1.00 13.81 ? 252 TRP A CZ2 1 
ATOM   1846  C CZ3 . TRP A  1 227 ? 85.287  162.971 52.976  1.00 16.15 ? 252 TRP A CZ3 1 
ATOM   1847  C CH2 . TRP A  1 227 ? 86.280  162.186 53.588  1.00 15.89 ? 252 TRP A CH2 1 
ATOM   1848  N N   . ILE A  1 228 ? 78.525  163.799 54.412  1.00 17.78 ? 253 ILE A N   1 
ATOM   1849  C CA  . ILE A  1 228 ? 77.671  164.673 53.604  1.00 18.34 ? 253 ILE A CA  1 
ATOM   1850  C C   . ILE A  1 228 ? 77.608  166.060 54.266  1.00 20.05 ? 253 ILE A C   1 
ATOM   1851  O O   . ILE A  1 228 ? 77.729  167.087 53.591  1.00 19.18 ? 253 ILE A O   1 
ATOM   1852  C CB  . ILE A  1 228 ? 76.268  164.061 53.388  1.00 18.94 ? 253 ILE A CB  1 
ATOM   1853  C CG1 . ILE A  1 228 ? 76.369  162.830 52.451  1.00 18.45 ? 253 ILE A CG1 1 
ATOM   1854  C CG2 . ILE A  1 228 ? 75.267  165.105 52.852  1.00 21.97 ? 253 ILE A CG2 1 
ATOM   1855  C CD1 . ILE A  1 228 ? 75.056  161.966 52.430  1.00 18.07 ? 253 ILE A CD1 1 
ATOM   1856  N N   . HIS A  1 229 ? 77.412  166.075 55.583  1.00 19.70 ? 254 HIS A N   1 
ATOM   1857  C CA  . HIS A  1 229 ? 77.442  167.309 56.344  1.00 22.53 ? 254 HIS A CA  1 
ATOM   1858  C C   . HIS A  1 229 ? 78.739  168.089 56.148  1.00 22.32 ? 254 HIS A C   1 
ATOM   1859  O O   . HIS A  1 229 ? 78.721  169.306 56.129  1.00 22.89 ? 254 HIS A O   1 
ATOM   1860  C CB  . HIS A  1 229 ? 77.257  167.010 57.837  1.00 22.89 ? 254 HIS A CB  1 
ATOM   1861  C CG  . HIS A  1 229 ? 77.423  168.209 58.714  1.00 27.50 ? 254 HIS A CG  1 
ATOM   1862  N ND1 . HIS A  1 229 ? 76.520  169.255 58.727  1.00 30.74 ? 254 HIS A ND1 1 
ATOM   1863  C CD2 . HIS A  1 229 ? 78.376  168.520 59.626  1.00 29.73 ? 254 HIS A CD2 1 
ATOM   1864  C CE1 . HIS A  1 229 ? 76.920  170.166 59.597  1.00 32.52 ? 254 HIS A CE1 1 
ATOM   1865  N NE2 . HIS A  1 229 ? 78.048  169.748 60.150  1.00 32.13 ? 254 HIS A NE2 1 
ATOM   1866  N N   . LYS A  1 230 ? 79.869  167.391 56.023  1.00 21.14 ? 255 LYS A N   1 
ATOM   1867  C CA  . LYS A  1 230 ? 81.142  168.082 55.868  1.00 21.57 ? 255 LYS A CA  1 
ATOM   1868  C C   . LYS A  1 230 ? 81.354  168.620 54.456  1.00 21.12 ? 255 LYS A C   1 
ATOM   1869  O O   . LYS A  1 230 ? 82.344  169.305 54.209  1.00 21.18 ? 255 LYS A O   1 
ATOM   1870  C CB  . LYS A  1 230 ? 82.318  167.164 56.253  1.00 20.75 ? 255 LYS A CB  1 
ATOM   1871  C CG  . LYS A  1 230 ? 82.304  166.796 57.743  1.00 22.93 ? 255 LYS A CG  1 
ATOM   1872  C CD  . LYS A  1 230 ? 82.999  167.848 58.595  1.00 27.59 ? 255 LYS A CD  1 
ATOM   1873  C CE  . LYS A  1 230 ? 84.513  167.657 58.467  1.00 29.21 ? 255 LYS A CE  1 
ATOM   1874  N NZ  . LYS A  1 230 ? 85.243  168.484 59.466  1.00 30.71 ? 255 LYS A NZ  1 
ATOM   1875  N N   . GLY A  1 231 ? 80.456  168.273 53.534  1.00 20.28 ? 256 GLY A N   1 
ATOM   1876  C CA  . GLY A  1 231 ? 80.492  168.830 52.181  1.00 21.03 ? 256 GLY A CA  1 
ATOM   1877  C C   . GLY A  1 231 ? 80.675  167.846 51.027  1.00 20.29 ? 256 GLY A C   1 
ATOM   1878  O O   . GLY A  1 231 ? 80.826  168.268 49.895  1.00 20.28 ? 256 GLY A O   1 
ATOM   1879  N N   . MET A  1 232 ? 80.662  166.535 51.284  1.00 18.40 ? 257 MET A N   1 
ATOM   1880  C CA  . MET A  1 232 ? 80.670  165.576 50.168  1.00 18.27 ? 257 MET A CA  1 
ATOM   1881  C C   . MET A  1 232 ? 79.232  165.364 49.645  1.00 18.72 ? 257 MET A C   1 
ATOM   1882  O O   . MET A  1 232 ? 78.364  164.926 50.405  1.00 18.89 ? 257 MET A O   1 
ATOM   1883  C CB  . MET A  1 232 ? 81.272  164.228 50.627  1.00 17.13 ? 257 MET A CB  1 
ATOM   1884  C CG  . MET A  1 232 ? 81.447  163.197 49.515  1.00 18.34 ? 257 MET A CG  1 
ATOM   1885  S SD  . MET A  1 232 ? 82.688  163.738 48.309  1.00 19.09 ? 257 MET A SD  1 
ATOM   1886  C CE  . MET A  1 232 ? 84.158  163.909 49.360  1.00 16.29 ? 257 MET A CE  1 
ATOM   1887  N N   . PRO A  1 233 ? 78.978  165.660 48.359  1.00 19.44 ? 258 PRO A N   1 
ATOM   1888  C CA  . PRO A  1 233 ? 77.642  165.405 47.790  1.00 20.15 ? 258 PRO A CA  1 
ATOM   1889  C C   . PRO A  1 233 ? 77.253  163.944 47.985  1.00 18.64 ? 258 PRO A C   1 
ATOM   1890  O O   . PRO A  1 233 ? 78.100  163.047 47.855  1.00 16.99 ? 258 PRO A O   1 
ATOM   1891  C CB  . PRO A  1 233 ? 77.824  165.666 46.294  1.00 21.28 ? 258 PRO A CB  1 
ATOM   1892  C CG  . PRO A  1 233 ? 79.084  166.446 46.166  1.00 21.95 ? 258 PRO A CG  1 
ATOM   1893  C CD  . PRO A  1 233 ? 79.936  166.158 47.359  1.00 19.40 ? 258 PRO A CD  1 
ATOM   1894  N N   . SER A  1 234 ? 75.979  163.692 48.272  1.00 18.90 ? 259 SER A N   1 
ATOM   1895  C CA  . SER A  1 234 ? 75.581  162.322 48.557  1.00 17.98 ? 259 SER A CA  1 
ATOM   1896  C C   . SER A  1 234 ? 75.949  161.410 47.393  1.00 17.51 ? 259 SER A C   1 
ATOM   1897  O O   . SER A  1 234 ? 76.392  160.296 47.607  1.00 16.24 ? 259 SER A O   1 
ATOM   1898  C CB  . SER A  1 234 ? 74.084  162.245 48.875  1.00 19.60 ? 259 SER A CB  1 
ATOM   1899  O OG  . SER A  1 234 ? 73.313  162.622 47.747  1.00 19.06 ? 259 SER A OG  1 
ATOM   1900  N N   . GLU A  1 235 ? 75.772  161.874 46.160  1.00 18.37 ? 260 GLU A N   1 
ATOM   1901  C CA  . GLU A  1 235 ? 76.018  161.014 44.986  1.00 19.56 ? 260 GLU A CA  1 
ATOM   1902  C C   . GLU A  1 235 ? 77.495  160.655 44.773  1.00 18.94 ? 260 GLU A C   1 
ATOM   1903  O O   . GLU A  1 235 ? 77.793  159.713 44.032  1.00 18.83 ? 260 GLU A O   1 
ATOM   1904  C CB  . GLU A  1 235 ? 75.383  161.583 43.693  1.00 21.65 ? 260 GLU A CB  1 
ATOM   1905  C CG  . GLU A  1 235 ? 76.076  162.831 43.138  1.00 25.21 ? 260 GLU A CG  1 
ATOM   1906  C CD  . GLU A  1 235 ? 75.538  164.114 43.772  1.00 31.20 ? 260 GLU A CD  1 
ATOM   1907  O OE1 . GLU A  1 235 ? 74.740  163.998 44.754  1.00 30.42 ? 260 GLU A OE1 1 
ATOM   1908  O OE2 . GLU A  1 235 ? 75.888  165.220 43.271  1.00 31.55 ? 260 GLU A OE2 1 
ATOM   1909  N N   . LYS A  1 236 ? 78.400  161.376 45.437  1.00 17.90 ? 261 LYS A N   1 
ATOM   1910  C CA  . LYS A  1 236 ? 79.826  161.009 45.452  1.00 17.23 ? 261 LYS A CA  1 
ATOM   1911  C C   . LYS A  1 236 ? 80.208  160.117 46.620  1.00 16.62 ? 261 LYS A C   1 
ATOM   1912  O O   . LYS A  1 236 ? 81.391  159.772 46.765  1.00 16.42 ? 261 LYS A O   1 
ATOM   1913  C CB  . LYS A  1 236 ? 80.720  162.246 45.471  1.00 17.09 ? 261 LYS A CB  1 
ATOM   1914  C CG  . LYS A  1 236 ? 80.674  163.041 44.159  1.00 19.03 ? 261 LYS A CG  1 
ATOM   1915  C CD  . LYS A  1 236 ? 81.896  163.982 44.028  1.00 18.36 ? 261 LYS A CD  1 
ATOM   1916  C CE  . LYS A  1 236 ? 81.934  164.543 42.632  1.00 19.88 ? 261 LYS A CE  1 
ATOM   1917  N NZ  . LYS A  1 236 ? 83.067  165.471 42.392  1.00 17.98 ? 261 LYS A NZ  1 
ATOM   1918  N N   . VAL A  1 237 ? 79.243  159.752 47.470  1.00 15.94 ? 262 VAL A N   1 
ATOM   1919  C CA  . VAL A  1 237 ? 79.541  158.752 48.524  1.00 15.84 ? 262 VAL A CA  1 
ATOM   1920  C C   . VAL A  1 237 ? 79.228  157.340 48.022  1.00 15.68 ? 262 VAL A C   1 
ATOM   1921  O O   . VAL A  1 237 ? 78.091  157.035 47.681  1.00 16.19 ? 262 VAL A O   1 
ATOM   1922  C CB  . VAL A  1 237 ? 78.725  159.018 49.821  1.00 15.59 ? 262 VAL A CB  1 
ATOM   1923  C CG1 . VAL A  1 237 ? 79.049  157.960 50.894  1.00 16.32 ? 262 VAL A CG1 1 
ATOM   1924  C CG2 . VAL A  1 237 ? 78.993  160.457 50.331  1.00 16.33 ? 262 VAL A CG2 1 
ATOM   1925  N N   . VAL A  1 238 ? 80.249  156.493 47.919  1.00 15.79 ? 263 VAL A N   1 
ATOM   1926  C CA  . VAL A  1 238 ? 79.998  155.098 47.597  1.00 14.68 ? 263 VAL A CA  1 
ATOM   1927  C C   . VAL A  1 238 ? 80.225  154.352 48.907  1.00 14.33 ? 263 VAL A C   1 
ATOM   1928  O O   . VAL A  1 238 ? 81.324  154.331 49.456  1.00 13.88 ? 263 VAL A O   1 
ATOM   1929  C CB  . VAL A  1 238 ? 80.882  154.622 46.428  1.00 14.62 ? 263 VAL A CB  1 
ATOM   1930  C CG1 . VAL A  1 238 ? 80.560  153.158 46.078  1.00 14.07 ? 263 VAL A CG1 1 
ATOM   1931  C CG2 . VAL A  1 238 ? 80.631  155.528 45.216  1.00 14.21 ? 263 VAL A CG2 1 
ATOM   1932  N N   . MET A  1 239 ? 79.155  153.745 49.411  1.00 15.13 ? 264 MET A N   1 
ATOM   1933  C CA  . MET A  1 239 ? 79.136  153.259 50.788  1.00 14.44 ? 264 MET A CA  1 
ATOM   1934  C C   . MET A  1 239 ? 79.716  151.852 50.950  1.00 13.79 ? 264 MET A C   1 
ATOM   1935  O O   . MET A  1 239 ? 79.166  150.890 50.421  1.00 13.92 ? 264 MET A O   1 
ATOM   1936  C CB  . MET A  1 239 ? 77.680  153.269 51.294  1.00 15.09 ? 264 MET A CB  1 
ATOM   1937  C CG  . MET A  1 239 ? 77.535  152.874 52.769  1.00 16.16 ? 264 MET A CG  1 
ATOM   1938  S SD  . MET A  1 239 ? 75.747  152.652 53.074  1.00 20.47 ? 264 MET A SD  1 
ATOM   1939  C CE  . MET A  1 239 ? 75.538  151.037 52.373  1.00 16.39 ? 264 MET A CE  1 
ATOM   1940  N N   . GLY A  1 240 ? 80.795  151.729 51.714  1.00 12.73 ? 265 GLY A N   1 
ATOM   1941  C CA  . GLY A  1 240 ? 81.498  150.455 51.854  1.00 13.32 ? 265 GLY A CA  1 
ATOM   1942  C C   . GLY A  1 240 ? 80.674  149.445 52.660  1.00 13.75 ? 265 GLY A C   1 
ATOM   1943  O O   . GLY A  1 240 ? 80.010  149.806 53.649  1.00 14.03 ? 265 GLY A O   1 
ATOM   1944  N N   . ILE A  1 241 ? 80.705  148.202 52.192  1.00 12.96 ? 266 ILE A N   1 
ATOM   1945  C CA  . ILE A  1 241 ? 80.063  147.071 52.838  1.00 13.41 ? 266 ILE A CA  1 
ATOM   1946  C C   . ILE A  1 241 ? 81.091  145.942 52.870  1.00 13.61 ? 266 ILE A C   1 
ATOM   1947  O O   . ILE A  1 241 ? 81.708  145.620 51.830  1.00 12.78 ? 266 ILE A O   1 
ATOM   1948  C CB  . ILE A  1 241 ? 78.845  146.621 52.040  1.00 14.37 ? 266 ILE A CB  1 
ATOM   1949  C CG1 . ILE A  1 241 ? 77.829  147.761 51.906  1.00 13.32 ? 266 ILE A CG1 1 
ATOM   1950  C CG2 . ILE A  1 241 ? 78.189  145.335 52.648  1.00 15.40 ? 266 ILE A CG2 1 
ATOM   1951  C CD1 . ILE A  1 241 ? 76.607  147.349 51.009  1.00 16.24 ? 266 ILE A CD1 1 
ATOM   1952  N N   . PRO A  1 242 ? 81.308  145.355 54.065  1.00 13.41 ? 267 PRO A N   1 
ATOM   1953  C CA  . PRO A  1 242 ? 82.341  144.325 54.191  1.00 14.01 ? 267 PRO A CA  1 
ATOM   1954  C C   . PRO A  1 242 ? 81.842  142.911 53.906  1.00 14.33 ? 267 PRO A C   1 
ATOM   1955  O O   . PRO A  1 242 ? 80.705  142.555 54.233  1.00 14.98 ? 267 PRO A O   1 
ATOM   1956  C CB  . PRO A  1 242 ? 82.769  144.454 55.659  1.00 13.49 ? 267 PRO A CB  1 
ATOM   1957  C CG  . PRO A  1 242 ? 81.509  144.893 56.381  1.00 13.74 ? 267 PRO A CG  1 
ATOM   1958  C CD  . PRO A  1 242 ? 80.728  145.731 55.375  1.00 13.42 ? 267 PRO A CD  1 
ATOM   1959  N N   . THR A  1 243 ? 82.685  142.072 53.323  1.00 15.45 ? 268 THR A N   1 
ATOM   1960  C CA  . THR A  1 243 ? 82.300  140.659 53.203  1.00 15.47 ? 268 THR A CA  1 
ATOM   1961  C C   . THR A  1 243 ? 83.043  139.832 54.254  1.00 17.03 ? 268 THR A C   1 
ATOM   1962  O O   . THR A  1 243 ? 83.212  138.626 54.099  1.00 20.27 ? 268 THR A O   1 
ATOM   1963  C CB  . THR A  1 243 ? 82.689  140.109 51.850  1.00 15.43 ? 268 THR A CB  1 
ATOM   1964  O OG1 . THR A  1 243 ? 84.081  140.393 51.634  1.00 13.16 ? 268 THR A OG1 1 
ATOM   1965  C CG2 . THR A  1 243 ? 81.828  140.769 50.724  1.00 14.29 ? 268 THR A CG2 1 
ATOM   1966  N N   . TYR A  1 244 ? 83.541  140.473 55.297  1.00 15.78 ? 269 TYR A N   1 
ATOM   1967  C CA  . TYR A  1 244 ? 84.242  139.748 56.351  1.00 15.33 ? 269 TYR A CA  1 
ATOM   1968  C C   . TYR A  1 244 ? 83.611  140.225 57.657  1.00 15.32 ? 269 TYR A C   1 
ATOM   1969  O O   . TYR A  1 244 ? 82.833  141.200 57.664  1.00 13.65 ? 269 TYR A O   1 
ATOM   1970  C CB  . TYR A  1 244 ? 85.744  140.062 56.333  1.00 15.16 ? 269 TYR A CB  1 
ATOM   1971  C CG  . TYR A  1 244 ? 86.007  141.523 56.673  1.00 15.39 ? 269 TYR A CG  1 
ATOM   1972  C CD1 . TYR A  1 244 ? 85.882  142.504 55.696  1.00 13.19 ? 269 TYR A CD1 1 
ATOM   1973  C CD2 . TYR A  1 244 ? 86.324  141.915 57.980  1.00 14.41 ? 269 TYR A CD2 1 
ATOM   1974  C CE1 . TYR A  1 244 ? 86.084  143.847 55.982  1.00 14.00 ? 269 TYR A CE1 1 
ATOM   1975  C CE2 . TYR A  1 244 ? 86.515  143.259 58.287  1.00 14.06 ? 269 TYR A CE2 1 
ATOM   1976  C CZ  . TYR A  1 244 ? 86.371  144.221 57.262  1.00 13.27 ? 269 TYR A CZ  1 
ATOM   1977  O OH  . TYR A  1 244 ? 86.566  145.558 57.517  1.00 14.41 ? 269 TYR A OH  1 
ATOM   1978  N N   . GLY A  1 245 ? 83.925  139.531 58.751  1.00 14.80 ? 270 GLY A N   1 
ATOM   1979  C CA  . GLY A  1 245 ? 83.472  139.993 60.058  1.00 15.18 ? 270 GLY A CA  1 
ATOM   1980  C C   . GLY A  1 245 ? 84.646  140.033 61.021  1.00 15.61 ? 270 GLY A C   1 
ATOM   1981  O O   . GLY A  1 245 ? 85.710  139.520 60.703  1.00 15.10 ? 270 GLY A O   1 
ATOM   1982  N N   . HIS A  1 246 ? 84.454  140.651 62.187  1.00 14.98 ? 271 HIS A N   1 
ATOM   1983  C CA  . HIS A  1 246 ? 85.472  140.684 63.211  1.00 15.59 ? 271 HIS A CA  1 
ATOM   1984  C C   . HIS A  1 246 ? 85.054  139.787 64.351  1.00 16.39 ? 271 HIS A C   1 
ATOM   1985  O O   . HIS A  1 246 ? 83.877  139.774 64.752  1.00 16.74 ? 271 HIS A O   1 
ATOM   1986  C CB  . HIS A  1 246 ? 85.713  142.125 63.729  1.00 15.62 ? 271 HIS A CB  1 
ATOM   1987  C CG  . HIS A  1 246 ? 86.650  142.913 62.873  1.00 16.74 ? 271 HIS A CG  1 
ATOM   1988  N ND1 . HIS A  1 246 ? 87.890  142.433 62.496  1.00 18.55 ? 271 HIS A ND1 1 
ATOM   1989  C CD2 . HIS A  1 246 ? 86.526  144.133 62.299  1.00 16.79 ? 271 HIS A CD2 1 
ATOM   1990  C CE1 . HIS A  1 246 ? 88.491  143.333 61.731  1.00 17.95 ? 271 HIS A CE1 1 
ATOM   1991  N NE2 . HIS A  1 246 ? 87.688  144.375 61.604  1.00 15.51 ? 271 HIS A NE2 1 
ATOM   1992  N N   . SER A  1 247 ? 86.030  139.038 64.857  1.00 16.29 ? 272 SER A N   1 
ATOM   1993  C CA  . SER A  1 247 ? 85.796  138.006 65.847  1.00 17.93 ? 272 SER A CA  1 
ATOM   1994  C C   . SER A  1 247 ? 86.493  138.386 67.150  1.00 18.17 ? 272 SER A C   1 
ATOM   1995  O O   . SER A  1 247 ? 87.476  139.134 67.140  1.00 18.35 ? 272 SER A O   1 
ATOM   1996  C CB  . SER A  1 247 ? 86.358  136.679 65.344  1.00 17.50 ? 272 SER A CB  1 
ATOM   1997  O OG  . SER A  1 247 ? 87.765  136.795 65.156  1.00 18.55 ? 272 SER A OG  1 
ATOM   1998  N N   . PHE A  1 248 ? 85.950  137.891 68.260  1.00 18.68 ? 273 PHE A N   1 
ATOM   1999  C CA  . PHE A  1 248 ? 86.496  138.120 69.589  1.00 19.81 ? 273 PHE A CA  1 
ATOM   2000  C C   . PHE A  1 248 ? 86.487  136.784 70.326  1.00 20.56 ? 273 PHE A C   1 
ATOM   2001  O O   . PHE A  1 248 ? 85.606  135.953 70.092  1.00 20.70 ? 273 PHE A O   1 
ATOM   2002  C CB  . PHE A  1 248 ? 85.595  139.089 70.374  1.00 19.84 ? 273 PHE A CB  1 
ATOM   2003  C CG  . PHE A  1 248 ? 85.475  140.447 69.752  1.00 20.00 ? 273 PHE A CG  1 
ATOM   2004  C CD1 . PHE A  1 248 ? 84.513  140.700 68.779  1.00 18.17 ? 273 PHE A CD1 1 
ATOM   2005  C CD2 . PHE A  1 248 ? 86.312  141.477 70.144  1.00 19.54 ? 273 PHE A CD2 1 
ATOM   2006  C CE1 . PHE A  1 248 ? 84.391  141.966 68.191  1.00 18.97 ? 273 PHE A CE1 1 
ATOM   2007  C CE2 . PHE A  1 248 ? 86.194  142.751 69.560  1.00 19.21 ? 273 PHE A CE2 1 
ATOM   2008  C CZ  . PHE A  1 248 ? 85.241  142.986 68.582  1.00 20.46 ? 273 PHE A CZ  1 
ATOM   2009  N N   . THR A  1 249 ? 87.420  136.594 71.252  1.00 21.20 ? 274 THR A N   1 
ATOM   2010  C CA  . THR A  1 249 ? 87.339  135.473 72.172  1.00 23.06 ? 274 THR A CA  1 
ATOM   2011  C C   . THR A  1 249 ? 86.738  136.070 73.432  1.00 24.10 ? 274 THR A C   1 
ATOM   2012  O O   . THR A  1 249 ? 87.231  137.072 73.943  1.00 24.69 ? 274 THR A O   1 
ATOM   2013  C CB  . THR A  1 249 ? 88.729  134.869 72.453  1.00 24.03 ? 274 THR A CB  1 
ATOM   2014  O OG1 . THR A  1 249 ? 89.279  134.376 71.229  1.00 23.98 ? 274 THR A OG1 1 
ATOM   2015  C CG2 . THR A  1 249 ? 88.677  133.725 73.490  1.00 26.01 ? 274 THR A CG2 1 
ATOM   2016  N N   . LEU A  1 250 ? 85.657  135.472 73.920  1.00 24.38 ? 275 LEU A N   1 
ATOM   2017  C CA  . LEU A  1 250 ? 84.941  136.033 75.049  1.00 24.92 ? 275 LEU A CA  1 
ATOM   2018  C C   . LEU A  1 250 ? 85.679  135.711 76.333  1.00 26.94 ? 275 LEU A C   1 
ATOM   2019  O O   . LEU A  1 250 ? 86.217  134.611 76.474  1.00 27.22 ? 275 LEU A O   1 
ATOM   2020  C CB  . LEU A  1 250 ? 83.526  135.458 75.113  1.00 24.88 ? 275 LEU A CB  1 
ATOM   2021  C CG  . LEU A  1 250 ? 82.608  135.902 73.977  1.00 24.48 ? 275 LEU A CG  1 
ATOM   2022  C CD1 . LEU A  1 250 ? 81.419  134.951 73.920  1.00 24.76 ? 275 LEU A CD1 1 
ATOM   2023  C CD2 . LEU A  1 250 ? 82.190  137.362 74.201  1.00 22.82 ? 275 LEU A CD2 1 
ATOM   2024  N N   . ALA A  1 251 ? 85.661  136.658 77.276  1.00 27.45 ? 276 ALA A N   1 
ATOM   2025  C CA  . ALA A  1 251 ? 86.319  136.482 78.558  1.00 29.26 ? 276 ALA A CA  1 
ATOM   2026  C C   . ALA A  1 251 ? 85.414  135.860 79.626  1.00 30.75 ? 276 ALA A C   1 
ATOM   2027  O O   . ALA A  1 251 ? 85.905  135.367 80.641  1.00 31.57 ? 276 ALA A O   1 
ATOM   2028  C CB  . ALA A  1 251 ? 86.886  137.832 79.051  1.00 29.51 ? 276 ALA A CB  1 
ATOM   2029  N N   . SER A  1 252 ? 84.098  135.868 79.395  1.00 30.30 ? 277 SER A N   1 
ATOM   2030  C CA  . SER A  1 252 ? 83.139  135.369 80.393  1.00 31.60 ? 277 SER A CA  1 
ATOM   2031  C C   . SER A  1 252 ? 81.936  134.694 79.751  1.00 31.47 ? 277 SER A C   1 
ATOM   2032  O O   . SER A  1 252 ? 81.897  134.497 78.533  1.00 29.85 ? 277 SER A O   1 
ATOM   2033  C CB  . SER A  1 252 ? 82.639  136.525 81.262  1.00 32.06 ? 277 SER A CB  1 
ATOM   2034  O OG  . SER A  1 252 ? 81.813  137.399 80.491  1.00 31.13 ? 277 SER A OG  1 
ATOM   2035  N N   . ALA A  1 253 ? 80.937  134.379 80.581  1.00 32.44 ? 278 ALA A N   1 
ATOM   2036  C CA  . ALA A  1 253 ? 79.665  133.813 80.115  1.00 32.51 ? 278 ALA A CA  1 
ATOM   2037  C C   . ALA A  1 253 ? 78.777  134.806 79.334  1.00 31.58 ? 278 ALA A C   1 
ATOM   2038  O O   . ALA A  1 253 ? 77.850  134.399 78.644  1.00 31.11 ? 278 ALA A O   1 
ATOM   2039  C CB  . ALA A  1 253 ? 78.885  133.205 81.308  1.00 34.10 ? 278 ALA A CB  1 
ATOM   2040  N N   . GLU A  1 254 ? 79.060  136.105 79.445  1.00 31.01 ? 279 GLU A N   1 
ATOM   2041  C CA  . GLU A  1 254 ? 78.270  137.125 78.760  1.00 30.43 ? 279 GLU A CA  1 
ATOM   2042  C C   . GLU A  1 254 ? 78.544  137.075 77.245  1.00 28.25 ? 279 GLU A C   1 
ATOM   2043  O O   . GLU A  1 254 ? 79.697  136.932 76.817  1.00 26.61 ? 279 GLU A O   1 
ATOM   2044  C CB  . GLU A  1 254 ? 78.640  138.492 79.339  1.00 31.58 ? 279 GLU A CB  1 
ATOM   2045  C CG  . GLU A  1 254 ? 77.657  139.640 79.066  1.00 34.86 ? 279 GLU A CG  1 
ATOM   2046  C CD  . GLU A  1 254 ? 77.798  140.787 80.089  1.00 38.58 ? 279 GLU A CD  1 
ATOM   2047  O OE1 . GLU A  1 254 ? 77.356  140.605 81.235  1.00 43.40 ? 279 GLU A OE1 1 
ATOM   2048  O OE2 . GLU A  1 254 ? 78.334  141.869 79.749  1.00 38.91 ? 279 GLU A OE2 1 
ATOM   2049  N N   . THR A  1 255 ? 77.490  137.202 76.436  1.00 27.48 ? 280 THR A N   1 
ATOM   2050  C CA  . THR A  1 255 ? 77.613  137.019 74.991  1.00 26.33 ? 280 THR A CA  1 
ATOM   2051  C C   . THR A  1 255 ? 76.953  138.146 74.192  1.00 25.52 ? 280 THR A C   1 
ATOM   2052  O O   . THR A  1 255 ? 76.850  138.082 72.966  1.00 24.35 ? 280 THR A O   1 
ATOM   2053  C CB  . THR A  1 255 ? 77.011  135.664 74.557  1.00 26.75 ? 280 THR A CB  1 
ATOM   2054  O OG1 . THR A  1 255 ? 75.619  135.656 74.863  1.00 27.50 ? 280 THR A OG1 1 
ATOM   2055  C CG2 . THR A  1 255 ? 77.682  134.497 75.289  1.00 27.59 ? 280 THR A CG2 1 
ATOM   2056  N N   . THR A  1 256 ? 76.538  139.198 74.889  1.00 26.03 ? 281 THR A N   1 
ATOM   2057  C CA  . THR A  1 256 ? 75.846  140.318 74.258  1.00 25.43 ? 281 THR A CA  1 
ATOM   2058  C C   . THR A  1 256 ? 76.861  141.322 73.650  1.00 24.50 ? 281 THR A C   1 
ATOM   2059  O O   . THR A  1 256 ? 78.054  141.217 73.884  1.00 24.62 ? 281 THR A O   1 
ATOM   2060  C CB  . THR A  1 256 ? 74.924  140.994 75.290  1.00 26.66 ? 281 THR A CB  1 
ATOM   2061  O OG1 . THR A  1 256 ? 75.669  141.258 76.486  1.00 27.97 ? 281 THR A OG1 1 
ATOM   2062  C CG2 . THR A  1 256 ? 73.764  140.061 75.672  1.00 28.33 ? 281 THR A CG2 1 
ATOM   2063  N N   . VAL A  1 257 ? 76.401  142.264 72.835  1.00 23.70 ? 282 VAL A N   1 
ATOM   2064  C CA  . VAL A  1 257 ? 77.258  143.365 72.399  1.00 22.65 ? 282 VAL A CA  1 
ATOM   2065  C C   . VAL A  1 257 ? 77.787  144.083 73.659  1.00 23.28 ? 282 VAL A C   1 
ATOM   2066  O O   . VAL A  1 257 ? 77.033  144.349 74.588  1.00 23.40 ? 282 VAL A O   1 
ATOM   2067  C CB  . VAL A  1 257 ? 76.460  144.341 71.514  1.00 22.63 ? 282 VAL A CB  1 
ATOM   2068  C CG1 . VAL A  1 257 ? 77.199  145.685 71.296  1.00 22.46 ? 282 VAL A CG1 1 
ATOM   2069  C CG2 . VAL A  1 257 ? 76.134  143.678 70.172  1.00 21.59 ? 282 VAL A CG2 1 
ATOM   2070  N N   . GLY A  1 258 ? 79.077  144.388 73.689  1.00 22.76 ? 283 GLY A N   1 
ATOM   2071  C CA  . GLY A  1 258 ? 79.658  145.057 74.856  1.00 23.53 ? 283 GLY A CA  1 
ATOM   2072  C C   . GLY A  1 258 ? 80.100  144.091 75.950  1.00 24.73 ? 283 GLY A C   1 
ATOM   2073  O O   . GLY A  1 258 ? 80.482  144.525 77.035  1.00 25.40 ? 283 GLY A O   1 
ATOM   2074  N N   . ALA A  1 259 ? 80.054  142.784 75.679  1.00 24.25 ? 284 ALA A N   1 
ATOM   2075  C CA  . ALA A  1 259 ? 80.594  141.778 76.621  1.00 25.35 ? 284 ALA A CA  1 
ATOM   2076  C C   . ALA A  1 259 ? 82.119  141.824 76.659  1.00 25.19 ? 284 ALA A C   1 
ATOM   2077  O O   . ALA A  1 259 ? 82.745  142.077 75.646  1.00 25.18 ? 284 ALA A O   1 
ATOM   2078  C CB  . ALA A  1 259 ? 80.145  140.359 76.207  1.00 24.70 ? 284 ALA A CB  1 
ATOM   2079  N N   . PRO A  1 260 ? 82.722  141.531 77.823  1.00 26.69 ? 285 PRO A N   1 
ATOM   2080  C CA  . PRO A  1 260 ? 84.201  141.460 77.942  1.00 26.96 ? 285 PRO A CA  1 
ATOM   2081  C C   . PRO A  1 260 ? 84.857  140.423 76.995  1.00 26.36 ? 285 PRO A C   1 
ATOM   2082  O O   . PRO A  1 260 ? 84.362  139.301 76.869  1.00 25.52 ? 285 PRO A O   1 
ATOM   2083  C CB  . PRO A  1 260 ? 84.445  141.052 79.408  1.00 28.84 ? 285 PRO A CB  1 
ATOM   2084  C CG  . PRO A  1 260 ? 83.107  141.078 80.117  1.00 29.68 ? 285 PRO A CG  1 
ATOM   2085  C CD  . PRO A  1 260 ? 82.001  141.247 79.076  1.00 27.44 ? 285 PRO A CD  1 
ATOM   2086  N N   . ALA A  1 261 ? 85.964  140.786 76.350  1.00 26.08 ? 286 ALA A N   1 
ATOM   2087  C CA  . ALA A  1 261 ? 86.678  139.844 75.471  1.00 26.13 ? 286 ALA A CA  1 
ATOM   2088  C C   . ALA A  1 261 ? 88.129  139.721 75.910  1.00 27.36 ? 286 ALA A C   1 
ATOM   2089  O O   . ALA A  1 261 ? 88.710  140.708 76.329  1.00 28.34 ? 286 ALA A O   1 
ATOM   2090  C CB  . ALA A  1 261 ? 86.605  140.326 74.023  1.00 24.35 ? 286 ALA A CB  1 
ATOM   2091  N N   . SER A  1 262 ? 88.730  138.537 75.804  1.00 28.36 ? 287 SER A N   1 
ATOM   2092  C CA  . SER A  1 262 ? 90.131  138.374 76.228  1.00 29.82 ? 287 SER A CA  1 
ATOM   2093  C C   . SER A  1 262 ? 91.087  138.686 75.088  1.00 29.26 ? 287 SER A C   1 
ATOM   2094  O O   . SER A  1 262 ? 92.280  138.861 75.318  1.00 29.87 ? 287 SER A O   1 
ATOM   2095  C CB  . SER A  1 262 ? 90.407  136.956 76.724  1.00 30.94 ? 287 SER A CB  1 
ATOM   2096  O OG  . SER A  1 262 ? 90.268  136.025 75.656  1.00 32.19 ? 287 SER A OG  1 
ATOM   2097  N N   . GLY A  1 263 ? 90.568  138.716 73.860  1.00 26.82 ? 288 GLY A N   1 
ATOM   2098  C CA  . GLY A  1 263 ? 91.393  138.948 72.684  1.00 26.32 ? 288 GLY A CA  1 
ATOM   2099  C C   . GLY A  1 263 ? 90.618  138.732 71.390  1.00 24.22 ? 288 GLY A C   1 
ATOM   2100  O O   . GLY A  1 263 ? 89.403  138.527 71.413  1.00 24.10 ? 288 GLY A O   1 
ATOM   2101  N N   . PRO A  1 264 ? 91.320  138.785 70.248  1.00 23.78 ? 289 PRO A N   1 
ATOM   2102  C CA  . PRO A  1 264 ? 90.683  138.499 68.968  1.00 22.03 ? 289 PRO A CA  1 
ATOM   2103  C C   . PRO A  1 264 ? 90.189  137.047 68.944  1.00 21.97 ? 289 PRO A C   1 
ATOM   2104  O O   . PRO A  1 264 ? 90.645  136.214 69.747  1.00 22.44 ? 289 PRO A O   1 
ATOM   2105  C CB  . PRO A  1 264 ? 91.810  138.710 67.938  1.00 22.41 ? 289 PRO A CB  1 
ATOM   2106  C CG  . PRO A  1 264 ? 93.106  138.540 68.737  1.00 23.93 ? 289 PRO A CG  1 
ATOM   2107  C CD  . PRO A  1 264 ? 92.787  138.943 70.152  1.00 24.48 ? 289 PRO A CD  1 
ATOM   2108  N N   . GLY A  1 265 ? 89.243  136.753 68.060  1.00 20.62 ? 290 GLY A N   1 
ATOM   2109  C CA  . GLY A  1 265 ? 88.772  135.372 67.876  1.00 21.02 ? 290 GLY A CA  1 
ATOM   2110  C C   . GLY A  1 265 ? 89.837  134.511 67.223  1.00 21.31 ? 290 GLY A C   1 
ATOM   2111  O O   . GLY A  1 265 ? 90.811  135.021 66.673  1.00 21.59 ? 290 GLY A O   1 
ATOM   2112  N N   . ALA A  1 266 ? 89.662  133.195 67.275  1.00 22.52 ? 291 ALA A N   1 
ATOM   2113  C CA  . ALA A  1 266 ? 90.645  132.281 66.686  1.00 22.89 ? 291 ALA A CA  1 
ATOM   2114  C C   . ALA A  1 266 ? 90.732  132.550 65.187  1.00 22.13 ? 291 ALA A C   1 
ATOM   2115  O O   . ALA A  1 266 ? 89.721  132.847 64.549  1.00 20.64 ? 291 ALA A O   1 
ATOM   2116  C CB  . ALA A  1 266 ? 90.237  130.830 66.943  1.00 23.99 ? 291 ALA A CB  1 
ATOM   2117  N N   . ALA A  1 267 ? 91.936  132.431 64.632  1.00 22.55 ? 292 ALA A N   1 
ATOM   2118  C CA  . ALA A  1 267 ? 92.161  132.588 63.193  1.00 21.97 ? 292 ALA A CA  1 
ATOM   2119  C C   . ALA A  1 267 ? 91.288  131.595 62.425  1.00 21.52 ? 292 ALA A C   1 
ATOM   2120  O O   . ALA A  1 267 ? 91.026  130.488 62.902  1.00 21.66 ? 292 ALA A O   1 
ATOM   2121  C CB  . ALA A  1 267 ? 93.658  132.339 62.874  1.00 23.10 ? 292 ALA A CB  1 
ATOM   2122  N N   . GLY A  1 268 ? 90.825  131.986 61.246  1.00 20.27 ? 293 GLY A N   1 
ATOM   2123  C CA  . GLY A  1 268 ? 90.093  131.056 60.390  1.00 20.81 ? 293 GLY A CA  1 
ATOM   2124  C C   . GLY A  1 268 ? 91.085  130.168 59.653  1.00 22.03 ? 293 GLY A C   1 
ATOM   2125  O O   . GLY A  1 268 ? 92.248  130.542 59.498  1.00 22.95 ? 293 GLY A O   1 
ATOM   2126  N N   . PRO A  1 269 ? 90.647  128.985 59.188  1.00 22.77 ? 294 PRO A N   1 
ATOM   2127  C CA  . PRO A  1 269 ? 91.622  128.065 58.594  1.00 23.49 ? 294 PRO A CA  1 
ATOM   2128  C C   . PRO A  1 269 ? 92.156  128.531 57.237  1.00 22.76 ? 294 PRO A C   1 
ATOM   2129  O O   . PRO A  1 269 ? 93.225  128.082 56.807  1.00 23.74 ? 294 PRO A O   1 
ATOM   2130  C CB  . PRO A  1 269 ? 90.849  126.741 58.484  1.00 24.73 ? 294 PRO A CB  1 
ATOM   2131  C CG  . PRO A  1 269 ? 89.422  127.139 58.395  1.00 24.24 ? 294 PRO A CG  1 
ATOM   2132  C CD  . PRO A  1 269 ? 89.283  128.432 59.192  1.00 23.72 ? 294 PRO A CD  1 
ATOM   2133  N N   . ILE A  1 270 ? 91.446  129.436 56.580  1.00 20.93 ? 295 ILE A N   1 
ATOM   2134  C CA  . ILE A  1 270 ? 91.849  129.878 55.255  1.00 21.06 ? 295 ILE A CA  1 
ATOM   2135  C C   . ILE A  1 270 ? 92.536  131.256 55.264  1.00 20.64 ? 295 ILE A C   1 
ATOM   2136  O O   . ILE A  1 270 ? 93.559  131.441 54.597  1.00 20.67 ? 295 ILE A O   1 
ATOM   2137  C CB  . ILE A  1 270 ? 90.636  129.913 54.289  1.00 20.77 ? 295 ILE A CB  1 
ATOM   2138  C CG1 . ILE A  1 270 ? 89.919  128.556 54.261  1.00 21.26 ? 295 ILE A CG1 1 
ATOM   2139  C CG2 . ILE A  1 270 ? 91.065  130.386 52.898  1.00 20.32 ? 295 ILE A CG2 1 
ATOM   2140  C CD1 . ILE A  1 270 ? 90.738  127.366 53.720  1.00 24.74 ? 295 ILE A CD1 1 
ATOM   2141  N N   . THR A  1 271 ? 91.966  132.214 56.003  1.00 19.70 ? 296 THR A N   1 
ATOM   2142  C CA  . THR A  1 271 ? 92.508  133.565 56.087  1.00 19.45 ? 296 THR A CA  1 
ATOM   2143  C C   . THR A  1 271 ? 93.604  133.675 57.161  1.00 20.82 ? 296 THR A C   1 
ATOM   2144  O O   . THR A  1 271 ? 94.434  134.583 57.112  1.00 21.34 ? 296 THR A O   1 
ATOM   2145  C CB  . THR A  1 271 ? 91.387  134.639 56.318  1.00 18.62 ? 296 THR A CB  1 
ATOM   2146  O OG1 . THR A  1 271 ? 90.616  134.286 57.474  1.00 18.61 ? 296 THR A OG1 1 
ATOM   2147  C CG2 . THR A  1 271 ? 90.460  134.713 55.071  1.00 15.77 ? 296 THR A CG2 1 
ATOM   2148  N N   . GLU A  1 272 ? 93.606  132.757 58.121  1.00 21.23 ? 297 GLU A N   1 
ATOM   2149  C CA  . GLU A  1 272 ? 94.758  132.603 59.016  1.00 23.22 ? 297 GLU A CA  1 
ATOM   2150  C C   . GLU A  1 272 ? 95.152  133.925 59.680  1.00 22.85 ? 297 GLU A C   1 
ATOM   2151  O O   . GLU A  1 272 ? 96.336  134.236 59.800  1.00 23.22 ? 297 GLU A O   1 
ATOM   2152  C CB  . GLU A  1 272 ? 95.953  132.028 58.223  1.00 24.08 ? 297 GLU A CB  1 
ATOM   2153  C CG  . GLU A  1 272 ? 95.758  130.574 57.759  1.00 26.27 ? 297 GLU A CG  1 
ATOM   2154  C CD  . GLU A  1 272 ? 97.016  129.978 57.146  1.00 29.06 ? 297 GLU A CD  1 
ATOM   2155  O OE1 . GLU A  1 272 ? 97.547  130.517 56.160  1.00 30.18 ? 297 GLU A OE1 1 
ATOM   2156  O OE2 . GLU A  1 272 ? 97.488  128.969 57.655  1.00 31.98 ? 297 GLU A OE2 1 
ATOM   2157  N N   . SER A  1 273 ? 94.163  134.707 60.099  1.00 21.58 ? 298 SER A N   1 
ATOM   2158  C CA  . SER A  1 273 ? 94.438  135.988 60.737  1.00 22.20 ? 298 SER A CA  1 
ATOM   2159  C C   . SER A  1 273 ? 93.494  136.201 61.927  1.00 21.91 ? 298 SER A C   1 
ATOM   2160  O O   . SER A  1 273 ? 92.306  136.489 61.750  1.00 20.18 ? 298 SER A O   1 
ATOM   2161  C CB  . SER A  1 273 ? 94.271  137.122 59.722  1.00 21.55 ? 298 SER A CB  1 
ATOM   2162  O OG  . SER A  1 273 ? 94.437  138.378 60.355  1.00 23.37 ? 298 SER A OG  1 
ATOM   2163  N N   . SER A  1 274 ? 94.021  136.067 63.141  1.00 22.50 ? 299 SER A N   1 
ATOM   2164  C CA  . SER A  1 274 ? 93.158  136.123 64.326  1.00 22.75 ? 299 SER A CA  1 
ATOM   2165  C C   . SER A  1 274 ? 92.461  137.475 64.406  1.00 21.36 ? 299 SER A C   1 
ATOM   2166  O O   . SER A  1 274 ? 93.122  138.507 64.373  1.00 21.06 ? 299 SER A O   1 
ATOM   2167  C CB  . SER A  1 274 ? 93.979  135.903 65.582  1.00 24.18 ? 299 SER A CB  1 
ATOM   2168  O OG  . SER A  1 274 ? 94.491  134.590 65.561  1.00 29.26 ? 299 SER A OG  1 
ATOM   2169  N N   . GLY A  1 275 ? 91.134  137.484 64.489  1.00 20.40 ? 300 GLY A N   1 
ATOM   2170  C CA  . GLY A  1 275 ? 90.419  138.754 64.600  1.00 19.16 ? 300 GLY A CA  1 
ATOM   2171  C C   . GLY A  1 275 ? 89.453  139.037 63.457  1.00 18.89 ? 300 GLY A C   1 
ATOM   2172  O O   . GLY A  1 275 ? 88.519  139.857 63.609  1.00 18.72 ? 300 GLY A O   1 
ATOM   2173  N N   . PHE A  1 276 ? 89.667  138.384 62.308  1.00 17.64 ? 301 PHE A N   1 
ATOM   2174  C CA  . PHE A  1 276 ? 88.649  138.415 61.240  1.00 17.07 ? 301 PHE A CA  1 
ATOM   2175  C C   . PHE A  1 276 ? 88.409  137.067 60.576  1.00 16.88 ? 301 PHE A C   1 
ATOM   2176  O O   . PHE A  1 276 ? 89.212  136.142 60.728  1.00 17.91 ? 301 PHE A O   1 
ATOM   2177  C CB  . PHE A  1 276 ? 88.909  139.525 60.203  1.00 16.58 ? 301 PHE A CB  1 
ATOM   2178  C CG  . PHE A  1 276 ? 89.882  139.154 59.055  1.00 17.66 ? 301 PHE A CG  1 
ATOM   2179  C CD1 . PHE A  1 276 ? 89.416  138.592 57.867  1.00 17.88 ? 301 PHE A CD1 1 
ATOM   2180  C CD2 . PHE A  1 276 ? 91.219  139.507 59.125  1.00 19.56 ? 301 PHE A CD2 1 
ATOM   2181  C CE1 . PHE A  1 276 ? 90.301  138.314 56.789  1.00 18.73 ? 301 PHE A CE1 1 
ATOM   2182  C CE2 . PHE A  1 276 ? 92.104  139.237 58.053  1.00 20.28 ? 301 PHE A CE2 1 
ATOM   2183  C CZ  . PHE A  1 276 ? 91.635  138.632 56.896  1.00 17.80 ? 301 PHE A CZ  1 
ATOM   2184  N N   . LEU A  1 277 ? 87.288  136.972 59.861  1.00 15.77 ? 302 LEU A N   1 
ATOM   2185  C CA  . LEU A  1 277 ? 86.925  135.784 59.105  1.00 16.26 ? 302 LEU A CA  1 
ATOM   2186  C C   . LEU A  1 277 ? 86.291  136.265 57.806  1.00 15.48 ? 302 LEU A C   1 
ATOM   2187  O O   . LEU A  1 277 ? 85.487  137.207 57.809  1.00 14.21 ? 302 LEU A O   1 
ATOM   2188  C CB  . LEU A  1 277 ? 85.878  134.932 59.875  1.00 15.76 ? 302 LEU A CB  1 
ATOM   2189  C CG  . LEU A  1 277 ? 86.303  134.282 61.199  1.00 17.70 ? 302 LEU A CG  1 
ATOM   2190  C CD1 . LEU A  1 277 ? 85.091  133.600 61.856  1.00 18.96 ? 302 LEU A CD1 1 
ATOM   2191  C CD2 . LEU A  1 277 ? 87.419  133.280 60.940  1.00 16.36 ? 302 LEU A CD2 1 
ATOM   2192  N N   . ALA A  1 278 ? 86.620  135.608 56.706  1.00 15.66 ? 303 ALA A N   1 
ATOM   2193  C CA  . ALA A  1 278 ? 85.915  135.875 55.436  1.00 14.97 ? 303 ALA A CA  1 
ATOM   2194  C C   . ALA A  1 278 ? 84.533  135.231 55.469  1.00 15.78 ? 303 ALA A C   1 
ATOM   2195  O O   . ALA A  1 278 ? 84.279  134.322 56.247  1.00 16.04 ? 303 ALA A O   1 
ATOM   2196  C CB  . ALA A  1 278 ? 86.707  135.322 54.256  1.00 14.26 ? 303 ALA A CB  1 
ATOM   2197  N N   . TYR A  1 279 ? 83.644  135.673 54.593  1.00 15.89 ? 304 TYR A N   1 
ATOM   2198  C CA  . TYR A  1 279 ? 82.302  135.085 54.580  1.00 16.16 ? 304 TYR A CA  1 
ATOM   2199  C C   . TYR A  1 279 ? 82.308  133.559 54.323  1.00 16.70 ? 304 TYR A C   1 
ATOM   2200  O O   . TYR A  1 279 ? 81.483  132.835 54.873  1.00 17.42 ? 304 TYR A O   1 
ATOM   2201  C CB  . TYR A  1 279 ? 81.421  135.795 53.542  1.00 16.21 ? 304 TYR A CB  1 
ATOM   2202  C CG  . TYR A  1 279 ? 79.983  135.329 53.633  1.00 17.62 ? 304 TYR A CG  1 
ATOM   2203  C CD1 . TYR A  1 279 ? 79.209  135.641 54.758  1.00 17.80 ? 304 TYR A CD1 1 
ATOM   2204  C CD2 . TYR A  1 279 ? 79.408  134.560 52.627  1.00 17.91 ? 304 TYR A CD2 1 
ATOM   2205  C CE1 . TYR A  1 279 ? 77.887  135.185 54.874  1.00 18.43 ? 304 TYR A CE1 1 
ATOM   2206  C CE2 . TYR A  1 279 ? 78.076  134.101 52.731  1.00 19.78 ? 304 TYR A CE2 1 
ATOM   2207  C CZ  . TYR A  1 279 ? 77.332  134.429 53.860  1.00 20.22 ? 304 TYR A CZ  1 
ATOM   2208  O OH  . TYR A  1 279 ? 76.039  134.014 53.989  1.00 19.82 ? 304 TYR A OH  1 
ATOM   2209  N N   . TYR A  1 280 ? 83.205  133.062 53.474  1.00 17.01 ? 305 TYR A N   1 
ATOM   2210  C CA  . TYR A  1 280 ? 83.246  131.607 53.235  1.00 17.96 ? 305 TYR A CA  1 
ATOM   2211  C C   . TYR A  1 280 ? 83.741  130.829 54.460  1.00 18.55 ? 305 TYR A C   1 
ATOM   2212  O O   . TYR A  1 280 ? 83.612  129.591 54.516  1.00 19.75 ? 305 TYR A O   1 
ATOM   2213  C CB  . TYR A  1 280 ? 84.059  131.240 51.987  1.00 18.95 ? 305 TYR A CB  1 
ATOM   2214  C CG  . TYR A  1 280 ? 85.462  131.845 51.956  1.00 17.85 ? 305 TYR A CG  1 
ATOM   2215  C CD1 . TYR A  1 280 ? 86.459  131.394 52.823  1.00 17.53 ? 305 TYR A CD1 1 
ATOM   2216  C CD2 . TYR A  1 280 ? 85.782  132.863 51.072  1.00 18.23 ? 305 TYR A CD2 1 
ATOM   2217  C CE1 . TYR A  1 280 ? 87.733  131.942 52.802  1.00 18.02 ? 305 TYR A CE1 1 
ATOM   2218  C CE2 . TYR A  1 280 ? 87.077  133.419 51.048  1.00 15.51 ? 305 TYR A CE2 1 
ATOM   2219  C CZ  . TYR A  1 280 ? 88.030  132.961 51.921  1.00 17.91 ? 305 TYR A CZ  1 
ATOM   2220  O OH  . TYR A  1 280 ? 89.309  133.522 51.888  1.00 17.66 ? 305 TYR A OH  1 
ATOM   2221  N N   . GLU A  1 281 ? 84.319  131.543 55.420  1.00 17.28 ? 306 GLU A N   1 
ATOM   2222  C CA  . GLU A  1 281 ? 84.644  130.955 56.737  1.00 17.95 ? 306 GLU A CA  1 
ATOM   2223  C C   . GLU A  1 281 ? 83.478  131.153 57.698  1.00 18.34 ? 306 GLU A C   1 
ATOM   2224  O O   . GLU A  1 281 ? 83.171  130.293 58.518  1.00 18.43 ? 306 GLU A O   1 
ATOM   2225  C CB  . GLU A  1 281 ? 85.900  131.617 57.305  1.00 17.81 ? 306 GLU A CB  1 
ATOM   2226  C CG  . GLU A  1 281 ? 87.155  131.202 56.546  1.00 18.65 ? 306 GLU A CG  1 
ATOM   2227  C CD  . GLU A  1 281 ? 88.405  131.994 56.959  1.00 19.10 ? 306 GLU A CD  1 
ATOM   2228  O OE1 . GLU A  1 281 ? 88.324  133.239 57.075  1.00 14.51 ? 306 GLU A OE1 1 
ATOM   2229  O OE2 . GLU A  1 281 ? 89.467  131.347 57.134  1.00 18.07 ? 306 GLU A OE2 1 
ATOM   2230  N N   . ILE A  1 282 ? 82.822  132.301 57.595  1.00 17.42 ? 307 ILE A N   1 
ATOM   2231  C CA  . ILE A  1 282 ? 81.707  132.579 58.509  1.00 18.18 ? 307 ILE A CA  1 
ATOM   2232  C C   . ILE A  1 282 ? 80.585  131.555 58.327  1.00 18.71 ? 307 ILE A C   1 
ATOM   2233  O O   . ILE A  1 282 ? 79.984  131.118 59.289  1.00 18.72 ? 307 ILE A O   1 
ATOM   2234  C CB  . ILE A  1 282 ? 81.169  133.992 58.289  1.00 16.73 ? 307 ILE A CB  1 
ATOM   2235  C CG1 . ILE A  1 282 ? 82.173  135.012 58.841  1.00 17.31 ? 307 ILE A CG1 1 
ATOM   2236  C CG2 . ILE A  1 282 ? 79.820  134.174 58.961  1.00 19.03 ? 307 ILE A CG2 1 
ATOM   2237  C CD1 . ILE A  1 282 ? 81.819  136.432 58.479  1.00 18.38 ? 307 ILE A CD1 1 
ATOM   2238  N N   . CYS A  1 283 ? 80.260  131.205 57.089  1.00 19.22 ? 308 CYS A N   1 
ATOM   2239  C CA  . CYS A  1 283 ? 79.153  130.277 56.912  1.00 21.80 ? 308 CYS A CA  1 
ATOM   2240  C C   . CYS A  1 283 ? 79.436  128.898 57.540  1.00 22.32 ? 308 CYS A C   1 
ATOM   2241  O O   . CYS A  1 283 ? 78.502  128.213 57.999  1.00 22.08 ? 308 CYS A O   1 
ATOM   2242  C CB  . CYS A  1 283 ? 78.699  130.212 55.435  1.00 23.33 ? 308 CYS A CB  1 
ATOM   2243  S SG  . CYS A  1 283 ? 79.957  129.625 54.252  1.00 30.64 ? 308 CYS A SG  1 
ATOM   2244  N N   . GLN A  1 284 ? 80.715  128.506 57.606  1.00 21.39 ? 309 GLN A N   1 
ATOM   2245  C CA  . GLN A  1 284 ? 81.081  127.296 58.337  1.00 22.91 ? 309 GLN A CA  1 
ATOM   2246  C C   . GLN A  1 284 ? 80.969  127.514 59.855  1.00 22.69 ? 309 GLN A C   1 
ATOM   2247  O O   . GLN A  1 284 ? 80.485  126.642 60.583  1.00 23.00 ? 309 GLN A O   1 
ATOM   2248  C CB  . GLN A  1 284 ? 82.495  126.804 57.961  1.00 23.48 ? 309 GLN A CB  1 
ATOM   2249  C CG  . GLN A  1 284 ? 82.694  126.535 56.453  1.00 24.67 ? 309 GLN A CG  1 
ATOM   2250  C CD  . GLN A  1 284 ? 81.730  125.490 55.903  1.00 27.31 ? 309 GLN A CD  1 
ATOM   2251  O OE1 . GLN A  1 284 ? 81.423  124.503 56.564  1.00 28.84 ? 309 GLN A OE1 1 
ATOM   2252  N NE2 . GLN A  1 284 ? 81.244  125.710 54.689  1.00 27.88 ? 309 GLN A NE2 1 
ATOM   2253  N N   . PHE A  1 285 ? 81.406  128.681 60.332  1.00 21.65 ? 310 PHE A N   1 
ATOM   2254  C CA  . PHE A  1 285 ? 81.331  128.996 61.778  1.00 21.21 ? 310 PHE A CA  1 
ATOM   2255  C C   . PHE A  1 285 ? 79.876  128.972 62.267  1.00 21.46 ? 310 PHE A C   1 
ATOM   2256  O O   . PHE A  1 285 ? 79.591  128.555 63.406  1.00 22.23 ? 310 PHE A O   1 
ATOM   2257  C CB  . PHE A  1 285 ? 81.956  130.377 62.045  1.00 20.16 ? 310 PHE A CB  1 
ATOM   2258  C CG  . PHE A  1 285 ? 81.791  130.856 63.461  1.00 21.02 ? 310 PHE A CG  1 
ATOM   2259  C CD1 . PHE A  1 285 ? 82.693  130.470 64.444  1.00 22.19 ? 310 PHE A CD1 1 
ATOM   2260  C CD2 . PHE A  1 285 ? 80.754  131.702 63.805  1.00 19.56 ? 310 PHE A CD2 1 
ATOM   2261  C CE1 . PHE A  1 285 ? 82.546  130.908 65.753  1.00 23.62 ? 310 PHE A CE1 1 
ATOM   2262  C CE2 . PHE A  1 285 ? 80.600  132.136 65.106  1.00 21.27 ? 310 PHE A CE2 1 
ATOM   2263  C CZ  . PHE A  1 285 ? 81.508  131.740 66.086  1.00 22.28 ? 310 PHE A CZ  1 
ATOM   2264  N N   . LEU A  1 286 ? 78.954  129.380 61.398  1.00 20.28 ? 311 LEU A N   1 
ATOM   2265  C CA  . LEU A  1 286 ? 77.545  129.501 61.787  1.00 20.98 ? 311 LEU A CA  1 
ATOM   2266  C C   . LEU A  1 286 ? 76.914  128.155 62.067  1.00 22.55 ? 311 LEU A C   1 
ATOM   2267  O O   . LEU A  1 286 ? 75.986  128.062 62.870  1.00 23.25 ? 311 LEU A O   1 
ATOM   2268  C CB  . LEU A  1 286 ? 76.721  130.266 60.728  1.00 20.09 ? 311 LEU A CB  1 
ATOM   2269  C CG  . LEU A  1 286 ? 77.105  131.745 60.540  1.00 19.42 ? 311 LEU A CG  1 
ATOM   2270  C CD1 . LEU A  1 286 ? 76.210  132.427 59.499  1.00 20.74 ? 311 LEU A CD1 1 
ATOM   2271  C CD2 . LEU A  1 286 ? 76.982  132.506 61.867  1.00 19.88 ? 311 LEU A CD2 1 
ATOM   2272  N N   . LYS A  1 287 ? 77.426  127.103 61.437  1.00 22.92 ? 312 LYS A N   1 
ATOM   2273  C CA  . LYS A  1 287 ? 76.956  125.756 61.752  1.00 24.81 ? 312 LYS A CA  1 
ATOM   2274  C C   . LYS A  1 287 ? 77.241  125.395 63.216  1.00 25.59 ? 312 LYS A C   1 
ATOM   2275  O O   . LYS A  1 287 ? 78.398  125.235 63.623  1.00 25.15 ? 312 LYS A O   1 
ATOM   2276  C CB  . LYS A  1 287 ? 77.594  124.730 60.821  1.00 25.45 ? 312 LYS A CB  1 
ATOM   2277  C CG  . LYS A  1 287 ? 77.234  124.932 59.352  1.00 26.54 ? 312 LYS A CG  1 
ATOM   2278  C CD  . LYS A  1 287 ? 78.055  124.004 58.465  1.00 29.98 ? 312 LYS A CD  1 
ATOM   2279  C CE  . LYS A  1 287 ? 77.805  124.324 56.997  1.00 30.36 ? 312 LYS A CE  1 
ATOM   2280  N NZ  . LYS A  1 287 ? 78.702  123.549 56.116  1.00 31.23 ? 312 LYS A NZ  1 
ATOM   2281  N N   . GLY A  1 288 ? 76.174  125.232 63.992  1.00 25.91 ? 313 GLY A N   1 
ATOM   2282  C CA  . GLY A  1 288 ? 76.305  124.984 65.412  1.00 26.68 ? 313 GLY A CA  1 
ATOM   2283  C C   . GLY A  1 288 ? 76.315  126.244 66.253  1.00 25.96 ? 313 GLY A C   1 
ATOM   2284  O O   . GLY A  1 288 ? 76.444  126.169 67.464  1.00 26.47 ? 313 GLY A O   1 
ATOM   2285  N N   . ALA A  1 289 ? 76.190  127.405 65.622  1.00 24.92 ? 314 ALA A N   1 
ATOM   2286  C CA  . ALA A  1 289 ? 76.312  128.682 66.334  1.00 24.59 ? 314 ALA A CA  1 
ATOM   2287  C C   . ALA A  1 289 ? 74.930  129.215 66.705  1.00 25.34 ? 314 ALA A C   1 
ATOM   2288  O O   . ALA A  1 289 ? 73.920  128.763 66.154  1.00 25.36 ? 314 ALA A O   1 
ATOM   2289  C CB  . ALA A  1 289 ? 77.038  129.707 65.477  1.00 22.30 ? 314 ALA A CB  1 
ATOM   2290  N N   . LYS A  1 290 ? 74.885  130.173 67.623  1.00 25.27 ? 315 LYS A N   1 
ATOM   2291  C CA  . LYS A  1 290 ? 73.628  130.877 67.887  1.00 26.04 ? 315 LYS A CA  1 
ATOM   2292  C C   . LYS A  1 290 ? 73.679  132.267 67.259  1.00 24.71 ? 315 LYS A C   1 
ATOM   2293  O O   . LYS A  1 290 ? 74.591  133.029 67.523  1.00 23.83 ? 315 LYS A O   1 
ATOM   2294  C CB  . LYS A  1 290 ? 73.368  130.997 69.377  1.00 27.66 ? 315 LYS A CB  1 
ATOM   2295  C CG  . LYS A  1 290 ? 72.085  131.776 69.680  1.00 31.58 ? 315 LYS A CG  1 
ATOM   2296  C CD  . LYS A  1 290 ? 71.717  131.752 71.162  1.00 37.75 ? 315 LYS A CD  1 
ATOM   2297  C CE  . LYS A  1 290 ? 70.315  132.347 71.364  1.00 40.92 ? 315 LYS A CE  1 
ATOM   2298  N NZ  . LYS A  1 290 ? 70.311  133.451 72.386  1.00 42.74 ? 315 LYS A NZ  1 
ATOM   2299  N N   . ILE A  1 291 ? 72.714  132.571 66.399  1.00 24.16 ? 316 ILE A N   1 
ATOM   2300  C CA  . ILE A  1 291 ? 72.681  133.835 65.683  1.00 22.94 ? 316 ILE A CA  1 
ATOM   2301  C C   . ILE A  1 291 ? 71.677  134.803 66.310  1.00 23.30 ? 316 ILE A C   1 
ATOM   2302  O O   . ILE A  1 291 ? 70.514  134.443 66.536  1.00 23.32 ? 316 ILE A O   1 
ATOM   2303  C CB  . ILE A  1 291 ? 72.309  133.622 64.208  1.00 22.70 ? 316 ILE A CB  1 
ATOM   2304  C CG1 . ILE A  1 291 ? 73.397  132.821 63.501  1.00 22.10 ? 316 ILE A CG1 1 
ATOM   2305  C CG2 . ILE A  1 291 ? 72.128  134.973 63.483  1.00 22.77 ? 316 ILE A CG2 1 
ATOM   2306  C CD1 . ILE A  1 291 ? 73.014  132.446 62.079  1.00 23.31 ? 316 ILE A CD1 1 
ATOM   2307  N N   . THR A  1 292 ? 72.130  136.025 66.581  1.00 22.27 ? 317 THR A N   1 
ATOM   2308  C CA  . THR A  1 292 ? 71.252  137.095 67.056  1.00 22.56 ? 317 THR A CA  1 
ATOM   2309  C C   . THR A  1 292 ? 71.292  138.279 66.098  1.00 21.39 ? 317 THR A C   1 
ATOM   2310  O O   . THR A  1 292 ? 72.375  138.709 65.691  1.00 20.42 ? 317 THR A O   1 
ATOM   2311  C CB  . THR A  1 292 ? 71.657  137.564 68.476  1.00 23.76 ? 317 THR A CB  1 
ATOM   2312  O OG1 . THR A  1 292 ? 71.754  136.429 69.349  1.00 24.77 ? 317 THR A OG1 1 
ATOM   2313  C CG2 . THR A  1 292 ? 70.627  138.527 69.026  1.00 24.33 ? 317 THR A CG2 1 
ATOM   2314  N N   . ARG A  1 293 ? 70.123  138.784 65.706  1.00 21.84 ? 318 ARG A N   1 
ATOM   2315  C CA  . ARG A  1 293 ? 70.032  139.996 64.884  1.00 22.67 ? 318 ARG A CA  1 
ATOM   2316  C C   . ARG A  1 293 ? 69.770  141.169 65.798  1.00 22.71 ? 318 ARG A C   1 
ATOM   2317  O O   . ARG A  1 293 ? 68.824  141.140 66.562  1.00 23.47 ? 318 ARG A O   1 
ATOM   2318  C CB  . ARG A  1 293 ? 68.812  139.979 63.974  1.00 24.27 ? 318 ARG A CB  1 
ATOM   2319  C CG  . ARG A  1 293 ? 68.938  139.092 62.818  1.00 27.47 ? 318 ARG A CG  1 
ATOM   2320  C CD  . ARG A  1 293 ? 68.619  139.783 61.474  1.00 28.93 ? 318 ARG A CD  1 
ATOM   2321  N NE  . ARG A  1 293 ? 69.088  138.737 60.635  1.00 29.76 ? 318 ARG A NE  1 
ATOM   2322  C CZ  . ARG A  1 293 ? 70.095  138.790 59.799  1.00 27.63 ? 318 ARG A CZ  1 
ATOM   2323  N NH1 . ARG A  1 293 ? 70.674  139.941 59.460  1.00 23.22 ? 318 ARG A NH1 1 
ATOM   2324  N NH2 . ARG A  1 293 ? 70.438  137.651 59.232  1.00 28.89 ? 318 ARG A NH2 1 
ATOM   2325  N N   . LEU A  1 294 ? 70.582  142.204 65.709  1.00 20.59 ? 319 LEU A N   1 
ATOM   2326  C CA  . LEU A  1 294 ? 70.321  143.397 66.492  1.00 20.84 ? 319 LEU A CA  1 
ATOM   2327  C C   . LEU A  1 294 ? 69.238  144.218 65.774  1.00 21.52 ? 319 LEU A C   1 
ATOM   2328  O O   . LEU A  1 294 ? 69.407  144.603 64.614  1.00 20.65 ? 319 LEU A O   1 
ATOM   2329  C CB  . LEU A  1 294 ? 71.615  144.207 66.638  1.00 19.32 ? 319 LEU A CB  1 
ATOM   2330  C CG  . LEU A  1 294 ? 72.734  143.458 67.376  1.00 18.89 ? 319 LEU A CG  1 
ATOM   2331  C CD1 . LEU A  1 294 ? 74.112  144.035 67.028  1.00 17.04 ? 319 LEU A CD1 1 
ATOM   2332  C CD2 . LEU A  1 294 ? 72.483  143.509 68.889  1.00 21.34 ? 319 LEU A CD2 1 
ATOM   2333  N N   . GLN A  1 295 ? 68.133  144.483 66.462  1.00 23.19 ? 320 GLN A N   1 
ATOM   2334  C CA  . GLN A  1 295 ? 67.007  145.197 65.852  1.00 24.46 ? 320 GLN A CA  1 
ATOM   2335  C C   . GLN A  1 295 ? 67.384  146.662 65.721  1.00 23.70 ? 320 GLN A C   1 
ATOM   2336  O O   . GLN A  1 295 ? 66.972  147.326 64.773  1.00 24.25 ? 320 GLN A O   1 
ATOM   2337  C CB  . GLN A  1 295 ? 65.756  145.028 66.708  1.00 26.48 ? 320 GLN A CB  1 
ATOM   2338  C CG  . GLN A  1 295 ? 66.076  145.030 68.203  1.00 32.06 ? 320 GLN A CG  1 
ATOM   2339  C CD  . GLN A  1 295 ? 67.003  143.858 68.634  1.00 36.13 ? 320 GLN A CD  1 
ATOM   2340  O OE1 . GLN A  1 295 ? 67.963  144.046 69.394  1.00 35.72 ? 320 GLN A OE1 1 
ATOM   2341  N NE2 . GLN A  1 295 ? 66.707  142.650 68.136  1.00 39.04 ? 320 GLN A NE2 1 
ATOM   2342  N N   . ASP A  1 296 ? 68.196  147.156 66.652  1.00 21.91 ? 321 ASP A N   1 
ATOM   2343  C CA  . ASP A  1 296 ? 68.622  148.543 66.594  1.00 21.33 ? 321 ASP A CA  1 
ATOM   2344  C C   . ASP A  1 296 ? 69.736  148.760 65.585  1.00 19.85 ? 321 ASP A C   1 
ATOM   2345  O O   . ASP A  1 296 ? 69.646  149.649 64.739  1.00 19.36 ? 321 ASP A O   1 
ATOM   2346  C CB  . ASP A  1 296 ? 68.995  149.093 67.988  1.00 21.43 ? 321 ASP A CB  1 
ATOM   2347  C CG  . ASP A  1 296 ? 69.974  148.185 68.765  1.00 21.98 ? 321 ASP A CG  1 
ATOM   2348  O OD1 . ASP A  1 296 ? 70.442  147.145 68.239  1.00 20.96 ? 321 ASP A OD1 1 
ATOM   2349  O OD2 . ASP A  1 296 ? 70.270  148.532 69.922  1.00 21.21 ? 321 ASP A OD2 1 
ATOM   2350  N N   . GLN A  1 297 ? 70.774  147.926 65.635  1.00 19.12 ? 322 GLN A N   1 
ATOM   2351  C CA  . GLN A  1 297 ? 71.903  148.124 64.723  1.00 17.93 ? 322 GLN A CA  1 
ATOM   2352  C C   . GLN A  1 297 ? 71.682  147.546 63.336  1.00 17.42 ? 322 GLN A C   1 
ATOM   2353  O O   . GLN A  1 297 ? 72.361  147.934 62.383  1.00 16.92 ? 322 GLN A O   1 
ATOM   2354  C CB  . GLN A  1 297 ? 73.194  147.617 65.361  1.00 17.36 ? 322 GLN A CB  1 
ATOM   2355  C CG  . GLN A  1 297 ? 73.462  148.292 66.710  1.00 19.44 ? 322 GLN A CG  1 
ATOM   2356  C CD  . GLN A  1 297 ? 74.928  148.342 67.014  1.00 22.87 ? 322 GLN A CD  1 
ATOM   2357  O OE1 . GLN A  1 297 ? 75.647  149.294 66.627  1.00 27.17 ? 322 GLN A OE1 1 
ATOM   2358  N NE2 . GLN A  1 297 ? 75.394  147.338 67.697  1.00 22.54 ? 322 GLN A NE2 1 
ATOM   2359  N N   . GLN A  1 298 ? 70.720  146.637 63.219  1.00 17.76 ? 323 GLN A N   1 
ATOM   2360  C CA  . GLN A  1 298 ? 70.279  146.119 61.923  1.00 18.11 ? 323 GLN A CA  1 
ATOM   2361  C C   . GLN A  1 298 ? 71.258  145.101 61.327  1.00 17.21 ? 323 GLN A C   1 
ATOM   2362  O O   . GLN A  1 298 ? 71.290  144.895 60.097  1.00 17.26 ? 323 GLN A O   1 
ATOM   2363  C CB  . GLN A  1 298 ? 70.054  147.255 60.906  1.00 18.02 ? 323 GLN A CB  1 
ATOM   2364  C CG  . GLN A  1 298 ? 69.158  148.400 61.387  1.00 21.42 ? 323 GLN A CG  1 
ATOM   2365  C CD  . GLN A  1 298 ? 67.722  148.208 60.989  1.00 25.40 ? 323 GLN A CD  1 
ATOM   2366  O OE1 . GLN A  1 298 ? 67.267  147.082 60.802  1.00 26.86 ? 323 GLN A OE1 1 
ATOM   2367  N NE2 . GLN A  1 298 ? 66.987  149.308 60.869  1.00 26.90 ? 323 GLN A NE2 1 
ATOM   2368  N N   . VAL A  1 299 ? 72.053  144.466 62.182  1.00 16.61 ? 324 VAL A N   1 
ATOM   2369  C CA  . VAL A  1 299 ? 73.038  143.492 61.703  1.00 16.30 ? 324 VAL A CA  1 
ATOM   2370  C C   . VAL A  1 299 ? 73.103  142.295 62.678  1.00 16.94 ? 324 VAL A C   1 
ATOM   2371  O O   . VAL A  1 299 ? 72.694  142.404 63.844  1.00 16.72 ? 324 VAL A O   1 
ATOM   2372  C CB  . VAL A  1 299 ? 74.443  144.132 61.560  1.00 16.01 ? 324 VAL A CB  1 
ATOM   2373  C CG1 . VAL A  1 299 ? 74.487  145.130 60.396  1.00 15.23 ? 324 VAL A CG1 1 
ATOM   2374  C CG2 . VAL A  1 299 ? 74.867  144.814 62.867  1.00 15.26 ? 324 VAL A CG2 1 
ATOM   2375  N N   . PRO A  1 300 ? 73.637  141.156 62.206  1.00 16.49 ? 325 PRO A N   1 
ATOM   2376  C CA  . PRO A  1 300 ? 73.716  139.967 63.049  1.00 16.79 ? 325 PRO A CA  1 
ATOM   2377  C C   . PRO A  1 300 ? 75.065  139.764 63.734  1.00 16.43 ? 325 PRO A C   1 
ATOM   2378  O O   . PRO A  1 300 ? 76.101  140.198 63.231  1.00 15.14 ? 325 PRO A O   1 
ATOM   2379  C CB  . PRO A  1 300 ? 73.487  138.821 62.044  1.00 17.23 ? 325 PRO A CB  1 
ATOM   2380  C CG  . PRO A  1 300 ? 74.148  139.340 60.779  1.00 16.90 ? 325 PRO A CG  1 
ATOM   2381  C CD  . PRO A  1 300 ? 74.020  140.877 60.805  1.00 16.04 ? 325 PRO A CD  1 
ATOM   2382  N N   . TYR A  1 301 ? 75.051  139.088 64.878  1.00 16.83 ? 326 TYR A N   1 
ATOM   2383  C CA  . TYR A  1 301 ? 76.280  138.477 65.375  1.00 17.44 ? 326 TYR A CA  1 
ATOM   2384  C C   . TYR A  1 301 ? 75.973  137.028 65.735  1.00 17.85 ? 326 TYR A C   1 
ATOM   2385  O O   . TYR A  1 301 ? 74.797  136.648 65.845  1.00 18.75 ? 326 TYR A O   1 
ATOM   2386  C CB  . TYR A  1 301 ? 76.848  139.243 66.559  1.00 17.79 ? 326 TYR A CB  1 
ATOM   2387  C CG  . TYR A  1 301 ? 76.017  139.186 67.817  1.00 19.27 ? 326 TYR A CG  1 
ATOM   2388  C CD1 . TYR A  1 301 ? 74.987  140.104 68.047  1.00 19.40 ? 326 TYR A CD1 1 
ATOM   2389  C CD2 . TYR A  1 301 ? 76.270  138.218 68.794  1.00 20.20 ? 326 TYR A CD2 1 
ATOM   2390  C CE1 . TYR A  1 301 ? 74.225  140.055 69.213  1.00 20.44 ? 326 TYR A CE1 1 
ATOM   2391  C CE2 . TYR A  1 301 ? 75.516  138.169 69.968  1.00 21.51 ? 326 TYR A CE2 1 
ATOM   2392  C CZ  . TYR A  1 301 ? 74.506  139.097 70.174  1.00 23.32 ? 326 TYR A CZ  1 
ATOM   2393  O OH  . TYR A  1 301 ? 73.758  139.046 71.335  1.00 24.80 ? 326 TYR A OH  1 
ATOM   2394  N N   . ALA A  1 302 ? 77.010  136.211 65.889  1.00 17.64 ? 327 ALA A N   1 
ATOM   2395  C CA  . ALA A  1 302 ? 76.803  134.788 66.201  1.00 18.42 ? 327 ALA A CA  1 
ATOM   2396  C C   . ALA A  1 302 ? 77.818  134.380 67.235  1.00 19.49 ? 327 ALA A C   1 
ATOM   2397  O O   . ALA A  1 302 ? 78.942  134.916 67.254  1.00 19.37 ? 327 ALA A O   1 
ATOM   2398  C CB  . ALA A  1 302 ? 76.971  133.924 64.933  1.00 18.04 ? 327 ALA A CB  1 
ATOM   2399  N N   . VAL A  1 303 ? 77.414  133.434 68.082  1.00 20.73 ? 328 VAL A N   1 
ATOM   2400  C CA  . VAL A  1 303 ? 78.242  132.926 69.171  1.00 21.26 ? 328 VAL A CA  1 
ATOM   2401  C C   . VAL A  1 303 ? 78.292  131.401 69.102  1.00 22.00 ? 328 VAL A C   1 
ATOM   2402  O O   . VAL A  1 303 ? 77.263  130.714 68.909  1.00 21.98 ? 328 VAL A O   1 
ATOM   2403  C CB  . VAL A  1 303 ? 77.672  133.347 70.545  1.00 22.25 ? 328 VAL A CB  1 
ATOM   2404  C CG1 . VAL A  1 303 ? 78.579  132.853 71.687  1.00 23.66 ? 328 VAL A CG1 1 
ATOM   2405  C CG2 . VAL A  1 303 ? 77.555  134.866 70.602  1.00 22.62 ? 328 VAL A CG2 1 
ATOM   2406  N N   . LYS A  1 304 ? 79.499  130.865 69.214  1.00 22.35 ? 329 LYS A N   1 
ATOM   2407  C CA  . LYS A  1 304 ? 79.666  129.421 69.321  1.00 23.54 ? 329 LYS A CA  1 
ATOM   2408  C C   . LYS A  1 304 ? 80.867  129.181 70.239  1.00 24.54 ? 329 LYS A C   1 
ATOM   2409  O O   . LYS A  1 304 ? 81.972  129.671 69.969  1.00 23.94 ? 329 LYS A O   1 
ATOM   2410  C CB  . LYS A  1 304 ? 79.876  128.784 67.939  1.00 22.56 ? 329 LYS A CB  1 
ATOM   2411  C CG  . LYS A  1 304 ? 79.825  127.238 67.963  1.00 24.90 ? 329 LYS A CG  1 
ATOM   2412  C CD  . LYS A  1 304 ? 80.853  126.638 66.998  1.00 27.69 ? 329 LYS A CD  1 
ATOM   2413  C CE  . LYS A  1 304 ? 80.388  126.721 65.575  1.00 26.27 ? 329 LYS A CE  1 
ATOM   2414  N NZ  . LYS A  1 304 ? 81.363  126.277 64.545  1.00 23.96 ? 329 LYS A NZ  1 
ATOM   2415  N N   . GLY A  1 305 ? 80.633  128.478 71.342  1.00 26.10 ? 330 GLY A N   1 
ATOM   2416  C CA  . GLY A  1 305 ? 81.668  128.266 72.362  1.00 27.43 ? 330 GLY A CA  1 
ATOM   2417  C C   . GLY A  1 305 ? 82.070  129.631 72.893  1.00 27.27 ? 330 GLY A C   1 
ATOM   2418  O O   . GLY A  1 305 ? 81.206  130.446 73.213  1.00 27.68 ? 330 GLY A O   1 
ATOM   2419  N N   . ASN A  1 306 ? 83.373  129.906 72.962  1.00 27.24 ? 331 ASN A N   1 
ATOM   2420  C CA  . ASN A  1 306 ? 83.834  131.211 73.439  1.00 26.49 ? 331 ASN A CA  1 
ATOM   2421  C C   . ASN A  1 306 ? 84.068  132.224 72.295  1.00 24.89 ? 331 ASN A C   1 
ATOM   2422  O O   . ASN A  1 306 ? 84.658  133.289 72.494  1.00 24.16 ? 331 ASN A O   1 
ATOM   2423  C CB  . ASN A  1 306 ? 85.053  131.063 74.374  1.00 27.50 ? 331 ASN A CB  1 
ATOM   2424  C CG  . ASN A  1 306 ? 86.317  130.611 73.650  1.00 29.23 ? 331 ASN A CG  1 
ATOM   2425  O OD1 . ASN A  1 306 ? 86.296  130.319 72.464  1.00 27.95 ? 331 ASN A OD1 1 
ATOM   2426  N ND2 . ASN A  1 306 ? 87.440  130.565 74.381  1.00 31.40 ? 331 ASN A ND2 1 
ATOM   2427  N N   . GLN A  1 307 ? 83.586  131.897 71.096  1.00 23.42 ? 332 GLN A N   1 
ATOM   2428  C CA  . GLN A  1 307 ? 83.792  132.781 69.949  1.00 21.74 ? 332 GLN A CA  1 
ATOM   2429  C C   . GLN A  1 307 ? 82.552  133.632 69.616  1.00 20.88 ? 332 GLN A C   1 
ATOM   2430  O O   . GLN A  1 307 ? 81.426  133.114 69.558  1.00 21.17 ? 332 GLN A O   1 
ATOM   2431  C CB  . GLN A  1 307 ? 84.241  131.962 68.734  1.00 21.28 ? 332 GLN A CB  1 
ATOM   2432  C CG  . GLN A  1 307 ? 85.553  131.173 69.003  1.00 24.02 ? 332 GLN A CG  1 
ATOM   2433  C CD  . GLN A  1 307 ? 86.752  132.087 69.161  1.00 23.42 ? 332 GLN A CD  1 
ATOM   2434  O OE1 . GLN A  1 307 ? 87.323  132.208 70.259  1.00 28.60 ? 332 GLN A OE1 1 
ATOM   2435  N NE2 . GLN A  1 307 ? 87.157  132.722 68.073  1.00 18.47 ? 332 GLN A NE2 1 
ATOM   2436  N N   . TRP A  1 308 ? 82.782  134.921 69.368  1.00 19.91 ? 333 TRP A N   1 
ATOM   2437  C CA  . TRP A  1 308 ? 81.737  135.908 69.070  1.00 19.28 ? 333 TRP A CA  1 
ATOM   2438  C C   . TRP A  1 308 ? 82.139  136.595 67.775  1.00 18.48 ? 333 TRP A C   1 
ATOM   2439  O O   . TRP A  1 308 ? 83.242  137.129 67.669  1.00 18.51 ? 333 TRP A O   1 
ATOM   2440  C CB  . TRP A  1 308 ? 81.692  136.944 70.211  1.00 19.45 ? 333 TRP A CB  1 
ATOM   2441  C CG  . TRP A  1 308 ? 80.521  137.902 70.259  1.00 19.14 ? 333 TRP A CG  1 
ATOM   2442  C CD1 . TRP A  1 308 ? 79.472  137.863 71.140  1.00 20.34 ? 333 TRP A CD1 1 
ATOM   2443  C CD2 . TRP A  1 308 ? 80.323  139.092 69.461  1.00 18.10 ? 333 TRP A CD2 1 
ATOM   2444  N NE1 . TRP A  1 308 ? 78.622  138.929 70.917  1.00 19.61 ? 333 TRP A NE1 1 
ATOM   2445  C CE2 . TRP A  1 308 ? 79.124  139.697 69.902  1.00 18.57 ? 333 TRP A CE2 1 
ATOM   2446  C CE3 . TRP A  1 308 ? 81.036  139.691 68.413  1.00 17.12 ? 333 TRP A CE3 1 
ATOM   2447  C CZ2 . TRP A  1 308 ? 78.610  140.872 69.319  1.00 18.74 ? 333 TRP A CZ2 1 
ATOM   2448  C CZ3 . TRP A  1 308 ? 80.526  140.844 67.834  1.00 17.38 ? 333 TRP A CZ3 1 
ATOM   2449  C CH2 . TRP A  1 308 ? 79.329  141.431 68.301  1.00 17.10 ? 333 TRP A CH2 1 
ATOM   2450  N N   . VAL A  1 309 ? 81.256  136.576 66.781  1.00 17.81 ? 334 VAL A N   1 
ATOM   2451  C CA  . VAL A  1 309 ? 81.601  137.107 65.485  1.00 16.61 ? 334 VAL A CA  1 
ATOM   2452  C C   . VAL A  1 309 ? 80.514  138.064 65.019  1.00 16.60 ? 334 VAL A C   1 
ATOM   2453  O O   . VAL A  1 309 ? 79.337  137.685 64.949  1.00 15.96 ? 334 VAL A O   1 
ATOM   2454  C CB  . VAL A  1 309 ? 81.762  135.979 64.445  1.00 17.01 ? 334 VAL A CB  1 
ATOM   2455  C CG1 . VAL A  1 309 ? 82.068  136.566 63.052  1.00 16.45 ? 334 VAL A CG1 1 
ATOM   2456  C CG2 . VAL A  1 309 ? 82.838  135.017 64.869  1.00 16.36 ? 334 VAL A CG2 1 
ATOM   2457  N N   . GLY A  1 310 ? 80.901  139.299 64.706  1.00 15.47 ? 335 GLY A N   1 
ATOM   2458  C CA  . GLY A  1 310 ? 79.944  140.256 64.145  1.00 15.62 ? 335 GLY A CA  1 
ATOM   2459  C C   . GLY A  1 310 ? 80.182  140.300 62.653  1.00 15.52 ? 335 GLY A C   1 
ATOM   2460  O O   . GLY A  1 310 ? 81.313  140.498 62.225  1.00 15.33 ? 335 GLY A O   1 
ATOM   2461  N N   . TYR A  1 311 ? 79.126  140.108 61.861  1.00 14.52 ? 336 TYR A N   1 
ATOM   2462  C CA  . TYR A  1 311 ? 79.330  139.947 60.423  1.00 14.72 ? 336 TYR A CA  1 
ATOM   2463  C C   . TYR A  1 311 ? 78.119  140.478 59.647  1.00 14.85 ? 336 TYR A C   1 
ATOM   2464  O O   . TYR A  1 311 ? 77.129  140.943 60.237  1.00 15.13 ? 336 TYR A O   1 
ATOM   2465  C CB  . TYR A  1 311 ? 79.577  138.453 60.084  1.00 14.89 ? 336 TYR A CB  1 
ATOM   2466  C CG  . TYR A  1 311 ? 78.339  137.624 60.348  1.00 16.45 ? 336 TYR A CG  1 
ATOM   2467  C CD1 . TYR A  1 311 ? 78.006  137.251 61.641  1.00 15.92 ? 336 TYR A CD1 1 
ATOM   2468  C CD2 . TYR A  1 311 ? 77.469  137.277 59.312  1.00 16.22 ? 336 TYR A CD2 1 
ATOM   2469  C CE1 . TYR A  1 311 ? 76.885  136.513 61.909  1.00 17.87 ? 336 TYR A CE1 1 
ATOM   2470  C CE2 . TYR A  1 311 ? 76.333  136.528 59.566  1.00 17.45 ? 336 TYR A CE2 1 
ATOM   2471  C CZ  . TYR A  1 311 ? 76.049  136.150 60.874  1.00 18.45 ? 336 TYR A CZ  1 
ATOM   2472  O OH  . TYR A  1 311 ? 74.914  135.442 61.171  1.00 17.99 ? 336 TYR A OH  1 
ATOM   2473  N N   . ASP A  1 312 ? 78.222  140.443 58.323  1.00 15.12 ? 337 ASP A N   1 
ATOM   2474  C CA  . ASP A  1 312 ? 77.146  140.863 57.451  1.00 16.16 ? 337 ASP A CA  1 
ATOM   2475  C C   . ASP A  1 312 ? 76.658  139.675 56.622  1.00 16.01 ? 337 ASP A C   1 
ATOM   2476  O O   . ASP A  1 312 ? 77.454  138.817 56.186  1.00 16.38 ? 337 ASP A O   1 
ATOM   2477  C CB  . ASP A  1 312 ? 77.630  142.017 56.527  1.00 15.74 ? 337 ASP A CB  1 
ATOM   2478  C CG  . ASP A  1 312 ? 77.481  143.379 57.176  1.00 17.68 ? 337 ASP A CG  1 
ATOM   2479  O OD1 . ASP A  1 312 ? 76.364  143.957 57.099  1.00 19.72 ? 337 ASP A OD1 1 
ATOM   2480  O OD2 . ASP A  1 312 ? 78.473  143.860 57.799  1.00 17.90 ? 337 ASP A OD2 1 
ATOM   2481  N N   . ASP A  1 313 ? 75.350  139.622 56.393  1.00 15.93 ? 338 ASP A N   1 
ATOM   2482  C CA  . ASP A  1 313 ? 74.757  138.547 55.591  1.00 16.83 ? 338 ASP A CA  1 
ATOM   2483  C C   . ASP A  1 313 ? 73.827  139.128 54.513  1.00 17.67 ? 338 ASP A C   1 
ATOM   2484  O O   . ASP A  1 313 ? 73.776  140.368 54.331  1.00 17.34 ? 338 ASP A O   1 
ATOM   2485  C CB  . ASP A  1 313 ? 74.052  137.499 56.468  1.00 17.65 ? 338 ASP A CB  1 
ATOM   2486  C CG  . ASP A  1 313 ? 72.912  138.082 57.287  1.00 20.31 ? 338 ASP A CG  1 
ATOM   2487  O OD1 . ASP A  1 313 ? 72.583  139.274 57.089  1.00 18.40 ? 338 ASP A OD1 1 
ATOM   2488  O OD2 . ASP A  1 313 ? 72.319  137.343 58.122  1.00 21.10 ? 338 ASP A OD2 1 
ATOM   2489  N N   . VAL A  1 314 ? 73.146  138.261 53.761  1.00 17.35 ? 339 VAL A N   1 
ATOM   2490  C CA  . VAL A  1 314 ? 72.307  138.763 52.680  1.00 18.83 ? 339 VAL A CA  1 
ATOM   2491  C C   . VAL A  1 314 ? 71.287  139.776 53.208  1.00 18.92 ? 339 VAL A C   1 
ATOM   2492  O O   . VAL A  1 314 ? 71.115  140.869 52.644  1.00 18.45 ? 339 VAL A O   1 
ATOM   2493  C CB  . VAL A  1 314 ? 71.650  137.606 51.886  1.00 19.22 ? 339 VAL A CB  1 
ATOM   2494  C CG1 . VAL A  1 314 ? 70.556  138.115 50.957  1.00 21.73 ? 339 VAL A CG1 1 
ATOM   2495  C CG2 . VAL A  1 314 ? 72.778  136.837 51.098  1.00 19.03 ? 339 VAL A CG2 1 
ATOM   2496  N N   . LYS A  1 315 ? 70.644  139.430 54.314  1.00 19.67 ? 340 LYS A N   1 
ATOM   2497  C CA  . LYS A  1 315 ? 69.621  140.301 54.890  1.00 21.04 ? 340 LYS A CA  1 
ATOM   2498  C C   . LYS A  1 315 ? 70.159  141.674 55.331  1.00 20.36 ? 340 LYS A C   1 
ATOM   2499  O O   . LYS A  1 315 ? 69.552  142.708 55.065  1.00 19.45 ? 340 LYS A O   1 
ATOM   2500  C CB  . LYS A  1 315 ? 68.981  139.612 56.071  1.00 21.96 ? 340 LYS A CB  1 
ATOM   2501  C CG  . LYS A  1 315 ? 67.582  139.072 55.809  1.00 28.35 ? 340 LYS A CG  1 
ATOM   2502  C CD  . LYS A  1 315 ? 67.012  138.293 57.026  1.00 33.68 ? 340 LYS A CD  1 
ATOM   2503  C CE  . LYS A  1 315 ? 66.246  139.189 58.036  1.00 37.48 ? 340 LYS A CE  1 
ATOM   2504  N NZ  . LYS A  1 315 ? 66.174  138.521 59.372  1.00 40.53 ? 340 LYS A NZ  1 
ATOM   2505  N N   . SER A  1 316 ? 71.290  141.692 56.019  1.00 19.62 ? 341 SER A N   1 
ATOM   2506  C CA  . SER A  1 316 ? 71.797  142.969 56.506  1.00 19.84 ? 341 SER A CA  1 
ATOM   2507  C C   . SER A  1 316 ? 72.268  143.811 55.319  1.00 19.70 ? 341 SER A C   1 
ATOM   2508  O O   . SER A  1 316 ? 72.078  145.032 55.295  1.00 19.85 ? 341 SER A O   1 
ATOM   2509  C CB  . SER A  1 316 ? 72.881  142.763 57.573  1.00 19.27 ? 341 SER A CB  1 
ATOM   2510  O OG  . SER A  1 316 ? 74.081  142.349 56.984  1.00 18.74 ? 341 SER A OG  1 
ATOM   2511  N N   . MET A  1 317 ? 72.809  143.157 54.297  1.00 19.60 ? 342 MET A N   1 
ATOM   2512  C CA  . MET A  1 317 ? 73.152  143.900 53.087  1.00 19.58 ? 342 MET A CA  1 
ATOM   2513  C C   . MET A  1 317 ? 71.954  144.488 52.319  1.00 19.63 ? 342 MET A C   1 
ATOM   2514  O O   . MET A  1 317 ? 72.048  145.580 51.802  1.00 19.36 ? 342 MET A O   1 
ATOM   2515  C CB  . MET A  1 317 ? 74.061  143.098 52.207  1.00 19.30 ? 342 MET A CB  1 
ATOM   2516  C CG  . MET A  1 317 ? 75.440  142.968 52.880  1.00 20.01 ? 342 MET A CG  1 
ATOM   2517  S SD  . MET A  1 317 ? 76.554  142.170 51.752  1.00 20.65 ? 342 MET A SD  1 
ATOM   2518  C CE  . MET A  1 317 ? 77.879  141.768 52.906  1.00 20.41 ? 342 MET A CE  1 
ATOM   2519  N N   . GLU A  1 318 ? 70.840  143.780 52.274  1.00 19.63 ? 343 GLU A N   1 
ATOM   2520  C CA  . GLU A  1 318 ? 69.652  144.306 51.620  1.00 20.82 ? 343 GLU A CA  1 
ATOM   2521  C C   . GLU A  1 318 ? 69.200  145.578 52.356  1.00 20.02 ? 343 GLU A C   1 
ATOM   2522  O O   . GLU A  1 318 ? 68.826  146.554 51.738  1.00 19.77 ? 343 GLU A O   1 
ATOM   2523  C CB  . GLU A  1 318 ? 68.548  143.228 51.551  1.00 22.45 ? 343 GLU A CB  1 
ATOM   2524  C CG  . GLU A  1 318 ? 68.940  142.092 50.549  1.00 25.83 ? 343 GLU A CG  1 
ATOM   2525  C CD  . GLU A  1 318 ? 67.966  140.917 50.516  1.00 30.97 ? 343 GLU A CD  1 
ATOM   2526  O OE1 . GLU A  1 318 ? 67.243  140.704 51.513  1.00 32.94 ? 343 GLU A OE1 1 
ATOM   2527  O OE2 . GLU A  1 318 ? 67.943  140.197 49.488  1.00 33.18 ? 343 GLU A OE2 1 
ATOM   2528  N N   . THR A  1 319 ? 69.274  145.569 53.681  1.00 18.76 ? 344 THR A N   1 
ATOM   2529  C CA  . THR A  1 319 ? 68.904  146.744 54.458  1.00 18.77 ? 344 THR A CA  1 
ATOM   2530  C C   . THR A  1 319 ? 69.875  147.889 54.177  1.00 17.72 ? 344 THR A C   1 
ATOM   2531  O O   . THR A  1 319 ? 69.451  149.033 54.014  1.00 17.84 ? 344 THR A O   1 
ATOM   2532  C CB  . THR A  1 319 ? 68.822  146.407 55.976  1.00 19.85 ? 344 THR A CB  1 
ATOM   2533  O OG1 . THR A  1 319 ? 67.811  145.392 56.155  1.00 19.49 ? 344 THR A OG1 1 
ATOM   2534  C CG2 . THR A  1 319 ? 68.413  147.619 56.788  1.00 18.74 ? 344 THR A CG2 1 
ATOM   2535  N N   . LYS A  1 320 ? 71.172  147.580 54.083  1.00 16.34 ? 345 LYS A N   1 
ATOM   2536  C CA  . LYS A  1 320 ? 72.166  148.614 53.799  1.00 16.03 ? 345 LYS A CA  1 
ATOM   2537  C C   . LYS A  1 320 ? 71.932  149.220 52.414  1.00 16.32 ? 345 LYS A C   1 
ATOM   2538  O O   . LYS A  1 320 ? 72.087  150.423 52.226  1.00 17.03 ? 345 LYS A O   1 
ATOM   2539  C CB  . LYS A  1 320 ? 73.596  148.065 53.941  1.00 14.45 ? 345 LYS A CB  1 
ATOM   2540  C CG  . LYS A  1 320 ? 73.954  147.905 55.405  1.00 14.78 ? 345 LYS A CG  1 
ATOM   2541  C CD  . LYS A  1 320 ? 75.340  147.310 55.609  1.00 15.27 ? 345 LYS A CD  1 
ATOM   2542  C CE  . LYS A  1 320 ? 75.723  147.317 57.114  1.00 14.48 ? 345 LYS A CE  1 
ATOM   2543  N NZ  . LYS A  1 320 ? 76.997  146.570 57.347  1.00 16.11 ? 345 LYS A NZ  1 
ATOM   2544  N N   . VAL A  1 321 ? 71.534  148.402 51.447  1.00 15.84 ? 346 VAL A N   1 
ATOM   2545  C CA  . VAL A  1 321 ? 71.203  148.966 50.144  1.00 16.45 ? 346 VAL A CA  1 
ATOM   2546  C C   . VAL A  1 321 ? 69.923  149.830 50.212  1.00 17.16 ? 346 VAL A C   1 
ATOM   2547  O O   . VAL A  1 321 ? 69.833  150.858 49.543  1.00 17.26 ? 346 VAL A O   1 
ATOM   2548  C CB  . VAL A  1 321 ? 71.029  147.868 49.070  1.00 17.25 ? 346 VAL A CB  1 
ATOM   2549  C CG1 . VAL A  1 321 ? 70.417  148.453 47.789  1.00 18.29 ? 346 VAL A CG1 1 
ATOM   2550  C CG2 . VAL A  1 321 ? 72.360  147.181 48.787  1.00 16.52 ? 346 VAL A CG2 1 
ATOM   2551  N N   . GLN A  1 322 ? 68.931  149.451 51.021  1.00 17.58 ? 347 GLN A N   1 
ATOM   2552  C CA  . GLN A  1 322 ? 67.720  150.313 51.105  1.00 19.25 ? 347 GLN A CA  1 
ATOM   2553  C C   . GLN A  1 322 ? 68.124  151.675 51.647  1.00 17.75 ? 347 GLN A C   1 
ATOM   2554  O O   . GLN A  1 322 ? 67.630  152.720 51.196  1.00 17.62 ? 347 GLN A O   1 
ATOM   2555  C CB  . GLN A  1 322 ? 66.616  149.710 51.998  1.00 20.66 ? 347 GLN A CB  1 
ATOM   2556  C CG  . GLN A  1 322 ? 66.145  148.357 51.532  1.00 26.55 ? 347 GLN A CG  1 
ATOM   2557  C CD  . GLN A  1 322 ? 65.896  148.342 50.042  1.00 33.89 ? 347 GLN A CD  1 
ATOM   2558  O OE1 . GLN A  1 322 ? 65.066  149.107 49.536  1.00 36.57 ? 347 GLN A OE1 1 
ATOM   2559  N NE2 . GLN A  1 322 ? 66.634  147.478 49.317  1.00 35.92 ? 347 GLN A NE2 1 
ATOM   2560  N N   . PHE A  1 323 ? 69.004  151.649 52.643  1.00 16.02 ? 348 PHE A N   1 
ATOM   2561  C CA  . PHE A  1 323 ? 69.567  152.882 53.232  1.00 16.02 ? 348 PHE A CA  1 
ATOM   2562  C C   . PHE A  1 323 ? 70.296  153.739 52.199  1.00 15.70 ? 348 PHE A C   1 
ATOM   2563  O O   . PHE A  1 323 ? 70.023  154.939 52.055  1.00 16.29 ? 348 PHE A O   1 
ATOM   2564  C CB  . PHE A  1 323 ? 70.504  152.554 54.431  1.00 14.78 ? 348 PHE A CB  1 
ATOM   2565  C CG  . PHE A  1 323 ? 71.331  153.741 54.920  1.00 16.66 ? 348 PHE A CG  1 
ATOM   2566  C CD1 . PHE A  1 323 ? 70.813  154.639 55.850  1.00 18.69 ? 348 PHE A CD1 1 
ATOM   2567  C CD2 . PHE A  1 323 ? 72.635  153.936 54.464  1.00 15.96 ? 348 PHE A CD2 1 
ATOM   2568  C CE1 . PHE A  1 323 ? 71.576  155.730 56.314  1.00 19.54 ? 348 PHE A CE1 1 
ATOM   2569  C CE2 . PHE A  1 323 ? 73.385  155.019 54.912  1.00 16.36 ? 348 PHE A CE2 1 
ATOM   2570  C CZ  . PHE A  1 323 ? 72.862  155.901 55.838  1.00 18.10 ? 348 PHE A CZ  1 
ATOM   2571  N N   . LEU A  1 324 ? 71.230  153.145 51.463  1.00 15.04 ? 349 LEU A N   1 
ATOM   2572  C CA  . LEU A  1 324 ? 71.981  153.937 50.459  1.00 15.57 ? 349 LEU A CA  1 
ATOM   2573  C C   . LEU A  1 324 ? 71.073  154.576 49.376  1.00 17.23 ? 349 LEU A C   1 
ATOM   2574  O O   . LEU A  1 324 ? 71.266  155.733 48.975  1.00 17.27 ? 349 LEU A O   1 
ATOM   2575  C CB  . LEU A  1 324 ? 73.146  153.110 49.866  1.00 15.10 ? 349 LEU A CB  1 
ATOM   2576  C CG  . LEU A  1 324 ? 72.933  152.134 48.707  1.00 16.23 ? 349 LEU A CG  1 
ATOM   2577  C CD1 . LEU A  1 324 ? 72.905  152.928 47.375  1.00 17.79 ? 349 LEU A CD1 1 
ATOM   2578  C CD2 . LEU A  1 324 ? 74.086  151.133 48.701  1.00 15.75 ? 349 LEU A CD2 1 
ATOM   2579  N N   . LYS A  1 325 ? 70.055  153.853 48.929  1.00 18.37 ? 350 LYS A N   1 
ATOM   2580  C CA  . LYS A  1 325 ? 69.124  154.423 47.980  1.00 20.74 ? 350 LYS A CA  1 
ATOM   2581  C C   . LYS A  1 325 ? 68.349  155.573 48.611  1.00 22.24 ? 350 LYS A C   1 
ATOM   2582  O O   . LYS A  1 325 ? 68.074  156.602 47.978  1.00 22.36 ? 350 LYS A O   1 
ATOM   2583  C CB  . LYS A  1 325 ? 68.116  153.361 47.514  1.00 21.63 ? 350 LYS A CB  1 
ATOM   2584  C CG  . LYS A  1 325 ? 68.747  152.171 46.761  1.00 22.92 ? 350 LYS A CG  1 
ATOM   2585  C CD  . LYS A  1 325 ? 67.594  151.352 46.113  1.00 26.40 ? 350 LYS A CD  1 
ATOM   2586  C CE  . LYS A  1 325 ? 68.087  150.590 44.908  1.00 27.80 ? 350 LYS A CE  1 
ATOM   2587  N NZ  . LYS A  1 325 ? 66.986  149.790 44.316  1.00 29.43 ? 350 LYS A NZ  1 
ATOM   2588  N N   . ASN A  1 326 ? 67.943  155.374 49.853  1.00 22.35 ? 351 ASN A N   1 
ATOM   2589  C CA  . ASN A  1 326 ? 67.117  156.371 50.509  1.00 23.83 ? 351 ASN A CA  1 
ATOM   2590  C C   . ASN A  1 326 ? 67.909  157.667 50.690  1.00 23.10 ? 351 ASN A C   1 
ATOM   2591  O O   . ASN A  1 326 ? 67.358  158.768 50.652  1.00 22.74 ? 351 ASN A O   1 
ATOM   2592  C CB  . ASN A  1 326 ? 66.711  155.829 51.866  1.00 24.67 ? 351 ASN A CB  1 
ATOM   2593  C CG  . ASN A  1 326 ? 65.668  156.669 52.521  1.00 28.37 ? 351 ASN A CG  1 
ATOM   2594  O OD1 . ASN A  1 326 ? 65.920  157.252 53.570  1.00 32.95 ? 351 ASN A OD1 1 
ATOM   2595  N ND2 . ASN A  1 326 ? 64.481  156.744 51.914  1.00 29.62 ? 351 ASN A ND2 1 
ATOM   2596  N N   . LEU A  1 327 ? 69.209  157.532 50.915  1.00 21.35 ? 352 LEU A N   1 
ATOM   2597  C CA  . LEU A  1 327 ? 70.060  158.712 51.072  1.00 21.46 ? 352 LEU A CA  1 
ATOM   2598  C C   . LEU A  1 327 ? 70.637  159.227 49.756  1.00 20.83 ? 352 LEU A C   1 
ATOM   2599  O O   . LEU A  1 327 ? 71.451  160.145 49.752  1.00 20.79 ? 352 LEU A O   1 
ATOM   2600  C CB  . LEU A  1 327 ? 71.179  158.446 52.073  1.00 21.07 ? 352 LEU A CB  1 
ATOM   2601  C CG  . LEU A  1 327 ? 70.729  158.948 53.444  1.00 24.66 ? 352 LEU A CG  1 
ATOM   2602  C CD1 . LEU A  1 327 ? 69.725  157.961 54.080  1.00 22.85 ? 352 LEU A CD1 1 
ATOM   2603  C CD2 . LEU A  1 327 ? 71.923  159.163 54.334  1.00 25.77 ? 352 LEU A CD2 1 
ATOM   2604  N N   . ASN A  1 328 ? 70.210  158.644 48.646  1.00 20.02 ? 353 ASN A N   1 
ATOM   2605  C CA  . ASN A  1 328 ? 70.703  159.052 47.330  1.00 20.69 ? 353 ASN A CA  1 
ATOM   2606  C C   . ASN A  1 328 ? 72.222  159.049 47.235  1.00 18.63 ? 353 ASN A C   1 
ATOM   2607  O O   . ASN A  1 328 ? 72.817  160.006 46.746  1.00 18.83 ? 353 ASN A O   1 
ATOM   2608  C CB  . ASN A  1 328 ? 70.165  160.443 46.968  1.00 22.17 ? 353 ASN A CB  1 
ATOM   2609  C CG  . ASN A  1 328 ? 68.643  160.495 46.959  1.00 25.84 ? 353 ASN A CG  1 
ATOM   2610  O OD1 . ASN A  1 328 ? 68.023  161.248 47.723  1.00 29.99 ? 353 ASN A OD1 1 
ATOM   2611  N ND2 . ASN A  1 328 ? 68.037  159.700 46.097  1.00 25.97 ? 353 ASN A ND2 1 
ATOM   2612  N N   . LEU A  1 329 ? 72.847  157.969 47.698  1.00 16.83 ? 354 LEU A N   1 
ATOM   2613  C CA  . LEU A  1 329 ? 74.280  157.824 47.607  1.00 15.66 ? 354 LEU A CA  1 
ATOM   2614  C C   . LEU A  1 329 ? 74.645  157.363 46.187  1.00 16.62 ? 354 LEU A C   1 
ATOM   2615  O O   . LEU A  1 329 ? 73.763  157.047 45.392  1.00 16.34 ? 354 LEU A O   1 
ATOM   2616  C CB  . LEU A  1 329 ? 74.761  156.795 48.648  1.00 15.18 ? 354 LEU A CB  1 
ATOM   2617  C CG  . LEU A  1 329 ? 74.380  157.058 50.119  1.00 14.62 ? 354 LEU A CG  1 
ATOM   2618  C CD1 . LEU A  1 329 ? 75.184  156.147 51.087  1.00 13.57 ? 354 LEU A CD1 1 
ATOM   2619  C CD2 . LEU A  1 329 ? 74.589  158.568 50.467  1.00 13.33 ? 354 LEU A CD2 1 
ATOM   2620  N N   . GLY A  1 330 ? 75.938  157.321 45.856  1.00 15.88 ? 355 GLY A N   1 
ATOM   2621  C CA  . GLY A  1 330 ? 76.336  156.977 44.479  1.00 17.09 ? 355 GLY A CA  1 
ATOM   2622  C C   . GLY A  1 330 ? 76.343  155.475 44.213  1.00 17.34 ? 355 GLY A C   1 
ATOM   2623  O O   . GLY A  1 330 ? 76.329  155.029 43.060  1.00 18.14 ? 355 GLY A O   1 
ATOM   2624  N N   . GLY A  1 331 ? 76.365  154.689 45.283  1.00 16.68 ? 356 GLY A N   1 
ATOM   2625  C CA  . GLY A  1 331 ? 76.190  153.244 45.160  1.00 16.02 ? 356 GLY A CA  1 
ATOM   2626  C C   . GLY A  1 331 ? 76.811  152.540 46.346  1.00 15.32 ? 356 GLY A C   1 
ATOM   2627  O O   . GLY A  1 331 ? 76.892  153.104 47.441  1.00 14.49 ? 356 GLY A O   1 
ATOM   2628  N N   . ALA A  1 332 ? 77.233  151.297 46.142  1.00 14.82 ? 357 ALA A N   1 
ATOM   2629  C CA  . ALA A  1 332 ? 77.823  150.509 47.221  1.00 14.56 ? 357 ALA A CA  1 
ATOM   2630  C C   . ALA A  1 332 ? 79.224  150.127 46.821  1.00 13.94 ? 357 ALA A C   1 
ATOM   2631  O O   . ALA A  1 332 ? 79.512  149.986 45.636  1.00 14.66 ? 357 ALA A O   1 
ATOM   2632  C CB  . ALA A  1 332 ? 76.978  149.232 47.488  1.00 14.45 ? 357 ALA A CB  1 
ATOM   2633  N N   . MET A  1 333 ? 80.093  149.970 47.810  1.00 13.84 ? 358 MET A N   1 
ATOM   2634  C CA  . MET A  1 333 ? 81.448  149.469 47.579  1.00 13.53 ? 358 MET A CA  1 
ATOM   2635  C C   . MET A  1 333 ? 81.617  148.223 48.426  1.00 13.98 ? 358 MET A C   1 
ATOM   2636  O O   . MET A  1 333 ? 81.001  148.111 49.493  1.00 14.51 ? 358 MET A O   1 
ATOM   2637  C CB  . MET A  1 333 ? 82.466  150.519 48.005  1.00 12.67 ? 358 MET A CB  1 
ATOM   2638  C CG  . MET A  1 333 ? 83.926  150.035 48.049  1.00 13.53 ? 358 MET A CG  1 
ATOM   2639  S SD  . MET A  1 333 ? 84.388  149.363 49.638  1.00 15.87 ? 358 MET A SD  1 
ATOM   2640  C CE  . MET A  1 333 ? 84.648  150.882 50.589  1.00 12.68 ? 358 MET A CE  1 
ATOM   2641  N N   . ILE A  1 334 ? 82.434  147.282 47.957  1.00 13.69 ? 359 ILE A N   1 
ATOM   2642  C CA  . ILE A  1 334 ? 82.584  146.021 48.641  1.00 13.88 ? 359 ILE A CA  1 
ATOM   2643  C C   . ILE A  1 334 ? 84.055  145.855 48.992  1.00 13.86 ? 359 ILE A C   1 
ATOM   2644  O O   . ILE A  1 334 ? 84.899  145.843 48.108  1.00 13.47 ? 359 ILE A O   1 
ATOM   2645  C CB  . ILE A  1 334 ? 82.196  144.804 47.724  1.00 14.05 ? 359 ILE A CB  1 
ATOM   2646  C CG1 . ILE A  1 334 ? 80.819  144.986 47.100  1.00 14.53 ? 359 ILE A CG1 1 
ATOM   2647  C CG2 . ILE A  1 334 ? 82.223  143.522 48.539  1.00 14.91 ? 359 ILE A CG2 1 
ATOM   2648  C CD1 . ILE A  1 334 ? 79.694  144.991 48.149  1.00 15.76 ? 359 ILE A CD1 1 
ATOM   2649  N N   . TRP A  1 335 ? 84.355  145.683 50.279  1.00 13.76 ? 360 TRP A N   1 
ATOM   2650  C CA  . TRP A  1 335 ? 85.653  145.155 50.673  1.00 13.12 ? 360 TRP A CA  1 
ATOM   2651  C C   . TRP A  1 335 ? 85.493  143.737 51.287  1.00 14.16 ? 360 TRP A C   1 
ATOM   2652  O O   . TRP A  1 335 ? 85.015  143.621 52.407  1.00 14.47 ? 360 TRP A O   1 
ATOM   2653  C CB  . TRP A  1 335 ? 86.354  146.085 51.671  1.00 12.53 ? 360 TRP A CB  1 
ATOM   2654  C CG  . TRP A  1 335 ? 87.716  145.563 51.957  1.00 13.01 ? 360 TRP A CG  1 
ATOM   2655  C CD1 . TRP A  1 335 ? 88.047  144.584 52.862  1.00 12.47 ? 360 TRP A CD1 1 
ATOM   2656  C CD2 . TRP A  1 335 ? 88.923  145.903 51.270  1.00 12.28 ? 360 TRP A CD2 1 
ATOM   2657  N NE1 . TRP A  1 335 ? 89.393  144.307 52.790  1.00 14.44 ? 360 TRP A NE1 1 
ATOM   2658  C CE2 . TRP A  1 335 ? 89.954  145.101 51.814  1.00 13.51 ? 360 TRP A CE2 1 
ATOM   2659  C CE3 . TRP A  1 335 ? 89.232  146.801 50.235  1.00 13.32 ? 360 TRP A CE3 1 
ATOM   2660  C CZ2 . TRP A  1 335 ? 91.284  145.173 51.362  1.00 14.96 ? 360 TRP A CZ2 1 
ATOM   2661  C CZ3 . TRP A  1 335 ? 90.549  146.856 49.769  1.00 11.79 ? 360 TRP A CZ3 1 
ATOM   2662  C CH2 . TRP A  1 335 ? 91.558  146.064 50.341  1.00 14.33 ? 360 TRP A CH2 1 
ATOM   2663  N N   . SER A  1 336 ? 85.882  142.664 50.589  1.00 13.54 ? 361 SER A N   1 
ATOM   2664  C CA  . SER A  1 336 ? 86.391  142.683 49.207  1.00 14.25 ? 361 SER A CA  1 
ATOM   2665  C C   . SER A  1 336 ? 85.764  141.450 48.529  1.00 14.15 ? 361 SER A C   1 
ATOM   2666  O O   . SER A  1 336 ? 85.337  140.529 49.209  1.00 15.19 ? 361 SER A O   1 
ATOM   2667  C CB  . SER A  1 336 ? 87.934  142.639 49.149  1.00 13.15 ? 361 SER A CB  1 
ATOM   2668  O OG  . SER A  1 336 ? 88.480  141.496 49.805  1.00 15.51 ? 361 SER A OG  1 
ATOM   2669  N N   . ILE A  1 337 ? 85.656  141.441 47.211  1.00 14.31 ? 362 ILE A N   1 
ATOM   2670  C CA  . ILE A  1 337 ? 84.834  140.408 46.577  1.00 15.01 ? 362 ILE A CA  1 
ATOM   2671  C C   . ILE A  1 337 ? 85.517  139.040 46.689  1.00 15.48 ? 362 ILE A C   1 
ATOM   2672  O O   . ILE A  1 337 ? 84.843  138.009 46.649  1.00 16.87 ? 362 ILE A O   1 
ATOM   2673  C CB  . ILE A  1 337 ? 84.498  140.730 45.111  1.00 16.15 ? 362 ILE A CB  1 
ATOM   2674  C CG1 . ILE A  1 337 ? 85.775  140.848 44.249  1.00 15.46 ? 362 ILE A CG1 1 
ATOM   2675  C CG2 . ILE A  1 337 ? 83.641  141.977 45.028  1.00 15.03 ? 362 ILE A CG2 1 
ATOM   2676  C CD1 . ILE A  1 337 ? 85.479  140.861 42.707  1.00 18.81 ? 362 ILE A CD1 1 
ATOM   2677  N N   . ASP A  1 338 ? 86.835  139.036 46.892  1.00 15.65 ? 363 ASP A N   1 
ATOM   2678  C CA  . ASP A  1 338 ? 87.546  137.780 47.110  1.00 16.40 ? 363 ASP A CA  1 
ATOM   2679  C C   . ASP A  1 338 ? 87.338  137.170 48.508  1.00 15.59 ? 363 ASP A C   1 
ATOM   2680  O O   . ASP A  1 338 ? 87.855  136.103 48.809  1.00 15.95 ? 363 ASP A O   1 
ATOM   2681  C CB  . ASP A  1 338 ? 89.032  137.837 46.734  1.00 16.65 ? 363 ASP A CB  1 
ATOM   2682  C CG  . ASP A  1 338 ? 89.730  139.161 47.111  1.00 18.24 ? 363 ASP A CG  1 
ATOM   2683  O OD1 . ASP A  1 338 ? 89.098  140.121 47.638  1.00 16.67 ? 363 ASP A OD1 1 
ATOM   2684  O OD2 . ASP A  1 338 ? 90.956  139.227 46.806  1.00 19.19 ? 363 ASP A OD2 1 
ATOM   2685  N N   . MET A  1 339 ? 86.571  137.849 49.354  1.00 14.89 ? 364 MET A N   1 
ATOM   2686  C CA  . MET A  1 339 ? 86.177  137.245 50.627  1.00 14.69 ? 364 MET A CA  1 
ATOM   2687  C C   . MET A  1 339 ? 84.689  136.941 50.688  1.00 15.07 ? 364 MET A C   1 
ATOM   2688  O O   . MET A  1 339 ? 84.213  136.429 51.692  1.00 15.76 ? 364 MET A O   1 
ATOM   2689  C CB  . MET A  1 339 ? 86.612  138.111 51.821  1.00 14.33 ? 364 MET A CB  1 
ATOM   2690  C CG  . MET A  1 339 ? 88.133  138.231 51.939  1.00 14.94 ? 364 MET A CG  1 
ATOM   2691  S SD  . MET A  1 339 ? 88.638  139.096 53.462  1.00 17.19 ? 364 MET A SD  1 
ATOM   2692  C CE  . MET A  1 339 ? 87.746  140.659 53.224  1.00 14.28 ? 364 MET A CE  1 
ATOM   2693  N N   . ASP A  1 340 ? 83.961  137.225 49.610  1.00 14.39 ? 365 ASP A N   1 
ATOM   2694  C CA  . ASP A  1 340 ? 82.628  136.655 49.440  1.00 15.37 ? 365 ASP A CA  1 
ATOM   2695  C C   . ASP A  1 340 ? 82.875  135.160 49.152  1.00 16.14 ? 365 ASP A C   1 
ATOM   2696  O O   . ASP A  1 340 ? 84.025  134.766 48.927  1.00 16.21 ? 365 ASP A O   1 
ATOM   2697  C CB  . ASP A  1 340 ? 81.925  137.344 48.248  1.00 15.33 ? 365 ASP A CB  1 
ATOM   2698  C CG  . ASP A  1 340 ? 80.414  137.080 48.183  1.00 17.52 ? 365 ASP A CG  1 
ATOM   2699  O OD1 . ASP A  1 340 ? 79.885  136.303 49.017  1.00 17.03 ? 365 ASP A OD1 1 
ATOM   2700  O OD2 . ASP A  1 340 ? 79.761  137.700 47.295  1.00 17.88 ? 365 ASP A OD2 1 
ATOM   2701  N N   . ASP A  1 341 ? 81.830  134.326 49.161  1.00 16.26 ? 366 ASP A N   1 
ATOM   2702  C CA  . ASP A  1 341 ? 82.000  132.941 48.677  1.00 17.23 ? 366 ASP A CA  1 
ATOM   2703  C C   . ASP A  1 341 ? 82.000  132.962 47.145  1.00 18.06 ? 366 ASP A C   1 
ATOM   2704  O O   . ASP A  1 341 ? 81.044  132.545 46.504  1.00 18.19 ? 366 ASP A O   1 
ATOM   2705  C CB  . ASP A  1 341 ? 80.923  132.007 49.250  1.00 17.28 ? 366 ASP A CB  1 
ATOM   2706  C CG  . ASP A  1 341 ? 81.187  130.513 48.942  1.00 19.65 ? 366 ASP A CG  1 
ATOM   2707  O OD1 . ASP A  1 341 ? 82.329  130.158 48.609  1.00 19.14 ? 366 ASP A OD1 1 
ATOM   2708  O OD2 . ASP A  1 341 ? 80.247  129.692 49.051  1.00 19.43 ? 366 ASP A OD2 1 
ATOM   2709  N N   . PHE A  1 342 ? 83.092  133.453 46.552  1.00 18.65 ? 367 PHE A N   1 
ATOM   2710  C CA  . PHE A  1 342 ? 83.120  133.648 45.087  1.00 19.24 ? 367 PHE A CA  1 
ATOM   2711  C C   . PHE A  1 342 ? 82.936  132.351 44.284  1.00 20.79 ? 367 PHE A C   1 
ATOM   2712  O O   . PHE A  1 342 ? 82.351  132.385 43.204  1.00 21.57 ? 367 PHE A O   1 
ATOM   2713  C CB  . PHE A  1 342 ? 84.380  134.415 44.638  1.00 18.01 ? 367 PHE A CB  1 
ATOM   2714  C CG  . PHE A  1 342 ? 85.678  133.766 45.084  1.00 19.15 ? 367 PHE A CG  1 
ATOM   2715  C CD1 . PHE A  1 342 ? 86.223  134.062 46.335  1.00 18.24 ? 367 PHE A CD1 1 
ATOM   2716  C CD2 . PHE A  1 342 ? 86.335  132.853 44.268  1.00 18.74 ? 367 PHE A CD2 1 
ATOM   2717  C CE1 . PHE A  1 342 ? 87.405  133.475 46.754  1.00 16.33 ? 367 PHE A CE1 1 
ATOM   2718  C CE2 . PHE A  1 342 ? 87.520  132.248 44.682  1.00 20.19 ? 367 PHE A CE2 1 
ATOM   2719  C CZ  . PHE A  1 342 ? 88.041  132.539 45.927  1.00 17.86 ? 367 PHE A CZ  1 
ATOM   2720  N N   . THR A  1 343 ? 83.420  131.212 44.787  1.00 21.07 ? 368 THR A N   1 
ATOM   2721  C CA  . THR A  1 343 ? 83.265  129.948 44.046  1.00 22.68 ? 368 THR A CA  1 
ATOM   2722  C C   . THR A  1 343 ? 81.916  129.302 44.327  1.00 23.29 ? 368 THR A C   1 
ATOM   2723  O O   . THR A  1 343 ? 81.469  128.470 43.562  1.00 23.72 ? 368 THR A O   1 
ATOM   2724  C CB  . THR A  1 343 ? 84.365  128.901 44.378  1.00 23.69 ? 368 THR A CB  1 
ATOM   2725  O OG1 . THR A  1 343 ? 84.258  128.508 45.754  1.00 22.37 ? 368 THR A OG1 1 
ATOM   2726  C CG2 . THR A  1 343 ? 85.764  129.472 44.112  1.00 24.54 ? 368 THR A CG2 1 
ATOM   2727  N N   . GLY A  1 344 ? 81.286  129.673 45.441  1.00 22.61 ? 369 GLY A N   1 
ATOM   2728  C CA  . GLY A  1 344 ? 80.008  129.064 45.851  1.00 23.67 ? 369 GLY A CA  1 
ATOM   2729  C C   . GLY A  1 344 ? 80.223  127.736 46.542  1.00 24.95 ? 369 GLY A C   1 
ATOM   2730  O O   . GLY A  1 344 ? 79.272  127.048 46.915  1.00 25.50 ? 369 GLY A O   1 
ATOM   2731  N N   . LYS A  1 345 ? 81.481  127.359 46.729  1.00 25.46 ? 370 LYS A N   1 
ATOM   2732  C CA  . LYS A  1 345 ? 81.768  126.031 47.247  1.00 27.11 ? 370 LYS A CA  1 
ATOM   2733  C C   . LYS A  1 345 ? 81.627  125.900 48.766  1.00 26.51 ? 370 LYS A C   1 
ATOM   2734  O O   . LYS A  1 345 ? 81.692  124.802 49.295  1.00 26.74 ? 370 LYS A O   1 
ATOM   2735  C CB  . LYS A  1 345 ? 83.157  125.545 46.804  1.00 28.11 ? 370 LYS A CB  1 
ATOM   2736  C CG  . LYS A  1 345 ? 83.289  125.311 45.315  1.00 30.93 ? 370 LYS A CG  1 
ATOM   2737  C CD  . LYS A  1 345 ? 82.201  124.378 44.776  1.00 36.40 ? 370 LYS A CD  1 
ATOM   2738  C CE  . LYS A  1 345 ? 82.405  122.909 45.199  1.00 40.42 ? 370 LYS A CE  1 
ATOM   2739  N NZ  . LYS A  1 345 ? 83.636  122.339 44.583  1.00 43.55 ? 370 LYS A NZ  1 
ATOM   2740  N N   . SER A  1 346 ? 81.448  127.003 49.487  1.00 25.18 ? 371 SER A N   1 
ATOM   2741  C CA  . SER A  1 346 ? 81.390  126.887 50.945  1.00 24.70 ? 371 SER A CA  1 
ATOM   2742  C C   . SER A  1 346 ? 79.996  127.053 51.589  1.00 24.66 ? 371 SER A C   1 
ATOM   2743  O O   . SER A  1 346 ? 79.638  126.294 52.502  1.00 25.16 ? 371 SER A O   1 
ATOM   2744  C CB  . SER A  1 346 ? 82.413  127.815 51.617  1.00 24.08 ? 371 SER A CB  1 
ATOM   2745  O OG  . SER A  1 346 ? 82.203  127.839 53.013  1.00 23.85 ? 371 SER A OG  1 
ATOM   2746  N N   . CYS A  1 347 ? 79.216  128.021 51.111  1.00 23.40 ? 372 CYS A N   1 
ATOM   2747  C CA  . CYS A  1 347 ? 78.055  128.501 51.863  1.00 23.51 ? 372 CYS A CA  1 
ATOM   2748  C C   . CYS A  1 347 ? 76.706  127.990 51.357  1.00 23.96 ? 372 CYS A C   1 
ATOM   2749  O O   . CYS A  1 347 ? 75.658  128.400 51.870  1.00 22.88 ? 372 CYS A O   1 
ATOM   2750  C CB  . CYS A  1 347 ? 78.035  130.038 51.897  1.00 22.99 ? 372 CYS A CB  1 
ATOM   2751  S SG  . CYS A  1 347 ? 79.589  130.763 52.532  1.00 24.16 ? 372 CYS A SG  1 
ATOM   2752  N N   . ASN A  1 348 ? 76.739  127.150 50.329  1.00 24.71 ? 373 ASN A N   1 
ATOM   2753  C CA  . ASN A  1 348 ? 75.505  126.610 49.734  1.00 26.36 ? 373 ASN A CA  1 
ATOM   2754  C C   . ASN A  1 348 ? 74.523  127.736 49.409  1.00 25.36 ? 373 ASN A C   1 
ATOM   2755  O O   . ASN A  1 348 ? 73.314  127.609 49.644  1.00 25.22 ? 373 ASN A O   1 
ATOM   2756  C CB  . ASN A  1 348 ? 74.844  125.583 50.664  1.00 26.89 ? 373 ASN A CB  1 
ATOM   2757  C CG  . ASN A  1 348 ? 73.930  124.602 49.914  1.00 30.68 ? 373 ASN A CG  1 
ATOM   2758  O OD1 . ASN A  1 348 ? 72.962  124.095 50.483  1.00 33.61 ? 373 ASN A OD1 1 
ATOM   2759  N ND2 . ASN A  1 348 ? 74.236  124.337 48.639  1.00 29.14 ? 373 ASN A ND2 1 
ATOM   2760  N N   . GLN A  1 349 ? 75.044  128.838 48.866  1.00 23.59 ? 374 GLN A N   1 
ATOM   2761  C CA  . GLN A  1 349 ? 74.172  129.946 48.445  1.00 23.54 ? 374 GLN A CA  1 
ATOM   2762  C C   . GLN A  1 349 ? 74.490  130.399 47.018  1.00 23.15 ? 374 GLN A C   1 
ATOM   2763  O O   . GLN A  1 349 ? 74.111  131.498 46.622  1.00 22.42 ? 374 GLN A O   1 
ATOM   2764  C CB  . GLN A  1 349 ? 74.302  131.160 49.387  1.00 22.64 ? 374 GLN A CB  1 
ATOM   2765  C CG  . GLN A  1 349 ? 73.682  131.006 50.779  1.00 24.58 ? 374 GLN A CG  1 
ATOM   2766  C CD  . GLN A  1 349 ? 74.041  132.182 51.664  1.00 25.84 ? 374 GLN A CD  1 
ATOM   2767  O OE1 . GLN A  1 349 ? 75.134  132.235 52.228  1.00 25.44 ? 374 GLN A OE1 1 
ATOM   2768  N NE2 . GLN A  1 349 ? 73.135  133.137 51.771  1.00 23.88 ? 374 GLN A NE2 1 
ATOM   2769  N N   . GLY A  1 350 ? 75.205  129.561 46.259  1.00 23.44 ? 375 GLY A N   1 
ATOM   2770  C CA  . GLY A  1 350 ? 75.634  129.914 44.893  1.00 23.34 ? 375 GLY A CA  1 
ATOM   2771  C C   . GLY A  1 350 ? 76.861  130.820 44.877  1.00 22.42 ? 375 GLY A C   1 
ATOM   2772  O O   . GLY A  1 350 ? 77.309  131.292 45.930  1.00 21.51 ? 375 GLY A O   1 
ATOM   2773  N N   . PRO A  1 351 ? 77.418  131.079 43.687  1.00 22.51 ? 376 PRO A N   1 
ATOM   2774  C CA  . PRO A  1 351 ? 78.607  131.949 43.601  1.00 21.56 ? 376 PRO A CA  1 
ATOM   2775  C C   . PRO A  1 351 ? 78.302  133.394 44.013  1.00 20.57 ? 376 PRO A C   1 
ATOM   2776  O O   . PRO A  1 351 ? 77.227  133.894 43.695  1.00 20.26 ? 376 PRO A O   1 
ATOM   2777  C CB  . PRO A  1 351 ? 78.963  131.911 42.110  1.00 22.34 ? 376 PRO A CB  1 
ATOM   2778  C CG  . PRO A  1 351 ? 77.641  131.545 41.406  1.00 24.73 ? 376 PRO A CG  1 
ATOM   2779  C CD  . PRO A  1 351 ? 76.935  130.625 42.360  1.00 23.21 ? 376 PRO A CD  1 
ATOM   2780  N N   . TYR A  1 352 ? 79.236  134.041 44.712  1.00 19.23 ? 377 TYR A N   1 
ATOM   2781  C CA  . TYR A  1 352 ? 79.087  135.448 45.145  1.00 18.50 ? 377 TYR A CA  1 
ATOM   2782  C C   . TYR A  1 352 ? 77.714  135.777 45.783  1.00 18.39 ? 377 TYR A C   1 
ATOM   2783  O O   . TYR A  1 352 ? 77.024  136.708 45.332  1.00 18.56 ? 377 TYR A O   1 
ATOM   2784  C CB  . TYR A  1 352 ? 79.302  136.403 43.950  1.00 18.97 ? 377 TYR A CB  1 
ATOM   2785  C CG  . TYR A  1 352 ? 80.737  136.513 43.400  1.00 18.87 ? 377 TYR A CG  1 
ATOM   2786  C CD1 . TYR A  1 352 ? 81.698  137.285 44.045  1.00 19.10 ? 377 TYR A CD1 1 
ATOM   2787  C CD2 . TYR A  1 352 ? 81.102  135.881 42.216  1.00 21.37 ? 377 TYR A CD2 1 
ATOM   2788  C CE1 . TYR A  1 352 ? 83.002  137.408 43.535  1.00 18.61 ? 377 TYR A CE1 1 
ATOM   2789  C CE2 . TYR A  1 352 ? 82.415  135.999 41.694  1.00 20.82 ? 377 TYR A CE2 1 
ATOM   2790  C CZ  . TYR A  1 352 ? 83.344  136.761 42.372  1.00 20.34 ? 377 TYR A CZ  1 
ATOM   2791  O OH  . TYR A  1 352 ? 84.622  136.896 41.880  1.00 21.56 ? 377 TYR A OH  1 
ATOM   2792  N N   . PRO A  1 353 ? 77.310  135.034 46.832  1.00 18.35 ? 378 PRO A N   1 
ATOM   2793  C CA  . PRO A  1 353 ? 75.973  135.285 47.363  1.00 18.39 ? 378 PRO A CA  1 
ATOM   2794  C C   . PRO A  1 353 ? 75.810  136.681 47.942  1.00 17.28 ? 378 PRO A C   1 
ATOM   2795  O O   . PRO A  1 353 ? 74.747  137.258 47.775  1.00 17.34 ? 378 PRO A O   1 
ATOM   2796  C CB  . PRO A  1 353 ? 75.819  134.244 48.482  1.00 18.56 ? 378 PRO A CB  1 
ATOM   2797  C CG  . PRO A  1 353 ? 77.249  133.971 48.925  1.00 18.33 ? 378 PRO A CG  1 
ATOM   2798  C CD  . PRO A  1 353 ? 78.054  134.040 47.638  1.00 18.22 ? 378 PRO A CD  1 
ATOM   2799  N N   . LEU A  1 354 ? 76.827  137.215 48.619  1.00 16.51 ? 379 LEU A N   1 
ATOM   2800  C CA  . LEU A  1 354 ? 76.701  138.558 49.203  1.00 15.82 ? 379 LEU A CA  1 
ATOM   2801  C C   . LEU A  1 354 ? 76.683  139.632 48.107  1.00 16.13 ? 379 LEU A C   1 
ATOM   2802  O O   . LEU A  1 354 ? 75.841  140.538 48.137  1.00 16.10 ? 379 LEU A O   1 
ATOM   2803  C CB  . LEU A  1 354 ? 77.831  138.855 50.212  1.00 14.55 ? 379 LEU A CB  1 
ATOM   2804  C CG  . LEU A  1 354 ? 77.913  137.926 51.450  1.00 16.85 ? 379 LEU A CG  1 
ATOM   2805  C CD1 . LEU A  1 354 ? 79.107  138.297 52.329  1.00 17.87 ? 379 LEU A CD1 1 
ATOM   2806  C CD2 . LEU A  1 354 ? 76.588  137.922 52.271  1.00 16.81 ? 379 LEU A CD2 1 
ATOM   2807  N N   . VAL A  1 355 ? 77.644  139.584 47.182  1.00 15.80 ? 380 VAL A N   1 
ATOM   2808  C CA  . VAL A  1 355 ? 77.706  140.622 46.126  1.00 16.26 ? 380 VAL A CA  1 
ATOM   2809  C C   . VAL A  1 355 ? 76.502  140.533 45.171  1.00 17.41 ? 380 VAL A C   1 
ATOM   2810  O O   . VAL A  1 355 ? 75.954  141.546 44.751  1.00 16.85 ? 380 VAL A O   1 
ATOM   2811  C CB  . VAL A  1 355 ? 79.043  140.600 45.351  1.00 16.83 ? 380 VAL A CB  1 
ATOM   2812  C CG1 . VAL A  1 355 ? 79.098  141.755 44.313  1.00 17.12 ? 380 VAL A CG1 1 
ATOM   2813  C CG2 . VAL A  1 355 ? 80.191  140.749 46.330  1.00 15.08 ? 380 VAL A CG2 1 
ATOM   2814  N N   . GLN A  1 356 ? 76.070  139.316 44.849  1.00 18.21 ? 381 GLN A N   1 
ATOM   2815  C CA  . GLN A  1 356 ? 74.876  139.155 44.030  1.00 20.17 ? 381 GLN A CA  1 
ATOM   2816  C C   . GLN A  1 356 ? 73.650  139.753 44.712  1.00 20.13 ? 381 GLN A C   1 
ATOM   2817  O O   . GLN A  1 356 ? 72.797  140.349 44.048  1.00 21.01 ? 381 GLN A O   1 
ATOM   2818  C CB  . GLN A  1 356 ? 74.636  137.680 43.709  1.00 21.67 ? 381 GLN A CB  1 
ATOM   2819  C CG  . GLN A  1 356 ? 75.646  137.144 42.747  1.00 24.50 ? 381 GLN A CG  1 
ATOM   2820  C CD  . GLN A  1 356 ? 75.387  137.619 41.334  1.00 29.41 ? 381 GLN A CD  1 
ATOM   2821  O OE1 . GLN A  1 356 ? 74.438  138.366 41.066  1.00 31.54 ? 381 GLN A OE1 1 
ATOM   2822  N NE2 . GLN A  1 356 ? 76.204  137.144 40.403  1.00 32.82 ? 381 GLN A NE2 1 
ATOM   2823  N N   . ALA A  1 357 ? 73.553  139.600 46.029  1.00 19.42 ? 382 ALA A N   1 
ATOM   2824  C CA  . ALA A  1 357 ? 72.404  140.162 46.779  1.00 19.92 ? 382 ALA A CA  1 
ATOM   2825  C C   . ALA A  1 357 ? 72.400  141.681 46.690  1.00 19.35 ? 382 ALA A C   1 
ATOM   2826  O O   . ALA A  1 357 ? 71.358  142.317 46.546  1.00 19.59 ? 382 ALA A O   1 
ATOM   2827  C CB  . ALA A  1 357 ? 72.494  139.753 48.256  1.00 19.83 ? 382 ALA A CB  1 
ATOM   2828  N N   . VAL A  1 358 ? 73.583  142.266 46.851  1.00 17.58 ? 383 VAL A N   1 
ATOM   2829  C CA  . VAL A  1 358 ? 73.748  143.711 46.710  1.00 17.41 ? 383 VAL A CA  1 
ATOM   2830  C C   . VAL A  1 358 ? 73.369  144.163 45.294  1.00 18.77 ? 383 VAL A C   1 
ATOM   2831  O O   . VAL A  1 358 ? 72.597  145.098 45.127  1.00 18.35 ? 383 VAL A O   1 
ATOM   2832  C CB  . VAL A  1 358 ? 75.186  144.132 47.031  1.00 15.92 ? 383 VAL A CB  1 
ATOM   2833  C CG1 . VAL A  1 358 ? 75.456  145.606 46.633  1.00 15.84 ? 383 VAL A CG1 1 
ATOM   2834  C CG2 . VAL A  1 358 ? 75.466  143.922 48.529  1.00 15.96 ? 383 VAL A CG2 1 
ATOM   2835  N N   . LYS A  1 359 ? 73.937  143.506 44.282  1.00 19.19 ? 384 LYS A N   1 
ATOM   2836  C CA  . LYS A  1 359 ? 73.644  143.848 42.897  1.00 20.46 ? 384 LYS A CA  1 
ATOM   2837  C C   . LYS A  1 359 ? 72.144  143.775 42.620  1.00 22.37 ? 384 LYS A C   1 
ATOM   2838  O O   . LYS A  1 359 ? 71.564  144.674 41.998  1.00 23.02 ? 384 LYS A O   1 
ATOM   2839  C CB  . LYS A  1 359 ? 74.398  142.917 41.944  1.00 20.40 ? 384 LYS A CB  1 
ATOM   2840  C CG  . LYS A  1 359 ? 74.146  143.251 40.474  1.00 23.36 ? 384 LYS A CG  1 
ATOM   2841  C CD  . LYS A  1 359 ? 74.692  142.173 39.546  1.00 25.92 ? 384 LYS A CD  1 
ATOM   2842  C CE  . LYS A  1 359 ? 74.689  142.672 38.096  1.00 28.28 ? 384 LYS A CE  1 
ATOM   2843  N NZ  . LYS A  1 359 ? 74.721  141.503 37.188  1.00 31.76 ? 384 LYS A NZ  1 
ATOM   2844  N N   . ARG A  1 360 ? 71.519  142.693 43.058  1.00 23.26 ? 385 ARG A N   1 
ATOM   2845  C CA  . ARG A  1 360 ? 70.068  142.540 42.892  1.00 25.89 ? 385 ARG A CA  1 
ATOM   2846  C C   . ARG A  1 360 ? 69.282  143.672 43.560  1.00 25.63 ? 385 ARG A C   1 
ATOM   2847  O O   . ARG A  1 360 ? 68.339  144.203 42.975  1.00 25.90 ? 385 ARG A O   1 
ATOM   2848  C CB  . ARG A  1 360 ? 69.598  141.222 43.500  1.00 26.18 ? 385 ARG A CB  1 
ATOM   2849  C CG  . ARG A  1 360 ? 69.102  140.215 42.511  1.00 31.44 ? 385 ARG A CG  1 
ATOM   2850  C CD  . ARG A  1 360 ? 68.351  139.081 43.231  1.00 35.80 ? 385 ARG A CD  1 
ATOM   2851  N NE  . ARG A  1 360 ? 69.239  138.239 44.046  1.00 37.80 ? 385 ARG A NE  1 
ATOM   2852  C CZ  . ARG A  1 360 ? 69.308  138.273 45.378  1.00 36.94 ? 385 ARG A CZ  1 
ATOM   2853  N NH1 . ARG A  1 360 ? 68.535  139.116 46.053  1.00 38.48 ? 385 ARG A NH1 1 
ATOM   2854  N NH2 . ARG A  1 360 ? 70.145  137.468 46.036  1.00 35.61 ? 385 ARG A NH2 1 
ATOM   2855  N N   . SER A  1 361 ? 69.632  143.996 44.802  1.00 24.51 ? 386 SER A N   1 
ATOM   2856  C CA  . SER A  1 361 ? 68.906  145.045 45.534  1.00 26.03 ? 386 SER A CA  1 
ATOM   2857  C C   . SER A  1 361 ? 69.101  146.391 44.853  1.00 26.09 ? 386 SER A C   1 
ATOM   2858  O O   . SER A  1 361 ? 68.170  147.179 44.791  1.00 26.66 ? 386 SER A O   1 
ATOM   2859  C CB  . SER A  1 361 ? 69.361  145.192 47.000  1.00 25.15 ? 386 SER A CB  1 
ATOM   2860  O OG  . SER A  1 361 ? 69.104  144.029 47.759  1.00 28.42 ? 386 SER A OG  1 
ATOM   2861  N N   . LEU A  1 362 ? 70.315  146.659 44.373  1.00 25.30 ? 387 LEU A N   1 
ATOM   2862  C CA  . LEU A  1 362 ? 70.590  147.927 43.686  1.00 26.67 ? 387 LEU A CA  1 
ATOM   2863  C C   . LEU A  1 362 ? 69.742  148.109 42.423  1.00 29.26 ? 387 LEU A C   1 
ATOM   2864  O O   . LEU A  1 362 ? 69.394  149.227 42.073  1.00 29.49 ? 387 LEU A O   1 
ATOM   2865  C CB  . LEU A  1 362 ? 72.066  148.033 43.304  1.00 25.01 ? 387 LEU A CB  1 
ATOM   2866  C CG  . LEU A  1 362 ? 73.113  148.214 44.390  1.00 23.45 ? 387 LEU A CG  1 
ATOM   2867  C CD1 . LEU A  1 362 ? 74.520  148.115 43.762  1.00 19.12 ? 387 LEU A CD1 1 
ATOM   2868  C CD2 . LEU A  1 362 ? 72.901  149.573 45.029  1.00 20.14 ? 387 LEU A CD2 1 
ATOM   2869  N N   . GLY A  1 363 ? 69.408  147.017 41.743  1.00 31.88 ? 388 GLY A N   1 
ATOM   2870  C CA  . GLY A  1 363 ? 68.704  147.118 40.453  1.00 35.50 ? 388 GLY A CA  1 
ATOM   2871  C C   . GLY A  1 363 ? 67.207  146.936 40.572  1.00 38.67 ? 388 GLY A C   1 
ATOM   2872  O O   . GLY A  1 363 ? 66.435  147.212 39.631  1.00 40.57 ? 388 GLY A O   1 
ATOM   2873  N N   . SER A  1 364 ? 66.774  146.459 41.727  1.00 39.55 ? 389 SER A N   1 
ATOM   2874  C CA  . SER A  1 364 ? 65.359  146.264 41.928  1.00 42.04 ? 389 SER A CA  1 
ATOM   2875  C C   . SER A  1 364 ? 64.746  147.591 42.355  1.00 42.69 ? 389 SER A C   1 
ATOM   2876  O O   . SER A  1 364 ? 63.865  148.121 41.663  1.00 45.17 ? 389 SER A O   1 
ATOM   2877  C CB  . SER A  1 364 ? 65.121  145.194 42.981  1.00 41.72 ? 389 SER A CB  1 
ATOM   2878  O OG  . SER A  1 364 ? 65.374  145.728 44.263  1.00 41.97 ? 389 SER A OG  1 
ATOM   2879  N N   . ALA B  1 1   ? 18.449  147.838 -0.201  1.00 36.72 ? 26  ALA B N   1 
ATOM   2880  C CA  . ALA B  1 1   ? 19.544  147.472 0.761   1.00 36.04 ? 26  ALA B CA  1 
ATOM   2881  C C   . ALA B  1 1   ? 19.848  148.621 1.718   1.00 33.67 ? 26  ALA B C   1 
ATOM   2882  O O   . ALA B  1 1   ? 19.916  149.764 1.297   1.00 33.57 ? 26  ALA B O   1 
ATOM   2883  C CB  . ALA B  1 1   ? 20.818  147.087 0.002   1.00 36.69 ? 26  ALA B CB  1 
ATOM   2884  N N   . TYR B  1 2   ? 20.060  148.319 3.000   1.00 31.87 ? 27  TYR B N   1 
ATOM   2885  C CA  . TYR B  1 2   ? 20.477  149.345 3.933   1.00 29.10 ? 27  TYR B CA  1 
ATOM   2886  C C   . TYR B  1 2   ? 21.878  149.840 3.565   1.00 28.11 ? 27  TYR B C   1 
ATOM   2887  O O   . TYR B  1 2   ? 22.723  149.069 3.115   1.00 28.36 ? 27  TYR B O   1 
ATOM   2888  C CB  . TYR B  1 2   ? 20.486  148.818 5.376   1.00 28.88 ? 27  TYR B CB  1 
ATOM   2889  C CG  . TYR B  1 2   ? 19.123  148.422 5.900   1.00 28.70 ? 27  TYR B CG  1 
ATOM   2890  C CD1 . TYR B  1 2   ? 18.180  149.382 6.231   1.00 28.00 ? 27  TYR B CD1 1 
ATOM   2891  C CD2 . TYR B  1 2   ? 18.786  147.084 6.078   1.00 30.61 ? 27  TYR B CD2 1 
ATOM   2892  C CE1 . TYR B  1 2   ? 16.921  149.015 6.710   1.00 29.16 ? 27  TYR B CE1 1 
ATOM   2893  C CE2 . TYR B  1 2   ? 17.537  146.710 6.563   1.00 31.08 ? 27  TYR B CE2 1 
ATOM   2894  C CZ  . TYR B  1 2   ? 16.612  147.686 6.868   1.00 29.79 ? 27  TYR B CZ  1 
ATOM   2895  O OH  . TYR B  1 2   ? 15.385  147.335 7.355   1.00 30.50 ? 27  TYR B OH  1 
ATOM   2896  N N   . LYS B  1 3   ? 22.119  151.126 3.761   1.00 26.08 ? 28  LYS B N   1 
ATOM   2897  C CA  . LYS B  1 3   ? 23.462  151.684 3.596   1.00 25.49 ? 28  LYS B CA  1 
ATOM   2898  C C   . LYS B  1 3   ? 24.268  151.556 4.881   1.00 24.20 ? 28  LYS B C   1 
ATOM   2899  O O   . LYS B  1 3   ? 23.700  151.576 5.974   1.00 24.05 ? 28  LYS B O   1 
ATOM   2900  C CB  . LYS B  1 3   ? 23.345  153.165 3.233   1.00 24.53 ? 28  LYS B CB  1 
ATOM   2901  C CG  . LYS B  1 3   ? 22.596  153.406 1.900   1.00 25.62 ? 28  LYS B CG  1 
ATOM   2902  C CD  . LYS B  1 3   ? 22.265  154.896 1.723   1.00 25.51 ? 28  LYS B CD  1 
ATOM   2903  C CE  . LYS B  1 3   ? 21.722  155.176 0.314   1.00 28.24 ? 28  LYS B CE  1 
ATOM   2904  N NZ  . LYS B  1 3   ? 20.482  154.365 0.054   1.00 29.11 ? 28  LYS B NZ  1 
ATOM   2905  N N   . LEU B  1 4   ? 25.588  151.445 4.753   1.00 23.46 ? 29  LEU B N   1 
ATOM   2906  C CA  . LEU B  1 4   ? 26.498  151.578 5.884   1.00 21.92 ? 29  LEU B CA  1 
ATOM   2907  C C   . LEU B  1 4   ? 27.565  152.598 5.464   1.00 21.94 ? 29  LEU B C   1 
ATOM   2908  O O   . LEU B  1 4   ? 28.470  152.306 4.662   1.00 20.75 ? 29  LEU B O   1 
ATOM   2909  C CB  . LEU B  1 4   ? 27.117  150.231 6.286   1.00 23.60 ? 29  LEU B CB  1 
ATOM   2910  C CG  . LEU B  1 4   ? 28.122  150.222 7.448   1.00 21.75 ? 29  LEU B CG  1 
ATOM   2911  C CD1 . LEU B  1 4   ? 27.590  151.006 8.649   1.00 20.73 ? 29  LEU B CD1 1 
ATOM   2912  C CD2 . LEU B  1 4   ? 28.453  148.762 7.865   1.00 23.13 ? 29  LEU B CD2 1 
ATOM   2913  N N   . VAL B  1 5   ? 27.419  153.802 6.017   1.00 20.95 ? 30  VAL B N   1 
ATOM   2914  C CA  . VAL B  1 5   ? 28.166  154.989 5.602   1.00 21.03 ? 30  VAL B CA  1 
ATOM   2915  C C   . VAL B  1 5   ? 29.258  155.236 6.642   1.00 20.96 ? 30  VAL B C   1 
ATOM   2916  O O   . VAL B  1 5   ? 28.975  155.429 7.824   1.00 21.35 ? 30  VAL B O   1 
ATOM   2917  C CB  . VAL B  1 5   ? 27.219  156.216 5.478   1.00 19.68 ? 30  VAL B CB  1 
ATOM   2918  C CG1 . VAL B  1 5   ? 28.004  157.517 5.141   1.00 20.97 ? 30  VAL B CG1 1 
ATOM   2919  C CG2 . VAL B  1 5   ? 26.190  155.969 4.411   1.00 20.91 ? 30  VAL B CG2 1 
ATOM   2920  N N   . CYS B  1 6   ? 30.504  155.208 6.205   1.00 21.08 ? 31  CYS B N   1 
ATOM   2921  C CA  . CYS B  1 6   ? 31.618  155.238 7.133   1.00 21.69 ? 31  CYS B CA  1 
ATOM   2922  C C   . CYS B  1 6   ? 32.523  156.447 6.931   1.00 21.13 ? 31  CYS B C   1 
ATOM   2923  O O   . CYS B  1 6   ? 33.213  156.537 5.932   1.00 21.14 ? 31  CYS B O   1 
ATOM   2924  C CB  . CYS B  1 6   ? 32.431  153.952 6.985   1.00 22.94 ? 31  CYS B CB  1 
ATOM   2925  S SG  . CYS B  1 6   ? 31.447  152.521 7.467   1.00 24.21 ? 31  CYS B SG  1 
ATOM   2926  N N   . TYR B  1 7   ? 32.488  157.385 7.875   1.00 20.40 ? 32  TYR B N   1 
ATOM   2927  C CA  . TYR B  1 7   ? 33.428  158.493 7.852   1.00 20.86 ? 32  TYR B CA  1 
ATOM   2928  C C   . TYR B  1 7   ? 34.778  158.005 8.321   1.00 21.43 ? 32  TYR B C   1 
ATOM   2929  O O   . TYR B  1 7   ? 34.866  157.204 9.254   1.00 21.09 ? 32  TYR B O   1 
ATOM   2930  C CB  . TYR B  1 7   ? 32.993  159.609 8.791   1.00 20.34 ? 32  TYR B CB  1 
ATOM   2931  C CG  . TYR B  1 7   ? 31.859  160.489 8.304   1.00 19.94 ? 32  TYR B CG  1 
ATOM   2932  C CD1 . TYR B  1 7   ? 32.112  161.620 7.515   1.00 21.12 ? 32  TYR B CD1 1 
ATOM   2933  C CD2 . TYR B  1 7   ? 30.547  160.221 8.672   1.00 17.98 ? 32  TYR B CD2 1 
ATOM   2934  C CE1 . TYR B  1 7   ? 31.064  162.468 7.106   1.00 20.54 ? 32  TYR B CE1 1 
ATOM   2935  C CE2 . TYR B  1 7   ? 29.497  161.038 8.263   1.00 19.62 ? 32  TYR B CE2 1 
ATOM   2936  C CZ  . TYR B  1 7   ? 29.763  162.156 7.475   1.00 19.94 ? 32  TYR B CZ  1 
ATOM   2937  O OH  . TYR B  1 7   ? 28.729  162.966 7.080   1.00 20.52 ? 32  TYR B OH  1 
ATOM   2938  N N   . PHE B  1 8   ? 35.834  158.478 7.675   1.00 21.90 ? 33  PHE B N   1 
ATOM   2939  C CA  . PHE B  1 8   ? 37.180  158.357 8.232   1.00 23.14 ? 33  PHE B CA  1 
ATOM   2940  C C   . PHE B  1 8   ? 37.860  159.720 8.124   1.00 23.53 ? 33  PHE B C   1 
ATOM   2941  O O   . PHE B  1 8   ? 37.417  160.572 7.355   1.00 23.34 ? 33  PHE B O   1 
ATOM   2942  C CB  . PHE B  1 8   ? 38.009  157.266 7.559   1.00 23.74 ? 33  PHE B CB  1 
ATOM   2943  C CG  . PHE B  1 8   ? 38.379  157.564 6.141   1.00 25.26 ? 33  PHE B CG  1 
ATOM   2944  C CD1 . PHE B  1 8   ? 37.462  157.393 5.118   1.00 25.08 ? 33  PHE B CD1 1 
ATOM   2945  C CD2 . PHE B  1 8   ? 39.653  158.003 5.826   1.00 26.03 ? 33  PHE B CD2 1 
ATOM   2946  C CE1 . PHE B  1 8   ? 37.815  157.662 3.806   1.00 26.33 ? 33  PHE B CE1 1 
ATOM   2947  C CE2 . PHE B  1 8   ? 40.010  158.266 4.516   1.00 27.63 ? 33  PHE B CE2 1 
ATOM   2948  C CZ  . PHE B  1 8   ? 39.086  158.105 3.509   1.00 27.75 ? 33  PHE B CZ  1 
ATOM   2949  N N   . THR B  1 9   ? 38.922  159.933 8.894   1.00 24.71 ? 34  THR B N   1 
ATOM   2950  C CA  . THR B  1 9   ? 39.453  161.284 9.065   1.00 25.54 ? 34  THR B CA  1 
ATOM   2951  C C   . THR B  1 9   ? 40.925  161.442 8.681   1.00 28.42 ? 34  THR B C   1 
ATOM   2952  O O   . THR B  1 9   ? 41.751  160.533 8.855   1.00 28.93 ? 34  THR B O   1 
ATOM   2953  C CB  . THR B  1 9   ? 39.319  161.720 10.515  1.00 24.77 ? 34  THR B CB  1 
ATOM   2954  O OG1 . THR B  1 9   ? 40.332  161.063 11.283  1.00 26.10 ? 34  THR B OG1 1 
ATOM   2955  C CG2 . THR B  1 9   ? 37.927  161.343 11.055  1.00 23.46 ? 34  THR B CG2 1 
ATOM   2956  N N   . ASN B  1 10  ? 41.246  162.619 8.170   1.00 29.02 ? 35  ASN B N   1 
ATOM   2957  C CA  . ASN B  1 10  ? 42.615  162.921 7.769   1.00 32.56 ? 35  ASN B CA  1 
ATOM   2958  C C   . ASN B  1 10  ? 43.605  162.958 8.946   1.00 32.45 ? 35  ASN B C   1 
ATOM   2959  O O   . ASN B  1 10  ? 44.773  162.624 8.775   1.00 34.61 ? 35  ASN B O   1 
ATOM   2960  C CB  . ASN B  1 10  ? 42.646  164.230 6.956   1.00 33.52 ? 35  ASN B CB  1 
ATOM   2961  C CG  . ASN B  1 10  ? 43.172  165.428 7.748   1.00 39.78 ? 35  ASN B CG  1 
ATOM   2962  O OD1 . ASN B  1 10  ? 44.184  165.340 8.468   1.00 45.82 ? 35  ASN B OD1 1 
ATOM   2963  N ND2 . ASN B  1 10  ? 42.521  166.582 7.568   1.00 43.27 ? 35  ASN B ND2 1 
ATOM   2964  N N   . TRP B  1 11  ? 43.137  163.340 10.136  1.00 31.36 ? 36  TRP B N   1 
ATOM   2965  C CA  . TRP B  1 11  ? 44.033  163.578 11.272  1.00 31.54 ? 36  TRP B CA  1 
ATOM   2966  C C   . TRP B  1 11  ? 44.423  162.330 12.060  1.00 31.72 ? 36  TRP B C   1 
ATOM   2967  O O   . TRP B  1 11  ? 45.293  162.405 12.939  1.00 32.24 ? 36  TRP B O   1 
ATOM   2968  C CB  . TRP B  1 11  ? 43.468  164.640 12.242  1.00 30.97 ? 36  TRP B CB  1 
ATOM   2969  C CG  . TRP B  1 11  ? 42.087  164.341 12.752  1.00 28.60 ? 36  TRP B CG  1 
ATOM   2970  C CD1 . TRP B  1 11  ? 41.757  163.677 13.902  1.00 27.73 ? 36  TRP B CD1 1 
ATOM   2971  C CD2 . TRP B  1 11  ? 40.853  164.690 12.121  1.00 27.07 ? 36  TRP B CD2 1 
ATOM   2972  N NE1 . TRP B  1 11  ? 40.384  163.597 14.028  1.00 26.46 ? 36  TRP B NE1 1 
ATOM   2973  C CE2 . TRP B  1 11  ? 39.807  164.212 12.947  1.00 25.58 ? 36  TRP B CE2 1 
ATOM   2974  C CE3 . TRP B  1 11  ? 40.527  165.364 10.937  1.00 27.38 ? 36  TRP B CE3 1 
ATOM   2975  C CZ2 . TRP B  1 11  ? 38.455  164.381 12.624  1.00 23.19 ? 36  TRP B CZ2 1 
ATOM   2976  C CZ3 . TRP B  1 11  ? 39.183  165.535 10.622  1.00 26.77 ? 36  TRP B CZ3 1 
ATOM   2977  C CH2 . TRP B  1 11  ? 38.165  165.036 11.457  1.00 24.38 ? 36  TRP B CH2 1 
ATOM   2978  N N   . SER B  1 12  ? 43.800  161.188 11.768  1.00 30.57 ? 37  SER B N   1 
ATOM   2979  C CA  . SER B  1 12  ? 44.140  159.970 12.520  1.00 30.82 ? 37  SER B CA  1 
ATOM   2980  C C   . SER B  1 12  ? 45.502  159.405 12.124  1.00 33.04 ? 37  SER B C   1 
ATOM   2981  O O   . SER B  1 12  ? 46.070  158.574 12.835  1.00 33.64 ? 37  SER B O   1 
ATOM   2982  C CB  . SER B  1 12  ? 43.048  158.895 12.392  1.00 29.72 ? 37  SER B CB  1 
ATOM   2983  O OG  . SER B  1 12  ? 42.832  158.519 11.043  1.00 29.54 ? 37  SER B OG  1 
ATOM   2984  N N   . GLN B  1 13  ? 46.028  159.860 10.991  1.00 34.50 ? 38  GLN B N   1 
ATOM   2985  C CA  . GLN B  1 13  ? 47.339  159.411 10.533  1.00 37.09 ? 38  GLN B CA  1 
ATOM   2986  C C   . GLN B  1 13  ? 48.472  159.857 11.463  1.00 38.57 ? 38  GLN B C   1 
ATOM   2987  O O   . GLN B  1 13  ? 49.579  159.310 11.409  1.00 40.33 ? 38  GLN B O   1 
ATOM   2988  C CB  . GLN B  1 13  ? 47.607  159.870 9.088   1.00 38.09 ? 38  GLN B CB  1 
ATOM   2989  C CG  . GLN B  1 13  ? 47.592  161.390 8.900   1.00 38.99 ? 38  GLN B CG  1 
ATOM   2990  C CD  . GLN B  1 13  ? 47.850  161.800 7.455   1.00 40.51 ? 38  GLN B CD  1 
ATOM   2991  O OE1 . GLN B  1 13  ? 48.796  161.341 6.834   1.00 42.89 ? 38  GLN B OE1 1 
ATOM   2992  N NE2 . GLN B  1 13  ? 47.007  162.675 6.924   1.00 40.44 ? 38  GLN B NE2 1 
ATOM   2993  N N   . ASP B  1 14  ? 48.206  160.831 12.334  1.00 38.54 ? 39  ASP B N   1 
ATOM   2994  C CA  . ASP B  1 14  ? 49.264  161.309 13.230  1.00 39.95 ? 39  ASP B CA  1 
ATOM   2995  C C   . ASP B  1 14  ? 49.221  160.756 14.652  1.00 39.52 ? 39  ASP B C   1 
ATOM   2996  O O   . ASP B  1 14  ? 50.021  161.173 15.485  1.00 40.45 ? 39  ASP B O   1 
ATOM   2997  C CB  . ASP B  1 14  ? 49.283  162.833 13.301  1.00 40.62 ? 39  ASP B CB  1 
ATOM   2998  C CG  . ASP B  1 14  ? 49.216  163.484 11.938  1.00 42.36 ? 39  ASP B CG  1 
ATOM   2999  O OD1 . ASP B  1 14  ? 49.738  162.910 10.951  1.00 45.20 ? 39  ASP B OD1 1 
ATOM   3000  O OD2 . ASP B  1 14  ? 48.639  164.586 11.858  1.00 44.06 ? 39  ASP B OD2 1 
ATOM   3001  N N   . ARG B  1 15  ? 48.307  159.829 14.937  1.00 37.32 ? 40  ARG B N   1 
ATOM   3002  C CA  . ARG B  1 15  ? 48.308  159.152 16.231  1.00 36.96 ? 40  ARG B CA  1 
ATOM   3003  C C   . ARG B  1 15  ? 49.336  158.008 16.270  1.00 38.95 ? 40  ARG B C   1 
ATOM   3004  O O   . ARG B  1 15  ? 49.812  157.567 15.219  1.00 39.45 ? 40  ARG B O   1 
ATOM   3005  C CB  . ARG B  1 15  ? 46.907  158.617 16.532  1.00 34.47 ? 40  ARG B CB  1 
ATOM   3006  C CG  . ARG B  1 15  ? 45.828  159.681 16.358  1.00 32.75 ? 40  ARG B CG  1 
ATOM   3007  C CD  . ARG B  1 15  ? 44.479  159.215 16.897  1.00 30.12 ? 40  ARG B CD  1 
ATOM   3008  N NE  . ARG B  1 15  ? 43.566  160.347 17.035  1.00 28.55 ? 40  ARG B NE  1 
ATOM   3009  C CZ  . ARG B  1 15  ? 42.339  160.402 16.538  1.00 27.09 ? 40  ARG B CZ  1 
ATOM   3010  N NH1 . ARG B  1 15  ? 41.834  159.374 15.866  1.00 26.15 ? 40  ARG B NH1 1 
ATOM   3011  N NH2 . ARG B  1 15  ? 41.609  161.493 16.732  1.00 25.09 ? 40  ARG B NH2 1 
ATOM   3012  N N   . GLN B  1 16  ? 49.673  157.537 17.473  1.00 39.71 ? 41  GLN B N   1 
ATOM   3013  C CA  . GLN B  1 16  ? 50.515  156.342 17.638  1.00 42.20 ? 41  GLN B CA  1 
ATOM   3014  C C   . GLN B  1 16  ? 49.640  155.095 17.668  1.00 41.67 ? 41  GLN B C   1 
ATOM   3015  O O   . GLN B  1 16  ? 48.429  155.203 17.860  1.00 39.75 ? 41  GLN B O   1 
ATOM   3016  N N   . GLU B  1 17  ? 50.243  153.912 17.494  1.00 43.18 ? 42  GLU B N   1 
ATOM   3017  C CA  . GLU B  1 17  ? 49.489  152.641 17.510  1.00 42.91 ? 42  GLU B CA  1 
ATOM   3018  C C   . GLU B  1 17  ? 48.870  152.309 18.857  1.00 42.14 ? 42  GLU B C   1 
ATOM   3019  O O   . GLU B  1 17  ? 49.413  152.680 19.882  1.00 42.87 ? 42  GLU B O   1 
ATOM   3020  N N   . PRO B  1 18  ? 47.724  151.629 18.865  1.00 41.19 ? 43  PRO B N   1 
ATOM   3021  C CA  . PRO B  1 18  ? 47.092  151.146 17.638  1.00 40.70 ? 43  PRO B CA  1 
ATOM   3022  C C   . PRO B  1 18  ? 46.020  152.068 17.110  1.00 38.84 ? 43  PRO B C   1 
ATOM   3023  O O   . PRO B  1 18  ? 44.901  151.629 16.787  1.00 38.14 ? 43  PRO B O   1 
ATOM   3024  N N   . GLY B  1 19  ? 46.351  153.355 17.014  1.00 38.14 ? 44  GLY B N   1 
ATOM   3025  C CA  . GLY B  1 19  ? 45.383  154.358 16.563  1.00 35.25 ? 44  GLY B CA  1 
ATOM   3026  C C   . GLY B  1 19  ? 45.838  155.016 15.274  1.00 35.17 ? 44  GLY B C   1 
ATOM   3027  O O   . GLY B  1 19  ? 45.102  155.784 14.653  1.00 33.41 ? 44  GLY B O   1 
ATOM   3028  N N   . LYS B  1 20  ? 47.077  154.728 14.884  1.00 36.49 ? 45  LYS B N   1 
ATOM   3029  C CA  . LYS B  1 20  ? 47.623  155.238 13.641  1.00 36.81 ? 45  LYS B CA  1 
ATOM   3030  C C   . LYS B  1 20  ? 46.866  154.637 12.467  1.00 35.76 ? 45  LYS B C   1 
ATOM   3031  O O   . LYS B  1 20  ? 46.953  153.444 12.220  1.00 36.25 ? 45  LYS B O   1 
ATOM   3032  C CB  . LYS B  1 20  ? 49.101  154.864 13.547  1.00 39.36 ? 45  LYS B CB  1 
ATOM   3033  C CG  . LYS B  1 20  ? 49.849  155.592 12.487  1.00 41.48 ? 45  LYS B CG  1 
ATOM   3034  C CD  . LYS B  1 20  ? 51.358  155.370 12.672  1.00 46.66 ? 45  LYS B CD  1 
ATOM   3035  C CE  . LYS B  1 20  ? 52.135  156.664 12.472  1.00 49.69 ? 45  LYS B CE  1 
ATOM   3036  N NZ  . LYS B  1 20  ? 51.939  157.213 11.096  1.00 52.11 ? 45  LYS B NZ  1 
ATOM   3037  N N   . PHE B  1 21  ? 46.122  155.463 11.743  1.00 34.24 ? 46  PHE B N   1 
ATOM   3038  C CA  . PHE B  1 21  ? 45.222  154.975 10.700  1.00 33.39 ? 46  PHE B CA  1 
ATOM   3039  C C   . PHE B  1 21  ? 45.542  155.676 9.399   1.00 34.38 ? 46  PHE B C   1 
ATOM   3040  O O   . PHE B  1 21  ? 45.721  156.886 9.382   1.00 34.57 ? 46  PHE B O   1 
ATOM   3041  C CB  . PHE B  1 21  ? 43.784  155.309 11.104  1.00 31.14 ? 46  PHE B CB  1 
ATOM   3042  C CG  . PHE B  1 21  ? 42.738  154.901 10.101  1.00 30.17 ? 46  PHE B CG  1 
ATOM   3043  C CD1 . PHE B  1 21  ? 42.456  155.698 9.008   1.00 28.99 ? 46  PHE B CD1 1 
ATOM   3044  C CD2 . PHE B  1 21  ? 41.982  153.743 10.294  1.00 29.19 ? 46  PHE B CD2 1 
ATOM   3045  C CE1 . PHE B  1 21  ? 41.459  155.334 8.100   1.00 27.73 ? 46  PHE B CE1 1 
ATOM   3046  C CE2 . PHE B  1 21  ? 40.990  153.373 9.383   1.00 27.54 ? 46  PHE B CE2 1 
ATOM   3047  C CZ  . PHE B  1 21  ? 40.735  154.165 8.288   1.00 26.28 ? 46  PHE B CZ  1 
ATOM   3048  N N   . THR B  1 22  ? 45.626  154.923 8.312   1.00 35.38 ? 47  THR B N   1 
ATOM   3049  C CA  . THR B  1 22  ? 45.676  155.525 6.994   1.00 36.10 ? 47  THR B CA  1 
ATOM   3050  C C   . THR B  1 22  ? 44.603  154.859 6.154   1.00 35.91 ? 47  THR B C   1 
ATOM   3051  O O   . THR B  1 22  ? 44.016  153.865 6.578   1.00 35.82 ? 47  THR B O   1 
ATOM   3052  C CB  . THR B  1 22  ? 47.050  155.324 6.299   1.00 38.04 ? 47  THR B CB  1 
ATOM   3053  O OG1 . THR B  1 22  ? 47.201  153.951 5.923   1.00 39.16 ? 47  THR B OG1 1 
ATOM   3054  C CG2 . THR B  1 22  ? 48.203  155.730 7.220   1.00 38.69 ? 47  THR B CG2 1 
ATOM   3055  N N   . PRO B  1 23  ? 44.339  155.410 4.963   1.00 36.59 ? 48  PRO B N   1 
ATOM   3056  C CA  . PRO B  1 23  ? 43.410  154.815 4.015   1.00 36.21 ? 48  PRO B CA  1 
ATOM   3057  C C   . PRO B  1 23  ? 43.742  153.350 3.754   1.00 37.21 ? 48  PRO B C   1 
ATOM   3058  O O   . PRO B  1 23  ? 42.842  152.585 3.426   1.00 36.40 ? 48  PRO B O   1 
ATOM   3059  C CB  . PRO B  1 23  ? 43.639  155.641 2.745   1.00 37.00 ? 48  PRO B CB  1 
ATOM   3060  C CG  . PRO B  1 23  ? 44.042  156.987 3.264   1.00 37.30 ? 48  PRO B CG  1 
ATOM   3061  C CD  . PRO B  1 23  ? 44.916  156.671 4.453   1.00 37.55 ? 48  PRO B CD  1 
ATOM   3062  N N   . GLU B  1 24  ? 45.018  152.973 3.887   1.00 38.60 ? 49  GLU B N   1 
ATOM   3063  C CA  . GLU B  1 24  ? 45.431  151.573 3.746   1.00 40.30 ? 49  GLU B CA  1 
ATOM   3064  C C   . GLU B  1 24  ? 44.732  150.660 4.753   1.00 38.87 ? 49  GLU B C   1 
ATOM   3065  O O   . GLU B  1 24  ? 44.618  149.459 4.515   1.00 39.48 ? 49  GLU B O   1 
ATOM   3066  C CB  . GLU B  1 24  ? 46.944  151.409 3.920   1.00 42.64 ? 49  GLU B CB  1 
ATOM   3067  C CG  . GLU B  1 24  ? 47.766  151.610 2.678   1.00 46.63 ? 49  GLU B CG  1 
ATOM   3068  C CD  . GLU B  1 24  ? 49.081  150.856 2.771   1.00 53.28 ? 49  GLU B CD  1 
ATOM   3069  O OE1 . GLU B  1 24  ? 49.456  150.427 3.891   1.00 55.21 ? 49  GLU B OE1 1 
ATOM   3070  O OE2 . GLU B  1 24  ? 49.735  150.661 1.728   1.00 56.63 ? 49  GLU B OE2 1 
ATOM   3071  N N   . ASN B  1 25  ? 44.286  151.217 5.881   1.00 37.06 ? 50  ASN B N   1 
ATOM   3072  C CA  . ASN B  1 25  ? 43.602  150.404 6.897   1.00 36.13 ? 50  ASN B CA  1 
ATOM   3073  C C   . ASN B  1 25  ? 42.155  150.096 6.551   1.00 35.09 ? 50  ASN B C   1 
ATOM   3074  O O   . ASN B  1 25  ? 41.497  149.332 7.253   1.00 34.65 ? 50  ASN B O   1 
ATOM   3075  C CB  . ASN B  1 25  ? 43.645  151.078 8.269   1.00 34.92 ? 50  ASN B CB  1 
ATOM   3076  C CG  . ASN B  1 25  ? 45.015  151.042 8.875   1.00 36.19 ? 50  ASN B CG  1 
ATOM   3077  O OD1 . ASN B  1 25  ? 45.506  149.975 9.250   1.00 38.34 ? 50  ASN B OD1 1 
ATOM   3078  N ND2 . ASN B  1 25  ? 45.660  152.197 8.954   1.00 33.79 ? 50  ASN B ND2 1 
ATOM   3079  N N   . ILE B  1 26  ? 41.654  150.711 5.486   1.00 34.51 ? 51  ILE B N   1 
ATOM   3080  C CA  . ILE B  1 26  ? 40.246  150.590 5.124   1.00 33.62 ? 51  ILE B CA  1 
ATOM   3081  C C   . ILE B  1 26  ? 39.991  149.254 4.438   1.00 34.36 ? 51  ILE B C   1 
ATOM   3082  O O   . ILE B  1 26  ? 40.706  148.866 3.519   1.00 35.67 ? 51  ILE B O   1 
ATOM   3083  C CB  . ILE B  1 26  ? 39.834  151.741 4.167   1.00 33.35 ? 51  ILE B CB  1 
ATOM   3084  C CG1 . ILE B  1 26  ? 39.995  153.095 4.871   1.00 32.70 ? 51  ILE B CG1 1 
ATOM   3085  C CG2 . ILE B  1 26  ? 38.418  151.530 3.657   1.00 31.99 ? 51  ILE B CG2 1 
ATOM   3086  C CD1 . ILE B  1 26  ? 39.629  154.308 3.999   1.00 32.97 ? 51  ILE B CD1 1 
ATOM   3087  N N   . ASP B  1 27  ? 38.974  148.544 4.896   1.00 33.94 ? 52  ASP B N   1 
ATOM   3088  C CA  . ASP B  1 27  ? 38.553  147.311 4.241   1.00 34.74 ? 52  ASP B CA  1 
ATOM   3089  C C   . ASP B  1 27  ? 37.435  147.699 3.274   1.00 33.90 ? 52  ASP B C   1 
ATOM   3090  O O   . ASP B  1 27  ? 36.445  148.293 3.692   1.00 32.88 ? 52  ASP B O   1 
ATOM   3091  C CB  . ASP B  1 27  ? 38.083  146.321 5.310   1.00 34.83 ? 52  ASP B CB  1 
ATOM   3092  C CG  . ASP B  1 27  ? 37.189  145.232 4.761   1.00 36.14 ? 52  ASP B CG  1 
ATOM   3093  O OD1 . ASP B  1 27  ? 37.111  145.072 3.522   1.00 35.72 ? 52  ASP B OD1 1 
ATOM   3094  O OD2 . ASP B  1 27  ? 36.553  144.541 5.587   1.00 37.38 ? 52  ASP B OD2 1 
ATOM   3095  N N   . PRO B  1 28  ? 37.624  147.414 1.971   1.00 34.75 ? 53  PRO B N   1 
ATOM   3096  C CA  . PRO B  1 28  ? 36.747  147.835 0.870   1.00 34.17 ? 53  PRO B CA  1 
ATOM   3097  C C   . PRO B  1 28  ? 35.338  147.238 0.883   1.00 33.56 ? 53  PRO B C   1 
ATOM   3098  O O   . PRO B  1 28  ? 34.434  147.776 0.232   1.00 32.10 ? 53  PRO B O   1 
ATOM   3099  C CB  . PRO B  1 28  ? 37.500  147.389 -0.389  1.00 36.24 ? 53  PRO B CB  1 
ATOM   3100  C CG  . PRO B  1 28  ? 38.536  146.409 0.071   1.00 37.66 ? 53  PRO B CG  1 
ATOM   3101  C CD  . PRO B  1 28  ? 38.856  146.764 1.492   1.00 36.39 ? 53  PRO B CD  1 
ATOM   3102  N N   . PHE B  1 29  ? 35.149  146.136 1.608   1.00 33.56 ? 54  PHE B N   1 
ATOM   3103  C CA  . PHE B  1 29  ? 33.817  145.527 1.726   1.00 33.28 ? 54  PHE B CA  1 
ATOM   3104  C C   . PHE B  1 29  ? 33.132  145.785 3.069   1.00 31.95 ? 54  PHE B C   1 
ATOM   3105  O O   . PHE B  1 29  ? 32.017  145.314 3.295   1.00 31.52 ? 54  PHE B O   1 
ATOM   3106  C CB  . PHE B  1 29  ? 33.886  144.017 1.416   1.00 34.99 ? 54  PHE B CB  1 
ATOM   3107  C CG  . PHE B  1 29  ? 34.274  143.732 0.002   1.00 36.56 ? 54  PHE B CG  1 
ATOM   3108  C CD1 . PHE B  1 29  ? 33.311  143.662 -0.998  1.00 36.46 ? 54  PHE B CD1 1 
ATOM   3109  C CD2 . PHE B  1 29  ? 35.614  143.602 -0.349  1.00 37.79 ? 54  PHE B CD2 1 
ATOM   3110  C CE1 . PHE B  1 29  ? 33.679  143.440 -2.313  1.00 36.74 ? 54  PHE B CE1 1 
ATOM   3111  C CE2 . PHE B  1 29  ? 35.984  143.376 -1.663  1.00 37.66 ? 54  PHE B CE2 1 
ATOM   3112  C CZ  . PHE B  1 29  ? 35.018  143.289 -2.641  1.00 38.81 ? 54  PHE B CZ  1 
ATOM   3113  N N   . LEU B  1 30  ? 33.789  146.542 3.945   1.00 30.80 ? 55  LEU B N   1 
ATOM   3114  C CA  . LEU B  1 30  ? 33.246  146.823 5.276   1.00 30.04 ? 55  LEU B CA  1 
ATOM   3115  C C   . LEU B  1 30  ? 31.983  147.660 5.171   1.00 28.75 ? 55  LEU B C   1 
ATOM   3116  O O   . LEU B  1 30  ? 30.958  147.318 5.742   1.00 28.32 ? 55  LEU B O   1 
ATOM   3117  C CB  . LEU B  1 30  ? 34.269  147.571 6.140   1.00 29.90 ? 55  LEU B CB  1 
ATOM   3118  C CG  . LEU B  1 30  ? 34.427  147.266 7.647   1.00 31.22 ? 55  LEU B CG  1 
ATOM   3119  C CD1 . LEU B  1 30  ? 34.815  148.522 8.405   1.00 30.64 ? 55  LEU B CD1 1 
ATOM   3120  C CD2 . LEU B  1 30  ? 33.235  146.610 8.316   1.00 32.32 ? 55  LEU B CD2 1 
ATOM   3121  N N   . CYS B  1 31  ? 32.063  148.762 4.436   1.00 28.16 ? 56  CYS B N   1 
ATOM   3122  C CA  . CYS B  1 31  ? 30.953  149.704 4.326   1.00 27.54 ? 56  CYS B CA  1 
ATOM   3123  C C   . CYS B  1 31  ? 30.444  149.812 2.897   1.00 27.37 ? 56  CYS B C   1 
ATOM   3124  O O   . CYS B  1 31  ? 31.117  149.389 1.955   1.00 28.22 ? 56  CYS B O   1 
ATOM   3125  C CB  . CYS B  1 31  ? 31.442  151.074 4.779   1.00 26.50 ? 56  CYS B CB  1 
ATOM   3126  S SG  . CYS B  1 31  ? 32.269  150.976 6.398   1.00 30.37 ? 56  CYS B SG  1 
ATOM   3127  N N   . SER B  1 32  ? 29.269  150.406 2.725   1.00 26.34 ? 57  SER B N   1 
ATOM   3128  C CA  . SER B  1 32  ? 28.770  150.668 1.370   1.00 26.64 ? 57  SER B CA  1 
ATOM   3129  C C   . SER B  1 32  ? 29.246  152.024 0.828   1.00 25.58 ? 57  SER B C   1 
ATOM   3130  O O   . SER B  1 32  ? 29.408  152.181 -0.389  1.00 25.91 ? 57  SER B O   1 
ATOM   3131  C CB  . SER B  1 32  ? 27.248  150.568 1.295   1.00 26.29 ? 57  SER B CB  1 
ATOM   3132  O OG  . SER B  1 32  ? 26.652  151.460 2.235   1.00 25.46 ? 57  SER B OG  1 
ATOM   3133  N N   . HIS B  1 33  ? 29.443  152.992 1.722   1.00 24.72 ? 58  HIS B N   1 
ATOM   3134  C CA  . HIS B  1 33  ? 29.942  154.321 1.358   1.00 24.55 ? 58  HIS B CA  1 
ATOM   3135  C C   . HIS B  1 33  ? 31.026  154.679 2.350   1.00 24.47 ? 58  HIS B C   1 
ATOM   3136  O O   . HIS B  1 33  ? 30.855  154.439 3.549   1.00 24.67 ? 58  HIS B O   1 
ATOM   3137  C CB  . HIS B  1 33  ? 28.849  155.385 1.502   1.00 24.03 ? 58  HIS B CB  1 
ATOM   3138  C CG  . HIS B  1 33  ? 27.632  155.147 0.659   1.00 24.87 ? 58  HIS B CG  1 
ATOM   3139  N ND1 . HIS B  1 33  ? 26.836  154.030 0.785   1.00 24.96 ? 58  HIS B ND1 1 
ATOM   3140  C CD2 . HIS B  1 33  ? 27.064  155.905 -0.309  1.00 24.96 ? 58  HIS B CD2 1 
ATOM   3141  C CE1 . HIS B  1 33  ? 25.835  154.106 -0.074  1.00 25.54 ? 58  HIS B CE1 1 
ATOM   3142  N NE2 . HIS B  1 33  ? 25.951  155.238 -0.746  1.00 24.94 ? 58  HIS B NE2 1 
ATOM   3143  N N   . LEU B  1 34  ? 32.131  155.248 1.865   1.00 24.59 ? 59  LEU B N   1 
ATOM   3144  C CA  . LEU B  1 34  ? 33.159  155.831 2.717   1.00 23.90 ? 59  LEU B CA  1 
ATOM   3145  C C   . LEU B  1 34  ? 33.158  157.339 2.542   1.00 23.81 ? 59  LEU B C   1 
ATOM   3146  O O   . LEU B  1 34  ? 32.886  157.830 1.457   1.00 24.03 ? 59  LEU B O   1 
ATOM   3147  C CB  . LEU B  1 34  ? 34.544  155.337 2.320   1.00 25.16 ? 59  LEU B CB  1 
ATOM   3148  C CG  . LEU B  1 34  ? 34.750  153.840 2.486   1.00 26.20 ? 59  LEU B CG  1 
ATOM   3149  C CD1 . LEU B  1 34  ? 35.947  153.435 1.649   1.00 27.44 ? 59  LEU B CD1 1 
ATOM   3150  C CD2 . LEU B  1 34  ? 34.944  153.509 3.961   1.00 26.13 ? 59  LEU B CD2 1 
ATOM   3151  N N   . ILE B  1 35  ? 33.476  158.072 3.602   1.00 22.37 ? 60  ILE B N   1 
ATOM   3152  C CA  . ILE B  1 35  ? 33.482  159.533 3.495   1.00 22.49 ? 60  ILE B CA  1 
ATOM   3153  C C   . ILE B  1 35  ? 34.769  160.095 4.083   1.00 22.77 ? 60  ILE B C   1 
ATOM   3154  O O   . ILE B  1 35  ? 35.046  159.915 5.263   1.00 22.91 ? 60  ILE B O   1 
ATOM   3155  C CB  . ILE B  1 35  ? 32.255  160.165 4.171   1.00 20.93 ? 60  ILE B CB  1 
ATOM   3156  C CG1 . ILE B  1 35  ? 30.966  159.557 3.616   1.00 21.84 ? 60  ILE B CG1 1 
ATOM   3157  C CG2 . ILE B  1 35  ? 32.258  161.713 3.982   1.00 20.77 ? 60  ILE B CG2 1 
ATOM   3158  C CD1 . ILE B  1 35  ? 29.698  160.263 4.155   1.00 20.45 ? 60  ILE B CD1 1 
ATOM   3159  N N   . TYR B  1 36  ? 35.562  160.769 3.257   1.00 23.64 ? 61  TYR B N   1 
ATOM   3160  C CA  . TYR B  1 36  ? 36.808  161.382 3.716   1.00 24.55 ? 61  TYR B CA  1 
ATOM   3161  C C   . TYR B  1 36  ? 36.551  162.722 4.404   1.00 24.64 ? 61  TYR B C   1 
ATOM   3162  O O   . TYR B  1 36  ? 35.872  163.580 3.830   1.00 25.10 ? 61  TYR B O   1 
ATOM   3163  C CB  . TYR B  1 36  ? 37.719  161.634 2.526   1.00 25.72 ? 61  TYR B CB  1 
ATOM   3164  C CG  . TYR B  1 36  ? 38.977  162.397 2.862   1.00 26.70 ? 61  TYR B CG  1 
ATOM   3165  C CD1 . TYR B  1 36  ? 40.123  161.740 3.267   1.00 28.62 ? 61  TYR B CD1 1 
ATOM   3166  C CD2 . TYR B  1 36  ? 39.020  163.778 2.753   1.00 27.52 ? 61  TYR B CD2 1 
ATOM   3167  C CE1 . TYR B  1 36  ? 41.293  162.446 3.556   1.00 28.29 ? 61  TYR B CE1 1 
ATOM   3168  C CE2 . TYR B  1 36  ? 40.165  164.491 3.049   1.00 27.66 ? 61  TYR B CE2 1 
ATOM   3169  C CZ  . TYR B  1 36  ? 41.298  163.822 3.452   1.00 29.30 ? 61  TYR B CZ  1 
ATOM   3170  O OH  . TYR B  1 36  ? 42.438  164.531 3.749   1.00 30.09 ? 61  TYR B OH  1 
ATOM   3171  N N   . SER B  1 37  ? 37.109  162.903 5.602   1.00 24.06 ? 62  SER B N   1 
ATOM   3172  C CA  . SER B  1 37  ? 36.940  164.129 6.386   1.00 24.44 ? 62  SER B CA  1 
ATOM   3173  C C   . SER B  1 37  ? 38.292  164.774 6.736   1.00 25.24 ? 62  SER B C   1 
ATOM   3174  O O   . SER B  1 37  ? 39.151  164.112 7.317   1.00 26.05 ? 62  SER B O   1 
ATOM   3175  C CB  . SER B  1 37  ? 36.196  163.832 7.694   1.00 23.41 ? 62  SER B CB  1 
ATOM   3176  O OG  . SER B  1 37  ? 35.233  162.806 7.556   1.00 24.53 ? 62  SER B OG  1 
ATOM   3177  N N   . PHE B  1 38  ? 38.506  166.053 6.411   1.00 25.60 ? 63  PHE B N   1 
ATOM   3178  C CA  . PHE B  1 38  ? 37.570  166.919 5.703   1.00 25.28 ? 63  PHE B CA  1 
ATOM   3179  C C   . PHE B  1 38  ? 38.374  167.654 4.623   1.00 26.59 ? 63  PHE B C   1 
ATOM   3180  O O   . PHE B  1 38  ? 39.570  167.915 4.807   1.00 26.57 ? 63  PHE B O   1 
ATOM   3181  C CB  . PHE B  1 38  ? 36.989  167.988 6.656   1.00 24.78 ? 63  PHE B CB  1 
ATOM   3182  C CG  . PHE B  1 38  ? 35.951  167.462 7.614   1.00 23.73 ? 63  PHE B CG  1 
ATOM   3183  C CD1 . PHE B  1 38  ? 34.689  167.090 7.154   1.00 22.69 ? 63  PHE B CD1 1 
ATOM   3184  C CD2 . PHE B  1 38  ? 36.230  167.348 8.976   1.00 22.95 ? 63  PHE B CD2 1 
ATOM   3185  C CE1 . PHE B  1 38  ? 33.715  166.605 8.020   1.00 22.15 ? 63  PHE B CE1 1 
ATOM   3186  C CE2 . PHE B  1 38  ? 35.268  166.866 9.854   1.00 22.37 ? 63  PHE B CE2 1 
ATOM   3187  C CZ  . PHE B  1 38  ? 33.999  166.485 9.369   1.00 21.91 ? 63  PHE B CZ  1 
ATOM   3188  N N   . ALA B  1 39  ? 37.733  167.987 3.506   1.00 26.84 ? 64  ALA B N   1 
ATOM   3189  C CA  . ALA B  1 39  ? 38.342  168.868 2.513   1.00 28.39 ? 64  ALA B CA  1 
ATOM   3190  C C   . ALA B  1 39  ? 38.165  170.303 2.992   1.00 29.20 ? 64  ALA B C   1 
ATOM   3191  O O   . ALA B  1 39  ? 37.349  170.574 3.885   1.00 28.37 ? 64  ALA B O   1 
ATOM   3192  C CB  . ALA B  1 39  ? 37.690  168.695 1.151   1.00 28.54 ? 64  ALA B CB  1 
ATOM   3193  N N   . SER B  1 40  ? 38.912  171.221 2.390   1.00 30.36 ? 65  SER B N   1 
ATOM   3194  C CA  . SER B  1 40  ? 38.762  172.633 2.736   1.00 31.54 ? 65  SER B CA  1 
ATOM   3195  C C   . SER B  1 40  ? 38.439  173.472 1.495   1.00 31.84 ? 65  SER B C   1 
ATOM   3196  O O   . SER B  1 40  ? 38.302  172.948 0.387   1.00 32.19 ? 65  SER B O   1 
ATOM   3197  C CB  . SER B  1 40  ? 40.015  173.149 3.443   1.00 32.38 ? 65  SER B CB  1 
ATOM   3198  O OG  . SER B  1 40  ? 39.827  174.493 3.881   1.00 36.05 ? 65  SER B OG  1 
ATOM   3199  N N   . ILE B  1 41  ? 38.307  174.778 1.693   1.00 32.47 ? 66  ILE B N   1 
ATOM   3200  C CA  . ILE B  1 41  ? 38.007  175.714 0.609   1.00 32.97 ? 66  ILE B CA  1 
ATOM   3201  C C   . ILE B  1 41  ? 39.040  176.821 0.637   1.00 34.90 ? 66  ILE B C   1 
ATOM   3202  O O   . ILE B  1 41  ? 39.261  177.450 1.669   1.00 34.57 ? 66  ILE B O   1 
ATOM   3203  C CB  . ILE B  1 41  ? 36.597  176.355 0.765   1.00 32.25 ? 66  ILE B CB  1 
ATOM   3204  C CG1 . ILE B  1 41  ? 35.513  175.280 0.830   1.00 31.47 ? 66  ILE B CG1 1 
ATOM   3205  C CG2 . ILE B  1 41  ? 36.322  177.343 -0.363  1.00 33.04 ? 66  ILE B CG2 1 
ATOM   3206  C CD1 . ILE B  1 41  ? 34.111  175.821 0.974   1.00 31.62 ? 66  ILE B CD1 1 
ATOM   3207  N N   . GLU B  1 42  ? 39.680  177.046 -0.503  1.00 36.39 ? 67  GLU B N   1 
ATOM   3208  C CA  . GLU B  1 42  ? 40.698  178.061 -0.611  1.00 39.03 ? 67  GLU B CA  1 
ATOM   3209  C C   . GLU B  1 42  ? 40.475  178.829 -1.914  1.00 39.43 ? 67  GLU B C   1 
ATOM   3210  O O   . GLU B  1 42  ? 40.343  178.231 -2.980  1.00 38.96 ? 67  GLU B O   1 
ATOM   3211  C CB  . GLU B  1 42  ? 42.072  177.394 -0.569  1.00 40.28 ? 67  GLU B CB  1 
ATOM   3212  C CG  . GLU B  1 42  ? 43.243  178.319 -0.728  1.00 45.92 ? 67  GLU B CG  1 
ATOM   3213  C CD  . GLU B  1 42  ? 44.547  177.551 -0.937  1.00 51.14 ? 67  GLU B CD  1 
ATOM   3214  O OE1 . GLU B  1 42  ? 45.116  177.038 0.061   1.00 52.61 ? 67  GLU B OE1 1 
ATOM   3215  O OE2 . GLU B  1 42  ? 44.995  177.461 -2.105  1.00 52.82 ? 67  GLU B OE2 1 
ATOM   3216  N N   . ASN B  1 43  ? 40.391  180.155 -1.827  1.00 40.38 ? 68  ASN B N   1 
ATOM   3217  C CA  . ASN B  1 43  ? 40.108  180.960 -3.016  1.00 41.49 ? 68  ASN B CA  1 
ATOM   3218  C C   . ASN B  1 43  ? 38.871  180.438 -3.756  1.00 40.06 ? 68  ASN B C   1 
ATOM   3219  O O   . ASN B  1 43  ? 38.848  180.385 -4.994  1.00 40.45 ? 68  ASN B O   1 
ATOM   3220  C CB  . ASN B  1 43  ? 41.311  180.979 -3.956  1.00 43.49 ? 68  ASN B CB  1 
ATOM   3221  C CG  . ASN B  1 43  ? 42.509  181.690 -3.357  1.00 46.68 ? 68  ASN B CG  1 
ATOM   3222  O OD1 . ASN B  1 43  ? 42.363  182.661 -2.611  1.00 49.37 ? 68  ASN B OD1 1 
ATOM   3223  N ND2 . ASN B  1 43  ? 43.708  181.215 -3.689  1.00 48.41 ? 68  ASN B ND2 1 
ATOM   3224  N N   . ASN B  1 44  ? 37.857  180.072 -2.971  1.00 38.15 ? 69  ASN B N   1 
ATOM   3225  C CA  . ASN B  1 44  ? 36.555  179.578 -3.445  1.00 37.09 ? 69  ASN B CA  1 
ATOM   3226  C C   . ASN B  1 44  ? 36.618  178.259 -4.204  1.00 36.78 ? 69  ASN B C   1 
ATOM   3227  O O   . ASN B  1 44  ? 35.653  177.895 -4.865  1.00 36.87 ? 69  ASN B O   1 
ATOM   3228  C CB  . ASN B  1 44  ? 35.821  180.613 -4.308  1.00 37.40 ? 69  ASN B CB  1 
ATOM   3229  C CG  . ASN B  1 44  ? 35.560  181.911 -3.576  1.00 37.93 ? 69  ASN B CG  1 
ATOM   3230  O OD1 . ASN B  1 44  ? 35.259  181.921 -2.384  1.00 36.78 ? 69  ASN B OD1 1 
ATOM   3231  N ND2 . ASN B  1 44  ? 35.672  183.017 -4.295  1.00 38.71 ? 69  ASN B ND2 1 
ATOM   3232  N N   . LYS B  1 45  ? 37.743  177.554 -4.133  1.00 37.02 ? 70  LYS B N   1 
ATOM   3233  C CA  . LYS B  1 45  ? 37.838  176.226 -4.765  1.00 36.70 ? 70  LYS B CA  1 
ATOM   3234  C C   . LYS B  1 45  ? 38.096  175.130 -3.732  1.00 35.25 ? 70  LYS B C   1 
ATOM   3235  O O   . LYS B  1 45  ? 38.780  175.371 -2.740  1.00 35.36 ? 70  LYS B O   1 
ATOM   3236  C CB  . LYS B  1 45  ? 38.962  176.201 -5.801  1.00 38.55 ? 70  LYS B CB  1 
ATOM   3237  C CG  . LYS B  1 45  ? 38.852  177.231 -6.907  1.00 40.96 ? 70  LYS B CG  1 
ATOM   3238  C CD  . LYS B  1 45  ? 39.803  176.846 -8.034  1.00 45.16 ? 70  LYS B CD  1 
ATOM   3239  C CE  . LYS B  1 45  ? 40.262  178.054 -8.812  1.00 48.74 ? 70  LYS B CE  1 
ATOM   3240  N NZ  . LYS B  1 45  ? 39.114  178.589 -9.581  1.00 50.81 ? 70  LYS B NZ  1 
ATOM   3241  N N   . VAL B  1 46  ? 37.585  173.922 -3.975  1.00 34.40 ? 71  VAL B N   1 
ATOM   3242  C CA  . VAL B  1 46  ? 37.746  172.830 -3.012  1.00 33.47 ? 71  VAL B CA  1 
ATOM   3243  C C   . VAL B  1 46  ? 39.221  172.409 -2.983  1.00 35.24 ? 71  VAL B C   1 
ATOM   3244  O O   . VAL B  1 46  ? 39.853  172.318 -4.029  1.00 36.09 ? 71  VAL B O   1 
ATOM   3245  C CB  . VAL B  1 46  ? 36.823  171.621 -3.348  1.00 32.16 ? 71  VAL B CB  1 
ATOM   3246  C CG1 . VAL B  1 46  ? 37.126  171.080 -4.732  1.00 32.58 ? 71  VAL B CG1 1 
ATOM   3247  C CG2 . VAL B  1 46  ? 36.967  170.514 -2.297  1.00 31.04 ? 71  VAL B CG2 1 
ATOM   3248  N N   . ILE B  1 47  ? 39.780  172.215 -1.789  1.00 35.72 ? 72  ILE B N   1 
ATOM   3249  C CA  . ILE B  1 47  ? 41.127  171.638 -1.653  1.00 37.66 ? 72  ILE B CA  1 
ATOM   3250  C C   . ILE B  1 47  ? 41.176  170.575 -0.555  1.00 36.93 ? 72  ILE B C   1 
ATOM   3251  O O   . ILE B  1 47  ? 40.400  170.599 0.404   1.00 35.66 ? 72  ILE B O   1 
ATOM   3252  C CB  . ILE B  1 47  ? 42.234  172.683 -1.342  1.00 39.04 ? 72  ILE B CB  1 
ATOM   3253  C CG1 . ILE B  1 47  ? 41.858  173.521 -0.110  1.00 39.33 ? 72  ILE B CG1 1 
ATOM   3254  C CG2 . ILE B  1 47  ? 42.579  173.528 -2.588  1.00 41.70 ? 72  ILE B CG2 1 
ATOM   3255  C CD1 . ILE B  1 47  ? 43.066  174.007 0.733   1.00 42.09 ? 72  ILE B CD1 1 
ATOM   3256  N N   . ILE B  1 48  ? 42.097  169.636 -0.708  1.00 38.06 ? 73  ILE B N   1 
ATOM   3257  C CA  . ILE B  1 48  ? 42.358  168.656 0.331   1.00 38.14 ? 73  ILE B CA  1 
ATOM   3258  C C   . ILE B  1 48  ? 43.721  169.015 0.895   1.00 40.04 ? 73  ILE B C   1 
ATOM   3259  O O   . ILE B  1 48  ? 44.684  169.027 0.155   1.00 41.52 ? 73  ILE B O   1 
ATOM   3260  C CB  . ILE B  1 48  ? 42.398  167.245 -0.276  1.00 38.27 ? 73  ILE B CB  1 
ATOM   3261  C CG1 . ILE B  1 48  ? 40.974  166.677 -0.398  1.00 36.44 ? 73  ILE B CG1 1 
ATOM   3262  C CG2 . ILE B  1 48  ? 43.242  166.307 0.560   1.00 38.86 ? 73  ILE B CG2 1 
ATOM   3263  C CD1 . ILE B  1 48  ? 40.878  165.425 -1.297  1.00 36.38 ? 73  ILE B CD1 1 
ATOM   3264  N N   . LYS B  1 49  ? 43.820  169.340 2.182   1.00 39.97 ? 74  LYS B N   1 
ATOM   3265  C CA  . LYS B  1 49  ? 45.155  169.547 2.751   1.00 42.13 ? 74  LYS B CA  1 
ATOM   3266  C C   . LYS B  1 49  ? 45.538  168.377 3.640   1.00 41.58 ? 74  LYS B C   1 
ATOM   3267  O O   . LYS B  1 49  ? 45.047  168.212 4.756   1.00 40.48 ? 74  LYS B O   1 
ATOM   3268  C CB  . LYS B  1 49  ? 45.313  170.899 3.456   1.00 42.83 ? 74  LYS B CB  1 
ATOM   3269  C CG  . LYS B  1 49  ? 44.102  171.385 4.215   1.00 43.52 ? 74  LYS B CG  1 
ATOM   3270  C CD  . LYS B  1 49  ? 44.198  172.896 4.485   1.00 47.34 ? 74  LYS B CD  1 
ATOM   3271  C CE  . LYS B  1 49  ? 43.097  173.340 5.450   1.00 47.91 ? 74  LYS B CE  1 
ATOM   3272  N NZ  . LYS B  1 49  ? 42.642  174.726 5.142   1.00 49.46 ? 74  LYS B NZ  1 
ATOM   3273  N N   . ASP B  1 50  ? 46.415  167.545 3.102   1.00 42.61 ? 75  ASP B N   1 
ATOM   3274  C CA  . ASP B  1 50  ? 46.706  166.259 3.689   1.00 42.10 ? 75  ASP B CA  1 
ATOM   3275  C C   . ASP B  1 50  ? 48.121  165.967 3.281   1.00 44.19 ? 75  ASP B C   1 
ATOM   3276  O O   . ASP B  1 50  ? 48.447  166.054 2.100   1.00 44.91 ? 75  ASP B O   1 
ATOM   3277  C CB  . ASP B  1 50  ? 45.785  165.216 3.074   1.00 40.99 ? 75  ASP B CB  1 
ATOM   3278  C CG  . ASP B  1 50  ? 45.862  163.878 3.779   1.00 40.50 ? 75  ASP B CG  1 
ATOM   3279  O OD1 . ASP B  1 50  ? 46.949  163.511 4.270   1.00 40.60 ? 75  ASP B OD1 1 
ATOM   3280  O OD2 . ASP B  1 50  ? 44.814  163.205 3.853   1.00 39.31 ? 75  ASP B OD2 1 
ATOM   3281  N N   . LYS B  1 51  ? 48.971  165.622 4.234   1.00 44.85 ? 76  LYS B N   1 
ATOM   3282  C CA  . LYS B  1 51  ? 50.362  165.385 3.870   1.00 47.42 ? 76  LYS B CA  1 
ATOM   3283  C C   . LYS B  1 51  ? 50.533  164.070 3.108   1.00 47.59 ? 76  LYS B C   1 
ATOM   3284  O O   . LYS B  1 51  ? 51.592  163.809 2.543   1.00 49.54 ? 76  LYS B O   1 
ATOM   3285  C CB  . LYS B  1 51  ? 51.273  165.440 5.094   1.00 48.50 ? 76  LYS B CB  1 
ATOM   3286  C CG  . LYS B  1 51  ? 50.771  164.628 6.270   1.00 48.52 ? 76  LYS B CG  1 
ATOM   3287  C CD  . LYS B  1 51  ? 51.870  164.511 7.325   1.00 52.19 ? 76  LYS B CD  1 
ATOM   3288  C CE  . LYS B  1 51  ? 51.273  164.523 8.725   1.00 52.24 ? 76  LYS B CE  1 
ATOM   3289  N NZ  . LYS B  1 51  ? 50.917  165.908 9.174   1.00 52.52 ? 76  LYS B NZ  1 
ATOM   3290  N N   . SER B  1 52  ? 49.490  163.247 3.077   1.00 45.74 ? 77  SER B N   1 
ATOM   3291  C CA  . SER B  1 52  ? 49.546  162.001 2.318   1.00 46.27 ? 77  SER B CA  1 
ATOM   3292  C C   . SER B  1 52  ? 48.503  162.022 1.201   1.00 45.35 ? 77  SER B C   1 
ATOM   3293  O O   . SER B  1 52  ? 47.889  161.003 0.885   1.00 44.59 ? 77  SER B O   1 
ATOM   3294  C CB  . SER B  1 52  ? 49.299  160.803 3.239   1.00 45.74 ? 77  SER B CB  1 
ATOM   3295  O OG  . SER B  1 52  ? 49.725  161.084 4.561   1.00 45.85 ? 77  SER B OG  1 
ATOM   3296  N N   . GLU B  1 53  ? 48.304  163.196 0.614   1.00 45.41 ? 78  GLU B N   1 
ATOM   3297  C CA  . GLU B  1 53  ? 47.314  163.371 -0.444  1.00 44.44 ? 78  GLU B CA  1 
ATOM   3298  C C   . GLU B  1 53  ? 47.552  162.405 -1.596  1.00 45.11 ? 78  GLU B C   1 
ATOM   3299  O O   . GLU B  1 53  ? 46.603  161.837 -2.149  1.00 43.46 ? 78  GLU B O   1 
ATOM   3300  C CB  . GLU B  1 53  ? 47.365  164.801 -0.980  1.00 45.10 ? 78  GLU B CB  1 
ATOM   3301  C CG  . GLU B  1 53  ? 46.143  165.186 -1.803  1.00 44.70 ? 78  GLU B CG  1 
ATOM   3302  C CD  . GLU B  1 53  ? 46.318  166.532 -2.486  1.00 46.76 ? 78  GLU B CD  1 
ATOM   3303  O OE1 . GLU B  1 53  ? 47.412  167.120 -2.337  1.00 47.27 ? 78  GLU B OE1 1 
ATOM   3304  O OE2 . GLU B  1 53  ? 45.372  166.987 -3.173  1.00 45.81 ? 78  GLU B OE2 1 
ATOM   3305  N N   . VAL B  1 54  ? 48.820  162.228 -1.969  1.00 46.70 ? 79  VAL B N   1 
ATOM   3306  C CA  . VAL B  1 54  ? 49.153  161.326 -3.070  1.00 47.94 ? 79  VAL B CA  1 
ATOM   3307  C C   . VAL B  1 54  ? 48.702  159.899 -2.767  1.00 47.36 ? 79  VAL B C   1 
ATOM   3308  O O   . VAL B  1 54  ? 48.131  159.230 -3.628  1.00 47.75 ? 79  VAL B O   1 
ATOM   3309  C CB  . VAL B  1 54  ? 50.654  161.339 -3.420  1.00 50.55 ? 79  VAL B CB  1 
ATOM   3310  C CG1 . VAL B  1 54  ? 50.968  160.251 -4.446  1.00 52.04 ? 79  VAL B CG1 1 
ATOM   3311  C CG2 . VAL B  1 54  ? 51.064  162.704 -3.946  1.00 51.20 ? 79  VAL B CG2 1 
ATOM   3312  N N   . MET B  1 55  ? 48.941  159.441 -1.539  1.00 46.63 ? 80  MET B N   1 
ATOM   3313  C CA  . MET B  1 55  ? 48.546  158.092 -1.146  1.00 45.96 ? 80  MET B CA  1 
ATOM   3314  C C   . MET B  1 55  ? 47.021  157.946 -1.091  1.00 42.96 ? 80  MET B C   1 
ATOM   3315  O O   . MET B  1 55  ? 46.472  156.911 -1.472  1.00 42.63 ? 80  MET B O   1 
ATOM   3316  C CB  . MET B  1 55  ? 49.172  157.715 0.204   1.00 46.80 ? 80  MET B CB  1 
ATOM   3317  C CG  . MET B  1 55  ? 49.119  156.213 0.543   1.00 50.47 ? 80  MET B CG  1 
ATOM   3318  S SD  . MET B  1 55  ? 49.145  155.888 2.333   1.00 58.09 ? 80  MET B SD  1 
ATOM   3319  C CE  . MET B  1 55  ? 50.835  156.384 2.682   1.00 57.79 ? 80  MET B CE  1 
ATOM   3320  N N   . LEU B  1 56  ? 46.341  158.980 -0.609  1.00 40.13 ? 81  LEU B N   1 
ATOM   3321  C CA  . LEU B  1 56  ? 44.891  158.948 -0.547  1.00 37.62 ? 81  LEU B CA  1 
ATOM   3322  C C   . LEU B  1 56  ? 44.260  158.616 -1.908  1.00 37.46 ? 81  LEU B C   1 
ATOM   3323  O O   . LEU B  1 56  ? 43.347  157.786 -1.990  1.00 36.84 ? 81  LEU B O   1 
ATOM   3324  C CB  . LEU B  1 56  ? 44.345  160.276 -0.021  1.00 35.96 ? 81  LEU B CB  1 
ATOM   3325  C CG  . LEU B  1 56  ? 42.840  160.516 -0.176  1.00 33.81 ? 81  LEU B CG  1 
ATOM   3326  C CD1 . LEU B  1 56  ? 42.008  159.649 0.780   1.00 33.11 ? 81  LEU B CD1 1 
ATOM   3327  C CD2 . LEU B  1 56  ? 42.509  162.016 0.030   1.00 31.88 ? 81  LEU B CD2 1 
ATOM   3328  N N   . TYR B  1 57  ? 44.726  159.277 -2.963  1.00 37.78 ? 82  TYR B N   1 
ATOM   3329  C CA  . TYR B  1 57  ? 44.166  159.074 -4.300  1.00 38.29 ? 82  TYR B CA  1 
ATOM   3330  C C   . TYR B  1 57  ? 44.404  157.665 -4.827  1.00 39.28 ? 82  TYR B C   1 
ATOM   3331  O O   . TYR B  1 57  ? 43.515  157.075 -5.444  1.00 39.17 ? 82  TYR B O   1 
ATOM   3332  C CB  . TYR B  1 57  ? 44.692  160.123 -5.302  1.00 39.50 ? 82  TYR B CB  1 
ATOM   3333  C CG  . TYR B  1 57  ? 44.271  161.526 -4.922  1.00 38.83 ? 82  TYR B CG  1 
ATOM   3334  C CD1 . TYR B  1 57  ? 42.954  161.798 -4.548  1.00 36.82 ? 82  TYR B CD1 1 
ATOM   3335  C CD2 . TYR B  1 57  ? 45.191  162.573 -4.916  1.00 40.89 ? 82  TYR B CD2 1 
ATOM   3336  C CE1 . TYR B  1 57  ? 42.564  163.083 -4.179  1.00 36.54 ? 82  TYR B CE1 1 
ATOM   3337  C CE2 . TYR B  1 57  ? 44.807  163.861 -4.556  1.00 39.83 ? 82  TYR B CE2 1 
ATOM   3338  C CZ  . TYR B  1 57  ? 43.502  164.105 -4.192  1.00 38.36 ? 82  TYR B CZ  1 
ATOM   3339  O OH  . TYR B  1 57  ? 43.140  165.377 -3.824  1.00 37.81 ? 82  TYR B OH  1 
ATOM   3340  N N   . GLN B  1 58  ? 45.596  157.129 -4.572  1.00 40.52 ? 83  GLN B N   1 
ATOM   3341  C CA  . GLN B  1 58  ? 45.944  155.784 -5.006  1.00 41.67 ? 83  GLN B CA  1 
ATOM   3342  C C   . GLN B  1 58  ? 45.113  154.748 -4.266  1.00 39.72 ? 83  GLN B C   1 
ATOM   3343  O O   . GLN B  1 58  ? 44.658  153.772 -4.852  1.00 39.42 ? 83  GLN B O   1 
ATOM   3344  C CB  . GLN B  1 58  ? 47.432  155.495 -4.766  1.00 44.01 ? 83  GLN B CB  1 
ATOM   3345  C CG  . GLN B  1 58  ? 48.392  156.280 -5.621  1.00 47.89 ? 83  GLN B CG  1 
ATOM   3346  C CD  . GLN B  1 58  ? 49.836  156.020 -5.218  1.00 52.65 ? 83  GLN B CD  1 
ATOM   3347  O OE1 . GLN B  1 58  ? 50.109  155.614 -4.085  1.00 54.46 ? 83  GLN B OE1 1 
ATOM   3348  N NE2 . GLN B  1 58  ? 50.756  156.244 -6.133  1.00 53.58 ? 83  GLN B NE2 1 
ATOM   3349  N N   . THR B  1 59  ? 44.907  154.974 -2.970  1.00 38.76 ? 84  THR B N   1 
ATOM   3350  C CA  . THR B  1 59  ? 44.110  154.064 -2.156  1.00 37.42 ? 84  THR B CA  1 
ATOM   3351  C C   . THR B  1 59  ? 42.645  154.124 -2.563  1.00 36.00 ? 84  THR B C   1 
ATOM   3352  O O   . THR B  1 59  ? 41.963  153.103 -2.637  1.00 35.75 ? 84  THR B O   1 
ATOM   3353  C CB  . THR B  1 59  ? 44.264  154.387 -0.674  1.00 36.20 ? 84  THR B CB  1 
ATOM   3354  O OG1 . THR B  1 59  ? 45.655  154.314 -0.335  1.00 38.72 ? 84  THR B OG1 1 
ATOM   3355  C CG2 . THR B  1 59  ? 43.510  153.403 0.163   1.00 35.61 ? 84  THR B CG2 1 
ATOM   3356  N N   . ILE B  1 60  ? 42.149  155.325 -2.820  1.00 35.38 ? 85  ILE B N   1 
ATOM   3357  C CA  . ILE B  1 60  ? 40.790  155.449 -3.348  1.00 33.73 ? 85  ILE B CA  1 
ATOM   3358  C C   . ILE B  1 60  ? 40.585  154.593 -4.609  1.00 35.48 ? 85  ILE B C   1 
ATOM   3359  O O   . ILE B  1 60  ? 39.603  153.854 -4.696  1.00 35.25 ? 85  ILE B O   1 
ATOM   3360  C CB  . ILE B  1 60  ? 40.408  156.919 -3.640  1.00 33.38 ? 85  ILE B CB  1 
ATOM   3361  C CG1 . ILE B  1 60  ? 40.208  157.685 -2.319  1.00 31.31 ? 85  ILE B CG1 1 
ATOM   3362  C CG2 . ILE B  1 60  ? 39.139  156.982 -4.501  1.00 31.62 ? 85  ILE B CG2 1 
ATOM   3363  C CD1 . ILE B  1 60  ? 39.895  159.194 -2.504  1.00 32.36 ? 85  ILE B CD1 1 
ATOM   3364  N N   . ASN B  1 61  ? 41.495  154.694 -5.582  1.00 36.69 ? 86  ASN B N   1 
ATOM   3365  C CA  . ASN B  1 61  ? 41.367  153.934 -6.823  1.00 38.60 ? 86  ASN B CA  1 
ATOM   3366  C C   . ASN B  1 61  ? 41.506  152.451 -6.573  1.00 39.39 ? 86  ASN B C   1 
ATOM   3367  O O   . ASN B  1 61  ? 40.810  151.636 -7.178  1.00 39.60 ? 86  ASN B O   1 
ATOM   3368  C CB  . ASN B  1 61  ? 42.415  154.357 -7.860  1.00 39.65 ? 86  ASN B CB  1 
ATOM   3369  C CG  . ASN B  1 61  ? 42.246  155.804 -8.306  1.00 40.75 ? 86  ASN B CG  1 
ATOM   3370  O OD1 . ASN B  1 61  ? 41.152  156.366 -8.247  1.00 38.38 ? 86  ASN B OD1 1 
ATOM   3371  N ND2 . ASN B  1 61  ? 43.335  156.409 -8.758  1.00 41.57 ? 86  ASN B ND2 1 
ATOM   3372  N N   . SER B  1 62  ? 42.443  152.110 -5.700  1.00 40.11 ? 87  SER B N   1 
ATOM   3373  C CA  . SER B  1 62  ? 42.663  150.724 -5.315  1.00 41.68 ? 87  SER B CA  1 
ATOM   3374  C C   . SER B  1 62  ? 41.417  150.111 -4.640  1.00 39.74 ? 87  SER B C   1 
ATOM   3375  O O   . SER B  1 62  ? 40.990  149.002 -4.984  1.00 40.46 ? 87  SER B O   1 
ATOM   3376  C CB  . SER B  1 62  ? 43.863  150.645 -4.374  1.00 42.50 ? 87  SER B CB  1 
ATOM   3377  O OG  . SER B  1 62  ? 44.196  149.298 -4.098  1.00 45.21 ? 87  SER B OG  1 
ATOM   3378  N N   . LEU B  1 63  ? 40.844  150.826 -3.677  1.00 37.51 ? 88  LEU B N   1 
ATOM   3379  C CA  . LEU B  1 63  ? 39.640  150.367 -2.984  1.00 35.62 ? 88  LEU B CA  1 
ATOM   3380  C C   . LEU B  1 63  ? 38.474  150.140 -3.944  1.00 35.86 ? 88  LEU B C   1 
ATOM   3381  O O   . LEU B  1 63  ? 37.746  149.142 -3.829  1.00 35.72 ? 88  LEU B O   1 
ATOM   3382  C CB  . LEU B  1 63  ? 39.230  151.365 -1.899  1.00 33.32 ? 88  LEU B CB  1 
ATOM   3383  C CG  . LEU B  1 63  ? 40.121  151.473 -0.667  1.00 33.33 ? 88  LEU B CG  1 
ATOM   3384  C CD1 . LEU B  1 63  ? 39.759  152.699 0.194   1.00 31.32 ? 88  LEU B CD1 1 
ATOM   3385  C CD2 . LEU B  1 63  ? 40.080  150.199 0.172   1.00 33.41 ? 88  LEU B CD2 1 
ATOM   3386  N N   . LYS B  1 64  ? 38.308  151.058 -4.896  1.00 35.65 ? 89  LYS B N   1 
ATOM   3387  C CA  . LYS B  1 64  ? 37.183  151.001 -5.829  1.00 35.67 ? 89  LYS B CA  1 
ATOM   3388  C C   . LYS B  1 64  ? 37.375  149.951 -6.924  1.00 37.53 ? 89  LYS B C   1 
ATOM   3389  O O   . LYS B  1 64  ? 36.399  149.475 -7.499  1.00 37.05 ? 89  LYS B O   1 
ATOM   3390  C CB  . LYS B  1 64  ? 36.884  152.390 -6.419  1.00 34.94 ? 89  LYS B CB  1 
ATOM   3391  C CG  . LYS B  1 64  ? 36.513  153.415 -5.332  1.00 33.17 ? 89  LYS B CG  1 
ATOM   3392  C CD  . LYS B  1 64  ? 36.116  154.772 -5.916  1.00 33.73 ? 89  LYS B CD  1 
ATOM   3393  C CE  . LYS B  1 64  ? 34.911  154.634 -6.839  1.00 34.16 ? 89  LYS B CE  1 
ATOM   3394  N NZ  . LYS B  1 64  ? 34.495  155.976 -7.349  1.00 33.91 ? 89  LYS B NZ  1 
ATOM   3395  N N   . THR B  1 65  ? 38.626  149.599 -7.214  1.00 39.88 ? 90  THR B N   1 
ATOM   3396  C CA  . THR B  1 65  ? 38.910  148.519 -8.180  1.00 42.12 ? 90  THR B CA  1 
ATOM   3397  C C   . THR B  1 65  ? 38.543  147.196 -7.529  1.00 42.73 ? 90  THR B C   1 
ATOM   3398  O O   . THR B  1 65  ? 37.892  146.351 -8.140  1.00 43.53 ? 90  THR B O   1 
ATOM   3399  C CB  . THR B  1 65  ? 40.392  148.463 -8.568  1.00 44.16 ? 90  THR B CB  1 
ATOM   3400  O OG1 . THR B  1 65  ? 40.764  149.696 -9.190  1.00 44.64 ? 90  THR B OG1 1 
ATOM   3401  C CG2 . THR B  1 65  ? 40.674  147.303 -9.552  1.00 46.17 ? 90  THR B CG2 1 
ATOM   3402  N N   . LYS B  1 66  ? 38.948  147.050 -6.269  1.00 42.22 ? 91  LYS B N   1 
ATOM   3403  C CA  . LYS B  1 66  ? 38.670  145.865 -5.478  1.00 43.00 ? 91  LYS B CA  1 
ATOM   3404  C C   . LYS B  1 66  ? 37.181  145.647 -5.253  1.00 41.72 ? 91  LYS B C   1 
ATOM   3405  O O   . LYS B  1 66  ? 36.700  144.519 -5.333  1.00 42.22 ? 91  LYS B O   1 
ATOM   3406  C CB  . LYS B  1 66  ? 39.390  145.945 -4.134  1.00 42.54 ? 91  LYS B CB  1 
ATOM   3407  C CG  . LYS B  1 66  ? 40.880  145.632 -4.247  1.00 46.30 ? 91  LYS B CG  1 
ATOM   3408  C CD  . LYS B  1 66  ? 41.557  145.808 -2.893  1.00 48.42 ? 91  LYS B CD  1 
ATOM   3409  C CE  . LYS B  1 66  ? 43.077  145.819 -3.039  1.00 51.44 ? 91  LYS B CE  1 
ATOM   3410  N NZ  . LYS B  1 66  ? 43.677  146.316 -1.769  1.00 52.64 ? 91  LYS B NZ  1 
ATOM   3411  N N   . ASN B  1 67  ? 36.460  146.723 -4.948  1.00 39.36 ? 92  ASN B N   1 
ATOM   3412  C CA  . ASN B  1 67  ? 35.015  146.642 -4.806  1.00 38.07 ? 92  ASN B CA  1 
ATOM   3413  C C   . ASN B  1 67  ? 34.323  147.657 -5.700  1.00 37.51 ? 92  ASN B C   1 
ATOM   3414  O O   . ASN B  1 67  ? 34.195  148.821 -5.322  1.00 35.99 ? 92  ASN B O   1 
ATOM   3415  C CB  . ASN B  1 67  ? 34.604  146.844 -3.346  1.00 35.64 ? 92  ASN B CB  1 
ATOM   3416  C CG  . ASN B  1 67  ? 33.108  146.824 -3.162  1.00 34.25 ? 92  ASN B CG  1 
ATOM   3417  O OD1 . ASN B  1 67  ? 32.359  146.671 -4.119  1.00 34.00 ? 92  ASN B OD1 1 
ATOM   3418  N ND2 . ASN B  1 67  ? 32.662  147.001 -1.927  1.00 31.84 ? 92  ASN B ND2 1 
ATOM   3419  N N   . PRO B  1 68  ? 33.878  147.224 -6.891  1.00 38.81 ? 93  PRO B N   1 
ATOM   3420  C CA  . PRO B  1 68  ? 33.326  148.167 -7.854  1.00 38.88 ? 93  PRO B CA  1 
ATOM   3421  C C   . PRO B  1 68  ? 31.975  148.758 -7.455  1.00 37.42 ? 93  PRO B C   1 
ATOM   3422  O O   . PRO B  1 68  ? 31.504  149.675 -8.118  1.00 37.67 ? 93  PRO B O   1 
ATOM   3423  C CB  . PRO B  1 68  ? 33.174  147.313 -9.133  1.00 41.17 ? 93  PRO B CB  1 
ATOM   3424  C CG  . PRO B  1 68  ? 34.092  146.143 -8.933  1.00 42.52 ? 93  PRO B CG  1 
ATOM   3425  C CD  . PRO B  1 68  ? 34.010  145.871 -7.471  1.00 40.91 ? 93  PRO B CD  1 
ATOM   3426  N N   . LYS B  1 69  ? 31.352  148.256 -6.394  1.00 36.49 ? 94  LYS B N   1 
ATOM   3427  C CA  . LYS B  1 69  ? 30.109  148.869 -5.917  1.00 35.02 ? 94  LYS B CA  1 
ATOM   3428  C C   . LYS B  1 69  ? 30.346  149.896 -4.825  1.00 32.87 ? 94  LYS B C   1 
ATOM   3429  O O   . LYS B  1 69  ? 29.417  150.611 -4.446  1.00 31.39 ? 94  LYS B O   1 
ATOM   3430  C CB  . LYS B  1 69  ? 29.069  147.833 -5.471  1.00 35.35 ? 94  LYS B CB  1 
ATOM   3431  C CG  . LYS B  1 69  ? 28.452  147.090 -6.658  1.00 40.12 ? 94  LYS B CG  1 
ATOM   3432  C CD  . LYS B  1 69  ? 27.219  146.270 -6.291  1.00 44.03 ? 94  LYS B CD  1 
ATOM   3433  C CE  . LYS B  1 69  ? 26.724  145.491 -7.534  1.00 46.90 ? 94  LYS B CE  1 
ATOM   3434  N NZ  . LYS B  1 69  ? 26.027  144.217 -7.162  1.00 48.05 ? 94  LYS B NZ  1 
ATOM   3435  N N   . LEU B  1 70  ? 31.580  149.981 -4.323  1.00 32.57 ? 95  LEU B N   1 
ATOM   3436  C CA  . LEU B  1 70  ? 31.875  150.889 -3.205  1.00 30.58 ? 95  LEU B CA  1 
ATOM   3437  C C   . LEU B  1 70  ? 31.751  152.343 -3.647  1.00 29.98 ? 95  LEU B C   1 
ATOM   3438  O O   . LEU B  1 70  ? 32.202  152.706 -4.730  1.00 30.46 ? 95  LEU B O   1 
ATOM   3439  C CB  . LEU B  1 70  ? 33.269  150.615 -2.620  1.00 30.76 ? 95  LEU B CB  1 
ATOM   3440  C CG  . LEU B  1 70  ? 33.840  151.530 -1.520  1.00 30.13 ? 95  LEU B CG  1 
ATOM   3441  C CD1 . LEU B  1 70  ? 33.077  151.400 -0.198  1.00 27.45 ? 95  LEU B CD1 1 
ATOM   3442  C CD2 . LEU B  1 70  ? 35.321  151.263 -1.309  1.00 29.30 ? 95  LEU B CD2 1 
ATOM   3443  N N   . LYS B  1 71  ? 31.129  153.165 -2.804  1.00 28.45 ? 96  LYS B N   1 
ATOM   3444  C CA  . LYS B  1 71  ? 31.057  154.602 -3.044  1.00 27.50 ? 96  LYS B CA  1 
ATOM   3445  C C   . LYS B  1 71  ? 31.984  155.368 -2.101  1.00 26.62 ? 96  LYS B C   1 
ATOM   3446  O O   . LYS B  1 71  ? 32.031  155.102 -0.902  1.00 26.10 ? 96  LYS B O   1 
ATOM   3447  C CB  . LYS B  1 71  ? 29.620  155.109 -2.879  1.00 26.64 ? 96  LYS B CB  1 
ATOM   3448  C CG  . LYS B  1 71  ? 28.578  154.403 -3.745  1.00 29.07 ? 96  LYS B CG  1 
ATOM   3449  C CD  . LYS B  1 71  ? 28.857  154.647 -5.232  1.00 34.59 ? 96  LYS B CD  1 
ATOM   3450  C CE  . LYS B  1 71  ? 27.622  154.416 -6.087  1.00 37.89 ? 96  LYS B CE  1 
ATOM   3451  N NZ  . LYS B  1 71  ? 27.747  153.214 -6.938  1.00 41.21 ? 96  LYS B NZ  1 
ATOM   3452  N N   . ILE B  1 72  ? 32.715  156.336 -2.640  1.00 26.25 ? 97  ILE B N   1 
ATOM   3453  C CA  . ILE B  1 72  ? 33.581  157.148 -1.815  1.00 25.26 ? 97  ILE B CA  1 
ATOM   3454  C C   . ILE B  1 72  ? 33.293  158.627 -2.065  1.00 25.34 ? 97  ILE B C   1 
ATOM   3455  O O   . ILE B  1 72  ? 33.481  159.136 -3.174  1.00 25.18 ? 97  ILE B O   1 
ATOM   3456  C CB  . ILE B  1 72  ? 35.069  156.826 -2.059  1.00 26.64 ? 97  ILE B CB  1 
ATOM   3457  C CG1 . ILE B  1 72  ? 35.296  155.314 -1.928  1.00 26.51 ? 97  ILE B CG1 1 
ATOM   3458  C CG2 . ILE B  1 72  ? 35.954  157.641 -1.108  1.00 25.72 ? 97  ILE B CG2 1 
ATOM   3459  C CD1 . ILE B  1 72  ? 36.719  154.905 -1.829  1.00 26.04 ? 97  ILE B CD1 1 
ATOM   3460  N N   . LEU B  1 73  ? 32.825  159.291 -1.011  1.00 24.23 ? 98  LEU B N   1 
ATOM   3461  C CA  . LEU B  1 73  ? 32.451  160.702 -1.044  1.00 24.33 ? 98  LEU B CA  1 
ATOM   3462  C C   . LEU B  1 73  ? 33.503  161.538 -0.339  1.00 24.32 ? 98  LEU B C   1 
ATOM   3463  O O   . LEU B  1 73  ? 34.262  161.027 0.481   1.00 24.06 ? 98  LEU B O   1 
ATOM   3464  C CB  . LEU B  1 73  ? 31.104  160.906 -0.332  1.00 23.65 ? 98  LEU B CB  1 
ATOM   3465  C CG  . LEU B  1 73  ? 29.844  160.379 -1.025  1.00 25.77 ? 98  LEU B CG  1 
ATOM   3466  C CD1 . LEU B  1 73  ? 29.759  158.874 -0.912  1.00 26.55 ? 98  LEU B CD1 1 
ATOM   3467  C CD2 . LEU B  1 73  ? 28.612  161.017 -0.399  1.00 27.46 ? 98  LEU B CD2 1 
ATOM   3468  N N   . LEU B  1 74  ? 33.548  162.828 -0.666  1.00 24.59 ? 99  LEU B N   1 
ATOM   3469  C CA  . LEU B  1 74  ? 34.408  163.773 0.019   1.00 25.10 ? 99  LEU B CA  1 
ATOM   3470  C C   . LEU B  1 74  ? 33.545  164.673 0.913   1.00 24.63 ? 99  LEU B C   1 
ATOM   3471  O O   . LEU B  1 74  ? 32.508  165.192 0.462   1.00 24.32 ? 99  LEU B O   1 
ATOM   3472  C CB  . LEU B  1 74  ? 35.153  164.635 -1.023  1.00 26.68 ? 99  LEU B CB  1 
ATOM   3473  C CG  . LEU B  1 74  ? 36.022  165.787 -0.509  1.00 27.22 ? 99  LEU B CG  1 
ATOM   3474  C CD1 . LEU B  1 74  ? 37.252  165.199 0.152   1.00 29.43 ? 99  LEU B CD1 1 
ATOM   3475  C CD2 . LEU B  1 74  ? 36.416  166.768 -1.634  1.00 28.75 ? 99  LEU B CD2 1 
ATOM   3476  N N   . SER B  1 75  ? 33.949  164.871 2.175   1.00 24.02 ? 100 SER B N   1 
ATOM   3477  C CA  . SER B  1 75  ? 33.163  165.726 3.066   1.00 22.72 ? 100 SER B CA  1 
ATOM   3478  C C   . SER B  1 75  ? 33.842  167.078 3.247   1.00 23.25 ? 100 SER B C   1 
ATOM   3479  O O   . SER B  1 75  ? 35.076  167.144 3.339   1.00 23.82 ? 100 SER B O   1 
ATOM   3480  C CB  . SER B  1 75  ? 32.984  165.090 4.443   1.00 21.57 ? 100 SER B CB  1 
ATOM   3481  O OG  . SER B  1 75  ? 32.143  165.909 5.242   1.00 21.47 ? 100 SER B OG  1 
ATOM   3482  N N   . ILE B  1 76  ? 33.038  168.143 3.298   1.00 22.83 ? 101 ILE B N   1 
ATOM   3483  C CA  . ILE B  1 76  ? 33.520  169.489 3.640   1.00 23.61 ? 101 ILE B CA  1 
ATOM   3484  C C   . ILE B  1 76  ? 32.707  169.955 4.830   1.00 22.68 ? 101 ILE B C   1 
ATOM   3485  O O   . ILE B  1 76  ? 31.483  169.810 4.841   1.00 20.96 ? 101 ILE B O   1 
ATOM   3486  C CB  . ILE B  1 76  ? 33.310  170.485 2.489   1.00 24.44 ? 101 ILE B CB  1 
ATOM   3487  C CG1 . ILE B  1 76  ? 34.118  170.042 1.277   1.00 27.50 ? 101 ILE B CG1 1 
ATOM   3488  C CG2 . ILE B  1 76  ? 33.774  171.901 2.884   1.00 26.12 ? 101 ILE B CG2 1 
ATOM   3489  C CD1 . ILE B  1 76  ? 34.175  171.073 0.171   1.00 29.53 ? 101 ILE B CD1 1 
ATOM   3490  N N   . GLY B  1 77  ? 33.378  170.488 5.842   1.00 22.43 ? 102 GLY B N   1 
ATOM   3491  C CA  . GLY B  1 77  ? 32.672  170.975 7.011   1.00 23.13 ? 102 GLY B CA  1 
ATOM   3492  C C   . GLY B  1 77  ? 33.239  170.432 8.304   1.00 22.95 ? 102 GLY B C   1 
ATOM   3493  O O   . GLY B  1 77  ? 34.458  170.404 8.489   1.00 23.96 ? 102 GLY B O   1 
ATOM   3494  N N   . GLY B  1 78  ? 32.351  169.993 9.193   1.00 21.80 ? 103 GLY B N   1 
ATOM   3495  C CA  . GLY B  1 78  ? 32.765  169.521 10.510  1.00 22.27 ? 103 GLY B CA  1 
ATOM   3496  C C   . GLY B  1 78  ? 32.886  170.647 11.532  1.00 22.77 ? 103 GLY B C   1 
ATOM   3497  O O   . GLY B  1 78  ? 32.744  171.837 11.196  1.00 23.74 ? 103 GLY B O   1 
ATOM   3498  N N   . TYR B  1 79  ? 33.149  170.281 12.784  1.00 22.66 ? 104 TYR B N   1 
ATOM   3499  C CA  . TYR B  1 79  ? 33.096  171.247 13.909  1.00 23.64 ? 104 TYR B CA  1 
ATOM   3500  C C   . TYR B  1 79  ? 34.091  172.414 13.826  1.00 24.57 ? 104 TYR B C   1 
ATOM   3501  O O   . TYR B  1 79  ? 33.716  173.590 13.988  1.00 25.08 ? 104 TYR B O   1 
ATOM   3502  C CB  . TYR B  1 79  ? 33.281  170.529 15.258  1.00 23.28 ? 104 TYR B CB  1 
ATOM   3503  C CG  . TYR B  1 79  ? 33.080  171.443 16.472  1.00 25.00 ? 104 TYR B CG  1 
ATOM   3504  C CD1 . TYR B  1 79  ? 31.811  171.920 16.803  1.00 27.56 ? 104 TYR B CD1 1 
ATOM   3505  C CD2 . TYR B  1 79  ? 34.152  171.818 17.282  1.00 28.92 ? 104 TYR B CD2 1 
ATOM   3506  C CE1 . TYR B  1 79  ? 31.607  172.759 17.913  1.00 30.04 ? 104 TYR B CE1 1 
ATOM   3507  C CE2 . TYR B  1 79  ? 33.965  172.669 18.398  1.00 30.80 ? 104 TYR B CE2 1 
ATOM   3508  C CZ  . TYR B  1 79  ? 32.686  173.125 18.699  1.00 31.66 ? 104 TYR B CZ  1 
ATOM   3509  O OH  . TYR B  1 79  ? 32.471  173.943 19.783  1.00 35.97 ? 104 TYR B OH  1 
ATOM   3510  N N   . LEU B  1 80  ? 35.357  172.100 13.620  1.00 24.58 ? 105 LEU B N   1 
ATOM   3511  C CA  . LEU B  1 80  ? 36.369  173.146 13.592  1.00 26.51 ? 105 LEU B CA  1 
ATOM   3512  C C   . LEU B  1 80  ? 36.229  174.062 12.367  1.00 27.08 ? 105 LEU B C   1 
ATOM   3513  O O   . LEU B  1 80  ? 36.502  175.261 12.452  1.00 28.07 ? 105 LEU B O   1 
ATOM   3514  C CB  . LEU B  1 80  ? 37.772  172.553 13.703  1.00 27.51 ? 105 LEU B CB  1 
ATOM   3515  C CG  . LEU B  1 80  ? 38.098  171.892 15.054  1.00 28.71 ? 105 LEU B CG  1 
ATOM   3516  C CD1 . LEU B  1 80  ? 39.545  171.374 15.033  1.00 30.48 ? 105 LEU B CD1 1 
ATOM   3517  C CD2 . LEU B  1 80  ? 37.891  172.893 16.221  1.00 29.73 ? 105 LEU B CD2 1 
ATOM   3518  N N   . PHE B  1 81  ? 35.811  173.508 11.230  1.00 26.22 ? 106 PHE B N   1 
ATOM   3519  C CA  . PHE B  1 81  ? 35.583  174.322 10.024  1.00 26.33 ? 106 PHE B CA  1 
ATOM   3520  C C   . PHE B  1 81  ? 34.539  175.390 10.342  1.00 26.38 ? 106 PHE B C   1 
ATOM   3521  O O   . PHE B  1 81  ? 34.698  176.549 9.958   1.00 26.14 ? 106 PHE B O   1 
ATOM   3522  C CB  . PHE B  1 81  ? 35.088  173.427 8.884   1.00 25.99 ? 106 PHE B CB  1 
ATOM   3523  C CG  . PHE B  1 81  ? 35.181  174.038 7.496   1.00 26.38 ? 106 PHE B CG  1 
ATOM   3524  C CD1 . PHE B  1 81  ? 36.409  174.157 6.842   1.00 28.64 ? 106 PHE B CD1 1 
ATOM   3525  C CD2 . PHE B  1 81  ? 34.032  174.429 6.823   1.00 25.41 ? 106 PHE B CD2 1 
ATOM   3526  C CE1 . PHE B  1 81  ? 36.478  174.682 5.537   1.00 29.62 ? 106 PHE B CE1 1 
ATOM   3527  C CE2 . PHE B  1 81  ? 34.084  174.948 5.527   1.00 26.29 ? 106 PHE B CE2 1 
ATOM   3528  C CZ  . PHE B  1 81  ? 35.315  175.066 4.875   1.00 27.51 ? 106 PHE B CZ  1 
ATOM   3529  N N   . GLY B  1 82  ? 33.468  174.983 11.033  1.00 25.04 ? 107 GLY B N   1 
ATOM   3530  C CA  . GLY B  1 82  ? 32.446  175.935 11.515  1.00 25.64 ? 107 GLY B CA  1 
ATOM   3531  C C   . GLY B  1 82  ? 31.682  176.559 10.361  1.00 26.01 ? 107 GLY B C   1 
ATOM   3532  O O   . GLY B  1 82  ? 31.667  176.007 9.252   1.00 24.63 ? 107 GLY B O   1 
ATOM   3533  N N   . SER B  1 83  ? 31.058  177.710 10.608  1.00 26.36 ? 108 SER B N   1 
ATOM   3534  C CA  . SER B  1 83  ? 30.444  178.487 9.522   1.00 27.23 ? 108 SER B CA  1 
ATOM   3535  C C   . SER B  1 83  ? 31.477  179.302 8.771   1.00 28.44 ? 108 SER B C   1 
ATOM   3536  O O   . SER B  1 83  ? 31.322  179.545 7.568   1.00 29.10 ? 108 SER B O   1 
ATOM   3537  C CB  . SER B  1 83  ? 29.351  179.425 10.052  1.00 27.09 ? 108 SER B CB  1 
ATOM   3538  O OG  . SER B  1 83  ? 28.231  178.672 10.472  1.00 25.79 ? 108 SER B OG  1 
ATOM   3539  N N   . LYS B  1 84  ? 32.518  179.730 9.482   1.00 29.27 ? 109 LYS B N   1 
ATOM   3540  C CA  . LYS B  1 84  ? 33.563  180.598 8.913   1.00 31.15 ? 109 LYS B CA  1 
ATOM   3541  C C   . LYS B  1 84  ? 34.192  180.048 7.642   1.00 30.43 ? 109 LYS B C   1 
ATOM   3542  O O   . LYS B  1 84  ? 34.480  180.793 6.711   1.00 31.16 ? 109 LYS B O   1 
ATOM   3543  C CB  . LYS B  1 84  ? 34.708  180.816 9.911   1.00 32.48 ? 109 LYS B CB  1 
ATOM   3544  C CG  . LYS B  1 84  ? 34.426  181.689 11.121  1.00 36.33 ? 109 LYS B CG  1 
ATOM   3545  C CD  . LYS B  1 84  ? 35.447  181.306 12.207  1.00 40.55 ? 109 LYS B CD  1 
ATOM   3546  C CE  . LYS B  1 84  ? 35.644  179.773 12.200  1.00 42.72 ? 109 LYS B CE  1 
ATOM   3547  N NZ  . LYS B  1 84  ? 36.986  179.307 12.692  1.00 43.60 ? 109 LYS B NZ  1 
ATOM   3548  N N   . GLY B  1 85  ? 34.467  178.752 7.620   1.00 29.15 ? 110 GLY B N   1 
ATOM   3549  C CA  . GLY B  1 85  ? 35.146  178.167 6.466   1.00 29.33 ? 110 GLY B CA  1 
ATOM   3550  C C   . GLY B  1 85  ? 34.339  178.273 5.172   1.00 28.80 ? 110 GLY B C   1 
ATOM   3551  O O   . GLY B  1 85  ? 34.895  178.161 4.080   1.00 29.10 ? 110 GLY B O   1 
ATOM   3552  N N   . PHE B  1 86  ? 33.024  178.486 5.300   1.00 27.70 ? 111 PHE B N   1 
ATOM   3553  C CA  . PHE B  1 86  ? 32.144  178.635 4.138   1.00 27.39 ? 111 PHE B CA  1 
ATOM   3554  C C   . PHE B  1 86  ? 32.097  180.068 3.559   1.00 28.39 ? 111 PHE B C   1 
ATOM   3555  O O   . PHE B  1 86  ? 31.499  180.303 2.497   1.00 28.96 ? 111 PHE B O   1 
ATOM   3556  C CB  . PHE B  1 86  ? 30.733  178.119 4.456   1.00 25.66 ? 111 PHE B CB  1 
ATOM   3557  C CG  . PHE B  1 86  ? 30.658  176.616 4.656   1.00 24.47 ? 111 PHE B CG  1 
ATOM   3558  C CD1 . PHE B  1 86  ? 30.556  175.760 3.568   1.00 25.38 ? 111 PHE B CD1 1 
ATOM   3559  C CD2 . PHE B  1 86  ? 30.666  176.067 5.932   1.00 24.99 ? 111 PHE B CD2 1 
ATOM   3560  C CE1 . PHE B  1 86  ? 30.475  174.383 3.740   1.00 24.18 ? 111 PHE B CE1 1 
ATOM   3561  C CE2 . PHE B  1 86  ? 30.590  174.681 6.117   1.00 23.24 ? 111 PHE B CE2 1 
ATOM   3562  C CZ  . PHE B  1 86  ? 30.499  173.845 5.011   1.00 23.61 ? 111 PHE B CZ  1 
ATOM   3563  N N   . HIS B  1 87  ? 32.739  181.010 4.243   1.00 28.68 ? 112 HIS B N   1 
ATOM   3564  C CA  . HIS B  1 87  ? 32.829  182.390 3.766   1.00 30.39 ? 112 HIS B CA  1 
ATOM   3565  C C   . HIS B  1 87  ? 34.256  182.660 3.338   1.00 31.23 ? 112 HIS B C   1 
ATOM   3566  O O   . HIS B  1 87  ? 35.168  182.247 4.027   1.00 31.40 ? 112 HIS B O   1 
ATOM   3567  C CB  . HIS B  1 87  ? 32.414  183.350 4.893   1.00 30.83 ? 112 HIS B CB  1 
ATOM   3568  C CG  . HIS B  1 87  ? 30.976  183.205 5.274   1.00 31.20 ? 112 HIS B CG  1 
ATOM   3569  N ND1 . HIS B  1 87  ? 29.954  183.757 4.532   1.00 32.16 ? 112 HIS B ND1 1 
ATOM   3570  C CD2 . HIS B  1 87  ? 30.380  182.501 6.266   1.00 31.36 ? 112 HIS B CD2 1 
ATOM   3571  C CE1 . HIS B  1 87  ? 28.794  183.435 5.074   1.00 31.65 ? 112 HIS B CE1 1 
ATOM   3572  N NE2 . HIS B  1 87  ? 29.025  182.671 6.125   1.00 31.57 ? 112 HIS B NE2 1 
ATOM   3573  N N   . PRO B  1 88  ? 34.462  183.379 2.215   1.00 32.56 ? 113 PRO B N   1 
ATOM   3574  C CA  . PRO B  1 88  ? 33.477  184.107 1.407   1.00 32.42 ? 113 PRO B CA  1 
ATOM   3575  C C   . PRO B  1 88  ? 32.811  183.308 0.266   1.00 31.60 ? 113 PRO B C   1 
ATOM   3576  O O   . PRO B  1 88  ? 32.165  183.907 -0.610  1.00 31.77 ? 113 PRO B O   1 
ATOM   3577  C CB  . PRO B  1 88  ? 34.313  185.246 0.818   1.00 34.85 ? 113 PRO B CB  1 
ATOM   3578  C CG  . PRO B  1 88  ? 35.690  184.633 0.627   1.00 35.44 ? 113 PRO B CG  1 
ATOM   3579  C CD  . PRO B  1 88  ? 35.831  183.535 1.685   1.00 33.59 ? 113 PRO B CD  1 
ATOM   3580  N N   . MET B  1 89  ? 32.952  181.985 0.253   1.00 30.03 ? 114 MET B N   1 
ATOM   3581  C CA  . MET B  1 89  ? 32.449  181.217 -0.886  1.00 29.72 ? 114 MET B CA  1 
ATOM   3582  C C   . MET B  1 89  ? 30.935  181.371 -1.089  1.00 29.78 ? 114 MET B C   1 
ATOM   3583  O O   . MET B  1 89  ? 30.472  181.560 -2.209  1.00 30.82 ? 114 MET B O   1 
ATOM   3584  C CB  . MET B  1 89  ? 32.854  179.736 -0.794  1.00 28.62 ? 114 MET B CB  1 
ATOM   3585  C CG  . MET B  1 89  ? 32.369  178.882 -1.952  1.00 27.92 ? 114 MET B CG  1 
ATOM   3586  S SD  . MET B  1 89  ? 30.688  178.277 -1.678  1.00 27.68 ? 114 MET B SD  1 
ATOM   3587  C CE  . MET B  1 89  ? 30.968  176.938 -0.513  1.00 26.62 ? 114 MET B CE  1 
ATOM   3588  N N   . VAL B  1 90  ? 30.164  181.302 -0.015  1.00 29.04 ? 115 VAL B N   1 
ATOM   3589  C CA  . VAL B  1 90  ? 28.717  181.344 -0.161  1.00 29.74 ? 115 VAL B CA  1 
ATOM   3590  C C   . VAL B  1 90  ? 28.166  182.748 -0.386  1.00 31.10 ? 115 VAL B C   1 
ATOM   3591  O O   . VAL B  1 90  ? 26.976  182.885 -0.592  1.00 31.39 ? 115 VAL B O   1 
ATOM   3592  C CB  . VAL B  1 90  ? 27.983  180.763 1.068   1.00 28.35 ? 115 VAL B CB  1 
ATOM   3593  C CG1 . VAL B  1 90  ? 28.293  179.297 1.229   1.00 28.00 ? 115 VAL B CG1 1 
ATOM   3594  C CG2 . VAL B  1 90  ? 28.343  181.552 2.344   1.00 28.37 ? 115 VAL B CG2 1 
ATOM   3595  N N   . ASP B  1 91  ? 29.030  183.765 -0.365  1.00 32.82 ? 116 ASP B N   1 
ATOM   3596  C CA  . ASP B  1 91  ? 28.598  185.176 -0.265  1.00 34.49 ? 116 ASP B CA  1 
ATOM   3597  C C   . ASP B  1 91  ? 27.856  185.709 -1.500  1.00 35.02 ? 116 ASP B C   1 
ATOM   3598  O O   . ASP B  1 91  ? 27.137  186.720 -1.426  1.00 35.22 ? 116 ASP B O   1 
ATOM   3599  C CB  . ASP B  1 91  ? 29.809  186.083 -0.004  1.00 36.32 ? 116 ASP B CB  1 
ATOM   3600  C CG  . ASP B  1 91  ? 30.479  185.821 1.335   1.00 38.45 ? 116 ASP B CG  1 
ATOM   3601  O OD1 . ASP B  1 91  ? 30.005  184.945 2.095   1.00 37.86 ? 116 ASP B OD1 1 
ATOM   3602  O OD2 . ASP B  1 91  ? 31.481  186.520 1.628   1.00 42.47 ? 116 ASP B OD2 1 
ATOM   3603  N N   . SER B  1 92  ? 28.074  185.069 -2.644  1.00 34.57 ? 117 SER B N   1 
ATOM   3604  C CA  . SER B  1 92  ? 27.406  185.483 -3.888  1.00 35.05 ? 117 SER B CA  1 
ATOM   3605  C C   . SER B  1 92  ? 27.268  184.312 -4.852  1.00 33.78 ? 117 SER B C   1 
ATOM   3606  O O   . SER B  1 92  ? 27.938  183.299 -4.716  1.00 32.58 ? 117 SER B O   1 
ATOM   3607  C CB  . SER B  1 92  ? 28.161  186.614 -4.583  1.00 37.05 ? 117 SER B CB  1 
ATOM   3608  O OG  . SER B  1 92  ? 29.292  186.103 -5.255  1.00 37.92 ? 117 SER B OG  1 
ATOM   3609  N N   . SER B  1 93  ? 26.399  184.455 -5.836  1.00 34.02 ? 118 SER B N   1 
ATOM   3610  C CA  . SER B  1 93  ? 26.217  183.386 -6.810  1.00 33.74 ? 118 SER B CA  1 
ATOM   3611  C C   . SER B  1 93  ? 27.471  183.161 -7.644  1.00 34.02 ? 118 SER B C   1 
ATOM   3612  O O   . SER B  1 93  ? 27.714  182.048 -8.093  1.00 33.30 ? 118 SER B O   1 
ATOM   3613  C CB  . SER B  1 93  ? 25.024  183.671 -7.720  1.00 34.39 ? 118 SER B CB  1 
ATOM   3614  O OG  . SER B  1 93  ? 25.201  184.895 -8.396  1.00 36.08 ? 118 SER B OG  1 
ATOM   3615  N N   . THR B  1 94  ? 28.280  184.200 -7.850  1.00 35.36 ? 119 THR B N   1 
ATOM   3616  C CA  . THR B  1 94  ? 29.490  184.014 -8.662  1.00 36.59 ? 119 THR B CA  1 
ATOM   3617  C C   . THR B  1 94  ? 30.536  183.208 -7.895  1.00 35.14 ? 119 THR B C   1 
ATOM   3618  O O   . THR B  1 94  ? 31.128  182.278 -8.431  1.00 34.45 ? 119 THR B O   1 
ATOM   3619  C CB  . THR B  1 94  ? 30.075  185.338 -9.213  1.00 38.55 ? 119 THR B CB  1 
ATOM   3620  O OG1 . THR B  1 94  ? 30.237  186.263 -8.145  1.00 41.43 ? 119 THR B OG1 1 
ATOM   3621  C CG2 . THR B  1 94  ? 29.145  185.953 -10.234 1.00 39.98 ? 119 THR B CG2 1 
ATOM   3622  N N   . SER B  1 95  ? 30.733  183.522 -6.624  1.00 34.58 ? 120 SER B N   1 
ATOM   3623  C CA  . SER B  1 95  ? 31.648  182.714 -5.837  1.00 33.75 ? 120 SER B CA  1 
ATOM   3624  C C   . SER B  1 95  ? 31.142  181.265 -5.620  1.00 32.16 ? 120 SER B C   1 
ATOM   3625  O O   . SER B  1 95  ? 31.931  180.313 -5.676  1.00 31.37 ? 120 SER B O   1 
ATOM   3626  C CB  . SER B  1 95  ? 32.030  183.424 -4.526  1.00 34.72 ? 120 SER B CB  1 
ATOM   3627  O OG  . SER B  1 95  ? 30.900  183.757 -3.741  1.00 34.46 ? 120 SER B OG  1 
ATOM   3628  N N   . ARG B  1 96  ? 29.842  181.078 -5.394  1.00 30.82 ? 121 ARG B N   1 
ATOM   3629  C CA  . ARG B  1 96  ? 29.304  179.715 -5.314  1.00 30.14 ? 121 ARG B CA  1 
ATOM   3630  C C   . ARG B  1 96  ? 29.474  178.927 -6.627  1.00 30.62 ? 121 ARG B C   1 
ATOM   3631  O O   . ARG B  1 96  ? 29.764  177.737 -6.613  1.00 30.69 ? 121 ARG B O   1 
ATOM   3632  C CB  . ARG B  1 96  ? 27.833  179.725 -4.889  1.00 29.48 ? 121 ARG B CB  1 
ATOM   3633  C CG  . ARG B  1 96  ? 27.619  180.116 -3.430  1.00 28.52 ? 121 ARG B CG  1 
ATOM   3634  C CD  . ARG B  1 96  ? 26.172  179.869 -2.974  1.00 27.56 ? 121 ARG B CD  1 
ATOM   3635  N NE  . ARG B  1 96  ? 25.173  180.436 -3.885  1.00 27.68 ? 121 ARG B NE  1 
ATOM   3636  C CZ  . ARG B  1 96  ? 24.655  181.664 -3.797  1.00 30.03 ? 121 ARG B CZ  1 
ATOM   3637  N NH1 . ARG B  1 96  ? 25.038  182.503 -2.844  1.00 28.91 ? 121 ARG B NH1 1 
ATOM   3638  N NH2 . ARG B  1 96  ? 23.746  182.060 -4.679  1.00 30.06 ? 121 ARG B NH2 1 
ATOM   3639  N N   . LEU B  1 97  ? 29.258  179.585 -7.757  1.00 31.82 ? 122 LEU B N   1 
ATOM   3640  C CA  . LEU B  1 97  ? 29.456  178.956 -9.061  1.00 32.69 ? 122 LEU B CA  1 
ATOM   3641  C C   . LEU B  1 97  ? 30.907  178.507 -9.218  1.00 33.28 ? 122 LEU B C   1 
ATOM   3642  O O   . LEU B  1 97  ? 31.177  177.385 -9.635  1.00 32.27 ? 122 LEU B O   1 
ATOM   3643  C CB  . LEU B  1 97  ? 29.098  179.936 -10.178 1.00 34.07 ? 122 LEU B CB  1 
ATOM   3644  C CG  . LEU B  1 97  ? 29.245  179.431 -11.620 1.00 35.75 ? 122 LEU B CG  1 
ATOM   3645  C CD1 . LEU B  1 97  ? 28.499  178.091 -11.789 1.00 35.10 ? 122 LEU B CD1 1 
ATOM   3646  C CD2 . LEU B  1 97  ? 28.733  180.483 -12.605 1.00 36.36 ? 122 LEU B CD2 1 
ATOM   3647  N N   . GLU B  1 98  ? 31.845  179.401 -8.918  1.00 34.52 ? 123 GLU B N   1 
ATOM   3648  C CA  . GLU B  1 98  ? 33.250  179.013 -8.894  1.00 35.71 ? 123 GLU B CA  1 
ATOM   3649  C C   . GLU B  1 98  ? 33.453  177.733 -8.069  1.00 34.16 ? 123 GLU B C   1 
ATOM   3650  O O   . GLU B  1 98  ? 34.069  176.762 -8.535  1.00 34.55 ? 123 GLU B O   1 
ATOM   3651  C CB  . GLU B  1 98  ? 34.116  180.151 -8.329  1.00 37.14 ? 123 GLU B CB  1 
ATOM   3652  C CG  . GLU B  1 98  ? 35.611  179.957 -8.582  1.00 41.03 ? 123 GLU B CG  1 
ATOM   3653  C CD  . GLU B  1 98  ? 36.468  181.169 -8.199  1.00 45.82 ? 123 GLU B CD  1 
ATOM   3654  O OE1 . GLU B  1 98  ? 35.952  182.140 -7.593  1.00 45.47 ? 123 GLU B OE1 1 
ATOM   3655  O OE2 . GLU B  1 98  ? 37.676  181.132 -8.510  1.00 48.44 ? 123 GLU B OE2 1 
ATOM   3656  N N   . PHE B  1 99  ? 32.954  177.741 -6.843  1.00 32.15 ? 124 PHE B N   1 
ATOM   3657  C CA  . PHE B  1 99  ? 33.128  176.606 -5.950  1.00 30.77 ? 124 PHE B CA  1 
ATOM   3658  C C   . PHE B  1 99  ? 32.535  175.344 -6.550  1.00 30.13 ? 124 PHE B C   1 
ATOM   3659  O O   . PHE B  1 99  ? 33.196  174.297 -6.608  1.00 29.62 ? 124 PHE B O   1 
ATOM   3660  C CB  . PHE B  1 99  ? 32.485  176.880 -4.593  1.00 29.84 ? 124 PHE B CB  1 
ATOM   3661  C CG  . PHE B  1 99  ? 32.454  175.678 -3.681  1.00 29.43 ? 124 PHE B CG  1 
ATOM   3662  C CD1 . PHE B  1 99  ? 33.609  175.227 -3.061  1.00 29.84 ? 124 PHE B CD1 1 
ATOM   3663  C CD2 . PHE B  1 99  ? 31.265  175.001 -3.445  1.00 28.04 ? 124 PHE B CD2 1 
ATOM   3664  C CE1 . PHE B  1 99  ? 33.579  174.111 -2.215  1.00 28.97 ? 124 PHE B CE1 1 
ATOM   3665  C CE2 . PHE B  1 99  ? 31.230  173.894 -2.602  1.00 29.42 ? 124 PHE B CE2 1 
ATOM   3666  C CZ  . PHE B  1 99  ? 32.396  173.452 -1.988  1.00 28.51 ? 124 PHE B CZ  1 
ATOM   3667  N N   . ILE B  1 100 ? 31.283  175.446 -6.988  1.00 29.29 ? 125 ILE B N   1 
ATOM   3668  C CA  . ILE B  1 100 ? 30.560  174.294 -7.519  1.00 29.37 ? 125 ILE B CA  1 
ATOM   3669  C C   . ILE B  1 100 ? 31.230  173.698 -8.772  1.00 30.25 ? 125 ILE B C   1 
ATOM   3670  O O   . ILE B  1 100 ? 31.383  172.479 -8.882  1.00 29.57 ? 125 ILE B O   1 
ATOM   3671  C CB  . ILE B  1 100 ? 29.077  174.641 -7.783  1.00 29.15 ? 125 ILE B CB  1 
ATOM   3672  C CG1 . ILE B  1 100 ? 28.366  174.910 -6.449  1.00 28.94 ? 125 ILE B CG1 1 
ATOM   3673  C CG2 . ILE B  1 100 ? 28.395  173.519 -8.558  1.00 29.49 ? 125 ILE B CG2 1 
ATOM   3674  C CD1 . ILE B  1 100 ? 26.964  175.520 -6.580  1.00 30.23 ? 125 ILE B CD1 1 
ATOM   3675  N N   . ASN B  1 101 ? 31.659  174.556 -9.696  1.00 31.53 ? 126 ASN B N   1 
ATOM   3676  C CA  . ASN B  1 101 ? 32.406  174.092 -10.857 1.00 33.16 ? 126 ASN B CA  1 
ATOM   3677  C C   . ASN B  1 101 ? 33.665  173.340 -10.434 1.00 33.50 ? 126 ASN B C   1 
ATOM   3678  O O   . ASN B  1 101 ? 33.968  172.272 -10.972 1.00 34.00 ? 126 ASN B O   1 
ATOM   3679  C CB  . ASN B  1 101 ? 32.766  175.251 -11.792 1.00 34.86 ? 126 ASN B CB  1 
ATOM   3680  C CG  . ASN B  1 101 ? 31.563  175.768 -12.574 1.00 35.59 ? 126 ASN B CG  1 
ATOM   3681  O OD1 . ASN B  1 101 ? 30.570  175.073 -12.737 1.00 37.26 ? 126 ASN B OD1 1 
ATOM   3682  N ND2 . ASN B  1 101 ? 31.653  176.990 -13.048 1.00 38.35 ? 126 ASN B ND2 1 
ATOM   3683  N N   . SER B  1 102 ? 34.401  173.901 -9.480  1.00 33.32 ? 127 SER B N   1 
ATOM   3684  C CA  . SER B  1 102 ? 35.629  173.280 -8.993  1.00 33.20 ? 127 SER B CA  1 
ATOM   3685  C C   . SER B  1 102 ? 35.344  171.920 -8.339  1.00 32.27 ? 127 SER B C   1 
ATOM   3686  O O   . SER B  1 102 ? 36.172  171.000 -8.407  1.00 32.27 ? 127 SER B O   1 
ATOM   3687  C CB  . SER B  1 102 ? 36.319  174.180 -7.977  1.00 33.43 ? 127 SER B CB  1 
ATOM   3688  O OG  . SER B  1 102 ? 35.830  173.935 -6.656  1.00 32.86 ? 127 SER B OG  1 
ATOM   3689  N N   . ILE B  1 103 ? 34.182  171.814 -7.696  1.00 30.54 ? 128 ILE B N   1 
ATOM   3690  C CA  . ILE B  1 103 ? 33.769  170.599 -7.010  1.00 29.73 ? 128 ILE B CA  1 
ATOM   3691  C C   . ILE B  1 103 ? 33.520  169.451 -7.993  1.00 30.02 ? 128 ILE B C   1 
ATOM   3692  O O   . ILE B  1 103 ? 34.049  168.347 -7.839  1.00 30.74 ? 128 ILE B O   1 
ATOM   3693  C CB  . ILE B  1 103 ? 32.495  170.862 -6.195  1.00 28.17 ? 128 ILE B CB  1 
ATOM   3694  C CG1 . ILE B  1 103 ? 32.871  171.482 -4.844  1.00 28.42 ? 128 ILE B CG1 1 
ATOM   3695  C CG2 . ILE B  1 103 ? 31.666  169.581 -6.030  1.00 28.10 ? 128 ILE B CG2 1 
ATOM   3696  C CD1 . ILE B  1 103 ? 33.340  170.458 -3.810  1.00 29.11 ? 128 ILE B CD1 1 
ATOM   3697  N N   . ILE B  1 104 ? 32.716  169.715 -9.007  1.00 30.06 ? 129 ILE B N   1 
ATOM   3698  C CA  . ILE B  1 104 ? 32.415  168.698 -9.980  1.00 31.03 ? 129 ILE B CA  1 
ATOM   3699  C C   . ILE B  1 104 ? 33.698  168.208 -10.651 1.00 32.66 ? 129 ILE B C   1 
ATOM   3700  O O   . ILE B  1 104 ? 33.888  167.007 -10.847 1.00 32.95 ? 129 ILE B O   1 
ATOM   3701  C CB  . ILE B  1 104 ? 31.429  169.226 -11.014 1.00 31.37 ? 129 ILE B CB  1 
ATOM   3702  C CG1 . ILE B  1 104 ? 30.052  169.392 -10.347 1.00 30.19 ? 129 ILE B CG1 1 
ATOM   3703  C CG2 . ILE B  1 104 ? 31.386  168.284 -12.198 1.00 32.28 ? 129 ILE B CG2 1 
ATOM   3704  C CD1 . ILE B  1 104 ? 29.046  170.212 -11.145 1.00 30.37 ? 129 ILE B CD1 1 
ATOM   3705  N N   . LEU B  1 105 ? 34.584  169.142 -10.983 1.00 33.49 ? 130 LEU B N   1 
ATOM   3706  C CA  . LEU B  1 105 ? 35.886  168.808 -11.578 1.00 35.85 ? 130 LEU B CA  1 
ATOM   3707  C C   . LEU B  1 105 ? 36.721  167.906 -10.695 1.00 34.85 ? 130 LEU B C   1 
ATOM   3708  O O   . LEU B  1 105 ? 37.236  166.893 -11.147 1.00 35.80 ? 130 LEU B O   1 
ATOM   3709  C CB  . LEU B  1 105 ? 36.695  170.077 -11.837 1.00 36.77 ? 130 LEU B CB  1 
ATOM   3710  C CG  . LEU B  1 105 ? 36.967  170.398 -13.283 1.00 40.86 ? 130 LEU B CG  1 
ATOM   3711  C CD1 . LEU B  1 105 ? 37.981  169.403 -13.843 1.00 42.99 ? 130 LEU B CD1 1 
ATOM   3712  C CD2 . LEU B  1 105 ? 35.665  170.333 -14.048 1.00 42.74 ? 130 LEU B CD2 1 
ATOM   3713  N N   . PHE B  1 106 ? 36.867  168.315 -9.442  1.00 33.70 ? 131 PHE B N   1 
ATOM   3714  C CA  . PHE B  1 106 ? 37.727  167.650 -8.480  1.00 33.22 ? 131 PHE B CA  1 
ATOM   3715  C C   . PHE B  1 106 ? 37.229  166.223 -8.186  1.00 32.54 ? 131 PHE B C   1 
ATOM   3716  O O   . PHE B  1 106 ? 38.024  165.279 -8.210  1.00 33.02 ? 131 PHE B O   1 
ATOM   3717  C CB  . PHE B  1 106 ? 37.777  168.501 -7.212  1.00 32.67 ? 131 PHE B CB  1 
ATOM   3718  C CG  . PHE B  1 106 ? 38.767  168.032 -6.175  1.00 32.92 ? 131 PHE B CG  1 
ATOM   3719  C CD1 . PHE B  1 106 ? 38.386  167.128 -5.191  1.00 32.84 ? 131 PHE B CD1 1 
ATOM   3720  C CD2 . PHE B  1 106 ? 40.057  168.549 -6.150  1.00 35.22 ? 131 PHE B CD2 1 
ATOM   3721  C CE1 . PHE B  1 106 ? 39.282  166.728 -4.211  1.00 33.27 ? 131 PHE B CE1 1 
ATOM   3722  C CE2 . PHE B  1 106 ? 40.967  168.151 -5.183  1.00 35.88 ? 131 PHE B CE2 1 
ATOM   3723  C CZ  . PHE B  1 106 ? 40.581  167.236 -4.214  1.00 34.46 ? 131 PHE B CZ  1 
ATOM   3724  N N   . LEU B  1 107 ? 35.922  166.075 -7.947  1.00 30.46 ? 132 LEU B N   1 
ATOM   3725  C CA  . LEU B  1 107 ? 35.326  164.764 -7.660  1.00 30.34 ? 132 LEU B CA  1 
ATOM   3726  C C   . LEU B  1 107 ? 35.524  163.777 -8.829  1.00 31.52 ? 132 LEU B C   1 
ATOM   3727  O O   . LEU B  1 107 ? 35.955  162.654 -8.615  1.00 31.73 ? 132 LEU B O   1 
ATOM   3728  C CB  . LEU B  1 107 ? 33.835  164.872 -7.310  1.00 28.34 ? 132 LEU B CB  1 
ATOM   3729  C CG  . LEU B  1 107 ? 33.397  165.724 -6.105  1.00 27.46 ? 132 LEU B CG  1 
ATOM   3730  C CD1 . LEU B  1 107 ? 31.872  165.743 -5.982  1.00 23.87 ? 132 LEU B CD1 1 
ATOM   3731  C CD2 . LEU B  1 107 ? 34.015  165.231 -4.816  1.00 26.85 ? 132 LEU B CD2 1 
ATOM   3732  N N   . ARG B  1 108 ? 35.227  164.217 -10.051 1.00 32.82 ? 133 ARG B N   1 
ATOM   3733  C CA  . ARG B  1 108 ? 35.420  163.379 -11.236 1.00 34.47 ? 133 ARG B CA  1 
ATOM   3734  C C   . ARG B  1 108 ? 36.895  163.022 -11.421 1.00 36.12 ? 133 ARG B C   1 
ATOM   3735  O O   . ARG B  1 108 ? 37.224  161.882 -11.738 1.00 37.34 ? 133 ARG B O   1 
ATOM   3736  C CB  . ARG B  1 108 ? 34.900  164.083 -12.496 1.00 35.33 ? 133 ARG B CB  1 
ATOM   3737  C CG  . ARG B  1 108 ? 33.390  164.294 -12.541 1.00 35.09 ? 133 ARG B CG  1 
ATOM   3738  C CD  . ARG B  1 108 ? 32.656  162.970 -12.412 1.00 35.58 ? 133 ARG B CD  1 
ATOM   3739  N NE  . ARG B  1 108 ? 31.245  163.087 -12.764 1.00 35.03 ? 133 ARG B NE  1 
ATOM   3740  C CZ  . ARG B  1 108 ? 30.334  162.171 -12.444 1.00 34.99 ? 133 ARG B CZ  1 
ATOM   3741  N NH1 . ARG B  1 108 ? 30.692  161.101 -11.755 1.00 33.90 ? 133 ARG B NH1 1 
ATOM   3742  N NH2 . ARG B  1 108 ? 29.067  162.332 -12.791 1.00 35.79 ? 133 ARG B NH2 1 
ATOM   3743  N N   . ASN B  1 109 ? 37.780  164.005 -11.251 1.00 36.58 ? 134 ASN B N   1 
ATOM   3744  C CA  . ASN B  1 109 ? 39.219  163.806 -11.459 1.00 38.03 ? 134 ASN B CA  1 
ATOM   3745  C C   . ASN B  1 109 ? 39.866  162.888 -10.437 1.00 37.70 ? 134 ASN B C   1 
ATOM   3746  O O   . ASN B  1 109 ? 40.908  162.310 -10.713 1.00 38.45 ? 134 ASN B O   1 
ATOM   3747  C CB  . ASN B  1 109 ? 39.978  165.132 -11.425 1.00 38.91 ? 134 ASN B CB  1 
ATOM   3748  C CG  . ASN B  1 109 ? 39.902  165.892 -12.737 1.00 41.95 ? 134 ASN B CG  1 
ATOM   3749  O OD1 . ASN B  1 109 ? 39.226  165.478 -13.681 1.00 44.09 ? 134 ASN B OD1 1 
ATOM   3750  N ND2 . ASN B  1 109 ? 40.606  167.017 -12.802 1.00 43.65 ? 134 ASN B ND2 1 
ATOM   3751  N N   . HIS B  1 110 ? 39.275  162.772 -9.250  1.00 35.53 ? 135 HIS B N   1 
ATOM   3752  C CA  . HIS B  1 110 ? 39.892  161.949 -8.217  1.00 35.35 ? 135 HIS B CA  1 
ATOM   3753  C C   . HIS B  1 110 ? 39.030  160.760 -7.835  1.00 34.22 ? 135 HIS B C   1 
ATOM   3754  O O   . HIS B  1 110 ? 39.187  160.195 -6.761  1.00 33.24 ? 135 HIS B O   1 
ATOM   3755  C CB  . HIS B  1 110 ? 40.244  162.792 -6.990  1.00 34.50 ? 135 HIS B CB  1 
ATOM   3756  C CG  . HIS B  1 110 ? 41.281  163.837 -7.263  1.00 36.86 ? 135 HIS B CG  1 
ATOM   3757  N ND1 . HIS B  1 110 ? 42.616  163.534 -7.428  1.00 39.40 ? 135 HIS B ND1 1 
ATOM   3758  C CD2 . HIS B  1 110 ? 41.174  165.175 -7.428  1.00 37.38 ? 135 HIS B CD2 1 
ATOM   3759  C CE1 . HIS B  1 110 ? 43.290  164.644 -7.676  1.00 41.34 ? 135 HIS B CE1 1 
ATOM   3760  N NE2 . HIS B  1 110 ? 42.438  165.655 -7.680  1.00 40.79 ? 135 HIS B NE2 1 
ATOM   3761  N N   . ASN B  1 111 ? 38.109  160.403 -8.721  1.00 34.47 ? 136 ASN B N   1 
ATOM   3762  C CA  . ASN B  1 111 ? 37.324  159.180 -8.569  1.00 34.54 ? 136 ASN B CA  1 
ATOM   3763  C C   . ASN B  1 111 ? 36.419  159.169 -7.328  1.00 32.60 ? 136 ASN B C   1 
ATOM   3764  O O   . ASN B  1 111 ? 36.214  158.117 -6.707  1.00 32.96 ? 136 ASN B O   1 
ATOM   3765  C CB  . ASN B  1 111 ? 38.267  157.972 -8.571  1.00 35.94 ? 136 ASN B CB  1 
ATOM   3766  C CG  . ASN B  1 111 ? 37.607  156.706 -9.101  1.00 37.41 ? 136 ASN B CG  1 
ATOM   3767  O OD1 . ASN B  1 111 ? 36.549  156.750 -9.743  1.00 37.23 ? 136 ASN B OD1 1 
ATOM   3768  N ND2 . ASN B  1 111 ? 38.248  155.563 -8.852  1.00 39.05 ? 136 ASN B ND2 1 
ATOM   3769  N N   . PHE B  1 112 ? 35.890  160.339 -6.961  1.00 31.36 ? 137 PHE B N   1 
ATOM   3770  C CA  . PHE B  1 112 ? 34.937  160.453 -5.860  1.00 29.72 ? 137 PHE B CA  1 
ATOM   3771  C C   . PHE B  1 112 ? 33.533  160.306 -6.429  1.00 29.77 ? 137 PHE B C   1 
ATOM   3772  O O   . PHE B  1 112 ? 33.292  160.646 -7.589  1.00 30.53 ? 137 PHE B O   1 
ATOM   3773  C CB  . PHE B  1 112 ? 35.058  161.812 -5.160  1.00 29.00 ? 137 PHE B CB  1 
ATOM   3774  C CG  . PHE B  1 112 ? 36.167  161.886 -4.133  1.00 28.98 ? 137 PHE B CG  1 
ATOM   3775  C CD1 . PHE B  1 112 ? 36.023  161.283 -2.888  1.00 27.48 ? 137 PHE B CD1 1 
ATOM   3776  C CD2 . PHE B  1 112 ? 37.335  162.579 -4.401  1.00 29.45 ? 137 PHE B CD2 1 
ATOM   3777  C CE1 . PHE B  1 112 ? 37.045  161.373 -1.927  1.00 27.11 ? 137 PHE B CE1 1 
ATOM   3778  C CE2 . PHE B  1 112 ? 38.358  162.666 -3.458  1.00 29.11 ? 137 PHE B CE2 1 
ATOM   3779  C CZ  . PHE B  1 112 ? 38.208  162.069 -2.218  1.00 29.24 ? 137 PHE B CZ  1 
ATOM   3780  N N   . ASP B  1 113 ? 32.601  159.806 -5.620  1.00 28.28 ? 138 ASP B N   1 
ATOM   3781  C CA  . ASP B  1 113 ? 31.254  159.524 -6.108  1.00 28.09 ? 138 ASP B CA  1 
ATOM   3782  C C   . ASP B  1 113 ? 30.250  160.579 -5.692  1.00 26.89 ? 138 ASP B C   1 
ATOM   3783  O O   . ASP B  1 113 ? 29.094  160.547 -6.125  1.00 27.42 ? 138 ASP B O   1 
ATOM   3784  C CB  . ASP B  1 113 ? 30.794  158.162 -5.607  1.00 27.70 ? 138 ASP B CB  1 
ATOM   3785  C CG  . ASP B  1 113 ? 31.616  157.048 -6.188  1.00 29.61 ? 138 ASP B CG  1 
ATOM   3786  O OD1 . ASP B  1 113 ? 31.442  156.773 -7.392  1.00 29.95 ? 138 ASP B OD1 1 
ATOM   3787  O OD2 . ASP B  1 113 ? 32.458  156.477 -5.456  1.00 28.97 ? 138 ASP B OD2 1 
ATOM   3788  N N   . GLY B  1 114 ? 30.685  161.504 -4.846  1.00 26.26 ? 139 GLY B N   1 
ATOM   3789  C CA  . GLY B  1 114 ? 29.818  162.589 -4.414  1.00 25.09 ? 139 GLY B CA  1 
ATOM   3790  C C   . GLY B  1 114 ? 30.414  163.454 -3.318  1.00 24.80 ? 139 GLY B C   1 
ATOM   3791  O O   . GLY B  1 114 ? 31.582  163.290 -2.918  1.00 25.16 ? 139 GLY B O   1 
ATOM   3792  N N   . LEU B  1 115 ? 29.599  164.382 -2.834  1.00 24.07 ? 140 LEU B N   1 
ATOM   3793  C CA  . LEU B  1 115 ? 30.014  165.343 -1.836  1.00 23.29 ? 140 LEU B CA  1 
ATOM   3794  C C   . LEU B  1 115 ? 29.118  165.279 -0.604  1.00 22.88 ? 140 LEU B C   1 
ATOM   3795  O O   . LEU B  1 115 ? 27.895  165.212 -0.725  1.00 22.15 ? 140 LEU B O   1 
ATOM   3796  C CB  . LEU B  1 115 ? 29.934  166.759 -2.430  1.00 23.59 ? 140 LEU B CB  1 
ATOM   3797  C CG  . LEU B  1 115 ? 30.242  167.936 -1.508  1.00 23.83 ? 140 LEU B CG  1 
ATOM   3798  C CD1 . LEU B  1 115 ? 31.719  167.941 -1.147  1.00 25.28 ? 140 LEU B CD1 1 
ATOM   3799  C CD2 . LEU B  1 115 ? 29.852  169.274 -2.169  1.00 25.46 ? 140 LEU B CD2 1 
ATOM   3800  N N   . ASP B  1 116 ? 29.741  165.333 0.573   1.00 22.55 ? 141 ASP B N   1 
ATOM   3801  C CA  . ASP B  1 116 ? 29.021  165.458 1.835   1.00 22.32 ? 141 ASP B CA  1 
ATOM   3802  C C   . ASP B  1 116 ? 29.294  166.876 2.345   1.00 22.46 ? 141 ASP B C   1 
ATOM   3803  O O   . ASP B  1 116 ? 30.452  167.291 2.461   1.00 22.93 ? 141 ASP B O   1 
ATOM   3804  C CB  . ASP B  1 116 ? 29.536  164.408 2.834   1.00 22.03 ? 141 ASP B CB  1 
ATOM   3805  C CG  . ASP B  1 116 ? 28.837  164.481 4.188   1.00 22.25 ? 141 ASP B CG  1 
ATOM   3806  O OD1 . ASP B  1 116 ? 27.600  164.255 4.237   1.00 22.34 ? 141 ASP B OD1 1 
ATOM   3807  O OD2 . ASP B  1 116 ? 29.534  164.753 5.200   1.00 23.07 ? 141 ASP B OD2 1 
ATOM   3808  N N   . VAL B  1 117 ? 28.238  167.638 2.608   1.00 21.99 ? 142 VAL B N   1 
ATOM   3809  C CA  . VAL B  1 117 ? 28.410  168.980 3.139   1.00 22.24 ? 142 VAL B CA  1 
ATOM   3810  C C   . VAL B  1 117 ? 27.977  168.980 4.596   1.00 22.36 ? 142 VAL B C   1 
ATOM   3811  O O   . VAL B  1 117 ? 26.790  169.080 4.876   1.00 22.73 ? 142 VAL B O   1 
ATOM   3812  C CB  . VAL B  1 117 ? 27.553  169.990 2.353   1.00 22.87 ? 142 VAL B CB  1 
ATOM   3813  C CG1 . VAL B  1 117 ? 27.749  171.410 2.898   1.00 23.37 ? 142 VAL B CG1 1 
ATOM   3814  C CG2 . VAL B  1 117 ? 27.916  169.955 0.871   1.00 22.14 ? 142 VAL B CG2 1 
ATOM   3815  N N   . SER B  1 118 ? 28.925  168.831 5.526   1.00 22.07 ? 143 SER B N   1 
ATOM   3816  C CA  . SER B  1 118 ? 28.570  168.779 6.942   1.00 21.73 ? 143 SER B CA  1 
ATOM   3817  C C   . SER B  1 118 ? 28.826  170.114 7.634   1.00 21.66 ? 143 SER B C   1 
ATOM   3818  O O   . SER B  1 118 ? 29.807  170.267 8.364   1.00 21.29 ? 143 SER B O   1 
ATOM   3819  C CB  . SER B  1 118 ? 29.327  167.637 7.647   1.00 21.88 ? 143 SER B CB  1 
ATOM   3820  O OG  . SER B  1 118 ? 28.919  166.388 7.104   1.00 21.80 ? 143 SER B OG  1 
ATOM   3821  N N   . TRP B  1 119 ? 27.926  171.070 7.388   1.00 21.56 ? 144 TRP B N   1 
ATOM   3822  C CA  . TRP B  1 119 ? 28.062  172.432 7.883   1.00 21.95 ? 144 TRP B CA  1 
ATOM   3823  C C   . TRP B  1 119 ? 27.638  172.472 9.340   1.00 21.48 ? 144 TRP B C   1 
ATOM   3824  O O   . TRP B  1 119 ? 26.468  172.250 9.649   1.00 21.86 ? 144 TRP B O   1 
ATOM   3825  C CB  . TRP B  1 119 ? 27.153  173.345 7.054   1.00 22.37 ? 144 TRP B CB  1 
ATOM   3826  C CG  . TRP B  1 119 ? 27.247  174.811 7.369   1.00 22.66 ? 144 TRP B CG  1 
ATOM   3827  C CD1 . TRP B  1 119 ? 27.471  175.385 8.590   1.00 23.32 ? 144 TRP B CD1 1 
ATOM   3828  C CD2 . TRP B  1 119 ? 27.084  175.886 6.448   1.00 23.47 ? 144 TRP B CD2 1 
ATOM   3829  N NE1 . TRP B  1 119 ? 27.474  176.749 8.476   1.00 24.38 ? 144 TRP B NE1 1 
ATOM   3830  C CE2 . TRP B  1 119 ? 27.236  177.083 7.170   1.00 24.70 ? 144 TRP B CE2 1 
ATOM   3831  C CE3 . TRP B  1 119 ? 26.843  175.952 5.069   1.00 24.68 ? 144 TRP B CE3 1 
ATOM   3832  C CZ2 . TRP B  1 119 ? 27.146  178.336 6.568   1.00 25.28 ? 144 TRP B CZ2 1 
ATOM   3833  C CZ3 . TRP B  1 119 ? 26.743  177.187 4.475   1.00 25.63 ? 144 TRP B CZ3 1 
ATOM   3834  C CH2 . TRP B  1 119 ? 26.899  178.367 5.220   1.00 26.68 ? 144 TRP B CH2 1 
ATOM   3835  N N   . ILE B  1 120 ? 28.589  172.732 10.233  1.00 21.71 ? 145 ILE B N   1 
ATOM   3836  C CA  . ILE B  1 120 ? 28.340  172.712 11.678  1.00 21.36 ? 145 ILE B CA  1 
ATOM   3837  C C   . ILE B  1 120 ? 28.501  174.135 12.253  1.00 22.02 ? 145 ILE B C   1 
ATOM   3838  O O   . ILE B  1 120 ? 29.640  174.541 12.544  1.00 22.75 ? 145 ILE B O   1 
ATOM   3839  C CB  . ILE B  1 120 ? 29.360  171.767 12.409  1.00 21.21 ? 145 ILE B CB  1 
ATOM   3840  C CG1 . ILE B  1 120 ? 29.404  170.351 11.796  1.00 19.63 ? 145 ILE B CG1 1 
ATOM   3841  C CG2 . ILE B  1 120 ? 29.146  171.757 13.949  1.00 22.20 ? 145 ILE B CG2 1 
ATOM   3842  C CD1 . ILE B  1 120 ? 28.031  169.675 11.612  1.00 18.05 ? 145 ILE B CD1 1 
ATOM   3843  N N   . TYR B  1 121 ? 27.418  174.918 12.386  1.00 22.03 ? 146 TYR B N   1 
ATOM   3844  C CA  . TYR B  1 121 ? 26.055  174.639 11.864  1.00 22.03 ? 146 TYR B CA  1 
ATOM   3845  C C   . TYR B  1 121 ? 25.544  175.895 11.158  1.00 22.43 ? 146 TYR B C   1 
ATOM   3846  O O   . TYR B  1 121 ? 26.000  177.009 11.468  1.00 23.03 ? 146 TYR B O   1 
ATOM   3847  C CB  . TYR B  1 121 ? 25.069  174.421 13.007  1.00 21.42 ? 146 TYR B CB  1 
ATOM   3848  C CG  . TYR B  1 121 ? 25.401  173.339 13.993  1.00 21.19 ? 146 TYR B CG  1 
ATOM   3849  C CD1 . TYR B  1 121 ? 25.128  172.009 13.700  1.00 20.01 ? 146 TYR B CD1 1 
ATOM   3850  C CD2 . TYR B  1 121 ? 25.949  173.649 15.242  1.00 21.33 ? 146 TYR B CD2 1 
ATOM   3851  C CE1 . TYR B  1 121 ? 25.398  170.992 14.625  1.00 20.34 ? 146 TYR B CE1 1 
ATOM   3852  C CE2 . TYR B  1 121 ? 26.224  172.647 16.170  1.00 23.02 ? 146 TYR B CE2 1 
ATOM   3853  C CZ  . TYR B  1 121 ? 25.943  171.324 15.851  1.00 21.59 ? 146 TYR B CZ  1 
ATOM   3854  O OH  . TYR B  1 121 ? 26.200  170.333 16.753  1.00 21.33 ? 146 TYR B OH  1 
ATOM   3855  N N   . PRO B  1 122 ? 24.556  175.749 10.260  1.00 22.35 ? 147 PRO B N   1 
ATOM   3856  C CA  . PRO B  1 122 ? 24.016  176.964 9.647   1.00 23.67 ? 147 PRO B CA  1 
ATOM   3857  C C   . PRO B  1 122 ? 23.399  177.881 10.705  1.00 24.85 ? 147 PRO B C   1 
ATOM   3858  O O   . PRO B  1 122 ? 23.642  179.096 10.679  1.00 26.02 ? 147 PRO B O   1 
ATOM   3859  C CB  . PRO B  1 122 ? 22.948  176.431 8.683   1.00 23.66 ? 147 PRO B CB  1 
ATOM   3860  C CG  . PRO B  1 122 ? 23.475  175.026 8.299   1.00 21.79 ? 147 PRO B CG  1 
ATOM   3861  C CD  . PRO B  1 122 ? 24.065  174.517 9.598   1.00 22.03 ? 147 PRO B CD  1 
ATOM   3862  N N   . ASP B  1 123 ? 22.642  177.288 11.640  1.00 24.81 ? 148 ASP B N   1 
ATOM   3863  C CA  . ASP B  1 123 ? 21.977  178.028 12.725  1.00 26.01 ? 148 ASP B CA  1 
ATOM   3864  C C   . ASP B  1 123 ? 21.027  179.033 12.095  1.00 27.31 ? 148 ASP B C   1 
ATOM   3865  O O   . ASP B  1 123 ? 20.821  178.993 10.885  1.00 27.36 ? 148 ASP B O   1 
ATOM   3866  C CB  . ASP B  1 123 ? 23.001  178.716 13.631  1.00 26.74 ? 148 ASP B CB  1 
ATOM   3867  C CG  . ASP B  1 123 ? 22.522  178.846 15.087  1.00 27.60 ? 148 ASP B CG  1 
ATOM   3868  O OD1 . ASP B  1 123 ? 21.305  178.894 15.364  1.00 29.51 ? 148 ASP B OD1 1 
ATOM   3869  O OD2 . ASP B  1 123 ? 23.383  178.905 15.962  1.00 29.64 ? 148 ASP B OD2 1 
ATOM   3870  N N   . GLN B  1 124 ? 20.466  179.942 12.886  1.00 28.48 ? 149 GLN B N   1 
ATOM   3871  C CA  . GLN B  1 124 ? 19.472  180.863 12.357  1.00 30.48 ? 149 GLN B CA  1 
ATOM   3872  C C   . GLN B  1 124 ? 20.076  181.797 11.320  1.00 31.01 ? 149 GLN B C   1 
ATOM   3873  O O   . GLN B  1 124 ? 19.477  182.034 10.286  1.00 31.82 ? 149 GLN B O   1 
ATOM   3874  C CB  . GLN B  1 124 ? 18.826  181.688 13.464  1.00 31.95 ? 149 GLN B CB  1 
ATOM   3875  C CG  . GLN B  1 124 ? 17.779  180.952 14.280  1.00 34.74 ? 149 GLN B CG  1 
ATOM   3876  C CD  . GLN B  1 124 ? 17.304  181.804 15.447  1.00 39.14 ? 149 GLN B CD  1 
ATOM   3877  O OE1 . GLN B  1 124 ? 16.234  182.403 15.396  1.00 42.61 ? 149 GLN B OE1 1 
ATOM   3878  N NE2 . GLN B  1 124 ? 18.124  181.893 16.485  1.00 40.05 ? 149 GLN B NE2 1 
ATOM   3879  N N   . LYS B  1 125 ? 21.266  182.321 11.595  1.00 31.17 ? 150 LYS B N   1 
ATOM   3880  C CA  . LYS B  1 125 ? 21.895  183.279 10.687  1.00 32.33 ? 150 LYS B CA  1 
ATOM   3881  C C   . LYS B  1 125 ? 22.123  182.751 9.263   1.00 30.70 ? 150 LYS B C   1 
ATOM   3882  O O   . LYS B  1 125 ? 21.939  183.480 8.280   1.00 30.70 ? 150 LYS B O   1 
ATOM   3883  C CB  . LYS B  1 125 ? 23.225  183.764 11.262  1.00 33.41 ? 150 LYS B CB  1 
ATOM   3884  C CG  . LYS B  1 125 ? 23.714  185.061 10.604  1.00 37.85 ? 150 LYS B CG  1 
ATOM   3885  C CD  . LYS B  1 125 ? 25.193  185.319 10.883  1.00 42.12 ? 150 LYS B CD  1 
ATOM   3886  C CE  . LYS B  1 125 ? 25.718  186.423 9.977   1.00 46.34 ? 150 LYS B CE  1 
ATOM   3887  N NZ  . LYS B  1 125 ? 26.996  187.009 10.497  1.00 50.24 ? 150 LYS B NZ  1 
ATOM   3888  N N   . GLU B  1 126 ? 22.533  181.498 9.136   1.00 28.84 ? 151 GLU B N   1 
ATOM   3889  C CA  . GLU B  1 126 ? 22.902  180.982 7.810   1.00 28.46 ? 151 GLU B CA  1 
ATOM   3890  C C   . GLU B  1 126 ? 22.057  179.809 7.307   1.00 26.55 ? 151 GLU B C   1 
ATOM   3891  O O   . GLU B  1 126 ? 22.388  179.145 6.320   1.00 24.80 ? 151 GLU B O   1 
ATOM   3892  C CB  . GLU B  1 126 ? 24.385  180.666 7.773   1.00 28.60 ? 151 GLU B CB  1 
ATOM   3893  C CG  . GLU B  1 126 ? 25.201  181.865 8.239   1.00 32.52 ? 151 GLU B CG  1 
ATOM   3894  C CD  . GLU B  1 126 ? 26.558  181.888 7.615   1.00 35.81 ? 151 GLU B CD  1 
ATOM   3895  O OE1 . GLU B  1 126 ? 26.638  181.844 6.374   1.00 37.67 ? 151 GLU B OE1 1 
ATOM   3896  O OE2 . GLU B  1 126 ? 27.550  181.934 8.359   1.00 39.33 ? 151 GLU B OE2 1 
ATOM   3897  N N   . ASN B  1 127 ? 20.937  179.602 7.974   1.00 26.10 ? 152 ASN B N   1 
ATOM   3898  C CA  . ASN B  1 127 ? 19.948  178.608 7.570   1.00 25.84 ? 152 ASN B CA  1 
ATOM   3899  C C   . ASN B  1 127 ? 19.722  178.632 6.056   1.00 25.89 ? 152 ASN B C   1 
ATOM   3900  O O   . ASN B  1 127 ? 19.873  177.636 5.337   1.00 25.18 ? 152 ASN B O   1 
ATOM   3901  C CB  . ASN B  1 127 ? 18.657  178.944 8.309   1.00 27.20 ? 152 ASN B CB  1 
ATOM   3902  C CG  . ASN B  1 127 ? 17.488  178.160 7.816   1.00 29.37 ? 152 ASN B CG  1 
ATOM   3903  O OD1 . ASN B  1 127 ? 17.276  178.036 6.606   1.00 32.11 ? 152 ASN B OD1 1 
ATOM   3904  N ND2 . ASN B  1 127 ? 16.697  177.639 8.744   1.00 29.60 ? 152 ASN B ND2 1 
ATOM   3905  N N   . THR B  1 128 ? 19.413  179.826 5.593   1.00 26.17 ? 153 THR B N   1 
ATOM   3906  C CA  . THR B  1 128 ? 19.019  180.115 4.250   1.00 27.41 ? 153 THR B CA  1 
ATOM   3907  C C   . THR B  1 128 ? 20.219  179.981 3.280   1.00 27.07 ? 153 THR B C   1 
ATOM   3908  O O   . THR B  1 128 ? 20.048  179.589 2.124   1.00 26.69 ? 153 THR B O   1 
ATOM   3909  C CB  . THR B  1 128 ? 18.454  181.541 4.335   1.00 29.03 ? 153 THR B CB  1 
ATOM   3910  O OG1 . THR B  1 128 ? 17.106  181.604 3.856   1.00 32.59 ? 153 THR B OG1 1 
ATOM   3911  C CG2 . THR B  1 128 ? 19.353  182.543 3.781   1.00 27.38 ? 153 THR B CG2 1 
ATOM   3912  N N   . HIS B  1 129 ? 21.436  180.253 3.768   1.00 26.44 ? 154 HIS B N   1 
ATOM   3913  C CA  . HIS B  1 129 ? 22.646  180.109 2.954   1.00 26.65 ? 154 HIS B CA  1 
ATOM   3914  C C   . HIS B  1 129 ? 22.926  178.639 2.695   1.00 25.56 ? 154 HIS B C   1 
ATOM   3915  O O   . HIS B  1 129 ? 23.360  178.262 1.619   1.00 24.78 ? 154 HIS B O   1 
ATOM   3916  C CB  . HIS B  1 129 ? 23.870  180.711 3.654   1.00 27.31 ? 154 HIS B CB  1 
ATOM   3917  C CG  . HIS B  1 129 ? 23.743  182.174 3.965   1.00 29.71 ? 154 HIS B CG  1 
ATOM   3918  N ND1 . HIS B  1 129 ? 22.672  182.702 4.654   1.00 33.27 ? 154 HIS B ND1 1 
ATOM   3919  C CD2 . HIS B  1 129 ? 24.566  183.216 3.700   1.00 33.48 ? 154 HIS B CD2 1 
ATOM   3920  C CE1 . HIS B  1 129 ? 22.834  184.005 4.796   1.00 33.15 ? 154 HIS B CE1 1 
ATOM   3921  N NE2 . HIS B  1 129 ? 23.973  184.345 4.218   1.00 34.92 ? 154 HIS B NE2 1 
ATOM   3922  N N   . PHE B  1 130 ? 22.698  177.813 3.711   1.00 24.07 ? 155 PHE B N   1 
ATOM   3923  C CA  . PHE B  1 130 ? 22.867  176.369 3.580   1.00 23.27 ? 155 PHE B CA  1 
ATOM   3924  C C   . PHE B  1 130 ? 21.886  175.818 2.562   1.00 23.00 ? 155 PHE B C   1 
ATOM   3925  O O   . PHE B  1 130 ? 22.266  175.033 1.707   1.00 22.72 ? 155 PHE B O   1 
ATOM   3926  C CB  . PHE B  1 130 ? 22.643  175.685 4.928   1.00 22.40 ? 155 PHE B CB  1 
ATOM   3927  C CG  . PHE B  1 130 ? 22.809  174.183 4.900   1.00 21.33 ? 155 PHE B CG  1 
ATOM   3928  C CD1 . PHE B  1 130 ? 24.049  173.603 4.648   1.00 20.69 ? 155 PHE B CD1 1 
ATOM   3929  C CD2 . PHE B  1 130 ? 21.725  173.355 5.155   1.00 21.30 ? 155 PHE B CD2 1 
ATOM   3930  C CE1 . PHE B  1 130 ? 24.215  172.202 4.658   1.00 22.12 ? 155 PHE B CE1 1 
ATOM   3931  C CE2 . PHE B  1 130 ? 21.869  171.949 5.158   1.00 21.32 ? 155 PHE B CE2 1 
ATOM   3932  C CZ  . PHE B  1 130 ? 23.109  171.371 4.913   1.00 21.19 ? 155 PHE B CZ  1 
ATOM   3933  N N   . THR B  1 131 ? 20.627  176.244 2.644   1.00 22.85 ? 156 THR B N   1 
ATOM   3934  C CA  . THR B  1 131 ? 19.614  175.782 1.699   1.00 23.10 ? 156 THR B CA  1 
ATOM   3935  C C   . THR B  1 131 ? 20.017  176.040 0.247   1.00 23.52 ? 156 THR B C   1 
ATOM   3936  O O   . THR B  1 131 ? 19.929  175.155 -0.614  1.00 23.05 ? 156 THR B O   1 
ATOM   3937  C CB  . THR B  1 131 ? 18.280  176.512 1.941   1.00 24.52 ? 156 THR B CB  1 
ATOM   3938  O OG1 . THR B  1 131 ? 17.809  176.206 3.257   1.00 23.94 ? 156 THR B OG1 1 
ATOM   3939  C CG2 . THR B  1 131 ? 17.236  176.113 0.883   1.00 24.51 ? 156 THR B CG2 1 
ATOM   3940  N N   . VAL B  1 132 ? 20.420  177.275 -0.028  1.00 24.07 ? 157 VAL B N   1 
ATOM   3941  C CA  . VAL B  1 132 ? 20.828  177.682 -1.368  1.00 24.95 ? 157 VAL B CA  1 
ATOM   3942  C C   . VAL B  1 132 ? 22.061  176.928 -1.853  1.00 24.50 ? 157 VAL B C   1 
ATOM   3943  O O   . VAL B  1 132 ? 22.118  176.504 -3.007  1.00 25.90 ? 157 VAL B O   1 
ATOM   3944  C CB  . VAL B  1 132 ? 21.108  179.203 -1.436  1.00 25.68 ? 157 VAL B CB  1 
ATOM   3945  C CG1 . VAL B  1 132 ? 21.607  179.585 -2.855  1.00 27.36 ? 157 VAL B CG1 1 
ATOM   3946  C CG2 . VAL B  1 132 ? 19.860  179.968 -1.094  1.00 27.15 ? 157 VAL B CG2 1 
ATOM   3947  N N   . LEU B  1 133 ? 23.063  176.771 -0.999  1.00 23.52 ? 158 LEU B N   1 
ATOM   3948  C CA  . LEU B  1 133 ? 24.254  176.025 -1.422  1.00 23.43 ? 158 LEU B CA  1 
ATOM   3949  C C   . LEU B  1 133 ? 23.879  174.600 -1.834  1.00 23.43 ? 158 LEU B C   1 
ATOM   3950  O O   . LEU B  1 133 ? 24.290  174.122 -2.891  1.00 23.55 ? 158 LEU B O   1 
ATOM   3951  C CB  . LEU B  1 133 ? 25.281  175.973 -0.296  1.00 23.08 ? 158 LEU B CB  1 
ATOM   3952  C CG  . LEU B  1 133 ? 26.528  175.102 -0.477  1.00 22.64 ? 158 LEU B CG  1 
ATOM   3953  C CD1 . LEU B  1 133 ? 27.340  175.543 -1.702  1.00 23.73 ? 158 LEU B CD1 1 
ATOM   3954  C CD2 . LEU B  1 133 ? 27.367  175.229 0.784   1.00 22.86 ? 158 LEU B CD2 1 
ATOM   3955  N N   . ILE B  1 134 ? 23.107  173.929 -0.976  1.00 22.39 ? 159 ILE B N   1 
ATOM   3956  C CA  . ILE B  1 134 ? 22.653  172.575 -1.247  1.00 22.14 ? 159 ILE B CA  1 
ATOM   3957  C C   . ILE B  1 134 ? 21.847  172.556 -2.553  1.00 23.50 ? 159 ILE B C   1 
ATOM   3958  O O   . ILE B  1 134 ? 22.079  171.712 -3.424  1.00 24.05 ? 159 ILE B O   1 
ATOM   3959  C CB  . ILE B  1 134 ? 21.781  172.043 -0.072  1.00 21.38 ? 159 ILE B CB  1 
ATOM   3960  C CG1 . ILE B  1 134 ? 22.628  171.854 1.189   1.00 21.91 ? 159 ILE B CG1 1 
ATOM   3961  C CG2 . ILE B  1 134 ? 21.094  170.760 -0.454  1.00 21.46 ? 159 ILE B CG2 1 
ATOM   3962  C CD1 . ILE B  1 134 ? 23.815  170.920 1.021   1.00 22.69 ? 159 ILE B CD1 1 
ATOM   3963  N N   . HIS B  1 135 ? 20.911  173.497 -2.698  1.00 23.67 ? 160 HIS B N   1 
ATOM   3964  C CA  . HIS B  1 135 ? 20.052  173.530 -3.880  1.00 25.27 ? 160 HIS B CA  1 
ATOM   3965  C C   . HIS B  1 135 ? 20.893  173.691 -5.159  1.00 25.72 ? 160 HIS B C   1 
ATOM   3966  O O   . HIS B  1 135 ? 20.698  172.959 -6.119  1.00 26.37 ? 160 HIS B O   1 
ATOM   3967  C CB  . HIS B  1 135 ? 18.978  174.628 -3.780  1.00 26.24 ? 160 HIS B CB  1 
ATOM   3968  C CG  . HIS B  1 135 ? 17.997  174.611 -4.917  1.00 28.48 ? 160 HIS B CG  1 
ATOM   3969  N ND1 . HIS B  1 135 ? 17.019  173.649 -5.041  1.00 30.00 ? 160 HIS B ND1 1 
ATOM   3970  C CD2 . HIS B  1 135 ? 17.865  175.416 -5.996  1.00 31.05 ? 160 HIS B CD2 1 
ATOM   3971  C CE1 . HIS B  1 135 ? 16.316  173.866 -6.140  1.00 30.88 ? 160 HIS B CE1 1 
ATOM   3972  N NE2 . HIS B  1 135 ? 16.810  174.933 -6.739  1.00 32.80 ? 160 HIS B NE2 1 
ATOM   3973  N N   . GLU B  1 136 ? 21.850  174.617 -5.143  1.00 25.29 ? 161 GLU B N   1 
ATOM   3974  C CA  . GLU B  1 136 ? 22.728  174.852 -6.293  1.00 26.52 ? 161 GLU B CA  1 
ATOM   3975  C C   . GLU B  1 136 ? 23.671  173.683 -6.606  1.00 26.03 ? 161 GLU B C   1 
ATOM   3976  O O   . GLU B  1 136 ? 23.933  173.388 -7.768  1.00 26.21 ? 161 GLU B O   1 
ATOM   3977  C CB  . GLU B  1 136 ? 23.493  176.181 -6.125  1.00 26.99 ? 161 GLU B CB  1 
ATOM   3978  C CG  . GLU B  1 136 ? 22.549  177.384 -6.253  1.00 28.76 ? 161 GLU B CG  1 
ATOM   3979  C CD  . GLU B  1 136 ? 23.209  178.743 -6.056  1.00 30.42 ? 161 GLU B CD  1 
ATOM   3980  O OE1 . GLU B  1 136 ? 24.450  178.806 -5.886  1.00 31.30 ? 161 GLU B OE1 1 
ATOM   3981  O OE2 . GLU B  1 136 ? 22.474  179.751 -6.078  1.00 30.13 ? 161 GLU B OE2 1 
ATOM   3982  N N   . LEU B  1 137 ? 24.186  173.025 -5.577  1.00 25.00 ? 162 LEU B N   1 
ATOM   3983  C CA  . LEU B  1 137 ? 24.935  171.803 -5.796  1.00 25.43 ? 162 LEU B CA  1 
ATOM   3984  C C   . LEU B  1 137 ? 24.057  170.744 -6.457  1.00 25.74 ? 162 LEU B C   1 
ATOM   3985  O O   . LEU B  1 137 ? 24.459  170.159 -7.457  1.00 26.72 ? 162 LEU B O   1 
ATOM   3986  C CB  . LEU B  1 137 ? 25.494  171.254 -4.485  1.00 23.72 ? 162 LEU B CB  1 
ATOM   3987  C CG  . LEU B  1 137 ? 26.700  172.050 -3.978  1.00 24.50 ? 162 LEU B CG  1 
ATOM   3988  C CD1 . LEU B  1 137 ? 26.858  171.824 -2.463  1.00 21.28 ? 162 LEU B CD1 1 
ATOM   3989  C CD2 . LEU B  1 137 ? 27.957  171.685 -4.744  1.00 23.17 ? 162 LEU B CD2 1 
ATOM   3990  N N   . ALA B  1 138 ? 22.864  170.504 -5.906  1.00 25.58 ? 163 ALA B N   1 
ATOM   3991  C CA  . ALA B  1 138 ? 21.977  169.458 -6.451  1.00 26.44 ? 163 ALA B CA  1 
ATOM   3992  C C   . ALA B  1 138 ? 21.650  169.705 -7.929  1.00 27.89 ? 163 ALA B C   1 
ATOM   3993  O O   . ALA B  1 138 ? 21.694  168.778 -8.739  1.00 27.91 ? 163 ALA B O   1 
ATOM   3994  C CB  . ALA B  1 138 ? 20.697  169.327 -5.621  1.00 25.70 ? 163 ALA B CB  1 
ATOM   3995  N N   . GLU B  1 139 ? 21.345  170.955 -8.270  1.00 28.93 ? 164 GLU B N   1 
ATOM   3996  C CA  . GLU B  1 139 ? 21.053  171.343 -9.656  1.00 31.19 ? 164 GLU B CA  1 
ATOM   3997  C C   . GLU B  1 139 ? 22.240  171.069 -10.577 1.00 30.97 ? 164 GLU B C   1 
ATOM   3998  O O   . GLU B  1 139 ? 22.086  170.473 -11.640 1.00 31.62 ? 164 GLU B O   1 
ATOM   3999  C CB  . GLU B  1 139 ? 20.695  172.837 -9.743  1.00 32.11 ? 164 GLU B CB  1 
ATOM   4000  C CG  . GLU B  1 139 ? 19.437  173.230 -8.983  1.00 36.57 ? 164 GLU B CG  1 
ATOM   4001  C CD  . GLU B  1 139 ? 18.170  173.172 -9.845  1.00 43.66 ? 164 GLU B CD  1 
ATOM   4002  O OE1 . GLU B  1 139 ? 18.114  173.880 -10.877 1.00 45.90 ? 164 GLU B OE1 1 
ATOM   4003  O OE2 . GLU B  1 139 ? 17.227  172.423 -9.469  1.00 45.81 ? 164 GLU B OE2 1 
ATOM   4004  N N   . ALA B  1 140 ? 23.419  171.531 -10.171 1.00 30.37 ? 165 ALA B N   1 
ATOM   4005  C CA  . ALA B  1 140 ? 24.646  171.314 -10.938 1.00 30.74 ? 165 ALA B CA  1 
ATOM   4006  C C   . ALA B  1 140 ? 25.011  169.832 -11.083 1.00 30.62 ? 165 ALA B C   1 
ATOM   4007  O O   . ALA B  1 140 ? 25.452  169.410 -12.151 1.00 31.39 ? 165 ALA B O   1 
ATOM   4008  C CB  . ALA B  1 140 ? 25.799  172.081 -10.310 1.00 30.33 ? 165 ALA B CB  1 
ATOM   4009  N N   . PHE B  1 141 ? 24.862  169.048 -10.014 1.00 29.59 ? 166 PHE B N   1 
ATOM   4010  C CA  . PHE B  1 141 ? 25.115  167.603 -10.124 1.00 29.65 ? 166 PHE B CA  1 
ATOM   4011  C C   . PHE B  1 141 ? 24.167  166.943 -11.129 1.00 31.01 ? 166 PHE B C   1 
ATOM   4012  O O   . PHE B  1 141 ? 24.575  166.066 -11.911 1.00 31.90 ? 166 PHE B O   1 
ATOM   4013  C CB  . PHE B  1 141 ? 25.004  166.908 -8.759  1.00 28.10 ? 166 PHE B CB  1 
ATOM   4014  C CG  . PHE B  1 141 ? 26.172  167.170 -7.836  1.00 26.29 ? 166 PHE B CG  1 
ATOM   4015  C CD1 . PHE B  1 141 ? 27.103  168.151 -8.123  1.00 27.00 ? 166 PHE B CD1 1 
ATOM   4016  C CD2 . PHE B  1 141 ? 26.307  166.448 -6.660  1.00 25.44 ? 166 PHE B CD2 1 
ATOM   4017  C CE1 . PHE B  1 141 ? 28.166  168.404 -7.254  1.00 26.95 ? 166 PHE B CE1 1 
ATOM   4018  C CE2 . PHE B  1 141 ? 27.355  166.686 -5.784  1.00 24.71 ? 166 PHE B CE2 1 
ATOM   4019  C CZ  . PHE B  1 141 ? 28.295  167.661 -6.082  1.00 25.71 ? 166 PHE B CZ  1 
ATOM   4020  N N   . GLN B  1 142 ? 22.899  167.340 -11.091 1.00 31.38 ? 167 GLN B N   1 
ATOM   4021  C CA  . GLN B  1 142 ? 21.914  166.788 -12.004 1.00 33.32 ? 167 GLN B CA  1 
ATOM   4022  C C   . GLN B  1 142 ? 22.249  167.181 -13.440 1.00 34.76 ? 167 GLN B C   1 
ATOM   4023  O O   . GLN B  1 142 ? 22.172  166.348 -14.346 1.00 35.56 ? 167 GLN B O   1 
ATOM   4024  C CB  . GLN B  1 142 ? 20.491  167.227 -11.627 1.00 33.34 ? 167 GLN B CB  1 
ATOM   4025  C CG  . GLN B  1 142 ? 19.446  166.950 -12.705 1.00 35.52 ? 167 GLN B CG  1 
ATOM   4026  C CD  . GLN B  1 142 ? 19.302  165.467 -13.014 1.00 38.57 ? 167 GLN B CD  1 
ATOM   4027  O OE1 . GLN B  1 142 ? 19.531  164.620 -12.148 1.00 37.86 ? 167 GLN B OE1 1 
ATOM   4028  N NE2 . GLN B  1 142 ? 18.913  165.144 -14.255 1.00 38.94 ? 167 GLN B NE2 1 
ATOM   4029  N N   . LYS B  1 143 ? 22.633  168.440 -13.644 1.00 35.45 ? 168 LYS B N   1 
ATOM   4030  C CA  . LYS B  1 143 ? 23.005  168.915 -14.978 1.00 38.02 ? 168 LYS B CA  1 
ATOM   4031  C C   . LYS B  1 143 ? 24.243  168.192 -15.518 1.00 38.74 ? 168 LYS B C   1 
ATOM   4032  O O   . LYS B  1 143 ? 24.282  167.820 -16.691 1.00 40.45 ? 168 LYS B O   1 
ATOM   4033  C CB  . LYS B  1 143 ? 23.222  170.436 -14.987 1.00 37.87 ? 168 LYS B CB  1 
ATOM   4034  C CG  . LYS B  1 143 ? 23.274  171.067 -16.387 1.00 41.46 ? 168 LYS B CG  1 
ATOM   4035  C CD  . LYS B  1 143 ? 23.444  172.593 -16.298 1.00 43.38 ? 168 LYS B CD  1 
ATOM   4036  C CE  . LYS B  1 143 ? 23.453  173.248 -17.675 1.00 46.72 ? 168 LYS B CE  1 
ATOM   4037  N NZ  . LYS B  1 143 ? 23.673  174.718 -17.558 1.00 47.91 ? 168 LYS B NZ  1 
ATOM   4038  N N   . ASP B  1 144 ? 25.251  168.002 -14.670 1.00 38.33 ? 169 ASP B N   1 
ATOM   4039  C CA  . ASP B  1 144 ? 26.471  167.280 -15.063 1.00 39.57 ? 169 ASP B CA  1 
ATOM   4040  C C   . ASP B  1 144 ? 26.156  165.840 -15.444 1.00 40.68 ? 169 ASP B C   1 
ATOM   4041  O O   . ASP B  1 144 ? 26.758  165.272 -16.371 1.00 41.77 ? 169 ASP B O   1 
ATOM   4042  C CB  . ASP B  1 144 ? 27.508  167.327 -13.940 1.00 38.50 ? 169 ASP B CB  1 
ATOM   4043  C CG  . ASP B  1 144 ? 28.618  166.301 -14.113 1.00 39.00 ? 169 ASP B CG  1 
ATOM   4044  O OD1 . ASP B  1 144 ? 29.581  166.567 -14.850 1.00 40.62 ? 169 ASP B OD1 1 
ATOM   4045  O OD2 . ASP B  1 144 ? 28.554  165.236 -13.475 1.00 38.60 ? 169 ASP B OD2 1 
ATOM   4046  N N   . PHE B  1 145 ? 25.191  165.257 -14.740 1.00 40.77 ? 170 PHE B N   1 
ATOM   4047  C CA  . PHE B  1 145 ? 24.692  163.926 -15.072 1.00 42.02 ? 170 PHE B CA  1 
ATOM   4048  C C   . PHE B  1 145 ? 24.166  163.844 -16.513 1.00 44.40 ? 170 PHE B C   1 
ATOM   4049  O O   . PHE B  1 145 ? 24.609  163.000 -17.294 1.00 45.31 ? 170 PHE B O   1 
ATOM   4050  C CB  . PHE B  1 145 ? 23.607  163.508 -14.081 1.00 41.03 ? 170 PHE B CB  1 
ATOM   4051  C CG  . PHE B  1 145 ? 23.023  162.149 -14.351 1.00 42.01 ? 170 PHE B CG  1 
ATOM   4052  C CD1 . PHE B  1 145 ? 23.842  161.030 -14.447 1.00 41.84 ? 170 PHE B CD1 1 
ATOM   4053  C CD2 . PHE B  1 145 ? 21.648  161.986 -14.483 1.00 42.80 ? 170 PHE B CD2 1 
ATOM   4054  C CE1 . PHE B  1 145 ? 23.303  159.769 -14.684 1.00 44.18 ? 170 PHE B CE1 1 
ATOM   4055  C CE2 . PHE B  1 145 ? 21.095  160.725 -14.717 1.00 44.95 ? 170 PHE B CE2 1 
ATOM   4056  C CZ  . PHE B  1 145 ? 21.927  159.613 -14.822 1.00 44.52 ? 170 PHE B CZ  1 
ATOM   4057  N N   . THR B  1 146 ? 23.231  164.722 -16.863 1.00 45.62 ? 171 THR B N   1 
ATOM   4058  C CA  . THR B  1 146 ? 22.649  164.710 -18.205 1.00 48.51 ? 171 THR B CA  1 
ATOM   4059  C C   . THR B  1 146 ? 23.698  164.834 -19.309 1.00 50.41 ? 171 THR B C   1 
ATOM   4060  O O   . THR B  1 146 ? 23.483  164.373 -20.423 1.00 52.30 ? 171 THR B O   1 
ATOM   4061  C CB  . THR B  1 146 ? 21.590  165.818 -18.386 1.00 48.66 ? 171 THR B CB  1 
ATOM   4062  O OG1 . THR B  1 146 ? 22.239  167.093 -18.477 1.00 48.96 ? 171 THR B OG1 1 
ATOM   4063  C CG2 . THR B  1 146 ? 20.608  165.820 -17.217 1.00 46.87 ? 171 THR B CG2 1 
ATOM   4064  N N   . LYS B  1 147 ? 24.826  165.469 -19.012 1.00 51.16 ? 172 LYS B N   1 
ATOM   4065  C CA  . LYS B  1 147 ? 25.861  165.688 -20.027 1.00 53.68 ? 172 LYS B CA  1 
ATOM   4066  C C   . LYS B  1 147 ? 27.024  164.711 -19.876 1.00 54.28 ? 172 LYS B C   1 
ATOM   4067  O O   . LYS B  1 147 ? 28.077  164.877 -20.480 1.00 55.62 ? 172 LYS B O   1 
ATOM   4068  C CB  . LYS B  1 147 ? 26.379  167.132 -19.983 1.00 53.70 ? 172 LYS B CB  1 
ATOM   4069  C CG  . LYS B  1 147 ? 25.323  168.190 -20.298 1.00 54.86 ? 172 LYS B CG  1 
ATOM   4070  C CD  . LYS B  1 147 ? 25.955  169.551 -20.580 1.00 56.66 ? 172 LYS B CD  1 
ATOM   4071  C CE  . LYS B  1 147 ? 24.935  170.680 -20.428 1.00 56.99 ? 172 LYS B CE  1 
ATOM   4072  N NZ  . LYS B  1 147 ? 25.281  171.868 -21.272 1.00 58.92 ? 172 LYS B NZ  1 
ATOM   4073  N N   . SER B  1 148 ? 26.821  163.677 -19.079 1.00 54.07 ? 173 SER B N   1 
ATOM   4074  C CA  . SER B  1 148 ? 27.903  162.779 -18.730 1.00 54.72 ? 173 SER B CA  1 
ATOM   4075  C C   . SER B  1 148 ? 27.473  161.340 -18.962 1.00 55.59 ? 173 SER B C   1 
ATOM   4076  O O   . SER B  1 148 ? 26.280  161.036 -18.978 1.00 56.07 ? 173 SER B O   1 
ATOM   4077  C CB  . SER B  1 148 ? 28.295  162.995 -17.260 1.00 52.99 ? 173 SER B CB  1 
ATOM   4078  O OG  . SER B  1 148 ? 28.889  161.840 -16.696 1.00 53.61 ? 173 SER B OG  1 
ATOM   4079  N N   . THR B  1 149 ? 28.444  160.451 -19.142 1.00 56.35 ? 174 THR B N   1 
ATOM   4080  C CA  . THR B  1 149 ? 28.139  159.035 -19.309 1.00 56.74 ? 174 THR B CA  1 
ATOM   4081  C C   . THR B  1 149 ? 28.094  158.364 -17.942 1.00 54.90 ? 174 THR B C   1 
ATOM   4082  O O   . THR B  1 149 ? 27.640  157.231 -17.812 1.00 55.59 ? 174 THR B O   1 
ATOM   4083  C CB  . THR B  1 149 ? 29.199  158.308 -20.184 1.00 58.85 ? 174 THR B CB  1 
ATOM   4084  O OG1 . THR B  1 149 ? 30.420  158.166 -19.440 1.00 59.03 ? 174 THR B OG1 1 
ATOM   4085  C CG2 . THR B  1 149 ? 29.466  159.076 -21.476 1.00 59.69 ? 174 THR B CG2 1 
ATOM   4086  N N   . LYS B  1 150 ? 28.566  159.076 -16.923 1.00 52.50 ? 175 LYS B N   1 
ATOM   4087  C CA  . LYS B  1 150 ? 28.743  158.495 -15.598 1.00 50.15 ? 175 LYS B CA  1 
ATOM   4088  C C   . LYS B  1 150 ? 27.518  158.650 -14.711 1.00 47.49 ? 175 LYS B C   1 
ATOM   4089  O O   . LYS B  1 150 ? 26.577  159.391 -15.029 1.00 46.94 ? 175 LYS B O   1 
ATOM   4090  C CB  . LYS B  1 150 ? 29.950  159.117 -14.896 1.00 49.96 ? 175 LYS B CB  1 
ATOM   4091  C CG  . LYS B  1 150 ? 31.258  159.045 -15.685 1.00 51.88 ? 175 LYS B CG  1 
ATOM   4092  C CD  . LYS B  1 150 ? 32.426  159.569 -14.836 1.00 52.92 ? 175 LYS B CD  1 
ATOM   4093  C CE  . LYS B  1 150 ? 33.700  159.774 -15.656 1.00 55.07 ? 175 LYS B CE  1 
ATOM   4094  N NZ  . LYS B  1 150 ? 34.788  160.369 -14.819 1.00 54.52 ? 175 LYS B NZ  1 
ATOM   4095  N N   . GLU B  1 151 ? 27.546  157.941 -13.589 1.00 45.26 ? 176 GLU B N   1 
ATOM   4096  C CA  . GLU B  1 151 ? 26.513  158.061 -12.568 1.00 42.84 ? 176 GLU B CA  1 
ATOM   4097  C C   . GLU B  1 151 ? 26.496  159.465 -11.982 1.00 40.06 ? 176 GLU B C   1 
ATOM   4098  O O   . GLU B  1 151 ? 27.545  160.099 -11.831 1.00 39.09 ? 176 GLU B O   1 
ATOM   4099  C CB  . GLU B  1 151 ? 26.773  157.071 -11.450 1.00 42.69 ? 176 GLU B CB  1 
ATOM   4100  C CG  . GLU B  1 151 ? 27.175  155.718 -11.964 1.00 47.56 ? 176 GLU B CG  1 
ATOM   4101  C CD  . GLU B  1 151 ? 26.309  154.638 -11.381 1.00 51.25 ? 176 GLU B CD  1 
ATOM   4102  O OE1 . GLU B  1 151 ? 25.118  154.585 -11.765 1.00 53.58 ? 176 GLU B OE1 1 
ATOM   4103  O OE2 . GLU B  1 151 ? 26.813  153.851 -10.544 1.00 53.39 ? 176 GLU B OE2 1 
ATOM   4104  N N   . ARG B  1 152 ? 25.298  159.944 -11.658 1.00 37.84 ? 177 ARG B N   1 
ATOM   4105  C CA  . ARG B  1 152 ? 25.161  161.253 -11.038 1.00 35.28 ? 177 ARG B CA  1 
ATOM   4106  C C   . ARG B  1 152 ? 25.939  161.306 -9.721  1.00 32.95 ? 177 ARG B C   1 
ATOM   4107  O O   . ARG B  1 152 ? 25.837  160.397 -8.887  1.00 32.55 ? 177 ARG B O   1 
ATOM   4108  C CB  . ARG B  1 152 ? 23.684  161.585 -10.785 1.00 34.75 ? 177 ARG B CB  1 
ATOM   4109  C CG  . ARG B  1 152 ? 23.511  162.917 -10.052 1.00 34.28 ? 177 ARG B CG  1 
ATOM   4110  C CD  . ARG B  1 152 ? 22.062  163.402 -10.039 1.00 35.73 ? 177 ARG B CD  1 
ATOM   4111  N NE  . ARG B  1 152 ? 21.182  162.541 -9.248  1.00 35.75 ? 177 ARG B NE  1 
ATOM   4112  C CZ  . ARG B  1 152 ? 21.316  162.314 -7.944  1.00 37.26 ? 177 ARG B CZ  1 
ATOM   4113  N NH1 . ARG B  1 152 ? 22.315  162.861 -7.247  1.00 36.14 ? 177 ARG B NH1 1 
ATOM   4114  N NH2 . ARG B  1 152 ? 20.448  161.519 -7.326  1.00 38.11 ? 177 ARG B NH2 1 
ATOM   4115  N N   . LEU B  1 153 ? 26.691  162.385 -9.518  1.00 31.07 ? 178 LEU B N   1 
ATOM   4116  C CA  . LEU B  1 153 ? 27.374  162.601 -8.240  1.00 28.68 ? 178 LEU B CA  1 
ATOM   4117  C C   . LEU B  1 153 ? 26.341  162.671 -7.107  1.00 27.28 ? 178 LEU B C   1 
ATOM   4118  O O   . LEU B  1 153 ? 25.313  163.334 -7.246  1.00 26.98 ? 178 LEU B O   1 
ATOM   4119  C CB  . LEU B  1 153 ? 28.212  163.884 -8.289  1.00 28.29 ? 178 LEU B CB  1 
ATOM   4120  C CG  . LEU B  1 153 ? 29.397  163.885 -9.269  1.00 29.52 ? 178 LEU B CG  1 
ATOM   4121  C CD1 . LEU B  1 153 ? 29.810  165.311 -9.612  1.00 28.99 ? 178 LEU B CD1 1 
ATOM   4122  C CD2 . LEU B  1 153 ? 30.571  163.115 -8.698  1.00 28.22 ? 178 LEU B CD2 1 
ATOM   4123  N N   . LEU B  1 154 ? 26.614  161.996 -5.994  1.00 25.93 ? 179 LEU B N   1 
ATOM   4124  C CA  . LEU B  1 154 ? 25.715  162.051 -4.834  1.00 25.26 ? 179 LEU B CA  1 
ATOM   4125  C C   . LEU B  1 154 ? 25.932  163.334 -4.022  1.00 24.37 ? 179 LEU B C   1 
ATOM   4126  O O   . LEU B  1 154 ? 27.040  163.881 -4.004  1.00 24.06 ? 179 LEU B O   1 
ATOM   4127  C CB  . LEU B  1 154 ? 25.932  160.826 -3.936  1.00 24.97 ? 179 LEU B CB  1 
ATOM   4128  C CG  . LEU B  1 154 ? 25.726  159.450 -4.584  1.00 27.29 ? 179 LEU B CG  1 
ATOM   4129  C CD1 . LEU B  1 154 ? 26.316  158.370 -3.695  1.00 28.99 ? 179 LEU B CD1 1 
ATOM   4130  C CD2 . LEU B  1 154 ? 24.246  159.147 -4.879  1.00 28.72 ? 179 LEU B CD2 1 
ATOM   4131  N N   . LEU B  1 155 ? 24.868  163.805 -3.371  1.00 23.48 ? 180 LEU B N   1 
ATOM   4132  C CA  . LEU B  1 155 ? 24.922  164.936 -2.442  1.00 23.28 ? 180 LEU B CA  1 
ATOM   4133  C C   . LEU B  1 155 ? 24.302  164.495 -1.127  1.00 22.38 ? 180 LEU B C   1 
ATOM   4134  O O   . LEU B  1 155 ? 23.116  164.121 -1.107  1.00 22.22 ? 180 LEU B O   1 
ATOM   4135  C CB  . LEU B  1 155 ? 24.123  166.135 -2.971  1.00 23.39 ? 180 LEU B CB  1 
ATOM   4136  C CG  . LEU B  1 155 ? 24.301  167.468 -2.210  1.00 23.39 ? 180 LEU B CG  1 
ATOM   4137  C CD1 . LEU B  1 155 ? 25.782  167.862 -2.117  1.00 22.70 ? 180 LEU B CD1 1 
ATOM   4138  C CD2 . LEU B  1 155 ? 23.482  168.606 -2.829  1.00 24.17 ? 180 LEU B CD2 1 
ATOM   4139  N N   . THR B  1 156 ? 25.113  164.528 -0.060  1.00 21.85 ? 181 THR B N   1 
ATOM   4140  C CA  . THR B  1 156 ? 24.679  164.205 1.315   1.00 21.45 ? 181 THR B CA  1 
ATOM   4141  C C   . THR B  1 156 ? 25.063  165.342 2.278   1.00 21.27 ? 181 THR B C   1 
ATOM   4142  O O   . THR B  1 156 ? 25.809  166.252 1.901   1.00 22.10 ? 181 THR B O   1 
ATOM   4143  C CB  . THR B  1 156 ? 25.302  162.881 1.813   1.00 20.88 ? 181 THR B CB  1 
ATOM   4144  O OG1 . THR B  1 156 ? 26.721  163.021 1.933   1.00 21.79 ? 181 THR B OG1 1 
ATOM   4145  C CG2 . THR B  1 156 ? 25.013  161.752 0.846   1.00 21.92 ? 181 THR B CG2 1 
ATOM   4146  N N   . ALA B  1 157 ? 24.545  165.302 3.511   1.00 20.49 ? 182 ALA B N   1 
ATOM   4147  C CA  . ALA B  1 157 ? 24.895  166.305 4.518   1.00 19.97 ? 182 ALA B CA  1 
ATOM   4148  C C   . ALA B  1 157 ? 24.871  165.652 5.887   1.00 19.36 ? 182 ALA B C   1 
ATOM   4149  O O   . ALA B  1 157 ? 23.896  164.985 6.223   1.00 19.33 ? 182 ALA B O   1 
ATOM   4150  C CB  . ALA B  1 157 ? 23.882  167.438 4.512   1.00 20.08 ? 182 ALA B CB  1 
ATOM   4151  N N   . GLY B  1 158 ? 25.920  165.866 6.671   1.00 18.66 ? 183 GLY B N   1 
ATOM   4152  C CA  . GLY B  1 158 ? 25.894  165.579 8.108   1.00 18.42 ? 183 GLY B CA  1 
ATOM   4153  C C   . GLY B  1 158 ? 25.112  166.693 8.779   1.00 18.40 ? 183 GLY B C   1 
ATOM   4154  O O   . GLY B  1 158 ? 25.417  167.868 8.583   1.00 18.99 ? 183 GLY B O   1 
ATOM   4155  N N   . VAL B  1 159 ? 24.068  166.333 9.522   1.00 17.91 ? 184 VAL B N   1 
ATOM   4156  C CA  . VAL B  1 159 ? 23.141  167.329 10.063  1.00 18.04 ? 184 VAL B CA  1 
ATOM   4157  C C   . VAL B  1 159 ? 22.943  167.137 11.569  1.00 17.80 ? 184 VAL B C   1 
ATOM   4158  O O   . VAL B  1 159 ? 23.037  166.023 12.077  1.00 17.58 ? 184 VAL B O   1 
ATOM   4159  C CB  . VAL B  1 159 ? 21.761  167.322 9.311   1.00 18.29 ? 184 VAL B CB  1 
ATOM   4160  C CG1 . VAL B  1 159 ? 21.944  167.716 7.808   1.00 17.89 ? 184 VAL B CG1 1 
ATOM   4161  C CG2 . VAL B  1 159 ? 21.041  165.948 9.452   1.00 16.73 ? 184 VAL B CG2 1 
ATOM   4162  N N   . SER B  1 160 ? 22.667  168.225 12.278  1.00 18.83 ? 185 SER B N   1 
ATOM   4163  C CA  . SER B  1 160 ? 22.449  168.156 13.730  1.00 18.44 ? 185 SER B CA  1 
ATOM   4164  C C   . SER B  1 160 ? 21.294  167.208 14.080  1.00 18.84 ? 185 SER B C   1 
ATOM   4165  O O   . SER B  1 160 ? 20.280  167.134 13.346  1.00 17.86 ? 185 SER B O   1 
ATOM   4166  C CB  . SER B  1 160 ? 22.154  169.551 14.280  1.00 19.46 ? 185 SER B CB  1 
ATOM   4167  O OG  . SER B  1 160 ? 21.848  169.515 15.671  1.00 19.68 ? 185 SER B OG  1 
ATOM   4168  N N   . ALA B  1 161 ? 21.450  166.494 15.199  1.00 17.81 ? 186 ALA B N   1 
ATOM   4169  C CA  . ALA B  1 161 ? 20.361  165.699 15.786  1.00 17.97 ? 186 ALA B CA  1 
ATOM   4170  C C   . ALA B  1 161 ? 19.655  166.395 16.961  1.00 19.04 ? 186 ALA B C   1 
ATOM   4171  O O   . ALA B  1 161 ? 18.808  165.784 17.608  1.00 19.19 ? 186 ALA B O   1 
ATOM   4172  C CB  . ALA B  1 161 ? 20.895  164.335 16.260  1.00 17.42 ? 186 ALA B CB  1 
ATOM   4173  N N   . GLY B  1 162 ? 20.007  167.651 17.240  1.00 19.87 ? 187 GLY B N   1 
ATOM   4174  C CA  . GLY B  1 162 ? 19.423  168.398 18.382  1.00 20.24 ? 187 GLY B CA  1 
ATOM   4175  C C   . GLY B  1 162 ? 18.271  169.273 17.926  1.00 21.27 ? 187 GLY B C   1 
ATOM   4176  O O   . GLY B  1 162 ? 18.433  170.107 17.032  1.00 21.20 ? 187 GLY B O   1 
ATOM   4177  N N   . ARG B  1 163 ? 17.101  169.090 18.531  1.00 21.28 ? 188 ARG B N   1 
ATOM   4178  C CA  . ARG B  1 163 ? 15.890  169.750 18.034  1.00 22.86 ? 188 ARG B CA  1 
ATOM   4179  C C   . ARG B  1 163 ? 16.004  171.248 17.810  1.00 23.71 ? 188 ARG B C   1 
ATOM   4180  O O   . ARG B  1 163 ? 15.516  171.778 16.793  1.00 23.68 ? 188 ARG B O   1 
ATOM   4181  C CB  . ARG B  1 163 ? 14.703  169.513 18.956  1.00 23.50 ? 188 ARG B CB  1 
ATOM   4182  C CG  . ARG B  1 163 ? 13.475  170.236 18.412  1.00 25.44 ? 188 ARG B CG  1 
ATOM   4183  C CD  . ARG B  1 163 ? 12.244  169.981 19.225  1.00 30.10 ? 188 ARG B CD  1 
ATOM   4184  N NE  . ARG B  1 163 ? 11.182  170.881 18.800  1.00 33.74 ? 188 ARG B NE  1 
ATOM   4185  C CZ  . ARG B  1 163 ? 9.902   170.684 19.068  1.00 36.05 ? 188 ARG B CZ  1 
ATOM   4186  N NH1 . ARG B  1 163 ? 9.530   169.617 19.756  1.00 36.90 ? 188 ARG B NH1 1 
ATOM   4187  N NH2 . ARG B  1 163 ? 9.000   171.550 18.643  1.00 38.24 ? 188 ARG B NH2 1 
ATOM   4188  N N   . GLN B  1 164 ? 16.598  171.935 18.781  1.00 23.98 ? 189 GLN B N   1 
ATOM   4189  C CA  . GLN B  1 164 ? 16.710  173.383 18.724  1.00 26.08 ? 189 GLN B CA  1 
ATOM   4190  C C   . GLN B  1 164 ? 17.596  173.824 17.544  1.00 24.98 ? 189 GLN B C   1 
ATOM   4191  O O   . GLN B  1 164 ? 17.219  174.696 16.775  1.00 24.63 ? 189 GLN B O   1 
ATOM   4192  C CB  . GLN B  1 164 ? 17.208  173.933 20.070  1.00 27.57 ? 189 GLN B CB  1 
ATOM   4193  C CG  . GLN B  1 164 ? 17.683  175.370 20.041  1.00 32.72 ? 189 GLN B CG  1 
ATOM   4194  C CD  . GLN B  1 164 ? 16.551  176.378 20.090  1.00 39.76 ? 189 GLN B CD  1 
ATOM   4195  O OE1 . GLN B  1 164 ? 15.367  176.037 19.919  1.00 43.61 ? 189 GLN B OE1 1 
ATOM   4196  N NE2 . GLN B  1 164 ? 16.905  177.639 20.314  1.00 42.61 ? 189 GLN B NE2 1 
ATOM   4197  N N   . MET B  1 165 ? 18.748  173.176 17.375  1.00 23.36 ? 190 MET B N   1 
ATOM   4198  C CA  . MET B  1 165 ? 19.625  173.504 16.262  1.00 22.65 ? 190 MET B CA  1 
ATOM   4199  C C   . MET B  1 165 ? 19.004  173.119 14.915  1.00 22.54 ? 190 MET B C   1 
ATOM   4200  O O   . MET B  1 165 ? 19.238  173.789 13.898  1.00 22.18 ? 190 MET B O   1 
ATOM   4201  C CB  . MET B  1 165 ? 21.000  172.845 16.440  1.00 22.01 ? 190 MET B CB  1 
ATOM   4202  C CG  . MET B  1 165 ? 22.011  173.283 15.374  1.00 21.49 ? 190 MET B CG  1 
ATOM   4203  S SD  . MET B  1 165 ? 22.214  175.073 15.358  1.00 23.83 ? 190 MET B SD  1 
ATOM   4204  C CE  . MET B  1 165 ? 23.006  175.312 16.976  1.00 26.40 ? 190 MET B CE  1 
ATOM   4205  N N   . ILE B  1 166 ? 18.214  172.043 14.909  1.00 21.90 ? 191 ILE B N   1 
ATOM   4206  C CA  . ILE B  1 166 ? 17.489  171.619 13.701  1.00 21.98 ? 191 ILE B CA  1 
ATOM   4207  C C   . ILE B  1 166 ? 16.479  172.700 13.283  1.00 23.47 ? 191 ILE B C   1 
ATOM   4208  O O   . ILE B  1 166 ? 16.459  173.135 12.129  1.00 23.19 ? 191 ILE B O   1 
ATOM   4209  C CB  . ILE B  1 166 ? 16.772  170.251 13.889  1.00 21.37 ? 191 ILE B CB  1 
ATOM   4210  C CG1 . ILE B  1 166 ? 17.778  169.103 14.025  1.00 20.07 ? 191 ILE B CG1 1 
ATOM   4211  C CG2 . ILE B  1 166 ? 15.777  169.967 12.765  1.00 21.26 ? 191 ILE B CG2 1 
ATOM   4212  C CD1 . ILE B  1 166 ? 17.176  167.887 14.699  1.00 17.25 ? 191 ILE B CD1 1 
ATOM   4213  N N   . ASP B  1 167 ? 15.653  173.135 14.228  1.00 24.43 ? 192 ASP B N   1 
ATOM   4214  C CA  . ASP B  1 167 ? 14.719  174.231 13.979  1.00 26.18 ? 192 ASP B CA  1 
ATOM   4215  C C   . ASP B  1 167 ? 15.439  175.492 13.514  1.00 26.17 ? 192 ASP B C   1 
ATOM   4216  O O   . ASP B  1 167 ? 14.948  176.218 12.649  1.00 26.29 ? 192 ASP B O   1 
ATOM   4217  C CB  . ASP B  1 167 ? 13.911  174.556 15.245  1.00 27.55 ? 192 ASP B CB  1 
ATOM   4218  C CG  . ASP B  1 167 ? 12.919  173.465 15.607  1.00 28.76 ? 192 ASP B CG  1 
ATOM   4219  O OD1 . ASP B  1 167 ? 12.460  172.714 14.716  1.00 29.28 ? 192 ASP B OD1 1 
ATOM   4220  O OD2 . ASP B  1 167 ? 12.583  173.375 16.798  1.00 30.92 ? 192 ASP B OD2 1 
ATOM   4221  N N   . ASN B  1 168 ? 16.590  175.774 14.106  1.00 25.59 ? 193 ASN B N   1 
ATOM   4222  C CA  . ASN B  1 168 ? 17.340  176.977 13.742  1.00 26.23 ? 193 ASN B CA  1 
ATOM   4223  C C   . ASN B  1 168 ? 17.924  176.903 12.323  1.00 25.37 ? 193 ASN B C   1 
ATOM   4224  O O   . ASN B  1 168 ? 17.940  177.895 11.604  1.00 25.70 ? 193 ASN B O   1 
ATOM   4225  C CB  . ASN B  1 168 ? 18.485  177.220 14.738  1.00 26.41 ? 193 ASN B CB  1 
ATOM   4226  C CG  . ASN B  1 168 ? 17.997  177.750 16.109  1.00 28.31 ? 193 ASN B CG  1 
ATOM   4227  O OD1 . ASN B  1 168 ? 16.841  178.113 16.282  1.00 30.61 ? 193 ASN B OD1 1 
ATOM   4228  N ND2 . ASN B  1 168 ? 18.908  177.824 17.058  1.00 29.68 ? 193 ASN B ND2 1 
ATOM   4229  N N   . SER B  1 169 ? 18.400  175.723 11.935  1.00 23.58 ? 194 SER B N   1 
ATOM   4230  C CA  . SER B  1 169 ? 19.323  175.593 10.806  1.00 23.33 ? 194 SER B CA  1 
ATOM   4231  C C   . SER B  1 169 ? 18.696  175.127 9.481   1.00 23.17 ? 194 SER B C   1 
ATOM   4232  O O   . SER B  1 169 ? 19.208  175.457 8.422   1.00 23.22 ? 194 SER B O   1 
ATOM   4233  C CB  . SER B  1 169 ? 20.445  174.589 11.152  1.00 21.73 ? 194 SER B CB  1 
ATOM   4234  O OG  . SER B  1 169 ? 21.239  174.977 12.263  1.00 22.07 ? 194 SER B OG  1 
ATOM   4235  N N   . TYR B  1 170 ? 17.642  174.311 9.534   1.00 22.90 ? 195 TYR B N   1 
ATOM   4236  C CA  . TYR B  1 170 ? 17.279  173.508 8.360   1.00 23.09 ? 195 TYR B CA  1 
ATOM   4237  C C   . TYR B  1 170 ? 15.897  173.765 7.804   1.00 24.29 ? 195 TYR B C   1 
ATOM   4238  O O   . TYR B  1 170 ? 14.903  173.739 8.529   1.00 24.65 ? 195 TYR B O   1 
ATOM   4239  C CB  . TYR B  1 170 ? 17.440  172.002 8.640   1.00 21.74 ? 195 TYR B CB  1 
ATOM   4240  C CG  . TYR B  1 170 ? 18.827  171.637 9.145   1.00 20.91 ? 195 TYR B CG  1 
ATOM   4241  C CD1 . TYR B  1 170 ? 19.971  171.928 8.391   1.00 19.79 ? 195 TYR B CD1 1 
ATOM   4242  C CD2 . TYR B  1 170 ? 18.994  171.010 10.362  1.00 18.94 ? 195 TYR B CD2 1 
ATOM   4243  C CE1 . TYR B  1 170 ? 21.230  171.615 8.858   1.00 20.54 ? 195 TYR B CE1 1 
ATOM   4244  C CE2 . TYR B  1 170 ? 20.261  170.664 10.822  1.00 20.00 ? 195 TYR B CE2 1 
ATOM   4245  C CZ  . TYR B  1 170 ? 21.368  170.983 10.074  1.00 19.39 ? 195 TYR B CZ  1 
ATOM   4246  O OH  . TYR B  1 170 ? 22.620  170.663 10.552  1.00 21.14 ? 195 TYR B OH  1 
ATOM   4247  N N   . GLN B  1 171 ? 15.837  174.005 6.504   1.00 24.50 ? 196 GLN B N   1 
ATOM   4248  C CA  . GLN B  1 171 ? 14.555  173.976 5.814   1.00 25.87 ? 196 GLN B CA  1 
ATOM   4249  C C   . GLN B  1 171 ? 14.379  172.547 5.295   1.00 25.70 ? 196 GLN B C   1 
ATOM   4250  O O   . GLN B  1 171 ? 14.804  172.213 4.179   1.00 25.45 ? 196 GLN B O   1 
ATOM   4251  C CB  . GLN B  1 171 ? 14.524  175.038 4.713   1.00 26.78 ? 196 GLN B CB  1 
ATOM   4252  C CG  . GLN B  1 171 ? 14.573  176.455 5.311   1.00 28.85 ? 196 GLN B CG  1 
ATOM   4253  C CD  . GLN B  1 171 ? 14.715  177.540 4.262   1.00 30.19 ? 196 GLN B CD  1 
ATOM   4254  O OE1 . GLN B  1 171 ? 13.764  178.260 3.984   1.00 32.32 ? 196 GLN B OE1 1 
ATOM   4255  N NE2 . GLN B  1 171 ? 15.898  177.659 3.674   1.00 27.45 ? 196 GLN B NE2 1 
ATOM   4256  N N   . VAL B  1 172 ? 13.794  171.683 6.135   1.00 25.42 ? 197 VAL B N   1 
ATOM   4257  C CA  . VAL B  1 172 ? 13.850  170.231 5.898   1.00 24.87 ? 197 VAL B CA  1 
ATOM   4258  C C   . VAL B  1 172 ? 13.157  169.778 4.613   1.00 26.32 ? 197 VAL B C   1 
ATOM   4259  O O   . VAL B  1 172 ? 13.680  168.938 3.868   1.00 25.82 ? 197 VAL B O   1 
ATOM   4260  C CB  . VAL B  1 172 ? 13.309  169.446 7.112   1.00 24.70 ? 197 VAL B CB  1 
ATOM   4261  C CG1 . VAL B  1 172 ? 13.314  167.952 6.839   1.00 23.12 ? 197 VAL B CG1 1 
ATOM   4262  C CG2 . VAL B  1 172 ? 14.140  169.779 8.360   1.00 22.17 ? 197 VAL B CG2 1 
ATOM   4263  N N   . GLU B  1 173 ? 11.971  170.304 4.354   1.00 27.72 ? 198 GLU B N   1 
ATOM   4264  C CA  . GLU B  1 173 ? 11.269  169.911 3.140   1.00 30.01 ? 198 GLU B CA  1 
ATOM   4265  C C   . GLU B  1 173 ? 12.069  170.267 1.889   1.00 30.13 ? 198 GLU B C   1 
ATOM   4266  O O   . GLU B  1 173 ? 12.164  169.468 0.959   1.00 30.30 ? 198 GLU B O   1 
ATOM   4267  C CB  . GLU B  1 173 ? 9.846   170.477 3.106   1.00 31.39 ? 198 GLU B CB  1 
ATOM   4268  C CG  . GLU B  1 173 ? 9.038   170.013 4.314   1.00 34.86 ? 198 GLU B CG  1 
ATOM   4269  C CD  . GLU B  1 173 ? 7.546   169.849 4.036   1.00 42.22 ? 198 GLU B CD  1 
ATOM   4270  O OE1 . GLU B  1 173 ? 6.898   170.823 3.585   1.00 44.44 ? 198 GLU B OE1 1 
ATOM   4271  O OE2 . GLU B  1 173 ? 7.022   168.729 4.273   1.00 45.31 ? 198 GLU B OE2 1 
ATOM   4272  N N   . LYS B  1 174 ? 12.684  171.446 1.879   1.00 30.29 ? 199 LYS B N   1 
ATOM   4273  C CA  . LYS B  1 174 ? 13.467  171.859 0.715   1.00 30.96 ? 199 LYS B CA  1 
ATOM   4274  C C   . LYS B  1 174 ? 14.725  171.001 0.601   1.00 29.76 ? 199 LYS B C   1 
ATOM   4275  O O   . LYS B  1 174 ? 15.046  170.514 -0.480  1.00 29.54 ? 199 LYS B O   1 
ATOM   4276  C CB  . LYS B  1 174 ? 13.820  173.351 0.772   1.00 30.95 ? 199 LYS B CB  1 
ATOM   4277  C CG  . LYS B  1 174 ? 12.635  174.290 0.538   1.00 34.68 ? 199 LYS B CG  1 
ATOM   4278  C CD  . LYS B  1 174 ? 12.905  175.677 1.149   1.00 37.01 ? 199 LYS B CD  1 
ATOM   4279  C CE  . LYS B  1 174 ? 11.853  176.714 0.775   1.00 39.98 ? 199 LYS B CE  1 
ATOM   4280  N NZ  . LYS B  1 174 ? 12.272  177.561 -0.375  1.00 42.56 ? 199 LYS B NZ  1 
ATOM   4281  N N   . LEU B  1 175 ? 15.436  170.829 1.716   1.00 28.75 ? 200 LEU B N   1 
ATOM   4282  C CA  . LEU B  1 175 ? 16.620  169.968 1.759   1.00 28.48 ? 200 LEU B CA  1 
ATOM   4283  C C   . LEU B  1 175 ? 16.339  168.539 1.253   1.00 28.49 ? 200 LEU B C   1 
ATOM   4284  O O   . LEU B  1 175 ? 17.151  167.958 0.504   1.00 28.55 ? 200 LEU B O   1 
ATOM   4285  C CB  . LEU B  1 175 ? 17.184  169.908 3.189   1.00 27.86 ? 200 LEU B CB  1 
ATOM   4286  C CG  . LEU B  1 175 ? 18.295  170.872 3.633   1.00 28.49 ? 200 LEU B CG  1 
ATOM   4287  C CD1 . LEU B  1 175 ? 18.541  172.003 2.677   1.00 29.22 ? 200 LEU B CD1 1 
ATOM   4288  C CD2 . LEU B  1 175 ? 18.030  171.417 5.038   1.00 27.61 ? 200 LEU B CD2 1 
ATOM   4289  N N   . ALA B  1 176 ? 15.209  167.969 1.671   1.00 28.37 ? 201 ALA B N   1 
ATOM   4290  C CA  . ALA B  1 176 ? 14.858  166.575 1.340   1.00 28.25 ? 201 ALA B CA  1 
ATOM   4291  C C   . ALA B  1 176 ? 14.745  166.323 -0.169  1.00 29.37 ? 201 ALA B C   1 
ATOM   4292  O O   . ALA B  1 176 ? 15.047  165.228 -0.655  1.00 29.75 ? 201 ALA B O   1 
ATOM   4293  C CB  . ALA B  1 176 ? 13.559  166.176 2.025   1.00 28.66 ? 201 ALA B CB  1 
ATOM   4294  N N   . LYS B  1 177 ? 14.300  167.327 -0.908  1.00 29.94 ? 202 LYS B N   1 
ATOM   4295  C CA  . LYS B  1 177 ? 14.254  167.218 -2.353  1.00 30.81 ? 202 LYS B CA  1 
ATOM   4296  C C   . LYS B  1 177 ? 15.640  167.161 -2.989  1.00 30.06 ? 202 LYS B C   1 
ATOM   4297  O O   . LYS B  1 177 ? 15.820  166.529 -4.028  1.00 30.43 ? 202 LYS B O   1 
ATOM   4298  C CB  . LYS B  1 177 ? 13.495  168.397 -2.923  1.00 32.29 ? 202 LYS B CB  1 
ATOM   4299  C CG  . LYS B  1 177 ? 12.032  168.369 -2.551  1.00 34.75 ? 202 LYS B CG  1 
ATOM   4300  C CD  . LYS B  1 177 ? 11.326  169.575 -3.108  1.00 40.29 ? 202 LYS B CD  1 
ATOM   4301  C CE  . LYS B  1 177 ? 9.973   169.749 -2.443  1.00 43.02 ? 202 LYS B CE  1 
ATOM   4302  N NZ  . LYS B  1 177 ? 9.061   170.435 -3.392  1.00 47.04 ? 202 LYS B NZ  1 
ATOM   4303  N N   . ASP B  1 178 ? 16.612  167.832 -2.374  1.00 28.34 ? 203 ASP B N   1 
ATOM   4304  C CA  . ASP B  1 178 ? 17.923  168.024 -2.993  1.00 28.00 ? 203 ASP B CA  1 
ATOM   4305  C C   . ASP B  1 178 ? 18.983  167.010 -2.568  1.00 26.65 ? 203 ASP B C   1 
ATOM   4306  O O   . ASP B  1 178 ? 19.944  166.744 -3.305  1.00 26.27 ? 203 ASP B O   1 
ATOM   4307  C CB  . ASP B  1 178 ? 18.418  169.458 -2.751  1.00 27.70 ? 203 ASP B CB  1 
ATOM   4308  C CG  . ASP B  1 178 ? 17.620  170.479 -3.550  1.00 30.56 ? 203 ASP B CG  1 
ATOM   4309  O OD1 . ASP B  1 178 ? 17.253  170.144 -4.697  1.00 30.08 ? 203 ASP B OD1 1 
ATOM   4310  O OD2 . ASP B  1 178 ? 17.339  171.596 -3.043  1.00 31.47 ? 203 ASP B OD2 1 
ATOM   4311  N N   . LEU B  1 179 ? 18.808  166.431 -1.392  1.00 25.29 ? 204 LEU B N   1 
ATOM   4312  C CA  . LEU B  1 179 ? 19.824  165.543 -0.846  1.00 24.24 ? 204 LEU B CA  1 
ATOM   4313  C C   . LEU B  1 179 ? 19.494  164.106 -1.175  1.00 24.52 ? 204 LEU B C   1 
ATOM   4314  O O   . LEU B  1 179 ? 18.358  163.694 -1.065  1.00 24.73 ? 204 LEU B O   1 
ATOM   4315  C CB  . LEU B  1 179 ? 19.917  165.719 0.669   1.00 22.90 ? 204 LEU B CB  1 
ATOM   4316  C CG  . LEU B  1 179 ? 20.414  167.057 1.241   1.00 24.10 ? 204 LEU B CG  1 
ATOM   4317  C CD1 . LEU B  1 179 ? 20.142  167.115 2.749   1.00 21.41 ? 204 LEU B CD1 1 
ATOM   4318  C CD2 . LEU B  1 179 ? 21.905  167.276 0.941   1.00 22.69 ? 204 LEU B CD2 1 
ATOM   4319  N N   . ASP B  1 180 ? 20.486  163.338 -1.601  1.00 24.54 ? 205 ASP B N   1 
ATOM   4320  C CA  . ASP B  1 180 ? 20.288  161.902 -1.704  1.00 24.55 ? 205 ASP B CA  1 
ATOM   4321  C C   . ASP B  1 180 ? 19.984  161.272 -0.327  1.00 23.75 ? 205 ASP B C   1 
ATOM   4322  O O   . ASP B  1 180 ? 19.120  160.413 -0.201  1.00 23.96 ? 205 ASP B O   1 
ATOM   4323  C CB  . ASP B  1 180 ? 21.501  161.273 -2.356  1.00 24.71 ? 205 ASP B CB  1 
ATOM   4324  C CG  . ASP B  1 180 ? 21.619  161.665 -3.807  1.00 26.77 ? 205 ASP B CG  1 
ATOM   4325  O OD1 . ASP B  1 180 ? 20.766  161.212 -4.592  1.00 28.87 ? 205 ASP B OD1 1 
ATOM   4326  O OD2 . ASP B  1 180 ? 22.514  162.452 -4.152  1.00 26.14 ? 205 ASP B OD2 1 
ATOM   4327  N N   . PHE B  1 181 ? 20.684  161.720 0.707   1.00 22.59 ? 206 PHE B N   1 
ATOM   4328  C CA  . PHE B  1 181 ? 20.350  161.318 2.072   1.00 22.03 ? 206 PHE B CA  1 
ATOM   4329  C C   . PHE B  1 181 ? 21.028  162.218 3.098   1.00 21.23 ? 206 PHE B C   1 
ATOM   4330  O O   . PHE B  1 181 ? 21.945  162.962 2.770   1.00 21.31 ? 206 PHE B O   1 
ATOM   4331  C CB  . PHE B  1 181 ? 20.646  159.810 2.342   1.00 22.15 ? 206 PHE B CB  1 
ATOM   4332  C CG  . PHE B  1 181 ? 22.101  159.368 2.090   1.00 22.45 ? 206 PHE B CG  1 
ATOM   4333  C CD1 . PHE B  1 181 ? 23.062  159.445 3.108   1.00 20.37 ? 206 PHE B CD1 1 
ATOM   4334  C CD2 . PHE B  1 181 ? 22.470  158.797 0.875   1.00 22.66 ? 206 PHE B CD2 1 
ATOM   4335  C CE1 . PHE B  1 181 ? 24.359  159.005 2.914   1.00 21.19 ? 206 PHE B CE1 1 
ATOM   4336  C CE2 . PHE B  1 181 ? 23.790  158.377 0.660   1.00 24.34 ? 206 PHE B CE2 1 
ATOM   4337  C CZ  . PHE B  1 181 ? 24.726  158.477 1.680   1.00 22.72 ? 206 PHE B CZ  1 
ATOM   4338  N N   . ILE B  1 182 ? 20.563  162.166 4.339   1.00 20.18 ? 207 ILE B N   1 
ATOM   4339  C CA  . ILE B  1 182 ? 21.279  162.856 5.405   1.00 19.93 ? 207 ILE B CA  1 
ATOM   4340  C C   . ILE B  1 182 ? 22.064  161.861 6.232   1.00 19.28 ? 207 ILE B C   1 
ATOM   4341  O O   . ILE B  1 182 ? 21.620  160.725 6.446   1.00 19.94 ? 207 ILE B O   1 
ATOM   4342  C CB  . ILE B  1 182 ? 20.350  163.654 6.356   1.00 19.55 ? 207 ILE B CB  1 
ATOM   4343  C CG1 . ILE B  1 182 ? 19.249  162.767 6.941   1.00 19.16 ? 207 ILE B CG1 1 
ATOM   4344  C CG2 . ILE B  1 182 ? 19.754  164.868 5.618   1.00 19.11 ? 207 ILE B CG2 1 
ATOM   4345  C CD1 . ILE B  1 182 ? 18.545  163.404 8.164   1.00 18.93 ? 207 ILE B CD1 1 
ATOM   4346  N N   . ASN B  1 183 ? 23.221  162.316 6.692   1.00 18.63 ? 208 ASN B N   1 
ATOM   4347  C CA  . ASN B  1 183 ? 23.973  161.622 7.709   1.00 18.58 ? 208 ASN B CA  1 
ATOM   4348  C C   . ASN B  1 183 ? 23.630  162.262 9.066   1.00 17.80 ? 208 ASN B C   1 
ATOM   4349  O O   . ASN B  1 183 ? 24.202  163.282 9.459   1.00 18.38 ? 208 ASN B O   1 
ATOM   4350  C CB  . ASN B  1 183 ? 25.467  161.695 7.381   1.00 18.83 ? 208 ASN B CB  1 
ATOM   4351  C CG  . ASN B  1 183 ? 25.817  160.956 6.064   1.00 20.37 ? 208 ASN B CG  1 
ATOM   4352  O OD1 . ASN B  1 183 ? 26.323  161.555 5.094   1.00 24.71 ? 208 ASN B OD1 1 
ATOM   4353  N ND2 . ASN B  1 183 ? 25.539  159.675 6.029   1.00 16.47 ? 208 ASN B ND2 1 
ATOM   4354  N N   . LEU B  1 184 ? 22.660  161.667 9.763   1.00 17.48 ? 209 LEU B N   1 
ATOM   4355  C CA  . LEU B  1 184 ? 22.162  162.229 11.024  1.00 16.92 ? 209 LEU B CA  1 
ATOM   4356  C C   . LEU B  1 184 ? 23.220  162.102 12.113  1.00 16.29 ? 209 LEU B C   1 
ATOM   4357  O O   . LEU B  1 184 ? 23.622  160.982 12.456  1.00 17.00 ? 209 LEU B O   1 
ATOM   4358  C CB  . LEU B  1 184 ? 20.894  161.485 11.458  1.00 16.91 ? 209 LEU B CB  1 
ATOM   4359  C CG  . LEU B  1 184 ? 20.280  161.972 12.783  1.00 17.95 ? 209 LEU B CG  1 
ATOM   4360  C CD1 . LEU B  1 184 ? 19.855  163.452 12.712  1.00 16.92 ? 209 LEU B CD1 1 
ATOM   4361  C CD2 . LEU B  1 184 ? 19.094  161.111 13.166  1.00 18.90 ? 209 LEU B CD2 1 
ATOM   4362  N N   . LEU B  1 185 ? 23.666  163.225 12.669  1.00 16.09 ? 210 LEU B N   1 
ATOM   4363  C CA  . LEU B  1 185 ? 24.760  163.183 13.649  1.00 16.82 ? 210 LEU B CA  1 
ATOM   4364  C C   . LEU B  1 185 ? 24.214  162.876 15.042  1.00 17.09 ? 210 LEU B C   1 
ATOM   4365  O O   . LEU B  1 185 ? 24.314  163.692 15.972  1.00 17.45 ? 210 LEU B O   1 
ATOM   4366  C CB  . LEU B  1 185 ? 25.585  164.489 13.620  1.00 17.12 ? 210 LEU B CB  1 
ATOM   4367  C CG  . LEU B  1 185 ? 26.161  164.820 12.231  1.00 17.74 ? 210 LEU B CG  1 
ATOM   4368  C CD1 . LEU B  1 185 ? 26.604  166.290 12.088  1.00 18.63 ? 210 LEU B CD1 1 
ATOM   4369  C CD2 . LEU B  1 185 ? 27.306  163.851 11.864  1.00 16.73 ? 210 LEU B CD2 1 
ATOM   4370  N N   . SER B  1 186 ? 23.650  161.678 15.181  1.00 17.14 ? 211 SER B N   1 
ATOM   4371  C CA  . SER B  1 186 ? 22.958  161.281 16.415  1.00 17.22 ? 211 SER B CA  1 
ATOM   4372  C C   . SER B  1 186 ? 23.917  160.826 17.530  1.00 16.67 ? 211 SER B C   1 
ATOM   4373  O O   . SER B  1 186 ? 23.914  159.671 17.963  1.00 16.30 ? 211 SER B O   1 
ATOM   4374  C CB  . SER B  1 186 ? 21.919  160.205 16.095  1.00 17.75 ? 211 SER B CB  1 
ATOM   4375  O OG  . SER B  1 186 ? 22.357  159.390 14.991  1.00 17.78 ? 211 SER B OG  1 
ATOM   4376  N N   . PHE B  1 187 ? 24.724  161.770 17.984  1.00 17.14 ? 212 PHE B N   1 
ATOM   4377  C CA  . PHE B  1 187 ? 25.667  161.591 19.091  1.00 17.03 ? 212 PHE B CA  1 
ATOM   4378  C C   . PHE B  1 187 ? 26.000  163.003 19.584  1.00 17.20 ? 212 PHE B C   1 
ATOM   4379  O O   . PHE B  1 187 ? 25.385  163.983 19.125  1.00 18.03 ? 212 PHE B O   1 
ATOM   4380  C CB  . PHE B  1 187 ? 26.921  160.782 18.658  1.00 16.30 ? 212 PHE B CB  1 
ATOM   4381  C CG  . PHE B  1 187 ? 27.347  161.005 17.208  1.00 16.71 ? 212 PHE B CG  1 
ATOM   4382  C CD1 . PHE B  1 187 ? 28.014  162.168 16.825  1.00 17.53 ? 212 PHE B CD1 1 
ATOM   4383  C CD2 . PHE B  1 187 ? 27.119  160.016 16.238  1.00 17.38 ? 212 PHE B CD2 1 
ATOM   4384  C CE1 . PHE B  1 187 ? 28.407  162.365 15.492  1.00 16.01 ? 212 PHE B CE1 1 
ATOM   4385  C CE2 . PHE B  1 187 ? 27.510  160.204 14.891  1.00 16.89 ? 212 PHE B CE2 1 
ATOM   4386  C CZ  . PHE B  1 187 ? 28.148  161.391 14.524  1.00 17.33 ? 212 PHE B CZ  1 
ATOM   4387  N N   . ASP B  1 188 ? 26.945  163.129 20.513  1.00 17.15 ? 213 ASP B N   1 
ATOM   4388  C CA  . ASP B  1 188 ? 27.210  164.415 21.193  1.00 17.32 ? 213 ASP B CA  1 
ATOM   4389  C C   . ASP B  1 188 ? 25.930  164.962 21.800  1.00 17.06 ? 213 ASP B C   1 
ATOM   4390  O O   . ASP B  1 188 ? 25.744  166.171 21.887  1.00 18.00 ? 213 ASP B O   1 
ATOM   4391  C CB  . ASP B  1 188 ? 27.854  165.443 20.247  1.00 17.90 ? 213 ASP B CB  1 
ATOM   4392  C CG  . ASP B  1 188 ? 29.159  164.934 19.654  1.00 19.57 ? 213 ASP B CG  1 
ATOM   4393  O OD1 . ASP B  1 188 ? 29.884  164.229 20.367  1.00 19.83 ? 213 ASP B OD1 1 
ATOM   4394  O OD2 . ASP B  1 188 ? 29.455  165.194 18.474  1.00 21.23 ? 213 ASP B OD2 1 
ATOM   4395  N N   . PHE B  1 189 ? 25.059  164.074 22.254  1.00 16.61 ? 214 PHE B N   1 
ATOM   4396  C CA  . PHE B  1 189 ? 23.833  164.525 22.927  1.00 17.38 ? 214 PHE B CA  1 
ATOM   4397  C C   . PHE B  1 189 ? 24.160  165.056 24.306  1.00 18.46 ? 214 PHE B C   1 
ATOM   4398  O O   . PHE B  1 189 ? 23.435  165.890 24.839  1.00 18.49 ? 214 PHE B O   1 
ATOM   4399  C CB  . PHE B  1 189 ? 22.815  163.382 23.069  1.00 16.47 ? 214 PHE B CB  1 
ATOM   4400  C CG  . PHE B  1 189 ? 22.082  163.056 21.791  1.00 17.76 ? 214 PHE B CG  1 
ATOM   4401  C CD1 . PHE B  1 189 ? 21.091  163.918 21.299  1.00 18.83 ? 214 PHE B CD1 1 
ATOM   4402  C CD2 . PHE B  1 189 ? 22.377  161.905 21.083  1.00 16.71 ? 214 PHE B CD2 1 
ATOM   4403  C CE1 . PHE B  1 189 ? 20.400  163.615 20.124  1.00 19.14 ? 214 PHE B CE1 1 
ATOM   4404  C CE2 . PHE B  1 189 ? 21.717  161.604 19.895  1.00 18.39 ? 214 PHE B CE2 1 
ATOM   4405  C CZ  . PHE B  1 189 ? 20.708  162.450 19.421  1.00 18.39 ? 214 PHE B CZ  1 
ATOM   4406  N N   . HIS B  1 190 ? 25.234  164.531 24.895  1.00 18.23 ? 215 HIS B N   1 
ATOM   4407  C CA  . HIS B  1 190 ? 25.711  165.041 26.172  1.00 19.77 ? 215 HIS B CA  1 
ATOM   4408  C C   . HIS B  1 190 ? 27.221  165.042 26.142  1.00 19.87 ? 215 HIS B C   1 
ATOM   4409  O O   . HIS B  1 190 ? 27.825  164.239 25.434  1.00 19.45 ? 215 HIS B O   1 
ATOM   4410  C CB  . HIS B  1 190 ? 25.229  164.168 27.341  1.00 19.19 ? 215 HIS B CB  1 
ATOM   4411  C CG  . HIS B  1 190 ? 23.739  164.175 27.524  1.00 19.03 ? 215 HIS B CG  1 
ATOM   4412  N ND1 . HIS B  1 190 ? 23.046  165.262 28.019  1.00 19.72 ? 215 HIS B ND1 1 
ATOM   4413  C CD2 . HIS B  1 190 ? 22.816  163.215 27.295  1.00 18.45 ? 215 HIS B CD2 1 
ATOM   4414  C CE1 . HIS B  1 190 ? 21.753  164.982 28.051  1.00 18.28 ? 215 HIS B CE1 1 
ATOM   4415  N NE2 . HIS B  1 190 ? 21.587  163.742 27.622  1.00 18.63 ? 215 HIS B NE2 1 
ATOM   4416  N N   . GLY B  1 191 ? 27.824  165.915 26.937  1.00 21.57 ? 216 GLY B N   1 
ATOM   4417  C CA  . GLY B  1 191 ? 29.290  166.033 26.981  1.00 22.50 ? 216 GLY B CA  1 
ATOM   4418  C C   . GLY B  1 191 ? 29.689  167.121 27.980  1.00 24.45 ? 216 GLY B C   1 
ATOM   4419  O O   . GLY B  1 191 ? 28.826  167.829 28.520  1.00 23.44 ? 216 GLY B O   1 
ATOM   4420  N N   . SER B  1 192 ? 30.994  167.265 28.217  1.00 25.30 ? 217 SER B N   1 
ATOM   4421  C CA  . SER B  1 192 ? 31.485  168.165 29.254  1.00 27.34 ? 217 SER B CA  1 
ATOM   4422  C C   . SER B  1 192 ? 31.266  169.669 29.006  1.00 28.26 ? 217 SER B C   1 
ATOM   4423  O O   . SER B  1 192 ? 31.607  170.484 29.851  1.00 29.44 ? 217 SER B O   1 
ATOM   4424  C CB  . SER B  1 192 ? 32.963  167.863 29.577  1.00 28.16 ? 217 SER B CB  1 
ATOM   4425  O OG  . SER B  1 192 ? 33.793  168.150 28.462  1.00 29.49 ? 217 SER B OG  1 
ATOM   4426  N N   . TRP B  1 193 ? 30.670  170.033 27.876  1.00 27.70 ? 218 TRP B N   1 
ATOM   4427  C CA  . TRP B  1 193 ? 30.372  171.423 27.567  1.00 28.60 ? 218 TRP B CA  1 
ATOM   4428  C C   . TRP B  1 193 ? 29.075  171.862 28.269  1.00 28.82 ? 218 TRP B C   1 
ATOM   4429  O O   . TRP B  1 193 ? 28.783  173.031 28.346  1.00 29.04 ? 218 TRP B O   1 
ATOM   4430  C CB  . TRP B  1 193 ? 30.216  171.593 26.044  1.00 28.11 ? 218 TRP B CB  1 
ATOM   4431  C CG  . TRP B  1 193 ? 29.168  170.639 25.496  1.00 25.88 ? 218 TRP B CG  1 
ATOM   4432  C CD1 . TRP B  1 193 ? 27.820  170.777 25.592  1.00 26.26 ? 218 TRP B CD1 1 
ATOM   4433  C CD2 . TRP B  1 193 ? 29.394  169.392 24.818  1.00 24.99 ? 218 TRP B CD2 1 
ATOM   4434  N NE1 . TRP B  1 193 ? 27.182  169.701 25.011  1.00 23.51 ? 218 TRP B NE1 1 
ATOM   4435  C CE2 . TRP B  1 193 ? 28.124  168.840 24.522  1.00 24.03 ? 218 TRP B CE2 1 
ATOM   4436  C CE3 . TRP B  1 193 ? 30.545  168.687 24.433  1.00 25.87 ? 218 TRP B CE3 1 
ATOM   4437  C CZ2 . TRP B  1 193 ? 27.970  167.615 23.870  1.00 23.17 ? 218 TRP B CZ2 1 
ATOM   4438  C CZ3 . TRP B  1 193 ? 30.393  167.474 23.773  1.00 25.08 ? 218 TRP B CZ3 1 
ATOM   4439  C CH2 . TRP B  1 193 ? 29.112  166.946 23.501  1.00 24.70 ? 218 TRP B CH2 1 
ATOM   4440  N N   . GLU B  1 194 ? 28.297  170.925 28.794  1.00 28.32 ? 219 GLU B N   1 
ATOM   4441  C CA  . GLU B  1 194 ? 26.977  171.288 29.316  1.00 28.65 ? 219 GLU B CA  1 
ATOM   4442  C C   . GLU B  1 194 ? 27.019  172.088 30.607  1.00 29.78 ? 219 GLU B C   1 
ATOM   4443  O O   . GLU B  1 194 ? 27.957  171.958 31.399  1.00 29.42 ? 219 GLU B O   1 
ATOM   4444  C CB  . GLU B  1 194 ? 26.145  170.042 29.557  1.00 28.14 ? 219 GLU B CB  1 
ATOM   4445  C CG  . GLU B  1 194 ? 25.582  169.448 28.271  1.00 29.92 ? 219 GLU B CG  1 
ATOM   4446  C CD  . GLU B  1 194 ? 25.016  168.067 28.457  1.00 31.06 ? 219 GLU B CD  1 
ATOM   4447  O OE1 . GLU B  1 194 ? 25.779  167.142 28.795  1.00 36.05 ? 219 GLU B OE1 1 
ATOM   4448  O OE2 . GLU B  1 194 ? 23.813  167.891 28.248  1.00 32.33 ? 219 GLU B OE2 1 
ATOM   4449  N N   . LYS B  1 195 ? 25.974  172.872 30.835  1.00 29.92 ? 220 LYS B N   1 
ATOM   4450  C CA  . LYS B  1 195 ? 25.769  173.510 32.131  1.00 31.89 ? 220 LYS B CA  1 
ATOM   4451  C C   . LYS B  1 195 ? 24.332  173.238 32.571  1.00 31.24 ? 220 LYS B C   1 
ATOM   4452  O O   . LYS B  1 195 ? 23.396  173.457 31.800  1.00 30.73 ? 220 LYS B O   1 
ATOM   4453  C CB  . LYS B  1 195 ? 26.036  175.016 32.052  1.00 34.02 ? 220 LYS B CB  1 
ATOM   4454  C CG  . LYS B  1 195 ? 27.482  175.380 31.731  1.00 36.25 ? 220 LYS B CG  1 
ATOM   4455  C CD  . LYS B  1 195 ? 27.580  176.833 31.264  1.00 42.22 ? 220 LYS B CD  1 
ATOM   4456  C CE  . LYS B  1 195 ? 29.039  177.284 31.189  1.00 44.88 ? 220 LYS B CE  1 
ATOM   4457  N NZ  . LYS B  1 195 ? 29.877  176.223 30.543  1.00 45.14 ? 220 LYS B NZ  1 
ATOM   4458  N N   . PRO B  1 196 ? 24.150  172.730 33.798  1.00 30.44 ? 221 PRO B N   1 
ATOM   4459  C CA  . PRO B  1 196 ? 25.227  172.427 34.742  1.00 30.05 ? 221 PRO B CA  1 
ATOM   4460  C C   . PRO B  1 196 ? 26.040  171.255 34.229  1.00 27.88 ? 221 PRO B C   1 
ATOM   4461  O O   . PRO B  1 196 ? 25.577  170.501 33.367  1.00 26.06 ? 221 PRO B O   1 
ATOM   4462  C CB  . PRO B  1 196 ? 24.474  172.021 36.006  1.00 30.49 ? 221 PRO B CB  1 
ATOM   4463  C CG  . PRO B  1 196 ? 23.211  171.366 35.444  1.00 30.44 ? 221 PRO B CG  1 
ATOM   4464  C CD  . PRO B  1 196 ? 22.840  172.255 34.282  1.00 30.73 ? 221 PRO B CD  1 
ATOM   4465  N N   . LEU B  1 197 ? 27.249  171.107 34.748  1.00 27.06 ? 222 LEU B N   1 
ATOM   4466  C CA  . LEU B  1 197 ? 28.148  170.071 34.255  1.00 26.21 ? 222 LEU B CA  1 
ATOM   4467  C C   . LEU B  1 197 ? 27.871  168.780 35.027  1.00 24.53 ? 222 LEU B C   1 
ATOM   4468  O O   . LEU B  1 197 ? 28.309  168.603 36.162  1.00 24.74 ? 222 LEU B O   1 
ATOM   4469  C CB  . LEU B  1 197 ? 29.600  170.572 34.367  1.00 27.70 ? 222 LEU B CB  1 
ATOM   4470  C CG  . LEU B  1 197 ? 30.833  169.724 34.011  1.00 29.31 ? 222 LEU B CG  1 
ATOM   4471  C CD1 . LEU B  1 197 ? 30.607  168.761 32.881  1.00 28.22 ? 222 LEU B CD1 1 
ATOM   4472  C CD2 . LEU B  1 197 ? 32.047  170.661 33.746  1.00 31.59 ? 222 LEU B CD2 1 
ATOM   4473  N N   . ILE B  1 198 ? 27.092  167.901 34.416  1.00 22.84 ? 223 ILE B N   1 
ATOM   4474  C CA  . ILE B  1 198 ? 26.729  166.625 35.027  1.00 21.93 ? 223 ILE B CA  1 
ATOM   4475  C C   . ILE B  1 198 ? 26.948  165.514 34.023  1.00 20.76 ? 223 ILE B C   1 
ATOM   4476  O O   . ILE B  1 198 ? 26.984  165.780 32.819  1.00 19.88 ? 223 ILE B O   1 
ATOM   4477  C CB  . ILE B  1 198 ? 25.261  166.626 35.519  1.00 21.96 ? 223 ILE B CB  1 
ATOM   4478  C CG1 . ILE B  1 198 ? 24.296  166.840 34.340  1.00 21.28 ? 223 ILE B CG1 1 
ATOM   4479  C CG2 . ILE B  1 198 ? 25.079  167.723 36.575  1.00 22.65 ? 223 ILE B CG2 1 
ATOM   4480  C CD1 . ILE B  1 198 ? 22.834  167.018 34.750  1.00 23.16 ? 223 ILE B CD1 1 
ATOM   4481  N N   . THR B  1 199 ? 27.110  164.271 34.493  1.00 20.01 ? 224 THR B N   1 
ATOM   4482  C CA  . THR B  1 199 ? 27.317  163.177 33.552  1.00 19.15 ? 224 THR B CA  1 
ATOM   4483  C C   . THR B  1 199 ? 26.082  162.959 32.657  1.00 19.20 ? 224 THR B C   1 
ATOM   4484  O O   . THR B  1 199 ? 24.946  163.119 33.111  1.00 19.63 ? 224 THR B O   1 
ATOM   4485  C CB  . THR B  1 199 ? 27.658  161.859 34.245  1.00 18.62 ? 224 THR B CB  1 
ATOM   4486  O OG1 . THR B  1 199 ? 26.557  161.442 35.068  1.00 18.01 ? 224 THR B OG1 1 
ATOM   4487  C CG2 . THR B  1 199 ? 28.928  162.012 35.111  1.00 18.84 ? 224 THR B CG2 1 
ATOM   4488  N N   . GLY B  1 200 ? 26.327  162.561 31.412  1.00 18.62 ? 225 GLY B N   1 
ATOM   4489  C CA  . GLY B  1 200 ? 25.267  162.228 30.447  1.00 18.27 ? 225 GLY B CA  1 
ATOM   4490  C C   . GLY B  1 200 ? 25.892  161.375 29.350  1.00 17.17 ? 225 GLY B C   1 
ATOM   4491  O O   . GLY B  1 200 ? 27.092  161.476 29.076  1.00 17.54 ? 225 GLY B O   1 
ATOM   4492  N N   . HIS B  1 201 ? 25.085  160.530 28.715  1.00 17.24 ? 226 HIS B N   1 
ATOM   4493  C CA  . HIS B  1 201 ? 25.597  159.630 27.671  1.00 16.41 ? 226 HIS B CA  1 
ATOM   4494  C C   . HIS B  1 201 ? 25.706  160.328 26.321  1.00 16.61 ? 226 HIS B C   1 
ATOM   4495  O O   . HIS B  1 201 ? 24.793  161.022 25.875  1.00 16.14 ? 226 HIS B O   1 
ATOM   4496  C CB  . HIS B  1 201 ? 24.700  158.389 27.535  1.00 16.35 ? 226 HIS B CB  1 
ATOM   4497  C CG  . HIS B  1 201 ? 25.374  157.225 26.879  1.00 17.04 ? 226 HIS B CG  1 
ATOM   4498  N ND1 . HIS B  1 201 ? 25.550  157.134 25.510  1.00 17.72 ? 226 HIS B ND1 1 
ATOM   4499  C CD2 . HIS B  1 201 ? 25.912  156.097 27.407  1.00 15.41 ? 226 HIS B CD2 1 
ATOM   4500  C CE1 . HIS B  1 201 ? 26.167  156.002 25.223  1.00 15.90 ? 226 HIS B CE1 1 
ATOM   4501  N NE2 . HIS B  1 201 ? 26.397  155.354 26.355  1.00 18.08 ? 226 HIS B NE2 1 
ATOM   4502  N N   . ASN B  1 202 ? 26.845  160.119 25.670  1.00 17.00 ? 227 ASN B N   1 
ATOM   4503  C CA  . ASN B  1 202 ? 27.086  160.594 24.328  1.00 17.08 ? 227 ASN B CA  1 
ATOM   4504  C C   . ASN B  1 202 ? 25.955  160.295 23.333  1.00 17.08 ? 227 ASN B C   1 
ATOM   4505  O O   . ASN B  1 202 ? 25.590  161.144 22.514  1.00 16.48 ? 227 ASN B O   1 
ATOM   4506  C CB  . ASN B  1 202 ? 28.400  159.970 23.840  1.00 17.02 ? 227 ASN B CB  1 
ATOM   4507  C CG  . ASN B  1 202 ? 28.744  160.362 22.424  1.00 18.22 ? 227 ASN B CG  1 
ATOM   4508  O OD1 . ASN B  1 202 ? 28.632  161.536 22.042  1.00 17.25 ? 227 ASN B OD1 1 
ATOM   4509  N ND2 . ASN B  1 202 ? 29.214  159.378 21.638  1.00 18.63 ? 227 ASN B ND2 1 
ATOM   4510  N N   . SER B  1 203 ? 25.395  159.087 23.388  1.00 16.71 ? 228 SER B N   1 
ATOM   4511  C CA  . SER B  1 203 ? 24.457  158.699 22.358  1.00 16.41 ? 228 SER B CA  1 
ATOM   4512  C C   . SER B  1 203 ? 23.405  157.714 22.863  1.00 16.49 ? 228 SER B C   1 
ATOM   4513  O O   . SER B  1 203 ? 23.388  156.541 22.476  1.00 17.17 ? 228 SER B O   1 
ATOM   4514  C CB  . SER B  1 203 ? 25.229  158.145 21.141  1.00 17.40 ? 228 SER B CB  1 
ATOM   4515  O OG  . SER B  1 203 ? 24.379  158.014 20.001  1.00 18.19 ? 228 SER B OG  1 
ATOM   4516  N N   . PRO B  1 204 ? 22.511  158.192 23.738  1.00 16.13 ? 229 PRO B N   1 
ATOM   4517  C CA  . PRO B  1 204 ? 21.483  157.295 24.275  1.00 16.59 ? 229 PRO B CA  1 
ATOM   4518  C C   . PRO B  1 204 ? 20.472  157.030 23.176  1.00 16.98 ? 229 PRO B C   1 
ATOM   4519  O O   . PRO B  1 204 ? 20.077  157.971 22.493  1.00 17.70 ? 229 PRO B O   1 
ATOM   4520  C CB  . PRO B  1 204 ? 20.837  158.133 25.385  1.00 17.23 ? 229 PRO B CB  1 
ATOM   4521  C CG  . PRO B  1 204 ? 20.984  159.596 24.902  1.00 16.30 ? 229 PRO B CG  1 
ATOM   4522  C CD  . PRO B  1 204 ? 22.339  159.597 24.158  1.00 16.79 ? 229 PRO B CD  1 
ATOM   4523  N N   . LEU B  1 205 ? 20.046  155.788 23.005  1.00 17.17 ? 230 LEU B N   1 
ATOM   4524  C CA  . LEU B  1 205 ? 18.997  155.471 22.042  1.00 18.22 ? 230 LEU B CA  1 
ATOM   4525  C C   . LEU B  1 205 ? 17.695  156.163 22.420  1.00 19.39 ? 230 LEU B C   1 
ATOM   4526  O O   . LEU B  1 205 ? 16.972  156.722 21.557  1.00 18.46 ? 230 LEU B O   1 
ATOM   4527  C CB  . LEU B  1 205 ? 18.745  153.946 22.014  1.00 18.67 ? 230 LEU B CB  1 
ATOM   4528  C CG  . LEU B  1 205 ? 17.664  153.461 21.028  1.00 19.64 ? 230 LEU B CG  1 
ATOM   4529  C CD1 . LEU B  1 205 ? 17.806  154.119 19.645  1.00 18.55 ? 230 LEU B CD1 1 
ATOM   4530  C CD2 . LEU B  1 205 ? 17.673  151.928 20.891  1.00 21.03 ? 230 LEU B CD2 1 
ATOM   4531  N N   . SER B  1 206 ? 17.371  156.103 23.716  1.00 19.18 ? 231 SER B N   1 
ATOM   4532  C CA  . SER B  1 206 ? 16.063  156.561 24.162  1.00 21.33 ? 231 SER B CA  1 
ATOM   4533  C C   . SER B  1 206 ? 16.130  157.570 25.292  1.00 21.09 ? 231 SER B C   1 
ATOM   4534  O O   . SER B  1 206 ? 17.162  157.741 25.925  1.00 19.66 ? 231 SER B O   1 
ATOM   4535  C CB  . SER B  1 206 ? 15.230  155.367 24.636  1.00 23.00 ? 231 SER B CB  1 
ATOM   4536  O OG  . SER B  1 206 ? 15.136  154.401 23.601  1.00 26.03 ? 231 SER B OG  1 
ATOM   4537  N N   . LYS B  1 207 ? 14.991  158.201 25.546  1.00 22.47 ? 232 LYS B N   1 
ATOM   4538  C CA  . LYS B  1 207 ? 14.854  159.183 26.607  1.00 22.96 ? 232 LYS B CA  1 
ATOM   4539  C C   . LYS B  1 207 ? 15.213  158.565 27.962  1.00 22.14 ? 232 LYS B C   1 
ATOM   4540  O O   . LYS B  1 207 ? 14.806  157.450 28.268  1.00 22.46 ? 232 LYS B O   1 
ATOM   4541  C CB  . LYS B  1 207 ? 13.405  159.687 26.611  1.00 24.16 ? 232 LYS B CB  1 
ATOM   4542  C CG  . LYS B  1 207 ? 13.089  160.685 27.675  1.00 26.19 ? 232 LYS B CG  1 
ATOM   4543  C CD  . LYS B  1 207 ? 11.656  161.255 27.517  1.00 27.33 ? 232 LYS B CD  1 
ATOM   4544  C CE  . LYS B  1 207 ? 10.657  160.522 28.395  1.00 30.45 ? 232 LYS B CE  1 
ATOM   4545  N NZ  . LYS B  1 207 ? 11.069  160.563 29.842  1.00 30.72 ? 232 LYS B NZ  1 
ATOM   4546  N N   . GLY B  1 208 ? 15.974  159.286 28.775  1.00 21.24 ? 233 GLY B N   1 
ATOM   4547  C CA  . GLY B  1 208 ? 16.229  158.852 30.144  1.00 21.32 ? 233 GLY B CA  1 
ATOM   4548  C C   . GLY B  1 208 ? 15.010  159.128 31.006  1.00 22.84 ? 233 GLY B C   1 
ATOM   4549  O O   . GLY B  1 208 ? 14.301  160.105 30.781  1.00 22.47 ? 233 GLY B O   1 
ATOM   4550  N N   . TRP B  1 209 ? 14.766  158.281 31.999  1.00 23.42 ? 234 TRP B N   1 
ATOM   4551  C CA  . TRP B  1 209 ? 13.593  158.447 32.836  1.00 26.20 ? 234 TRP B CA  1 
ATOM   4552  C C   . TRP B  1 209 ? 13.559  159.822 33.505  1.00 28.04 ? 234 TRP B C   1 
ATOM   4553  O O   . TRP B  1 209 ? 12.499  160.343 33.791  1.00 28.22 ? 234 TRP B O   1 
ATOM   4554  C CB  . TRP B  1 209 ? 13.529  157.386 33.919  1.00 25.82 ? 234 TRP B CB  1 
ATOM   4555  C CG  . TRP B  1 209 ? 13.329  155.970 33.426  1.00 25.35 ? 234 TRP B CG  1 
ATOM   4556  C CD1 . TRP B  1 209 ? 12.639  155.557 32.316  1.00 25.37 ? 234 TRP B CD1 1 
ATOM   4557  C CD2 . TRP B  1 209 ? 13.785  154.787 34.082  1.00 23.82 ? 234 TRP B CD2 1 
ATOM   4558  N NE1 . TRP B  1 209 ? 12.666  154.182 32.237  1.00 25.62 ? 234 TRP B NE1 1 
ATOM   4559  C CE2 . TRP B  1 209 ? 13.358  153.690 33.316  1.00 24.86 ? 234 TRP B CE2 1 
ATOM   4560  C CE3 . TRP B  1 209 ? 14.521  154.555 35.247  1.00 24.47 ? 234 TRP B CE3 1 
ATOM   4561  C CZ2 . TRP B  1 209 ? 13.656  152.377 33.666  1.00 24.95 ? 234 TRP B CZ2 1 
ATOM   4562  C CZ3 . TRP B  1 209 ? 14.811  153.242 35.602  1.00 25.98 ? 234 TRP B CZ3 1 
ATOM   4563  C CH2 . TRP B  1 209 ? 14.374  152.172 34.811  1.00 26.15 ? 234 TRP B CH2 1 
ATOM   4564  N N   . GLN B  1 210 ? 14.721  160.410 33.750  1.00 29.47 ? 235 GLN B N   1 
ATOM   4565  C CA  . GLN B  1 210 ? 14.725  161.738 34.353  1.00 32.85 ? 235 GLN B CA  1 
ATOM   4566  C C   . GLN B  1 210 ? 14.581  162.883 33.326  1.00 33.36 ? 235 GLN B C   1 
ATOM   4567  O O   . GLN B  1 210 ? 14.399  164.035 33.704  1.00 35.10 ? 235 GLN B O   1 
ATOM   4568  C CB  . GLN B  1 210 ? 15.977  161.935 35.223  1.00 32.80 ? 235 GLN B CB  1 
ATOM   4569  C CG  . GLN B  1 210 ? 15.818  161.450 36.668  1.00 36.58 ? 235 GLN B CG  1 
ATOM   4570  C CD  . GLN B  1 210 ? 15.055  162.450 37.557  1.00 41.40 ? 235 GLN B CD  1 
ATOM   4571  O OE1 . GLN B  1 210 ? 15.070  163.663 37.310  1.00 44.37 ? 235 GLN B OE1 1 
ATOM   4572  N NE2 . GLN B  1 210 ? 14.384  161.944 38.583  1.00 43.77 ? 235 GLN B NE2 1 
ATOM   4573  N N   . ASP B  1 211 ? 14.649  162.572 32.037  1.00 33.28 ? 236 ASP B N   1 
ATOM   4574  C CA  . ASP B  1 211 ? 14.619  163.608 31.015  1.00 33.29 ? 236 ASP B CA  1 
ATOM   4575  C C   . ASP B  1 211 ? 13.223  164.191 30.916  1.00 34.98 ? 236 ASP B C   1 
ATOM   4576  O O   . ASP B  1 211 ? 12.259  163.480 30.689  1.00 35.83 ? 236 ASP B O   1 
ATOM   4577  C CB  . ASP B  1 211 ? 15.072  163.044 29.672  1.00 32.20 ? 236 ASP B CB  1 
ATOM   4578  C CG  . ASP B  1 211 ? 16.550  162.719 29.647  1.00 31.59 ? 236 ASP B CG  1 
ATOM   4579  O OD1 . ASP B  1 211 ? 17.271  163.236 30.512  1.00 34.31 ? 236 ASP B OD1 1 
ATOM   4580  O OD2 . ASP B  1 211 ? 17.002  161.948 28.779  1.00 28.66 ? 236 ASP B OD2 1 
ATOM   4581  N N   . ARG B  1 212 ? 13.125  165.496 31.126  1.00 36.27 ? 237 ARG B N   1 
ATOM   4582  C CA  . ARG B  1 212 ? 11.862  166.189 31.167  1.00 38.41 ? 237 ARG B CA  1 
ATOM   4583  C C   . ARG B  1 212 ? 12.024  167.433 30.290  1.00 38.29 ? 237 ARG B C   1 
ATOM   4584  O O   . ARG B  1 212 ? 13.084  168.046 30.288  1.00 37.86 ? 237 ARG B O   1 
ATOM   4585  C CB  . ARG B  1 212 ? 11.570  166.579 32.622  1.00 39.88 ? 237 ARG B CB  1 
ATOM   4586  C CG  . ARG B  1 212 ? 10.307  167.367 32.845  1.00 43.56 ? 237 ARG B CG  1 
ATOM   4587  C CD  . ARG B  1 212 ? 9.191   166.526 33.483  1.00 48.00 ? 237 ARG B CD  1 
ATOM   4588  N NE  . ARG B  1 212 ? 8.019   166.517 32.599  1.00 50.81 ? 237 ARG B NE  1 
ATOM   4589  C CZ  . ARG B  1 212 ? 6.798   166.092 32.929  1.00 52.43 ? 237 ARG B CZ  1 
ATOM   4590  N NH1 . ARG B  1 212 ? 6.535   165.632 34.154  1.00 51.14 ? 237 ARG B NH1 1 
ATOM   4591  N NH2 . ARG B  1 212 ? 5.835   166.137 32.013  1.00 52.36 ? 237 ARG B NH2 1 
ATOM   4592  N N   . GLY B  1 213 ? 10.993  167.786 29.529  1.00 39.32 ? 238 GLY B N   1 
ATOM   4593  C CA  . GLY B  1 213 ? 11.014  169.007 28.711  1.00 39.28 ? 238 GLY B CA  1 
ATOM   4594  C C   . GLY B  1 213 ? 12.006  168.971 27.568  1.00 37.69 ? 238 GLY B C   1 
ATOM   4595  O O   . GLY B  1 213 ? 11.994  168.043 26.763  1.00 37.20 ? 238 GLY B O   1 
ATOM   4596  N N   . PRO B  1 214 ? 12.875  169.991 27.475  1.00 37.42 ? 239 PRO B N   1 
ATOM   4597  C CA  . PRO B  1 214 ? 13.863  170.018 26.393  1.00 35.27 ? 239 PRO B CA  1 
ATOM   4598  C C   . PRO B  1 214 ? 14.909  168.892 26.435  1.00 33.28 ? 239 PRO B C   1 
ATOM   4599  O O   . PRO B  1 214 ? 15.375  168.460 25.383  1.00 30.87 ? 239 PRO B O   1 
ATOM   4600  C CB  . PRO B  1 214 ? 14.536  171.385 26.556  1.00 36.09 ? 239 PRO B CB  1 
ATOM   4601  C CG  . PRO B  1 214 ? 14.293  171.765 28.000  1.00 37.58 ? 239 PRO B CG  1 
ATOM   4602  C CD  . PRO B  1 214 ? 12.911  171.225 28.288  1.00 39.00 ? 239 PRO B CD  1 
ATOM   4603  N N   . SER B  1 215 ? 15.299  168.439 27.624  1.00 32.20 ? 240 SER B N   1 
ATOM   4604  C CA  . SER B  1 215 ? 16.265  167.359 27.702  1.00 30.45 ? 240 SER B CA  1 
ATOM   4605  C C   . SER B  1 215 ? 15.639  166.084 27.147  1.00 28.60 ? 240 SER B C   1 
ATOM   4606  O O   . SER B  1 215 ? 16.360  165.154 26.805  1.00 26.91 ? 240 SER B O   1 
ATOM   4607  C CB  . SER B  1 215 ? 16.718  167.128 29.142  1.00 31.04 ? 240 SER B CB  1 
ATOM   4608  O OG  . SER B  1 215 ? 15.570  167.110 29.973  1.00 35.17 ? 240 SER B OG  1 
ATOM   4609  N N   . SER B  1 216 ? 14.305  166.048 27.054  1.00 27.87 ? 241 SER B N   1 
ATOM   4610  C CA  . SER B  1 216 ? 13.633  164.875 26.515  1.00 27.36 ? 241 SER B CA  1 
ATOM   4611  C C   . SER B  1 216 ? 13.960  164.698 25.016  1.00 26.36 ? 241 SER B C   1 
ATOM   4612  O O   . SER B  1 216 ? 13.685  163.645 24.430  1.00 25.92 ? 241 SER B O   1 
ATOM   4613  C CB  . SER B  1 216 ? 12.120  164.951 26.744  1.00 29.10 ? 241 SER B CB  1 
ATOM   4614  O OG  . SER B  1 216 ? 11.515  165.754 25.745  1.00 30.62 ? 241 SER B OG  1 
ATOM   4615  N N   . TYR B  1 217 ? 14.539  165.737 24.409  1.00 24.85 ? 242 TYR B N   1 
ATOM   4616  C CA  . TYR B  1 217 ? 14.891  165.719 22.998  1.00 23.76 ? 242 TYR B CA  1 
ATOM   4617  C C   . TYR B  1 217 ? 16.240  165.084 22.743  1.00 21.97 ? 242 TYR B C   1 
ATOM   4618  O O   . TYR B  1 217 ? 16.543  164.786 21.593  1.00 20.53 ? 242 TYR B O   1 
ATOM   4619  C CB  . TYR B  1 217 ? 14.984  167.131 22.416  1.00 23.89 ? 242 TYR B CB  1 
ATOM   4620  C CG  . TYR B  1 217 ? 13.771  167.979 22.613  1.00 26.68 ? 242 TYR B CG  1 
ATOM   4621  C CD1 . TYR B  1 217 ? 12.508  167.412 22.650  1.00 27.98 ? 242 TYR B CD1 1 
ATOM   4622  C CD2 . TYR B  1 217 ? 13.883  169.359 22.724  1.00 27.83 ? 242 TYR B CD2 1 
ATOM   4623  C CE1 . TYR B  1 217 ? 11.389  168.193 22.821  1.00 31.11 ? 242 TYR B CE1 1 
ATOM   4624  C CE2 . TYR B  1 217 ? 12.760  170.153 22.888  1.00 31.03 ? 242 TYR B CE2 1 
ATOM   4625  C CZ  . TYR B  1 217 ? 11.524  169.554 22.925  1.00 31.77 ? 242 TYR B CZ  1 
ATOM   4626  O OH  . TYR B  1 217 ? 10.404  170.313 23.103  1.00 37.18 ? 242 TYR B OH  1 
ATOM   4627  N N   . TYR B  1 218 ? 17.054  164.904 23.786  1.00 21.20 ? 243 TYR B N   1 
ATOM   4628  C CA  . TYR B  1 218 ? 18.458  164.534 23.585  1.00 21.03 ? 243 TYR B CA  1 
ATOM   4629  C C   . TYR B  1 218 ? 18.680  163.023 23.528  1.00 20.34 ? 243 TYR B C   1 
ATOM   4630  O O   . TYR B  1 218 ? 19.334  162.447 24.420  1.00 19.25 ? 243 TYR B O   1 
ATOM   4631  C CB  . TYR B  1 218 ? 19.361  165.162 24.655  1.00 21.30 ? 243 TYR B CB  1 
ATOM   4632  C CG  . TYR B  1 218 ? 19.262  166.680 24.707  1.00 25.40 ? 243 TYR B CG  1 
ATOM   4633  C CD1 . TYR B  1 218 ? 18.801  167.409 23.608  1.00 29.17 ? 243 TYR B CD1 1 
ATOM   4634  C CD2 . TYR B  1 218 ? 19.617  167.374 25.847  1.00 29.43 ? 243 TYR B CD2 1 
ATOM   4635  C CE1 . TYR B  1 218 ? 18.699  168.804 23.654  1.00 31.84 ? 243 TYR B CE1 1 
ATOM   4636  C CE2 . TYR B  1 218 ? 19.511  168.768 25.910  1.00 31.99 ? 243 TYR B CE2 1 
ATOM   4637  C CZ  . TYR B  1 218 ? 19.063  169.469 24.818  1.00 33.18 ? 243 TYR B CZ  1 
ATOM   4638  O OH  . TYR B  1 218 ? 18.982  170.832 24.889  1.00 34.72 ? 243 TYR B OH  1 
ATOM   4639  N N   . ASN B  1 219 ? 18.101  162.386 22.508  1.00 19.30 ? 244 ASN B N   1 
ATOM   4640  C CA  . ASN B  1 219 ? 18.302  160.950 22.297  1.00 18.45 ? 244 ASN B CA  1 
ATOM   4641  C C   . ASN B  1 219 ? 18.085  160.611 20.826  1.00 18.25 ? 244 ASN B C   1 
ATOM   4642  O O   . ASN B  1 219 ? 17.447  161.384 20.106  1.00 17.69 ? 244 ASN B O   1 
ATOM   4643  C CB  . ASN B  1 219 ? 17.376  160.118 23.204  1.00 18.44 ? 244 ASN B CB  1 
ATOM   4644  C CG  . ASN B  1 219 ? 15.903  160.489 23.048  1.00 19.88 ? 244 ASN B CG  1 
ATOM   4645  O OD1 . ASN B  1 219 ? 15.341  161.238 23.864  1.00 24.32 ? 244 ASN B OD1 1 
ATOM   4646  N ND2 . ASN B  1 219 ? 15.268  159.950 22.031  1.00 18.14 ? 244 ASN B ND2 1 
ATOM   4647  N N   . VAL B  1 220 ? 18.640  159.478 20.381  1.00 17.98 ? 245 VAL B N   1 
ATOM   4648  C CA  . VAL B  1 220 ? 18.607  159.095 18.960  1.00 17.83 ? 245 VAL B CA  1 
ATOM   4649  C C   . VAL B  1 220 ? 17.166  158.972 18.450  1.00 18.88 ? 245 VAL B C   1 
ATOM   4650  O O   . VAL B  1 220 ? 16.820  159.491 17.402  1.00 18.86 ? 245 VAL B O   1 
ATOM   4651  C CB  . VAL B  1 220 ? 19.315  157.744 18.738  1.00 18.14 ? 245 VAL B CB  1 
ATOM   4652  C CG1 . VAL B  1 220 ? 19.136  157.252 17.279  1.00 17.53 ? 245 VAL B CG1 1 
ATOM   4653  C CG2 . VAL B  1 220 ? 20.800  157.828 19.132  1.00 17.02 ? 245 VAL B CG2 1 
ATOM   4654  N N   . GLU B  1 221 ? 16.339  158.268 19.216  1.00 19.75 ? 246 GLU B N   1 
ATOM   4655  C CA  . GLU B  1 221 ? 14.939  158.051 18.893  1.00 21.36 ? 246 GLU B CA  1 
ATOM   4656  C C   . GLU B  1 221 ? 14.189  159.363 18.627  1.00 21.30 ? 246 GLU B C   1 
ATOM   4657  O O   . GLU B  1 221 ? 13.479  159.483 17.629  1.00 20.96 ? 246 GLU B O   1 
ATOM   4658  C CB  . GLU B  1 221 ? 14.275  157.252 20.029  1.00 22.13 ? 246 GLU B CB  1 
ATOM   4659  C CG  . GLU B  1 221 ? 12.930  156.729 19.696  1.00 27.50 ? 246 GLU B CG  1 
ATOM   4660  C CD  . GLU B  1 221 ? 12.356  155.810 20.774  1.00 29.64 ? 246 GLU B CD  1 
ATOM   4661  O OE1 . GLU B  1 221 ? 13.058  155.479 21.763  1.00 31.11 ? 246 GLU B OE1 1 
ATOM   4662  O OE2 . GLU B  1 221 ? 11.177  155.442 20.627  1.00 34.57 ? 246 GLU B OE2 1 
ATOM   4663  N N   . TYR B  1 222 ? 14.362  160.360 19.490  1.00 21.23 ? 247 TYR B N   1 
ATOM   4664  C CA  . TYR B  1 222 ? 13.651  161.610 19.275  1.00 21.47 ? 247 TYR B CA  1 
ATOM   4665  C C   . TYR B  1 222 ? 14.161  162.297 18.010  1.00 20.44 ? 247 TYR B C   1 
ATOM   4666  O O   . TYR B  1 222 ? 13.383  162.838 17.231  1.00 20.25 ? 247 TYR B O   1 
ATOM   4667  C CB  . TYR B  1 222 ? 13.793  162.564 20.455  1.00 21.72 ? 247 TYR B CB  1 
ATOM   4668  C CG  . TYR B  1 222 ? 12.904  163.771 20.276  1.00 23.20 ? 247 TYR B CG  1 
ATOM   4669  C CD1 . TYR B  1 222 ? 13.364  164.898 19.600  1.00 23.87 ? 247 TYR B CD1 1 
ATOM   4670  C CD2 . TYR B  1 222 ? 11.589  163.767 20.750  1.00 25.20 ? 247 TYR B CD2 1 
ATOM   4671  C CE1 . TYR B  1 222 ? 12.544  166.002 19.407  1.00 25.46 ? 247 TYR B CE1 1 
ATOM   4672  C CE2 . TYR B  1 222 ? 10.757  164.873 20.565  1.00 27.98 ? 247 TYR B CE2 1 
ATOM   4673  C CZ  . TYR B  1 222 ? 11.250  165.979 19.876  1.00 27.84 ? 247 TYR B CZ  1 
ATOM   4674  O OH  . TYR B  1 222 ? 10.463  167.089 19.682  1.00 30.71 ? 247 TYR B OH  1 
ATOM   4675  N N   . ALA B  1 223 ? 15.477  162.276 17.811  1.00 18.80 ? 248 ALA B N   1 
ATOM   4676  C CA  . ALA B  1 223 ? 16.061  163.000 16.689  1.00 19.08 ? 248 ALA B CA  1 
ATOM   4677  C C   . ALA B  1 223 ? 15.594  162.400 15.374  1.00 19.26 ? 248 ALA B C   1 
ATOM   4678  O O   . ALA B  1 223 ? 15.254  163.118 14.421  1.00 20.56 ? 248 ALA B O   1 
ATOM   4679  C CB  . ALA B  1 223 ? 17.608  162.962 16.754  1.00 17.34 ? 248 ALA B CB  1 
ATOM   4680  N N   . VAL B  1 224 ? 15.621  161.084 15.304  1.00 18.94 ? 249 VAL B N   1 
ATOM   4681  C CA  . VAL B  1 224 ? 15.117  160.395 14.117  1.00 19.42 ? 249 VAL B CA  1 
ATOM   4682  C C   . VAL B  1 224 ? 13.658  160.776 13.857  1.00 20.71 ? 249 VAL B C   1 
ATOM   4683  O O   . VAL B  1 224 ? 13.286  161.136 12.725  1.00 20.38 ? 249 VAL B O   1 
ATOM   4684  C CB  . VAL B  1 224 ? 15.270  158.874 14.261  1.00 19.19 ? 249 VAL B CB  1 
ATOM   4685  C CG1 . VAL B  1 224 ? 14.398  158.138 13.242  1.00 19.90 ? 249 VAL B CG1 1 
ATOM   4686  C CG2 . VAL B  1 224 ? 16.739  158.474 14.100  1.00 18.18 ? 249 VAL B CG2 1 
ATOM   4687  N N   . GLY B  1 225 ? 12.838  160.710 14.911  1.00 21.47 ? 250 GLY B N   1 
ATOM   4688  C CA  . GLY B  1 225 ? 11.392  161.003 14.796  1.00 22.56 ? 250 GLY B CA  1 
ATOM   4689  C C   . GLY B  1 225 ? 11.170  162.430 14.318  1.00 22.90 ? 250 GLY B C   1 
ATOM   4690  O O   . GLY B  1 225 ? 10.289  162.705 13.490  1.00 24.21 ? 250 GLY B O   1 
ATOM   4691  N N   . TYR B  1 226 ? 11.985  163.348 14.821  1.00 21.82 ? 251 TYR B N   1 
ATOM   4692  C CA  . TYR B  1 226 ? 11.823  164.773 14.497  1.00 22.48 ? 251 TYR B CA  1 
ATOM   4693  C C   . TYR B  1 226 ? 12.183  165.107 13.038  1.00 22.72 ? 251 TYR B C   1 
ATOM   4694  O O   . TYR B  1 226 ? 11.467  165.850 12.373  1.00 22.85 ? 251 TYR B O   1 
ATOM   4695  C CB  . TYR B  1 226 ? 12.651  165.632 15.455  1.00 22.33 ? 251 TYR B CB  1 
ATOM   4696  C CG  . TYR B  1 226 ? 12.207  167.064 15.489  1.00 22.51 ? 251 TYR B CG  1 
ATOM   4697  C CD1 . TYR B  1 226 ? 10.921  167.402 15.901  1.00 25.23 ? 251 TYR B CD1 1 
ATOM   4698  C CD2 . TYR B  1 226 ? 13.049  168.079 15.070  1.00 22.77 ? 251 TYR B CD2 1 
ATOM   4699  C CE1 . TYR B  1 226 ? 10.497  168.723 15.904  1.00 27.37 ? 251 TYR B CE1 1 
ATOM   4700  C CE2 . TYR B  1 226 ? 12.634  169.397 15.075  1.00 24.51 ? 251 TYR B CE2 1 
ATOM   4701  C CZ  . TYR B  1 226 ? 11.360  169.710 15.500  1.00 26.89 ? 251 TYR B CZ  1 
ATOM   4702  O OH  . TYR B  1 226 ? 10.958  171.029 15.507  1.00 30.67 ? 251 TYR B OH  1 
ATOM   4703  N N   . TRP B  1 227 ? 13.315  164.585 12.557  1.00 21.89 ? 252 TRP B N   1 
ATOM   4704  C CA  . TRP B  1 227 ? 13.654  164.710 11.134  1.00 21.42 ? 252 TRP B CA  1 
ATOM   4705  C C   . TRP B  1 227 ? 12.533  164.196 10.234  1.00 22.66 ? 252 TRP B C   1 
ATOM   4706  O O   . TRP B  1 227 ? 12.163  164.838 9.238   1.00 23.22 ? 252 TRP B O   1 
ATOM   4707  C CB  . TRP B  1 227 ? 14.984  164.009 10.826  1.00 20.30 ? 252 TRP B CB  1 
ATOM   4708  C CG  . TRP B  1 227 ? 16.137  164.940 11.049  1.00 20.18 ? 252 TRP B CG  1 
ATOM   4709  C CD1 . TRP B  1 227 ? 16.912  165.024 12.165  1.00 17.76 ? 252 TRP B CD1 1 
ATOM   4710  C CD2 . TRP B  1 227 ? 16.599  165.960 10.149  1.00 19.34 ? 252 TRP B CD2 1 
ATOM   4711  N NE1 . TRP B  1 227 ? 17.844  166.029 12.016  1.00 21.09 ? 252 TRP B NE1 1 
ATOM   4712  C CE2 . TRP B  1 227 ? 17.674  166.617 10.784  1.00 19.38 ? 252 TRP B CE2 1 
ATOM   4713  C CE3 . TRP B  1 227 ? 16.215  166.373 8.866   1.00 19.49 ? 252 TRP B CE3 1 
ATOM   4714  C CZ2 . TRP B  1 227 ? 18.389  167.653 10.175  1.00 18.22 ? 252 TRP B CZ2 1 
ATOM   4715  C CZ3 . TRP B  1 227 ? 16.921  167.420 8.264   1.00 20.88 ? 252 TRP B CZ3 1 
ATOM   4716  C CH2 . TRP B  1 227 ? 17.984  168.052 8.923   1.00 20.18 ? 252 TRP B CH2 1 
ATOM   4717  N N   . ILE B  1 228 ? 11.971  163.044 10.573  1.00 22.89 ? 253 ILE B N   1 
ATOM   4718  C CA  . ILE B  1 228 ? 10.893  162.489 9.746   1.00 23.99 ? 253 ILE B CA  1 
ATOM   4719  C C   . ILE B  1 228 ? 9.646   163.365 9.814   1.00 26.09 ? 253 ILE B C   1 
ATOM   4720  O O   . ILE B  1 228 ? 9.012   163.672 8.779   1.00 26.21 ? 253 ILE B O   1 
ATOM   4721  C CB  . ILE B  1 228 ? 10.565  161.030 10.169  1.00 24.91 ? 253 ILE B CB  1 
ATOM   4722  C CG1 . ILE B  1 228 ? 11.700  160.089 9.711   1.00 23.33 ? 253 ILE B CG1 1 
ATOM   4723  C CG2 . ILE B  1 228 ? 9.182   160.567 9.626   1.00 26.83 ? 253 ILE B CG2 1 
ATOM   4724  C CD1 . ILE B  1 228 ? 11.672  158.729 10.395  1.00 22.85 ? 253 ILE B CD1 1 
ATOM   4725  N N   . HIS B  1 229 ? 9.291   163.757 11.033  1.00 26.18 ? 254 HIS B N   1 
ATOM   4726  C CA  . HIS B  1 229 ? 8.191   164.677 11.263  1.00 28.65 ? 254 HIS B CA  1 
ATOM   4727  C C   . HIS B  1 229 ? 8.339   165.956 10.428  1.00 28.98 ? 254 HIS B C   1 
ATOM   4728  O O   . HIS B  1 229 ? 7.368   166.445 9.861   1.00 29.60 ? 254 HIS B O   1 
ATOM   4729  C CB  . HIS B  1 229 ? 8.082   165.018 12.758  1.00 29.09 ? 254 HIS B CB  1 
ATOM   4730  C CG  . HIS B  1 229 ? 7.219   166.207 13.040  1.00 32.81 ? 254 HIS B CG  1 
ATOM   4731  N ND1 . HIS B  1 229 ? 5.842   166.152 13.006  1.00 36.12 ? 254 HIS B ND1 1 
ATOM   4732  C CD2 . HIS B  1 229 ? 7.538   167.488 13.343  1.00 34.69 ? 254 HIS B CD2 1 
ATOM   4733  C CE1 . HIS B  1 229 ? 5.347   167.344 13.286  1.00 37.99 ? 254 HIS B CE1 1 
ATOM   4734  N NE2 . HIS B  1 229 ? 6.354   168.175 13.490  1.00 38.23 ? 254 HIS B NE2 1 
ATOM   4735  N N   . LYS B  1 230 ? 9.560   166.469 10.316  1.00 27.57 ? 255 LYS B N   1 
ATOM   4736  C CA  . LYS B  1 230 ? 9.787   167.710 9.578   1.00 28.44 ? 255 LYS B CA  1 
ATOM   4737  C C   . LYS B  1 230 ? 9.789   167.519 8.058   1.00 28.42 ? 255 LYS B C   1 
ATOM   4738  O O   . LYS B  1 230 ? 9.916   168.483 7.312   1.00 28.46 ? 255 LYS B O   1 
ATOM   4739  C CB  . LYS B  1 230 ? 11.106  168.368 10.017  1.00 27.37 ? 255 LYS B CB  1 
ATOM   4740  C CG  . LYS B  1 230 ? 11.154  168.760 11.497  1.00 28.85 ? 255 LYS B CG  1 
ATOM   4741  C CD  . LYS B  1 230 ? 10.511  170.099 11.753  1.00 33.38 ? 255 LYS B CD  1 
ATOM   4742  C CE  . LYS B  1 230 ? 11.291  171.194 11.056  1.00 34.59 ? 255 LYS B CE  1 
ATOM   4743  N NZ  . LYS B  1 230 ? 11.303  172.467 11.851  1.00 36.52 ? 255 LYS B NZ  1 
ATOM   4744  N N   . GLY B  1 231 ? 9.698   166.274 7.598   1.00 28.37 ? 256 GLY B N   1 
ATOM   4745  C CA  . GLY B  1 231 ? 9.589   166.022 6.168   1.00 28.13 ? 256 GLY B CA  1 
ATOM   4746  C C   . GLY B  1 231 ? 10.689  165.209 5.503   1.00 26.64 ? 256 GLY B C   1 
ATOM   4747  O O   . GLY B  1 231 ? 10.663  165.026 4.299   1.00 26.95 ? 256 GLY B O   1 
ATOM   4748  N N   . MET B  1 232 ? 11.678  164.727 6.249   1.00 25.60 ? 257 MET B N   1 
ATOM   4749  C CA  . MET B  1 232 ? 12.699  163.853 5.621   1.00 24.56 ? 257 MET B CA  1 
ATOM   4750  C C   . MET B  1 232 ? 12.134  162.417 5.492   1.00 25.08 ? 257 MET B C   1 
ATOM   4751  O O   . MET B  1 232 ? 11.702  161.828 6.485   1.00 25.11 ? 257 MET B O   1 
ATOM   4752  C CB  . MET B  1 232 ? 14.005  163.899 6.407   1.00 23.39 ? 257 MET B CB  1 
ATOM   4753  C CG  . MET B  1 232 ? 15.183  163.143 5.788   1.00 22.88 ? 257 MET B CG  1 
ATOM   4754  S SD  . MET B  1 232 ? 15.725  163.948 4.276   1.00 24.78 ? 257 MET B SD  1 
ATOM   4755  C CE  . MET B  1 232 ? 16.193  165.573 4.871   1.00 22.42 ? 257 MET B CE  1 
ATOM   4756  N N   . PRO B  1 233 ? 12.084  161.869 4.258   1.00 25.91 ? 258 PRO B N   1 
ATOM   4757  C CA  . PRO B  1 233 ? 11.592  160.497 4.123   1.00 26.25 ? 258 PRO B CA  1 
ATOM   4758  C C   . PRO B  1 233 ? 12.472  159.606 4.998   1.00 24.87 ? 258 PRO B C   1 
ATOM   4759  O O   . PRO B  1 233 ? 13.670  159.848 5.104   1.00 23.66 ? 258 PRO B O   1 
ATOM   4760  C CB  . PRO B  1 233 ? 11.815  160.183 2.639   1.00 26.96 ? 258 PRO B CB  1 
ATOM   4761  C CG  . PRO B  1 233 ? 11.854  161.518 1.955   1.00 27.53 ? 258 PRO B CG  1 
ATOM   4762  C CD  . PRO B  1 233 ? 12.504  162.442 2.962   1.00 26.00 ? 258 PRO B CD  1 
ATOM   4763  N N   . SER B  1 234 ? 11.888  158.609 5.644   1.00 25.01 ? 259 SER B N   1 
ATOM   4764  C CA  . SER B  1 234 ? 12.647  157.774 6.574   1.00 24.11 ? 259 SER B CA  1 
ATOM   4765  C C   . SER B  1 234 ? 13.815  157.091 5.862   1.00 23.88 ? 259 SER B C   1 
ATOM   4766  O O   . SER B  1 234 ? 14.905  156.963 6.441   1.00 22.10 ? 259 SER B O   1 
ATOM   4767  C CB  . SER B  1 234 ? 11.740  156.742 7.250   1.00 25.33 ? 259 SER B CB  1 
ATOM   4768  O OG  . SER B  1 234 ? 11.385  155.711 6.337   1.00 27.14 ? 259 SER B OG  1 
ATOM   4769  N N   . GLU B  1 235 ? 13.601  156.686 4.609   1.00 23.98 ? 260 GLU B N   1 
ATOM   4770  C CA  . GLU B  1 235 ? 14.664  156.040 3.840   1.00 25.24 ? 260 GLU B CA  1 
ATOM   4771  C C   . GLU B  1 235 ? 15.866  156.934 3.498   1.00 23.71 ? 260 GLU B C   1 
ATOM   4772  O O   . GLU B  1 235 ? 16.918  156.411 3.143   1.00 23.71 ? 260 GLU B O   1 
ATOM   4773  C CB  . GLU B  1 235 ? 14.119  155.389 2.565   1.00 27.33 ? 260 GLU B CB  1 
ATOM   4774  C CG  . GLU B  1 235 ? 13.540  156.379 1.541   1.00 30.52 ? 260 GLU B CG  1 
ATOM   4775  C CD  . GLU B  1 235 ? 12.042  156.608 1.705   1.00 35.42 ? 260 GLU B CD  1 
ATOM   4776  O OE1 . GLU B  1 235 ? 11.487  156.368 2.818   1.00 35.29 ? 260 GLU B OE1 1 
ATOM   4777  O OE2 . GLU B  1 235 ? 11.414  157.027 0.700   1.00 36.82 ? 260 GLU B OE2 1 
ATOM   4778  N N   . LYS B  1 236 ? 15.726  158.257 3.627   1.00 22.70 ? 261 LYS B N   1 
ATOM   4779  C CA  . LYS B  1 236 ? 16.871  159.170 3.446   1.00 22.30 ? 261 LYS B CA  1 
ATOM   4780  C C   . LYS B  1 236 ? 17.548  159.518 4.767   1.00 21.57 ? 261 LYS B C   1 
ATOM   4781  O O   . LYS B  1 236 ? 18.534  160.274 4.798   1.00 20.84 ? 261 LYS B O   1 
ATOM   4782  C CB  . LYS B  1 236 ? 16.469  160.464 2.724   1.00 22.61 ? 261 LYS B CB  1 
ATOM   4783  C CG  . LYS B  1 236 ? 16.246  160.293 1.237   1.00 23.61 ? 261 LYS B CG  1 
ATOM   4784  C CD  . LYS B  1 236 ? 15.887  161.637 0.595   1.00 25.14 ? 261 LYS B CD  1 
ATOM   4785  C CE  . LYS B  1 236 ? 15.683  161.488 -0.917  1.00 25.70 ? 261 LYS B CE  1 
ATOM   4786  N NZ  . LYS B  1 236 ? 15.967  162.786 -1.589  1.00 25.15 ? 261 LYS B NZ  1 
ATOM   4787  N N   . VAL B  1 237 ? 17.040  158.966 5.867   1.00 21.00 ? 262 VAL B N   1 
ATOM   4788  C CA  . VAL B  1 237 ? 17.728  159.121 7.147   1.00 19.88 ? 262 VAL B CA  1 
ATOM   4789  C C   . VAL B  1 237 ? 18.741  157.995 7.364   1.00 19.90 ? 262 VAL B C   1 
ATOM   4790  O O   . VAL B  1 237 ? 18.369  156.824 7.519   1.00 20.17 ? 262 VAL B O   1 
ATOM   4791  C CB  . VAL B  1 237 ? 16.740  159.171 8.351   1.00 20.51 ? 262 VAL B CB  1 
ATOM   4792  C CG1 . VAL B  1 237 ? 17.510  159.369 9.645   1.00 18.95 ? 262 VAL B CG1 1 
ATOM   4793  C CG2 . VAL B  1 237 ? 15.731  160.317 8.169   1.00 19.44 ? 262 VAL B CG2 1 
ATOM   4794  N N   . VAL B  1 238 ? 20.024  158.351 7.374   1.00 19.11 ? 263 VAL B N   1 
ATOM   4795  C CA  . VAL B  1 238 ? 21.070  157.379 7.677   1.00 18.98 ? 263 VAL B CA  1 
ATOM   4796  C C   . VAL B  1 238 ? 21.542  157.726 9.094   1.00 18.52 ? 263 VAL B C   1 
ATOM   4797  O O   . VAL B  1 238 ? 22.111  158.789 9.325   1.00 17.75 ? 263 VAL B O   1 
ATOM   4798  C CB  . VAL B  1 238 ? 22.226  157.413 6.630   1.00 19.74 ? 263 VAL B CB  1 
ATOM   4799  C CG1 . VAL B  1 238 ? 23.301  156.349 6.959   1.00 17.92 ? 263 VAL B CG1 1 
ATOM   4800  C CG2 . VAL B  1 238 ? 21.681  157.186 5.207   1.00 18.87 ? 263 VAL B CG2 1 
ATOM   4801  N N   . MET B  1 239 ? 21.258  156.834 10.046  1.00 18.69 ? 264 MET B N   1 
ATOM   4802  C CA  . MET B  1 239 ? 21.364  157.142 11.462  1.00 18.19 ? 264 MET B CA  1 
ATOM   4803  C C   . MET B  1 239 ? 22.788  156.977 11.988  1.00 18.73 ? 264 MET B C   1 
ATOM   4804  O O   . MET B  1 239 ? 23.362  155.893 11.939  1.00 19.13 ? 264 MET B O   1 
ATOM   4805  C CB  . MET B  1 239 ? 20.398  156.241 12.238  1.00 18.77 ? 264 MET B CB  1 
ATOM   4806  C CG  . MET B  1 239 ? 20.359  156.448 13.760  1.00 17.12 ? 264 MET B CG  1 
ATOM   4807  S SD  . MET B  1 239 ? 19.337  155.156 14.553  1.00 20.11 ? 264 MET B SD  1 
ATOM   4808  C CE  . MET B  1 239 ? 20.611  153.935 14.830  1.00 18.58 ? 264 MET B CE  1 
ATOM   4809  N N   . GLY B  1 240 ? 23.346  158.054 12.519  1.00 18.03 ? 265 GLY B N   1 
ATOM   4810  C CA  . GLY B  1 240 ? 24.713  158.056 13.013  1.00 17.53 ? 265 GLY B CA  1 
ATOM   4811  C C   . GLY B  1 240 ? 24.919  157.232 14.273  1.00 17.60 ? 265 GLY B C   1 
ATOM   4812  O O   . GLY B  1 240 ? 24.081  157.224 15.176  1.00 17.48 ? 265 GLY B O   1 
ATOM   4813  N N   . ILE B  1 241 ? 26.046  156.532 14.327  1.00 17.25 ? 266 ILE B N   1 
ATOM   4814  C CA  . ILE B  1 241 ? 26.425  155.763 15.502  1.00 17.00 ? 266 ILE B CA  1 
ATOM   4815  C C   . ILE B  1 241 ? 27.890  156.078 15.785  1.00 17.43 ? 266 ILE B C   1 
ATOM   4816  O O   . ILE B  1 241 ? 28.716  156.056 14.869  1.00 17.50 ? 266 ILE B O   1 
ATOM   4817  C CB  . ILE B  1 241 ? 26.262  154.255 15.228  1.00 17.49 ? 266 ILE B CB  1 
ATOM   4818  C CG1 . ILE B  1 241 ? 24.787  153.927 14.930  1.00 17.19 ? 266 ILE B CG1 1 
ATOM   4819  C CG2 . ILE B  1 241 ? 26.760  153.441 16.422  1.00 16.87 ? 266 ILE B CG2 1 
ATOM   4820  C CD1 . ILE B  1 241 ? 24.567  152.465 14.487  1.00 18.89 ? 266 ILE B CD1 1 
ATOM   4821  N N   . PRO B  1 242 ? 28.225  156.399 17.046  1.00 17.94 ? 267 PRO B N   1 
ATOM   4822  C CA  . PRO B  1 242 ? 29.596  156.804 17.334  1.00 17.94 ? 267 PRO B CA  1 
ATOM   4823  C C   . PRO B  1 242 ? 30.469  155.616 17.727  1.00 19.30 ? 267 PRO B C   1 
ATOM   4824  O O   . PRO B  1 242 ? 29.994  154.694 18.372  1.00 19.25 ? 267 PRO B O   1 
ATOM   4825  C CB  . PRO B  1 242 ? 29.432  157.687 18.563  1.00 17.65 ? 267 PRO B CB  1 
ATOM   4826  C CG  . PRO B  1 242 ? 28.291  157.040 19.318  1.00 18.11 ? 267 PRO B CG  1 
ATOM   4827  C CD  . PRO B  1 242 ? 27.349  156.526 18.228  1.00 17.35 ? 267 PRO B CD  1 
ATOM   4828  N N   . THR B  1 243 ? 31.752  155.657 17.381  1.00 19.48 ? 268 THR B N   1 
ATOM   4829  C CA  . THR B  1 243 ? 32.664  154.662 17.914  1.00 19.80 ? 268 THR B CA  1 
ATOM   4830  C C   . THR B  1 243 ? 33.476  155.232 19.068  1.00 21.04 ? 268 THR B C   1 
ATOM   4831  O O   . THR B  1 243 ? 34.362  154.555 19.578  1.00 24.43 ? 268 THR B O   1 
ATOM   4832  C CB  . THR B  1 243 ? 33.649  154.169 16.858  1.00 19.96 ? 268 THR B CB  1 
ATOM   4833  O OG1 . THR B  1 243 ? 34.275  155.295 16.242  1.00 18.40 ? 268 THR B OG1 1 
ATOM   4834  C CG2 . THR B  1 243 ? 32.944  153.343 15.817  1.00 19.82 ? 268 THR B CG2 1 
ATOM   4835  N N   . TYR B  1 244 ? 33.184  156.455 19.489  1.00 20.19 ? 269 TYR B N   1 
ATOM   4836  C CA  . TYR B  1 244 ? 33.883  157.051 20.622  1.00 20.30 ? 269 TYR B CA  1 
ATOM   4837  C C   . TYR B  1 244 ? 32.871  157.215 21.759  1.00 20.26 ? 269 TYR B C   1 
ATOM   4838  O O   . TYR B  1 244 ? 31.658  157.022 21.559  1.00 19.24 ? 269 TYR B O   1 
ATOM   4839  C CB  . TYR B  1 244 ? 34.460  158.421 20.232  1.00 20.25 ? 269 TYR B CB  1 
ATOM   4840  C CG  . TYR B  1 244 ? 33.366  159.419 19.895  1.00 20.06 ? 269 TYR B CG  1 
ATOM   4841  C CD1 . TYR B  1 244 ? 32.739  159.401 18.650  1.00 18.60 ? 269 TYR B CD1 1 
ATOM   4842  C CD2 . TYR B  1 244 ? 32.932  160.353 20.836  1.00 18.96 ? 269 TYR B CD2 1 
ATOM   4843  C CE1 . TYR B  1 244 ? 31.727  160.288 18.349  1.00 18.48 ? 269 TYR B CE1 1 
ATOM   4844  C CE2 . TYR B  1 244 ? 31.927  161.236 20.545  1.00 18.73 ? 269 TYR B CE2 1 
ATOM   4845  C CZ  . TYR B  1 244 ? 31.324  161.207 19.304  1.00 19.98 ? 269 TYR B CZ  1 
ATOM   4846  O OH  . TYR B  1 244 ? 30.301  162.090 19.022  1.00 17.49 ? 269 TYR B OH  1 
ATOM   4847  N N   . GLY B  1 245 ? 33.353  157.578 22.948  1.00 19.87 ? 270 GLY B N   1 
ATOM   4848  C CA  . GLY B  1 245 ? 32.437  157.914 24.043  1.00 19.26 ? 270 GLY B CA  1 
ATOM   4849  C C   . GLY B  1 245 ? 32.881  159.249 24.622  1.00 19.46 ? 270 GLY B C   1 
ATOM   4850  O O   . GLY B  1 245 ? 33.987  159.693 24.339  1.00 19.75 ? 270 GLY B O   1 
ATOM   4851  N N   . HIS B  1 246 ? 32.006  159.893 25.398  1.00 18.89 ? 271 HIS B N   1 
ATOM   4852  C CA  . HIS B  1 246 ? 32.369  161.084 26.155  1.00 19.04 ? 271 HIS B CA  1 
ATOM   4853  C C   . HIS B  1 246 ? 32.645  160.769 27.627  1.00 19.16 ? 271 HIS B C   1 
ATOM   4854  O O   . HIS B  1 246 ? 31.932  159.993 28.254  1.00 19.18 ? 271 HIS B O   1 
ATOM   4855  C CB  . HIS B  1 246 ? 31.298  162.177 26.028  1.00 18.64 ? 271 HIS B CB  1 
ATOM   4856  C CG  . HIS B  1 246 ? 31.389  162.940 24.747  1.00 19.98 ? 271 HIS B CG  1 
ATOM   4857  N ND1 . HIS B  1 246 ? 32.566  163.523 24.314  1.00 20.22 ? 271 HIS B ND1 1 
ATOM   4858  C CD2 . HIS B  1 246 ? 30.458  163.218 23.803  1.00 19.43 ? 271 HIS B CD2 1 
ATOM   4859  C CE1 . HIS B  1 246 ? 32.347  164.148 23.169  1.00 20.22 ? 271 HIS B CE1 1 
ATOM   4860  N NE2 . HIS B  1 246 ? 31.077  163.975 22.836  1.00 20.46 ? 271 HIS B NE2 1 
ATOM   4861  N N   . SER B  1 247 ? 33.682  161.389 28.172  1.00 20.24 ? 272 SER B N   1 
ATOM   4862  C CA  . SER B  1 247 ? 34.119  161.090 29.528  1.00 20.20 ? 272 SER B CA  1 
ATOM   4863  C C   . SER B  1 247 ? 33.980  162.313 30.435  1.00 20.88 ? 272 SER B C   1 
ATOM   4864  O O   . SER B  1 247 ? 34.027  163.443 29.973  1.00 22.00 ? 272 SER B O   1 
ATOM   4865  C CB  . SER B  1 247 ? 35.584  160.686 29.483  1.00 21.05 ? 272 SER B CB  1 
ATOM   4866  O OG  . SER B  1 247 ? 36.322  161.792 28.994  1.00 20.26 ? 272 SER B OG  1 
ATOM   4867  N N   . PHE B  1 248 ? 33.845  162.069 31.737  1.00 20.85 ? 273 PHE B N   1 
ATOM   4868  C CA  . PHE B  1 248 ? 33.707  163.108 32.732  1.00 21.19 ? 273 PHE B CA  1 
ATOM   4869  C C   . PHE B  1 248 ? 34.605  162.744 33.912  1.00 22.20 ? 273 PHE B C   1 
ATOM   4870  O O   . PHE B  1 248 ? 34.781  161.562 34.212  1.00 21.94 ? 273 PHE B O   1 
ATOM   4871  C CB  . PHE B  1 248 ? 32.268  163.174 33.255  1.00 21.31 ? 273 PHE B CB  1 
ATOM   4872  C CG  . PHE B  1 248 ? 31.243  163.571 32.213  1.00 20.74 ? 273 PHE B CG  1 
ATOM   4873  C CD1 . PHE B  1 248 ? 30.635  162.614 31.423  1.00 21.23 ? 273 PHE B CD1 1 
ATOM   4874  C CD2 . PHE B  1 248 ? 30.881  164.899 32.043  1.00 22.09 ? 273 PHE B CD2 1 
ATOM   4875  C CE1 . PHE B  1 248 ? 29.678  162.971 30.457  1.00 21.47 ? 273 PHE B CE1 1 
ATOM   4876  C CE2 . PHE B  1 248 ? 29.920  165.267 31.086  1.00 20.95 ? 273 PHE B CE2 1 
ATOM   4877  C CZ  . PHE B  1 248 ? 29.323  164.305 30.300  1.00 20.73 ? 273 PHE B CZ  1 
ATOM   4878  N N   . THR B  1 249 ? 35.163  163.754 34.580  1.00 22.90 ? 274 THR B N   1 
ATOM   4879  C CA  . THR B  1 249 ? 35.733  163.552 35.913  1.00 23.52 ? 274 THR B CA  1 
ATOM   4880  C C   . THR B  1 249 ? 34.645  163.867 36.951  1.00 23.77 ? 274 THR B C   1 
ATOM   4881  O O   . THR B  1 249 ? 34.069  164.958 36.937  1.00 24.04 ? 274 THR B O   1 
ATOM   4882  C CB  . THR B  1 249 ? 36.968  164.447 36.119  1.00 25.00 ? 274 THR B CB  1 
ATOM   4883  O OG1 . THR B  1 249 ? 37.956  164.126 35.128  1.00 25.06 ? 274 THR B OG1 1 
ATOM   4884  C CG2 . THR B  1 249 ? 37.558  164.295 37.538  1.00 26.49 ? 274 THR B CG2 1 
ATOM   4885  N N   . LEU B  1 250 ? 34.362  162.916 37.842  1.00 23.27 ? 275 LEU B N   1 
ATOM   4886  C CA  . LEU B  1 250 ? 33.310  163.074 38.841  1.00 23.43 ? 275 LEU B CA  1 
ATOM   4887  C C   . LEU B  1 250 ? 33.739  164.034 39.938  1.00 25.06 ? 275 LEU B C   1 
ATOM   4888  O O   . LEU B  1 250 ? 34.901  164.034 40.342  1.00 25.87 ? 275 LEU B O   1 
ATOM   4889  C CB  . LEU B  1 250 ? 32.933  161.709 39.445  1.00 22.66 ? 275 LEU B CB  1 
ATOM   4890  C CG  . LEU B  1 250 ? 32.371  160.723 38.415  1.00 20.61 ? 275 LEU B CG  1 
ATOM   4891  C CD1 . LEU B  1 250 ? 32.321  159.339 39.025  1.00 22.13 ? 275 LEU B CD1 1 
ATOM   4892  C CD2 . LEU B  1 250 ? 30.994  161.151 37.922  1.00 20.30 ? 275 LEU B CD2 1 
ATOM   4893  N N   . ALA B  1 251 ? 32.806  164.850 40.431  1.00 25.06 ? 276 ALA B N   1 
ATOM   4894  C CA  . ALA B  1 251 ? 33.136  165.805 41.484  1.00 26.56 ? 276 ALA B CA  1 
ATOM   4895  C C   . ALA B  1 251 ? 32.699  165.355 42.880  1.00 27.20 ? 276 ALA B C   1 
ATOM   4896  O O   . ALA B  1 251 ? 32.924  166.065 43.856  1.00 28.03 ? 276 ALA B O   1 
ATOM   4897  C CB  . ALA B  1 251 ? 32.560  167.203 41.159  1.00 27.10 ? 276 ALA B CB  1 
ATOM   4898  N N   . SER B  1 252 ? 32.085  164.177 42.976  1.00 25.84 ? 277 SER B N   1 
ATOM   4899  C CA  . SER B  1 252 ? 31.621  163.665 44.263  1.00 26.24 ? 277 SER B CA  1 
ATOM   4900  C C   . SER B  1 252 ? 31.571  162.135 44.211  1.00 25.95 ? 277 SER B C   1 
ATOM   4901  O O   . SER B  1 252 ? 31.965  161.538 43.209  1.00 25.29 ? 277 SER B O   1 
ATOM   4902  C CB  . SER B  1 252 ? 30.228  164.222 44.583  1.00 26.47 ? 277 SER B CB  1 
ATOM   4903  O OG  . SER B  1 252 ? 29.267  163.541 43.782  1.00 23.76 ? 277 SER B OG  1 
ATOM   4904  N N   . ALA B  1 253 ? 31.048  161.505 45.262  1.00 26.48 ? 278 ALA B N   1 
ATOM   4905  C CA  . ALA B  1 253 ? 30.899  160.049 45.296  1.00 26.92 ? 278 ALA B CA  1 
ATOM   4906  C C   . ALA B  1 253 ? 29.753  159.527 44.408  1.00 26.20 ? 278 ALA B C   1 
ATOM   4907  O O   . ALA B  1 253 ? 29.645  158.327 44.171  1.00 24.99 ? 278 ALA B O   1 
ATOM   4908  C CB  . ALA B  1 253 ? 30.721  159.552 46.742  1.00 28.52 ? 278 ALA B CB  1 
ATOM   4909  N N   . GLU B  1 254 ? 28.898  160.415 43.903  1.00 25.97 ? 279 GLU B N   1 
ATOM   4910  C CA  . GLU B  1 254 ? 27.814  159.949 43.035  1.00 25.37 ? 279 GLU B CA  1 
ATOM   4911  C C   . GLU B  1 254 ? 28.348  159.517 41.676  1.00 23.83 ? 279 GLU B C   1 
ATOM   4912  O O   . GLU B  1 254 ? 29.201  160.181 41.101  1.00 23.07 ? 279 GLU B O   1 
ATOM   4913  C CB  . GLU B  1 254 ? 26.730  161.020 42.855  1.00 26.08 ? 279 GLU B CB  1 
ATOM   4914  C CG  . GLU B  1 254 ? 25.985  161.401 44.143  1.00 30.24 ? 279 GLU B CG  1 
ATOM   4915  C CD  . GLU B  1 254 ? 24.737  162.239 43.861  1.00 35.10 ? 279 GLU B CD  1 
ATOM   4916  O OE1 . GLU B  1 254 ? 23.692  161.631 43.553  1.00 35.42 ? 279 GLU B OE1 1 
ATOM   4917  O OE2 . GLU B  1 254 ? 24.798  163.495 43.957  1.00 36.40 ? 279 GLU B OE2 1 
ATOM   4918  N N   . THR B  1 255 ? 27.824  158.419 41.151  1.00 22.85 ? 280 THR B N   1 
ATOM   4919  C CA  . THR B  1 255 ? 28.348  157.866 39.908  1.00 22.53 ? 280 THR B CA  1 
ATOM   4920  C C   . THR B  1 255 ? 27.245  157.579 38.881  1.00 21.82 ? 280 THR B C   1 
ATOM   4921  O O   . THR B  1 255 ? 27.497  156.952 37.871  1.00 21.53 ? 280 THR B O   1 
ATOM   4922  C CB  . THR B  1 255 ? 29.073  156.541 40.168  1.00 22.91 ? 280 THR B CB  1 
ATOM   4923  O OG1 . THR B  1 255 ? 28.158  155.632 40.788  1.00 22.89 ? 280 THR B OG1 1 
ATOM   4924  C CG2 . THR B  1 255 ? 30.309  156.739 41.085  1.00 23.98 ? 280 THR B CG2 1 
ATOM   4925  N N   . THR B  1 256 ? 26.025  158.018 39.153  1.00 21.96 ? 281 THR B N   1 
ATOM   4926  C CA  . THR B  1 256 ? 24.907  157.776 38.237  1.00 22.42 ? 281 THR B CA  1 
ATOM   4927  C C   . THR B  1 256 ? 24.892  158.762 37.039  1.00 21.67 ? 281 THR B C   1 
ATOM   4928  O O   . THR B  1 256 ? 25.670  159.704 36.980  1.00 21.15 ? 281 THR B O   1 
ATOM   4929  C CB  . THR B  1 256 ? 23.576  157.884 38.995  1.00 22.98 ? 281 THR B CB  1 
ATOM   4930  O OG1 . THR B  1 256 ? 23.628  159.036 39.823  1.00 25.05 ? 281 THR B OG1 1 
ATOM   4931  C CG2 . THR B  1 256 ? 23.347  156.675 39.919  1.00 24.62 ? 281 THR B CG2 1 
ATOM   4932  N N   . VAL B  1 257 ? 24.000  158.539 36.084  1.00 21.30 ? 282 VAL B N   1 
ATOM   4933  C CA  . VAL B  1 257 ? 23.722  159.547 35.062  1.00 20.71 ? 282 VAL B CA  1 
ATOM   4934  C C   . VAL B  1 257 ? 23.256  160.810 35.780  1.00 20.71 ? 282 VAL B C   1 
ATOM   4935  O O   . VAL B  1 257 ? 22.420  160.737 36.679  1.00 20.66 ? 282 VAL B O   1 
ATOM   4936  C CB  . VAL B  1 257 ? 22.570  159.085 34.120  1.00 20.41 ? 282 VAL B CB  1 
ATOM   4937  C CG1 . VAL B  1 257 ? 22.076  160.232 33.228  1.00 21.83 ? 282 VAL B CG1 1 
ATOM   4938  C CG2 . VAL B  1 257 ? 23.014  157.924 33.289  1.00 20.79 ? 282 VAL B CG2 1 
ATOM   4939  N N   . GLY B  1 258 ? 23.776  161.965 35.395  1.00 20.11 ? 283 GLY B N   1 
ATOM   4940  C CA  . GLY B  1 258 ? 23.306  163.230 35.996  1.00 20.72 ? 283 GLY B CA  1 
ATOM   4941  C C   . GLY B  1 258 ? 24.062  163.566 37.270  1.00 21.82 ? 283 GLY B C   1 
ATOM   4942  O O   . GLY B  1 258 ? 23.672  164.473 38.002  1.00 21.68 ? 283 GLY B O   1 
ATOM   4943  N N   . ALA B  1 259 ? 25.147  162.832 37.532  1.00 21.16 ? 284 ALA B N   1 
ATOM   4944  C CA  . ALA B  1 259 ? 25.981  163.093 38.711  1.00 22.00 ? 284 ALA B CA  1 
ATOM   4945  C C   . ALA B  1 259 ? 26.863  164.307 38.461  1.00 22.41 ? 284 ALA B C   1 
ATOM   4946  O O   . ALA B  1 259 ? 27.274  164.540 37.325  1.00 21.58 ? 284 ALA B O   1 
ATOM   4947  C CB  . ALA B  1 259 ? 26.855  161.873 39.049  1.00 21.76 ? 284 ALA B CB  1 
ATOM   4948  N N   . PRO B  1 260 ? 27.171  165.063 39.526  1.00 23.44 ? 285 PRO B N   1 
ATOM   4949  C CA  . PRO B  1 260 ? 28.022  166.231 39.382  1.00 24.55 ? 285 PRO B CA  1 
ATOM   4950  C C   . PRO B  1 260 ? 29.385  165.842 38.826  1.00 24.51 ? 285 PRO B C   1 
ATOM   4951  O O   . PRO B  1 260 ? 29.972  164.815 39.240  1.00 24.19 ? 285 PRO B O   1 
ATOM   4952  C CB  . PRO B  1 260 ? 28.149  166.748 40.817  1.00 25.99 ? 285 PRO B CB  1 
ATOM   4953  C CG  . PRO B  1 260 ? 26.816  166.362 41.449  1.00 26.66 ? 285 PRO B CG  1 
ATOM   4954  C CD  . PRO B  1 260 ? 26.543  164.983 40.862  1.00 24.50 ? 285 PRO B CD  1 
ATOM   4955  N N   . ALA B  1 261 ? 29.866  166.638 37.880  1.00 24.09 ? 286 ALA B N   1 
ATOM   4956  C CA  . ALA B  1 261 ? 31.175  166.415 37.288  1.00 24.06 ? 286 ALA B CA  1 
ATOM   4957  C C   . ALA B  1 261 ? 31.995  167.688 37.388  1.00 25.72 ? 286 ALA B C   1 
ATOM   4958  O O   . ALA B  1 261 ? 31.452  168.775 37.290  1.00 25.95 ? 286 ALA B O   1 
ATOM   4959  C CB  . ALA B  1 261 ? 31.022  165.995 35.843  1.00 23.53 ? 286 ALA B CB  1 
ATOM   4960  N N   . SER B  1 262 ? 33.300  167.561 37.603  1.00 26.58 ? 287 SER B N   1 
ATOM   4961  C CA  . SER B  1 262 ? 34.152  168.729 37.683  1.00 28.99 ? 287 SER B CA  1 
ATOM   4962  C C   . SER B  1 262 ? 34.663  169.170 36.303  1.00 28.87 ? 287 SER B C   1 
ATOM   4963  O O   . SER B  1 262 ? 35.162  170.280 36.148  1.00 29.82 ? 287 SER B O   1 
ATOM   4964  C CB  . SER B  1 262 ? 35.310  168.482 38.672  1.00 30.47 ? 287 SER B CB  1 
ATOM   4965  O OG  . SER B  1 262 ? 36.097  167.400 38.213  1.00 31.74 ? 287 SER B OG  1 
ATOM   4966  N N   . GLY B  1 263 ? 34.535  168.302 35.303  1.00 27.77 ? 288 GLY B N   1 
ATOM   4967  C CA  . GLY B  1 263 ? 34.960  168.618 33.928  1.00 27.36 ? 288 GLY B CA  1 
ATOM   4968  C C   . GLY B  1 263 ? 35.077  167.343 33.085  1.00 25.88 ? 288 GLY B C   1 
ATOM   4969  O O   . GLY B  1 263 ? 34.591  166.292 33.494  1.00 25.36 ? 288 GLY B O   1 
ATOM   4970  N N   . PRO B  1 264 ? 35.722  167.433 31.904  1.00 25.30 ? 289 PRO B N   1 
ATOM   4971  C CA  . PRO B  1 264 ? 35.929  166.272 31.043  1.00 24.36 ? 289 PRO B CA  1 
ATOM   4972  C C   . PRO B  1 264 ? 36.728  165.199 31.770  1.00 24.59 ? 289 PRO B C   1 
ATOM   4973  O O   . PRO B  1 264 ? 37.377  165.494 32.777  1.00 24.41 ? 289 PRO B O   1 
ATOM   4974  C CB  . PRO B  1 264 ? 36.751  166.845 29.873  1.00 25.11 ? 289 PRO B CB  1 
ATOM   4975  C CG  . PRO B  1 264 ? 37.421  168.110 30.451  1.00 26.63 ? 289 PRO B CG  1 
ATOM   4976  C CD  . PRO B  1 264 ? 36.363  168.653 31.365  1.00 26.56 ? 289 PRO B CD  1 
ATOM   4977  N N   . GLY B  1 265 ? 36.659  163.962 31.283  1.00 23.69 ? 290 GLY B N   1 
ATOM   4978  C CA  . GLY B  1 265 ? 37.493  162.895 31.821  1.00 23.67 ? 290 GLY B CA  1 
ATOM   4979  C C   . GLY B  1 265 ? 38.939  163.034 31.359  1.00 25.03 ? 290 GLY B C   1 
ATOM   4980  O O   . GLY B  1 265 ? 39.238  163.763 30.411  1.00 25.13 ? 290 GLY B O   1 
ATOM   4981  N N   . ALA B  1 266 ? 39.838  162.328 32.025  1.00 25.60 ? 291 ALA B N   1 
ATOM   4982  C CA  . ALA B  1 266 ? 41.256  162.307 31.635  1.00 27.25 ? 291 ALA B CA  1 
ATOM   4983  C C   . ALA B  1 266 ? 41.405  161.946 30.157  1.00 26.70 ? 291 ALA B C   1 
ATOM   4984  O O   . ALA B  1 266 ? 40.718  161.069 29.637  1.00 24.52 ? 291 ALA B O   1 
ATOM   4985  C CB  . ALA B  1 266 ? 42.052  161.316 32.529  1.00 28.10 ? 291 ALA B CB  1 
ATOM   4986  N N   . ALA B  1 267 ? 42.304  162.638 29.469  1.00 27.56 ? 292 ALA B N   1 
ATOM   4987  C CA  . ALA B  1 267 ? 42.587  162.323 28.060  1.00 27.13 ? 292 ALA B CA  1 
ATOM   4988  C C   . ALA B  1 267 ? 43.000  160.850 27.880  1.00 27.22 ? 292 ALA B C   1 
ATOM   4989  O O   . ALA B  1 267 ? 43.584  160.259 28.778  1.00 26.88 ? 292 ALA B O   1 
ATOM   4990  C CB  . ALA B  1 267 ? 43.711  163.254 27.533  1.00 28.32 ? 292 ALA B CB  1 
ATOM   4991  N N   . GLY B  1 268 ? 42.680  160.264 26.723  1.00 27.01 ? 293 GLY B N   1 
ATOM   4992  C CA  . GLY B  1 268 ? 43.204  158.936 26.355  1.00 27.59 ? 293 GLY B CA  1 
ATOM   4993  C C   . GLY B  1 268 ? 44.661  159.023 25.909  1.00 29.60 ? 293 GLY B C   1 
ATOM   4994  O O   . GLY B  1 268 ? 45.081  160.052 25.378  1.00 30.20 ? 293 GLY B O   1 
ATOM   4995  N N   . PRO B  1 269 ? 45.434  157.939 26.113  1.00 30.77 ? 294 PRO B N   1 
ATOM   4996  C CA  . PRO B  1 269 ? 46.871  157.938 25.837  1.00 32.89 ? 294 PRO B CA  1 
ATOM   4997  C C   . PRO B  1 269 ? 47.127  158.165 24.361  1.00 33.05 ? 294 PRO B C   1 
ATOM   4998  O O   . PRO B  1 269 ? 48.194  158.628 23.993  1.00 34.34 ? 294 PRO B O   1 
ATOM   4999  C CB  . PRO B  1 269 ? 47.309  156.513 26.229  1.00 33.40 ? 294 PRO B CB  1 
ATOM   5000  C CG  . PRO B  1 269 ? 46.032  155.691 26.104  1.00 32.37 ? 294 PRO B CG  1 
ATOM   5001  C CD  . PRO B  1 269 ? 44.958  156.622 26.580  1.00 30.32 ? 294 PRO B CD  1 
ATOM   5002  N N   . ILE B  1 270 ? 46.155  157.828 23.519  1.00 31.44 ? 295 ILE B N   1 
ATOM   5003  C CA  . ILE B  1 270 ? 46.350  157.884 22.068  1.00 31.46 ? 295 ILE B CA  1 
ATOM   5004  C C   . ILE B  1 270 ? 45.629  159.074 21.417  1.00 30.78 ? 295 ILE B C   1 
ATOM   5005  O O   . ILE B  1 270 ? 46.190  159.766 20.564  1.00 31.27 ? 295 ILE B O   1 
ATOM   5006  C CB  . ILE B  1 270 ? 45.879  156.572 21.386  1.00 30.88 ? 295 ILE B CB  1 
ATOM   5007  C CG1 . ILE B  1 270 ? 46.505  155.342 22.046  1.00 31.85 ? 295 ILE B CG1 1 
ATOM   5008  C CG2 . ILE B  1 270 ? 46.107  156.615 19.879  1.00 31.48 ? 295 ILE B CG2 1 
ATOM   5009  C CD1 . ILE B  1 270 ? 48.015  155.413 22.242  1.00 35.98 ? 295 ILE B CD1 1 
ATOM   5010  N N   . THR B  1 271 ? 44.381  159.314 21.804  1.00 29.14 ? 296 THR B N   1 
ATOM   5011  C CA  . THR B  1 271 ? 43.635  160.411 21.200  1.00 28.56 ? 296 THR B CA  1 
ATOM   5012  C C   . THR B  1 271 ? 43.957  161.755 21.874  1.00 28.97 ? 296 THR B C   1 
ATOM   5013  O O   . THR B  1 271 ? 43.693  162.792 21.294  1.00 29.19 ? 296 THR B O   1 
ATOM   5014  C CB  . THR B  1 271 ? 42.103  160.143 21.179  1.00 26.61 ? 296 THR B CB  1 
ATOM   5015  O OG1 . THR B  1 271 ? 41.657  159.828 22.500  1.00 27.41 ? 296 THR B OG1 1 
ATOM   5016  C CG2 . THR B  1 271 ? 41.775  158.969 20.267  1.00 26.22 ? 296 THR B CG2 1 
ATOM   5017  N N   . GLU B  1 272 ? 44.525  161.714 23.086  1.00 30.21 ? 297 GLU B N   1 
ATOM   5018  C CA  . GLU B  1 272 ? 45.000  162.907 23.820  1.00 31.13 ? 297 GLU B CA  1 
ATOM   5019  C C   . GLU B  1 272 ? 44.032  164.103 23.774  1.00 30.58 ? 297 GLU B C   1 
ATOM   5020  O O   . GLU B  1 272 ? 44.430  165.233 23.477  1.00 30.58 ? 297 GLU B O   1 
ATOM   5021  C CB  . GLU B  1 272 ? 46.376  163.361 23.296  1.00 33.22 ? 297 GLU B CB  1 
ATOM   5022  C CG  . GLU B  1 272 ? 47.284  162.235 22.801  1.00 34.76 ? 297 GLU B CG  1 
ATOM   5023  C CD  . GLU B  1 272 ? 48.661  162.738 22.387  1.00 39.72 ? 297 GLU B CD  1 
ATOM   5024  O OE1 . GLU B  1 272 ? 49.475  163.054 23.289  1.00 41.92 ? 297 GLU B OE1 1 
ATOM   5025  O OE2 . GLU B  1 272 ? 48.928  162.842 21.163  1.00 40.69 ? 297 GLU B OE2 1 
ATOM   5026  N N   . SER B  1 273 ? 42.761  163.859 24.064  1.00 29.29 ? 298 SER B N   1 
ATOM   5027  C CA  . SER B  1 273 ? 41.759  164.914 23.973  1.00 29.06 ? 298 SER B CA  1 
ATOM   5028  C C   . SER B  1 273 ? 40.787  164.743 25.131  1.00 28.45 ? 298 SER B C   1 
ATOM   5029  O O   . SER B  1 273 ? 39.853  163.960 25.054  1.00 27.10 ? 298 SER B O   1 
ATOM   5030  C CB  . SER B  1 273 ? 41.040  164.842 22.616  1.00 28.55 ? 298 SER B CB  1 
ATOM   5031  O OG  . SER B  1 273 ? 40.132  165.924 22.425  1.00 29.42 ? 298 SER B OG  1 
ATOM   5032  N N   . SER B  1 274 ? 41.041  165.449 26.224  1.00 28.56 ? 299 SER B N   1 
ATOM   5033  C CA  . SER B  1 274 ? 40.199  165.348 27.403  1.00 28.41 ? 299 SER B CA  1 
ATOM   5034  C C   . SER B  1 274 ? 38.704  165.502 27.036  1.00 26.40 ? 299 SER B C   1 
ATOM   5035  O O   . SER B  1 274 ? 38.304  166.497 26.437  1.00 26.20 ? 299 SER B O   1 
ATOM   5036  C CB  . SER B  1 274 ? 40.637  166.403 28.426  1.00 29.84 ? 299 SER B CB  1 
ATOM   5037  O OG  . SER B  1 274 ? 39.778  166.432 29.548  1.00 31.97 ? 299 SER B OG  1 
ATOM   5038  N N   . GLY B  1 275 ? 37.882  164.526 27.396  1.00 24.27 ? 300 GLY B N   1 
ATOM   5039  C CA  . GLY B  1 275 ? 36.453  164.593 27.089  1.00 22.91 ? 300 GLY B CA  1 
ATOM   5040  C C   . GLY B  1 275 ? 35.936  163.479 26.191  1.00 22.28 ? 300 GLY B C   1 
ATOM   5041  O O   . GLY B  1 275 ? 34.726  163.146 26.224  1.00 21.09 ? 300 GLY B O   1 
ATOM   5042  N N   . PHE B  1 276 ? 36.827  162.889 25.382  1.00 22.00 ? 301 PHE B N   1 
ATOM   5043  C CA  . PHE B  1 276 ? 36.431  161.705 24.631  1.00 21.35 ? 301 PHE B CA  1 
ATOM   5044  C C   . PHE B  1 276 ? 37.480  160.600 24.629  1.00 21.58 ? 301 PHE B C   1 
ATOM   5045  O O   . PHE B  1 276 ? 38.656  160.823 24.968  1.00 23.25 ? 301 PHE B O   1 
ATOM   5046  C CB  . PHE B  1 276 ? 35.877  162.032 23.216  1.00 21.07 ? 301 PHE B CB  1 
ATOM   5047  C CG  . PHE B  1 276 ? 36.932  162.170 22.131  1.00 22.16 ? 301 PHE B CG  1 
ATOM   5048  C CD1 . PHE B  1 276 ? 37.438  161.047 21.479  1.00 24.88 ? 301 PHE B CD1 1 
ATOM   5049  C CD2 . PHE B  1 276 ? 37.381  163.426 21.738  1.00 23.74 ? 301 PHE B CD2 1 
ATOM   5050  C CE1 . PHE B  1 276 ? 38.414  161.176 20.474  1.00 23.11 ? 301 PHE B CE1 1 
ATOM   5051  C CE2 . PHE B  1 276 ? 38.321  163.562 20.729  1.00 25.18 ? 301 PHE B CE2 1 
ATOM   5052  C CZ  . PHE B  1 276 ? 38.839  162.432 20.099  1.00 25.25 ? 301 PHE B CZ  1 
ATOM   5053  N N   . LEU B  1 277 ? 37.021  159.394 24.318  1.00 21.28 ? 302 LEU B N   1 
ATOM   5054  C CA  . LEU B  1 277 ? 37.892  158.247 24.139  1.00 21.78 ? 302 LEU B CA  1 
ATOM   5055  C C   . LEU B  1 277 ? 37.453  157.487 22.894  1.00 21.09 ? 302 LEU B C   1 
ATOM   5056  O O   . LEU B  1 277 ? 36.275  157.338 22.660  1.00 20.22 ? 302 LEU B O   1 
ATOM   5057  C CB  . LEU B  1 277 ? 37.806  157.316 25.346  1.00 21.60 ? 302 LEU B CB  1 
ATOM   5058  C CG  . LEU B  1 277 ? 38.315  157.869 26.670  1.00 21.85 ? 302 LEU B CG  1 
ATOM   5059  C CD1 . LEU B  1 277 ? 38.157  156.771 27.710  1.00 24.09 ? 302 LEU B CD1 1 
ATOM   5060  C CD2 . LEU B  1 277 ? 39.778  158.296 26.538  1.00 23.18 ? 302 LEU B CD2 1 
ATOM   5061  N N   . ALA B  1 278 ? 38.407  157.029 22.090  1.00 21.61 ? 303 ALA B N   1 
ATOM   5062  C CA  . ALA B  1 278 ? 38.094  156.111 20.994  1.00 21.56 ? 303 ALA B CA  1 
ATOM   5063  C C   . ALA B  1 278 ? 37.775  154.739 21.585  1.00 21.59 ? 303 ALA B C   1 
ATOM   5064  O O   . ALA B  1 278 ? 38.240  154.415 22.684  1.00 21.15 ? 303 ALA B O   1 
ATOM   5065  C CB  . ALA B  1 278 ? 39.282  156.005 20.064  1.00 22.03 ? 303 ALA B CB  1 
ATOM   5066  N N   . TYR B  1 279 ? 37.026  153.915 20.854  1.00 21.11 ? 304 TYR B N   1 
ATOM   5067  C CA  . TYR B  1 279 ? 36.749  152.566 21.332  1.00 21.69 ? 304 TYR B CA  1 
ATOM   5068  C C   . TYR B  1 279 ? 37.999  151.778 21.700  1.00 22.75 ? 304 TYR B C   1 
ATOM   5069  O O   . TYR B  1 279 ? 37.994  151.071 22.683  1.00 23.91 ? 304 TYR B O   1 
ATOM   5070  C CB  . TYR B  1 279 ? 35.954  151.761 20.316  1.00 21.62 ? 304 TYR B CB  1 
ATOM   5071  C CG  . TYR B  1 279 ? 35.416  150.499 20.906  1.00 22.80 ? 304 TYR B CG  1 
ATOM   5072  C CD1 . TYR B  1 279 ? 34.590  150.544 22.021  1.00 25.61 ? 304 TYR B CD1 1 
ATOM   5073  C CD2 . TYR B  1 279 ? 35.699  149.266 20.340  1.00 25.12 ? 304 TYR B CD2 1 
ATOM   5074  C CE1 . TYR B  1 279 ? 34.081  149.378 22.579  1.00 25.43 ? 304 TYR B CE1 1 
ATOM   5075  C CE2 . TYR B  1 279 ? 35.194  148.094 20.887  1.00 26.92 ? 304 TYR B CE2 1 
ATOM   5076  C CZ  . TYR B  1 279 ? 34.382  148.165 22.003  1.00 26.62 ? 304 TYR B CZ  1 
ATOM   5077  O OH  . TYR B  1 279 ? 33.889  147.016 22.560  1.00 27.50 ? 304 TYR B OH  1 
ATOM   5078  N N   . TYR B  1 280 ? 39.051  151.855 20.903  1.00 23.65 ? 305 TYR B N   1 
ATOM   5079  C CA  . TYR B  1 280 ? 40.265  151.102 21.249  1.00 25.81 ? 305 TYR B CA  1 
ATOM   5080  C C   . TYR B  1 280 ? 40.864  151.513 22.600  1.00 25.78 ? 305 TYR B C   1 
ATOM   5081  O O   . TYR B  1 280 ? 41.540  150.716 23.239  1.00 27.48 ? 305 TYR B O   1 
ATOM   5082  C CB  . TYR B  1 280 ? 41.324  151.101 20.127  1.00 26.08 ? 305 TYR B CB  1 
ATOM   5083  C CG  . TYR B  1 280 ? 41.744  152.454 19.614  1.00 26.93 ? 305 TYR B CG  1 
ATOM   5084  C CD1 . TYR B  1 280 ? 42.595  153.274 20.355  1.00 26.65 ? 305 TYR B CD1 1 
ATOM   5085  C CD2 . TYR B  1 280 ? 41.318  152.896 18.365  1.00 26.21 ? 305 TYR B CD2 1 
ATOM   5086  C CE1 . TYR B  1 280 ? 42.992  154.510 19.858  1.00 27.98 ? 305 TYR B CE1 1 
ATOM   5087  C CE2 . TYR B  1 280 ? 41.693  154.101 17.864  1.00 27.23 ? 305 TYR B CE2 1 
ATOM   5088  C CZ  . TYR B  1 280 ? 42.529  154.922 18.612  1.00 28.88 ? 305 TYR B CZ  1 
ATOM   5089  O OH  . TYR B  1 280 ? 42.875  156.138 18.085  1.00 28.36 ? 305 TYR B OH  1 
ATOM   5090  N N   . GLU B  1 281 ? 40.621  152.754 23.015  1.00 24.87 ? 306 GLU B N   1 
ATOM   5091  C CA  . GLU B  1 281 ? 40.959  153.216 24.373  1.00 24.99 ? 306 GLU B CA  1 
ATOM   5092  C C   . GLU B  1 281 ? 39.925  152.769 25.406  1.00 24.37 ? 306 GLU B C   1 
ATOM   5093  O O   . GLU B  1 281 ? 40.261  152.381 26.524  1.00 24.50 ? 306 GLU B O   1 
ATOM   5094  C CB  . GLU B  1 281 ? 41.054  154.752 24.391  1.00 24.55 ? 306 GLU B CB  1 
ATOM   5095  C CG  . GLU B  1 281 ? 42.314  155.230 23.700  1.00 27.14 ? 306 GLU B CG  1 
ATOM   5096  C CD  . GLU B  1 281 ? 42.297  156.706 23.391  1.00 26.53 ? 306 GLU B CD  1 
ATOM   5097  O OE1 . GLU B  1 281 ? 41.240  157.216 22.946  1.00 24.57 ? 306 GLU B OE1 1 
ATOM   5098  O OE2 . GLU B  1 281 ? 43.362  157.341 23.577  1.00 26.05 ? 306 GLU B OE2 1 
ATOM   5099  N N   . ILE B  1 282 ? 38.657  152.842 25.035  1.00 22.82 ? 307 ILE B N   1 
ATOM   5100  C CA  . ILE B  1 282 ? 37.618  152.396 25.939  1.00 23.22 ? 307 ILE B CA  1 
ATOM   5101  C C   . ILE B  1 282 ? 37.802  150.941 26.400  1.00 24.15 ? 307 ILE B C   1 
ATOM   5102  O O   . ILE B  1 282 ? 37.581  150.629 27.572  1.00 23.80 ? 307 ILE B O   1 
ATOM   5103  C CB  . ILE B  1 282 ? 36.229  152.617 25.319  1.00 21.99 ? 307 ILE B CB  1 
ATOM   5104  C CG1 . ILE B  1 282 ? 35.935  154.119 25.264  1.00 21.90 ? 307 ILE B CG1 1 
ATOM   5105  C CG2 . ILE B  1 282 ? 35.167  151.855 26.095  1.00 22.41 ? 307 ILE B CG2 1 
ATOM   5106  C CD1 . ILE B  1 282 ? 34.823  154.476 24.288  1.00 22.72 ? 307 ILE B CD1 1 
ATOM   5107  N N   . CYS B  1 283 ? 38.213  150.050 25.496  1.00 25.39 ? 308 CYS B N   1 
ATOM   5108  C CA  . CYS B  1 283 ? 38.416  148.649 25.873  1.00 27.41 ? 308 CYS B CA  1 
ATOM   5109  C C   . CYS B  1 283 ? 39.441  148.516 27.000  1.00 27.98 ? 308 CYS B C   1 
ATOM   5110  O O   . CYS B  1 283 ? 39.266  147.693 27.903  1.00 28.39 ? 308 CYS B O   1 
ATOM   5111  C CB  . CYS B  1 283 ? 38.893  147.830 24.677  1.00 28.93 ? 308 CYS B CB  1 
ATOM   5112  S SG  . CYS B  1 283 ? 37.627  147.617 23.425  1.00 36.12 ? 308 CYS B SG  1 
ATOM   5113  N N   . GLN B  1 284 ? 40.514  149.301 26.924  1.00 27.77 ? 309 GLN B N   1 
ATOM   5114  C CA  . GLN B  1 284 ? 41.516  149.331 27.983  1.00 28.69 ? 309 GLN B CA  1 
ATOM   5115  C C   . GLN B  1 284 ? 40.937  149.925 29.270  1.00 27.96 ? 309 GLN B C   1 
ATOM   5116  O O   . GLN B  1 284 ? 41.166  149.382 30.355  1.00 28.48 ? 309 GLN B O   1 
ATOM   5117  C CB  . GLN B  1 284 ? 42.800  150.072 27.549  1.00 29.56 ? 309 GLN B CB  1 
ATOM   5118  C CG  . GLN B  1 284 ? 43.490  149.505 26.306  1.00 30.83 ? 309 GLN B CG  1 
ATOM   5119  C CD  . GLN B  1 284 ? 43.706  147.999 26.388  1.00 34.17 ? 309 GLN B CD  1 
ATOM   5120  O OE1 . GLN B  1 284 ? 44.103  147.475 27.429  1.00 34.12 ? 309 GLN B OE1 1 
ATOM   5121  N NE2 . GLN B  1 284 ? 43.436  147.296 25.288  1.00 33.59 ? 309 GLN B NE2 1 
ATOM   5122  N N   . PHE B  1 285 ? 40.174  151.013 29.152  1.00 26.07 ? 310 PHE B N   1 
ATOM   5123  C CA  . PHE B  1 285 ? 39.575  151.665 30.324  1.00 25.38 ? 310 PHE B CA  1 
ATOM   5124  C C   . PHE B  1 285 ? 38.639  150.706 31.085  1.00 25.09 ? 310 PHE B C   1 
ATOM   5125  O O   . PHE B  1 285 ? 38.642  150.648 32.312  1.00 25.55 ? 310 PHE B O   1 
ATOM   5126  C CB  . PHE B  1 285 ? 38.827  152.930 29.888  1.00 24.34 ? 310 PHE B CB  1 
ATOM   5127  C CG  . PHE B  1 285 ? 38.025  153.573 30.987  1.00 23.02 ? 310 PHE B CG  1 
ATOM   5128  C CD1 . PHE B  1 285 ? 38.632  154.449 31.872  1.00 25.01 ? 310 PHE B CD1 1 
ATOM   5129  C CD2 . PHE B  1 285 ? 36.680  153.273 31.160  1.00 22.79 ? 310 PHE B CD2 1 
ATOM   5130  C CE1 . PHE B  1 285 ? 37.900  155.054 32.909  1.00 24.67 ? 310 PHE B CE1 1 
ATOM   5131  C CE2 . PHE B  1 285 ? 35.935  153.882 32.190  1.00 21.94 ? 310 PHE B CE2 1 
ATOM   5132  C CZ  . PHE B  1 285 ? 36.564  154.764 33.069  1.00 23.52 ? 310 PHE B CZ  1 
ATOM   5133  N N   . LEU B  1 286 ? 37.867  149.921 30.350  1.00 24.65 ? 311 LEU B N   1 
ATOM   5134  C CA  . LEU B  1 286 ? 36.924  148.984 30.966  1.00 24.71 ? 311 LEU B CA  1 
ATOM   5135  C C   . LEU B  1 286 ? 37.562  147.934 31.892  1.00 26.11 ? 311 LEU B C   1 
ATOM   5136  O O   . LEU B  1 286 ? 36.890  147.387 32.767  1.00 25.86 ? 311 LEU B O   1 
ATOM   5137  C CB  . LEU B  1 286 ? 36.085  148.274 29.903  1.00 24.30 ? 311 LEU B CB  1 
ATOM   5138  C CG  . LEU B  1 286 ? 35.139  149.136 29.078  1.00 22.88 ? 311 LEU B CG  1 
ATOM   5139  C CD1 . LEU B  1 286 ? 34.409  148.302 28.028  1.00 22.77 ? 311 LEU B CD1 1 
ATOM   5140  C CD2 . LEU B  1 286 ? 34.169  149.870 30.002  1.00 23.29 ? 311 LEU B CD2 1 
ATOM   5141  N N   . LYS B  1 287 ? 38.850  147.650 31.717  1.00 27.27 ? 312 LYS B N   1 
ATOM   5142  C CA  . LYS B  1 287 ? 39.528  146.747 32.634  1.00 29.07 ? 312 LYS B CA  1 
ATOM   5143  C C   . LYS B  1 287 ? 39.650  147.360 34.032  1.00 29.41 ? 312 LYS B C   1 
ATOM   5144  O O   . LYS B  1 287 ? 40.357  148.355 34.233  1.00 29.35 ? 312 LYS B O   1 
ATOM   5145  C CB  . LYS B  1 287 ? 40.909  146.362 32.082  1.00 30.61 ? 312 LYS B CB  1 
ATOM   5146  C CG  . LYS B  1 287 ? 40.816  145.693 30.723  1.00 31.39 ? 312 LYS B CG  1 
ATOM   5147  C CD  . LYS B  1 287 ? 42.179  145.470 30.094  1.00 34.71 ? 312 LYS B CD  1 
ATOM   5148  C CE  . LYS B  1 287 ? 42.033  144.908 28.685  1.00 36.39 ? 312 LYS B CE  1 
ATOM   5149  N NZ  . LYS B  1 287 ? 43.369  144.621 28.088  1.00 38.60 ? 312 LYS B NZ  1 
ATOM   5150  N N   . GLY B  1 288 ? 38.968  146.742 34.996  1.00 29.62 ? 313 GLY B N   1 
ATOM   5151  C CA  . GLY B  1 288 ? 38.923  147.248 36.364  1.00 29.73 ? 313 GLY B CA  1 
ATOM   5152  C C   . GLY B  1 288 ? 37.781  148.232 36.532  1.00 28.71 ? 313 GLY B C   1 
ATOM   5153  O O   . GLY B  1 288 ? 37.564  148.755 37.622  1.00 28.58 ? 313 GLY B O   1 
ATOM   5154  N N   . ALA B  1 289 ? 37.025  148.481 35.459  1.00 27.65 ? 314 ALA B N   1 
ATOM   5155  C CA  . ALA B  1 289 ? 35.899  149.403 35.562  1.00 26.77 ? 314 ALA B CA  1 
ATOM   5156  C C   . ALA B  1 289 ? 34.618  148.660 35.936  1.00 26.64 ? 314 ALA B C   1 
ATOM   5157  O O   . ALA B  1 289 ? 34.541  147.440 35.794  1.00 26.80 ? 314 ALA B O   1 
ATOM   5158  C CB  . ALA B  1 289 ? 35.701  150.164 34.243  1.00 26.06 ? 314 ALA B CB  1 
ATOM   5159  N N   . LYS B  1 290 ? 33.618  149.400 36.407  1.00 25.92 ? 315 LYS B N   1 
ATOM   5160  C CA  . LYS B  1 290 ? 32.280  148.850 36.614  1.00 26.18 ? 315 LYS B CA  1 
ATOM   5161  C C   . LYS B  1 290 ? 31.348  149.350 35.520  1.00 24.74 ? 315 LYS B C   1 
ATOM   5162  O O   . LYS B  1 290 ? 31.202  150.556 35.335  1.00 23.61 ? 315 LYS B O   1 
ATOM   5163  C CB  . LYS B  1 290 ? 31.727  149.275 37.978  1.00 26.99 ? 315 LYS B CB  1 
ATOM   5164  C CG  . LYS B  1 290 ? 30.269  148.877 38.154  1.00 30.67 ? 315 LYS B CG  1 
ATOM   5165  C CD  . LYS B  1 290 ? 29.724  149.194 39.558  1.00 36.44 ? 315 LYS B CD  1 
ATOM   5166  C CE  . LYS B  1 290 ? 28.176  149.209 39.536  1.00 38.81 ? 315 LYS B CE  1 
ATOM   5167  N NZ  . LYS B  1 290 ? 27.580  149.583 40.865  1.00 40.89 ? 315 LYS B NZ  1 
ATOM   5168  N N   . ILE B  1 291 ? 30.726  148.422 34.801  1.00 24.27 ? 316 ILE B N   1 
ATOM   5169  C CA  . ILE B  1 291 ? 29.895  148.746 33.656  1.00 23.67 ? 316 ILE B CA  1 
ATOM   5170  C C   . ILE B  1 291 ? 28.439  148.662 34.082  1.00 23.80 ? 316 ILE B C   1 
ATOM   5171  O O   . ILE B  1 291 ? 28.039  147.717 34.757  1.00 23.27 ? 316 ILE B O   1 
ATOM   5172  C CB  . ILE B  1 291 ? 30.143  147.740 32.512  1.00 24.49 ? 316 ILE B CB  1 
ATOM   5173  C CG1 . ILE B  1 291 ? 31.592  147.845 32.009  1.00 24.59 ? 316 ILE B CG1 1 
ATOM   5174  C CG2 . ILE B  1 291 ? 29.127  147.924 31.386  1.00 23.52 ? 316 ILE B CG2 1 
ATOM   5175  C CD1 . ILE B  1 291 ? 32.029  146.626 31.198  1.00 25.20 ? 316 ILE B CD1 1 
ATOM   5176  N N   . THR B  1 292 ? 27.656  149.671 33.707  1.00 23.14 ? 317 THR B N   1 
ATOM   5177  C CA  . THR B  1 292 ? 26.234  149.690 33.984  1.00 23.35 ? 317 THR B CA  1 
ATOM   5178  C C   . THR B  1 292 ? 25.522  149.898 32.663  1.00 23.23 ? 317 THR B C   1 
ATOM   5179  O O   . THR B  1 292 ? 25.865  150.814 31.912  1.00 22.01 ? 317 THR B O   1 
ATOM   5180  C CB  . THR B  1 292 ? 25.858  150.847 34.961  1.00 23.75 ? 317 THR B CB  1 
ATOM   5181  O OG1 . THR B  1 292 ? 26.472  150.624 36.228  1.00 23.86 ? 317 THR B OG1 1 
ATOM   5182  C CG2 . THR B  1 292 ? 24.352  150.919 35.175  1.00 23.73 ? 317 THR B CG2 1 
ATOM   5183  N N   . ARG B  1 293 ? 24.548  149.040 32.365  1.00 23.74 ? 318 ARG B N   1 
ATOM   5184  C CA  . ARG B  1 293 ? 23.730  149.221 31.156  1.00 24.07 ? 318 ARG B CA  1 
ATOM   5185  C C   . ARG B  1 293 ? 22.470  149.943 31.545  1.00 23.47 ? 318 ARG B C   1 
ATOM   5186  O O   . ARG B  1 293 ? 21.717  149.450 32.373  1.00 23.79 ? 318 ARG B O   1 
ATOM   5187  C CB  . ARG B  1 293 ? 23.302  147.885 30.556  1.00 25.40 ? 318 ARG B CB  1 
ATOM   5188  C CG  . ARG B  1 293 ? 24.406  147.074 29.969  1.00 27.90 ? 318 ARG B CG  1 
ATOM   5189  C CD  . ARG B  1 293 ? 23.978  146.461 28.615  1.00 31.15 ? 318 ARG B CD  1 
ATOM   5190  N NE  . ARG B  1 293 ? 25.223  146.172 27.948  1.00 33.09 ? 318 ARG B NE  1 
ATOM   5191  C CZ  . ARG B  1 293 ? 25.681  146.770 26.866  1.00 30.78 ? 318 ARG B CZ  1 
ATOM   5192  N NH1 . ARG B  1 293 ? 24.969  147.651 26.178  1.00 29.00 ? 318 ARG B NH1 1 
ATOM   5193  N NH2 . ARG B  1 293 ? 26.858  146.402 26.434  1.00 34.81 ? 318 ARG B NH2 1 
ATOM   5194  N N   . LEU B  1 294 ? 22.230  151.097 30.935  1.00 22.28 ? 319 LEU B N   1 
ATOM   5195  C CA  . LEU B  1 294 ? 21.047  151.878 31.251  1.00 21.87 ? 319 LEU B CA  1 
ATOM   5196  C C   . LEU B  1 294 ? 19.783  151.221 30.692  1.00 22.49 ? 319 LEU B C   1 
ATOM   5197  O O   . LEU B  1 294 ? 19.637  151.069 29.491  1.00 21.95 ? 319 LEU B O   1 
ATOM   5198  C CB  . LEU B  1 294 ? 21.205  153.300 30.727  1.00 20.62 ? 319 LEU B CB  1 
ATOM   5199  C CG  . LEU B  1 294 ? 22.299  154.131 31.408  1.00 20.39 ? 319 LEU B CG  1 
ATOM   5200  C CD1 . LEU B  1 294 ? 22.706  155.319 30.538  1.00 19.19 ? 319 LEU B CD1 1 
ATOM   5201  C CD2 . LEU B  1 294 ? 21.811  154.590 32.768  1.00 22.51 ? 319 LEU B CD2 1 
ATOM   5202  N N   . GLN B  1 295 ? 18.882  150.812 31.574  1.00 23.08 ? 320 GLN B N   1 
ATOM   5203  C CA  . GLN B  1 295 ? 17.643  150.171 31.150  1.00 24.74 ? 320 GLN B CA  1 
ATOM   5204  C C   . GLN B  1 295 ? 16.770  151.118 30.363  1.00 24.36 ? 320 GLN B C   1 
ATOM   5205  O O   . GLN B  1 295 ? 16.091  150.705 29.418  1.00 24.90 ? 320 GLN B O   1 
ATOM   5206  C CB  . GLN B  1 295 ? 16.838  149.742 32.360  1.00 26.35 ? 320 GLN B CB  1 
ATOM   5207  C CG  . GLN B  1 295 ? 17.553  148.782 33.236  1.00 31.25 ? 320 GLN B CG  1 
ATOM   5208  C CD  . GLN B  1 295 ? 16.935  147.445 33.155  1.00 37.16 ? 320 GLN B CD  1 
ATOM   5209  O OE1 . GLN B  1 295 ? 16.109  147.083 34.004  1.00 39.56 ? 320 GLN B OE1 1 
ATOM   5210  N NE2 . GLN B  1 295 ? 17.276  146.696 32.097  1.00 38.95 ? 320 GLN B NE2 1 
ATOM   5211  N N   . ASP B  1 296 ? 16.742  152.385 30.775  1.00 23.26 ? 321 ASP B N   1 
ATOM   5212  C CA  . ASP B  1 296 ? 15.940  153.353 30.037  1.00 22.07 ? 321 ASP B CA  1 
ATOM   5213  C C   . ASP B  1 296 ? 16.571  153.752 28.704  1.00 20.99 ? 321 ASP B C   1 
ATOM   5214  O O   . ASP B  1 296 ? 15.888  153.852 27.678  1.00 19.82 ? 321 ASP B O   1 
ATOM   5215  C CB  . ASP B  1 296 ? 15.611  154.574 30.899  1.00 22.32 ? 321 ASP B CB  1 
ATOM   5216  C CG  . ASP B  1 296 ? 16.844  155.235 31.498  1.00 20.93 ? 321 ASP B CG  1 
ATOM   5217  O OD1 . ASP B  1 296 ? 17.968  154.704 31.354  1.00 19.57 ? 321 ASP B OD1 1 
ATOM   5218  O OD2 . ASP B  1 296 ? 16.672  156.299 32.132  1.00 21.99 ? 321 ASP B OD2 1 
ATOM   5219  N N   . GLN B  1 297 ? 17.877  153.960 28.690  1.00 19.78 ? 322 GLN B N   1 
ATOM   5220  C CA  . GLN B  1 297 ? 18.454  154.560 27.493  1.00 19.22 ? 322 GLN B CA  1 
ATOM   5221  C C   . GLN B  1 297 ? 19.104  153.561 26.538  1.00 19.33 ? 322 GLN B C   1 
ATOM   5222  O O   . GLN B  1 297 ? 19.503  153.950 25.437  1.00 19.20 ? 322 GLN B O   1 
ATOM   5223  C CB  . GLN B  1 297 ? 19.437  155.669 27.886  1.00 19.03 ? 322 GLN B CB  1 
ATOM   5224  C CG  . GLN B  1 297 ? 18.717  156.721 28.686  1.00 20.00 ? 322 GLN B CG  1 
ATOM   5225  C CD  . GLN B  1 297 ? 19.466  158.025 28.737  1.00 22.92 ? 322 GLN B CD  1 
ATOM   5226  O OE1 . GLN B  1 297 ? 19.129  158.992 28.009  1.00 24.20 ? 322 GLN B OE1 1 
ATOM   5227  N NE2 . GLN B  1 297 ? 20.474  158.084 29.594  1.00 17.10 ? 322 GLN B NE2 1 
ATOM   5228  N N   . GLN B  1 298 ? 19.216  152.307 26.982  1.00 19.08 ? 323 GLN B N   1 
ATOM   5229  C CA  . GLN B  1 298 ? 19.669  151.180 26.161  1.00 19.78 ? 323 GLN B CA  1 
ATOM   5230  C C   . GLN B  1 298 ? 21.140  151.243 25.778  1.00 18.88 ? 323 GLN B C   1 
ATOM   5231  O O   . GLN B  1 298 ? 21.519  150.711 24.730  1.00 19.53 ? 323 GLN B O   1 
ATOM   5232  C CB  . GLN B  1 298 ? 18.858  151.067 24.864  1.00 20.29 ? 323 GLN B CB  1 
ATOM   5233  C CG  . GLN B  1 298 ? 17.392  151.317 25.019  1.00 23.79 ? 323 GLN B CG  1 
ATOM   5234  C CD  . GLN B  1 298 ? 16.704  150.145 25.569  1.00 28.34 ? 323 GLN B CD  1 
ATOM   5235  O OE1 . GLN B  1 298 ? 17.330  149.275 26.156  1.00 30.97 ? 323 GLN B OE1 1 
ATOM   5236  N NE2 . GLN B  1 298 ? 15.389  150.081 25.378  1.00 33.23 ? 323 GLN B NE2 1 
ATOM   5237  N N   . VAL B  1 299 ? 21.952  151.903 26.596  1.00 17.75 ? 324 VAL B N   1 
ATOM   5238  C CA  . VAL B  1 299 ? 23.375  152.043 26.320  1.00 17.89 ? 324 VAL B CA  1 
ATOM   5239  C C   . VAL B  1 299 ? 24.144  151.962 27.643  1.00 18.05 ? 324 VAL B C   1 
ATOM   5240  O O   . VAL B  1 299 ? 23.557  152.207 28.716  1.00 19.49 ? 324 VAL B O   1 
ATOM   5241  C CB  . VAL B  1 299 ? 23.714  153.418 25.646  1.00 17.23 ? 324 VAL B CB  1 
ATOM   5242  C CG1 . VAL B  1 299 ? 23.253  153.453 24.220  1.00 16.59 ? 324 VAL B CG1 1 
ATOM   5243  C CG2 . VAL B  1 299 ? 23.120  154.596 26.444  1.00 16.47 ? 324 VAL B CG2 1 
ATOM   5244  N N   . PRO B  1 300 ? 25.449  151.633 27.574  1.00 17.93 ? 325 PRO B N   1 
ATOM   5245  C CA  . PRO B  1 300 ? 26.266  151.457 28.773  1.00 18.01 ? 325 PRO B CA  1 
ATOM   5246  C C   . PRO B  1 300 ? 27.066  152.685 29.181  1.00 18.03 ? 325 PRO B C   1 
ATOM   5247  O O   . PRO B  1 300 ? 27.404  153.550 28.340  1.00 16.17 ? 325 PRO B O   1 
ATOM   5248  C CB  . PRO B  1 300 ? 27.246  150.352 28.355  1.00 18.33 ? 325 PRO B CB  1 
ATOM   5249  C CG  . PRO B  1 300 ? 27.441  150.613 26.864  1.00 18.32 ? 325 PRO B CG  1 
ATOM   5250  C CD  . PRO B  1 300 ? 26.116  151.114 26.359  1.00 17.59 ? 325 PRO B CD  1 
ATOM   5251  N N   . TYR B  1 301 ? 27.370  152.756 30.474  1.00 17.94 ? 326 TYR B N   1 
ATOM   5252  C CA  . TYR B  1 301 ? 28.439  153.620 30.943  1.00 18.31 ? 326 TYR B CA  1 
ATOM   5253  C C   . TYR B  1 301 ? 29.329  152.815 31.857  1.00 18.98 ? 326 TYR B C   1 
ATOM   5254  O O   . TYR B  1 301 ? 28.950  151.716 32.307  1.00 19.35 ? 326 TYR B O   1 
ATOM   5255  C CB  . TYR B  1 301 ? 27.945  154.916 31.615  1.00 17.52 ? 326 TYR B CB  1 
ATOM   5256  C CG  . TYR B  1 301 ? 27.241  154.756 32.949  1.00 19.23 ? 326 TYR B CG  1 
ATOM   5257  C CD1 . TYR B  1 301 ? 25.879  154.473 33.006  1.00 18.60 ? 326 TYR B CD1 1 
ATOM   5258  C CD2 . TYR B  1 301 ? 27.930  154.903 34.152  1.00 19.82 ? 326 TYR B CD2 1 
ATOM   5259  C CE1 . TYR B  1 301 ? 25.218  154.339 34.226  1.00 20.59 ? 326 TYR B CE1 1 
ATOM   5260  C CE2 . TYR B  1 301 ? 27.271  154.759 35.383  1.00 20.60 ? 326 TYR B CE2 1 
ATOM   5261  C CZ  . TYR B  1 301 ? 25.925  154.490 35.404  1.00 20.89 ? 326 TYR B CZ  1 
ATOM   5262  O OH  . TYR B  1 301 ? 25.275  154.338 36.595  1.00 22.79 ? 326 TYR B OH  1 
ATOM   5263  N N   . ALA B  1 302 ? 30.521  153.352 32.114  1.00 19.15 ? 327 ALA B N   1 
ATOM   5264  C CA  . ALA B  1 302 ? 31.484  152.679 32.970  1.00 19.85 ? 327 ALA B CA  1 
ATOM   5265  C C   . ALA B  1 302 ? 32.122  153.689 33.897  1.00 20.05 ? 327 ALA B C   1 
ATOM   5266  O O   . ALA B  1 302 ? 32.364  154.830 33.498  1.00 19.44 ? 327 ALA B O   1 
ATOM   5267  C CB  . ALA B  1 302 ? 32.555  151.988 32.113  1.00 19.47 ? 327 ALA B CB  1 
ATOM   5268  N N   . VAL B  1 303 ? 32.419  153.238 35.119  1.00 21.27 ? 328 VAL B N   1 
ATOM   5269  C CA  . VAL B  1 303 ? 33.060  154.041 36.164  1.00 21.49 ? 328 VAL B CA  1 
ATOM   5270  C C   . VAL B  1 303 ? 34.313  153.321 36.643  1.00 22.27 ? 328 VAL B C   1 
ATOM   5271  O O   . VAL B  1 303 ? 34.293  152.109 36.897  1.00 22.41 ? 328 VAL B O   1 
ATOM   5272  C CB  . VAL B  1 303 ? 32.092  154.264 37.351  1.00 22.18 ? 328 VAL B CB  1 
ATOM   5273  C CG1 . VAL B  1 303 ? 32.757  155.068 38.482  1.00 23.04 ? 328 VAL B CG1 1 
ATOM   5274  C CG2 . VAL B  1 303 ? 30.861  154.988 36.870  1.00 20.55 ? 328 VAL B CG2 1 
ATOM   5275  N N   . LYS B  1 304 ? 35.418  154.052 36.728  1.00 22.91 ? 329 LYS B N   1 
ATOM   5276  C CA  . LYS B  1 304 ? 36.617  153.540 37.393  1.00 23.97 ? 329 LYS B CA  1 
ATOM   5277  C C   . LYS B  1 304 ? 37.264  154.733 38.067  1.00 24.91 ? 329 LYS B C   1 
ATOM   5278  O O   . LYS B  1 304 ? 37.549  155.744 37.413  1.00 24.40 ? 329 LYS B O   1 
ATOM   5279  C CB  . LYS B  1 304 ? 37.577  152.885 36.387  1.00 24.25 ? 329 LYS B CB  1 
ATOM   5280  C CG  . LYS B  1 304 ? 38.754  152.124 37.035  1.00 26.98 ? 329 LYS B CG  1 
ATOM   5281  C CD  . LYS B  1 304 ? 39.529  151.293 35.985  1.00 28.04 ? 329 LYS B CD  1 
ATOM   5282  C CE  . LYS B  1 304 ? 40.191  152.202 34.958  1.00 28.60 ? 329 LYS B CE  1 
ATOM   5283  N NZ  . LYS B  1 304 ? 40.978  151.478 33.916  1.00 27.34 ? 329 LYS B NZ  1 
ATOM   5284  N N   . GLY B  1 305 ? 37.482  154.629 39.380  1.00 26.27 ? 330 GLY B N   1 
ATOM   5285  C CA  . GLY B  1 305 ? 37.946  155.779 40.169  1.00 27.35 ? 330 GLY B CA  1 
ATOM   5286  C C   . GLY B  1 305 ? 36.952  156.919 39.962  1.00 26.79 ? 330 GLY B C   1 
ATOM   5287  O O   . GLY B  1 305 ? 35.731  156.699 39.961  1.00 25.87 ? 330 GLY B O   1 
ATOM   5288  N N   . ASN B  1 306 ? 37.457  158.133 39.769  1.00 26.79 ? 331 ASN B N   1 
ATOM   5289  C CA  . ASN B  1 306 ? 36.576  159.272 39.497  1.00 26.19 ? 331 ASN B CA  1 
ATOM   5290  C C   . ASN B  1 306 ? 36.301  159.518 38.009  1.00 24.62 ? 331 ASN B C   1 
ATOM   5291  O O   . ASN B  1 306 ? 35.852  160.605 37.641  1.00 24.20 ? 331 ASN B O   1 
ATOM   5292  C CB  . ASN B  1 306 ? 37.150  160.551 40.119  1.00 27.62 ? 331 ASN B CB  1 
ATOM   5293  C CG  . ASN B  1 306 ? 38.445  160.969 39.470  1.00 28.67 ? 331 ASN B CG  1 
ATOM   5294  O OD1 . ASN B  1 306 ? 38.888  160.367 38.490  1.00 27.64 ? 331 ASN B OD1 1 
ATOM   5295  N ND2 . ASN B  1 306 ? 39.057  162.010 40.004  1.00 30.66 ? 331 ASN B ND2 1 
ATOM   5296  N N   . GLN B  1 307 ? 36.584  158.533 37.156  1.00 23.34 ? 332 GLN B N   1 
ATOM   5297  C CA  . GLN B  1 307 ? 36.308  158.666 35.721  1.00 22.68 ? 332 GLN B CA  1 
ATOM   5298  C C   . GLN B  1 307 ? 35.008  157.968 35.305  1.00 21.79 ? 332 GLN B C   1 
ATOM   5299  O O   . GLN B  1 307 ? 34.745  156.828 35.692  1.00 21.73 ? 332 GLN B O   1 
ATOM   5300  C CB  . GLN B  1 307 ? 37.472  158.142 34.894  1.00 22.84 ? 332 GLN B CB  1 
ATOM   5301  C CG  . GLN B  1 307 ? 38.787  158.829 35.223  1.00 25.14 ? 332 GLN B CG  1 
ATOM   5302  C CD  . GLN B  1 307 ? 38.804  160.262 34.772  1.00 25.54 ? 332 GLN B CD  1 
ATOM   5303  O OE1 . GLN B  1 307 ? 38.949  161.189 35.581  1.00 28.02 ? 332 GLN B OE1 1 
ATOM   5304  N NE2 . GLN B  1 307 ? 38.644  160.462 33.486  1.00 23.26 ? 332 GLN B NE2 1 
ATOM   5305  N N   . TRP B  1 308 ? 34.220  158.656 34.486  1.00 21.08 ? 333 TRP B N   1 
ATOM   5306  C CA  . TRP B  1 308 ? 32.897  158.200 34.069  1.00 19.60 ? 333 TRP B CA  1 
ATOM   5307  C C   . TRP B  1 308 ? 32.851  158.348 32.559  1.00 19.14 ? 333 TRP B C   1 
ATOM   5308  O O   . TRP B  1 308 ? 33.125  159.413 32.022  1.00 18.76 ? 333 TRP B O   1 
ATOM   5309  C CB  . TRP B  1 308 ? 31.843  159.096 34.747  1.00 19.63 ? 333 TRP B CB  1 
ATOM   5310  C CG  . TRP B  1 308 ? 30.393  158.665 34.673  1.00 19.12 ? 333 TRP B CG  1 
ATOM   5311  C CD1 . TRP B  1 308 ? 29.632  158.185 35.708  1.00 18.78 ? 333 TRP B CD1 1 
ATOM   5312  C CD2 . TRP B  1 308 ? 29.509  158.760 33.535  1.00 18.74 ? 333 TRP B CD2 1 
ATOM   5313  N NE1 . TRP B  1 308 ? 28.339  157.963 35.279  1.00 19.43 ? 333 TRP B NE1 1 
ATOM   5314  C CE2 . TRP B  1 308 ? 28.239  158.301 33.954  1.00 18.94 ? 333 TRP B CE2 1 
ATOM   5315  C CE3 . TRP B  1 308 ? 29.670  159.186 32.208  1.00 18.14 ? 333 TRP B CE3 1 
ATOM   5316  C CZ2 . TRP B  1 308 ? 27.132  158.242 33.088  1.00 18.36 ? 333 TRP B CZ2 1 
ATOM   5317  C CZ3 . TRP B  1 308 ? 28.567  159.119 31.344  1.00 17.99 ? 333 TRP B CZ3 1 
ATOM   5318  C CH2 . TRP B  1 308 ? 27.316  158.659 31.801  1.00 17.80 ? 333 TRP B CH2 1 
ATOM   5319  N N   . VAL B  1 309 ? 32.543  157.258 31.867  1.00 18.90 ? 334 VAL B N   1 
ATOM   5320  C CA  . VAL B  1 309 ? 32.606  157.250 30.421  1.00 19.59 ? 334 VAL B CA  1 
ATOM   5321  C C   . VAL B  1 309 ? 31.306  156.671 29.873  1.00 18.83 ? 334 VAL B C   1 
ATOM   5322  O O   . VAL B  1 309 ? 30.911  155.541 30.212  1.00 19.56 ? 334 VAL B O   1 
ATOM   5323  C CB  . VAL B  1 309 ? 33.792  156.385 29.916  1.00 19.88 ? 334 VAL B CB  1 
ATOM   5324  C CG1 . VAL B  1 309 ? 33.762  156.262 28.380  1.00 19.76 ? 334 VAL B CG1 1 
ATOM   5325  C CG2 . VAL B  1 309 ? 35.124  156.972 30.413  1.00 20.40 ? 334 VAL B CG2 1 
ATOM   5326  N N   . GLY B  1 310 ? 30.631  157.448 29.036  1.00 18.75 ? 335 GLY B N   1 
ATOM   5327  C CA  . GLY B  1 310 ? 29.440  156.941 28.344  1.00 18.62 ? 335 GLY B CA  1 
ATOM   5328  C C   . GLY B  1 310 ? 29.864  156.567 26.934  1.00 18.53 ? 335 GLY B C   1 
ATOM   5329  O O   . GLY B  1 310 ? 30.416  157.397 26.226  1.00 18.41 ? 335 GLY B O   1 
ATOM   5330  N N   . TYR B  1 311 ? 29.588  155.338 26.512  1.00 17.99 ? 336 TYR B N   1 
ATOM   5331  C CA  . TYR B  1 311 ? 30.153  154.817 25.246  1.00 18.11 ? 336 TYR B CA  1 
ATOM   5332  C C   . TYR B  1 311 ? 29.209  153.830 24.579  1.00 18.49 ? 336 TYR B C   1 
ATOM   5333  O O   . TYR B  1 311 ? 28.164  153.463 25.146  1.00 18.23 ? 336 TYR B O   1 
ATOM   5334  C CB  . TYR B  1 311 ? 31.502  154.108 25.507  1.00 18.74 ? 336 TYR B CB  1 
ATOM   5335  C CG  . TYR B  1 311 ? 31.350  152.854 26.350  1.00 18.60 ? 336 TYR B CG  1 
ATOM   5336  C CD1 . TYR B  1 311 ? 31.146  152.941 27.716  1.00 18.90 ? 336 TYR B CD1 1 
ATOM   5337  C CD2 . TYR B  1 311 ? 31.379  151.580 25.768  1.00 17.90 ? 336 TYR B CD2 1 
ATOM   5338  C CE1 . TYR B  1 311 ? 30.981  151.785 28.499  1.00 20.22 ? 336 TYR B CE1 1 
ATOM   5339  C CE2 . TYR B  1 311 ? 31.235  150.425 26.544  1.00 20.10 ? 336 TYR B CE2 1 
ATOM   5340  C CZ  . TYR B  1 311 ? 31.023  150.534 27.901  1.00 20.17 ? 336 TYR B CZ  1 
ATOM   5341  O OH  . TYR B  1 311 ? 30.857  149.410 28.673  1.00 21.13 ? 336 TYR B OH  1 
ATOM   5342  N N   . ASP B  1 312 ? 29.562  153.401 23.369  1.00 18.49 ? 337 ASP B N   1 
ATOM   5343  C CA  . ASP B  1 312 ? 28.777  152.385 22.673  1.00 19.73 ? 337 ASP B CA  1 
ATOM   5344  C C   . ASP B  1 312 ? 29.581  151.116 22.512  1.00 20.14 ? 337 ASP B C   1 
ATOM   5345  O O   . ASP B  1 312 ? 30.800  151.166 22.303  1.00 20.08 ? 337 ASP B O   1 
ATOM   5346  C CB  . ASP B  1 312 ? 28.295  152.872 21.290  1.00 19.92 ? 337 ASP B CB  1 
ATOM   5347  C CG  . ASP B  1 312 ? 27.010  153.704 21.379  1.00 20.77 ? 337 ASP B CG  1 
ATOM   5348  O OD1 . ASP B  1 312 ? 27.082  154.912 21.696  1.00 19.47 ? 337 ASP B OD1 1 
ATOM   5349  O OD2 . ASP B  1 312 ? 25.932  153.134 21.167  1.00 25.69 ? 337 ASP B OD2 1 
ATOM   5350  N N   . ASP B  1 313 ? 28.901  149.978 22.608  1.00 20.22 ? 338 ASP B N   1 
ATOM   5351  C CA  . ASP B  1 313 ? 29.562  148.680 22.467  1.00 21.64 ? 338 ASP B CA  1 
ATOM   5352  C C   . ASP B  1 313 ? 28.806  147.795 21.480  1.00 21.95 ? 338 ASP B C   1 
ATOM   5353  O O   . ASP B  1 313 ? 27.879  148.264 20.845  1.00 21.24 ? 338 ASP B O   1 
ATOM   5354  C CB  . ASP B  1 313 ? 29.801  147.990 23.820  1.00 21.53 ? 338 ASP B CB  1 
ATOM   5355  C CG  . ASP B  1 313 ? 28.512  147.665 24.582  1.00 23.96 ? 338 ASP B CG  1 
ATOM   5356  O OD1 . ASP B  1 313 ? 27.396  147.777 24.035  1.00 23.72 ? 338 ASP B OD1 1 
ATOM   5357  O OD2 . ASP B  1 313 ? 28.636  147.253 25.764  1.00 25.03 ? 338 ASP B OD2 1 
ATOM   5358  N N   . VAL B  1 314 ? 29.225  146.544 21.313  1.00 22.25 ? 339 VAL B N   1 
ATOM   5359  C CA  . VAL B  1 314 ? 28.586  145.686 20.320  1.00 23.42 ? 339 VAL B CA  1 
ATOM   5360  C C   . VAL B  1 314 ? 27.072  145.514 20.596  1.00 23.58 ? 339 VAL B C   1 
ATOM   5361  O O   . VAL B  1 314 ? 26.256  145.566 19.673  1.00 22.68 ? 339 VAL B O   1 
ATOM   5362  C CB  . VAL B  1 314 ? 29.303  144.310 20.195  1.00 24.61 ? 339 VAL B CB  1 
ATOM   5363  C CG1 . VAL B  1 314 ? 28.414  143.293 19.512  1.00 27.04 ? 339 VAL B CG1 1 
ATOM   5364  C CG2 . VAL B  1 314 ? 30.640  144.460 19.441  1.00 24.15 ? 339 VAL B CG2 1 
ATOM   5365  N N   . LYS B  1 315 ? 26.696  145.329 21.857  1.00 23.91 ? 340 LYS B N   1 
ATOM   5366  C CA  . LYS B  1 315 ? 25.282  145.158 22.205  1.00 24.79 ? 340 LYS B CA  1 
ATOM   5367  C C   . LYS B  1 315 ? 24.434  146.414 21.958  1.00 23.93 ? 340 LYS B C   1 
ATOM   5368  O O   . LYS B  1 315 ? 23.307  146.323 21.432  1.00 23.67 ? 340 LYS B O   1 
ATOM   5369  C CB  . LYS B  1 315 ? 25.153  144.692 23.655  1.00 26.14 ? 340 LYS B CB  1 
ATOM   5370  C CG  . LYS B  1 315 ? 25.669  143.256 23.862  1.00 30.33 ? 340 LYS B CG  1 
ATOM   5371  C CD  . LYS B  1 315 ? 25.645  142.836 25.335  1.00 35.40 ? 340 LYS B CD  1 
ATOM   5372  C CE  . LYS B  1 315 ? 24.334  142.148 25.695  1.00 38.74 ? 340 LYS B CE  1 
ATOM   5373  N NZ  . LYS B  1 315 ? 24.521  141.204 26.814  1.00 42.02 ? 340 LYS B NZ  1 
ATOM   5374  N N   . SER B  1 316 ? 24.962  147.584 22.313  1.00 22.99 ? 341 SER B N   1 
ATOM   5375  C CA  . SER B  1 316 ? 24.227  148.821 22.012  1.00 23.62 ? 341 SER B CA  1 
ATOM   5376  C C   . SER B  1 316 ? 24.078  148.991 20.501  1.00 23.75 ? 341 SER B C   1 
ATOM   5377  O O   . SER B  1 316 ? 23.062  149.451 19.998  1.00 25.52 ? 341 SER B O   1 
ATOM   5378  C CB  . SER B  1 316 ? 24.870  150.056 22.676  1.00 22.02 ? 341 SER B CB  1 
ATOM   5379  O OG  . SER B  1 316 ? 26.089  150.396 22.050  1.00 23.57 ? 341 SER B OG  1 
ATOM   5380  N N   . MET B  1 317 ? 25.074  148.586 19.741  1.00 24.63 ? 342 MET B N   1 
ATOM   5381  C CA  . MET B  1 317 ? 24.911  148.701 18.309  1.00 24.30 ? 342 MET B CA  1 
ATOM   5382  C C   . MET B  1 317 ? 23.877  147.746 17.692  1.00 24.41 ? 342 MET B C   1 
ATOM   5383  O O   . MET B  1 317 ? 23.110  148.113 16.788  1.00 23.43 ? 342 MET B O   1 
ATOM   5384  C CB  . MET B  1 317 ? 26.262  148.674 17.659  1.00 25.08 ? 342 MET B CB  1 
ATOM   5385  C CG  . MET B  1 317 ? 26.957  150.008 18.041  1.00 25.48 ? 342 MET B CG  1 
ATOM   5386  S SD  . MET B  1 317 ? 28.316  150.213 17.006  1.00 27.96 ? 342 MET B SD  1 
ATOM   5387  C CE  . MET B  1 317 ? 29.236  151.486 17.886  1.00 28.57 ? 342 MET B CE  1 
ATOM   5388  N N   . GLU B  1 318 ? 23.802  146.542 18.238  1.00 23.91 ? 343 GLU B N   1 
ATOM   5389  C CA  . GLU B  1 318 ? 22.723  145.648 17.861  1.00 24.80 ? 343 GLU B CA  1 
ATOM   5390  C C   . GLU B  1 318 ? 21.331  146.236 18.077  1.00 23.90 ? 343 GLU B C   1 
ATOM   5391  O O   . GLU B  1 318 ? 20.510  146.182 17.168  1.00 24.50 ? 343 GLU B O   1 
ATOM   5392  C CB  . GLU B  1 318 ? 22.887  144.295 18.550  1.00 26.13 ? 343 GLU B CB  1 
ATOM   5393  C CG  . GLU B  1 318 ? 24.010  143.530 17.868  1.00 29.41 ? 343 GLU B CG  1 
ATOM   5394  C CD  . GLU B  1 318 ? 24.586  142.402 18.700  1.00 35.45 ? 343 GLU B CD  1 
ATOM   5395  O OE1 . GLU B  1 318 ? 24.125  142.179 19.847  1.00 36.40 ? 343 GLU B OE1 1 
ATOM   5396  O OE2 . GLU B  1 318 ? 25.514  141.739 18.184  1.00 37.23 ? 343 GLU B OE2 1 
ATOM   5397  N N   . THR B  1 319 ? 21.085  146.805 19.258  1.00 22.29 ? 344 THR B N   1 
ATOM   5398  C CA  . THR B  1 319 ? 19.804  147.438 19.579  1.00 22.27 ? 344 THR B CA  1 
ATOM   5399  C C   . THR B  1 319 ? 19.527  148.641 18.682  1.00 21.11 ? 344 THR B C   1 
ATOM   5400  O O   . THR B  1 319 ? 18.390  148.838 18.203  1.00 20.89 ? 344 THR B O   1 
ATOM   5401  C CB  . THR B  1 319 ? 19.755  147.895 21.053  1.00 22.39 ? 344 THR B CB  1 
ATOM   5402  O OG1 . THR B  1 319 ? 20.158  146.796 21.882  1.00 23.16 ? 344 THR B OG1 1 
ATOM   5403  C CG2 . THR B  1 319 ? 18.332  148.306 21.433  1.00 22.23 ? 344 THR B CG2 1 
ATOM   5404  N N   . LYS B  1 320 ? 20.565  149.436 18.430  1.00 20.02 ? 345 LYS B N   1 
ATOM   5405  C CA  . LYS B  1 320 ? 20.414  150.566 17.504  1.00 19.55 ? 345 LYS B CA  1 
ATOM   5406  C C   . LYS B  1 320 ? 20.098  150.132 16.085  1.00 19.61 ? 345 LYS B C   1 
ATOM   5407  O O   . LYS B  1 320 ? 19.297  150.760 15.391  1.00 20.57 ? 345 LYS B O   1 
ATOM   5408  C CB  . LYS B  1 320 ? 21.631  151.482 17.563  1.00 18.97 ? 345 LYS B CB  1 
ATOM   5409  C CG  . LYS B  1 320 ? 21.650  152.345 18.832  1.00 17.49 ? 345 LYS B CG  1 
ATOM   5410  C CD  . LYS B  1 320 ? 22.988  153.075 19.014  1.00 17.58 ? 345 LYS B CD  1 
ATOM   5411  C CE  . LYS B  1 320 ? 22.893  154.090 20.153  1.00 17.85 ? 345 LYS B CE  1 
ATOM   5412  N NZ  . LYS B  1 320 ? 24.170  154.871 20.256  1.00 18.78 ? 345 LYS B NZ  1 
ATOM   5413  N N   . VAL B  1 321 ? 20.670  149.034 15.632  1.00 20.53 ? 346 VAL B N   1 
ATOM   5414  C CA  . VAL B  1 321 ? 20.288  148.585 14.287  1.00 20.93 ? 346 VAL B CA  1 
ATOM   5415  C C   . VAL B  1 321 ? 18.848  148.061 14.259  1.00 22.16 ? 346 VAL B C   1 
ATOM   5416  O O   . VAL B  1 321 ? 18.107  148.270 13.289  1.00 22.47 ? 346 VAL B O   1 
ATOM   5417  C CB  . VAL B  1 321 ? 21.266  147.556 13.697  1.00 21.42 ? 346 VAL B CB  1 
ATOM   5418  C CG1 . VAL B  1 321 ? 20.687  146.954 12.426  1.00 23.49 ? 346 VAL B CG1 1 
ATOM   5419  C CG2 . VAL B  1 321 ? 22.620  148.225 13.402  1.00 20.26 ? 346 VAL B CG2 1 
ATOM   5420  N N   . GLN B  1 322 ? 18.459  147.342 15.298  1.00 22.49 ? 347 GLN B N   1 
ATOM   5421  C CA  . GLN B  1 322 ? 17.091  146.854 15.339  1.00 24.48 ? 347 GLN B CA  1 
ATOM   5422  C C   . GLN B  1 322 ? 16.159  148.056 15.234  1.00 23.08 ? 347 GLN B C   1 
ATOM   5423  O O   . GLN B  1 322 ? 15.173  148.033 14.501  1.00 24.15 ? 347 GLN B O   1 
ATOM   5424  C CB  . GLN B  1 322 ? 16.825  146.062 16.628  1.00 24.95 ? 347 GLN B CB  1 
ATOM   5425  C CG  . GLN B  1 322 ? 15.532  145.285 16.583  1.00 31.39 ? 347 GLN B CG  1 
ATOM   5426  C CD  . GLN B  1 322 ? 15.431  144.378 15.358  1.00 38.59 ? 347 GLN B CD  1 
ATOM   5427  O OE1 . GLN B  1 322 ? 14.599  144.594 14.458  1.00 40.82 ? 347 GLN B OE1 1 
ATOM   5428  N NE2 . GLN B  1 322 ? 16.283  143.363 15.310  1.00 41.04 ? 347 GLN B NE2 1 
ATOM   5429  N N   . PHE B  1 323 ? 16.458  149.102 15.991  1.00 22.27 ? 348 PHE B N   1 
ATOM   5430  C CA  . PHE B  1 323 ? 15.639  150.316 15.948  1.00 21.96 ? 348 PHE B CA  1 
ATOM   5431  C C   . PHE B  1 323 ? 15.568  150.894 14.528  1.00 21.52 ? 348 PHE B C   1 
ATOM   5432  O O   . PHE B  1 323 ? 14.488  151.153 14.013  1.00 22.18 ? 348 PHE B O   1 
ATOM   5433  C CB  . PHE B  1 323 ? 16.177  151.381 16.922  1.00 20.98 ? 348 PHE B CB  1 
ATOM   5434  C CG  . PHE B  1 323 ? 15.564  152.752 16.708  1.00 21.92 ? 348 PHE B CG  1 
ATOM   5435  C CD1 . PHE B  1 323 ? 14.294  153.042 17.194  1.00 23.95 ? 348 PHE B CD1 1 
ATOM   5436  C CD2 . PHE B  1 323 ? 16.234  153.724 15.994  1.00 19.16 ? 348 PHE B CD2 1 
ATOM   5437  C CE1 . PHE B  1 323 ? 13.720  154.294 16.987  1.00 23.86 ? 348 PHE B CE1 1 
ATOM   5438  C CE2 . PHE B  1 323 ? 15.662  154.968 15.793  1.00 20.92 ? 348 PHE B CE2 1 
ATOM   5439  C CZ  . PHE B  1 323 ? 14.407  155.252 16.286  1.00 20.43 ? 348 PHE B CZ  1 
ATOM   5440  N N   . LEU B  1 324 ? 16.717  151.088 13.881  1.00 21.06 ? 349 LEU B N   1 
ATOM   5441  C CA  . LEU B  1 324 ? 16.716  151.727 12.550  1.00 21.12 ? 349 LEU B CA  1 
ATOM   5442  C C   . LEU B  1 324 ? 15.948  150.917 11.502  1.00 22.42 ? 349 LEU B C   1 
ATOM   5443  O O   . LEU B  1 324 ? 15.248  151.473 10.649  1.00 23.00 ? 349 LEU B O   1 
ATOM   5444  C CB  . LEU B  1 324 ? 18.148  152.083 12.097  1.00 20.42 ? 349 LEU B CB  1 
ATOM   5445  C CG  . LEU B  1 324 ? 19.028  151.020 11.450  1.00 20.62 ? 349 LEU B CG  1 
ATOM   5446  C CD1 . LEU B  1 324 ? 18.678  150.972 9.966   1.00 19.72 ? 349 LEU B CD1 1 
ATOM   5447  C CD2 . LEU B  1 324 ? 20.517  151.372 11.656  1.00 19.30 ? 349 LEU B CD2 1 
ATOM   5448  N N   . LYS B  1 325 ? 16.027  149.595 11.596  1.00 23.26 ? 350 LYS B N   1 
ATOM   5449  C CA  . LYS B  1 325 ? 15.225  148.745 10.738  1.00 25.17 ? 350 LYS B CA  1 
ATOM   5450  C C   . LYS B  1 325 ? 13.733  148.920 11.044  1.00 25.98 ? 350 LYS B C   1 
ATOM   5451  O O   . LYS B  1 325 ? 12.920  149.056 10.133  1.00 25.70 ? 350 LYS B O   1 
ATOM   5452  C CB  . LYS B  1 325 ? 15.615  147.279 10.935  1.00 26.43 ? 350 LYS B CB  1 
ATOM   5453  C CG  . LYS B  1 325 ? 17.023  146.912 10.416  1.00 27.88 ? 350 LYS B CG  1 
ATOM   5454  C CD  . LYS B  1 325 ? 17.215  145.393 10.588  1.00 31.22 ? 350 LYS B CD  1 
ATOM   5455  C CE  . LYS B  1 325 ? 18.394  144.889 9.806   1.00 32.64 ? 350 LYS B CE  1 
ATOM   5456  N NZ  . LYS B  1 325 ? 18.554  143.426 10.020  1.00 33.39 ? 350 LYS B NZ  1 
ATOM   5457  N N   . ASN B  1 326 ? 13.403  148.922 12.338  1.00 26.23 ? 351 ASN B N   1 
ATOM   5458  C CA  . ASN B  1 326 ? 12.028  149.081 12.833  1.00 27.97 ? 351 ASN B CA  1 
ATOM   5459  C C   . ASN B  1 326 ? 11.434  150.368 12.278  1.00 27.54 ? 351 ASN B C   1 
ATOM   5460  O O   . ASN B  1 326 ? 10.254  150.438 11.958  1.00 28.21 ? 351 ASN B O   1 
ATOM   5461  C CB  . ASN B  1 326 ? 12.058  149.195 14.363  1.00 28.38 ? 351 ASN B CB  1 
ATOM   5462  C CG  . ASN B  1 326 ? 11.184  148.178 15.067  1.00 33.97 ? 351 ASN B CG  1 
ATOM   5463  O OD1 . ASN B  1 326 ? 9.969   148.380 15.233  1.00 39.91 ? 351 ASN B OD1 1 
ATOM   5464  N ND2 . ASN B  1 326 ? 11.806  147.094 15.550  1.00 34.94 ? 351 ASN B ND2 1 
ATOM   5465  N N   . LEU B  1 327 ? 12.253  151.408 12.184  1.00 26.11 ? 352 LEU B N   1 
ATOM   5466  C CA  . LEU B  1 327 ? 11.745  152.679 11.695  1.00 26.71 ? 352 LEU B CA  1 
ATOM   5467  C C   . LEU B  1 327 ? 11.936  152.917 10.193  1.00 26.75 ? 352 LEU B C   1 
ATOM   5468  O O   . LEU B  1 327 ? 11.728  154.039 9.719   1.00 27.15 ? 352 LEU B O   1 
ATOM   5469  C CB  . LEU B  1 327 ? 12.296  153.845 12.523  1.00 25.74 ? 352 LEU B CB  1 
ATOM   5470  C CG  . LEU B  1 327 ? 11.252  154.074 13.625  1.00 29.49 ? 352 LEU B CG  1 
ATOM   5471  C CD1 . LEU B  1 327 ? 11.487  153.187 14.861  1.00 27.01 ? 352 LEU B CD1 1 
ATOM   5472  C CD2 . LEU B  1 327 ? 11.129  155.521 14.011  1.00 31.40 ? 352 LEU B CD2 1 
ATOM   5473  N N   . ASN B  1 328 ? 12.307  151.867 9.458   1.00 26.57 ? 353 ASN B N   1 
ATOM   5474  C CA  . ASN B  1 328 ? 12.505  151.932 7.996   1.00 27.08 ? 353 ASN B CA  1 
ATOM   5475  C C   . ASN B  1 328 ? 13.453  153.028 7.534   1.00 25.54 ? 353 ASN B C   1 
ATOM   5476  O O   . ASN B  1 328 ? 13.184  153.727 6.540   1.00 25.94 ? 353 ASN B O   1 
ATOM   5477  C CB  . ASN B  1 328 ? 11.177  152.081 7.240   1.00 28.37 ? 353 ASN B CB  1 
ATOM   5478  C CG  . ASN B  1 328 ? 10.202  150.954 7.533   1.00 32.41 ? 353 ASN B CG  1 
ATOM   5479  O OD1 . ASN B  1 328 ? 9.006   151.194 7.672   1.00 36.08 ? 353 ASN B OD1 1 
ATOM   5480  N ND2 . ASN B  1 328 ? 10.700  149.730 7.617   1.00 32.33 ? 353 ASN B ND2 1 
ATOM   5481  N N   . LEU B  1 329 ? 14.566  153.176 8.240   1.00 24.03 ? 354 LEU B N   1 
ATOM   5482  C CA  . LEU B  1 329 ? 15.553  154.189 7.897   1.00 22.58 ? 354 LEU B CA  1 
ATOM   5483  C C   . LEU B  1 329 ? 16.454  153.704 6.762   1.00 22.57 ? 354 LEU B C   1 
ATOM   5484  O O   . LEU B  1 329 ? 16.402  152.541 6.384   1.00 23.56 ? 354 LEU B O   1 
ATOM   5485  C CB  . LEU B  1 329 ? 16.394  154.554 9.121   1.00 20.95 ? 354 LEU B CB  1 
ATOM   5486  C CG  . LEU B  1 329 ? 15.666  154.954 10.409  1.00 20.78 ? 354 LEU B CG  1 
ATOM   5487  C CD1 . LEU B  1 329 ? 16.689  155.513 11.419  1.00 17.49 ? 354 LEU B CD1 1 
ATOM   5488  C CD2 . LEU B  1 329 ? 14.517  155.978 10.154  1.00 20.81 ? 354 LEU B CD2 1 
ATOM   5489  N N   . GLY B  1 330 ? 17.267  154.606 6.215   1.00 22.64 ? 355 GLY B N   1 
ATOM   5490  C CA  . GLY B  1 330 ? 18.138  154.275 5.072   1.00 22.77 ? 355 GLY B CA  1 
ATOM   5491  C C   . GLY B  1 330 ? 19.329  153.388 5.417   1.00 22.50 ? 355 GLY B C   1 
ATOM   5492  O O   . GLY B  1 330 ? 19.863  152.701 4.554   1.00 22.60 ? 355 GLY B O   1 
ATOM   5493  N N   . GLY B  1 331 ? 19.743  153.398 6.684   1.00 21.71 ? 356 GLY B N   1 
ATOM   5494  C CA  . GLY B  1 331 ? 20.888  152.596 7.133   1.00 21.07 ? 356 GLY B CA  1 
ATOM   5495  C C   . GLY B  1 331 ? 21.526  153.230 8.360   1.00 20.64 ? 356 GLY B C   1 
ATOM   5496  O O   . GLY B  1 331 ? 20.885  153.994 9.087   1.00 20.18 ? 356 GLY B O   1 
ATOM   5497  N N   . ALA B  1 332 ? 22.802  152.926 8.583   1.00 20.12 ? 357 ALA B N   1 
ATOM   5498  C CA  . ALA B  1 332 ? 23.535  153.454 9.697   1.00 19.33 ? 357 ALA B CA  1 
ATOM   5499  C C   . ALA B  1 332 ? 24.742  154.214 9.156   1.00 19.54 ? 357 ALA B C   1 
ATOM   5500  O O   . ALA B  1 332 ? 25.280  153.859 8.091   1.00 20.06 ? 357 ALA B O   1 
ATOM   5501  C CB  . ALA B  1 332 ? 23.997  152.317 10.588  1.00 19.83 ? 357 ALA B CB  1 
ATOM   5502  N N   . MET B  1 333 ? 25.153  155.254 9.881   1.00 18.03 ? 358 MET B N   1 
ATOM   5503  C CA  . MET B  1 333 ? 26.371  155.976 9.562   1.00 18.00 ? 358 MET B CA  1 
ATOM   5504  C C   . MET B  1 333 ? 27.291  155.852 10.783  1.00 18.38 ? 358 MET B C   1 
ATOM   5505  O O   . MET B  1 333 ? 26.802  155.774 11.916  1.00 18.15 ? 358 MET B O   1 
ATOM   5506  C CB  . MET B  1 333 ? 26.054  157.454 9.254   1.00 18.03 ? 358 MET B CB  1 
ATOM   5507  C CG  . MET B  1 333 ? 27.305  158.370 9.145   1.00 17.05 ? 358 MET B CG  1 
ATOM   5508  S SD  . MET B  1 333 ? 27.797  159.034 10.760  1.00 18.71 ? 358 MET B SD  1 
ATOM   5509  C CE  . MET B  1 333 ? 26.472  160.235 10.970  1.00 15.21 ? 358 MET B CE  1 
ATOM   5510  N N   . ILE B  1 334 ? 28.607  155.832 10.555  1.00 18.54 ? 359 ILE B N   1 
ATOM   5511  C CA  . ILE B  1 334 ? 29.558  155.633 11.625  1.00 18.57 ? 359 ILE B CA  1 
ATOM   5512  C C   . ILE B  1 334 ? 30.458  156.844 11.699  1.00 18.66 ? 359 ILE B C   1 
ATOM   5513  O O   . ILE B  1 334 ? 31.103  157.195 10.702  1.00 19.97 ? 359 ILE B O   1 
ATOM   5514  C CB  . ILE B  1 334 ? 30.464  154.391 11.353  1.00 19.39 ? 359 ILE B CB  1 
ATOM   5515  C CG1 . ILE B  1 334 ? 29.619  153.130 11.104  1.00 19.50 ? 359 ILE B CG1 1 
ATOM   5516  C CG2 . ILE B  1 334 ? 31.525  154.240 12.459  1.00 18.00 ? 359 ILE B CG2 1 
ATOM   5517  C CD1 . ILE B  1 334 ? 28.777  152.651 12.305  1.00 18.69 ? 359 ILE B CD1 1 
ATOM   5518  N N   . TRP B  1 335 ? 30.522  157.486 12.865  1.00 18.04 ? 360 TRP B N   1 
ATOM   5519  C CA  . TRP B  1 335 ? 31.593  158.449 13.142  1.00 18.26 ? 360 TRP B CA  1 
ATOM   5520  C C   . TRP B  1 335 ? 32.482  157.942 14.281  1.00 18.19 ? 360 TRP B C   1 
ATOM   5521  O O   . TRP B  1 335 ? 32.048  157.971 15.422  1.00 18.07 ? 360 TRP B O   1 
ATOM   5522  C CB  . TRP B  1 335 ? 31.058  159.848 13.538  1.00 16.98 ? 360 TRP B CB  1 
ATOM   5523  C CG  . TRP B  1 335 ? 32.244  160.808 13.705  1.00 19.13 ? 360 TRP B CG  1 
ATOM   5524  C CD1 . TRP B  1 335 ? 33.011  161.009 14.837  1.00 18.96 ? 360 TRP B CD1 1 
ATOM   5525  C CD2 . TRP B  1 335 ? 32.814  161.643 12.689  1.00 18.94 ? 360 TRP B CD2 1 
ATOM   5526  N NE1 . TRP B  1 335 ? 34.021  161.908 14.571  1.00 19.66 ? 360 TRP B NE1 1 
ATOM   5527  C CE2 . TRP B  1 335 ? 33.918  162.316 13.264  1.00 20.49 ? 360 TRP B CE2 1 
ATOM   5528  C CE3 . TRP B  1 335 ? 32.510  161.871 11.342  1.00 17.36 ? 360 TRP B CE3 1 
ATOM   5529  C CZ2 . TRP B  1 335 ? 34.714  163.211 12.535  1.00 20.03 ? 360 TRP B CZ2 1 
ATOM   5530  C CZ3 . TRP B  1 335 ? 33.294  162.759 10.623  1.00 17.56 ? 360 TRP B CZ3 1 
ATOM   5531  C CH2 . TRP B  1 335 ? 34.393  163.414 11.223  1.00 19.16 ? 360 TRP B CH2 1 
ATOM   5532  N N   . SER B  1 336 ? 33.713  157.490 14.017  1.00 19.26 ? 361 SER B N   1 
ATOM   5533  C CA  . SER B  1 336 ? 34.300  157.341 12.688  1.00 19.28 ? 361 SER B CA  1 
ATOM   5534  C C   . SER B  1 336 ? 35.082  156.024 12.704  1.00 20.36 ? 361 SER B C   1 
ATOM   5535  O O   . SER B  1 336 ? 35.422  155.502 13.766  1.00 20.18 ? 361 SER B O   1 
ATOM   5536  C CB  . SER B  1 336 ? 35.207  158.519 12.341  1.00 20.23 ? 361 SER B CB  1 
ATOM   5537  O OG  . SER B  1 336 ? 36.309  158.635 13.228  1.00 21.62 ? 361 SER B OG  1 
ATOM   5538  N N   . ILE B  1 337 ? 35.341  155.451 11.544  1.00 20.81 ? 362 ILE B N   1 
ATOM   5539  C CA  . ILE B  1 337 ? 35.870  154.098 11.560  1.00 21.70 ? 362 ILE B CA  1 
ATOM   5540  C C   . ILE B  1 337 ? 37.302  154.048 12.085  1.00 22.84 ? 362 ILE B C   1 
ATOM   5541  O O   . ILE B  1 337 ? 37.723  153.029 12.631  1.00 23.75 ? 362 ILE B O   1 
ATOM   5542  C CB  . ILE B  1 337 ? 35.691  153.369 10.200  1.00 22.82 ? 362 ILE B CB  1 
ATOM   5543  C CG1 . ILE B  1 337 ? 36.571  153.982 9.108   1.00 23.30 ? 362 ILE B CG1 1 
ATOM   5544  C CG2 . ILE B  1 337 ? 34.210  153.386 9.812   1.00 22.47 ? 362 ILE B CG2 1 
ATOM   5545  C CD1 . ILE B  1 337 ? 36.525  153.221 7.786   1.00 25.14 ? 362 ILE B CD1 1 
ATOM   5546  N N   . ASP B  1 338 ? 38.031  155.152 11.969  1.00 22.56 ? 363 ASP B N   1 
ATOM   5547  C CA  . ASP B  1 338 ? 39.364  155.180 12.512  1.00 24.42 ? 363 ASP B CA  1 
ATOM   5548  C C   . ASP B  1 338 ? 39.447  155.209 14.032  1.00 23.61 ? 363 ASP B C   1 
ATOM   5549  O O   . ASP B  1 338 ? 40.552  155.178 14.590  1.00 24.25 ? 363 ASP B O   1 
ATOM   5550  C CB  . ASP B  1 338 ? 40.254  156.264 11.883  1.00 25.26 ? 363 ASP B CB  1 
ATOM   5551  C CG  . ASP B  1 338 ? 39.496  157.560 11.485  1.00 27.10 ? 363 ASP B CG  1 
ATOM   5552  O OD1 . ASP B  1 338 ? 38.261  157.673 11.622  1.00 26.30 ? 363 ASP B OD1 1 
ATOM   5553  O OD2 . ASP B  1 338 ? 40.199  158.472 10.985  1.00 28.46 ? 363 ASP B OD2 1 
ATOM   5554  N N   . MET B  1 339 ? 38.293  155.240 14.695  1.00 22.16 ? 364 MET B N   1 
ATOM   5555  C CA  . MET B  1 339 ? 38.239  155.154 16.159  1.00 22.02 ? 364 MET B CA  1 
ATOM   5556  C C   . MET B  1 339 ? 37.650  153.834 16.646  1.00 21.99 ? 364 MET B C   1 
ATOM   5557  O O   . MET B  1 339 ? 37.589  153.590 17.849  1.00 21.37 ? 364 MET B O   1 
ATOM   5558  C CB  . MET B  1 339 ? 37.481  156.361 16.776  1.00 21.84 ? 364 MET B CB  1 
ATOM   5559  C CG  . MET B  1 339 ? 38.246  157.668 16.618  1.00 21.76 ? 364 MET B CG  1 
ATOM   5560  S SD  . MET B  1 339 ? 37.511  159.072 17.459  1.00 22.18 ? 364 MET B SD  1 
ATOM   5561  C CE  . MET B  1 339 ? 35.958  159.230 16.550  1.00 19.16 ? 364 MET B CE  1 
ATOM   5562  N N   . ASP B  1 340 ? 37.218  152.986 15.711  1.00 22.13 ? 365 ASP B N   1 
ATOM   5563  C CA  . ASP B  1 340 ? 36.880  151.602 16.040  1.00 22.56 ? 365 ASP B CA  1 
ATOM   5564  C C   . ASP B  1 340 ? 38.224  150.942 16.271  1.00 23.71 ? 365 ASP B C   1 
ATOM   5565  O O   . ASP B  1 340 ? 39.258  151.552 15.962  1.00 24.87 ? 365 ASP B O   1 
ATOM   5566  C CB  . ASP B  1 340 ? 36.156  150.949 14.863  1.00 22.38 ? 365 ASP B CB  1 
ATOM   5567  C CG  . ASP B  1 340 ? 35.411  149.663 15.247  1.00 22.79 ? 365 ASP B CG  1 
ATOM   5568  O OD1 . ASP B  1 340 ? 35.559  149.160 16.391  1.00 21.83 ? 365 ASP B OD1 1 
ATOM   5569  O OD2 . ASP B  1 340 ? 34.706  149.138 14.361  1.00 22.74 ? 365 ASP B OD2 1 
ATOM   5570  N N   . ASP B  1 341 ? 38.245  149.725 16.812  1.00 24.06 ? 366 ASP B N   1 
ATOM   5571  C CA  . ASP B  1 341 ? 39.510  148.992 16.935  1.00 25.52 ? 366 ASP B CA  1 
ATOM   5572  C C   . ASP B  1 341 ? 39.859  148.381 15.584  1.00 26.64 ? 366 ASP B C   1 
ATOM   5573  O O   . ASP B  1 341 ? 39.748  147.163 15.396  1.00 27.25 ? 366 ASP B O   1 
ATOM   5574  C CB  . ASP B  1 341 ? 39.403  147.903 18.025  1.00 26.17 ? 366 ASP B CB  1 
ATOM   5575  C CG  . ASP B  1 341 ? 40.724  147.241 18.327  1.00 28.19 ? 366 ASP B CG  1 
ATOM   5576  O OD1 . ASP B  1 341 ? 41.774  147.819 17.999  1.00 29.97 ? 366 ASP B OD1 1 
ATOM   5577  O OD2 . ASP B  1 341 ? 40.722  146.128 18.895  1.00 30.78 ? 366 ASP B OD2 1 
ATOM   5578  N N   . PHE B  1 342 ? 40.266  149.229 14.637  1.00 26.57 ? 367 PHE B N   1 
ATOM   5579  C CA  . PHE B  1 342 ? 40.427  148.809 13.244  1.00 27.88 ? 367 PHE B CA  1 
ATOM   5580  C C   . PHE B  1 342 ? 41.495  147.725 13.015  1.00 30.55 ? 367 PHE B C   1 
ATOM   5581  O O   . PHE B  1 342 ? 41.342  146.880 12.119  1.00 31.97 ? 367 PHE B O   1 
ATOM   5582  C CB  . PHE B  1 342 ? 40.654  150.016 12.316  1.00 27.38 ? 367 PHE B CB  1 
ATOM   5583  C CG  . PHE B  1 342 ? 41.836  150.872 12.695  1.00 27.32 ? 367 PHE B CG  1 
ATOM   5584  C CD1 . PHE B  1 342 ? 41.700  151.900 13.613  1.00 25.76 ? 367 PHE B CD1 1 
ATOM   5585  C CD2 . PHE B  1 342 ? 43.085  150.650 12.117  1.00 29.00 ? 367 PHE B CD2 1 
ATOM   5586  C CE1 . PHE B  1 342 ? 42.787  152.685 13.968  1.00 27.00 ? 367 PHE B CE1 1 
ATOM   5587  C CE2 . PHE B  1 342 ? 44.180  151.429 12.460  1.00 30.48 ? 367 PHE B CE2 1 
ATOM   5588  C CZ  . PHE B  1 342 ? 44.033  152.451 13.382  1.00 28.21 ? 367 PHE B CZ  1 
ATOM   5589  N N   . THR B  1 343 ? 42.564  147.747 13.815  1.00 31.39 ? 368 THR B N   1 
ATOM   5590  C CA  . THR B  1 343 ? 43.576  146.696 13.770  1.00 33.79 ? 368 THR B CA  1 
ATOM   5591  C C   . THR B  1 343 ? 43.172  145.446 14.537  1.00 33.97 ? 368 THR B C   1 
ATOM   5592  O O   . THR B  1 343 ? 43.737  144.392 14.312  1.00 35.41 ? 368 THR B O   1 
ATOM   5593  C CB  . THR B  1 343 ? 44.949  147.158 14.333  1.00 34.67 ? 368 THR B CB  1 
ATOM   5594  O OG1 . THR B  1 343 ? 44.839  147.369 15.746  1.00 35.18 ? 368 THR B OG1 1 
ATOM   5595  C CG2 . THR B  1 343 ? 45.406  148.438 13.674  1.00 35.09 ? 368 THR B CG2 1 
ATOM   5596  N N   . GLY B  1 344 ? 42.207  145.554 15.447  1.00 32.96 ? 369 GLY B N   1 
ATOM   5597  C CA  . GLY B  1 344 ? 41.840  144.426 16.292  1.00 33.73 ? 369 GLY B CA  1 
ATOM   5598  C C   . GLY B  1 344 ? 42.833  144.131 17.408  1.00 35.08 ? 369 GLY B C   1 
ATOM   5599  O O   . GLY B  1 344 ? 42.654  143.182 18.168  1.00 35.83 ? 369 GLY B O   1 
ATOM   5600  N N   . LYS B  1 345 ? 43.882  144.933 17.534  1.00 35.81 ? 370 LYS B N   1 
ATOM   5601  C CA  . LYS B  1 345 ? 44.906  144.622 18.537  1.00 38.07 ? 370 LYS B CA  1 
ATOM   5602  C C   . LYS B  1 345 ? 44.554  145.086 19.953  1.00 37.23 ? 370 LYS B C   1 
ATOM   5603  O O   . LYS B  1 345 ? 45.211  144.703 20.911  1.00 38.35 ? 370 LYS B O   1 
ATOM   5604  C CB  . LYS B  1 345 ? 46.261  145.202 18.126  1.00 39.65 ? 370 LYS B CB  1 
ATOM   5605  C CG  . LYS B  1 345 ? 46.671  144.854 16.706  1.00 42.38 ? 370 LYS B CG  1 
ATOM   5606  C CD  . LYS B  1 345 ? 47.564  143.647 16.647  1.00 48.78 ? 370 LYS B CD  1 
ATOM   5607  C CE  . LYS B  1 345 ? 49.048  144.030 16.530  1.00 52.74 ? 370 LYS B CE  1 
ATOM   5608  N NZ  . LYS B  1 345 ? 49.408  144.646 15.205  1.00 54.16 ? 370 LYS B NZ  1 
ATOM   5609  N N   . SER B  1 346 ? 43.536  145.917 20.103  1.00 35.26 ? 371 SER B N   1 
ATOM   5610  C CA  . SER B  1 346 ? 43.272  146.440 21.431  1.00 35.20 ? 371 SER B CA  1 
ATOM   5611  C C   . SER B  1 346 ? 42.238  145.635 22.188  1.00 34.87 ? 371 SER B C   1 
ATOM   5612  O O   . SER B  1 346 ? 42.462  145.254 23.339  1.00 35.92 ? 371 SER B O   1 
ATOM   5613  C CB  . SER B  1 346 ? 42.827  147.902 21.389  1.00 33.41 ? 371 SER B CB  1 
ATOM   5614  O OG  . SER B  1 346 ? 42.692  148.370 22.722  1.00 33.43 ? 371 SER B OG  1 
ATOM   5615  N N   . CYS B  1 347 ? 41.127  145.353 21.514  1.00 33.81 ? 372 CYS B N   1 
ATOM   5616  C CA  . CYS B  1 347 ? 39.911  144.900 22.155  1.00 32.74 ? 372 CYS B CA  1 
ATOM   5617  C C   . CYS B  1 347 ? 39.714  143.386 22.143  1.00 34.00 ? 372 CYS B C   1 
ATOM   5618  O O   . CYS B  1 347 ? 38.806  142.866 22.796  1.00 33.32 ? 372 CYS B O   1 
ATOM   5619  C CB  . CYS B  1 347 ? 38.731  145.598 21.489  1.00 32.02 ? 372 CYS B CB  1 
ATOM   5620  S SG  . CYS B  1 347 ? 38.784  147.395 21.729  1.00 31.35 ? 372 CYS B SG  1 
ATOM   5621  N N   . ASN B  1 348 ? 40.556  142.690 21.385  1.00 34.83 ? 373 ASN B N   1 
ATOM   5622  C CA  . ASN B  1 348 ? 40.475  141.245 21.272  1.00 36.23 ? 373 ASN B CA  1 
ATOM   5623  C C   . ASN B  1 348 ? 39.131  140.758 20.730  1.00 35.18 ? 373 ASN B C   1 
ATOM   5624  O O   . ASN B  1 348 ? 38.675  139.683 21.106  1.00 36.46 ? 373 ASN B O   1 
ATOM   5625  C CB  . ASN B  1 348 ? 40.739  140.596 22.631  1.00 37.06 ? 373 ASN B CB  1 
ATOM   5626  C CG  . ASN B  1 348 ? 41.043  139.124 22.513  1.00 40.45 ? 373 ASN B CG  1 
ATOM   5627  O OD1 . ASN B  1 348 ? 40.598  138.315 23.328  1.00 43.98 ? 373 ASN B OD1 1 
ATOM   5628  N ND2 . ASN B  1 348 ? 41.815  138.761 21.494  1.00 42.67 ? 373 ASN B ND2 1 
ATOM   5629  N N   . GLN B  1 349 ? 38.507  141.548 19.862  1.00 33.18 ? 374 GLN B N   1 
ATOM   5630  C CA  . GLN B  1 349 ? 37.206  141.230 19.282  1.00 32.04 ? 374 GLN B CA  1 
ATOM   5631  C C   . GLN B  1 349 ? 37.326  141.217 17.745  1.00 32.11 ? 374 GLN B C   1 
ATOM   5632  O O   . GLN B  1 349 ? 36.329  141.339 17.044  1.00 30.89 ? 374 GLN B O   1 
ATOM   5633  C CB  . GLN B  1 349 ? 36.170  142.292 19.712  1.00 30.65 ? 374 GLN B CB  1 
ATOM   5634  C CG  . GLN B  1 349 ? 35.709  142.240 21.190  1.00 31.19 ? 374 GLN B CG  1 
ATOM   5635  C CD  . GLN B  1 349 ? 34.878  143.462 21.622  1.00 32.59 ? 374 GLN B CD  1 
ATOM   5636  O OE1 . GLN B  1 349 ? 35.396  144.579 21.736  1.00 33.11 ? 374 GLN B OE1 1 
ATOM   5637  N NE2 . GLN B  1 349 ? 33.585  143.246 21.877  1.00 32.32 ? 374 GLN B NE2 1 
ATOM   5638  N N   . GLY B  1 350 ? 38.553  141.073 17.234  1.00 32.70 ? 375 GLY B N   1 
ATOM   5639  C CA  . GLY B  1 350 ? 38.826  141.115 15.784  1.00 32.96 ? 375 GLY B CA  1 
ATOM   5640  C C   . GLY B  1 350 ? 38.914  142.550 15.261  1.00 31.76 ? 375 GLY B C   1 
ATOM   5641  O O   . GLY B  1 350 ? 38.719  143.497 16.019  1.00 30.62 ? 375 GLY B O   1 
ATOM   5642  N N   . PRO B  1 351 ? 39.191  142.729 13.953  1.00 31.90 ? 376 PRO B N   1 
ATOM   5643  C CA  . PRO B  1 351 ? 39.236  144.084 13.376  1.00 30.93 ? 376 PRO B CA  1 
ATOM   5644  C C   . PRO B  1 351 ? 37.850  144.743 13.237  1.00 29.06 ? 376 PRO B C   1 
ATOM   5645  O O   . PRO B  1 351 ? 36.872  144.085 12.867  1.00 28.43 ? 376 PRO B O   1 
ATOM   5646  C CB  . PRO B  1 351 ? 39.872  143.882 11.989  1.00 32.20 ? 376 PRO B CB  1 
ATOM   5647  C CG  . PRO B  1 351 ? 40.251  142.420 11.907  1.00 34.06 ? 376 PRO B CG  1 
ATOM   5648  C CD  . PRO B  1 351 ? 39.457  141.687 12.953  1.00 33.70 ? 376 PRO B CD  1 
ATOM   5649  N N   . TYR B  1 352 ? 37.785  146.032 13.551  1.00 27.51 ? 377 TYR B N   1 
ATOM   5650  C CA  . TYR B  1 352 ? 36.542  146.808 13.473  1.00 26.37 ? 377 TYR B CA  1 
ATOM   5651  C C   . TYR B  1 352 ? 35.390  146.102 14.175  1.00 26.19 ? 377 TYR B C   1 
ATOM   5652  O O   . TYR B  1 352 ? 34.345  145.870 13.553  1.00 26.42 ? 377 TYR B O   1 
ATOM   5653  C CB  . TYR B  1 352 ? 36.121  147.055 12.019  1.00 26.24 ? 377 TYR B CB  1 
ATOM   5654  C CG  . TYR B  1 352 ? 37.056  147.915 11.183  1.00 26.92 ? 377 TYR B CG  1 
ATOM   5655  C CD1 . TYR B  1 352 ? 37.023  149.292 11.265  1.00 26.47 ? 377 TYR B CD1 1 
ATOM   5656  C CD2 . TYR B  1 352 ? 37.944  147.340 10.281  1.00 27.65 ? 377 TYR B CD2 1 
ATOM   5657  C CE1 . TYR B  1 352 ? 37.852  150.071 10.507  1.00 25.49 ? 377 TYR B CE1 1 
ATOM   5658  C CE2 . TYR B  1 352 ? 38.778  148.119 9.503   1.00 28.91 ? 377 TYR B CE2 1 
ATOM   5659  C CZ  . TYR B  1 352 ? 38.730  149.487 9.627   1.00 28.52 ? 377 TYR B CZ  1 
ATOM   5660  O OH  . TYR B  1 352 ? 39.547  150.293 8.862   1.00 30.43 ? 377 TYR B OH  1 
ATOM   5661  N N   . PRO B  1 353 ? 35.558  145.775 15.465  1.00 25.48 ? 378 PRO B N   1 
ATOM   5662  C CA  . PRO B  1 353 ? 34.491  145.031 16.155  1.00 25.36 ? 378 PRO B CA  1 
ATOM   5663  C C   . PRO B  1 353 ? 33.142  145.763 16.130  1.00 23.73 ? 378 PRO B C   1 
ATOM   5664  O O   . PRO B  1 353 ? 32.114  145.122 15.963  1.00 22.92 ? 378 PRO B O   1 
ATOM   5665  C CB  . PRO B  1 353 ? 35.021  144.897 17.589  1.00 25.05 ? 378 PRO B CB  1 
ATOM   5666  C CG  . PRO B  1 353 ? 36.001  146.032 17.740  1.00 24.80 ? 378 PRO B CG  1 
ATOM   5667  C CD  . PRO B  1 353 ? 36.647  146.154 16.377  1.00 25.11 ? 378 PRO B CD  1 
ATOM   5668  N N   . LEU B  1 354 ? 33.150  147.094 16.255  1.00 23.19 ? 379 LEU B N   1 
ATOM   5669  C CA  . LEU B  1 354 ? 31.907  147.847 16.265  1.00 21.97 ? 379 LEU B CA  1 
ATOM   5670  C C   . LEU B  1 354 ? 31.248  147.903 14.880  1.00 22.42 ? 379 LEU B C   1 
ATOM   5671  O O   . LEU B  1 354 ? 30.057  147.603 14.741  1.00 21.35 ? 379 LEU B O   1 
ATOM   5672  C CB  . LEU B  1 354 ? 32.105  149.275 16.812  1.00 21.24 ? 379 LEU B CB  1 
ATOM   5673  C CG  . LEU B  1 354 ? 32.631  149.370 18.248  1.00 20.79 ? 379 LEU B CG  1 
ATOM   5674  C CD1 . LEU B  1 354 ? 32.777  150.807 18.668  1.00 20.72 ? 379 LEU B CD1 1 
ATOM   5675  C CD2 . LEU B  1 354 ? 31.732  148.609 19.229  1.00 22.09 ? 379 LEU B CD2 1 
ATOM   5676  N N   . VAL B  1 355 ? 32.005  148.306 13.863  1.00 21.52 ? 380 VAL B N   1 
ATOM   5677  C CA  . VAL B  1 355 ? 31.421  148.444 12.542  1.00 21.54 ? 380 VAL B CA  1 
ATOM   5678  C C   . VAL B  1 355 ? 31.029  147.062 12.009  1.00 22.77 ? 380 VAL B C   1 
ATOM   5679  O O   . VAL B  1 355 ? 30.002  146.907 11.352  1.00 21.90 ? 380 VAL B O   1 
ATOM   5680  C CB  . VAL B  1 355 ? 32.373  149.199 11.581  1.00 21.93 ? 380 VAL B CB  1 
ATOM   5681  C CG1 . VAL B  1 355 ? 31.738  149.439 10.224  1.00 22.03 ? 380 VAL B CG1 1 
ATOM   5682  C CG2 . VAL B  1 355 ? 32.788  150.539 12.205  1.00 20.37 ? 380 VAL B CG2 1 
ATOM   5683  N N   . GLN B  1 356 ? 31.838  146.049 12.293  1.00 23.57 ? 381 GLN B N   1 
ATOM   5684  C CA  . GLN B  1 356 ? 31.486  144.704 11.880  1.00 25.74 ? 381 GLN B CA  1 
ATOM   5685  C C   . GLN B  1 356 ? 30.152  144.266 12.493  1.00 25.12 ? 381 GLN B C   1 
ATOM   5686  O O   . GLN B  1 356 ? 29.366  143.583 11.840  1.00 25.58 ? 381 GLN B O   1 
ATOM   5687  C CB  . GLN B  1 356 ? 32.606  143.727 12.243  1.00 27.44 ? 381 GLN B CB  1 
ATOM   5688  C CG  . GLN B  1 356 ? 32.384  142.330 11.744  1.00 31.72 ? 381 GLN B CG  1 
ATOM   5689  C CD  . GLN B  1 356 ? 32.345  142.259 10.228  1.00 35.06 ? 381 GLN B CD  1 
ATOM   5690  O OE1 . GLN B  1 356 ? 31.523  141.545 9.669   1.00 38.28 ? 381 GLN B OE1 1 
ATOM   5691  N NE2 . GLN B  1 356 ? 33.232  142.991 9.561   1.00 33.42 ? 381 GLN B NE2 1 
ATOM   5692  N N   . ALA B  1 357 ? 29.894  144.656 13.737  1.00 24.15 ? 382 ALA B N   1 
ATOM   5693  C CA  . ALA B  1 357 ? 28.624  144.280 14.399  1.00 24.52 ? 382 ALA B CA  1 
ATOM   5694  C C   . ALA B  1 357 ? 27.452  144.973 13.712  1.00 24.09 ? 382 ALA B C   1 
ATOM   5695  O O   . ALA B  1 357 ? 26.388  144.376 13.504  1.00 24.67 ? 382 ALA B O   1 
ATOM   5696  C CB  . ALA B  1 357 ? 28.662  144.631 15.899  1.00 23.93 ? 382 ALA B CB  1 
ATOM   5697  N N   . VAL B  1 358 ? 27.656  146.235 13.339  1.00 22.72 ? 383 VAL B N   1 
ATOM   5698  C CA  . VAL B  1 358 ? 26.648  146.966 12.601  1.00 22.03 ? 383 VAL B CA  1 
ATOM   5699  C C   . VAL B  1 358 ? 26.370  146.288 11.260  1.00 23.57 ? 383 VAL B C   1 
ATOM   5700  O O   . VAL B  1 358 ? 25.211  146.054 10.914  1.00 23.77 ? 383 VAL B O   1 
ATOM   5701  C CB  . VAL B  1 358 ? 27.039  148.445 12.409  1.00 21.70 ? 383 VAL B CB  1 
ATOM   5702  C CG1 . VAL B  1 358 ? 26.031  149.155 11.508  1.00 19.54 ? 383 VAL B CG1 1 
ATOM   5703  C CG2 . VAL B  1 358 ? 27.123  149.138 13.770  1.00 20.37 ? 383 VAL B CG2 1 
ATOM   5704  N N   . LYS B  1 359 ? 27.426  145.942 10.520  1.00 24.18 ? 384 LYS B N   1 
ATOM   5705  C CA  . LYS B  1 359 ? 27.246  145.262 9.233   1.00 26.13 ? 384 LYS B CA  1 
ATOM   5706  C C   . LYS B  1 359 ? 26.505  143.935 9.441   1.00 27.68 ? 384 LYS B C   1 
ATOM   5707  O O   . LYS B  1 359 ? 25.525  143.651 8.761   1.00 28.26 ? 384 LYS B O   1 
ATOM   5708  C CB  . LYS B  1 359 ? 28.592  145.058 8.518   1.00 26.50 ? 384 LYS B CB  1 
ATOM   5709  C CG  . LYS B  1 359 ? 28.524  144.259 7.204   1.00 29.60 ? 384 LYS B CG  1 
ATOM   5710  C CD  . LYS B  1 359 ? 29.890  144.171 6.552   1.00 30.77 ? 384 LYS B CD  1 
ATOM   5711  C CE  . LYS B  1 359 ? 29.875  143.231 5.358   1.00 33.98 ? 384 LYS B CE  1 
ATOM   5712  N NZ  . LYS B  1 359 ? 31.239  143.054 4.777   1.00 35.44 ? 384 LYS B NZ  1 
ATOM   5713  N N   . ARG B  1 360 ? 26.955  143.124 10.385  1.00 28.56 ? 385 ARG B N   1 
ATOM   5714  C CA  . ARG B  1 360 ? 26.266  141.859 10.616  1.00 31.08 ? 385 ARG B CA  1 
ATOM   5715  C C   . ARG B  1 360 ? 24.790  142.042 11.012  1.00 30.51 ? 385 ARG B C   1 
ATOM   5716  O O   . ARG B  1 360 ? 23.913  141.308 10.562  1.00 30.74 ? 385 ARG B O   1 
ATOM   5717  C CB  . ARG B  1 360 ? 26.972  141.050 11.687  1.00 31.99 ? 385 ARG B CB  1 
ATOM   5718  C CG  . ARG B  1 360 ? 26.086  139.936 12.226  1.00 35.39 ? 385 ARG B CG  1 
ATOM   5719  C CD  . ARG B  1 360 ? 26.937  138.912 12.904  1.00 40.93 ? 385 ARG B CD  1 
ATOM   5720  N NE  . ARG B  1 360 ? 28.273  139.450 13.111  1.00 43.52 ? 385 ARG B NE  1 
ATOM   5721  C CZ  . ARG B  1 360 ? 28.622  140.212 14.139  1.00 42.49 ? 385 ARG B CZ  1 
ATOM   5722  N NH1 . ARG B  1 360 ? 27.727  140.503 15.072  1.00 42.07 ? 385 ARG B NH1 1 
ATOM   5723  N NH2 . ARG B  1 360 ? 29.873  140.658 14.237  1.00 40.49 ? 385 ARG B NH2 1 
ATOM   5724  N N   . SER B  1 361 ? 24.518  143.012 11.872  1.00 29.05 ? 386 SER B N   1 
ATOM   5725  C CA  . SER B  1 361 ? 23.138  143.298 12.262  1.00 29.57 ? 386 SER B CA  1 
ATOM   5726  C C   . SER B  1 361 ? 22.272  143.774 11.082  1.00 30.01 ? 386 SER B C   1 
ATOM   5727  O O   . SER B  1 361 ? 21.103  143.396 10.973  1.00 30.20 ? 386 SER B O   1 
ATOM   5728  C CB  . SER B  1 361 ? 23.113  144.321 13.396  1.00 28.43 ? 386 SER B CB  1 
ATOM   5729  O OG  . SER B  1 361 ? 23.726  143.791 14.557  1.00 29.69 ? 386 SER B OG  1 
ATOM   5730  N N   . LEU B  1 362 ? 22.841  144.599 10.199  1.00 29.49 ? 387 LEU B N   1 
ATOM   5731  C CA  . LEU B  1 362 ? 22.109  145.092 9.025   1.00 30.67 ? 387 LEU B CA  1 
ATOM   5732  C C   . LEU B  1 362 ? 21.739  143.987 8.028   1.00 34.18 ? 387 LEU B C   1 
ATOM   5733  O O   . LEU B  1 362 ? 20.680  144.043 7.415   1.00 34.45 ? 387 LEU B O   1 
ATOM   5734  C CB  . LEU B  1 362 ? 22.909  146.172 8.282   1.00 29.03 ? 387 LEU B CB  1 
ATOM   5735  C CG  . LEU B  1 362 ? 23.108  147.498 9.018   1.00 26.54 ? 387 LEU B CG  1 
ATOM   5736  C CD1 . LEU B  1 362 ? 24.008  148.432 8.208   1.00 25.30 ? 387 LEU B CD1 1 
ATOM   5737  C CD2 . LEU B  1 362 ? 21.785  148.108 9.210   1.00 25.63 ? 387 LEU B CD2 1 
ATOM   5738  N N   . GLY B  1 363 ? 22.621  143.006 7.862   1.00 36.43 ? 388 GLY B N   1 
ATOM   5739  C CA  . GLY B  1 363 ? 22.423  141.949 6.874   1.00 40.87 ? 388 GLY B CA  1 
ATOM   5740  C C   . GLY B  1 363 ? 21.432  140.912 7.363   1.00 43.66 ? 388 GLY B C   1 
ATOM   5741  O O   . GLY B  1 363 ? 21.356  139.808 6.830   1.00 45.89 ? 388 GLY B O   1 
ATOM   5742  N N   . SER B  1 364 ? 20.644  141.320 8.358   1.00 44.69 ? 389 SER B N   1 
ATOM   5743  C CA  . SER B  1 364 ? 19.753  140.470 9.164   1.00 46.30 ? 389 SER B CA  1 
ATOM   5744  C C   . SER B  1 364 ? 20.543  139.568 10.099  1.00 47.20 ? 389 SER B C   1 
ATOM   5745  O O   . SER B  1 364 ? 20.948  140.008 11.178  1.00 46.44 ? 389 SER B O   1 
ATOM   5746  C CB  . SER B  1 364 ? 18.735  139.677 8.338   1.00 48.49 ? 389 SER B CB  1 
ATOM   5747  O OG  . SER B  1 364 ? 17.951  138.843 9.185   1.00 50.31 ? 389 SER B OG  1 
ATOM   5748  N N   . ALA C  1 1   ? 31.261  137.336 69.384  1.00 40.66 ? 26  ALA C N   1 
ATOM   5749  C CA  . ALA C  1 1   ? 29.923  137.145 70.021  1.00 39.04 ? 26  ALA C CA  1 
ATOM   5750  C C   . ALA C  1 1   ? 29.523  135.674 69.987  1.00 36.89 ? 26  ALA C C   1 
ATOM   5751  O O   . ALA C  1 1   ? 29.653  134.997 68.944  1.00 37.60 ? 26  ALA C O   1 
ATOM   5752  C CB  . ALA C  1 1   ? 28.866  138.017 69.321  1.00 39.28 ? 26  ALA C CB  1 
ATOM   5753  N N   . TYR C  1 2   ? 29.025  135.164 71.108  1.00 34.69 ? 27  TYR C N   1 
ATOM   5754  C CA  . TYR C  1 2   ? 28.572  133.785 71.140  1.00 31.47 ? 27  TYR C CA  1 
ATOM   5755  C C   . TYR C  1 2   ? 27.252  133.676 70.389  1.00 30.29 ? 27  TYR C C   1 
ATOM   5756  O O   . TYR C  1 2   ? 26.413  134.573 70.461  1.00 30.20 ? 27  TYR C O   1 
ATOM   5757  C CB  . TYR C  1 2   ? 28.417  133.285 72.585  1.00 30.99 ? 27  TYR C CB  1 
ATOM   5758  C CG  . TYR C  1 2   ? 29.725  133.225 73.341  1.00 31.11 ? 27  TYR C CG  1 
ATOM   5759  C CD1 . TYR C  1 2   ? 30.720  132.339 72.960  1.00 31.03 ? 27  TYR C CD1 1 
ATOM   5760  C CD2 . TYR C  1 2   ? 29.980  134.076 74.400  1.00 32.34 ? 27  TYR C CD2 1 
ATOM   5761  C CE1 . TYR C  1 2   ? 31.931  132.285 73.627  1.00 31.56 ? 27  TYR C CE1 1 
ATOM   5762  C CE2 . TYR C  1 2   ? 31.198  134.029 75.080  1.00 34.76 ? 27  TYR C CE2 1 
ATOM   5763  C CZ  . TYR C  1 2   ? 32.166  133.116 74.684  1.00 33.61 ? 27  TYR C CZ  1 
ATOM   5764  O OH  . TYR C  1 2   ? 33.381  133.040 75.344  1.00 35.09 ? 27  TYR C OH  1 
ATOM   5765  N N   . LYS C  1 3   ? 27.082  132.579 69.662  1.00 27.91 ? 28  LYS C N   1 
ATOM   5766  C CA  . LYS C  1 3   ? 25.823  132.276 69.034  1.00 26.38 ? 28  LYS C CA  1 
ATOM   5767  C C   . LYS C  1 3   ? 24.894  131.558 70.018  1.00 24.84 ? 28  LYS C C   1 
ATOM   5768  O O   . LYS C  1 3   ? 25.344  130.880 70.952  1.00 24.76 ? 28  LYS C O   1 
ATOM   5769  C CB  . LYS C  1 3   ? 26.049  131.402 67.794  1.00 25.13 ? 28  LYS C CB  1 
ATOM   5770  C CG  . LYS C  1 3   ? 26.995  132.025 66.750  1.00 26.86 ? 28  LYS C CG  1 
ATOM   5771  C CD  . LYS C  1 3   ? 27.289  131.016 65.606  1.00 26.91 ? 28  LYS C CD  1 
ATOM   5772  C CE  . LYS C  1 3   ? 28.006  131.674 64.426  1.00 27.68 ? 28  LYS C CE  1 
ATOM   5773  N NZ  . LYS C  1 3   ? 29.280  132.276 64.854  1.00 29.37 ? 28  LYS C NZ  1 
ATOM   5774  N N   . LEU C  1 4   ? 23.598  131.711 69.790  1.00 23.68 ? 29  LEU C N   1 
ATOM   5775  C CA  . LEU C  1 4   ? 22.576  130.956 70.494  1.00 22.46 ? 29  LEU C CA  1 
ATOM   5776  C C   . LEU C  1 4   ? 21.648  130.444 69.408  1.00 21.70 ? 29  LEU C C   1 
ATOM   5777  O O   . LEU C  1 4   ? 20.847  131.194 68.862  1.00 21.44 ? 29  LEU C O   1 
ATOM   5778  C CB  . LEU C  1 4   ? 21.829  131.826 71.517  1.00 22.64 ? 29  LEU C CB  1 
ATOM   5779  C CG  . LEU C  1 4   ? 20.750  131.039 72.291  1.00 21.91 ? 29  LEU C CG  1 
ATOM   5780  C CD1 . LEU C  1 4   ? 21.248  129.665 72.816  1.00 19.49 ? 29  LEU C CD1 1 
ATOM   5781  C CD2 . LEU C  1 4   ? 20.173  131.852 73.441  1.00 21.77 ? 29  LEU C CD2 1 
ATOM   5782  N N   . VAL C  1 5   ? 21.825  129.169 69.067  1.00 21.31 ? 30  VAL C N   1 
ATOM   5783  C CA  . VAL C  1 5   ? 21.215  128.551 67.894  1.00 20.65 ? 30  VAL C CA  1 
ATOM   5784  C C   . VAL C  1 5   ? 20.097  127.659 68.377  1.00 20.13 ? 30  VAL C C   1 
ATOM   5785  O O   . VAL C  1 5   ? 20.330  126.711 69.099  1.00 20.51 ? 30  VAL C O   1 
ATOM   5786  C CB  . VAL C  1 5   ? 22.226  127.681 67.146  1.00 20.46 ? 30  VAL C CB  1 
ATOM   5787  C CG1 . VAL C  1 5   ? 21.556  127.011 65.922  1.00 20.64 ? 30  VAL C CG1 1 
ATOM   5788  C CG2 . VAL C  1 5   ? 23.468  128.506 66.713  1.00 21.58 ? 30  VAL C CG2 1 
ATOM   5789  N N   . CYS C  1 6   ? 18.884  127.952 67.956  1.00 20.29 ? 31  CYS C N   1 
ATOM   5790  C CA  . CYS C  1 6   ? 17.712  127.362 68.552  1.00 20.27 ? 31  CYS C CA  1 
ATOM   5791  C C   . CYS C  1 6   ? 16.879  126.582 67.547  1.00 19.89 ? 31  CYS C C   1 
ATOM   5792  O O   . CYS C  1 6   ? 16.279  127.167 66.647  1.00 19.55 ? 31  CYS C O   1 
ATOM   5793  C CB  . CYS C  1 6   ? 16.858  128.487 69.139  1.00 20.70 ? 31  CYS C CB  1 
ATOM   5794  S SG  . CYS C  1 6   ? 17.647  129.267 70.551  1.00 24.01 ? 31  CYS C SG  1 
ATOM   5795  N N   . TYR C  1 7   ? 16.805  125.267 67.724  1.00 18.97 ? 32  TYR C N   1 
ATOM   5796  C CA  . TYR C  1 7   ? 15.999  124.465 66.829  1.00 18.55 ? 32  TYR C CA  1 
ATOM   5797  C C   . TYR C  1 7   ? 14.567  124.520 67.332  1.00 19.00 ? 32  TYR C C   1 
ATOM   5798  O O   . TYR C  1 7   ? 14.334  124.522 68.542  1.00 18.70 ? 32  TYR C O   1 
ATOM   5799  C CB  . TYR C  1 7   ? 16.445  123.008 66.873  1.00 18.37 ? 32  TYR C CB  1 
ATOM   5800  C CG  . TYR C  1 7   ? 17.649  122.629 66.050  1.00 17.58 ? 32  TYR C CG  1 
ATOM   5801  C CD1 . TYR C  1 7   ? 17.516  122.301 64.703  1.00 19.25 ? 32  TYR C CD1 1 
ATOM   5802  C CD2 . TYR C  1 7   ? 18.905  122.504 66.642  1.00 18.10 ? 32  TYR C CD2 1 
ATOM   5803  C CE1 . TYR C  1 7   ? 18.620  121.894 63.942  1.00 19.45 ? 32  TYR C CE1 1 
ATOM   5804  C CE2 . TYR C  1 7   ? 20.005  122.121 65.903  1.00 18.30 ? 32  TYR C CE2 1 
ATOM   5805  C CZ  . TYR C  1 7   ? 19.859  121.803 64.557  1.00 18.76 ? 32  TYR C CZ  1 
ATOM   5806  O OH  . TYR C  1 7   ? 20.960  121.403 63.818  1.00 19.27 ? 32  TYR C OH  1 
ATOM   5807  N N   . PHE C  1 8   ? 13.616  124.573 66.410  1.00 18.81 ? 33  PHE C N   1 
ATOM   5808  C CA  . PHE C  1 8   ? 12.216  124.346 66.745  1.00 19.85 ? 33  PHE C CA  1 
ATOM   5809  C C   . PHE C  1 8   ? 11.621  123.365 65.743  1.00 20.15 ? 33  PHE C C   1 
ATOM   5810  O O   . PHE C  1 8   ? 12.193  123.138 64.671  1.00 20.03 ? 33  PHE C O   1 
ATOM   5811  C CB  . PHE C  1 8   ? 11.409  125.655 66.839  1.00 20.57 ? 33  PHE C CB  1 
ATOM   5812  C CG  . PHE C  1 8   ? 11.202  126.358 65.520  1.00 22.10 ? 33  PHE C CG  1 
ATOM   5813  C CD1 . PHE C  1 8   ? 12.199  127.164 64.981  1.00 21.22 ? 33  PHE C CD1 1 
ATOM   5814  C CD2 . PHE C  1 8   ? 9.996   126.220 64.818  1.00 22.23 ? 33  PHE C CD2 1 
ATOM   5815  C CE1 . PHE C  1 8   ? 12.005  127.824 63.765  1.00 23.73 ? 33  PHE C CE1 1 
ATOM   5816  C CE2 . PHE C  1 8   ? 9.806   126.881 63.594  1.00 23.77 ? 33  PHE C CE2 1 
ATOM   5817  C CZ  . PHE C  1 8   ? 10.812  127.673 63.071  1.00 22.75 ? 33  PHE C CZ  1 
ATOM   5818  N N   . THR C  1 9   ? 10.494  122.759 66.096  1.00 20.39 ? 34  THR C N   1 
ATOM   5819  C CA  . THR C  1 9   ? 10.035  121.610 65.352  1.00 19.92 ? 34  THR C CA  1 
ATOM   5820  C C   . THR C  1 9   ? 8.620   121.771 64.810  1.00 22.06 ? 34  THR C C   1 
ATOM   5821  O O   . THR C  1 9   ? 7.789   122.483 65.374  1.00 21.74 ? 34  THR C O   1 
ATOM   5822  C CB  . THR C  1 9   ? 10.094  120.340 66.196  1.00 19.70 ? 34  THR C CB  1 
ATOM   5823  O OG1 . THR C  1 9   ? 8.991   120.321 67.116  1.00 18.51 ? 34  THR C OG1 1 
ATOM   5824  C CG2 . THR C  1 9   ? 11.443  120.271 66.957  1.00 18.34 ? 34  THR C CG2 1 
ATOM   5825  N N   . ASN C  1 10  ? 8.377   121.088 63.701  1.00 22.07 ? 35  ASN C N   1 
ATOM   5826  C CA  . ASN C  1 10  ? 7.103   121.135 63.002  1.00 24.61 ? 35  ASN C CA  1 
ATOM   5827  C C   . ASN C  1 10  ? 5.998   120.359 63.729  1.00 24.12 ? 35  ASN C C   1 
ATOM   5828  O O   . ASN C  1 10  ? 4.814   120.708 63.637  1.00 26.59 ? 35  ASN C O   1 
ATOM   5829  C CB  . ASN C  1 10  ? 7.335   120.646 61.548  1.00 25.74 ? 35  ASN C CB  1 
ATOM   5830  C CG  . ASN C  1 10  ? 6.331   119.604 61.084  1.00 32.12 ? 35  ASN C CG  1 
ATOM   5831  O OD1 . ASN C  1 10  ? 5.143   119.688 61.394  1.00 38.28 ? 35  ASN C OD1 1 
ATOM   5832  N ND2 . ASN C  1 10  ? 6.804   118.619 60.313  1.00 36.13 ? 35  ASN C ND2 1 
ATOM   5833  N N   . TRP C  1 11  ? 6.366   119.323 64.472  1.00 22.54 ? 36  TRP C N   1 
ATOM   5834  C CA  . TRP C  1 11  ? 5.352   118.461 65.078  1.00 21.90 ? 36  TRP C CA  1 
ATOM   5835  C C   . TRP C  1 11  ? 4.807   118.922 66.434  1.00 21.48 ? 36  TRP C C   1 
ATOM   5836  O O   . TRP C  1 11  ? 3.757   118.423 66.879  1.00 21.19 ? 36  TRP C O   1 
ATOM   5837  C CB  . TRP C  1 11  ? 5.862   117.018 65.187  1.00 21.20 ? 36  TRP C CB  1 
ATOM   5838  C CG  . TRP C  1 11  ? 7.168   116.914 65.911  1.00 20.18 ? 36  TRP C CG  1 
ATOM   5839  C CD1 . TRP C  1 11  ? 7.347   116.685 67.247  1.00 18.93 ? 36  TRP C CD1 1 
ATOM   5840  C CD2 . TRP C  1 11  ? 8.487   117.037 65.344  1.00 20.63 ? 36  TRP C CD2 1 
ATOM   5841  N NE1 . TRP C  1 11  ? 8.691   116.636 67.541  1.00 18.72 ? 36  TRP C NE1 1 
ATOM   5842  C CE2 . TRP C  1 11  ? 9.412   116.842 66.395  1.00 18.20 ? 36  TRP C CE2 1 
ATOM   5843  C CE3 . TRP C  1 11  ? 8.977   117.253 64.044  1.00 20.66 ? 36  TRP C CE3 1 
ATOM   5844  C CZ2 . TRP C  1 11  ? 10.798  116.892 66.198  1.00 18.56 ? 36  TRP C CZ2 1 
ATOM   5845  C CZ3 . TRP C  1 11  ? 10.361  117.294 63.854  1.00 20.13 ? 36  TRP C CZ3 1 
ATOM   5846  C CH2 . TRP C  1 11  ? 11.248  117.125 64.924  1.00 18.90 ? 36  TRP C CH2 1 
ATOM   5847  N N   . SER C  1 12  ? 5.476   119.888 67.071  1.00 20.52 ? 37  SER C N   1 
ATOM   5848  C CA  . SER C  1 12  ? 4.991   120.405 68.371  1.00 21.13 ? 37  SER C CA  1 
ATOM   5849  C C   . SER C  1 12  ? 3.632   121.118 68.280  1.00 22.93 ? 37  SER C C   1 
ATOM   5850  O O   . SER C  1 12  ? 2.942   121.288 69.290  1.00 23.04 ? 37  SER C O   1 
ATOM   5851  C CB  . SER C  1 12  ? 6.051   121.298 69.061  1.00 21.15 ? 37  SER C CB  1 
ATOM   5852  O OG  . SER C  1 12  ? 6.348   122.454 68.292  1.00 19.48 ? 37  SER C OG  1 
ATOM   5853  N N   . GLN C  1 13  ? 3.224   121.511 67.071  1.00 23.99 ? 38  GLN C N   1 
ATOM   5854  C CA  . GLN C  1 13  ? 1.940   122.188 66.920  1.00 25.67 ? 38  GLN C CA  1 
ATOM   5855  C C   . GLN C  1 13  ? 0.767   121.241 67.205  1.00 26.97 ? 38  GLN C C   1 
ATOM   5856  O O   . GLN C  1 13  ? -0.342  121.690 67.499  1.00 27.95 ? 38  GLN C O   1 
ATOM   5857  C CB  . GLN C  1 13  ? 1.818   122.811 65.517  1.00 26.86 ? 38  GLN C CB  1 
ATOM   5858  C CG  . GLN C  1 13  ? 1.911   121.809 64.377  1.00 26.93 ? 38  GLN C CG  1 
ATOM   5859  C CD  . GLN C  1 13  ? 1.680   122.449 63.028  1.00 29.93 ? 38  GLN C CD  1 
ATOM   5860  O OE1 . GLN C  1 13  ? 0.658   123.091 62.798  1.00 31.79 ? 38  GLN C OE1 1 
ATOM   5861  N NE2 . GLN C  1 13  ? 2.626   122.274 62.122  1.00 30.11 ? 38  GLN C NE2 1 
ATOM   5862  N N   . ASP C  1 14  ? 1.017   119.934 67.131  1.00 26.93 ? 39  ASP C N   1 
ATOM   5863  C CA  . ASP C  1 14  ? -0.029  118.925 67.350  1.00 28.64 ? 39  ASP C CA  1 
ATOM   5864  C C   . ASP C  1 14  ? -0.214  118.516 68.813  1.00 28.06 ? 39  ASP C C   1 
ATOM   5865  O O   . ASP C  1 14  ? -1.097  117.715 69.112  1.00 28.02 ? 39  ASP C O   1 
ATOM   5866  C CB  . ASP C  1 14  ? 0.240   117.651 66.518  1.00 28.88 ? 39  ASP C CB  1 
ATOM   5867  C CG  . ASP C  1 14  ? 0.219   117.914 65.012  1.00 31.59 ? 39  ASP C CG  1 
ATOM   5868  O OD1 . ASP C  1 14  ? -0.586  118.738 64.566  1.00 33.01 ? 39  ASP C OD1 1 
ATOM   5869  O OD2 . ASP C  1 14  ? 1.023   117.300 64.280  1.00 34.25 ? 39  ASP C OD2 1 
ATOM   5870  N N   . ARG C  1 15  ? 0.618   119.030 69.717  1.00 26.81 ? 40  ARG C N   1 
ATOM   5871  C CA  . ARG C  1 15  ? 0.495   118.704 71.151  1.00 26.39 ? 40  ARG C CA  1 
ATOM   5872  C C   . ARG C  1 15  ? -0.588  119.507 71.847  1.00 27.89 ? 40  ARG C C   1 
ATOM   5873  O O   . ARG C  1 15  ? -1.053  120.499 71.313  1.00 28.31 ? 40  ARG C O   1 
ATOM   5874  C CB  . ARG C  1 15  ? 1.820   118.949 71.871  1.00 24.94 ? 40  ARG C CB  1 
ATOM   5875  C CG  . ARG C  1 15  ? 2.848   117.914 71.521  1.00 23.90 ? 40  ARG C CG  1 
ATOM   5876  C CD  . ARG C  1 15  ? 4.242   118.346 71.860  1.00 21.14 ? 40  ARG C CD  1 
ATOM   5877  N NE  . ARG C  1 15  ? 5.167   117.296 71.446  1.00 20.59 ? 40  ARG C NE  1 
ATOM   5878  C CZ  . ARG C  1 15  ? 6.465   117.456 71.255  1.00 18.59 ? 40  ARG C CZ  1 
ATOM   5879  N NH1 . ARG C  1 15  ? 7.012   118.635 71.449  1.00 19.52 ? 40  ARG C NH1 1 
ATOM   5880  N NH2 . ARG C  1 15  ? 7.220   116.432 70.867  1.00 18.35 ? 40  ARG C NH2 1 
ATOM   5881  N N   . GLN C  1 16  ? -0.984  119.069 73.039  1.00 28.86 ? 41  GLN C N   1 
ATOM   5882  C CA  . GLN C  1 16  ? -1.931  119.817 73.875  1.00 31.07 ? 41  GLN C CA  1 
ATOM   5883  C C   . GLN C  1 16  ? -1.177  120.838 74.717  1.00 30.90 ? 41  GLN C C   1 
ATOM   5884  O O   . GLN C  1 16  ? 0.034   120.718 74.912  1.00 28.38 ? 41  GLN C O   1 
ATOM   5885  C CB  . GLN C  1 16  ? -2.696  118.884 74.826  1.00 31.97 ? 41  GLN C CB  1 
ATOM   5886  C CG  . GLN C  1 16  ? -3.651  117.919 74.133  1.00 35.07 ? 41  GLN C CG  1 
ATOM   5887  C CD  . GLN C  1 16  ? -4.744  118.630 73.348  1.00 40.13 ? 41  GLN C CD  1 
ATOM   5888  O OE1 . GLN C  1 16  ? -5.253  119.676 73.761  1.00 43.75 ? 41  GLN C OE1 1 
ATOM   5889  N NE2 . GLN C  1 16  ? -5.117  118.056 72.210  1.00 41.28 ? 41  GLN C NE2 1 
ATOM   5890  N N   . GLU C  1 17  ? -1.916  121.824 75.221  1.00 32.30 ? 42  GLU C N   1 
ATOM   5891  C CA  . GLU C  1 17  ? -1.420  122.826 76.160  1.00 34.02 ? 42  GLU C CA  1 
ATOM   5892  C C   . GLU C  1 17  ? -0.832  122.159 77.407  1.00 32.92 ? 42  GLU C C   1 
ATOM   5893  O O   . GLU C  1 17  ? -1.398  121.199 77.913  1.00 32.97 ? 42  GLU C O   1 
ATOM   5894  C CB  . GLU C  1 17  ? -2.612  123.703 76.574  1.00 36.56 ? 42  GLU C CB  1 
ATOM   5895  C CG  . GLU C  1 17  ? -2.287  125.168 76.759  1.00 42.08 ? 42  GLU C CG  1 
ATOM   5896  C CD  . GLU C  1 17  ? -1.824  125.843 75.471  1.00 46.40 ? 42  GLU C CD  1 
ATOM   5897  O OE1 . GLU C  1 17  ? -2.413  125.562 74.395  1.00 47.78 ? 42  GLU C OE1 1 
ATOM   5898  O OE2 . GLU C  1 17  ? -0.882  126.673 75.548  1.00 47.73 ? 42  GLU C OE2 1 
ATOM   5899  N N   . PRO C  1 18  ? 0.310   122.656 77.922  1.00 32.36 ? 43  PRO C N   1 
ATOM   5900  C CA  . PRO C  1 18  ? 1.148   123.786 77.518  1.00 31.94 ? 43  PRO C CA  1 
ATOM   5901  C C   . PRO C  1 18  ? 2.280   123.384 76.578  1.00 30.08 ? 43  PRO C C   1 
ATOM   5902  O O   . PRO C  1 18  ? 3.343   124.013 76.582  1.00 30.05 ? 43  PRO C O   1 
ATOM   5903  C CB  . PRO C  1 18  ? 1.754   124.243 78.852  1.00 32.08 ? 43  PRO C CB  1 
ATOM   5904  C CG  . PRO C  1 18  ? 1.882   122.968 79.675  1.00 32.68 ? 43  PRO C CG  1 
ATOM   5905  C CD  . PRO C  1 18  ? 0.894   121.948 79.079  1.00 32.13 ? 43  PRO C CD  1 
ATOM   5906  N N   . GLY C  1 19  ? 2.072   122.323 75.803  1.00 27.90 ? 44  GLY C N   1 
ATOM   5907  C CA  . GLY C  1 19  ? 3.080   121.884 74.866  1.00 25.18 ? 44  GLY C CA  1 
ATOM   5908  C C   . GLY C  1 19  ? 2.757   122.301 73.439  1.00 24.80 ? 44  GLY C C   1 
ATOM   5909  O O   . GLY C  1 19  ? 3.558   122.064 72.534  1.00 23.22 ? 44  GLY C O   1 
ATOM   5910  N N   . LYS C  1 20  ? 1.591   122.926 73.237  1.00 24.43 ? 45  LYS C N   1 
ATOM   5911  C CA  . LYS C  1 20  ? 1.170   123.284 71.881  1.00 24.88 ? 45  LYS C CA  1 
ATOM   5912  C C   . LYS C  1 20  ? 1.980   124.487 71.408  1.00 24.41 ? 45  LYS C C   1 
ATOM   5913  O O   . LYS C  1 20  ? 1.820   125.585 71.922  1.00 23.32 ? 45  LYS C O   1 
ATOM   5914  C CB  . LYS C  1 20  ? -0.338  123.580 71.803  1.00 26.87 ? 45  LYS C CB  1 
ATOM   5915  C CG  . LYS C  1 20  ? -0.804  123.894 70.372  1.00 28.71 ? 45  LYS C CG  1 
ATOM   5916  C CD  . LYS C  1 20  ? -2.339  124.109 70.274  1.00 36.81 ? 45  LYS C CD  1 
ATOM   5917  C CE  . LYS C  1 20  ? -3.145  122.833 70.583  1.00 39.23 ? 45  LYS C CE  1 
ATOM   5918  N NZ  . LYS C  1 20  ? -2.929  121.676 69.602  1.00 40.61 ? 45  LYS C NZ  1 
ATOM   5919  N N   . PHE C  1 21  ? 2.873   124.259 70.448  1.00 23.81 ? 46  PHE C N   1 
ATOM   5920  C CA  . PHE C  1 21  ? 3.807   125.287 69.975  1.00 23.86 ? 46  PHE C CA  1 
ATOM   5921  C C   . PHE C  1 21  ? 3.575   125.646 68.497  1.00 24.92 ? 46  PHE C C   1 
ATOM   5922  O O   . PHE C  1 21  ? 3.471   124.769 67.637  1.00 24.68 ? 46  PHE C O   1 
ATOM   5923  C CB  . PHE C  1 21  ? 5.249   124.783 70.192  1.00 21.82 ? 46  PHE C CB  1 
ATOM   5924  C CG  . PHE C  1 21  ? 6.335   125.750 69.773  1.00 21.72 ? 46  PHE C CG  1 
ATOM   5925  C CD1 . PHE C  1 21  ? 6.742   125.835 68.447  1.00 21.25 ? 46  PHE C CD1 1 
ATOM   5926  C CD2 . PHE C  1 21  ? 6.982   126.538 70.715  1.00 22.18 ? 46  PHE C CD2 1 
ATOM   5927  C CE1 . PHE C  1 21  ? 7.771   126.701 68.069  1.00 21.08 ? 46  PHE C CE1 1 
ATOM   5928  C CE2 . PHE C  1 21  ? 8.002   127.400 70.351  1.00 21.26 ? 46  PHE C CE2 1 
ATOM   5929  C CZ  . PHE C  1 21  ? 8.400   127.483 69.030  1.00 21.79 ? 46  PHE C CZ  1 
ATOM   5930  N N   . THR C  1 22  ? 3.489   126.937 68.199  1.00 26.48 ? 47  THR C N   1 
ATOM   5931  C CA  . THR C  1 22  ? 3.571   127.376 66.806  1.00 27.65 ? 47  THR C CA  1 
ATOM   5932  C C   . THR C  1 22  ? 4.694   128.421 66.709  1.00 27.89 ? 47  THR C C   1 
ATOM   5933  O O   . THR C  1 22  ? 5.211   128.888 67.730  1.00 27.54 ? 47  THR C O   1 
ATOM   5934  C CB  . THR C  1 22  ? 2.264   128.024 66.298  1.00 29.42 ? 47  THR C CB  1 
ATOM   5935  O OG1 . THR C  1 22  ? 2.209   129.378 66.745  1.00 29.33 ? 47  THR C OG1 1 
ATOM   5936  C CG2 . THR C  1 22  ? 1.012   127.269 66.781  1.00 30.49 ? 47  THR C CG2 1 
ATOM   5937  N N   . PRO C  1 23  ? 5.089   128.773 65.484  1.00 28.41 ? 48  PRO C N   1 
ATOM   5938  C CA  . PRO C  1 23  ? 6.084   129.827 65.274  1.00 28.70 ? 48  PRO C CA  1 
ATOM   5939  C C   . PRO C  1 23  ? 5.719   131.166 65.926  1.00 29.36 ? 48  PRO C C   1 
ATOM   5940  O O   . PRO C  1 23  ? 6.607   131.968 66.217  1.00 29.00 ? 48  PRO C O   1 
ATOM   5941  C CB  . PRO C  1 23  ? 6.124   129.949 63.758  1.00 28.85 ? 48  PRO C CB  1 
ATOM   5942  C CG  . PRO C  1 23  ? 5.904   128.514 63.305  1.00 29.26 ? 48  PRO C CG  1 
ATOM   5943  C CD  . PRO C  1 23  ? 4.840   128.000 64.256  1.00 28.95 ? 48  PRO C CD  1 
ATOM   5944  N N   . GLU C  1 24  ? 4.431   131.395 66.174  1.00 30.32 ? 49  GLU C N   1 
ATOM   5945  C CA  . GLU C  1 24  ? 4.001   132.601 66.893  1.00 31.37 ? 49  GLU C CA  1 
ATOM   5946  C C   . GLU C  1 24  ? 4.418   132.665 68.368  1.00 31.09 ? 49  GLU C C   1 
ATOM   5947  O O   . GLU C  1 24  ? 4.416   133.764 68.947  1.00 31.25 ? 49  GLU C O   1 
ATOM   5948  C CB  . GLU C  1 24  ? 2.493   132.802 66.773  1.00 33.21 ? 49  GLU C CB  1 
ATOM   5949  C CG  . GLU C  1 24  ? 2.032   133.180 65.377  1.00 35.76 ? 49  GLU C CG  1 
ATOM   5950  C CD  . GLU C  1 24  ? 0.588   133.654 65.365  1.00 41.71 ? 49  GLU C CD  1 
ATOM   5951  O OE1 . GLU C  1 24  ? -0.300  132.886 65.797  1.00 43.49 ? 49  GLU C OE1 1 
ATOM   5952  O OE2 . GLU C  1 24  ? 0.332   134.796 64.934  1.00 44.57 ? 49  GLU C OE2 1 
ATOM   5953  N N   . ASN C  1 25  ? 4.736   131.512 68.978  1.00 29.05 ? 50  ASN C N   1 
ATOM   5954  C CA  . ASN C  1 25  ? 5.294   131.472 70.337  1.00 28.95 ? 50  ASN C CA  1 
ATOM   5955  C C   . ASN C  1 25  ? 6.778   131.856 70.369  1.00 28.23 ? 50  ASN C C   1 
ATOM   5956  O O   . ASN C  1 25  ? 7.386   131.892 71.430  1.00 28.04 ? 50  ASN C O   1 
ATOM   5957  C CB  . ASN C  1 25  ? 5.202   130.061 70.961  1.00 27.40 ? 50  ASN C CB  1 
ATOM   5958  C CG  . ASN C  1 25  ? 3.783   129.607 71.214  1.00 29.06 ? 50  ASN C CG  1 
ATOM   5959  O OD1 . ASN C  1 25  ? 3.135   130.041 72.173  1.00 29.80 ? 50  ASN C OD1 1 
ATOM   5960  N ND2 . ASN C  1 25  ? 3.301   128.692 70.378  1.00 26.44 ? 50  ASN C ND2 1 
ATOM   5961  N N   . ILE C  1 26  ? 7.392   132.063 69.213  1.00 28.46 ? 51  ILE C N   1 
ATOM   5962  C CA  . ILE C  1 26  ? 8.816   132.408 69.199  1.00 27.84 ? 51  ILE C CA  1 
ATOM   5963  C C   . ILE C  1 26  ? 9.062   133.882 69.507  1.00 28.96 ? 51  ILE C C   1 
ATOM   5964  O O   . ILE C  1 26  ? 8.489   134.761 68.883  1.00 29.82 ? 51  ILE C O   1 
ATOM   5965  C CB  . ILE C  1 26  ? 9.472   132.110 67.851  1.00 28.03 ? 51  ILE C CB  1 
ATOM   5966  C CG1 . ILE C  1 26  ? 9.375   130.609 67.526  1.00 27.23 ? 51  ILE C CG1 1 
ATOM   5967  C CG2 . ILE C  1 26  ? 10.920  132.578 67.867  1.00 26.67 ? 51  ILE C CG2 1 
ATOM   5968  C CD1 . ILE C  1 26  ? 9.905   130.256 66.154  1.00 26.30 ? 51  ILE C CD1 1 
ATOM   5969  N N   . ASP C  1 27  ? 9.942   134.129 70.469  1.00 28.92 ? 52  ASP C N   1 
ATOM   5970  C CA  . ASP C  1 27  ? 10.403  135.456 70.826  1.00 30.03 ? 52  ASP C CA  1 
ATOM   5971  C C   . ASP C  1 27  ? 11.553  135.779 69.881  1.00 29.55 ? 52  ASP C C   1 
ATOM   5972  O O   . ASP C  1 27  ? 12.548  135.058 69.879  1.00 29.34 ? 52  ASP C O   1 
ATOM   5973  C CB  . ASP C  1 27  ? 10.911  135.402 72.275  1.00 29.97 ? 52  ASP C CB  1 
ATOM   5974  C CG  . ASP C  1 27  ? 11.716  136.636 72.683  1.00 32.70 ? 52  ASP C CG  1 
ATOM   5975  O OD1 . ASP C  1 27  ? 11.878  137.582 71.880  1.00 31.86 ? 52  ASP C OD1 1 
ATOM   5976  O OD2 . ASP C  1 27  ? 12.201  136.645 73.841  1.00 34.46 ? 52  ASP C OD2 1 
ATOM   5977  N N   . PRO C  1 28  ? 11.410  136.836 69.058  1.00 30.69 ? 53  PRO C N   1 
ATOM   5978  C CA  . PRO C  1 28  ? 12.397  137.160 68.010  1.00 30.63 ? 53  PRO C CA  1 
ATOM   5979  C C   . PRO C  1 28  ? 13.770  137.582 68.531  1.00 30.71 ? 53  PRO C C   1 
ATOM   5980  O O   . PRO C  1 28  ? 14.711  137.662 67.746  1.00 30.83 ? 53  PRO C O   1 
ATOM   5981  C CB  . PRO C  1 28  ? 11.750  138.331 67.246  1.00 32.09 ? 53  PRO C CB  1 
ATOM   5982  C CG  . PRO C  1 28  ? 10.790  138.953 68.213  1.00 33.12 ? 53  PRO C CG  1 
ATOM   5983  C CD  . PRO C  1 28  ? 10.293  137.799 69.084  1.00 31.84 ? 53  PRO C CD  1 
ATOM   5984  N N   . PHE C  1 29  ? 13.881  137.881 69.824  1.00 30.51 ? 54  PHE C N   1 
ATOM   5985  C CA  . PHE C  1 29  ? 15.172  138.281 70.406  1.00 30.80 ? 54  PHE C CA  1 
ATOM   5986  C C   . PHE C  1 29  ? 15.761  137.221 71.338  1.00 29.71 ? 54  PHE C C   1 
ATOM   5987  O O   . PHE C  1 29  ? 16.775  137.460 71.993  1.00 30.31 ? 54  PHE C O   1 
ATOM   5988  C CB  . PHE C  1 29  ? 15.052  139.607 71.176  1.00 32.14 ? 54  PHE C CB  1 
ATOM   5989  C CG  . PHE C  1 29  ? 14.764  140.802 70.295  1.00 34.25 ? 54  PHE C CG  1 
ATOM   5990  C CD1 . PHE C  1 29  ? 15.797  141.491 69.670  1.00 34.52 ? 54  PHE C CD1 1 
ATOM   5991  C CD2 . PHE C  1 29  ? 13.462  141.233 70.096  1.00 34.76 ? 54  PHE C CD2 1 
ATOM   5992  C CE1 . PHE C  1 29  ? 15.538  142.596 68.851  1.00 36.23 ? 54  PHE C CE1 1 
ATOM   5993  C CE2 . PHE C  1 29  ? 13.195  142.333 69.280  1.00 37.01 ? 54  PHE C CE2 1 
ATOM   5994  C CZ  . PHE C  1 29  ? 14.240  143.017 68.659  1.00 37.26 ? 54  PHE C CZ  1 
ATOM   5995  N N   . LEU C  1 30  ? 15.109  136.068 71.423  1.00 28.60 ? 55  LEU C N   1 
ATOM   5996  C CA  . LEU C  1 30  ? 15.572  134.998 72.287  1.00 27.88 ? 55  LEU C CA  1 
ATOM   5997  C C   . LEU C  1 30  ? 16.904  134.439 71.800  1.00 27.57 ? 55  LEU C C   1 
ATOM   5998  O O   . LEU C  1 30  ? 17.846  134.289 72.582  1.00 27.45 ? 55  LEU C O   1 
ATOM   5999  C CB  . LEU C  1 30  ? 14.566  133.855 72.279  1.00 27.44 ? 55  LEU C CB  1 
ATOM   6000  C CG  . LEU C  1 30  ? 14.255  133.033 73.535  1.00 28.71 ? 55  LEU C CG  1 
ATOM   6001  C CD1 . LEU C  1 30  ? 14.095  131.561 73.168  1.00 27.15 ? 55  LEU C CD1 1 
ATOM   6002  C CD2 . LEU C  1 30  ? 15.233  133.222 74.717  1.00 29.19 ? 55  LEU C CD2 1 
ATOM   6003  N N   . CYS C  1 31  ? 16.972  134.105 70.510  1.00 26.90 ? 56  CYS C N   1 
ATOM   6004  C CA  . CYS C  1 31  ? 18.149  133.446 69.946  1.00 26.26 ? 56  CYS C CA  1 
ATOM   6005  C C   . CYS C  1 31  ? 18.774  134.301 68.840  1.00 26.84 ? 56  CYS C C   1 
ATOM   6006  O O   . CYS C  1 31  ? 18.144  135.244 68.359  1.00 27.71 ? 56  CYS C O   1 
ATOM   6007  C CB  . CYS C  1 31  ? 17.754  132.074 69.394  1.00 24.58 ? 56  CYS C CB  1 
ATOM   6008  S SG  . CYS C  1 31  ? 16.771  131.084 70.587  1.00 27.25 ? 56  CYS C SG  1 
ATOM   6009  N N   . SER C  1 32  ? 20.008  133.987 68.442  1.00 25.99 ? 57  SER C N   1 
ATOM   6010  C CA  . SER C  1 32  ? 20.628  134.651 67.280  1.00 26.33 ? 57  SER C CA  1 
ATOM   6011  C C   . SER C  1 32  ? 20.305  133.901 65.979  1.00 25.62 ? 57  SER C C   1 
ATOM   6012  O O   . SER C  1 32  ? 20.290  134.495 64.899  1.00 25.54 ? 57  SER C O   1 
ATOM   6013  C CB  . SER C  1 32  ? 22.153  134.733 67.443  1.00 26.35 ? 57  SER C CB  1 
ATOM   6014  O OG  . SER C  1 32  ? 22.732  133.430 67.576  1.00 25.42 ? 57  SER C OG  1 
ATOM   6015  N N   . HIS C  1 33  ? 20.063  132.598 66.092  1.00 24.28 ? 58  HIS C N   1 
ATOM   6016  C CA  . HIS C  1 33  ? 19.721  131.752 64.940  1.00 24.00 ? 58  HIS C CA  1 
ATOM   6017  C C   . HIS C  1 33  ? 18.565  130.832 65.316  1.00 23.64 ? 58  HIS C C   1 
ATOM   6018  O O   . HIS C  1 33  ? 18.577  130.235 66.399  1.00 23.84 ? 58  HIS C O   1 
ATOM   6019  C CB  . HIS C  1 33  ? 20.891  130.836 64.573  1.00 23.57 ? 58  HIS C CB  1 
ATOM   6020  C CG  . HIS C  1 33  ? 22.142  131.558 64.183  1.00 24.22 ? 58  HIS C CG  1 
ATOM   6021  N ND1 . HIS C  1 33  ? 22.874  132.304 65.079  1.00 24.52 ? 58  HIS C ND1 1 
ATOM   6022  C CD2 . HIS C  1 33  ? 22.807  131.622 63.002  1.00 24.92 ? 58  HIS C CD2 1 
ATOM   6023  C CE1 . HIS C  1 33  ? 23.934  132.807 64.466  1.00 26.20 ? 58  HIS C CE1 1 
ATOM   6024  N NE2 . HIS C  1 33  ? 23.923  132.400 63.208  1.00 26.15 ? 58  HIS C NE2 1 
ATOM   6025  N N   . LEU C  1 34  ? 17.576  130.716 64.432  1.00 23.28 ? 59  LEU C N   1 
ATOM   6026  C CA  . LEU C  1 34  ? 16.477  129.761 64.626  1.00 22.50 ? 59  LEU C CA  1 
ATOM   6027  C C   . LEU C  1 34  ? 16.550  128.744 63.510  1.00 21.72 ? 59  LEU C C   1 
ATOM   6028  O O   . LEU C  1 34  ? 16.858  129.113 62.379  1.00 22.03 ? 59  LEU C O   1 
ATOM   6029  C CB  . LEU C  1 34  ? 15.128  130.483 64.522  1.00 23.10 ? 59  LEU C CB  1 
ATOM   6030  C CG  . LEU C  1 34  ? 14.848  131.455 65.657  1.00 24.30 ? 59  LEU C CG  1 
ATOM   6031  C CD1 . LEU C  1 34  ? 13.690  132.401 65.320  1.00 26.29 ? 59  LEU C CD1 1 
ATOM   6032  C CD2 . LEU C  1 34  ? 14.525  130.596 66.892  1.00 24.55 ? 59  LEU C CD2 1 
ATOM   6033  N N   . ILE C  1 35  ? 16.254  127.483 63.811  1.00 20.34 ? 60  ILE C N   1 
ATOM   6034  C CA  . ILE C  1 35  ? 16.296  126.439 62.789  1.00 20.20 ? 60  ILE C CA  1 
ATOM   6035  C C   . ILE C  1 35  ? 15.000  125.635 62.768  1.00 19.85 ? 60  ILE C C   1 
ATOM   6036  O O   . ILE C  1 35  ? 14.609  125.036 63.777  1.00 19.88 ? 60  ILE C O   1 
ATOM   6037  C CB  . ILE C  1 35  ? 17.495  125.492 62.998  1.00 19.70 ? 60  ILE C CB  1 
ATOM   6038  C CG1 . ILE C  1 35  ? 18.785  126.305 63.155  1.00 20.21 ? 60  ILE C CG1 1 
ATOM   6039  C CG2 . ILE C  1 35  ? 17.600  124.511 61.837  1.00 18.83 ? 60  ILE C CG2 1 
ATOM   6040  C CD1 . ILE C  1 35  ? 20.053  125.420 63.229  1.00 19.57 ? 60  ILE C CD1 1 
ATOM   6041  N N   . TYR C  1 36  ? 14.342  125.632 61.615  1.00 19.71 ? 61  TYR C N   1 
ATOM   6042  C CA  . TYR C  1 36  ? 13.099  124.897 61.431  1.00 20.15 ? 61  TYR C CA  1 
ATOM   6043  C C   . TYR C  1 36  ? 13.423  123.448 61.132  1.00 19.72 ? 61  TYR C C   1 
ATOM   6044  O O   . TYR C  1 36  ? 14.207  123.168 60.227  1.00 20.22 ? 61  TYR C O   1 
ATOM   6045  C CB  . TYR C  1 36  ? 12.301  125.500 60.275  1.00 21.01 ? 61  TYR C CB  1 
ATOM   6046  C CG  . TYR C  1 36  ? 11.047  124.731 59.929  1.00 20.70 ? 61  TYR C CG  1 
ATOM   6047  C CD1 . TYR C  1 36  ? 11.077  123.667 59.035  1.00 20.82 ? 61  TYR C CD1 1 
ATOM   6048  C CD2 . TYR C  1 36  ? 9.834   125.069 60.510  1.00 22.16 ? 61  TYR C CD2 1 
ATOM   6049  C CE1 . TYR C  1 36  ? 9.915   122.952 58.714  1.00 20.92 ? 61  TYR C CE1 1 
ATOM   6050  C CE2 . TYR C  1 36  ? 8.670   124.369 60.211  1.00 22.86 ? 61  TYR C CE2 1 
ATOM   6051  C CZ  . TYR C  1 36  ? 8.721   123.314 59.307  1.00 22.82 ? 61  TYR C CZ  1 
ATOM   6052  O OH  . TYR C  1 36  ? 7.567   122.638 59.020  1.00 22.94 ? 61  TYR C OH  1 
ATOM   6053  N N   . SER C  1 37  ? 12.826  122.541 61.898  1.00 19.20 ? 62  SER C N   1 
ATOM   6054  C CA  . SER C  1 37  ? 13.044  121.100 61.758  1.00 19.41 ? 62  SER C CA  1 
ATOM   6055  C C   . SER C  1 37  ? 11.702  120.419 61.479  1.00 19.72 ? 62  SER C C   1 
ATOM   6056  O O   . SER C  1 37  ? 10.764  120.618 62.258  1.00 19.48 ? 62  SER C O   1 
ATOM   6057  C CB  . SER C  1 37  ? 13.584  120.549 63.085  1.00 18.76 ? 62  SER C CB  1 
ATOM   6058  O OG  . SER C  1 37  ? 14.577  121.412 63.648  1.00 20.89 ? 62  SER C OG  1 
ATOM   6059  N N   . PHE C  1 38  ? 11.562  119.627 60.402  1.00 20.28 ? 63  PHE C N   1 
ATOM   6060  C CA  . PHE C  1 38  ? 12.560  119.383 59.353  1.00 20.70 ? 63  PHE C CA  1 
ATOM   6061  C C   . PHE C  1 38  ? 11.862  119.453 57.981  1.00 21.64 ? 63  PHE C C   1 
ATOM   6062  O O   . PHE C  1 38  ? 10.698  119.073 57.859  1.00 21.65 ? 63  PHE C O   1 
ATOM   6063  C CB  . PHE C  1 38  ? 13.137  117.952 59.469  1.00 20.33 ? 63  PHE C CB  1 
ATOM   6064  C CG  . PHE C  1 38  ? 14.052  117.739 60.657  1.00 19.22 ? 63  PHE C CG  1 
ATOM   6065  C CD1 . PHE C  1 38  ? 15.319  118.315 60.683  1.00 18.98 ? 63  PHE C CD1 1 
ATOM   6066  C CD2 . PHE C  1 38  ? 13.657  116.940 61.725  1.00 18.55 ? 63  PHE C CD2 1 
ATOM   6067  C CE1 . PHE C  1 38  ? 16.178  118.105 61.780  1.00 18.85 ? 63  PHE C CE1 1 
ATOM   6068  C CE2 . PHE C  1 38  ? 14.484  116.730 62.818  1.00 18.35 ? 63  PHE C CE2 1 
ATOM   6069  C CZ  . PHE C  1 38  ? 15.751  117.311 62.850  1.00 18.70 ? 63  PHE C CZ  1 
ATOM   6070  N N   . ALA C  1 39  ? 12.565  119.950 56.970  1.00 21.67 ? 64  ALA C N   1 
ATOM   6071  C CA  . ALA C  1 39  ? 12.117  119.852 55.580  1.00 23.23 ? 64  ALA C CA  1 
ATOM   6072  C C   . ALA C  1 39  ? 12.376  118.438 55.076  1.00 23.49 ? 64  ALA C C   1 
ATOM   6073  O O   . ALA C  1 39  ? 13.171  117.691 55.660  1.00 22.64 ? 64  ALA C O   1 
ATOM   6074  C CB  . ALA C  1 39  ? 12.887  120.852 54.712  1.00 23.62 ? 64  ALA C CB  1 
ATOM   6075  N N   . SER C  1 40  ? 11.723  118.079 53.979  1.00 24.08 ? 65  SER C N   1 
ATOM   6076  C CA  . SER C  1 40  ? 11.965  116.801 53.345  1.00 24.53 ? 65  SER C CA  1 
ATOM   6077  C C   . SER C  1 40  ? 12.567  116.994 51.950  1.00 25.20 ? 65  SER C C   1 
ATOM   6078  O O   . SER C  1 40  ? 12.881  118.125 51.549  1.00 25.24 ? 65  SER C O   1 
ATOM   6079  C CB  . SER C  1 40  ? 10.680  115.976 53.258  1.00 25.05 ? 65  SER C CB  1 
ATOM   6080  O OG  . SER C  1 40  ? 11.007  114.629 52.971  1.00 26.25 ? 65  SER C OG  1 
ATOM   6081  N N   . ILE C  1 41  ? 12.766  115.880 51.242  1.00 24.93 ? 66  ILE C N   1 
ATOM   6082  C CA  . ILE C  1 41  ? 13.246  115.885 49.857  1.00 25.56 ? 66  ILE C CA  1 
ATOM   6083  C C   . ILE C  1 41  ? 12.333  114.992 49.051  1.00 26.26 ? 66  ILE C C   1 
ATOM   6084  O O   . ILE C  1 41  ? 12.178  113.814 49.365  1.00 25.36 ? 66  ILE C O   1 
ATOM   6085  C CB  . ILE C  1 41  ? 14.684  115.330 49.710  1.00 25.15 ? 66  ILE C CB  1 
ATOM   6086  C CG1 . ILE C  1 41  ? 15.671  116.153 50.539  1.00 25.09 ? 66  ILE C CG1 1 
ATOM   6087  C CG2 . ILE C  1 41  ? 15.099  115.310 48.218  1.00 26.06 ? 66  ILE C CG2 1 
ATOM   6088  C CD1 . ILE C  1 41  ? 17.053  115.555 50.637  1.00 25.26 ? 66  ILE C CD1 1 
ATOM   6089  N N   . GLU C  1 42  ? 11.711  115.570 48.033  1.00 27.09 ? 67  GLU C N   1 
ATOM   6090  C CA  . GLU C  1 42  ? 10.782  114.860 47.176  1.00 29.35 ? 67  GLU C CA  1 
ATOM   6091  C C   . GLU C  1 42  ? 11.228  115.083 45.753  1.00 29.78 ? 67  GLU C C   1 
ATOM   6092  O O   . GLU C  1 42  ? 11.345  116.228 45.322  1.00 29.69 ? 67  GLU C O   1 
ATOM   6093  C CB  . GLU C  1 42  ? 9.383   115.436 47.336  1.00 30.16 ? 67  GLU C CB  1 
ATOM   6094  C CG  . GLU C  1 42  ? 8.680   115.000 48.585  1.00 33.20 ? 67  GLU C CG  1 
ATOM   6095  C CD  . GLU C  1 42  ? 8.039   113.639 48.433  1.00 37.88 ? 67  GLU C CD  1 
ATOM   6096  O OE1 . GLU C  1 42  ? 7.997   113.135 47.292  1.00 40.43 ? 67  GLU C OE1 1 
ATOM   6097  O OE2 . GLU C  1 42  ? 7.574   113.071 49.446  1.00 39.23 ? 67  GLU C OE2 1 
ATOM   6098  N N   . ASN C  1 43  ? 11.488  114.000 45.033  1.00 30.29 ? 68  ASN C N   1 
ATOM   6099  C CA  . ASN C  1 43  ? 11.913  114.099 43.644  1.00 31.85 ? 68  ASN C CA  1 
ATOM   6100  C C   . ASN C  1 43  ? 13.116  115.039 43.539  1.00 31.38 ? 68  ASN C C   1 
ATOM   6101  O O   . ASN C  1 43  ? 13.157  115.919 42.679  1.00 31.15 ? 68  ASN C O   1 
ATOM   6102  C CB  . ASN C  1 43  ? 10.759  114.612 42.771  1.00 32.75 ? 68  ASN C CB  1 
ATOM   6103  C CG  . ASN C  1 43  ? 11.036  114.448 41.303  1.00 36.48 ? 68  ASN C CG  1 
ATOM   6104  O OD1 . ASN C  1 43  ? 11.765  113.540 40.902  1.00 35.79 ? 68  ASN C OD1 1 
ATOM   6105  N ND2 . ASN C  1 43  ? 10.438  115.314 40.480  1.00 36.74 ? 68  ASN C ND2 1 
ATOM   6106  N N   . ASN C  1 44  ? 14.069  114.845 44.453  1.00 30.63 ? 69  ASN C N   1 
ATOM   6107  C CA  . ASN C  1 44  ? 15.294  115.653 44.554  1.00 30.99 ? 69  ASN C CA  1 
ATOM   6108  C C   . ASN C  1 44  ? 15.126  117.086 44.998  1.00 30.90 ? 69  ASN C C   1 
ATOM   6109  O O   . ASN C  1 44  ? 16.113  117.812 45.077  1.00 31.64 ? 69  ASN C O   1 
ATOM   6110  C CB  . ASN C  1 44  ? 16.049  115.667 43.229  1.00 32.15 ? 69  ASN C CB  1 
ATOM   6111  C CG  . ASN C  1 44  ? 16.399  114.292 42.761  1.00 32.61 ? 69  ASN C CG  1 
ATOM   6112  O OD1 . ASN C  1 44  ? 16.656  113.405 43.567  1.00 32.33 ? 69  ASN C OD1 1 
ATOM   6113  N ND2 . ASN C  1 44  ? 16.401  114.094 41.450  1.00 34.66 ? 69  ASN C ND2 1 
ATOM   6114  N N   . LYS C  1 45  ? 13.903  117.520 45.267  1.00 30.35 ? 70  LYS C N   1 
ATOM   6115  C CA  . LYS C  1 45  ? 13.728  118.919 45.631  1.00 30.72 ? 70  LYS C CA  1 
ATOM   6116  C C   . LYS C  1 45  ? 13.359  119.072 47.095  1.00 29.26 ? 70  LYS C C   1 
ATOM   6117  O O   . LYS C  1 45  ? 12.571  118.285 47.631  1.00 28.77 ? 70  LYS C O   1 
ATOM   6118  C CB  . LYS C  1 45  ? 12.673  119.593 44.767  1.00 31.59 ? 70  LYS C CB  1 
ATOM   6119  C CG  . LYS C  1 45  ? 13.052  119.659 43.297  1.00 35.08 ? 70  LYS C CG  1 
ATOM   6120  C CD  . LYS C  1 45  ? 11.841  119.947 42.463  1.00 38.73 ? 70  LYS C CD  1 
ATOM   6121  C CE  . LYS C  1 45  ? 12.112  119.617 41.011  1.00 42.23 ? 70  LYS C CE  1 
ATOM   6122  N NZ  . LYS C  1 45  ? 10.912  118.954 40.439  1.00 45.53 ? 70  LYS C NZ  1 
ATOM   6123  N N   . VAL C  1 46  ? 13.919  120.091 47.734  1.00 28.52 ? 71  VAL C N   1 
ATOM   6124  C CA  . VAL C  1 46  ? 13.543  120.410 49.110  1.00 27.47 ? 71  VAL C CA  1 
ATOM   6125  C C   . VAL C  1 46  ? 12.053  120.774 49.136  1.00 28.90 ? 71  VAL C C   1 
ATOM   6126  O O   . VAL C  1 46  ? 11.572  121.505 48.256  1.00 28.55 ? 71  VAL C O   1 
ATOM   6127  C CB  . VAL C  1 46  ? 14.399  121.576 49.673  1.00 27.08 ? 71  VAL C CB  1 
ATOM   6128  C CG1 . VAL C  1 46  ? 14.176  122.880 48.864  1.00 27.28 ? 71  VAL C CG1 1 
ATOM   6129  C CG2 . VAL C  1 46  ? 14.089  121.803 51.152  1.00 25.54 ? 71  VAL C CG2 1 
ATOM   6130  N N   . ILE C  1 47  ? 11.314  120.235 50.104  1.00 28.57 ? 72  ILE C N   1 
ATOM   6131  C CA  . ILE C  1 47  ? 9.952   120.693 50.361  1.00 30.08 ? 72  ILE C CA  1 
ATOM   6132  C C   . ILE C  1 47  ? 9.716   120.792 51.860  1.00 29.25 ? 72  ILE C C   1 
ATOM   6133  O O   . ILE C  1 47  ? 10.422  120.180 52.648  1.00 28.31 ? 72  ILE C O   1 
ATOM   6134  C CB  . ILE C  1 47  ? 8.871   119.760 49.794  1.00 30.68 ? 72  ILE C CB  1 
ATOM   6135  C CG1 . ILE C  1 47  ? 9.060   118.339 50.316  1.00 30.59 ? 72  ILE C CG1 1 
ATOM   6136  C CG2 . ILE C  1 47  ? 8.864   119.770 48.277  1.00 33.40 ? 72  ILE C CG2 1 
ATOM   6137  C CD1 . ILE C  1 47  ? 7.754   117.584 50.413  1.00 35.10 ? 72  ILE C CD1 1 
ATOM   6138  N N   . ILE C  1 48  ? 8.706   121.549 52.249  1.00 29.75 ? 73  ILE C N   1 
ATOM   6139  C CA  . ILE C  1 48  ? 8.285   121.589 53.642  1.00 29.66 ? 73  ILE C CA  1 
ATOM   6140  C C   . ILE C  1 48  ? 6.864   121.064 53.706  1.00 30.69 ? 73  ILE C C   1 
ATOM   6141  O O   . ILE C  1 48  ? 5.973   121.580 53.012  1.00 31.69 ? 73  ILE C O   1 
ATOM   6142  C CB  . ILE C  1 48  ? 8.311   123.018 54.191  1.00 30.18 ? 73  ILE C CB  1 
ATOM   6143  C CG1 . ILE C  1 48  ? 9.751   123.415 54.551  1.00 29.38 ? 73  ILE C CG1 1 
ATOM   6144  C CG2 . ILE C  1 48  ? 7.348   123.147 55.376  1.00 29.65 ? 73  ILE C CG2 1 
ATOM   6145  C CD1 . ILE C  1 48  ? 9.941   124.870 54.975  1.00 29.48 ? 73  ILE C CD1 1 
ATOM   6146  N N   . LYS C  1 49  ? 6.642   120.035 54.509  1.00 29.74 ? 74  LYS C N   1 
ATOM   6147  C CA  . LYS C  1 49  ? 5.304   119.471 54.651  1.00 31.27 ? 74  LYS C CA  1 
ATOM   6148  C C   . LYS C  1 49  ? 4.754   119.938 56.001  1.00 30.62 ? 74  LYS C C   1 
ATOM   6149  O O   . LYS C  1 49  ? 5.110   119.392 57.040  1.00 28.33 ? 74  LYS C O   1 
ATOM   6150  C CB  . LYS C  1 49  ? 5.338   117.935 54.598  1.00 31.38 ? 74  LYS C CB  1 
ATOM   6151  C CG  . LYS C  1 49  ? 5.962   117.293 53.335  1.00 34.88 ? 74  LYS C CG  1 
ATOM   6152  C CD  . LYS C  1 49  ? 6.375   115.806 53.622  1.00 37.61 ? 74  LYS C CD  1 
ATOM   6153  C CE  . LYS C  1 49  ? 6.773   114.997 52.377  1.00 41.72 ? 74  LYS C CE  1 
ATOM   6154  N NZ  . LYS C  1 49  ? 7.756   113.829 52.637  1.00 40.87 ? 74  LYS C NZ  1 
ATOM   6155  N N   . ASP C  1 50  ? 3.898   120.961 55.984  1.00 30.85 ? 75  ASP C N   1 
ATOM   6156  C CA  . ASP C  1 50  ? 3.435   121.583 57.231  1.00 30.69 ? 75  ASP C CA  1 
ATOM   6157  C C   . ASP C  1 50  ? 2.031   122.135 56.967  1.00 31.88 ? 75  ASP C C   1 
ATOM   6158  O O   . ASP C  1 50  ? 1.852   122.969 56.079  1.00 31.86 ? 75  ASP C O   1 
ATOM   6159  C CB  . ASP C  1 50  ? 4.409   122.703 57.640  1.00 30.10 ? 75  ASP C CB  1 
ATOM   6160  C CG  . ASP C  1 50  ? 4.178   123.225 59.072  1.00 30.50 ? 75  ASP C CG  1 
ATOM   6161  O OD1 . ASP C  1 50  ? 2.999   123.386 59.468  1.00 30.09 ? 75  ASP C OD1 1 
ATOM   6162  O OD2 . ASP C  1 50  ? 5.184   123.482 59.792  1.00 28.10 ? 75  ASP C OD2 1 
ATOM   6163  N N   . LYS C  1 51  ? 1.042   121.646 57.709  1.00 32.22 ? 76  LYS C N   1 
ATOM   6164  C CA  . LYS C  1 51  ? -0.333  122.083 57.490  1.00 34.21 ? 76  LYS C CA  1 
ATOM   6165  C C   . LYS C  1 51  ? -0.484  123.546 57.868  1.00 34.18 ? 76  LYS C C   1 
ATOM   6166  O O   . LYS C  1 51  ? -1.475  124.161 57.523  1.00 34.98 ? 76  LYS C O   1 
ATOM   6167  C CB  . LYS C  1 51  ? -1.341  121.238 58.275  1.00 34.73 ? 76  LYS C CB  1 
ATOM   6168  C CG  . LYS C  1 51  ? -1.073  121.206 59.780  1.00 35.56 ? 76  LYS C CG  1 
ATOM   6169  C CD  . LYS C  1 51  ? -2.346  120.902 60.534  1.00 39.65 ? 76  LYS C CD  1 
ATOM   6170  C CE  . LYS C  1 51  ? -2.061  120.535 61.956  1.00 39.59 ? 76  LYS C CE  1 
ATOM   6171  N NZ  . LYS C  1 51  ? -1.371  119.230 61.948  1.00 41.36 ? 76  LYS C NZ  1 
ATOM   6172  N N   . SER C  1 52  ? 0.496   124.099 58.576  1.00 32.57 ? 77  SER C N   1 
ATOM   6173  C CA  . SER C  1 52  ? 0.449   125.517 58.944  1.00 33.09 ? 77  SER C CA  1 
ATOM   6174  C C   . SER C  1 52  ? 1.511   126.329 58.207  1.00 32.77 ? 77  SER C C   1 
ATOM   6175  O O   . SER C  1 52  ? 2.098   127.264 58.775  1.00 31.45 ? 77  SER C O   1 
ATOM   6176  C CB  . SER C  1 52  ? 0.679   125.673 60.452  1.00 32.36 ? 77  SER C CB  1 
ATOM   6177  O OG  . SER C  1 52  ? -0.281  124.945 61.186  1.00 31.84 ? 77  SER C OG  1 
ATOM   6178  N N   . GLU C  1 53  ? 1.783   125.975 56.954  1.00 32.81 ? 78  GLU C N   1 
ATOM   6179  C CA  . GLU C  1 53  ? 2.889   126.633 56.261  1.00 32.98 ? 78  GLU C CA  1 
ATOM   6180  C C   . GLU C  1 53  ? 2.561   128.094 55.929  1.00 33.78 ? 78  GLU C C   1 
ATOM   6181  O O   . GLU C  1 53  ? 3.455   128.937 55.853  1.00 33.45 ? 78  GLU C O   1 
ATOM   6182  C CB  . GLU C  1 53  ? 3.363   125.839 55.036  1.00 33.27 ? 78  GLU C CB  1 
ATOM   6183  C CG  . GLU C  1 53  ? 2.594   126.085 53.775  1.00 37.00 ? 78  GLU C CG  1 
ATOM   6184  C CD  . GLU C  1 53  ? 2.973   125.092 52.691  1.00 39.13 ? 78  GLU C CD  1 
ATOM   6185  O OE1 . GLU C  1 53  ? 4.184   124.768 52.517  1.00 40.27 ? 78  GLU C OE1 1 
ATOM   6186  O OE2 . GLU C  1 53  ? 2.047   124.599 52.047  1.00 40.48 ? 78  GLU C OE2 1 
ATOM   6187  N N   . VAL C  1 54  ? 1.280   128.414 55.781  1.00 34.66 ? 79  VAL C N   1 
ATOM   6188  C CA  . VAL C  1 54  ? 0.922   129.820 55.543  1.00 36.00 ? 79  VAL C CA  1 
ATOM   6189  C C   . VAL C  1 54  ? 1.404   130.678 56.725  1.00 35.42 ? 79  VAL C C   1 
ATOM   6190  O O   . VAL C  1 54  ? 2.141   131.644 56.530  1.00 35.27 ? 79  VAL C O   1 
ATOM   6191  C CB  . VAL C  1 54  ? -0.581  130.011 55.286  1.00 37.45 ? 79  VAL C CB  1 
ATOM   6192  C CG1 . VAL C  1 54  ? -0.933  131.499 55.252  1.00 38.98 ? 79  VAL C CG1 1 
ATOM   6193  C CG2 . VAL C  1 54  ? -0.978  129.330 53.979  1.00 38.10 ? 79  VAL C CG2 1 
ATOM   6194  N N   . MET C  1 55  ? 1.030   130.293 57.947  1.00 34.28 ? 80  MET C N   1 
ATOM   6195  C CA  . MET C  1 55  ? 1.530   130.988 59.139  1.00 34.13 ? 80  MET C CA  1 
ATOM   6196  C C   . MET C  1 55  ? 3.043   130.896 59.292  1.00 31.83 ? 80  MET C C   1 
ATOM   6197  O O   . MET C  1 55  ? 3.687   131.856 59.720  1.00 31.51 ? 80  MET C O   1 
ATOM   6198  C CB  . MET C  1 55  ? 0.869   130.461 60.421  1.00 34.51 ? 80  MET C CB  1 
ATOM   6199  C CG  . MET C  1 55  ? 1.154   131.319 61.660  1.00 38.09 ? 80  MET C CG  1 
ATOM   6200  S SD  . MET C  1 55  ? 0.563   133.043 61.499  1.00 49.35 ? 80  MET C SD  1 
ATOM   6201  C CE  . MET C  1 55  ? -1.096  132.823 60.835  1.00 47.04 ? 80  MET C CE  1 
ATOM   6202  N N   . LEU C  1 56  ? 3.610   129.733 58.979  1.00 29.30 ? 81  LEU C N   1 
ATOM   6203  C CA  . LEU C  1 56  ? 5.056   129.573 59.042  1.00 27.47 ? 81  LEU C CA  1 
ATOM   6204  C C   . LEU C  1 56  ? 5.796   130.667 58.266  1.00 27.62 ? 81  LEU C C   1 
ATOM   6205  O O   . LEU C  1 56  ? 6.670   131.339 58.815  1.00 26.97 ? 81  LEU C O   1 
ATOM   6206  C CB  . LEU C  1 56  ? 5.483   128.197 58.521  1.00 25.97 ? 81  LEU C CB  1 
ATOM   6207  C CG  . LEU C  1 56  ? 6.993   128.025 58.443  1.00 25.37 ? 81  LEU C CG  1 
ATOM   6208  C CD1 . LEU C  1 56  ? 7.618   128.194 59.829  1.00 23.30 ? 81  LEU C CD1 1 
ATOM   6209  C CD2 . LEU C  1 56  ? 7.348   126.641 57.862  1.00 25.51 ? 81  LEU C CD2 1 
ATOM   6210  N N   . TYR C  1 57  ? 5.457   130.835 56.991  1.00 27.46 ? 82  TYR C N   1 
ATOM   6211  C CA  . TYR C  1 57  ? 6.158   131.819 56.160  1.00 28.57 ? 82  TYR C CA  1 
ATOM   6212  C C   . TYR C  1 57  ? 5.841   133.253 56.597  1.00 29.38 ? 82  TYR C C   1 
ATOM   6213  O O   . TYR C  1 57  ? 6.720   134.106 56.629  1.00 28.73 ? 82  TYR C O   1 
ATOM   6214  C CB  . TYR C  1 57  ? 5.875   131.598 54.661  1.00 28.89 ? 82  TYR C CB  1 
ATOM   6215  C CG  . TYR C  1 57  ? 6.250   130.185 54.218  1.00 29.86 ? 82  TYR C CG  1 
ATOM   6216  C CD1 . TYR C  1 57  ? 7.480   129.627 54.560  1.00 29.19 ? 82  TYR C CD1 1 
ATOM   6217  C CD2 . TYR C  1 57  ? 5.374   129.422 53.458  1.00 31.12 ? 82  TYR C CD2 1 
ATOM   6218  C CE1 . TYR C  1 57  ? 7.821   128.333 54.165  1.00 29.59 ? 82  TYR C CE1 1 
ATOM   6219  C CE2 . TYR C  1 57  ? 5.706   128.152 53.051  1.00 31.27 ? 82  TYR C CE2 1 
ATOM   6220  C CZ  . TYR C  1 57  ? 6.924   127.605 53.410  1.00 30.28 ? 82  TYR C CZ  1 
ATOM   6221  O OH  . TYR C  1 57  ? 7.231   126.318 53.004  1.00 31.62 ? 82  TYR C OH  1 
ATOM   6222  N N   . GLN C  1 58  ? 4.588   133.517 56.956  1.00 30.32 ? 83  GLN C N   1 
ATOM   6223  C CA  . GLN C  1 58  ? 4.271   134.837 57.515  1.00 31.56 ? 83  GLN C CA  1 
ATOM   6224  C C   . GLN C  1 58  ? 5.046   135.145 58.795  1.00 30.82 ? 83  GLN C C   1 
ATOM   6225  O O   . GLN C  1 58  ? 5.483   136.280 59.009  1.00 30.77 ? 83  GLN C O   1 
ATOM   6226  C CB  . GLN C  1 58  ? 2.770   134.981 57.752  1.00 33.06 ? 83  GLN C CB  1 
ATOM   6227  C CG  . GLN C  1 58  ? 1.996   135.096 56.451  1.00 34.90 ? 83  GLN C CG  1 
ATOM   6228  C CD  . GLN C  1 58  ? 0.508   135.205 56.676  1.00 39.06 ? 83  GLN C CD  1 
ATOM   6229  O OE1 . GLN C  1 58  ? 0.038   135.158 57.813  1.00 39.86 ? 83  GLN C OE1 1 
ATOM   6230  N NE2 . GLN C  1 58  ? -0.247  135.333 55.591  1.00 38.87 ? 83  GLN C NE2 1 
ATOM   6231  N N   . THR C  1 59  ? 5.207   134.141 59.655  1.00 29.11 ? 84  THR C N   1 
ATOM   6232  C CA  . THR C  1 59  ? 5.877   134.361 60.932  1.00 28.90 ? 84  THR C CA  1 
ATOM   6233  C C   . THR C  1 59  ? 7.376   134.559 60.755  1.00 28.22 ? 84  THR C C   1 
ATOM   6234  O O   . THR C  1 59  ? 7.964   135.397 61.411  1.00 28.63 ? 84  THR C O   1 
ATOM   6235  C CB  . THR C  1 59  ? 5.619   133.224 61.917  1.00 28.13 ? 84  THR C CB  1 
ATOM   6236  O OG1 . THR C  1 59  ? 4.215   133.157 62.179  1.00 28.47 ? 84  THR C OG1 1 
ATOM   6237  C CG2 . THR C  1 59  ? 6.370   133.483 63.240  1.00 28.74 ? 84  THR C CG2 1 
ATOM   6238  N N   . ILE C  1 60  ? 7.998   133.787 59.878  1.00 27.74 ? 85  ILE C N   1 
ATOM   6239  C CA  . ILE C  1 60  ? 9.392   134.049 59.512  1.00 27.50 ? 85  ILE C CA  1 
ATOM   6240  C C   . ILE C  1 60  ? 9.589   135.521 59.110  1.00 29.25 ? 85  ILE C C   1 
ATOM   6241  O O   . ILE C  1 60  ? 10.575  136.154 59.499  1.00 29.10 ? 85  ILE C O   1 
ATOM   6242  C CB  . ILE C  1 60  ? 9.872   133.135 58.355  1.00 27.54 ? 85  ILE C CB  1 
ATOM   6243  C CG1 . ILE C  1 60  ? 10.154  131.711 58.856  1.00 25.18 ? 85  ILE C CG1 1 
ATOM   6244  C CG2 . ILE C  1 60  ? 11.143  133.695 57.729  1.00 26.86 ? 85  ILE C CG2 1 
ATOM   6245  C CD1 . ILE C  1 60  ? 10.187  130.673 57.746  1.00 26.07 ? 85  ILE C CD1 1 
ATOM   6246  N N   . ASN C  1 61  ? 8.654   136.064 58.323  1.00 30.26 ? 86  ASN C N   1 
ATOM   6247  C CA  . ASN C  1 61  ? 8.733   137.464 57.903  1.00 32.14 ? 86  ASN C CA  1 
ATOM   6248  C C   . ASN C  1 61  ? 8.557   138.414 59.074  1.00 32.81 ? 86  ASN C C   1 
ATOM   6249  O O   . ASN C  1 61  ? 9.269   139.394 59.188  1.00 33.29 ? 86  ASN C O   1 
ATOM   6250  C CB  . ASN C  1 61  ? 7.707   137.790 56.815  1.00 33.36 ? 86  ASN C CB  1 
ATOM   6251  C CG  . ASN C  1 61  ? 8.054   137.148 55.485  1.00 34.84 ? 86  ASN C CG  1 
ATOM   6252  O OD1 . ASN C  1 61  ? 9.170   136.646 55.299  1.00 35.80 ? 86  ASN C OD1 1 
ATOM   6253  N ND2 . ASN C  1 61  ? 7.107   137.153 54.555  1.00 35.69 ? 86  ASN C ND2 1 
ATOM   6254  N N   . SER C  1 62  ? 7.604   138.099 59.945  1.00 33.23 ? 87  SER C N   1 
ATOM   6255  C CA  . SER C  1 62  ? 7.341   138.887 61.154  1.00 34.10 ? 87  SER C CA  1 
ATOM   6256  C C   . SER C  1 62  ? 8.590   138.926 62.043  1.00 32.86 ? 87  SER C C   1 
ATOM   6257  O O   . SER C  1 62  ? 9.084   139.991 62.428  1.00 33.58 ? 87  SER C O   1 
ATOM   6258  C CB  . SER C  1 62  ? 6.198   138.246 61.937  1.00 34.08 ? 87  SER C CB  1 
ATOM   6259  O OG  . SER C  1 62  ? 5.485   139.222 62.666  1.00 39.35 ? 87  SER C OG  1 
ATOM   6260  N N   . LEU C  1 63  ? 9.103   137.753 62.366  1.00 31.04 ? 88  LEU C N   1 
ATOM   6261  C CA  . LEU C  1 63  ? 10.244  137.661 63.272  1.00 30.37 ? 88  LEU C CA  1 
ATOM   6262  C C   . LEU C  1 63  ? 11.424  138.477 62.774  1.00 30.57 ? 88  LEU C C   1 
ATOM   6263  O O   . LEU C  1 63  ? 12.056  139.191 63.535  1.00 30.37 ? 88  LEU C O   1 
ATOM   6264  C CB  . LEU C  1 63  ? 10.666  136.211 63.460  1.00 28.69 ? 88  LEU C CB  1 
ATOM   6265  C CG  . LEU C  1 63  ? 9.677   135.273 64.142  1.00 28.94 ? 88  LEU C CG  1 
ATOM   6266  C CD1 . LEU C  1 63  ? 10.114  133.842 63.921  1.00 25.60 ? 88  LEU C CD1 1 
ATOM   6267  C CD2 . LEU C  1 63  ? 9.578   135.585 65.627  1.00 29.31 ? 88  LEU C CD2 1 
ATOM   6268  N N   . LYS C  1 64  ? 11.714  138.372 61.485  1.00 30.86 ? 89  LYS C N   1 
ATOM   6269  C CA  . LYS C  1 64  ? 12.883  139.027 60.931  1.00 31.38 ? 89  LYS C CA  1 
ATOM   6270  C C   . LYS C  1 64  ? 12.678  140.531 60.729  1.00 33.37 ? 89  LYS C C   1 
ATOM   6271  O O   . LYS C  1 64  ? 13.644  141.279 60.619  1.00 33.90 ? 89  LYS C O   1 
ATOM   6272  C CB  . LYS C  1 64  ? 13.291  138.338 59.621  1.00 31.19 ? 89  LYS C CB  1 
ATOM   6273  C CG  . LYS C  1 64  ? 13.692  136.868 59.827  1.00 28.82 ? 89  LYS C CG  1 
ATOM   6274  C CD  . LYS C  1 64  ? 14.193  136.186 58.541  1.00 29.81 ? 89  LYS C CD  1 
ATOM   6275  C CE  . LYS C  1 64  ? 15.221  137.035 57.786  1.00 30.92 ? 89  LYS C CE  1 
ATOM   6276  N NZ  . LYS C  1 64  ? 15.823  136.230 56.678  1.00 30.93 ? 89  LYS C NZ  1 
ATOM   6277  N N   . THR C  1 65  ? 11.424  140.966 60.654  1.00 34.78 ? 90  THR C N   1 
ATOM   6278  C CA  . THR C  1 65  ? 11.104  142.398 60.610  1.00 36.88 ? 90  THR C CA  1 
ATOM   6279  C C   . THR C  1 65  ? 11.401  142.966 61.989  1.00 37.61 ? 90  THR C C   1 
ATOM   6280  O O   . THR C  1 65  ? 12.118  143.964 62.135  1.00 38.19 ? 90  THR C O   1 
ATOM   6281  C CB  . THR C  1 65  ? 9.613   142.644 60.258  1.00 37.95 ? 90  THR C CB  1 
ATOM   6282  O OG1 . THR C  1 65  ? 9.341   142.142 58.942  1.00 37.48 ? 90  THR C OG1 1 
ATOM   6283  C CG2 . THR C  1 65  ? 9.265   144.138 60.291  1.00 40.20 ? 90  THR C CG2 1 
ATOM   6284  N N   . LYS C  1 66  ? 10.849  142.296 62.999  1.00 36.78 ? 91  LYS C N   1 
ATOM   6285  C CA  . LYS C  1 66  ? 11.023  142.689 64.391  1.00 37.61 ? 91  LYS C CA  1 
ATOM   6286  C C   . LYS C  1 66  ? 12.491  142.687 64.810  1.00 36.80 ? 91  LYS C C   1 
ATOM   6287  O O   . LYS C  1 66  ? 12.943  143.606 65.481  1.00 37.80 ? 91  LYS C O   1 
ATOM   6288  C CB  . LYS C  1 66  ? 10.189  141.777 65.306  1.00 36.58 ? 91  LYS C CB  1 
ATOM   6289  C CG  . LYS C  1 66  ? 8.683   142.078 65.225  1.00 39.64 ? 91  LYS C CG  1 
ATOM   6290  C CD  . LYS C  1 66  ? 7.832   140.979 65.853  1.00 40.57 ? 91  LYS C CD  1 
ATOM   6291  C CE  . LYS C  1 66  ? 6.345   141.346 65.806  1.00 44.37 ? 91  LYS C CE  1 
ATOM   6292  N NZ  . LYS C  1 66  ? 5.516   140.241 66.391  1.00 44.14 ? 91  LYS C NZ  1 
ATOM   6293  N N   . ASN C  1 67  ? 13.232  141.650 64.429  1.00 35.40 ? 92  ASN C N   1 
ATOM   6294  C CA  . ASN C  1 67  ? 14.658  141.591 64.731  1.00 34.70 ? 92  ASN C CA  1 
ATOM   6295  C C   . ASN C  1 67  ? 15.471  141.360 63.466  1.00 34.78 ? 92  ASN C C   1 
ATOM   6296  O O   . ASN C  1 67  ? 15.682  140.206 63.065  1.00 32.62 ? 92  ASN C O   1 
ATOM   6297  C CB  . ASN C  1 67  ? 14.962  140.479 65.745  1.00 33.06 ? 92  ASN C CB  1 
ATOM   6298  C CG  . ASN C  1 67  ? 16.449  140.373 66.051  1.00 32.66 ? 92  ASN C CG  1 
ATOM   6299  O OD1 . ASN C  1 67  ? 17.237  141.182 65.565  1.00 33.04 ? 92  ASN C OD1 1 
ATOM   6300  N ND2 . ASN C  1 67  ? 16.839  139.367 66.838  1.00 29.91 ? 92  ASN C ND2 1 
ATOM   6301  N N   . PRO C  1 68  ? 15.940  142.451 62.833  1.00 36.49 ? 93  PRO C N   1 
ATOM   6302  C CA  . PRO C  1 68  ? 16.658  142.353 61.552  1.00 37.02 ? 93  PRO C CA  1 
ATOM   6303  C C   . PRO C  1 68  ? 18.028  141.662 61.630  1.00 36.73 ? 93  PRO C C   1 
ATOM   6304  O O   . PRO C  1 68  ? 18.639  141.417 60.602  1.00 37.41 ? 93  PRO C O   1 
ATOM   6305  C CB  . PRO C  1 68  ? 16.815  143.823 61.107  1.00 39.22 ? 93  PRO C CB  1 
ATOM   6306  C CG  . PRO C  1 68  ? 15.857  144.615 61.954  1.00 39.79 ? 93  PRO C CG  1 
ATOM   6307  C CD  . PRO C  1 68  ? 15.744  143.853 63.255  1.00 38.07 ? 93  PRO C CD  1 
ATOM   6308  N N   . LYS C  1 69  ? 18.510  141.346 62.824  1.00 36.31 ? 94  LYS C N   1 
ATOM   6309  C CA  . LYS C  1 69  ? 19.778  140.629 62.949  1.00 35.70 ? 94  LYS C CA  1 
ATOM   6310  C C   . LYS C  1 69  ? 19.532  139.123 62.978  1.00 33.48 ? 94  LYS C C   1 
ATOM   6311  O O   . LYS C  1 69  ? 20.452  138.333 62.782  1.00 33.05 ? 94  LYS C O   1 
ATOM   6312  C CB  . LYS C  1 69  ? 20.506  141.041 64.242  1.00 36.64 ? 94  LYS C CB  1 
ATOM   6313  C CG  . LYS C  1 69  ? 21.325  142.323 64.145  1.00 40.85 ? 94  LYS C CG  1 
ATOM   6314  C CD  . LYS C  1 69  ? 21.694  142.843 65.533  1.00 46.38 ? 94  LYS C CD  1 
ATOM   6315  C CE  . LYS C  1 69  ? 22.469  141.812 66.372  1.00 47.58 ? 94  LYS C CE  1 
ATOM   6316  N NZ  . LYS C  1 69  ? 23.198  142.509 67.494  1.00 50.89 ? 94  LYS C NZ  1 
ATOM   6317  N N   . LEU C  1 70  ? 18.282  138.728 63.230  1.00 32.03 ? 95  LEU C N   1 
ATOM   6318  C CA  . LEU C  1 70  ? 17.918  137.314 63.394  1.00 29.51 ? 95  LEU C CA  1 
ATOM   6319  C C   . LEU C  1 70  ? 18.175  136.512 62.110  1.00 28.91 ? 95  LEU C C   1 
ATOM   6320  O O   . LEU C  1 70  ? 17.853  136.972 61.014  1.00 29.78 ? 95  LEU C O   1 
ATOM   6321  C CB  . LEU C  1 70  ? 16.436  137.210 63.794  1.00 28.94 ? 95  LEU C CB  1 
ATOM   6322  C CG  . LEU C  1 70  ? 15.865  135.822 64.100  1.00 26.85 ? 95  LEU C CG  1 
ATOM   6323  C CD1 . LEU C  1 70  ? 16.565  135.221 65.314  1.00 25.57 ? 95  LEU C CD1 1 
ATOM   6324  C CD2 . LEU C  1 70  ? 14.368  135.908 64.336  1.00 26.38 ? 95  LEU C CD2 1 
ATOM   6325  N N   . LYS C  1 71  ? 18.749  135.321 62.251  1.00 27.44 ? 96  LYS C N   1 
ATOM   6326  C CA  . LYS C  1 71  ? 18.894  134.376 61.139  1.00 26.96 ? 96  LYS C CA  1 
ATOM   6327  C C   . LYS C  1 71  ? 17.962  133.193 61.350  1.00 25.67 ? 96  LYS C C   1 
ATOM   6328  O O   . LYS C  1 71  ? 17.824  132.690 62.472  1.00 25.06 ? 96  LYS C O   1 
ATOM   6329  C CB  . LYS C  1 71  ? 20.325  133.832 61.067  1.00 26.77 ? 96  LYS C CB  1 
ATOM   6330  C CG  . LYS C  1 71  ? 21.396  134.898 60.976  1.00 29.01 ? 96  LYS C CG  1 
ATOM   6331  C CD  . LYS C  1 71  ? 21.388  135.509 59.586  1.00 34.38 ? 96  LYS C CD  1 
ATOM   6332  C CE  . LYS C  1 71  ? 22.686  136.226 59.300  1.00 37.72 ? 96  LYS C CE  1 
ATOM   6333  N NZ  . LYS C  1 71  ? 22.590  137.619 59.753  1.00 40.95 ? 96  LYS C NZ  1 
ATOM   6334  N N   . ILE C  1 72  ? 17.339  132.742 60.267  1.00 24.64 ? 97  ILE C N   1 
ATOM   6335  C CA  . ILE C  1 72  ? 16.467  131.592 60.323  1.00 23.57 ? 97  ILE C CA  1 
ATOM   6336  C C   . ILE C  1 72  ? 16.886  130.591 59.257  1.00 23.14 ? 97  ILE C C   1 
ATOM   6337  O O   . ILE C  1 72  ? 16.883  130.908 58.069  1.00 23.61 ? 97  ILE C O   1 
ATOM   6338  C CB  . ILE C  1 72  ? 14.972  132.003 60.153  1.00 23.96 ? 97  ILE C CB  1 
ATOM   6339  C CG1 . ILE C  1 72  ? 14.604  133.034 61.215  1.00 23.57 ? 97  ILE C CG1 1 
ATOM   6340  C CG2 . ILE C  1 72  ? 14.075  130.785 60.299  1.00 23.02 ? 97  ILE C CG2 1 
ATOM   6341  C CD1 . ILE C  1 72  ? 13.133  133.481 61.162  1.00 24.58 ? 97  ILE C CD1 1 
ATOM   6342  N N   . LEU C  1 73  ? 17.272  129.389 59.690  1.00 22.04 ? 98  LEU C N   1 
ATOM   6343  C CA  . LEU C  1 73  ? 17.736  128.370 58.763  1.00 21.89 ? 98  LEU C CA  1 
ATOM   6344  C C   . LEU C  1 73  ? 16.700  127.268 58.635  1.00 21.19 ? 98  LEU C C   1 
ATOM   6345  O O   . LEU C  1 73  ? 15.840  127.119 59.497  1.00 20.45 ? 98  LEU C O   1 
ATOM   6346  C CB  . LEU C  1 73  ? 19.053  127.761 59.239  1.00 21.99 ? 98  LEU C CB  1 
ATOM   6347  C CG  . LEU C  1 73  ? 20.292  128.652 59.266  1.00 24.52 ? 98  LEU C CG  1 
ATOM   6348  C CD1 . LEU C  1 73  ? 20.200  129.651 60.398  1.00 26.83 ? 98  LEU C CD1 1 
ATOM   6349  C CD2 . LEU C  1 73  ? 21.504  127.746 59.471  1.00 25.64 ? 98  LEU C CD2 1 
ATOM   6350  N N   . LEU C  1 74  ? 16.803  126.511 57.551  1.00 21.28 ? 99  LEU C N   1 
ATOM   6351  C CA  . LEU C  1 74  ? 15.975  125.349 57.300  1.00 21.36 ? 99  LEU C CA  1 
ATOM   6352  C C   . LEU C  1 74  ? 16.852  124.125 57.525  1.00 20.99 ? 99  LEU C C   1 
ATOM   6353  O O   . LEU C  1 74  ? 17.955  124.046 56.969  1.00 22.04 ? 99  LEU C O   1 
ATOM   6354  C CB  . LEU C  1 74  ? 15.478  125.367 55.841  1.00 21.83 ? 99  LEU C CB  1 
ATOM   6355  C CG  . LEU C  1 74  ? 14.538  124.245 55.391  1.00 22.79 ? 99  LEU C CG  1 
ATOM   6356  C CD1 . LEU C  1 74  ? 13.354  124.142 56.352  1.00 22.66 ? 99  LEU C CD1 1 
ATOM   6357  C CD2 . LEU C  1 74  ? 14.049  124.471 53.947  1.00 23.44 ? 99  LEU C CD2 1 
ATOM   6358  N N   . SER C  1 75  ? 16.398  123.190 58.358  1.00 20.43 ? 100 SER C N   1 
ATOM   6359  C CA  . SER C  1 75  ? 17.142  121.939 58.549  1.00 19.74 ? 100 SER C CA  1 
ATOM   6360  C C   . SER C  1 75  ? 16.569  120.793 57.717  1.00 19.95 ? 100 SER C C   1 
ATOM   6361  O O   . SER C  1 75  ? 15.363  120.644 57.608  1.00 19.84 ? 100 SER C O   1 
ATOM   6362  C CB  . SER C  1 75  ? 17.170  121.535 60.035  1.00 18.64 ? 100 SER C CB  1 
ATOM   6363  O OG  . SER C  1 75  ? 17.972  120.371 60.200  1.00 18.21 ? 100 SER C OG  1 
ATOM   6364  N N   . ILE C  1 76  ? 17.438  119.994 57.102  1.00 20.68 ? 101 ILE C N   1 
ATOM   6365  C CA  . ILE C  1 76  ? 16.984  118.751 56.494  1.00 20.93 ? 101 ILE C CA  1 
ATOM   6366  C C   . ILE C  1 76  ? 17.709  117.625 57.189  1.00 20.54 ? 101 ILE C C   1 
ATOM   6367  O O   . ILE C  1 76  ? 18.933  117.656 57.332  1.00 20.61 ? 101 ILE C O   1 
ATOM   6368  C CB  . ILE C  1 76  ? 17.320  118.672 55.006  1.00 22.43 ? 101 ILE C CB  1 
ATOM   6369  C CG1 . ILE C  1 76  ? 16.492  119.659 54.197  1.00 24.69 ? 101 ILE C CG1 1 
ATOM   6370  C CG2 . ILE C  1 76  ? 17.053  117.270 54.458  1.00 22.47 ? 101 ILE C CG2 1 
ATOM   6371  C CD1 . ILE C  1 76  ? 16.861  119.618 52.715  1.00 27.56 ? 101 ILE C CD1 1 
ATOM   6372  N N   . GLY C  1 77  ? 16.962  116.632 57.644  1.00 20.20 ? 102 GLY C N   1 
ATOM   6373  C CA  . GLY C  1 77  ? 17.591  115.481 58.274  1.00 19.68 ? 102 GLY C CA  1 
ATOM   6374  C C   . GLY C  1 77  ? 16.869  115.079 59.538  1.00 18.92 ? 102 GLY C C   1 
ATOM   6375  O O   . GLY C  1 77  ? 15.630  115.059 59.583  1.00 18.89 ? 102 GLY C O   1 
ATOM   6376  N N   . GLY C  1 78  ? 17.647  114.768 60.569  1.00 18.15 ? 103 GLY C N   1 
ATOM   6377  C CA  . GLY C  1 78  ? 17.075  114.312 61.835  1.00 18.50 ? 103 GLY C CA  1 
ATOM   6378  C C   . GLY C  1 78  ? 16.927  112.803 61.894  1.00 18.68 ? 103 GLY C C   1 
ATOM   6379  O O   . GLY C  1 78  ? 17.100  112.114 60.887  1.00 19.08 ? 103 GLY C O   1 
ATOM   6380  N N   . TYR C  1 79  ? 16.601  112.292 63.075  1.00 18.17 ? 104 TYR C N   1 
ATOM   6381  C CA  . TYR C  1 79  ? 16.567  110.841 63.318  1.00 19.81 ? 104 TYR C CA  1 
ATOM   6382  C C   . TYR C  1 79  ? 15.652  110.041 62.396  1.00 20.35 ? 104 TYR C C   1 
ATOM   6383  O O   . TYR C  1 79  ? 16.095  109.065 61.783  1.00 20.53 ? 104 TYR C O   1 
ATOM   6384  C CB  . TYR C  1 79  ? 16.208  110.535 64.772  1.00 19.13 ? 104 TYR C CB  1 
ATOM   6385  C CG  . TYR C  1 79  ? 16.382  109.069 65.131  1.00 22.58 ? 104 TYR C CG  1 
ATOM   6386  C CD1 . TYR C  1 79  ? 17.655  108.513 65.272  1.00 24.76 ? 104 TYR C CD1 1 
ATOM   6387  C CD2 . TYR C  1 79  ? 15.280  108.249 65.311  1.00 25.56 ? 104 TYR C CD2 1 
ATOM   6388  C CE1 . TYR C  1 79  ? 17.827  107.172 65.610  1.00 26.89 ? 104 TYR C CE1 1 
ATOM   6389  C CE2 . TYR C  1 79  ? 15.435  106.905 65.643  1.00 28.33 ? 104 TYR C CE2 1 
ATOM   6390  C CZ  . TYR C  1 79  ? 16.706  106.380 65.787  1.00 27.99 ? 104 TYR C CZ  1 
ATOM   6391  O OH  . TYR C  1 79  ? 16.861  105.057 66.123  1.00 33.83 ? 104 TYR C OH  1 
ATOM   6392  N N   . LEU C  1 80  ? 14.385  110.437 62.296  1.00 20.31 ? 105 LEU C N   1 
ATOM   6393  C CA  . LEU C  1 80  ? 13.440  109.687 61.450  1.00 21.78 ? 105 LEU C CA  1 
ATOM   6394  C C   . LEU C  1 80  ? 13.785  109.747 59.956  1.00 22.16 ? 105 LEU C C   1 
ATOM   6395  O O   . LEU C  1 80  ? 13.606  108.770 59.233  1.00 23.20 ? 105 LEU C O   1 
ATOM   6396  C CB  . LEU C  1 80  ? 11.984  110.146 61.699  1.00 22.07 ? 105 LEU C CB  1 
ATOM   6397  C CG  . LEU C  1 80  ? 11.381  109.808 63.076  1.00 24.95 ? 105 LEU C CG  1 
ATOM   6398  C CD1 . LEU C  1 80  ? 9.946   110.409 63.194  1.00 27.28 ? 105 LEU C CD1 1 
ATOM   6399  C CD2 . LEU C  1 80  ? 11.368  108.318 63.363  1.00 27.05 ? 105 LEU C CD2 1 
ATOM   6400  N N   . PHE C  1 81  ? 14.281  110.889 59.490  1.00 21.63 ? 106 PHE C N   1 
ATOM   6401  C CA  . PHE C  1 81  ? 14.695  111.024 58.084  1.00 22.32 ? 106 PHE C CA  1 
ATOM   6402  C C   . PHE C  1 81  ? 15.845  110.045 57.790  1.00 22.28 ? 106 PHE C C   1 
ATOM   6403  O O   . PHE C  1 81  ? 15.904  109.396 56.749  1.00 22.89 ? 106 PHE C O   1 
ATOM   6404  C CB  . PHE C  1 81  ? 15.128  112.478 57.843  1.00 21.46 ? 106 PHE C CB  1 
ATOM   6405  C CG  . PHE C  1 81  ? 15.230  112.879 56.393  1.00 22.19 ? 106 PHE C CG  1 
ATOM   6406  C CD1 . PHE C  1 81  ? 14.087  113.112 55.639  1.00 22.31 ? 106 PHE C CD1 1 
ATOM   6407  C CD2 . PHE C  1 81  ? 16.475  113.069 55.803  1.00 21.60 ? 106 PHE C CD2 1 
ATOM   6408  C CE1 . PHE C  1 81  ? 14.182  113.508 54.314  1.00 23.35 ? 106 PHE C CE1 1 
ATOM   6409  C CE2 . PHE C  1 81  ? 16.589  113.474 54.487  1.00 22.60 ? 106 PHE C CE2 1 
ATOM   6410  C CZ  . PHE C  1 81  ? 15.437  113.704 53.738  1.00 23.58 ? 106 PHE C CZ  1 
ATOM   6411  N N   . GLY C  1 82  ? 16.758  109.925 58.737  1.00 21.79 ? 107 GLY C N   1 
ATOM   6412  C CA  . GLY C  1 82  ? 17.895  109.017 58.599  1.00 21.47 ? 107 GLY C CA  1 
ATOM   6413  C C   . GLY C  1 82  ? 18.720  109.220 57.343  1.00 21.33 ? 107 GLY C C   1 
ATOM   6414  O O   . GLY C  1 82  ? 18.849  110.333 56.816  1.00 20.86 ? 107 GLY C O   1 
ATOM   6415  N N   . SER C  1 83  ? 19.306  108.132 56.868  1.00 21.90 ? 108 SER C N   1 
ATOM   6416  C CA  . SER C  1 83  ? 20.044  108.166 55.619  1.00 22.23 ? 108 SER C CA  1 
ATOM   6417  C C   . SER C  1 83  ? 19.083  108.014 54.435  1.00 23.08 ? 108 SER C C   1 
ATOM   6418  O O   . SER C  1 83  ? 19.312  108.572 53.357  1.00 22.95 ? 108 SER C O   1 
ATOM   6419  C CB  . SER C  1 83  ? 21.102  107.050 55.602  1.00 22.86 ? 108 SER C CB  1 
ATOM   6420  O OG  . SER C  1 83  ? 22.180  107.350 56.484  1.00 23.23 ? 108 SER C OG  1 
ATOM   6421  N N   . LYS C  1 84  ? 18.003  107.260 54.637  1.00 22.97 ? 109 LYS C N   1 
ATOM   6422  C CA  . LYS C  1 84  ? 17.077  106.944 53.539  1.00 24.71 ? 109 LYS C CA  1 
ATOM   6423  C C   . LYS C  1 84  ? 16.552  108.198 52.842  1.00 24.33 ? 109 LYS C C   1 
ATOM   6424  O O   . LYS C  1 84  ? 16.400  108.223 51.617  1.00 24.40 ? 109 LYS C O   1 
ATOM   6425  C CB  . LYS C  1 84  ? 15.903  106.093 54.034  1.00 25.36 ? 109 LYS C CB  1 
ATOM   6426  C CG  . LYS C  1 84  ? 16.240  104.613 54.293  1.00 29.26 ? 109 LYS C CG  1 
ATOM   6427  C CD  . LYS C  1 84  ? 15.027  103.843 54.832  1.00 32.11 ? 109 LYS C CD  1 
ATOM   6428  C CE  . LYS C  1 84  ? 15.368  102.361 55.025  1.00 36.22 ? 109 LYS C CE  1 
ATOM   6429  N NZ  . LYS C  1 84  ? 16.517  102.177 55.972  1.00 36.76 ? 109 LYS C NZ  1 
ATOM   6430  N N   . GLY C  1 85  ? 16.276  109.234 53.628  1.00 22.97 ? 110 GLY C N   1 
ATOM   6431  C CA  . GLY C  1 85  ? 15.669  110.464 53.090  1.00 23.44 ? 110 GLY C CA  1 
ATOM   6432  C C   . GLY C  1 85  ? 16.522  111.149 52.040  1.00 23.21 ? 110 GLY C C   1 
ATOM   6433  O O   . GLY C  1 85  ? 16.008  111.834 51.146  1.00 23.27 ? 110 GLY C O   1 
ATOM   6434  N N   . PHE C  1 86  ? 17.832  110.943 52.138  1.00 22.11 ? 111 PHE C N   1 
ATOM   6435  C CA  . PHE C  1 86  ? 18.764  111.538 51.191  1.00 22.35 ? 111 PHE C CA  1 
ATOM   6436  C C   . PHE C  1 86  ? 18.915  110.756 49.879  1.00 23.27 ? 111 PHE C C   1 
ATOM   6437  O O   . PHE C  1 86  ? 19.610  111.205 48.979  1.00 23.92 ? 111 PHE C O   1 
ATOM   6438  C CB  . PHE C  1 86  ? 20.125  111.721 51.855  1.00 21.54 ? 111 PHE C CB  1 
ATOM   6439  C CG  . PHE C  1 86  ? 20.119  112.742 52.958  1.00 21.04 ? 111 PHE C CG  1 
ATOM   6440  C CD1 . PHE C  1 86  ? 20.285  114.091 52.672  1.00 21.06 ? 111 PHE C CD1 1 
ATOM   6441  C CD2 . PHE C  1 86  ? 19.933  112.352 54.276  1.00 20.09 ? 111 PHE C CD2 1 
ATOM   6442  C CE1 . PHE C  1 86  ? 20.279  115.037 53.691  1.00 21.51 ? 111 PHE C CE1 1 
ATOM   6443  C CE2 . PHE C  1 86  ? 19.915  113.280 55.290  1.00 20.43 ? 111 PHE C CE2 1 
ATOM   6444  C CZ  . PHE C  1 86  ? 20.091  114.633 54.996  1.00 20.49 ? 111 PHE C CZ  1 
ATOM   6445  N N   . HIS C  1 87  ? 18.291  109.588 49.782  1.00 23.19 ? 112 HIS C N   1 
ATOM   6446  C CA  . HIS C  1 87  ? 18.417  108.739 48.590  1.00 24.89 ? 112 HIS C CA  1 
ATOM   6447  C C   . HIS C  1 87  ? 17.111  108.779 47.822  1.00 24.83 ? 112 HIS C C   1 
ATOM   6448  O O   . HIS C  1 87  ? 16.062  108.745 48.437  1.00 24.03 ? 112 HIS C O   1 
ATOM   6449  C CB  . HIS C  1 87  ? 18.695  107.285 49.004  1.00 25.01 ? 112 HIS C CB  1 
ATOM   6450  C CG  . HIS C  1 87  ? 20.081  107.059 49.522  1.00 26.76 ? 112 HIS C CG  1 
ATOM   6451  N ND1 . HIS C  1 87  ? 21.185  106.994 48.700  1.00 27.92 ? 112 HIS C ND1 1 
ATOM   6452  C CD2 . HIS C  1 87  ? 20.542  106.881 50.785  1.00 27.70 ? 112 HIS C CD2 1 
ATOM   6453  C CE1 . HIS C  1 87  ? 22.268  106.799 49.433  1.00 28.42 ? 112 HIS C CE1 1 
ATOM   6454  N NE2 . HIS C  1 87  ? 21.905  106.722 50.701  1.00 28.16 ? 112 HIS C NE2 1 
ATOM   6455  N N   . PRO C  1 88  ? 17.160  108.822 46.478  1.00 26.10 ? 113 PRO C N   1 
ATOM   6456  C CA  . PRO C  1 88  ? 18.311  108.736 45.583  1.00 26.69 ? 113 PRO C CA  1 
ATOM   6457  C C   . PRO C  1 88  ? 19.004  110.081 45.266  1.00 26.58 ? 113 PRO C C   1 
ATOM   6458  O O   . PRO C  1 88  ? 19.887  110.131 44.402  1.00 26.39 ? 113 PRO C O   1 
ATOM   6459  C CB  . PRO C  1 88  ? 17.678  108.190 44.306  1.00 28.64 ? 113 PRO C CB  1 
ATOM   6460  C CG  . PRO C  1 88  ? 16.333  108.894 44.265  1.00 28.21 ? 113 PRO C CG  1 
ATOM   6461  C CD  . PRO C  1 88  ? 15.908  109.031 45.725  1.00 26.61 ? 113 PRO C CD  1 
ATOM   6462  N N   . MET C  1 89  ? 18.614  111.159 45.938  1.00 25.51 ? 114 MET C N   1 
ATOM   6463  C CA  . MET C  1 89  ? 19.190  112.481 45.621  1.00 26.29 ? 114 MET C CA  1 
ATOM   6464  C C   . MET C  1 89  ? 20.741  112.540 45.622  1.00 26.55 ? 114 MET C C   1 
ATOM   6465  O O   . MET C  1 89  ? 21.339  113.159 44.735  1.00 26.96 ? 114 MET C O   1 
ATOM   6466  C CB  . MET C  1 89  ? 18.629  113.563 46.552  1.00 25.30 ? 114 MET C CB  1 
ATOM   6467  C CG  . MET C  1 89  ? 19.133  114.954 46.211  1.00 26.35 ? 114 MET C CG  1 
ATOM   6468  S SD  . MET C  1 89  ? 20.736  115.348 46.955  1.00 25.99 ? 114 MET C SD  1 
ATOM   6469  C CE  . MET C  1 89  ? 20.367  115.494 48.700  1.00 23.97 ? 114 MET C CE  1 
ATOM   6470  N N   . VAL C  1 90  ? 21.389  111.911 46.605  1.00 26.39 ? 115 VAL C N   1 
ATOM   6471  C CA  . VAL C  1 90  ? 22.858  111.997 46.719  1.00 27.35 ? 115 VAL C CA  1 
ATOM   6472  C C   . VAL C  1 90  ? 23.573  111.063 45.761  1.00 29.23 ? 115 VAL C C   1 
ATOM   6473  O O   . VAL C  1 90  ? 24.786  111.185 45.561  1.00 29.27 ? 115 VAL C O   1 
ATOM   6474  C CB  . VAL C  1 90  ? 23.389  111.721 48.143  1.00 26.54 ? 115 VAL C CB  1 
ATOM   6475  C CG1 . VAL C  1 90  ? 22.816  112.732 49.140  1.00 26.46 ? 115 VAL C CG1 1 
ATOM   6476  C CG2 . VAL C  1 90  ? 23.071  110.282 48.573  1.00 26.91 ? 115 VAL C CG2 1 
ATOM   6477  N N   . ASP C  1 91  ? 22.809  110.165 45.143  1.00 29.95 ? 116 ASP C N   1 
ATOM   6478  C CA  . ASP C  1 91  ? 23.372  109.074 44.357  1.00 31.95 ? 116 ASP C CA  1 
ATOM   6479  C C   . ASP C  1 91  ? 23.869  109.429 42.964  1.00 33.03 ? 116 ASP C C   1 
ATOM   6480  O O   . ASP C  1 91  ? 24.436  108.586 42.290  1.00 33.38 ? 116 ASP C O   1 
ATOM   6481  C CB  . ASP C  1 91  ? 22.383  107.906 44.287  1.00 32.56 ? 116 ASP C CB  1 
ATOM   6482  C CG  . ASP C  1 91  ? 22.167  107.266 45.634  1.00 33.88 ? 116 ASP C CG  1 
ATOM   6483  O OD1 . ASP C  1 91  ? 23.176  107.021 46.319  1.00 35.22 ? 116 ASP C OD1 1 
ATOM   6484  O OD2 . ASP C  1 91  ? 21.001  107.042 46.023  1.00 35.61 ? 116 ASP C OD2 1 
ATOM   6485  N N   . SER C  1 92  ? 23.664  110.663 42.524  1.00 32.91 ? 117 SER C N   1 
ATOM   6486  C CA  . SER C  1 92  ? 24.215  111.068 41.228  1.00 34.66 ? 117 SER C CA  1 
ATOM   6487  C C   . SER C  1 92  ? 24.476  112.568 41.156  1.00 34.02 ? 117 SER C C   1 
ATOM   6488  O O   . SER C  1 92  ? 23.856  113.347 41.873  1.00 32.57 ? 117 SER C O   1 
ATOM   6489  C CB  . SER C  1 92  ? 23.286  110.637 40.075  1.00 35.94 ? 117 SER C CB  1 
ATOM   6490  O OG  . SER C  1 92  ? 22.082  111.386 40.128  1.00 36.52 ? 117 SER C OG  1 
ATOM   6491  N N   . SER C  1 93  ? 25.397  112.978 40.288  1.00 35.29 ? 118 SER C N   1 
ATOM   6492  C CA  . SER C  1 93  ? 25.711  114.395 40.184  1.00 35.66 ? 118 SER C CA  1 
ATOM   6493  C C   . SER C  1 93  ? 24.531  115.173 39.593  1.00 35.66 ? 118 SER C C   1 
ATOM   6494  O O   . SER C  1 93  ? 24.256  116.297 40.001  1.00 34.92 ? 118 SER C O   1 
ATOM   6495  C CB  . SER C  1 93  ? 27.003  114.630 39.386  1.00 37.18 ? 118 SER C CB  1 
ATOM   6496  O OG  . SER C  1 93  ? 26.961  113.979 38.132  1.00 40.06 ? 118 SER C OG  1 
ATOM   6497  N N   . THR C  1 94  ? 23.807  114.573 38.658  1.00 36.04 ? 119 THR C N   1 
ATOM   6498  C CA  . THR C  1 94  ? 22.645  115.274 38.113  1.00 36.30 ? 119 THR C CA  1 
ATOM   6499  C C   . THR C  1 94  ? 21.575  115.534 39.196  1.00 34.33 ? 119 THR C C   1 
ATOM   6500  O O   . THR C  1 94  ? 21.043  116.638 39.300  1.00 33.77 ? 119 THR C O   1 
ATOM   6501  C CB  . THR C  1 94  ? 22.039  114.585 36.847  1.00 37.80 ? 119 THR C CB  1 
ATOM   6502  O OG1 . THR C  1 94  ? 21.584  113.273 37.185  1.00 39.98 ? 119 THR C OG1 1 
ATOM   6503  C CG2 . THR C  1 94  ? 23.069  114.477 35.738  1.00 39.14 ? 119 THR C CG2 1 
ATOM   6504  N N   . SER C  1 95  ? 21.258  114.540 40.013  1.00 33.12 ? 120 SER C N   1 
ATOM   6505  C CA  . SER C  1 95  ? 20.240  114.758 41.025  1.00 31.90 ? 120 SER C CA  1 
ATOM   6506  C C   . SER C  1 95  ? 20.739  115.661 42.170  1.00 30.50 ? 120 SER C C   1 
ATOM   6507  O O   . SER C  1 95  ? 19.955  116.360 42.822  1.00 29.46 ? 120 SER C O   1 
ATOM   6508  C CB  . SER C  1 95  ? 19.719  113.421 41.546  1.00 31.90 ? 120 SER C CB  1 
ATOM   6509  O OG  . SER C  1 95  ? 20.802  112.664 42.038  1.00 33.26 ? 120 SER C OG  1 
ATOM   6510  N N   . ARG C  1 96  ? 22.039  115.660 42.426  1.00 29.94 ? 121 ARG C N   1 
ATOM   6511  C CA  . ARG C  1 96  ? 22.553  116.558 43.446  1.00 29.35 ? 121 ARG C CA  1 
ATOM   6512  C C   . ARG C  1 96  ? 22.446  117.998 42.939  1.00 30.00 ? 121 ARG C C   1 
ATOM   6513  O O   . ARG C  1 96  ? 22.098  118.908 43.703  1.00 29.91 ? 121 ARG C O   1 
ATOM   6514  C CB  . ARG C  1 96  ? 23.995  116.218 43.831  1.00 29.00 ? 121 ARG C CB  1 
ATOM   6515  C CG  . ARG C  1 96  ? 24.131  115.004 44.726  1.00 28.26 ? 121 ARG C CG  1 
ATOM   6516  C CD  . ARG C  1 96  ? 25.479  114.966 45.444  1.00 27.93 ? 121 ARG C CD  1 
ATOM   6517  N NE  . ARG C  1 96  ? 26.588  114.972 44.501  1.00 28.70 ? 121 ARG C NE  1 
ATOM   6518  C CZ  . ARG C  1 96  ? 27.004  113.900 43.840  1.00 31.49 ? 121 ARG C CZ  1 
ATOM   6519  N NH1 . ARG C  1 96  ? 26.395  112.727 44.015  1.00 29.22 ? 121 ARG C NH1 1 
ATOM   6520  N NH2 . ARG C  1 96  ? 28.021  113.997 42.992  1.00 31.27 ? 121 ARG C NH2 1 
ATOM   6521  N N   . LEU C  1 97  ? 22.770  118.206 41.666  1.00 31.30 ? 122 LEU C N   1 
ATOM   6522  C CA  . LEU C  1 97  ? 22.646  119.537 41.074  1.00 32.15 ? 122 LEU C CA  1 
ATOM   6523  C C   . LEU C  1 97  ? 21.201  120.030 41.162  1.00 32.45 ? 122 LEU C C   1 
ATOM   6524  O O   . LEU C  1 97  ? 20.947  121.204 41.460  1.00 32.24 ? 122 LEU C O   1 
ATOM   6525  C CB  . LEU C  1 97  ? 23.123  119.544 39.619  1.00 33.27 ? 122 LEU C CB  1 
ATOM   6526  C CG  . LEU C  1 97  ? 23.070  120.898 38.897  1.00 34.27 ? 122 LEU C CG  1 
ATOM   6527  C CD1 . LEU C  1 97  ? 23.908  121.949 39.634  1.00 34.13 ? 122 LEU C CD1 1 
ATOM   6528  C CD2 . LEU C  1 97  ? 23.507  120.765 37.427  1.00 36.72 ? 122 LEU C CD2 1 
ATOM   6529  N N   . GLU C  1 98  ? 20.256  119.133 40.894  1.00 32.55 ? 123 GLU C N   1 
ATOM   6530  C CA  . GLU C  1 98  ? 18.843  119.482 40.945  1.00 32.79 ? 123 GLU C CA  1 
ATOM   6531  C C   . GLU C  1 98  ? 18.466  119.951 42.346  1.00 30.54 ? 123 GLU C C   1 
ATOM   6532  O O   . GLU C  1 98  ? 17.828  120.987 42.520  1.00 29.67 ? 123 GLU C O   1 
ATOM   6533  C CB  . GLU C  1 98  ? 17.987  118.280 40.549  1.00 33.80 ? 123 GLU C CB  1 
ATOM   6534  C CG  . GLU C  1 98  ? 16.514  118.598 40.351  1.00 37.49 ? 123 GLU C CG  1 
ATOM   6535  C CD  . GLU C  1 98  ? 15.717  117.421 39.800  1.00 42.20 ? 123 GLU C CD  1 
ATOM   6536  O OE1 . GLU C  1 98  ? 16.306  116.337 39.565  1.00 43.18 ? 123 GLU C OE1 1 
ATOM   6537  O OE2 . GLU C  1 98  ? 14.493  117.592 39.598  1.00 44.49 ? 123 GLU C OE2 1 
ATOM   6538  N N   . PHE C  1 99  ? 18.861  119.164 43.339  1.00 29.00 ? 124 PHE C N   1 
ATOM   6539  C CA  . PHE C  1 99  ? 18.609  119.483 44.734  1.00 27.53 ? 124 PHE C CA  1 
ATOM   6540  C C   . PHE C  1 99  ? 19.218  120.826 45.137  1.00 27.11 ? 124 PHE C C   1 
ATOM   6541  O O   . PHE C  1 99  ? 18.548  121.666 45.737  1.00 26.63 ? 124 PHE C O   1 
ATOM   6542  C CB  . PHE C  1 99  ? 19.176  118.383 45.630  1.00 26.78 ? 124 PHE C CB  1 
ATOM   6543  C CG  . PHE C  1 99  ? 19.102  118.699 47.101  1.00 26.20 ? 124 PHE C CG  1 
ATOM   6544  C CD1 . PHE C  1 99  ? 17.884  118.698 47.770  1.00 26.75 ? 124 PHE C CD1 1 
ATOM   6545  C CD2 . PHE C  1 99  ? 20.252  118.997 47.813  1.00 26.25 ? 124 PHE C CD2 1 
ATOM   6546  C CE1 . PHE C  1 99  ? 17.819  118.988 49.143  1.00 26.21 ? 124 PHE C CE1 1 
ATOM   6547  C CE2 . PHE C  1 99  ? 20.206  119.287 49.170  1.00 25.41 ? 124 PHE C CE2 1 
ATOM   6548  C CZ  . PHE C  1 99  ? 18.993  119.284 49.839  1.00 26.08 ? 124 PHE C CZ  1 
ATOM   6549  N N   . ILE C  1 100 ? 20.488  121.022 44.805  1.00 27.09 ? 125 ILE C N   1 
ATOM   6550  C CA  . ILE C  1 100 ? 21.218  122.223 45.216  1.00 27.86 ? 125 ILE C CA  1 
ATOM   6551  C C   . ILE C  1 100 ? 20.638  123.513 44.584  1.00 28.87 ? 125 ILE C C   1 
ATOM   6552  O O   . ILE C  1 100 ? 20.427  124.524 45.273  1.00 28.20 ? 125 ILE C O   1 
ATOM   6553  C CB  . ILE C  1 100 ? 22.742  122.073 44.922  1.00 28.13 ? 125 ILE C CB  1 
ATOM   6554  C CG1 . ILE C  1 100 ? 23.348  121.014 45.850  1.00 27.98 ? 125 ILE C CG1 1 
ATOM   6555  C CG2 . ILE C  1 100 ? 23.479  123.383 45.146  1.00 29.10 ? 125 ILE C CG2 1 
ATOM   6556  C CD1 . ILE C  1 100 ? 24.804  120.725 45.584  1.00 27.93 ? 125 ILE C CD1 1 
ATOM   6557  N N   . ASN C  1 101 ? 20.365  123.471 43.282  1.00 29.99 ? 126 ASN C N   1 
ATOM   6558  C CA  . ASN C  1 101 ? 19.670  124.580 42.635  1.00 31.61 ? 126 ASN C CA  1 
ATOM   6559  C C   . ASN C  1 101 ? 18.325  124.850 43.289  1.00 31.14 ? 126 ASN C C   1 
ATOM   6560  O O   . ASN C  1 101 ? 17.984  126.001 43.523  1.00 32.11 ? 126 ASN C O   1 
ATOM   6561  C CB  . ASN C  1 101 ? 19.483  124.332 41.133  1.00 32.93 ? 126 ASN C CB  1 
ATOM   6562  C CG  . ASN C  1 101 ? 20.784  124.400 40.370  1.00 34.27 ? 126 ASN C CG  1 
ATOM   6563  O OD1 . ASN C  1 101 ? 21.757  124.986 40.836  1.00 35.81 ? 126 ASN C OD1 1 
ATOM   6564  N ND2 . ASN C  1 101 ? 20.815  123.784 39.195  1.00 36.26 ? 126 ASN C ND2 1 
ATOM   6565  N N   . SER C  1 102 ? 17.576  123.789 43.589  1.00 30.75 ? 127 SER C N   1 
ATOM   6566  C CA  . SER C  1 102 ? 16.265  123.882 44.269  1.00 30.14 ? 127 SER C CA  1 
ATOM   6567  C C   . SER C  1 102 ? 16.374  124.536 45.660  1.00 29.10 ? 127 SER C C   1 
ATOM   6568  O O   . SER C  1 102 ? 15.549  125.382 46.048  1.00 29.24 ? 127 SER C O   1 
ATOM   6569  C CB  . SER C  1 102 ? 15.627  122.481 44.404  1.00 29.33 ? 127 SER C CB  1 
ATOM   6570  O OG  . SER C  1 102 ? 15.895  121.877 45.678  1.00 30.50 ? 127 SER C OG  1 
ATOM   6571  N N   . ILE C  1 103 ? 17.405  124.126 46.390  1.00 27.76 ? 128 ILE C N   1 
ATOM   6572  C CA  . ILE C  1 103 ? 17.721  124.622 47.714  1.00 27.51 ? 128 ILE C CA  1 
ATOM   6573  C C   . ILE C  1 103 ? 17.885  126.142 47.710  1.00 27.60 ? 128 ILE C C   1 
ATOM   6574  O O   . ILE C  1 103 ? 17.272  126.837 48.514  1.00 27.44 ? 128 ILE C O   1 
ATOM   6575  C CB  . ILE C  1 103 ? 19.025  123.946 48.248  1.00 26.39 ? 128 ILE C CB  1 
ATOM   6576  C CG1 . ILE C  1 103 ? 18.715  122.570 48.843  1.00 27.59 ? 128 ILE C CG1 1 
ATOM   6577  C CG2 . ILE C  1 103 ? 19.720  124.800 49.274  1.00 26.80 ? 128 ILE C CG2 1 
ATOM   6578  C CD1 . ILE C  1 103 ? 17.811  122.604 50.069  1.00 26.73 ? 128 ILE C CD1 1 
ATOM   6579  N N   . ILE C  1 104 ? 18.728  126.647 46.818  1.00 28.31 ? 129 ILE C N   1 
ATOM   6580  C CA  . ILE C  1 104 ? 19.055  128.068 46.801  1.00 28.90 ? 129 ILE C CA  1 
ATOM   6581  C C   . ILE C  1 104 ? 17.814  128.929 46.525  1.00 29.87 ? 129 ILE C C   1 
ATOM   6582  O O   . ILE C  1 104 ? 17.565  129.938 47.205  1.00 29.25 ? 129 ILE C O   1 
ATOM   6583  C CB  . ILE C  1 104 ? 20.187  128.347 45.800  1.00 30.10 ? 129 ILE C CB  1 
ATOM   6584  C CG1 . ILE C  1 104 ? 21.504  127.757 46.326  1.00 30.06 ? 129 ILE C CG1 1 
ATOM   6585  C CG2 . ILE C  1 104 ? 20.293  129.845 45.491  1.00 31.32 ? 129 ILE C CG2 1 
ATOM   6586  C CD1 . ILE C  1 104 ? 22.641  127.824 45.320  1.00 31.63 ? 129 ILE C CD1 1 
ATOM   6587  N N   . LEU C  1 105 ? 17.021  128.506 45.544  1.00 30.20 ? 130 LEU C N   1 
ATOM   6588  C CA  . LEU C  1 105 ? 15.794  129.206 45.213  1.00 31.74 ? 130 LEU C CA  1 
ATOM   6589  C C   . LEU C  1 105 ? 14.811  129.103 46.366  1.00 30.84 ? 130 LEU C C   1 
ATOM   6590  O O   . LEU C  1 105 ? 14.182  130.094 46.715  1.00 31.03 ? 130 LEU C O   1 
ATOM   6591  C CB  . LEU C  1 105 ? 15.160  128.645 43.930  1.00 32.65 ? 130 LEU C CB  1 
ATOM   6592  C CG  . LEU C  1 105 ? 15.191  129.396 42.595  1.00 36.88 ? 130 LEU C CG  1 
ATOM   6593  C CD1 . LEU C  1 105 ? 16.384  130.347 42.446  1.00 38.31 ? 130 LEU C CD1 1 
ATOM   6594  C CD2 . LEU C  1 105 ? 15.112  128.413 41.409  1.00 37.43 ? 130 LEU C CD2 1 
ATOM   6595  N N   . PHE C  1 106 ? 14.668  127.910 46.950  1.00 29.52 ? 131 PHE C N   1 
ATOM   6596  C CA  . PHE C  1 106 ? 13.703  127.726 48.036  1.00 28.55 ? 131 PHE C CA  1 
ATOM   6597  C C   . PHE C  1 106 ? 14.047  128.634 49.209  1.00 28.12 ? 131 PHE C C   1 
ATOM   6598  O O   . PHE C  1 106 ? 13.169  129.286 49.805  1.00 27.76 ? 131 PHE C O   1 
ATOM   6599  C CB  . PHE C  1 106 ? 13.671  126.266 48.529  1.00 27.53 ? 131 PHE C CB  1 
ATOM   6600  C CG  . PHE C  1 106 ? 12.539  125.986 49.479  1.00 26.95 ? 131 PHE C CG  1 
ATOM   6601  C CD1 . PHE C  1 106 ? 12.697  126.187 50.844  1.00 26.43 ? 131 PHE C CD1 1 
ATOM   6602  C CD2 . PHE C  1 106 ? 11.302  125.569 49.003  1.00 28.81 ? 131 PHE C CD2 1 
ATOM   6603  C CE1 . PHE C  1 106 ? 11.646  125.970 51.720  1.00 26.68 ? 131 PHE C CE1 1 
ATOM   6604  C CE2 . PHE C  1 106 ? 10.239  125.340 49.884  1.00 29.56 ? 131 PHE C CE2 1 
ATOM   6605  C CZ  . PHE C  1 106 ? 10.418  125.540 51.248  1.00 27.10 ? 131 PHE C CZ  1 
ATOM   6606  N N   . LEU C  1 107 ? 15.330  128.642 49.563  1.00 26.87 ? 132 LEU C N   1 
ATOM   6607  C CA  . LEU C  1 107 ? 15.791  129.439 50.687  1.00 26.70 ? 132 LEU C CA  1 
ATOM   6608  C C   . LEU C  1 107 ? 15.533  130.939 50.459  1.00 27.52 ? 132 LEU C C   1 
ATOM   6609  O O   . LEU C  1 107 ? 14.973  131.602 51.336  1.00 26.74 ? 132 LEU C O   1 
ATOM   6610  C CB  . LEU C  1 107 ? 17.268  129.159 51.010  1.00 25.88 ? 132 LEU C CB  1 
ATOM   6611  C CG  . LEU C  1 107 ? 17.596  127.741 51.509  1.00 25.16 ? 132 LEU C CG  1 
ATOM   6612  C CD1 . LEU C  1 107 ? 19.098  127.639 51.874  1.00 22.96 ? 132 LEU C CD1 1 
ATOM   6613  C CD2 . LEU C  1 107 ? 16.741  127.351 52.715  1.00 24.36 ? 132 LEU C CD2 1 
ATOM   6614  N N   . ARG C  1 108 ? 15.916  131.460 49.288  1.00 29.22 ? 133 ARG C N   1 
ATOM   6615  C CA  . ARG C  1 108 ? 15.666  132.860 48.953  1.00 30.96 ? 133 ARG C CA  1 
ATOM   6616  C C   . ARG C  1 108 ? 14.169  133.157 48.915  1.00 31.72 ? 133 ARG C C   1 
ATOM   6617  O O   . ARG C  1 108 ? 13.716  134.141 49.476  1.00 32.09 ? 133 ARG C O   1 
ATOM   6618  C CB  . ARG C  1 108 ? 16.275  133.212 47.594  1.00 32.53 ? 133 ARG C CB  1 
ATOM   6619  C CG  . ARG C  1 108 ? 17.784  133.062 47.520  1.00 32.56 ? 133 ARG C CG  1 
ATOM   6620  C CD  . ARG C  1 108 ? 18.483  133.919 48.583  1.00 34.21 ? 133 ARG C CD  1 
ATOM   6621  N NE  . ARG C  1 108 ? 19.915  134.031 48.306  1.00 34.61 ? 133 ARG C NE  1 
ATOM   6622  C CZ  . ARG C  1 108 ? 20.819  134.505 49.164  1.00 34.34 ? 133 ARG C CZ  1 
ATOM   6623  N NH1 . ARG C  1 108 ? 20.456  134.909 50.379  1.00 33.30 ? 133 ARG C NH1 1 
ATOM   6624  N NH2 . ARG C  1 108 ? 22.091  134.558 48.812  1.00 32.71 ? 133 ARG C NH2 1 
ATOM   6625  N N   . ASN C  1 109 ? 13.413  132.290 48.247  1.00 31.80 ? 134 ASN C N   1 
ATOM   6626  C CA  . ASN C  1 109 ? 11.988  132.493 48.034  1.00 32.74 ? 134 ASN C CA  1 
ATOM   6627  C C   . ASN C  1 109 ? 11.180  132.533 49.323  1.00 31.73 ? 134 ASN C C   1 
ATOM   6628  O O   . ASN C  1 109 ? 10.061  133.044 49.336  1.00 32.09 ? 134 ASN C O   1 
ATOM   6629  C CB  . ASN C  1 109 ? 11.424  131.383 47.142  1.00 33.21 ? 134 ASN C CB  1 
ATOM   6630  C CG  . ASN C  1 109 ? 11.744  131.596 45.670  1.00 36.32 ? 134 ASN C CG  1 
ATOM   6631  O OD1 . ASN C  1 109 ? 12.059  132.711 45.243  1.00 38.84 ? 134 ASN C OD1 1 
ATOM   6632  N ND2 . ASN C  1 109 ? 11.674  130.523 44.890  1.00 36.29 ? 134 ASN C ND2 1 
ATOM   6633  N N   . HIS C  1 110 ? 11.738  131.997 50.403  1.00 30.38 ? 135 HIS C N   1 
ATOM   6634  C CA  . HIS C  1 110 ? 10.997  131.897 51.660  1.00 29.76 ? 135 HIS C CA  1 
ATOM   6635  C C   . HIS C  1 110 ? 11.626  132.643 52.824  1.00 29.50 ? 135 HIS C C   1 
ATOM   6636  O O   . HIS C  1 110 ? 11.226  132.449 53.977  1.00 28.37 ? 135 HIS C O   1 
ATOM   6637  C CB  . HIS C  1 110 ? 10.781  130.425 52.029  1.00 28.58 ? 135 HIS C CB  1 
ATOM   6638  C CG  . HIS C  1 110 ? 9.829   129.733 51.117  1.00 29.44 ? 135 HIS C CG  1 
ATOM   6639  N ND1 . HIS C  1 110 ? 10.222  129.170 49.925  1.00 30.04 ? 135 HIS C ND1 1 
ATOM   6640  C CD2 . HIS C  1 110 ? 8.489   129.553 51.197  1.00 30.43 ? 135 HIS C CD2 1 
ATOM   6641  C CE1 . HIS C  1 110 ? 9.171   128.654 49.316  1.00 31.03 ? 135 HIS C CE1 1 
ATOM   6642  N NE2 . HIS C  1 110 ? 8.107   128.873 50.067  1.00 31.67 ? 135 HIS C NE2 1 
ATOM   6643  N N   . ASN C  1 111 ? 12.630  133.459 52.521  1.00 30.26 ? 136 ASN C N   1 
ATOM   6644  C CA  . ASN C  1 111 ? 13.256  134.307 53.514  1.00 30.40 ? 136 ASN C CA  1 
ATOM   6645  C C   . ASN C  1 111 ? 14.063  133.527 54.573  1.00 29.17 ? 136 ASN C C   1 
ATOM   6646  O O   . ASN C  1 111 ? 14.195  133.985 55.711  1.00 29.74 ? 136 ASN C O   1 
ATOM   6647  C CB  . ASN C  1 111 ? 12.179  135.192 54.165  1.00 31.23 ? 136 ASN C CB  1 
ATOM   6648  C CG  . ASN C  1 111 ? 12.733  136.506 54.743  1.00 32.94 ? 136 ASN C CG  1 
ATOM   6649  O OD1 . ASN C  1 111 ? 13.889  136.878 54.519  1.00 33.16 ? 136 ASN C OD1 1 
ATOM   6650  N ND2 . ASN C  1 111 ? 11.885  137.219 55.485  1.00 34.33 ? 136 ASN C ND2 1 
ATOM   6651  N N   . PHE C  1 112 ? 14.633  132.384 54.196  1.00 27.41 ? 137 PHE C N   1 
ATOM   6652  C CA  . PHE C  1 112 ? 15.570  131.655 55.063  1.00 26.45 ? 137 PHE C CA  1 
ATOM   6653  C C   . PHE C  1 112 ? 16.990  132.124 54.787  1.00 26.74 ? 137 PHE C C   1 
ATOM   6654  O O   . PHE C  1 112 ? 17.330  132.399 53.642  1.00 27.41 ? 137 PHE C O   1 
ATOM   6655  C CB  . PHE C  1 112 ? 15.545  130.158 54.772  1.00 25.12 ? 137 PHE C CB  1 
ATOM   6656  C CG  . PHE C  1 112 ? 14.340  129.443 55.300  1.00 24.75 ? 137 PHE C CG  1 
ATOM   6657  C CD1 . PHE C  1 112 ? 14.264  129.073 56.633  1.00 22.00 ? 137 PHE C CD1 1 
ATOM   6658  C CD2 . PHE C  1 112 ? 13.305  129.086 54.449  1.00 25.15 ? 137 PHE C CD2 1 
ATOM   6659  C CE1 . PHE C  1 112 ? 13.158  128.399 57.116  1.00 21.89 ? 137 PHE C CE1 1 
ATOM   6660  C CE2 . PHE C  1 112 ? 12.191  128.400 54.926  1.00 24.91 ? 137 PHE C CE2 1 
ATOM   6661  C CZ  . PHE C  1 112 ? 12.121  128.058 56.269  1.00 22.81 ? 137 PHE C CZ  1 
ATOM   6662  N N   . ASP C  1 113 ? 17.818  132.155 55.831  1.00 26.00 ? 138 ASP C N   1 
ATOM   6663  C CA  . ASP C  1 113 ? 19.211  132.598 55.737  1.00 26.62 ? 138 ASP C CA  1 
ATOM   6664  C C   . ASP C  1 113 ? 20.238  131.492 55.503  1.00 26.10 ? 138 ASP C C   1 
ATOM   6665  O O   . ASP C  1 113 ? 21.438  131.755 55.354  1.00 26.60 ? 138 ASP C O   1 
ATOM   6666  C CB  . ASP C  1 113 ? 19.563  133.374 57.000  1.00 26.88 ? 138 ASP C CB  1 
ATOM   6667  C CG  . ASP C  1 113 ? 18.630  134.541 57.222  1.00 28.85 ? 138 ASP C CG  1 
ATOM   6668  O OD1 . ASP C  1 113 ? 18.770  135.538 56.484  1.00 30.71 ? 138 ASP C OD1 1 
ATOM   6669  O OD2 . ASP C  1 113 ? 17.742  134.455 58.098  1.00 27.96 ? 138 ASP C OD2 1 
ATOM   6670  N N   . GLY C  1 114 ? 19.790  130.247 55.457  1.00 24.96 ? 139 GLY C N   1 
ATOM   6671  C CA  . GLY C  1 114 ? 20.751  129.170 55.292  1.00 24.63 ? 139 GLY C CA  1 
ATOM   6672  C C   . GLY C  1 114 ? 20.156  127.798 55.479  1.00 23.26 ? 139 GLY C C   1 
ATOM   6673  O O   . GLY C  1 114 ? 18.973  127.660 55.756  1.00 22.75 ? 139 GLY C O   1 
ATOM   6674  N N   . LEU C  1 115 ? 21.001  126.790 55.320  1.00 23.46 ? 140 LEU C N   1 
ATOM   6675  C CA  . LEU C  1 115 ? 20.588  125.400 55.387  1.00 22.50 ? 140 LEU C CA  1 
ATOM   6676  C C   . LEU C  1 115 ? 21.385  124.688 56.469  1.00 22.35 ? 140 LEU C C   1 
ATOM   6677  O O   . LEU C  1 115 ? 22.615  124.814 56.527  1.00 22.99 ? 140 LEU C O   1 
ATOM   6678  C CB  . LEU C  1 115 ? 20.857  124.716 54.048  1.00 23.33 ? 140 LEU C CB  1 
ATOM   6679  C CG  . LEU C  1 115 ? 20.554  123.213 53.954  1.00 21.84 ? 140 LEU C CG  1 
ATOM   6680  C CD1 . LEU C  1 115 ? 19.050  123.016 54.086  1.00 23.29 ? 140 LEU C CD1 1 
ATOM   6681  C CD2 . LEU C  1 115 ? 21.064  122.614 52.629  1.00 23.54 ? 140 LEU C CD2 1 
ATOM   6682  N N   . ASP C  1 116 ? 20.685  123.929 57.305  1.00 21.40 ? 141 ASP C N   1 
ATOM   6683  C CA  . ASP C  1 116 ? 21.305  123.000 58.249  1.00 21.37 ? 141 ASP C CA  1 
ATOM   6684  C C   . ASP C  1 116 ? 21.155  121.568 57.712  1.00 21.17 ? 141 ASP C C   1 
ATOM   6685  O O   . ASP C  1 116 ? 20.035  121.090 57.498  1.00 20.76 ? 141 ASP C O   1 
ATOM   6686  C CB  . ASP C  1 116 ? 20.576  123.090 59.595  1.00 20.77 ? 141 ASP C CB  1 
ATOM   6687  C CG  . ASP C  1 116 ? 21.165  122.153 60.639  1.00 21.77 ? 141 ASP C CG  1 
ATOM   6688  O OD1 . ASP C  1 116 ? 22.385  122.263 60.893  1.00 21.53 ? 141 ASP C OD1 1 
ATOM   6689  O OD2 . ASP C  1 116 ? 20.399  121.323 61.196  1.00 22.36 ? 141 ASP C OD2 1 
ATOM   6690  N N   . VAL C  1 117 ? 22.262  120.881 57.466  1.00 21.42 ? 142 VAL C N   1 
ATOM   6691  C CA  . VAL C  1 117 ? 22.134  119.489 57.045  1.00 21.34 ? 142 VAL C CA  1 
ATOM   6692  C C   . VAL C  1 117 ? 22.490  118.591 58.247  1.00 21.58 ? 142 VAL C C   1 
ATOM   6693  O O   . VAL C  1 117 ? 23.654  118.500 58.634  1.00 22.01 ? 142 VAL C O   1 
ATOM   6694  C CB  . VAL C  1 117 ? 23.024  119.157 55.836  1.00 22.11 ? 142 VAL C CB  1 
ATOM   6695  C CG1 . VAL C  1 117 ? 22.852  117.686 55.435  1.00 22.15 ? 142 VAL C CG1 1 
ATOM   6696  C CG2 . VAL C  1 117 ? 22.689  120.054 54.650  1.00 21.85 ? 142 VAL C CG2 1 
ATOM   6697  N N   . SER C  1 118 ? 21.476  117.953 58.829  1.00 20.95 ? 143 SER C N   1 
ATOM   6698  C CA  . SER C  1 118 ? 21.639  117.146 60.027  1.00 20.97 ? 143 SER C CA  1 
ATOM   6699  C C   . SER C  1 118 ? 21.379  115.684 59.731  1.00 20.17 ? 143 SER C C   1 
ATOM   6700  O O   . SER C  1 118 ? 20.340  115.148 60.086  1.00 19.99 ? 143 SER C O   1 
ATOM   6701  C CB  . SER C  1 118 ? 20.660  117.606 61.091  1.00 20.28 ? 143 SER C CB  1 
ATOM   6702  O OG  . SER C  1 118 ? 21.124  118.802 61.678  1.00 22.38 ? 143 SER C OG  1 
ATOM   6703  N N   . TRP C  1 119 ? 22.332  115.065 59.063  1.00 20.49 ? 144 TRP C N   1 
ATOM   6704  C CA  . TRP C  1 119 ? 22.177  113.739 58.519  1.00 20.28 ? 144 TRP C CA  1 
ATOM   6705  C C   . TRP C  1 119 ? 22.515  112.766 59.633  1.00 20.02 ? 144 TRP C C   1 
ATOM   6706  O O   . TRP C  1 119 ? 23.636  112.784 60.156  1.00 21.19 ? 144 TRP C O   1 
ATOM   6707  C CB  . TRP C  1 119 ? 23.128  113.600 57.328  1.00 20.84 ? 144 TRP C CB  1 
ATOM   6708  C CG  . TRP C  1 119 ? 23.099  112.291 56.607  1.00 21.66 ? 144 TRP C CG  1 
ATOM   6709  C CD1 . TRP C  1 119 ? 22.838  111.065 57.139  1.00 20.85 ? 144 TRP C CD1 1 
ATOM   6710  C CD2 . TRP C  1 119 ? 23.405  112.072 55.221  1.00 22.59 ? 144 TRP C CD2 1 
ATOM   6711  N NE1 . TRP C  1 119 ? 22.950  110.094 56.165  1.00 22.08 ? 144 TRP C NE1 1 
ATOM   6712  C CE2 . TRP C  1 119 ? 23.301  110.688 54.981  1.00 22.16 ? 144 TRP C CE2 1 
ATOM   6713  C CE3 . TRP C  1 119 ? 23.756  112.918 54.156  1.00 23.08 ? 144 TRP C CE3 1 
ATOM   6714  C CZ2 . TRP C  1 119 ? 23.503  110.125 53.713  1.00 22.58 ? 144 TRP C CZ2 1 
ATOM   6715  C CZ3 . TRP C  1 119 ? 23.967  112.348 52.902  1.00 24.00 ? 144 TRP C CZ3 1 
ATOM   6716  C CH2 . TRP C  1 119 ? 23.848  110.969 52.702  1.00 22.72 ? 144 TRP C CH2 1 
ATOM   6717  N N   . ILE C  1 120 ? 21.528  111.973 60.034  1.00 19.07 ? 145 ILE C N   1 
ATOM   6718  C CA  . ILE C  1 120 ? 21.638  111.059 61.167  1.00 19.11 ? 145 ILE C CA  1 
ATOM   6719  C C   . ILE C  1 120 ? 21.573  109.585 60.689  1.00 19.39 ? 145 ILE C C   1 
ATOM   6720  O O   . ILE C  1 120 ? 20.477  109.039 60.538  1.00 19.91 ? 145 ILE C O   1 
ATOM   6721  C CB  . ILE C  1 120 ? 20.485  111.310 62.187  1.00 18.04 ? 145 ILE C CB  1 
ATOM   6722  C CG1 . ILE C  1 120 ? 20.351  112.803 62.538  1.00 17.77 ? 145 ILE C CG1 1 
ATOM   6723  C CG2 . ILE C  1 120 ? 20.659  110.461 63.462  1.00 19.24 ? 145 ILE C CG2 1 
ATOM   6724  C CD1 . ILE C  1 120 ? 21.585  113.416 63.237  1.00 17.17 ? 145 ILE C CD1 1 
ATOM   6725  N N   . TYR C  1 121 ? 22.700  108.932 60.406  1.00 19.57 ? 146 TYR C N   1 
ATOM   6726  C CA  . TYR C  1 121 ? 24.047  109.496 60.306  1.00 20.07 ? 146 TYR C CA  1 
ATOM   6727  C C   . TYR C  1 121 ? 24.660  108.998 59.001  1.00 20.71 ? 146 TYR C C   1 
ATOM   6728  O O   . TYR C  1 121 ? 24.199  108.012 58.429  1.00 21.16 ? 146 TYR C O   1 
ATOM   6729  C CB  . TYR C  1 121 ? 24.955  108.966 61.419  1.00 19.88 ? 146 TYR C CB  1 
ATOM   6730  C CG  . TYR C  1 121 ? 24.448  109.127 62.838  1.00 20.14 ? 146 TYR C CG  1 
ATOM   6731  C CD1 . TYR C  1 121 ? 24.585  110.337 63.513  1.00 18.88 ? 146 TYR C CD1 1 
ATOM   6732  C CD2 . TYR C  1 121 ? 23.850  108.062 63.507  1.00 20.71 ? 146 TYR C CD2 1 
ATOM   6733  C CE1 . TYR C  1 121 ? 24.160  110.483 64.808  1.00 18.88 ? 146 TYR C CE1 1 
ATOM   6734  C CE2 . TYR C  1 121 ? 23.401  108.208 64.817  1.00 19.49 ? 146 TYR C CE2 1 
ATOM   6735  C CZ  . TYR C  1 121 ? 23.570  109.413 65.465  1.00 19.46 ? 146 TYR C CZ  1 
ATOM   6736  O OH  . TYR C  1 121 ? 23.127  109.583 66.779  1.00 18.86 ? 146 TYR C OH  1 
ATOM   6737  N N   . PRO C  1 122 ? 25.732  109.657 58.537  1.00 21.01 ? 147 PRO C N   1 
ATOM   6738  C CA  . PRO C  1 122 ? 26.369  109.137 57.327  1.00 22.20 ? 147 PRO C CA  1 
ATOM   6739  C C   . PRO C  1 122 ? 26.953  107.737 57.563  1.00 23.30 ? 147 PRO C C   1 
ATOM   6740  O O   . PRO C  1 122 ? 26.760  106.833 56.741  1.00 23.90 ? 147 PRO C O   1 
ATOM   6741  C CB  . PRO C  1 122 ? 27.483  110.146 57.054  1.00 22.14 ? 147 PRO C CB  1 
ATOM   6742  C CG  . PRO C  1 122 ? 26.968  111.425 57.641  1.00 21.26 ? 147 PRO C CG  1 
ATOM   6743  C CD  . PRO C  1 122 ? 26.221  110.997 58.905  1.00 20.49 ? 147 PRO C CD  1 
ATOM   6744  N N   . ASP C  1 123 ? 27.660  107.584 58.681  1.00 23.97 ? 148 ASP C N   1 
ATOM   6745  C CA  . ASP C  1 123 ? 28.343  106.348 59.038  1.00 25.67 ? 148 ASP C CA  1 
ATOM   6746  C C   . ASP C  1 123 ? 29.349  106.042 57.944  1.00 27.12 ? 148 ASP C C   1 
ATOM   6747  O O   . ASP C  1 123 ? 29.623  106.881 57.078  1.00 27.00 ? 148 ASP C O   1 
ATOM   6748  C CB  . ASP C  1 123 ? 27.339  105.192 59.202  1.00 26.27 ? 148 ASP C CB  1 
ATOM   6749  C CG  . ASP C  1 123 ? 27.731  104.200 60.310  1.00 27.61 ? 148 ASP C CG  1 
ATOM   6750  O OD1 . ASP C  1 123 ? 28.930  103.897 60.478  1.00 29.13 ? 148 ASP C OD1 1 
ATOM   6751  O OD2 . ASP C  1 123 ? 26.823  103.693 60.996  1.00 28.09 ? 148 ASP C OD2 1 
ATOM   6752  N N   . GLN C  1 124 ? 29.919  104.845 57.992  1.00 28.58 ? 149 GLN C N   1 
ATOM   6753  C CA  . GLN C  1 124 ? 30.927  104.461 57.020  1.00 30.57 ? 149 GLN C CA  1 
ATOM   6754  C C   . GLN C  1 124 ? 30.353  104.475 55.599  1.00 30.98 ? 149 GLN C C   1 
ATOM   6755  O O   . GLN C  1 124 ? 30.983  104.967 54.659  1.00 32.12 ? 149 GLN C O   1 
ATOM   6756  C CB  . GLN C  1 124 ? 31.485  103.069 57.370  1.00 32.03 ? 149 GLN C CB  1 
ATOM   6757  C CG  . GLN C  1 124 ? 32.146  102.983 58.759  1.00 33.55 ? 149 GLN C CG  1 
ATOM   6758  C CD  . GLN C  1 124 ? 32.834  101.645 59.020  1.00 38.45 ? 149 GLN C CD  1 
ATOM   6759  O OE1 . GLN C  1 124 ? 34.046  101.518 58.834  1.00 41.94 ? 149 GLN C OE1 1 
ATOM   6760  N NE2 . GLN C  1 124 ? 32.067  100.646 59.453  1.00 39.17 ? 149 GLN C NE2 1 
ATOM   6761  N N   . LYS C  1 125 ? 29.147  103.941 55.443  1.00 30.80 ? 150 LYS C N   1 
ATOM   6762  C CA  . LYS C  1 125 ? 28.555  103.799 54.113  1.00 31.58 ? 150 LYS C CA  1 
ATOM   6763  C C   . LYS C  1 125 ? 28.393  105.126 53.344  1.00 30.62 ? 150 LYS C C   1 
ATOM   6764  O O   . LYS C  1 125 ? 28.644  105.181 52.132  1.00 30.82 ? 150 LYS C O   1 
ATOM   6765  C CB  . LYS C  1 125 ? 27.214  103.050 54.191  1.00 31.91 ? 150 LYS C CB  1 
ATOM   6766  C CG  . LYS C  1 125 ? 26.475  102.999 52.854  1.00 35.48 ? 150 LYS C CG  1 
ATOM   6767  C CD  . LYS C  1 125 ? 25.850  101.638 52.572  1.00 40.38 ? 150 LYS C CD  1 
ATOM   6768  C CE  . LYS C  1 125 ? 25.329  101.591 51.136  1.00 43.27 ? 150 LYS C CE  1 
ATOM   6769  N NZ  . LYS C  1 125 ? 24.864  100.226 50.734  1.00 46.69 ? 150 LYS C NZ  1 
ATOM   6770  N N   . GLU C  1 126 ? 27.963  106.183 54.029  1.00 28.54 ? 151 GLU C N   1 
ATOM   6771  C CA  . GLU C  1 126 ? 27.655  107.449 53.351  1.00 28.58 ? 151 GLU C CA  1 
ATOM   6772  C C   . GLU C  1 126 ? 28.650  108.561 53.670  1.00 27.76 ? 151 GLU C C   1 
ATOM   6773  O O   . GLU C  1 126 ? 28.429  109.713 53.318  1.00 26.63 ? 151 GLU C O   1 
ATOM   6774  C CB  . GLU C  1 126 ? 26.247  107.928 53.699  1.00 27.76 ? 151 GLU C CB  1 
ATOM   6775  C CG  . GLU C  1 126 ? 25.219  106.836 53.638  1.00 30.55 ? 151 GLU C CG  1 
ATOM   6776  C CD  . GLU C  1 126 ? 24.521  106.740 52.302  1.00 34.56 ? 151 GLU C CD  1 
ATOM   6777  O OE1 . GLU C  1 126 ? 24.975  107.362 51.297  1.00 36.80 ? 151 GLU C OE1 1 
ATOM   6778  O OE2 . GLU C  1 126 ? 23.505  106.015 52.265  1.00 37.84 ? 151 GLU C OE2 1 
ATOM   6779  N N   . ASN C  1 127 ? 29.739  108.214 54.348  1.00 28.11 ? 152 ASN C N   1 
ATOM   6780  C CA  . ASN C  1 127 ? 30.776  109.183 54.637  1.00 28.61 ? 152 ASN C CA  1 
ATOM   6781  C C   . ASN C  1 127 ? 31.069  109.996 53.369  1.00 28.77 ? 152 ASN C C   1 
ATOM   6782  O O   . ASN C  1 127 ? 30.971  111.219 53.376  1.00 28.10 ? 152 ASN C O   1 
ATOM   6783  C CB  . ASN C  1 127 ? 32.036  108.459 55.148  1.00 29.85 ? 152 ASN C CB  1 
ATOM   6784  C CG  . ASN C  1 127 ? 33.195  109.409 55.452  1.00 31.43 ? 152 ASN C CG  1 
ATOM   6785  O OD1 . ASN C  1 127 ? 33.596  110.226 54.610  1.00 33.10 ? 152 ASN C OD1 1 
ATOM   6786  N ND2 . ASN C  1 127 ? 33.757  109.281 56.651  1.00 30.00 ? 152 ASN C ND2 1 
ATOM   6787  N N   . THR C  1 128 ? 31.392  109.316 52.273  1.00 29.43 ? 153 THR C N   1 
ATOM   6788  C CA  . THR C  1 128 ? 31.706  110.006 51.017  1.00 30.49 ? 153 THR C CA  1 
ATOM   6789  C C   . THR C  1 128 ? 30.553  110.883 50.481  1.00 29.82 ? 153 THR C C   1 
ATOM   6790  O O   . THR C  1 128 ? 30.768  112.041 50.102  1.00 29.84 ? 153 THR C O   1 
ATOM   6791  C CB  . THR C  1 128 ? 32.136  109.019 49.941  1.00 31.48 ? 153 THR C CB  1 
ATOM   6792  O OG1 . THR C  1 128 ? 33.314  108.347 50.384  1.00 33.99 ? 153 THR C OG1 1 
ATOM   6793  C CG2 . THR C  1 128 ? 32.453  109.743 48.655  1.00 32.49 ? 153 THR C CG2 1 
ATOM   6794  N N   . HIS C  1 129 ? 29.336  110.340 50.463  1.00 28.76 ? 154 HIS C N   1 
ATOM   6795  C CA  . HIS C  1 129 ? 28.210  111.079 49.922  1.00 28.12 ? 154 HIS C CA  1 
ATOM   6796  C C   . HIS C  1 129 ? 27.960  112.344 50.711  1.00 26.78 ? 154 HIS C C   1 
ATOM   6797  O O   . HIS C  1 129 ? 27.587  113.345 50.139  1.00 26.65 ? 154 HIS C O   1 
ATOM   6798  C CB  . HIS C  1 129 ? 26.924  110.250 49.927  1.00 27.93 ? 154 HIS C CB  1 
ATOM   6799  C CG  . HIS C  1 129 ? 26.774  109.357 48.734  1.00 30.11 ? 154 HIS C CG  1 
ATOM   6800  N ND1 . HIS C  1 129 ? 26.081  108.165 48.783  1.00 32.33 ? 154 HIS C ND1 1 
ATOM   6801  C CD2 . HIS C  1 129 ? 27.240  109.470 47.467  1.00 31.32 ? 154 HIS C CD2 1 
ATOM   6802  C CE1 . HIS C  1 129 ? 26.110  107.590 47.591  1.00 31.92 ? 154 HIS C CE1 1 
ATOM   6803  N NE2 . HIS C  1 129 ? 26.821  108.354 46.779  1.00 32.69 ? 154 HIS C NE2 1 
ATOM   6804  N N   . PHE C  1 130 ? 28.119  112.285 52.030  1.00 25.49 ? 155 PHE C N   1 
ATOM   6805  C CA  . PHE C  1 130 ? 27.929  113.459 52.877  1.00 24.55 ? 155 PHE C CA  1 
ATOM   6806  C C   . PHE C  1 130 ? 28.990  114.506 52.597  1.00 25.24 ? 155 PHE C C   1 
ATOM   6807  O O   . PHE C  1 130 ? 28.701  115.696 52.450  1.00 25.01 ? 155 PHE C O   1 
ATOM   6808  C CB  . PHE C  1 130 ? 27.998  113.050 54.351  1.00 23.79 ? 155 PHE C CB  1 
ATOM   6809  C CG  . PHE C  1 130 ? 27.801  114.184 55.313  1.00 23.68 ? 155 PHE C CG  1 
ATOM   6810  C CD1 . PHE C  1 130 ? 26.548  114.749 55.501  1.00 21.65 ? 155 PHE C CD1 1 
ATOM   6811  C CD2 . PHE C  1 130 ? 28.870  114.666 56.056  1.00 24.00 ? 155 PHE C CD2 1 
ATOM   6812  C CE1 . PHE C  1 130 ? 26.363  115.783 56.413  1.00 23.75 ? 155 PHE C CE1 1 
ATOM   6813  C CE2 . PHE C  1 130 ? 28.698  115.691 56.962  1.00 23.66 ? 155 PHE C CE2 1 
ATOM   6814  C CZ  . PHE C  1 130 ? 27.439  116.247 57.156  1.00 23.20 ? 155 PHE C CZ  1 
ATOM   6815  N N   . THR C  1 131 ? 30.235  114.063 52.547  1.00 25.28 ? 156 THR C N   1 
ATOM   6816  C CA  . THR C  1 131 ? 31.326  114.985 52.261  1.00 26.48 ? 156 THR C CA  1 
ATOM   6817  C C   . THR C  1 131 ? 31.105  115.694 50.930  1.00 26.71 ? 156 THR C C   1 
ATOM   6818  O O   . THR C  1 131 ? 31.252  116.909 50.826  1.00 27.23 ? 156 THR C O   1 
ATOM   6819  C CB  . THR C  1 131 ? 32.654  114.247 52.223  1.00 27.23 ? 156 THR C CB  1 
ATOM   6820  O OG1 . THR C  1 131 ? 32.903  113.728 53.524  1.00 27.23 ? 156 THR C OG1 1 
ATOM   6821  C CG2 . THR C  1 131 ? 33.786  115.186 51.859  1.00 29.28 ? 156 THR C CG2 1 
ATOM   6822  N N   . VAL C  1 132 ? 30.760  114.922 49.914  1.00 27.14 ? 157 VAL C N   1 
ATOM   6823  C CA  . VAL C  1 132 ? 30.505  115.480 48.586  1.00 27.46 ? 157 VAL C CA  1 
ATOM   6824  C C   . VAL C  1 132 ? 29.308  116.457 48.583  1.00 26.71 ? 157 VAL C C   1 
ATOM   6825  O O   . VAL C  1 132 ? 29.396  117.564 48.015  1.00 27.04 ? 157 VAL C O   1 
ATOM   6826  C CB  . VAL C  1 132 ? 30.321  114.367 47.543  1.00 28.37 ? 157 VAL C CB  1 
ATOM   6827  C CG1 . VAL C  1 132 ? 30.007  114.966 46.162  1.00 28.30 ? 157 VAL C CG1 1 
ATOM   6828  C CG2 . VAL C  1 132 ? 31.600  113.505 47.465  1.00 30.12 ? 157 VAL C CG2 1 
ATOM   6829  N N   . LEU C  1 133 ? 28.196  116.062 49.205  1.00 24.97 ? 158 LEU C N   1 
ATOM   6830  C CA  . LEU C  1 133 ? 27.036  116.965 49.302  1.00 24.84 ? 158 LEU C CA  1 
ATOM   6831  C C   . LEU C  1 133 ? 27.383  118.315 49.959  1.00 25.00 ? 158 LEU C C   1 
ATOM   6832  O O   . LEU C  1 133 ? 27.101  119.387 49.399  1.00 25.12 ? 158 LEU C O   1 
ATOM   6833  C CB  . LEU C  1 133 ? 25.882  116.298 50.050  1.00 23.55 ? 158 LEU C CB  1 
ATOM   6834  C CG  . LEU C  1 133 ? 24.614  117.148 50.205  1.00 23.43 ? 158 LEU C CG  1 
ATOM   6835  C CD1 . LEU C  1 133 ? 23.994  117.490 48.856  1.00 23.12 ? 158 LEU C CD1 1 
ATOM   6836  C CD2 . LEU C  1 133 ? 23.601  116.415 51.113  1.00 22.42 ? 158 LEU C CD2 1 
ATOM   6837  N N   . ILE C  1 134 ? 27.998  118.258 51.141  1.00 24.21 ? 159 ILE C N   1 
ATOM   6838  C CA  . ILE C  1 134 ? 28.404  119.476 51.842  1.00 24.52 ? 159 ILE C CA  1 
ATOM   6839  C C   . ILE C  1 134 ? 29.312  120.345 50.990  1.00 25.64 ? 159 ILE C C   1 
ATOM   6840  O O   . ILE C  1 134 ? 29.144  121.557 50.930  1.00 26.45 ? 159 ILE C O   1 
ATOM   6841  C CB  . ILE C  1 134 ? 29.126  119.165 53.174  1.00 23.49 ? 159 ILE C CB  1 
ATOM   6842  C CG1 . ILE C  1 134 ? 28.178  118.460 54.139  1.00 22.76 ? 159 ILE C CG1 1 
ATOM   6843  C CG2 . ILE C  1 134 ? 29.684  120.449 53.821  1.00 24.10 ? 159 ILE C CG2 1 
ATOM   6844  C CD1 . ILE C  1 134 ? 26.804  119.115 54.291  1.00 23.45 ? 159 ILE C CD1 1 
ATOM   6845  N N   . HIS C  1 135 ? 30.293  119.721 50.351  1.00 26.86 ? 160 HIS C N   1 
ATOM   6846  C CA  . HIS C  1 135 ? 31.240  120.456 49.557  1.00 28.30 ? 160 HIS C CA  1 
ATOM   6847  C C   . HIS C  1 135 ? 30.547  121.178 48.391  1.00 28.79 ? 160 HIS C C   1 
ATOM   6848  O O   . HIS C  1 135 ? 30.851  122.340 48.104  1.00 29.30 ? 160 HIS C O   1 
ATOM   6849  C CB  . HIS C  1 135 ? 32.355  119.539 49.048  1.00 29.47 ? 160 HIS C CB  1 
ATOM   6850  C CG  . HIS C  1 135 ? 33.398  120.265 48.255  1.00 32.48 ? 160 HIS C CG  1 
ATOM   6851  N ND1 . HIS C  1 135 ? 34.267  121.168 48.830  1.00 33.92 ? 160 HIS C ND1 1 
ATOM   6852  C CD2 . HIS C  1 135 ? 33.679  120.259 46.931  1.00 33.83 ? 160 HIS C CD2 1 
ATOM   6853  C CE1 . HIS C  1 135 ? 35.047  121.678 47.894  1.00 35.96 ? 160 HIS C CE1 1 
ATOM   6854  N NE2 . HIS C  1 135 ? 34.708  121.145 46.733  1.00 36.46 ? 160 HIS C NE2 1 
ATOM   6855  N N   . GLU C  1 136 ? 29.621  120.490 47.725  1.00 27.84 ? 161 GLU C N   1 
ATOM   6856  C CA  . GLU C  1 136 ? 28.951  121.057 46.565  1.00 28.39 ? 161 GLU C CA  1 
ATOM   6857  C C   . GLU C  1 136 ? 27.978  122.153 47.003  1.00 27.65 ? 161 GLU C C   1 
ATOM   6858  O O   . GLU C  1 136 ? 27.797  123.159 46.314  1.00 27.54 ? 161 GLU C O   1 
ATOM   6859  C CB  . GLU C  1 136 ? 28.247  119.956 45.747  1.00 28.24 ? 161 GLU C CB  1 
ATOM   6860  C CG  . GLU C  1 136 ? 29.236  119.025 45.029  1.00 30.30 ? 161 GLU C CG  1 
ATOM   6861  C CD  . GLU C  1 136 ? 28.582  117.867 44.288  1.00 32.12 ? 161 GLU C CD  1 
ATOM   6862  O OE1 . GLU C  1 136 ? 27.338  117.763 44.302  1.00 32.07 ? 161 GLU C OE1 1 
ATOM   6863  O OE2 . GLU C  1 136 ? 29.323  117.050 43.688  1.00 33.03 ? 161 GLU C OE2 1 
ATOM   6864  N N   . LEU C  1 137 ? 27.367  121.951 48.162  1.00 26.67 ? 162 LEU C N   1 
ATOM   6865  C CA  . LEU C  1 137 ? 26.467  122.954 48.715  1.00 26.38 ? 162 LEU C CA  1 
ATOM   6866  C C   . LEU C  1 137 ? 27.263  124.202 49.009  1.00 26.78 ? 162 LEU C C   1 
ATOM   6867  O O   . LEU C  1 137 ? 26.829  125.298 48.685  1.00 27.46 ? 162 LEU C O   1 
ATOM   6868  C CB  . LEU C  1 137 ? 25.814  122.443 49.991  1.00 24.82 ? 162 LEU C CB  1 
ATOM   6869  C CG  . LEU C  1 137 ? 24.526  121.647 49.763  1.00 24.35 ? 162 LEU C CG  1 
ATOM   6870  C CD1 . LEU C  1 137 ? 24.153  120.913 51.047  1.00 21.41 ? 162 LEU C CD1 1 
ATOM   6871  C CD2 . LEU C  1 137 ? 23.407  122.588 49.343  1.00 24.51 ? 162 LEU C CD2 1 
ATOM   6872  N N   . ALA C  1 138 ? 28.425  124.028 49.635  1.00 27.15 ? 163 ALA C N   1 
ATOM   6873  C CA  . ALA C  1 138 ? 29.269  125.158 50.018  1.00 28.44 ? 163 ALA C CA  1 
ATOM   6874  C C   . ALA C  1 138 ? 29.696  125.940 48.783  1.00 30.13 ? 163 ALA C C   1 
ATOM   6875  O O   . ALA C  1 138 ? 29.625  127.176 48.767  1.00 30.63 ? 163 ALA C O   1 
ATOM   6876  C CB  . ALA C  1 138 ? 30.502  124.678 50.801  1.00 28.54 ? 163 ALA C CB  1 
ATOM   6877  N N   . GLU C  1 139 ? 30.132  125.211 47.753  1.00 31.35 ? 164 GLU C N   1 
ATOM   6878  C CA  . GLU C  1 139 ? 30.566  125.817 46.486  1.00 33.06 ? 164 GLU C CA  1 
ATOM   6879  C C   . GLU C  1 139 ? 29.449  126.630 45.868  1.00 32.63 ? 164 GLU C C   1 
ATOM   6880  O O   . GLU C  1 139 ? 29.656  127.767 45.457  1.00 32.85 ? 164 GLU C O   1 
ATOM   6881  C CB  . GLU C  1 139 ? 30.963  124.756 45.466  1.00 34.57 ? 164 GLU C CB  1 
ATOM   6882  C CG  . GLU C  1 139 ? 32.029  123.802 45.920  1.00 38.73 ? 164 GLU C CG  1 
ATOM   6883  C CD  . GLU C  1 139 ? 33.400  124.270 45.548  1.00 45.26 ? 164 GLU C CD  1 
ATOM   6884  O OE1 . GLU C  1 139 ? 33.759  124.164 44.354  1.00 48.52 ? 164 GLU C OE1 1 
ATOM   6885  O OE2 . GLU C  1 139 ? 34.120  124.739 46.452  1.00 47.24 ? 164 GLU C OE2 1 
ATOM   6886  N N   . ALA C  1 140 ? 28.263  126.031 45.785  1.00 31.24 ? 165 ALA C N   1 
ATOM   6887  C CA  . ALA C  1 140 ? 27.114  126.705 45.173  1.00 31.60 ? 165 ALA C CA  1 
ATOM   6888  C C   . ALA C  1 140 ? 26.671  127.948 45.970  1.00 31.10 ? 165 ALA C C   1 
ATOM   6889  O O   . ALA C  1 140 ? 26.285  128.963 45.391  1.00 31.21 ? 165 ALA C O   1 
ATOM   6890  C CB  . ALA C  1 140 ? 25.950  125.729 45.010  1.00 30.85 ? 165 ALA C CB  1 
ATOM   6891  N N   . PHE C  1 141 ? 26.717  127.857 47.298  1.00 29.90 ? 166 PHE C N   1 
ATOM   6892  C CA  . PHE C  1 141 ? 26.376  128.993 48.151  1.00 30.18 ? 166 PHE C CA  1 
ATOM   6893  C C   . PHE C  1 141 ? 27.382  130.128 47.920  1.00 31.66 ? 166 PHE C C   1 
ATOM   6894  O O   . PHE C  1 141 ? 27.021  131.300 47.899  1.00 32.17 ? 166 PHE C O   1 
ATOM   6895  C CB  . PHE C  1 141 ? 26.351  128.569 49.634  1.00 28.24 ? 166 PHE C CB  1 
ATOM   6896  C CG  . PHE C  1 141 ? 25.119  127.775 50.023  1.00 27.94 ? 166 PHE C CG  1 
ATOM   6897  C CD1 . PHE C  1 141 ? 24.276  127.257 49.048  1.00 26.91 ? 166 PHE C CD1 1 
ATOM   6898  C CD2 . PHE C  1 141 ? 24.818  127.528 51.363  1.00 26.48 ? 166 PHE C CD2 1 
ATOM   6899  C CE1 . PHE C  1 141 ? 23.130  126.515 49.397  1.00 25.85 ? 166 PHE C CE1 1 
ATOM   6900  C CE2 . PHE C  1 141 ? 23.681  126.766 51.717  1.00 25.48 ? 166 PHE C CE2 1 
ATOM   6901  C CZ  . PHE C  1 141 ? 22.840  126.274 50.731  1.00 24.76 ? 166 PHE C CZ  1 
ATOM   6902  N N   . GLN C  1 142 ? 28.645  129.776 47.730  1.00 33.13 ? 167 GLN C N   1 
ATOM   6903  C CA  . GLN C  1 142 ? 29.651  130.793 47.464  1.00 35.58 ? 167 GLN C CA  1 
ATOM   6904  C C   . GLN C  1 142 ? 29.397  131.403 46.085  1.00 37.44 ? 167 GLN C C   1 
ATOM   6905  O O   . GLN C  1 142 ? 29.344  132.634 45.943  1.00 38.36 ? 167 GLN C O   1 
ATOM   6906  C CB  . GLN C  1 142 ? 31.068  130.222 47.584  1.00 36.00 ? 167 GLN C CB  1 
ATOM   6907  C CG  . GLN C  1 142 ? 32.158  131.148 47.053  1.00 39.57 ? 167 GLN C CG  1 
ATOM   6908  C CD  . GLN C  1 142 ? 32.195  132.478 47.787  1.00 41.88 ? 167 GLN C CD  1 
ATOM   6909  O OE1 . GLN C  1 142 ? 31.703  132.590 48.911  1.00 41.70 ? 167 GLN C OE1 1 
ATOM   6910  N NE2 . GLN C  1 142 ? 32.779  133.493 47.152  1.00 43.06 ? 167 GLN C NE2 1 
ATOM   6911  N N   . LYS C  1 143 ? 29.211  130.549 45.079  1.00 37.88 ? 168 LYS C N   1 
ATOM   6912  C CA  . LYS C  1 143 ? 28.922  131.030 43.728  1.00 40.18 ? 168 LYS C CA  1 
ATOM   6913  C C   . LYS C  1 143 ? 27.679  131.934 43.692  1.00 40.41 ? 168 LYS C C   1 
ATOM   6914  O O   . LYS C  1 143 ? 27.701  132.996 43.074  1.00 41.80 ? 168 LYS C O   1 
ATOM   6915  C CB  . LYS C  1 143 ? 28.795  129.868 42.732  1.00 40.07 ? 168 LYS C CB  1 
ATOM   6916  C CG  . LYS C  1 143 ? 28.564  130.321 41.287  1.00 42.92 ? 168 LYS C CG  1 
ATOM   6917  C CD  . LYS C  1 143 ? 28.721  129.181 40.278  1.00 45.03 ? 168 LYS C CD  1 
ATOM   6918  C CE  . LYS C  1 143 ? 28.438  129.675 38.864  1.00 48.16 ? 168 LYS C CE  1 
ATOM   6919  N NZ  . LYS C  1 143 ? 28.627  128.624 37.836  1.00 50.05 ? 168 LYS C NZ  1 
ATOM   6920  N N   . ASP C  1 144 ? 26.600  131.517 44.352  1.00 39.97 ? 169 ASP C N   1 
ATOM   6921  C CA  . ASP C  1 144 ? 25.390  132.335 44.437  1.00 40.38 ? 169 ASP C CA  1 
ATOM   6922  C C   . ASP C  1 144 ? 25.668  133.709 45.050  1.00 41.82 ? 169 ASP C C   1 
ATOM   6923  O O   . ASP C  1 144 ? 25.105  134.720 44.618  1.00 42.20 ? 169 ASP C O   1 
ATOM   6924  C CB  . ASP C  1 144 ? 24.336  131.635 45.281  1.00 39.08 ? 169 ASP C CB  1 
ATOM   6925  C CG  . ASP C  1 144 ? 23.192  132.562 45.664  1.00 39.15 ? 169 ASP C CG  1 
ATOM   6926  O OD1 . ASP C  1 144 ? 22.287  132.758 44.835  1.00 40.13 ? 169 ASP C OD1 1 
ATOM   6927  O OD2 . ASP C  1 144 ? 23.175  133.067 46.803  1.00 37.87 ? 169 ASP C OD2 1 
ATOM   6928  N N   . PHE C  1 145 ? 26.524  133.727 46.072  1.00 42.14 ? 170 PHE C N   1 
ATOM   6929  C CA  . PHE C  1 145 ? 26.881  134.963 46.782  1.00 43.54 ? 170 PHE C CA  1 
ATOM   6930  C C   . PHE C  1 145 ? 27.505  135.989 45.844  1.00 45.96 ? 170 PHE C C   1 
ATOM   6931  O O   . PHE C  1 145 ? 27.051  137.133 45.784  1.00 46.82 ? 170 PHE C O   1 
ATOM   6932  C CB  . PHE C  1 145 ? 27.832  134.662 47.943  1.00 42.59 ? 170 PHE C CB  1 
ATOM   6933  C CG  . PHE C  1 145 ? 28.349  135.891 48.643  1.00 43.97 ? 170 PHE C CG  1 
ATOM   6934  C CD1 . PHE C  1 145 ? 27.478  136.756 49.289  1.00 44.00 ? 170 PHE C CD1 1 
ATOM   6935  C CD2 . PHE C  1 145 ? 29.710  136.178 48.655  1.00 45.72 ? 170 PHE C CD2 1 
ATOM   6936  C CE1 . PHE C  1 145 ? 27.949  137.893 49.935  1.00 46.39 ? 170 PHE C CE1 1 
ATOM   6937  C CE2 . PHE C  1 145 ? 30.195  137.311 49.300  1.00 48.07 ? 170 PHE C CE2 1 
ATOM   6938  C CZ  . PHE C  1 145 ? 29.316  138.174 49.940  1.00 47.83 ? 170 PHE C CZ  1 
ATOM   6939  N N   . THR C  1 146 ? 28.528  135.569 45.101  1.00 47.66 ? 171 THR C N   1 
ATOM   6940  C CA  . THR C  1 146 ? 29.195  136.446 44.123  1.00 50.67 ? 171 THR C CA  1 
ATOM   6941  C C   . THR C  1 146 ? 28.273  136.906 42.994  1.00 52.25 ? 171 THR C C   1 
ATOM   6942  O O   . THR C  1 146 ? 28.527  137.930 42.359  1.00 54.05 ? 171 THR C O   1 
ATOM   6943  C CB  . THR C  1 146 ? 30.417  135.764 43.468  1.00 51.15 ? 171 THR C CB  1 
ATOM   6944  O OG1 . THR C  1 146 ? 29.964  134.832 42.479  1.00 51.32 ? 171 THR C OG1 1 
ATOM   6945  C CG2 . THR C  1 146 ? 31.255  135.038 44.499  1.00 49.66 ? 171 THR C CG2 1 
ATOM   6946  N N   . LYS C  1 147 ? 27.226  136.138 42.714  1.00 52.46 ? 172 LYS C N   1 
ATOM   6947  C CA  . LYS C  1 147 ? 26.290  136.517 41.660  1.00 54.75 ? 172 LYS C CA  1 
ATOM   6948  C C   . LYS C  1 147 ? 25.063  137.200 42.245  1.00 55.10 ? 172 LYS C C   1 
ATOM   6949  O O   . LYS C  1 147 ? 24.075  137.429 41.551  1.00 56.19 ? 172 LYS C O   1 
ATOM   6950  C CB  . LYS C  1 147 ? 25.890  135.308 40.809  1.00 54.34 ? 172 LYS C CB  1 
ATOM   6951  C CG  . LYS C  1 147 ? 27.097  134.585 40.223  1.00 55.60 ? 172 LYS C CG  1 
ATOM   6952  C CD  . LYS C  1 147 ? 26.858  134.069 38.813  1.00 57.35 ? 172 LYS C CD  1 
ATOM   6953  C CE  . LYS C  1 147 ? 28.199  133.786 38.131  1.00 59.10 ? 172 LYS C CE  1 
ATOM   6954  N NZ  . LYS C  1 147 ? 28.072  133.483 36.671  1.00 60.64 ? 172 LYS C NZ  1 
ATOM   6955  N N   . SER C  1 148 ? 25.150  137.538 43.523  1.00 54.89 ? 173 SER C N   1 
ATOM   6956  C CA  . SER C  1 148 ? 24.057  138.173 44.229  1.00 55.11 ? 173 SER C CA  1 
ATOM   6957  C C   . SER C  1 148 ? 24.570  139.443 44.895  1.00 56.14 ? 173 SER C C   1 
ATOM   6958  O O   . SER C  1 148 ? 25.769  139.722 44.888  1.00 57.09 ? 173 SER C O   1 
ATOM   6959  C CB  . SER C  1 148 ? 23.505  137.215 45.292  1.00 53.47 ? 173 SER C CB  1 
ATOM   6960  O OG  . SER C  1 148 ? 22.325  137.725 45.885  1.00 53.89 ? 173 SER C OG  1 
ATOM   6961  N N   . THR C  1 149 ? 23.658  140.214 45.469  1.00 56.37 ? 174 THR C N   1 
ATOM   6962  C CA  . THR C  1 149 ? 24.039  141.376 46.263  1.00 56.75 ? 174 THR C CA  1 
ATOM   6963  C C   . THR C  1 149 ? 23.537  141.134 47.681  1.00 54.89 ? 174 THR C C   1 
ATOM   6964  O O   . THR C  1 149 ? 23.514  142.031 48.516  1.00 55.73 ? 174 THR C O   1 
ATOM   6965  C CB  . THR C  1 149 ? 23.475  142.690 45.667  1.00 58.72 ? 174 THR C CB  1 
ATOM   6966  O OG1 . THR C  1 149 ? 22.042  142.692 45.747  1.00 59.02 ? 174 THR C OG1 1 
ATOM   6967  C CG2 . THR C  1 149 ? 23.893  142.827 44.211  1.00 59.56 ? 174 THR C CG2 1 
ATOM   6968  N N   . LYS C  1 150 ? 23.148  139.891 47.939  1.00 52.48 ? 175 LYS C N   1 
ATOM   6969  C CA  . LYS C  1 150 ? 22.593  139.506 49.227  1.00 50.28 ? 175 LYS C CA  1 
ATOM   6970  C C   . LYS C  1 150 ? 23.641  138.772 50.033  1.00 48.15 ? 175 LYS C C   1 
ATOM   6971  O O   . LYS C  1 150 ? 24.713  138.453 49.527  1.00 48.39 ? 175 LYS C O   1 
ATOM   6972  C CB  . LYS C  1 150 ? 21.380  138.601 49.028  1.00 49.77 ? 175 LYS C CB  1 
ATOM   6973  C CG  . LYS C  1 150 ? 20.305  139.203 48.156  1.00 51.90 ? 175 LYS C CG  1 
ATOM   6974  C CD  . LYS C  1 150 ? 19.414  138.125 47.565  1.00 53.81 ? 175 LYS C CD  1 
ATOM   6975  C CE  . LYS C  1 150 ? 18.475  138.714 46.522  1.00 55.88 ? 175 LYS C CE  1 
ATOM   6976  N NZ  . LYS C  1 150 ? 17.622  137.651 45.928  1.00 56.42 ? 175 LYS C NZ  1 
ATOM   6977  N N   . GLU C  1 151 ? 23.325  138.499 51.287  1.00 45.61 ? 176 GLU C N   1 
ATOM   6978  C CA  . GLU C  1 151 ? 24.232  137.765 52.149  1.00 43.72 ? 176 GLU C CA  1 
ATOM   6979  C C   . GLU C  1 151 ? 24.445  136.349 51.603  1.00 41.08 ? 176 GLU C C   1 
ATOM   6980  O O   . GLU C  1 151 ? 23.534  135.760 51.004  1.00 39.87 ? 176 GLU C O   1 
ATOM   6981  C CB  . GLU C  1 151 ? 23.637  137.668 53.553  1.00 43.55 ? 176 GLU C CB  1 
ATOM   6982  C CG  . GLU C  1 151 ? 24.644  137.881 54.654  1.00 46.53 ? 176 GLU C CG  1 
ATOM   6983  C CD  . GLU C  1 151 ? 24.967  139.335 54.803  1.00 51.55 ? 176 GLU C CD  1 
ATOM   6984  O OE1 . GLU C  1 151 ? 24.120  140.058 55.367  1.00 54.55 ? 176 GLU C OE1 1 
ATOM   6985  O OE2 . GLU C  1 151 ? 26.038  139.767 54.326  1.00 54.29 ? 176 GLU C OE2 1 
ATOM   6986  N N   . ARG C  1 152 ? 25.638  135.799 51.807  1.00 38.95 ? 177 ARG C N   1 
ATOM   6987  C CA  . ARG C  1 152 ? 25.855  134.394 51.485  1.00 36.72 ? 177 ARG C CA  1 
ATOM   6988  C C   . ARG C  1 152 ? 24.975  133.506 52.367  1.00 33.67 ? 177 ARG C C   1 
ATOM   6989  O O   . ARG C  1 152 ? 24.905  133.683 53.586  1.00 32.88 ? 177 ARG C O   1 
ATOM   6990  C CB  . ARG C  1 152 ? 27.322  133.987 51.666  1.00 37.00 ? 177 ARG C CB  1 
ATOM   6991  C CG  . ARG C  1 152 ? 27.544  132.501 51.395  1.00 37.08 ? 177 ARG C CG  1 
ATOM   6992  C CD  . ARG C  1 152 ? 29.020  132.096 51.309  1.00 38.43 ? 177 ARG C CD  1 
ATOM   6993  N NE  . ARG C  1 152 ? 29.746  132.189 52.571  1.00 38.78 ? 177 ARG C NE  1 
ATOM   6994  C CZ  . ARG C  1 152 ? 29.501  131.462 53.665  1.00 39.68 ? 177 ARG C CZ  1 
ATOM   6995  N NH1 . ARG C  1 152 ? 28.504  130.585 53.709  1.00 38.10 ? 177 ARG C NH1 1 
ATOM   6996  N NH2 . ARG C  1 152 ? 30.249  131.636 54.745  1.00 40.58 ? 177 ARG C NH2 1 
ATOM   6997  N N   . LEU C  1 153 ? 24.303  132.540 51.760  1.00 31.71 ? 178 LEU C N   1 
ATOM   6998  C CA  . LEU C  1 153 ? 23.524  131.597 52.549  1.00 29.24 ? 178 LEU C CA  1 
ATOM   6999  C C   . LEU C  1 153 ? 24.438  130.825 53.494  1.00 28.30 ? 178 LEU C C   1 
ATOM   7000  O O   . LEU C  1 153 ? 25.528  130.396 53.107  1.00 28.38 ? 178 LEU C O   1 
ATOM   7001  C CB  . LEU C  1 153 ? 22.756  130.634 51.632  1.00 28.68 ? 178 LEU C CB  1 
ATOM   7002  C CG  . LEU C  1 153 ? 21.682  131.282 50.763  1.00 28.65 ? 178 LEU C CG  1 
ATOM   7003  C CD1 . LEU C  1 153 ? 21.316  130.383 49.568  1.00 27.52 ? 178 LEU C CD1 1 
ATOM   7004  C CD2 . LEU C  1 153 ? 20.471  131.569 51.612  1.00 26.20 ? 178 LEU C CD2 1 
ATOM   7005  N N   . LEU C  1 154 ? 24.009  130.672 54.744  1.00 27.22 ? 179 LEU C N   1 
ATOM   7006  C CA  . LEU C  1 154 ? 24.757  129.877 55.719  1.00 26.77 ? 179 LEU C CA  1 
ATOM   7007  C C   . LEU C  1 154 ? 24.638  128.375 55.449  1.00 25.50 ? 179 LEU C C   1 
ATOM   7008  O O   . LEU C  1 154 ? 23.606  127.884 54.964  1.00 25.61 ? 179 LEU C O   1 
ATOM   7009  C CB  . LEU C  1 154 ? 24.279  130.171 57.156  1.00 25.59 ? 179 LEU C CB  1 
ATOM   7010  C CG  . LEU C  1 154 ? 24.430  131.645 57.548  1.00 28.49 ? 179 LEU C CG  1 
ATOM   7011  C CD1 . LEU C  1 154 ? 23.860  131.910 58.926  1.00 28.46 ? 179 LEU C CD1 1 
ATOM   7012  C CD2 . LEU C  1 154 ? 25.893  132.093 57.462  1.00 30.68 ? 179 LEU C CD2 1 
ATOM   7013  N N   . LEU C  1 155 ? 25.700  127.649 55.775  1.00 25.07 ? 180 LEU C N   1 
ATOM   7014  C CA  . LEU C  1 155 ? 25.688  126.183 55.729  1.00 24.35 ? 180 LEU C CA  1 
ATOM   7015  C C   . LEU C  1 155 ? 26.154  125.613 57.069  1.00 23.81 ? 180 LEU C C   1 
ATOM   7016  O O   . LEU C  1 155 ? 27.298  125.835 57.484  1.00 24.73 ? 180 LEU C O   1 
ATOM   7017  C CB  . LEU C  1 155 ? 26.598  125.659 54.615  1.00 24.19 ? 180 LEU C CB  1 
ATOM   7018  C CG  . LEU C  1 155 ? 26.509  124.158 54.338  1.00 24.85 ? 180 LEU C CG  1 
ATOM   7019  C CD1 . LEU C  1 155 ? 25.072  123.764 53.908  1.00 24.00 ? 180 LEU C CD1 1 
ATOM   7020  C CD2 . LEU C  1 155 ? 27.522  123.770 53.259  1.00 24.56 ? 180 LEU C CD2 1 
ATOM   7021  N N   . THR C  1 156 ? 25.277  124.877 57.736  1.00 22.83 ? 181 THR C N   1 
ATOM   7022  C CA  . THR C  1 156 ? 25.636  124.248 59.003  1.00 22.69 ? 181 THR C CA  1 
ATOM   7023  C C   . THR C  1 156 ? 25.243  122.775 58.994  1.00 22.02 ? 181 THR C C   1 
ATOM   7024  O O   . THR C  1 156 ? 24.542  122.303 58.095  1.00 22.68 ? 181 THR C O   1 
ATOM   7025  C CB  . THR C  1 156 ? 24.947  124.916 60.203  1.00 22.16 ? 181 THR C CB  1 
ATOM   7026  O OG1 . THR C  1 156 ? 23.529  124.724 60.110  1.00 21.65 ? 181 THR C OG1 1 
ATOM   7027  C CG2 . THR C  1 156 ? 25.278  126.398 60.275  1.00 23.37 ? 181 THR C CG2 1 
ATOM   7028  N N   . ALA C  1 157 ? 25.696  122.041 60.000  1.00 21.67 ? 182 ALA C N   1 
ATOM   7029  C CA  . ALA C  1 157 ? 25.354  120.624 60.106  1.00 21.06 ? 182 ALA C CA  1 
ATOM   7030  C C   . ALA C  1 157 ? 25.202  120.212 61.557  1.00 20.22 ? 182 ALA C C   1 
ATOM   7031  O O   . ALA C  1 157 ? 26.082  120.485 62.378  1.00 20.73 ? 182 ALA C O   1 
ATOM   7032  C CB  . ALA C  1 157 ? 26.446  119.769 59.461  1.00 21.23 ? 182 ALA C CB  1 
ATOM   7033  N N   . GLY C  1 158 ? 24.111  119.516 61.850  1.00 19.59 ? 183 GLY C N   1 
ATOM   7034  C CA  . GLY C  1 158 ? 23.977  118.790 63.109  1.00 18.77 ? 183 GLY C CA  1 
ATOM   7035  C C   . GLY C  1 158 ? 24.769  117.508 62.987  1.00 18.93 ? 183 GLY C C   1 
ATOM   7036  O O   . GLY C  1 158 ? 24.597  116.748 62.022  1.00 18.67 ? 183 GLY C O   1 
ATOM   7037  N N   . VAL C  1 159 ? 25.664  117.276 63.952  1.00 18.35 ? 184 VAL C N   1 
ATOM   7038  C CA  . VAL C  1 159 ? 26.627  116.185 63.854  1.00 17.96 ? 184 VAL C CA  1 
ATOM   7039  C C   . VAL C  1 159 ? 26.734  115.417 65.176  1.00 18.34 ? 184 VAL C C   1 
ATOM   7040  O O   . VAL C  1 159 ? 26.560  115.983 66.260  1.00 18.23 ? 184 VAL C O   1 
ATOM   7041  C CB  . VAL C  1 159 ? 28.015  116.707 63.438  1.00 19.06 ? 184 VAL C CB  1 
ATOM   7042  C CG1 . VAL C  1 159 ? 27.942  117.411 62.077  1.00 19.38 ? 184 VAL C CG1 1 
ATOM   7043  C CG2 . VAL C  1 159 ? 28.594  117.676 64.504  1.00 17.98 ? 184 VAL C CG2 1 
ATOM   7044  N N   . SER C  1 160 ? 27.000  114.121 65.058  1.00 18.32 ? 185 SER C N   1 
ATOM   7045  C CA  . SER C  1 160 ? 27.097  113.225 66.194  1.00 17.75 ? 185 SER C CA  1 
ATOM   7046  C C   . SER C  1 160 ? 28.138  113.709 67.207  1.00 18.17 ? 185 SER C C   1 
ATOM   7047  O O   . SER C  1 160 ? 29.215  114.236 66.840  1.00 16.73 ? 185 SER C O   1 
ATOM   7048  C CB  . SER C  1 160 ? 27.522  111.834 65.702  1.00 18.54 ? 185 SER C CB  1 
ATOM   7049  O OG  . SER C  1 160 ? 27.659  110.922 66.790  1.00 18.68 ? 185 SER C OG  1 
ATOM   7050  N N   . ALA C  1 161 ? 27.831  113.453 68.481  1.00 17.50 ? 186 ALA C N   1 
ATOM   7051  C CA  . ALA C  1 161 ? 28.768  113.670 69.574  1.00 18.08 ? 186 ALA C CA  1 
ATOM   7052  C C   . ALA C  1 161 ? 29.384  112.363 70.063  1.00 19.00 ? 186 ALA C C   1 
ATOM   7053  O O   . ALA C  1 161 ? 30.061  112.355 71.083  1.00 19.05 ? 186 ALA C O   1 
ATOM   7054  C CB  . ALA C  1 161 ? 28.045  114.363 70.746  1.00 17.11 ? 186 ALA C CB  1 
ATOM   7055  N N   . GLY C  1 162 ? 29.142  111.259 69.357  1.00 19.52 ? 187 GLY C N   1 
ATOM   7056  C CA  . GLY C  1 162 ? 29.684  109.953 69.766  1.00 19.88 ? 187 GLY C CA  1 
ATOM   7057  C C   . GLY C  1 162 ? 30.947  109.550 69.014  1.00 21.57 ? 187 GLY C C   1 
ATOM   7058  O O   . GLY C  1 162 ? 30.939  109.393 67.788  1.00 21.72 ? 187 GLY C O   1 
ATOM   7059  N N   . ARG C  1 163 ? 32.044  109.374 69.742  1.00 22.14 ? 188 ARG C N   1 
ATOM   7060  C CA  . ARG C  1 163 ? 33.331  109.139 69.088  1.00 23.10 ? 188 ARG C CA  1 
ATOM   7061  C C   . ARG C  1 163 ? 33.292  108.110 67.950  1.00 24.09 ? 188 ARG C C   1 
ATOM   7062  O O   . ARG C  1 163 ? 33.797  108.370 66.867  1.00 24.17 ? 188 ARG C O   1 
ATOM   7063  C CB  . ARG C  1 163 ? 34.430  108.767 70.088  1.00 24.51 ? 188 ARG C CB  1 
ATOM   7064  C CG  . ARG C  1 163 ? 35.750  108.458 69.336  1.00 26.17 ? 188 ARG C CG  1 
ATOM   7065  C CD  . ARG C  1 163 ? 36.866  108.070 70.213  1.00 30.55 ? 188 ARG C CD  1 
ATOM   7066  N NE  . ARG C  1 163 ? 38.005  107.656 69.405  1.00 34.63 ? 188 ARG C NE  1 
ATOM   7067  C CZ  . ARG C  1 163 ? 39.240  107.613 69.872  1.00 36.83 ? 188 ARG C CZ  1 
ATOM   7068  N NH1 . ARG C  1 163 ? 39.457  107.972 71.130  1.00 38.23 ? 188 ARG C NH1 1 
ATOM   7069  N NH2 . ARG C  1 163 ? 40.247  107.224 69.100  1.00 38.18 ? 188 ARG C NH2 1 
ATOM   7070  N N   . GLN C  1 164 ? 32.722  106.931 68.173  1.00 24.25 ? 189 GLN C N   1 
ATOM   7071  C CA  . GLN C  1 164 ? 32.748  105.956 67.078  1.00 26.08 ? 189 GLN C CA  1 
ATOM   7072  C C   . GLN C  1 164 ? 32.000  106.458 65.828  1.00 24.52 ? 189 GLN C C   1 
ATOM   7073  O O   . GLN C  1 164 ? 32.489  106.316 64.723  1.00 25.61 ? 189 GLN C O   1 
ATOM   7074  C CB  . GLN C  1 164 ? 32.231  104.581 67.512  1.00 27.06 ? 189 GLN C CB  1 
ATOM   7075  C CG  . GLN C  1 164 ? 32.385  103.496 66.403  1.00 31.45 ? 189 GLN C CG  1 
ATOM   7076  C CD  . GLN C  1 164 ? 33.834  103.253 65.970  1.00 37.91 ? 189 GLN C CD  1 
ATOM   7077  O OE1 . GLN C  1 164 ? 34.238  103.596 64.847  1.00 39.77 ? 189 GLN C OE1 1 
ATOM   7078  N NE2 . GLN C  1 164 ? 34.619  102.635 66.851  1.00 40.12 ? 189 GLN C NE2 1 
ATOM   7079  N N   . MET C  1 165 ? 30.824  107.049 66.005  1.00 23.12 ? 190 MET C N   1 
ATOM   7080  C CA  . MET C  1 165 ? 30.052  107.572 64.863  1.00 22.34 ? 190 MET C CA  1 
ATOM   7081  C C   . MET C  1 165 ? 30.787  108.720 64.139  1.00 22.59 ? 190 MET C C   1 
ATOM   7082  O O   . MET C  1 165 ? 30.736  108.825 62.917  1.00 23.30 ? 190 MET C O   1 
ATOM   7083  C CB  . MET C  1 165 ? 28.645  107.991 65.322  1.00 20.97 ? 190 MET C CB  1 
ATOM   7084  C CG  . MET C  1 165 ? 27.659  108.258 64.171  1.00 20.94 ? 190 MET C CG  1 
ATOM   7085  S SD  . MET C  1 165 ? 27.620  106.932 62.927  1.00 23.66 ? 190 MET C SD  1 
ATOM   7086  C CE  . MET C  1 165 ? 27.042  105.562 63.960  1.00 25.57 ? 190 MET C CE  1 
ATOM   7087  N N   . ILE C  1 166 ? 31.494  109.561 64.894  1.00 22.13 ? 191 ILE C N   1 
ATOM   7088  C CA  . ILE C  1 166 ? 32.311  110.627 64.319  1.00 22.38 ? 191 ILE C CA  1 
ATOM   7089  C C   . ILE C  1 166 ? 33.416  110.045 63.416  1.00 24.21 ? 191 ILE C C   1 
ATOM   7090  O O   . ILE C  1 166 ? 33.618  110.491 62.275  1.00 23.87 ? 191 ILE C O   1 
ATOM   7091  C CB  . ILE C  1 166 ? 32.936  111.528 65.434  1.00 22.27 ? 191 ILE C CB  1 
ATOM   7092  C CG1 . ILE C  1 166 ? 31.830  112.273 66.197  1.00 20.86 ? 191 ILE C CG1 1 
ATOM   7093  C CG2 . ILE C  1 166 ? 33.935  112.540 64.835  1.00 23.32 ? 191 ILE C CG2 1 
ATOM   7094  C CD1 . ILE C  1 166 ? 32.267  112.766 67.585  1.00 19.38 ? 191 ILE C CD1 1 
ATOM   7095  N N   . ASP C  1 167 ? 34.140  109.064 63.934  1.00 25.16 ? 192 ASP C N   1 
ATOM   7096  C CA  . ASP C  1 167 ? 35.190  108.395 63.163  1.00 27.46 ? 192 ASP C CA  1 
ATOM   7097  C C   . ASP C  1 167 ? 34.635  107.792 61.865  1.00 27.61 ? 192 ASP C C   1 
ATOM   7098  O O   . ASP C  1 167 ? 35.207  107.981 60.782  1.00 28.69 ? 192 ASP C O   1 
ATOM   7099  C CB  . ASP C  1 167 ? 35.857  107.302 64.017  1.00 28.42 ? 192 ASP C CB  1 
ATOM   7100  C CG  . ASP C  1 167 ? 36.849  107.877 65.039  1.00 29.97 ? 192 ASP C CG  1 
ATOM   7101  O OD1 . ASP C  1 167 ? 37.322  109.014 64.840  1.00 31.56 ? 192 ASP C OD1 1 
ATOM   7102  O OD2 . ASP C  1 167 ? 37.147  107.197 66.040  1.00 31.51 ? 192 ASP C OD2 1 
ATOM   7103  N N   . ASN C  1 168 ? 33.537  107.052 61.987  1.00 26.91 ? 193 ASN C N   1 
ATOM   7104  C CA  . ASN C  1 168 ? 32.880  106.446 60.823  1.00 27.01 ? 193 ASN C CA  1 
ATOM   7105  C C   . ASN C  1 168 ? 32.449  107.491 59.783  1.00 26.10 ? 193 ASN C C   1 
ATOM   7106  O O   . ASN C  1 168 ? 32.594  107.272 58.581  1.00 26.22 ? 193 ASN C O   1 
ATOM   7107  C CB  . ASN C  1 168 ? 31.607  105.689 61.258  1.00 26.39 ? 193 ASN C CB  1 
ATOM   7108  C CG  . ASN C  1 168 ? 31.905  104.431 62.055  1.00 28.81 ? 193 ASN C CG  1 
ATOM   7109  O OD1 . ASN C  1 168 ? 33.059  104.103 62.312  1.00 29.83 ? 193 ASN C OD1 1 
ATOM   7110  N ND2 . ASN C  1 168 ? 30.846  103.718 62.451  1.00 29.09 ? 193 ASN C ND2 1 
ATOM   7111  N N   . SER C  1 169 ? 31.899  108.613 60.255  1.00 24.87 ? 194 SER C N   1 
ATOM   7112  C CA  . SER C  1 169 ? 31.024  109.459 59.414  1.00 24.02 ? 194 SER C CA  1 
ATOM   7113  C C   . SER C  1 169 ? 31.650  110.656 58.710  1.00 24.81 ? 194 SER C C   1 
ATOM   7114  O O   . SER C  1 169 ? 31.167  111.049 57.649  1.00 24.12 ? 194 SER C O   1 
ATOM   7115  C CB  . SER C  1 169 ? 29.836  110.021 60.233  1.00 22.54 ? 194 SER C CB  1 
ATOM   7116  O OG  . SER C  1 169 ? 28.956  109.004 60.673  1.00 21.82 ? 194 SER C OG  1 
ATOM   7117  N N   . TYR C  1 170 ? 32.659  111.276 59.322  1.00 24.62 ? 195 TYR C N   1 
ATOM   7118  C CA  . TYR C  1 170 ? 33.010  112.647 58.943  1.00 24.96 ? 195 TYR C CA  1 
ATOM   7119  C C   . TYR C  1 170 ? 34.466  112.817 58.557  1.00 26.16 ? 195 TYR C C   1 
ATOM   7120  O O   . TYR C  1 170 ? 35.345  112.276 59.215  1.00 26.90 ? 195 TYR C O   1 
ATOM   7121  C CB  . TYR C  1 170 ? 32.736  113.596 60.114  1.00 23.76 ? 195 TYR C CB  1 
ATOM   7122  C CG  . TYR C  1 170 ? 31.338  113.509 60.680  1.00 22.24 ? 195 TYR C CG  1 
ATOM   7123  C CD1 . TYR C  1 170 ? 30.245  113.749 59.881  1.00 21.65 ? 195 TYR C CD1 1 
ATOM   7124  C CD2 . TYR C  1 170 ? 31.117  113.187 62.014  1.00 22.20 ? 195 TYR C CD2 1 
ATOM   7125  C CE1 . TYR C  1 170 ? 28.959  113.677 60.373  1.00 21.78 ? 195 TYR C CE1 1 
ATOM   7126  C CE2 . TYR C  1 170 ? 29.822  113.120 62.534  1.00 19.93 ? 195 TYR C CE2 1 
ATOM   7127  C CZ  . TYR C  1 170 ? 28.751  113.368 61.705  1.00 20.84 ? 195 TYR C CZ  1 
ATOM   7128  O OH  . TYR C  1 170 ? 27.463  113.300 62.167  1.00 18.93 ? 195 TYR C OH  1 
ATOM   7129  N N   . GLN C  1 171 ? 34.719  113.603 57.518  1.00 26.69 ? 196 GLN C N   1 
ATOM   7130  C CA  . GLN C  1 171 ? 36.069  114.024 57.187  1.00 28.53 ? 196 GLN C CA  1 
ATOM   7131  C C   . GLN C  1 171 ? 36.172  115.453 57.714  1.00 28.55 ? 196 GLN C C   1 
ATOM   7132  O O   . GLN C  1 171 ? 35.875  116.425 57.016  1.00 28.80 ? 196 GLN C O   1 
ATOM   7133  C CB  . GLN C  1 171 ? 36.321  113.907 55.667  1.00 29.29 ? 196 GLN C CB  1 
ATOM   7134  C CG  . GLN C  1 171 ? 36.051  112.469 55.168  1.00 30.49 ? 196 GLN C CG  1 
ATOM   7135  C CD  . GLN C  1 171 ? 36.106  112.310 53.660  1.00 33.08 ? 196 GLN C CD  1 
ATOM   7136  O OE1 . GLN C  1 171 ? 36.954  112.897 52.992  1.00 35.48 ? 196 GLN C OE1 1 
ATOM   7137  N NE2 . GLN C  1 171 ? 35.206  111.491 53.117  1.00 32.94 ? 196 GLN C NE2 1 
ATOM   7138  N N   . VAL C  1 172 ? 36.582  115.548 58.975  1.00 28.32 ? 197 VAL C N   1 
ATOM   7139  C CA  . VAL C  1 172 ? 36.437  116.746 59.785  1.00 28.08 ? 197 VAL C CA  1 
ATOM   7140  C C   . VAL C  1 172 ? 37.165  117.969 59.215  1.00 29.46 ? 197 VAL C C   1 
ATOM   7141  O O   . VAL C  1 172 ? 36.606  119.064 59.189  1.00 29.40 ? 197 VAL C O   1 
ATOM   7142  C CB  . VAL C  1 172 ? 36.897  116.461 61.245  1.00 27.82 ? 197 VAL C CB  1 
ATOM   7143  C CG1 . VAL C  1 172 ? 36.875  117.736 62.079  1.00 26.72 ? 197 VAL C CG1 1 
ATOM   7144  C CG2 . VAL C  1 172 ? 36.007  115.383 61.875  1.00 25.73 ? 197 VAL C CG2 1 
ATOM   7145  N N   . GLU C  1 173 ? 38.401  117.777 58.761  1.00 31.33 ? 198 GLU C N   1 
ATOM   7146  C CA  . GLU C  1 173 ? 39.148  118.850 58.124  1.00 33.48 ? 198 GLU C CA  1 
ATOM   7147  C C   . GLU C  1 173 ? 38.438  119.426 56.896  1.00 33.88 ? 198 GLU C C   1 
ATOM   7148  O O   . GLU C  1 173 ? 38.471  120.639 56.682  1.00 34.06 ? 198 GLU C O   1 
ATOM   7149  C CB  . GLU C  1 173 ? 40.559  118.389 57.755  1.00 35.80 ? 198 GLU C CB  1 
ATOM   7150  C CG  . GLU C  1 173 ? 41.444  118.195 58.985  1.00 38.87 ? 198 GLU C CG  1 
ATOM   7151  C CD  . GLU C  1 173 ? 42.863  117.811 58.641  1.00 45.15 ? 198 GLU C CD  1 
ATOM   7152  O OE1 . GLU C  1 173 ? 43.672  118.705 58.300  1.00 47.82 ? 198 GLU C OE1 1 
ATOM   7153  O OE2 . GLU C  1 173 ? 43.171  116.607 58.731  1.00 47.89 ? 198 GLU C OE2 1 
ATOM   7154  N N   . LYS C  1 174 ? 37.814  118.563 56.089  1.00 33.66 ? 199 LYS C N   1 
ATOM   7155  C CA  . LYS C  1 174 ? 37.034  119.018 54.933  1.00 33.88 ? 199 LYS C CA  1 
ATOM   7156  C C   . LYS C  1 174 ? 35.820  119.803 55.390  1.00 32.82 ? 199 LYS C C   1 
ATOM   7157  O O   . LYS C  1 174 ? 35.552  120.893 54.889  1.00 33.57 ? 199 LYS C O   1 
ATOM   7158  C CB  . LYS C  1 174 ? 36.560  117.851 54.064  1.00 33.79 ? 199 LYS C CB  1 
ATOM   7159  C CG  . LYS C  1 174 ? 37.447  117.515 52.877  1.00 36.55 ? 199 LYS C CG  1 
ATOM   7160  C CD  . LYS C  1 174 ? 38.086  116.145 53.016  1.00 39.70 ? 199 LYS C CD  1 
ATOM   7161  C CE  . LYS C  1 174 ? 38.171  115.435 51.665  1.00 41.86 ? 199 LYS C CE  1 
ATOM   7162  N NZ  . LYS C  1 174 ? 38.052  116.386 50.519  1.00 45.22 ? 199 LYS C NZ  1 
ATOM   7163  N N   . LEU C  1 175 ? 35.080  119.234 56.337  1.00 31.46 ? 200 LEU C N   1 
ATOM   7164  C CA  . LEU C  1 175 ? 33.912  119.891 56.927  1.00 30.74 ? 200 LEU C CA  1 
ATOM   7165  C C   . LEU C  1 175 ? 34.227  121.267 57.534  1.00 31.24 ? 200 LEU C C   1 
ATOM   7166  O O   . LEU C  1 175 ? 33.417  122.209 57.417  1.00 31.28 ? 200 LEU C O   1 
ATOM   7167  C CB  . LEU C  1 175 ? 33.302  118.996 58.008  1.00 29.40 ? 200 LEU C CB  1 
ATOM   7168  C CG  . LEU C  1 175 ? 32.053  118.157 57.701  1.00 30.62 ? 200 LEU C CG  1 
ATOM   7169  C CD1 . LEU C  1 175 ? 31.802  117.919 56.226  1.00 30.94 ? 200 LEU C CD1 1 
ATOM   7170  C CD2 . LEU C  1 175 ? 32.050  116.825 58.515  1.00 30.07 ? 200 LEU C CD2 1 
ATOM   7171  N N   . ALA C  1 176 ? 35.376  121.385 58.205  1.00 31.30 ? 201 ALA C N   1 
ATOM   7172  C CA  . ALA C  1 176 ? 35.771  122.662 58.797  1.00 32.15 ? 201 ALA C CA  1 
ATOM   7173  C C   . ALA C  1 176 ? 35.868  123.775 57.746  1.00 33.03 ? 201 ALA C C   1 
ATOM   7174  O O   . ALA C  1 176 ? 35.663  124.943 58.060  1.00 34.26 ? 201 ALA C O   1 
ATOM   7175  C CB  . ALA C  1 176 ? 37.094  122.529 59.545  1.00 32.71 ? 201 ALA C CB  1 
ATOM   7176  N N   . LYS C  1 177 ? 36.180  123.421 56.504  1.00 33.85 ? 202 LYS C N   1 
ATOM   7177  C CA  . LYS C  1 177 ? 36.307  124.421 55.446  1.00 34.59 ? 202 LYS C CA  1 
ATOM   7178  C C   . LYS C  1 177 ? 34.982  124.786 54.795  1.00 33.61 ? 202 LYS C C   1 
ATOM   7179  O O   . LYS C  1 177 ? 34.802  125.907 54.306  1.00 34.17 ? 202 LYS C O   1 
ATOM   7180  C CB  . LYS C  1 177 ? 37.264  123.934 54.358  1.00 36.56 ? 202 LYS C CB  1 
ATOM   7181  C CG  . LYS C  1 177 ? 38.703  124.231 54.657  1.00 39.55 ? 202 LYS C CG  1 
ATOM   7182  C CD  . LYS C  1 177 ? 39.547  123.947 53.449  1.00 45.40 ? 202 LYS C CD  1 
ATOM   7183  C CE  . LYS C  1 177 ? 39.947  122.496 53.413  1.00 46.83 ? 202 LYS C CE  1 
ATOM   7184  N NZ  . LYS C  1 177 ? 41.290  122.394 52.770  1.00 51.17 ? 202 LYS C NZ  1 
ATOM   7185  N N   . ASP C  1 178 ? 34.059  123.836 54.776  1.00 31.61 ? 203 ASP C N   1 
ATOM   7186  C CA  . ASP C  1 178 ? 32.830  123.995 54.024  1.00 30.98 ? 203 ASP C CA  1 
ATOM   7187  C C   . ASP C  1 178 ? 31.717  124.572 54.892  1.00 29.64 ? 203 ASP C C   1 
ATOM   7188  O O   . ASP C  1 178 ? 30.889  125.329 54.404  1.00 29.45 ? 203 ASP C O   1 
ATOM   7189  C CB  . ASP C  1 178 ? 32.390  122.655 53.426  1.00 30.38 ? 203 ASP C CB  1 
ATOM   7190  C CG  . ASP C  1 178 ? 33.308  122.181 52.303  1.00 32.05 ? 203 ASP C CG  1 
ATOM   7191  O OD1 . ASP C  1 178 ? 33.903  123.017 51.617  1.00 33.47 ? 203 ASP C OD1 1 
ATOM   7192  O OD2 . ASP C  1 178 ? 33.427  120.961 52.100  1.00 34.24 ? 203 ASP C OD2 1 
ATOM   7193  N N   . LEU C  1 179 ? 31.701  124.211 56.178  1.00 28.83 ? 204 LEU C N   1 
ATOM   7194  C CA  . LEU C  1 179 ? 30.638  124.635 57.086  1.00 27.53 ? 204 LEU C CA  1 
ATOM   7195  C C   . LEU C  1 179 ? 30.938  125.987 57.717  1.00 28.31 ? 204 LEU C C   1 
ATOM   7196  O O   . LEU C  1 179 ? 32.086  126.295 58.004  1.00 29.28 ? 204 LEU C O   1 
ATOM   7197  C CB  . LEU C  1 179 ? 30.417  123.593 58.204  1.00 26.52 ? 204 LEU C CB  1 
ATOM   7198  C CG  . LEU C  1 179 ? 29.993  122.172 57.811  1.00 24.85 ? 204 LEU C CG  1 
ATOM   7199  C CD1 . LEU C  1 179 ? 29.731  121.316 59.057  1.00 23.17 ? 204 LEU C CD1 1 
ATOM   7200  C CD2 . LEU C  1 179 ? 28.746  122.185 56.906  1.00 24.44 ? 204 LEU C CD2 1 
ATOM   7201  N N   . ASP C  1 180 ? 29.900  126.792 57.939  1.00 27.88 ? 205 ASP C N   1 
ATOM   7202  C CA  . ASP C  1 180 ? 30.034  127.973 58.789  1.00 27.98 ? 205 ASP C CA  1 
ATOM   7203  C C   . ASP C  1 180 ? 30.190  127.559 60.267  1.00 26.88 ? 205 ASP C C   1 
ATOM   7204  O O   . ASP C  1 180 ? 30.953  128.161 61.024  1.00 27.48 ? 205 ASP C O   1 
ATOM   7205  C CB  . ASP C  1 180 ? 28.846  128.900 58.582  1.00 28.26 ? 205 ASP C CB  1 
ATOM   7206  C CG  . ASP C  1 180 ? 28.869  129.546 57.213  1.00 30.02 ? 205 ASP C CG  1 
ATOM   7207  O OD1 . ASP C  1 180 ? 29.765  130.389 56.990  1.00 32.05 ? 205 ASP C OD1 1 
ATOM   7208  O OD2 . ASP C  1 180 ? 28.018  129.197 56.362  1.00 27.58 ? 205 ASP C OD2 1 
ATOM   7209  N N   . PHE C  1 181 ? 29.484  126.514 60.665  1.00 25.46 ? 206 PHE C N   1 
ATOM   7210  C CA  . PHE C  1 181 ? 29.689  125.919 61.988  1.00 24.34 ? 206 PHE C CA  1 
ATOM   7211  C C   . PHE C  1 181 ? 28.976  124.585 62.110  1.00 23.43 ? 206 PHE C C   1 
ATOM   7212  O O   . PHE C  1 181 ? 28.124  124.256 61.284  1.00 22.97 ? 206 PHE C O   1 
ATOM   7213  C CB  . PHE C  1 181 ? 29.293  126.880 63.137  1.00 24.50 ? 206 PHE C CB  1 
ATOM   7214  C CG  . PHE C  1 181 ? 27.852  127.411 63.078  1.00 23.96 ? 206 PHE C CG  1 
ATOM   7215  C CD1 . PHE C  1 181 ? 26.801  126.699 63.645  1.00 22.59 ? 206 PHE C CD1 1 
ATOM   7216  C CD2 . PHE C  1 181 ? 27.577  128.648 62.508  1.00 24.38 ? 206 PHE C CD2 1 
ATOM   7217  C CE1 . PHE C  1 181 ? 25.501  127.201 63.634  1.00 21.98 ? 206 PHE C CE1 1 
ATOM   7218  C CE2 . PHE C  1 181 ? 26.279  129.157 62.486  1.00 24.87 ? 206 PHE C CE2 1 
ATOM   7219  C CZ  . PHE C  1 181 ? 25.239  128.428 63.048  1.00 23.61 ? 206 PHE C CZ  1 
ATOM   7220  N N   . ILE C  1 182 ? 29.345  123.800 63.123  1.00 22.35 ? 207 ILE C N   1 
ATOM   7221  C CA  . ILE C  1 182 ? 28.601  122.598 63.417  1.00 21.44 ? 207 ILE C CA  1 
ATOM   7222  C C   . ILE C  1 182 ? 27.698  122.839 64.595  1.00 20.54 ? 207 ILE C C   1 
ATOM   7223  O O   . ILE C  1 182 ? 28.033  123.609 65.506  1.00 22.26 ? 207 ILE C O   1 
ATOM   7224  C CB  . ILE C  1 182 ? 29.494  121.378 63.728  1.00 20.93 ? 207 ILE C CB  1 
ATOM   7225  C CG1 . ILE C  1 182 ? 30.460  121.668 64.893  1.00 21.78 ? 207 ILE C CG1 1 
ATOM   7226  C CG2 . ILE C  1 182 ? 30.213  120.915 62.461  1.00 21.89 ? 207 ILE C CG2 1 
ATOM   7227  C CD1 . ILE C  1 182 ? 31.067  120.398 65.504  1.00 22.58 ? 207 ILE C CD1 1 
ATOM   7228  N N   . ASN C  1 183 ? 26.535  122.209 64.547  1.00 19.72 ? 208 ASN C N   1 
ATOM   7229  C CA  . ASN C  1 183 ? 25.645  122.119 65.689  1.00 19.39 ? 208 ASN C CA  1 
ATOM   7230  C C   . ASN C  1 183 ? 25.912  120.762 66.325  1.00 18.50 ? 208 ASN C C   1 
ATOM   7231  O O   . ASN C  1 183 ? 25.451  119.731 65.824  1.00 17.30 ? 208 ASN C O   1 
ATOM   7232  C CB  . ASN C  1 183 ? 24.186  122.231 65.223  1.00 19.15 ? 208 ASN C CB  1 
ATOM   7233  C CG  . ASN C  1 183 ? 23.848  123.628 64.690  1.00 20.47 ? 208 ASN C CG  1 
ATOM   7234  O OD1 . ASN C  1 183 ? 23.391  123.787 63.538  1.00 24.01 ? 208 ASN C OD1 1 
ATOM   7235  N ND2 . ASN C  1 183 ? 24.080  124.632 65.505  1.00 16.01 ? 208 ASN C ND2 1 
ATOM   7236  N N   . LEU C  1 184 ? 26.705  120.756 67.401  1.00 19.29 ? 209 LEU C N   1 
ATOM   7237  C CA  . LEU C  1 184 ? 27.153  119.491 68.013  1.00 18.42 ? 209 LEU C CA  1 
ATOM   7238  C C   . LEU C  1 184 ? 26.005  118.875 68.800  1.00 17.71 ? 209 LEU C C   1 
ATOM   7239  O O   . LEU C  1 184 ? 25.523  119.474 69.763  1.00 17.51 ? 209 LEU C O   1 
ATOM   7240  C CB  . LEU C  1 184 ? 28.365  119.721 68.928  1.00 19.14 ? 209 LEU C CB  1 
ATOM   7241  C CG  . LEU C  1 184 ? 28.895  118.488 69.667  1.00 19.27 ? 209 LEU C CG  1 
ATOM   7242  C CD1 . LEU C  1 184 ? 29.302  117.364 68.701  1.00 17.69 ? 209 LEU C CD1 1 
ATOM   7243  C CD2 . LEU C  1 184 ? 30.070  118.870 70.576  1.00 20.94 ? 209 LEU C CD2 1 
ATOM   7244  N N   . LEU C  1 185 ? 25.564  117.687 68.394  1.00 16.73 ? 210 LEU C N   1 
ATOM   7245  C CA  . LEU C  1 185 ? 24.418  117.059 69.046  1.00 16.32 ? 210 LEU C CA  1 
ATOM   7246  C C   . LEU C  1 185 ? 24.855  116.368 70.355  1.00 15.62 ? 210 LEU C C   1 
ATOM   7247  O O   . LEU C  1 185 ? 24.762  115.149 70.487  1.00 15.45 ? 210 LEU C O   1 
ATOM   7248  C CB  . LEU C  1 185 ? 23.749  116.090 68.078  1.00 15.85 ? 210 LEU C CB  1 
ATOM   7249  C CG  . LEU C  1 185 ? 23.351  116.775 66.765  1.00 17.09 ? 210 LEU C CG  1 
ATOM   7250  C CD1 . LEU C  1 185 ? 23.058  115.710 65.679  1.00 16.28 ? 210 LEU C CD1 1 
ATOM   7251  C CD2 . LEU C  1 185 ? 22.116  117.652 67.028  1.00 16.15 ? 210 LEU C CD2 1 
ATOM   7252  N N   . SER C  1 186 ? 25.323  117.180 71.301  1.00 16.27 ? 211 SER C N   1 
ATOM   7253  C CA  . SER C  1 186 ? 25.907  116.689 72.562  1.00 16.59 ? 211 SER C CA  1 
ATOM   7254  C C   . SER C  1 186 ? 24.825  116.344 73.579  1.00 16.11 ? 211 SER C C   1 
ATOM   7255  O O   . SER C  1 186 ? 24.737  116.964 74.650  1.00 16.73 ? 211 SER C O   1 
ATOM   7256  C CB  . SER C  1 186 ? 26.912  117.693 73.140  1.00 16.96 ? 211 SER C CB  1 
ATOM   7257  O OG  . SER C  1 186 ? 26.581  119.021 72.812  1.00 16.46 ? 211 SER C OG  1 
ATOM   7258  N N   . PHE C  1 187 ? 24.020  115.347 73.207  1.00 15.35 ? 212 PHE C N   1 
ATOM   7259  C CA  . PHE C  1 187 ? 22.967  114.779 74.042  1.00 15.59 ? 212 PHE C CA  1 
ATOM   7260  C C   . PHE C  1 187 ? 22.676  113.383 73.505  1.00 15.70 ? 212 PHE C C   1 
ATOM   7261  O O   . PHE C  1 187 ? 23.405  112.907 72.601  1.00 15.92 ? 212 PHE C O   1 
ATOM   7262  C CB  . PHE C  1 187 ? 21.716  115.700 74.123  1.00 14.53 ? 212 PHE C CB  1 
ATOM   7263  C CG  . PHE C  1 187 ? 21.429  116.455 72.830  1.00 15.11 ? 212 PHE C CG  1 
ATOM   7264  C CD1 . PHE C  1 187 ? 20.893  115.799 71.744  1.00 16.71 ? 212 PHE C CD1 1 
ATOM   7265  C CD2 . PHE C  1 187 ? 21.722  117.799 72.712  1.00 15.22 ? 212 PHE C CD2 1 
ATOM   7266  C CE1 . PHE C  1 187 ? 20.655  116.485 70.539  1.00 16.95 ? 212 PHE C CE1 1 
ATOM   7267  C CE2 . PHE C  1 187 ? 21.481  118.491 71.518  1.00 15.88 ? 212 PHE C CE2 1 
ATOM   7268  C CZ  . PHE C  1 187 ? 20.955  117.835 70.442  1.00 14.62 ? 212 PHE C CZ  1 
ATOM   7269  N N   . ASP C  1 188 ? 21.681  112.701 74.087  1.00 15.04 ? 213 ASP C N   1 
ATOM   7270  C CA  . ASP C  1 188 ? 21.457  111.272 73.804  1.00 15.72 ? 213 ASP C CA  1 
ATOM   7271  C C   . ASP C  1 188 ? 22.708  110.430 74.030  1.00 15.65 ? 213 ASP C C   1 
ATOM   7272  O O   . ASP C  1 188 ? 22.979  109.474 73.311  1.00 15.85 ? 213 ASP C O   1 
ATOM   7273  C CB  . ASP C  1 188 ? 20.912  111.074 72.396  1.00 15.70 ? 213 ASP C CB  1 
ATOM   7274  C CG  . ASP C  1 188 ? 19.648  111.852 72.182  1.00 17.27 ? 213 ASP C CG  1 
ATOM   7275  O OD1 . ASP C  1 188 ? 18.802  111.845 73.116  1.00 16.93 ? 213 ASP C OD1 1 
ATOM   7276  O OD2 . ASP C  1 188 ? 19.497  112.475 71.113  1.00 17.94 ? 213 ASP C OD2 1 
ATOM   7277  N N   . PHE C  1 189 ? 23.464  110.778 75.054  1.00 15.64 ? 214 PHE C N   1 
ATOM   7278  C CA  . PHE C  1 189 ? 24.663  109.995 75.398  1.00 16.34 ? 214 PHE C CA  1 
ATOM   7279  C C   . PHE C  1 189 ? 24.250  108.676 76.049  1.00 16.71 ? 214 PHE C C   1 
ATOM   7280  O O   . PHE C  1 189 ? 24.934  107.660 75.912  1.00 16.88 ? 214 PHE C O   1 
ATOM   7281  C CB  . PHE C  1 189 ? 25.564  110.787 76.338  1.00 16.84 ? 214 PHE C CB  1 
ATOM   7282  C CG  . PHE C  1 189 ? 26.387  111.826 75.646  1.00 15.62 ? 214 PHE C CG  1 
ATOM   7283  C CD1 . PHE C  1 189 ? 27.432  111.456 74.826  1.00 16.83 ? 214 PHE C CD1 1 
ATOM   7284  C CD2 . PHE C  1 189 ? 26.077  113.172 75.777  1.00 16.16 ? 214 PHE C CD2 1 
ATOM   7285  C CE1 . PHE C  1 189 ? 28.207  112.418 74.183  1.00 16.88 ? 214 PHE C CE1 1 
ATOM   7286  C CE2 . PHE C  1 189 ? 26.849  114.147 75.134  1.00 16.77 ? 214 PHE C CE2 1 
ATOM   7287  C CZ  . PHE C  1 189 ? 27.907  113.754 74.329  1.00 17.63 ? 214 PHE C CZ  1 
ATOM   7288  N N   . HIS C  1 190 ? 23.093  108.691 76.705  1.00 16.45 ? 215 HIS C N   1 
ATOM   7289  C CA  . HIS C  1 190 ? 22.516  107.486 77.293  1.00 16.74 ? 215 HIS C CA  1 
ATOM   7290  C C   . HIS C  1 190 ? 21.006  107.532 77.111  1.00 17.40 ? 215 HIS C C   1 
ATOM   7291  O O   . HIS C  1 190 ? 20.428  108.608 76.996  1.00 16.52 ? 215 HIS C O   1 
ATOM   7292  C CB  . HIS C  1 190 ? 22.847  107.420 78.790  1.00 16.38 ? 215 HIS C CB  1 
ATOM   7293  C CG  . HIS C  1 190 ? 24.315  107.332 79.066  1.00 15.77 ? 215 HIS C CG  1 
ATOM   7294  N ND1 . HIS C  1 190 ? 25.039  106.183 78.841  1.00 15.85 ? 215 HIS C ND1 1 
ATOM   7295  C CD2 . HIS C  1 190 ? 25.196  108.254 79.523  1.00 16.61 ? 215 HIS C CD2 1 
ATOM   7296  C CE1 . HIS C  1 190 ? 26.310  106.399 79.156  1.00 17.61 ? 215 HIS C CE1 1 
ATOM   7297  N NE2 . HIS C  1 190 ? 26.430  107.651 79.573  1.00 16.86 ? 215 HIS C NE2 1 
ATOM   7298  N N   . GLY C  1 191 ? 20.375  106.360 77.081  1.00 18.50 ? 216 GLY C N   1 
ATOM   7299  C CA  . GLY C  1 191 ? 18.918  106.270 76.929  1.00 19.26 ? 216 GLY C CA  1 
ATOM   7300  C C   . GLY C  1 191 ? 18.523  104.799 76.924  1.00 20.75 ? 216 GLY C C   1 
ATOM   7301  O O   . GLY C  1 191 ? 19.391  103.914 77.030  1.00 19.80 ? 216 GLY C O   1 
ATOM   7302  N N   . SER C  1 192 ? 17.224  104.518 76.800  1.00 21.27 ? 217 SER C N   1 
ATOM   7303  C CA  . SER C  1 192 ? 16.779  103.130 76.989  1.00 23.27 ? 217 SER C CA  1 
ATOM   7304  C C   . SER C  1 192 ? 17.038  102.205 75.787  1.00 23.95 ? 217 SER C C   1 
ATOM   7305  O O   . SER C  1 192 ? 16.600  101.066 75.780  1.00 25.40 ? 217 SER C O   1 
ATOM   7306  C CB  . SER C  1 192 ? 15.314  103.067 77.442  1.00 23.50 ? 217 SER C CB  1 
ATOM   7307  O OG  . SER C  1 192 ? 14.483  103.743 76.523  1.00 25.95 ? 217 SER C OG  1 
ATOM   7308  N N   . TRP C  1 193 ? 17.792  102.666 74.797  1.00 23.63 ? 218 TRP C N   1 
ATOM   7309  C CA  . TRP C  1 193 ? 18.241  101.778 73.726  1.00 23.65 ? 218 TRP C CA  1 
ATOM   7310  C C   . TRP C  1 193 ? 19.421  100.916 74.161  1.00 24.09 ? 218 TRP C C   1 
ATOM   7311  O O   . TRP C  1 193 ? 19.752  99.939  73.495  1.00 23.34 ? 218 TRP C O   1 
ATOM   7312  C CB  . TRP C  1 193 ? 18.652  102.588 72.501  1.00 23.77 ? 218 TRP C CB  1 
ATOM   7313  C CG  . TRP C  1 193 ? 19.635  103.671 72.854  1.00 23.54 ? 218 TRP C CG  1 
ATOM   7314  C CD1 . TRP C  1 193 ? 20.987  103.522 73.047  1.00 22.42 ? 218 TRP C CD1 1 
ATOM   7315  C CD2 . TRP C  1 193 ? 19.345  105.051 73.101  1.00 22.24 ? 218 TRP C CD2 1 
ATOM   7316  N NE1 . TRP C  1 193 ? 21.543  104.732 73.375  1.00 20.86 ? 218 TRP C NE1 1 
ATOM   7317  C CE2 . TRP C  1 193 ? 20.560  105.683 73.428  1.00 21.46 ? 218 TRP C CE2 1 
ATOM   7318  C CE3 . TRP C  1 193 ? 18.176  105.818 73.073  1.00 23.69 ? 218 TRP C CE3 1 
ATOM   7319  C CZ2 . TRP C  1 193 ? 20.643  107.046 73.705  1.00 21.88 ? 218 TRP C CZ2 1 
ATOM   7320  C CZ3 . TRP C  1 193 ? 18.260  107.175 73.366  1.00 21.96 ? 218 TRP C CZ3 1 
ATOM   7321  C CH2 . TRP C  1 193 ? 19.476  107.772 73.670  1.00 22.17 ? 218 TRP C CH2 1 
ATOM   7322  N N   . GLU C  1 194 ? 20.042  101.250 75.291  1.00 23.05 ? 219 GLU C N   1 
ATOM   7323  C CA  . GLU C  1 194 ? 21.296  100.574 75.669  1.00 23.95 ? 219 GLU C CA  1 
ATOM   7324  C C   . GLU C  1 194 ? 21.136  99.114  76.102  1.00 24.62 ? 219 GLU C C   1 
ATOM   7325  O O   . GLU C  1 194 ? 20.109  98.714  76.635  1.00 23.28 ? 219 GLU C O   1 
ATOM   7326  C CB  . GLU C  1 194 ? 22.059  101.382 76.743  1.00 23.37 ? 219 GLU C CB  1 
ATOM   7327  C CG  . GLU C  1 194 ? 22.651  102.673 76.148  1.00 25.07 ? 219 GLU C CG  1 
ATOM   7328  C CD  . GLU C  1 194 ? 23.062  103.721 77.191  1.00 29.38 ? 219 GLU C CD  1 
ATOM   7329  O OE1 . GLU C  1 194 ? 22.229  104.154 78.022  1.00 34.42 ? 219 GLU C OE1 1 
ATOM   7330  O OE2 . GLU C  1 194 ? 24.206  104.165 77.160  1.00 28.97 ? 219 GLU C OE2 1 
ATOM   7331  N N   . LYS C  1 195 ? 22.177  98.331  75.851  1.00 25.30 ? 220 LYS C N   1 
ATOM   7332  C CA  . LYS C  1 195 ? 22.307  96.994  76.404  1.00 27.31 ? 220 LYS C CA  1 
ATOM   7333  C C   . LYS C  1 195 ? 23.685  96.936  77.086  1.00 27.22 ? 220 LYS C C   1 
ATOM   7334  O O   . LYS C  1 195 ? 24.696  97.200  76.445  1.00 27.70 ? 220 LYS C O   1 
ATOM   7335  C CB  . LYS C  1 195 ? 22.219  95.935  75.301  1.00 28.43 ? 220 LYS C CB  1 
ATOM   7336  C CG  . LYS C  1 195 ? 20.895  95.897  74.556  1.00 31.31 ? 220 LYS C CG  1 
ATOM   7337  C CD  . LYS C  1 195 ? 21.034  95.087  73.263  1.00 37.24 ? 220 LYS C CD  1 
ATOM   7338  C CE  . LYS C  1 195 ? 19.678  94.501  72.848  1.00 39.33 ? 220 LYS C CE  1 
ATOM   7339  N NZ  . LYS C  1 195 ? 18.578  95.393  73.299  1.00 40.62 ? 220 LYS C NZ  1 
ATOM   7340  N N   . PRO C  1 196 ? 23.733  96.596  78.382  1.00 26.75 ? 221 PRO C N   1 
ATOM   7341  C CA  . PRO C  1 196 ? 22.596  96.249  79.231  1.00 25.78 ? 221 PRO C CA  1 
ATOM   7342  C C   . PRO C  1 196 ? 21.733  97.472  79.444  1.00 23.50 ? 221 PRO C C   1 
ATOM   7343  O O   . PRO C  1 196 ? 22.200  98.593  79.242  1.00 21.34 ? 221 PRO C O   1 
ATOM   7344  C CB  . PRO C  1 196 ? 23.257  95.849  80.557  1.00 26.27 ? 221 PRO C CB  1 
ATOM   7345  C CG  . PRO C  1 196 ? 24.559  96.605  80.571  1.00 27.16 ? 221 PRO C CG  1 
ATOM   7346  C CD  . PRO C  1 196 ? 25.007  96.580  79.125  1.00 27.67 ? 221 PRO C CD  1 
ATOM   7347  N N   . LEU C  1 197 ? 20.473  97.265  79.822  1.00 22.49 ? 222 LEU C N   1 
ATOM   7348  C CA  . LEU C  1 197 ? 19.552  98.399  79.997  1.00 21.50 ? 222 LEU C CA  1 
ATOM   7349  C C   . LEU C  1 197 ? 19.682  98.921  81.427  1.00 20.05 ? 222 LEU C C   1 
ATOM   7350  O O   . LEU C  1 197 ? 19.171  98.322  82.385  1.00 19.55 ? 222 LEU C O   1 
ATOM   7351  C CB  . LEU C  1 197 ? 18.118  97.975  79.671  1.00 22.29 ? 222 LEU C CB  1 
ATOM   7352  C CG  . LEU C  1 197 ? 16.950  98.964  79.711  1.00 25.23 ? 222 LEU C CG  1 
ATOM   7353  C CD1 . LEU C  1 197 ? 17.320  100.391 79.405  1.00 25.35 ? 222 LEU C CD1 1 
ATOM   7354  C CD2 . LEU C  1 197 ? 15.843  98.446  78.760  1.00 27.73 ? 222 LEU C CD2 1 
ATOM   7355  N N   . ILE C  1 198 ? 20.423  100.016 81.555  1.00 18.62 ? 223 ILE C N   1 
ATOM   7356  C CA  . ILE C  1 198 ? 20.733  100.619 82.849  1.00 17.74 ? 223 ILE C CA  1 
ATOM   7357  C C   . ILE C  1 198 ? 20.547  102.139 82.768  1.00 17.07 ? 223 ILE C C   1 
ATOM   7358  O O   . ILE C  1 198 ? 20.631  102.728 81.680  1.00 16.22 ? 223 ILE C O   1 
ATOM   7359  C CB  . ILE C  1 198 ? 22.146  100.261 83.332  1.00 18.44 ? 223 ILE C CB  1 
ATOM   7360  C CG1 . ILE C  1 198 ? 23.224  100.849 82.408  1.00 19.12 ? 223 ILE C CG1 1 
ATOM   7361  C CG2 . ILE C  1 198 ? 22.308  98.734  83.417  1.00 17.78 ? 223 ILE C CG2 1 
ATOM   7362  C CD1 . ILE C  1 198 ? 24.682  100.476 82.830  1.00 19.67 ? 223 ILE C CD1 1 
ATOM   7363  N N   . THR C  1 199 ? 20.292  102.791 83.906  1.00 16.33 ? 224 THR C N   1 
ATOM   7364  C CA  . THR C  1 199 ? 20.116  104.238 83.869  1.00 15.16 ? 224 THR C CA  1 
ATOM   7365  C C   . THR C  1 199 ? 21.416  104.939 83.459  1.00 15.67 ? 224 THR C C   1 
ATOM   7366  O O   . THR C  1 199 ? 22.528  104.457 83.739  1.00 15.24 ? 224 THR C O   1 
ATOM   7367  C CB  . THR C  1 199 ? 19.581  104.797 85.225  1.00 15.84 ? 224 THR C CB  1 
ATOM   7368  O OG1 . THR C  1 199 ? 20.562  104.593 86.263  1.00 16.50 ? 224 THR C OG1 1 
ATOM   7369  C CG2 . THR C  1 199 ? 18.279  104.091 85.604  1.00 13.54 ? 224 THR C CG2 1 
ATOM   7370  N N   . GLY C  1 200 ? 21.264  106.098 82.828  1.00 14.80 ? 225 GLY C N   1 
ATOM   7371  C CA  . GLY C  1 200 ? 22.405  106.896 82.360  1.00 15.14 ? 225 GLY C CA  1 
ATOM   7372  C C   . GLY C  1 200 ? 21.862  108.271 82.028  1.00 14.64 ? 225 GLY C C   1 
ATOM   7373  O O   . GLY C  1 200 ? 20.690  108.399 81.656  1.00 14.02 ? 225 GLY C O   1 
ATOM   7374  N N   . HIS C  1 201 ? 22.680  109.307 82.177  1.00 14.20 ? 226 HIS C N   1 
ATOM   7375  C CA  . HIS C  1 201 ? 22.173  110.677 81.954  1.00 14.87 ? 226 HIS C CA  1 
ATOM   7376  C C   . HIS C  1 201 ? 22.180  111.030 80.461  1.00 14.89 ? 226 HIS C C   1 
ATOM   7377  O O   . HIS C  1 201 ? 23.160  110.792 79.773  1.00 15.33 ? 226 HIS C O   1 
ATOM   7378  C CB  . HIS C  1 201 ? 23.016  111.714 82.738  1.00 15.42 ? 226 HIS C CB  1 
ATOM   7379  C CG  . HIS C  1 201 ? 22.333  113.041 82.912  1.00 15.43 ? 226 HIS C CG  1 
ATOM   7380  N ND1 . HIS C  1 201 ? 22.249  113.973 81.898  1.00 14.92 ? 226 HIS C ND1 1 
ATOM   7381  C CD2 . HIS C  1 201 ? 21.666  113.570 83.967  1.00 13.63 ? 226 HIS C CD2 1 
ATOM   7382  C CE1 . HIS C  1 201 ? 21.560  115.022 82.324  1.00 13.59 ? 226 HIS C CE1 1 
ATOM   7383  N NE2 . HIS C  1 201 ? 21.206  114.806 83.580  1.00 14.36 ? 226 HIS C NE2 1 
ATOM   7384  N N   . ASN C  1 202 ? 21.096  111.639 79.983  1.00 14.92 ? 227 ASN C N   1 
ATOM   7385  C CA  . ASN C  1 202 ? 20.996  112.165 78.616  1.00 14.50 ? 227 ASN C CA  1 
ATOM   7386  C C   . ASN C  1 202 ? 22.212  112.987 78.144  1.00 15.07 ? 227 ASN C C   1 
ATOM   7387  O O   . ASN C  1 202 ? 22.650  112.867 76.988  1.00 14.50 ? 227 ASN C O   1 
ATOM   7388  C CB  . ASN C  1 202 ? 19.728  113.047 78.520  1.00 14.02 ? 227 ASN C CB  1 
ATOM   7389  C CG  . ASN C  1 202 ? 19.489  113.601 77.124  1.00 15.32 ? 227 ASN C CG  1 
ATOM   7390  O OD1 . ASN C  1 202 ? 19.683  112.905 76.133  1.00 15.83 ? 227 ASN C OD1 1 
ATOM   7391  N ND2 . ASN C  1 202 ? 19.014  114.862 77.046  1.00 14.20 ? 227 ASN C ND2 1 
ATOM   7392  N N   . SER C  1 203 ? 22.731  113.857 79.008  1.00 14.91 ? 228 SER C N   1 
ATOM   7393  C CA  . SER C  1 203 ? 23.741  114.812 78.562  1.00 15.72 ? 228 SER C CA  1 
ATOM   7394  C C   . SER C  1 203 ? 24.672  115.225 79.694  1.00 15.32 ? 228 SER C C   1 
ATOM   7395  O O   . SER C  1 203 ? 24.645  116.387 80.144  1.00 15.64 ? 228 SER C O   1 
ATOM   7396  C CB  . SER C  1 203 ? 23.038  116.061 77.966  1.00 15.50 ? 228 SER C CB  1 
ATOM   7397  O OG  . SER C  1 203 ? 23.986  116.901 77.334  1.00 17.89 ? 228 SER C OG  1 
ATOM   7398  N N   . PRO C  1 204 ? 25.492  114.281 80.174  1.00 15.27 ? 229 PRO C N   1 
ATOM   7399  C CA  . PRO C  1 204 ? 26.427  114.619 81.243  1.00 15.84 ? 229 PRO C CA  1 
ATOM   7400  C C   . PRO C  1 204 ? 27.546  115.527 80.705  1.00 16.90 ? 229 PRO C C   1 
ATOM   7401  O O   . PRO C  1 204 ? 28.071  115.273 79.612  1.00 16.60 ? 229 PRO C O   1 
ATOM   7402  C CB  . PRO C  1 204 ? 26.964  113.245 81.678  1.00 16.13 ? 229 PRO C CB  1 
ATOM   7403  C CG  . PRO C  1 204 ? 26.867  112.382 80.442  1.00 15.54 ? 229 PRO C CG  1 
ATOM   7404  C CD  . PRO C  1 204 ? 25.591  112.866 79.750  1.00 15.40 ? 229 PRO C CD  1 
ATOM   7405  N N   . LEU C  1 205 ? 27.904  116.583 81.437  1.00 17.11 ? 230 LEU C N   1 
ATOM   7406  C CA  . LEU C  1 205 ? 28.981  117.456 80.978  1.00 17.80 ? 230 LEU C CA  1 
ATOM   7407  C C   . LEU C  1 205 ? 30.304  116.691 80.991  1.00 18.93 ? 230 LEU C C   1 
ATOM   7408  O O   . LEU C  1 205 ? 31.117  116.771 80.053  1.00 19.10 ? 230 LEU C O   1 
ATOM   7409  C CB  . LEU C  1 205 ? 29.094  118.699 81.882  1.00 18.57 ? 230 LEU C CB  1 
ATOM   7410  C CG  . LEU C  1 205 ? 30.326  119.603 81.678  1.00 19.92 ? 230 LEU C CG  1 
ATOM   7411  C CD1 . LEU C  1 205 ? 30.377  120.113 80.238  1.00 19.01 ? 230 LEU C CD1 1 
ATOM   7412  C CD2 . LEU C  1 205 ? 30.345  120.795 82.658  1.00 19.56 ? 230 LEU C CD2 1 
ATOM   7413  N N   . SER C  1 206 ? 30.521  115.938 82.062  1.00 19.03 ? 231 SER C N   1 
ATOM   7414  C CA  . SER C  1 206 ? 31.820  115.300 82.258  1.00 20.57 ? 231 SER C CA  1 
ATOM   7415  C C   . SER C  1 206 ? 31.709  113.798 82.451  1.00 19.90 ? 231 SER C C   1 
ATOM   7416  O O   . SER C  1 206 ? 30.625  113.257 82.652  1.00 18.41 ? 231 SER C O   1 
ATOM   7417  C CB  . SER C  1 206 ? 32.532  115.919 83.465  1.00 21.49 ? 231 SER C CB  1 
ATOM   7418  O OG  . SER C  1 206 ? 32.644  117.318 83.294  1.00 24.86 ? 231 SER C OG  1 
ATOM   7419  N N   . LYS C  1 207 ? 32.858  113.147 82.385  1.00 20.72 ? 232 LYS C N   1 
ATOM   7420  C CA  . LYS C  1 207 ? 32.961  111.725 82.553  1.00 21.32 ? 232 LYS C CA  1 
ATOM   7421  C C   . LYS C  1 207 ? 32.513  111.379 83.964  1.00 21.01 ? 232 LYS C C   1 
ATOM   7422  O O   . LYS C  1 207 ? 32.907  112.058 84.909  1.00 21.22 ? 232 LYS C O   1 
ATOM   7423  C CB  . LYS C  1 207 ? 34.440  111.359 82.406  1.00 22.85 ? 232 LYS C CB  1 
ATOM   7424  C CG  . LYS C  1 207 ? 34.764  109.908 82.531  1.00 24.94 ? 232 LYS C CG  1 
ATOM   7425  C CD  . LYS C  1 207 ? 36.281  109.674 82.355  1.00 25.14 ? 232 LYS C CD  1 
ATOM   7426  C CE  . LYS C  1 207 ? 37.072  109.945 83.614  1.00 29.12 ? 232 LYS C CE  1 
ATOM   7427  N NZ  . LYS C  1 207 ? 36.824  108.920 84.689  1.00 29.28 ? 232 LYS C NZ  1 
ATOM   7428  N N   . GLY C  1 208 ? 31.744  110.304 84.110  1.00 20.24 ? 233 GLY C N   1 
ATOM   7429  C CA  . GLY C  1 208 ? 31.468  109.732 85.438  1.00 20.24 ? 233 GLY C CA  1 
ATOM   7430  C C   . GLY C  1 208 ? 32.748  109.186 86.061  1.00 21.45 ? 233 GLY C C   1 
ATOM   7431  O O   . GLY C  1 208 ? 33.650  108.715 85.346  1.00 21.27 ? 233 GLY C O   1 
ATOM   7432  N N   . TRP C  1 209 ? 32.838  109.255 87.386  1.00 21.47 ? 234 TRP C N   1 
ATOM   7433  C CA  . TRP C  1 209 ? 33.987  108.713 88.103  1.00 23.86 ? 234 TRP C CA  1 
ATOM   7434  C C   . TRP C  1 209 ? 34.239  107.239 87.766  1.00 25.69 ? 234 TRP C C   1 
ATOM   7435  O O   . TRP C  1 209 ? 35.371  106.822 87.639  1.00 26.46 ? 234 TRP C O   1 
ATOM   7436  C CB  . TRP C  1 209 ? 33.808  108.883 89.618  1.00 23.23 ? 234 TRP C CB  1 
ATOM   7437  C CG  . TRP C  1 209 ? 33.907  110.318 90.122  1.00 22.68 ? 234 TRP C CG  1 
ATOM   7438  C CD1 . TRP C  1 209 ? 34.619  111.347 89.559  1.00 21.88 ? 234 TRP C CD1 1 
ATOM   7439  C CD2 . TRP C  1 209 ? 33.310  110.848 91.313  1.00 22.14 ? 234 TRP C CD2 1 
ATOM   7440  N NE1 . TRP C  1 209 ? 34.481  112.491 90.316  1.00 23.03 ? 234 TRP C NE1 1 
ATOM   7441  C CE2 . TRP C  1 209 ? 33.679  112.214 91.395  1.00 22.26 ? 234 TRP C CE2 1 
ATOM   7442  C CE3 . TRP C  1 209 ? 32.467  110.309 92.298  1.00 21.80 ? 234 TRP C CE3 1 
ATOM   7443  C CZ2 . TRP C  1 209 ? 33.261  113.041 92.433  1.00 23.72 ? 234 TRP C CZ2 1 
ATOM   7444  C CZ3 . TRP C  1 209 ? 32.035  111.144 93.345  1.00 24.41 ? 234 TRP C CZ3 1 
ATOM   7445  C CH2 . TRP C  1 209 ? 32.439  112.491 93.406  1.00 24.93 ? 234 TRP C CH2 1 
ATOM   7446  N N   . GLN C  1 210 ? 33.174  106.466 87.615  1.00 28.19 ? 235 GLN C N   1 
ATOM   7447  C CA  . GLN C  1 210 ? 33.288  105.033 87.267  1.00 31.23 ? 235 GLN C CA  1 
ATOM   7448  C C   . GLN C  1 210 ? 33.741  104.810 85.808  1.00 31.87 ? 235 GLN C C   1 
ATOM   7449  O O   . GLN C  1 210 ? 34.450  103.837 85.507  1.00 34.07 ? 235 GLN C O   1 
ATOM   7450  C CB  . GLN C  1 210 ? 31.919  104.365 87.465  1.00 31.19 ? 235 GLN C CB  1 
ATOM   7451  C CG  . GLN C  1 210 ? 31.529  104.067 88.941  1.00 34.31 ? 235 GLN C CG  1 
ATOM   7452  C CD  . GLN C  1 210 ? 32.210  102.827 89.498  1.00 38.79 ? 235 GLN C CD  1 
ATOM   7453  O OE1 . GLN C  1 210 ? 33.418  102.817 89.734  1.00 41.74 ? 235 GLN C OE1 1 
ATOM   7454  N NE2 . GLN C  1 210 ? 31.433  101.771 89.716  1.00 40.00 ? 235 GLN C NE2 1 
ATOM   7455  N N   . ASP C  1 211 ? 33.348  105.719 84.913  1.00 31.57 ? 236 ASP C N   1 
ATOM   7456  C CA  . ASP C  1 211 ? 33.523  105.530 83.456  1.00 32.14 ? 236 ASP C CA  1 
ATOM   7457  C C   . ASP C  1 211 ? 34.951  105.302 83.038  1.00 33.68 ? 236 ASP C C   1 
ATOM   7458  O O   . ASP C  1 211 ? 35.826  106.121 83.322  1.00 34.56 ? 236 ASP C O   1 
ATOM   7459  C CB  . ASP C  1 211 ? 33.021  106.743 82.693  1.00 31.03 ? 236 ASP C CB  1 
ATOM   7460  C CG  . ASP C  1 211 ? 31.558  106.864 82.752  1.00 30.88 ? 236 ASP C CG  1 
ATOM   7461  O OD1 . ASP C  1 211 ? 30.963  105.876 83.223  1.00 34.38 ? 236 ASP C OD1 1 
ATOM   7462  O OD2 . ASP C  1 211 ? 31.001  107.911 82.346  1.00 29.95 ? 236 ASP C OD2 1 
ATOM   7463  N N   . ARG C  1 212 ? 35.191  104.184 82.362  1.00 34.83 ? 237 ARG C N   1 
ATOM   7464  C CA  . ARG C  1 212 ? 36.487  103.933 81.764  1.00 36.44 ? 237 ARG C CA  1 
ATOM   7465  C C   . ARG C  1 212 ? 36.288  103.335 80.383  1.00 36.33 ? 237 ARG C C   1 
ATOM   7466  O O   . ARG C  1 212 ? 35.170  102.956 80.019  1.00 35.61 ? 237 ARG C O   1 
ATOM   7467  C CB  . ARG C  1 212 ? 37.333  103.008 82.640  1.00 38.21 ? 237 ARG C CB  1 
ATOM   7468  C CG  . ARG C  1 212 ? 38.161  103.759 83.698  1.00 40.58 ? 237 ARG C CG  1 
ATOM   7469  C CD  . ARG C  1 212 ? 38.483  102.860 84.888  1.00 44.97 ? 237 ARG C CD  1 
ATOM   7470  N NE  . ARG C  1 212 ? 37.586  101.701 84.983  1.00 46.56 ? 237 ARG C NE  1 
ATOM   7471  C CZ  . ARG C  1 212 ? 37.796  100.531 84.371  1.00 47.89 ? 237 ARG C CZ  1 
ATOM   7472  N NH1 . ARG C  1 212 ? 38.870  100.349 83.607  1.00 49.35 ? 237 ARG C NH1 1 
ATOM   7473  N NH2 . ARG C  1 212 ? 36.929  99.537  84.519  1.00 47.63 ? 237 ARG C NH2 1 
ATOM   7474  N N   . GLY C  1 213 ? 37.370  103.270 79.614  1.00 37.15 ? 238 GLY C N   1 
ATOM   7475  C CA  . GLY C  1 213 ? 37.314  102.742 78.250  1.00 37.58 ? 238 GLY C CA  1 
ATOM   7476  C C   . GLY C  1 213 ? 36.365  103.547 77.390  1.00 36.23 ? 238 GLY C C   1 
ATOM   7477  O O   . GLY C  1 213 ? 36.292  104.764 77.524  1.00 36.12 ? 238 GLY C O   1 
ATOM   7478  N N   . PRO C  1 214 ? 35.629  102.868 76.498  1.00 35.67 ? 239 PRO C N   1 
ATOM   7479  C CA  . PRO C  1 214 ? 34.669  103.524 75.626  1.00 34.26 ? 239 PRO C CA  1 
ATOM   7480  C C   . PRO C  1 214 ? 33.617  104.337 76.381  1.00 32.89 ? 239 PRO C C   1 
ATOM   7481  O O   . PRO C  1 214 ? 33.154  105.355 75.881  1.00 31.23 ? 239 PRO C O   1 
ATOM   7482  C CB  . PRO C  1 214 ? 33.993  102.362 74.887  1.00 34.87 ? 239 PRO C CB  1 
ATOM   7483  C CG  . PRO C  1 214 ? 34.903  101.168 75.064  1.00 35.90 ? 239 PRO C CG  1 
ATOM   7484  C CD  . PRO C  1 214 ? 35.986  101.512 76.045  1.00 36.88 ? 239 PRO C CD  1 
ATOM   7485  N N   . SER C  1 215 ? 33.222  103.900 77.574  1.00 32.02 ? 240 SER C N   1 
ATOM   7486  C CA  . SER C  1 215 ? 32.165  104.640 78.268  1.00 30.13 ? 240 SER C CA  1 
ATOM   7487  C C   . SER C  1 215 ? 32.636  106.077 78.575  1.00 28.60 ? 240 SER C C   1 
ATOM   7488  O O   . SER C  1 215 ? 31.812  106.991 78.679  1.00 27.28 ? 240 SER C O   1 
ATOM   7489  C CB  . SER C  1 215 ? 31.708  103.891 79.532  1.00 30.51 ? 240 SER C CB  1 
ATOM   7490  O OG  . SER C  1 215 ? 32.828  103.473 80.291  1.00 33.71 ? 240 SER C OG  1 
ATOM   7491  N N   . SER C  1 216 ? 33.957  106.276 78.674  1.00 27.95 ? 241 SER C N   1 
ATOM   7492  C CA  . SER C  1 216 ? 34.525  107.595 79.006  1.00 27.14 ? 241 SER C CA  1 
ATOM   7493  C C   . SER C  1 216 ? 34.402  108.618 77.872  1.00 25.71 ? 241 SER C C   1 
ATOM   7494  O O   . SER C  1 216 ? 34.696  109.801 78.055  1.00 24.93 ? 241 SER C O   1 
ATOM   7495  C CB  . SER C  1 216 ? 35.984  107.470 79.450  1.00 29.00 ? 241 SER C CB  1 
ATOM   7496  O OG  . SER C  1 216 ? 36.851  107.353 78.335  1.00 31.66 ? 241 SER C OG  1 
ATOM   7497  N N   . TYR C  1 217 ? 33.960  108.166 76.703  1.00 23.92 ? 242 TYR C N   1 
ATOM   7498  C CA  . TYR C  1 217 ? 33.688  109.081 75.601  1.00 22.64 ? 242 TYR C CA  1 
ATOM   7499  C C   . TYR C  1 217 ? 32.297  109.718 75.665  1.00 20.74 ? 242 TYR C C   1 
ATOM   7500  O O   . TYR C  1 217 ? 32.025  110.643 74.913  1.00 19.18 ? 242 TYR C O   1 
ATOM   7501  C CB  . TYR C  1 217 ? 33.773  108.374 74.253  1.00 23.17 ? 242 TYR C CB  1 
ATOM   7502  C CG  . TYR C  1 217 ? 35.030  107.596 74.015  1.00 25.37 ? 242 TYR C CG  1 
ATOM   7503  C CD1 . TYR C  1 217 ? 36.234  107.959 74.609  1.00 27.53 ? 242 TYR C CD1 1 
ATOM   7504  C CD2 . TYR C  1 217 ? 35.017  106.504 73.162  1.00 27.74 ? 242 TYR C CD2 1 
ATOM   7505  C CE1 . TYR C  1 217 ? 37.395  107.227 74.363  1.00 30.04 ? 242 TYR C CE1 1 
ATOM   7506  C CE2 . TYR C  1 217 ? 36.152  105.769 72.925  1.00 29.34 ? 242 TYR C CE2 1 
ATOM   7507  C CZ  . TYR C  1 217 ? 37.333  106.131 73.515  1.00 30.89 ? 242 TYR C CZ  1 
ATOM   7508  O OH  . TYR C  1 217 ? 38.445  105.368 73.236  1.00 34.89 ? 242 TYR C OH  1 
ATOM   7509  N N   . TYR C  1 218 ? 31.402  109.198 76.506  1.00 19.91 ? 243 TYR C N   1 
ATOM   7510  C CA  . TYR C  1 218 ? 29.987  109.618 76.435  1.00 19.43 ? 243 TYR C CA  1 
ATOM   7511  C C   . TYR C  1 218 ? 29.646  110.807 77.328  1.00 19.04 ? 243 TYR C C   1 
ATOM   7512  O O   . TYR C  1 218 ? 28.854  110.688 78.271  1.00 18.56 ? 243 TYR C O   1 
ATOM   7513  C CB  . TYR C  1 218 ? 29.042  108.465 76.749  1.00 19.86 ? 243 TYR C CB  1 
ATOM   7514  C CG  . TYR C  1 218 ? 29.222  107.275 75.832  1.00 23.67 ? 243 TYR C CG  1 
ATOM   7515  C CD1 . TYR C  1 218 ? 29.758  107.425 74.554  1.00 27.27 ? 243 TYR C CD1 1 
ATOM   7516  C CD2 . TYR C  1 218 ? 28.854  106.005 76.245  1.00 27.81 ? 243 TYR C CD2 1 
ATOM   7517  C CE1 . TYR C  1 218 ? 29.920  106.304 73.704  1.00 30.50 ? 243 TYR C CE1 1 
ATOM   7518  C CE2 . TYR C  1 218 ? 29.009  104.892 75.413  1.00 31.18 ? 243 TYR C CE2 1 
ATOM   7519  C CZ  . TYR C  1 218 ? 29.537  105.044 74.159  1.00 31.26 ? 243 TYR C CZ  1 
ATOM   7520  O OH  . TYR C  1 218 ? 29.679  103.923 73.371  1.00 33.86 ? 243 TYR C OH  1 
ATOM   7521  N N   . ASN C  1 219 ? 30.249  111.949 77.027  1.00 18.71 ? 244 ASN C N   1 
ATOM   7522  C CA  . ASN C  1 219 ? 29.930  113.177 77.739  1.00 18.12 ? 244 ASN C CA  1 
ATOM   7523  C C   . ASN C  1 219 ? 30.291  114.363 76.863  1.00 18.22 ? 244 ASN C C   1 
ATOM   7524  O O   . ASN C  1 219 ? 31.063  114.238 75.890  1.00 17.54 ? 244 ASN C O   1 
ATOM   7525  C CB  . ASN C  1 219 ? 30.682  113.229 79.078  1.00 17.64 ? 244 ASN C CB  1 
ATOM   7526  C CG  . ASN C  1 219 ? 32.177  112.995 78.913  1.00 20.29 ? 244 ASN C CG  1 
ATOM   7527  O OD1 . ASN C  1 219 ? 32.675  111.880 79.086  1.00 25.38 ? 244 ASN C OD1 1 
ATOM   7528  N ND2 . ASN C  1 219 ? 32.888  114.027 78.555  1.00 18.18 ? 244 ASN C ND2 1 
ATOM   7529  N N   . VAL C  1 220 ? 29.735  115.517 77.216  1.00 18.13 ? 245 VAL C N   1 
ATOM   7530  C CA  . VAL C  1 220 ? 29.893  116.712 76.408  1.00 18.44 ? 245 VAL C CA  1 
ATOM   7531  C C   . VAL C  1 220 ? 31.365  117.102 76.263  1.00 19.69 ? 245 VAL C C   1 
ATOM   7532  O O   . VAL C  1 220 ? 31.841  117.431 75.167  1.00 19.98 ? 245 VAL C O   1 
ATOM   7533  C CB  . VAL C  1 220 ? 29.086  117.912 77.000  1.00 18.10 ? 245 VAL C CB  1 
ATOM   7534  C CG1 . VAL C  1 220 ? 29.296  119.116 76.127  1.00 17.24 ? 245 VAL C CG1 1 
ATOM   7535  C CG2 . VAL C  1 220 ? 27.572  117.559 77.120  1.00 14.88 ? 245 VAL C CG2 1 
ATOM   7536  N N   . GLU C  1 221 ? 32.100  117.077 77.364  1.00 20.96 ? 246 GLU C N   1 
ATOM   7537  C CA  . GLU C  1 221 ? 33.505  117.482 77.314  1.00 22.67 ? 246 GLU C CA  1 
ATOM   7538  C C   . GLU C  1 221 ? 34.299  116.708 76.294  1.00 22.67 ? 246 GLU C C   1 
ATOM   7539  O O   . GLU C  1 221 ? 35.080  117.287 75.534  1.00 23.14 ? 246 GLU C O   1 
ATOM   7540  C CB  . GLU C  1 221 ? 34.206  117.237 78.639  1.00 23.78 ? 246 GLU C CB  1 
ATOM   7541  C CG  . GLU C  1 221 ? 34.030  118.318 79.640  1.00 27.33 ? 246 GLU C CG  1 
ATOM   7542  C CD  . GLU C  1 221 ? 35.014  118.141 80.771  1.00 29.57 ? 246 GLU C CD  1 
ATOM   7543  O OE1 . GLU C  1 221 ? 36.185  118.513 80.586  1.00 30.77 ? 246 GLU C OE1 1 
ATOM   7544  O OE2 . GLU C  1 221 ? 34.618  117.575 81.807  1.00 28.77 ? 246 GLU C OE2 1 
ATOM   7545  N N   . TYR C  1 222 ? 34.167  115.384 76.334  1.00 22.01 ? 247 TYR C N   1 
ATOM   7546  C CA  . TYR C  1 222 ? 34.945  114.528 75.438  1.00 22.11 ? 247 TYR C CA  1 
ATOM   7547  C C   . TYR C  1 222 ? 34.552  114.774 73.984  1.00 21.14 ? 247 TYR C C   1 
ATOM   7548  O O   . TYR C  1 222 ? 35.422  114.896 73.101  1.00 21.55 ? 247 TYR C O   1 
ATOM   7549  C CB  . TYR C  1 222 ? 34.754  113.045 75.765  1.00 22.37 ? 247 TYR C CB  1 
ATOM   7550  C CG  . TYR C  1 222 ? 35.691  112.215 74.924  1.00 24.70 ? 247 TYR C CG  1 
ATOM   7551  C CD1 . TYR C  1 222 ? 35.367  111.881 73.608  1.00 23.79 ? 247 TYR C CD1 1 
ATOM   7552  C CD2 . TYR C  1 222 ? 36.931  111.824 75.418  1.00 25.25 ? 247 TYR C CD2 1 
ATOM   7553  C CE1 . TYR C  1 222 ? 36.260  111.152 72.820  1.00 25.87 ? 247 TYR C CE1 1 
ATOM   7554  C CE2 . TYR C  1 222 ? 37.819  111.092 74.642  1.00 27.80 ? 247 TYR C CE2 1 
ATOM   7555  C CZ  . TYR C  1 222 ? 37.472  110.758 73.342  1.00 28.00 ? 247 TYR C CZ  1 
ATOM   7556  O OH  . TYR C  1 222 ? 38.365  110.040 72.574  1.00 30.29 ? 247 TYR C OH  1 
ATOM   7557  N N   . ALA C  1 223 ? 33.249  114.842 73.726  1.00 19.72 ? 248 ALA C N   1 
ATOM   7558  C CA  . ALA C  1 223 ? 32.767  115.107 72.355  1.00 19.69 ? 248 ALA C CA  1 
ATOM   7559  C C   . ALA C  1 223 ? 33.306  116.426 71.814  1.00 19.91 ? 248 ALA C C   1 
ATOM   7560  O O   . ALA C  1 223 ? 33.764  116.487 70.679  1.00 20.87 ? 248 ALA C O   1 
ATOM   7561  C CB  . ALA C  1 223 ? 31.239  115.121 72.294  1.00 18.04 ? 248 ALA C CB  1 
ATOM   7562  N N   . VAL C  1 224 ? 33.248  117.484 72.615  1.00 19.96 ? 249 VAL C N   1 
ATOM   7563  C CA  . VAL C  1 224 ? 33.758  118.808 72.181  1.00 20.80 ? 249 VAL C CA  1 
ATOM   7564  C C   . VAL C  1 224 ? 35.271  118.723 71.908  1.00 22.13 ? 249 VAL C C   1 
ATOM   7565  O O   . VAL C  1 224 ? 35.786  119.222 70.893  1.00 23.05 ? 249 VAL C O   1 
ATOM   7566  C CB  . VAL C  1 224 ? 33.541  119.886 73.278  1.00 20.60 ? 249 VAL C CB  1 
ATOM   7567  C CG1 . VAL C  1 224 ? 34.451  121.088 73.032  1.00 22.19 ? 249 VAL C CG1 1 
ATOM   7568  C CG2 . VAL C  1 224 ? 32.055  120.316 73.387  1.00 19.48 ? 249 VAL C CG2 1 
ATOM   7569  N N   . GLY C  1 225 ? 35.991  118.104 72.842  1.00 23.02 ? 250 GLY C N   1 
ATOM   7570  C CA  . GLY C  1 225 ? 37.451  117.983 72.760  1.00 23.74 ? 250 GLY C CA  1 
ATOM   7571  C C   . GLY C  1 225 ? 37.846  117.173 71.523  1.00 24.42 ? 250 GLY C C   1 
ATOM   7572  O O   . GLY C  1 225 ? 38.822  117.503 70.822  1.00 24.13 ? 250 GLY C O   1 
ATOM   7573  N N   . TYR C  1 226 ? 37.079  116.121 71.249  1.00 22.95 ? 251 TYR C N   1 
ATOM   7574  C CA  . TYR C  1 226 ? 37.338  115.255 70.096  1.00 23.57 ? 251 TYR C CA  1 
ATOM   7575  C C   . TYR C  1 226 ? 37.147  115.961 68.748  1.00 23.56 ? 251 TYR C C   1 
ATOM   7576  O O   . TYR C  1 226 ? 37.971  115.810 67.843  1.00 24.46 ? 251 TYR C O   1 
ATOM   7577  C CB  . TYR C  1 226 ? 36.448  114.008 70.137  1.00 22.97 ? 251 TYR C CB  1 
ATOM   7578  C CG  . TYR C  1 226 ? 36.994  112.899 69.270  1.00 24.21 ? 251 TYR C CG  1 
ATOM   7579  C CD1 . TYR C  1 226 ? 38.245  112.350 69.543  1.00 26.56 ? 251 TYR C CD1 1 
ATOM   7580  C CD2 . TYR C  1 226 ? 36.284  112.413 68.165  1.00 24.86 ? 251 TYR C CD2 1 
ATOM   7581  C CE1 . TYR C  1 226 ? 38.775  111.332 68.753  1.00 27.07 ? 251 TYR C CE1 1 
ATOM   7582  C CE2 . TYR C  1 226 ? 36.804  111.383 67.385  1.00 24.90 ? 251 TYR C CE2 1 
ATOM   7583  C CZ  . TYR C  1 226 ? 38.059  110.860 67.683  1.00 26.16 ? 251 TYR C CZ  1 
ATOM   7584  O OH  . TYR C  1 226 ? 38.612  109.849 66.914  1.00 27.20 ? 251 TYR C OH  1 
ATOM   7585  N N   . TRP C  1 227 ? 36.058  116.720 68.597  1.00 22.58 ? 252 TRP C N   1 
ATOM   7586  C CA  . TRP C  1 227 ? 35.848  117.491 67.358  1.00 22.48 ? 252 TRP C CA  1 
ATOM   7587  C C   . TRP C  1 227 ? 36.969  118.510 67.114  1.00 23.87 ? 252 TRP C C   1 
ATOM   7588  O O   . TRP C  1 227 ? 37.449  118.680 65.985  1.00 24.26 ? 252 TRP C O   1 
ATOM   7589  C CB  . TRP C  1 227 ? 34.487  118.196 67.360  1.00 21.19 ? 252 TRP C CB  1 
ATOM   7590  C CG  . TRP C  1 227 ? 33.387  117.330 66.820  1.00 20.92 ? 252 TRP C CG  1 
ATOM   7591  C CD1 . TRP C  1 227 ? 32.522  116.539 67.536  1.00 20.13 ? 252 TRP C CD1 1 
ATOM   7592  C CD2 . TRP C  1 227 ? 33.041  117.167 65.442  1.00 20.16 ? 252 TRP C CD2 1 
ATOM   7593  N NE1 . TRP C  1 227 ? 31.669  115.879 66.665  1.00 20.00 ? 252 TRP C NE1 1 
ATOM   7594  C CE2 . TRP C  1 227 ? 31.985  116.245 65.378  1.00 19.94 ? 252 TRP C CE2 1 
ATOM   7595  C CE3 . TRP C  1 227 ? 33.545  117.709 64.244  1.00 22.83 ? 252 TRP C CE3 1 
ATOM   7596  C CZ2 . TRP C  1 227 ? 31.386  115.871 64.160  1.00 20.83 ? 252 TRP C CZ2 1 
ATOM   7597  C CZ3 . TRP C  1 227 ? 32.958  117.334 63.034  1.00 22.73 ? 252 TRP C CZ3 1 
ATOM   7598  C CH2 . TRP C  1 227 ? 31.891  116.419 63.004  1.00 21.71 ? 252 TRP C CH2 1 
ATOM   7599  N N   . ILE C  1 228 ? 37.386  119.198 68.167  1.00 24.20 ? 253 ILE C N   1 
ATOM   7600  C CA  . ILE C  1 228 ? 38.506  120.120 68.055  1.00 25.90 ? 253 ILE C CA  1 
ATOM   7601  C C   . ILE C  1 228 ? 39.789  119.358 67.686  1.00 28.13 ? 253 ILE C C   1 
ATOM   7602  O O   . ILE C  1 228 ? 40.529  119.740 66.766  1.00 27.48 ? 253 ILE C O   1 
ATOM   7603  C CB  . ILE C  1 228 ? 38.673  120.937 69.376  1.00 26.45 ? 253 ILE C CB  1 
ATOM   7604  C CG1 . ILE C  1 228 ? 37.463  121.872 69.571  1.00 24.36 ? 253 ILE C CG1 1 
ATOM   7605  C CG2 . ILE C  1 228 ? 40.006  121.731 69.408  1.00 28.31 ? 253 ILE C CG2 1 
ATOM   7606  C CD1 . ILE C  1 228 ? 37.451  122.590 70.896  1.00 25.00 ? 253 ILE C CD1 1 
ATOM   7607  N N   . HIS C  1 229 ? 40.039  118.263 68.403  1.00 28.85 ? 254 HIS C N   1 
ATOM   7608  C CA  . HIS C  1 229 ? 41.209  117.422 68.128  1.00 30.88 ? 254 HIS C CA  1 
ATOM   7609  C C   . HIS C  1 229 ? 41.243  116.956 66.668  1.00 31.33 ? 254 HIS C C   1 
ATOM   7610  O O   . HIS C  1 229 ? 42.306  116.894 66.061  1.00 33.00 ? 254 HIS C O   1 
ATOM   7611  C CB  . HIS C  1 229 ? 41.257  116.215 69.081  1.00 30.95 ? 254 HIS C CB  1 
ATOM   7612  C CG  . HIS C  1 229 ? 42.252  115.167 68.674  1.00 34.50 ? 254 HIS C CG  1 
ATOM   7613  N ND1 . HIS C  1 229 ? 43.618  115.355 68.768  1.00 36.78 ? 254 HIS C ND1 1 
ATOM   7614  C CD2 . HIS C  1 229 ? 42.078  113.936 68.130  1.00 35.63 ? 254 HIS C CD2 1 
ATOM   7615  C CE1 . HIS C  1 229 ? 44.239  114.281 68.314  1.00 38.75 ? 254 HIS C CE1 1 
ATOM   7616  N NE2 . HIS C  1 229 ? 43.329  113.407 67.919  1.00 38.53 ? 254 HIS C NE2 1 
ATOM   7617  N N   . LYS C  1 230 ? 40.084  116.646 66.096  1.00 30.38 ? 255 LYS C N   1 
ATOM   7618  C CA  . LYS C  1 230 ? 40.023  116.193 64.701  1.00 30.72 ? 255 LYS C CA  1 
ATOM   7619  C C   . LYS C  1 230 ? 40.107  117.338 63.690  1.00 30.97 ? 255 LYS C C   1 
ATOM   7620  O O   . LYS C  1 230 ? 40.239  117.107 62.491  1.00 31.14 ? 255 LYS C O   1 
ATOM   7621  C CB  . LYS C  1 230 ? 38.768  115.353 64.465  1.00 29.27 ? 255 LYS C CB  1 
ATOM   7622  C CG  . LYS C  1 230 ? 38.720  114.111 65.333  1.00 30.56 ? 255 LYS C CG  1 
ATOM   7623  C CD  . LYS C  1 230 ? 39.301  112.887 64.607  1.00 35.71 ? 255 LYS C CD  1 
ATOM   7624  C CE  . LYS C  1 230 ? 38.333  112.421 63.514  1.00 35.73 ? 255 LYS C CE  1 
ATOM   7625  N NZ  . LYS C  1 230 ? 38.633  111.070 62.953  1.00 36.39 ? 255 LYS C NZ  1 
ATOM   7626  N N   . GLY C  1 231 ? 40.018  118.574 64.170  1.00 30.53 ? 256 GLY C N   1 
ATOM   7627  C CA  . GLY C  1 231 ? 40.364  119.706 63.332  1.00 31.26 ? 256 GLY C CA  1 
ATOM   7628  C C   . GLY C  1 231 ? 39.280  120.725 63.082  1.00 30.38 ? 256 GLY C C   1 
ATOM   7629  O O   . GLY C  1 231 ? 39.414  121.570 62.196  1.00 30.92 ? 256 GLY C O   1 
ATOM   7630  N N   . MET C  1 232 ? 38.197  120.651 63.848  1.00 28.97 ? 257 MET C N   1 
ATOM   7631  C CA  . MET C  1 232 ? 37.176  121.700 63.821  1.00 28.22 ? 257 MET C CA  1 
ATOM   7632  C C   . MET C  1 232 ? 37.665  122.840 64.727  1.00 28.95 ? 257 MET C C   1 
ATOM   7633  O O   . MET C  1 232 ? 37.970  122.615 65.911  1.00 28.73 ? 257 MET C O   1 
ATOM   7634  C CB  . MET C  1 232 ? 35.831  121.133 64.306  1.00 26.70 ? 257 MET C CB  1 
ATOM   7635  C CG  . MET C  1 232 ? 34.637  122.082 64.240  1.00 26.29 ? 257 MET C CG  1 
ATOM   7636  S SD  . MET C  1 232 ? 34.330  122.645 62.547  1.00 29.28 ? 257 MET C SD  1 
ATOM   7637  C CE  . MET C  1 232 ? 33.998  121.081 61.734  1.00 26.83 ? 257 MET C CE  1 
ATOM   7638  N N   . PRO C  1 233 ? 37.786  124.058 64.175  1.00 29.33 ? 258 PRO C N   1 
ATOM   7639  C CA  . PRO C  1 233 ? 38.197  125.177 65.027  1.00 30.31 ? 258 PRO C CA  1 
ATOM   7640  C C   . PRO C  1 233 ? 37.213  125.327 66.176  1.00 28.36 ? 258 PRO C C   1 
ATOM   7641  O O   . PRO C  1 233 ? 36.029  125.138 65.980  1.00 27.43 ? 258 PRO C O   1 
ATOM   7642  C CB  . PRO C  1 233 ? 38.113  126.399 64.104  1.00 31.31 ? 258 PRO C CB  1 
ATOM   7643  C CG  . PRO C  1 233 ? 37.848  125.894 62.718  1.00 31.33 ? 258 PRO C CG  1 
ATOM   7644  C CD  . PRO C  1 233 ? 37.726  124.397 62.742  1.00 30.25 ? 258 PRO C CD  1 
ATOM   7645  N N   . SER C  1 234 ? 37.678  125.693 67.365  1.00 28.64 ? 259 SER C N   1 
ATOM   7646  C CA  . SER C  1 234 ? 36.765  125.720 68.519  1.00 27.43 ? 259 SER C CA  1 
ATOM   7647  C C   . SER C  1 234 ? 35.608  126.700 68.295  1.00 27.11 ? 259 SER C C   1 
ATOM   7648  O O   . SER C  1 234 ? 34.480  126.459 68.737  1.00 24.79 ? 259 SER C O   1 
ATOM   7649  C CB  . SER C  1 234 ? 37.522  126.064 69.813  1.00 28.54 ? 259 SER C CB  1 
ATOM   7650  O OG  . SER C  1 234 ? 37.907  127.431 69.820  1.00 29.50 ? 259 SER C OG  1 
ATOM   7651  N N   . GLU C  1 235 ? 35.882  127.808 67.607  1.00 28.27 ? 260 GLU C N   1 
ATOM   7652  C CA  . GLU C  1 235 ? 34.848  128.811 67.413  1.00 29.03 ? 260 GLU C CA  1 
ATOM   7653  C C   . GLU C  1 235 ? 33.773  128.361 66.437  1.00 27.72 ? 260 GLU C C   1 
ATOM   7654  O O   . GLU C  1 235 ? 32.741  129.015 66.315  1.00 27.73 ? 260 GLU C O   1 
ATOM   7655  C CB  . GLU C  1 235 ? 35.430  130.154 66.972  1.00 31.03 ? 260 GLU C CB  1 
ATOM   7656  C CG  . GLU C  1 235 ? 36.069  130.113 65.616  1.00 34.30 ? 260 GLU C CG  1 
ATOM   7657  C CD  . GLU C  1 235 ? 37.537  129.745 65.706  1.00 39.56 ? 260 GLU C CD  1 
ATOM   7658  O OE1 . GLU C  1 235 ? 37.948  129.204 66.766  1.00 39.02 ? 260 GLU C OE1 1 
ATOM   7659  O OE2 . GLU C  1 235 ? 38.277  130.030 64.727  1.00 40.90 ? 260 GLU C OE2 1 
ATOM   7660  N N   . LYS C  1 236 ? 33.998  127.244 65.752  1.00 27.15 ? 261 LYS C N   1 
ATOM   7661  C CA  . LYS C  1 236 ? 32.974  126.697 64.854  1.00 25.53 ? 261 LYS C CA  1 
ATOM   7662  C C   . LYS C  1 236 ? 32.150  125.585 65.519  1.00 24.14 ? 261 LYS C C   1 
ATOM   7663  O O   . LYS C  1 236 ? 31.257  125.009 64.896  1.00 22.54 ? 261 LYS C O   1 
ATOM   7664  C CB  . LYS C  1 236 ? 33.597  126.172 63.548  1.00 26.08 ? 261 LYS C CB  1 
ATOM   7665  C CG  . LYS C  1 236 ? 34.098  127.267 62.572  1.00 27.45 ? 261 LYS C CG  1 
ATOM   7666  C CD  . LYS C  1 236 ? 34.166  126.714 61.141  1.00 27.10 ? 261 LYS C CD  1 
ATOM   7667  C CE  . LYS C  1 236 ? 34.555  127.794 60.124  1.00 29.31 ? 261 LYS C CE  1 
ATOM   7668  N NZ  . LYS C  1 236 ? 34.428  127.257 58.738  1.00 26.75 ? 261 LYS C NZ  1 
ATOM   7669  N N   . VAL C  1 237 ? 32.457  125.271 66.773  1.00 23.44 ? 262 VAL C N   1 
ATOM   7670  C CA  . VAL C  1 237 ? 31.650  124.295 67.519  1.00 22.05 ? 262 VAL C CA  1 
ATOM   7671  C C   . VAL C  1 237 ? 30.583  125.038 68.301  1.00 21.74 ? 262 VAL C C   1 
ATOM   7672  O O   . VAL C  1 237 ? 30.897  125.838 69.168  1.00 22.58 ? 262 VAL C O   1 
ATOM   7673  C CB  . VAL C  1 237 ? 32.487  123.500 68.538  1.00 22.95 ? 262 VAL C CB  1 
ATOM   7674  C CG1 . VAL C  1 237 ? 31.595  122.475 69.276  1.00 21.36 ? 262 VAL C CG1 1 
ATOM   7675  C CG2 . VAL C  1 237 ? 33.680  122.828 67.846  1.00 22.03 ? 262 VAL C CG2 1 
ATOM   7676  N N   . VAL C  1 238 ? 29.329  124.796 67.969  1.00 20.89 ? 263 VAL C N   1 
ATOM   7677  C CA  . VAL C  1 238 ? 28.220  125.354 68.708  1.00 20.69 ? 263 VAL C CA  1 
ATOM   7678  C C   . VAL C  1 238 ? 27.671  124.178 69.490  1.00 19.64 ? 263 VAL C C   1 
ATOM   7679  O O   . VAL C  1 238 ? 27.169  123.204 68.921  1.00 19.00 ? 263 VAL C O   1 
ATOM   7680  C CB  . VAL C  1 238 ? 27.167  126.008 67.785  1.00 20.79 ? 263 VAL C CB  1 
ATOM   7681  C CG1 . VAL C  1 238 ? 25.973  126.587 68.624  1.00 20.36 ? 263 VAL C CG1 1 
ATOM   7682  C CG2 . VAL C  1 238 ? 27.856  127.117 66.950  1.00 21.68 ? 263 VAL C CG2 1 
ATOM   7683  N N   . MET C  1 239 ? 27.824  124.263 70.811  1.00 19.72 ? 264 MET C N   1 
ATOM   7684  C CA  . MET C  1 239 ? 27.646  123.096 71.670  1.00 18.71 ? 264 MET C CA  1 
ATOM   7685  C C   . MET C  1 239 ? 26.177  122.878 71.987  1.00 18.03 ? 264 MET C C   1 
ATOM   7686  O O   . MET C  1 239 ? 25.538  123.749 72.559  1.00 17.50 ? 264 MET C O   1 
ATOM   7687  C CB  . MET C  1 239 ? 28.481  123.296 72.951  1.00 19.35 ? 264 MET C CB  1 
ATOM   7688  C CG  . MET C  1 239 ? 28.471  122.135 73.954  1.00 19.04 ? 264 MET C CG  1 
ATOM   7689  S SD  . MET C  1 239 ? 29.226  122.650 75.527  1.00 22.34 ? 264 MET C SD  1 
ATOM   7690  C CE  . MET C  1 239 ? 27.817  123.216 76.462  1.00 21.47 ? 264 MET C CE  1 
ATOM   7691  N N   . GLY C  1 240 ? 25.651  121.704 71.626  1.00 17.55 ? 265 GLY C N   1 
ATOM   7692  C CA  . GLY C  1 240 ? 24.256  121.347 71.895  1.00 17.42 ? 265 GLY C CA  1 
ATOM   7693  C C   . GLY C  1 240 ? 23.888  121.148 73.364  1.00 17.16 ? 265 GLY C C   1 
ATOM   7694  O O   . GLY C  1 240 ? 24.633  120.546 74.127  1.00 17.64 ? 265 GLY C O   1 
ATOM   7695  N N   . ILE C  1 241 ? 22.714  121.645 73.736  1.00 16.79 ? 266 ILE C N   1 
ATOM   7696  C CA  . ILE C  1 241 ? 22.162  121.519 75.084  1.00 16.66 ? 266 ILE C CA  1 
ATOM   7697  C C   . ILE C  1 241 ? 20.685  121.130 74.943  1.00 16.60 ? 266 ILE C C   1 
ATOM   7698  O O   . ILE C  1 241 ? 19.938  121.801 74.221  1.00 17.14 ? 266 ILE C O   1 
ATOM   7699  C CB  . ILE C  1 241 ? 22.270  122.865 75.855  1.00 17.21 ? 266 ILE C CB  1 
ATOM   7700  C CG1 . ILE C  1 241 ? 23.723  123.378 75.895  1.00 17.31 ? 266 ILE C CG1 1 
ATOM   7701  C CG2 . ILE C  1 241 ? 21.731  122.747 77.267  1.00 17.94 ? 266 ILE C CG2 1 
ATOM   7702  C CD1 . ILE C  1 241 ? 23.873  124.731 76.708  1.00 18.31 ? 266 ILE C CD1 1 
ATOM   7703  N N   . PRO C  1 242 ? 20.258  120.050 75.620  1.00 16.10 ? 267 PRO C N   1 
ATOM   7704  C CA  . PRO C  1 242 ? 18.888  119.564 75.502  1.00 16.09 ? 267 PRO C CA  1 
ATOM   7705  C C   . PRO C  1 242 ? 17.919  120.226 76.479  1.00 17.05 ? 267 PRO C C   1 
ATOM   7706  O O   . PRO C  1 242 ? 18.280  120.525 77.611  1.00 17.16 ? 267 PRO C O   1 
ATOM   7707  C CB  . PRO C  1 242 ? 19.027  118.078 75.852  1.00 15.43 ? 267 PRO C CB  1 
ATOM   7708  C CG  . PRO C  1 242 ? 20.125  118.091 76.936  1.00 15.96 ? 267 PRO C CG  1 
ATOM   7709  C CD  . PRO C  1 242 ? 21.102  119.162 76.458  1.00 15.92 ? 267 PRO C CD  1 
ATOM   7710  N N   . THR C  1 243 ? 16.681  120.433 76.044  1.00 17.40 ? 268 THR C N   1 
ATOM   7711  C CA  . THR C  1 243 ? 15.648  120.905 76.954  1.00 17.83 ? 268 THR C CA  1 
ATOM   7712  C C   . THR C  1 243 ? 14.726  119.738 77.334  1.00 18.78 ? 268 THR C C   1 
ATOM   7713  O O   . THR C  1 243 ? 13.611  119.959 77.777  1.00 21.50 ? 268 THR C O   1 
ATOM   7714  C CB  . THR C  1 243 ? 14.772  121.992 76.302  1.00 18.39 ? 268 THR C CB  1 
ATOM   7715  O OG1 . THR C  1 243 ? 14.259  121.502 75.059  1.00 17.12 ? 268 THR C OG1 1 
ATOM   7716  C CG2 . THR C  1 243 ? 15.561  123.294 76.072  1.00 17.74 ? 268 THR C CG2 1 
ATOM   7717  N N   . TYR C  1 244 ? 15.152  118.504 77.086  1.00 17.25 ? 269 TYR C N   1 
ATOM   7718  C CA  . TYR C  1 244 ? 14.348  117.319 77.423  1.00 16.73 ? 269 TYR C CA  1 
ATOM   7719  C C   . TYR C  1 244 ? 15.271  116.399 78.237  1.00 16.68 ? 269 TYR C C   1 
ATOM   7720  O O   . TYR C  1 244 ? 16.476  116.642 78.300  1.00 16.11 ? 269 TYR C O   1 
ATOM   7721  C CB  . TYR C  1 244 ? 13.879  116.610 76.141  1.00 16.07 ? 269 TYR C CB  1 
ATOM   7722  C CG  . TYR C  1 244 ? 15.048  116.027 75.349  1.00 15.98 ? 269 TYR C CG  1 
ATOM   7723  C CD1 . TYR C  1 244 ? 15.828  116.839 74.521  1.00 15.54 ? 269 TYR C CD1 1 
ATOM   7724  C CD2 . TYR C  1 244 ? 15.393  114.685 75.459  1.00 15.43 ? 269 TYR C CD2 1 
ATOM   7725  C CE1 . TYR C  1 244 ? 16.931  116.322 73.807  1.00 15.79 ? 269 TYR C CE1 1 
ATOM   7726  C CE2 . TYR C  1 244 ? 16.508  114.160 74.758  1.00 16.03 ? 269 TYR C CE2 1 
ATOM   7727  C CZ  . TYR C  1 244 ? 17.266  114.993 73.940  1.00 15.59 ? 269 TYR C CZ  1 
ATOM   7728  O OH  . TYR C  1 244 ? 18.348  114.490 73.241  1.00 15.41 ? 269 TYR C OH  1 
ATOM   7729  N N   . GLY C  1 245 ? 14.716  115.369 78.874  1.00 16.46 ? 270 GLY C N   1 
ATOM   7730  C CA  . GLY C  1 245 ? 15.540  114.406 79.604  1.00 16.19 ? 270 GLY C CA  1 
ATOM   7731  C C   . GLY C  1 245 ? 15.164  113.000 79.159  1.00 15.62 ? 270 GLY C C   1 
ATOM   7732  O O   . GLY C  1 245 ? 14.113  112.808 78.548  1.00 15.65 ? 270 GLY C O   1 
ATOM   7733  N N   . HIS C  1 246 ? 16.013  112.010 79.431  1.00 14.56 ? 271 HIS C N   1 
ATOM   7734  C CA  . HIS C  1 246 ? 15.628  110.629 79.135  1.00 15.02 ? 271 HIS C CA  1 
ATOM   7735  C C   . HIS C  1 246 ? 15.198  109.943 80.417  1.00 14.94 ? 271 HIS C C   1 
ATOM   7736  O O   . HIS C  1 246 ? 15.817  110.119 81.468  1.00 15.66 ? 271 HIS C O   1 
ATOM   7737  C CB  . HIS C  1 246 ? 16.746  109.815 78.444  1.00 15.27 ? 271 HIS C CB  1 
ATOM   7738  C CG  . HIS C  1 246 ? 16.853  110.058 76.976  1.00 16.13 ? 271 HIS C CG  1 
ATOM   7739  N ND1 . HIS C  1 246 ? 15.777  109.933 76.114  1.00 17.58 ? 271 HIS C ND1 1 
ATOM   7740  C CD2 . HIS C  1 246 ? 17.909  110.424 76.211  1.00 16.41 ? 271 HIS C CD2 1 
ATOM   7741  C CE1 . HIS C  1 246 ? 16.166  110.231 74.886  1.00 17.20 ? 271 HIS C CE1 1 
ATOM   7742  N NE2 . HIS C  1 246 ? 17.456  110.518 74.915  1.00 17.48 ? 271 HIS C NE2 1 
ATOM   7743  N N   . SER C  1 247 ? 14.127  109.162 80.316  1.00 15.30 ? 272 SER C N   1 
ATOM   7744  C CA  . SER C  1 247 ? 13.539  108.502 81.469  1.00 15.24 ? 272 SER C CA  1 
ATOM   7745  C C   . SER C  1 247 ? 13.716  106.984 81.375  1.00 15.29 ? 272 SER C C   1 
ATOM   7746  O O   . SER C  1 247 ? 13.799  106.412 80.277  1.00 14.75 ? 272 SER C O   1 
ATOM   7747  C CB  . SER C  1 247 ? 12.045  108.826 81.496  1.00 14.90 ? 272 SER C CB  1 
ATOM   7748  O OG  . SER C  1 247 ? 11.459  108.412 80.278  1.00 14.63 ? 272 SER C OG  1 
ATOM   7749  N N   . PHE C  1 248 ? 13.732  106.340 82.542  1.00 16.28 ? 273 PHE C N   1 
ATOM   7750  C CA  . PHE C  1 248 ? 13.833  104.889 82.645  1.00 15.90 ? 273 PHE C CA  1 
ATOM   7751  C C   . PHE C  1 248 ? 12.832  104.420 83.676  1.00 16.75 ? 273 PHE C C   1 
ATOM   7752  O O   . PHE C  1 248 ? 12.572  105.125 84.649  1.00 17.20 ? 273 PHE C O   1 
ATOM   7753  C CB  . PHE C  1 248 ? 15.215  104.481 83.158  1.00 16.57 ? 273 PHE C CB  1 
ATOM   7754  C CG  . PHE C  1 248 ? 16.343  104.872 82.247  1.00 16.46 ? 273 PHE C CG  1 
ATOM   7755  C CD1 . PHE C  1 248 ? 16.848  106.155 82.270  1.00 16.88 ? 273 PHE C CD1 1 
ATOM   7756  C CD2 . PHE C  1 248 ? 16.878  103.948 81.365  1.00 15.87 ? 273 PHE C CD2 1 
ATOM   7757  C CE1 . PHE C  1 248 ? 17.891  106.518 81.421  1.00 17.94 ? 273 PHE C CE1 1 
ATOM   7758  C CE2 . PHE C  1 248 ? 17.915  104.308 80.495  1.00 17.84 ? 273 PHE C CE2 1 
ATOM   7759  C CZ  . PHE C  1 248 ? 18.424  105.588 80.537  1.00 16.57 ? 273 PHE C CZ  1 
ATOM   7760  N N   . THR C  1 249 ? 12.272  103.235 83.463  1.00 16.58 ? 274 THR C N   1 
ATOM   7761  C CA  . THR C  1 249 ? 11.585  102.530 84.534  1.00 17.40 ? 274 THR C CA  1 
ATOM   7762  C C   . THR C  1 249 ? 12.600  101.634 85.260  1.00 17.23 ? 274 THR C C   1 
ATOM   7763  O O   . THR C  1 249 ? 13.279  100.808 84.631  1.00 17.30 ? 274 THR C O   1 
ATOM   7764  C CB  . THR C  1 249 ? 10.409  101.724 84.004  1.00 17.62 ? 274 THR C CB  1 
ATOM   7765  O OG1 . THR C  1 249 ? 9.508   102.616 83.321  1.00 18.45 ? 274 THR C OG1 1 
ATOM   7766  C CG2 . THR C  1 249 ? 9.692   101.067 85.162  1.00 20.48 ? 274 THR C CG2 1 
ATOM   7767  N N   . LEU C  1 250 ? 12.727  101.831 86.568  1.00 17.19 ? 275 LEU C N   1 
ATOM   7768  C CA  . LEU C  1 250 ? 13.672  101.057 87.368  1.00 17.53 ? 275 LEU C CA  1 
ATOM   7769  C C   . LEU C  1 250 ? 13.219  99.612  87.549  1.00 18.57 ? 275 LEU C C   1 
ATOM   7770  O O   . LEU C  1 250 ? 12.032  99.347  87.745  1.00 18.34 ? 275 LEU C O   1 
ATOM   7771  C CB  . LEU C  1 250 ? 13.912  101.718 88.724  1.00 18.10 ? 275 LEU C CB  1 
ATOM   7772  C CG  . LEU C  1 250 ? 14.497  103.133 88.666  1.00 16.70 ? 275 LEU C CG  1 
ATOM   7773  C CD1 . LEU C  1 250 ? 14.435  103.753 90.048  1.00 17.55 ? 275 LEU C CD1 1 
ATOM   7774  C CD2 . LEU C  1 250 ? 15.923  103.061 88.171  1.00 16.67 ? 275 LEU C CD2 1 
ATOM   7775  N N   . ALA C  1 251 ? 14.180  98.681  87.499  1.00 19.06 ? 276 ALA C N   1 
ATOM   7776  C CA  . ALA C  1 251 ? 13.889  97.255  87.655  1.00 19.68 ? 276 ALA C CA  1 
ATOM   7777  C C   . ALA C  1 251 ? 14.068  96.724  89.101  1.00 20.47 ? 276 ALA C C   1 
ATOM   7778  O O   . ALA C  1 251 ? 13.794  95.554  89.384  1.00 20.98 ? 276 ALA C O   1 
ATOM   7779  C CB  . ALA C  1 251 ? 14.746  96.463  86.675  1.00 19.91 ? 276 ALA C CB  1 
ATOM   7780  N N   . SER C  1 252 ? 14.560  97.573  90.004  1.00 20.12 ? 277 SER C N   1 
ATOM   7781  C CA  . SER C  1 252 ? 14.815  97.161  91.385  1.00 21.19 ? 277 SER C CA  1 
ATOM   7782  C C   . SER C  1 252 ? 14.744  98.394  92.286  1.00 21.42 ? 277 SER C C   1 
ATOM   7783  O O   . SER C  1 252 ? 14.399  99.478  91.813  1.00 21.37 ? 277 SER C O   1 
ATOM   7784  C CB  . SER C  1 252 ? 16.192  96.482  91.514  1.00 21.15 ? 277 SER C CB  1 
ATOM   7785  O OG  . SER C  1 252 ? 17.248  97.439  91.442  1.00 19.84 ? 277 SER C OG  1 
ATOM   7786  N N   . ALA C  1 253 ? 15.076  98.241  93.569  1.00 22.42 ? 278 ALA C N   1 
ATOM   7787  C CA  . ALA C  1 253 ? 15.144  99.398  94.482  1.00 22.26 ? 278 ALA C CA  1 
ATOM   7788  C C   . ALA C  1 253 ? 16.336  100.328 94.195  1.00 22.02 ? 278 ALA C C   1 
ATOM   7789  O O   . ALA C  1 253 ? 16.364  101.461 94.686  1.00 21.82 ? 278 ALA C O   1 
ATOM   7790  C CB  . ALA C  1 253 ? 15.172  98.941  95.982  1.00 23.25 ? 278 ALA C CB  1 
ATOM   7791  N N   . GLU C  1 254 ? 17.319  99.863  93.415  1.00 21.15 ? 279 GLU C N   1 
ATOM   7792  C CA  . GLU C  1 254 ? 18.489  100.687 93.085  1.00 20.94 ? 279 GLU C CA  1 
ATOM   7793  C C   . GLU C  1 254 ? 18.115  101.905 92.234  1.00 19.95 ? 279 GLU C C   1 
ATOM   7794  O O   . GLU C  1 254 ? 17.394  101.782 91.244  1.00 19.33 ? 279 GLU C O   1 
ATOM   7795  C CB  . GLU C  1 254 ? 19.578  99.862  92.349  1.00 21.65 ? 279 GLU C CB  1 
ATOM   7796  C CG  . GLU C  1 254 ? 20.263  98.796  93.183  1.00 24.88 ? 279 GLU C CG  1 
ATOM   7797  C CD  . GLU C  1 254 ? 21.622  98.385  92.569  1.00 30.25 ? 279 GLU C CD  1 
ATOM   7798  O OE1 . GLU C  1 254 ? 22.620  99.131  92.746  1.00 30.67 ? 279 GLU C OE1 1 
ATOM   7799  O OE2 . GLU C  1 254 ? 21.683  97.333  91.896  1.00 30.00 ? 279 GLU C OE2 1 
ATOM   7800  N N   . THR C  1 255 ? 18.626  103.074 92.615  1.00 19.48 ? 280 THR C N   1 
ATOM   7801  C CA  . THR C  1 255 ? 18.182  104.330 92.019  1.00 19.48 ? 280 THR C CA  1 
ATOM   7802  C C   . THR C  1 255 ? 19.352  105.173 91.511  1.00 19.05 ? 280 THR C C   1 
ATOM   7803  O O   . THR C  1 255 ? 19.149  106.298 91.085  1.00 18.97 ? 280 THR C O   1 
ATOM   7804  C CB  . THR C  1 255 ? 17.430  105.203 93.061  1.00 19.49 ? 280 THR C CB  1 
ATOM   7805  O OG1 . THR C  1 255 ? 18.314  105.474 94.156  1.00 19.13 ? 280 THR C OG1 1 
ATOM   7806  C CG2 . THR C  1 255 ? 16.144  104.479 93.607  1.00 20.85 ? 280 THR C CG2 1 
ATOM   7807  N N   . THR C  1 256 ? 20.562  104.629 91.566  1.00 19.67 ? 281 THR C N   1 
ATOM   7808  C CA  . THR C  1 256 ? 21.765  105.364 91.158  1.00 19.50 ? 281 THR C CA  1 
ATOM   7809  C C   . THR C  1 256 ? 21.978  105.352 89.634  1.00 19.17 ? 281 THR C C   1 
ATOM   7810  O O   . THR C  1 256 ? 21.229  104.721 88.901  1.00 18.94 ? 281 THR C O   1 
ATOM   7811  C CB  . THR C  1 256 ? 23.016  104.797 91.845  1.00 21.14 ? 281 THR C CB  1 
ATOM   7812  O OG1 . THR C  1 256 ? 23.018  103.358 91.737  1.00 22.37 ? 281 THR C OG1 1 
ATOM   7813  C CG2 . THR C  1 256 ? 23.012  105.184 93.311  1.00 21.69 ? 281 THR C CG2 1 
ATOM   7814  N N   . VAL C  1 257 ? 22.974  106.096 89.162  1.00 18.64 ? 282 VAL C N   1 
ATOM   7815  C CA  . VAL C  1 257 ? 23.413  106.008 87.787  1.00 17.96 ? 282 VAL C CA  1 
ATOM   7816  C C   . VAL C  1 257 ? 23.920  104.592 87.551  1.00 17.61 ? 282 VAL C C   1 
ATOM   7817  O O   . VAL C  1 257 ? 24.648  104.047 88.381  1.00 17.77 ? 282 VAL C O   1 
ATOM   7818  C CB  . VAL C  1 257 ? 24.562  106.994 87.501  1.00 18.85 ? 282 VAL C CB  1 
ATOM   7819  C CG1 . VAL C  1 257 ? 25.236  106.662 86.180  1.00 19.52 ? 282 VAL C CG1 1 
ATOM   7820  C CG2 . VAL C  1 257 ? 24.043  108.440 87.473  1.00 19.29 ? 282 VAL C CG2 1 
ATOM   7821  N N   . GLY C  1 258 ? 23.514  103.994 86.438  1.00 16.85 ? 283 GLY C N   1 
ATOM   7822  C CA  . GLY C  1 258 ? 23.908  102.616 86.089  1.00 17.02 ? 283 GLY C CA  1 
ATOM   7823  C C   . GLY C  1 258 ? 23.062  101.527 86.746  1.00 18.13 ? 283 GLY C C   1 
ATOM   7824  O O   . GLY C  1 258 ? 23.402  100.349 86.659  1.00 17.51 ? 283 GLY C O   1 
ATOM   7825  N N   . ALA C  1 259 ? 21.971  101.922 87.415  1.00 17.29 ? 284 ALA C N   1 
ATOM   7826  C CA  . ALA C  1 259 ? 21.041  100.955 88.013  1.00 17.67 ? 284 ALA C CA  1 
ATOM   7827  C C   . ALA C  1 259 ? 20.236  100.221 86.935  1.00 17.33 ? 284 ALA C C   1 
ATOM   7828  O O   . ALA C  1 259 ? 19.999  100.756 85.852  1.00 16.47 ? 284 ALA C O   1 
ATOM   7829  C CB  . ALA C  1 259 ? 20.091  101.653 89.020  1.00 17.05 ? 284 ALA C CB  1 
ATOM   7830  N N   . PRO C  1 260 ? 19.812  98.981  87.238  1.00 18.45 ? 285 PRO C N   1 
ATOM   7831  C CA  . PRO C  1 260 ? 19.012  98.153  86.334  1.00 18.58 ? 285 PRO C CA  1 
ATOM   7832  C C   . PRO C  1 260 ? 17.694  98.829  85.996  1.00 18.47 ? 285 PRO C C   1 
ATOM   7833  O O   . PRO C  1 260 ? 17.029  99.366  86.883  1.00 18.51 ? 285 PRO C O   1 
ATOM   7834  C CB  . PRO C  1 260 ? 18.743  96.896  87.167  1.00 19.87 ? 285 PRO C CB  1 
ATOM   7835  C CG  . PRO C  1 260 ? 19.977  96.815  88.076  1.00 20.60 ? 285 PRO C CG  1 
ATOM   7836  C CD  . PRO C  1 260 ? 20.166  98.257  88.477  1.00 18.82 ? 285 PRO C CD  1 
ATOM   7837  N N   . ALA C  1 261 ? 17.331  98.794  84.721  1.00 18.60 ? 286 ALA C N   1 
ATOM   7838  C CA  . ALA C  1 261 ? 16.091  99.388  84.252  1.00 18.15 ? 286 ALA C CA  1 
ATOM   7839  C C   . ALA C  1 261 ? 15.359  98.362  83.423  1.00 19.40 ? 286 ALA C C   1 
ATOM   7840  O O   . ALA C  1 261 ? 15.990  97.615  82.663  1.00 19.78 ? 286 ALA C O   1 
ATOM   7841  C CB  . ALA C  1 261 ? 16.385  100.621 83.406  1.00 16.64 ? 286 ALA C CB  1 
ATOM   7842  N N   . SER C  1 262 ? 14.032  98.331  83.534  1.00 19.83 ? 287 SER C N   1 
ATOM   7843  C CA  . SER C  1 262 ? 13.251  97.341  82.809  1.00 21.41 ? 287 SER C CA  1 
ATOM   7844  C C   . SER C  1 262 ? 12.834  97.874  81.449  1.00 21.49 ? 287 SER C C   1 
ATOM   7845  O O   . SER C  1 262 ? 12.387  97.113  80.587  1.00 21.94 ? 287 SER C O   1 
ATOM   7846  C CB  . SER C  1 262 ? 11.996  96.946  83.604  1.00 22.69 ? 287 SER C CB  1 
ATOM   7847  O OG  . SER C  1 262 ? 11.271  98.097  84.008  1.00 22.75 ? 287 SER C OG  1 
ATOM   7848  N N   . GLY C  1 263 ? 12.952  99.183  81.262  1.00 20.56 ? 288 GLY C N   1 
ATOM   7849  C CA  . GLY C  1 263 ? 12.543  99.794  79.990  1.00 20.34 ? 288 GLY C CA  1 
ATOM   7850  C C   . GLY C  1 263 ? 12.543  101.316 80.055  1.00 19.35 ? 288 GLY C C   1 
ATOM   7851  O O   . GLY C  1 263 ? 13.046  101.893 81.015  1.00 18.49 ? 288 GLY C O   1 
ATOM   7852  N N   . PRO C  1 264 ? 11.991  101.979 79.018  1.00 18.45 ? 289 PRO C N   1 
ATOM   7853  C CA  . PRO C  1 264 ? 11.934  103.441 79.084  1.00 18.10 ? 289 PRO C CA  1 
ATOM   7854  C C   . PRO C  1 264 ? 10.999  103.880 80.211  1.00 17.50 ? 289 PRO C C   1 
ATOM   7855  O O   . PRO C  1 264 ? 10.232  103.059 80.701  1.00 18.58 ? 289 PRO C O   1 
ATOM   7856  C CB  . PRO C  1 264 ? 11.369  103.850 77.710  1.00 17.88 ? 289 PRO C CB  1 
ATOM   7857  C CG  . PRO C  1 264 ? 10.640  102.621 77.183  1.00 19.63 ? 289 PRO C CG  1 
ATOM   7858  C CD  . PRO C  1 264 ? 11.433  101.431 77.763  1.00 19.50 ? 289 PRO C CD  1 
ATOM   7859  N N   . GLY C  1 265 ? 11.116  105.128 80.645  1.00 16.48 ? 290 GLY C N   1 
ATOM   7860  C CA  . GLY C  1 265 ? 10.171  105.714 81.603  1.00 16.92 ? 290 GLY C CA  1 
ATOM   7861  C C   . GLY C  1 265 ? 8.785   105.827 80.985  1.00 17.63 ? 290 GLY C C   1 
ATOM   7862  O O   . GLY C  1 265 ? 8.637   105.827 79.755  1.00 16.43 ? 290 GLY C O   1 
ATOM   7863  N N   . ALA C  1 266 ? 7.772   105.918 81.837  1.00 18.45 ? 291 ALA C N   1 
ATOM   7864  C CA  . ALA C  1 266 ? 6.394   106.175 81.399  1.00 19.51 ? 291 ALA C CA  1 
ATOM   7865  C C   . ALA C  1 266 ? 6.318   107.420 80.519  1.00 18.82 ? 291 ALA C C   1 
ATOM   7866  O O   . ALA C  1 266 ? 6.971   108.419 80.804  1.00 18.78 ? 291 ALA C O   1 
ATOM   7867  C CB  . ALA C  1 266 ? 5.484   106.357 82.634  1.00 19.90 ? 291 ALA C CB  1 
ATOM   7868  N N   . ALA C  1 267 ? 5.517   107.364 79.460  1.00 19.50 ? 292 ALA C N   1 
ATOM   7869  C CA  . ALA C  1 267 ? 5.393   108.501 78.550  1.00 19.71 ? 292 ALA C CA  1 
ATOM   7870  C C   . ALA C  1 267 ? 4.851   109.696 79.322  1.00 19.59 ? 292 ALA C C   1 
ATOM   7871  O O   . ALA C  1 267 ? 4.063   109.524 80.272  1.00 20.19 ? 292 ALA C O   1 
ATOM   7872  C CB  . ALA C  1 267 ? 4.457   108.161 77.383  1.00 20.64 ? 292 ALA C CB  1 
ATOM   7873  N N   . GLY C  1 268 ? 5.265   110.899 78.918  1.00 18.80 ? 293 GLY C N   1 
ATOM   7874  C CA  . GLY C  1 268 ? 4.697   112.115 79.479  1.00 19.63 ? 293 GLY C CA  1 
ATOM   7875  C C   . GLY C  1 268 ? 3.290   112.335 78.947  1.00 20.51 ? 293 GLY C C   1 
ATOM   7876  O O   . GLY C  1 268 ? 2.958   111.842 77.870  1.00 20.57 ? 293 GLY C O   1 
ATOM   7877  N N   . PRO C  1 269 ? 2.437   113.046 79.715  1.00 21.55 ? 294 PRO C N   1 
ATOM   7878  C CA  . PRO C  1 269 ? 1.063   113.280 79.255  1.00 22.30 ? 294 PRO C CA  1 
ATOM   7879  C C   . PRO C  1 269 ? 1.010   114.157 77.995  1.00 22.03 ? 294 PRO C C   1 
ATOM   7880  O O   . PRO C  1 269 ? 0.065   114.041 77.219  1.00 22.03 ? 294 PRO C O   1 
ATOM   7881  C CB  . PRO C  1 269 ? 0.386   113.974 80.453  1.00 23.08 ? 294 PRO C CB  1 
ATOM   7882  C CG  . PRO C  1 269 ? 1.534   114.597 81.209  1.00 23.75 ? 294 PRO C CG  1 
ATOM   7883  C CD  . PRO C  1 269 ? 2.702   113.660 81.028  1.00 21.90 ? 294 PRO C CD  1 
ATOM   7884  N N   . ILE C  1 270 ? 2.032   114.980 77.752  1.00 21.55 ? 295 ILE C N   1 
ATOM   7885  C CA  . ILE C  1 270 ? 1.990   115.885 76.575  1.00 22.04 ? 295 ILE C CA  1 
ATOM   7886  C C   . ILE C  1 270 ? 2.800   115.385 75.384  1.00 21.18 ? 295 ILE C C   1 
ATOM   7887  O O   . ILE C  1 270 ? 2.360   115.465 74.216  1.00 20.74 ? 295 ILE C O   1 
ATOM   7888  C CB  . ILE C  1 270 ? 2.474   117.304 76.915  1.00 21.92 ? 295 ILE C CB  1 
ATOM   7889  C CG1 . ILE C  1 270 ? 1.753   117.818 78.153  1.00 23.48 ? 295 ILE C CG1 1 
ATOM   7890  C CG2 . ILE C  1 270 ? 2.225   118.232 75.736  1.00 22.56 ? 295 ILE C CG2 1 
ATOM   7891  C CD1 . ILE C  1 270 ? 0.249   117.731 78.021  1.00 25.62 ? 295 ILE C CD1 1 
ATOM   7892  N N   . THR C  1 271 ? 4.006   114.910 75.667  1.00 19.70 ? 296 THR C N   1 
ATOM   7893  C CA  . THR C  1 271 ? 4.856   114.418 74.598  1.00 19.53 ? 296 THR C CA  1 
ATOM   7894  C C   . THR C  1 271 ? 4.513   113.000 74.151  1.00 19.82 ? 296 THR C C   1 
ATOM   7895  O O   . THR C  1 271 ? 4.867   112.617 73.044  1.00 20.47 ? 296 THR C O   1 
ATOM   7896  C CB  . THR C  1 271 ? 6.365   114.594 74.940  1.00 17.76 ? 296 THR C CB  1 
ATOM   7897  O OG1 . THR C  1 271 ? 6.649   114.055 76.235  1.00 18.69 ? 296 THR C OG1 1 
ATOM   7898  C CG2 . THR C  1 271 ? 6.701   116.076 74.962  1.00 17.51 ? 296 THR C CG2 1 
ATOM   7899  N N   . GLU C  1 272 ? 3.874   112.218 75.026  1.00 20.61 ? 297 GLU C N   1 
ATOM   7900  C CA  . GLU C  1 272 ? 3.371   110.883 74.672  1.00 21.70 ? 297 GLU C CA  1 
ATOM   7901  C C   . GLU C  1 272 ? 4.428   109.987 74.040  1.00 21.71 ? 297 GLU C C   1 
ATOM   7902  O O   . GLU C  1 272 ? 4.144   109.285 73.073  1.00 22.43 ? 297 GLU C O   1 
ATOM   7903  C CB  . GLU C  1 272 ? 2.164   111.012 73.737  1.00 23.02 ? 297 GLU C CB  1 
ATOM   7904  C CG  . GLU C  1 272 ? 1.104   111.907 74.330  1.00 25.05 ? 297 GLU C CG  1 
ATOM   7905  C CD  . GLU C  1 272 ? -0.174  111.943 73.513  1.00 28.60 ? 297 GLU C CD  1 
ATOM   7906  O OE1 . GLU C  1 272 ? -0.176  112.452 72.375  1.00 28.65 ? 297 GLU C OE1 1 
ATOM   7907  O OE2 . GLU C  1 272 ? -1.181  111.449 74.014  1.00 29.85 ? 297 GLU C OE2 1 
ATOM   7908  N N   . SER C  1 273 ? 5.649   110.006 74.579  1.00 20.65 ? 298 SER C N   1 
ATOM   7909  C CA  . SER C  1 273 ? 6.742   109.197 74.012  1.00 20.91 ? 298 SER C CA  1 
ATOM   7910  C C   . SER C  1 273 ? 7.592   108.563 75.127  1.00 19.99 ? 298 SER C C   1 
ATOM   7911  O O   . SER C  1 273 ? 8.443   109.217 75.727  1.00 18.92 ? 298 SER C O   1 
ATOM   7912  C CB  . SER C  1 273 ? 7.611   110.070 73.082  1.00 20.23 ? 298 SER C CB  1 
ATOM   7913  O OG  . SER C  1 273 ? 8.609   109.310 72.442  1.00 21.69 ? 298 SER C OG  1 
ATOM   7914  N N   . SER C  1 274 ? 7.339   107.292 75.405  1.00 20.26 ? 299 SER C N   1 
ATOM   7915  C CA  . SER C  1 274 ? 8.042   106.598 76.469  1.00 20.63 ? 299 SER C CA  1 
ATOM   7916  C C   . SER C  1 274 ? 9.517   106.773 76.275  1.00 18.98 ? 299 SER C C   1 
ATOM   7917  O O   . SER C  1 274 ? 10.014  106.380 75.247  1.00 19.22 ? 299 SER C O   1 
ATOM   7918  C CB  . SER C  1 274 ? 7.759   105.100 76.370  1.00 21.71 ? 299 SER C CB  1 
ATOM   7919  O OG  . SER C  1 274 ? 6.401   104.896 76.667  1.00 26.88 ? 299 SER C OG  1 
ATOM   7920  N N   . GLY C  1 275 ? 10.219  107.310 77.262  1.00 18.20 ? 300 GLY C N   1 
ATOM   7921  C CA  . GLY C  1 275 ? 11.666  107.399 77.177  1.00 17.29 ? 300 GLY C CA  1 
ATOM   7922  C C   . GLY C  1 275 ? 12.236  108.810 77.209  1.00 17.19 ? 300 GLY C C   1 
ATOM   7923  O O   . GLY C  1 275 ? 13.436  108.989 77.470  1.00 16.23 ? 300 GLY C O   1 
ATOM   7924  N N   . PHE C  1 276 ? 11.402  109.801 76.915  1.00 16.35 ? 301 PHE C N   1 
ATOM   7925  C CA  . PHE C  1 276 ? 11.800  111.190 77.130  1.00 16.70 ? 301 PHE C CA  1 
ATOM   7926  C C   . PHE C  1 276 ? 10.682  112.025 77.707  1.00 16.19 ? 301 PHE C C   1 
ATOM   7927  O O   . PHE C  1 276 ? 9.515   111.619 77.717  1.00 17.42 ? 301 PHE C O   1 
ATOM   7928  C CB  . PHE C  1 276 ? 12.463  111.849 75.899  1.00 15.94 ? 301 PHE C CB  1 
ATOM   7929  C CG  . PHE C  1 276 ? 11.493  112.414 74.885  1.00 16.80 ? 301 PHE C CG  1 
ATOM   7930  C CD1 . PHE C  1 276 ? 11.037  113.728 74.984  1.00 18.58 ? 301 PHE C CD1 1 
ATOM   7931  C CD2 . PHE C  1 276 ? 11.064  111.642 73.809  1.00 18.84 ? 301 PHE C CD2 1 
ATOM   7932  C CE1 . PHE C  1 276 ? 10.154  114.255 74.022  1.00 18.01 ? 301 PHE C CE1 1 
ATOM   7933  C CE2 . PHE C  1 276 ? 10.184  112.155 72.844  1.00 18.74 ? 301 PHE C CE2 1 
ATOM   7934  C CZ  . PHE C  1 276 ? 9.735   113.466 72.958  1.00 19.21 ? 301 PHE C CZ  1 
ATOM   7935  N N   . LEU C  1 277 ? 11.063  113.163 78.274  1.00 15.77 ? 302 LEU C N   1 
ATOM   7936  C CA  . LEU C  1 277 ? 10.105  114.114 78.789  1.00 16.10 ? 302 LEU C CA  1 
ATOM   7937  C C   . LEU C  1 277 ? 10.592  115.516 78.407  1.00 16.23 ? 302 LEU C C   1 
ATOM   7938  O O   . LEU C  1 277 ? 11.790  115.796 78.490  1.00 15.24 ? 302 LEU C O   1 
ATOM   7939  C CB  . LEU C  1 277 ? 10.029  114.019 80.326  1.00 15.30 ? 302 LEU C CB  1 
ATOM   7940  C CG  . LEU C  1 277 ? 9.398   112.778 80.982  1.00 16.86 ? 302 LEU C CG  1 
ATOM   7941  C CD1 . LEU C  1 277 ? 9.511   112.868 82.519  1.00 17.91 ? 302 LEU C CD1 1 
ATOM   7942  C CD2 . LEU C  1 277 ? 7.940   112.614 80.569  1.00 16.80 ? 302 LEU C CD2 1 
ATOM   7943  N N   . ALA C  1 278 ? 9.688   116.404 78.000  1.00 16.36 ? 303 ALA C N   1 
ATOM   7944  C CA  . ALA C  1 278 ? 10.112  117.797 77.772  1.00 16.46 ? 303 ALA C CA  1 
ATOM   7945  C C   . ALA C  1 278 ? 10.276  118.486 79.132  1.00 17.04 ? 303 ALA C C   1 
ATOM   7946  O O   . ALA C  1 278 ? 9.743   118.007 80.129  1.00 17.38 ? 303 ALA C O   1 
ATOM   7947  C CB  . ALA C  1 278 ? 9.061   118.567 76.922  1.00 17.03 ? 303 ALA C CB  1 
ATOM   7948  N N   . TYR C  1 279 ? 10.974  119.611 79.170  1.00 16.64 ? 304 TYR C N   1 
ATOM   7949  C CA  . TYR C  1 279 ? 11.186  120.307 80.437  1.00 17.91 ? 304 TYR C CA  1 
ATOM   7950  C C   . TYR C  1 279 ? 9.875   120.683 81.115  1.00 18.86 ? 304 TYR C C   1 
ATOM   7951  O O   . TYR C  1 279 ? 9.774   120.569 82.324  1.00 19.33 ? 304 TYR C O   1 
ATOM   7952  C CB  . TYR C  1 279 ? 12.036  121.567 80.255  1.00 18.22 ? 304 TYR C CB  1 
ATOM   7953  C CG  . TYR C  1 279 ? 12.418  122.198 81.583  1.00 19.88 ? 304 TYR C CG  1 
ATOM   7954  C CD1 . TYR C  1 279 ? 13.247  121.523 82.479  1.00 19.17 ? 304 TYR C CD1 1 
ATOM   7955  C CD2 . TYR C  1 279 ? 11.934  123.449 81.947  1.00 20.59 ? 304 TYR C CD2 1 
ATOM   7956  C CE1 . TYR C  1 279 ? 13.585  122.083 83.705  1.00 22.20 ? 304 TYR C CE1 1 
ATOM   7957  C CE2 . TYR C  1 279 ? 12.267  124.018 83.181  1.00 21.74 ? 304 TYR C CE2 1 
ATOM   7958  C CZ  . TYR C  1 279 ? 13.099  123.329 84.041  1.00 21.90 ? 304 TYR C CZ  1 
ATOM   7959  O OH  . TYR C  1 279 ? 13.430  123.873 85.248  1.00 23.68 ? 304 TYR C OH  1 
ATOM   7960  N N   . TYR C  1 280 ? 8.874   121.139 80.354  1.00 19.32 ? 305 TYR C N   1 
ATOM   7961  C CA  . TYR C  1 280 ? 7.602   121.515 80.986  1.00 20.74 ? 305 TYR C CA  1 
ATOM   7962  C C   . TYR C  1 280 ? 6.889   120.318 81.637  1.00 20.89 ? 305 TYR C C   1 
ATOM   7963  O O   . TYR C  1 280 ? 6.037   120.506 82.510  1.00 22.33 ? 305 TYR C O   1 
ATOM   7964  C CB  . TYR C  1 280 ? 6.662   122.267 80.022  1.00 21.57 ? 305 TYR C CB  1 
ATOM   7965  C CG  . TYR C  1 280 ? 6.378   121.544 78.709  1.00 21.72 ? 305 TYR C CG  1 
ATOM   7966  C CD1 . TYR C  1 280 ? 5.539   120.431 78.665  1.00 20.83 ? 305 TYR C CD1 1 
ATOM   7967  C CD2 . TYR C  1 280 ? 6.946   121.982 77.520  1.00 20.76 ? 305 TYR C CD2 1 
ATOM   7968  C CE1 . TYR C  1 280 ? 5.287   119.765 77.452  1.00 20.91 ? 305 TYR C CE1 1 
ATOM   7969  C CE2 . TYR C  1 280 ? 6.693   121.333 76.312  1.00 21.07 ? 305 TYR C CE2 1 
ATOM   7970  C CZ  . TYR C  1 280 ? 5.856   120.229 76.284  1.00 20.62 ? 305 TYR C CZ  1 
ATOM   7971  O OH  . TYR C  1 280 ? 5.607   119.582 75.083  1.00 20.02 ? 305 TYR C OH  1 
ATOM   7972  N N   . GLU C  1 281 ? 7.238   119.098 81.230  1.00 19.26 ? 306 GLU C N   1 
ATOM   7973  C CA  . GLU C  1 281 ? 6.727   117.882 81.899  1.00 19.19 ? 306 GLU C CA  1 
ATOM   7974  C C   . GLU C  1 281 ? 7.596   117.570 83.095  1.00 18.67 ? 306 GLU C C   1 
ATOM   7975  O O   . GLU C  1 281 ? 7.115   117.136 84.162  1.00 18.73 ? 306 GLU C O   1 
ATOM   7976  C CB  . GLU C  1 281 ? 6.719   116.682 80.928  1.00 18.46 ? 306 GLU C CB  1 
ATOM   7977  C CG  . GLU C  1 281 ? 5.646   116.837 79.834  1.00 19.61 ? 306 GLU C CG  1 
ATOM   7978  C CD  . GLU C  1 281 ? 5.730   115.774 78.737  1.00 19.24 ? 306 GLU C CD  1 
ATOM   7979  O OE1 . GLU C  1 281 ? 6.838   115.481 78.232  1.00 16.74 ? 306 GLU C OE1 1 
ATOM   7980  O OE2 . GLU C  1 281 ? 4.663   115.242 78.386  1.00 19.47 ? 306 GLU C OE2 1 
ATOM   7981  N N   . ILE C  1 282 ? 8.892   117.784 82.912  1.00 18.06 ? 307 ILE C N   1 
ATOM   7982  C CA  . ILE C  1 282 ? 9.839   117.525 83.979  1.00 18.25 ? 307 ILE C CA  1 
ATOM   7983  C C   . ILE C  1 282 ? 9.535   118.350 85.230  1.00 19.86 ? 307 ILE C C   1 
ATOM   7984  O O   . ILE C  1 282 ? 9.584   117.822 86.342  1.00 19.88 ? 307 ILE C O   1 
ATOM   7985  C CB  . ILE C  1 282 ? 11.284  117.742 83.515  1.00 18.27 ? 307 ILE C CB  1 
ATOM   7986  C CG1 . ILE C  1 282 ? 11.736  116.569 82.612  1.00 17.59 ? 307 ILE C CG1 1 
ATOM   7987  C CG2 . ILE C  1 282 ? 12.218  117.841 84.735  1.00 18.18 ? 307 ILE C CG2 1 
ATOM   7988  C CD1 . ILE C  1 282 ? 12.967  116.929 81.739  1.00 18.77 ? 307 ILE C CD1 1 
ATOM   7989  N N   . CYS C  1 283 ? 9.205   119.636 85.071  1.00 20.80 ? 308 CYS C N   1 
ATOM   7990  C CA  . CYS C  1 283 ? 8.875   120.437 86.266  1.00 22.90 ? 308 CYS C CA  1 
ATOM   7991  C C   . CYS C  1 283 ? 7.701   119.810 87.040  1.00 22.86 ? 308 CYS C C   1 
ATOM   7992  O O   . CYS C  1 283 ? 7.676   119.865 88.266  1.00 23.08 ? 308 CYS C O   1 
ATOM   7993  C CB  . CYS C  1 283 ? 8.549   121.894 85.916  1.00 24.15 ? 308 CYS C CB  1 
ATOM   7994  S SG  . CYS C  1 283 ? 9.884   122.799 85.040  1.00 31.19 ? 308 CYS C SG  1 
ATOM   7995  N N   . GLN C  1 284 ? 6.726   119.230 86.337  1.00 22.20 ? 309 GLN C N   1 
ATOM   7996  C CA  . GLN C  1 284 ? 5.639   118.547 87.039  1.00 22.32 ? 309 GLN C CA  1 
ATOM   7997  C C   . GLN C  1 284 ? 6.128   117.260 87.725  1.00 22.14 ? 309 GLN C C   1 
ATOM   7998  O O   . GLN C  1 284 ? 5.804   117.015 88.890  1.00 21.84 ? 309 GLN C O   1 
ATOM   7999  C CB  . GLN C  1 284 ? 4.456   118.277 86.106  1.00 23.21 ? 309 GLN C CB  1 
ATOM   8000  C CG  . GLN C  1 284 ? 3.819   119.563 85.496  1.00 24.39 ? 309 GLN C CG  1 
ATOM   8001  C CD  . GLN C  1 284 ? 3.344   120.590 86.552  1.00 28.99 ? 309 GLN C CD  1 
ATOM   8002  O OE1 . GLN C  1 284 ? 2.694   120.228 87.524  1.00 30.64 ? 309 GLN C OE1 1 
ATOM   8003  N NE2 . GLN C  1 284 ? 3.672   121.872 86.345  1.00 28.06 ? 309 GLN C NE2 1 
ATOM   8004  N N   . PHE C  1 285 ? 6.912   116.451 87.001  1.00 20.39 ? 310 PHE C N   1 
ATOM   8005  C CA  . PHE C  1 285 ? 7.495   115.224 87.554  1.00 20.19 ? 310 PHE C CA  1 
ATOM   8006  C C   . PHE C  1 285 ? 8.253   115.502 88.869  1.00 20.01 ? 310 PHE C C   1 
ATOM   8007  O O   . PHE C  1 285 ? 8.186   114.718 89.820  1.00 20.66 ? 310 PHE C O   1 
ATOM   8008  C CB  . PHE C  1 285 ? 8.468   114.598 86.525  1.00 18.64 ? 310 PHE C CB  1 
ATOM   8009  C CG  . PHE C  1 285 ? 9.160   113.356 87.028  1.00 19.42 ? 310 PHE C CG  1 
ATOM   8010  C CD1 . PHE C  1 285 ? 8.523   112.126 86.989  1.00 20.66 ? 310 PHE C CD1 1 
ATOM   8011  C CD2 . PHE C  1 285 ? 10.438  113.418 87.534  1.00 20.13 ? 310 PHE C CD2 1 
ATOM   8012  C CE1 . PHE C  1 285 ? 9.153   110.973 87.453  1.00 20.50 ? 310 PHE C CE1 1 
ATOM   8013  C CE2 . PHE C  1 285 ? 11.067  112.271 88.010  1.00 19.39 ? 310 PHE C CE2 1 
ATOM   8014  C CZ  . PHE C  1 285 ? 10.420  111.050 87.966  1.00 19.39 ? 310 PHE C CZ  1 
ATOM   8015  N N   . LEU C  1 286 ? 8.972   116.616 88.914  1.00 19.52 ? 311 LEU C N   1 
ATOM   8016  C CA  . LEU C  1 286 ? 9.859   116.913 90.032  1.00 20.17 ? 311 LEU C CA  1 
ATOM   8017  C C   . LEU C  1 286 ? 9.095   117.140 91.336  1.00 21.27 ? 311 LEU C C   1 
ATOM   8018  O O   . LEU C  1 286 ? 9.667   116.987 92.405  1.00 21.59 ? 311 LEU C O   1 
ATOM   8019  C CB  . LEU C  1 286 ? 10.738  118.140 89.729  1.00 20.68 ? 311 LEU C CB  1 
ATOM   8020  C CG  . LEU C  1 286 ? 11.803  117.979 88.648  1.00 19.92 ? 311 LEU C CG  1 
ATOM   8021  C CD1 . LEU C  1 286 ? 12.601  119.271 88.435  1.00 20.78 ? 311 LEU C CD1 1 
ATOM   8022  C CD2 . LEU C  1 286 ? 12.726  116.795 89.033  1.00 20.26 ? 311 LEU C CD2 1 
ATOM   8023  N N   . LYS C  1 287 ? 7.812   117.478 91.235  1.00 21.67 ? 312 LYS C N   1 
ATOM   8024  C CA  . LYS C  1 287 ? 6.965   117.641 92.414  1.00 24.06 ? 312 LYS C CA  1 
ATOM   8025  C C   . LYS C  1 287 ? 6.741   116.283 93.100  1.00 24.10 ? 312 LYS C C   1 
ATOM   8026  O O   . LYS C  1 287 ? 6.052   115.411 92.559  1.00 24.06 ? 312 LYS C O   1 
ATOM   8027  C CB  . LYS C  1 287 ? 5.627   118.306 92.031  1.00 24.76 ? 312 LYS C CB  1 
ATOM   8028  C CG  . LYS C  1 287 ? 5.816   119.705 91.456  1.00 26.37 ? 312 LYS C CG  1 
ATOM   8029  C CD  . LYS C  1 287 ? 4.481   120.384 91.018  1.00 29.68 ? 312 LYS C CD  1 
ATOM   8030  C CE  . LYS C  1 287 ? 4.758   121.785 90.427  1.00 30.09 ? 312 LYS C CE  1 
ATOM   8031  N NZ  . LYS C  1 287 ? 3.516   122.430 89.884  1.00 32.93 ? 312 LYS C NZ  1 
ATOM   8032  N N   . GLY C  1 288 ? 7.320   116.126 94.290  1.00 24.61 ? 313 GLY C N   1 
ATOM   8033  C CA  . GLY C  1 288 ? 7.317   114.854 95.017  1.00 24.28 ? 313 GLY C CA  1 
ATOM   8034  C C   . GLY C  1 288 ? 8.484   113.948 94.619  1.00 23.58 ? 313 GLY C C   1 
ATOM   8035  O O   . GLY C  1 288 ? 8.571   112.801 95.074  1.00 22.48 ? 313 GLY C O   1 
ATOM   8036  N N   . ALA C  1 289 ? 9.392   114.450 93.778  1.00 22.10 ? 314 ALA C N   1 
ATOM   8037  C CA  . ALA C  1 289 ? 10.523  113.632 93.378  1.00 21.83 ? 314 ALA C CA  1 
ATOM   8038  C C   . ALA C  1 289 ? 11.716  113.945 94.271  1.00 22.71 ? 314 ALA C C   1 
ATOM   8039  O O   . ALA C  1 289 ? 11.735  114.949 94.985  1.00 22.67 ? 314 ALA C O   1 
ATOM   8040  C CB  . ALA C  1 289 ? 10.873  113.873 91.914  1.00 20.71 ? 314 ALA C CB  1 
ATOM   8041  N N   . LYS C  1 290 ? 12.723  113.089 94.221  1.00 22.18 ? 315 LYS C N   1 
ATOM   8042  C CA  . LYS C  1 290 ? 13.953  113.371 94.906  1.00 22.86 ? 315 LYS C CA  1 
ATOM   8043  C C   . LYS C  1 290 ? 15.049  113.625 93.857  1.00 21.44 ? 315 LYS C C   1 
ATOM   8044  O O   . LYS C  1 290 ? 15.269  112.819 92.946  1.00 20.38 ? 315 LYS C O   1 
ATOM   8045  C CB  . LYS C  1 290 ? 14.290  112.197 95.825  1.00 24.38 ? 315 LYS C CB  1 
ATOM   8046  C CG  . LYS C  1 290 ? 15.769  111.993 96.022  1.00 27.66 ? 315 LYS C CG  1 
ATOM   8047  C CD  . LYS C  1 290 ? 16.222  112.448 97.372  1.00 33.70 ? 315 LYS C CD  1 
ATOM   8048  C CE  . LYS C  1 290 ? 17.258  111.462 97.919  1.00 36.19 ? 315 LYS C CE  1 
ATOM   8049  N NZ  . LYS C  1 290 ? 17.303  111.593 99.395  1.00 39.18 ? 315 LYS C NZ  1 
ATOM   8050  N N   . ILE C  1 291 ? 15.717  114.760 93.980  1.00 21.03 ? 316 ILE C N   1 
ATOM   8051  C CA  . ILE C  1 291 ? 16.677  115.201 92.979  1.00 20.88 ? 316 ILE C CA  1 
ATOM   8052  C C   . ILE C  1 291 ? 18.070  115.012 93.526  1.00 20.73 ? 316 ILE C C   1 
ATOM   8053  O O   . ILE C  1 291 ? 18.323  115.329 94.691  1.00 20.38 ? 316 ILE C O   1 
ATOM   8054  C CB  . ILE C  1 291 ? 16.495  116.686 92.676  1.00 21.43 ? 316 ILE C CB  1 
ATOM   8055  C CG1 . ILE C  1 291 ? 15.122  116.933 92.016  1.00 22.09 ? 316 ILE C CG1 1 
ATOM   8056  C CG2 . ILE C  1 291 ? 17.674  117.224 91.864  1.00 20.24 ? 316 ILE C CG2 1 
ATOM   8057  C CD1 . ILE C  1 291 ? 14.636  118.386 92.147  1.00 23.56 ? 316 ILE C CD1 1 
ATOM   8058  N N   . THR C  1 292 ? 18.943  114.435 92.704  1.00 19.09 ? 317 THR C N   1 
ATOM   8059  C CA  . THR C  1 292 ? 20.348  114.243 93.054  1.00 19.85 ? 317 THR C CA  1 
ATOM   8060  C C   . THR C  1 292 ? 21.205  114.943 91.987  1.00 20.04 ? 317 THR C C   1 
ATOM   8061  O O   . THR C  1 292 ? 20.970  114.767 90.797  1.00 18.46 ? 317 THR C O   1 
ATOM   8062  C CB  . THR C  1 292 ? 20.701  112.727 93.136  1.00 20.50 ? 317 THR C CB  1 
ATOM   8063  O OG1 . THR C  1 292 ? 19.788  112.078 94.031  1.00 21.23 ? 317 THR C OG1 1 
ATOM   8064  C CG2 . THR C  1 292 ? 22.164  112.487 93.626  1.00 20.33 ? 317 THR C CG2 1 
ATOM   8065  N N   . ARG C  1 293 ? 22.183  115.742 92.408  1.00 20.12 ? 318 ARG C N   1 
ATOM   8066  C CA  . ARG C  1 293 ? 23.079  116.372 91.443  1.00 21.02 ? 318 ARG C CA  1 
ATOM   8067  C C   . ARG C  1 293 ? 24.319  115.552 91.393  1.00 20.65 ? 318 ARG C C   1 
ATOM   8068  O O   . ARG C  1 293 ? 24.904  115.297 92.427  1.00 21.44 ? 318 ARG C O   1 
ATOM   8069  C CB  . ARG C  1 293 ? 23.509  117.755 91.904  1.00 22.57 ? 318 ARG C CB  1 
ATOM   8070  C CG  . ARG C  1 293 ? 22.434  118.746 91.783  1.00 26.23 ? 318 ARG C CG  1 
ATOM   8071  C CD  . ARG C  1 293 ? 22.949  120.112 91.263  1.00 29.69 ? 318 ARG C CD  1 
ATOM   8072  N NE  . ARG C  1 293 ? 21.719  120.811 91.059  1.00 31.76 ? 318 ARG C NE  1 
ATOM   8073  C CZ  . ARG C  1 293 ? 21.173  121.040 89.888  1.00 29.97 ? 318 ARG C CZ  1 
ATOM   8074  N NH1 . ARG C  1 293 ? 21.836  120.784 88.770  1.00 27.22 ? 318 ARG C NH1 1 
ATOM   8075  N NH2 . ARG C  1 293 ? 19.987  121.619 89.872  1.00 32.09 ? 318 ARG C NH2 1 
ATOM   8076  N N   . LEU C  1 294 ? 24.730  115.137 90.210  1.00 19.79 ? 319 LEU C N   1 
ATOM   8077  C CA  . LEU C  1 294 ? 25.929  114.329 90.112  1.00 19.46 ? 319 LEU C CA  1 
ATOM   8078  C C   . LEU C  1 294 ? 27.147  115.222 90.220  1.00 20.60 ? 319 LEU C C   1 
ATOM   8079  O O   . LEU C  1 294 ? 27.348  116.120 89.413  1.00 20.52 ? 319 LEU C O   1 
ATOM   8080  C CB  . LEU C  1 294 ? 25.937  113.584 88.793  1.00 18.35 ? 319 LEU C CB  1 
ATOM   8081  C CG  . LEU C  1 294 ? 24.770  112.613 88.683  1.00 17.52 ? 319 LEU C CG  1 
ATOM   8082  C CD1 . LEU C  1 294 ? 24.569  112.136 87.229  1.00 17.23 ? 319 LEU C CD1 1 
ATOM   8083  C CD2 . LEU C  1 294 ? 25.018  111.452 89.624  1.00 20.15 ? 319 LEU C CD2 1 
ATOM   8084  N N   . GLN C  1 295 ? 27.979  114.952 91.209  1.00 21.49 ? 320 GLN C N   1 
ATOM   8085  C CA  . GLN C  1 295 ? 29.153  115.774 91.437  1.00 23.01 ? 320 GLN C CA  1 
ATOM   8086  C C   . GLN C  1 295 ? 30.212  115.545 90.389  1.00 22.84 ? 320 GLN C C   1 
ATOM   8087  O O   . GLN C  1 295 ? 30.995  116.452 90.092  1.00 23.16 ? 320 GLN C O   1 
ATOM   8088  C CB  . GLN C  1 295 ? 29.739  115.435 92.791  1.00 24.88 ? 320 GLN C CB  1 
ATOM   8089  C CG  . GLN C  1 295 ? 29.364  116.412 93.856  1.00 30.03 ? 320 GLN C CG  1 
ATOM   8090  C CD  . GLN C  1 295 ? 30.165  116.160 95.090  1.00 35.88 ? 320 GLN C CD  1 
ATOM   8091  O OE1 . GLN C  1 295 ? 31.017  116.956 95.463  1.00 40.35 ? 320 GLN C OE1 1 
ATOM   8092  N NE2 . GLN C  1 295 ? 29.931  115.018 95.719  1.00 37.35 ? 320 GLN C NE2 1 
ATOM   8093  N N   . ASP C  1 296 ? 30.247  114.329 89.831  1.00 21.35 ? 321 ASP C N   1 
ATOM   8094  C CA  . ASP C  1 296 ? 31.194  114.040 88.775  1.00 20.99 ? 321 ASP C CA  1 
ATOM   8095  C C   . ASP C  1 296 ? 30.707  114.583 87.443  1.00 19.79 ? 321 ASP C C   1 
ATOM   8096  O O   . ASP C  1 296 ? 31.458  115.218 86.706  1.00 19.81 ? 321 ASP C O   1 
ATOM   8097  C CB  . ASP C  1 296 ? 31.560  112.546 88.660  1.00 20.07 ? 321 ASP C CB  1 
ATOM   8098  C CG  . ASP C  1 296 ? 30.347  111.602 88.660  1.00 20.66 ? 321 ASP C CG  1 
ATOM   8099  O OD1 . ASP C  1 296 ? 29.178  112.033 88.732  1.00 18.75 ? 321 ASP C OD1 1 
ATOM   8100  O OD2 . ASP C  1 296 ? 30.600  110.374 88.610  1.00 22.23 ? 321 ASP C OD2 1 
ATOM   8101  N N   . GLN C  1 297 ? 29.452  114.335 87.130  1.00 18.70 ? 322 GLN C N   1 
ATOM   8102  C CA  . GLN C  1 297 ? 28.951  114.648 85.775  1.00 18.39 ? 322 GLN C CA  1 
ATOM   8103  C C   . GLN C  1 297 ? 28.303  116.037 85.636  1.00 18.32 ? 322 GLN C C   1 
ATOM   8104  O O   . GLN C  1 297 ? 28.020  116.478 84.528  1.00 17.05 ? 322 GLN C O   1 
ATOM   8105  C CB  . GLN C  1 297 ? 27.990  113.549 85.323  1.00 17.76 ? 322 GLN C CB  1 
ATOM   8106  C CG  . GLN C  1 297 ? 28.687  112.180 85.306  1.00 19.43 ? 322 GLN C CG  1 
ATOM   8107  C CD  . GLN C  1 297 ? 28.019  111.190 84.376  1.00 21.41 ? 322 GLN C CD  1 
ATOM   8108  O OE1 . GLN C  1 297 ? 28.463  110.991 83.235  1.00 23.57 ? 322 GLN C OE1 1 
ATOM   8109  N NE2 . GLN C  1 297 ? 26.968  110.563 84.851  1.00 19.86 ? 322 GLN C NE2 1 
ATOM   8110  N N   . GLN C  1 298 ? 28.103  116.712 86.768  1.00 18.26 ? 323 GLN C N   1 
ATOM   8111  C CA  . GLN C  1 298 ? 27.633  118.112 86.815  1.00 19.15 ? 323 GLN C CA  1 
ATOM   8112  C C   . GLN C  1 298 ? 26.210  118.328 86.299  1.00 18.33 ? 323 GLN C C   1 
ATOM   8113  O O   . GLN C  1 298 ? 25.890  119.424 85.796  1.00 17.91 ? 323 GLN C O   1 
ATOM   8114  C CB  . GLN C  1 298 ? 28.596  119.065 86.068  1.00 19.93 ? 323 GLN C CB  1 
ATOM   8115  C CG  . GLN C  1 298 ? 30.067  118.753 86.271  1.00 22.77 ? 323 GLN C CG  1 
ATOM   8116  C CD  . GLN C  1 298 ? 30.643  119.545 87.404  1.00 27.19 ? 323 GLN C CD  1 
ATOM   8117  O OE1 . GLN C  1 298 ? 29.907  120.027 88.249  1.00 27.72 ? 323 GLN C OE1 1 
ATOM   8118  N NE2 . GLN C  1 298 ? 31.965  119.712 87.419  1.00 29.60 ? 323 GLN C NE2 1 
ATOM   8119  N N   . VAL C  1 299 ? 25.369  117.301 86.429  1.00 17.30 ? 324 VAL C N   1 
ATOM   8120  C CA  . VAL C  1 299 ? 23.981  117.378 85.982  1.00 17.37 ? 324 VAL C CA  1 
ATOM   8121  C C   . VAL C  1 299 ? 23.082  116.626 86.959  1.00 17.16 ? 324 VAL C C   1 
ATOM   8122  O O   . VAL C  1 299 ? 23.559  115.764 87.696  1.00 17.56 ? 324 VAL C O   1 
ATOM   8123  C CB  . VAL C  1 299 ? 23.791  116.754 84.584  1.00 16.38 ? 324 VAL C CB  1 
ATOM   8124  C CG1 . VAL C  1 299 ? 24.406  117.651 83.493  1.00 16.09 ? 324 VAL C CG1 1 
ATOM   8125  C CG2 . VAL C  1 299 ? 24.399  115.357 84.541  1.00 15.41 ? 324 VAL C CG2 1 
ATOM   8126  N N   . PRO C  1 300 ? 21.782  116.966 86.981  1.00 16.66 ? 325 PRO C N   1 
ATOM   8127  C CA  . PRO C  1 300 ? 20.860  116.302 87.907  1.00 16.75 ? 325 PRO C CA  1 
ATOM   8128  C C   . PRO C  1 300 ? 20.144  115.070 87.339  1.00 16.07 ? 325 PRO C C   1 
ATOM   8129  O O   . PRO C  1 300 ? 19.980  114.930 86.115  1.00 14.93 ? 325 PRO C O   1 
ATOM   8130  C CB  . PRO C  1 300 ? 19.825  117.419 88.221  1.00 17.01 ? 325 PRO C CB  1 
ATOM   8131  C CG  . PRO C  1 300 ? 19.789  118.224 86.931  1.00 17.09 ? 325 PRO C CG  1 
ATOM   8132  C CD  . PRO C  1 300 ? 21.206  118.181 86.376  1.00 16.65 ? 325 PRO C CD  1 
ATOM   8133  N N   . TYR C  1 301 ? 19.720  114.173 88.232  1.00 15.61 ? 326 TYR C N   1 
ATOM   8134  C CA  . TYR C  1 301 ? 18.636  113.273 87.907  1.00 15.24 ? 326 TYR C CA  1 
ATOM   8135  C C   . TYR C  1 301 ? 17.597  113.303 89.023  1.00 16.28 ? 326 TYR C C   1 
ATOM   8136  O O   . TYR C  1 301 ? 17.872  113.783 90.121  1.00 16.89 ? 326 TYR C O   1 
ATOM   8137  C CB  . TYR C  1 301 ? 19.115  111.837 87.678  1.00 15.56 ? 326 TYR C CB  1 
ATOM   8138  C CG  . TYR C  1 301 ? 19.684  111.113 88.890  1.00 16.16 ? 326 TYR C CG  1 
ATOM   8139  C CD1 . TYR C  1 301 ? 21.029  111.220 89.214  1.00 18.05 ? 326 TYR C CD1 1 
ATOM   8140  C CD2 . TYR C  1 301 ? 18.886  110.265 89.665  1.00 17.04 ? 326 TYR C CD2 1 
ATOM   8141  C CE1 . TYR C  1 301 ? 21.554  110.523 90.305  1.00 18.48 ? 326 TYR C CE1 1 
ATOM   8142  C CE2 . TYR C  1 301 ? 19.394  109.584 90.761  1.00 17.14 ? 326 TYR C CE2 1 
ATOM   8143  C CZ  . TYR C  1 301 ? 20.729  109.711 91.069  1.00 19.24 ? 326 TYR C CZ  1 
ATOM   8144  O OH  . TYR C  1 301 ? 21.255  109.021 92.142  1.00 19.83 ? 326 TYR C OH  1 
ATOM   8145  N N   . ALA C  1 302 ? 16.410  112.788 88.733  1.00 15.82 ? 327 ALA C N   1 
ATOM   8146  C CA  . ALA C  1 302 ? 15.357  112.778 89.726  1.00 16.28 ? 327 ALA C CA  1 
ATOM   8147  C C   . ALA C  1 302 ? 14.666  111.430 89.729  1.00 16.19 ? 327 ALA C C   1 
ATOM   8148  O O   . ALA C  1 302 ? 14.554  110.782 88.689  1.00 16.25 ? 327 ALA C O   1 
ATOM   8149  C CB  . ALA C  1 302 ? 14.358  113.924 89.464  1.00 16.25 ? 327 ALA C CB  1 
ATOM   8150  N N   . VAL C  1 303 ? 14.197  111.011 90.906  1.00 16.91 ? 328 VAL C N   1 
ATOM   8151  C CA  . VAL C  1 303 ? 13.538  109.735 91.065  1.00 17.32 ? 328 VAL C CA  1 
ATOM   8152  C C   . VAL C  1 303 ? 12.194  109.930 91.768  1.00 17.94 ? 328 VAL C C   1 
ATOM   8153  O O   . VAL C  1 303 ? 12.111  110.618 92.776  1.00 18.85 ? 328 VAL C O   1 
ATOM   8154  C CB  . VAL C  1 303 ? 14.407  108.763 91.913  1.00 17.26 ? 328 VAL C CB  1 
ATOM   8155  C CG1 . VAL C  1 303 ? 13.662  107.418 92.131  1.00 18.48 ? 328 VAL C CG1 1 
ATOM   8156  C CG2 . VAL C  1 303 ? 15.751  108.534 91.233  1.00 17.17 ? 328 VAL C CG2 1 
ATOM   8157  N N   . LYS C  1 304 ? 11.145  109.330 91.229  1.00 18.71 ? 329 LYS C N   1 
ATOM   8158  C CA  . LYS C  1 304 ? 9.849   109.304 91.927  1.00 19.35 ? 329 LYS C CA  1 
ATOM   8159  C C   . LYS C  1 304 ? 9.239   107.951 91.622  1.00 19.77 ? 329 LYS C C   1 
ATOM   8160  O O   . LYS C  1 304 ? 9.068   107.601 90.455  1.00 19.10 ? 329 LYS C O   1 
ATOM   8161  C CB  . LYS C  1 304 ? 8.933   110.431 91.440  1.00 19.22 ? 329 LYS C CB  1 
ATOM   8162  C CG  . LYS C  1 304 ? 7.666   110.611 92.348  1.00 20.82 ? 329 LYS C CG  1 
ATOM   8163  C CD  . LYS C  1 304 ? 6.899   111.926 92.025  1.00 22.65 ? 329 LYS C CD  1 
ATOM   8164  C CE  . LYS C  1 304 ? 6.309   111.909 90.613  1.00 22.62 ? 329 LYS C CE  1 
ATOM   8165  N NZ  . LYS C  1 304 ? 5.622   113.221 90.314  1.00 22.00 ? 329 LYS C NZ  1 
ATOM   8166  N N   . GLY C  1 305 ? 8.967   107.174 92.666  1.00 20.40 ? 330 GLY C N   1 
ATOM   8167  C CA  . GLY C  1 305 ? 8.495   105.808 92.500  1.00 20.91 ? 330 GLY C CA  1 
ATOM   8168  C C   . GLY C  1 305 ? 9.525   105.042 91.693  1.00 20.59 ? 330 GLY C C   1 
ATOM   8169  O O   . GLY C  1 305 ? 10.733  105.154 91.969  1.00 19.29 ? 330 GLY C O   1 
ATOM   8170  N N   . ASN C  1 306 ? 9.074   104.269 90.706  1.00 19.86 ? 331 ASN C N   1 
ATOM   8171  C CA  . ASN C  1 306 ? 10.024  103.513 89.889  1.00 20.51 ? 331 ASN C CA  1 
ATOM   8172  C C   . ASN C  1 306 ? 10.492  104.248 88.634  1.00 19.58 ? 331 ASN C C   1 
ATOM   8173  O O   . ASN C  1 306 ? 11.031  103.612 87.739  1.00 20.45 ? 331 ASN C O   1 
ATOM   8174  C CB  . ASN C  1 306 ? 9.457   102.131 89.526  1.00 20.68 ? 331 ASN C CB  1 
ATOM   8175  C CG  . ASN C  1 306 ? 8.246   102.233 88.640  1.00 22.86 ? 331 ASN C CG  1 
ATOM   8176  O OD1 . ASN C  1 306 ? 7.828   103.329 88.282  1.00 22.16 ? 331 ASN C OD1 1 
ATOM   8177  N ND2 . ASN C  1 306 ? 7.685   101.096 88.260  1.00 24.62 ? 331 ASN C ND2 1 
ATOM   8178  N N   . GLN C  1 307 ? 10.299  105.575 88.586  1.00 18.86 ? 332 GLN C N   1 
ATOM   8179  C CA  . GLN C  1 307 ? 10.709  106.428 87.460  1.00 17.73 ? 332 GLN C CA  1 
ATOM   8180  C C   . GLN C  1 307 ? 11.994  107.205 87.766  1.00 17.14 ? 332 GLN C C   1 
ATOM   8181  O O   . GLN C  1 307 ? 12.099  107.838 88.824  1.00 17.48 ? 332 GLN C O   1 
ATOM   8182  C CB  . GLN C  1 307 ? 9.603   107.423 87.112  1.00 18.97 ? 332 GLN C CB  1 
ATOM   8183  C CG  . GLN C  1 307 ? 8.312   106.725 86.757  1.00 19.33 ? 332 GLN C CG  1 
ATOM   8184  C CD  . GLN C  1 307 ? 8.479   105.911 85.499  1.00 18.75 ? 332 GLN C CD  1 
ATOM   8185  O OE1 . GLN C  1 307 ? 8.333   104.679 85.500  1.00 22.78 ? 332 GLN C OE1 1 
ATOM   8186  N NE2 . GLN C  1 307 ? 8.772   106.585 84.416  1.00 14.81 ? 332 GLN C NE2 1 
ATOM   8187  N N   . TRP C  1 308 ? 12.954  107.157 86.835  1.00 15.48 ? 333 TRP C N   1 
ATOM   8188  C CA  . TRP C  1 308 ? 14.259  107.822 86.983  1.00 15.07 ? 333 TRP C CA  1 
ATOM   8189  C C   . TRP C  1 308 ? 14.418  108.672 85.725  1.00 14.93 ? 333 TRP C C   1 
ATOM   8190  O O   . TRP C  1 308 ? 14.259  108.160 84.619  1.00 13.99 ? 333 TRP C O   1 
ATOM   8191  C CB  . TRP C  1 308 ? 15.324  106.716 87.001  1.00 14.43 ? 333 TRP C CB  1 
ATOM   8192  C CG  . TRP C  1 308 ? 16.734  107.048 87.367  1.00 15.44 ? 333 TRP C CG  1 
ATOM   8193  C CD1 . TRP C  1 308 ? 17.373  106.709 88.537  1.00 15.09 ? 333 TRP C CD1 1 
ATOM   8194  C CD2 . TRP C  1 308 ? 17.730  107.663 86.534  1.00 15.36 ? 333 TRP C CD2 1 
ATOM   8195  N NE1 . TRP C  1 308 ? 18.686  107.122 88.490  1.00 15.41 ? 333 TRP C NE1 1 
ATOM   8196  C CE2 . TRP C  1 308 ? 18.928  107.709 87.277  1.00 16.38 ? 333 TRP C CE2 1 
ATOM   8197  C CE3 . TRP C  1 308 ? 17.713  108.213 85.244  1.00 16.48 ? 333 TRP C CE3 1 
ATOM   8198  C CZ2 . TRP C  1 308 ? 20.116  108.269 86.765  1.00 16.72 ? 333 TRP C CZ2 1 
ATOM   8199  C CZ3 . TRP C  1 308 ? 18.881  108.752 84.736  1.00 16.77 ? 333 TRP C CZ3 1 
ATOM   8200  C CH2 . TRP C  1 308 ? 20.068  108.787 85.501  1.00 16.26 ? 333 TRP C CH2 1 
ATOM   8201  N N   . VAL C  1 309 ? 14.722  109.961 85.889  1.00 14.77 ? 334 VAL C N   1 
ATOM   8202  C CA  . VAL C  1 309 ? 14.778  110.890 84.765  1.00 15.07 ? 334 VAL C CA  1 
ATOM   8203  C C   . VAL C  1 309 ? 16.074  111.685 84.850  1.00 14.79 ? 334 VAL C C   1 
ATOM   8204  O O   . VAL C  1 309 ? 16.326  112.343 85.855  1.00 15.78 ? 334 VAL C O   1 
ATOM   8205  C CB  . VAL C  1 309 ? 13.565  111.883 84.778  1.00 15.45 ? 334 VAL C CB  1 
ATOM   8206  C CG1 . VAL C  1 309 ? 13.664  112.886 83.629  1.00 16.73 ? 334 VAL C CG1 1 
ATOM   8207  C CG2 . VAL C  1 309 ? 12.238  111.133 84.704  1.00 15.91 ? 334 VAL C CG2 1 
ATOM   8208  N N   . GLY C  1 310 ? 16.909  111.593 83.815  1.00 15.09 ? 335 GLY C N   1 
ATOM   8209  C CA  . GLY C  1 310 ? 18.118  112.416 83.723  1.00 15.27 ? 335 GLY C CA  1 
ATOM   8210  C C   . GLY C  1 310 ? 17.846  113.609 82.813  1.00 15.51 ? 335 GLY C C   1 
ATOM   8211  O O   . GLY C  1 310 ? 17.426  113.430 81.667  1.00 15.40 ? 335 GLY C O   1 
ATOM   8212  N N   . TYR C  1 311 ? 18.095  114.813 83.316  1.00 15.90 ? 336 TYR C N   1 
ATOM   8213  C CA  . TYR C  1 311 ? 17.634  116.045 82.663  1.00 16.11 ? 336 TYR C CA  1 
ATOM   8214  C C   . TYR C  1 311 ? 18.598  117.214 82.907  1.00 16.70 ? 336 TYR C C   1 
ATOM   8215  O O   . TYR C  1 311 ? 19.579  117.085 83.658  1.00 16.07 ? 336 TYR C O   1 
ATOM   8216  C CB  . TYR C  1 311 ? 16.218  116.387 83.137  1.00 15.58 ? 336 TYR C CB  1 
ATOM   8217  C CG  . TYR C  1 311 ? 16.173  116.814 84.570  1.00 15.95 ? 336 TYR C CG  1 
ATOM   8218  C CD1 . TYR C  1 311 ? 16.176  115.882 85.594  1.00 16.06 ? 336 TYR C CD1 1 
ATOM   8219  C CD2 . TYR C  1 311 ? 16.170  118.159 84.905  1.00 16.13 ? 336 TYR C CD2 1 
ATOM   8220  C CE1 . TYR C  1 311 ? 16.153  116.280 86.915  1.00 16.76 ? 336 TYR C CE1 1 
ATOM   8221  C CE2 . TYR C  1 311 ? 16.146  118.568 86.226  1.00 17.19 ? 336 TYR C CE2 1 
ATOM   8222  C CZ  . TYR C  1 311 ? 16.138  117.623 87.217  1.00 16.79 ? 336 TYR C CZ  1 
ATOM   8223  O OH  . TYR C  1 311 ? 16.129  118.034 88.511  1.00 16.65 ? 336 TYR C OH  1 
ATOM   8224  N N   . ASP C  1 312 ? 18.336  118.342 82.249  1.00 16.72 ? 337 ASP C N   1 
ATOM   8225  C CA  . ASP C  1 312 ? 19.121  119.559 82.460  1.00 17.94 ? 337 ASP C CA  1 
ATOM   8226  C C   . ASP C  1 312 ? 18.221  120.647 83.032  1.00 18.40 ? 337 ASP C C   1 
ATOM   8227  O O   . ASP C  1 312 ? 17.042  120.749 82.669  1.00 18.56 ? 337 ASP C O   1 
ATOM   8228  C CB  . ASP C  1 312 ? 19.766  120.064 81.152  1.00 17.66 ? 337 ASP C CB  1 
ATOM   8229  C CG  . ASP C  1 312 ? 21.069  119.320 80.819  1.00 20.10 ? 337 ASP C CG  1 
ATOM   8230  O OD1 . ASP C  1 312 ? 20.997  118.221 80.223  1.00 20.14 ? 337 ASP C OD1 1 
ATOM   8231  O OD2 . ASP C  1 312 ? 22.165  119.809 81.197  1.00 24.10 ? 337 ASP C OD2 1 
ATOM   8232  N N   . ASP C  1 313 ? 18.783  121.449 83.925  1.00 19.24 ? 338 ASP C N   1 
ATOM   8233  C CA  . ASP C  1 313 ? 18.039  122.536 84.541  1.00 20.04 ? 338 ASP C CA  1 
ATOM   8234  C C   . ASP C  1 313 ? 18.848  123.826 84.455  1.00 21.17 ? 338 ASP C C   1 
ATOM   8235  O O   . ASP C  1 313 ? 19.932  123.864 83.836  1.00 20.12 ? 338 ASP C O   1 
ATOM   8236  C CB  . ASP C  1 313 ? 17.647  122.188 85.990  1.00 20.54 ? 338 ASP C CB  1 
ATOM   8237  C CG  . ASP C  1 313 ? 18.857  121.898 86.888  1.00 21.85 ? 338 ASP C CG  1 
ATOM   8238  O OD1 . ASP C  1 313 ? 20.027  122.087 86.460  1.00 20.05 ? 338 ASP C OD1 1 
ATOM   8239  O OD2 . ASP C  1 313 ? 18.627  121.466 88.038  1.00 22.01 ? 338 ASP C OD2 1 
ATOM   8240  N N   . VAL C  1 314 ? 18.306  124.907 85.007  1.00 21.55 ? 339 VAL C N   1 
ATOM   8241  C CA  . VAL C  1 314 ? 19.004  126.179 84.896  1.00 23.15 ? 339 VAL C CA  1 
ATOM   8242  C C   . VAL C  1 314 ? 20.445  126.096 85.388  1.00 23.43 ? 339 VAL C C   1 
ATOM   8243  O O   . VAL C  1 314 ? 21.355  126.612 84.736  1.00 24.32 ? 339 VAL C O   1 
ATOM   8244  C CB  . VAL C  1 314 ? 18.274  127.285 85.671  1.00 23.68 ? 339 VAL C CB  1 
ATOM   8245  C CG1 . VAL C  1 314 ? 19.207  128.460 85.917  1.00 26.68 ? 339 VAL C CG1 1 
ATOM   8246  C CG2 . VAL C  1 314 ? 17.012  127.707 84.888  1.00 24.41 ? 339 VAL C CG2 1 
ATOM   8247  N N   . LYS C  1 315 ? 20.652  125.438 86.524  1.00 23.07 ? 340 LYS C N   1 
ATOM   8248  C CA  . LYS C  1 315 ? 21.985  125.287 87.102  1.00 23.98 ? 340 LYS C CA  1 
ATOM   8249  C C   . LYS C  1 315 ? 22.969  124.472 86.255  1.00 23.00 ? 340 LYS C C   1 
ATOM   8250  O O   . LYS C  1 315 ? 24.113  124.882 86.079  1.00 22.39 ? 340 LYS C O   1 
ATOM   8251  C CB  . LYS C  1 315 ? 21.896  124.660 88.499  1.00 24.59 ? 340 LYS C CB  1 
ATOM   8252  C CG  . LYS C  1 315 ? 21.779  125.702 89.623  1.00 30.24 ? 340 LYS C CG  1 
ATOM   8253  C CD  . LYS C  1 315 ? 21.950  125.044 91.008  1.00 35.47 ? 340 LYS C CD  1 
ATOM   8254  C CE  . LYS C  1 315 ? 21.951  126.082 92.117  1.00 40.07 ? 340 LYS C CE  1 
ATOM   8255  N NZ  . LYS C  1 315 ? 21.669  125.466 93.456  1.00 42.53 ? 340 LYS C NZ  1 
ATOM   8256  N N   . SER C  1 316 ? 22.554  123.313 85.749  1.00 21.87 ? 341 SER C N   1 
ATOM   8257  C CA  . SER C  1 316 ? 23.494  122.538 84.895  1.00 21.75 ? 341 SER C CA  1 
ATOM   8258  C C   . SER C  1 316 ? 23.838  123.303 83.600  1.00 22.20 ? 341 SER C C   1 
ATOM   8259  O O   . SER C  1 316 ? 24.938  123.166 83.043  1.00 22.58 ? 341 SER C O   1 
ATOM   8260  C CB  . SER C  1 316 ? 22.930  121.150 84.548  1.00 21.18 ? 341 SER C CB  1 
ATOM   8261  O OG  . SER C  1 316 ? 21.749  121.251 83.749  1.00 19.48 ? 341 SER C OG  1 
ATOM   8262  N N   . MET C  1 317 ? 22.889  124.075 83.087  1.00 21.98 ? 342 MET C N   1 
ATOM   8263  C CA  . MET C  1 317 ? 23.174  124.844 81.883  1.00 22.93 ? 342 MET C CA  1 
ATOM   8264  C C   . MET C  1 317 ? 24.137  126.007 82.144  1.00 23.14 ? 342 MET C C   1 
ATOM   8265  O O   . MET C  1 317 ? 24.966  126.329 81.300  1.00 23.13 ? 342 MET C O   1 
ATOM   8266  C CB  . MET C  1 317 ? 21.891  125.337 81.256  1.00 23.59 ? 342 MET C CB  1 
ATOM   8267  C CG  . MET C  1 317 ? 21.041  124.169 80.759  1.00 23.85 ? 342 MET C CG  1 
ATOM   8268  S SD  . MET C  1 317 ? 19.769  124.732 79.660  1.00 26.96 ? 342 MET C SD  1 
ATOM   8269  C CE  . MET C  1 317 ? 18.857  123.202 79.441  1.00 24.33 ? 342 MET C CE  1 
ATOM   8270  N N   . GLU C  1 318 ? 24.024  126.632 83.305  1.00 23.20 ? 343 GLU C N   1 
ATOM   8271  C CA  . GLU C  1 318 ? 24.993  127.643 83.685  1.00 24.51 ? 343 GLU C CA  1 
ATOM   8272  C C   . GLU C  1 318 ? 26.411  127.040 83.673  1.00 23.78 ? 343 GLU C C   1 
ATOM   8273  O O   . GLU C  1 318 ? 27.352  127.623 83.129  1.00 23.62 ? 343 GLU C O   1 
ATOM   8274  C CB  . GLU C  1 318 ? 24.631  128.244 85.054  1.00 26.13 ? 343 GLU C CB  1 
ATOM   8275  C CG  . GLU C  1 318 ? 23.332  129.071 84.986  1.00 29.32 ? 343 GLU C CG  1 
ATOM   8276  C CD  . GLU C  1 318 ? 22.867  129.636 86.326  1.00 35.32 ? 343 GLU C CD  1 
ATOM   8277  O OE1 . GLU C  1 318 ? 23.209  129.073 87.399  1.00 38.09 ? 343 GLU C OE1 1 
ATOM   8278  O OE2 . GLU C  1 318 ? 22.145  130.662 86.297  1.00 38.05 ? 343 GLU C OE2 1 
ATOM   8279  N N   . THR C  1 319 ? 26.563  125.867 84.266  1.00 22.50 ? 344 THR C N   1 
ATOM   8280  C CA  . THR C  1 319 ? 27.874  125.197 84.253  1.00 22.69 ? 344 THR C CA  1 
ATOM   8281  C C   . THR C  1 319 ? 28.329  124.875 82.840  1.00 21.80 ? 344 THR C C   1 
ATOM   8282  O O   . THR C  1 319 ? 29.495  125.066 82.492  1.00 21.96 ? 344 THR C O   1 
ATOM   8283  C CB  . THR C  1 319 ? 27.840  123.921 85.104  1.00 22.91 ? 344 THR C CB  1 
ATOM   8284  O OG1 . THR C  1 319 ? 27.497  124.287 86.438  1.00 23.92 ? 344 THR C OG1 1 
ATOM   8285  C CG2 . THR C  1 319 ? 29.206  123.226 85.126  1.00 23.30 ? 344 THR C CG2 1 
ATOM   8286  N N   . LYS C  1 320 ? 27.407  124.384 82.015  1.00 20.15 ? 345 LYS C N   1 
ATOM   8287  C CA  . LYS C  1 320 ? 27.721  124.120 80.619  1.00 19.76 ? 345 LYS C CA  1 
ATOM   8288  C C   . LYS C  1 320 ? 28.161  125.362 79.851  1.00 20.85 ? 345 LYS C C   1 
ATOM   8289  O O   . LYS C  1 320 ? 29.057  125.288 79.021  1.00 21.29 ? 345 LYS C O   1 
ATOM   8290  C CB  . LYS C  1 320 ? 26.544  123.424 79.921  1.00 18.81 ? 345 LYS C CB  1 
ATOM   8291  C CG  . LYS C  1 320 ? 26.418  121.942 80.367  1.00 17.61 ? 345 LYS C CG  1 
ATOM   8292  C CD  . LYS C  1 320 ? 25.216  121.253 79.740  1.00 17.11 ? 345 LYS C CD  1 
ATOM   8293  C CE  . LYS C  1 320 ? 25.241  119.764 80.030  1.00 17.17 ? 345 LYS C CE  1 
ATOM   8294  N NZ  . LYS C  1 320 ? 23.988  119.096 79.581  1.00 18.43 ? 345 LYS C NZ  1 
ATOM   8295  N N   . VAL C  1 321 ? 27.544  126.504 80.134  1.00 20.80 ? 346 VAL C N   1 
ATOM   8296  C CA  . VAL C  1 321 ? 27.973  127.747 79.504  1.00 21.89 ? 346 VAL C CA  1 
ATOM   8297  C C   . VAL C  1 321 ? 29.341  128.188 80.010  1.00 23.15 ? 346 VAL C C   1 
ATOM   8298  O O   . VAL C  1 321 ? 30.136  128.669 79.226  1.00 23.70 ? 346 VAL C O   1 
ATOM   8299  C CB  . VAL C  1 321 ? 26.952  128.877 79.677  1.00 22.14 ? 346 VAL C CB  1 
ATOM   8300  C CG1 . VAL C  1 321 ? 27.518  130.206 79.174  1.00 23.29 ? 346 VAL C CG1 1 
ATOM   8301  C CG2 . VAL C  1 321 ? 25.652  128.538 78.942  1.00 20.79 ? 346 VAL C CG2 1 
ATOM   8302  N N   . GLN C  1 322 ? 29.629  128.029 81.306  1.00 23.91 ? 347 GLN C N   1 
ATOM   8303  C CA  . GLN C  1 322 ? 30.968  128.403 81.796  1.00 25.57 ? 347 GLN C CA  1 
ATOM   8304  C C   . GLN C  1 322 ? 31.988  127.582 81.028  1.00 24.76 ? 347 GLN C C   1 
ATOM   8305  O O   . GLN C  1 322 ? 33.069  128.063 80.667  1.00 25.28 ? 347 GLN C O   1 
ATOM   8306  C CB  . GLN C  1 322 ? 31.144  128.109 83.287  1.00 26.84 ? 347 GLN C CB  1 
ATOM   8307  C CG  . GLN C  1 322 ? 30.362  128.977 84.259  1.00 32.67 ? 347 GLN C CG  1 
ATOM   8308  C CD  . GLN C  1 322 ? 30.067  128.248 85.590  1.00 38.78 ? 347 GLN C CD  1 
ATOM   8309  O OE1 . GLN C  1 322 ? 30.933  127.555 86.144  1.00 40.99 ? 347 GLN C OE1 1 
ATOM   8310  N NE2 . GLN C  1 322 ? 28.835  128.392 86.090  1.00 39.91 ? 347 GLN C NE2 1 
ATOM   8311  N N   . PHE C  1 323 ? 31.649  126.318 80.817  1.00 23.22 ? 348 PHE C N   1 
ATOM   8312  C CA  . PHE C  1 323 ? 32.518  125.410 80.094  1.00 23.20 ? 348 PHE C CA  1 
ATOM   8313  C C   . PHE C  1 323 ? 32.741  125.835 78.637  1.00 23.26 ? 348 PHE C C   1 
ATOM   8314  O O   . PHE C  1 323 ? 33.872  126.004 78.219  1.00 24.00 ? 348 PHE C O   1 
ATOM   8315  C CB  . PHE C  1 323 ? 32.009  123.970 80.170  1.00 21.79 ? 348 PHE C CB  1 
ATOM   8316  C CG  . PHE C  1 323 ? 32.672  123.049 79.177  1.00 22.01 ? 348 PHE C CG  1 
ATOM   8317  C CD1 . PHE C  1 323 ? 33.894  122.454 79.467  1.00 24.10 ? 348 PHE C CD1 1 
ATOM   8318  C CD2 . PHE C  1 323 ? 32.076  122.797 77.945  1.00 20.47 ? 348 PHE C CD2 1 
ATOM   8319  C CE1 . PHE C  1 323 ? 34.512  121.609 78.536  1.00 24.54 ? 348 PHE C CE1 1 
ATOM   8320  C CE2 . PHE C  1 323 ? 32.683  121.966 77.016  1.00 21.72 ? 348 PHE C CE2 1 
ATOM   8321  C CZ  . PHE C  1 323 ? 33.901  121.377 77.300  1.00 22.83 ? 348 PHE C CZ  1 
ATOM   8322  N N   . LEU C  1 324 ? 31.670  126.034 77.878  1.00 22.92 ? 349 LEU C N   1 
ATOM   8323  C CA  . LEU C  1 324 ? 31.827  126.430 76.468  1.00 23.68 ? 349 LEU C CA  1 
ATOM   8324  C C   . LEU C  1 324 ? 32.635  127.726 76.305  1.00 25.13 ? 349 LEU C C   1 
ATOM   8325  O O   . LEU C  1 324 ? 33.385  127.882 75.331  1.00 26.13 ? 349 LEU C O   1 
ATOM   8326  C CB  . LEU C  1 324 ? 30.469  126.502 75.746  1.00 22.34 ? 349 LEU C CB  1 
ATOM   8327  C CG  . LEU C  1 324 ? 29.564  127.732 75.876  1.00 22.88 ? 349 LEU C CG  1 
ATOM   8328  C CD1 . LEU C  1 324 ? 29.969  128.816 74.882  1.00 21.47 ? 349 LEU C CD1 1 
ATOM   8329  C CD2 . LEU C  1 324 ? 28.129  127.272 75.613  1.00 21.46 ? 349 LEU C CD2 1 
ATOM   8330  N N   . LYS C  1 325 ? 32.494  128.651 77.249  1.00 25.78 ? 350 LYS C N   1 
ATOM   8331  C CA  . LYS C  1 325 ? 33.287  129.883 77.203  1.00 27.50 ? 350 LYS C CA  1 
ATOM   8332  C C   . LYS C  1 325 ? 34.754  129.615 77.472  1.00 28.62 ? 350 LYS C C   1 
ATOM   8333  O O   . LYS C  1 325 ? 35.643  130.182 76.821  1.00 29.37 ? 350 LYS C O   1 
ATOM   8334  C CB  . LYS C  1 325 ? 32.802  130.886 78.244  1.00 28.58 ? 350 LYS C CB  1 
ATOM   8335  C CG  . LYS C  1 325 ? 31.442  131.492 77.951  1.00 29.07 ? 350 LYS C CG  1 
ATOM   8336  C CD  . LYS C  1 325 ? 31.190  132.578 78.997  1.00 32.80 ? 350 LYS C CD  1 
ATOM   8337  C CE  . LYS C  1 325 ? 29.904  133.313 78.760  1.00 33.99 ? 350 LYS C CE  1 
ATOM   8338  N NZ  . LYS C  1 325 ? 29.768  134.392 79.788  1.00 35.53 ? 350 LYS C NZ  1 
ATOM   8339  N N   . ASN C  1 326 ? 35.017  128.760 78.448  1.00 28.79 ? 351 ASN C N   1 
ATOM   8340  C CA  . ASN C  1 326 ? 36.389  128.419 78.781  1.00 30.87 ? 351 ASN C CA  1 
ATOM   8341  C C   . ASN C  1 326 ? 37.078  127.699 77.640  1.00 30.44 ? 351 ASN C C   1 
ATOM   8342  O O   . ASN C  1 326 ? 38.299  127.743 77.524  1.00 31.51 ? 351 ASN C O   1 
ATOM   8343  C CB  . ASN C  1 326 ? 36.437  127.547 80.036  1.00 30.54 ? 351 ASN C CB  1 
ATOM   8344  C CG  . ASN C  1 326 ? 36.374  128.370 81.291  1.00 35.56 ? 351 ASN C CG  1 
ATOM   8345  O OD1 . ASN C  1 326 ? 36.114  129.576 81.232  1.00 39.70 ? 351 ASN C OD1 1 
ATOM   8346  N ND2 . ASN C  1 326 ? 36.628  127.746 82.433  1.00 36.27 ? 351 ASN C ND2 1 
ATOM   8347  N N   . LEU C  1 327 ? 36.298  127.003 76.821  1.00 28.97 ? 352 LEU C N   1 
ATOM   8348  C CA  . LEU C  1 327 ? 36.878  126.281 75.694  1.00 29.11 ? 352 LEU C CA  1 
ATOM   8349  C C   . LEU C  1 327 ? 36.777  127.051 74.378  1.00 29.68 ? 352 LEU C C   1 
ATOM   8350  O O   . LEU C  1 327 ? 36.952  126.469 73.309  1.00 29.30 ? 352 LEU C O   1 
ATOM   8351  C CB  . LEU C  1 327 ? 36.264  124.890 75.551  1.00 28.01 ? 352 LEU C CB  1 
ATOM   8352  C CG  . LEU C  1 327 ? 37.121  123.863 76.288  1.00 29.54 ? 352 LEU C CG  1 
ATOM   8353  C CD1 . LEU C  1 327 ? 36.917  123.941 77.803  1.00 27.22 ? 352 LEU C CD1 1 
ATOM   8354  C CD2 . LEU C  1 327 ? 36.827  122.493 75.782  1.00 31.51 ? 352 LEU C CD2 1 
ATOM   8355  N N   . ASN C  1 328 ? 36.506  128.353 74.483  1.00 29.82 ? 353 ASN C N   1 
ATOM   8356  C CA  . ASN C  1 328 ? 36.351  129.253 73.334  1.00 30.00 ? 353 ASN C CA  1 
ATOM   8357  C C   . ASN C  1 328 ? 35.526  128.680 72.194  1.00 28.23 ? 353 ASN C C   1 
ATOM   8358  O O   . ASN C  1 328 ? 35.904  128.759 71.027  1.00 28.71 ? 353 ASN C O   1 
ATOM   8359  C CB  . ASN C  1 328 ? 37.715  129.726 72.848  1.00 31.97 ? 353 ASN C CB  1 
ATOM   8360  C CG  . ASN C  1 328 ? 38.546  130.306 73.977  1.00 35.00 ? 353 ASN C CG  1 
ATOM   8361  O OD1 . ASN C  1 328 ? 39.654  129.845 74.261  1.00 38.62 ? 353 ASN C OD1 1 
ATOM   8362  N ND2 . ASN C  1 328 ? 37.993  131.301 74.653  1.00 36.49 ? 353 ASN C ND2 1 
ATOM   8363  N N   . LEU C  1 329 ? 34.389  128.103 72.538  1.00 25.95 ? 354 LEU C N   1 
ATOM   8364  C CA  . LEU C  1 329 ? 33.511  127.534 71.527  1.00 24.59 ? 354 LEU C CA  1 
ATOM   8365  C C   . LEU C  1 329 ? 32.712  128.652 70.886  1.00 24.61 ? 354 LEU C C   1 
ATOM   8366  O O   . LEU C  1 329 ? 32.777  129.792 71.333  1.00 24.89 ? 354 LEU C O   1 
ATOM   8367  C CB  . LEU C  1 329 ? 32.596  126.483 72.161  1.00 22.81 ? 354 LEU C CB  1 
ATOM   8368  C CG  . LEU C  1 329 ? 33.338  125.361 72.903  1.00 22.90 ? 354 LEU C CG  1 
ATOM   8369  C CD1 . LEU C  1 329 ? 32.352  124.272 73.354  1.00 20.72 ? 354 LEU C CD1 1 
ATOM   8370  C CD2 . LEU C  1 329 ? 34.457  124.764 72.018  1.00 22.19 ? 354 LEU C CD2 1 
ATOM   8371  N N   . GLY C  1 330 ? 31.952  128.333 69.847  1.00 24.39 ? 355 GLY C N   1 
ATOM   8372  C CA  . GLY C  1 330 ? 31.218  129.362 69.113  1.00 25.37 ? 355 GLY C CA  1 
ATOM   8373  C C   . GLY C  1 330 ? 29.914  129.794 69.763  1.00 24.68 ? 355 GLY C C   1 
ATOM   8374  O O   . GLY C  1 330 ? 29.387  130.859 69.462  1.00 25.72 ? 355 GLY C O   1 
ATOM   8375  N N   . GLY C  1 331 ? 29.387  128.985 70.665  1.00 23.96 ? 356 GLY C N   1 
ATOM   8376  C CA  . GLY C  1 331 ? 28.155  129.365 71.367  1.00 23.53 ? 356 GLY C CA  1 
ATOM   8377  C C   . GLY C  1 331 ? 27.419  128.114 71.781  1.00 22.24 ? 356 GLY C C   1 
ATOM   8378  O O   . GLY C  1 331 ? 28.024  127.051 71.838  1.00 21.46 ? 356 GLY C O   1 
ATOM   8379  N N   . ALA C  1 332 ? 26.113  128.232 72.049  1.00 21.51 ? 357 ALA C N   1 
ATOM   8380  C CA  . ALA C  1 332 ? 25.311  127.083 72.446  1.00 19.77 ? 357 ALA C CA  1 
ATOM   8381  C C   . ALA C  1 332 ? 24.211  126.825 71.418  1.00 19.52 ? 357 ALA C C   1 
ATOM   8382  O O   . ALA C  1 332 ? 23.735  127.758 70.758  1.00 19.68 ? 357 ALA C O   1 
ATOM   8383  C CB  . ALA C  1 332 ? 24.698  127.326 73.829  1.00 19.92 ? 357 ALA C CB  1 
ATOM   8384  N N   . MET C  1 333 ? 23.834  125.560 71.251  1.00 18.89 ? 358 MET C N   1 
ATOM   8385  C CA  . MET C  1 333 ? 22.680  125.217 70.434  1.00 18.21 ? 358 MET C CA  1 
ATOM   8386  C C   . MET C  1 333 ? 21.647  124.564 71.363  1.00 17.70 ? 358 MET C C   1 
ATOM   8387  O O   . MET C  1 333 ? 22.025  123.938 72.358  1.00 17.85 ? 358 MET C O   1 
ATOM   8388  C CB  . MET C  1 333 ? 23.108  124.269 69.304  1.00 18.65 ? 358 MET C CB  1 
ATOM   8389  C CG  . MET C  1 333 ? 21.958  123.643 68.529  1.00 16.47 ? 358 MET C CG  1 
ATOM   8390  S SD  . MET C  1 333 ? 21.411  122.093 69.303  1.00 18.12 ? 358 MET C SD  1 
ATOM   8391  C CE  . MET C  1 333 ? 22.683  120.992 68.720  1.00 16.11 ? 358 MET C CE  1 
ATOM   8392  N N   . ILE C  1 334 ? 20.362  124.736 71.075  1.00 17.63 ? 359 ILE C N   1 
ATOM   8393  C CA  . ILE C  1 334 ? 19.318  124.176 71.923  1.00 17.69 ? 359 ILE C CA  1 
ATOM   8394  C C   . ILE C  1 334 ? 18.476  123.206 71.121  1.00 17.53 ? 359 ILE C C   1 
ATOM   8395  O O   . ILE C  1 334 ? 17.915  123.591 70.105  1.00 17.96 ? 359 ILE C O   1 
ATOM   8396  C CB  . ILE C  1 334 ? 18.332  125.268 72.434  1.00 18.30 ? 359 ILE C CB  1 
ATOM   8397  C CG1 . ILE C  1 334 ? 19.053  126.414 73.155  1.00 19.58 ? 359 ILE C CG1 1 
ATOM   8398  C CG2 . ILE C  1 334 ? 17.302  124.644 73.349  1.00 18.90 ? 359 ILE C CG2 1 
ATOM   8399  C CD1 . ILE C  1 334 ? 19.755  125.972 74.469  1.00 21.48 ? 359 ILE C CD1 1 
ATOM   8400  N N   . TRP C  1 335 ? 18.360  121.964 71.576  1.00 16.93 ? 360 TRP C N   1 
ATOM   8401  C CA  . TRP C  1 335 ? 17.359  121.077 71.020  1.00 16.87 ? 360 TRP C CA  1 
ATOM   8402  C C   . TRP C  1 335 ? 16.316  120.750 72.112  1.00 16.78 ? 360 TRP C C   1 
ATOM   8403  O O   . TRP C  1 335 ? 16.635  120.008 73.042  1.00 16.56 ? 360 TRP C O   1 
ATOM   8404  C CB  . TRP C  1 335 ? 17.987  119.770 70.442  1.00 16.49 ? 360 TRP C CB  1 
ATOM   8405  C CG  . TRP C  1 335 ? 16.881  118.940 69.858  1.00 16.84 ? 360 TRP C CG  1 
ATOM   8406  C CD1 . TRP C  1 335 ? 16.025  118.102 70.541  1.00 16.52 ? 360 TRP C CD1 1 
ATOM   8407  C CD2 . TRP C  1 335 ? 16.419  118.965 68.499  1.00 16.31 ? 360 TRP C CD2 1 
ATOM   8408  N NE1 . TRP C  1 335 ? 15.067  117.597 69.674  1.00 15.70 ? 360 TRP C NE1 1 
ATOM   8409  C CE2 . TRP C  1 335 ? 15.292  118.111 68.421  1.00 15.93 ? 360 TRP C CE2 1 
ATOM   8410  C CE3 . TRP C  1 335 ? 16.859  119.616 67.336  1.00 16.04 ? 360 TRP C CE3 1 
ATOM   8411  C CZ2 . TRP C  1 335 ? 14.598  117.892 67.224  1.00 15.92 ? 360 TRP C CZ2 1 
ATOM   8412  C CZ3 . TRP C  1 335 ? 16.138  119.415 66.137  1.00 14.04 ? 360 TRP C CZ3 1 
ATOM   8413  C CH2 . TRP C  1 335 ? 15.035  118.557 66.099  1.00 17.29 ? 360 TRP C CH2 1 
ATOM   8414  N N   . SER C  1 336 ? 15.088  121.283 72.039  1.00 16.49 ? 361 SER C N   1 
ATOM   8415  C CA  . SER C  1 336 ? 14.641  122.284 71.076  1.00 16.93 ? 361 SER C CA  1 
ATOM   8416  C C   . SER C  1 336 ? 13.767  123.297 71.850  1.00 17.92 ? 361 SER C C   1 
ATOM   8417  O O   . SER C  1 336 ? 13.254  122.998 72.934  1.00 18.74 ? 361 SER C O   1 
ATOM   8418  C CB  . SER C  1 336 ? 13.845  121.645 69.937  1.00 16.59 ? 361 SER C CB  1 
ATOM   8419  O OG  . SER C  1 336 ? 12.714  120.963 70.438  1.00 16.82 ? 361 SER C OG  1 
ATOM   8420  N N   . ILE C  1 337 ? 13.618  124.507 71.352  1.00 17.78 ? 362 ILE C N   1 
ATOM   8421  C CA  . ILE C  1 337 ? 13.013  125.519 72.220  1.00 18.61 ? 362 ILE C CA  1 
ATOM   8422  C C   . ILE C  1 337 ? 11.533  125.223 72.506  1.00 18.84 ? 362 ILE C C   1 
ATOM   8423  O O   . ILE C  1 337 ? 10.968  125.719 73.488  1.00 18.80 ? 362 ILE C O   1 
ATOM   8424  C CB  . ILE C  1 337 ? 13.189  126.914 71.665  1.00 19.55 ? 362 ILE C CB  1 
ATOM   8425  C CG1 . ILE C  1 337 ? 12.498  127.027 70.296  1.00 19.36 ? 362 ILE C CG1 1 
ATOM   8426  C CG2 . ILE C  1 337 ? 14.666  127.205 71.503  1.00 19.70 ? 362 ILE C CG2 1 
ATOM   8427  C CD1 . ILE C  1 337 ? 12.428  128.484 69.770  1.00 22.65 ? 362 ILE C CD1 1 
ATOM   8428  N N   . ASP C  1 338 ? 10.918  124.398 71.665  1.00 18.02 ? 363 ASP C N   1 
ATOM   8429  C CA  . ASP C  1 338 ? 9.522   124.071 71.896  1.00 19.08 ? 363 ASP C CA  1 
ATOM   8430  C C   . ASP C  1 338 ? 9.305   123.027 72.990  1.00 18.34 ? 363 ASP C C   1 
ATOM   8431  O O   . ASP C  1 338 ? 8.172   122.672 73.279  1.00 19.05 ? 363 ASP C O   1 
ATOM   8432  C CB  . ASP C  1 338 ? 8.753   123.725 70.593  1.00 20.12 ? 363 ASP C CB  1 
ATOM   8433  C CG  . ASP C  1 338 ? 9.571   122.910 69.585  1.00 21.38 ? 363 ASP C CG  1 
ATOM   8434  O OD1 . ASP C  1 338 ? 10.780  122.636 69.802  1.00 20.98 ? 363 ASP C OD1 1 
ATOM   8435  O OD2 . ASP C  1 338 ? 8.975   122.582 68.523  1.00 22.16 ? 363 ASP C OD2 1 
ATOM   8436  N N   . MET C  1 339 ? 10.393  122.537 73.588  1.00 17.51 ? 364 MET C N   1 
ATOM   8437  C CA  . MET C  1 339 ? 10.309  121.652 74.756  1.00 16.95 ? 364 MET C CA  1 
ATOM   8438  C C   . MET C  1 339 ? 10.777  122.325 76.061  1.00 17.02 ? 364 MET C C   1 
ATOM   8439  O O   . MET C  1 339 ? 10.658  121.763 77.141  1.00 16.34 ? 364 MET C O   1 
ATOM   8440  C CB  . MET C  1 339 ? 11.088  120.345 74.506  1.00 16.45 ? 364 MET C CB  1 
ATOM   8441  C CG  . MET C  1 339 ? 10.457  119.491 73.355  1.00 16.21 ? 364 MET C CG  1 
ATOM   8442  S SD  . MET C  1 339 ? 11.164  117.825 73.297  1.00 18.03 ? 364 MET C SD  1 
ATOM   8443  C CE  . MET C  1 339 ? 12.828  118.274 72.852  1.00 16.41 ? 364 MET C CE  1 
ATOM   8444  N N   . ASP C  1 340 ? 11.315  123.530 75.946  1.00 17.94 ? 365 ASP C N   1 
ATOM   8445  C CA  . ASP C  1 340 ? 11.469  124.406 77.105  1.00 17.58 ? 365 ASP C CA  1 
ATOM   8446  C C   . ASP C  1 340 ? 10.049  124.831 77.532  1.00 19.14 ? 365 ASP C C   1 
ATOM   8447  O O   . ASP C  1 340 ? 9.093   124.616 76.779  1.00 18.57 ? 365 ASP C O   1 
ATOM   8448  C CB  . ASP C  1 340 ? 12.299  125.605 76.683  1.00 17.93 ? 365 ASP C CB  1 
ATOM   8449  C CG  . ASP C  1 340 ? 12.827  126.427 77.859  1.00 19.44 ? 365 ASP C CG  1 
ATOM   8450  O OD1 . ASP C  1 340 ? 12.533  126.104 79.036  1.00 19.31 ? 365 ASP C OD1 1 
ATOM   8451  O OD2 . ASP C  1 340 ? 13.536  127.419 77.583  1.00 20.44 ? 365 ASP C OD2 1 
ATOM   8452  N N   . ASP C  1 341 ? 9.889   125.413 78.723  1.00 19.06 ? 366 ASP C N   1 
ATOM   8453  C CA  . ASP C  1 341 ? 8.560   125.903 79.141  1.00 20.86 ? 366 ASP C CA  1 
ATOM   8454  C C   . ASP C  1 341 ? 8.275   127.215 78.415  1.00 21.03 ? 366 ASP C C   1 
ATOM   8455  O O   . ASP C  1 341 ? 8.247   128.296 79.012  1.00 21.88 ? 366 ASP C O   1 
ATOM   8456  C CB  . ASP C  1 341 ? 8.474   126.050 80.672  1.00 20.40 ? 366 ASP C CB  1 
ATOM   8457  C CG  . ASP C  1 341 ? 7.065   126.392 81.175  1.00 24.23 ? 366 ASP C CG  1 
ATOM   8458  O OD1 . ASP C  1 341 ? 6.065   126.090 80.481  1.00 25.07 ? 366 ASP C OD1 1 
ATOM   8459  O OD2 . ASP C  1 341 ? 6.957   126.975 82.291  1.00 24.20 ? 366 ASP C OD2 1 
ATOM   8460  N N   . PHE C  1 342 ? 8.061   127.114 77.110  1.00 21.13 ? 367 PHE C N   1 
ATOM   8461  C CA  . PHE C  1 342 ? 7.976   128.309 76.263  1.00 22.21 ? 367 PHE C CA  1 
ATOM   8462  C C   . PHE C  1 342 ? 6.841   129.271 76.651  1.00 24.36 ? 367 PHE C C   1 
ATOM   8463  O O   . PHE C  1 342 ? 6.978   130.482 76.465  1.00 25.14 ? 367 PHE C O   1 
ATOM   8464  C CB  . PHE C  1 342 ? 7.919   127.941 74.768  1.00 21.12 ? 367 PHE C CB  1 
ATOM   8465  C CG  . PHE C  1 342 ? 6.744   127.070 74.399  1.00 21.71 ? 367 PHE C CG  1 
ATOM   8466  C CD1 . PHE C  1 342 ? 6.832   125.696 74.471  1.00 21.74 ? 367 PHE C CD1 1 
ATOM   8467  C CD2 . PHE C  1 342 ? 5.551   127.641 73.986  1.00 23.04 ? 367 PHE C CD2 1 
ATOM   8468  C CE1 . PHE C  1 342 ? 5.722   124.884 74.128  1.00 21.67 ? 367 PHE C CE1 1 
ATOM   8469  C CE2 . PHE C  1 342 ? 4.448   126.849 73.628  1.00 24.64 ? 367 PHE C CE2 1 
ATOM   8470  C CZ  . PHE C  1 342 ? 4.538   125.464 73.717  1.00 22.05 ? 367 PHE C CZ  1 
ATOM   8471  N N   . THR C  1 343 ? 5.737   128.761 77.200  1.00 24.62 ? 368 THR C N   1 
ATOM   8472  C CA  . THR C  1 343 ? 4.649   129.649 77.640  1.00 26.78 ? 368 THR C CA  1 
ATOM   8473  C C   . THR C  1 343 ? 4.804   130.143 79.072  1.00 27.79 ? 368 THR C C   1 
ATOM   8474  O O   . THR C  1 343 ? 4.107   131.064 79.478  1.00 28.60 ? 368 THR C O   1 
ATOM   8475  C CB  . THR C  1 343 ? 3.273   128.973 77.620  1.00 26.92 ? 368 THR C CB  1 
ATOM   8476  O OG1 . THR C  1 343 ? 3.260   127.917 78.580  1.00 25.87 ? 368 THR C OG1 1 
ATOM   8477  C CG2 . THR C  1 343 ? 2.928   128.430 76.236  1.00 28.17 ? 368 THR C CG2 1 
ATOM   8478  N N   . GLY C  1 344 ? 5.680   129.509 79.850  1.00 27.12 ? 369 GLY C N   1 
ATOM   8479  C CA  . GLY C  1 344 ? 5.811   129.863 81.263  1.00 28.55 ? 369 GLY C CA  1 
ATOM   8480  C C   . GLY C  1 344 ? 4.720   129.277 82.146  1.00 29.80 ? 369 GLY C C   1 
ATOM   8481  O O   . GLY C  1 344 ? 4.715   129.484 83.361  1.00 30.92 ? 369 GLY C O   1 
ATOM   8482  N N   . LYS C  1 345 ? 3.792   128.523 81.565  1.00 29.90 ? 370 LYS C N   1 
ATOM   8483  C CA  . LYS C  1 345 ? 2.657   128.030 82.358  1.00 31.31 ? 370 LYS C CA  1 
ATOM   8484  C C   . LYS C  1 345 ? 2.972   126.867 83.278  1.00 30.31 ? 370 LYS C C   1 
ATOM   8485  O O   . LYS C  1 345 ? 2.203   126.572 84.188  1.00 30.93 ? 370 LYS C O   1 
ATOM   8486  C CB  . LYS C  1 345 ? 1.516   127.593 81.452  1.00 31.81 ? 370 LYS C CB  1 
ATOM   8487  C CG  . LYS C  1 345 ? 0.884   128.694 80.679  1.00 35.36 ? 370 LYS C CG  1 
ATOM   8488  C CD  . LYS C  1 345 ? -0.363  128.137 80.026  1.00 39.51 ? 370 LYS C CD  1 
ATOM   8489  C CE  . LYS C  1 345 ? -1.226  129.251 79.558  1.00 43.01 ? 370 LYS C CE  1 
ATOM   8490  N NZ  . LYS C  1 345 ? -0.594  129.866 78.359  1.00 45.53 ? 370 LYS C NZ  1 
ATOM   8491  N N   . SER C  1 346 ? 4.065   126.163 83.042  1.00 28.98 ? 371 SER C N   1 
ATOM   8492  C CA  . SER C  1 346 ? 4.270   124.937 83.815  1.00 28.84 ? 371 SER C CA  1 
ATOM   8493  C C   . SER C  1 346 ? 5.258   125.094 84.962  1.00 28.50 ? 371 SER C C   1 
ATOM   8494  O O   . SER C  1 346 ? 5.039   124.569 86.039  1.00 29.20 ? 371 SER C O   1 
ATOM   8495  C CB  . SER C  1 346 ? 4.709   123.763 82.920  1.00 27.51 ? 371 SER C CB  1 
ATOM   8496  O OG  . SER C  1 346 ? 4.933   122.595 83.707  1.00 28.29 ? 371 SER C OG  1 
ATOM   8497  N N   . CYS C  1 347 ? 6.350   125.809 84.728  1.00 27.75 ? 372 CYS C N   1 
ATOM   8498  C CA  . CYS C  1 347 ? 7.481   125.737 85.641  1.00 26.80 ? 372 CYS C CA  1 
ATOM   8499  C C   . CYS C  1 347 ? 7.620   126.928 86.585  1.00 27.99 ? 372 CYS C C   1 
ATOM   8500  O O   . CYS C  1 347 ? 8.505   126.931 87.426  1.00 27.49 ? 372 CYS C O   1 
ATOM   8501  C CB  . CYS C  1 347 ? 8.761   125.602 84.843  1.00 26.12 ? 372 CYS C CB  1 
ATOM   8502  S SG  . CYS C  1 347 ? 8.814   124.097 83.816  1.00 25.71 ? 372 CYS C SG  1 
ATOM   8503  N N   . ASN C  1 348 ? 6.787   127.943 86.401  1.00 28.32 ? 373 ASN C N   1 
ATOM   8504  C CA  . ASN C  1 348 ? 6.809   129.154 87.257  1.00 30.69 ? 373 ASN C CA  1 
ATOM   8505  C C   . ASN C  1 348 ? 8.175   129.874 87.253  1.00 30.31 ? 373 ASN C C   1 
ATOM   8506  O O   . ASN C  1 348 ? 8.592   130.460 88.250  1.00 30.78 ? 373 ASN C O   1 
ATOM   8507  C CB  . ASN C  1 348 ? 6.376   128.807 88.683  1.00 31.48 ? 373 ASN C CB  1 
ATOM   8508  C CG  . ASN C  1 348 ? 6.161   130.035 89.548  1.00 34.87 ? 373 ASN C CG  1 
ATOM   8509  O OD1 . ASN C  1 348 ? 6.539   130.042 90.716  1.00 38.35 ? 373 ASN C OD1 1 
ATOM   8510  N ND2 . ASN C  1 348 ? 5.580   131.091 88.973  1.00 35.68 ? 373 ASN C ND2 1 
ATOM   8511  N N   . GLN C  1 349 ? 8.861   129.848 86.114  1.00 28.58 ? 374 GLN C N   1 
ATOM   8512  C CA  . GLN C  1 349 ? 10.175  130.476 86.017  1.00 28.14 ? 374 GLN C CA  1 
ATOM   8513  C C   . GLN C  1 349 ? 10.164  131.476 84.863  1.00 27.98 ? 374 GLN C C   1 
ATOM   8514  O O   . GLN C  1 349 ? 11.217  131.841 84.356  1.00 27.90 ? 374 GLN C O   1 
ATOM   8515  C CB  . GLN C  1 349 ? 11.286  129.430 85.799  1.00 26.74 ? 374 GLN C CB  1 
ATOM   8516  C CG  . GLN C  1 349 ? 11.663  128.476 86.996  1.00 27.37 ? 374 GLN C CG  1 
ATOM   8517  C CD  . GLN C  1 349 ? 12.609  127.291 86.570  1.00 30.51 ? 374 GLN C CD  1 
ATOM   8518  O OE1 . GLN C  1 349 ? 12.185  126.328 85.906  1.00 29.85 ? 374 GLN C OE1 1 
ATOM   8519  N NE2 . GLN C  1 349 ? 13.884  127.373 86.963  1.00 29.64 ? 374 GLN C NE2 1 
ATOM   8520  N N   . GLY C  1 350 ? 8.974   131.886 84.424  1.00 28.02 ? 375 GLY C N   1 
ATOM   8521  C CA  . GLY C  1 350 ? 8.840   132.773 83.243  1.00 28.15 ? 375 GLY C CA  1 
ATOM   8522  C C   . GLY C  1 350 ? 8.940   131.993 81.934  1.00 26.68 ? 375 GLY C C   1 
ATOM   8523  O O   . GLY C  1 350 ? 9.214   130.804 81.957  1.00 25.65 ? 375 GLY C O   1 
ATOM   8524  N N   . PRO C  1 351 ? 8.729   132.654 80.783  1.00 26.85 ? 376 PRO C N   1 
ATOM   8525  C CA  . PRO C  1 351 ? 8.794   131.967 79.481  1.00 25.75 ? 376 PRO C CA  1 
ATOM   8526  C C   . PRO C  1 351 ? 10.237  131.595 79.059  1.00 24.80 ? 376 PRO C C   1 
ATOM   8527  O O   . PRO C  1 351 ? 11.162  132.357 79.319  1.00 24.70 ? 376 PRO C O   1 
ATOM   8528  C CB  . PRO C  1 351 ? 8.155   132.966 78.497  1.00 26.87 ? 376 PRO C CB  1 
ATOM   8529  C CG  . PRO C  1 351 ? 8.042   134.262 79.221  1.00 28.49 ? 376 PRO C CG  1 
ATOM   8530  C CD  . PRO C  1 351 ? 8.478   134.102 80.653  1.00 28.47 ? 376 PRO C CD  1 
ATOM   8531  N N   . TYR C  1 352 ? 10.410  130.411 78.467  1.00 23.60 ? 377 TYR C N   1 
ATOM   8532  C CA  . TYR C  1 352 ? 11.734  129.879 78.098  1.00 22.45 ? 377 TYR C CA  1 
ATOM   8533  C C   . TYR C  1 352 ? 12.778  129.949 79.222  1.00 22.78 ? 377 TYR C C   1 
ATOM   8534  O O   . TYR C  1 352 ? 13.860  130.509 79.029  1.00 23.12 ? 377 TYR C O   1 
ATOM   8535  C CB  . TYR C  1 352 ? 12.288  130.608 76.883  1.00 22.95 ? 377 TYR C CB  1 
ATOM   8536  C CG  . TYR C  1 352 ? 11.462  130.465 75.615  1.00 23.54 ? 377 TYR C CG  1 
ATOM   8537  C CD1 . TYR C  1 352 ? 11.588  129.338 74.798  1.00 23.28 ? 377 TYR C CD1 1 
ATOM   8538  C CD2 . TYR C  1 352 ? 10.595  131.465 75.217  1.00 25.32 ? 377 TYR C CD2 1 
ATOM   8539  C CE1 . TYR C  1 352 ? 10.848  129.211 73.629  1.00 22.56 ? 377 TYR C CE1 1 
ATOM   8540  C CE2 . TYR C  1 352 ? 9.843   131.349 74.050  1.00 26.28 ? 377 TYR C CE2 1 
ATOM   8541  C CZ  . TYR C  1 352 ? 9.980   130.229 73.258  1.00 24.96 ? 377 TYR C CZ  1 
ATOM   8542  O OH  . TYR C  1 352 ? 9.235   130.117 72.104  1.00 25.46 ? 377 TYR C OH  1 
ATOM   8543  N N   . PRO C  1 353 ? 12.472  129.370 80.395  1.00 22.71 ? 378 PRO C N   1 
ATOM   8544  C CA  . PRO C  1 353 ? 13.384  129.516 81.523  1.00 22.49 ? 378 PRO C CA  1 
ATOM   8545  C C   . PRO C  1 353 ? 14.786  128.957 81.227  1.00 22.02 ? 378 PRO C C   1 
ATOM   8546  O O   . PRO C  1 353 ? 15.793  129.555 81.656  1.00 21.49 ? 378 PRO C O   1 
ATOM   8547  C CB  . PRO C  1 353 ? 12.686  128.715 82.644  1.00 22.74 ? 378 PRO C CB  1 
ATOM   8548  C CG  . PRO C  1 353 ? 11.705  127.804 81.941  1.00 22.14 ? 378 PRO C CG  1 
ATOM   8549  C CD  . PRO C  1 353 ? 11.252  128.626 80.762  1.00 22.55 ? 378 PRO C CD  1 
ATOM   8550  N N   . LEU C  1 354 ? 14.855  127.825 80.519  1.00 20.04 ? 379 LEU C N   1 
ATOM   8551  C CA  . LEU C  1 354 ? 16.158  127.212 80.211  1.00 19.88 ? 379 LEU C CA  1 
ATOM   8552  C C   . LEU C  1 354 ? 16.920  128.054 79.204  1.00 20.02 ? 379 LEU C C   1 
ATOM   8553  O O   . LEU C  1 354 ? 18.072  128.389 79.433  1.00 19.99 ? 379 LEU C O   1 
ATOM   8554  C CB  . LEU C  1 354 ? 16.024  125.770 79.690  1.00 17.95 ? 379 LEU C CB  1 
ATOM   8555  C CG  . LEU C  1 354 ? 15.464  124.723 80.658  1.00 19.23 ? 379 LEU C CG  1 
ATOM   8556  C CD1 . LEU C  1 354 ? 15.355  123.359 79.988  1.00 18.43 ? 379 LEU C CD1 1 
ATOM   8557  C CD2 . LEU C  1 354 ? 16.332  124.648 81.968  1.00 18.42 ? 379 LEU C CD2 1 
ATOM   8558  N N   . VAL C  1 355 ? 16.275  128.391 78.085  1.00 20.20 ? 380 VAL C N   1 
ATOM   8559  C CA  . VAL C  1 355 ? 16.930  129.211 77.066  1.00 20.95 ? 380 VAL C CA  1 
ATOM   8560  C C   . VAL C  1 355 ? 17.334  130.603 77.577  1.00 22.38 ? 380 VAL C C   1 
ATOM   8561  O O   . VAL C  1 355 ? 18.437  131.090 77.281  1.00 21.60 ? 380 VAL C O   1 
ATOM   8562  C CB  . VAL C  1 355 ? 16.095  129.285 75.753  1.00 20.73 ? 380 VAL C CB  1 
ATOM   8563  C CG1 . VAL C  1 355 ? 16.876  130.003 74.662  1.00 22.58 ? 380 VAL C CG1 1 
ATOM   8564  C CG2 . VAL C  1 355 ? 15.774  127.877 75.267  1.00 20.59 ? 380 VAL C CG2 1 
ATOM   8565  N N   . GLN C  1 356 ? 16.449  131.240 78.348  1.00 23.69 ? 381 GLN C N   1 
ATOM   8566  C CA  . GLN C  1 356 ? 16.759  132.533 78.953  1.00 26.51 ? 381 GLN C CA  1 
ATOM   8567  C C   . GLN C  1 356 ? 18.009  132.448 79.813  1.00 26.18 ? 381 GLN C C   1 
ATOM   8568  O O   . GLN C  1 356 ? 18.864  133.332 79.768  1.00 27.49 ? 381 GLN C O   1 
ATOM   8569  C CB  . GLN C  1 356 ? 15.587  133.070 79.801  1.00 27.64 ? 381 GLN C CB  1 
ATOM   8570  C CG  . GLN C  1 356 ? 14.507  133.756 78.958  1.00 31.70 ? 381 GLN C CG  1 
ATOM   8571  C CD  . GLN C  1 356 ? 15.008  135.025 78.261  1.00 34.89 ? 381 GLN C CD  1 
ATOM   8572  O OE1 . GLN C  1 356 ? 16.015  135.607 78.642  1.00 37.73 ? 381 GLN C OE1 1 
ATOM   8573  N NE2 . GLN C  1 356 ? 14.288  135.456 77.244  1.00 36.10 ? 381 GLN C NE2 1 
ATOM   8574  N N   . ALA C  1 357 ? 18.102  131.401 80.615  1.00 25.29 ? 382 ALA C N   1 
ATOM   8575  C CA  . ALA C  1 357 ? 19.297  131.217 81.445  1.00 25.48 ? 382 ALA C CA  1 
ATOM   8576  C C   . ALA C  1 357 ? 20.568  131.063 80.585  1.00 25.22 ? 382 ALA C C   1 
ATOM   8577  O O   . ALA C  1 357 ? 21.626  131.597 80.921  1.00 25.62 ? 382 ALA C O   1 
ATOM   8578  C CB  . ALA C  1 357 ? 19.125  130.013 82.382  1.00 24.56 ? 382 ALA C CB  1 
ATOM   8579  N N   . VAL C  1 358 ? 20.472  130.333 79.481  1.00 23.58 ? 383 VAL C N   1 
ATOM   8580  C CA  . VAL C  1 358 ? 21.636  130.191 78.605  1.00 23.48 ? 383 VAL C CA  1 
ATOM   8581  C C   . VAL C  1 358 ? 22.000  131.541 77.982  1.00 24.79 ? 383 VAL C C   1 
ATOM   8582  O O   . VAL C  1 358 ? 23.168  131.938 77.946  1.00 24.70 ? 383 VAL C O   1 
ATOM   8583  C CB  . VAL C  1 358 ? 21.413  129.137 77.494  1.00 22.10 ? 383 VAL C CB  1 
ATOM   8584  C CG1 . VAL C  1 358 ? 22.571  129.166 76.500  1.00 20.87 ? 383 VAL C CG1 1 
ATOM   8585  C CG2 . VAL C  1 358 ? 21.289  127.757 78.101  1.00 20.51 ? 383 VAL C CG2 1 
ATOM   8586  N N   . LYS C  1 359 ? 20.982  132.268 77.534  1.00 25.84 ? 384 LYS C N   1 
ATOM   8587  C CA  . LYS C  1 359 ? 21.198  133.579 76.929  1.00 27.32 ? 384 LYS C CA  1 
ATOM   8588  C C   . LYS C  1 359 ? 21.898  134.489 77.928  1.00 29.20 ? 384 LYS C C   1 
ATOM   8589  O O   . LYS C  1 359 ? 22.899  135.144 77.601  1.00 29.20 ? 384 LYS C O   1 
ATOM   8590  C CB  . LYS C  1 359 ? 19.872  134.182 76.457  1.00 27.39 ? 384 LYS C CB  1 
ATOM   8591  C CG  . LYS C  1 359 ? 20.015  135.473 75.667  1.00 29.19 ? 384 LYS C CG  1 
ATOM   8592  C CD  . LYS C  1 359 ? 18.655  136.143 75.489  1.00 30.91 ? 384 LYS C CD  1 
ATOM   8593  C CE  . LYS C  1 359 ? 18.748  137.366 74.551  1.00 33.78 ? 384 LYS C CE  1 
ATOM   8594  N NZ  . LYS C  1 359 ? 17.545  138.242 74.675  1.00 35.93 ? 384 LYS C NZ  1 
ATOM   8595  N N   . ARG C  1 360 ? 21.382  134.501 79.157  1.00 30.02 ? 385 ARG C N   1 
ATOM   8596  C CA  . ARG C  1 360 ? 21.953  135.325 80.225  1.00 32.41 ? 385 ARG C CA  1 
ATOM   8597  C C   . ARG C  1 360 ? 23.419  134.989 80.491  1.00 32.53 ? 385 ARG C C   1 
ATOM   8598  O O   . ARG C  1 360 ? 24.244  135.889 80.623  1.00 33.22 ? 385 ARG C O   1 
ATOM   8599  C CB  . ARG C  1 360 ? 21.169  135.135 81.531  1.00 32.39 ? 385 ARG C CB  1 
ATOM   8600  C CG  . ARG C  1 360 ? 21.062  136.395 82.396  1.00 37.97 ? 385 ARG C CG  1 
ATOM   8601  C CD  . ARG C  1 360 ? 20.628  136.080 83.829  1.00 41.76 ? 385 ARG C CD  1 
ATOM   8602  N NE  . ARG C  1 360 ? 19.366  135.348 83.828  1.00 43.39 ? 385 ARG C NE  1 
ATOM   8603  C CZ  . ARG C  1 360 ? 19.264  134.045 84.015  1.00 41.65 ? 385 ARG C CZ  1 
ATOM   8604  N NH1 . ARG C  1 360 ? 20.362  133.337 84.227  1.00 43.48 ? 385 ARG C NH1 1 
ATOM   8605  N NH2 . ARG C  1 360 ? 18.071  133.453 83.974  1.00 41.46 ? 385 ARG C NH2 1 
ATOM   8606  N N   . SER C  1 361 ? 23.721  133.695 80.626  1.00 31.58 ? 386 SER C N   1 
ATOM   8607  C CA  . SER C  1 361 ? 25.079  133.256 80.954  1.00 32.13 ? 386 SER C CA  1 
ATOM   8608  C C   . SER C  1 361 ? 26.040  133.620 79.830  1.00 32.57 ? 386 SER C C   1 
ATOM   8609  O O   . SER C  1 361 ? 27.196  133.992 80.076  1.00 33.08 ? 386 SER C O   1 
ATOM   8610  C CB  . SER C  1 361 ? 25.116  131.745 81.201  1.00 31.27 ? 386 SER C CB  1 
ATOM   8611  O OG  . SER C  1 361 ? 24.196  131.363 82.218  1.00 33.16 ? 386 SER C OG  1 
ATOM   8612  N N   . LEU C  1 362 ? 25.555  133.502 78.596  1.00 31.78 ? 387 LEU C N   1 
ATOM   8613  C CA  . LEU C  1 362 ? 26.353  133.825 77.430  1.00 32.99 ? 387 LEU C CA  1 
ATOM   8614  C C   . LEU C  1 362 ? 26.670  135.314 77.349  1.00 35.74 ? 387 LEU C C   1 
ATOM   8615  O O   . LEU C  1 362 ? 27.716  135.690 76.844  1.00 36.61 ? 387 LEU C O   1 
ATOM   8616  C CB  . LEU C  1 362 ? 25.626  133.422 76.150  1.00 31.47 ? 387 LEU C CB  1 
ATOM   8617  C CG  . LEU C  1 362 ? 25.552  131.958 75.737  1.00 28.60 ? 387 LEU C CG  1 
ATOM   8618  C CD1 . LEU C  1 362 ? 24.693  131.855 74.453  1.00 27.20 ? 387 LEU C CD1 1 
ATOM   8619  C CD2 . LEU C  1 362 ? 26.928  131.376 75.507  1.00 26.83 ? 387 LEU C CD2 1 
ATOM   8620  N N   . GLY C  1 363 ? 25.763  136.156 77.830  1.00 37.79 ? 388 GLY C N   1 
ATOM   8621  C CA  . GLY C  1 363 ? 25.880  137.597 77.596  1.00 41.46 ? 388 GLY C CA  1 
ATOM   8622  C C   . GLY C  1 363 ? 26.599  138.304 78.726  1.00 44.59 ? 388 GLY C C   1 
ATOM   8623  O O   . GLY C  1 363 ? 27.091  139.424 78.575  1.00 46.70 ? 388 GLY C O   1 
ATOM   8624  N N   . SER C  1 364 ? 26.659  137.648 79.877  1.00 45.58 ? 389 SER C N   1 
ATOM   8625  C CA  . SER C  1 364 ? 27.198  138.270 81.076  1.00 48.06 ? 389 SER C CA  1 
ATOM   8626  C C   . SER C  1 364 ? 28.703  138.090 81.105  1.00 48.93 ? 389 SER C C   1 
ATOM   8627  O O   . SER C  1 364 ? 29.187  136.980 80.877  1.00 48.10 ? 389 SER C O   1 
ATOM   8628  C CB  . SER C  1 364 ? 26.590  137.600 82.298  1.00 47.57 ? 389 SER C CB  1 
ATOM   8629  O OG  . SER C  1 364 ? 27.066  136.273 82.374  1.00 47.65 ? 389 SER C OG  1 
ATOM   8630  N N   . ALA D  1 1   ? 81.558  173.165 32.068  1.00 34.88 ? 26  ALA D N   1 
ATOM   8631  C CA  . ALA D  1 1   ? 81.809  174.605 31.806  1.00 32.73 ? 26  ALA D CA  1 
ATOM   8632  C C   . ALA D  1 1   ? 80.608  175.396 32.305  1.00 30.40 ? 26  ALA D C   1 
ATOM   8633  O O   . ALA D  1 1   ? 79.537  174.824 32.549  1.00 31.29 ? 26  ALA D O   1 
ATOM   8634  C CB  . ALA D  1 1   ? 82.043  174.841 30.313  1.00 33.69 ? 26  ALA D CB  1 
ATOM   8635  N N   . TYR D  1 2   ? 80.752  176.708 32.451  1.00 27.58 ? 27  TYR D N   1 
ATOM   8636  C CA  . TYR D  1 2   ? 79.660  177.474 33.037  1.00 24.82 ? 27  TYR D CA  1 
ATOM   8637  C C   . TYR D  1 2   ? 78.538  177.663 32.029  1.00 23.40 ? 27  TYR D C   1 
ATOM   8638  O O   . TYR D  1 2   ? 78.800  177.735 30.843  1.00 22.65 ? 27  TYR D O   1 
ATOM   8639  C CB  . TYR D  1 2   ? 80.162  178.829 33.522  1.00 24.32 ? 27  TYR D CB  1 
ATOM   8640  C CG  . TYR D  1 2   ? 81.194  178.714 34.617  1.00 24.58 ? 27  TYR D CG  1 
ATOM   8641  C CD1 . TYR D  1 2   ? 80.821  178.437 35.932  1.00 24.56 ? 27  TYR D CD1 1 
ATOM   8642  C CD2 . TYR D  1 2   ? 82.534  178.873 34.337  1.00 25.62 ? 27  TYR D CD2 1 
ATOM   8643  C CE1 . TYR D  1 2   ? 81.780  178.327 36.942  1.00 23.31 ? 27  TYR D CE1 1 
ATOM   8644  C CE2 . TYR D  1 2   ? 83.494  178.775 35.329  1.00 26.50 ? 27  TYR D CE2 1 
ATOM   8645  C CZ  . TYR D  1 2   ? 83.106  178.508 36.621  1.00 25.86 ? 27  TYR D CZ  1 
ATOM   8646  O OH  . TYR D  1 2   ? 84.068  178.410 37.582  1.00 27.81 ? 27  TYR D OH  1 
ATOM   8647  N N   . LYS D  1 3   ? 77.305  177.776 32.511  1.00 20.83 ? 28  LYS D N   1 
ATOM   8648  C CA  . LYS D  1 3   ? 76.194  178.102 31.645  1.00 20.03 ? 28  LYS D CA  1 
ATOM   8649  C C   . LYS D  1 3   ? 76.036  179.605 31.581  1.00 19.10 ? 28  LYS D C   1 
ATOM   8650  O O   . LYS D  1 3   ? 76.334  180.301 32.555  1.00 17.69 ? 28  LYS D O   1 
ATOM   8651  C CB  . LYS D  1 3   ? 74.902  177.471 32.177  1.00 19.84 ? 28  LYS D CB  1 
ATOM   8652  C CG  . LYS D  1 3   ? 74.958  175.912 32.246  1.00 22.28 ? 28  LYS D CG  1 
ATOM   8653  C CD  . LYS D  1 3   ? 73.718  175.345 32.998  1.00 23.12 ? 28  LYS D CD  1 
ATOM   8654  C CE  . LYS D  1 3   ? 73.639  173.793 32.964  1.00 25.15 ? 28  LYS D CE  1 
ATOM   8655  N NZ  . LYS D  1 3   ? 74.819  173.132 33.606  1.00 25.39 ? 28  LYS D NZ  1 
ATOM   8656  N N   . LEU D  1 4   ? 75.546  180.103 30.442  1.00 18.37 ? 29  LEU D N   1 
ATOM   8657  C CA  . LEU D  1 4   ? 75.105  181.487 30.336  1.00 17.81 ? 29  LEU D CA  1 
ATOM   8658  C C   . LEU D  1 4   ? 73.673  181.452 29.783  1.00 18.39 ? 29  LEU D C   1 
ATOM   8659  O O   . LEU D  1 4   ? 73.401  181.125 28.600  1.00 18.08 ? 29  LEU D O   1 
ATOM   8660  C CB  . LEU D  1 4   ? 76.063  182.317 29.452  1.00 18.38 ? 29  LEU D CB  1 
ATOM   8661  C CG  . LEU D  1 4   ? 75.704  183.791 29.213  1.00 17.96 ? 29  LEU D CG  1 
ATOM   8662  C CD1 . LEU D  1 4   ? 75.372  184.543 30.536  1.00 15.87 ? 29  LEU D CD1 1 
ATOM   8663  C CD2 . LEU D  1 4   ? 76.845  184.503 28.409  1.00 19.37 ? 29  LEU D CD2 1 
ATOM   8664  N N   . VAL D  1 5   ? 72.737  181.725 30.671  1.00 17.76 ? 30  VAL D N   1 
ATOM   8665  C CA  . VAL D  1 5   ? 71.360  181.423 30.389  1.00 17.87 ? 30  VAL D CA  1 
ATOM   8666  C C   . VAL D  1 5   ? 70.656  182.749 30.170  1.00 17.91 ? 30  VAL D C   1 
ATOM   8667  O O   . VAL D  1 5   ? 70.631  183.573 31.064  1.00 18.24 ? 30  VAL D O   1 
ATOM   8668  C CB  . VAL D  1 5   ? 70.746  180.701 31.609  1.00 17.85 ? 30  VAL D CB  1 
ATOM   8669  C CG1 . VAL D  1 5   ? 69.227  180.547 31.440  1.00 18.04 ? 30  VAL D CG1 1 
ATOM   8670  C CG2 . VAL D  1 5   ? 71.423  179.306 31.804  1.00 18.29 ? 30  VAL D CG2 1 
ATOM   8671  N N   . CYS D  1 6   ? 70.075  182.960 28.996  1.00 18.37 ? 31  CYS D N   1 
ATOM   8672  C CA  . CYS D  1 6   ? 69.600  184.299 28.626  1.00 18.37 ? 31  CYS D CA  1 
ATOM   8673  C C   . CYS D  1 6   ? 68.121  184.335 28.347  1.00 18.21 ? 31  CYS D C   1 
ATOM   8674  O O   . CYS D  1 6   ? 67.680  183.748 27.345  1.00 18.62 ? 31  CYS D O   1 
ATOM   8675  C CB  . CYS D  1 6   ? 70.329  184.741 27.355  1.00 19.18 ? 31  CYS D CB  1 
ATOM   8676  S SG  . CYS D  1 6   ? 72.109  184.941 27.718  1.00 20.81 ? 31  CYS D SG  1 
ATOM   8677  N N   . TYR D  1 7   ? 67.358  185.033 29.197  1.00 16.87 ? 32  TYR D N   1 
ATOM   8678  C CA  . TYR D  1 7   ? 65.934  185.222 28.939  1.00 17.97 ? 32  TYR D CA  1 
ATOM   8679  C C   . TYR D  1 7   ? 65.780  186.323 27.904  1.00 18.78 ? 32  TYR D C   1 
ATOM   8680  O O   . TYR D  1 7   ? 66.567  187.271 27.905  1.00 18.25 ? 32  TYR D O   1 
ATOM   8681  C CB  . TYR D  1 7   ? 65.199  185.678 30.207  1.00 17.14 ? 32  TYR D CB  1 
ATOM   8682  C CG  . TYR D  1 7   ? 64.870  184.616 31.249  1.00 17.88 ? 32  TYR D CG  1 
ATOM   8683  C CD1 . TYR D  1 7   ? 63.661  183.908 31.207  1.00 17.81 ? 32  TYR D CD1 1 
ATOM   8684  C CD2 . TYR D  1 7   ? 65.740  184.371 32.316  1.00 16.25 ? 32  TYR D CD2 1 
ATOM   8685  C CE1 . TYR D  1 7   ? 63.354  182.952 32.205  1.00 18.62 ? 32  TYR D CE1 1 
ATOM   8686  C CE2 . TYR D  1 7   ? 65.444  183.453 33.317  1.00 16.10 ? 32  TYR D CE2 1 
ATOM   8687  C CZ  . TYR D  1 7   ? 64.245  182.741 33.259  1.00 19.00 ? 32  TYR D CZ  1 
ATOM   8688  O OH  . TYR D  1 7   ? 63.969  181.827 34.258  1.00 17.44 ? 32  TYR D OH  1 
ATOM   8689  N N   . PHE D  1 8   ? 64.780  186.199 27.034  1.00 18.77 ? 33  PHE D N   1 
ATOM   8690  C CA  . PHE D  1 8   ? 64.368  187.305 26.165  1.00 20.28 ? 33  PHE D CA  1 
ATOM   8691  C C   . PHE D  1 8   ? 62.842  187.363 26.170  1.00 21.11 ? 33  PHE D C   1 
ATOM   8692  O O   . PHE D  1 8   ? 62.174  186.382 26.500  1.00 21.40 ? 33  PHE D O   1 
ATOM   8693  C CB  . PHE D  1 8   ? 64.939  187.204 24.731  1.00 20.56 ? 33  PHE D CB  1 
ATOM   8694  C CG  . PHE D  1 8   ? 64.398  186.049 23.925  1.00 22.24 ? 33  PHE D CG  1 
ATOM   8695  C CD1 . PHE D  1 8   ? 64.911  184.761 24.097  1.00 23.03 ? 33  PHE D CD1 1 
ATOM   8696  C CD2 . PHE D  1 8   ? 63.417  186.252 22.970  1.00 23.66 ? 33  PHE D CD2 1 
ATOM   8697  C CE1 . PHE D  1 8   ? 64.416  183.681 23.349  1.00 25.33 ? 33  PHE D CE1 1 
ATOM   8698  C CE2 . PHE D  1 8   ? 62.920  185.172 22.210  1.00 26.50 ? 33  PHE D CE2 1 
ATOM   8699  C CZ  . PHE D  1 8   ? 63.414  183.894 22.414  1.00 25.47 ? 33  PHE D CZ  1 
ATOM   8700  N N   . THR D  1 9   ? 62.273  188.506 25.824  1.00 21.45 ? 34  THR D N   1 
ATOM   8701  C CA  . THR D  1 9   ? 60.858  188.683 26.117  1.00 22.03 ? 34  THR D CA  1 
ATOM   8702  C C   . THR D  1 9   ? 60.066  188.909 24.847  1.00 23.95 ? 34  THR D C   1 
ATOM   8703  O O   . THR D  1 9   ? 60.589  189.363 23.840  1.00 23.65 ? 34  THR D O   1 
ATOM   8704  C CB  . THR D  1 9   ? 60.618  189.869 27.073  1.00 21.76 ? 34  THR D CB  1 
ATOM   8705  O OG1 . THR D  1 9   ? 60.924  191.114 26.404  1.00 21.72 ? 34  THR D OG1 1 
ATOM   8706  C CG2 . THR D  1 9   ? 61.478  189.736 28.352  1.00 20.26 ? 34  THR D CG2 1 
ATOM   8707  N N   . ASN D  1 10  ? 58.783  188.590 24.884  1.00 25.21 ? 35  ASN D N   1 
ATOM   8708  C CA  . ASN D  1 10  ? 58.010  188.733 23.664  1.00 27.99 ? 35  ASN D CA  1 
ATOM   8709  C C   . ASN D  1 10  ? 57.525  190.170 23.482  1.00 27.97 ? 35  ASN D C   1 
ATOM   8710  O O   . ASN D  1 10  ? 57.245  190.595 22.359  1.00 28.98 ? 35  ASN D O   1 
ATOM   8711  C CB  . ASN D  1 10  ? 56.826  187.763 23.674  1.00 30.05 ? 35  ASN D CB  1 
ATOM   8712  C CG  . ASN D  1 10  ? 55.560  188.430 24.096  1.00 35.57 ? 35  ASN D CG  1 
ATOM   8713  O OD1 . ASN D  1 10  ? 54.873  189.063 23.284  1.00 42.70 ? 35  ASN D OD1 1 
ATOM   8714  N ND2 . ASN D  1 10  ? 55.222  188.293 25.366  1.00 40.49 ? 35  ASN D ND2 1 
ATOM   8715  N N   . TRP D  1 11  ? 57.436  190.922 24.577  1.00 26.53 ? 36  TRP D N   1 
ATOM   8716  C CA  . TRP D  1 11  ? 56.885  192.273 24.511  1.00 27.13 ? 36  TRP D CA  1 
ATOM   8717  C C   . TRP D  1 11  ? 57.892  193.324 24.011  1.00 26.82 ? 36  TRP D C   1 
ATOM   8718  O O   . TRP D  1 11  ? 57.485  194.426 23.628  1.00 27.38 ? 36  TRP D O   1 
ATOM   8719  C CB  . TRP D  1 11  ? 56.253  192.718 25.848  1.00 26.12 ? 36  TRP D CB  1 
ATOM   8720  C CG  . TRP D  1 11  ? 57.183  192.608 27.062  1.00 25.65 ? 36  TRP D CG  1 
ATOM   8721  C CD1 . TRP D  1 11  ? 57.991  193.580 27.571  1.00 24.33 ? 36  TRP D CD1 1 
ATOM   8722  C CD2 . TRP D  1 11  ? 57.344  191.467 27.919  1.00 24.56 ? 36  TRP D CD2 1 
ATOM   8723  N NE1 . TRP D  1 11  ? 58.674  193.109 28.676  1.00 23.79 ? 36  TRP D NE1 1 
ATOM   8724  C CE2 . TRP D  1 11  ? 58.296  191.816 28.910  1.00 23.41 ? 36  TRP D CE2 1 
ATOM   8725  C CE3 . TRP D  1 11  ? 56.796  190.178 27.928  1.00 24.40 ? 36  TRP D CE3 1 
ATOM   8726  C CZ2 . TRP D  1 11  ? 58.707  190.925 29.909  1.00 22.83 ? 36  TRP D CZ2 1 
ATOM   8727  C CZ3 . TRP D  1 11  ? 57.195  189.292 28.920  1.00 24.94 ? 36  TRP D CZ3 1 
ATOM   8728  C CH2 . TRP D  1 11  ? 58.149  189.667 29.901  1.00 22.88 ? 36  TRP D CH2 1 
ATOM   8729  N N   . SER D  1 12  ? 59.182  192.998 23.981  1.00 24.81 ? 37  SER D N   1 
ATOM   8730  C CA  . SER D  1 12  ? 60.162  193.987 23.524  1.00 25.63 ? 37  SER D CA  1 
ATOM   8731  C C   . SER D  1 12  ? 59.987  194.353 22.047  1.00 27.30 ? 37  SER D C   1 
ATOM   8732  O O   . SER D  1 12  ? 60.460  195.395 21.606  1.00 27.89 ? 37  SER D O   1 
ATOM   8733  C CB  . SER D  1 12  ? 61.610  193.528 23.794  1.00 24.25 ? 37  SER D CB  1 
ATOM   8734  O OG  . SER D  1 12  ? 61.831  192.229 23.267  1.00 24.89 ? 37  SER D OG  1 
ATOM   8735  N N   . GLN D  1 13  ? 59.293  193.510 21.289  1.00 28.95 ? 38  GLN D N   1 
ATOM   8736  C CA  . GLN D  1 13  ? 59.092  193.765 19.864  1.00 31.24 ? 38  GLN D CA  1 
ATOM   8737  C C   . GLN D  1 13  ? 58.196  194.985 19.594  1.00 32.84 ? 38  GLN D C   1 
ATOM   8738  O O   . GLN D  1 13  ? 58.119  195.483 18.464  1.00 34.47 ? 38  GLN D O   1 
ATOM   8739  C CB  . GLN D  1 13  ? 58.514  192.522 19.185  1.00 32.66 ? 38  GLN D CB  1 
ATOM   8740  C CG  . GLN D  1 13  ? 57.171  192.068 19.731  1.00 33.29 ? 38  GLN D CG  1 
ATOM   8741  C CD  . GLN D  1 13  ? 56.618  190.871 18.963  1.00 35.89 ? 38  GLN D CD  1 
ATOM   8742  O OE1 . GLN D  1 13  ? 56.469  190.920 17.742  1.00 37.45 ? 38  GLN D OE1 1 
ATOM   8743  N NE2 . GLN D  1 13  ? 56.322  189.791 19.673  1.00 34.10 ? 38  GLN D NE2 1 
ATOM   8744  N N   . ASP D  1 14  ? 57.514  195.465 20.625  1.00 32.91 ? 39  ASP D N   1 
ATOM   8745  C CA  . ASP D  1 14  ? 56.627  196.621 20.483  1.00 34.81 ? 39  ASP D CA  1 
ATOM   8746  C C   . ASP D  1 14  ? 57.313  197.959 20.811  1.00 34.60 ? 39  ASP D C   1 
ATOM   8747  O O   . ASP D  1 14  ? 56.737  199.023 20.582  1.00 35.54 ? 39  ASP D O   1 
ATOM   8748  C CB  . ASP D  1 14  ? 55.365  196.422 21.324  1.00 35.49 ? 39  ASP D CB  1 
ATOM   8749  C CG  . ASP D  1 14  ? 54.598  195.172 20.918  1.00 38.07 ? 39  ASP D CG  1 
ATOM   8750  O OD1 . ASP D  1 14  ? 54.512  194.910 19.706  1.00 41.19 ? 39  ASP D OD1 1 
ATOM   8751  O OD2 . ASP D  1 14  ? 54.100  194.435 21.797  1.00 40.21 ? 39  ASP D OD2 1 
ATOM   8752  N N   . ARG D  1 15  ? 58.547  197.909 21.318  1.00 33.13 ? 40  ARG D N   1 
ATOM   8753  C CA  . ARG D  1 15  ? 59.300  199.121 21.630  1.00 33.19 ? 40  ARG D CA  1 
ATOM   8754  C C   . ARG D  1 15  ? 59.920  199.783 20.389  1.00 35.02 ? 40  ARG D C   1 
ATOM   8755  O O   . ARG D  1 15  ? 60.004  199.157 19.331  1.00 35.76 ? 40  ARG D O   1 
ATOM   8756  C CB  . ARG D  1 15  ? 60.390  198.808 22.663  1.00 31.07 ? 40  ARG D CB  1 
ATOM   8757  C CG  . ARG D  1 15  ? 59.844  198.381 24.016  1.00 28.37 ? 40  ARG D CG  1 
ATOM   8758  C CD  . ARG D  1 15  ? 60.963  197.906 24.965  1.00 25.97 ? 40  ARG D CD  1 
ATOM   8759  N NE  . ARG D  1 15  ? 60.393  197.558 26.270  1.00 24.48 ? 40  ARG D NE  1 
ATOM   8760  C CZ  . ARG D  1 15  ? 60.845  196.618 27.086  1.00 23.80 ? 40  ARG D CZ  1 
ATOM   8761  N NH1 . ARG D  1 15  ? 61.914  195.891 26.770  1.00 22.74 ? 40  ARG D NH1 1 
ATOM   8762  N NH2 . ARG D  1 15  ? 60.199  196.395 28.226  1.00 25.62 ? 40  ARG D NH2 1 
ATOM   8763  N N   . GLN D  1 16  ? 60.355  201.040 20.534  1.00 36.67 ? 41  GLN D N   1 
ATOM   8764  C CA  . GLN D  1 16  ? 61.028  201.804 19.462  1.00 38.46 ? 41  GLN D CA  1 
ATOM   8765  C C   . GLN D  1 16  ? 62.543  201.638 19.580  1.00 37.94 ? 41  GLN D C   1 
ATOM   8766  O O   . GLN D  1 16  ? 63.037  201.187 20.612  1.00 35.80 ? 41  GLN D O   1 
ATOM   8767  C CB  . GLN D  1 16  ? 60.720  203.297 19.588  1.00 39.90 ? 41  GLN D CB  1 
ATOM   8768  C CG  . GLN D  1 16  ? 59.244  203.629 19.636  1.00 42.82 ? 41  GLN D CG  1 
ATOM   8769  C CD  . GLN D  1 16  ? 58.477  202.974 18.508  1.00 47.79 ? 41  GLN D CD  1 
ATOM   8770  O OE1 . GLN D  1 16  ? 58.789  203.174 17.323  1.00 50.20 ? 41  GLN D OE1 1 
ATOM   8771  N NE2 . GLN D  1 16  ? 57.454  202.191 18.862  1.00 48.27 ? 41  GLN D NE2 1 
ATOM   8772  N N   . GLU D  1 17  ? 63.291  202.021 18.546  1.00 39.24 ? 42  GLU D N   1 
ATOM   8773  C CA  . GLU D  1 17  ? 64.752  201.890 18.617  1.00 38.96 ? 42  GLU D CA  1 
ATOM   8774  C C   . GLU D  1 17  ? 65.277  202.862 19.671  1.00 37.74 ? 42  GLU D C   1 
ATOM   8775  O O   . GLU D  1 17  ? 64.714  203.936 19.851  1.00 37.98 ? 42  GLU D O   1 
ATOM   8776  C CB  . GLU D  1 17  ? 65.411  202.164 17.251  1.00 41.07 ? 42  GLU D CB  1 
ATOM   8777  C CG  . GLU D  1 17  ? 64.468  202.095 16.030  1.00 45.72 ? 42  GLU D CG  1 
ATOM   8778  C CD  . GLU D  1 17  ? 64.004  200.677 15.666  1.00 49.43 ? 42  GLU D CD  1 
ATOM   8779  O OE1 . GLU D  1 17  ? 64.529  199.702 16.246  1.00 49.76 ? 42  GLU D OE1 1 
ATOM   8780  O OE2 . GLU D  1 17  ? 63.103  200.544 14.798  1.00 52.51 ? 42  GLU D OE2 1 
ATOM   8781  N N   . PRO D  1 18  ? 66.361  202.492 20.379  1.00 36.37 ? 43  PRO D N   1 
ATOM   8782  C CA  . PRO D  1 18  ? 67.171  201.274 20.201  1.00 35.19 ? 43  PRO D CA  1 
ATOM   8783  C C   . PRO D  1 18  ? 66.667  200.071 20.990  1.00 33.84 ? 43  PRO D C   1 
ATOM   8784  O O   . PRO D  1 18  ? 67.469  199.175 21.336  1.00 33.33 ? 43  PRO D O   1 
ATOM   8785  C CB  . PRO D  1 18  ? 68.542  201.699 20.750  1.00 34.62 ? 43  PRO D CB  1 
ATOM   8786  C CG  . PRO D  1 18  ? 68.202  202.666 21.871  1.00 34.06 ? 43  PRO D CG  1 
ATOM   8787  C CD  . PRO D  1 18  ? 66.904  203.369 21.438  1.00 35.73 ? 43  PRO D CD  1 
ATOM   8788  N N   . GLY D  1 19  ? 65.366  200.053 21.294  1.00 32.82 ? 44  GLY D N   1 
ATOM   8789  C CA  . GLY D  1 19  ? 64.803  199.023 22.150  1.00 30.05 ? 44  GLY D CA  1 
ATOM   8790  C C   . GLY D  1 19  ? 63.932  197.994 21.437  1.00 29.53 ? 44  GLY D C   1 
ATOM   8791  O O   . GLY D  1 19  ? 63.513  197.020 22.042  1.00 27.86 ? 44  GLY D O   1 
ATOM   8792  N N   . LYS D  1 20  ? 63.654  198.217 20.155  1.00 30.44 ? 45  LYS D N   1 
ATOM   8793  C CA  . LYS D  1 20  ? 62.865  197.270 19.363  1.00 30.92 ? 45  LYS D CA  1 
ATOM   8794  C C   . LYS D  1 20  ? 63.652  195.977 19.149  1.00 29.82 ? 45  LYS D C   1 
ATOM   8795  O O   . LYS D  1 20  ? 64.610  195.958 18.380  1.00 30.04 ? 45  LYS D O   1 
ATOM   8796  C CB  . LYS D  1 20  ? 62.507  197.886 18.007  1.00 32.97 ? 45  LYS D CB  1 
ATOM   8797  C CG  . LYS D  1 20  ? 61.717  196.964 17.097  1.00 35.94 ? 45  LYS D CG  1 
ATOM   8798  C CD  . LYS D  1 20  ? 60.963  197.756 16.008  1.00 40.50 ? 45  LYS D CD  1 
ATOM   8799  C CE  . LYS D  1 20  ? 60.215  196.828 15.065  1.00 41.76 ? 45  LYS D CE  1 
ATOM   8800  N NZ  . LYS D  1 20  ? 59.530  195.698 15.776  1.00 44.06 ? 45  LYS D NZ  1 
ATOM   8801  N N   . PHE D  1 21  ? 63.232  194.904 19.817  1.00 27.81 ? 46  PHE D N   1 
ATOM   8802  C CA  . PHE D  1 21  ? 63.956  193.644 19.798  1.00 27.35 ? 46  PHE D CA  1 
ATOM   8803  C C   . PHE D  1 21  ? 63.075  192.548 19.230  1.00 28.06 ? 46  PHE D C   1 
ATOM   8804  O O   . PHE D  1 21  ? 61.893  192.460 19.573  1.00 28.32 ? 46  PHE D O   1 
ATOM   8805  C CB  . PHE D  1 21  ? 64.376  193.264 21.237  1.00 24.60 ? 46  PHE D CB  1 
ATOM   8806  C CG  . PHE D  1 21  ? 65.140  191.968 21.342  1.00 24.76 ? 46  PHE D CG  1 
ATOM   8807  C CD1 . PHE D  1 21  ? 64.479  190.749 21.314  1.00 24.38 ? 46  PHE D CD1 1 
ATOM   8808  C CD2 . PHE D  1 21  ? 66.530  191.970 21.512  1.00 24.42 ? 46  PHE D CD2 1 
ATOM   8809  C CE1 . PHE D  1 21  ? 65.182  189.554 21.414  1.00 22.87 ? 46  PHE D CE1 1 
ATOM   8810  C CE2 . PHE D  1 21  ? 67.245  190.776 21.609  1.00 23.13 ? 46  PHE D CE2 1 
ATOM   8811  C CZ  . PHE D  1 21  ? 66.566  189.562 21.566  1.00 22.41 ? 46  PHE D CZ  1 
ATOM   8812  N N   . THR D  1 22  ? 63.644  191.712 18.367  1.00 28.96 ? 47  THR D N   1 
ATOM   8813  C CA  . THR D  1 22  ? 62.943  190.511 17.907  1.00 30.29 ? 47  THR D CA  1 
ATOM   8814  C C   . THR D  1 22  ? 63.946  189.387 17.963  1.00 30.38 ? 47  THR D C   1 
ATOM   8815  O O   . THR D  1 22  ? 65.141  189.641 18.097  1.00 29.59 ? 47  THR D O   1 
ATOM   8816  C CB  . THR D  1 22  ? 62.427  190.615 16.444  1.00 32.09 ? 47  THR D CB  1 
ATOM   8817  O OG1 . THR D  1 22  ? 63.533  190.542 15.537  1.00 31.86 ? 47  THR D OG1 1 
ATOM   8818  C CG2 . THR D  1 22  ? 61.649  191.897 16.219  1.00 33.24 ? 47  THR D CG2 1 
ATOM   8819  N N   . PRO D  1 23  ? 63.474  188.135 17.873  1.00 31.23 ? 48  PRO D N   1 
ATOM   8820  C CA  . PRO D  1 23  ? 64.405  186.995 17.929  1.00 30.79 ? 48  PRO D CA  1 
ATOM   8821  C C   . PRO D  1 23  ? 65.547  187.054 16.903  1.00 31.36 ? 48  PRO D C   1 
ATOM   8822  O O   . PRO D  1 23  ? 66.580  186.415 17.115  1.00 30.35 ? 48  PRO D O   1 
ATOM   8823  C CB  . PRO D  1 23  ? 63.491  185.795 17.686  1.00 32.02 ? 48  PRO D CB  1 
ATOM   8824  C CG  . PRO D  1 23  ? 62.157  186.227 18.338  1.00 32.18 ? 48  PRO D CG  1 
ATOM   8825  C CD  . PRO D  1 23  ? 62.059  187.707 17.963  1.00 32.43 ? 48  PRO D CD  1 
ATOM   8826  N N   . GLU D  1 24  ? 65.365  187.809 15.815  1.00 32.34 ? 49  GLU D N   1 
ATOM   8827  C CA  . GLU D  1 24  ? 66.429  187.972 14.812  1.00 33.40 ? 49  GLU D CA  1 
ATOM   8828  C C   . GLU D  1 24  ? 67.583  188.830 15.338  1.00 31.78 ? 49  GLU D C   1 
ATOM   8829  O O   . GLU D  1 24  ? 68.653  188.844 14.753  1.00 31.79 ? 49  GLU D O   1 
ATOM   8830  C CB  . GLU D  1 24  ? 65.881  188.532 13.491  1.00 35.46 ? 49  GLU D CB  1 
ATOM   8831  C CG  . GLU D  1 24  ? 64.717  187.717 12.925  1.00 39.10 ? 49  GLU D CG  1 
ATOM   8832  C CD  . GLU D  1 24  ? 64.380  188.037 11.474  1.00 45.40 ? 49  GLU D CD  1 
ATOM   8833  O OE1 . GLU D  1 24  ? 64.212  189.226 11.129  1.00 48.01 ? 49  GLU D OE1 1 
ATOM   8834  O OE2 . GLU D  1 24  ? 64.251  187.086 10.672  1.00 48.04 ? 49  GLU D OE2 1 
ATOM   8835  N N   . ASN D  1 25  ? 67.365  189.542 16.442  1.00 30.22 ? 50  ASN D N   1 
ATOM   8836  C CA  . ASN D  1 25  ? 68.459  190.266 17.110  1.00 29.29 ? 50  ASN D CA  1 
ATOM   8837  C C   . ASN D  1 25  ? 69.366  189.349 17.918  1.00 28.38 ? 50  ASN D C   1 
ATOM   8838  O O   . ASN D  1 25  ? 70.401  189.775 18.441  1.00 27.92 ? 50  ASN D O   1 
ATOM   8839  C CB  . ASN D  1 25  ? 67.914  191.354 18.034  1.00 28.10 ? 50  ASN D CB  1 
ATOM   8840  C CG  . ASN D  1 25  ? 67.425  192.551 17.270  1.00 29.47 ? 50  ASN D CG  1 
ATOM   8841  O OD1 . ASN D  1 25  ? 68.219  193.300 16.663  1.00 29.98 ? 50  ASN D OD1 1 
ATOM   8842  N ND2 . ASN D  1 25  ? 66.117  192.735 17.258  1.00 27.85 ? 50  ASN D ND2 1 
ATOM   8843  N N   . ILE D  1 26  ? 68.984  188.086 18.029  1.00 28.04 ? 51  ILE D N   1 
ATOM   8844  C CA  . ILE D  1 26  ? 69.738  187.170 18.874  1.00 27.34 ? 51  ILE D CA  1 
ATOM   8845  C C   . ILE D  1 26  ? 70.991  186.629 18.186  1.00 27.53 ? 51  ILE D C   1 
ATOM   8846  O O   . ILE D  1 26  ? 70.939  186.175 17.054  1.00 27.29 ? 51  ILE D O   1 
ATOM   8847  C CB  . ILE D  1 26  ? 68.864  186.010 19.314  1.00 27.38 ? 51  ILE D CB  1 
ATOM   8848  C CG1 . ILE D  1 26  ? 67.675  186.557 20.113  1.00 27.84 ? 51  ILE D CG1 1 
ATOM   8849  C CG2 . ILE D  1 26  ? 69.683  185.024 20.117  1.00 26.34 ? 51  ILE D CG2 1 
ATOM   8850  C CD1 . ILE D  1 26  ? 66.730  185.480 20.638  1.00 26.72 ? 51  ILE D CD1 1 
ATOM   8851  N N   . ASP D  1 27  ? 72.119  186.698 18.881  1.00 26.68 ? 52  ASP D N   1 
ATOM   8852  C CA  . ASP D  1 27  ? 73.357  186.097 18.400  1.00 27.53 ? 52  ASP D CA  1 
ATOM   8853  C C   . ASP D  1 27  ? 73.373  184.657 18.862  1.00 27.32 ? 52  ASP D C   1 
ATOM   8854  O O   . ASP D  1 27  ? 73.310  184.404 20.055  1.00 26.71 ? 52  ASP D O   1 
ATOM   8855  C CB  . ASP D  1 27  ? 74.548  186.833 19.027  1.00 27.12 ? 52  ASP D CB  1 
ATOM   8856  C CG  . ASP D  1 27  ? 75.882  186.138 18.770  1.00 28.22 ? 52  ASP D CG  1 
ATOM   8857  O OD1 . ASP D  1 27  ? 75.918  185.038 18.154  1.00 25.49 ? 52  ASP D OD1 1 
ATOM   8858  O OD2 . ASP D  1 27  ? 76.908  186.726 19.195  1.00 30.76 ? 52  ASP D OD2 1 
ATOM   8859  N N   . PRO D  1 28  ? 73.498  183.701 17.928  1.00 28.87 ? 53  PRO D N   1 
ATOM   8860  C CA  . PRO D  1 28  ? 73.362  182.300 18.330  1.00 29.07 ? 53  PRO D CA  1 
ATOM   8861  C C   . PRO D  1 28  ? 74.488  181.769 19.226  1.00 28.44 ? 53  PRO D C   1 
ATOM   8862  O O   . PRO D  1 28  ? 74.306  180.745 19.888  1.00 27.98 ? 53  PRO D O   1 
ATOM   8863  C CB  . PRO D  1 28  ? 73.318  181.539 16.995  1.00 30.80 ? 53  PRO D CB  1 
ATOM   8864  C CG  . PRO D  1 28  ? 73.933  182.461 15.998  1.00 31.50 ? 53  PRO D CG  1 
ATOM   8865  C CD  . PRO D  1 28  ? 73.691  183.861 16.472  1.00 30.14 ? 53  PRO D CD  1 
ATOM   8866  N N   . PHE D  1 29  ? 75.624  182.462 19.261  1.00 28.06 ? 54  PHE D N   1 
ATOM   8867  C CA  . PHE D  1 29  ? 76.767  182.012 20.056  1.00 27.56 ? 54  PHE D CA  1 
ATOM   8868  C C   . PHE D  1 29  ? 76.978  182.859 21.322  1.00 26.54 ? 54  PHE D C   1 
ATOM   8869  O O   . PHE D  1 29  ? 77.943  182.684 22.073  1.00 25.40 ? 54  PHE D O   1 
ATOM   8870  C CB  . PHE D  1 29  ? 78.036  181.964 19.186  1.00 29.10 ? 54  PHE D CB  1 
ATOM   8871  C CG  . PHE D  1 29  ? 77.961  180.927 18.080  1.00 30.92 ? 54  PHE D CG  1 
ATOM   8872  C CD1 . PHE D  1 29  ? 78.310  179.606 18.321  1.00 32.23 ? 54  PHE D CD1 1 
ATOM   8873  C CD2 . PHE D  1 29  ? 77.500  181.272 16.823  1.00 32.15 ? 54  PHE D CD2 1 
ATOM   8874  C CE1 . PHE D  1 29  ? 78.226  178.643 17.314  1.00 33.18 ? 54  PHE D CE1 1 
ATOM   8875  C CE2 . PHE D  1 29  ? 77.414  180.323 15.806  1.00 33.70 ? 54  PHE D CE2 1 
ATOM   8876  C CZ  . PHE D  1 29  ? 77.772  179.010 16.057  1.00 34.38 ? 54  PHE D CZ  1 
ATOM   8877  N N   . LEU D  1 30  ? 76.054  183.771 21.575  1.00 26.02 ? 55  LEU D N   1 
ATOM   8878  C CA  . LEU D  1 30  ? 76.193  184.633 22.732  1.00 24.93 ? 55  LEU D CA  1 
ATOM   8879  C C   . LEU D  1 30  ? 76.040  183.794 24.029  1.00 23.96 ? 55  LEU D C   1 
ATOM   8880  O O   . LEU D  1 30  ? 76.886  183.835 24.912  1.00 23.62 ? 55  LEU D O   1 
ATOM   8881  C CB  . LEU D  1 30  ? 75.127  185.727 22.683  1.00 25.10 ? 55  LEU D CB  1 
ATOM   8882  C CG  . LEU D  1 30  ? 75.428  187.133 23.224  1.00 27.37 ? 55  LEU D CG  1 
ATOM   8883  C CD1 . LEU D  1 30  ? 74.210  187.652 23.944  1.00 26.82 ? 55  LEU D CD1 1 
ATOM   8884  C CD2 . LEU D  1 30  ? 76.651  187.183 24.114  1.00 26.71 ? 55  LEU D CD2 1 
ATOM   8885  N N   . CYS D  1 31  ? 74.941  183.052 24.136  1.00 23.46 ? 56  CYS D N   1 
ATOM   8886  C CA  . CYS D  1 31  ? 74.555  182.373 25.382  1.00 21.98 ? 56  CYS D CA  1 
ATOM   8887  C C   . CYS D  1 31  ? 74.577  180.881 25.153  1.00 22.32 ? 56  CYS D C   1 
ATOM   8888  O O   . CYS D  1 31  ? 74.563  180.448 24.002  1.00 21.89 ? 56  CYS D O   1 
ATOM   8889  C CB  . CYS D  1 31  ? 73.143  182.797 25.764  1.00 21.24 ? 56  CYS D CB  1 
ATOM   8890  S SG  . CYS D  1 31  ? 72.997  184.618 25.904  1.00 23.02 ? 56  CYS D SG  1 
ATOM   8891  N N   . SER D  1 32  ? 74.563  180.092 26.227  1.00 20.96 ? 57  SER D N   1 
ATOM   8892  C CA  . SER D  1 32  ? 74.507  178.638 26.073  1.00 21.94 ? 57  SER D CA  1 
ATOM   8893  C C   . SER D  1 32  ? 73.036  178.183 26.020  1.00 21.97 ? 57  SER D C   1 
ATOM   8894  O O   . SER D  1 32  ? 72.709  177.144 25.419  1.00 22.55 ? 57  SER D O   1 
ATOM   8895  C CB  . SER D  1 32  ? 75.224  177.956 27.240  1.00 21.82 ? 57  SER D CB  1 
ATOM   8896  O OG  . SER D  1 32  ? 74.567  178.255 28.466  1.00 20.50 ? 57  SER D OG  1 
ATOM   8897  N N   . HIS D  1 33  ? 72.163  178.985 26.618  1.00 20.95 ? 58  HIS D N   1 
ATOM   8898  C CA  . HIS D  1 33  ? 70.729  178.666 26.751  1.00 21.53 ? 58  HIS D CA  1 
ATOM   8899  C C   . HIS D  1 33  ? 69.944  179.948 26.545  1.00 21.75 ? 58  HIS D C   1 
ATOM   8900  O O   . HIS D  1 33  ? 70.271  180.979 27.169  1.00 21.97 ? 58  HIS D O   1 
ATOM   8901  C CB  . HIS D  1 33  ? 70.393  178.214 28.188  1.00 20.63 ? 58  HIS D CB  1 
ATOM   8902  C CG  . HIS D  1 33  ? 71.003  176.907 28.604  1.00 20.91 ? 58  HIS D CG  1 
ATOM   8903  N ND1 . HIS D  1 33  ? 72.360  176.734 28.796  1.00 21.07 ? 58  HIS D ND1 1 
ATOM   8904  C CD2 . HIS D  1 33  ? 70.425  175.727 28.945  1.00 21.46 ? 58  HIS D CD2 1 
ATOM   8905  C CE1 . HIS D  1 33  ? 72.596  175.488 29.183  1.00 22.98 ? 58  HIS D CE1 1 
ATOM   8906  N NE2 . HIS D  1 33  ? 71.435  174.865 29.302  1.00 22.22 ? 58  HIS D NE2 1 
ATOM   8907  N N   . LEU D  1 34  ? 68.901  179.909 25.715  1.00 21.55 ? 59  LEU D N   1 
ATOM   8908  C CA  . LEU D  1 34  ? 68.017  181.059 25.547  1.00 21.34 ? 59  LEU D CA  1 
ATOM   8909  C C   . LEU D  1 34  ? 66.662  180.680 26.122  1.00 21.20 ? 59  LEU D C   1 
ATOM   8910  O O   . LEU D  1 34  ? 66.294  179.524 26.055  1.00 21.89 ? 59  LEU D O   1 
ATOM   8911  C CB  . LEU D  1 34  ? 67.861  181.409 24.060  1.00 22.28 ? 59  LEU D CB  1 
ATOM   8912  C CG  . LEU D  1 34  ? 69.085  182.023 23.365  1.00 23.92 ? 59  LEU D CG  1 
ATOM   8913  C CD1 . LEU D  1 34  ? 68.919  181.963 21.846  1.00 25.20 ? 59  LEU D CD1 1 
ATOM   8914  C CD2 . LEU D  1 34  ? 69.295  183.462 23.844  1.00 23.79 ? 59  LEU D CD2 1 
ATOM   8915  N N   . ILE D  1 35  ? 65.934  181.623 26.717  1.00 19.51 ? 60  ILE D N   1 
ATOM   8916  C CA  . ILE D  1 35  ? 64.616  181.295 27.253  1.00 19.99 ? 60  ILE D CA  1 
ATOM   8917  C C   . ILE D  1 35  ? 63.567  182.343 26.856  1.00 20.81 ? 60  ILE D C   1 
ATOM   8918  O O   . ILE D  1 35  ? 63.687  183.511 27.227  1.00 20.05 ? 60  ILE D O   1 
ATOM   8919  C CB  . ILE D  1 35  ? 64.639  181.176 28.802  1.00 19.08 ? 60  ILE D CB  1 
ATOM   8920  C CG1 . ILE D  1 35  ? 65.699  180.173 29.253  1.00 19.38 ? 60  ILE D CG1 1 
ATOM   8921  C CG2 . ILE D  1 35  ? 63.257  180.787 29.329  1.00 18.96 ? 60  ILE D CG2 1 
ATOM   8922  C CD1 . ILE D  1 35  ? 65.842  180.070 30.797  1.00 20.00 ? 60  ILE D CD1 1 
ATOM   8923  N N   . TYR D  1 36  ? 62.535  181.914 26.117  1.00 21.00 ? 61  TYR D N   1 
ATOM   8924  C CA  . TYR D  1 36  ? 61.478  182.804 25.655  1.00 22.03 ? 61  TYR D CA  1 
ATOM   8925  C C   . TYR D  1 36  ? 60.478  183.062 26.790  1.00 22.00 ? 61  TYR D C   1 
ATOM   8926  O O   . TYR D  1 36  ? 59.995  182.113 27.389  1.00 22.26 ? 61  TYR D O   1 
ATOM   8927  C CB  . TYR D  1 36  ? 60.755  182.162 24.449  1.00 23.28 ? 61  TYR D CB  1 
ATOM   8928  C CG  . TYR D  1 36  ? 59.520  182.901 23.982  1.00 24.06 ? 61  TYR D CG  1 
ATOM   8929  C CD1 . TYR D  1 36  ? 58.275  182.659 24.562  1.00 24.64 ? 61  TYR D CD1 1 
ATOM   8930  C CD2 . TYR D  1 36  ? 59.594  183.837 22.955  1.00 23.95 ? 61  TYR D CD2 1 
ATOM   8931  C CE1 . TYR D  1 36  ? 57.131  183.328 24.127  1.00 25.63 ? 61  TYR D CE1 1 
ATOM   8932  C CE2 . TYR D  1 36  ? 58.471  184.524 22.516  1.00 26.12 ? 61  TYR D CE2 1 
ATOM   8933  C CZ  . TYR D  1 36  ? 57.232  184.264 23.107  1.00 27.40 ? 61  TYR D CZ  1 
ATOM   8934  O OH  . TYR D  1 36  ? 56.106  184.921 22.658  1.00 27.11 ? 61  TYR D OH  1 
ATOM   8935  N N   . SER D  1 37  ? 60.182  184.338 27.063  1.00 21.40 ? 62  SER D N   1 
ATOM   8936  C CA  . SER D  1 37  ? 59.219  184.762 28.081  1.00 22.66 ? 62  SER D CA  1 
ATOM   8937  C C   . SER D  1 37  ? 58.053  185.578 27.480  1.00 23.44 ? 62  SER D C   1 
ATOM   8938  O O   . SER D  1 37  ? 58.302  186.570 26.793  1.00 24.64 ? 62  SER D O   1 
ATOM   8939  C CB  . SER D  1 37  ? 59.950  185.635 29.110  1.00 21.92 ? 62  SER D CB  1 
ATOM   8940  O OG  . SER D  1 37  ? 61.285  185.177 29.316  1.00 22.68 ? 62  SER D OG  1 
ATOM   8941  N N   . PHE D  1 38  ? 56.790  185.201 27.711  1.00 24.46 ? 63  PHE D N   1 
ATOM   8942  C CA  . PHE D  1 38  ? 56.370  184.010 28.456  1.00 24.38 ? 63  PHE D CA  1 
ATOM   8943  C C   . PHE D  1 38  ? 55.264  183.278 27.686  1.00 26.04 ? 63  PHE D C   1 
ATOM   8944  O O   . PHE D  1 38  ? 54.476  183.913 26.967  1.00 26.28 ? 63  PHE D O   1 
ATOM   8945  C CB  . PHE D  1 38  ? 55.774  184.398 29.818  1.00 24.29 ? 63  PHE D CB  1 
ATOM   8946  C CG  . PHE D  1 38  ? 56.782  184.913 30.816  1.00 23.76 ? 63  PHE D CG  1 
ATOM   8947  C CD1 . PHE D  1 38  ? 57.674  184.043 31.445  1.00 21.58 ? 63  PHE D CD1 1 
ATOM   8948  C CD2 . PHE D  1 38  ? 56.817  186.264 31.144  1.00 22.61 ? 63  PHE D CD2 1 
ATOM   8949  C CE1 . PHE D  1 38  ? 58.597  184.520 32.363  1.00 20.02 ? 63  PHE D CE1 1 
ATOM   8950  C CE2 . PHE D  1 38  ? 57.721  186.744 32.072  1.00 20.73 ? 63  PHE D CE2 1 
ATOM   8951  C CZ  . PHE D  1 38  ? 58.608  185.874 32.678  1.00 21.23 ? 63  PHE D CZ  1 
ATOM   8952  N N   . ALA D  1 39  ? 55.178  181.958 27.868  1.00 26.04 ? 64  ALA D N   1 
ATOM   8953  C CA  . ALA D  1 39  ? 54.008  181.205 27.407  1.00 28.09 ? 64  ALA D CA  1 
ATOM   8954  C C   . ALA D  1 39  ? 52.839  181.389 28.387  1.00 28.62 ? 64  ALA D C   1 
ATOM   8955  O O   . ALA D  1 39  ? 53.032  181.773 29.549  1.00 27.94 ? 64  ALA D O   1 
ATOM   8956  C CB  . ALA D  1 39  ? 54.345  179.713 27.237  1.00 27.80 ? 64  ALA D CB  1 
ATOM   8957  N N   . SER D  1 40  ? 51.629  181.106 27.919  1.00 30.05 ? 65  SER D N   1 
ATOM   8958  C CA  . SER D  1 40  ? 50.458  181.242 28.760  1.00 31.17 ? 65  SER D CA  1 
ATOM   8959  C C   . SER D  1 40  ? 49.745  179.890 28.818  1.00 31.84 ? 65  SER D C   1 
ATOM   8960  O O   . SER D  1 40  ? 50.232  178.903 28.267  1.00 31.71 ? 65  SER D O   1 
ATOM   8961  C CB  . SER D  1 40  ? 49.550  182.349 28.207  1.00 31.77 ? 65  SER D CB  1 
ATOM   8962  O OG  . SER D  1 40  ? 48.426  182.551 29.046  1.00 35.89 ? 65  SER D OG  1 
ATOM   8963  N N   . ILE D  1 41  ? 48.601  179.838 29.489  1.00 32.40 ? 66  ILE D N   1 
ATOM   8964  C CA  . ILE D  1 41  ? 47.829  178.596 29.539  1.00 33.58 ? 66  ILE D CA  1 
ATOM   8965  C C   . ILE D  1 41  ? 46.387  178.907 29.182  1.00 35.51 ? 66  ILE D C   1 
ATOM   8966  O O   . ILE D  1 41  ? 45.809  179.860 29.699  1.00 35.64 ? 66  ILE D O   1 
ATOM   8967  C CB  . ILE D  1 41  ? 47.847  177.958 30.948  1.00 33.08 ? 66  ILE D CB  1 
ATOM   8968  C CG1 . ILE D  1 41  ? 49.281  177.606 31.367  1.00 31.70 ? 66  ILE D CG1 1 
ATOM   8969  C CG2 . ILE D  1 41  ? 46.936  176.743 30.989  1.00 33.57 ? 66  ILE D CG2 1 
ATOM   8970  C CD1 . ILE D  1 41  ? 49.391  177.064 32.789  1.00 32.28 ? 66  ILE D CD1 1 
ATOM   8971  N N   . GLU D  1 42  ? 45.796  178.106 28.309  1.00 37.05 ? 67  GLU D N   1 
ATOM   8972  C CA  . GLU D  1 42  ? 44.436  178.363 27.875  1.00 39.34 ? 67  GLU D CA  1 
ATOM   8973  C C   . GLU D  1 42  ? 43.708  177.031 27.794  1.00 40.28 ? 67  GLU D C   1 
ATOM   8974  O O   . GLU D  1 42  ? 44.201  176.096 27.164  1.00 39.98 ? 67  GLU D O   1 
ATOM   8975  C CB  . GLU D  1 42  ? 44.481  179.052 26.517  1.00 40.45 ? 67  GLU D CB  1 
ATOM   8976  C CG  . GLU D  1 42  ? 43.157  179.496 25.919  1.00 45.37 ? 67  GLU D CG  1 
ATOM   8977  C CD  . GLU D  1 42  ? 43.364  180.026 24.511  1.00 49.74 ? 67  GLU D CD  1 
ATOM   8978  O OE1 . GLU D  1 42  ? 43.857  181.174 24.369  1.00 51.66 ? 67  GLU D OE1 1 
ATOM   8979  O OE2 . GLU D  1 42  ? 43.081  179.280 23.552  1.00 51.48 ? 67  GLU D OE2 1 
ATOM   8980  N N   . ASN D  1 43  ? 42.547  176.946 28.440  1.00 40.87 ? 68  ASN D N   1 
ATOM   8981  C CA  . ASN D  1 43  ? 41.859  175.660 28.584  1.00 42.48 ? 68  ASN D CA  1 
ATOM   8982  C C   . ASN D  1 43  ? 42.844  174.562 28.959  1.00 40.87 ? 68  ASN D C   1 
ATOM   8983  O O   . ASN D  1 43  ? 42.838  173.487 28.363  1.00 40.99 ? 68  ASN D O   1 
ATOM   8984  C CB  . ASN D  1 43  ? 41.120  175.294 27.304  1.00 44.46 ? 68  ASN D CB  1 
ATOM   8985  C CG  . ASN D  1 43  ? 40.130  176.357 26.899  1.00 47.85 ? 68  ASN D CG  1 
ATOM   8986  O OD1 . ASN D  1 43  ? 39.416  176.895 27.742  1.00 50.24 ? 68  ASN D OD1 1 
ATOM   8987  N ND2 . ASN D  1 43  ? 40.088  176.679 25.613  1.00 50.26 ? 68  ASN D ND2 1 
ATOM   8988  N N   . ASN D  1 44  ? 43.697  174.861 29.940  1.00 38.77 ? 69  ASN D N   1 
ATOM   8989  C CA  . ASN D  1 44  ? 44.637  173.886 30.528  1.00 38.07 ? 69  ASN D CA  1 
ATOM   8990  C C   . ASN D  1 44  ? 45.726  173.384 29.586  1.00 37.62 ? 69  ASN D C   1 
ATOM   8991  O O   . ASN D  1 44  ? 46.355  172.362 29.847  1.00 37.54 ? 69  ASN D O   1 
ATOM   8992  C CB  . ASN D  1 44  ? 43.889  172.694 31.127  1.00 39.11 ? 69  ASN D CB  1 
ATOM   8993  C CG  . ASN D  1 44  ? 42.880  173.120 32.173  1.00 40.20 ? 69  ASN D CG  1 
ATOM   8994  O OD1 . ASN D  1 44  ? 43.160  174.003 32.991  1.00 40.04 ? 69  ASN D OD1 1 
ATOM   8995  N ND2 . ASN D  1 44  ? 41.694  172.507 32.145  1.00 42.29 ? 69  ASN D ND2 1 
ATOM   8996  N N   . LYS D  1 45  ? 45.930  174.091 28.481  1.00 37.51 ? 70  LYS D N   1 
ATOM   8997  C CA  . LYS D  1 45  ? 47.024  173.758 27.582  1.00 37.33 ? 70  LYS D CA  1 
ATOM   8998  C C   . LYS D  1 45  ? 47.901  174.982 27.368  1.00 35.84 ? 70  LYS D C   1 
ATOM   8999  O O   . LYS D  1 45  ? 47.447  176.132 27.507  1.00 35.35 ? 70  LYS D O   1 
ATOM   9000  C CB  . LYS D  1 45  ? 46.504  173.188 26.258  1.00 38.88 ? 70  LYS D CB  1 
ATOM   9001  C CG  . LYS D  1 45  ? 45.446  172.097 26.455  1.00 42.33 ? 70  LYS D CG  1 
ATOM   9002  C CD  . LYS D  1 45  ? 45.555  170.970 25.437  1.00 46.28 ? 70  LYS D CD  1 
ATOM   9003  C CE  . LYS D  1 45  ? 45.207  171.416 24.039  1.00 48.92 ? 70  LYS D CE  1 
ATOM   9004  N NZ  . LYS D  1 45  ? 45.111  170.246 23.114  1.00 51.62 ? 70  LYS D NZ  1 
ATOM   9005  N N   . VAL D  1 46  ? 49.166  174.721 27.071  1.00 34.77 ? 71  VAL D N   1 
ATOM   9006  C CA  . VAL D  1 46  ? 50.165  175.765 26.885  1.00 34.09 ? 71  VAL D CA  1 
ATOM   9007  C C   . VAL D  1 46  ? 50.005  176.460 25.530  1.00 35.47 ? 71  VAL D C   1 
ATOM   9008  O O   . VAL D  1 46  ? 49.942  175.792 24.507  1.00 36.49 ? 71  VAL D O   1 
ATOM   9009  C CB  . VAL D  1 46  ? 51.591  175.163 26.960  1.00 32.71 ? 71  VAL D CB  1 
ATOM   9010  C CG1 . VAL D  1 46  ? 51.796  174.168 25.818  1.00 34.53 ? 71  VAL D CG1 1 
ATOM   9011  C CG2 . VAL D  1 46  ? 52.641  176.268 26.899  1.00 31.23 ? 71  VAL D CG2 1 
ATOM   9012  N N   . ILE D  1 47  ? 49.939  177.790 25.523  1.00 35.36 ? 72  ILE D N   1 
ATOM   9013  C CA  . ILE D  1 47  ? 49.868  178.531 24.260  1.00 37.28 ? 72  ILE D CA  1 
ATOM   9014  C C   . ILE D  1 47  ? 50.909  179.654 24.248  1.00 36.15 ? 72  ILE D C   1 
ATOM   9015  O O   . ILE D  1 47  ? 51.375  180.082 25.293  1.00 34.90 ? 72  ILE D O   1 
ATOM   9016  C CB  . ILE D  1 47  ? 48.458  179.150 23.996  1.00 38.53 ? 72  ILE D CB  1 
ATOM   9017  C CG1 . ILE D  1 47  ? 47.852  179.688 25.298  1.00 39.02 ? 72  ILE D CG1 1 
ATOM   9018  C CG2 . ILE D  1 47  ? 47.529  178.149 23.328  1.00 41.55 ? 72  ILE D CG2 1 
ATOM   9019  C CD1 . ILE D  1 47  ? 47.237  181.083 25.187  1.00 41.45 ? 72  ILE D CD1 1 
ATOM   9020  N N   . ILE D  1 48  ? 51.294  180.103 23.060  1.00 37.37 ? 73  ILE D N   1 
ATOM   9021  C CA  . ILE D  1 48  ? 52.096  181.305 22.937  1.00 37.22 ? 73  ILE D CA  1 
ATOM   9022  C C   . ILE D  1 48  ? 51.197  182.397 22.391  1.00 38.44 ? 73  ILE D C   1 
ATOM   9023  O O   . ILE D  1 48  ? 50.543  182.209 21.374  1.00 39.99 ? 73  ILE D O   1 
ATOM   9024  C CB  . ILE D  1 48  ? 53.294  181.091 21.991  1.00 37.61 ? 73  ILE D CB  1 
ATOM   9025  C CG1 . ILE D  1 48  ? 54.294  180.117 22.622  1.00 36.94 ? 73  ILE D CG1 1 
ATOM   9026  C CG2 . ILE D  1 48  ? 54.003  182.427 21.686  1.00 36.95 ? 73  ILE D CG2 1 
ATOM   9027  C CD1 . ILE D  1 48  ? 55.602  180.024 21.846  1.00 37.28 ? 73  ILE D CD1 1 
ATOM   9028  N N   . LYS D  1 49  ? 51.137  183.527 23.080  1.00 38.24 ? 74  LYS D N   1 
ATOM   9029  C CA  . LYS D  1 49  ? 50.375  184.671 22.584  1.00 39.96 ? 74  LYS D CA  1 
ATOM   9030  C C   . LYS D  1 49  ? 51.373  185.729 22.090  1.00 38.97 ? 74  LYS D C   1 
ATOM   9031  O O   . LYS D  1 49  ? 51.911  186.498 22.875  1.00 37.01 ? 74  LYS D O   1 
ATOM   9032  C CB  . LYS D  1 49  ? 49.455  185.243 23.670  1.00 40.23 ? 74  LYS D CB  1 
ATOM   9033  C CG  . LYS D  1 49  ? 48.343  184.296 24.105  1.00 43.61 ? 74  LYS D CG  1 
ATOM   9034  C CD  . LYS D  1 49  ? 47.373  184.948 25.105  1.00 47.46 ? 74  LYS D CD  1 
ATOM   9035  C CE  . LYS D  1 49  ? 48.078  185.235 26.435  1.00 46.33 ? 74  LYS D CE  1 
ATOM   9036  N NZ  . LYS D  1 49  ? 47.202  185.865 27.467  1.00 48.02 ? 74  LYS D NZ  1 
ATOM   9037  N N   . ASP D  1 50  ? 51.590  185.763 20.777  1.00 39.54 ? 75  ASP D N   1 
ATOM   9038  C CA  . ASP D  1 50  ? 52.690  186.530 20.186  1.00 38.53 ? 75  ASP D CA  1 
ATOM   9039  C C   . ASP D  1 50  ? 52.295  186.731 18.741  1.00 40.37 ? 75  ASP D C   1 
ATOM   9040  O O   . ASP D  1 50  ? 52.086  185.758 18.012  1.00 41.16 ? 75  ASP D O   1 
ATOM   9041  C CB  . ASP D  1 50  ? 53.979  185.706 20.249  1.00 36.78 ? 75  ASP D CB  1 
ATOM   9042  C CG  . ASP D  1 50  ? 55.228  186.521 19.914  1.00 36.21 ? 75  ASP D CG  1 
ATOM   9043  O OD1 . ASP D  1 50  ? 55.193  187.320 18.959  1.00 36.63 ? 75  ASP D OD1 1 
ATOM   9044  O OD2 . ASP D  1 50  ? 56.251  186.355 20.609  1.00 34.52 ? 75  ASP D OD2 1 
ATOM   9045  N N   . LYS D  1 51  ? 52.172  187.983 18.318  1.00 41.09 ? 76  LYS D N   1 
ATOM   9046  C CA  . LYS D  1 51  ? 51.767  188.236 16.937  1.00 43.40 ? 76  LYS D CA  1 
ATOM   9047  C C   . LYS D  1 51  ? 52.872  187.933 15.920  1.00 43.18 ? 76  LYS D C   1 
ATOM   9048  O O   . LYS D  1 51  ? 52.606  187.889 14.729  1.00 44.73 ? 76  LYS D O   1 
ATOM   9049  C CB  . LYS D  1 51  ? 51.207  189.650 16.753  1.00 44.61 ? 76  LYS D CB  1 
ATOM   9050  C CG  . LYS D  1 51  ? 52.177  190.787 17.092  1.00 44.80 ? 76  LYS D CG  1 
ATOM   9051  C CD  . LYS D  1 51  ? 51.379  192.044 17.443  1.00 48.59 ? 76  LYS D CD  1 
ATOM   9052  C CE  . LYS D  1 51  ? 52.136  193.308 17.076  1.00 50.02 ? 76  LYS D CE  1 
ATOM   9053  N NZ  . LYS D  1 51  ? 53.486  193.249 17.659  1.00 49.11 ? 76  LYS D NZ  1 
ATOM   9054  N N   . SER D  1 52  ? 54.102  187.723 16.381  1.00 41.04 ? 77  SER D N   1 
ATOM   9055  C CA  . SER D  1 52  ? 55.167  187.291 15.470  1.00 41.13 ? 77  SER D CA  1 
ATOM   9056  C C   . SER D  1 52  ? 55.528  185.838 15.740  1.00 40.40 ? 77  SER D C   1 
ATOM   9057  O O   . SER D  1 52  ? 56.693  185.444 15.660  1.00 39.33 ? 77  SER D O   1 
ATOM   9058  C CB  . SER D  1 52  ? 56.403  188.177 15.616  1.00 40.00 ? 77  SER D CB  1 
ATOM   9059  O OG  . SER D  1 52  ? 56.029  189.534 15.597  1.00 40.76 ? 77  SER D OG  1 
ATOM   9060  N N   . GLU D  1 53  ? 54.516  185.052 16.087  1.00 40.34 ? 78  GLU D N   1 
ATOM   9061  C CA  . GLU D  1 53  ? 54.709  183.651 16.407  1.00 40.27 ? 78  GLU D CA  1 
ATOM   9062  C C   . GLU D  1 53  ? 55.418  182.868 15.297  1.00 40.70 ? 78  GLU D C   1 
ATOM   9063  O O   . GLU D  1 53  ? 56.317  182.076 15.568  1.00 39.48 ? 78  GLU D O   1 
ATOM   9064  C CB  . GLU D  1 53  ? 53.362  183.007 16.703  1.00 41.60 ? 78  GLU D CB  1 
ATOM   9065  C CG  . GLU D  1 53  ? 53.459  181.559 17.112  1.00 43.04 ? 78  GLU D CG  1 
ATOM   9066  C CD  . GLU D  1 53  ? 52.090  180.996 17.470  1.00 45.10 ? 78  GLU D CD  1 
ATOM   9067  O OE1 . GLU D  1 53  ? 51.102  181.512 16.916  1.00 45.22 ? 78  GLU D OE1 1 
ATOM   9068  O OE2 . GLU D  1 53  ? 52.001  180.070 18.314  1.00 45.25 ? 78  GLU D OE2 1 
ATOM   9069  N N   . VAL D  1 54  ? 55.009  183.080 14.050  1.00 42.65 ? 79  VAL D N   1 
ATOM   9070  C CA  . VAL D  1 54  ? 55.642  182.412 12.907  1.00 43.86 ? 79  VAL D CA  1 
ATOM   9071  C C   . VAL D  1 54  ? 57.152  182.684 12.809  1.00 42.96 ? 79  VAL D C   1 
ATOM   9072  O O   . VAL D  1 54  ? 57.958  181.760 12.660  1.00 42.96 ? 79  VAL D O   1 
ATOM   9073  C CB  . VAL D  1 54  ? 54.947  182.810 11.584  1.00 46.38 ? 79  VAL D CB  1 
ATOM   9074  C CG1 . VAL D  1 54  ? 55.699  182.262 10.377  1.00 47.80 ? 79  VAL D CG1 1 
ATOM   9075  C CG2 . VAL D  1 54  ? 53.503  182.315 11.594  1.00 47.44 ? 79  VAL D CG2 1 
ATOM   9076  N N   . MET D  1 55  ? 57.533  183.951 12.888  1.00 41.99 ? 80  MET D N   1 
ATOM   9077  C CA  . MET D  1 55  ? 58.938  184.296 12.840  1.00 41.14 ? 80  MET D CA  1 
ATOM   9078  C C   . MET D  1 55  ? 59.688  183.704 14.036  1.00 38.21 ? 80  MET D C   1 
ATOM   9079  O O   . MET D  1 55  ? 60.869  183.356 13.940  1.00 37.44 ? 80  MET D O   1 
ATOM   9080  C CB  . MET D  1 55  ? 59.099  185.804 12.841  1.00 41.82 ? 80  MET D CB  1 
ATOM   9081  C CG  . MET D  1 55  ? 60.443  186.262 12.311  1.00 44.97 ? 80  MET D CG  1 
ATOM   9082  S SD  . MET D  1 55  ? 61.064  187.639 13.269  1.00 51.65 ? 80  MET D SD  1 
ATOM   9083  C CE  . MET D  1 55  ? 61.652  186.747 14.708  1.00 46.03 ? 80  MET D CE  1 
ATOM   9084  N N   . LEU D  1 56  ? 59.012  183.609 15.179  1.00 35.99 ? 81  LEU D N   1 
ATOM   9085  C CA  . LEU D  1 56  ? 59.651  183.039 16.364  1.00 33.51 ? 81  LEU D CA  1 
ATOM   9086  C C   . LEU D  1 56  ? 60.146  181.632 16.049  1.00 33.41 ? 81  LEU D C   1 
ATOM   9087  O O   . LEU D  1 56  ? 61.307  181.307 16.299  1.00 32.17 ? 81  LEU D O   1 
ATOM   9088  C CB  . LEU D  1 56  ? 58.692  183.023 17.576  1.00 32.07 ? 81  LEU D CB  1 
ATOM   9089  C CG  . LEU D  1 56  ? 59.205  182.309 18.836  1.00 30.28 ? 81  LEU D CG  1 
ATOM   9090  C CD1 . LEU D  1 56  ? 60.446  183.003 19.414  1.00 27.13 ? 81  LEU D CD1 1 
ATOM   9091  C CD2 . LEU D  1 56  ? 58.109  182.183 19.907  1.00 28.16 ? 81  LEU D CD2 1 
ATOM   9092  N N   . TYR D  1 57  ? 59.266  180.808 15.482  1.00 34.60 ? 82  TYR D N   1 
ATOM   9093  C CA  . TYR D  1 57  ? 59.599  179.413 15.209  1.00 34.99 ? 82  TYR D CA  1 
ATOM   9094  C C   . TYR D  1 57  ? 60.671  179.307 14.130  1.00 35.96 ? 82  TYR D C   1 
ATOM   9095  O O   . TYR D  1 57  ? 61.563  178.461 14.205  1.00 35.85 ? 82  TYR D O   1 
ATOM   9096  C CB  . TYR D  1 57  ? 58.351  178.602 14.840  1.00 36.69 ? 82  TYR D CB  1 
ATOM   9097  C CG  . TYR D  1 57  ? 57.311  178.604 15.947  1.00 36.27 ? 82  TYR D CG  1 
ATOM   9098  C CD1 . TYR D  1 57  ? 57.696  178.522 17.284  1.00 35.38 ? 82  TYR D CD1 1 
ATOM   9099  C CD2 . TYR D  1 57  ? 55.953  178.702 15.665  1.00 39.11 ? 82  TYR D CD2 1 
ATOM   9100  C CE1 . TYR D  1 57  ? 56.757  178.523 18.310  1.00 34.80 ? 82  TYR D CE1 1 
ATOM   9101  C CE2 . TYR D  1 57  ? 55.005  178.717 16.700  1.00 37.86 ? 82  TYR D CE2 1 
ATOM   9102  C CZ  . TYR D  1 57  ? 55.425  178.626 18.015  1.00 35.71 ? 82  TYR D CZ  1 
ATOM   9103  O OH  . TYR D  1 57  ? 54.516  178.642 19.054  1.00 36.05 ? 82  TYR D OH  1 
ATOM   9104  N N   . GLN D  1 58  ? 60.586  180.171 13.126  1.00 36.76 ? 83  GLN D N   1 
ATOM   9105  C CA  . GLN D  1 58  ? 61.599  180.179 12.073  1.00 37.61 ? 83  GLN D CA  1 
ATOM   9106  C C   . GLN D  1 58  ? 62.945  180.554 12.670  1.00 35.91 ? 83  GLN D C   1 
ATOM   9107  O O   . GLN D  1 58  ? 63.973  179.956 12.356  1.00 36.05 ? 83  GLN D O   1 
ATOM   9108  C CB  . GLN D  1 58  ? 61.229  181.164 10.966  1.00 39.16 ? 83  GLN D CB  1 
ATOM   9109  C CG  . GLN D  1 58  ? 60.064  180.698 10.125  1.00 42.53 ? 83  GLN D CG  1 
ATOM   9110  C CD  . GLN D  1 58  ? 59.767  181.599 8.947   1.00 48.12 ? 83  GLN D CD  1 
ATOM   9111  O OE1 . GLN D  1 58  ? 60.557  182.491 8.596   1.00 49.32 ? 83  GLN D OE1 1 
ATOM   9112  N NE2 . GLN D  1 58  ? 58.627  181.360 8.310   1.00 48.48 ? 83  GLN D NE2 1 
ATOM   9113  N N   . THR D  1 59  ? 62.941  181.555 13.535  1.00 34.03 ? 84  THR D N   1 
ATOM   9114  C CA  . THR D  1 59  ? 64.187  182.026 14.103  1.00 33.03 ? 84  THR D CA  1 
ATOM   9115  C C   . THR D  1 59  ? 64.776  180.983 15.042  1.00 31.69 ? 84  THR D C   1 
ATOM   9116  O O   . THR D  1 59  ? 65.980  180.779 15.088  1.00 31.84 ? 84  THR D O   1 
ATOM   9117  C CB  . THR D  1 59  ? 63.977  183.328 14.863  1.00 31.83 ? 84  THR D CB  1 
ATOM   9118  O OG1 . THR D  1 59  ? 63.354  184.275 13.990  1.00 33.69 ? 84  THR D OG1 1 
ATOM   9119  C CG2 . THR D  1 59  ? 65.321  183.893 15.328  1.00 31.46 ? 84  THR D CG2 1 
ATOM   9120  N N   . ILE D  1 60  ? 63.931  180.317 15.803  1.00 30.80 ? 85  ILE D N   1 
ATOM   9121  C CA  . ILE D  1 60  ? 64.429  179.261 16.670  1.00 29.89 ? 85  ILE D CA  1 
ATOM   9122  C C   . ILE D  1 60  ? 65.182  178.187 15.883  1.00 31.07 ? 85  ILE D C   1 
ATOM   9123  O O   . ILE D  1 60  ? 66.227  177.707 16.325  1.00 30.32 ? 85  ILE D O   1 
ATOM   9124  C CB  . ILE D  1 60  ? 63.291  178.623 17.471  1.00 29.78 ? 85  ILE D CB  1 
ATOM   9125  C CG1 . ILE D  1 60  ? 62.892  179.549 18.622  1.00 28.14 ? 85  ILE D CG1 1 
ATOM   9126  C CG2 . ILE D  1 60  ? 63.705  177.260 18.008  1.00 28.93 ? 85  ILE D CG2 1 
ATOM   9127  C CD1 . ILE D  1 60  ? 61.647  179.066 19.344  1.00 30.88 ? 85  ILE D CD1 1 
ATOM   9128  N N   . ASN D  1 61  ? 64.641  177.797 14.727  1.00 32.28 ? 86  ASN D N   1 
ATOM   9129  C CA  . ASN D  1 61  ? 65.260  176.743 13.930  1.00 34.10 ? 86  ASN D CA  1 
ATOM   9130  C C   . ASN D  1 61  ? 66.577  177.226 13.325  1.00 34.46 ? 86  ASN D C   1 
ATOM   9131  O O   . ASN D  1 61  ? 67.578  176.503 13.275  1.00 34.88 ? 86  ASN D O   1 
ATOM   9132  C CB  . ASN D  1 61  ? 64.319  176.286 12.808  1.00 35.44 ? 86  ASN D CB  1 
ATOM   9133  C CG  . ASN D  1 61  ? 63.107  175.522 13.332  1.00 37.34 ? 86  ASN D CG  1 
ATOM   9134  O OD1 . ASN D  1 61  ? 63.135  174.984 14.430  1.00 35.64 ? 86  ASN D OD1 1 
ATOM   9135  N ND2 . ASN D  1 61  ? 62.049  175.446 12.520  1.00 38.58 ? 86  ASN D ND2 1 
ATOM   9136  N N   . SER D  1 62  ? 66.551  178.454 12.842  1.00 34.61 ? 87  SER D N   1 
ATOM   9137  C CA  . SER D  1 62  ? 67.740  179.058 12.248  1.00 35.92 ? 87  SER D CA  1 
ATOM   9138  C C   . SER D  1 62  ? 68.880  179.219 13.285  1.00 34.20 ? 87  SER D C   1 
ATOM   9139  O O   . SER D  1 62  ? 70.036  178.893 12.995  1.00 34.03 ? 87  SER D O   1 
ATOM   9140  C CB  . SER D  1 62  ? 67.351  180.391 11.619  1.00 36.33 ? 87  SER D CB  1 
ATOM   9141  O OG  . SER D  1 62  ? 68.484  181.121 11.235  1.00 40.53 ? 87  SER D OG  1 
ATOM   9142  N N   . LEU D  1 63  ? 68.553  179.697 14.487  1.00 31.86 ? 88  LEU D N   1 
ATOM   9143  C CA  . LEU D  1 63  ? 69.562  179.837 15.543  1.00 31.00 ? 88  LEU D CA  1 
ATOM   9144  C C   . LEU D  1 63  ? 70.236  178.504 15.855  1.00 31.26 ? 88  LEU D C   1 
ATOM   9145  O O   . LEU D  1 63  ? 71.467  178.428 16.005  1.00 30.93 ? 88  LEU D O   1 
ATOM   9146  C CB  . LEU D  1 63  ? 68.953  180.404 16.829  1.00 28.77 ? 88  LEU D CB  1 
ATOM   9147  C CG  . LEU D  1 63  ? 68.506  181.872 16.773  1.00 29.07 ? 88  LEU D CG  1 
ATOM   9148  C CD1 . LEU D  1 63  ? 67.704  182.248 17.996  1.00 26.84 ? 88  LEU D CD1 1 
ATOM   9149  C CD2 . LEU D  1 63  ? 69.705  182.829 16.595  1.00 29.31 ? 88  LEU D CD2 1 
ATOM   9150  N N   . LYS D  1 64  ? 69.413  177.465 15.989  1.00 31.36 ? 89  LYS D N   1 
ATOM   9151  C CA  . LYS D  1 64  ? 69.873  176.156 16.379  1.00 31.60 ? 89  LYS D CA  1 
ATOM   9152  C C   . LYS D  1 64  ? 70.589  175.468 15.229  1.00 33.52 ? 89  LYS D C   1 
ATOM   9153  O O   . LYS D  1 64  ? 71.497  174.679 15.457  1.00 33.74 ? 89  LYS D O   1 
ATOM   9154  C CB  . LYS D  1 64  ? 68.698  175.316 16.916  1.00 31.50 ? 89  LYS D CB  1 
ATOM   9155  C CG  . LYS D  1 64  ? 68.253  175.779 18.327  1.00 29.75 ? 89  LYS D CG  1 
ATOM   9156  C CD  . LYS D  1 64  ? 67.068  174.984 18.884  1.00 30.74 ? 89  LYS D CD  1 
ATOM   9157  C CE  . LYS D  1 64  ? 67.363  173.479 18.922  1.00 31.17 ? 89  LYS D CE  1 
ATOM   9158  N NZ  . LYS D  1 64  ? 66.379  172.782 19.810  1.00 30.69 ? 89  LYS D NZ  1 
ATOM   9159  N N   . THR D  1 65  ? 70.193  175.768 13.993  1.00 35.22 ? 90  THR D N   1 
ATOM   9160  C CA  . THR D  1 65  ? 70.976  175.319 12.839  1.00 37.57 ? 90  THR D CA  1 
ATOM   9161  C C   . THR D  1 65  ? 72.363  175.970 12.890  1.00 37.69 ? 90  THR D C   1 
ATOM   9162  O O   . THR D  1 65  ? 73.379  175.301 12.713  1.00 38.55 ? 90  THR D O   1 
ATOM   9163  C CB  . THR D  1 65  ? 70.250  175.638 11.501  1.00 39.01 ? 90  THR D CB  1 
ATOM   9164  O OG1 . THR D  1 65  ? 69.016  174.914 11.462  1.00 39.72 ? 90  THR D OG1 1 
ATOM   9165  C CG2 . THR D  1 65  ? 71.090  175.247 10.272  1.00 41.39 ? 90  THR D CG2 1 
ATOM   9166  N N   . LYS D  1 66  ? 72.411  177.273 13.144  1.00 36.63 ? 91  LYS D N   1 
ATOM   9167  C CA  . LYS D  1 66  ? 73.700  177.966 13.197  1.00 37.05 ? 91  LYS D CA  1 
ATOM   9168  C C   . LYS D  1 66  ? 74.570  177.466 14.363  1.00 35.74 ? 91  LYS D C   1 
ATOM   9169  O O   . LYS D  1 66  ? 75.778  177.297 14.212  1.00 35.66 ? 91  LYS D O   1 
ATOM   9170  C CB  . LYS D  1 66  ? 73.505  179.485 13.273  1.00 36.08 ? 91  LYS D CB  1 
ATOM   9171  C CG  . LYS D  1 66  ? 72.691  180.036 12.103  1.00 39.71 ? 91  LYS D CG  1 
ATOM   9172  C CD  . LYS D  1 66  ? 72.882  181.545 11.940  1.00 43.00 ? 91  LYS D CD  1 
ATOM   9173  C CE  . LYS D  1 66  ? 71.591  182.243 11.530  1.00 44.03 ? 91  LYS D CE  1 
ATOM   9174  N NZ  . LYS D  1 66  ? 70.647  182.256 12.696  1.00 42.54 ? 91  LYS D NZ  1 
ATOM   9175  N N   . ASN D  1 67  ? 73.956  177.222 15.519  1.00 33.72 ? 92  ASN D N   1 
ATOM   9176  C CA  . ASN D  1 67  ? 74.698  176.686 16.661  1.00 32.84 ? 92  ASN D CA  1 
ATOM   9177  C C   . ASN D  1 67  ? 74.075  175.406 17.229  1.00 32.81 ? 92  ASN D C   1 
ATOM   9178  O O   . ASN D  1 67  ? 73.215  175.477 18.108  1.00 31.83 ? 92  ASN D O   1 
ATOM   9179  C CB  . ASN D  1 67  ? 74.810  177.739 17.770  1.00 30.55 ? 92  ASN D CB  1 
ATOM   9180  C CG  . ASN D  1 67  ? 75.560  177.224 18.979  1.00 29.28 ? 92  ASN D CG  1 
ATOM   9181  O OD1 . ASN D  1 67  ? 76.059  176.097 18.972  1.00 29.02 ? 92  ASN D OD1 1 
ATOM   9182  N ND2 . ASN D  1 67  ? 75.637  178.050 20.040  1.00 27.37 ? 92  ASN D ND2 1 
ATOM   9183  N N   . PRO D  1 68  ? 74.507  174.229 16.743  1.00 34.82 ? 93  PRO D N   1 
ATOM   9184  C CA  . PRO D  1 68  ? 73.796  173.013 17.158  1.00 35.66 ? 93  PRO D CA  1 
ATOM   9185  C C   . PRO D  1 68  ? 73.897  172.678 18.654  1.00 34.49 ? 93  PRO D C   1 
ATOM   9186  O O   . PRO D  1 68  ? 73.223  171.776 19.112  1.00 34.82 ? 93  PRO D O   1 
ATOM   9187  C CB  . PRO D  1 68  ? 74.429  171.903 16.290  1.00 37.50 ? 93  PRO D CB  1 
ATOM   9188  C CG  . PRO D  1 68  ? 75.060  172.615 15.151  1.00 38.53 ? 93  PRO D CG  1 
ATOM   9189  C CD  . PRO D  1 68  ? 75.528  173.944 15.719  1.00 35.80 ? 93  PRO D CD  1 
ATOM   9190  N N   . LYS D  1 69  ? 74.705  173.406 19.416  1.00 33.86 ? 94  LYS D N   1 
ATOM   9191  C CA  . LYS D  1 69  ? 74.767  173.184 20.873  1.00 32.59 ? 94  LYS D CA  1 
ATOM   9192  C C   . LYS D  1 69  ? 73.800  174.035 21.670  1.00 30.08 ? 94  LYS D C   1 
ATOM   9193  O O   . LYS D  1 69  ? 73.512  173.747 22.835  1.00 29.37 ? 94  LYS D O   1 
ATOM   9194  C CB  . LYS D  1 69  ? 76.176  173.429 21.411  1.00 33.04 ? 94  LYS D CB  1 
ATOM   9195  C CG  . LYS D  1 69  ? 77.095  172.241 21.194  1.00 37.37 ? 94  LYS D CG  1 
ATOM   9196  C CD  . LYS D  1 69  ? 78.519  172.594 21.567  1.00 40.99 ? 94  LYS D CD  1 
ATOM   9197  C CE  . LYS D  1 69  ? 79.469  171.548 21.007  1.00 44.95 ? 94  LYS D CE  1 
ATOM   9198  N NZ  . LYS D  1 69  ? 80.866  172.057 21.051  1.00 47.50 ? 94  LYS D NZ  1 
ATOM   9199  N N   . LEU D  1 70  ? 73.313  175.094 21.047  1.00 28.98 ? 95  LEU D N   1 
ATOM   9200  C CA  . LEU D  1 70  ? 72.422  176.050 21.720  1.00 27.04 ? 95  LEU D CA  1 
ATOM   9201  C C   . LEU D  1 70  ? 71.156  175.364 22.242  1.00 26.82 ? 95  LEU D C   1 
ATOM   9202  O O   . LEU D  1 70  ? 70.565  174.563 21.527  1.00 27.47 ? 95  LEU D O   1 
ATOM   9203  C CB  . LEU D  1 70  ? 72.033  177.129 20.722  1.00 26.81 ? 95  LEU D CB  1 
ATOM   9204  C CG  . LEU D  1 70  ? 71.046  178.173 21.239  1.00 26.37 ? 95  LEU D CG  1 
ATOM   9205  C CD1 . LEU D  1 70  ? 71.727  179.013 22.324  1.00 23.90 ? 95  LEU D CD1 1 
ATOM   9206  C CD2 . LEU D  1 70  ? 70.587  179.040 20.069  1.00 26.58 ? 95  LEU D CD2 1 
ATOM   9207  N N   . LYS D  1 71  ? 70.756  175.645 23.482  1.00 25.66 ? 96  LYS D N   1 
ATOM   9208  C CA  . LYS D  1 71  ? 69.461  175.169 23.991  1.00 25.02 ? 96  LYS D CA  1 
ATOM   9209  C C   . LYS D  1 71  ? 68.485  176.334 24.060  1.00 24.01 ? 96  LYS D C   1 
ATOM   9210  O O   . LYS D  1 71  ? 68.841  177.419 24.514  1.00 23.33 ? 96  LYS D O   1 
ATOM   9211  C CB  . LYS D  1 71  ? 69.582  174.577 25.398  1.00 25.22 ? 96  LYS D CB  1 
ATOM   9212  C CG  . LYS D  1 71  ? 70.671  173.527 25.591  1.00 26.91 ? 96  LYS D CG  1 
ATOM   9213  C CD  . LYS D  1 71  ? 70.460  172.266 24.804  1.00 31.52 ? 96  LYS D CD  1 
ATOM   9214  C CE  . LYS D  1 71  ? 71.556  171.254 25.195  1.00 34.96 ? 96  LYS D CE  1 
ATOM   9215  N NZ  . LYS D  1 71  ? 71.561  170.043 24.325  1.00 39.49 ? 96  LYS D NZ  1 
ATOM   9216  N N   . ILE D  1 72  ? 67.249  176.111 23.642  1.00 23.52 ? 97  ILE D N   1 
ATOM   9217  C CA  . ILE D  1 72  ? 66.226  177.138 23.734  1.00 22.90 ? 97  ILE D CA  1 
ATOM   9218  C C   . ILE D  1 72  ? 65.040  176.582 24.522  1.00 23.05 ? 97  ILE D C   1 
ATOM   9219  O O   . ILE D  1 72  ? 64.460  175.559 24.147  1.00 23.40 ? 97  ILE D O   1 
ATOM   9220  C CB  . ILE D  1 72  ? 65.793  177.604 22.332  1.00 23.58 ? 97  ILE D CB  1 
ATOM   9221  C CG1 . ILE D  1 72  ? 67.025  178.104 21.548  1.00 24.00 ? 97  ILE D CG1 1 
ATOM   9222  C CG2 . ILE D  1 72  ? 64.725  178.682 22.419  1.00 24.11 ? 97  ILE D CG2 1 
ATOM   9223  C CD1 . ILE D  1 72  ? 66.682  178.801 20.240  1.00 23.24 ? 97  ILE D CD1 1 
ATOM   9224  N N   . LEU D  1 73  ? 64.712  177.239 25.629  1.00 22.26 ? 98  LEU D N   1 
ATOM   9225  C CA  . LEU D  1 73  ? 63.635  176.793 26.516  1.00 22.44 ? 98  LEU D CA  1 
ATOM   9226  C C   . LEU D  1 73  ? 62.449  177.753 26.438  1.00 22.47 ? 98  LEU D C   1 
ATOM   9227  O O   . LEU D  1 73  ? 62.602  178.926 26.054  1.00 21.57 ? 98  LEU D O   1 
ATOM   9228  C CB  . LEU D  1 73  ? 64.124  176.727 27.965  1.00 22.22 ? 98  LEU D CB  1 
ATOM   9229  C CG  . LEU D  1 73  ? 65.150  175.665 28.356  1.00 24.62 ? 98  LEU D CG  1 
ATOM   9230  C CD1 . LEU D  1 73  ? 66.508  176.065 27.838  1.00 26.76 ? 98  LEU D CD1 1 
ATOM   9231  C CD2 . LEU D  1 73  ? 65.182  175.585 29.891  1.00 26.12 ? 98  LEU D CD2 1 
ATOM   9232  N N   . LEU D  1 74  ? 61.269  177.248 26.782  1.00 22.49 ? 99  LEU D N   1 
ATOM   9233  C CA  . LEU D  1 74  ? 60.068  178.083 26.884  1.00 23.22 ? 99  LEU D CA  1 
ATOM   9234  C C   . LEU D  1 74  ? 59.838  178.364 28.371  1.00 22.67 ? 99  LEU D C   1 
ATOM   9235  O O   . LEU D  1 74  ? 59.901  177.440 29.181  1.00 22.99 ? 99  LEU D O   1 
ATOM   9236  C CB  . LEU D  1 74  ? 58.878  177.310 26.337  1.00 24.27 ? 99  LEU D CB  1 
ATOM   9237  C CG  . LEU D  1 74  ? 57.520  177.994 26.364  1.00 25.75 ? 99  LEU D CG  1 
ATOM   9238  C CD1 . LEU D  1 74  ? 57.549  179.180 25.416  1.00 26.92 ? 99  LEU D CD1 1 
ATOM   9239  C CD2 . LEU D  1 74  ? 56.475  177.018 25.909  1.00 27.93 ? 99  LEU D CD2 1 
ATOM   9240  N N   . SER D  1 75  ? 59.574  179.615 28.746  1.00 22.12 ? 100 SER D N   1 
ATOM   9241  C CA  . SER D  1 75  ? 59.211  179.893 30.135  1.00 21.54 ? 100 SER D CA  1 
ATOM   9242  C C   . SER D  1 75  ? 57.716  180.128 30.290  1.00 22.55 ? 100 SER D C   1 
ATOM   9243  O O   . SER D  1 75  ? 57.102  180.841 29.490  1.00 22.73 ? 100 SER D O   1 
ATOM   9244  C CB  . SER D  1 75  ? 59.942  181.124 30.676  1.00 20.61 ? 100 SER D CB  1 
ATOM   9245  O OG  . SER D  1 75  ? 59.718  181.234 32.083  1.00 21.04 ? 100 SER D OG  1 
ATOM   9246  N N   . ILE D  1 76  ? 57.132  179.548 31.329  1.00 22.25 ? 101 ILE D N   1 
ATOM   9247  C CA  . ILE D  1 76  ? 55.760  179.901 31.681  1.00 23.77 ? 101 ILE D CA  1 
ATOM   9248  C C   . ILE D  1 76  ? 55.750  180.537 33.060  1.00 23.00 ? 101 ILE D C   1 
ATOM   9249  O O   . ILE D  1 76  ? 56.355  180.011 33.999  1.00 22.58 ? 101 ILE D O   1 
ATOM   9250  C CB  . ILE D  1 76  ? 54.815  178.686 31.676  1.00 24.86 ? 101 ILE D CB  1 
ATOM   9251  C CG1 . ILE D  1 76  ? 54.798  178.055 30.284  1.00 27.59 ? 101 ILE D CG1 1 
ATOM   9252  C CG2 . ILE D  1 76  ? 53.385  179.146 32.041  1.00 26.43 ? 101 ILE D CG2 1 
ATOM   9253  C CD1 . ILE D  1 76  ? 54.096  176.668 30.182  1.00 31.42 ? 101 ILE D CD1 1 
ATOM   9254  N N   . GLY D  1 77  ? 55.069  181.671 33.183  1.00 23.72 ? 102 GLY D N   1 
ATOM   9255  C CA  . GLY D  1 77  ? 54.966  182.343 34.470  1.00 23.35 ? 102 GLY D CA  1 
ATOM   9256  C C   . GLY D  1 77  ? 55.352  183.809 34.418  1.00 22.62 ? 102 GLY D C   1 
ATOM   9257  O O   . GLY D  1 77  ? 54.908  184.556 33.536  1.00 22.35 ? 102 GLY D O   1 
ATOM   9258  N N   . GLY D  1 78  ? 56.174  184.226 35.377  1.00 21.60 ? 103 GLY D N   1 
ATOM   9259  C CA  . GLY D  1 78  ? 56.517  185.633 35.507  1.00 20.67 ? 103 GLY D CA  1 
ATOM   9260  C C   . GLY D  1 78  ? 55.583  186.391 36.425  1.00 22.16 ? 103 GLY D C   1 
ATOM   9261  O O   . GLY D  1 78  ? 54.533  185.883 36.842  1.00 21.99 ? 103 GLY D O   1 
ATOM   9262  N N   . TYR D  1 79  ? 55.963  187.629 36.719  1.00 21.67 ? 104 TYR D N   1 
ATOM   9263  C CA  . TYR D  1 79  ? 55.255  188.438 37.695  1.00 22.99 ? 104 TYR D CA  1 
ATOM   9264  C C   . TYR D  1 79  ? 53.770  188.676 37.384  1.00 23.73 ? 104 TYR D C   1 
ATOM   9265  O O   . TYR D  1 79  ? 52.901  188.423 38.232  1.00 24.24 ? 104 TYR D O   1 
ATOM   9266  C CB  . TYR D  1 79  ? 55.959  189.785 37.846  1.00 22.62 ? 104 TYR D CB  1 
ATOM   9267  C CG  . TYR D  1 79  ? 55.355  190.621 38.940  1.00 25.05 ? 104 TYR D CG  1 
ATOM   9268  C CD1 . TYR D  1 79  ? 55.571  190.307 40.274  1.00 26.81 ? 104 TYR D CD1 1 
ATOM   9269  C CD2 . TYR D  1 79  ? 54.549  191.717 38.633  1.00 28.40 ? 104 TYR D CD2 1 
ATOM   9270  C CE1 . TYR D  1 79  ? 55.008  191.072 41.276  1.00 29.64 ? 104 TYR D CE1 1 
ATOM   9271  C CE2 . TYR D  1 79  ? 53.980  192.487 39.622  1.00 30.46 ? 104 TYR D CE2 1 
ATOM   9272  C CZ  . TYR D  1 79  ? 54.217  192.159 40.934  1.00 30.98 ? 104 TYR D CZ  1 
ATOM   9273  O OH  . TYR D  1 79  ? 53.654  192.921 41.919  1.00 34.80 ? 104 TYR D OH  1 
ATOM   9274  N N   . LEU D  1 80  ? 53.468  189.152 36.177  1.00 24.16 ? 105 LEU D N   1 
ATOM   9275  C CA  . LEU D  1 80  ? 52.087  189.499 35.837  1.00 25.64 ? 105 LEU D CA  1 
ATOM   9276  C C   . LEU D  1 80  ? 51.169  188.273 35.804  1.00 26.57 ? 105 LEU D C   1 
ATOM   9277  O O   . LEU D  1 80  ? 49.985  188.349 36.142  1.00 26.99 ? 105 LEU D O   1 
ATOM   9278  C CB  . LEU D  1 80  ? 52.002  190.229 34.494  1.00 26.09 ? 105 LEU D CB  1 
ATOM   9279  C CG  . LEU D  1 80  ? 52.543  191.672 34.481  1.00 28.02 ? 105 LEU D CG  1 
ATOM   9280  C CD1 . LEU D  1 80  ? 52.175  192.350 33.153  1.00 30.02 ? 105 LEU D CD1 1 
ATOM   9281  C CD2 . LEU D  1 80  ? 52.031  192.509 35.674  1.00 29.44 ? 105 LEU D CD2 1 
ATOM   9282  N N   . PHE D  1 81  ? 51.732  187.151 35.377  1.00 25.95 ? 106 PHE D N   1 
ATOM   9283  C CA  . PHE D  1 81  ? 50.996  185.889 35.301  1.00 26.99 ? 106 PHE D CA  1 
ATOM   9284  C C   . PHE D  1 81  ? 50.604  185.408 36.697  1.00 26.49 ? 106 PHE D C   1 
ATOM   9285  O O   . PHE D  1 81  ? 49.499  184.902 36.923  1.00 28.06 ? 106 PHE D O   1 
ATOM   9286  C CB  . PHE D  1 81  ? 51.881  184.865 34.576  1.00 25.54 ? 106 PHE D CB  1 
ATOM   9287  C CG  . PHE D  1 81  ? 51.169  183.596 34.169  1.00 27.49 ? 106 PHE D CG  1 
ATOM   9288  C CD1 . PHE D  1 81  ? 50.438  183.540 32.987  1.00 28.74 ? 106 PHE D CD1 1 
ATOM   9289  C CD2 . PHE D  1 81  ? 51.281  182.450 34.938  1.00 26.58 ? 106 PHE D CD2 1 
ATOM   9290  C CE1 . PHE D  1 81  ? 49.809  182.370 32.591  1.00 30.88 ? 106 PHE D CE1 1 
ATOM   9291  C CE2 . PHE D  1 81  ? 50.660  181.272 34.551  1.00 28.63 ? 106 PHE D CE2 1 
ATOM   9292  C CZ  . PHE D  1 81  ? 49.913  181.224 33.378  1.00 29.87 ? 106 PHE D CZ  1 
ATOM   9293  N N   . GLY D  1 82  ? 51.506  185.590 37.652  1.00 25.98 ? 107 GLY D N   1 
ATOM   9294  C CA  . GLY D  1 82  ? 51.198  185.336 39.061  1.00 25.72 ? 107 GLY D CA  1 
ATOM   9295  C C   . GLY D  1 82  ? 50.904  183.882 39.389  1.00 26.36 ? 107 GLY D C   1 
ATOM   9296  O O   . GLY D  1 82  ? 51.344  182.963 38.693  1.00 25.70 ? 107 GLY D O   1 
ATOM   9297  N N   . SER D  1 83  ? 50.180  183.681 40.486  1.00 26.90 ? 108 SER D N   1 
ATOM   9298  C CA  . SER D  1 83  ? 49.612  182.389 40.799  1.00 28.02 ? 108 SER D CA  1 
ATOM   9299  C C   . SER D  1 83  ? 48.338  182.150 40.008  1.00 29.32 ? 108 SER D C   1 
ATOM   9300  O O   . SER D  1 83  ? 48.071  181.029 39.590  1.00 30.12 ? 108 SER D O   1 
ATOM   9301  C CB  . SER D  1 83  ? 49.303  182.279 42.297  1.00 28.39 ? 108 SER D CB  1 
ATOM   9302  O OG  . SER D  1 83  ? 50.518  182.232 43.022  1.00 28.07 ? 108 SER D OG  1 
ATOM   9303  N N   . LYS D  1 84  ? 47.543  183.197 39.812  1.00 30.50 ? 109 LYS D N   1 
ATOM   9304  C CA  . LYS D  1 84  ? 46.217  183.028 39.211  1.00 31.81 ? 109 LYS D CA  1 
ATOM   9305  C C   . LYS D  1 84  ? 46.325  182.405 37.821  1.00 31.61 ? 109 LYS D C   1 
ATOM   9306  O O   . LYS D  1 84  ? 45.421  181.698 37.389  1.00 31.86 ? 109 LYS D O   1 
ATOM   9307  C CB  . LYS D  1 84  ? 45.466  184.357 39.132  1.00 33.48 ? 109 LYS D CB  1 
ATOM   9308  C CG  . LYS D  1 84  ? 46.145  185.376 38.238  1.00 34.34 ? 109 LYS D CG  1 
ATOM   9309  C CD  . LYS D  1 84  ? 45.404  186.711 38.228  1.00 39.91 ? 109 LYS D CD  1 
ATOM   9310  C CE  . LYS D  1 84  ? 46.309  187.788 37.614  1.00 41.04 ? 109 LYS D CE  1 
ATOM   9311  N NZ  . LYS D  1 84  ? 45.684  189.146 37.610  1.00 43.71 ? 109 LYS D NZ  1 
ATOM   9312  N N   . GLY D  1 85  ? 47.443  182.656 37.133  1.00 30.00 ? 110 GLY D N   1 
ATOM   9313  C CA  . GLY D  1 85  ? 47.665  182.079 35.794  1.00 29.78 ? 110 GLY D CA  1 
ATOM   9314  C C   . GLY D  1 85  ? 47.680  180.560 35.812  1.00 29.71 ? 110 GLY D C   1 
ATOM   9315  O O   . GLY D  1 85  ? 47.313  179.901 34.825  1.00 30.03 ? 110 GLY D O   1 
ATOM   9316  N N   . PHE D  1 86  ? 48.078  179.997 36.957  1.00 28.87 ? 111 PHE D N   1 
ATOM   9317  C CA  . PHE D  1 86  ? 48.267  178.554 37.067  1.00 28.32 ? 111 PHE D CA  1 
ATOM   9318  C C   . PHE D  1 86  ? 46.987  177.811 37.425  1.00 29.57 ? 111 PHE D C   1 
ATOM   9319  O O   . PHE D  1 86  ? 46.995  176.592 37.469  1.00 29.67 ? 111 PHE D O   1 
ATOM   9320  C CB  . PHE D  1 86  ? 49.409  178.209 38.043  1.00 27.14 ? 111 PHE D CB  1 
ATOM   9321  C CG  . PHE D  1 86  ? 50.796  178.509 37.495  1.00 25.94 ? 111 PHE D CG  1 
ATOM   9322  C CD1 . PHE D  1 86  ? 51.449  177.593 36.679  1.00 25.53 ? 111 PHE D CD1 1 
ATOM   9323  C CD2 . PHE D  1 86  ? 51.443  179.698 37.806  1.00 23.33 ? 111 PHE D CD2 1 
ATOM   9324  C CE1 . PHE D  1 86  ? 52.692  177.862 36.171  1.00 24.22 ? 111 PHE D CE1 1 
ATOM   9325  C CE2 . PHE D  1 86  ? 52.714  179.972 37.307  1.00 24.19 ? 111 PHE D CE2 1 
ATOM   9326  C CZ  . PHE D  1 86  ? 53.337  179.057 36.492  1.00 23.54 ? 111 PHE D CZ  1 
ATOM   9327  N N   . HIS D  1 87  ? 45.900  178.555 37.668  1.00 30.24 ? 112 HIS D N   1 
ATOM   9328  C CA  . HIS D  1 87  ? 44.589  177.996 37.976  1.00 31.41 ? 112 HIS D CA  1 
ATOM   9329  C C   . HIS D  1 87  ? 43.642  178.219 36.786  1.00 32.54 ? 112 HIS D C   1 
ATOM   9330  O O   . HIS D  1 87  ? 43.696  179.265 36.131  1.00 31.99 ? 112 HIS D O   1 
ATOM   9331  C CB  . HIS D  1 87  ? 43.976  178.702 39.190  1.00 32.31 ? 112 HIS D CB  1 
ATOM   9332  C CG  . HIS D  1 87  ? 44.714  178.485 40.475  1.00 32.67 ? 112 HIS D CG  1 
ATOM   9333  N ND1 . HIS D  1 87  ? 44.474  177.402 41.297  1.00 34.09 ? 112 HIS D ND1 1 
ATOM   9334  C CD2 . HIS D  1 87  ? 45.645  179.240 41.109  1.00 32.73 ? 112 HIS D CD2 1 
ATOM   9335  C CE1 . HIS D  1 87  ? 45.250  177.483 42.364  1.00 33.74 ? 112 HIS D CE1 1 
ATOM   9336  N NE2 . HIS D  1 87  ? 45.969  178.587 42.275  1.00 32.54 ? 112 HIS D NE2 1 
ATOM   9337  N N   . PRO D  1 88  ? 42.735  177.268 36.532  1.00 33.77 ? 113 PRO D N   1 
ATOM   9338  C CA  . PRO D  1 88  ? 42.495  176.069 37.330  1.00 34.18 ? 113 PRO D CA  1 
ATOM   9339  C C   . PRO D  1 88  ? 43.389  174.891 36.934  1.00 32.97 ? 113 PRO D C   1 
ATOM   9340  O O   . PRO D  1 88  ? 43.194  173.785 37.420  1.00 33.63 ? 113 PRO D O   1 
ATOM   9341  C CB  . PRO D  1 88  ? 41.025  175.752 37.035  1.00 35.79 ? 113 PRO D CB  1 
ATOM   9342  C CG  . PRO D  1 88  ? 40.820  176.242 35.621  1.00 36.74 ? 113 PRO D CG  1 
ATOM   9343  C CD  . PRO D  1 88  ? 41.847  177.331 35.352  1.00 35.09 ? 113 PRO D CD  1 
ATOM   9344  N N   . MET D  1 89  ? 44.377  175.122 36.083  1.00 32.27 ? 114 MET D N   1 
ATOM   9345  C CA  . MET D  1 89  ? 45.221  174.010 35.614  1.00 32.10 ? 114 MET D CA  1 
ATOM   9346  C C   . MET D  1 89  ? 45.783  173.111 36.717  1.00 32.08 ? 114 MET D C   1 
ATOM   9347  O O   . MET D  1 89  ? 45.761  171.900 36.585  1.00 33.16 ? 114 MET D O   1 
ATOM   9348  C CB  . MET D  1 89  ? 46.384  174.495 34.740  1.00 31.01 ? 114 MET D CB  1 
ATOM   9349  C CG  . MET D  1 89  ? 47.272  173.338 34.207  1.00 30.45 ? 114 MET D CG  1 
ATOM   9350  S SD  . MET D  1 89  ? 48.665  172.810 35.264  1.00 30.44 ? 114 MET D SD  1 
ATOM   9351  C CE  . MET D  1 89  ? 49.664  174.308 35.293  1.00 27.34 ? 114 MET D CE  1 
ATOM   9352  N N   . VAL D  1 90  ? 46.323  173.694 37.783  1.00 31.46 ? 115 VAL D N   1 
ATOM   9353  C CA  . VAL D  1 90  ? 46.991  172.898 38.806  1.00 31.51 ? 115 VAL D CA  1 
ATOM   9354  C C   . VAL D  1 90  ? 46.022  172.199 39.755  1.00 33.49 ? 115 VAL D C   1 
ATOM   9355  O O   . VAL D  1 90  ? 46.436  171.330 40.526  1.00 33.46 ? 115 VAL D O   1 
ATOM   9356  C CB  . VAL D  1 90  ? 47.971  173.751 39.648  1.00 30.35 ? 115 VAL D CB  1 
ATOM   9357  C CG1 . VAL D  1 90  ? 49.154  174.212 38.800  1.00 28.72 ? 115 VAL D CG1 1 
ATOM   9358  C CG2 . VAL D  1 90  ? 47.242  174.949 40.279  1.00 30.31 ? 115 VAL D CG2 1 
ATOM   9359  N N   . ASP D  1 91  ? 44.742  172.582 39.695  1.00 35.31 ? 116 ASP D N   1 
ATOM   9360  C CA  . ASP D  1 91  ? 43.734  172.166 40.681  1.00 37.10 ? 116 ASP D CA  1 
ATOM   9361  C C   . ASP D  1 91  ? 43.323  170.698 40.662  1.00 38.41 ? 116 ASP D C   1 
ATOM   9362  O O   . ASP D  1 91  ? 42.662  170.211 41.596  1.00 38.94 ? 116 ASP D O   1 
ATOM   9363  C CB  . ASP D  1 91  ? 42.481  173.046 40.551  1.00 38.66 ? 116 ASP D CB  1 
ATOM   9364  C CG  . ASP D  1 91  ? 42.702  174.446 41.105  1.00 41.07 ? 116 ASP D CG  1 
ATOM   9365  O OD1 . ASP D  1 91  ? 43.278  174.559 42.221  1.00 42.08 ? 116 ASP D OD1 1 
ATOM   9366  O OD2 . ASP D  1 91  ? 42.311  175.428 40.422  1.00 43.49 ? 116 ASP D OD2 1 
ATOM   9367  N N   . SER D  1 92  ? 43.649  169.979 39.597  1.00 38.29 ? 117 SER D N   1 
ATOM   9368  C CA  . SER D  1 92  ? 43.292  168.566 39.570  1.00 39.47 ? 117 SER D CA  1 
ATOM   9369  C C   . SER D  1 92  ? 44.261  167.773 38.726  1.00 39.17 ? 117 SER D C   1 
ATOM   9370  O O   . SER D  1 92  ? 45.040  168.338 37.944  1.00 37.33 ? 117 SER D O   1 
ATOM   9371  C CB  . SER D  1 92  ? 41.837  168.335 39.108  1.00 41.82 ? 117 SER D CB  1 
ATOM   9372  O OG  . SER D  1 92  ? 41.680  168.482 37.705  1.00 43.13 ? 117 SER D OG  1 
ATOM   9373  N N   . SER D  1 93  ? 44.220  166.462 38.913  1.00 39.93 ? 118 SER D N   1 
ATOM   9374  C CA  . SER D  1 93  ? 45.035  165.543 38.146  1.00 40.43 ? 118 SER D CA  1 
ATOM   9375  C C   . SER D  1 93  ? 44.646  165.627 36.677  1.00 40.58 ? 118 SER D C   1 
ATOM   9376  O O   . SER D  1 93  ? 45.505  165.648 35.800  1.00 39.18 ? 118 SER D O   1 
ATOM   9377  C CB  . SER D  1 93  ? 44.820  164.103 38.645  1.00 42.32 ? 118 SER D CB  1 
ATOM   9378  O OG  . SER D  1 93  ? 45.835  163.754 39.569  1.00 44.43 ? 118 SER D OG  1 
ATOM   9379  N N   . THR D  1 94  ? 43.349  165.662 36.385  1.00 41.57 ? 119 THR D N   1 
ATOM   9380  C CA  . THR D  1 94  ? 42.979  165.606 34.975  1.00 42.44 ? 119 THR D CA  1 
ATOM   9381  C C   . THR D  1 94  ? 43.615  166.819 34.275  1.00 40.74 ? 119 THR D C   1 
ATOM   9382  O O   . THR D  1 94  ? 44.284  166.673 33.243  1.00 39.96 ? 119 THR D O   1 
ATOM   9383  C CB  . THR D  1 94  ? 41.449  165.464 34.715  1.00 44.46 ? 119 THR D CB  1 
ATOM   9384  O OG1 . THR D  1 94  ? 40.812  166.734 34.854  1.00 45.80 ? 119 THR D OG1 1 
ATOM   9385  C CG2 . THR D  1 94  ? 40.815  164.485 35.676  1.00 45.52 ? 119 THR D CG2 1 
ATOM   9386  N N   . SER D  1 95  ? 43.475  167.997 34.887  1.00 39.44 ? 120 SER D N   1 
ATOM   9387  C CA  . SER D  1 95  ? 43.920  169.222 34.261  1.00 38.10 ? 120 SER D CA  1 
ATOM   9388  C C   . SER D  1 95  ? 45.447  169.330 34.151  1.00 36.39 ? 120 SER D C   1 
ATOM   9389  O O   . SER D  1 95  ? 45.959  169.937 33.206  1.00 35.62 ? 120 SER D O   1 
ATOM   9390  C CB  . SER D  1 95  ? 43.310  170.449 34.965  1.00 38.35 ? 120 SER D CB  1 
ATOM   9391  O OG  . SER D  1 95  ? 43.590  170.450 36.353  1.00 38.59 ? 120 SER D OG  1 
ATOM   9392  N N   . ARG D  1 96  ? 46.180  168.739 35.094  1.00 35.42 ? 121 ARG D N   1 
ATOM   9393  C CA  . ARG D  1 96  ? 47.643  168.831 35.076  1.00 34.02 ? 121 ARG D CA  1 
ATOM   9394  C C   . ARG D  1 96  ? 48.205  167.898 34.021  1.00 34.62 ? 121 ARG D C   1 
ATOM   9395  O O   . ARG D  1 96  ? 49.276  168.147 33.450  1.00 33.30 ? 121 ARG D O   1 
ATOM   9396  C CB  . ARG D  1 96  ? 48.240  168.470 36.437  1.00 33.27 ? 121 ARG D CB  1 
ATOM   9397  C CG  . ARG D  1 96  ? 47.970  169.505 37.523  1.00 32.69 ? 121 ARG D CG  1 
ATOM   9398  C CD  . ARG D  1 96  ? 48.937  169.407 38.731  1.00 31.61 ? 121 ARG D CD  1 
ATOM   9399  N NE  . ARG D  1 96  ? 48.901  168.094 39.397  1.00 32.33 ? 121 ARG D NE  1 
ATOM   9400  C CZ  . ARG D  1 96  ? 48.044  167.725 40.352  1.00 33.42 ? 121 ARG D CZ  1 
ATOM   9401  N NH1 . ARG D  1 96  ? 47.097  168.558 40.795  1.00 33.22 ? 121 ARG D NH1 1 
ATOM   9402  N NH2 . ARG D  1 96  ? 48.124  166.503 40.862  1.00 32.27 ? 121 ARG D NH2 1 
ATOM   9403  N N   . LEU D  1 97  ? 47.483  166.808 33.786  1.00 35.97 ? 122 LEU D N   1 
ATOM   9404  C CA  . LEU D  1 97  ? 47.911  165.836 32.807  1.00 37.26 ? 122 LEU D CA  1 
ATOM   9405  C C   . LEU D  1 97  ? 47.695  166.436 31.424  1.00 37.78 ? 122 LEU D C   1 
ATOM   9406  O O   . LEU D  1 97  ? 48.575  166.375 30.564  1.00 38.04 ? 122 LEU D O   1 
ATOM   9407  C CB  . LEU D  1 97  ? 47.137  164.534 32.964  1.00 38.81 ? 122 LEU D CB  1 
ATOM   9408  C CG  . LEU D  1 97  ? 48.009  163.292 32.713  1.00 40.45 ? 122 LEU D CG  1 
ATOM   9409  C CD1 . LEU D  1 97  ? 48.366  163.154 31.253  1.00 40.28 ? 122 LEU D CD1 1 
ATOM   9410  C CD2 . LEU D  1 97  ? 49.286  163.341 33.560  1.00 38.73 ? 122 LEU D CD2 1 
ATOM   9411  N N   . GLU D  1 98  ? 46.526  167.040 31.240  1.00 38.50 ? 123 GLU D N   1 
ATOM   9412  C CA  . GLU D  1 98  ? 46.186  167.737 30.013  1.00 39.43 ? 123 GLU D CA  1 
ATOM   9413  C C   . GLU D  1 98  ? 47.255  168.775 29.680  1.00 37.25 ? 123 GLU D C   1 
ATOM   9414  O O   . GLU D  1 98  ? 47.641  168.927 28.520  1.00 37.55 ? 123 GLU D O   1 
ATOM   9415  C CB  . GLU D  1 98  ? 44.814  168.407 30.158  1.00 40.97 ? 123 GLU D CB  1 
ATOM   9416  C CG  . GLU D  1 98  ? 44.345  169.184 28.930  1.00 44.50 ? 123 GLU D CG  1 
ATOM   9417  C CD  . GLU D  1 98  ? 43.628  168.325 27.930  1.00 50.20 ? 123 GLU D CD  1 
ATOM   9418  O OE1 . GLU D  1 98  ? 43.781  167.083 27.964  1.00 53.62 ? 123 GLU D OE1 1 
ATOM   9419  O OE2 . GLU D  1 98  ? 42.883  168.886 27.099  1.00 53.61 ? 123 GLU D OE2 1 
ATOM   9420  N N   . PHE D  1 99  ? 47.736  169.479 30.702  1.00 35.11 ? 124 PHE D N   1 
ATOM   9421  C CA  . PHE D  1 99  ? 48.717  170.528 30.523  1.00 33.13 ? 124 PHE D CA  1 
ATOM   9422  C C   . PHE D  1 99  ? 50.076  169.936 30.183  1.00 32.28 ? 124 PHE D C   1 
ATOM   9423  O O   . PHE D  1 99  ? 50.731  170.359 29.223  1.00 31.65 ? 124 PHE D O   1 
ATOM   9424  C CB  . PHE D  1 99  ? 48.840  171.369 31.795  1.00 32.13 ? 124 PHE D CB  1 
ATOM   9425  C CG  . PHE D  1 99  ? 50.031  172.283 31.801  1.00 30.78 ? 124 PHE D CG  1 
ATOM   9426  C CD1 . PHE D  1 99  ? 50.099  173.361 30.931  1.00 31.16 ? 124 PHE D CD1 1 
ATOM   9427  C CD2 . PHE D  1 99  ? 51.084  172.068 32.671  1.00 29.30 ? 124 PHE D CD2 1 
ATOM   9428  C CE1 . PHE D  1 99  ? 51.204  174.221 30.945  1.00 29.79 ? 124 PHE D CE1 1 
ATOM   9429  C CE2 . PHE D  1 99  ? 52.183  172.929 32.689  1.00 29.76 ? 124 PHE D CE2 1 
ATOM   9430  C CZ  . PHE D  1 99  ? 52.235  174.001 31.830  1.00 28.59 ? 124 PHE D CZ  1 
ATOM   9431  N N   . ILE D  1 100 ? 50.499  168.965 30.978  1.00 31.79 ? 125 ILE D N   1 
ATOM   9432  C CA  . ILE D  1 100 ? 51.778  168.301 30.756  1.00 31.95 ? 125 ILE D CA  1 
ATOM   9433  C C   . ILE D  1 100 ? 51.923  167.636 29.386  1.00 33.05 ? 125 ILE D C   1 
ATOM   9434  O O   . ILE D  1 100 ? 53.004  167.709 28.772  1.00 32.67 ? 125 ILE D O   1 
ATOM   9435  C CB  . ILE D  1 100 ? 52.074  167.287 31.856  1.00 32.34 ? 125 ILE D CB  1 
ATOM   9436  C CG1 . ILE D  1 100 ? 52.205  168.010 33.190  1.00 31.72 ? 125 ILE D CG1 1 
ATOM   9437  C CG2 . ILE D  1 100 ? 53.371  166.538 31.566  1.00 31.67 ? 125 ILE D CG2 1 
ATOM   9438  C CD1 . ILE D  1 100 ? 52.589  167.089 34.317  1.00 33.67 ? 125 ILE D CD1 1 
ATOM   9439  N N   . ASN D  1 101 ? 50.860  166.985 28.918  1.00 35.19 ? 126 ASN D N   1 
ATOM   9440  C CA  . ASN D  1 101 ? 50.826  166.448 27.558  1.00 36.77 ? 126 ASN D CA  1 
ATOM   9441  C C   . ASN D  1 101 ? 50.977  167.570 26.539  1.00 36.38 ? 126 ASN D C   1 
ATOM   9442  O O   . ASN D  1 101 ? 51.676  167.420 25.548  1.00 36.68 ? 126 ASN D O   1 
ATOM   9443  C CB  . ASN D  1 101 ? 49.514  165.714 27.278  1.00 38.66 ? 126 ASN D CB  1 
ATOM   9444  C CG  . ASN D  1 101 ? 49.371  164.424 28.072  1.00 40.53 ? 126 ASN D CG  1 
ATOM   9445  O OD1 . ASN D  1 101 ? 50.337  163.929 28.666  1.00 40.86 ? 126 ASN D OD1 1 
ATOM   9446  N ND2 . ASN D  1 101 ? 48.154  163.859 28.070  1.00 41.95 ? 126 ASN D ND2 1 
ATOM   9447  N N   . SER D  1 102 ? 50.281  168.679 26.772  1.00 36.05 ? 127 SER D N   1 
ATOM   9448  C CA  . SER D  1 102 ? 50.317  169.789 25.833  1.00 35.62 ? 127 SER D CA  1 
ATOM   9449  C C   . SER D  1 102 ? 51.737  170.334 25.790  1.00 34.11 ? 127 SER D C   1 
ATOM   9450  O O   . SER D  1 102 ? 52.210  170.755 24.734  1.00 33.83 ? 127 SER D O   1 
ATOM   9451  C CB  . SER D  1 102 ? 49.270  170.882 26.172  1.00 35.60 ? 127 SER D CB  1 
ATOM   9452  O OG  . SER D  1 102 ? 49.730  171.834 27.122  1.00 34.02 ? 127 SER D OG  1 
ATOM   9453  N N   . ILE D  1 103 ? 52.405  170.312 26.941  1.00 32.68 ? 128 ILE D N   1 
ATOM   9454  C CA  . ILE D  1 103 ? 53.785  170.804 27.079  1.00 31.34 ? 128 ILE D CA  1 
ATOM   9455  C C   . ILE D  1 103 ? 54.787  169.995 26.265  1.00 31.86 ? 128 ILE D C   1 
ATOM   9456  O O   . ILE D  1 103 ? 55.487  170.539 25.417  1.00 31.49 ? 128 ILE D O   1 
ATOM   9457  C CB  . ILE D  1 103 ? 54.229  170.807 28.561  1.00 30.04 ? 128 ILE D CB  1 
ATOM   9458  C CG1 . ILE D  1 103 ? 53.583  171.982 29.298  1.00 29.77 ? 128 ILE D CG1 1 
ATOM   9459  C CG2 . ILE D  1 103 ? 55.737  170.864 28.685  1.00 29.81 ? 128 ILE D CG2 1 
ATOM   9460  C CD1 . ILE D  1 103 ? 54.071  173.373 28.848  1.00 30.87 ? 128 ILE D CD1 1 
ATOM   9461  N N   . ILE D  1 104 ? 54.865  168.695 26.530  1.00 32.71 ? 129 ILE D N   1 
ATOM   9462  C CA  . ILE D  1 104 ? 55.765  167.820 25.774  1.00 33.21 ? 129 ILE D CA  1 
ATOM   9463  C C   . ILE D  1 104 ? 55.524  167.923 24.257  1.00 34.74 ? 129 ILE D C   1 
ATOM   9464  O O   . ILE D  1 104 ? 56.470  168.030 23.462  1.00 34.84 ? 129 ILE D O   1 
ATOM   9465  C CB  . ILE D  1 104 ? 55.593  166.362 26.227  1.00 34.75 ? 129 ILE D CB  1 
ATOM   9466  C CG1 . ILE D  1 104 ? 56.003  166.216 27.700  1.00 32.88 ? 129 ILE D CG1 1 
ATOM   9467  C CG2 . ILE D  1 104 ? 56.352  165.386 25.302  1.00 35.78 ? 129 ILE D CG2 1 
ATOM   9468  C CD1 . ILE D  1 104 ? 55.691  164.833 28.279  1.00 34.25 ? 129 ILE D CD1 1 
ATOM   9469  N N   . LEU D  1 105 ? 54.263  167.905 23.848  1.00 35.89 ? 130 LEU D N   1 
ATOM   9470  C CA  . LEU D  1 105 ? 53.953  167.949 22.423  1.00 37.49 ? 130 LEU D CA  1 
ATOM   9471  C C   . LEU D  1 105 ? 54.417  169.265 21.799  1.00 36.63 ? 130 LEU D C   1 
ATOM   9472  O O   . LEU D  1 105 ? 55.100  169.271 20.767  1.00 37.40 ? 130 LEU D O   1 
ATOM   9473  C CB  . LEU D  1 105 ? 52.458  167.730 22.180  1.00 39.08 ? 130 LEU D CB  1 
ATOM   9474  C CG  . LEU D  1 105 ? 52.084  167.390 20.739  1.00 43.15 ? 130 LEU D CG  1 
ATOM   9475  C CD1 . LEU D  1 105 ? 50.636  166.896 20.605  1.00 45.55 ? 130 LEU D CD1 1 
ATOM   9476  C CD2 . LEU D  1 105 ? 52.347  168.581 19.833  1.00 44.90 ? 130 LEU D CD2 1 
ATOM   9477  N N   . PHE D  1 106 ? 54.057  170.375 22.437  1.00 35.24 ? 131 PHE D N   1 
ATOM   9478  C CA  . PHE D  1 106 ? 54.349  171.711 21.931  1.00 34.41 ? 131 PHE D CA  1 
ATOM   9479  C C   . PHE D  1 106 ? 55.869  171.954 21.864  1.00 33.27 ? 131 PHE D C   1 
ATOM   9480  O O   . PHE D  1 106 ? 56.377  172.518 20.880  1.00 33.19 ? 131 PHE D O   1 
ATOM   9481  C CB  . PHE D  1 106 ? 53.631  172.737 22.825  1.00 33.72 ? 131 PHE D CB  1 
ATOM   9482  C CG  . PHE D  1 106 ? 53.906  174.180 22.481  1.00 33.88 ? 131 PHE D CG  1 
ATOM   9483  C CD1 . PHE D  1 106 ? 55.094  174.777 22.852  1.00 32.26 ? 131 PHE D CD1 1 
ATOM   9484  C CD2 . PHE D  1 106 ? 52.958  174.937 21.795  1.00 36.43 ? 131 PHE D CD2 1 
ATOM   9485  C CE1 . PHE D  1 106 ? 55.346  176.107 22.554  1.00 33.24 ? 131 PHE D CE1 1 
ATOM   9486  C CE2 . PHE D  1 106 ? 53.196  176.270 21.493  1.00 35.05 ? 131 PHE D CE2 1 
ATOM   9487  C CZ  . PHE D  1 106 ? 54.395  176.854 21.870  1.00 35.18 ? 131 PHE D CZ  1 
ATOM   9488  N N   . LEU D  1 107 ? 56.595  171.526 22.900  1.00 31.81 ? 132 LEU D N   1 
ATOM   9489  C CA  . LEU D  1 107 ? 58.060  171.695 22.932  1.00 30.67 ? 132 LEU D CA  1 
ATOM   9490  C C   . LEU D  1 107 ? 58.721  170.908 21.800  1.00 32.10 ? 132 LEU D C   1 
ATOM   9491  O O   . LEU D  1 107 ? 59.610  171.419 21.106  1.00 32.07 ? 132 LEU D O   1 
ATOM   9492  C CB  . LEU D  1 107 ? 58.659  171.253 24.276  1.00 29.15 ? 132 LEU D CB  1 
ATOM   9493  C CG  . LEU D  1 107 ? 58.312  172.010 25.568  1.00 27.71 ? 132 LEU D CG  1 
ATOM   9494  C CD1 . LEU D  1 107 ? 59.100  171.444 26.721  1.00 26.54 ? 132 LEU D CD1 1 
ATOM   9495  C CD2 . LEU D  1 107 ? 58.562  173.512 25.487  1.00 25.31 ? 132 LEU D CD2 1 
ATOM   9496  N N   . ARG D  1 108 ? 58.314  169.656 21.639  1.00 33.43 ? 133 ARG D N   1 
ATOM   9497  C CA  . ARG D  1 108 ? 58.844  168.825 20.564  1.00 35.19 ? 133 ARG D CA  1 
ATOM   9498  C C   . ARG D  1 108 ? 58.482  169.387 19.193  1.00 36.24 ? 133 ARG D C   1 
ATOM   9499  O O   . ARG D  1 108 ? 59.348  169.558 18.349  1.00 36.77 ? 133 ARG D O   1 
ATOM   9500  C CB  . ARG D  1 108 ? 58.361  167.374 20.684  1.00 36.60 ? 133 ARG D CB  1 
ATOM   9501  C CG  . ARG D  1 108 ? 58.879  166.641 21.913  1.00 36.96 ? 133 ARG D CG  1 
ATOM   9502  C CD  . ARG D  1 108 ? 60.407  166.546 21.947  1.00 37.52 ? 133 ARG D CD  1 
ATOM   9503  N NE  . ARG D  1 108 ? 60.876  165.540 22.903  1.00 37.01 ? 133 ARG D NE  1 
ATOM   9504  C CZ  . ARG D  1 108 ? 62.116  165.483 23.376  1.00 35.85 ? 133 ARG D CZ  1 
ATOM   9505  N NH1 . ARG D  1 108 ? 63.015  166.383 22.983  1.00 34.06 ? 133 ARG D NH1 1 
ATOM   9506  N NH2 . ARG D  1 108 ? 62.458  164.528 24.231  1.00 34.07 ? 133 ARG D NH2 1 
ATOM   9507  N N   . ASN D  1 109 ? 57.202  169.667 18.960  1.00 37.09 ? 134 ASN D N   1 
ATOM   9508  C CA  . ASN D  1 109 ? 56.793  170.227 17.676  1.00 38.57 ? 134 ASN D CA  1 
ATOM   9509  C C   . ASN D  1 109 ? 57.463  171.557 17.321  1.00 37.52 ? 134 ASN D C   1 
ATOM   9510  O O   . ASN D  1 109 ? 57.641  171.863 16.148  1.00 38.22 ? 134 ASN D O   1 
ATOM   9511  C CB  . ASN D  1 109 ? 55.279  170.360 17.584  1.00 39.63 ? 134 ASN D CB  1 
ATOM   9512  C CG  . ASN D  1 109 ? 54.584  169.015 17.457  1.00 43.21 ? 134 ASN D CG  1 
ATOM   9513  O OD1 . ASN D  1 109 ? 55.233  167.982 17.229  1.00 45.07 ? 134 ASN D OD1 1 
ATOM   9514  N ND2 . ASN D  1 109 ? 53.255  169.019 17.593  1.00 43.83 ? 134 ASN D ND2 1 
ATOM   9515  N N   . HIS D  1 110 ? 57.844  172.345 18.319  1.00 35.37 ? 135 HIS D N   1 
ATOM   9516  C CA  . HIS D  1 110 ? 58.415  173.649 18.023  1.00 34.97 ? 135 HIS D CA  1 
ATOM   9517  C C   . HIS D  1 110 ? 59.927  173.751 18.255  1.00 33.74 ? 135 HIS D C   1 
ATOM   9518  O O   . HIS D  1 110 ? 60.475  174.854 18.244  1.00 32.75 ? 135 HIS D O   1 
ATOM   9519  C CB  . HIS D  1 110 ? 57.640  174.755 18.760  1.00 34.33 ? 135 HIS D CB  1 
ATOM   9520  C CG  . HIS D  1 110 ? 56.225  174.889 18.288  1.00 36.33 ? 135 HIS D CG  1 
ATOM   9521  N ND1 . HIS D  1 110 ? 55.910  175.295 17.010  1.00 38.53 ? 135 HIS D ND1 1 
ATOM   9522  C CD2 . HIS D  1 110 ? 55.046  174.635 18.905  1.00 37.30 ? 135 HIS D CD2 1 
ATOM   9523  C CE1 . HIS D  1 110 ? 54.595  175.285 16.857  1.00 39.76 ? 135 HIS D CE1 1 
ATOM   9524  N NE2 . HIS D  1 110 ? 54.047  174.898 17.996  1.00 39.28 ? 135 HIS D NE2 1 
ATOM   9525  N N   . ASN D  1 111 ? 60.591  172.607 18.449  1.00 33.95 ? 136 ASN D N   1 
ATOM   9526  C CA  . ASN D  1 111 ? 62.054  172.564 18.549  1.00 33.34 ? 136 ASN D CA  1 
ATOM   9527  C C   . ASN D  1 111 ? 62.636  173.256 19.800  1.00 31.53 ? 136 ASN D C   1 
ATOM   9528  O O   . ASN D  1 111 ? 63.767  173.777 19.758  1.00 30.77 ? 136 ASN D O   1 
ATOM   9529  C CB  . ASN D  1 111 ? 62.661  173.165 17.270  1.00 34.92 ? 136 ASN D CB  1 
ATOM   9530  C CG  . ASN D  1 111 ? 64.099  172.717 17.016  1.00 36.12 ? 136 ASN D CG  1 
ATOM   9531  O OD1 . ASN D  1 111 ? 64.604  171.775 17.642  1.00 35.63 ? 136 ASN D OD1 1 
ATOM   9532  N ND2 . ASN D  1 111 ? 64.761  173.390 16.068  1.00 37.11 ? 136 ASN D ND2 1 
ATOM   9533  N N   . PHE D  1 112 ? 61.874  173.262 20.899  1.00 30.14 ? 137 PHE D N   1 
ATOM   9534  C CA  . PHE D  1 112 ? 62.347  173.764 22.205  1.00 28.58 ? 137 PHE D CA  1 
ATOM   9535  C C   . PHE D  1 112 ? 63.040  172.630 22.941  1.00 28.48 ? 137 PHE D C   1 
ATOM   9536  O O   . PHE D  1 112 ? 62.633  171.474 22.820  1.00 30.45 ? 137 PHE D O   1 
ATOM   9537  C CB  . PHE D  1 112 ? 61.189  174.229 23.083  1.00 27.41 ? 137 PHE D CB  1 
ATOM   9538  C CG  . PHE D  1 112 ? 60.644  175.586 22.730  1.00 28.09 ? 137 PHE D CG  1 
ATOM   9539  C CD1 . PHE D  1 112 ? 61.258  176.740 23.199  1.00 26.16 ? 137 PHE D CD1 1 
ATOM   9540  C CD2 . PHE D  1 112 ? 59.482  175.707 21.975  1.00 29.32 ? 137 PHE D CD2 1 
ATOM   9541  C CE1 . PHE D  1 112 ? 60.744  177.997 22.902  1.00 26.35 ? 137 PHE D CE1 1 
ATOM   9542  C CE2 . PHE D  1 112 ? 58.958  176.962 21.662  1.00 29.38 ? 137 PHE D CE2 1 
ATOM   9543  C CZ  . PHE D  1 112 ? 59.596  178.112 22.126  1.00 27.58 ? 137 PHE D CZ  1 
ATOM   9544  N N   . ASP D  1 113 ? 64.081  172.953 23.700  1.00 27.01 ? 138 ASP D N   1 
ATOM   9545  C CA  . ASP D  1 113 ? 64.838  171.937 24.430  1.00 26.71 ? 138 ASP D CA  1 
ATOM   9546  C C   . ASP D  1 113 ? 64.345  171.683 25.873  1.00 25.90 ? 138 ASP D C   1 
ATOM   9547  O O   . ASP D  1 113 ? 64.888  170.825 26.565  1.00 26.04 ? 138 ASP D O   1 
ATOM   9548  C CB  . ASP D  1 113 ? 66.317  172.316 24.438  1.00 26.52 ? 138 ASP D CB  1 
ATOM   9549  C CG  . ASP D  1 113 ? 66.892  172.364 23.040  1.00 27.49 ? 138 ASP D CG  1 
ATOM   9550  O OD1 . ASP D  1 113 ? 67.183  171.290 22.491  1.00 31.27 ? 138 ASP D OD1 1 
ATOM   9551  O OD2 . ASP D  1 113 ? 66.986  173.464 22.464  1.00 26.87 ? 138 ASP D OD2 1 
ATOM   9552  N N   . GLY D  1 114 ? 63.329  172.413 26.333  1.00 25.41 ? 139 GLY D N   1 
ATOM   9553  C CA  . GLY D  1 114 ? 62.877  172.257 27.725  1.00 24.24 ? 139 GLY D CA  1 
ATOM   9554  C C   . GLY D  1 114 ? 61.932  173.353 28.193  1.00 24.06 ? 139 GLY D C   1 
ATOM   9555  O O   . GLY D  1 114 ? 61.662  174.300 27.458  1.00 24.16 ? 139 GLY D O   1 
ATOM   9556  N N   . LEU D  1 115 ? 61.452  173.229 29.430  1.00 23.51 ? 140 LEU D N   1 
ATOM   9557  C CA  . LEU D  1 115 ? 60.503  174.173 30.027  1.00 22.90 ? 140 LEU D CA  1 
ATOM   9558  C C   . LEU D  1 115 ? 61.140  174.848 31.231  1.00 21.88 ? 140 LEU D C   1 
ATOM   9559  O O   . LEU D  1 115 ? 61.796  174.179 32.025  1.00 22.32 ? 140 LEU D O   1 
ATOM   9560  C CB  . LEU D  1 115 ? 59.264  173.408 30.504  1.00 23.39 ? 140 LEU D CB  1 
ATOM   9561  C CG  . LEU D  1 115 ? 58.184  174.251 31.209  1.00 23.33 ? 140 LEU D CG  1 
ATOM   9562  C CD1 . LEU D  1 115 ? 57.517  175.182 30.211  1.00 23.29 ? 140 LEU D CD1 1 
ATOM   9563  C CD2 . LEU D  1 115 ? 57.149  173.338 31.869  1.00 24.84 ? 140 LEU D CD2 1 
ATOM   9564  N N   . ASP D  1 116 ? 60.957  176.163 31.360  1.00 21.73 ? 141 ASP D N   1 
ATOM   9565  C CA  . ASP D  1 116 ? 61.321  176.911 32.573  1.00 20.93 ? 141 ASP D CA  1 
ATOM   9566  C C   . ASP D  1 116 ? 60.022  177.254 33.291  1.00 21.74 ? 141 ASP D C   1 
ATOM   9567  O O   . ASP D  1 116 ? 59.168  177.915 32.719  1.00 21.92 ? 141 ASP D O   1 
ATOM   9568  C CB  . ASP D  1 116 ? 62.013  178.221 32.180  1.00 20.50 ? 141 ASP D CB  1 
ATOM   9569  C CG  . ASP D  1 116 ? 62.387  179.079 33.394  1.00 20.62 ? 141 ASP D CG  1 
ATOM   9570  O OD1 . ASP D  1 116 ? 63.186  178.617 34.242  1.00 21.67 ? 141 ASP D OD1 1 
ATOM   9571  O OD2 . ASP D  1 116 ? 61.886  180.213 33.507  1.00 21.80 ? 141 ASP D OD2 1 
ATOM   9572  N N   . VAL D  1 117 ? 59.837  176.798 34.526  1.00 21.24 ? 142 VAL D N   1 
ATOM   9573  C CA  . VAL D  1 117 ? 58.648  177.211 35.222  1.00 21.46 ? 142 VAL D CA  1 
ATOM   9574  C C   . VAL D  1 117 ? 59.019  178.318 36.206  1.00 20.87 ? 142 VAL D C   1 
ATOM   9575  O O   . VAL D  1 117 ? 59.716  178.060 37.180  1.00 21.05 ? 142 VAL D O   1 
ATOM   9576  C CB  . VAL D  1 117 ? 57.999  176.064 36.011  1.00 22.30 ? 142 VAL D CB  1 
ATOM   9577  C CG1 . VAL D  1 117 ? 56.802  176.606 36.763  1.00 22.41 ? 142 VAL D CG1 1 
ATOM   9578  C CG2 . VAL D  1 117 ? 57.570  174.914 35.075  1.00 21.82 ? 142 VAL D CG2 1 
ATOM   9579  N N   . SER D  1 118 ? 58.538  179.526 35.954  1.00 20.84 ? 143 SER D N   1 
ATOM   9580  C CA  . SER D  1 118 ? 58.881  180.679 36.777  1.00 20.67 ? 143 SER D CA  1 
ATOM   9581  C C   . SER D  1 118 ? 57.646  181.191 37.463  1.00 20.79 ? 143 SER D C   1 
ATOM   9582  O O   . SER D  1 118 ? 57.066  182.223 37.085  1.00 21.67 ? 143 SER D O   1 
ATOM   9583  C CB  . SER D  1 118 ? 59.545  181.768 35.935  1.00 20.27 ? 143 SER D CB  1 
ATOM   9584  O OG  . SER D  1 118 ? 60.872  181.380 35.655  1.00 20.30 ? 143 SER D OG  1 
ATOM   9585  N N   . TRP D  1 119 ? 57.225  180.443 38.477  1.00 20.51 ? 144 TRP D N   1 
ATOM   9586  C CA  . TRP D  1 119 ? 55.981  180.752 39.165  1.00 20.40 ? 144 TRP D CA  1 
ATOM   9587  C C   . TRP D  1 119 ? 56.269  181.834 40.215  1.00 19.69 ? 144 TRP D C   1 
ATOM   9588  O O   . TRP D  1 119 ? 57.027  181.621 41.164  1.00 19.26 ? 144 TRP D O   1 
ATOM   9589  C CB  . TRP D  1 119 ? 55.429  179.458 39.785  1.00 21.03 ? 144 TRP D CB  1 
ATOM   9590  C CG  . TRP D  1 119 ? 54.117  179.572 40.534  1.00 22.51 ? 144 TRP D CG  1 
ATOM   9591  C CD1 . TRP D  1 119 ? 53.651  180.654 41.235  1.00 22.27 ? 144 TRP D CD1 1 
ATOM   9592  C CD2 . TRP D  1 119 ? 53.143  178.532 40.708  1.00 23.62 ? 144 TRP D CD2 1 
ATOM   9593  N NE1 . TRP D  1 119 ? 52.435  180.353 41.819  1.00 24.46 ? 144 TRP D NE1 1 
ATOM   9594  C CE2 . TRP D  1 119 ? 52.102  179.059 41.508  1.00 23.77 ? 144 TRP D CE2 1 
ATOM   9595  C CE3 . TRP D  1 119 ? 53.040  177.213 40.248  1.00 24.37 ? 144 TRP D CE3 1 
ATOM   9596  C CZ2 . TRP D  1 119 ? 50.962  178.313 41.847  1.00 25.33 ? 144 TRP D CZ2 1 
ATOM   9597  C CZ3 . TRP D  1 119 ? 51.913  176.468 40.598  1.00 23.94 ? 144 TRP D CZ3 1 
ATOM   9598  C CH2 . TRP D  1 119 ? 50.898  177.018 41.394  1.00 26.12 ? 144 TRP D CH2 1 
ATOM   9599  N N   . ILE D  1 120 ? 55.681  183.008 40.030  1.00 20.01 ? 145 ILE D N   1 
ATOM   9600  C CA  . ILE D  1 120 ? 55.922  184.148 40.930  1.00 20.10 ? 145 ILE D CA  1 
ATOM   9601  C C   . ILE D  1 120 ? 54.654  184.474 41.737  1.00 20.91 ? 145 ILE D C   1 
ATOM   9602  O O   . ILE D  1 120 ? 53.775  185.200 41.216  1.00 21.97 ? 145 ILE D O   1 
ATOM   9603  C CB  . ILE D  1 120 ? 56.314  185.397 40.091  1.00 19.21 ? 145 ILE D CB  1 
ATOM   9604  C CG1 . ILE D  1 120 ? 57.381  185.019 39.060  1.00 18.56 ? 145 ILE D CG1 1 
ATOM   9605  C CG2 . ILE D  1 120 ? 56.794  186.565 40.986  1.00 19.25 ? 145 ILE D CG2 1 
ATOM   9606  C CD1 . ILE D  1 120 ? 58.713  184.542 39.699  1.00 18.02 ? 145 ILE D CD1 1 
ATOM   9607  N N   . TYR D  1 121 ? 54.485  183.958 42.970  1.00 20.97 ? 146 TYR D N   1 
ATOM   9608  C CA  . TYR D  1 121 ? 55.313  182.953 43.657  1.00 20.60 ? 146 TYR D CA  1 
ATOM   9609  C C   . TYR D  1 121 ? 54.339  181.912 44.217  1.00 21.52 ? 146 TYR D C   1 
ATOM   9610  O O   . TYR D  1 121 ? 53.188  182.237 44.466  1.00 23.14 ? 146 TYR D O   1 
ATOM   9611  C CB  . TYR D  1 121 ? 56.009  183.579 44.870  1.00 20.71 ? 146 TYR D CB  1 
ATOM   9612  C CG  . TYR D  1 121 ? 56.895  184.779 44.556  1.00 19.87 ? 146 TYR D CG  1 
ATOM   9613  C CD1 . TYR D  1 121 ? 58.126  184.606 43.929  1.00 19.82 ? 146 TYR D CD1 1 
ATOM   9614  C CD2 . TYR D  1 121 ? 56.499  186.072 44.896  1.00 22.66 ? 146 TYR D CD2 1 
ATOM   9615  C CE1 . TYR D  1 121 ? 58.960  185.711 43.647  1.00 20.07 ? 146 TYR D CE1 1 
ATOM   9616  C CE2 . TYR D  1 121 ? 57.318  187.183 44.616  1.00 21.21 ? 146 TYR D CE2 1 
ATOM   9617  C CZ  . TYR D  1 121 ? 58.532  186.993 43.993  1.00 21.33 ? 146 TYR D CZ  1 
ATOM   9618  O OH  . TYR D  1 121 ? 59.342  188.088 43.719  1.00 21.31 ? 146 TYR D OH  1 
ATOM   9619  N N   . PRO D  1 122 ? 54.797  180.671 44.467  1.00 21.23 ? 147 PRO D N   1 
ATOM   9620  C CA  . PRO D  1 122 ? 53.877  179.733 45.127  1.00 22.40 ? 147 PRO D CA  1 
ATOM   9621  C C   . PRO D  1 122 ? 53.478  180.240 46.511  1.00 23.00 ? 147 PRO D C   1 
ATOM   9622  O O   . PRO D  1 122 ? 52.332  180.090 46.902  1.00 23.73 ? 147 PRO D O   1 
ATOM   9623  C CB  . PRO D  1 122 ? 54.703  178.452 45.265  1.00 22.08 ? 147 PRO D CB  1 
ATOM   9624  C CG  . PRO D  1 122 ? 55.725  178.551 44.108  1.00 20.71 ? 147 PRO D CG  1 
ATOM   9625  C CD  . PRO D  1 122 ? 56.082  180.037 44.122  1.00 20.23 ? 147 PRO D CD  1 
ATOM   9626  N N   . ASP D  1 123 ? 54.430  180.835 47.232  1.00 23.34 ? 148 ASP D N   1 
ATOM   9627  C CA  . ASP D  1 123 ? 54.206  181.212 48.632  1.00 24.36 ? 148 ASP D CA  1 
ATOM   9628  C C   . ASP D  1 123 ? 53.685  179.984 49.412  1.00 25.52 ? 148 ASP D C   1 
ATOM   9629  O O   . ASP D  1 123 ? 53.690  178.850 48.900  1.00 25.50 ? 148 ASP D O   1 
ATOM   9630  C CB  . ASP D  1 123 ? 53.192  182.356 48.726  1.00 24.94 ? 148 ASP D CB  1 
ATOM   9631  C CG  . ASP D  1 123 ? 53.448  183.269 49.924  1.00 26.77 ? 148 ASP D CG  1 
ATOM   9632  O OD1 . ASP D  1 123 ? 53.953  182.805 50.976  1.00 27.44 ? 148 ASP D OD1 1 
ATOM   9633  O OD2 . ASP D  1 123 ? 53.183  184.475 49.779  1.00 28.52 ? 148 ASP D OD2 1 
ATOM   9634  N N   . GLN D  1 124 ? 53.198  180.206 50.629  1.00 26.42 ? 149 GLN D N   1 
ATOM   9635  C CA  . GLN D  1 124 ? 52.767  179.077 51.451  1.00 28.44 ? 149 GLN D CA  1 
ATOM   9636  C C   . GLN D  1 124 ? 51.563  178.379 50.847  1.00 28.51 ? 149 GLN D C   1 
ATOM   9637  O O   . GLN D  1 124 ? 51.451  177.154 50.902  1.00 29.61 ? 149 GLN D O   1 
ATOM   9638  C CB  . GLN D  1 124 ? 52.386  179.534 52.851  1.00 29.68 ? 149 GLN D CB  1 
ATOM   9639  C CG  . GLN D  1 124 ? 53.419  180.398 53.531  1.00 32.56 ? 149 GLN D CG  1 
ATOM   9640  C CD  . GLN D  1 124 ? 52.947  180.817 54.912  1.00 37.41 ? 149 GLN D CD  1 
ATOM   9641  O OE1 . GLN D  1 124 ? 52.708  179.975 55.782  1.00 39.83 ? 149 GLN D OE1 1 
ATOM   9642  N NE2 . GLN D  1 124 ? 52.786  182.128 55.111  1.00 39.56 ? 149 GLN D NE2 1 
ATOM   9643  N N   . LYS D  1 125 ? 50.658  179.172 50.301  1.00 28.36 ? 150 LYS D N   1 
ATOM   9644  C CA  . LYS D  1 125 ? 49.387  178.683 49.779  1.00 30.08 ? 150 LYS D CA  1 
ATOM   9645  C C   . LYS D  1 125 ? 49.527  177.683 48.634  1.00 29.23 ? 150 LYS D C   1 
ATOM   9646  O O   . LYS D  1 125 ? 48.743  176.748 48.533  1.00 28.73 ? 150 LYS D O   1 
ATOM   9647  C CB  . LYS D  1 125 ? 48.537  179.867 49.317  1.00 30.97 ? 150 LYS D CB  1 
ATOM   9648  C CG  . LYS D  1 125 ? 47.198  179.486 48.705  1.00 35.78 ? 150 LYS D CG  1 
ATOM   9649  C CD  . LYS D  1 125 ? 46.237  180.677 48.796  1.00 41.17 ? 150 LYS D CD  1 
ATOM   9650  C CE  . LYS D  1 125 ? 45.657  181.021 47.420  1.00 44.40 ? 150 LYS D CE  1 
ATOM   9651  N NZ  . LYS D  1 125 ? 44.992  179.846 46.780  1.00 46.69 ? 150 LYS D NZ  1 
ATOM   9652  N N   . GLU D  1 126 ? 50.504  177.883 47.754  1.00 27.15 ? 151 GLU D N   1 
ATOM   9653  C CA  . GLU D  1 126 ? 50.624  177.013 46.587  1.00 28.02 ? 151 GLU D CA  1 
ATOM   9654  C C   . GLU D  1 126 ? 51.911  176.192 46.606  1.00 26.59 ? 151 GLU D C   1 
ATOM   9655  O O   . GLU D  1 126 ? 52.302  175.610 45.597  1.00 25.58 ? 151 GLU D O   1 
ATOM   9656  C CB  . GLU D  1 126 ? 50.571  177.832 45.292  1.00 27.59 ? 151 GLU D CB  1 
ATOM   9657  C CG  . GLU D  1 126 ? 49.311  178.682 45.144  1.00 31.76 ? 151 GLU D CG  1 
ATOM   9658  C CD  . GLU D  1 126 ? 48.111  177.883 44.729  1.00 35.53 ? 151 GLU D CD  1 
ATOM   9659  O OE1 . GLU D  1 126 ? 48.273  176.764 44.181  1.00 37.66 ? 151 GLU D OE1 1 
ATOM   9660  O OE2 . GLU D  1 126 ? 46.986  178.359 44.961  1.00 40.99 ? 151 GLU D OE2 1 
ATOM   9661  N N   . ASN D  1 127 ? 52.560  176.160 47.761  1.00 26.55 ? 152 ASN D N   1 
ATOM   9662  C CA  . ASN D  1 127 ? 53.791  175.397 47.935  1.00 25.97 ? 152 ASN D CA  1 
ATOM   9663  C C   . ASN D  1 127 ? 53.564  173.952 47.467  1.00 25.87 ? 152 ASN D C   1 
ATOM   9664  O O   . ASN D  1 127 ? 54.332  173.406 46.668  1.00 25.51 ? 152 ASN D O   1 
ATOM   9665  C CB  . ASN D  1 127 ? 54.242  175.482 49.403  1.00 26.15 ? 152 ASN D CB  1 
ATOM   9666  C CG  . ASN D  1 127 ? 55.364  174.513 49.732  1.00 27.86 ? 152 ASN D CG  1 
ATOM   9667  O OD1 . ASN D  1 127 ? 55.292  173.334 49.387  1.00 27.25 ? 152 ASN D OD1 1 
ATOM   9668  N ND2 . ASN D  1 127 ? 56.398  175.004 50.426  1.00 25.54 ? 152 ASN D ND2 1 
ATOM   9669  N N   . THR D  1 128 ? 52.468  173.353 47.916  1.00 26.30 ? 153 THR D N   1 
ATOM   9670  C CA  . THR D  1 128 ? 52.185  171.975 47.549  1.00 27.15 ? 153 THR D CA  1 
ATOM   9671  C C   . THR D  1 128 ? 51.920  171.839 46.051  1.00 27.13 ? 153 THR D C   1 
ATOM   9672  O O   . THR D  1 128 ? 52.478  170.954 45.404  1.00 26.83 ? 153 THR D O   1 
ATOM   9673  C CB  . THR D  1 128 ? 51.000  171.407 48.333  1.00 28.56 ? 153 THR D CB  1 
ATOM   9674  O OG1 . THR D  1 128 ? 51.354  171.305 49.723  1.00 28.66 ? 153 THR D OG1 1 
ATOM   9675  C CG2 . THR D  1 128 ? 50.612  170.017 47.808  1.00 29.05 ? 153 THR D CG2 1 
ATOM   9676  N N   . HIS D  1 129 ? 51.059  172.702 45.506  1.00 26.92 ? 154 HIS D N   1 
ATOM   9677  C CA  . HIS D  1 129 ? 50.734  172.622 44.078  1.00 27.05 ? 154 HIS D CA  1 
ATOM   9678  C C   . HIS D  1 129 ? 51.989  172.749 43.241  1.00 25.63 ? 154 HIS D C   1 
ATOM   9679  O O   . HIS D  1 129 ? 52.186  171.994 42.296  1.00 25.19 ? 154 HIS D O   1 
ATOM   9680  C CB  . HIS D  1 129 ? 49.719  173.693 43.671  1.00 27.05 ? 154 HIS D CB  1 
ATOM   9681  C CG  . HIS D  1 129 ? 48.302  173.299 43.936  1.00 29.91 ? 154 HIS D CG  1 
ATOM   9682  N ND1 . HIS D  1 129 ? 47.356  174.183 44.410  1.00 32.68 ? 154 HIS D ND1 1 
ATOM   9683  C CD2 . HIS D  1 129 ? 47.673  172.108 43.804  1.00 31.96 ? 154 HIS D CD2 1 
ATOM   9684  C CE1 . HIS D  1 129 ? 46.198  173.559 44.541  1.00 31.89 ? 154 HIS D CE1 1 
ATOM   9685  N NE2 . HIS D  1 129 ? 46.365  172.296 44.188  1.00 33.58 ? 154 HIS D NE2 1 
ATOM   9686  N N   . PHE D  1 130 ? 52.847  173.697 43.598  1.00 24.17 ? 155 PHE D N   1 
ATOM   9687  C CA  . PHE D  1 130 ? 54.082  173.908 42.833  1.00 23.91 ? 155 PHE D CA  1 
ATOM   9688  C C   . PHE D  1 130 ? 54.972  172.668 42.926  1.00 24.45 ? 155 PHE D C   1 
ATOM   9689  O O   . PHE D  1 130 ? 55.494  172.190 41.930  1.00 24.66 ? 155 PHE D O   1 
ATOM   9690  C CB  . PHE D  1 130 ? 54.834  175.147 43.335  1.00 22.46 ? 155 PHE D CB  1 
ATOM   9691  C CG  . PHE D  1 130 ? 56.186  175.349 42.700  1.00 22.72 ? 155 PHE D CG  1 
ATOM   9692  C CD1 . PHE D  1 130 ? 56.296  175.857 41.404  1.00 21.17 ? 155 PHE D CD1 1 
ATOM   9693  C CD2 . PHE D  1 130 ? 57.346  175.036 43.397  1.00 23.26 ? 155 PHE D CD2 1 
ATOM   9694  C CE1 . PHE D  1 130 ? 57.532  176.067 40.823  1.00 22.08 ? 155 PHE D CE1 1 
ATOM   9695  C CE2 . PHE D  1 130 ? 58.599  175.227 42.821  1.00 20.70 ? 155 PHE D CE2 1 
ATOM   9696  C CZ  . PHE D  1 130 ? 58.696  175.748 41.533  1.00 22.89 ? 155 PHE D CZ  1 
ATOM   9697  N N   . THR D  1 131 ? 55.144  172.147 44.135  1.00 24.70 ? 156 THR D N   1 
ATOM   9698  C CA  . THR D  1 131 ? 56.048  171.027 44.340  1.00 24.57 ? 156 THR D CA  1 
ATOM   9699  C C   . THR D  1 131 ? 55.593  169.803 43.539  1.00 25.20 ? 156 THR D C   1 
ATOM   9700  O O   . THR D  1 131 ? 56.410  169.057 42.996  1.00 24.02 ? 156 THR D O   1 
ATOM   9701  C CB  . THR D  1 131 ? 56.109  170.666 45.837  1.00 25.74 ? 156 THR D CB  1 
ATOM   9702  O OG1 . THR D  1 131 ? 56.710  171.761 46.552  1.00 25.96 ? 156 THR D OG1 1 
ATOM   9703  C CG2 . THR D  1 131 ? 56.922  169.423 46.059  1.00 25.47 ? 156 THR D CG2 1 
ATOM   9704  N N   . VAL D  1 132 ? 54.286  169.598 43.492  1.00 25.38 ? 157 VAL D N   1 
ATOM   9705  C CA  . VAL D  1 132 ? 53.703  168.472 42.754  1.00 26.41 ? 157 VAL D CA  1 
ATOM   9706  C C   . VAL D  1 132 ? 53.834  168.700 41.236  1.00 26.33 ? 157 VAL D C   1 
ATOM   9707  O O   . VAL D  1 132 ? 54.217  167.790 40.484  1.00 26.77 ? 157 VAL D O   1 
ATOM   9708  C CB  . VAL D  1 132 ? 52.224  168.307 43.141  1.00 27.14 ? 157 VAL D CB  1 
ATOM   9709  C CG1 . VAL D  1 132 ? 51.499  167.374 42.187  1.00 28.54 ? 157 VAL D CG1 1 
ATOM   9710  C CG2 . VAL D  1 132 ? 52.105  167.809 44.584  1.00 27.69 ? 157 VAL D CG2 1 
ATOM   9711  N N   . LEU D  1 133 ? 53.501  169.911 40.793  1.00 25.77 ? 158 LEU D N   1 
ATOM   9712  C CA  . LEU D  1 133 ? 53.615  170.270 39.360  1.00 25.10 ? 158 LEU D CA  1 
ATOM   9713  C C   . LEU D  1 133 ? 55.020  170.001 38.832  1.00 25.00 ? 158 LEU D C   1 
ATOM   9714  O O   . LEU D  1 133 ? 55.196  169.354 37.793  1.00 25.68 ? 158 LEU D O   1 
ATOM   9715  C CB  . LEU D  1 133 ? 53.245  171.742 39.127  1.00 23.92 ? 158 LEU D CB  1 
ATOM   9716  C CG  . LEU D  1 133 ? 53.373  172.187 37.661  1.00 23.81 ? 158 LEU D CG  1 
ATOM   9717  C CD1 . LEU D  1 133 ? 52.415  171.380 36.797  1.00 24.17 ? 158 LEU D CD1 1 
ATOM   9718  C CD2 . LEU D  1 133 ? 53.073  173.670 37.530  1.00 23.55 ? 158 LEU D CD2 1 
ATOM   9719  N N   . ILE D  1 134 ? 56.025  170.501 39.548  1.00 24.07 ? 159 ILE D N   1 
ATOM   9720  C CA  . ILE D  1 134 ? 57.425  170.266 39.197  1.00 23.58 ? 159 ILE D CA  1 
ATOM   9721  C C   . ILE D  1 134 ? 57.771  168.768 39.178  1.00 25.21 ? 159 ILE D C   1 
ATOM   9722  O O   . ILE D  1 134 ? 58.390  168.256 38.221  1.00 24.62 ? 159 ILE D O   1 
ATOM   9723  C CB  . ILE D  1 134 ? 58.343  171.017 40.172  1.00 22.91 ? 159 ILE D CB  1 
ATOM   9724  C CG1 . ILE D  1 134 ? 58.177  172.532 39.993  1.00 22.14 ? 159 ILE D CG1 1 
ATOM   9725  C CG2 . ILE D  1 134 ? 59.796  170.574 40.012  1.00 22.81 ? 159 ILE D CG2 1 
ATOM   9726  C CD1 . ILE D  1 134 ? 58.546  173.070 38.591  1.00 21.17 ? 159 ILE D CD1 1 
ATOM   9727  N N   . HIS D  1 135 ? 57.340  168.045 40.210  1.00 25.35 ? 160 HIS D N   1 
ATOM   9728  C CA  . HIS D  1 135 ? 57.683  166.629 40.268  1.00 26.55 ? 160 HIS D CA  1 
ATOM   9729  C C   . HIS D  1 135 ? 57.030  165.854 39.117  1.00 26.92 ? 160 HIS D C   1 
ATOM   9730  O O   . HIS D  1 135 ? 57.658  164.987 38.505  1.00 27.01 ? 160 HIS D O   1 
ATOM   9731  C CB  . HIS D  1 135 ? 57.295  166.021 41.612  1.00 27.57 ? 160 HIS D CB  1 
ATOM   9732  C CG  . HIS D  1 135 ? 57.739  164.604 41.761  1.00 29.96 ? 160 HIS D CG  1 
ATOM   9733  N ND1 . HIS D  1 135 ? 59.023  164.266 42.136  1.00 31.02 ? 160 HIS D ND1 1 
ATOM   9734  C CD2 . HIS D  1 135 ? 57.082  163.436 41.559  1.00 30.84 ? 160 HIS D CD2 1 
ATOM   9735  C CE1 . HIS D  1 135 ? 59.131  162.947 42.173  1.00 32.78 ? 160 HIS D CE1 1 
ATOM   9736  N NE2 . HIS D  1 135 ? 57.970  162.420 41.824  1.00 31.40 ? 160 HIS D NE2 1 
ATOM   9737  N N   . GLU D  1 136 ? 55.778  166.172 38.796  1.00 27.01 ? 161 GLU D N   1 
ATOM   9738  C CA  . GLU D  1 136 ? 55.108  165.462 37.705  1.00 28.42 ? 161 GLU D CA  1 
ATOM   9739  C C   . GLU D  1 136 ? 55.720  165.799 36.326  1.00 28.14 ? 161 GLU D C   1 
ATOM   9740  O O   . GLU D  1 136 ? 55.764  164.945 35.420  1.00 28.36 ? 161 GLU D O   1 
ATOM   9741  C CB  . GLU D  1 136 ? 53.588  165.694 37.720  1.00 29.27 ? 161 GLU D CB  1 
ATOM   9742  C CG  . GLU D  1 136 ? 52.874  165.025 38.900  1.00 31.15 ? 161 GLU D CG  1 
ATOM   9743  C CD  . GLU D  1 136 ? 51.429  165.459 39.041  1.00 33.82 ? 161 GLU D CD  1 
ATOM   9744  O OE1 . GLU D  1 136 ? 50.981  166.313 38.236  1.00 34.90 ? 161 GLU D OE1 1 
ATOM   9745  O OE2 . GLU D  1 136 ? 50.734  164.963 39.964  1.00 35.98 ? 161 GLU D OE2 1 
ATOM   9746  N N   . LEU D  1 137 ? 56.161  167.036 36.167  1.00 26.09 ? 162 LEU D N   1 
ATOM   9747  C CA  . LEU D  1 137 ? 56.820  167.450 34.928  1.00 26.66 ? 162 LEU D CA  1 
ATOM   9748  C C   . LEU D  1 137 ? 58.110  166.657 34.788  1.00 26.88 ? 162 LEU D C   1 
ATOM   9749  O O   . LEU D  1 137 ? 58.366  166.056 33.732  1.00 27.12 ? 162 LEU D O   1 
ATOM   9750  C CB  . LEU D  1 137 ? 57.105  168.957 34.906  1.00 24.34 ? 162 LEU D CB  1 
ATOM   9751  C CG  . LEU D  1 137 ? 55.939  169.878 34.515  1.00 25.16 ? 162 LEU D CG  1 
ATOM   9752  C CD1 . LEU D  1 137 ? 56.183  171.319 35.006  1.00 23.57 ? 162 LEU D CD1 1 
ATOM   9753  C CD2 . LEU D  1 137 ? 55.712  169.855 32.999  1.00 26.33 ? 162 LEU D CD2 1 
ATOM   9754  N N   . ALA D  1 138 ? 58.910  166.628 35.851  1.00 26.50 ? 163 ALA D N   1 
ATOM   9755  C CA  . ALA D  1 138 ? 60.158  165.870 35.792  1.00 27.41 ? 163 ALA D CA  1 
ATOM   9756  C C   . ALA D  1 138 ? 59.835  164.440 35.375  1.00 29.44 ? 163 ALA D C   1 
ATOM   9757  O O   . ALA D  1 138 ? 60.432  163.919 34.430  1.00 30.01 ? 163 ALA D O   1 
ATOM   9758  C CB  . ALA D  1 138 ? 60.921  165.904 37.125  1.00 26.01 ? 163 ALA D CB  1 
ATOM   9759  N N   . GLU D  1 139 ? 58.895  163.804 36.076  1.00 30.42 ? 164 GLU D N   1 
ATOM   9760  C CA  . GLU D  1 139 ? 58.549  162.408 35.780  1.00 33.02 ? 164 GLU D CA  1 
ATOM   9761  C C   . GLU D  1 139 ? 58.163  162.205 34.332  1.00 33.00 ? 164 GLU D C   1 
ATOM   9762  O O   . GLU D  1 139 ? 58.603  161.239 33.692  1.00 33.85 ? 164 GLU D O   1 
ATOM   9763  C CB  . GLU D  1 139 ? 57.383  161.936 36.652  1.00 34.08 ? 164 GLU D CB  1 
ATOM   9764  C CG  . GLU D  1 139 ? 57.736  161.837 38.101  1.00 38.59 ? 164 GLU D CG  1 
ATOM   9765  C CD  . GLU D  1 139 ? 58.514  160.578 38.417  1.00 44.70 ? 164 GLU D CD  1 
ATOM   9766  O OE1 . GLU D  1 139 ? 57.947  159.471 38.248  1.00 48.55 ? 164 GLU D OE1 1 
ATOM   9767  O OE2 . GLU D  1 139 ? 59.680  160.703 38.854  1.00 45.47 ? 164 GLU D OE2 1 
ATOM   9768  N N   . ALA D  1 140 ? 57.297  163.085 33.830  1.00 32.07 ? 165 ALA D N   1 
ATOM   9769  C CA  . ALA D  1 140 ? 56.848  163.002 32.440  1.00 33.02 ? 165 ALA D CA  1 
ATOM   9770  C C   . ALA D  1 140 ? 57.976  163.265 31.410  1.00 32.37 ? 165 ALA D C   1 
ATOM   9771  O O   . ALA D  1 140 ? 57.996  162.644 30.354  1.00 33.33 ? 165 ALA D O   1 
ATOM   9772  C CB  . ALA D  1 140 ? 55.657  163.917 32.199  1.00 33.07 ? 165 ALA D CB  1 
ATOM   9773  N N   . PHE D  1 141 ? 58.898  164.175 31.710  1.00 30.86 ? 166 PHE D N   1 
ATOM   9774  C CA  . PHE D  1 141 ? 60.057  164.411 30.826  1.00 31.43 ? 166 PHE D CA  1 
ATOM   9775  C C   . PHE D  1 141 ? 60.975  163.191 30.817  1.00 32.73 ? 166 PHE D C   1 
ATOM   9776  O O   . PHE D  1 141 ? 61.518  162.803 29.774  1.00 33.62 ? 166 PHE D O   1 
ATOM   9777  C CB  . PHE D  1 141 ? 60.854  165.648 31.262  1.00 29.03 ? 166 PHE D CB  1 
ATOM   9778  C CG  . PHE D  1 141 ? 60.181  166.959 30.947  1.00 28.70 ? 166 PHE D CG  1 
ATOM   9779  C CD1 . PHE D  1 141 ? 58.875  167.002 30.497  1.00 29.29 ? 166 PHE D CD1 1 
ATOM   9780  C CD2 . PHE D  1 141 ? 60.856  168.156 31.142  1.00 26.84 ? 166 PHE D CD2 1 
ATOM   9781  C CE1 . PHE D  1 141 ? 58.266  168.213 30.213  1.00 29.03 ? 166 PHE D CE1 1 
ATOM   9782  C CE2 . PHE D  1 141 ? 60.246  169.372 30.873  1.00 27.29 ? 166 PHE D CE2 1 
ATOM   9783  C CZ  . PHE D  1 141 ? 58.956  169.404 30.404  1.00 27.08 ? 166 PHE D CZ  1 
ATOM   9784  N N   . GLN D  1 142 ? 61.137  162.571 31.982  1.00 33.87 ? 167 GLN D N   1 
ATOM   9785  C CA  . GLN D  1 142 ? 61.922  161.349 32.052  1.00 35.72 ? 167 GLN D CA  1 
ATOM   9786  C C   . GLN D  1 142 ? 61.234  160.204 31.289  1.00 38.09 ? 167 GLN D C   1 
ATOM   9787  O O   . GLN D  1 142 ? 61.879  159.496 30.494  1.00 39.46 ? 167 GLN D O   1 
ATOM   9788  C CB  . GLN D  1 142 ? 62.257  160.988 33.514  1.00 35.69 ? 167 GLN D CB  1 
ATOM   9789  C CG  . GLN D  1 142 ? 62.970  159.623 33.699  1.00 37.74 ? 167 GLN D CG  1 
ATOM   9790  C CD  . GLN D  1 142 ? 64.316  159.544 32.968  1.00 39.51 ? 167 GLN D CD  1 
ATOM   9791  O OE1 . GLN D  1 142 ? 64.966  160.556 32.739  1.00 38.53 ? 167 GLN D OE1 1 
ATOM   9792  N NE2 . GLN D  1 142 ? 64.729  158.334 32.605  1.00 40.66 ? 167 GLN D NE2 1 
ATOM   9793  N N   . LYS D  1 143 ? 59.930  160.016 31.498  1.00 38.72 ? 168 LYS D N   1 
ATOM   9794  C CA  . LYS D  1 143 ? 59.190  159.013 30.728  1.00 40.83 ? 168 LYS D CA  1 
ATOM   9795  C C   . LYS D  1 143 ? 59.306  159.243 29.211  1.00 41.59 ? 168 LYS D C   1 
ATOM   9796  O O   . LYS D  1 143 ? 59.578  158.304 28.441  1.00 42.67 ? 168 LYS D O   1 
ATOM   9797  C CB  . LYS D  1 143 ? 57.714  158.952 31.157  1.00 41.44 ? 168 LYS D CB  1 
ATOM   9798  C CG  . LYS D  1 143 ? 56.916  157.835 30.489  1.00 44.75 ? 168 LYS D CG  1 
ATOM   9799  C CD  . LYS D  1 143 ? 55.569  157.585 31.175  1.00 47.62 ? 168 LYS D CD  1 
ATOM   9800  C CE  . LYS D  1 143 ? 54.883  156.354 30.584  1.00 51.32 ? 168 LYS D CE  1 
ATOM   9801  N NZ  . LYS D  1 143 ? 53.612  156.019 31.285  1.00 54.89 ? 168 LYS D NZ  1 
ATOM   9802  N N   . ASP D  1 144 ? 59.082  160.483 28.785  1.00 40.68 ? 169 ASP D N   1 
ATOM   9803  C CA  . ASP D  1 144 ? 59.202  160.851 27.383  1.00 41.77 ? 169 ASP D CA  1 
ATOM   9804  C C   . ASP D  1 144 ? 60.583  160.487 26.845  1.00 42.60 ? 169 ASP D C   1 
ATOM   9805  O O   . ASP D  1 144 ? 60.716  159.884 25.781  1.00 43.88 ? 169 ASP D O   1 
ATOM   9806  C CB  . ASP D  1 144 ? 58.971  162.352 27.203  1.00 40.23 ? 169 ASP D CB  1 
ATOM   9807  C CG  . ASP D  1 144 ? 59.301  162.825 25.797  1.00 40.86 ? 169 ASP D CG  1 
ATOM   9808  O OD1 . ASP D  1 144 ? 58.597  162.423 24.861  1.00 40.94 ? 169 ASP D OD1 1 
ATOM   9809  O OD2 . ASP D  1 144 ? 60.261  163.608 25.620  1.00 39.62 ? 169 ASP D OD2 1 
ATOM   9810  N N   . PHE D  1 145 ? 61.611  160.854 27.598  1.00 42.52 ? 170 PHE D N   1 
ATOM   9811  C CA  . PHE D  1 145 ? 62.982  160.547 27.223  1.00 43.86 ? 170 PHE D CA  1 
ATOM   9812  C C   . PHE D  1 145 ? 63.148  159.087 26.805  1.00 46.79 ? 170 PHE D C   1 
ATOM   9813  O O   . PHE D  1 145 ? 63.702  158.795 25.738  1.00 47.36 ? 170 PHE D O   1 
ATOM   9814  C CB  . PHE D  1 145 ? 63.913  160.858 28.387  1.00 43.01 ? 170 PHE D CB  1 
ATOM   9815  C CG  . PHE D  1 145 ? 65.359  160.568 28.100  1.00 43.92 ? 170 PHE D CG  1 
ATOM   9816  C CD1 . PHE D  1 145 ? 65.936  160.975 26.906  1.00 43.26 ? 170 PHE D CD1 1 
ATOM   9817  C CD2 . PHE D  1 145 ? 66.149  159.913 29.035  1.00 44.68 ? 170 PHE D CD2 1 
ATOM   9818  C CE1 . PHE D  1 145 ? 67.278  160.716 26.641  1.00 44.74 ? 170 PHE D CE1 1 
ATOM   9819  C CE2 . PHE D  1 145 ? 67.486  159.654 28.780  1.00 45.89 ? 170 PHE D CE2 1 
ATOM   9820  C CZ  . PHE D  1 145 ? 68.054  160.057 27.576  1.00 45.70 ? 170 PHE D CZ  1 
ATOM   9821  N N   . THR D  1 146 ? 62.644  158.170 27.631  1.00 48.29 ? 171 THR D N   1 
ATOM   9822  C CA  . THR D  1 146 ? 62.823  156.728 27.388  1.00 51.32 ? 171 THR D CA  1 
ATOM   9823  C C   . THR D  1 146 ? 62.026  156.176 26.189  1.00 53.78 ? 171 THR D C   1 
ATOM   9824  O O   . THR D  1 146 ? 62.253  155.047 25.746  1.00 55.69 ? 171 THR D O   1 
ATOM   9825  C CB  . THR D  1 146 ? 62.520  155.886 28.658  1.00 51.96 ? 171 THR D CB  1 
ATOM   9826  O OG1 . THR D  1 146 ? 61.112  155.914 28.941  1.00 51.90 ? 171 THR D OG1 1 
ATOM   9827  C CG2 . THR D  1 146 ? 63.304  156.422 29.861  1.00 49.73 ? 171 THR D CG2 1 
ATOM   9828  N N   . LYS D  1 147 ? 61.094  156.967 25.670  1.00 54.43 ? 172 LYS D N   1 
ATOM   9829  C CA  . LYS D  1 147 ? 60.386  156.605 24.442  1.00 57.12 ? 172 LYS D CA  1 
ATOM   9830  C C   . LYS D  1 147 ? 61.012  157.317 23.234  1.00 57.60 ? 172 LYS D C   1 
ATOM   9831  O O   . LYS D  1 147 ? 60.590  157.110 22.092  1.00 59.07 ? 172 LYS D O   1 
ATOM   9832  C CB  . LYS D  1 147 ? 58.891  156.925 24.564  1.00 57.24 ? 172 LYS D CB  1 
ATOM   9833  C CG  . LYS D  1 147 ? 58.262  156.386 25.840  1.00 58.22 ? 172 LYS D CG  1 
ATOM   9834  C CD  . LYS D  1 147 ? 56.748  156.528 25.867  1.00 59.81 ? 172 LYS D CD  1 
ATOM   9835  C CE  . LYS D  1 147 ? 56.189  155.765 27.065  1.00 60.88 ? 172 LYS D CE  1 
ATOM   9836  N NZ  . LYS D  1 147 ? 54.747  155.363 26.954  1.00 62.75 ? 172 LYS D NZ  1 
ATOM   9837  N N   . SER D  1 148 ? 62.015  158.153 23.510  1.00 56.66 ? 173 SER D N   1 
ATOM   9838  C CA  . SER D  1 148 ? 62.882  158.784 22.501  1.00 57.44 ? 173 SER D CA  1 
ATOM   9839  C C   . SER D  1 148 ? 64.238  158.072 22.482  1.00 58.33 ? 173 SER D C   1 
ATOM   9840  O O   . SER D  1 148 ? 64.489  157.261 23.377  1.00 58.83 ? 173 SER D O   1 
ATOM   9841  C CB  . SER D  1 148 ? 63.125  160.236 22.899  1.00 55.40 ? 173 SER D CB  1 
ATOM   9842  O OG  . SER D  1 148 ? 62.019  161.059 22.582  1.00 55.59 ? 173 SER D OG  1 
ATOM   9843  N N   . THR D  1 149 ? 65.135  158.323 21.518  1.00 59.05 ? 174 THR D N   1 
ATOM   9844  C CA  . THR D  1 149 ? 64.962  159.093 20.261  1.00 59.22 ? 174 THR D CA  1 
ATOM   9845  C C   . THR D  1 149 ? 65.081  160.612 20.386  1.00 57.03 ? 174 THR D C   1 
ATOM   9846  O O   . THR D  1 149 ? 64.422  161.373 19.675  1.00 57.46 ? 174 THR D O   1 
ATOM   9847  C CB  . THR D  1 149 ? 63.690  158.690 19.458  1.00 61.04 ? 174 THR D CB  1 
ATOM   9848  O OG1 . THR D  1 149 ? 62.683  159.705 19.595  1.00 59.94 ? 174 THR D OG1 1 
ATOM   9849  C CG2 . THR D  1 149 ? 63.151  157.324 19.915  1.00 62.07 ? 174 THR D CG2 1 
ATOM   9850  N N   . LYS D  1 150 ? 65.944  161.070 21.274  1.00 54.87 ? 175 LYS D N   1 
ATOM   9851  C CA  . LYS D  1 150 ? 66.082  162.499 21.452  1.00 51.94 ? 175 LYS D CA  1 
ATOM   9852  C C   . LYS D  1 150 ? 66.529  162.773 22.857  1.00 48.92 ? 175 LYS D C   1 
ATOM   9853  O O   . LYS D  1 150 ? 66.307  161.964 23.754  1.00 48.23 ? 175 LYS D O   1 
ATOM   9854  C CB  . LYS D  1 150 ? 64.747  163.202 21.202  1.00 52.13 ? 175 LYS D CB  1 
ATOM   9855  C CG  . LYS D  1 150 ? 64.518  163.639 19.767  1.00 55.19 ? 175 LYS D CG  1 
ATOM   9856  C CD  . LYS D  1 150 ? 63.094  164.132 19.561  1.00 56.75 ? 175 LYS D CD  1 
ATOM   9857  C CE  . LYS D  1 150 ? 63.038  165.201 18.465  1.00 58.31 ? 175 LYS D CE  1 
ATOM   9858  N NZ  . LYS D  1 150 ? 61.740  165.173 17.716  1.00 60.73 ? 175 LYS D NZ  1 
ATOM   9859  N N   . GLU D  1 151 ? 67.164  163.924 23.041  1.00 45.78 ? 176 GLU D N   1 
ATOM   9860  C CA  . GLU D  1 151 ? 67.636  164.314 24.353  1.00 43.36 ? 176 GLU D CA  1 
ATOM   9861  C C   . GLU D  1 151 ? 66.437  164.562 25.274  1.00 40.73 ? 176 GLU D C   1 
ATOM   9862  O O   . GLU D  1 151 ? 65.358  164.974 24.826  1.00 40.23 ? 176 GLU D O   1 
ATOM   9863  C CB  . GLU D  1 151 ? 68.573  165.536 24.259  1.00 42.57 ? 176 GLU D CB  1 
ATOM   9864  C CG  . GLU D  1 151 ? 69.828  165.250 23.385  1.00 46.51 ? 176 GLU D CG  1 
ATOM   9865  C CD  . GLU D  1 151 ? 70.976  166.240 23.598  1.00 48.70 ? 176 GLU D CD  1 
ATOM   9866  O OE1 . GLU D  1 151 ? 70.760  167.320 24.181  1.00 49.35 ? 176 GLU D OE1 1 
ATOM   9867  O OE2 . GLU D  1 151 ? 72.112  165.928 23.189  1.00 52.31 ? 176 GLU D OE2 1 
ATOM   9868  N N   . ARG D  1 152 ? 66.609  164.264 26.551  1.00 38.36 ? 177 ARG D N   1 
ATOM   9869  C CA  . ARG D  1 152 ? 65.539  164.522 27.497  1.00 36.05 ? 177 ARG D CA  1 
ATOM   9870  C C   . ARG D  1 152 ? 65.243  166.018 27.602  1.00 33.22 ? 177 ARG D C   1 
ATOM   9871  O O   . ARG D  1 152 ? 66.163  166.843 27.701  1.00 32.47 ? 177 ARG D O   1 
ATOM   9872  C CB  . ARG D  1 152 ? 65.897  163.990 28.872  1.00 35.81 ? 177 ARG D CB  1 
ATOM   9873  C CG  . ARG D  1 152 ? 64.960  164.513 29.943  1.00 35.61 ? 177 ARG D CG  1 
ATOM   9874  C CD  . ARG D  1 152 ? 65.286  163.909 31.307  1.00 36.29 ? 177 ARG D CD  1 
ATOM   9875  N NE  . ARG D  1 152 ? 66.611  164.291 31.800  1.00 36.84 ? 177 ARG D NE  1 
ATOM   9876  C CZ  . ARG D  1 152 ? 66.921  165.499 32.272  1.00 37.68 ? 177 ARG D CZ  1 
ATOM   9877  N NH1 . ARG D  1 152 ? 66.024  166.473 32.268  1.00 36.51 ? 177 ARG D NH1 1 
ATOM   9878  N NH2 . ARG D  1 152 ? 68.147  165.751 32.713  1.00 38.35 ? 177 ARG D NH2 1 
ATOM   9879  N N   . LEU D  1 153 ? 63.961  166.373 27.597  1.00 31.09 ? 178 LEU D N   1 
ATOM   9880  C CA  . LEU D  1 153 ? 63.566  167.762 27.826  1.00 28.86 ? 178 LEU D CA  1 
ATOM   9881  C C   . LEU D  1 153 ? 64.097  168.285 29.174  1.00 27.09 ? 178 LEU D C   1 
ATOM   9882  O O   . LEU D  1 153 ? 64.020  167.598 30.193  1.00 26.40 ? 178 LEU D O   1 
ATOM   9883  C CB  . LEU D  1 153 ? 62.044  167.923 27.732  1.00 28.33 ? 178 LEU D CB  1 
ATOM   9884  C CG  . LEU D  1 153 ? 61.406  167.636 26.360  1.00 29.11 ? 178 LEU D CG  1 
ATOM   9885  C CD1 . LEU D  1 153 ? 59.880  167.532 26.450  1.00 28.46 ? 178 LEU D CD1 1 
ATOM   9886  C CD2 . LEU D  1 153 ? 61.790  168.688 25.345  1.00 28.12 ? 178 LEU D CD2 1 
ATOM   9887  N N   . LEU D  1 154 ? 64.646  169.496 29.166  1.00 25.58 ? 179 LEU D N   1 
ATOM   9888  C CA  . LEU D  1 154 ? 65.204  170.086 30.377  1.00 24.98 ? 179 LEU D CA  1 
ATOM   9889  C C   . LEU D  1 154 ? 64.062  170.695 31.191  1.00 23.90 ? 179 LEU D C   1 
ATOM   9890  O O   . LEU D  1 154 ? 63.037  171.083 30.627  1.00 24.17 ? 179 LEU D O   1 
ATOM   9891  C CB  . LEU D  1 154 ? 66.219  171.189 30.024  1.00 24.18 ? 179 LEU D CB  1 
ATOM   9892  C CG  . LEU D  1 154 ? 67.511  170.773 29.318  1.00 27.29 ? 179 LEU D CG  1 
ATOM   9893  C CD1 . LEU D  1 154 ? 68.281  172.000 28.810  1.00 26.29 ? 179 LEU D CD1 1 
ATOM   9894  C CD2 . LEU D  1 154 ? 68.375  169.917 30.253  1.00 28.54 ? 179 LEU D CD2 1 
ATOM   9895  N N   . LEU D  1 155 ? 64.252  170.800 32.498  1.00 23.39 ? 180 LEU D N   1 
ATOM   9896  C CA  . LEU D  1 155 ? 63.268  171.441 33.380  1.00 22.72 ? 180 LEU D CA  1 
ATOM   9897  C C   . LEU D  1 155 ? 64.014  172.361 34.328  1.00 21.52 ? 180 LEU D C   1 
ATOM   9898  O O   . LEU D  1 155 ? 64.881  171.926 35.089  1.00 22.02 ? 180 LEU D O   1 
ATOM   9899  C CB  . LEU D  1 155 ? 62.476  170.394 34.173  1.00 22.87 ? 180 LEU D CB  1 
ATOM   9900  C CG  . LEU D  1 155 ? 61.382  170.973 35.085  1.00 23.30 ? 180 LEU D CG  1 
ATOM   9901  C CD1 . LEU D  1 155 ? 60.287  171.670 34.259  1.00 23.07 ? 180 LEU D CD1 1 
ATOM   9902  C CD2 . LEU D  1 155 ? 60.773  169.861 35.965  1.00 23.82 ? 180 LEU D CD2 1 
ATOM   9903  N N   . THR D  1 156 ? 63.726  173.646 34.242  1.00 20.65 ? 181 THR D N   1 
ATOM   9904  C CA  . THR D  1 156 ? 64.348  174.623 35.131  1.00 20.13 ? 181 THR D CA  1 
ATOM   9905  C C   . THR D  1 156 ? 63.252  175.412 35.795  1.00 19.30 ? 181 THR D C   1 
ATOM   9906  O O   . THR D  1 156 ? 62.089  175.308 35.413  1.00 19.49 ? 181 THR D O   1 
ATOM   9907  C CB  . THR D  1 156 ? 65.249  175.577 34.306  1.00 19.28 ? 181 THR D CB  1 
ATOM   9908  O OG1 . THR D  1 156 ? 64.428  176.339 33.415  1.00 20.58 ? 181 THR D OG1 1 
ATOM   9909  C CG2 . THR D  1 156 ? 66.234  174.760 33.477  1.00 20.32 ? 181 THR D CG2 1 
ATOM   9910  N N   . ALA D  1 157 ? 63.610  176.200 36.798  1.00 19.12 ? 182 ALA D N   1 
ATOM   9911  C CA  . ALA D  1 157 ? 62.646  177.085 37.421  1.00 19.03 ? 182 ALA D CA  1 
ATOM   9912  C C   . ALA D  1 157 ? 63.311  178.398 37.791  1.00 17.94 ? 182 ALA D C   1 
ATOM   9913  O O   . ALA D  1 157 ? 64.390  178.396 38.372  1.00 18.08 ? 182 ALA D O   1 
ATOM   9914  C CB  . ALA D  1 157 ? 62.037  176.431 38.672  1.00 19.25 ? 182 ALA D CB  1 
ATOM   9915  N N   . GLY D  1 158 ? 62.648  179.508 37.480  1.00 17.85 ? 183 GLY D N   1 
ATOM   9916  C CA  . GLY D  1 158 ? 63.021  180.814 38.014  1.00 17.09 ? 183 GLY D CA  1 
ATOM   9917  C C   . GLY D  1 158 ? 62.469  180.914 39.435  1.00 17.31 ? 183 GLY D C   1 
ATOM   9918  O O   . GLY D  1 158 ? 61.256  180.798 39.646  1.00 17.93 ? 183 GLY D O   1 
ATOM   9919  N N   . VAL D  1 159 ? 63.344  181.145 40.410  1.00 16.85 ? 184 VAL D N   1 
ATOM   9920  C CA  . VAL D  1 159 ? 62.936  181.102 41.815  1.00 16.65 ? 184 VAL D CA  1 
ATOM   9921  C C   . VAL D  1 159 ? 63.331  182.347 42.603  1.00 16.85 ? 184 VAL D C   1 
ATOM   9922  O O   . VAL D  1 159 ? 64.283  183.038 42.257  1.00 16.14 ? 184 VAL D O   1 
ATOM   9923  C CB  . VAL D  1 159 ? 63.505  179.870 42.503  1.00 17.42 ? 184 VAL D CB  1 
ATOM   9924  C CG1 . VAL D  1 159 ? 63.047  178.603 41.766  1.00 17.55 ? 184 VAL D CG1 1 
ATOM   9925  C CG2 . VAL D  1 159 ? 65.029  179.945 42.509  1.00 15.54 ? 184 VAL D CG2 1 
ATOM   9926  N N   . SER D  1 160 ? 62.558  182.656 43.635  1.00 17.12 ? 185 SER D N   1 
ATOM   9927  C CA  . SER D  1 160 ? 62.790  183.863 44.420  1.00 17.27 ? 185 SER D CA  1 
ATOM   9928  C C   . SER D  1 160 ? 64.163  183.844 45.090  1.00 17.38 ? 185 SER D C   1 
ATOM   9929  O O   . SER D  1 160 ? 64.678  182.779 45.472  1.00 16.84 ? 185 SER D O   1 
ATOM   9930  C CB  . SER D  1 160 ? 61.740  184.004 45.513  1.00 17.95 ? 185 SER D CB  1 
ATOM   9931  O OG  . SER D  1 160 ? 62.069  185.092 46.386  1.00 18.03 ? 185 SER D OG  1 
ATOM   9932  N N   . ALA D  1 161 ? 64.721  185.037 45.254  1.00 16.34 ? 186 ALA D N   1 
ATOM   9933  C CA  . ALA D  1 161 ? 65.985  185.232 45.967  1.00 16.87 ? 186 ALA D CA  1 
ATOM   9934  C C   . ALA D  1 161 ? 65.759  185.831 47.359  1.00 17.85 ? 186 ALA D C   1 
ATOM   9935  O O   . ALA D  1 161 ? 66.713  186.195 48.042  1.00 17.90 ? 186 ALA D O   1 
ATOM   9936  C CB  . ALA D  1 161 ? 66.901  186.144 45.163  1.00 16.02 ? 186 ALA D CB  1 
ATOM   9937  N N   . GLY D  1 162 ? 64.497  185.960 47.754  1.00 18.06 ? 187 GLY D N   1 
ATOM   9938  C CA  . GLY D  1 162 ? 64.152  186.552 49.051  1.00 19.22 ? 187 GLY D CA  1 
ATOM   9939  C C   . GLY D  1 162 ? 63.905  185.481 50.084  1.00 20.30 ? 187 GLY D C   1 
ATOM   9940  O O   . GLY D  1 162 ? 63.072  184.587 49.876  1.00 20.14 ? 187 GLY D O   1 
ATOM   9941  N N   . ARG D  1 163 ? 64.621  185.585 51.207  1.00 20.48 ? 188 ARG D N   1 
ATOM   9942  C CA  . ARG D  1 163 ? 64.629  184.520 52.205  1.00 21.40 ? 188 ARG D CA  1 
ATOM   9943  C C   . ARG D  1 163 ? 63.248  184.052 52.636  1.00 22.28 ? 188 ARG D C   1 
ATOM   9944  O O   . ARG D  1 163 ? 62.991  182.851 52.680  1.00 22.21 ? 188 ARG D O   1 
ATOM   9945  C CB  . ARG D  1 163 ? 65.434  184.897 53.455  1.00 22.19 ? 188 ARG D CB  1 
ATOM   9946  C CG  . ARG D  1 163 ? 65.486  183.712 54.438  1.00 24.55 ? 188 ARG D CG  1 
ATOM   9947  C CD  . ARG D  1 163 ? 66.082  184.031 55.794  1.00 29.68 ? 188 ARG D CD  1 
ATOM   9948  N NE  . ARG D  1 163 ? 65.897  182.897 56.699  1.00 32.21 ? 188 ARG D NE  1 
ATOM   9949  C CZ  . ARG D  1 163 ? 66.581  182.704 57.819  1.00 35.50 ? 188 ARG D CZ  1 
ATOM   9950  N NH1 . ARG D  1 163 ? 67.516  183.565 58.182  1.00 37.01 ? 188 ARG D NH1 1 
ATOM   9951  N NH2 . ARG D  1 163 ? 66.335  181.641 58.577  1.00 36.51 ? 188 ARG D NH2 1 
ATOM   9952  N N   . GLN D  1 164 ? 62.377  184.992 52.997  1.00 22.57 ? 189 GLN D N   1 
ATOM   9953  C CA  . GLN D  1 164 ? 61.020  184.672 53.423  1.00 23.88 ? 189 GLN D CA  1 
ATOM   9954  C C   . GLN D  1 164 ? 60.221  183.900 52.357  1.00 23.00 ? 189 GLN D C   1 
ATOM   9955  O O   . GLN D  1 164 ? 59.528  182.918 52.660  1.00 22.90 ? 189 GLN D O   1 
ATOM   9956  C CB  . GLN D  1 164 ? 60.252  185.954 53.794  1.00 25.04 ? 189 GLN D CB  1 
ATOM   9957  C CG  . GLN D  1 164 ? 58.886  185.658 54.436  1.00 30.33 ? 189 GLN D CG  1 
ATOM   9958  C CD  . GLN D  1 164 ? 58.997  184.829 55.714  1.00 37.25 ? 189 GLN D CD  1 
ATOM   9959  O OE1 . GLN D  1 164 ? 58.718  183.614 55.722  1.00 40.04 ? 189 GLN D OE1 1 
ATOM   9960  N NE2 . GLN D  1 164 ? 59.391  185.482 56.809  1.00 39.63 ? 189 GLN D NE2 1 
ATOM   9961  N N   . MET D  1 165 ? 60.282  184.383 51.124  1.00 21.54 ? 190 MET D N   1 
ATOM   9962  C CA  . MET D  1 165 ? 59.526  183.760 50.033  1.00 21.02 ? 190 MET D CA  1 
ATOM   9963  C C   . MET D  1 165 ? 60.078  182.374 49.719  1.00 20.56 ? 190 MET D C   1 
ATOM   9964  O O   . MET D  1 165 ? 59.315  181.464 49.361  1.00 20.40 ? 190 MET D O   1 
ATOM   9965  C CB  . MET D  1 165 ? 59.545  184.637 48.777  1.00 20.49 ? 190 MET D CB  1 
ATOM   9966  C CG  . MET D  1 165 ? 58.519  184.238 47.701  1.00 20.14 ? 190 MET D CG  1 
ATOM   9967  S SD  . MET D  1 165 ? 56.817  184.025 48.302  1.00 23.14 ? 190 MET D SD  1 
ATOM   9968  C CE  . MET D  1 165 ? 56.275  185.724 48.626  1.00 26.12 ? 190 MET D CE  1 
ATOM   9969  N N   . ILE D  1 166 ? 61.399  182.228 49.820  1.00 19.84 ? 191 ILE D N   1 
ATOM   9970  C CA  . ILE D  1 166 ? 62.052  180.912 49.658  1.00 19.64 ? 191 ILE D CA  1 
ATOM   9971  C C   . ILE D  1 166 ? 61.515  179.927 50.698  1.00 21.12 ? 191 ILE D C   1 
ATOM   9972  O O   . ILE D  1 166 ? 61.052  178.823 50.347  1.00 21.44 ? 191 ILE D O   1 
ATOM   9973  C CB  . ILE D  1 166 ? 63.601  181.022 49.744  1.00 19.27 ? 191 ILE D CB  1 
ATOM   9974  C CG1 . ILE D  1 166 ? 64.139  181.887 48.580  1.00 18.13 ? 191 ILE D CG1 1 
ATOM   9975  C CG2 . ILE D  1 166 ? 64.266  179.615 49.745  1.00 18.62 ? 191 ILE D CG2 1 
ATOM   9976  C CD1 . ILE D  1 166 ? 65.594  182.373 48.774  1.00 17.24 ? 191 ILE D CD1 1 
ATOM   9977  N N   . ASP D  1 167 ? 61.563  180.321 51.972  1.00 21.86 ? 192 ASP D N   1 
ATOM   9978  C CA  . ASP D  1 167 ? 61.079  179.462 53.065  1.00 23.97 ? 192 ASP D CA  1 
ATOM   9979  C C   . ASP D  1 167 ? 59.625  179.075 52.853  1.00 23.91 ? 192 ASP D C   1 
ATOM   9980  O O   . ASP D  1 167 ? 59.241  177.930 53.123  1.00 25.05 ? 192 ASP D O   1 
ATOM   9981  C CB  . ASP D  1 167 ? 61.175  180.155 54.434  1.00 25.13 ? 192 ASP D CB  1 
ATOM   9982  C CG  . ASP D  1 167 ? 62.612  180.256 54.963  1.00 27.84 ? 192 ASP D CG  1 
ATOM   9983  O OD1 . ASP D  1 167 ? 63.528  179.546 54.477  1.00 27.56 ? 192 ASP D OD1 1 
ATOM   9984  O OD2 . ASP D  1 167 ? 62.811  181.065 55.892  1.00 29.32 ? 192 ASP D OD2 1 
ATOM   9985  N N   . ASN D  1 168 ? 58.812  180.036 52.415  1.00 23.22 ? 193 ASN D N   1 
ATOM   9986  C CA  . ASN D  1 168 ? 57.358  179.807 52.222  1.00 23.73 ? 193 ASN D CA  1 
ATOM   9987  C C   . ASN D  1 168 ? 57.037  178.898 51.016  1.00 23.66 ? 193 ASN D C   1 
ATOM   9988  O O   . ASN D  1 168 ? 56.156  178.047 51.087  1.00 23.51 ? 193 ASN D O   1 
ATOM   9989  C CB  . ASN D  1 168 ? 56.628  181.145 52.018  1.00 24.13 ? 193 ASN D CB  1 
ATOM   9990  C CG  . ASN D  1 168 ? 56.481  181.944 53.310  1.00 25.77 ? 193 ASN D CG  1 
ATOM   9991  O OD1 . ASN D  1 168 ? 56.761  181.444 54.386  1.00 28.10 ? 193 ASN D OD1 1 
ATOM   9992  N ND2 . ASN D  1 168 ? 56.002  183.183 53.198  1.00 27.95 ? 193 ASN D ND2 1 
ATOM   9993  N N   . SER D  1 169 ? 57.781  179.074 49.925  1.00 21.07 ? 194 SER D N   1 
ATOM   9994  C CA  . SER D  1 169 ? 57.352  178.589 48.610  1.00 21.44 ? 194 SER D CA  1 
ATOM   9995  C C   . SER D  1 169 ? 57.877  177.205 48.230  1.00 21.51 ? 194 SER D C   1 
ATOM   9996  O O   . SER D  1 169 ? 57.214  176.467 47.502  1.00 21.08 ? 194 SER D O   1 
ATOM   9997  C CB  . SER D  1 169 ? 57.801  179.572 47.517  1.00 20.19 ? 194 SER D CB  1 
ATOM   9998  O OG  . SER D  1 169 ? 57.189  180.844 47.656  1.00 20.00 ? 194 SER D OG  1 
ATOM   9999  N N   . TYR D  1 170 ? 59.072  176.859 48.702  1.00 21.24 ? 195 TYR D N   1 
ATOM   10000 C CA  . TYR D  1 170 ? 59.807  175.769 48.077  1.00 21.45 ? 195 TYR D CA  1 
ATOM   10001 C C   . TYR D  1 170 ? 60.162  174.606 49.004  1.00 22.57 ? 195 TYR D C   1 
ATOM   10002 O O   . TYR D  1 170 ? 60.468  174.802 50.178  1.00 22.17 ? 195 TYR D O   1 
ATOM   10003 C CB  . TYR D  1 170 ? 61.080  176.314 47.427  1.00 19.97 ? 195 TYR D CB  1 
ATOM   10004 C CG  . TYR D  1 170 ? 60.863  177.496 46.485  1.00 19.83 ? 195 TYR D CG  1 
ATOM   10005 C CD1 . TYR D  1 170 ? 60.075  177.365 45.346  1.00 20.44 ? 195 TYR D CD1 1 
ATOM   10006 C CD2 . TYR D  1 170 ? 61.478  178.737 46.721  1.00 16.72 ? 195 TYR D CD2 1 
ATOM   10007 C CE1 . TYR D  1 170 ? 59.894  178.438 44.459  1.00 19.37 ? 195 TYR D CE1 1 
ATOM   10008 C CE2 . TYR D  1 170 ? 61.310  179.811 45.841  1.00 17.50 ? 195 TYR D CE2 1 
ATOM   10009 C CZ  . TYR D  1 170 ? 60.517  179.651 44.721  1.00 18.05 ? 195 TYR D CZ  1 
ATOM   10010 O OH  . TYR D  1 170 ? 60.320  180.688 43.866  1.00 17.69 ? 195 TYR D OH  1 
ATOM   10011 N N   . GLN D  1 171 ? 60.139  173.395 48.441  1.00 23.01 ? 196 GLN D N   1 
ATOM   10012 C CA  . GLN D  1 171 ? 60.687  172.216 49.105  1.00 24.08 ? 196 GLN D CA  1 
ATOM   10013 C C   . GLN D  1 171 ? 62.025  171.958 48.442  1.00 24.14 ? 196 GLN D C   1 
ATOM   10014 O O   . GLN D  1 171 ? 62.107  171.305 47.393  1.00 24.52 ? 196 GLN D O   1 
ATOM   10015 C CB  . GLN D  1 171 ? 59.703  171.044 48.988  1.00 25.03 ? 196 GLN D CB  1 
ATOM   10016 C CG  . GLN D  1 171 ? 58.416  171.349 49.775  1.00 25.54 ? 196 GLN D CG  1 
ATOM   10017 C CD  . GLN D  1 171 ? 57.410  170.208 49.788  1.00 26.80 ? 196 GLN D CD  1 
ATOM   10018 O OE1 . GLN D  1 171 ? 57.762  169.036 49.983  1.00 26.25 ? 196 GLN D OE1 1 
ATOM   10019 N NE2 . GLN D  1 171 ? 56.141  170.556 49.609  1.00 24.21 ? 196 GLN D NE2 1 
ATOM   10020 N N   . VAL D  1 172 ? 63.074  172.513 49.043  1.00 23.70 ? 197 VAL D N   1 
ATOM   10021 C CA  . VAL D  1 172 ? 64.300  172.773 48.303  1.00 23.25 ? 197 VAL D CA  1 
ATOM   10022 C C   . VAL D  1 172 ? 65.059  171.519 47.919  1.00 24.20 ? 197 VAL D C   1 
ATOM   10023 O O   . VAL D  1 172 ? 65.484  171.383 46.767  1.00 23.45 ? 197 VAL D O   1 
ATOM   10024 C CB  . VAL D  1 172 ? 65.239  173.799 49.033  1.00 23.03 ? 197 VAL D CB  1 
ATOM   10025 C CG1 . VAL D  1 172 ? 66.584  173.902 48.299  1.00 21.76 ? 197 VAL D CG1 1 
ATOM   10026 C CG2 . VAL D  1 172 ? 64.571  175.183 49.101  1.00 20.68 ? 197 VAL D CG2 1 
ATOM   10027 N N   . GLU D  1 173 ? 65.207  170.588 48.858  1.00 26.06 ? 198 GLU D N   1 
ATOM   10028 C CA  . GLU D  1 173 ? 65.955  169.370 48.550  1.00 28.25 ? 198 GLU D CA  1 
ATOM   10029 C C   . GLU D  1 173 ? 65.274  168.597 47.426  1.00 28.53 ? 198 GLU D C   1 
ATOM   10030 O O   . GLU D  1 173 ? 65.924  168.002 46.573  1.00 28.60 ? 198 GLU D O   1 
ATOM   10031 C CB  . GLU D  1 173 ? 66.120  168.489 49.797  1.00 30.27 ? 198 GLU D CB  1 
ATOM   10032 C CG  . GLU D  1 173 ? 67.354  168.822 50.582  1.00 33.55 ? 198 GLU D CG  1 
ATOM   10033 C CD  . GLU D  1 173 ? 67.322  168.252 51.970  1.00 40.26 ? 198 GLU D CD  1 
ATOM   10034 O OE1 . GLU D  1 173 ? 66.291  168.410 52.645  1.00 43.80 ? 198 GLU D OE1 1 
ATOM   10035 O OE2 . GLU D  1 173 ? 68.322  167.640 52.386  1.00 43.96 ? 198 GLU D OE2 1 
ATOM   10036 N N   . LYS D  1 174 ? 63.953  168.642 47.417  1.00 28.57 ? 199 LYS D N   1 
ATOM   10037 C CA  . LYS D  1 174 ? 63.150  167.971 46.402  1.00 29.10 ? 199 LYS D CA  1 
ATOM   10038 C C   . LYS D  1 174 ? 63.334  168.593 45.026  1.00 27.72 ? 199 LYS D C   1 
ATOM   10039 O O   . LYS D  1 174 ? 63.481  167.888 44.023  1.00 26.96 ? 199 LYS D O   1 
ATOM   10040 C CB  . LYS D  1 174 ? 61.690  168.058 46.813  1.00 29.78 ? 199 LYS D CB  1 
ATOM   10041 C CG  . LYS D  1 174 ? 60.775  167.131 46.116  1.00 32.52 ? 199 LYS D CG  1 
ATOM   10042 C CD  . LYS D  1 174 ? 59.532  166.944 46.971  1.00 35.11 ? 199 LYS D CD  1 
ATOM   10043 C CE  . LYS D  1 174 ? 58.521  166.087 46.263  1.00 37.30 ? 199 LYS D CE  1 
ATOM   10044 N NZ  . LYS D  1 174 ? 59.005  164.701 46.145  1.00 38.18 ? 199 LYS D NZ  1 
ATOM   10045 N N   . LEU D  1 175 ? 63.303  169.923 44.990  1.00 26.31 ? 200 LEU D N   1 
ATOM   10046 C CA  . LEU D  1 175 ? 63.589  170.687 43.782  1.00 26.20 ? 200 LEU D CA  1 
ATOM   10047 C C   . LEU D  1 175 ? 64.980  170.333 43.219  1.00 25.69 ? 200 LEU D C   1 
ATOM   10048 O O   . LEU D  1 175 ? 65.181  170.199 42.000  1.00 25.51 ? 200 LEU D O   1 
ATOM   10049 C CB  . LEU D  1 175 ? 63.535  172.173 44.145  1.00 25.15 ? 200 LEU D CB  1 
ATOM   10050 C CG  . LEU D  1 175 ? 62.680  173.159 43.370  1.00 27.20 ? 200 LEU D CG  1 
ATOM   10051 C CD1 . LEU D  1 175 ? 61.354  172.568 42.890  1.00 24.92 ? 200 LEU D CD1 1 
ATOM   10052 C CD2 . LEU D  1 175 ? 62.470  174.467 44.195  1.00 26.35 ? 200 LEU D CD2 1 
ATOM   10053 N N   . ALA D  1 176 ? 65.948  170.187 44.111  1.00 25.87 ? 201 ALA D N   1 
ATOM   10054 C CA  . ALA D  1 176 ? 67.311  169.855 43.711  1.00 26.46 ? 201 ALA D CA  1 
ATOM   10055 C C   . ALA D  1 176 ? 67.324  168.532 42.934  1.00 27.90 ? 201 ALA D C   1 
ATOM   10056 O O   . ALA D  1 176 ? 68.189  168.297 42.081  1.00 28.16 ? 201 ALA D O   1 
ATOM   10057 C CB  . ALA D  1 176 ? 68.201  169.759 44.936  1.00 26.89 ? 201 ALA D CB  1 
ATOM   10058 N N   . LYS D  1 177 ? 66.351  167.677 43.233  1.00 28.62 ? 202 LYS D N   1 
ATOM   10059 C CA  . LYS D  1 177 ? 66.206  166.403 42.542  1.00 30.55 ? 202 LYS D CA  1 
ATOM   10060 C C   . LYS D  1 177 ? 65.484  166.517 41.216  1.00 29.67 ? 202 LYS D C   1 
ATOM   10061 O O   . LYS D  1 177 ? 65.891  165.902 40.245  1.00 30.08 ? 202 LYS D O   1 
ATOM   10062 C CB  . LYS D  1 177 ? 65.483  165.382 43.429  1.00 32.11 ? 202 LYS D CB  1 
ATOM   10063 C CG  . LYS D  1 177 ? 66.405  164.443 44.185  1.00 36.09 ? 202 LYS D CG  1 
ATOM   10064 C CD  . LYS D  1 177 ? 66.810  165.017 45.539  1.00 40.13 ? 202 LYS D CD  1 
ATOM   10065 C CE  . LYS D  1 177 ? 66.611  163.991 46.652  1.00 43.20 ? 202 LYS D CE  1 
ATOM   10066 N NZ  . LYS D  1 177 ? 65.159  163.700 46.913  1.00 45.73 ? 202 LYS D NZ  1 
ATOM   10067 N N   . ASP D  1 178 ? 64.408  167.294 41.184  1.00 28.63 ? 203 ASP D N   1 
ATOM   10068 C CA  . ASP D  1 178 ? 63.527  167.349 40.021  1.00 28.28 ? 203 ASP D CA  1 
ATOM   10069 C C   . ASP D  1 178 ? 63.996  168.298 38.913  1.00 27.02 ? 203 ASP D C   1 
ATOM   10070 O O   . ASP D  1 178 ? 63.604  168.130 37.755  1.00 26.81 ? 203 ASP D O   1 
ATOM   10071 C CB  . ASP D  1 178 ? 62.106  167.716 40.454  1.00 28.42 ? 203 ASP D CB  1 
ATOM   10072 C CG  . ASP D  1 178 ? 61.485  166.664 41.358  1.00 30.72 ? 203 ASP D CG  1 
ATOM   10073 O OD1 . ASP D  1 178 ? 61.998  165.529 41.361  1.00 31.74 ? 203 ASP D OD1 1 
ATOM   10074 O OD2 . ASP D  1 178 ? 60.500  166.966 42.077  1.00 30.34 ? 203 ASP D OD2 1 
ATOM   10075 N N   . LEU D  1 179 ? 64.798  169.302 39.275  1.00 25.01 ? 204 LEU D N   1 
ATOM   10076 C CA  . LEU D  1 179 ? 65.251  170.326 38.328  1.00 24.07 ? 204 LEU D CA  1 
ATOM   10077 C C   . LEU D  1 179 ? 66.644  170.069 37.798  1.00 24.28 ? 204 LEU D C   1 
ATOM   10078 O O   . LEU D  1 179 ? 67.526  169.633 38.541  1.00 24.43 ? 204 LEU D O   1 
ATOM   10079 C CB  . LEU D  1 179 ? 65.289  171.704 38.992  1.00 22.43 ? 204 LEU D CB  1 
ATOM   10080 C CG  . LEU D  1 179 ? 63.967  172.262 39.525  1.00 23.60 ? 204 LEU D CG  1 
ATOM   10081 C CD1 . LEU D  1 179 ? 64.214  173.681 40.065  1.00 21.90 ? 204 LEU D CD1 1 
ATOM   10082 C CD2 . LEU D  1 179 ? 62.896  172.270 38.448  1.00 22.31 ? 204 LEU D CD2 1 
ATOM   10083 N N   . ASP D  1 180 ? 66.849  170.391 36.522  1.00 23.77 ? 205 ASP D N   1 
ATOM   10084 C CA  . ASP D  1 180 ? 68.190  170.436 35.966  1.00 23.99 ? 205 ASP D CA  1 
ATOM   10085 C C   . ASP D  1 180 ? 68.959  171.591 36.615  1.00 23.03 ? 205 ASP D C   1 
ATOM   10086 O O   . ASP D  1 180 ? 70.127  171.426 36.976  1.00 22.70 ? 205 ASP D O   1 
ATOM   10087 C CB  . ASP D  1 180 ? 68.113  170.573 34.439  1.00 24.45 ? 205 ASP D CB  1 
ATOM   10088 C CG  . ASP D  1 180 ? 67.545  169.315 33.788  1.00 26.59 ? 205 ASP D CG  1 
ATOM   10089 O OD1 . ASP D  1 180 ? 68.324  168.353 33.716  1.00 28.67 ? 205 ASP D OD1 1 
ATOM   10090 O OD2 . ASP D  1 180 ? 66.337  169.260 33.395  1.00 25.26 ? 205 ASP D OD2 1 
ATOM   10091 N N   . PHE D  1 181 ? 68.316  172.761 36.748  1.00 21.26 ? 206 PHE D N   1 
ATOM   10092 C CA  . PHE D  1 181 ? 68.905  173.875 37.519  1.00 20.82 ? 206 PHE D CA  1 
ATOM   10093 C C   . PHE D  1 181 ? 67.886  174.945 37.908  1.00 19.57 ? 206 PHE D C   1 
ATOM   10094 O O   . PHE D  1 181 ? 66.801  175.011 37.328  1.00 20.09 ? 206 PHE D O   1 
ATOM   10095 C CB  . PHE D  1 181 ? 70.114  174.525 36.807  1.00 19.94 ? 206 PHE D CB  1 
ATOM   10096 C CG  . PHE D  1 181 ? 69.837  175.013 35.393  1.00 20.30 ? 206 PHE D CG  1 
ATOM   10097 C CD1 . PHE D  1 181 ? 69.405  176.325 35.152  1.00 18.74 ? 206 PHE D CD1 1 
ATOM   10098 C CD2 . PHE D  1 181 ? 70.079  174.176 34.302  1.00 20.89 ? 206 PHE D CD2 1 
ATOM   10099 C CE1 . PHE D  1 181 ? 69.180  176.783 33.841  1.00 20.38 ? 206 PHE D CE1 1 
ATOM   10100 C CE2 . PHE D  1 181 ? 69.866  174.615 32.978  1.00 22.46 ? 206 PHE D CE2 1 
ATOM   10101 C CZ  . PHE D  1 181 ? 69.421  175.932 32.739  1.00 20.76 ? 206 PHE D CZ  1 
ATOM   10102 N N   . ILE D  1 182 ? 68.229  175.792 38.876  1.00 18.46 ? 207 ILE D N   1 
ATOM   10103 C CA  . ILE D  1 182 ? 67.399  176.974 39.110  1.00 17.67 ? 207 ILE D CA  1 
ATOM   10104 C C   . ILE D  1 182 ? 67.980  178.221 38.447  1.00 17.39 ? 207 ILE D C   1 
ATOM   10105 O O   . ILE D  1 182 ? 69.199  178.412 38.397  1.00 16.94 ? 207 ILE D O   1 
ATOM   10106 C CB  . ILE D  1 182 ? 67.139  177.268 40.616  1.00 17.28 ? 207 ILE D CB  1 
ATOM   10107 C CG1 . ILE D  1 182 ? 68.457  177.389 41.373  1.00 17.93 ? 207 ILE D CG1 1 
ATOM   10108 C CG2 . ILE D  1 182 ? 66.295  176.160 41.215  1.00 18.75 ? 207 ILE D CG2 1 
ATOM   10109 C CD1 . ILE D  1 182 ? 68.336  178.079 42.716  1.00 17.85 ? 207 ILE D CD1 1 
ATOM   10110 N N   . ASN D  1 183 ? 67.075  179.041 37.916  1.00 16.64 ? 208 ASN D N   1 
ATOM   10111 C CA  . ASN D  1 183 ? 67.392  180.396 37.509  1.00 16.62 ? 208 ASN D CA  1 
ATOM   10112 C C   . ASN D  1 183 ? 67.079  181.300 38.707  1.00 15.86 ? 208 ASN D C   1 
ATOM   10113 O O   . ASN D  1 183 ? 65.913  181.652 38.961  1.00 16.33 ? 208 ASN D O   1 
ATOM   10114 C CB  . ASN D  1 183 ? 66.590  180.771 36.254  1.00 16.73 ? 208 ASN D CB  1 
ATOM   10115 C CG  . ASN D  1 183 ? 66.975  179.895 35.071  1.00 19.07 ? 208 ASN D CG  1 
ATOM   10116 O OD1 . ASN D  1 183 ? 66.139  179.190 34.483  1.00 21.72 ? 208 ASN D OD1 1 
ATOM   10117 N ND2 . ASN D  1 183 ? 68.261  179.872 34.775  1.00 15.35 ? 208 ASN D ND2 1 
ATOM   10118 N N   . LEU D  1 184 ? 68.116  181.607 39.486  1.00 15.28 ? 209 LEU D N   1 
ATOM   10119 C CA  . LEU D  1 184 ? 67.940  182.396 40.711  1.00 14.91 ? 209 LEU D CA  1 
ATOM   10120 C C   . LEU D  1 184 ? 67.683  183.842 40.327  1.00 14.51 ? 209 LEU D C   1 
ATOM   10121 O O   . LEU D  1 184 ? 68.503  184.478 39.671  1.00 14.23 ? 209 LEU D O   1 
ATOM   10122 C CB  . LEU D  1 184 ? 69.166  182.274 41.634  1.00 14.78 ? 209 LEU D CB  1 
ATOM   10123 C CG  . LEU D  1 184 ? 69.161  183.153 42.891  1.00 15.86 ? 209 LEU D CG  1 
ATOM   10124 C CD1 . LEU D  1 184 ? 68.009  182.679 43.814  1.00 15.06 ? 209 LEU D CD1 1 
ATOM   10125 C CD2 . LEU D  1 184 ? 70.477  182.992 43.597  1.00 15.31 ? 209 LEU D CD2 1 
ATOM   10126 N N   . LEU D  1 185 ? 66.529  184.355 40.736  1.00 14.75 ? 210 LEU D N   1 
ATOM   10127 C CA  . LEU D  1 185 ? 66.085  185.688 40.370  1.00 14.81 ? 210 LEU D CA  1 
ATOM   10128 C C   . LEU D  1 185 ? 66.712  186.681 41.365  1.00 14.43 ? 210 LEU D C   1 
ATOM   10129 O O   . LEU D  1 185 ? 65.994  187.342 42.125  1.00 14.85 ? 210 LEU D O   1 
ATOM   10130 C CB  . LEU D  1 185 ? 64.530  185.750 40.414  1.00 15.17 ? 210 LEU D CB  1 
ATOM   10131 C CG  . LEU D  1 185 ? 63.898  184.766 39.400  1.00 15.54 ? 210 LEU D CG  1 
ATOM   10132 C CD1 . LEU D  1 185 ? 62.381  184.645 39.595  1.00 17.68 ? 210 LEU D CD1 1 
ATOM   10133 C CD2 . LEU D  1 185 ? 64.224  185.198 37.984  1.00 15.87 ? 210 LEU D CD2 1 
ATOM   10134 N N   . SER D  1 186 ? 68.045  186.753 41.360  1.00 14.24 ? 211 SER D N   1 
ATOM   10135 C CA  . SER D  1 186 ? 68.809  187.576 42.321  1.00 14.58 ? 211 SER D CA  1 
ATOM   10136 C C   . SER D  1 186 ? 68.833  189.042 41.870  1.00 14.01 ? 211 SER D C   1 
ATOM   10137 O O   . SER D  1 186 ? 69.879  189.605 41.544  1.00 13.97 ? 211 SER D O   1 
ATOM   10138 C CB  . SER D  1 186 ? 70.239  187.041 42.513  1.00 14.13 ? 211 SER D CB  1 
ATOM   10139 O OG  . SER D  1 186 ? 70.666  186.289 41.390  1.00 13.85 ? 211 SER D OG  1 
ATOM   10140 N N   . PHE D  1 187 ? 67.654  189.647 41.893  1.00 13.41 ? 212 PHE D N   1 
ATOM   10141 C CA  . PHE D  1 187 ? 67.466  191.055 41.562  1.00 14.43 ? 212 PHE D CA  1 
ATOM   10142 C C   . PHE D  1 187 ? 66.086  191.435 42.116  1.00 15.15 ? 212 PHE D C   1 
ATOM   10143 O O   . PHE D  1 187 ? 65.440  190.623 42.784  1.00 14.76 ? 212 PHE D O   1 
ATOM   10144 C CB  . PHE D  1 187 ? 67.597  191.334 40.023  1.00 13.72 ? 212 PHE D CB  1 
ATOM   10145 C CG  . PHE D  1 187 ? 67.093  190.212 39.120  1.00 14.02 ? 212 PHE D CG  1 
ATOM   10146 C CD1 . PHE D  1 187 ? 65.728  189.972 38.968  1.00 15.67 ? 212 PHE D CD1 1 
ATOM   10147 C CD2 . PHE D  1 187 ? 67.986  189.437 38.388  1.00 14.62 ? 212 PHE D CD2 1 
ATOM   10148 C CE1 . PHE D  1 187 ? 65.260  188.959 38.128  1.00 14.77 ? 212 PHE D CE1 1 
ATOM   10149 C CE2 . PHE D  1 187 ? 67.534  188.427 37.528  1.00 15.00 ? 212 PHE D CE2 1 
ATOM   10150 C CZ  . PHE D  1 187 ? 66.160  188.178 37.410  1.00 14.57 ? 212 PHE D CZ  1 
ATOM   10151 N N   . ASP D  1 188 ? 65.650  192.661 41.866  1.00 15.72 ? 213 ASP D N   1 
ATOM   10152 C CA  . ASP D  1 188 ? 64.488  193.192 42.561  1.00 16.36 ? 213 ASP D CA  1 
ATOM   10153 C C   . ASP D  1 188 ? 64.619  193.031 44.082  1.00 16.35 ? 213 ASP D C   1 
ATOM   10154 O O   . ASP D  1 188 ? 63.639  192.778 44.790  1.00 16.71 ? 213 ASP D O   1 
ATOM   10155 C CB  . ASP D  1 188 ? 63.196  192.568 42.023  1.00 16.92 ? 213 ASP D CB  1 
ATOM   10156 C CG  . ASP D  1 188 ? 63.063  192.733 40.526  1.00 17.84 ? 213 ASP D CG  1 
ATOM   10157 O OD1 . ASP D  1 188 ? 63.339  193.854 40.012  1.00 20.14 ? 213 ASP D OD1 1 
ATOM   10158 O OD2 . ASP D  1 188 ? 62.702  191.738 39.837  1.00 18.58 ? 213 ASP D OD2 1 
ATOM   10159 N N   . PHE D  1 189 ? 65.824  193.227 44.595  1.00 15.63 ? 214 PHE D N   1 
ATOM   10160 C CA  . PHE D  1 189 ? 66.029  193.208 46.067  1.00 16.59 ? 214 PHE D CA  1 
ATOM   10161 C C   . PHE D  1 189 ? 65.470  194.478 46.703  1.00 17.40 ? 214 PHE D C   1 
ATOM   10162 O O   . PHE D  1 189 ? 65.005  194.466 47.859  1.00 18.06 ? 214 PHE D O   1 
ATOM   10163 C CB  . PHE D  1 189 ? 67.508  193.069 46.405  1.00 15.56 ? 214 PHE D CB  1 
ATOM   10164 C CG  . PHE D  1 189 ? 68.028  191.664 46.261  1.00 15.26 ? 214 PHE D CG  1 
ATOM   10165 C CD1 . PHE D  1 189 ? 67.611  190.667 47.126  1.00 15.48 ? 214 PHE D CD1 1 
ATOM   10166 C CD2 . PHE D  1 189 ? 68.951  191.346 45.261  1.00 14.98 ? 214 PHE D CD2 1 
ATOM   10167 C CE1 . PHE D  1 189 ? 68.088  189.360 46.998  1.00 16.64 ? 214 PHE D CE1 1 
ATOM   10168 C CE2 . PHE D  1 189 ? 69.452  190.062 45.144  1.00 15.69 ? 214 PHE D CE2 1 
ATOM   10169 C CZ  . PHE D  1 189 ? 69.016  189.062 46.002  1.00 17.90 ? 214 PHE D CZ  1 
ATOM   10170 N N   . HIS D  1 190 ? 65.499  195.565 45.929  1.00 17.29 ? 215 HIS D N   1 
ATOM   10171 C CA  . HIS D  1 190 ? 64.899  196.829 46.346  1.00 18.89 ? 215 HIS D CA  1 
ATOM   10172 C C   . HIS D  1 190 ? 64.216  197.489 45.167  1.00 19.72 ? 215 HIS D C   1 
ATOM   10173 O O   . HIS D  1 190 ? 64.558  197.243 44.006  1.00 19.49 ? 215 HIS D O   1 
ATOM   10174 C CB  . HIS D  1 190 ? 65.944  197.791 46.916  1.00 18.53 ? 215 HIS D CB  1 
ATOM   10175 C CG  . HIS D  1 190 ? 66.679  197.256 48.104  1.00 18.18 ? 215 HIS D CG  1 
ATOM   10176 N ND1 . HIS D  1 190 ? 66.089  197.126 49.344  1.00 20.05 ? 215 HIS D ND1 1 
ATOM   10177 C CD2 . HIS D  1 190 ? 67.952  196.805 48.243  1.00 17.61 ? 215 HIS D CD2 1 
ATOM   10178 C CE1 . HIS D  1 190 ? 66.970  196.624 50.199  1.00 19.30 ? 215 HIS D CE1 1 
ATOM   10179 N NE2 . HIS D  1 190 ? 68.112  196.440 49.560  1.00 19.23 ? 215 HIS D NE2 1 
ATOM   10180 N N   . GLY D  1 191 ? 63.268  198.355 45.487  1.00 21.11 ? 216 GLY D N   1 
ATOM   10181 C CA  . GLY D  1 191 ? 62.474  199.023 44.465  1.00 23.25 ? 216 GLY D CA  1 
ATOM   10182 C C   . GLY D  1 191 ? 61.350  199.805 45.095  1.00 24.29 ? 216 GLY D C   1 
ATOM   10183 O O   . GLY D  1 191 ? 61.222  199.857 46.326  1.00 24.53 ? 216 GLY D O   1 
ATOM   10184 N N   . SER D  1 192 ? 60.507  200.405 44.259  1.00 26.07 ? 217 SER D N   1 
ATOM   10185 C CA  . SER D  1 192 ? 59.608  201.441 44.752  1.00 27.77 ? 217 SER D CA  1 
ATOM   10186 C C   . SER D  1 192 ? 58.346  200.876 45.406  1.00 28.72 ? 217 SER D C   1 
ATOM   10187 O O   . SER D  1 192 ? 57.486  201.628 45.839  1.00 29.42 ? 217 SER D O   1 
ATOM   10188 C CB  . SER D  1 192 ? 59.273  202.451 43.636  1.00 28.63 ? 217 SER D CB  1 
ATOM   10189 O OG  . SER D  1 192 ? 58.768  201.790 42.487  1.00 30.13 ? 217 SER D OG  1 
ATOM   10190 N N   . TRP D  1 193 ? 58.255  199.550 45.488  1.00 28.12 ? 218 TRP D N   1 
ATOM   10191 C CA  . TRP D  1 193 ? 57.204  198.896 46.262  1.00 28.87 ? 218 TRP D CA  1 
ATOM   10192 C C   . TRP D  1 193 ? 57.494  198.955 47.769  1.00 29.40 ? 218 TRP D C   1 
ATOM   10193 O O   . TRP D  1 193 ? 56.625  198.667 48.577  1.00 30.10 ? 218 TRP D O   1 
ATOM   10194 C CB  . TRP D  1 193 ? 57.078  197.425 45.819  1.00 28.43 ? 218 TRP D CB  1 
ATOM   10195 C CG  . TRP D  1 193 ? 58.380  196.683 45.931  1.00 26.63 ? 218 TRP D CG  1 
ATOM   10196 C CD1 . TRP D  1 193 ? 58.913  196.121 47.059  1.00 26.30 ? 218 TRP D CD1 1 
ATOM   10197 C CD2 . TRP D  1 193 ? 59.323  196.440 44.875  1.00 24.82 ? 218 TRP D CD2 1 
ATOM   10198 N NE1 . TRP D  1 193 ? 60.141  195.551 46.773  1.00 25.81 ? 218 TRP D NE1 1 
ATOM   10199 C CE2 . TRP D  1 193 ? 60.416  195.741 45.441  1.00 24.75 ? 218 TRP D CE2 1 
ATOM   10200 C CE3 . TRP D  1 193 ? 59.357  196.765 43.517  1.00 25.45 ? 218 TRP D CE3 1 
ATOM   10201 C CZ2 . TRP D  1 193 ? 61.514  195.337 44.688  1.00 23.75 ? 218 TRP D CZ2 1 
ATOM   10202 C CZ3 . TRP D  1 193 ? 60.466  196.377 42.762  1.00 25.54 ? 218 TRP D CZ3 1 
ATOM   10203 C CH2 . TRP D  1 193 ? 61.530  195.666 43.357  1.00 24.06 ? 218 TRP D CH2 1 
ATOM   10204 N N   . GLU D  1 194 ? 58.716  199.301 48.163  1.00 28.78 ? 219 GLU D N   1 
ATOM   10205 C CA  . GLU D  1 194 ? 59.090  199.203 49.586  1.00 29.84 ? 219 GLU D CA  1 
ATOM   10206 C C   . GLU D  1 194 ? 58.432  200.223 50.531  1.00 31.31 ? 219 GLU D C   1 
ATOM   10207 O O   . GLU D  1 194 ? 58.077  201.318 50.121  1.00 31.29 ? 219 GLU D O   1 
ATOM   10208 C CB  . GLU D  1 194 ? 60.616  199.257 49.749  1.00 29.12 ? 219 GLU D CB  1 
ATOM   10209 C CG  . GLU D  1 194 ? 61.293  197.952 49.433  1.00 29.50 ? 219 GLU D CG  1 
ATOM   10210 C CD  . GLU D  1 194 ? 62.804  198.085 49.231  1.00 32.29 ? 219 GLU D CD  1 
ATOM   10211 O OE1 . GLU D  1 194 ? 63.245  198.913 48.410  1.00 36.09 ? 219 GLU D OE1 1 
ATOM   10212 O OE2 . GLU D  1 194 ? 63.557  197.357 49.879  1.00 33.28 ? 219 GLU D OE2 1 
ATOM   10213 N N   . LYS D  1 195 ? 58.290  199.840 51.798  1.00 32.42 ? 220 LYS D N   1 
ATOM   10214 C CA  . LYS D  1 195 ? 57.821  200.730 52.858  1.00 34.79 ? 220 LYS D CA  1 
ATOM   10215 C C   . LYS D  1 195 ? 58.624  200.500 54.140  1.00 35.01 ? 220 LYS D C   1 
ATOM   10216 O O   . LYS D  1 195 ? 58.669  199.376 54.657  1.00 35.65 ? 220 LYS D O   1 
ATOM   10217 C CB  . LYS D  1 195 ? 56.350  200.477 53.141  1.00 36.09 ? 220 LYS D CB  1 
ATOM   10218 C CG  . LYS D  1 195 ? 55.436  200.950 52.040  1.00 37.86 ? 220 LYS D CG  1 
ATOM   10219 C CD  . LYS D  1 195 ? 54.023  200.469 52.280  1.00 41.29 ? 220 LYS D CD  1 
ATOM   10220 C CE  . LYS D  1 195 ? 53.027  201.554 51.923  1.00 45.04 ? 220 LYS D CE  1 
ATOM   10221 N NZ  . LYS D  1 195 ? 53.385  202.240 50.655  1.00 45.40 ? 220 LYS D NZ  1 
ATOM   10222 N N   . PRO D  1 196 ? 59.269  201.562 54.655  1.00 35.01 ? 221 PRO D N   1 
ATOM   10223 C CA  . PRO D  1 196 ? 59.168  202.914 54.100  1.00 34.04 ? 221 PRO D CA  1 
ATOM   10224 C C   . PRO D  1 196 ? 59.917  203.065 52.750  1.00 31.44 ? 221 PRO D C   1 
ATOM   10225 O O   . PRO D  1 196 ? 60.799  202.269 52.402  1.00 30.60 ? 221 PRO D O   1 
ATOM   10226 C CB  . PRO D  1 196 ? 59.767  203.809 55.206  1.00 35.47 ? 221 PRO D CB  1 
ATOM   10227 C CG  . PRO D  1 196 ? 60.589  202.870 56.119  1.00 35.76 ? 221 PRO D CG  1 
ATOM   10228 C CD  . PRO D  1 196 ? 60.378  201.434 55.625  1.00 35.43 ? 221 PRO D CD  1 
ATOM   10229 N N   . LEU D  1 197 ? 59.536  204.073 51.991  1.00 30.20 ? 222 LEU D N   1 
ATOM   10230 C CA  . LEU D  1 197 ? 59.982  204.209 50.614  1.00 28.18 ? 222 LEU D CA  1 
ATOM   10231 C C   . LEU D  1 197 ? 61.316  204.963 50.565  1.00 26.31 ? 222 LEU D C   1 
ATOM   10232 O O   . LEU D  1 197 ? 61.355  206.183 50.690  1.00 26.29 ? 222 LEU D O   1 
ATOM   10233 C CB  . LEU D  1 197 ? 58.887  204.946 49.851  1.00 29.39 ? 222 LEU D CB  1 
ATOM   10234 C CG  . LEU D  1 197 ? 59.067  205.292 48.384  1.00 30.07 ? 222 LEU D CG  1 
ATOM   10235 C CD1 . LEU D  1 197 ? 59.619  204.121 47.631  1.00 29.96 ? 222 LEU D CD1 1 
ATOM   10236 C CD2 . LEU D  1 197 ? 57.692  205.799 47.846  1.00 32.94 ? 222 LEU D CD2 1 
ATOM   10237 N N   . ILE D  1 198 ? 62.405  204.223 50.416  1.00 23.90 ? 223 ILE D N   1 
ATOM   10238 C CA  . ILE D  1 198 ? 63.741  204.811 50.376  1.00 23.37 ? 223 ILE D CA  1 
ATOM   10239 C C   . ILE D  1 198 ? 64.579  204.193 49.252  1.00 22.05 ? 223 ILE D C   1 
ATOM   10240 O O   . ILE D  1 198 ? 64.253  203.123 48.754  1.00 21.19 ? 223 ILE D O   1 
ATOM   10241 C CB  . ILE D  1 198 ? 64.461  204.605 51.715  1.00 23.42 ? 223 ILE D CB  1 
ATOM   10242 C CG1 . ILE D  1 198 ? 64.622  203.103 52.004  1.00 23.57 ? 223 ILE D CG1 1 
ATOM   10243 C CG2 . ILE D  1 198 ? 63.694  205.330 52.832  1.00 25.61 ? 223 ILE D CG2 1 
ATOM   10244 C CD1 . ILE D  1 198 ? 65.477  202.771 53.262  1.00 26.33 ? 223 ILE D CD1 1 
ATOM   10245 N N   . THR D  1 199 ? 65.664  204.852 48.852  1.00 20.99 ? 224 THR D N   1 
ATOM   10246 C CA  . THR D  1 199 ? 66.464  204.312 47.768  1.00 19.31 ? 224 THR D CA  1 
ATOM   10247 C C   . THR D  1 199 ? 67.146  203.016 48.190  1.00 18.60 ? 224 THR D C   1 
ATOM   10248 O O   . THR D  1 199 ? 67.538  202.857 49.336  1.00 18.74 ? 224 THR D O   1 
ATOM   10249 C CB  . THR D  1 199 ? 67.532  205.302 47.275  1.00 19.51 ? 224 THR D CB  1 
ATOM   10250 O OG1 . THR D  1 199 ? 68.354  205.697 48.378  1.00 20.91 ? 224 THR D OG1 1 
ATOM   10251 C CG2 . THR D  1 199 ? 66.869  206.553 46.664  1.00 20.15 ? 224 THR D CG2 1 
ATOM   10252 N N   . GLY D  1 200 ? 67.282  202.092 47.250  1.00 17.13 ? 225 GLY D N   1 
ATOM   10253 C CA  . GLY D  1 200 ? 68.023  200.853 47.483  1.00 17.28 ? 225 GLY D CA  1 
ATOM   10254 C C   . GLY D  1 200 ? 68.366  200.263 46.128  1.00 16.76 ? 225 GLY D C   1 
ATOM   10255 O O   . GLY D  1 200 ? 67.691  200.536 45.132  1.00 16.72 ? 225 GLY D O   1 
ATOM   10256 N N   . HIS D  1 201 ? 69.426  199.474 46.079  1.00 16.34 ? 226 HIS D N   1 
ATOM   10257 C CA  . HIS D  1 201 ? 69.915  198.959 44.813  1.00 15.62 ? 226 HIS D CA  1 
ATOM   10258 C C   . HIS D  1 201 ? 69.157  197.713 44.371  1.00 15.22 ? 226 HIS D C   1 
ATOM   10259 O O   . HIS D  1 201 ? 68.853  196.834 45.181  1.00 14.37 ? 226 HIS D O   1 
ATOM   10260 C CB  . HIS D  1 201 ? 71.416  198.676 44.896  1.00 14.97 ? 226 HIS D CB  1 
ATOM   10261 C CG  . HIS D  1 201 ? 72.061  198.523 43.558  1.00 14.99 ? 226 HIS D CG  1 
ATOM   10262 N ND1 . HIS D  1 201 ? 71.964  197.362 42.815  1.00 15.76 ? 226 HIS D ND1 1 
ATOM   10263 C CD2 . HIS D  1 201 ? 72.787  199.392 42.812  1.00 14.63 ? 226 HIS D CD2 1 
ATOM   10264 C CE1 . HIS D  1 201 ? 72.626  197.519 41.679  1.00 14.01 ? 226 HIS D CE1 1 
ATOM   10265 N NE2 . HIS D  1 201 ? 73.130  198.742 41.653  1.00 12.65 ? 226 HIS D NE2 1 
ATOM   10266 N N   . ASN D  1 202 ? 68.852  197.657 43.070  1.00 15.12 ? 227 ASN D N   1 
ATOM   10267 C CA  . ASN D  1 202 ? 68.167  196.519 42.464  1.00 15.60 ? 227 ASN D CA  1 
ATOM   10268 C C   . ASN D  1 202 ? 68.873  195.193 42.761  1.00 14.91 ? 227 ASN D C   1 
ATOM   10269 O O   . ASN D  1 202 ? 68.221  194.179 43.039  1.00 14.99 ? 227 ASN D O   1 
ATOM   10270 C CB  . ASN D  1 202 ? 68.051  196.758 40.955  1.00 14.70 ? 227 ASN D CB  1 
ATOM   10271 C CG  . ASN D  1 202 ? 67.441  195.571 40.183  1.00 16.86 ? 227 ASN D CG  1 
ATOM   10272 O OD1 . ASN D  1 202 ? 66.397  194.994 40.557  1.00 16.55 ? 227 ASN D OD1 1 
ATOM   10273 N ND2 . ASN D  1 202 ? 68.075  195.241 39.071  1.00 15.61 ? 227 ASN D ND2 1 
ATOM   10274 N N   . SER D  1 203 ? 70.195  195.180 42.687  1.00 15.12 ? 228 SER D N   1 
ATOM   10275 C CA  . SER D  1 203 ? 70.898  193.897 42.763  1.00 14.85 ? 228 SER D CA  1 
ATOM   10276 C C   . SER D  1 203 ? 72.297  194.044 43.320  1.00 14.32 ? 228 SER D C   1 
ATOM   10277 O O   . SER D  1 203 ? 73.276  193.805 42.605  1.00 14.74 ? 228 SER D O   1 
ATOM   10278 C CB  . SER D  1 203 ? 70.940  193.225 41.371  1.00 15.27 ? 228 SER D CB  1 
ATOM   10279 O OG  . SER D  1 203 ? 71.343  191.858 41.457  1.00 16.69 ? 228 SER D OG  1 
ATOM   10280 N N   . PRO D  1 204 ? 72.399  194.387 44.610  1.00 14.47 ? 229 PRO D N   1 
ATOM   10281 C CA  . PRO D  1 204 ? 73.695  194.499 45.259  1.00 15.22 ? 229 PRO D CA  1 
ATOM   10282 C C   . PRO D  1 204 ? 74.301  193.119 45.441  1.00 15.87 ? 229 PRO D C   1 
ATOM   10283 O O   . PRO D  1 204 ? 73.585  192.176 45.792  1.00 15.70 ? 229 PRO D O   1 
ATOM   10284 C CB  . PRO D  1 204 ? 73.343  195.103 46.634  1.00 15.89 ? 229 PRO D CB  1 
ATOM   10285 C CG  . PRO D  1 204 ? 71.965  194.584 46.918  1.00 15.84 ? 229 PRO D CG  1 
ATOM   10286 C CD  . PRO D  1 204 ? 71.276  194.569 45.549  1.00 14.28 ? 229 PRO D CD  1 
ATOM   10287 N N   . LEU D  1 205 ? 75.606  192.985 45.220  1.00 15.60 ? 230 LEU D N   1 
ATOM   10288 C CA  . LEU D  1 205 ? 76.253  191.703 45.436  1.00 15.81 ? 230 LEU D CA  1 
ATOM   10289 C C   . LEU D  1 205 ? 76.248  191.343 46.915  1.00 16.54 ? 230 LEU D C   1 
ATOM   10290 O O   . LEU D  1 205 ? 75.985  190.200 47.282  1.00 15.63 ? 230 LEU D O   1 
ATOM   10291 C CB  . LEU D  1 205 ? 77.692  191.726 44.904  1.00 15.69 ? 230 LEU D CB  1 
ATOM   10292 C CG  . LEU D  1 205 ? 78.521  190.466 45.184  1.00 17.17 ? 230 LEU D CG  1 
ATOM   10293 C CD1 . LEU D  1 205 ? 77.835  189.256 44.602  1.00 17.23 ? 230 LEU D CD1 1 
ATOM   10294 C CD2 . LEU D  1 205 ? 79.956  190.585 44.650  1.00 16.60 ? 230 LEU D CD2 1 
ATOM   10295 N N   . SER D  1 206 ? 76.533  192.320 47.770  1.00 17.20 ? 231 SER D N   1 
ATOM   10296 C CA  . SER D  1 206 ? 76.735  192.042 49.209  1.00 18.79 ? 231 SER D CA  1 
ATOM   10297 C C   . SER D  1 206 ? 75.959  193.027 50.045  1.00 18.95 ? 231 SER D C   1 
ATOM   10298 O O   . SER D  1 206 ? 75.579  194.073 49.536  1.00 18.99 ? 231 SER D O   1 
ATOM   10299 C CB  . SER D  1 206 ? 78.212  192.206 49.580  1.00 18.83 ? 231 SER D CB  1 
ATOM   10300 O OG  . SER D  1 206 ? 78.969  191.179 48.990  1.00 21.09 ? 231 SER D OG  1 
ATOM   10301 N N   . LYS D  1 207 ? 75.746  192.720 51.327  1.00 19.90 ? 232 LYS D N   1 
ATOM   10302 C CA  . LYS D  1 207 ? 75.016  193.653 52.184  1.00 20.45 ? 232 LYS D CA  1 
ATOM   10303 C C   . LYS D  1 207 ? 75.813  194.939 52.409  1.00 20.88 ? 232 LYS D C   1 
ATOM   10304 O O   . LYS D  1 207 ? 77.024  194.986 52.192  1.00 21.10 ? 232 LYS D O   1 
ATOM   10305 C CB  . LYS D  1 207 ? 74.649  193.010 53.518  1.00 21.77 ? 232 LYS D CB  1 
ATOM   10306 C CG  . LYS D  1 207 ? 75.815  192.915 54.503  1.00 23.21 ? 232 LYS D CG  1 
ATOM   10307 C CD  . LYS D  1 207 ? 75.357  192.332 55.833  1.00 25.58 ? 232 LYS D CD  1 
ATOM   10308 C CE  . LYS D  1 207 ? 76.522  192.252 56.803  1.00 28.05 ? 232 LYS D CE  1 
ATOM   10309 N NZ  . LYS D  1 207 ? 76.879  193.634 57.284  1.00 29.54 ? 232 LYS D NZ  1 
ATOM   10310 N N   . GLY D  1 208 ? 75.129  195.996 52.832  1.00 20.91 ? 233 GLY D N   1 
ATOM   10311 C CA  . GLY D  1 208 ? 75.819  197.236 53.140  1.00 20.74 ? 233 GLY D CA  1 
ATOM   10312 C C   . GLY D  1 208 ? 76.415  197.107 54.535  1.00 21.72 ? 233 GLY D C   1 
ATOM   10313 O O   . GLY D  1 208 ? 75.951  196.296 55.343  1.00 20.66 ? 233 GLY D O   1 
ATOM   10314 N N   . TRP D  1 209 ? 77.432  197.910 54.829  1.00 22.48 ? 234 TRP D N   1 
ATOM   10315 C CA  . TRP D  1 209 ? 78.108  197.840 56.128  1.00 24.47 ? 234 TRP D CA  1 
ATOM   10316 C C   . TRP D  1 209 ? 77.145  198.093 57.294  1.00 26.59 ? 234 TRP D C   1 
ATOM   10317 O O   . TRP D  1 209 ? 77.341  197.584 58.396  1.00 26.75 ? 234 TRP D O   1 
ATOM   10318 C CB  . TRP D  1 209 ? 79.243  198.867 56.190  1.00 24.89 ? 234 TRP D CB  1 
ATOM   10319 C CG  . TRP D  1 209 ? 80.448  198.530 55.333  1.00 24.05 ? 234 TRP D CG  1 
ATOM   10320 C CD1 . TRP D  1 209 ? 80.850  197.290 54.922  1.00 22.06 ? 234 TRP D CD1 1 
ATOM   10321 C CD2 . TRP D  1 209 ? 81.418  199.455 54.830  1.00 23.48 ? 234 TRP D CD2 1 
ATOM   10322 N NE1 . TRP D  1 209 ? 82.021  197.387 54.187  1.00 22.71 ? 234 TRP D NE1 1 
ATOM   10323 C CE2 . TRP D  1 209 ? 82.389  198.706 54.121  1.00 23.06 ? 234 TRP D CE2 1 
ATOM   10324 C CE3 . TRP D  1 209 ? 81.569  200.838 54.920  1.00 24.59 ? 234 TRP D CE3 1 
ATOM   10325 C CZ2 . TRP D  1 209 ? 83.477  199.304 53.483  1.00 23.77 ? 234 TRP D CZ2 1 
ATOM   10326 C CZ3 . TRP D  1 209 ? 82.671  201.434 54.303  1.00 25.53 ? 234 TRP D CZ3 1 
ATOM   10327 C CH2 . TRP D  1 209 ? 83.601  200.668 53.588  1.00 25.41 ? 234 TRP D CH2 1 
ATOM   10328 N N   . GLN D  1 210 ? 76.120  198.904 57.038  1.00 27.54 ? 235 GLN D N   1 
ATOM   10329 C CA  . GLN D  1 210 ? 75.144  199.253 58.058  1.00 31.04 ? 235 GLN D CA  1 
ATOM   10330 C C   . GLN D  1 210 ? 73.956  198.319 58.133  1.00 31.11 ? 235 GLN D C   1 
ATOM   10331 O O   . GLN D  1 210 ? 73.116  198.487 59.002  1.00 32.07 ? 235 GLN D O   1 
ATOM   10332 C CB  . GLN D  1 210 ? 74.650  200.669 57.828  1.00 31.72 ? 235 GLN D CB  1 
ATOM   10333 C CG  . GLN D  1 210 ? 75.809  201.644 57.753  1.00 35.22 ? 235 GLN D CG  1 
ATOM   10334 C CD  . GLN D  1 210 ? 75.558  202.864 58.581  1.00 41.08 ? 235 GLN D CD  1 
ATOM   10335 O OE1 . GLN D  1 210 ? 75.737  203.987 58.112  1.00 43.16 ? 235 GLN D OE1 1 
ATOM   10336 N NE2 . GLN D  1 210 ? 75.124  202.658 59.829  1.00 43.51 ? 235 GLN D NE2 1 
ATOM   10337 N N   . ASP D  1 211 ? 73.890  197.342 57.235  1.00 30.19 ? 236 ASP D N   1 
ATOM   10338 C CA  . ASP D  1 211 ? 72.779  196.389 57.229  1.00 31.14 ? 236 ASP D CA  1 
ATOM   10339 C C   . ASP D  1 211 ? 72.872  195.348 58.352  1.00 32.47 ? 236 ASP D C   1 
ATOM   10340 O O   . ASP D  1 211 ? 73.895  194.689 58.542  1.00 32.82 ? 236 ASP D O   1 
ATOM   10341 C CB  . ASP D  1 211 ? 72.678  195.689 55.875  1.00 29.48 ? 236 ASP D CB  1 
ATOM   10342 C CG  . ASP D  1 211 ? 72.252  196.632 54.756  1.00 30.35 ? 236 ASP D CG  1 
ATOM   10343 O OD1 . ASP D  1 211 ? 71.756  197.734 55.066  1.00 32.69 ? 236 ASP D OD1 1 
ATOM   10344 O OD2 . ASP D  1 211 ? 72.409  196.272 53.568  1.00 29.22 ? 236 ASP D OD2 1 
ATOM   10345 N N   . ARG D  1 212 ? 71.782  195.187 59.088  1.00 33.95 ? 237 ARG D N   1 
ATOM   10346 C CA  . ARG D  1 212 ? 71.741  194.192 60.150  1.00 36.09 ? 237 ARG D CA  1 
ATOM   10347 C C   . ARG D  1 212 ? 70.382  193.505 60.223  1.00 36.03 ? 237 ARG D C   1 
ATOM   10348 O O   . ARG D  1 212 ? 69.369  194.069 59.824  1.00 35.51 ? 237 ARG D O   1 
ATOM   10349 C CB  . ARG D  1 212 ? 72.100  194.833 61.502  1.00 37.79 ? 237 ARG D CB  1 
ATOM   10350 C CG  . ARG D  1 212 ? 73.597  194.812 61.767  1.00 40.85 ? 237 ARG D CG  1 
ATOM   10351 C CD  . ARG D  1 212 ? 73.958  195.332 63.166  1.00 45.95 ? 237 ARG D CD  1 
ATOM   10352 N NE  . ARG D  1 212 ? 73.711  194.352 64.229  1.00 49.73 ? 237 ARG D NE  1 
ATOM   10353 C CZ  . ARG D  1 212 ? 74.541  193.357 64.555  1.00 51.03 ? 237 ARG D CZ  1 
ATOM   10354 N NH1 . ARG D  1 212 ? 75.688  193.180 63.897  1.00 49.77 ? 237 ARG D NH1 1 
ATOM   10355 N NH2 . ARG D  1 212 ? 74.218  192.531 65.543  1.00 51.59 ? 237 ARG D NH2 1 
ATOM   10356 N N   . GLY D  1 213 ? 70.372  192.278 60.737  1.00 37.04 ? 238 GLY D N   1 
ATOM   10357 C CA  . GLY D  1 213 ? 69.131  191.508 60.825  1.00 37.05 ? 238 GLY D CA  1 
ATOM   10358 C C   . GLY D  1 213 ? 68.555  191.306 59.432  1.00 35.46 ? 238 GLY D C   1 
ATOM   10359 O O   . GLY D  1 213 ? 69.296  191.135 58.468  1.00 34.96 ? 238 GLY D O   1 
ATOM   10360 N N   . PRO D  1 214 ? 67.221  191.338 59.316  1.00 35.37 ? 239 PRO D N   1 
ATOM   10361 C CA  . PRO D  1 214 ? 66.577  190.975 58.063  1.00 33.59 ? 239 PRO D CA  1 
ATOM   10362 C C   . PRO D  1 214 ? 67.063  191.812 56.882  1.00 31.80 ? 239 PRO D C   1 
ATOM   10363 O O   . PRO D  1 214 ? 67.068  191.308 55.754  1.00 30.85 ? 239 PRO D O   1 
ATOM   10364 C CB  . PRO D  1 214 ? 65.082  191.185 58.336  1.00 34.60 ? 239 PRO D CB  1 
ATOM   10365 C CG  . PRO D  1 214 ? 64.994  191.902 59.673  1.00 36.71 ? 239 PRO D CG  1 
ATOM   10366 C CD  . PRO D  1 214 ? 66.262  191.591 60.405  1.00 37.02 ? 239 PRO D CD  1 
ATOM   10367 N N   . SER D  1 215 ? 67.495  193.054 57.132  1.00 30.89 ? 240 SER D N   1 
ATOM   10368 C CA  . SER D  1 215 ? 68.036  193.919 56.064  1.00 29.76 ? 240 SER D CA  1 
ATOM   10369 C C   . SER D  1 215 ? 69.230  193.242 55.378  1.00 27.37 ? 240 SER D C   1 
ATOM   10370 O O   . SER D  1 215 ? 69.488  193.446 54.203  1.00 26.87 ? 240 SER D O   1 
ATOM   10371 C CB  . SER D  1 215 ? 68.499  195.285 56.617  1.00 30.45 ? 240 SER D CB  1 
ATOM   10372 O OG  . SER D  1 215 ? 67.741  195.683 57.757  1.00 34.81 ? 240 SER D OG  1 
ATOM   10373 N N   . SER D  1 216 ? 69.954  192.424 56.126  1.00 27.11 ? 241 SER D N   1 
ATOM   10374 C CA  . SER D  1 216 ? 71.157  191.790 55.591  1.00 25.74 ? 241 SER D CA  1 
ATOM   10375 C C   . SER D  1 216 ? 70.871  190.652 54.611  1.00 23.89 ? 241 SER D C   1 
ATOM   10376 O O   . SER D  1 216 ? 71.795  190.120 54.023  1.00 22.49 ? 241 SER D O   1 
ATOM   10377 C CB  . SER D  1 216 ? 72.034  191.278 56.746  1.00 27.72 ? 241 SER D CB  1 
ATOM   10378 O OG  . SER D  1 216 ? 71.528  190.059 57.245  1.00 29.01 ? 241 SER D OG  1 
ATOM   10379 N N   . TYR D  1 217 ? 69.597  190.297 54.410  1.00 22.17 ? 242 TYR D N   1 
ATOM   10380 C CA  . TYR D  1 217 ? 69.257  189.210 53.485  1.00 21.15 ? 242 TYR D CA  1 
ATOM   10381 C C   . TYR D  1 217 ? 69.133  189.653 52.037  1.00 19.80 ? 242 TYR D C   1 
ATOM   10382 O O   . TYR D  1 217 ? 69.131  188.813 51.134  1.00 18.53 ? 242 TYR D O   1 
ATOM   10383 C CB  . TYR D  1 217 ? 67.934  188.547 53.859  1.00 21.65 ? 242 TYR D CB  1 
ATOM   10384 C CG  . TYR D  1 217 ? 67.855  188.034 55.275  1.00 24.54 ? 242 TYR D CG  1 
ATOM   10385 C CD1 . TYR D  1 217 ? 68.995  187.625 55.960  1.00 25.03 ? 242 TYR D CD1 1 
ATOM   10386 C CD2 . TYR D  1 217 ? 66.624  187.904 55.911  1.00 25.97 ? 242 TYR D CD2 1 
ATOM   10387 C CE1 . TYR D  1 217 ? 68.911  187.136 57.268  1.00 28.51 ? 242 TYR D CE1 1 
ATOM   10388 C CE2 . TYR D  1 217 ? 66.534  187.418 57.208  1.00 28.97 ? 242 TYR D CE2 1 
ATOM   10389 C CZ  . TYR D  1 217 ? 67.676  187.037 57.876  1.00 29.11 ? 242 TYR D CZ  1 
ATOM   10390 O OH  . TYR D  1 217 ? 67.562  186.558 59.161  1.00 34.47 ? 242 TYR D OH  1 
ATOM   10391 N N   . TYR D  1 218 ? 69.016  190.961 51.813  1.00 19.64 ? 243 TYR D N   1 
ATOM   10392 C CA  . TYR D  1 218 ? 68.652  191.480 50.484  1.00 19.42 ? 243 TYR D CA  1 
ATOM   10393 C C   . TYR D  1 218 ? 69.816  191.698 49.534  1.00 17.71 ? 243 TYR D C   1 
ATOM   10394 O O   . TYR D  1 218 ? 70.001  192.810 49.054  1.00 17.79 ? 243 TYR D O   1 
ATOM   10395 C CB  . TYR D  1 218 ? 67.815  192.781 50.591  1.00 20.27 ? 243 TYR D CB  1 
ATOM   10396 C CG  . TYR D  1 218 ? 66.513  192.604 51.360  1.00 25.23 ? 243 TYR D CG  1 
ATOM   10397 C CD1 . TYR D  1 218 ? 66.497  192.554 52.755  1.00 30.09 ? 243 TYR D CD1 1 
ATOM   10398 C CD2 . TYR D  1 218 ? 65.315  192.472 50.688  1.00 28.81 ? 243 TYR D CD2 1 
ATOM   10399 C CE1 . TYR D  1 218 ? 65.296  192.376 53.455  1.00 33.74 ? 243 TYR D CE1 1 
ATOM   10400 C CE2 . TYR D  1 218 ? 64.131  192.291 51.364  1.00 31.86 ? 243 TYR D CE2 1 
ATOM   10401 C CZ  . TYR D  1 218 ? 64.123  192.240 52.736  1.00 33.44 ? 243 TYR D CZ  1 
ATOM   10402 O OH  . TYR D  1 218 ? 62.925  192.057 53.361  1.00 35.16 ? 243 TYR D OH  1 
ATOM   10403 N N   . ASN D  1 219 ? 70.559  190.643 49.228  1.00 16.57 ? 244 ASN D N   1 
ATOM   10404 C CA  . ASN D  1 219 ? 71.705  190.735 48.322  1.00 16.53 ? 244 ASN D CA  1 
ATOM   10405 C C   . ASN D  1 219 ? 72.016  189.384 47.667  1.00 15.87 ? 244 ASN D C   1 
ATOM   10406 O O   . ASN D  1 219 ? 71.656  188.323 48.199  1.00 16.10 ? 244 ASN D O   1 
ATOM   10407 C CB  . ASN D  1 219 ? 72.939  191.295 49.059  1.00 15.88 ? 244 ASN D CB  1 
ATOM   10408 C CG  . ASN D  1 219 ? 73.258  190.533 50.330  1.00 19.15 ? 244 ASN D CG  1 
ATOM   10409 O OD1 . ASN D  1 219 ? 72.886  190.947 51.444  1.00 22.69 ? 244 ASN D OD1 1 
ATOM   10410 N ND2 . ASN D  1 219 ? 73.920  189.420 50.179  1.00 15.77 ? 244 ASN D ND2 1 
ATOM   10411 N N   . VAL D  1 220 ? 72.699  189.421 46.529  1.00 15.46 ? 245 VAL D N   1 
ATOM   10412 C CA  . VAL D  1 220 ? 73.025  188.196 45.786  1.00 15.76 ? 245 VAL D CA  1 
ATOM   10413 C C   . VAL D  1 220 ? 73.766  187.174 46.672  1.00 17.01 ? 245 VAL D C   1 
ATOM   10414 O O   . VAL D  1 220 ? 73.433  185.967 46.701  1.00 17.81 ? 245 VAL D O   1 
ATOM   10415 C CB  . VAL D  1 220 ? 73.888  188.539 44.574  1.00 15.64 ? 245 VAL D CB  1 
ATOM   10416 C CG1 . VAL D  1 220 ? 74.310  187.261 43.816  1.00 15.29 ? 245 VAL D CG1 1 
ATOM   10417 C CG2 . VAL D  1 220 ? 73.138  189.536 43.644  1.00 15.55 ? 245 VAL D CG2 1 
ATOM   10418 N N   . GLU D  1 221 ? 74.774  187.657 47.391  1.00 17.12 ? 246 GLU D N   1 
ATOM   10419 C CA  . GLU D  1 221 ? 75.621  186.785 48.198  1.00 18.85 ? 246 GLU D CA  1 
ATOM   10420 C C   . GLU D  1 221 ? 74.785  186.009 49.218  1.00 19.07 ? 246 GLU D C   1 
ATOM   10421 O O   . GLU D  1 221 ? 74.950  184.788 49.359  1.00 19.56 ? 246 GLU D O   1 
ATOM   10422 C CB  . GLU D  1 221 ? 76.725  187.596 48.887  1.00 19.85 ? 246 GLU D CB  1 
ATOM   10423 C CG  . GLU D  1 221 ? 77.634  186.787 49.803  1.00 25.07 ? 246 GLU D CG  1 
ATOM   10424 C CD  . GLU D  1 221 ? 78.752  187.624 50.382  1.00 27.11 ? 246 GLU D CD  1 
ATOM   10425 O OE1 . GLU D  1 221 ? 78.642  188.876 50.381  1.00 29.81 ? 246 GLU D OE1 1 
ATOM   10426 O OE2 . GLU D  1 221 ? 79.739  187.035 50.838  1.00 31.10 ? 246 GLU D OE2 1 
ATOM   10427 N N   . TYR D  1 222 ? 73.874  186.691 49.918  1.00 18.34 ? 247 TYR D N   1 
ATOM   10428 C CA  . TYR D  1 222 ? 73.017  185.967 50.875  1.00 19.19 ? 247 TYR D CA  1 
ATOM   10429 C C   . TYR D  1 222 ? 72.088  184.958 50.205  1.00 18.04 ? 247 TYR D C   1 
ATOM   10430 O O   . TYR D  1 222 ? 71.930  183.836 50.686  1.00 18.77 ? 247 TYR D O   1 
ATOM   10431 C CB  . TYR D  1 222 ? 72.169  186.915 51.735  1.00 19.66 ? 247 TYR D CB  1 
ATOM   10432 C CG  . TYR D  1 222 ? 71.481  186.151 52.824  1.00 21.08 ? 247 TYR D CG  1 
ATOM   10433 C CD1 . TYR D  1 222 ? 72.148  185.853 54.010  1.00 23.32 ? 247 TYR D CD1 1 
ATOM   10434 C CD2 . TYR D  1 222 ? 70.197  185.675 52.642  1.00 20.73 ? 247 TYR D CD2 1 
ATOM   10435 C CE1 . TYR D  1 222 ? 71.537  185.123 55.017  1.00 24.12 ? 247 TYR D CE1 1 
ATOM   10436 C CE2 . TYR D  1 222 ? 69.573  184.943 53.621  1.00 22.69 ? 247 TYR D CE2 1 
ATOM   10437 C CZ  . TYR D  1 222 ? 70.256  184.665 54.807  1.00 24.59 ? 247 TYR D CZ  1 
ATOM   10438 O OH  . TYR D  1 222 ? 69.644  183.946 55.787  1.00 27.46 ? 247 TYR D OH  1 
ATOM   10439 N N   . ALA D  1 223 ? 71.440  185.375 49.128  1.00 16.29 ? 248 ALA D N   1 
ATOM   10440 C CA  . ALA D  1 223 ? 70.470  184.530 48.440  1.00 16.08 ? 248 ALA D CA  1 
ATOM   10441 C C   . ALA D  1 223 ? 71.133  183.283 47.897  1.00 16.14 ? 248 ALA D C   1 
ATOM   10442 O O   . ALA D  1 223 ? 70.557  182.197 47.954  1.00 16.11 ? 248 ALA D O   1 
ATOM   10443 C CB  . ALA D  1 223 ? 69.820  185.300 47.277  1.00 14.91 ? 248 ALA D CB  1 
ATOM   10444 N N   . VAL D  1 224 ? 72.325  183.439 47.325  1.00 15.80 ? 249 VAL D N   1 
ATOM   10445 C CA  . VAL D  1 224 ? 73.057  182.273 46.817  1.00 16.41 ? 249 VAL D CA  1 
ATOM   10446 C C   . VAL D  1 224 ? 73.430  181.345 47.974  1.00 17.64 ? 249 VAL D C   1 
ATOM   10447 O O   . VAL D  1 224 ? 73.218  180.133 47.893  1.00 17.65 ? 249 VAL D O   1 
ATOM   10448 C CB  . VAL D  1 224 ? 74.336  182.659 46.012  1.00 16.72 ? 249 VAL D CB  1 
ATOM   10449 C CG1 . VAL D  1 224 ? 75.235  181.443 45.797  1.00 17.11 ? 249 VAL D CG1 1 
ATOM   10450 C CG2 . VAL D  1 224 ? 73.960  183.306 44.682  1.00 15.80 ? 249 VAL D CG2 1 
ATOM   10451 N N   . GLY D  1 225 ? 73.980  181.911 49.048  1.00 18.27 ? 250 GLY D N   1 
ATOM   10452 C CA  . GLY D  1 225 ? 74.412  181.103 50.198  1.00 19.71 ? 250 GLY D CA  1 
ATOM   10453 C C   . GLY D  1 225 ? 73.224  180.379 50.827  1.00 20.34 ? 250 GLY D C   1 
ATOM   10454 O O   . GLY D  1 225 ? 73.345  179.254 51.311  1.00 21.68 ? 250 GLY D O   1 
ATOM   10455 N N   . TYR D  1 226 ? 72.060  181.024 50.809  1.00 19.70 ? 251 TYR D N   1 
ATOM   10456 C CA  . TYR D  1 226 ? 70.863  180.450 51.401  1.00 20.16 ? 251 TYR D CA  1 
ATOM   10457 C C   . TYR D  1 226 ? 70.287  179.275 50.613  1.00 19.99 ? 251 TYR D C   1 
ATOM   10458 O O   . TYR D  1 226 ? 69.939  178.240 51.200  1.00 20.85 ? 251 TYR D O   1 
ATOM   10459 C CB  . TYR D  1 226 ? 69.776  181.515 51.561  1.00 20.02 ? 251 TYR D CB  1 
ATOM   10460 C CG  . TYR D  1 226 ? 68.712  181.104 52.527  1.00 21.43 ? 251 TYR D CG  1 
ATOM   10461 C CD1 . TYR D  1 226 ? 69.016  180.913 53.874  1.00 24.13 ? 251 TYR D CD1 1 
ATOM   10462 C CD2 . TYR D  1 226 ? 67.403  180.904 52.105  1.00 21.89 ? 251 TYR D CD2 1 
ATOM   10463 C CE1 . TYR D  1 226 ? 68.043  180.542 54.773  1.00 25.14 ? 251 TYR D CE1 1 
ATOM   10464 C CE2 . TYR D  1 226 ? 66.417  180.514 52.996  1.00 22.93 ? 251 TYR D CE2 1 
ATOM   10465 C CZ  . TYR D  1 226 ? 66.740  180.342 54.324  1.00 24.67 ? 251 TYR D CZ  1 
ATOM   10466 O OH  . TYR D  1 226 ? 65.764  179.966 55.210  1.00 25.67 ? 251 TYR D OH  1 
ATOM   10467 N N   . TRP D  1 227 ? 70.163  179.435 49.302  1.00 18.90 ? 252 TRP D N   1 
ATOM   10468 C CA  . TRP D  1 227 ? 69.748  178.317 48.452  1.00 19.47 ? 252 TRP D CA  1 
ATOM   10469 C C   . TRP D  1 227 ? 70.661  177.102 48.609  1.00 20.20 ? 252 TRP D C   1 
ATOM   10470 O O   . TRP D  1 227 ? 70.192  175.959 48.685  1.00 20.14 ? 252 TRP D O   1 
ATOM   10471 C CB  . TRP D  1 227 ? 69.663  178.743 46.987  1.00 17.83 ? 252 TRP D CB  1 
ATOM   10472 C CG  . TRP D  1 227 ? 68.312  179.283 46.632  1.00 18.52 ? 252 TRP D CG  1 
ATOM   10473 C CD1 . TRP D  1 227 ? 67.932  180.583 46.612  1.00 16.72 ? 252 TRP D CD1 1 
ATOM   10474 C CD2 . TRP D  1 227 ? 67.151  178.515 46.293  1.00 18.62 ? 252 TRP D CD2 1 
ATOM   10475 N NE1 . TRP D  1 227 ? 66.617  180.684 46.240  1.00 18.88 ? 252 TRP D NE1 1 
ATOM   10476 C CE2 . TRP D  1 227 ? 66.109  179.425 46.051  1.00 18.49 ? 252 TRP D CE2 1 
ATOM   10477 C CE3 . TRP D  1 227 ? 66.898  177.143 46.159  1.00 20.49 ? 252 TRP D CE3 1 
ATOM   10478 C CZ2 . TRP D  1 227 ? 64.823  179.015 45.678  1.00 18.34 ? 252 TRP D CZ2 1 
ATOM   10479 C CZ3 . TRP D  1 227 ? 65.612  176.730 45.777  1.00 19.08 ? 252 TRP D CZ3 1 
ATOM   10480 C CH2 . TRP D  1 227 ? 64.600  177.665 45.540  1.00 19.76 ? 252 TRP D CH2 1 
ATOM   10481 N N   . ILE D  1 228 ? 71.968  177.338 48.648  1.00 20.83 ? 253 ILE D N   1 
ATOM   10482 C CA  . ILE D  1 228 ? 72.932  176.236 48.857  1.00 22.03 ? 253 ILE D CA  1 
ATOM   10483 C C   . ILE D  1 228 ? 72.733  175.597 50.244  1.00 23.56 ? 253 ILE D C   1 
ATOM   10484 O O   . ILE D  1 228 ? 72.661  174.367 50.384  1.00 23.94 ? 253 ILE D O   1 
ATOM   10485 C CB  . ILE D  1 228 ? 74.394  176.737 48.655  1.00 22.41 ? 253 ILE D CB  1 
ATOM   10486 C CG1 . ILE D  1 228 ? 74.606  177.148 47.192  1.00 21.63 ? 253 ILE D CG1 1 
ATOM   10487 C CG2 . ILE D  1 228 ? 75.421  175.663 49.026  1.00 23.50 ? 253 ILE D CG2 1 
ATOM   10488 C CD1 . ILE D  1 228 ? 75.812  178.037 46.985  1.00 23.81 ? 253 ILE D CD1 1 
ATOM   10489 N N   . HIS D  1 229 ? 72.576  176.447 51.256  1.00 24.24 ? 254 HIS D N   1 
ATOM   10490 C CA  . HIS D  1 229 ? 72.338  175.997 52.626  1.00 25.73 ? 254 HIS D CA  1 
ATOM   10491 C C   . HIS D  1 229 ? 71.051  175.171 52.756  1.00 26.20 ? 254 HIS D C   1 
ATOM   10492 O O   . HIS D  1 229 ? 70.969  174.261 53.584  1.00 27.59 ? 254 HIS D O   1 
ATOM   10493 C CB  . HIS D  1 229 ? 72.299  177.212 53.575  1.00 25.89 ? 254 HIS D CB  1 
ATOM   10494 C CG  . HIS D  1 229 ? 71.741  176.909 54.932  1.00 29.90 ? 254 HIS D CG  1 
ATOM   10495 N ND1 . HIS D  1 229 ? 72.484  176.318 55.931  1.00 32.72 ? 254 HIS D ND1 1 
ATOM   10496 C CD2 . HIS D  1 229 ? 70.507  177.117 55.455  1.00 31.94 ? 254 HIS D CD2 1 
ATOM   10497 C CE1 . HIS D  1 229 ? 71.735  176.172 57.011  1.00 34.67 ? 254 HIS D CE1 1 
ATOM   10498 N NE2 . HIS D  1 229 ? 70.528  176.643 56.746  1.00 34.67 ? 254 HIS D NE2 1 
ATOM   10499 N N   . LYS D  1 230 ? 70.055  175.484 51.936  1.00 24.63 ? 255 LYS D N   1 
ATOM   10500 C CA  . LYS D  1 230 ? 68.756  174.818 52.008  1.00 25.58 ? 255 LYS D CA  1 
ATOM   10501 C C   . LYS D  1 230 ? 68.728  173.509 51.204  1.00 25.66 ? 255 LYS D C   1 
ATOM   10502 O O   . LYS D  1 230 ? 67.738  172.772 51.241  1.00 25.63 ? 255 LYS D O   1 
ATOM   10503 C CB  . LYS D  1 230 ? 67.654  175.762 51.507  1.00 24.89 ? 255 LYS D CB  1 
ATOM   10504 C CG  . LYS D  1 230 ? 67.411  176.966 52.410  1.00 26.76 ? 255 LYS D CG  1 
ATOM   10505 C CD  . LYS D  1 230 ? 66.357  176.639 53.471  1.00 31.52 ? 255 LYS D CD  1 
ATOM   10506 C CE  . LYS D  1 230 ? 64.969  176.658 52.837  1.00 32.44 ? 255 LYS D CE  1 
ATOM   10507 N NZ  . LYS D  1 230 ? 63.901  176.590 53.880  1.00 34.09 ? 255 LYS D NZ  1 
ATOM   10508 N N   . GLY D  1 231 ? 69.810  173.246 50.464  1.00 24.50 ? 256 GLY D N   1 
ATOM   10509 C CA  . GLY D  1 231 ? 69.998  171.960 49.800  1.00 24.69 ? 256 GLY D CA  1 
ATOM   10510 C C   . GLY D  1 231 ? 70.132  171.969 48.283  1.00 23.54 ? 256 GLY D C   1 
ATOM   10511 O O   . GLY D  1 231 ? 70.100  170.935 47.665  1.00 23.36 ? 256 GLY D O   1 
ATOM   10512 N N   . MET D  1 232 ? 70.257  173.133 47.663  1.00 22.20 ? 257 MET D N   1 
ATOM   10513 C CA  . MET D  1 232 ? 70.466  173.155 46.220  1.00 22.02 ? 257 MET D CA  1 
ATOM   10514 C C   . MET D  1 232 ? 71.968  173.092 45.953  1.00 22.81 ? 257 MET D C   1 
ATOM   10515 O O   . MET D  1 232 ? 72.706  173.947 46.428  1.00 22.93 ? 257 MET D O   1 
ATOM   10516 C CB  . MET D  1 232 ? 69.883  174.433 45.634  1.00 21.04 ? 257 MET D CB  1 
ATOM   10517 C CG  . MET D  1 232 ? 70.058  174.573 44.139  1.00 20.13 ? 257 MET D CG  1 
ATOM   10518 S SD  . MET D  1 232 ? 69.056  173.371 43.225  1.00 20.67 ? 257 MET D SD  1 
ATOM   10519 C CE  . MET D  1 232 ? 67.422  173.608 43.989  1.00 20.97 ? 257 MET D CE  1 
ATOM   10520 N N   . PRO D  1 233 ? 72.442  172.068 45.216  1.00 23.52 ? 258 PRO D N   1 
ATOM   10521 C CA  . PRO D  1 233 ? 73.898  172.016 44.954  1.00 24.07 ? 258 PRO D CA  1 
ATOM   10522 C C   . PRO D  1 233 ? 74.376  173.278 44.219  1.00 22.43 ? 258 PRO D C   1 
ATOM   10523 O O   . PRO D  1 233 ? 73.657  173.806 43.369  1.00 21.50 ? 258 PRO D O   1 
ATOM   10524 C CB  . PRO D  1 233 ? 74.062  170.782 44.044  1.00 24.99 ? 258 PRO D CB  1 
ATOM   10525 C CG  . PRO D  1 233 ? 72.862  169.921 44.324  1.00 26.09 ? 258 PRO D CG  1 
ATOM   10526 C CD  . PRO D  1 233 ? 71.727  170.934 44.619  1.00 24.65 ? 258 PRO D CD  1 
ATOM   10527 N N   . SER D  1 234 ? 75.574  173.761 44.537  1.00 22.38 ? 259 SER D N   1 
ATOM   10528 C CA  . SER D  1 234 ? 76.044  175.013 43.941  1.00 21.25 ? 259 SER D CA  1 
ATOM   10529 C C   . SER D  1 234 ? 75.990  174.950 42.412  1.00 20.74 ? 259 SER D C   1 
ATOM   10530 O O   . SER D  1 234 ? 75.605  175.919 41.762  1.00 18.82 ? 259 SER D O   1 
ATOM   10531 C CB  . SER D  1 234 ? 77.470  175.341 44.415  1.00 22.15 ? 259 SER D CB  1 
ATOM   10532 O OG  . SER D  1 234 ? 78.400  174.387 43.936  1.00 21.43 ? 259 SER D OG  1 
ATOM   10533 N N   . GLU D  1 235 ? 76.392  173.814 41.836  1.00 21.72 ? 260 GLU D N   1 
ATOM   10534 C CA  . GLU D  1 235 ? 76.439  173.710 40.383  1.00 22.63 ? 260 GLU D CA  1 
ATOM   10535 C C   . GLU D  1 235 ? 75.051  173.780 39.732  1.00 21.88 ? 260 GLU D C   1 
ATOM   10536 O O   . GLU D  1 235 ? 74.961  173.980 38.520  1.00 20.76 ? 260 GLU D O   1 
ATOM   10537 C CB  . GLU D  1 235 ? 77.233  172.474 39.912  1.00 24.68 ? 260 GLU D CB  1 
ATOM   10538 C CG  . GLU D  1 235 ? 76.547  171.156 40.192  1.00 29.38 ? 260 GLU D CG  1 
ATOM   10539 C CD  . GLU D  1 235 ? 76.822  170.623 41.608  1.00 34.00 ? 260 GLU D CD  1 
ATOM   10540 O OE1 . GLU D  1 235 ? 77.353  171.387 42.455  1.00 33.29 ? 260 GLU D OE1 1 
ATOM   10541 O OE2 . GLU D  1 235 ? 76.511  169.434 41.865  1.00 35.51 ? 260 GLU D OE2 1 
ATOM   10542 N N   . LYS D  1 236 ? 73.980  173.623 40.530  1.00 21.26 ? 261 LYS D N   1 
ATOM   10543 C CA  . LYS D  1 236 ? 72.603  173.801 40.030  1.00 20.72 ? 261 LYS D CA  1 
ATOM   10544 C C   . LYS D  1 236 ? 72.072  175.202 40.267  1.00 19.72 ? 261 LYS D C   1 
ATOM   10545 O O   . LYS D  1 236 ? 70.949  175.515 39.865  1.00 18.83 ? 261 LYS D O   1 
ATOM   10546 C CB  . LYS D  1 236 ? 71.616  172.775 40.630  1.00 21.33 ? 261 LYS D CB  1 
ATOM   10547 C CG  . LYS D  1 236 ? 71.822  171.341 40.095  1.00 22.51 ? 261 LYS D CG  1 
ATOM   10548 C CD  . LYS D  1 236 ? 70.600  170.414 40.367  1.00 23.15 ? 261 LYS D CD  1 
ATOM   10549 C CE  . LYS D  1 236 ? 70.847  169.019 39.773  1.00 24.28 ? 261 LYS D CE  1 
ATOM   10550 N NZ  . LYS D  1 236 ? 69.580  168.239 39.694  1.00 23.05 ? 261 LYS D NZ  1 
ATOM   10551 N N   . VAL D  1 237 ? 72.873  176.068 40.885  1.00 19.11 ? 262 VAL D N   1 
ATOM   10552 C CA  . VAL D  1 237 ? 72.467  177.466 40.981  1.00 18.18 ? 262 VAL D CA  1 
ATOM   10553 C C   . VAL D  1 237 ? 72.963  178.289 39.782  1.00 17.76 ? 262 VAL D C   1 
ATOM   10554 O O   . VAL D  1 237 ? 74.161  178.457 39.619  1.00 18.42 ? 262 VAL D O   1 
ATOM   10555 C CB  . VAL D  1 237 ? 72.972  178.106 42.288  1.00 19.00 ? 262 VAL D CB  1 
ATOM   10556 C CG1 . VAL D  1 237 ? 72.562  179.590 42.348  1.00 17.53 ? 262 VAL D CG1 1 
ATOM   10557 C CG2 . VAL D  1 237 ? 72.434  177.351 43.481  1.00 19.00 ? 262 VAL D CG2 1 
ATOM   10558 N N   . VAL D  1 238 ? 72.050  178.805 38.943  1.00 16.81 ? 263 VAL D N   1 
ATOM   10559 C CA  . VAL D  1 238 ? 72.469  179.703 37.862  1.00 16.47 ? 263 VAL D CA  1 
ATOM   10560 C C   . VAL D  1 238 ? 72.090  181.113 38.313  1.00 15.63 ? 263 VAL D C   1 
ATOM   10561 O O   . VAL D  1 238 ? 70.928  181.407 38.514  1.00 14.63 ? 263 VAL D O   1 
ATOM   10562 C CB  . VAL D  1 238 ? 71.882  179.294 36.475  1.00 16.65 ? 263 VAL D CB  1 
ATOM   10563 C CG1 . VAL D  1 238 ? 72.369  180.263 35.369  1.00 15.37 ? 263 VAL D CG1 1 
ATOM   10564 C CG2 . VAL D  1 238 ? 72.325  177.851 36.114  1.00 17.62 ? 263 VAL D CG2 1 
ATOM   10565 N N   . MET D  1 239 ? 73.095  181.963 38.538  1.00 15.24 ? 264 MET D N   1 
ATOM   10566 C CA  . MET D  1 239 ? 72.886  183.200 39.284  1.00 15.17 ? 264 MET D CA  1 
ATOM   10567 C C   . MET D  1 239 ? 72.374  184.339 38.398  1.00 15.21 ? 264 MET D C   1 
ATOM   10568 O O   . MET D  1 239 ? 73.058  184.736 37.448  1.00 14.49 ? 264 MET D O   1 
ATOM   10569 C CB  . MET D  1 239 ? 74.203  183.593 39.955  1.00 15.63 ? 264 MET D CB  1 
ATOM   10570 C CG  . MET D  1 239 ? 74.124  184.786 40.892  1.00 15.71 ? 264 MET D CG  1 
ATOM   10571 S SD  . MET D  1 239 ? 75.811  185.323 41.300  1.00 19.68 ? 264 MET D SD  1 
ATOM   10572 C CE  . MET D  1 239 ? 76.204  186.204 39.811  1.00 18.79 ? 264 MET D CE  1 
ATOM   10573 N N   . GLY D  1 240 ? 71.168  184.838 38.696  1.00 14.35 ? 265 GLY D N   1 
ATOM   10574 C CA  . GLY D  1 240 ? 70.582  185.932 37.922  1.00 14.32 ? 265 GLY D CA  1 
ATOM   10575 C C   . GLY D  1 240 ? 71.369  187.249 38.014  1.00 14.19 ? 265 GLY D C   1 
ATOM   10576 O O   . GLY D  1 240 ? 71.825  187.668 39.087  1.00 14.30 ? 265 GLY D O   1 
ATOM   10577 N N   . ILE D  1 241 ? 71.511  187.905 36.885  1.00 13.28 ? 266 ILE D N   1 
ATOM   10578 C CA  . ILE D  1 241 ? 72.110  189.232 36.815  1.00 13.78 ? 266 ILE D CA  1 
ATOM   10579 C C   . ILE D  1 241 ? 71.169  190.072 35.945  1.00 15.30 ? 266 ILE D C   1 
ATOM   10580 O O   . ILE D  1 241 ? 70.749  189.625 34.864  1.00 15.91 ? 266 ILE D O   1 
ATOM   10581 C CB  . ILE D  1 241 ? 73.520  189.164 36.161  1.00 13.47 ? 266 ILE D CB  1 
ATOM   10582 C CG1 . ILE D  1 241 ? 74.450  188.239 36.956  1.00 14.50 ? 266 ILE D CG1 1 
ATOM   10583 C CG2 . ILE D  1 241 ? 74.151  190.617 35.922  1.00 13.24 ? 266 ILE D CG2 1 
ATOM   10584 C CD1 . ILE D  1 241 ? 75.834  188.013 36.249  1.00 13.50 ? 266 ILE D CD1 1 
ATOM   10585 N N   . PRO D  1 242 ? 70.808  191.284 36.406  1.00 15.77 ? 267 PRO D N   1 
ATOM   10586 C CA  . PRO D  1 242 ? 69.859  192.075 35.633  1.00 15.76 ? 267 PRO D CA  1 
ATOM   10587 C C   . PRO D  1 242 ? 70.555  192.990 34.622  1.00 16.36 ? 267 PRO D C   1 
ATOM   10588 O O   . PRO D  1 242 ? 71.659  193.472 34.879  1.00 16.37 ? 267 PRO D O   1 
ATOM   10589 C CB  . PRO D  1 242 ? 69.167  192.912 36.703  1.00 15.30 ? 267 PRO D CB  1 
ATOM   10590 C CG  . PRO D  1 242 ? 70.261  193.178 37.744  1.00 15.81 ? 267 PRO D CG  1 
ATOM   10591 C CD  . PRO D  1 242 ? 71.166  191.925 37.691  1.00 15.99 ? 267 PRO D CD  1 
ATOM   10592 N N   . THR D  1 243 ? 69.908  193.244 33.487  1.00 17.09 ? 268 THR D N   1 
ATOM   10593 C CA  . THR D  1 243 ? 70.392  194.260 32.569  1.00 17.46 ? 268 THR D CA  1 
ATOM   10594 C C   . THR D  1 243 ? 69.579  195.562 32.699  1.00 18.69 ? 268 THR D C   1 
ATOM   10595 O O   . THR D  1 243 ? 69.696  196.468 31.862  1.00 21.32 ? 268 THR D O   1 
ATOM   10596 C CB  . THR D  1 243 ? 70.318  193.756 31.135  1.00 18.01 ? 268 THR D CB  1 
ATOM   10597 O OG1 . THR D  1 243 ? 68.970  193.352 30.858  1.00 17.10 ? 268 THR D OG1 1 
ATOM   10598 C CG2 . THR D  1 243 ? 71.258  192.573 30.956  1.00 16.53 ? 268 THR D CG2 1 
ATOM   10599 N N   . TYR D  1 244 ? 68.735  195.641 33.717  1.00 17.41 ? 269 TYR D N   1 
ATOM   10600 C CA  . TYR D  1 244 ? 67.973  196.840 33.984  1.00 16.75 ? 269 TYR D CA  1 
ATOM   10601 C C   . TYR D  1 244 ? 68.363  197.359 35.362  1.00 16.38 ? 269 TYR D C   1 
ATOM   10602 O O   . TYR D  1 244 ? 69.032  196.667 36.136  1.00 16.51 ? 269 TYR D O   1 
ATOM   10603 C CB  . TYR D  1 244 ? 66.447  196.554 33.932  1.00 16.77 ? 269 TYR D CB  1 
ATOM   10604 C CG  . TYR D  1 244 ? 66.020  195.607 35.041  1.00 16.26 ? 269 TYR D CG  1 
ATOM   10605 C CD1 . TYR D  1 244 ? 66.233  194.237 34.921  1.00 16.07 ? 269 TYR D CD1 1 
ATOM   10606 C CD2 . TYR D  1 244 ? 65.455  196.088 36.219  1.00 17.85 ? 269 TYR D CD2 1 
ATOM   10607 C CE1 . TYR D  1 244 ? 65.869  193.359 35.938  1.00 16.26 ? 269 TYR D CE1 1 
ATOM   10608 C CE2 . TYR D  1 244 ? 65.081  195.225 37.249  1.00 16.39 ? 269 TYR D CE2 1 
ATOM   10609 C CZ  . TYR D  1 244 ? 65.306  193.852 37.104  1.00 16.93 ? 269 TYR D CZ  1 
ATOM   10610 O OH  . TYR D  1 244 ? 64.956  192.976 38.126  1.00 17.98 ? 269 TYR D OH  1 
ATOM   10611 N N   . GLY D  1 245 ? 67.933  198.575 35.679  1.00 16.79 ? 270 GLY D N   1 
ATOM   10612 C CA  . GLY D  1 245 ? 68.130  199.101 37.023  1.00 17.08 ? 270 GLY D CA  1 
ATOM   10613 C C   . GLY D  1 245 ? 66.808  199.601 37.562  1.00 17.50 ? 270 GLY D C   1 
ATOM   10614 O O   . GLY D  1 245 ? 65.860  199.808 36.790  1.00 18.52 ? 270 GLY D O   1 
ATOM   10615 N N   . HIS D  1 246 ? 66.724  199.810 38.881  1.00 17.36 ? 271 HIS D N   1 
ATOM   10616 C CA  . HIS D  1 246 ? 65.504  200.377 39.481  1.00 17.56 ? 271 HIS D CA  1 
ATOM   10617 C C   . HIS D  1 246 ? 65.746  201.851 39.842  1.00 18.06 ? 271 HIS D C   1 
ATOM   10618 O O   . HIS D  1 246 ? 66.798  202.206 40.385  1.00 17.45 ? 271 HIS D O   1 
ATOM   10619 C CB  . HIS D  1 246 ? 65.021  199.594 40.738  1.00 17.60 ? 271 HIS D CB  1 
ATOM   10620 C CG  . HIS D  1 246 ? 64.150  198.400 40.428  1.00 19.90 ? 271 HIS D CG  1 
ATOM   10621 N ND1 . HIS D  1 246 ? 63.030  198.471 39.620  1.00 21.06 ? 271 HIS D ND1 1 
ATOM   10622 C CD2 . HIS D  1 246 ? 64.233  197.107 40.836  1.00 19.21 ? 271 HIS D CD2 1 
ATOM   10623 C CE1 . HIS D  1 246 ? 62.477  197.271 39.522  1.00 20.24 ? 271 HIS D CE1 1 
ATOM   10624 N NE2 . HIS D  1 246 ? 63.177  196.428 40.261  1.00 20.70 ? 271 HIS D NE2 1 
ATOM   10625 N N   . SER D  1 247 ? 64.761  202.695 39.551  1.00 18.62 ? 272 SER D N   1 
ATOM   10626 C CA  . SER D  1 247 ? 64.892  204.142 39.705  1.00 18.63 ? 272 SER D CA  1 
ATOM   10627 C C   . SER D  1 247 ? 63.914  204.656 40.770  1.00 19.66 ? 272 SER D C   1 
ATOM   10628 O O   . SER D  1 247 ? 62.886  204.041 41.041  1.00 19.33 ? 272 SER D O   1 
ATOM   10629 C CB  . SER D  1 247 ? 64.579  204.836 38.366  1.00 19.00 ? 272 SER D CB  1 
ATOM   10630 O OG  . SER D  1 247 ? 63.204  204.603 38.006  1.00 19.28 ? 272 SER D OG  1 
ATOM   10631 N N   . PHE D  1 248 ? 64.250  205.794 41.357  1.00 19.67 ? 273 PHE D N   1 
ATOM   10632 C CA  . PHE D  1 248 ? 63.458  206.398 42.409  1.00 20.90 ? 273 PHE D CA  1 
ATOM   10633 C C   . PHE D  1 248 ? 63.435  207.896 42.172  1.00 21.54 ? 273 PHE D C   1 
ATOM   10634 O O   . PHE D  1 248 ? 64.420  208.458 41.708  1.00 21.29 ? 273 PHE D O   1 
ATOM   10635 C CB  . PHE D  1 248 ? 64.145  206.187 43.758  1.00 20.70 ? 273 PHE D CB  1 
ATOM   10636 C CG  . PHE D  1 248 ? 64.227  204.767 44.180  1.00 20.00 ? 273 PHE D CG  1 
ATOM   10637 C CD1 . PHE D  1 248 ? 65.285  203.972 43.770  1.00 19.04 ? 273 PHE D CD1 1 
ATOM   10638 C CD2 . PHE D  1 248 ? 63.241  204.220 44.996  1.00 20.38 ? 273 PHE D CD2 1 
ATOM   10639 C CE1 . PHE D  1 248 ? 65.378  202.653 44.178  1.00 19.02 ? 273 PHE D CE1 1 
ATOM   10640 C CE2 . PHE D  1 248 ? 63.312  202.899 45.413  1.00 20.42 ? 273 PHE D CE2 1 
ATOM   10641 C CZ  . PHE D  1 248 ? 64.376  202.108 45.007  1.00 19.21 ? 273 PHE D CZ  1 
ATOM   10642 N N   . THR D  1 249 ? 62.333  208.544 42.520  1.00 22.34 ? 274 THR D N   1 
ATOM   10643 C CA  . THR D  1 249 ? 62.307  209.990 42.561  1.00 23.76 ? 274 THR D CA  1 
ATOM   10644 C C   . THR D  1 249 ? 62.607  210.383 43.999  1.00 24.07 ? 274 THR D C   1 
ATOM   10645 O O   . THR D  1 249 ? 61.898  209.966 44.911  1.00 23.72 ? 274 THR D O   1 
ATOM   10646 C CB  . THR D  1 249 ? 60.951  210.567 42.115  1.00 24.71 ? 274 THR D CB  1 
ATOM   10647 O OG1 . THR D  1 249 ? 60.712  210.189 40.751  1.00 25.08 ? 274 THR D OG1 1 
ATOM   10648 C CG2 . THR D  1 249 ? 60.964  212.075 42.210  1.00 26.75 ? 274 THR D CG2 1 
ATOM   10649 N N   . LEU D  1 250 ? 63.673  211.165 44.177  1.00 23.61 ? 275 LEU D N   1 
ATOM   10650 C CA  . LEU D  1 250 ? 64.156  211.581 45.498  1.00 24.17 ? 275 LEU D CA  1 
ATOM   10651 C C   . LEU D  1 250 ? 63.221  212.602 46.132  1.00 25.91 ? 275 LEU D C   1 
ATOM   10652 O O   . LEU D  1 250 ? 62.770  213.530 45.460  1.