data_4BPU
# 
_entry.id   4BPU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BPU         
PDBE  EBI-57040    
WWPDB D_1290057040 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4BPW unspecified 'CRYSTALS STRUCTURE OF HUMAN PRIMASE BOUND TO UTP'                                                     
PDB 4BPX unspecified 'CRYSTAL STRUCTURE OF HUMAN PRIMASE IN COMPLEX WITH THE PRIMASE-BINDING MOTIF OF DNA POLYMERASE ALPHA' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BPU 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-05-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kilkenny, M.L.' 1 
'Perera, R.L.'   2 
'Pellegrini, L.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structures of Human Primase Reveal Design of Nucleotide Elongation Site and Mode of Pol Alpha Tethering' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                15961 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24043831 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1311185110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kilkenny, M.L.' 1 
primary 'Longo, M.'      2 
primary 'Perera, R.L.'   3 
primary 'Pellegrini, L.' 4 
# 
_cell.entry_id           4BPU 
_cell.length_a           114.550 
_cell.length_b           68.640 
_cell.length_c           126.760 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.36 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BPU 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA PRIMASE SMALL SUBUNIT' 50108.023 2   2.7.7.- YES ?                ? 
2 polymer     man 'DNA PRIMASE LARGE SUBUNIT' 29782.174 2   2.7.7.- ?   'RESIDUES 1-253' ? 
3 non-polymer syn 'ZINC ION'                  65.409    2   ?       ?   ?                ? 
4 non-polymer syn GLYCEROL                    92.094    4   ?       ?   ?                ? 
5 water       nat water                       18.015    214 ?       ?   ?                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'DNA PRIMASE 49 KDA SUBUNIT, P49' 
2 'DNA PRIMASE 58 KDA SUBUNIT, P58' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GTSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYK
IDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLW
VYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENK
ESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLL
KSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEH
FLENLDKSRKGELLKKSDLQKDF
;
;GTSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYK
IDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLW
VYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENK
ESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLL
KSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEH
FLENLDKSRKGELLKKSDLQKDF
;
A,C ? 
2 'polypeptide(L)' no no 
;MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRK
LKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKT
LREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHL
;
;MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRK
LKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKT
LREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHL
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   THR n 
1 3   SER n 
1 4   MET n 
1 5   GLU n 
1 6   THR n 
1 7   PHE n 
1 8   ASP n 
1 9   PRO n 
1 10  THR n 
1 11  GLU n 
1 12  LEU n 
1 13  PRO n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  LYS n 
1 18  LEU n 
1 19  TYR n 
1 20  TYR n 
1 21  ARG n 
1 22  ARG n 
1 23  LEU n 
1 24  PHE n 
1 25  PRO n 
1 26  TYR n 
1 27  SER n 
1 28  GLN n 
1 29  TYR n 
1 30  TYR n 
1 31  ARG n 
1 32  TRP n 
1 33  LEU n 
1 34  ASN n 
1 35  TYR n 
1 36  GLY n 
1 37  GLY n 
1 38  VAL n 
1 39  ILE n 
1 40  LYS n 
1 41  ASN n 
1 42  TYR n 
1 43  PHE n 
1 44  GLN n 
1 45  HIS n 
1 46  ARG n 
1 47  GLU n 
1 48  PHE n 
1 49  SER n 
1 50  PHE n 
1 51  THR n 
1 52  LEU n 
1 53  LYS n 
1 54  ASP n 
1 55  ASP n 
1 56  ILE n 
1 57  TYR n 
1 58  ILE n 
1 59  ARG n 
1 60  TYR n 
1 61  GLN n 
1 62  SER n 
1 63  PHE n 
1 64  ASN n 
1 65  ASN n 
1 66  GLN n 
1 67  SER n 
1 68  ASP n 
1 69  LEU n 
1 70  GLU n 
1 71  LYS n 
1 72  GLU n 
1 73  MET n 
1 74  GLN n 
1 75  ALA n 
1 76  ALA n 
1 77  ASN n 
1 78  PRO n 
1 79  TYR n 
1 80  LYS n 
1 81  ILE n 
1 82  ASP n 
1 83  ILE n 
1 84  GLY n 
1 85  ALA n 
1 86  VAL n 
1 87  TYR n 
1 88  SER n 
1 89  HIS n 
1 90  ARG n 
1 91  PRO n 
1 92  ASN n 
1 93  GLN n 
1 94  HIS n 
1 95  ASN n 
1 96  THR n 
1 97  VAL n 
1 98  LYS n 
1 99  LEU n 
1 100 GLY n 
1 101 ALA n 
1 102 PHE n 
1 103 GLN n 
1 104 ALA n 
1 105 GLN n 
1 106 GLU n 
1 107 LYS n 
1 108 GLU n 
1 109 LEU n 
1 110 VAL n 
1 111 PHE n 
1 112 ASP n 
1 113 ILE n 
1 114 ASP n 
1 115 MET n 
1 116 THR n 
1 117 ASP n 
1 118 TYR n 
1 119 ASP n 
1 120 ASP n 
1 121 VAL n 
1 122 ARG n 
1 123 ARG n 
1 124 CYS n 
1 125 CYS n 
1 126 SER n 
1 127 SER n 
1 128 ALA n 
1 129 ASP n 
1 130 ILE n 
1 131 CYS n 
1 132 PRO n 
1 133 LYS n 
1 134 CYS n 
1 135 TRP n 
1 136 THR n 
1 137 LEU n 
1 138 MET n 
1 139 THR n 
1 140 MET n 
1 141 ALA n 
1 142 ILE n 
1 143 ARG n 
1 144 ILE n 
1 145 ILE n 
1 146 ASP n 
1 147 ARG n 
1 148 ALA n 
1 149 LEU n 
1 150 LYS n 
1 151 GLU n 
1 152 ASP n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LYS n 
1 157 HIS n 
1 158 ARG n 
1 159 LEU n 
1 160 TRP n 
1 161 VAL n 
1 162 TYR n 
1 163 SER n 
1 164 GLY n 
1 165 ARG n 
1 166 ARG n 
1 167 GLY n 
1 168 VAL n 
1 169 HIS n 
1 170 CYS n 
1 171 TRP n 
1 172 VAL n 
1 173 CYS n 
1 174 ASP n 
1 175 GLU n 
1 176 SER n 
1 177 VAL n 
1 178 ARG n 
1 179 LYS n 
1 180 LEU n 
1 181 SER n 
1 182 SER n 
1 183 ALA n 
1 184 VAL n 
1 185 ARG n 
1 186 SER n 
1 187 GLY n 
1 188 ILE n 
1 189 VAL n 
1 190 GLU n 
1 191 TYR n 
1 192 LEU n 
1 193 SER n 
1 194 LEU n 
1 195 VAL n 
1 196 LYS n 
1 197 GLY n 
1 198 GLY n 
1 199 GLN n 
1 200 ASP n 
1 201 VAL n 
1 202 LYS n 
1 203 LYS n 
1 204 LYS n 
1 205 VAL n 
1 206 HIS n 
1 207 LEU n 
1 208 SER n 
1 209 GLU n 
1 210 LYS n 
1 211 ILE n 
1 212 HIS n 
1 213 PRO n 
1 214 PHE n 
1 215 ILE n 
1 216 ARG n 
1 217 LYS n 
1 218 SER n 
1 219 ILE n 
1 220 ASN n 
1 221 ILE n 
1 222 ILE n 
1 223 LYS n 
1 224 LYS n 
1 225 TYR n 
1 226 PHE n 
1 227 GLU n 
1 228 GLU n 
1 229 TYR n 
1 230 ALA n 
1 231 LEU n 
1 232 VAL n 
1 233 ASN n 
1 234 GLN n 
1 235 ASP n 
1 236 ILE n 
1 237 LEU n 
1 238 GLU n 
1 239 ASN n 
1 240 LYS n 
1 241 GLU n 
1 242 SER n 
1 243 TRP n 
1 244 ASP n 
1 245 LYS n 
1 246 ILE n 
1 247 LEU n 
1 248 ALA n 
1 249 LEU n 
1 250 VAL n 
1 251 PRO n 
1 252 GLU n 
1 253 THR n 
1 254 ILE n 
1 255 HIS n 
1 256 ASP n 
1 257 GLU n 
1 258 LEU n 
1 259 GLN n 
1 260 GLN n 
1 261 SER n 
1 262 PHE n 
1 263 GLN n 
1 264 LYS n 
1 265 SER n 
1 266 HIS n 
1 267 ASN n 
1 268 SER n 
1 269 LEU n 
1 270 GLN n 
1 271 ARG n 
1 272 TRP n 
1 273 GLU n 
1 274 HIS n 
1 275 LEU n 
1 276 LYS n 
1 277 LYS n 
1 278 VAL n 
1 279 ALA n 
1 280 SER n 
1 281 ARG n 
1 282 TYR n 
1 283 GLN n 
1 284 ASN n 
1 285 ASN n 
1 286 ILE n 
1 287 LYS n 
1 288 ASN n 
1 289 ASP n 
1 290 LYS n 
1 291 TYR n 
1 292 GLY n 
1 293 PRO n 
1 294 TRP n 
1 295 LEU n 
1 296 GLU n 
1 297 TRP n 
1 298 GLU n 
1 299 ILE n 
1 300 MET n 
1 301 LEU n 
1 302 GLN n 
1 303 TYR n 
1 304 CYS n 
1 305 PHE n 
1 306 PRO n 
1 307 ARG n 
1 308 LEU n 
1 309 ASP n 
1 310 ILE n 
1 311 ASN n 
1 312 VAL n 
1 313 SER n 
1 314 LYS n 
1 315 GLY n 
1 316 ILE n 
1 317 ASN n 
1 318 HIS n 
1 319 LEU n 
1 320 LEU n 
1 321 LYS n 
1 322 SER n 
1 323 PRO n 
1 324 PHE n 
1 325 SER n 
1 326 VAL n 
1 327 HIS n 
1 328 PRO n 
1 329 LYS n 
1 330 THR n 
1 331 GLY n 
1 332 ARG n 
1 333 ILE n 
1 334 SER n 
1 335 VAL n 
1 336 PRO n 
1 337 ILE n 
1 338 ASP n 
1 339 LEU n 
1 340 GLN n 
1 341 LYS n 
1 342 VAL n 
1 343 ASP n 
1 344 GLN n 
1 345 PHE n 
1 346 ASP n 
1 347 PRO n 
1 348 PHE n 
1 349 THR n 
1 350 VAL n 
1 351 PRO n 
1 352 THR n 
1 353 ILE n 
1 354 SER n 
1 355 PHE n 
1 356 ILE n 
1 357 CYS n 
1 358 ARG n 
1 359 GLU n 
1 360 LEU n 
1 361 ASP n 
1 362 ALA n 
1 363 ILE n 
1 364 SER n 
1 365 THR n 
1 366 ASN n 
1 367 GLU n 
1 368 GLU n 
1 369 GLU n 
1 370 LYS n 
1 371 GLU n 
1 372 GLU n 
1 373 ASN n 
1 374 GLU n 
1 375 ALA n 
1 376 GLU n 
1 377 SER n 
1 378 ASP n 
1 379 VAL n 
1 380 LYS n 
1 381 HIS n 
1 382 ARG n 
1 383 THR n 
1 384 ARG n 
1 385 ASP n 
1 386 TYR n 
1 387 LYS n 
1 388 LYS n 
1 389 THR n 
1 390 SER n 
1 391 LEU n 
1 392 ALA n 
1 393 PRO n 
1 394 TYR n 
1 395 VAL n 
1 396 LYS n 
1 397 VAL n 
1 398 PHE n 
1 399 GLU n 
1 400 HIS n 
1 401 PHE n 
1 402 LEU n 
1 403 GLU n 
1 404 ASN n 
1 405 LEU n 
1 406 ASP n 
1 407 LYS n 
1 408 SER n 
1 409 ARG n 
1 410 LYS n 
1 411 GLY n 
1 412 GLU n 
1 413 LEU n 
1 414 LEU n 
1 415 LYS n 
1 416 LYS n 
1 417 SER n 
1 418 ASP n 
1 419 LEU n 
1 420 GLN n 
1 421 LYS n 
1 422 ASP n 
1 423 PHE n 
2 1   MET n 
2 2   GLU n 
2 3   PHE n 
2 4   SER n 
2 5   GLY n 
2 6   ARG n 
2 7   LYS n 
2 8   TRP n 
2 9   ARG n 
2 10  LYS n 
2 11  LEU n 
2 12  ARG n 
2 13  LEU n 
2 14  ALA n 
2 15  GLY n 
2 16  ASP n 
2 17  GLN n 
2 18  ARG n 
2 19  ASN n 
2 20  ALA n 
2 21  SER n 
2 22  TYR n 
2 23  PRO n 
2 24  HIS n 
2 25  CYS n 
2 26  LEU n 
2 27  GLN n 
2 28  PHE n 
2 29  TYR n 
2 30  LEU n 
2 31  GLN n 
2 32  PRO n 
2 33  PRO n 
2 34  SER n 
2 35  GLU n 
2 36  ASN n 
2 37  ILE n 
2 38  SER n 
2 39  LEU n 
2 40  ILE n 
2 41  GLU n 
2 42  PHE n 
2 43  GLU n 
2 44  ASN n 
2 45  LEU n 
2 46  ALA n 
2 47  ILE n 
2 48  ASP n 
2 49  ARG n 
2 50  VAL n 
2 51  LYS n 
2 52  LEU n 
2 53  LEU n 
2 54  LYS n 
2 55  SER n 
2 56  VAL n 
2 57  GLU n 
2 58  ASN n 
2 59  LEU n 
2 60  GLY n 
2 61  VAL n 
2 62  SER n 
2 63  TYR n 
2 64  VAL n 
2 65  LYS n 
2 66  GLY n 
2 67  THR n 
2 68  GLU n 
2 69  GLN n 
2 70  TYR n 
2 71  GLN n 
2 72  SER n 
2 73  LYS n 
2 74  LEU n 
2 75  GLU n 
2 76  SER n 
2 77  GLU n 
2 78  LEU n 
2 79  ARG n 
2 80  LYS n 
2 81  LEU n 
2 82  LYS n 
2 83  PHE n 
2 84  SER n 
2 85  TYR n 
2 86  ARG n 
2 87  GLU n 
2 88  ASN n 
2 89  LEU n 
2 90  GLU n 
2 91  ASP n 
2 92  GLU n 
2 93  TYR n 
2 94  GLU n 
2 95  PRO n 
2 96  ARG n 
2 97  ARG n 
2 98  ARG n 
2 99  ASP n 
2 100 HIS n 
2 101 ILE n 
2 102 SER n 
2 103 HIS n 
2 104 PHE n 
2 105 ILE n 
2 106 LEU n 
2 107 ARG n 
2 108 LEU n 
2 109 ALA n 
2 110 TYR n 
2 111 CYS n 
2 112 GLN n 
2 113 SER n 
2 114 GLU n 
2 115 GLU n 
2 116 LEU n 
2 117 ARG n 
2 118 ARG n 
2 119 TRP n 
2 120 PHE n 
2 121 ILE n 
2 122 GLN n 
2 123 GLN n 
2 124 GLU n 
2 125 MET n 
2 126 ASP n 
2 127 LEU n 
2 128 LEU n 
2 129 ARG n 
2 130 PHE n 
2 131 ARG n 
2 132 PHE n 
2 133 SER n 
2 134 ILE n 
2 135 LEU n 
2 136 PRO n 
2 137 LYS n 
2 138 ASP n 
2 139 LYS n 
2 140 ILE n 
2 141 GLN n 
2 142 ASP n 
2 143 PHE n 
2 144 LEU n 
2 145 LYS n 
2 146 ASP n 
2 147 SER n 
2 148 GLN n 
2 149 LEU n 
2 150 GLN n 
2 151 PHE n 
2 152 GLU n 
2 153 ALA n 
2 154 ILE n 
2 155 SER n 
2 156 ASP n 
2 157 GLU n 
2 158 GLU n 
2 159 LYS n 
2 160 THR n 
2 161 LEU n 
2 162 ARG n 
2 163 GLU n 
2 164 GLN n 
2 165 GLU n 
2 166 ILE n 
2 167 VAL n 
2 168 ALA n 
2 169 SER n 
2 170 SER n 
2 171 PRO n 
2 172 SER n 
2 173 LEU n 
2 174 SER n 
2 175 GLY n 
2 176 LEU n 
2 177 LYS n 
2 178 LEU n 
2 179 GLY n 
2 180 PHE n 
2 181 GLU n 
2 182 SER n 
2 183 ILE n 
2 184 TYR n 
2 185 LYS n 
2 186 ILE n 
2 187 PRO n 
2 188 PHE n 
2 189 ALA n 
2 190 ASP n 
2 191 ALA n 
2 192 LEU n 
2 193 ASP n 
2 194 LEU n 
2 195 PHE n 
2 196 ARG n 
2 197 GLY n 
2 198 ARG n 
2 199 LYS n 
2 200 VAL n 
2 201 TYR n 
2 202 LEU n 
2 203 GLU n 
2 204 ASP n 
2 205 GLY n 
2 206 PHE n 
2 207 ALA n 
2 208 TYR n 
2 209 VAL n 
2 210 PRO n 
2 211 LEU n 
2 212 LYS n 
2 213 ASP n 
2 214 ILE n 
2 215 VAL n 
2 216 ALA n 
2 217 ILE n 
2 218 ILE n 
2 219 LEU n 
2 220 ASN n 
2 221 GLU n 
2 222 PHE n 
2 223 ARG n 
2 224 ALA n 
2 225 LYS n 
2 226 LEU n 
2 227 SER n 
2 228 LYS n 
2 229 ALA n 
2 230 LEU n 
2 231 ALA n 
2 232 LEU n 
2 233 THR n 
2 234 ALA n 
2 235 ARG n 
2 236 SER n 
2 237 LEU n 
2 238 PRO n 
2 239 ALA n 
2 240 VAL n 
2 241 GLN n 
2 242 SER n 
2 243 ASP n 
2 244 GLU n 
2 245 ARG n 
2 246 LEU n 
2 247 GLN n 
2 248 PRO n 
2 249 LEU n 
2 250 LEU n 
2 251 ASN n 
2 252 HIS n 
2 253 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ROSETTA2 
? ? ? ? ? ? PLASMID PRSFDUET-1 ? ? ? ? ? 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ROSETTA2 
? ? ? ? ? ? PLASMID PRSFDUET-1 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PRI1_HUMAN 1 ? ? P49642 ? 
2 UNP PRI2_HUMAN 2 ? ? P49643 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4BPU A 4 ? 423 ? P49642 1 ? 420 ? 1 420 
2 2 4BPU B 1 ? 253 ? P49643 1 ? 253 ? 1 253 
3 1 4BPU C 4 ? 423 ? P49642 1 ? 420 ? 1 420 
4 2 4BPU D 1 ? 253 ? P49643 1 ? 253 ? 1 253 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BPU GLY A 1  ? UNP P49642 ?   ?  'expression tag'      -2 1  
1 4BPU THR A 2  ? UNP P49642 ?   ?  'expression tag'      -1 2  
1 4BPU SER A 3  ? UNP P49642 ?   ?  'expression tag'      0  3  
1 4BPU ALA A 75 ? UNP P49642 LYS 72 'engineered mutation' 72 4  
1 4BPU ALA A 76 ? UNP P49642 MET 73 'engineered mutation' 73 5  
3 4BPU GLY C 1  ? UNP P49642 ?   ?  'expression tag'      -2 6  
3 4BPU THR C 2  ? UNP P49642 ?   ?  'expression tag'      -1 7  
3 4BPU SER C 3  ? UNP P49642 ?   ?  'expression tag'      0  8  
3 4BPU ALA C 75 ? UNP P49642 LYS 72 'engineered mutation' 72 9  
3 4BPU ALA C 76 ? UNP P49642 MET 73 'engineered mutation' 73 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.entry_id          4BPU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.5 
_exptl_crystal.density_percent_sol   65 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100MM TRIS-HCL/BICINE PH 8.5, 20% GLYCEROL, 10% PEG4000 AND 20MM EACH OF AN ALCOHOL MIX COMPRISING 1,6-HEXANEDIOL, 1-BUTANOL, 1,2-PROPANEDIOL, 2-PROPANOL, 1,4- BUTANEDIOL AND 1,3-PROPANEDIOL
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2011-06-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             0.9763 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BPU 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.96 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   52124 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.20 
_reflns.B_iso_Wilson_estimate        81.60 
_reflns.pdbx_redundancy              2.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.60 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.60 
_reflns_shell.pdbx_redundancy        3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BPU 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     52054 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.617 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    98.52 
_refine.ls_R_factor_obs                          0.2051 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2028 
_refine.ls_R_factor_R_free                       0.2454 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2656 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               91.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'THE STRUCTURE WAS REFINED IN PHENIX WITH RIDING HYDROGENS. THE HYDROGENS HAVE BEEN INCLUDED IN THE ENTRY.' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 27.74 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9768 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             214 
_refine_hist.number_atoms_total               10008 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        29.617 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 10092 'X-RAY DIFFRACTION' ? 
f_angle_d          0.954  ? ? 13598 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.989 ? ? 3849  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.040  ? ? 1458  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1731  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7000 2.7491  2655 0.3327 100.00 0.4102 . . 134 . . 
'X-RAY DIFFRACTION' . 2.7491 2.8019  2558 0.3071 99.00  0.3559 . . 132 . . 
'X-RAY DIFFRACTION' . 2.8019 2.8591  2630 0.2800 99.00  0.3168 . . 139 . . 
'X-RAY DIFFRACTION' . 2.8591 2.9212  2586 0.2663 99.00  0.2955 . . 128 . . 
'X-RAY DIFFRACTION' . 2.9212 2.9891  2630 0.2574 100.00 0.3234 . . 148 . . 
'X-RAY DIFFRACTION' . 2.9891 3.0637  2590 0.2634 99.00  0.2865 . . 142 . . 
'X-RAY DIFFRACTION' . 3.0637 3.1465  2601 0.2534 100.00 0.3028 . . 142 . . 
'X-RAY DIFFRACTION' . 3.1465 3.2390  2621 0.2441 100.00 0.3392 . . 138 . . 
'X-RAY DIFFRACTION' . 3.2390 3.3434  2621 0.2292 99.00  0.2897 . . 138 . . 
'X-RAY DIFFRACTION' . 3.3434 3.4627  2611 0.2201 99.00  0.2849 . . 144 . . 
'X-RAY DIFFRACTION' . 3.4627 3.6011  2625 0.2178 99.00  0.2497 . . 124 . . 
'X-RAY DIFFRACTION' . 3.6011 3.7647  2575 0.2090 100.00 0.2359 . . 143 . . 
'X-RAY DIFFRACTION' . 3.7647 3.9627  2623 0.2006 100.00 0.2614 . . 167 . . 
'X-RAY DIFFRACTION' . 3.9627 4.2104  2626 0.1881 99.00  0.2430 . . 141 . . 
'X-RAY DIFFRACTION' . 4.2104 4.5344  2629 0.1703 99.00  0.1993 . . 139 . . 
'X-RAY DIFFRACTION' . 4.5344 4.9888  2639 0.1717 99.00  0.2237 . . 129 . . 
'X-RAY DIFFRACTION' . 4.9888 5.7062  2633 0.1848 99.00  0.2142 . . 154 . . 
'X-RAY DIFFRACTION' . 5.7062 7.1723  2637 0.2044 99.00  0.2464 . . 139 . . 
'X-RAY DIFFRACTION' . 7.1723 29.6186 2308 0.1805 84.00  0.2149 . . 135 . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 2 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  4BPU 
_struct.title                     
'Crystal structure of human primase in heterodimeric form, comprising PriS and truncated PriL lacking the C-terminal Fe-S domain.' 
_struct.pdbx_descriptor           'DNA PRIMASE SMALL SUBUNIT (E.C.2.7.7.-), DNA PRIMASE LARGE SUBUNIT (E.C.2.7.7.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BPU 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, DNA-DEPENDENT RNA POLYMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 11  ? LEU A 23  ? GLU A 8   LEU A 20  1 ? 13 
HELX_P HELX_P2  2  PRO A 25  ? TYR A 35  ? PRO A 22  TYR A 32  1 ? 11 
HELX_P HELX_P3  3  GLY A 36  ? VAL A 38  ? GLY A 33  VAL A 35  5 ? 3  
HELX_P HELX_P4  4  LYS A 53  ? ASP A 55  ? LYS A 50  ASP A 52  5 ? 3  
HELX_P HELX_P5  5  ASN A 65  ? ASN A 77  ? ASN A 62  ASN A 74  1 ? 13 
HELX_P HELX_P6  6  ARG A 90  ? VAL A 97  ? ARG A 87  VAL A 94  5 ? 8  
HELX_P HELX_P7  7  THR A 116 ? ASP A 119 ? THR A 113 ASP A 116 5 ? 4  
HELX_P HELX_P8  8  CYS A 131 ? ASP A 152 ? CYS A 128 ASP A 149 1 ? 22 
HELX_P HELX_P9  9  ASP A 174 ? LYS A 179 ? ASP A 171 LYS A 176 1 ? 6  
HELX_P HELX_P10 10 SER A 181 ? SER A 193 ? SER A 178 SER A 190 1 ? 13 
HELX_P HELX_P11 11 HIS A 212 ? LEU A 231 ? HIS A 209 LEU A 228 1 ? 20 
HELX_P HELX_P12 12 ASN A 239 ? ALA A 248 ? ASN A 236 ALA A 245 1 ? 10 
HELX_P HELX_P13 13 PRO A 251 ? THR A 253 ? PRO A 248 THR A 250 5 ? 3  
HELX_P HELX_P14 14 ILE A 254 ? SER A 265 ? ILE A 251 SER A 262 1 ? 12 
HELX_P HELX_P15 15 ASN A 267 ? ASN A 285 ? ASN A 264 ASN A 282 1 ? 19 
HELX_P HELX_P16 16 TRP A 294 ? PHE A 305 ? TRP A 291 PHE A 302 1 ? 12 
HELX_P HELX_P17 17 ASP A 309 ? GLY A 315 ? ASP A 306 GLY A 312 1 ? 7  
HELX_P HELX_P18 18 ASP A 338 ? PHE A 345 ? ASP A 335 PHE A 342 5 ? 8  
HELX_P HELX_P19 19 THR A 352 ? ASP A 361 ? THR A 349 ASP A 358 1 ? 10 
HELX_P HELX_P20 20 ASP A 385 ? THR A 389 ? ASP A 382 THR A 386 5 ? 5  
HELX_P HELX_P21 21 LEU A 391 ? GLY A 411 ? LEU A 388 GLY A 408 1 ? 21 
HELX_P HELX_P22 22 SER B 38  ? SER B 62  ? SER B 38  SER B 62  1 ? 25 
HELX_P HELX_P23 23 THR B 67  ? LEU B 81  ? THR B 67  LEU B 81  1 ? 15 
HELX_P HELX_P24 24 PRO B 95  ? TYR B 110 ? PRO B 95  TYR B 110 1 ? 16 
HELX_P HELX_P25 25 SER B 113 ? ILE B 134 ? SER B 113 ILE B 134 1 ? 22 
HELX_P HELX_P26 26 PRO B 136 ? ASP B 146 ? PRO B 136 ASP B 146 1 ? 11 
HELX_P HELX_P27 27 SER B 155 ? THR B 160 ? SER B 155 THR B 160 1 ? 6  
HELX_P HELX_P28 28 ARG B 162 ? SER B 170 ? ARG B 162 SER B 170 1 ? 9  
HELX_P HELX_P29 29 ALA B 191 ? ARG B 196 ? ALA B 191 ARG B 196 1 ? 6  
HELX_P HELX_P30 30 LEU B 211 ? SER B 236 ? LEU B 211 SER B 236 1 ? 26 
HELX_P HELX_P31 31 ASP B 243 ? GLN B 247 ? ASP B 243 GLN B 247 5 ? 5  
HELX_P HELX_P32 32 GLU C 11  ? LEU C 23  ? GLU C 8   LEU C 20  1 ? 13 
HELX_P HELX_P33 33 PRO C 25  ? TYR C 35  ? PRO C 22  TYR C 32  1 ? 11 
HELX_P HELX_P34 34 GLY C 36  ? VAL C 38  ? GLY C 33  VAL C 35  5 ? 3  
HELX_P HELX_P35 35 LYS C 53  ? ASP C 55  ? LYS C 50  ASP C 52  5 ? 3  
HELX_P HELX_P36 36 ASN C 65  ? ASN C 77  ? ASN C 62  ASN C 74  1 ? 13 
HELX_P HELX_P37 37 ARG C 90  ? VAL C 97  ? ARG C 87  VAL C 94  5 ? 8  
HELX_P HELX_P38 38 THR C 116 ? ASP C 119 ? THR C 113 ASP C 116 5 ? 4  
HELX_P HELX_P39 39 TRP C 135 ? ASP C 152 ? TRP C 132 ASP C 149 1 ? 18 
HELX_P HELX_P40 40 ASP C 174 ? LYS C 179 ? ASP C 171 LYS C 176 1 ? 6  
HELX_P HELX_P41 41 SER C 181 ? SER C 193 ? SER C 178 SER C 190 1 ? 13 
HELX_P HELX_P42 42 HIS C 212 ? LEU C 231 ? HIS C 209 LEU C 228 1 ? 20 
HELX_P HELX_P43 43 ASN C 239 ? ALA C 248 ? ASN C 236 ALA C 245 1 ? 10 
HELX_P HELX_P44 44 PRO C 251 ? THR C 253 ? PRO C 248 THR C 250 5 ? 3  
HELX_P HELX_P45 45 ILE C 254 ? SER C 265 ? ILE C 251 SER C 262 1 ? 12 
HELX_P HELX_P46 46 ASN C 267 ? TYR C 282 ? ASN C 264 TYR C 279 1 ? 16 
HELX_P HELX_P47 47 TRP C 294 ? PHE C 305 ? TRP C 291 PHE C 302 1 ? 12 
HELX_P HELX_P48 48 ASP C 309 ? GLY C 315 ? ASP C 306 GLY C 312 1 ? 7  
HELX_P HELX_P49 49 ASP C 338 ? PHE C 345 ? ASP C 335 PHE C 342 5 ? 8  
HELX_P HELX_P50 50 THR C 352 ? LEU C 360 ? THR C 349 LEU C 357 1 ? 9  
HELX_P HELX_P51 51 LEU C 391 ? GLY C 411 ? LEU C 388 GLY C 408 1 ? 21 
HELX_P HELX_P52 52 SER D 38  ? TYR D 63  ? SER D 38  TYR D 63  1 ? 26 
HELX_P HELX_P53 53 THR D 67  ? LEU D 81  ? THR D 67  LEU D 81  1 ? 15 
HELX_P HELX_P54 54 GLU D 94  ? CYS D 111 ? GLU D 94  CYS D 111 1 ? 18 
HELX_P HELX_P55 55 SER D 113 ? ILE D 134 ? SER D 113 ILE D 134 1 ? 22 
HELX_P HELX_P56 56 PRO D 136 ? ASP D 146 ? PRO D 136 ASP D 146 1 ? 11 
HELX_P HELX_P57 57 SER D 155 ? THR D 160 ? SER D 155 THR D 160 1 ? 6  
HELX_P HELX_P58 58 ARG D 162 ? SER D 170 ? ARG D 162 SER D 170 1 ? 9  
HELX_P HELX_P59 59 ALA D 191 ? ARG D 196 ? ALA D 191 ARG D 196 1 ? 6  
HELX_P HELX_P60 60 PRO D 210 ? LEU D 237 ? PRO D 210 LEU D 237 1 ? 28 
HELX_P HELX_P61 61 ASP D 243 ? ARG D 245 ? ASP D 243 ARG D 245 5 ? 3  
HELX_P HELX_P62 62 LEU D 246 ? HIS D 252 ? LEU D 246 HIS D 252 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 124 SG ? ? A ZN 1409 A CYS 121 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc2 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 125 SG ? ? A ZN 1409 A CYS 122 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc3 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 131 SG ? ? A ZN 1409 A CYS 128 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc4 metalc ? ? E ZN . ZN ? ? ? 1_555 A CYS 134 SG ? ? A ZN 1409 A CYS 131 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc5 metalc ? ? J ZN . ZN ? ? ? 1_555 C CYS 124 SG ? ? C ZN 1409 C CYS 121 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc6 metalc ? ? J ZN . ZN ? ? ? 1_555 C CYS 131 SG ? ? C ZN 1409 C CYS 128 1_555 ? ? ? ? ? ? ? 2.353 ? 
metalc7 metalc ? ? J ZN . ZN ? ? ? 1_555 C CYS 134 SG ? ? C ZN 1409 C CYS 131 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc8 metalc ? ? J ZN . ZN ? ? ? 1_555 C CYS 125 SG ? ? C ZN 1409 C CYS 122 1_555 ? ? ? ? ? ? ? 2.160 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 4 ? 
AC ? 2 ? 
AD ? 3 ? 
BA ? 4 ? 
CA ? 4 ? 
CB ? 4 ? 
CC ? 2 ? 
CD ? 3 ? 
DA ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 56  ? GLN A 61  ? ILE A 53  GLN A 58  
AA 2 ARG A 46  ? LEU A 52  ? ARG A 43  LEU A 49  
AA 3 LYS A 80  ? TYR A 87  ? LYS A 77  TYR A 84  
AA 4 ALA A 104 ? GLU A 106 ? ALA A 101 GLU A 103 
AB 1 ILE A 56  ? GLN A 61  ? ILE A 53  GLN A 58  
AB 2 ARG A 46  ? LEU A 52  ? ARG A 43  LEU A 49  
AB 3 LYS A 80  ? TYR A 87  ? LYS A 77  TYR A 84  
AB 4 LEU A 320 ? LYS A 321 ? LEU A 317 LYS A 318 
AC 1 ALA A 104 ? GLU A 106 ? ALA A 101 GLU A 103 
AC 2 LYS A 80  ? TYR A 87  ? LYS A 77  TYR A 84  
AD 1 LEU A 109 ? ASP A 114 ? LEU A 106 ASP A 111 
AD 2 GLY A 167 ? VAL A 172 ? GLY A 164 VAL A 169 
AD 3 ARG A 158 ? TYR A 162 ? ARG A 155 TYR A 159 
BA 1 GLU B 152 ? ALA B 153 ? GLU B 152 ALA B 153 
BA 2 ILE B 183 ? PRO B 187 ? ILE B 183 PRO B 187 
BA 3 PHE B 206 ? PRO B 210 ? PHE B 206 PRO B 210 
BA 4 TYR B 201 ? GLU B 203 ? TYR B 201 GLU B 203 
CA 1 ILE C 56  ? GLN C 61  ? ILE C 53  GLN C 58  
CA 2 ARG C 46  ? LEU C 52  ? ARG C 43  LEU C 49  
CA 3 LYS C 80  ? TYR C 87  ? LYS C 77  TYR C 84  
CA 4 ALA C 104 ? GLU C 106 ? ALA C 101 GLU C 103 
CB 1 ILE C 56  ? GLN C 61  ? ILE C 53  GLN C 58  
CB 2 ARG C 46  ? LEU C 52  ? ARG C 43  LEU C 49  
CB 3 LYS C 80  ? TYR C 87  ? LYS C 77  TYR C 84  
CB 4 LEU C 320 ? LYS C 321 ? LEU C 317 LYS C 318 
CC 1 ALA C 104 ? GLU C 106 ? ALA C 101 GLU C 103 
CC 2 LYS C 80  ? TYR C 87  ? LYS C 77  TYR C 84  
CD 1 LEU C 109 ? ASP C 114 ? LEU C 106 ASP C 111 
CD 2 GLY C 167 ? VAL C 172 ? GLY C 164 VAL C 169 
CD 3 ARG C 158 ? TYR C 162 ? ARG C 155 TYR C 159 
DA 1 GLU D 152 ? ALA D 153 ? GLU D 152 ALA D 153 
DA 2 TYR D 184 ? PRO D 187 ? TYR D 184 PRO D 187 
DA 3 PHE D 206 ? VAL D 209 ? PHE D 206 VAL D 209 
DA 4 TYR D 201 ? GLU D 203 ? TYR D 201 GLU D 203 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLN A 61  ? N GLN A 58  O PHE A 48  ? O PHE A 45  
AA 2 3 N THR A 51  ? N THR A 48  O LYS A 80  ? O LYS A 77  
AA 3 4 O VAL A 86  ? O VAL A 83  N GLN A 105 ? N GLN A 102 
AB 1 2 N GLN A 61  ? N GLN A 58  O PHE A 48  ? O PHE A 45  
AB 2 3 N THR A 51  ? N THR A 48  O LYS A 80  ? O LYS A 77  
AB 3 4 N ILE A 83  ? N ILE A 80  O LEU A 320 ? O LEU A 317 
AC 1 2 N GLN A 105 ? N GLN A 102 O VAL A 86  ? O VAL A 83  
AD 1 2 N ILE A 113 ? N ILE A 110 O VAL A 168 ? O VAL A 165 
AD 2 3 N TRP A 171 ? N TRP A 168 O LEU A 159 ? O LEU A 156 
BA 1 2 N GLU B 152 ? N GLU B 152 O LYS B 185 ? O LYS B 185 
BA 2 3 N ILE B 186 ? N ILE B 186 O ALA B 207 ? O ALA B 207 
BA 3 4 N TYR B 208 ? N TYR B 208 O TYR B 201 ? O TYR B 201 
CA 1 2 N GLN C 61  ? N GLN C 58  O PHE C 48  ? O PHE C 45  
CA 2 3 N THR C 51  ? N THR C 48  O LYS C 80  ? O LYS C 77  
CA 3 4 O VAL C 86  ? O VAL C 83  N GLN C 105 ? N GLN C 102 
CB 1 2 N GLN C 61  ? N GLN C 58  O PHE C 48  ? O PHE C 45  
CB 2 3 N THR C 51  ? N THR C 48  O LYS C 80  ? O LYS C 77  
CB 3 4 N ILE C 83  ? N ILE C 80  O LEU C 320 ? O LEU C 317 
CC 1 2 N GLN C 105 ? N GLN C 102 O VAL C 86  ? O VAL C 83  
CD 1 2 N ILE C 113 ? N ILE C 110 O VAL C 168 ? O VAL C 165 
CD 2 3 N TRP C 171 ? N TRP C 168 O LEU C 159 ? O LEU C 156 
DA 1 2 N GLU D 152 ? N GLU D 152 O LYS D 185 ? O LYS D 185 
DA 2 3 N ILE D 186 ? N ILE D 186 O ALA D 207 ? O ALA D 207 
DA 3 4 N TYR D 208 ? N TYR D 208 O TYR D 201 ? O TYR D 201 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1409'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1409'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 1410' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1411' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1412' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1413' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 124 ? CYS A 121  . ? 1_555 ? 
2  AC1 4 CYS A 125 ? CYS A 122  . ? 1_555 ? 
3  AC1 4 CYS A 131 ? CYS A 128  . ? 1_555 ? 
4  AC1 4 CYS A 134 ? CYS A 131  . ? 1_555 ? 
5  AC2 4 CYS C 124 ? CYS C 121  . ? 1_555 ? 
6  AC2 4 CYS C 125 ? CYS C 122  . ? 1_555 ? 
7  AC2 4 CYS C 131 ? CYS C 128  . ? 1_555 ? 
8  AC2 4 CYS C 134 ? CYS C 131  . ? 1_555 ? 
9  AC3 4 ASP A 120 ? ASP A 117  . ? 1_555 ? 
10 AC3 4 VAL A 121 ? VAL A 118  . ? 1_555 ? 
11 AC3 4 LYS A 245 ? LYS A 242  . ? 1_555 ? 
12 AC3 4 TYR A 303 ? TYR A 300  . ? 1_555 ? 
13 AC4 5 GLU A 227 ? GLU A 224  . ? 1_555 ? 
14 AC4 5 TRP A 272 ? TRP A 269  . ? 1_555 ? 
15 AC4 5 LYS A 276 ? LYS A 273  . ? 1_555 ? 
16 AC4 5 GLU A 296 ? GLU A 293  . ? 1_555 ? 
17 AC4 5 MET A 300 ? MET A 297  . ? 1_555 ? 
18 AC5 5 LYS A 156 ? LYS A 153  . ? 1_555 ? 
19 AC5 5 HIS A 157 ? HIS A 154  . ? 1_555 ? 
20 AC5 5 ARG A 158 ? ARG A 155  . ? 1_555 ? 
21 AC5 5 PHE A 401 ? PHE A 398  . ? 1_555 ? 
22 AC5 5 ASN A 404 ? ASN A 401  . ? 1_555 ? 
23 AC6 5 TYR A 162 ? TYR A 159  . ? 1_555 ? 
24 AC6 5 ARG A 332 ? ARG A 329  . ? 1_555 ? 
25 AC6 5 PRO A 347 ? PRO A 344  . ? 1_555 ? 
26 AC6 5 PHE A 348 ? PHE A 345  . ? 1_555 ? 
27 AC6 5 HOH K .   ? HOH A 2059 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BPU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BPU 
_atom_sites.fract_transf_matrix[1][1]   0.008730 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002235 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014569 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008143 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . PHE A 1 7   ? 59.959  71.793  -24.425 1.00 88.65  ? 4    PHE A N    1 
ATOM   2     C  CA   . PHE A 1 7   ? 58.751  72.597  -24.603 1.00 89.27  ? 4    PHE A CA   1 
ATOM   3     C  C    . PHE A 1 7   ? 58.714  73.816  -23.694 1.00 91.55  ? 4    PHE A C    1 
ATOM   4     O  O    . PHE A 1 7   ? 59.051  73.728  -22.514 1.00 89.48  ? 4    PHE A O    1 
ATOM   5     C  CB   . PHE A 1 7   ? 57.498  71.758  -24.362 1.00 87.61  ? 4    PHE A CB   1 
ATOM   6     C  CG   . PHE A 1 7   ? 56.224  72.567  -24.380 1.00 86.76  ? 4    PHE A CG   1 
ATOM   7     C  CD1  . PHE A 1 7   ? 55.675  72.998  -25.579 1.00 76.80  ? 4    PHE A CD1  1 
ATOM   8     C  CD2  . PHE A 1 7   ? 55.571  72.885  -23.195 1.00 69.20  ? 4    PHE A CD2  1 
ATOM   9     C  CE1  . PHE A 1 7   ? 54.500  73.750  -25.600 1.00 74.95  ? 4    PHE A CE1  1 
ATOM   10    C  CE2  . PHE A 1 7   ? 54.399  73.632  -23.203 1.00 80.14  ? 4    PHE A CE2  1 
ATOM   11    C  CZ   . PHE A 1 7   ? 53.859  74.067  -24.415 1.00 77.86  ? 4    PHE A CZ   1 
ATOM   12    H  HA   . PHE A 1 7   ? 58.723  72.914  -25.519 1.00 107.12 ? 4    PHE A HA   1 
ATOM   13    H  HB2  . PHE A 1 7   ? 57.433  71.085  -25.057 1.00 105.14 ? 4    PHE A HB2  1 
ATOM   14    H  HB3  . PHE A 1 7   ? 57.568  71.331  -23.494 1.00 105.14 ? 4    PHE A HB3  1 
ATOM   15    H  HD1  . PHE A 1 7   ? 56.102  72.793  -26.379 1.00 92.16  ? 4    PHE A HD1  1 
ATOM   16    H  HD2  . PHE A 1 7   ? 55.928  72.601  -22.385 1.00 83.05  ? 4    PHE A HD2  1 
ATOM   17    H  HE1  . PHE A 1 7   ? 54.145  74.035  -26.411 1.00 89.94  ? 4    PHE A HE1  1 
ATOM   18    H  HE2  . PHE A 1 7   ? 53.974  73.840  -22.403 1.00 96.17  ? 4    PHE A HE2  1 
ATOM   19    H  HZ   . PHE A 1 7   ? 53.073  74.564  -24.425 1.00 93.43  ? 4    PHE A HZ   1 
ATOM   20    N  N    . ASP A 1 8   ? 58.290  74.948  -24.250 1.00 87.98  ? 5    ASP A N    1 
ATOM   21    C  CA   . ASP A 1 8   ? 58.289  76.210  -23.516 1.00 87.47  ? 5    ASP A CA   1 
ATOM   22    C  C    . ASP A 1 8   ? 56.861  76.703  -23.245 1.00 84.65  ? 5    ASP A C    1 
ATOM   23    O  O    . ASP A 1 8   ? 56.140  77.038  -24.180 1.00 90.34  ? 5    ASP A O    1 
ATOM   24    C  CB   . ASP A 1 8   ? 59.068  77.269  -24.299 1.00 85.14  ? 5    ASP A CB   1 
ATOM   25    C  CG   . ASP A 1 8   ? 58.995  78.636  -23.655 1.00 98.37  ? 5    ASP A CG   1 
ATOM   26    O  OD1  . ASP A 1 8   ? 59.002  78.715  -22.409 1.00 100.43 ? 5    ASP A OD1  1 
ATOM   27    O  OD2  . ASP A 1 8   ? 58.926  79.642  -24.394 1.00 102.76 ? 5    ASP A OD2  1 
ATOM   28    H  H    . ASP A 1 8   ? 57.997  75.012  -25.055 1.00 105.58 ? 5    ASP A H    1 
ATOM   29    H  HA   . ASP A 1 8   ? 58.730  76.081  -22.662 1.00 104.96 ? 5    ASP A HA   1 
ATOM   30    H  HB2  . ASP A 1 8   ? 60.001  77.006  -24.343 1.00 102.16 ? 5    ASP A HB2  1 
ATOM   31    H  HB3  . ASP A 1 8   ? 58.699  77.337  -25.193 1.00 102.16 ? 5    ASP A HB3  1 
ATOM   32    N  N    . PRO A 1 9   ? 56.451  76.759  -21.964 1.00 84.16  ? 6    PRO A N    1 
ATOM   33    C  CA   . PRO A 1 9   ? 55.084  77.165  -21.599 1.00 84.43  ? 6    PRO A CA   1 
ATOM   34    C  C    . PRO A 1 9   ? 54.765  78.644  -21.811 1.00 87.63  ? 6    PRO A C    1 
ATOM   35    O  O    . PRO A 1 9   ? 53.678  79.059  -21.403 1.00 86.21  ? 6    PRO A O    1 
ATOM   36    C  CB   . PRO A 1 9   ? 55.000  76.836  -20.103 1.00 80.03  ? 6    PRO A CB   1 
ATOM   37    C  CG   . PRO A 1 9   ? 56.081  75.851  -19.857 1.00 82.67  ? 6    PRO A CG   1 
ATOM   38    C  CD   . PRO A 1 9   ? 57.178  76.225  -20.799 1.00 78.59  ? 6    PRO A CD   1 
ATOM   39    H  HA   . PRO A 1 9   ? 54.435  76.627  -22.080 1.00 101.32 ? 6    PRO A HA   1 
ATOM   40    H  HB2  . PRO A 1 9   ? 55.145  77.641  -19.583 1.00 96.03  ? 6    PRO A HB2  1 
ATOM   41    H  HB3  . PRO A 1 9   ? 54.133  76.450  -19.902 1.00 96.03  ? 6    PRO A HB3  1 
ATOM   42    H  HG2  . PRO A 1 9   ? 56.381  75.919  -18.938 1.00 99.20  ? 6    PRO A HG2  1 
ATOM   43    H  HG3  . PRO A 1 9   ? 55.757  74.957  -20.047 1.00 99.20  ? 6    PRO A HG3  1 
ATOM   44    H  HD2  . PRO A 1 9   ? 57.741  76.911  -20.407 1.00 94.31  ? 6    PRO A HD2  1 
ATOM   45    H  HD3  . PRO A 1 9   ? 57.692  75.441  -21.049 1.00 94.31  ? 6    PRO A HD3  1 
ATOM   46    N  N    . THR A 1 10  ? 55.681  79.424  -22.384 1.00 87.47  ? 7    THR A N    1 
ATOM   47    C  CA   . THR A 1 10  ? 55.420  80.850  -22.615 1.00 90.80  ? 7    THR A CA   1 
ATOM   48    C  C    . THR A 1 10  ? 54.937  81.103  -24.037 1.00 86.93  ? 7    THR A C    1 
ATOM   49    O  O    . THR A 1 10  ? 54.292  82.110  -24.302 1.00 86.14  ? 7    THR A O    1 
ATOM   50    C  CB   . THR A 1 10  ? 56.666  81.712  -22.349 1.00 81.74  ? 7    THR A CB   1 
ATOM   51    O  OG1  . THR A 1 10  ? 57.809  81.126  -22.983 1.00 76.65  ? 7    THR A OG1  1 
ATOM   52    C  CG2  . THR A 1 10  ? 56.917  81.825  -20.854 1.00 84.05  ? 7    THR A CG2  1 
ATOM   53    H  H    . THR A 1 10  ? 56.456  79.158  -22.647 1.00 104.96 ? 7    THR A H    1 
ATOM   54    H  HA   . THR A 1 10  ? 54.723  81.142  -22.008 1.00 108.96 ? 7    THR A HA   1 
ATOM   55    H  HB   . THR A 1 10  ? 56.523  82.603  -22.704 1.00 98.09  ? 7    THR A HB   1 
ATOM   56    H  HG1  . THR A 1 10  ? 57.684  81.076  -23.812 1.00 91.98  ? 7    THR A HG1  1 
ATOM   57    H  HG21 . THR A 1 10  ? 57.059  80.944  -20.474 1.00 100.86 ? 7    THR A HG21 1 
ATOM   58    H  HG22 . THR A 1 10  ? 57.703  82.369  -20.690 1.00 100.86 ? 7    THR A HG22 1 
ATOM   59    H  HG23 . THR A 1 10  ? 56.153  82.237  -20.420 1.00 100.86 ? 7    THR A HG23 1 
ATOM   60    N  N    . GLU A 1 11  ? 55.244  80.180  -24.942 1.00 82.02  ? 8    GLU A N    1 
ATOM   61    C  CA   . GLU A 1 11  ? 54.710  80.223  -26.294 1.00 90.95  ? 8    GLU A CA   1 
ATOM   62    C  C    . GLU A 1 11  ? 53.249  79.782  -26.265 1.00 93.31  ? 8    GLU A C    1 
ATOM   63    O  O    . GLU A 1 11  ? 52.515  79.917  -27.245 1.00 97.07  ? 8    GLU A O    1 
ATOM   64    C  CB   . GLU A 1 11  ? 55.518  79.315  -27.222 1.00 89.95  ? 8    GLU A CB   1 
ATOM   65    C  CG   . GLU A 1 11  ? 56.972  79.713  -27.372 1.00 94.10  ? 8    GLU A CG   1 
ATOM   66    C  CD   . GLU A 1 11  ? 57.739  78.755  -28.255 1.00 102.21 ? 8    GLU A CD   1 
ATOM   67    O  OE1  . GLU A 1 11  ? 57.236  77.634  -28.486 1.00 113.63 ? 8    GLU A OE1  1 
ATOM   68    O  OE2  . GLU A 1 11  ? 58.842  79.118  -28.715 1.00 101.98 ? 8    GLU A OE2  1 
ATOM   69    H  H    . GLU A 1 11  ? 55.765  79.512  -24.793 1.00 98.43  ? 8    GLU A H    1 
ATOM   70    H  HA   . GLU A 1 11  ? 54.753  81.131  -26.633 1.00 109.14 ? 8    GLU A HA   1 
ATOM   71    H  HB2  . GLU A 1 11  ? 55.495  78.412  -26.870 1.00 107.94 ? 8    GLU A HB2  1 
ATOM   72    H  HB3  . GLU A 1 11  ? 55.115  79.334  -28.104 1.00 107.94 ? 8    GLU A HB3  1 
ATOM   73    H  HG2  . GLU A 1 11  ? 57.021  80.595  -27.771 1.00 112.92 ? 8    GLU A HG2  1 
ATOM   74    H  HG3  . GLU A 1 11  ? 57.392  79.718  -26.498 1.00 112.92 ? 8    GLU A HG3  1 
ATOM   75    N  N    . LEU A 1 12  ? 52.836  79.273  -25.111 1.00 88.37  ? 9    LEU A N    1 
ATOM   76    C  CA   . LEU A 1 12  ? 51.559  78.597  -24.963 1.00 92.73  ? 9    LEU A CA   1 
ATOM   77    C  C    . LEU A 1 12  ? 50.351  79.449  -25.361 1.00 85.69  ? 9    LEU A C    1 
ATOM   78    O  O    . LEU A 1 12  ? 49.512  78.989  -26.131 1.00 90.45  ? 9    LEU A O    1 
ATOM   79    C  CB   . LEU A 1 12  ? 51.410  78.122  -23.511 1.00 93.81  ? 9    LEU A CB   1 
ATOM   80    C  CG   . LEU A 1 12  ? 50.363  77.057  -23.184 1.00 81.92  ? 9    LEU A CG   1 
ATOM   81    C  CD1  . LEU A 1 12  ? 50.410  75.875  -24.154 1.00 85.39  ? 9    LEU A CD1  1 
ATOM   82    C  CD2  . LEU A 1 12  ? 50.565  76.584  -21.761 1.00 73.19  ? 9    LEU A CD2  1 
ATOM   83    H  H    . LEU A 1 12  ? 53.291  79.309  -24.382 1.00 106.05 ? 9    LEU A H    1 
ATOM   84    H  HA   . LEU A 1 12  ? 51.560  77.810  -25.530 1.00 111.28 ? 9    LEU A HA   1 
ATOM   85    H  HB2  . LEU A 1 12  ? 52.267  77.765  -23.229 1.00 112.57 ? 9    LEU A HB2  1 
ATOM   86    H  HB3  . LEU A 1 12  ? 51.199  78.897  -22.968 1.00 112.57 ? 9    LEU A HB3  1 
ATOM   87    H  HG   . LEU A 1 12  ? 49.480  77.456  -23.243 1.00 98.31  ? 9    LEU A HG   1 
ATOM   88    H  HD11 . LEU A 1 12  ? 51.287  75.463  -24.106 1.00 102.46 ? 9    LEU A HD11 1 
ATOM   89    H  HD12 . LEU A 1 12  ? 49.728  75.233  -23.901 1.00 102.46 ? 9    LEU A HD12 1 
ATOM   90    H  HD13 . LEU A 1 12  ? 50.244  76.198  -25.053 1.00 102.46 ? 9    LEU A HD13 1 
ATOM   91    H  HD21 . LEU A 1 12  ? 50.467  77.339  -21.160 1.00 87.83  ? 9    LEU A HD21 1 
ATOM   92    H  HD22 . LEU A 1 12  ? 49.899  75.909  -21.556 1.00 87.83  ? 9    LEU A HD22 1 
ATOM   93    H  HD23 . LEU A 1 12  ? 51.455  76.207  -21.677 1.00 87.83  ? 9    LEU A HD23 1 
ATOM   94    N  N    . PRO A 1 13  ? 50.240  80.680  -24.833 1.00 92.55  ? 10   PRO A N    1 
ATOM   95    C  CA   . PRO A 1 13  ? 49.038  81.463  -25.158 1.00 92.01  ? 10   PRO A CA   1 
ATOM   96    C  C    . PRO A 1 13  ? 48.916  81.765  -26.650 1.00 91.52  ? 10   PRO A C    1 
ATOM   97    O  O    . PRO A 1 13  ? 47.810  81.995  -27.136 1.00 87.16  ? 10   PRO A O    1 
ATOM   98    C  CB   . PRO A 1 13  ? 49.221  82.752  -24.344 1.00 81.92  ? 10   PRO A CB   1 
ATOM   99    C  CG   . PRO A 1 13  ? 50.681  82.822  -24.048 1.00 92.04  ? 10   PRO A CG   1 
ATOM   100   C  CD   . PRO A 1 13  ? 51.135  81.403  -23.916 1.00 87.89  ? 10   PRO A CD   1 
ATOM   101   H  HA   . PRO A 1 13  ? 48.240  81.001  -24.856 1.00 110.41 ? 10   PRO A HA   1 
ATOM   102   H  HB2  . PRO A 1 13  ? 48.941  83.516  -24.874 1.00 98.31  ? 10   PRO A HB2  1 
ATOM   103   H  HB3  . PRO A 1 13  ? 48.707  82.697  -23.524 1.00 98.31  ? 10   PRO A HB3  1 
ATOM   104   H  HG2  . PRO A 1 13  ? 51.141  83.260  -24.781 1.00 110.44 ? 10   PRO A HG2  1 
ATOM   105   H  HG3  . PRO A 1 13  ? 50.823  83.305  -23.219 1.00 110.44 ? 10   PRO A HG3  1 
ATOM   106   H  HD2  . PRO A 1 13  ? 52.057  81.314  -24.201 1.00 105.46 ? 10   PRO A HD2  1 
ATOM   107   H  HD3  . PRO A 1 13  ? 51.011  81.092  -23.005 1.00 105.46 ? 10   PRO A HD3  1 
ATOM   108   N  N    . GLU A 1 14  ? 50.040  81.753  -27.361 1.00 92.82  ? 11   GLU A N    1 
ATOM   109   C  CA   . GLU A 1 14  ? 50.043  81.956  -28.807 1.00 94.46  ? 11   GLU A CA   1 
ATOM   110   C  C    . GLU A 1 14  ? 49.691  80.654  -29.524 1.00 97.08  ? 11   GLU A C    1 
ATOM   111   O  O    . GLU A 1 14  ? 48.933  80.646  -30.500 1.00 96.22  ? 11   GLU A O    1 
ATOM   112   C  CB   . GLU A 1 14  ? 51.406  82.473  -29.286 1.00 100.42 ? 11   GLU A CB   1 
ATOM   113   C  CG   . GLU A 1 14  ? 51.834  83.801  -28.666 1.00 125.60 ? 11   GLU A CG   1 
ATOM   114   C  CD   . GLU A 1 14  ? 50.817  84.916  -28.885 1.00 129.22 ? 11   GLU A CD   1 
ATOM   115   O  OE1  . GLU A 1 14  ? 50.157  84.930  -29.949 1.00 117.52 ? 11   GLU A OE1  1 
ATOM   116   O  OE2  . GLU A 1 14  ? 50.681  85.781  -27.991 1.00 128.46 ? 11   GLU A OE2  1 
ATOM   117   H  H    . GLU A 1 14  ? 50.822  81.627  -27.026 1.00 111.38 ? 11   GLU A H    1 
ATOM   118   H  HA   . GLU A 1 14  ? 49.372  82.618  -29.036 1.00 113.35 ? 11   GLU A HA   1 
ATOM   119   H  HB2  . GLU A 1 14  ? 52.082  81.814  -29.064 1.00 120.50 ? 11   GLU A HB2  1 
ATOM   120   H  HB3  . GLU A 1 14  ? 51.371  82.595  -30.247 1.00 120.50 ? 11   GLU A HB3  1 
ATOM   121   H  HG2  . GLU A 1 14  ? 51.946  83.682  -27.710 1.00 150.72 ? 11   GLU A HG2  1 
ATOM   122   H  HG3  . GLU A 1 14  ? 52.673  84.079  -29.066 1.00 150.72 ? 11   GLU A HG3  1 
ATOM   123   N  N    . LEU A 1 15  ? 50.250  79.557  -29.029 1.00 88.02  ? 12   LEU A N    1 
ATOM   124   C  CA   . LEU A 1 15  ? 49.987  78.238  -29.585 1.00 85.56  ? 12   LEU A CA   1 
ATOM   125   C  C    . LEU A 1 15  ? 48.515  77.843  -29.421 1.00 84.39  ? 12   LEU A C    1 
ATOM   126   O  O    . LEU A 1 15  ? 47.925  77.209  -30.306 1.00 69.17  ? 12   LEU A O    1 
ATOM   127   C  CB   . LEU A 1 15  ? 50.897  77.218  -28.909 1.00 85.33  ? 12   LEU A CB   1 
ATOM   128   C  CG   . LEU A 1 15  ? 52.364  77.347  -29.320 1.00 89.74  ? 12   LEU A CG   1 
ATOM   129   C  CD1  . LEU A 1 15  ? 53.292  76.692  -28.296 1.00 86.80  ? 12   LEU A CD1  1 
ATOM   130   C  CD2  . LEU A 1 15  ? 52.576  76.740  -30.701 1.00 79.61  ? 12   LEU A CD2  1 
ATOM   131   H  H    . LEU A 1 15  ? 50.793  79.550  -28.362 1.00 105.62 ? 12   LEU A H    1 
ATOM   132   H  HA   . LEU A 1 15  ? 50.194  78.245  -30.533 1.00 102.67 ? 12   LEU A HA   1 
ATOM   133   H  HB2  . LEU A 1 15  ? 50.845  77.340  -27.948 1.00 102.39 ? 12   LEU A HB2  1 
ATOM   134   H  HB3  . LEU A 1 15  ? 50.599  76.326  -29.144 1.00 102.39 ? 12   LEU A HB3  1 
ATOM   135   H  HG   . LEU A 1 15  ? 52.594  78.288  -29.371 1.00 107.69 ? 12   LEU A HG   1 
ATOM   136   H  HD11 . LEU A 1 15  ? 53.069  75.751  -28.226 1.00 104.16 ? 12   LEU A HD11 1 
ATOM   137   H  HD12 . LEU A 1 15  ? 54.210  76.795  -28.592 1.00 104.16 ? 12   LEU A HD12 1 
ATOM   138   H  HD13 . LEU A 1 15  ? 53.170  77.126  -27.437 1.00 104.16 ? 12   LEU A HD13 1 
ATOM   139   H  HD21 . LEU A 1 15  ? 52.019  77.210  -31.342 1.00 95.53  ? 12   LEU A HD21 1 
ATOM   140   H  HD22 . LEU A 1 15  ? 53.511  76.831  -30.946 1.00 95.53  ? 12   LEU A HD22 1 
ATOM   141   H  HD23 . LEU A 1 15  ? 52.331  75.802  -30.674 1.00 95.53  ? 12   LEU A HD23 1 
ATOM   142   N  N    . LEU A 1 16  ? 47.926  78.217  -28.288 1.00 78.84  ? 13   LEU A N    1 
ATOM   143   C  CA   . LEU A 1 16  ? 46.518  77.922  -28.031 1.00 84.94  ? 13   LEU A CA   1 
ATOM   144   C  C    . LEU A 1 16  ? 45.611  78.565  -29.068 1.00 83.86  ? 13   LEU A C    1 
ATOM   145   O  O    . LEU A 1 16  ? 44.708  77.912  -29.590 1.00 81.45  ? 13   LEU A O    1 
ATOM   146   C  CB   . LEU A 1 16  ? 46.100  78.385  -26.633 1.00 84.74  ? 13   LEU A CB   1 
ATOM   147   C  CG   . LEU A 1 16  ? 46.568  77.555  -25.432 1.00 79.98  ? 13   LEU A CG   1 
ATOM   148   C  CD1  . LEU A 1 16  ? 45.935  78.101  -24.156 1.00 74.45  ? 13   LEU A CD1  1 
ATOM   149   C  CD2  . LEU A 1 16  ? 46.238  76.071  -25.592 1.00 69.28  ? 13   LEU A CD2  1 
ATOM   150   H  H    . LEU A 1 16  ? 48.318  78.642  -27.652 1.00 94.61  ? 13   LEU A H    1 
ATOM   151   H  HA   . LEU A 1 16  ? 46.387  76.962  -28.077 1.00 101.93 ? 13   LEU A HA   1 
ATOM   152   H  HB2  . LEU A 1 16  ? 46.438  79.285  -26.504 1.00 101.69 ? 13   LEU A HB2  1 
ATOM   153   H  HB3  . LEU A 1 16  ? 45.131  78.404  -26.603 1.00 101.69 ? 13   LEU A HB3  1 
ATOM   154   H  HG   . LEU A 1 16  ? 47.531  77.639  -25.347 1.00 95.98  ? 13   LEU A HG   1 
ATOM   155   H  HD11 . LEU A 1 16  ? 44.970  78.046  -24.234 1.00 89.34  ? 13   LEU A HD11 1 
ATOM   156   H  HD12 . LEU A 1 16  ? 46.237  77.570  -23.402 1.00 89.34  ? 13   LEU A HD12 1 
ATOM   157   H  HD13 . LEU A 1 16  ? 46.206  79.025  -24.040 1.00 89.34  ? 13   LEU A HD13 1 
ATOM   158   H  HD21 . LEU A 1 16  ? 46.679  75.734  -26.388 1.00 83.14  ? 13   LEU A HD21 1 
ATOM   159   H  HD22 . LEU A 1 16  ? 46.552  75.591  -24.810 1.00 83.14  ? 13   LEU A HD22 1 
ATOM   160   H  HD23 . LEU A 1 16  ? 45.277  75.970  -25.679 1.00 83.14  ? 13   LEU A HD23 1 
ATOM   161   N  N    . LYS A 1 17  ? 45.866  79.840  -29.362 1.00 94.83  ? 14   LYS A N    1 
ATOM   162   C  CA   . LYS A 1 17  ? 45.121  80.577  -30.384 1.00 85.68  ? 14   LYS A CA   1 
ATOM   163   C  C    . LYS A 1 17  ? 45.057  79.794  -31.684 1.00 71.82  ? 14   LYS A C    1 
ATOM   164   O  O    . LYS A 1 17  ? 43.976  79.529  -32.212 1.00 65.17  ? 14   LYS A O    1 
ATOM   165   C  CB   . LYS A 1 17  ? 45.786  81.928  -30.649 1.00 88.07  ? 14   LYS A CB   1 
ATOM   166   C  CG   . LYS A 1 17  ? 45.688  82.920  -29.507 1.00 115.47 ? 14   LYS A CG   1 
ATOM   167   C  CD   . LYS A 1 17  ? 46.280  84.267  -29.896 1.00 125.04 ? 14   LYS A CD   1 
ATOM   168   C  CE   . LYS A 1 17  ? 46.288  85.251  -28.730 1.00 107.27 ? 14   LYS A CE   1 
ATOM   169   N  NZ   . LYS A 1 17  ? 46.977  86.518  -29.104 1.00 105.73 ? 14   LYS A NZ   1 
ATOM   170   H  H    . LYS A 1 17  ? 46.476  80.308  -28.976 1.00 113.79 ? 14   LYS A H    1 
ATOM   171   H  HA   . LYS A 1 17  ? 44.215  80.735  -30.074 1.00 102.81 ? 14   LYS A HA   1 
ATOM   172   H  HB2  . LYS A 1 17  ? 46.727  81.779  -30.828 1.00 105.68 ? 14   LYS A HB2  1 
ATOM   173   H  HB3  . LYS A 1 17  ? 45.366  82.332  -31.425 1.00 105.68 ? 14   LYS A HB3  1 
ATOM   174   H  HG2  . LYS A 1 17  ? 44.755  83.052  -29.276 1.00 138.56 ? 14   LYS A HG2  1 
ATOM   175   H  HG3  . LYS A 1 17  ? 46.179  82.579  -28.743 1.00 138.56 ? 14   LYS A HG3  1 
ATOM   176   H  HD2  . LYS A 1 17  ? 47.196  84.138  -30.188 1.00 150.05 ? 14   LYS A HD2  1 
ATOM   177   H  HD3  . LYS A 1 17  ? 45.752  84.651  -30.612 1.00 150.05 ? 14   LYS A HD3  1 
ATOM   178   H  HE2  . LYS A 1 17  ? 45.374  85.463  -28.482 1.00 128.73 ? 14   LYS A HE2  1 
ATOM   179   H  HE3  . LYS A 1 17  ? 46.759  84.857  -27.979 1.00 128.73 ? 14   LYS A HE3  1 
ATOM   180   H  HZ1  . LYS A 1 17  ? 46.561  86.900  -29.791 1.00 126.88 ? 14   LYS A HZ1  1 
ATOM   181   H  HZ2  . LYS A 1 17  ? 46.973  87.081  -28.414 1.00 126.88 ? 14   LYS A HZ2  1 
ATOM   182   H  HZ3  . LYS A 1 17  ? 47.820  86.349  -29.334 1.00 126.88 ? 14   LYS A HZ3  1 
ATOM   183   N  N    . LEU A 1 18  ? 46.226  79.377  -32.159 1.00 57.93  ? 15   LEU A N    1 
ATOM   184   C  CA   . LEU A 1 18  ? 46.323  78.643  -33.412 1.00 66.54  ? 15   LEU A CA   1 
ATOM   185   C  C    . LEU A 1 18  ? 45.674  77.263  -33.326 1.00 84.14  ? 15   LEU A C    1 
ATOM   186   O  O    . LEU A 1 18  ? 44.902  76.869  -34.214 1.00 85.29  ? 15   LEU A O    1 
ATOM   187   C  CB   . LEU A 1 18  ? 47.795  78.503  -33.820 1.00 61.52  ? 15   LEU A CB   1 
ATOM   188   C  CG   . LEU A 1 18  ? 48.086  77.987  -35.230 1.00 76.47  ? 15   LEU A CG   1 
ATOM   189   C  CD1  . LEU A 1 18  ? 47.452  78.893  -36.284 1.00 92.61  ? 15   LEU A CD1  1 
ATOM   190   C  CD2  . LEU A 1 18  ? 49.589  77.902  -35.453 1.00 75.92  ? 15   LEU A CD2  1 
ATOM   191   H  H    . LEU A 1 18  ? 46.982  79.508  -31.770 1.00 69.51  ? 15   LEU A H    1 
ATOM   192   H  HA   . LEU A 1 18  ? 45.867  79.144  -34.106 1.00 79.85  ? 15   LEU A HA   1 
ATOM   193   H  HB2  . LEU A 1 18  ? 48.212  79.376  -33.745 1.00 73.82  ? 15   LEU A HB2  1 
ATOM   194   H  HB3  . LEU A 1 18  ? 48.222  77.892  -33.200 1.00 73.82  ? 15   LEU A HB3  1 
ATOM   195   H  HG   . LEU A 1 18  ? 47.712  77.097  -35.330 1.00 91.77  ? 15   LEU A HG   1 
ATOM   196   H  HD11 . LEU A 1 18  ? 47.818  79.787  -36.193 1.00 111.14 ? 15   LEU A HD11 1 
ATOM   197   H  HD12 . LEU A 1 18  ? 47.653  78.541  -37.166 1.00 111.14 ? 15   LEU A HD12 1 
ATOM   198   H  HD13 . LEU A 1 18  ? 46.492  78.913  -36.147 1.00 111.14 ? 15   LEU A HD13 1 
ATOM   199   H  HD21 . LEU A 1 18  ? 49.970  77.293  -34.801 1.00 91.11  ? 15   LEU A HD21 1 
ATOM   200   H  HD22 . LEU A 1 18  ? 49.757  77.574  -36.350 1.00 91.11  ? 15   LEU A HD22 1 
ATOM   201   H  HD23 . LEU A 1 18  ? 49.974  78.785  -35.346 1.00 91.11  ? 15   LEU A HD23 1 
ATOM   202   N  N    . TYR A 1 19  ? 45.985  76.541  -32.250 1.00 82.03  ? 16   TYR A N    1 
ATOM   203   C  CA   . TYR A 1 19  ? 45.481  75.186  -32.061 1.00 77.64  ? 16   TYR A CA   1 
ATOM   204   C  C    . TYR A 1 19  ? 43.956  75.170  -32.041 1.00 73.48  ? 16   TYR A C    1 
ATOM   205   O  O    . TYR A 1 19  ? 43.321  74.351  -32.707 1.00 72.33  ? 16   TYR A O    1 
ATOM   206   C  CB   . TYR A 1 19  ? 46.032  74.594  -30.763 1.00 82.27  ? 16   TYR A CB   1 
ATOM   207   C  CG   . TYR A 1 19  ? 45.464  73.229  -30.413 1.00 80.05  ? 16   TYR A CG   1 
ATOM   208   C  CD1  . TYR A 1 19  ? 45.881  72.084  -31.092 1.00 70.21  ? 16   TYR A CD1  1 
ATOM   209   C  CD2  . TYR A 1 19  ? 44.509  73.086  -29.406 1.00 64.14  ? 16   TYR A CD2  1 
ATOM   210   C  CE1  . TYR A 1 19  ? 45.367  70.835  -30.777 1.00 61.54  ? 16   TYR A CE1  1 
ATOM   211   C  CE2  . TYR A 1 19  ? 43.986  71.845  -29.087 1.00 62.64  ? 16   TYR A CE2  1 
ATOM   212   C  CZ   . TYR A 1 19  ? 44.419  70.721  -29.771 1.00 71.23  ? 16   TYR A CZ   1 
ATOM   213   O  OH   . TYR A 1 19  ? 43.901  69.486  -29.442 1.00 68.24  ? 16   TYR A OH   1 
ATOM   214   H  H    . TYR A 1 19  ? 46.490  76.817  -31.611 1.00 98.44  ? 16   TYR A H    1 
ATOM   215   H  HA   . TYR A 1 19  ? 45.780  74.629  -32.797 1.00 93.17  ? 16   TYR A HA   1 
ATOM   216   H  HB2  . TYR A 1 19  ? 46.994  74.501  -30.846 1.00 98.72  ? 16   TYR A HB2  1 
ATOM   217   H  HB3  . TYR A 1 19  ? 45.823  75.197  -30.032 1.00 98.72  ? 16   TYR A HB3  1 
ATOM   218   H  HD1  . TYR A 1 19  ? 46.518  72.159  -31.765 1.00 84.25  ? 16   TYR A HD1  1 
ATOM   219   H  HD2  . TYR A 1 19  ? 44.216  73.838  -28.943 1.00 76.96  ? 16   TYR A HD2  1 
ATOM   220   H  HE1  . TYR A 1 19  ? 45.657  70.080  -31.236 1.00 73.85  ? 16   TYR A HE1  1 
ATOM   221   H  HE2  . TYR A 1 19  ? 43.352  71.765  -28.411 1.00 75.17  ? 16   TYR A HE2  1 
ATOM   222   H  HH   . TYR A 1 19  ? 43.341  69.565  -28.821 1.00 81.89  ? 16   TYR A HH   1 
ATOM   223   N  N    . TYR A 1 20  ? 43.380  76.068  -31.250 1.00 70.00  ? 17   TYR A N    1 
ATOM   224   C  CA   . TYR A 1 20  ? 41.934  76.147  -31.097 1.00 76.93  ? 17   TYR A CA   1 
ATOM   225   C  C    . TYR A 1 20  ? 41.254  76.651  -32.360 1.00 86.56  ? 17   TYR A C    1 
ATOM   226   O  O    . TYR A 1 20  ? 40.043  76.509  -32.521 1.00 80.73  ? 17   TYR A O    1 
ATOM   227   C  CB   . TYR A 1 20  ? 41.575  77.063  -29.924 1.00 71.01  ? 17   TYR A CB   1 
ATOM   228   C  CG   . TYR A 1 20  ? 41.768  76.445  -28.555 1.00 87.30  ? 17   TYR A CG   1 
ATOM   229   C  CD1  . TYR A 1 20  ? 41.398  75.129  -28.297 1.00 79.36  ? 17   TYR A CD1  1 
ATOM   230   C  CD2  . TYR A 1 20  ? 42.317  77.182  -27.515 1.00 89.76  ? 17   TYR A CD2  1 
ATOM   231   C  CE1  . TYR A 1 20  ? 41.572  74.571  -27.050 1.00 74.29  ? 17   TYR A CE1  1 
ATOM   232   C  CE2  . TYR A 1 20  ? 42.493  76.629  -26.263 1.00 84.56  ? 17   TYR A CE2  1 
ATOM   233   C  CZ   . TYR A 1 20  ? 42.117  75.322  -26.037 1.00 74.99  ? 17   TYR A CZ   1 
ATOM   234   O  OH   . TYR A 1 20  ? 42.290  74.761  -24.794 1.00 82.56  ? 17   TYR A OH   1 
ATOM   235   H  H    . TYR A 1 20  ? 43.811  76.650  -30.786 1.00 84.00  ? 17   TYR A H    1 
ATOM   236   H  HA   . TYR A 1 20  ? 41.589  75.261  -30.903 1.00 92.32  ? 17   TYR A HA   1 
ATOM   237   H  HB2  . TYR A 1 20  ? 42.132  77.856  -29.970 1.00 85.22  ? 17   TYR A HB2  1 
ATOM   238   H  HB3  . TYR A 1 20  ? 40.642  77.316  -30.004 1.00 85.22  ? 17   TYR A HB3  1 
ATOM   239   H  HD1  . TYR A 1 20  ? 41.027  74.616  -28.979 1.00 95.24  ? 17   TYR A HD1  1 
ATOM   240   H  HD2  . TYR A 1 20  ? 42.570  78.064  -27.665 1.00 107.72 ? 17   TYR A HD2  1 
ATOM   241   H  HE1  . TYR A 1 20  ? 41.320  73.690  -26.893 1.00 89.15  ? 17   TYR A HE1  1 
ATOM   242   H  HE2  . TYR A 1 20  ? 42.863  77.135  -25.576 1.00 101.47 ? 17   TYR A HE2  1 
ATOM   243   H  HH   . TYR A 1 20  ? 42.630  75.323  -24.270 1.00 99.07  ? 17   TYR A HH   1 
ATOM   244   N  N    . ARG A 1 21  ? 42.033  77.236  -33.262 1.00 89.50  ? 18   ARG A N    1 
ATOM   245   C  CA   . ARG A 1 21  ? 41.464  77.782  -34.485 1.00 95.40  ? 18   ARG A CA   1 
ATOM   246   C  C    . ARG A 1 21  ? 41.573  76.831  -35.664 1.00 95.81  ? 18   ARG A C    1 
ATOM   247   O  O    . ARG A 1 21  ? 40.633  76.721  -36.450 1.00 100.49 ? 18   ARG A O    1 
ATOM   248   C  CB   . ARG A 1 21  ? 42.143  79.110  -34.834 1.00 89.70  ? 18   ARG A CB   1 
ATOM   249   C  CG   . ARG A 1 21  ? 41.631  79.762  -36.123 1.00 107.16 ? 18   ARG A CG   1 
ATOM   250   C  CD   . ARG A 1 21  ? 40.176  80.224  -36.007 1.00 123.14 ? 18   ARG A CD   1 
ATOM   251   N  NE   . ARG A 1 21  ? 39.571  80.477  -37.316 1.00 126.33 ? 18   ARG A NE   1 
ATOM   252   C  CZ   . ARG A 1 21  ? 38.267  80.648  -37.526 1.00 121.31 ? 18   ARG A CZ   1 
ATOM   253   N  NH1  . ARG A 1 21  ? 37.409  80.591  -36.516 1.00 110.40 ? 18   ARG A NH1  1 
ATOM   254   N  NH2  . ARG A 1 21  ? 37.817  80.870  -38.754 1.00 129.19 ? 18   ARG A NH2  1 
ATOM   255   H  H    . ARG A 1 21  ? 42.885  77.328  -33.191 1.00 107.40 ? 18   ARG A H    1 
ATOM   256   H  HA   . ARG A 1 21  ? 40.522  77.961  -34.336 1.00 114.48 ? 18   ARG A HA   1 
ATOM   257   H  HB2  . ARG A 1 21  ? 41.993  79.736  -34.108 1.00 107.64 ? 18   ARG A HB2  1 
ATOM   258   H  HB3  . ARG A 1 21  ? 43.094  78.954  -34.940 1.00 107.64 ? 18   ARG A HB3  1 
ATOM   259   H  HG2  . ARG A 1 21  ? 42.178  80.538  -36.325 1.00 128.59 ? 18   ARG A HG2  1 
ATOM   260   H  HG3  . ARG A 1 21  ? 41.686  79.119  -36.847 1.00 128.59 ? 18   ARG A HG3  1 
ATOM   261   H  HD2  . ARG A 1 21  ? 39.658  79.535  -35.563 1.00 147.76 ? 18   ARG A HD2  1 
ATOM   262   H  HD3  . ARG A 1 21  ? 40.144  81.048  -35.495 1.00 147.76 ? 18   ARG A HD3  1 
ATOM   263   H  HE   . ARG A 1 21  ? 40.094  80.517  -37.998 1.00 151.60 ? 18   ARG A HE   1 
ATOM   264   H  HH11 . ARG A 1 21  ? 37.694  80.446  -35.717 1.00 132.49 ? 18   ARG A HH11 1 
ATOM   265   H  HH12 . ARG A 1 21  ? 36.569  80.701  -36.659 1.00 132.49 ? 18   ARG A HH12 1 
ATOM   266   H  HH21 . ARG A 1 21  ? 38.368  80.908  -39.414 1.00 155.03 ? 18   ARG A HH21 1 
ATOM   267   H  HH22 . ARG A 1 21  ? 36.975  80.980  -38.890 1.00 155.03 ? 18   ARG A HH22 1 
ATOM   268   N  N    . ARG A 1 22  ? 42.703  76.137  -35.784 1.00 88.63  ? 19   ARG A N    1 
ATOM   269   C  CA   . ARG A 1 22  ? 42.960  75.357  -36.990 1.00 74.03  ? 19   ARG A CA   1 
ATOM   270   C  C    . ARG A 1 22  ? 43.352  73.892  -36.779 1.00 82.42  ? 19   ARG A C    1 
ATOM   271   O  O    . ARG A 1 22  ? 43.714  73.214  -37.742 1.00 90.63  ? 19   ARG A O    1 
ATOM   272   C  CB   . ARG A 1 22  ? 44.056  76.073  -37.780 1.00 89.33  ? 19   ARG A CB   1 
ATOM   273   C  CG   . ARG A 1 22  ? 43.587  77.410  -38.355 1.00 97.03  ? 19   ARG A CG   1 
ATOM   274   C  CD   . ARG A 1 22  ? 44.653  78.082  -39.199 1.00 101.49 ? 19   ARG A CD   1 
ATOM   275   N  NE   . ARG A 1 22  ? 44.959  77.331  -40.413 1.00 87.95  ? 19   ARG A NE   1 
ATOM   276   C  CZ   . ARG A 1 22  ? 46.095  77.444  -41.095 1.00 100.61 ? 19   ARG A CZ   1 
ATOM   277   N  NH1  . ARG A 1 22  ? 47.044  78.279  -40.684 1.00 95.06  ? 19   ARG A NH1  1 
ATOM   278   N  NH2  . ARG A 1 22  ? 46.289  76.715  -42.187 1.00 110.78 ? 19   ARG A NH2  1 
ATOM   279   H  H    . ARG A 1 22  ? 43.326  76.102  -35.193 1.00 106.35 ? 19   ARG A H    1 
ATOM   280   H  HA   . ARG A 1 22  ? 42.158  75.364  -37.534 1.00 88.84  ? 19   ARG A HA   1 
ATOM   281   H  HB2  . ARG A 1 22  ? 44.808  76.246  -37.192 1.00 107.20 ? 19   ARG A HB2  1 
ATOM   282   H  HB3  . ARG A 1 22  ? 44.333  75.509  -38.519 1.00 107.20 ? 19   ARG A HB3  1 
ATOM   283   H  HG2  . ARG A 1 22  ? 42.810  77.259  -38.915 1.00 116.43 ? 19   ARG A HG2  1 
ATOM   284   H  HG3  . ARG A 1 22  ? 43.360  78.007  -37.624 1.00 116.43 ? 19   ARG A HG3  1 
ATOM   285   H  HD2  . ARG A 1 22  ? 44.342  78.963  -39.460 1.00 121.79 ? 19   ARG A HD2  1 
ATOM   286   H  HD3  . ARG A 1 22  ? 45.468  78.158  -38.678 1.00 121.79 ? 19   ARG A HD3  1 
ATOM   287   H  HE   . ARG A 1 22  ? 44.354  76.803  -40.723 1.00 105.54 ? 19   ARG A HE   1 
ATOM   288   H  HH11 . ARG A 1 22  ? 46.924  78.752  -39.976 1.00 114.07 ? 19   ARG A HH11 1 
ATOM   289   H  HH12 . ARG A 1 22  ? 47.777  78.349  -41.128 1.00 114.07 ? 19   ARG A HH12 1 
ATOM   290   H  HH21 . ARG A 1 22  ? 45.678  76.174  -42.456 1.00 132.94 ? 19   ARG A HH21 1 
ATOM   291   H  HH22 . ARG A 1 22  ? 47.023  76.789  -42.628 1.00 132.94 ? 19   ARG A HH22 1 
ATOM   292   N  N    . LEU A 1 23  ? 43.294  73.403  -35.540 1.00 96.12  ? 20   LEU A N    1 
ATOM   293   C  CA   . LEU A 1 23  ? 43.711  72.024  -35.248 1.00 76.34  ? 20   LEU A CA   1 
ATOM   294   C  C    . LEU A 1 23  ? 42.733  71.227  -34.381 1.00 73.92  ? 20   LEU A C    1 
ATOM   295   O  O    . LEU A 1 23  ? 42.501  70.045  -34.632 1.00 76.88  ? 20   LEU A O    1 
ATOM   296   C  CB   . LEU A 1 23  ? 45.087  72.037  -34.608 1.00 65.83  ? 20   LEU A CB   1 
ATOM   297   C  CG   . LEU A 1 23  ? 46.222  72.237  -35.613 1.00 76.10  ? 20   LEU A CG   1 
ATOM   298   C  CD1  . LEU A 1 23  ? 47.562  72.373  -34.895 1.00 84.26  ? 20   LEU A CD1  1 
ATOM   299   C  CD2  . LEU A 1 23  ? 46.296  71.096  -36.630 1.00 85.78  ? 20   LEU A CD2  1 
ATOM   300   H  H    . LEU A 1 23  ? 43.020  73.843  -34.853 1.00 115.35 ? 20   LEU A H    1 
ATOM   301   H  HA   . LEU A 1 23  ? 43.793  71.551  -36.091 1.00 91.61  ? 20   LEU A HA   1 
ATOM   302   H  HB2  . LEU A 1 23  ? 45.128  72.762  -33.965 1.00 78.99  ? 20   LEU A HB2  1 
ATOM   303   H  HB3  . LEU A 1 23  ? 45.233  71.190  -34.159 1.00 78.99  ? 20   LEU A HB3  1 
ATOM   304   H  HG   . LEU A 1 23  ? 46.064  73.060  -36.103 1.00 91.32  ? 20   LEU A HG   1 
ATOM   305   H  HD11 . LEU A 1 23  ? 47.729  71.565  -34.384 1.00 101.12 ? 20   LEU A HD11 1 
ATOM   306   H  HD12 . LEU A 1 23  ? 48.262  72.498  -35.554 1.00 101.12 ? 20   LEU A HD12 1 
ATOM   307   H  HD13 . LEU A 1 23  ? 47.525  73.139  -34.301 1.00 101.12 ? 20   LEU A HD13 1 
ATOM   308   H  HD21 . LEU A 1 23  ? 45.458  71.053  -37.117 1.00 102.93 ? 20   LEU A HD21 1 
ATOM   309   H  HD22 . LEU A 1 23  ? 47.027  71.267  -37.243 1.00 102.93 ? 20   LEU A HD22 1 
ATOM   310   H  HD23 . LEU A 1 23  ? 46.448  70.263  -36.158 1.00 102.93 ? 20   LEU A HD23 1 
ATOM   311   N  N    . PHE A 1 24  ? 42.189  71.855  -33.345 1.00 68.23  ? 21   PHE A N    1 
ATOM   312   C  CA   . PHE A 1 24  ? 41.205  71.183  -32.503 1.00 61.87  ? 21   PHE A CA   1 
ATOM   313   C  C    . PHE A 1 24  ? 40.030  70.615  -33.324 1.00 68.32  ? 21   PHE A C    1 
ATOM   314   O  O    . PHE A 1 24  ? 39.282  71.373  -33.938 1.00 67.08  ? 21   PHE A O    1 
ATOM   315   C  CB   . PHE A 1 24  ? 40.660  72.142  -31.456 1.00 58.35  ? 21   PHE A CB   1 
ATOM   316   C  CG   . PHE A 1 24  ? 39.780  71.472  -30.441 1.00 71.94  ? 21   PHE A CG   1 
ATOM   317   C  CD1  . PHE A 1 24  ? 38.436  71.265  -30.703 1.00 64.64  ? 21   PHE A CD1  1 
ATOM   318   C  CD2  . PHE A 1 24  ? 40.294  71.044  -29.225 1.00 71.42  ? 21   PHE A CD2  1 
ATOM   319   C  CE1  . PHE A 1 24  ? 37.613  70.638  -29.775 1.00 76.74  ? 21   PHE A CE1  1 
ATOM   320   C  CE2  . PHE A 1 24  ? 39.482  70.416  -28.290 1.00 59.76  ? 21   PHE A CE2  1 
ATOM   321   C  CZ   . PHE A 1 24  ? 38.134  70.211  -28.564 1.00 68.27  ? 21   PHE A CZ   1 
ATOM   322   H  H    . PHE A 1 24  ? 42.370  72.662  -33.109 1.00 81.88  ? 21   PHE A H    1 
ATOM   323   H  HA   . PHE A 1 24  ? 41.634  70.445  -32.042 1.00 74.25  ? 21   PHE A HA   1 
ATOM   324   H  HB2  . PHE A 1 24  ? 41.404  72.548  -30.984 1.00 70.02  ? 21   PHE A HB2  1 
ATOM   325   H  HB3  . PHE A 1 24  ? 40.136  72.827  -31.899 1.00 70.02  ? 21   PHE A HB3  1 
ATOM   326   H  HD1  . PHE A 1 24  ? 38.080  71.545  -31.515 1.00 77.57  ? 21   PHE A HD1  1 
ATOM   327   H  HD2  . PHE A 1 24  ? 41.195  71.174  -29.037 1.00 85.70  ? 21   PHE A HD2  1 
ATOM   328   H  HE1  . PHE A 1 24  ? 36.712  70.506  -29.966 1.00 92.09  ? 21   PHE A HE1  1 
ATOM   329   H  HE2  . PHE A 1 24  ? 39.840  70.134  -27.479 1.00 71.71  ? 21   PHE A HE2  1 
ATOM   330   H  HZ   . PHE A 1 24  ? 37.586  69.795  -27.938 1.00 81.93  ? 21   PHE A HZ   1 
ATOM   331   N  N    . PRO A 1 25  ? 39.837  69.284  -33.305 1.00 70.83  ? 22   PRO A N    1 
ATOM   332   C  CA   . PRO A 1 25  ? 38.825  68.643  -34.157 1.00 51.26  ? 22   PRO A CA   1 
ATOM   333   C  C    . PRO A 1 25  ? 37.383  68.854  -33.659 1.00 63.78  ? 22   PRO A C    1 
ATOM   334   O  O    . PRO A 1 25  ? 36.750  67.896  -33.203 1.00 64.19  ? 22   PRO A O    1 
ATOM   335   C  CB   . PRO A 1 25  ? 39.220  67.160  -34.110 1.00 60.95  ? 22   PRO A CB   1 
ATOM   336   C  CG   . PRO A 1 25  ? 39.892  66.991  -32.784 1.00 71.05  ? 22   PRO A CG   1 
ATOM   337   C  CD   . PRO A 1 25  ? 40.558  68.307  -32.471 1.00 76.08  ? 22   PRO A CD   1 
ATOM   338   H  HA   . PRO A 1 25  ? 38.899  68.966  -35.068 1.00 61.51  ? 22   PRO A HA   1 
ATOM   339   H  HB2  . PRO A 1 25  ? 38.426  66.606  -34.168 1.00 73.14  ? 22   PRO A HB2  1 
ATOM   340   H  HB3  . PRO A 1 25  ? 39.834  66.961  -34.835 1.00 73.14  ? 22   PRO A HB3  1 
ATOM   341   H  HG2  . PRO A 1 25  ? 39.227  66.779  -32.110 1.00 85.26  ? 22   PRO A HG2  1 
ATOM   342   H  HG3  . PRO A 1 25  ? 40.551  66.282  -32.843 1.00 85.26  ? 22   PRO A HG3  1 
ATOM   343   H  HD2  . PRO A 1 25  ? 40.451  68.523  -31.531 1.00 91.29  ? 22   PRO A HD2  1 
ATOM   344   H  HD3  . PRO A 1 25  ? 41.495  68.277  -32.722 1.00 91.29  ? 22   PRO A HD3  1 
ATOM   345   N  N    . TYR A 1 26  ? 36.882  70.089  -33.766 1.00 56.03  ? 23   TYR A N    1 
ATOM   346   C  CA   . TYR A 1 26  ? 35.516  70.429  -33.342 1.00 67.44  ? 23   TYR A CA   1 
ATOM   347   C  C    . TYR A 1 26  ? 34.432  69.516  -33.943 1.00 67.88  ? 23   TYR A C    1 
ATOM   348   O  O    . TYR A 1 26  ? 33.392  69.260  -33.312 1.00 60.77  ? 23   TYR A O    1 
ATOM   349   C  CB   . TYR A 1 26  ? 35.198  71.875  -33.714 1.00 62.18  ? 23   TYR A CB   1 
ATOM   350   C  CG   . TYR A 1 26  ? 36.020  72.906  -32.979 1.00 67.30  ? 23   TYR A CG   1 
ATOM   351   C  CD1  . TYR A 1 26  ? 35.640  73.360  -31.715 1.00 78.43  ? 23   TYR A CD1  1 
ATOM   352   C  CD2  . TYR A 1 26  ? 37.168  73.438  -33.549 1.00 60.79  ? 23   TYR A CD2  1 
ATOM   353   C  CE1  . TYR A 1 26  ? 36.386  74.315  -31.043 1.00 69.02  ? 23   TYR A CE1  1 
ATOM   354   C  CE2  . TYR A 1 26  ? 37.920  74.387  -32.885 1.00 76.88  ? 23   TYR A CE2  1 
ATOM   355   C  CZ   . TYR A 1 26  ? 37.525  74.823  -31.631 1.00 70.79  ? 23   TYR A CZ   1 
ATOM   356   O  OH   . TYR A 1 26  ? 38.267  75.768  -30.964 1.00 75.76  ? 23   TYR A OH   1 
ATOM   357   H  H    . TYR A 1 26  ? 37.319  70.758  -34.085 1.00 67.24  ? 23   TYR A H    1 
ATOM   358   H  HA   . TYR A 1 26  ? 35.463  70.353  -32.377 1.00 80.93  ? 23   TYR A HA   1 
ATOM   359   H  HB2  . TYR A 1 26  ? 35.358  71.993  -34.663 1.00 74.61  ? 23   TYR A HB2  1 
ATOM   360   H  HB3  . TYR A 1 26  ? 34.264  72.047  -33.516 1.00 74.61  ? 23   TYR A HB3  1 
ATOM   361   H  HD1  . TYR A 1 26  ? 34.871  73.019  -31.319 1.00 94.12  ? 23   TYR A HD1  1 
ATOM   362   H  HD2  . TYR A 1 26  ? 37.436  73.149  -34.391 1.00 72.95  ? 23   TYR A HD2  1 
ATOM   363   H  HE1  . TYR A 1 26  ? 36.123  74.608  -30.200 1.00 82.83  ? 23   TYR A HE1  1 
ATOM   364   H  HE2  . TYR A 1 26  ? 38.688  74.733  -33.279 1.00 92.26  ? 23   TYR A HE2  1 
ATOM   365   H  HH   . TYR A 1 26  ? 38.930  75.992  -31.428 1.00 90.91  ? 23   TYR A HH   1 
ATOM   366   N  N    . SER A 1 27  ? 34.655  69.053  -35.169 1.00 66.96  ? 24   SER A N    1 
ATOM   367   C  CA   . SER A 1 27  ? 33.649  68.243  -35.854 1.00 87.02  ? 24   SER A CA   1 
ATOM   368   C  C    . SER A 1 27  ? 33.429  66.929  -35.107 1.00 73.95  ? 24   SER A C    1 
ATOM   369   O  O    . SER A 1 27  ? 32.308  66.605  -34.699 1.00 68.50  ? 24   SER A O    1 
ATOM   370   C  CB   . SER A 1 27  ? 34.056  67.972  -37.302 1.00 82.21  ? 24   SER A CB   1 
ATOM   371   O  OG   . SER A 1 27  ? 34.149  69.185  -38.024 1.00 97.05  ? 24   SER A OG   1 
ATOM   372   H  H    . SER A 1 27  ? 35.373  69.190  -35.623 1.00 80.35  ? 24   SER A H    1 
ATOM   373   H  HA   . SER A 1 27  ? 32.809  68.726  -35.865 1.00 104.42 ? 24   SER A HA   1 
ATOM   374   H  HB2  . SER A 1 27  ? 34.920  67.530  -37.312 1.00 98.65  ? 24   SER A HB2  1 
ATOM   375   H  HB3  . SER A 1 27  ? 33.388  67.406  -37.719 1.00 98.65  ? 24   SER A HB3  1 
ATOM   376   H  HG   . SER A 1 27  ? 34.373  69.030  -38.819 1.00 116.47 ? 24   SER A HG   1 
ATOM   377   N  N    . GLN A 1 28  ? 34.517  66.198  -34.898 1.00 71.61  ? 25   GLN A N    1 
ATOM   378   C  CA   . GLN A 1 28  ? 34.467  64.912  -34.215 1.00 75.68  ? 25   GLN A CA   1 
ATOM   379   C  C    . GLN A 1 28  ? 34.008  65.106  -32.770 1.00 70.32  ? 25   GLN A C    1 
ATOM   380   O  O    . GLN A 1 28  ? 33.285  64.270  -32.211 1.00 74.33  ? 25   GLN A O    1 
ATOM   381   C  CB   . GLN A 1 28  ? 35.842  64.256  -34.272 1.00 63.25  ? 25   GLN A CB   1 
ATOM   382   C  CG   . GLN A 1 28  ? 36.311  63.936  -35.694 1.00 69.88  ? 25   GLN A CG   1 
ATOM   383   C  CD   . GLN A 1 28  ? 36.966  65.122  -36.405 1.00 80.45  ? 25   GLN A CD   1 
ATOM   384   O  OE1  . GLN A 1 28  ? 36.809  66.280  -36.003 1.00 81.78  ? 25   GLN A OE1  1 
ATOM   385   N  NE2  . GLN A 1 28  ? 37.732  64.829  -37.451 1.00 80.81  ? 25   GLN A NE2  1 
ATOM   386   H  H    . GLN A 1 28  ? 35.307  66.428  -35.146 1.00 85.94  ? 25   GLN A H    1 
ATOM   387   H  HA   . GLN A 1 28  ? 33.831  64.332  -34.663 1.00 90.82  ? 25   GLN A HA   1 
ATOM   388   H  HB2  . GLN A 1 28  ? 36.492  64.857  -33.874 1.00 75.90  ? 25   GLN A HB2  1 
ATOM   389   H  HB3  . GLN A 1 28  ? 35.814  63.425  -33.774 1.00 75.90  ? 25   GLN A HB3  1 
ATOM   390   H  HG2  . GLN A 1 28  ? 36.960  63.216  -35.656 1.00 83.85  ? 25   GLN A HG2  1 
ATOM   391   H  HG3  . GLN A 1 28  ? 35.544  63.660  -36.221 1.00 83.85  ? 25   GLN A HG3  1 
ATOM   392   H  HE21 . GLN A 1 28  ? 37.835  64.009  -37.692 1.00 96.98  ? 25   GLN A HE21 1 
ATOM   393   H  HE22 . GLN A 1 28  ? 38.124  65.458  -37.887 1.00 96.98  ? 25   GLN A HE22 1 
ATOM   394   N  N    . TYR A 1 29  ? 34.396  66.245  -32.201 1.00 54.65  ? 26   TYR A N    1 
ATOM   395   C  CA   . TYR A 1 29  ? 34.022  66.618  -30.843 1.00 61.28  ? 26   TYR A CA   1 
ATOM   396   C  C    . TYR A 1 29  ? 32.501  66.722  -30.720 1.00 69.69  ? 26   TYR A C    1 
ATOM   397   O  O    . TYR A 1 29  ? 31.874  66.087  -29.841 1.00 65.62  ? 26   TYR A O    1 
ATOM   398   C  CB   . TYR A 1 29  ? 34.690  67.946  -30.474 1.00 60.74  ? 26   TYR A CB   1 
ATOM   399   C  CG   . TYR A 1 29  ? 34.857  68.198  -28.987 1.00 67.44  ? 26   TYR A CG   1 
ATOM   400   C  CD1  . TYR A 1 29  ? 35.825  67.540  -28.247 1.00 61.01  ? 26   TYR A CD1  1 
ATOM   401   C  CD2  . TYR A 1 29  ? 34.063  69.128  -28.334 1.00 72.86  ? 26   TYR A CD2  1 
ATOM   402   C  CE1  . TYR A 1 29  ? 35.976  67.779  -26.894 1.00 61.56  ? 26   TYR A CE1  1 
ATOM   403   C  CE2  . TYR A 1 29  ? 34.207  69.377  -26.987 1.00 68.07  ? 26   TYR A CE2  1 
ATOM   404   C  CZ   . TYR A 1 29  ? 35.163  68.703  -26.268 1.00 74.57  ? 26   TYR A CZ   1 
ATOM   405   O  OH   . TYR A 1 29  ? 35.292  68.972  -24.919 1.00 62.31  ? 26   TYR A OH   1 
ATOM   406   H  H    . TYR A 1 29  ? 34.889  66.832  -32.593 1.00 65.58  ? 26   TYR A H    1 
ATOM   407   H  HA   . TYR A 1 29  ? 34.332  65.937  -30.226 1.00 73.53  ? 26   TYR A HA   1 
ATOM   408   H  HB2  . TYR A 1 29  ? 35.573  67.968  -30.875 1.00 72.89  ? 26   TYR A HB2  1 
ATOM   409   H  HB3  . TYR A 1 29  ? 34.153  68.670  -30.833 1.00 72.89  ? 26   TYR A HB3  1 
ATOM   410   H  HD1  . TYR A 1 29  ? 36.371  66.914  -28.665 1.00 73.21  ? 26   TYR A HD1  1 
ATOM   411   H  HD2  . TYR A 1 29  ? 33.411  69.586  -28.814 1.00 87.44  ? 26   TYR A HD2  1 
ATOM   412   H  HE1  . TYR A 1 29  ? 36.626  67.324  -26.409 1.00 73.87  ? 26   TYR A HE1  1 
ATOM   413   H  HE2  . TYR A 1 29  ? 33.659  70.000  -26.567 1.00 81.69  ? 26   TYR A HE2  1 
ATOM   414   H  HH   . TYR A 1 29  ? 35.906  68.503  -24.590 1.00 74.77  ? 26   TYR A HH   1 
ATOM   415   N  N    . TYR A 1 30  ? 31.905  67.489  -31.633 1.00 73.87  ? 27   TYR A N    1 
ATOM   416   C  CA   . TYR A 1 30  ? 30.457  67.658  -31.633 1.00 64.80  ? 27   TYR A CA   1 
ATOM   417   C  C    . TYR A 1 30  ? 29.764  66.346  -32.003 1.00 63.94  ? 27   TYR A C    1 
ATOM   418   O  O    . TYR A 1 30  ? 28.734  66.000  -31.404 1.00 63.41  ? 27   TYR A O    1 
ATOM   419   C  CB   . TYR A 1 30  ? 30.046  68.778  -32.596 1.00 67.47  ? 27   TYR A CB   1 
ATOM   420   C  CG   . TYR A 1 30  ? 28.557  69.091  -32.571 1.00 79.74  ? 27   TYR A CG   1 
ATOM   421   C  CD1  . TYR A 1 30  ? 28.018  69.942  -31.610 1.00 73.59  ? 27   TYR A CD1  1 
ATOM   422   C  CD2  . TYR A 1 30  ? 27.688  68.529  -33.508 1.00 73.76  ? 27   TYR A CD2  1 
ATOM   423   C  CE1  . TYR A 1 30  ? 26.653  70.224  -31.578 1.00 79.96  ? 27   TYR A CE1  1 
ATOM   424   C  CE2  . TYR A 1 30  ? 26.321  68.802  -33.484 1.00 70.25  ? 27   TYR A CE2  1 
ATOM   425   C  CZ   . TYR A 1 30  ? 25.808  69.651  -32.522 1.00 87.97  ? 27   TYR A CZ   1 
ATOM   426   O  OH   . TYR A 1 30  ? 24.452  69.924  -32.503 1.00 90.03  ? 27   TYR A OH   1 
ATOM   427   H  H    . TYR A 1 30  ? 32.314  67.917  -32.257 1.00 88.64  ? 27   TYR A H    1 
ATOM   428   H  HA   . TYR A 1 30  ? 30.168  67.909  -30.741 1.00 77.76  ? 27   TYR A HA   1 
ATOM   429   H  HB2  . TYR A 1 30  ? 30.524  69.588  -32.357 1.00 80.96  ? 27   TYR A HB2  1 
ATOM   430   H  HB3  . TYR A 1 30  ? 30.278  68.514  -33.500 1.00 80.96  ? 27   TYR A HB3  1 
ATOM   431   H  HD1  . TYR A 1 30  ? 28.578  70.326  -30.975 1.00 88.30  ? 27   TYR A HD1  1 
ATOM   432   H  HD2  . TYR A 1 30  ? 28.027  67.955  -34.157 1.00 88.52  ? 27   TYR A HD2  1 
ATOM   433   H  HE1  . TYR A 1 30  ? 26.310  70.795  -30.929 1.00 95.95  ? 27   TYR A HE1  1 
ATOM   434   H  HE2  . TYR A 1 30  ? 25.757  68.420  -34.117 1.00 84.30  ? 27   TYR A HE2  1 
ATOM   435   H  HH   . TYR A 1 30  ? 24.068  69.512  -33.126 1.00 108.04 ? 27   TYR A HH   1 
ATOM   436   N  N    . ARG A 1 31  ? 30.350  65.592  -32.937 1.00 53.30  ? 28   ARG A N    1 
ATOM   437   C  CA   . ARG A 1 31  ? 29.827  64.266  -33.277 1.00 64.90  ? 28   ARG A CA   1 
ATOM   438   C  C    . ARG A 1 31  ? 29.708  63.414  -32.036 1.00 72.77  ? 28   ARG A C    1 
ATOM   439   O  O    . ARG A 1 31  ? 28.667  62.801  -31.777 1.00 70.97  ? 28   ARG A O    1 
ATOM   440   C  CB   . ARG A 1 31  ? 30.734  63.552  -34.283 1.00 76.56  ? 28   ARG A CB   1 
ATOM   441   C  CG   . ARG A 1 31  ? 30.585  63.982  -35.728 1.00 87.42  ? 28   ARG A CG   1 
ATOM   442   C  CD   . ARG A 1 31  ? 31.569  63.212  -36.598 1.00 80.44  ? 28   ARG A CD   1 
ATOM   443   N  NE   . ARG A 1 31  ? 31.273  61.776  -36.603 1.00 72.45  ? 28   ARG A NE   1 
ATOM   444   C  CZ   . ARG A 1 31  ? 32.067  60.845  -37.128 1.00 70.06  ? 28   ARG A CZ   1 
ATOM   445   N  NH1  . ARG A 1 31  ? 33.222  61.197  -37.689 1.00 55.89  ? 28   ARG A NH1  1 
ATOM   446   N  NH2  . ARG A 1 31  ? 31.706  59.563  -37.086 1.00 51.26  ? 28   ARG A NH2  1 
ATOM   447   H  H    . ARG A 1 31  ? 31.047  65.823  -33.385 1.00 63.95  ? 28   ARG A H    1 
ATOM   448   H  HA   . ARG A 1 31  ? 28.946  64.359  -33.672 1.00 77.88  ? 28   ARG A HA   1 
ATOM   449   H  HB2  . ARG A 1 31  ? 31.657  63.708  -34.027 1.00 91.87  ? 28   ARG A HB2  1 
ATOM   450   H  HB3  . ARG A 1 31  ? 30.545  62.601  -34.243 1.00 91.87  ? 28   ARG A HB3  1 
ATOM   451   H  HG2  . ARG A 1 31  ? 29.685  63.790  -36.035 1.00 104.90 ? 28   ARG A HG2  1 
ATOM   452   H  HG3  . ARG A 1 31  ? 30.778  64.930  -35.808 1.00 104.90 ? 28   ARG A HG3  1 
ATOM   453   H  HD2  . ARG A 1 31  ? 31.513  63.537  -37.510 1.00 96.53  ? 28   ARG A HD2  1 
ATOM   454   H  HD3  . ARG A 1 31  ? 32.467  63.336  -36.252 1.00 96.53  ? 28   ARG A HD3  1 
ATOM   455   H  HE   . ARG A 1 31  ? 30.537  61.517  -36.242 1.00 86.94  ? 28   ARG A HE   1 
ATOM   456   H  HH11 . ARG A 1 31  ? 33.453  62.025  -37.715 1.00 67.07  ? 28   ARG A HH11 1 
ATOM   457   H  HH12 . ARG A 1 31  ? 33.737  60.597  -38.027 1.00 67.07  ? 28   ARG A HH12 1 
ATOM   458   H  HH21 . ARG A 1 31  ? 30.960  59.337  -36.722 1.00 61.51  ? 28   ARG A HH21 1 
ATOM   459   H  HH22 . ARG A 1 31  ? 32.220  58.960  -37.422 1.00 61.51  ? 28   ARG A HH22 1 
ATOM   460   N  N    . TRP A 1 32  ? 30.771  63.437  -31.239 1.00 74.98  ? 29   TRP A N    1 
ATOM   461   C  CA   . TRP A 1 32  ? 30.794  62.713  -29.986 1.00 58.08  ? 29   TRP A CA   1 
ATOM   462   C  C    . TRP A 1 32  ? 29.703  63.219  -29.053 1.00 65.46  ? 29   TRP A C    1 
ATOM   463   O  O    . TRP A 1 32  ? 28.772  62.481  -28.708 1.00 62.67  ? 29   TRP A O    1 
ATOM   464   C  CB   . TRP A 1 32  ? 32.156  62.854  -29.308 1.00 68.13  ? 29   TRP A CB   1 
ATOM   465   C  CG   . TRP A 1 32  ? 32.235  62.151  -27.984 1.00 78.13  ? 29   TRP A CG   1 
ATOM   466   C  CD1  . TRP A 1 32  ? 31.518  61.056  -27.587 1.00 73.04  ? 29   TRP A CD1  1 
ATOM   467   C  CD2  . TRP A 1 32  ? 33.063  62.509  -26.878 1.00 64.01  ? 29   TRP A CD2  1 
ATOM   468   N  NE1  . TRP A 1 32  ? 31.849  60.714  -26.304 1.00 70.06  ? 29   TRP A NE1  1 
ATOM   469   C  CE2  . TRP A 1 32  ? 32.801  61.588  -25.846 1.00 81.29  ? 29   TRP A CE2  1 
ATOM   470   C  CE3  . TRP A 1 32  ? 34.007  63.515  -26.663 1.00 59.77  ? 29   TRP A CE3  1 
ATOM   471   C  CZ2  . TRP A 1 32  ? 33.453  61.645  -24.616 1.00 74.11  ? 29   TRP A CZ2  1 
ATOM   472   C  CZ3  . TRP A 1 32  ? 34.650  63.572  -25.450 1.00 68.91  ? 29   TRP A CZ3  1 
ATOM   473   C  CH2  . TRP A 1 32  ? 34.372  62.645  -24.439 1.00 77.10  ? 29   TRP A CH2  1 
ATOM   474   H  H    . TRP A 1 32  ? 31.495  63.869  -31.408 1.00 89.97  ? 29   TRP A H    1 
ATOM   475   H  HA   . TRP A 1 32  ? 30.635  61.771  -30.157 1.00 69.69  ? 29   TRP A HA   1 
ATOM   476   H  HB2  . TRP A 1 32  ? 32.837  62.477  -29.887 1.00 81.76  ? 29   TRP A HB2  1 
ATOM   477   H  HB3  . TRP A 1 32  ? 32.336  63.796  -29.157 1.00 81.76  ? 29   TRP A HB3  1 
ATOM   478   H  HD1  . TRP A 1 32  ? 30.887  60.615  -28.109 1.00 87.65  ? 29   TRP A HD1  1 
ATOM   479   H  HE1  . TRP A 1 32  ? 31.520  60.054  -25.861 1.00 84.07  ? 29   TRP A HE1  1 
ATOM   480   H  HE3  . TRP A 1 32  ? 34.198  64.135  -27.330 1.00 71.73  ? 29   TRP A HE3  1 
ATOM   481   H  HZ2  . TRP A 1 32  ? 33.271  61.030  -23.942 1.00 88.94  ? 29   TRP A HZ2  1 
ATOM   482   H  HZ3  . TRP A 1 32  ? 35.279  64.240  -25.297 1.00 82.69  ? 29   TRP A HZ3  1 
ATOM   483   H  HH2  . TRP A 1 32  ? 34.822  62.709  -23.628 1.00 92.51  ? 29   TRP A HH2  1 
ATOM   484   N  N    . LEU A 1 33  ? 29.814  64.474  -28.632 1.00 51.59  ? 30   LEU A N    1 
ATOM   485   C  CA   . LEU A 1 33  ? 28.964  64.933  -27.534 1.00 62.68  ? 30   LEU A CA   1 
ATOM   486   C  C    . LEU A 1 33  ? 27.505  65.166  -27.909 1.00 68.80  ? 30   LEU A C    1 
ATOM   487   O  O    . LEU A 1 33  ? 26.647  65.227  -27.025 1.00 62.87  ? 30   LEU A O    1 
ATOM   488   C  CB   . LEU A 1 33  ? 29.551  66.210  -26.929 1.00 70.88  ? 30   LEU A CB   1 
ATOM   489   C  CG   . LEU A 1 33  ? 30.968  66.066  -26.367 1.00 64.36  ? 30   LEU A CG   1 
ATOM   490   C  CD1  . LEU A 1 33  ? 31.455  67.393  -25.804 1.00 68.48  ? 30   LEU A CD1  1 
ATOM   491   C  CD2  . LEU A 1 33  ? 31.016  64.980  -25.284 1.00 56.44  ? 30   LEU A CD2  1 
ATOM   492   H  H    . LEU A 1 33  ? 30.353  65.063  -28.950 1.00 61.91  ? 30   LEU A H    1 
ATOM   493   H  HA   . LEU A 1 33  ? 28.976  64.255  -26.840 1.00 75.22  ? 30   LEU A HA   1 
ATOM   494   H  HB2  . LEU A 1 33  ? 29.578  66.893  -27.617 1.00 85.06  ? 30   LEU A HB2  1 
ATOM   495   H  HB3  . LEU A 1 33  ? 28.977  66.500  -26.204 1.00 85.06  ? 30   LEU A HB3  1 
ATOM   496   H  HG   . LEU A 1 33  ? 31.569  65.805  -27.082 1.00 77.24  ? 30   LEU A HG   1 
ATOM   497   H  HD11 . LEU A 1 33  ? 30.856  67.673  -25.094 1.00 82.18  ? 30   LEU A HD11 1 
ATOM   498   H  HD12 . LEU A 1 33  ? 32.352  67.278  -25.455 1.00 82.18  ? 30   LEU A HD12 1 
ATOM   499   H  HD13 . LEU A 1 33  ? 31.458  68.054  -26.514 1.00 82.18  ? 30   LEU A HD13 1 
ATOM   500   H  HD21 . LEU A 1 33  ? 30.743  64.135  -25.674 1.00 67.73  ? 30   LEU A HD21 1 
ATOM   501   H  HD22 . LEU A 1 33  ? 31.923  64.911  -24.947 1.00 67.73  ? 30   LEU A HD22 1 
ATOM   502   H  HD23 . LEU A 1 33  ? 30.413  65.225  -24.565 1.00 67.73  ? 30   LEU A HD23 1 
ATOM   503   N  N    . ASN A 1 34  ? 27.211  65.245  -29.206 1.00 78.63  ? 31   ASN A N    1 
ATOM   504   C  CA   . ASN A 1 34  ? 25.830  65.427  -29.651 1.00 68.17  ? 31   ASN A CA   1 
ATOM   505   C  C    . ASN A 1 34  ? 25.096  64.091  -29.808 1.00 69.73  ? 31   ASN A C    1 
ATOM   506   O  O    . ASN A 1 34  ? 23.863  64.044  -29.799 1.00 69.96  ? 31   ASN A O    1 
ATOM   507   C  CB   . ASN A 1 34  ? 25.803  66.209  -30.964 1.00 79.95  ? 31   ASN A CB   1 
ATOM   508   C  CG   . ASN A 1 34  ? 24.398  66.613  -31.374 1.00 87.30  ? 31   ASN A CG   1 
ATOM   509   O  OD1  . ASN A 1 34  ? 23.607  67.091  -30.551 1.00 81.24  ? 31   ASN A OD1  1 
ATOM   510   N  ND2  . ASN A 1 34  ? 24.073  66.408  -32.649 1.00 76.70  ? 31   ASN A ND2  1 
ATOM   511   H  H    . ASN A 1 34  ? 27.787  65.198  -29.843 1.00 94.35  ? 31   ASN A H    1 
ATOM   512   H  HA   . ASN A 1 34  ? 25.355  65.949  -28.986 1.00 81.81  ? 31   ASN A HA   1 
ATOM   513   H  HB2  . ASN A 1 34  ? 26.330  67.017  -30.862 1.00 95.94  ? 31   ASN A HB2  1 
ATOM   514   H  HB3  . ASN A 1 34  ? 26.175  65.656  -31.669 1.00 95.94  ? 31   ASN A HB3  1 
ATOM   515   H  HD21 . ASN A 1 34  ? 24.647  66.064  -33.189 1.00 92.04  ? 31   ASN A HD21 1 
ATOM   516   H  HD22 . ASN A 1 34  ? 23.289  66.620  -32.932 1.00 92.04  ? 31   ASN A HD22 1 
ATOM   517   N  N    . TYR A 1 35  ? 25.865  63.014  -29.960 1.00 75.33  ? 32   TYR A N    1 
ATOM   518   C  CA   . TYR A 1 35  ? 25.329  61.649  -30.008 1.00 79.27  ? 32   TYR A CA   1 
ATOM   519   C  C    . TYR A 1 35  ? 24.198  61.485  -31.023 1.00 76.36  ? 32   TYR A C    1 
ATOM   520   O  O    . TYR A 1 35  ? 23.118  60.995  -30.687 1.00 73.67  ? 32   TYR A O    1 
ATOM   521   C  CB   . TYR A 1 35  ? 24.838  61.220  -28.614 1.00 75.62  ? 32   TYR A CB   1 
ATOM   522   C  CG   . TYR A 1 35  ? 25.963  60.914  -27.648 1.00 70.60  ? 32   TYR A CG   1 
ATOM   523   C  CD1  . TYR A 1 35  ? 26.679  59.726  -27.737 1.00 77.45  ? 32   TYR A CD1  1 
ATOM   524   C  CD2  . TYR A 1 35  ? 26.301  61.807  -26.639 1.00 73.84  ? 32   TYR A CD2  1 
ATOM   525   C  CE1  . TYR A 1 35  ? 27.716  59.439  -26.855 1.00 73.09  ? 32   TYR A CE1  1 
ATOM   526   C  CE2  . TYR A 1 35  ? 27.328  61.532  -25.748 1.00 73.88  ? 32   TYR A CE2  1 
ATOM   527   C  CZ   . TYR A 1 35  ? 28.035  60.349  -25.857 1.00 79.96  ? 32   TYR A CZ   1 
ATOM   528   O  OH   . TYR A 1 35  ? 29.059  60.087  -24.970 1.00 65.22  ? 32   TYR A OH   1 
ATOM   529   H  H    . TYR A 1 35  ? 26.720  63.047  -30.040 1.00 90.40  ? 32   TYR A H    1 
ATOM   530   H  HA   . TYR A 1 35  ? 26.043  61.046  -30.266 1.00 95.13  ? 32   TYR A HA   1 
ATOM   531   H  HB2  . TYR A 1 35  ? 24.306  61.937  -28.234 1.00 90.75  ? 32   TYR A HB2  1 
ATOM   532   H  HB3  . TYR A 1 35  ? 24.297  60.420  -28.704 1.00 90.75  ? 32   TYR A HB3  1 
ATOM   533   H  HD1  . TYR A 1 35  ? 26.468  59.115  -28.406 1.00 92.94  ? 32   TYR A HD1  1 
ATOM   534   H  HD2  . TYR A 1 35  ? 25.831  62.605  -26.561 1.00 88.61  ? 32   TYR A HD2  1 
ATOM   535   H  HE1  . TYR A 1 35  ? 28.188  58.641  -26.929 1.00 87.71  ? 32   TYR A HE1  1 
ATOM   536   H  HE2  . TYR A 1 35  ? 27.543  62.144  -25.082 1.00 88.65  ? 32   TYR A HE2  1 
ATOM   537   H  HH   . TYR A 1 35  ? 29.138  60.722  -24.426 1.00 78.26  ? 32   TYR A HH   1 
ATOM   538   N  N    . GLY A 1 36  ? 24.460  61.912  -32.257 1.00 82.97  ? 33   GLY A N    1 
ATOM   539   C  CA   . GLY A 1 36  ? 23.548  61.716  -33.376 1.00 87.35  ? 33   GLY A CA   1 
ATOM   540   C  C    . GLY A 1 36  ? 22.183  62.376  -33.249 1.00 71.22  ? 33   GLY A C    1 
ATOM   541   O  O    . GLY A 1 36  ? 21.218  61.919  -33.850 1.00 77.24  ? 33   GLY A O    1 
ATOM   542   H  H    . GLY A 1 36  ? 25.181  62.329  -32.474 1.00 99.56  ? 33   GLY A H    1 
ATOM   543   H  HA2  . GLY A 1 36  ? 23.966  62.057  -34.182 1.00 104.82 ? 33   GLY A HA2  1 
ATOM   544   H  HA3  . GLY A 1 36  ? 23.404  60.764  -33.497 1.00 104.82 ? 33   GLY A HA3  1 
ATOM   545   N  N    . GLY A 1 37  ? 22.100  63.436  -32.450 1.00 68.40  ? 34   GLY A N    1 
ATOM   546   C  CA   . GLY A 1 37  ? 20.895  64.235  -32.322 1.00 57.58  ? 34   GLY A CA   1 
ATOM   547   C  C    . GLY A 1 37  ? 19.638  63.499  -31.877 1.00 66.31  ? 34   GLY A C    1 
ATOM   548   O  O    . GLY A 1 37  ? 18.591  64.130  -31.729 1.00 78.00  ? 34   GLY A O    1 
ATOM   549   H  H    . GLY A 1 37  ? 22.749  63.715  -31.960 1.00 82.08  ? 34   GLY A H    1 
ATOM   550   H  HA2  . GLY A 1 37  ? 21.062  64.945  -31.683 1.00 69.10  ? 34   GLY A HA2  1 
ATOM   551   H  HA3  . GLY A 1 37  ? 20.706  64.648  -33.179 1.00 69.10  ? 34   GLY A HA3  1 
ATOM   552   N  N    . VAL A 1 38  ? 19.734  62.190  -31.642 1.00 65.38  ? 35   VAL A N    1 
ATOM   553   C  CA   . VAL A 1 38  ? 18.569  61.382  -31.258 1.00 82.43  ? 35   VAL A CA   1 
ATOM   554   C  C    . VAL A 1 38  ? 17.775  61.996  -30.109 1.00 78.71  ? 35   VAL A C    1 
ATOM   555   O  O    . VAL A 1 38  ? 16.546  61.956  -30.104 1.00 96.62  ? 35   VAL A O    1 
ATOM   556   C  CB   . VAL A 1 38  ? 18.973  59.945  -30.848 1.00 84.74  ? 35   VAL A CB   1 
ATOM   557   C  CG1  . VAL A 1 38  ? 19.571  59.212  -32.041 1.00 84.12  ? 35   VAL A CG1  1 
ATOM   558   C  CG2  . VAL A 1 38  ? 19.953  59.958  -29.658 1.00 90.16  ? 35   VAL A CG2  1 
ATOM   559   H  H    . VAL A 1 38  ? 20.465  61.741  -31.698 1.00 78.46  ? 35   VAL A H    1 
ATOM   560   H  HA   . VAL A 1 38  ? 17.975  61.314  -32.022 1.00 98.92  ? 35   VAL A HA   1 
ATOM   561   H  HB   . VAL A 1 38  ? 18.177  59.463  -30.572 1.00 101.69 ? 35   VAL A HB   1 
ATOM   562   H  HG11 . VAL A 1 38  ? 20.356  59.694  -32.346 1.00 100.94 ? 35   VAL A HG11 1 
ATOM   563   H  HG12 . VAL A 1 38  ? 19.818  58.315  -31.769 1.00 100.94 ? 35   VAL A HG12 1 
ATOM   564   H  HG13 . VAL A 1 38  ? 18.910  59.173  -32.750 1.00 100.94 ? 35   VAL A HG13 1 
ATOM   565   H  HG21 . VAL A 1 38  ? 19.527  60.391  -28.903 1.00 108.20 ? 35   VAL A HG21 1 
ATOM   566   H  HG22 . VAL A 1 38  ? 20.184  59.044  -29.430 1.00 108.20 ? 35   VAL A HG22 1 
ATOM   567   H  HG23 . VAL A 1 38  ? 20.751  60.447  -29.913 1.00 108.20 ? 35   VAL A HG23 1 
ATOM   568   N  N    . ILE A 1 39  ? 18.484  62.564  -29.141 1.00 81.40  ? 36   ILE A N    1 
ATOM   569   C  CA   . ILE A 1 39  ? 17.839  63.198  -28.003 1.00 86.63  ? 36   ILE A CA   1 
ATOM   570   C  C    . ILE A 1 39  ? 18.185  64.674  -28.009 1.00 84.02  ? 36   ILE A C    1 
ATOM   571   O  O    . ILE A 1 39  ? 19.348  65.070  -28.141 1.00 81.32  ? 36   ILE A O    1 
ATOM   572   C  CB   . ILE A 1 39  ? 18.236  62.524  -26.665 1.00 77.70  ? 36   ILE A CB   1 
ATOM   573   C  CG1  . ILE A 1 39  ? 17.361  61.275  -26.464 1.00 57.54  ? 36   ILE A CG1  1 
ATOM   574   C  CG2  . ILE A 1 39  ? 18.057  63.493  -25.492 1.00 80.64  ? 36   ILE A CG2  1 
ATOM   575   C  CD1  . ILE A 1 39  ? 17.505  60.578  -25.138 1.00 100.98 ? 36   ILE A CD1  1 
ATOM   576   H  H    . ILE A 1 39  ? 19.343  62.596  -29.122 1.00 97.68  ? 36   ILE A H    1 
ATOM   577   H  HA   . ILE A 1 39  ? 16.878  63.117  -28.103 1.00 103.96 ? 36   ILE A HA   1 
ATOM   578   H  HB   . ILE A 1 39  ? 19.166  62.253  -26.712 1.00 93.24  ? 36   ILE A HB   1 
ATOM   579   H  HG12 . ILE A 1 39  ? 16.431  61.535  -26.554 1.00 69.05  ? 36   ILE A HG12 1 
ATOM   580   H  HG13 . ILE A 1 39  ? 17.584  60.631  -27.154 1.00 69.05  ? 36   ILE A HG13 1 
ATOM   581   H  HG21 . ILE A 1 39  ? 17.126  63.763  -25.446 1.00 96.77  ? 36   ILE A HG21 1 
ATOM   582   H  HG22 . ILE A 1 39  ? 18.312  63.044  -24.670 1.00 96.77  ? 36   ILE A HG22 1 
ATOM   583   H  HG23 . ILE A 1 39  ? 18.621  64.269  -25.634 1.00 96.77  ? 36   ILE A HG23 1 
ATOM   584   H  HD11 . ILE A 1 39  ? 17.268  61.196  -24.430 1.00 121.17 ? 36   ILE A HD11 1 
ATOM   585   H  HD12 . ILE A 1 39  ? 16.912  59.810  -25.120 1.00 121.17 ? 36   ILE A HD12 1 
ATOM   586   H  HD13 . ILE A 1 39  ? 18.425  60.289  -25.032 1.00 121.17 ? 36   ILE A HD13 1 
ATOM   587   N  N    . LYS A 1 40  ? 17.133  65.471  -27.879 1.00 90.98  ? 37   LYS A N    1 
ATOM   588   C  CA   . LYS A 1 40  ? 17.201  66.918  -28.005 1.00 96.92  ? 37   LYS A CA   1 
ATOM   589   C  C    . LYS A 1 40  ? 17.720  67.591  -26.740 1.00 88.47  ? 37   LYS A C    1 
ATOM   590   O  O    . LYS A 1 40  ? 17.419  67.164  -25.624 1.00 76.71  ? 37   LYS A O    1 
ATOM   591   C  CB   . LYS A 1 40  ? 15.819  67.449  -28.384 1.00 97.12  ? 37   LYS A CB   1 
ATOM   592   C  CG   . LYS A 1 40  ? 15.213  66.668  -29.546 1.00 110.30 ? 37   LYS A CG   1 
ATOM   593   C  CD   . LYS A 1 40  ? 13.786  67.052  -29.838 1.00 120.92 ? 37   LYS A CD   1 
ATOM   594   C  CE   . LYS A 1 40  ? 13.218  66.157  -30.921 1.00 93.37  ? 37   LYS A CE   1 
ATOM   595   N  NZ   . LYS A 1 40  ? 11.786  66.438  -31.158 1.00 119.97 ? 37   LYS A NZ   1 
ATOM   596   H  H    . LYS A 1 40  ? 16.340  65.184  -27.712 1.00 109.18 ? 37   LYS A H    1 
ATOM   597   H  HA   . LYS A 1 40  ? 17.809  67.139  -28.727 1.00 116.31 ? 37   LYS A HA   1 
ATOM   598   H  HB2  . LYS A 1 40  ? 15.225  67.367  -27.621 1.00 116.54 ? 37   LYS A HB2  1 
ATOM   599   H  HB3  . LYS A 1 40  ? 15.896  68.378  -28.650 1.00 116.54 ? 37   LYS A HB3  1 
ATOM   600   H  HG2  . LYS A 1 40  ? 15.736  66.837  -30.345 1.00 132.36 ? 37   LYS A HG2  1 
ATOM   601   H  HG3  . LYS A 1 40  ? 15.230  65.722  -29.333 1.00 132.36 ? 37   LYS A HG3  1 
ATOM   602   H  HD2  . LYS A 1 40  ? 13.250  66.943  -29.036 1.00 145.11 ? 37   LYS A HD2  1 
ATOM   603   H  HD3  . LYS A 1 40  ? 13.753  67.970  -30.147 1.00 145.11 ? 37   LYS A HD3  1 
ATOM   604   H  HE2  . LYS A 1 40  ? 13.700  66.311  -31.749 1.00 112.05 ? 37   LYS A HE2  1 
ATOM   605   H  HE3  . LYS A 1 40  ? 13.306  65.230  -30.650 1.00 112.05 ? 37   LYS A HE3  1 
ATOM   606   H  HZ1  . LYS A 1 40  ? 11.681  67.285  -31.412 1.00 143.97 ? 37   LYS A HZ1  1 
ATOM   607   H  HZ2  . LYS A 1 40  ? 11.473  65.903  -31.797 1.00 143.97 ? 37   LYS A HZ2  1 
ATOM   608   H  HZ3  . LYS A 1 40  ? 11.322  66.300  -30.411 1.00 143.97 ? 37   LYS A HZ3  1 
ATOM   609   N  N    . ASN A 1 41  ? 18.481  68.661  -26.951 1.00 84.92  ? 38   ASN A N    1 
ATOM   610   C  CA   . ASN A 1 41  ? 19.098  69.448  -25.889 1.00 92.74  ? 38   ASN A CA   1 
ATOM   611   C  C    . ASN A 1 41  ? 20.201  68.703  -25.133 1.00 92.69  ? 38   ASN A C    1 
ATOM   612   O  O    . ASN A 1 41  ? 20.655  69.169  -24.080 1.00 86.43  ? 38   ASN A O    1 
ATOM   613   C  CB   . ASN A 1 41  ? 18.041  69.936  -24.885 1.00 97.49  ? 38   ASN A CB   1 
ATOM   614   C  CG   . ASN A 1 41  ? 17.212  71.075  -25.422 1.00 99.07  ? 38   ASN A CG   1 
ATOM   615   O  OD1  . ASN A 1 41  ? 17.669  71.852  -26.263 1.00 97.99  ? 38   ASN A OD1  1 
ATOM   616   N  ND2  . ASN A 1 41  ? 15.987  71.194  -24.925 1.00 101.13 ? 38   ASN A ND2  1 
ATOM   617   H  H    . ASN A 1 41  ? 18.660  68.962  -27.736 1.00 101.90 ? 38   ASN A H    1 
ATOM   618   H  HA   . ASN A 1 41  ? 19.502  70.234  -26.289 1.00 111.29 ? 38   ASN A HA   1 
ATOM   619   H  HB2  . ASN A 1 41  ? 17.442  69.203  -24.675 1.00 116.99 ? 38   ASN A HB2  1 
ATOM   620   H  HB3  . ASN A 1 41  ? 18.487  70.243  -24.080 1.00 116.99 ? 38   ASN A HB3  1 
ATOM   621   H  HD21 . ASN A 1 41  ? 15.708  70.639  -24.332 1.00 121.35 ? 38   ASN A HD21 1 
ATOM   622   H  HD22 . ASN A 1 41  ? 15.473  71.828  -25.198 1.00 121.35 ? 38   ASN A HD22 1 
ATOM   623   N  N    . TYR A 1 42  ? 20.646  67.569  -25.674 1.00 77.34  ? 39   TYR A N    1 
ATOM   624   C  CA   . TYR A 1 42  ? 21.676  66.768  -25.013 1.00 80.01  ? 39   TYR A CA   1 
ATOM   625   C  C    . TYR A 1 42  ? 22.996  67.530  -24.982 1.00 80.73  ? 39   TYR A C    1 
ATOM   626   O  O    . TYR A 1 42  ? 23.620  67.670  -23.925 1.00 80.82  ? 39   TYR A O    1 
ATOM   627   C  CB   . TYR A 1 42  ? 21.852  65.423  -25.717 1.00 68.28  ? 39   TYR A CB   1 
ATOM   628   C  CG   . TYR A 1 42  ? 22.340  64.307  -24.816 1.00 73.50  ? 39   TYR A CG   1 
ATOM   629   C  CD1  . TYR A 1 42  ? 21.486  63.703  -23.903 1.00 67.71  ? 39   TYR A CD1  1 
ATOM   630   C  CD2  . TYR A 1 42  ? 23.646  63.838  -24.899 1.00 79.71  ? 39   TYR A CD2  1 
ATOM   631   C  CE1  . TYR A 1 42  ? 21.923  62.679  -23.080 1.00 65.69  ? 39   TYR A CE1  1 
ATOM   632   C  CE2  . TYR A 1 42  ? 24.095  62.808  -24.080 1.00 67.83  ? 39   TYR A CE2  1 
ATOM   633   C  CZ   . TYR A 1 42  ? 23.230  62.231  -23.175 1.00 69.74  ? 39   TYR A CZ   1 
ATOM   634   O  OH   . TYR A 1 42  ? 23.671  61.203  -22.365 1.00 55.12  ? 39   TYR A OH   1 
ATOM   635   H  H    . TYR A 1 42  ? 20.370  67.243  -26.420 1.00 92.81  ? 39   TYR A H    1 
ATOM   636   H  HA   . TYR A 1 42  ? 21.405  66.595  -24.097 1.00 96.02  ? 39   TYR A HA   1 
ATOM   637   H  HB2  . TYR A 1 42  ? 20.998  65.151  -26.087 1.00 81.94  ? 39   TYR A HB2  1 
ATOM   638   H  HB3  . TYR A 1 42  ? 22.499  65.529  -26.432 1.00 81.94  ? 39   TYR A HB3  1 
ATOM   639   H  HD1  . TYR A 1 42  ? 20.607  64.000  -23.834 1.00 81.26  ? 39   TYR A HD1  1 
ATOM   640   H  HD2  . TYR A 1 42  ? 24.232  64.226  -25.507 1.00 95.65  ? 39   TYR A HD2  1 
ATOM   641   H  HE1  . TYR A 1 42  ? 21.338  62.288  -22.472 1.00 78.83  ? 39   TYR A HE1  1 
ATOM   642   H  HE2  . TYR A 1 42  ? 24.973  62.508  -24.145 1.00 81.40  ? 39   TYR A HE2  1 
ATOM   643   H  HH   . TYR A 1 42  ? 23.048  60.944  -21.865 1.00 66.14  ? 39   TYR A HH   1 
ATOM   644   N  N    . PHE A 1 43  ? 23.422  68.012  -26.144 1.00 62.11  ? 40   PHE A N    1 
ATOM   645   C  CA   . PHE A 1 43  ? 24.626  68.824  -26.223 1.00 72.16  ? 40   PHE A CA   1 
ATOM   646   C  C    . PHE A 1 43  ? 24.382  70.201  -25.639 1.00 75.29  ? 40   PHE A C    1 
ATOM   647   O  O    . PHE A 1 43  ? 25.296  70.856  -25.137 1.00 75.02  ? 40   PHE A O    1 
ATOM   648   C  CB   . PHE A 1 43  ? 25.098  68.958  -27.663 1.00 59.81  ? 40   PHE A CB   1 
ATOM   649   C  CG   . PHE A 1 43  ? 26.246  69.913  -27.830 1.00 74.07  ? 40   PHE A CG   1 
ATOM   650   C  CD1  . PHE A 1 43  ? 27.554  69.477  -27.706 1.00 72.00  ? 40   PHE A CD1  1 
ATOM   651   C  CD2  . PHE A 1 43  ? 26.016  71.253  -28.101 1.00 74.95  ? 40   PHE A CD2  1 
ATOM   652   C  CE1  . PHE A 1 43  ? 28.619  70.360  -27.856 1.00 73.62  ? 40   PHE A CE1  1 
ATOM   653   C  CE2  . PHE A 1 43  ? 27.070  72.141  -28.253 1.00 76.71  ? 40   PHE A CE2  1 
ATOM   654   C  CZ   . PHE A 1 43  ? 28.377  71.694  -28.130 1.00 77.72  ? 40   PHE A CZ   1 
ATOM   655   H  H    . PHE A 1 43  ? 23.032  67.884  -26.899 1.00 74.53  ? 40   PHE A H    1 
ATOM   656   H  HA   . PHE A 1 43  ? 25.331  68.398  -25.711 1.00 86.59  ? 40   PHE A HA   1 
ATOM   657   H  HB2  . PHE A 1 43  ? 25.387  68.088  -27.981 1.00 71.77  ? 40   PHE A HB2  1 
ATOM   658   H  HB3  . PHE A 1 43  ? 24.362  69.279  -28.206 1.00 71.77  ? 40   PHE A HB3  1 
ATOM   659   H  HD1  . PHE A 1 43  ? 27.723  68.581  -27.523 1.00 86.40  ? 40   PHE A HD1  1 
ATOM   660   H  HD2  . PHE A 1 43  ? 25.142  71.560  -28.185 1.00 89.94  ? 40   PHE A HD2  1 
ATOM   661   H  HE1  . PHE A 1 43  ? 29.493  70.054  -27.772 1.00 88.35  ? 40   PHE A HE1  1 
ATOM   662   H  HE2  . PHE A 1 43  ? 26.900  73.037  -28.436 1.00 92.05  ? 40   PHE A HE2  1 
ATOM   663   H  HZ   . PHE A 1 43  ? 29.086  72.288  -28.230 1.00 93.27  ? 40   PHE A HZ   1 
ATOM   664   N  N    . GLN A 1 44  ? 23.136  70.639  -25.705 1.00 76.13  ? 41   GLN A N    1 
ATOM   665   C  CA   . GLN A 1 44  ? 22.804  71.989  -25.297 1.00 89.80  ? 41   GLN A CA   1 
ATOM   666   C  C    . GLN A 1 44  ? 22.730  72.069  -23.772 1.00 79.82  ? 41   GLN A C    1 
ATOM   667   O  O    . GLN A 1 44  ? 22.862  73.151  -23.198 1.00 85.73  ? 41   GLN A O    1 
ATOM   668   C  CB   . GLN A 1 44  ? 21.477  72.432  -25.937 1.00 89.90  ? 41   GLN A CB   1 
ATOM   669   C  CG   . GLN A 1 44  ? 21.555  72.736  -27.451 1.00 78.72  ? 41   GLN A CG   1 
ATOM   670   C  CD   . GLN A 1 44  ? 21.656  71.484  -28.346 1.00 88.79  ? 41   GLN A CD   1 
ATOM   671   O  OE1  . GLN A 1 44  ? 21.139  70.416  -28.005 1.00 92.21  ? 41   GLN A OE1  1 
ATOM   672   N  NE2  . GLN A 1 44  ? 22.323  71.622  -29.497 1.00 74.11  ? 41   GLN A NE2  1 
ATOM   673   H  H    . GLN A 1 44  ? 22.467  70.175  -25.983 1.00 91.35  ? 41   GLN A H    1 
ATOM   674   H  HA   . GLN A 1 44  ? 23.501  72.593  -25.597 1.00 107.76 ? 41   GLN A HA   1 
ATOM   675   H  HB2  . GLN A 1 44  ? 20.823  71.727  -25.813 1.00 107.88 ? 41   GLN A HB2  1 
ATOM   676   H  HB3  . GLN A 1 44  ? 21.174  73.239  -25.492 1.00 107.88 ? 41   GLN A HB3  1 
ATOM   677   H  HG2  . GLN A 1 44  ? 20.757  73.222  -27.712 1.00 94.47  ? 41   GLN A HG2  1 
ATOM   678   H  HG3  . GLN A 1 44  ? 22.339  73.282  -27.619 1.00 94.47  ? 41   GLN A HG3  1 
ATOM   679   H  HE21 . GLN A 1 44  ? 22.669  72.381  -29.705 1.00 88.93  ? 41   GLN A HE21 1 
ATOM   680   H  HE22 . GLN A 1 44  ? 22.405  70.951  -30.029 1.00 88.93  ? 41   GLN A HE22 1 
ATOM   681   N  N    . HIS A 1 45  ? 22.573  70.915  -23.124 1.00 75.57  ? 42   HIS A N    1 
ATOM   682   C  CA   . HIS A 1 45  ? 22.504  70.857  -21.664 1.00 79.71  ? 42   HIS A CA   1 
ATOM   683   C  C    . HIS A 1 45  ? 23.802  70.367  -21.027 1.00 75.48  ? 42   HIS A C    1 
ATOM   684   O  O    . HIS A 1 45  ? 23.882  70.193  -19.804 1.00 59.17  ? 42   HIS A O    1 
ATOM   685   C  CB   . HIS A 1 45  ? 21.352  69.951  -21.233 1.00 78.31  ? 42   HIS A CB   1 
ATOM   686   C  CG   . HIS A 1 45  ? 20.012  70.611  -21.301 1.00 93.27  ? 42   HIS A CG   1 
ATOM   687   N  ND1  . HIS A 1 45  ? 18.906  70.117  -20.642 1.00 94.50  ? 42   HIS A ND1  1 
ATOM   688   C  CD2  . HIS A 1 45  ? 19.599  71.728  -21.946 1.00 88.33  ? 42   HIS A CD2  1 
ATOM   689   C  CE1  . HIS A 1 45  ? 17.871  70.904  -20.873 1.00 84.44  ? 42   HIS A CE1  1 
ATOM   690   N  NE2  . HIS A 1 45  ? 18.265  71.888  -21.662 1.00 92.31  ? 42   HIS A NE2  1 
ATOM   691   H  H    . HIS A 1 45  ? 22.505  70.149  -23.508 1.00 90.69  ? 42   HIS A H    1 
ATOM   692   H  HA   . HIS A 1 45  ? 22.324  71.748  -21.324 1.00 95.65  ? 42   HIS A HA   1 
ATOM   693   H  HB2  . HIS A 1 45  ? 21.330  69.174  -21.814 1.00 93.97  ? 42   HIS A HB2  1 
ATOM   694   H  HB3  . HIS A 1 45  ? 21.500  69.672  -20.316 1.00 93.97  ? 42   HIS A HB3  1 
ATOM   695   H  HD1  . HIS A 1 45  ? 18.893  69.411  -20.151 1.00 113.39 ? 42   HIS A HD1  1 
ATOM   696   H  HD2  . HIS A 1 45  ? 20.122  72.284  -22.477 1.00 106.00 ? 42   HIS A HD2  1 
ATOM   697   H  HE1  . HIS A 1 45  ? 17.010  70.784  -20.542 1.00 101.33 ? 42   HIS A HE1  1 
ATOM   698   H  HE2  . HIS A 1 45  ? 17.765  72.524  -21.954 1.00 110.77 ? 42   HIS A HE2  1 
ATOM   699   N  N    . ARG A 1 46  ? 24.823  70.184  -21.859 1.00 68.50  ? 43   ARG A N    1 
ATOM   700   C  CA   . ARG A 1 46  ? 26.129  69.749  -21.392 1.00 61.55  ? 43   ARG A CA   1 
ATOM   701   C  C    . ARG A 1 46  ? 26.885  70.855  -20.682 1.00 64.93  ? 43   ARG A C    1 
ATOM   702   O  O    . ARG A 1 46  ? 26.976  71.965  -21.191 1.00 70.71  ? 43   ARG A O    1 
ATOM   703   C  CB   . ARG A 1 46  ? 26.968  69.246  -22.565 1.00 65.75  ? 43   ARG A CB   1 
ATOM   704   C  CG   . ARG A 1 46  ? 28.369  68.782  -22.169 1.00 67.87  ? 43   ARG A CG   1 
ATOM   705   C  CD   . ARG A 1 46  ? 28.328  67.471  -21.405 1.00 60.70  ? 43   ARG A CD   1 
ATOM   706   N  NE   . ARG A 1 46  ? 28.090  66.344  -22.296 1.00 58.69  ? 43   ARG A NE   1 
ATOM   707   C  CZ   . ARG A 1 46  ? 28.366  65.077  -22.004 1.00 70.21  ? 43   ARG A CZ   1 
ATOM   708   N  NH1  . ARG A 1 46  ? 28.899  64.759  -20.828 1.00 60.41  ? 43   ARG A NH1  1 
ATOM   709   N  NH2  . ARG A 1 46  ? 28.112  64.128  -22.898 1.00 62.92  ? 43   ARG A NH2  1 
ATOM   710   H  H    . ARG A 1 46  ? 24.781  70.307  -22.709 1.00 82.20  ? 43   ARG A H    1 
ATOM   711   H  HA   . ARG A 1 46  ? 26.013  69.016  -20.768 1.00 73.86  ? 43   ARG A HA   1 
ATOM   712   H  HB2  . ARG A 1 46  ? 26.513  68.495  -22.976 1.00 78.90  ? 43   ARG A HB2  1 
ATOM   713   H  HB3  . ARG A 1 46  ? 27.066  69.964  -23.211 1.00 78.90  ? 43   ARG A HB3  1 
ATOM   714   H  HG2  . ARG A 1 46  ? 28.901  68.651  -22.969 1.00 81.44  ? 43   ARG A HG2  1 
ATOM   715   H  HG3  . ARG A 1 46  ? 28.778  69.453  -21.600 1.00 81.44  ? 43   ARG A HG3  1 
ATOM   716   H  HD2  . ARG A 1 46  ? 29.179  67.333  -20.960 1.00 72.84  ? 43   ARG A HD2  1 
ATOM   717   H  HD3  . ARG A 1 46  ? 27.609  67.502  -20.754 1.00 72.84  ? 43   ARG A HD3  1 
ATOM   718   H  HE   . ARG A 1 46  ? 27.747  66.510  -23.066 1.00 70.43  ? 43   ARG A HE   1 
ATOM   719   H  HH11 . ARG A 1 46  ? 29.065  65.374  -20.250 1.00 72.49  ? 43   ARG A HH11 1 
ATOM   720   H  HH12 . ARG A 1 46  ? 29.076  63.938  -20.644 1.00 72.49  ? 43   ARG A HH12 1 
ATOM   721   H  HH21 . ARG A 1 46  ? 27.767  64.334  -23.658 1.00 75.50  ? 43   ARG A HH21 1 
ATOM   722   H  HH22 . ARG A 1 46  ? 28.287  63.306  -22.714 1.00 75.50  ? 43   ARG A HH22 1 
ATOM   723   N  N    . GLU A 1 47  ? 27.459  70.526  -19.525 1.00 68.37  ? 44   GLU A N    1 
ATOM   724   C  CA   . GLU A 1 47  ? 28.337  71.453  -18.827 1.00 62.84  ? 44   GLU A CA   1 
ATOM   725   C  C    . GLU A 1 47  ? 29.763  71.322  -19.345 1.00 65.83  ? 44   GLU A C    1 
ATOM   726   O  O    . GLU A 1 47  ? 30.266  70.222  -19.562 1.00 57.11  ? 44   GLU A O    1 
ATOM   727   C  CB   . GLU A 1 47  ? 28.319  71.207  -17.320 1.00 64.33  ? 44   GLU A CB   1 
ATOM   728   C  CG   . GLU A 1 47  ? 29.242  72.178  -16.552 1.00 72.58  ? 44   GLU A CG   1 
ATOM   729   C  CD   . GLU A 1 47  ? 29.257  71.954  -15.050 1.00 68.45  ? 44   GLU A CD   1 
ATOM   730   O  OE1  . GLU A 1 47  ? 28.694  70.946  -14.572 1.00 65.88  ? 44   GLU A OE1  1 
ATOM   731   O  OE2  . GLU A 1 47  ? 29.842  72.795  -14.343 1.00 70.47  ? 44   GLU A OE2  1 
ATOM   732   H  H    . GLU A 1 47  ? 27.354  69.772  -19.126 1.00 82.04  ? 44   GLU A H    1 
ATOM   733   H  HA   . GLU A 1 47  ? 28.037  72.361  -18.989 1.00 75.41  ? 44   GLU A HA   1 
ATOM   734   H  HB2  . GLU A 1 47  ? 27.415  71.327  -16.990 1.00 77.19  ? 44   GLU A HB2  1 
ATOM   735   H  HB3  . GLU A 1 47  ? 28.621  70.302  -17.143 1.00 77.19  ? 44   GLU A HB3  1 
ATOM   736   H  HG2  . GLU A 1 47  ? 30.149  72.069  -16.877 1.00 87.10  ? 44   GLU A HG2  1 
ATOM   737   H  HG3  . GLU A 1 47  ? 28.943  73.086  -16.713 1.00 87.10  ? 44   GLU A HG3  1 
ATOM   738   N  N    . PHE A 1 48  ? 30.395  72.468  -19.555 1.00 67.12  ? 45   PHE A N    1 
ATOM   739   C  CA   . PHE A 1 48  ? 31.827  72.552  -19.800 1.00 64.96  ? 45   PHE A CA   1 
ATOM   740   C  C    . PHE A 1 48  ? 32.395  73.472  -18.743 1.00 67.59  ? 45   PHE A C    1 
ATOM   741   O  O    . PHE A 1 48  ? 31.643  74.213  -18.099 1.00 58.46  ? 45   PHE A O    1 
ATOM   742   C  CB   . PHE A 1 48  ? 32.133  73.100  -21.194 1.00 61.87  ? 45   PHE A CB   1 
ATOM   743   C  CG   . PHE A 1 48  ? 31.807  72.153  -22.318 1.00 65.25  ? 45   PHE A CG   1 
ATOM   744   C  CD1  . PHE A 1 48  ? 30.505  72.019  -22.781 1.00 67.16  ? 45   PHE A CD1  1 
ATOM   745   C  CD2  . PHE A 1 48  ? 32.813  71.444  -22.952 1.00 63.29  ? 45   PHE A CD2  1 
ATOM   746   C  CE1  . PHE A 1 48  ? 30.205  71.158  -23.830 1.00 62.03  ? 45   PHE A CE1  1 
ATOM   747   C  CE2  . PHE A 1 48  ? 32.528  70.584  -24.001 1.00 69.44  ? 45   PHE A CE2  1 
ATOM   748   C  CZ   . PHE A 1 48  ? 31.218  70.441  -24.444 1.00 65.99  ? 45   PHE A CZ   1 
ATOM   749   H  H    . PHE A 1 48  ? 30.004  73.234  -19.559 1.00 80.54  ? 45   PHE A H    1 
ATOM   750   H  HA   . PHE A 1 48  ? 32.232  71.675  -19.709 1.00 77.95  ? 45   PHE A HA   1 
ATOM   751   H  HB2  . PHE A 1 48  ? 31.615  73.909  -21.331 1.00 74.24  ? 45   PHE A HB2  1 
ATOM   752   H  HB3  . PHE A 1 48  ? 33.080  73.305  -21.247 1.00 74.24  ? 45   PHE A HB3  1 
ATOM   753   H  HD1  . PHE A 1 48  ? 29.820  72.495  -22.369 1.00 80.60  ? 45   PHE A HD1  1 
ATOM   754   H  HD2  . PHE A 1 48  ? 33.690  71.533  -22.658 1.00 75.95  ? 45   PHE A HD2  1 
ATOM   755   H  HE1  . PHE A 1 48  ? 29.327  71.068  -24.123 1.00 74.43  ? 45   PHE A HE1  1 
ATOM   756   H  HE2  . PHE A 1 48  ? 33.212  70.105  -24.409 1.00 83.32  ? 45   PHE A HE2  1 
ATOM   757   H  HZ   . PHE A 1 48  ? 31.023  69.865  -25.148 1.00 79.18  ? 45   PHE A HZ   1 
ATOM   758   N  N    . SER A 1 49  ? 33.696  73.374  -18.495 1.00 62.59  ? 46   SER A N    1 
ATOM   759   C  CA   . SER A 1 49  ? 34.354  74.398  -17.695 1.00 68.31  ? 46   SER A CA   1 
ATOM   760   C  C    . SER A 1 49  ? 35.705  74.726  -18.296 1.00 68.85  ? 46   SER A C    1 
ATOM   761   O  O    . SER A 1 49  ? 36.403  73.853  -18.841 1.00 65.63  ? 46   SER A O    1 
ATOM   762   C  CB   . SER A 1 49  ? 34.512  73.977  -16.236 1.00 64.91  ? 46   SER A CB   1 
ATOM   763   O  OG   . SER A 1 49  ? 35.412  72.907  -16.116 1.00 82.65  ? 46   SER A OG   1 
ATOM   764   H  H    . SER A 1 49  ? 34.210  72.741  -18.771 1.00 75.11  ? 46   SER A H    1 
ATOM   765   H  HA   . SER A 1 49  ? 33.815  75.204  -17.715 1.00 81.97  ? 46   SER A HA   1 
ATOM   766   H  HB2  . SER A 1 49  ? 34.847  74.731  -15.726 1.00 77.89  ? 46   SER A HB2  1 
ATOM   767   H  HB3  . SER A 1 49  ? 33.647  73.703  -15.892 1.00 77.89  ? 46   SER A HB3  1 
ATOM   768   H  HG   . SER A 1 49  ? 35.489  72.687  -15.309 1.00 99.18  ? 46   SER A HG   1 
ATOM   769   N  N    . PHE A 1 50  ? 36.042  76.006  -18.200 1.00 66.26  ? 47   PHE A N    1 
ATOM   770   C  CA   . PHE A 1 50  ? 37.271  76.540  -18.749 1.00 64.26  ? 47   PHE A CA   1 
ATOM   771   C  C    . PHE A 1 50  ? 38.124  77.067  -17.622 1.00 64.32  ? 47   PHE A C    1 
ATOM   772   O  O    . PHE A 1 50  ? 37.609  77.624  -16.645 1.00 62.22  ? 47   PHE A O    1 
ATOM   773   C  CB   . PHE A 1 50  ? 36.988  77.679  -19.739 1.00 75.64  ? 47   PHE A CB   1 
ATOM   774   C  CG   . PHE A 1 50  ? 36.292  77.248  -20.999 1.00 75.14  ? 47   PHE A CG   1 
ATOM   775   C  CD1  . PHE A 1 50  ? 36.512  75.994  -21.544 1.00 77.38  ? 47   PHE A CD1  1 
ATOM   776   C  CD2  . PHE A 1 50  ? 35.411  78.102  -21.635 1.00 78.50  ? 47   PHE A CD2  1 
ATOM   777   C  CE1  . PHE A 1 50  ? 35.874  75.606  -22.699 1.00 70.97  ? 47   PHE A CE1  1 
ATOM   778   C  CE2  . PHE A 1 50  ? 34.766  77.722  -22.796 1.00 85.24  ? 47   PHE A CE2  1 
ATOM   779   C  CZ   . PHE A 1 50  ? 34.997  76.472  -23.329 1.00 89.81  ? 47   PHE A CZ   1 
ATOM   780   H  H    . PHE A 1 50  ? 35.557  76.599  -17.808 1.00 79.51  ? 47   PHE A H    1 
ATOM   781   H  HA   . PHE A 1 50  ? 37.758  75.839  -19.209 1.00 77.11  ? 47   PHE A HA   1 
ATOM   782   H  HB2  . PHE A 1 50  ? 36.426  78.338  -19.302 1.00 90.77  ? 47   PHE A HB2  1 
ATOM   783   H  HB3  . PHE A 1 50  ? 37.831  78.086  -19.993 1.00 90.77  ? 47   PHE A HB3  1 
ATOM   784   H  HD1  . PHE A 1 50  ? 37.102  75.409  -21.126 1.00 92.85  ? 47   PHE A HD1  1 
ATOM   785   H  HD2  . PHE A 1 50  ? 35.255  78.947  -21.279 1.00 94.20  ? 47   PHE A HD2  1 
ATOM   786   H  HE1  . PHE A 1 50  ? 36.031  74.762  -23.057 1.00 85.16  ? 47   PHE A HE1  1 
ATOM   787   H  HE2  . PHE A 1 50  ? 34.177  78.307  -23.215 1.00 102.29 ? 47   PHE A HE2  1 
ATOM   788   H  HZ   . PHE A 1 50  ? 34.563  76.211  -24.109 1.00 107.78 ? 47   PHE A HZ   1 
ATOM   789   N  N    . THR A 1 51  ? 39.427  76.847  -17.745 1.00 67.98  ? 48   THR A N    1 
ATOM   790   C  CA   . THR A 1 51  ? 40.399  77.505  -16.885 1.00 73.30  ? 48   THR A CA   1 
ATOM   791   C  C    . THR A 1 51  ? 41.249  78.388  -17.788 1.00 74.63  ? 48   THR A C    1 
ATOM   792   O  O    . THR A 1 51  ? 41.911  77.903  -18.714 1.00 65.73  ? 48   THR A O    1 
ATOM   793   C  CB   . THR A 1 51  ? 41.275  76.518  -16.093 1.00 67.12  ? 48   THR A CB   1 
ATOM   794   O  OG1  . THR A 1 51  ? 40.441  75.687  -15.277 1.00 70.55  ? 48   THR A OG1  1 
ATOM   795   C  CG2  . THR A 1 51  ? 42.254  77.266  -15.199 1.00 60.99  ? 48   THR A CG2  1 
ATOM   796   H  H    . THR A 1 51  ? 39.777  76.316  -18.324 1.00 81.58  ? 48   THR A H    1 
ATOM   797   H  HA   . THR A 1 51  ? 39.934  78.074  -16.252 1.00 87.96  ? 48   THR A HA   1 
ATOM   798   H  HB   . THR A 1 51  ? 41.781  75.965  -16.710 1.00 80.54  ? 48   THR A HB   1 
ATOM   799   H  HG1  . THR A 1 51  ? 40.912  75.145  -14.841 1.00 84.66  ? 48   THR A HG1  1 
ATOM   800   H  HG21 . THR A 1 51  ? 41.769  77.823  -14.570 1.00 73.18  ? 48   THR A HG21 1 
ATOM   801   H  HG22 . THR A 1 51  ? 42.801  76.635  -14.705 1.00 73.18  ? 48   THR A HG22 1 
ATOM   802   H  HG23 . THR A 1 51  ? 42.832  77.829  -15.738 1.00 73.18  ? 48   THR A HG23 1 
ATOM   803   N  N    . LEU A 1 52  ? 41.189  79.689  -17.536 1.00 79.02  ? 49   LEU A N    1 
ATOM   804   C  CA   . LEU A 1 52  ? 41.851  80.672  -18.380 1.00 80.37  ? 49   LEU A CA   1 
ATOM   805   C  C    . LEU A 1 52  ? 43.193  81.048  -17.772 1.00 91.48  ? 49   LEU A C    1 
ATOM   806   O  O    . LEU A 1 52  ? 43.616  80.467  -16.766 1.00 85.14  ? 49   LEU A O    1 
ATOM   807   C  CB   . LEU A 1 52  ? 40.968  81.909  -18.553 1.00 81.24  ? 49   LEU A CB   1 
ATOM   808   C  CG   . LEU A 1 52  ? 39.543  81.599  -19.021 1.00 79.23  ? 49   LEU A CG   1 
ATOM   809   C  CD1  . LEU A 1 52  ? 38.638  82.809  -18.883 1.00 71.07  ? 49   LEU A CD1  1 
ATOM   810   C  CD2  . LEU A 1 52  ? 39.569  81.108  -20.463 1.00 87.29  ? 49   LEU A CD2  1 
ATOM   811   H  H    . LEU A 1 52  ? 40.764  80.032  -16.872 1.00 94.83  ? 49   LEU A H    1 
ATOM   812   H  HA   . LEU A 1 52  ? 42.011  80.287  -19.256 1.00 96.45  ? 49   LEU A HA   1 
ATOM   813   H  HB2  . LEU A 1 52  ? 40.905  82.369  -17.701 1.00 97.49  ? 49   LEU A HB2  1 
ATOM   814   H  HB3  . LEU A 1 52  ? 41.375  82.493  -19.212 1.00 97.49  ? 49   LEU A HB3  1 
ATOM   815   H  HG   . LEU A 1 52  ? 39.178  80.889  -18.470 1.00 95.07  ? 49   LEU A HG   1 
ATOM   816   H  HD11 . LEU A 1 52  ? 38.993  83.532  -19.424 1.00 85.28  ? 49   LEU A HD11 1 
ATOM   817   H  HD12 . LEU A 1 52  ? 37.748  82.574  -19.189 1.00 85.28  ? 49   LEU A HD12 1 
ATOM   818   H  HD13 . LEU A 1 52  ? 38.608  83.076  -17.951 1.00 85.28  ? 49   LEU A HD13 1 
ATOM   819   H  HD21 . LEU A 1 52  ? 40.109  80.304  -20.513 1.00 104.75 ? 49   LEU A HD21 1 
ATOM   820   H  HD22 . LEU A 1 52  ? 38.661  80.916  -20.746 1.00 104.75 ? 49   LEU A HD22 1 
ATOM   821   H  HD23 . LEU A 1 52  ? 39.952  81.800  -21.025 1.00 104.75 ? 49   LEU A HD23 1 
ATOM   822   N  N    . LYS A 1 53  ? 43.857  82.021  -18.387 1.00 98.44  ? 50   LYS A N    1 
ATOM   823   C  CA   . LYS A 1 53  ? 45.141  82.500  -17.900 1.00 90.72  ? 50   LYS A CA   1 
ATOM   824   C  C    . LYS A 1 53  ? 44.991  83.026  -16.477 1.00 92.40  ? 50   LYS A C    1 
ATOM   825   O  O    . LYS A 1 53  ? 43.924  83.518  -16.101 1.00 81.99  ? 50   LYS A O    1 
ATOM   826   C  CB   . LYS A 1 53  ? 45.682  83.592  -18.820 1.00 95.96  ? 50   LYS A CB   1 
ATOM   827   C  CG   . LYS A 1 53  ? 47.148  83.918  -18.619 1.00 105.49 ? 50   LYS A CG   1 
ATOM   828   C  CD   . LYS A 1 53  ? 47.589  85.014  -19.575 1.00 112.78 ? 50   LYS A CD   1 
ATOM   829   C  CE   . LYS A 1 53  ? 49.069  85.322  -19.448 1.00 112.66 ? 50   LYS A CE   1 
ATOM   830   N  NZ   . LYS A 1 53  ? 49.488  86.356  -20.436 1.00 108.17 ? 50   LYS A NZ   1 
ATOM   831   H  H    . LYS A 1 53  ? 43.580  82.423  -19.095 1.00 118.13 ? 50   LYS A H    1 
ATOM   832   H  HA   . LYS A 1 53  ? 45.776  81.766  -17.889 1.00 108.87 ? 50   LYS A HA   1 
ATOM   833   H  HB2  . LYS A 1 53  ? 45.568  83.307  -19.740 1.00 115.15 ? 50   LYS A HB2  1 
ATOM   834   H  HB3  . LYS A 1 53  ? 45.176  84.406  -18.665 1.00 115.15 ? 50   LYS A HB3  1 
ATOM   835   H  HG2  . LYS A 1 53  ? 47.288  84.229  -17.711 1.00 126.59 ? 50   LYS A HG2  1 
ATOM   836   H  HG3  . LYS A 1 53  ? 47.681  83.127  -18.792 1.00 126.59 ? 50   LYS A HG3  1 
ATOM   837   H  HD2  . LYS A 1 53  ? 47.417  84.728  -20.486 1.00 135.34 ? 50   LYS A HD2  1 
ATOM   838   H  HD3  . LYS A 1 53  ? 47.093  85.825  -19.380 1.00 135.34 ? 50   LYS A HD3  1 
ATOM   839   H  HE2  . LYS A 1 53  ? 49.251  85.659  -18.557 1.00 135.20 ? 50   LYS A HE2  1 
ATOM   840   H  HE3  . LYS A 1 53  ? 49.581  84.515  -19.615 1.00 135.20 ? 50   LYS A HE3  1 
ATOM   841   H  HZ1  . LYS A 1 53  ? 49.032  87.108  -20.301 1.00 129.80 ? 50   LYS A HZ1  1 
ATOM   842   H  HZ2  . LYS A 1 53  ? 50.358  86.525  -20.348 1.00 129.80 ? 50   LYS A HZ2  1 
ATOM   843   H  HZ3  . LYS A 1 53  ? 49.332  86.067  -21.263 1.00 129.80 ? 50   LYS A HZ3  1 
ATOM   844   N  N    . ASP A 1 54  ? 46.063  82.904  -15.697 1.00 94.69  ? 51   ASP A N    1 
ATOM   845   C  CA   . ASP A 1 54  ? 46.059  83.294  -14.291 1.00 92.60  ? 51   ASP A CA   1 
ATOM   846   C  C    . ASP A 1 54  ? 45.029  82.473  -13.510 1.00 92.64  ? 51   ASP A C    1 
ATOM   847   O  O    . ASP A 1 54  ? 44.423  82.963  -12.553 1.00 97.42  ? 51   ASP A O    1 
ATOM   848   C  CB   . ASP A 1 54  ? 45.783  84.797  -14.148 1.00 101.10 ? 51   ASP A CB   1 
ATOM   849   C  CG   . ASP A 1 54  ? 46.743  85.649  -14.972 1.00 102.52 ? 51   ASP A CG   1 
ATOM   850   O  OD1  . ASP A 1 54  ? 47.969  85.395  -14.932 1.00 97.43  ? 51   ASP A OD1  1 
ATOM   851   O  OD2  . ASP A 1 54  ? 46.263  86.559  -15.682 1.00 99.95  ? 51   ASP A OD2  1 
ATOM   852   H  H    . ASP A 1 54  ? 46.818  82.592  -15.965 1.00 113.63 ? 51   ASP A H    1 
ATOM   853   H  HA   . ASP A 1 54  ? 46.934  83.114  -13.912 1.00 111.12 ? 51   ASP A HA   1 
ATOM   854   H  HB2  . ASP A 1 54  ? 44.881  84.983  -14.449 1.00 121.32 ? 51   ASP A HB2  1 
ATOM   855   H  HB3  . ASP A 1 54  ? 45.882  85.049  -13.216 1.00 121.32 ? 51   ASP A HB3  1 
ATOM   856   N  N    . ASP A 1 55  ? 44.844  81.224  -13.933 1.00 93.24  ? 52   ASP A N    1 
ATOM   857   C  CA   . ASP A 1 55  ? 43.996  80.264  -13.227 1.00 91.27  ? 52   ASP A CA   1 
ATOM   858   C  C    . ASP A 1 55  ? 42.594  80.796  -12.921 1.00 85.16  ? 52   ASP A C    1 
ATOM   859   O  O    . ASP A 1 55  ? 42.050  80.570  -11.839 1.00 78.89  ? 52   ASP A O    1 
ATOM   860   C  CB   . ASP A 1 55  ? 44.685  79.822  -11.934 1.00 91.39  ? 52   ASP A CB   1 
ATOM   861   C  CG   . ASP A 1 55  ? 45.890  78.943  -12.196 1.00 107.79 ? 52   ASP A CG   1 
ATOM   862   O  OD1  . ASP A 1 55  ? 45.799  78.066  -13.084 1.00 107.67 ? 52   ASP A OD1  1 
ATOM   863   O  OD2  . ASP A 1 55  ? 46.926  79.126  -11.519 1.00 105.41 ? 52   ASP A OD2  1 
ATOM   864   H  H    . ASP A 1 55  ? 45.208  80.902  -14.643 1.00 111.88 ? 52   ASP A H    1 
ATOM   865   H  HA   . ASP A 1 55  ? 43.892  79.478  -13.786 1.00 109.53 ? 52   ASP A HA   1 
ATOM   866   H  HB2  . ASP A 1 55  ? 44.984  80.607  -11.450 1.00 109.67 ? 52   ASP A HB2  1 
ATOM   867   H  HB3  . ASP A 1 55  ? 44.055  79.318  -11.395 1.00 109.67 ? 52   ASP A HB3  1 
ATOM   868   N  N    . ILE A 1 56  ? 42.006  81.488  -13.890 1.00 89.20  ? 53   ILE A N    1 
ATOM   869   C  CA   . ILE A 1 56  ? 40.620  81.924  -13.775 1.00 94.60  ? 53   ILE A CA   1 
ATOM   870   C  C    . ILE A 1 56  ? 39.718  80.754  -14.162 1.00 89.27  ? 53   ILE A C    1 
ATOM   871   O  O    . ILE A 1 56  ? 39.766  80.259  -15.289 1.00 77.46  ? 53   ILE A O    1 
ATOM   872   C  CB   . ILE A 1 56  ? 40.328  83.147  -14.666 1.00 93.99  ? 53   ILE A CB   1 
ATOM   873   C  CG1  . ILE A 1 56  ? 41.266  84.302  -14.295 1.00 87.86  ? 53   ILE A CG1  1 
ATOM   874   C  CG2  . ILE A 1 56  ? 38.859  83.570  -14.528 1.00 84.83  ? 53   ILE A CG2  1 
ATOM   875   C  CD1  . ILE A 1 56  ? 41.120  85.514  -15.189 1.00 111.90 ? 53   ILE A CD1  1 
ATOM   876   H  H    . ILE A 1 56  ? 42.388  81.719  -14.625 1.00 107.04 ? 53   ILE A H    1 
ATOM   877   H  HA   . ILE A 1 56  ? 40.433  82.164  -12.854 1.00 113.52 ? 53   ILE A HA   1 
ATOM   878   H  HB   . ILE A 1 56  ? 40.492  82.901  -15.590 1.00 112.79 ? 53   ILE A HB   1 
ATOM   879   H  HG12 . ILE A 1 56  ? 41.075  84.579  -13.385 1.00 105.43 ? 53   ILE A HG12 1 
ATOM   880   H  HG13 . ILE A 1 56  ? 42.183  83.993  -14.360 1.00 105.43 ? 53   ILE A HG13 1 
ATOM   881   H  HG21 . ILE A 1 56  ? 38.683  83.799  -13.602 1.00 101.80 ? 53   ILE A HG21 1 
ATOM   882   H  HG22 . ILE A 1 56  ? 38.698  84.340  -15.096 1.00 101.80 ? 53   ILE A HG22 1 
ATOM   883   H  HG23 . ILE A 1 56  ? 38.291  82.832  -14.800 1.00 101.80 ? 53   ILE A HG23 1 
ATOM   884   H  HD11 . ILE A 1 56  ? 40.210  85.844  -15.128 1.00 134.28 ? 53   ILE A HD11 1 
ATOM   885   H  HD12 . ILE A 1 56  ? 41.741  86.199  -14.895 1.00 134.28 ? 53   ILE A HD12 1 
ATOM   886   H  HD13 . ILE A 1 56  ? 41.318  85.258  -16.103 1.00 134.28 ? 53   ILE A HD13 1 
ATOM   887   N  N    . TYR A 1 57  ? 38.911  80.309  -13.205 1.00 83.99  ? 54   TYR A N    1 
ATOM   888   C  CA   . TYR A 1 57  ? 38.077  79.131  -13.382 1.00 75.08  ? 54   TYR A CA   1 
ATOM   889   C  C    . TYR A 1 57  ? 36.600  79.481  -13.543 1.00 76.08  ? 54   TYR A C    1 
ATOM   890   O  O    . TYR A 1 57  ? 36.032  80.202  -12.721 1.00 82.89  ? 54   TYR A O    1 
ATOM   891   C  CB   . TYR A 1 57  ? 38.267  78.197  -12.187 1.00 69.04  ? 54   TYR A CB   1 
ATOM   892   C  CG   . TYR A 1 57  ? 37.484  76.912  -12.279 1.00 71.26  ? 54   TYR A CG   1 
ATOM   893   C  CD1  . TYR A 1 57  ? 37.930  75.866  -13.069 1.00 70.56  ? 54   TYR A CD1  1 
ATOM   894   C  CD2  . TYR A 1 57  ? 36.301  76.742  -11.572 1.00 64.88  ? 54   TYR A CD2  1 
ATOM   895   C  CE1  . TYR A 1 57  ? 37.217  74.685  -13.158 1.00 81.48  ? 54   TYR A CE1  1 
ATOM   896   C  CE2  . TYR A 1 57  ? 35.580  75.568  -11.655 1.00 63.84  ? 54   TYR A CE2  1 
ATOM   897   C  CZ   . TYR A 1 57  ? 36.044  74.540  -12.447 1.00 73.08  ? 54   TYR A CZ   1 
ATOM   898   O  OH   . TYR A 1 57  ? 35.342  73.359  -12.543 1.00 73.67  ? 54   TYR A OH   1 
ATOM   899   H  H    . TYR A 1 57  ? 38.829  80.680  -12.433 1.00 100.79 ? 54   TYR A H    1 
ATOM   900   H  HA   . TYR A 1 57  ? 38.362  78.659  -14.180 1.00 90.09  ? 54   TYR A HA   1 
ATOM   901   H  HB2  . TYR A 1 57  ? 39.206  77.967  -12.118 1.00 82.85  ? 54   TYR A HB2  1 
ATOM   902   H  HB3  . TYR A 1 57  ? 37.982  78.659  -11.383 1.00 82.85  ? 54   TYR A HB3  1 
ATOM   903   H  HD1  . TYR A 1 57  ? 38.720  75.960  -13.550 1.00 84.67  ? 54   TYR A HD1  1 
ATOM   904   H  HD2  . TYR A 1 57  ? 35.986  77.434  -11.037 1.00 77.86  ? 54   TYR A HD2  1 
ATOM   905   H  HE1  . TYR A 1 57  ? 37.528  73.991  -13.693 1.00 97.77  ? 54   TYR A HE1  1 
ATOM   906   H  HE2  . TYR A 1 57  ? 34.790  75.470  -11.175 1.00 76.61  ? 54   TYR A HE2  1 
ATOM   907   H  HH   . TYR A 1 57  ? 34.651  73.396  -12.065 1.00 88.41  ? 54   TYR A HH   1 
ATOM   908   N  N    . ILE A 1 58  ? 35.990  78.988  -14.617 1.00 73.74  ? 55   ILE A N    1 
ATOM   909   C  CA   . ILE A 1 58  ? 34.549  79.139  -14.818 1.00 84.19  ? 55   ILE A CA   1 
ATOM   910   C  C    . ILE A 1 58  ? 33.922  77.819  -15.255 1.00 74.25  ? 55   ILE A C    1 
ATOM   911   O  O    . ILE A 1 58  ? 34.442  77.138  -16.142 1.00 74.15  ? 55   ILE A O    1 
ATOM   912   C  CB   . ILE A 1 58  ? 34.227  80.223  -15.863 1.00 85.04  ? 55   ILE A CB   1 
ATOM   913   C  CG1  . ILE A 1 58  ? 35.007  79.975  -17.153 1.00 72.31  ? 55   ILE A CG1  1 
ATOM   914   C  CG2  . ILE A 1 58  ? 34.569  81.605  -15.311 1.00 88.36  ? 55   ILE A CG2  1 
ATOM   915   C  CD1  . ILE A 1 58  ? 34.424  80.669  -18.332 1.00 83.14  ? 55   ILE A CD1  1 
ATOM   916   H  H    . ILE A 1 58  ? 36.389  78.560  -15.248 1.00 88.49  ? 55   ILE A H    1 
ATOM   917   H  HA   . ILE A 1 58  ? 34.140  79.401  -13.979 1.00 101.03 ? 55   ILE A HA   1 
ATOM   918   H  HB   . ILE A 1 58  ? 33.278  80.192  -16.062 1.00 102.05 ? 55   ILE A HB   1 
ATOM   919   H  HG12 . ILE A 1 58  ? 35.915  80.295  -17.037 1.00 86.77  ? 55   ILE A HG12 1 
ATOM   920   H  HG13 . ILE A 1 58  ? 35.013  79.023  -17.339 1.00 86.77  ? 55   ILE A HG13 1 
ATOM   921   H  HG21 . ILE A 1 58  ? 35.515  81.634  -15.098 1.00 106.03 ? 55   ILE A HG21 1 
ATOM   922   H  HG22 . ILE A 1 58  ? 34.359  82.273  -15.981 1.00 106.03 ? 55   ILE A HG22 1 
ATOM   923   H  HG23 . ILE A 1 58  ? 34.044  81.763  -14.510 1.00 106.03 ? 55   ILE A HG23 1 
ATOM   924   H  HD11 . ILE A 1 58  ? 34.419  81.624  -18.166 1.00 99.77  ? 55   ILE A HD11 1 
ATOM   925   H  HD12 . ILE A 1 58  ? 34.964  80.471  -19.113 1.00 99.77  ? 55   ILE A HD12 1 
ATOM   926   H  HD13 . ILE A 1 58  ? 33.517  80.352  -18.468 1.00 99.77  ? 55   ILE A HD13 1 
ATOM   927   N  N    . ARG A 1 59  ? 32.801  77.470  -14.632 1.00 69.03  ? 56   ARG A N    1 
ATOM   928   C  CA   . ARG A 1 59  ? 32.041  76.293  -15.022 1.00 69.30  ? 56   ARG A CA   1 
ATOM   929   C  C    . ARG A 1 59  ? 30.613  76.690  -15.383 1.00 69.19  ? 56   ARG A C    1 
ATOM   930   O  O    . ARG A 1 59  ? 30.307  77.875  -15.487 1.00 76.49  ? 56   ARG A O    1 
ATOM   931   C  CB   . ARG A 1 59  ? 32.055  75.249  -13.902 1.00 68.41  ? 56   ARG A CB   1 
ATOM   932   C  CG   . ARG A 1 59  ? 31.514  75.743  -12.580 1.00 70.16  ? 56   ARG A CG   1 
ATOM   933   C  CD   . ARG A 1 59  ? 31.452  74.616  -11.561 1.00 80.02  ? 56   ARG A CD   1 
ATOM   934   N  NE   . ARG A 1 59  ? 30.591  73.518  -11.999 1.00 72.02  ? 56   ARG A NE   1 
ATOM   935   C  CZ   . ARG A 1 59  ? 30.103  72.581  -11.193 1.00 61.53  ? 56   ARG A CZ   1 
ATOM   936   N  NH1  . ARG A 1 59  ? 30.391  72.600  -9.903  1.00 74.15  ? 56   ARG A NH1  1 
ATOM   937   N  NH2  . ARG A 1 59  ? 29.329  71.621  -11.673 1.00 60.22  ? 56   ARG A NH2  1 
ATOM   938   H  H    . ARG A 1 59  ? 32.458  77.904  -13.974 1.00 82.84  ? 56   ARG A H    1 
ATOM   939   H  HA   . ARG A 1 59  ? 32.451  75.897  -15.807 1.00 83.16  ? 56   ARG A HA   1 
ATOM   940   H  HB2  . ARG A 1 59  ? 31.515  74.492  -14.177 1.00 82.09  ? 56   ARG A HB2  1 
ATOM   941   H  HB3  . ARG A 1 59  ? 32.970  74.963  -13.757 1.00 82.09  ? 56   ARG A HB3  1 
ATOM   942   H  HG2  . ARG A 1 59  ? 32.095  76.437  -12.233 1.00 84.20  ? 56   ARG A HG2  1 
ATOM   943   H  HG3  . ARG A 1 59  ? 30.616  76.088  -12.709 1.00 84.20  ? 56   ARG A HG3  1 
ATOM   944   H  HD2  . ARG A 1 59  ? 32.345  74.263  -11.424 1.00 96.03  ? 56   ARG A HD2  1 
ATOM   945   H  HD3  . ARG A 1 59  ? 31.099  74.962  -10.726 1.00 96.03  ? 56   ARG A HD3  1 
ATOM   946   H  HE   . ARG A 1 59  ? 30.387  73.476  -12.834 1.00 86.42  ? 56   ARG A HE   1 
ATOM   947   H  HH11 . ARG A 1 59  ? 30.893  73.220  -9.584  1.00 88.98  ? 56   ARG A HH11 1 
ATOM   948   H  HH12 . ARG A 1 59  ? 30.075  71.992  -9.383  1.00 88.98  ? 56   ARG A HH12 1 
ATOM   949   H  HH21 . ARG A 1 59  ? 29.138  71.602  -12.511 1.00 72.27  ? 56   ARG A HH21 1 
ATOM   950   H  HH22 . ARG A 1 59  ? 29.017  71.017  -11.146 1.00 72.27  ? 56   ARG A HH22 1 
ATOM   951   N  N    . TYR A 1 60  ? 29.746  75.693  -15.549 1.00 73.76  ? 57   TYR A N    1 
ATOM   952   C  CA   . TYR A 1 60  ? 28.385  75.901  -16.040 1.00 73.24  ? 57   TYR A CA   1 
ATOM   953   C  C    . TYR A 1 60  ? 28.397  76.625  -17.394 1.00 74.50  ? 57   TYR A C    1 
ATOM   954   O  O    . TYR A 1 60  ? 27.520  77.432  -17.688 1.00 71.81  ? 57   TYR A O    1 
ATOM   955   C  CB   . TYR A 1 60  ? 27.545  76.675  -15.023 1.00 69.00  ? 57   TYR A CB   1 
ATOM   956   C  CG   . TYR A 1 60  ? 27.446  75.999  -13.677 1.00 72.55  ? 57   TYR A CG   1 
ATOM   957   C  CD1  . TYR A 1 60  ? 26.800  74.776  -13.536 1.00 74.41  ? 57   TYR A CD1  1 
ATOM   958   C  CD2  . TYR A 1 60  ? 27.990  76.583  -12.544 1.00 75.61  ? 57   TYR A CD2  1 
ATOM   959   C  CE1  . TYR A 1 60  ? 26.707  74.152  -12.302 1.00 65.29  ? 57   TYR A CE1  1 
ATOM   960   C  CE2  . TYR A 1 60  ? 27.904  75.969  -11.306 1.00 73.86  ? 57   TYR A CE2  1 
ATOM   961   C  CZ   . TYR A 1 60  ? 27.262  74.753  -11.191 1.00 77.07  ? 57   TYR A CZ   1 
ATOM   962   O  OH   . TYR A 1 60  ? 27.176  74.144  -9.959  1.00 77.59  ? 57   TYR A OH   1 
ATOM   963   H  H    . TYR A 1 60  ? 29.927  74.869  -15.381 1.00 88.52  ? 57   TYR A H    1 
ATOM   964   H  HA   . TYR A 1 60  ? 27.967  75.036  -16.172 1.00 87.89  ? 57   TYR A HA   1 
ATOM   965   H  HB2  . TYR A 1 60  ? 27.944  77.548  -14.888 1.00 82.80  ? 57   TYR A HB2  1 
ATOM   966   H  HB3  . TYR A 1 60  ? 26.646  76.774  -15.372 1.00 82.80  ? 57   TYR A HB3  1 
ATOM   967   H  HD1  . TYR A 1 60  ? 26.427  74.368  -14.284 1.00 89.29  ? 57   TYR A HD1  1 
ATOM   968   H  HD2  . TYR A 1 60  ? 28.426  77.401  -12.617 1.00 90.73  ? 57   TYR A HD2  1 
ATOM   969   H  HE1  . TYR A 1 60  ? 26.274  73.332  -12.224 1.00 78.34  ? 57   TYR A HE1  1 
ATOM   970   H  HE2  . TYR A 1 60  ? 28.277  76.374  -10.557 1.00 88.64  ? 57   TYR A HE2  1 
ATOM   971   H  HH   . TYR A 1 60  ? 26.761  73.416  -10.027 1.00 93.11  ? 57   TYR A HH   1 
ATOM   972   N  N    . GLN A 1 61  ? 29.378  76.283  -18.223 1.00 63.20  ? 58   GLN A N    1 
ATOM   973   C  CA   . GLN A 1 61  ? 29.432  76.734  -19.604 1.00 68.27  ? 58   GLN A CA   1 
ATOM   974   C  C    . GLN A 1 61  ? 28.677  75.777  -20.503 1.00 80.00  ? 58   GLN A C    1 
ATOM   975   O  O    . GLN A 1 61  ? 28.924  74.571  -20.467 1.00 89.50  ? 58   GLN A O    1 
ATOM   976   C  CB   . GLN A 1 61  ? 30.880  76.836  -20.093 1.00 76.85  ? 58   GLN A CB   1 
ATOM   977   C  CG   . GLN A 1 61  ? 31.766  77.690  -19.217 1.00 78.58  ? 58   GLN A CG   1 
ATOM   978   C  CD   . GLN A 1 61  ? 31.418  79.154  -19.313 1.00 94.63  ? 58   GLN A CD   1 
ATOM   979   O  OE1  . GLN A 1 61  ? 30.992  79.760  -18.327 1.00 97.36  ? 58   GLN A OE1  1 
ATOM   980   N  NE2  . GLN A 1 61  ? 31.592  79.737  -20.501 1.00 84.19  ? 58   GLN A NE2  1 
ATOM   981   H  H    . GLN A 1 61  ? 30.038  75.779  -18.001 1.00 75.84  ? 58   GLN A H    1 
ATOM   982   H  HA   . GLN A 1 61  ? 29.022  77.610  -19.674 1.00 81.92  ? 58   GLN A HA   1 
ATOM   983   H  HB2  . GLN A 1 61  ? 31.263  75.946  -20.123 1.00 92.22  ? 58   GLN A HB2  1 
ATOM   984   H  HB3  . GLN A 1 61  ? 30.882  77.224  -20.983 1.00 92.22  ? 58   GLN A HB3  1 
ATOM   985   H  HG2  . GLN A 1 61  ? 31.659  77.414  -18.293 1.00 94.30  ? 58   GLN A HG2  1 
ATOM   986   H  HG3  . GLN A 1 61  ? 32.689  77.579  -19.494 1.00 94.30  ? 58   GLN A HG3  1 
ATOM   987   H  HE21 . GLN A 1 61  ? 31.889  79.278  -21.165 1.00 101.03 ? 58   GLN A HE21 1 
ATOM   988   H  HE22 . GLN A 1 61  ? 31.407  80.570  -20.602 1.00 101.03 ? 58   GLN A HE22 1 
ATOM   989   N  N    . SER A 1 62  ? 27.722  76.299  -21.267 1.00 84.78  ? 59   SER A N    1 
ATOM   990   C  CA   . SER A 1 62  ? 27.009  75.483  -22.247 1.00 83.13  ? 59   SER A CA   1 
ATOM   991   C  C    . SER A 1 62  ? 26.902  76.229  -23.568 1.00 78.41  ? 59   SER A C    1 
ATOM   992   O  O    . SER A 1 62  ? 27.051  77.450  -23.614 1.00 88.38  ? 59   SER A O    1 
ATOM   993   C  CB   . SER A 1 62  ? 25.619  75.099  -21.731 1.00 83.37  ? 59   SER A CB   1 
ATOM   994   O  OG   . SER A 1 62  ? 24.777  76.230  -21.597 1.00 93.48  ? 59   SER A OG   1 
ATOM   995   H  H    . SER A 1 62  ? 27.469  77.120  -21.239 1.00 101.74 ? 59   SER A H    1 
ATOM   996   H  HA   . SER A 1 62  ? 27.508  74.666  -22.402 1.00 99.76  ? 59   SER A HA   1 
ATOM   997   H  HB2  . SER A 1 62  ? 25.213  74.480  -22.357 1.00 100.05 ? 59   SER A HB2  1 
ATOM   998   H  HB3  . SER A 1 62  ? 25.713  74.676  -20.863 1.00 100.05 ? 59   SER A HB3  1 
ATOM   999   H  HG   . SER A 1 62  ? 24.023  75.995  -21.313 1.00 112.18 ? 59   SER A HG   1 
ATOM   1000  N  N    . PHE A 1 63  ? 26.632  75.489  -24.636 1.00 81.62  ? 60   PHE A N    1 
ATOM   1001  C  CA   . PHE A 1 63  ? 26.643  76.050  -25.983 1.00 87.12  ? 60   PHE A CA   1 
ATOM   1002  C  C    . PHE A 1 63  ? 25.463  75.561  -26.822 1.00 87.17  ? 60   PHE A C    1 
ATOM   1003  O  O    . PHE A 1 63  ? 24.928  74.473  -26.595 1.00 80.69  ? 60   PHE A O    1 
ATOM   1004  C  CB   . PHE A 1 63  ? 27.969  75.715  -26.662 1.00 78.91  ? 60   PHE A CB   1 
ATOM   1005  C  CG   . PHE A 1 63  ? 29.159  76.083  -25.833 1.00 86.38  ? 60   PHE A CG   1 
ATOM   1006  C  CD1  . PHE A 1 63  ? 29.491  77.410  -25.631 1.00 86.47  ? 60   PHE A CD1  1 
ATOM   1007  C  CD2  . PHE A 1 63  ? 29.929  75.110  -25.230 1.00 88.67  ? 60   PHE A CD2  1 
ATOM   1008  C  CE1  . PHE A 1 63  ? 30.576  77.760  -24.855 1.00 85.11  ? 60   PHE A CE1  1 
ATOM   1009  C  CE2  . PHE A 1 63  ? 31.018  75.452  -24.453 1.00 87.38  ? 60   PHE A CE2  1 
ATOM   1010  C  CZ   . PHE A 1 63  ? 31.342  76.781  -24.265 1.00 88.58  ? 60   PHE A CZ   1 
ATOM   1011  H  H    . PHE A 1 63  ? 26.437  74.651  -24.608 1.00 97.94  ? 60   PHE A H    1 
ATOM   1012  H  HA   . PHE A 1 63  ? 26.579  77.016  -25.918 1.00 104.54 ? 60   PHE A HA   1 
ATOM   1013  H  HB2  . PHE A 1 63  ? 28.004  74.761  -26.831 1.00 94.69  ? 60   PHE A HB2  1 
ATOM   1014  H  HB3  . PHE A 1 63  ? 28.025  76.202  -27.499 1.00 94.69  ? 60   PHE A HB3  1 
ATOM   1015  H  HD1  . PHE A 1 63  ? 28.976  78.076  -26.027 1.00 103.77 ? 60   PHE A HD1  1 
ATOM   1016  H  HD2  . PHE A 1 63  ? 29.715  74.213  -25.353 1.00 106.40 ? 60   PHE A HD2  1 
ATOM   1017  H  HE1  . PHE A 1 63  ? 30.791  78.656  -24.732 1.00 102.13 ? 60   PHE A HE1  1 
ATOM   1018  H  HE2  . PHE A 1 63  ? 31.533  74.787  -24.056 1.00 104.86 ? 60   PHE A HE2  1 
ATOM   1019  H  HZ   . PHE A 1 63  ? 32.076  77.013  -23.743 1.00 106.30 ? 60   PHE A HZ   1 
ATOM   1020  N  N    . ASN A 1 64  ? 25.070  76.373  -27.800 1.00 84.12  ? 61   ASN A N    1 
ATOM   1021  C  CA   . ASN A 1 64  ? 23.895  76.084  -28.607 1.00 83.55  ? 61   ASN A CA   1 
ATOM   1022  C  C    . ASN A 1 64  ? 24.204  75.020  -29.642 1.00 72.52  ? 61   ASN A C    1 
ATOM   1023  O  O    . ASN A 1 64  ? 23.389  74.137  -29.907 1.00 72.58  ? 61   ASN A O    1 
ATOM   1024  C  CB   . ASN A 1 64  ? 23.401  77.350  -29.307 1.00 95.34  ? 61   ASN A CB   1 
ATOM   1025  C  CG   . ASN A 1 64  ? 22.859  78.383  -28.336 1.00 95.27  ? 61   ASN A CG   1 
ATOM   1026  O  OD1  . ASN A 1 64  ? 22.197  78.044  -27.356 1.00 90.45  ? 61   ASN A OD1  1 
ATOM   1027  N  ND2  . ASN A 1 64  ? 23.136  79.655  -28.608 1.00 80.09  ? 61   ASN A ND2  1 
ATOM   1028  H  H    . ASN A 1 64  ? 25.472  77.102  -28.015 1.00 100.94 ? 61   ASN A H    1 
ATOM   1029  H  HA   . ASN A 1 64  ? 23.185  75.755  -28.035 1.00 100.26 ? 61   ASN A HA   1 
ATOM   1030  H  HB2  . ASN A 1 64  ? 24.140  77.752  -29.791 1.00 114.41 ? 61   ASN A HB2  1 
ATOM   1031  H  HB3  . ASN A 1 64  ? 22.690  77.114  -29.923 1.00 114.41 ? 61   ASN A HB3  1 
ATOM   1032  H  HD21 . ASN A 1 64  ? 23.600  79.854  -29.304 1.00 96.11  ? 61   ASN A HD21 1 
ATOM   1033  H  HD22 . ASN A 1 64  ? 22.851  80.278  -28.089 1.00 96.11  ? 61   ASN A HD22 1 
ATOM   1034  N  N    . ASN A 1 65  ? 25.390  75.115  -30.230 1.00 66.32  ? 62   ASN A N    1 
ATOM   1035  C  CA   . ASN A 1 65  ? 25.825  74.146  -31.224 1.00 79.79  ? 62   ASN A CA   1 
ATOM   1036  C  C    . ASN A 1 65  ? 27.313  74.286  -31.475 1.00 75.22  ? 62   ASN A C    1 
ATOM   1037  O  O    . ASN A 1 65  ? 27.980  75.106  -30.847 1.00 79.37  ? 62   ASN A O    1 
ATOM   1038  C  CB   . ASN A 1 65  ? 25.068  74.329  -32.535 1.00 74.81  ? 62   ASN A CB   1 
ATOM   1039  C  CG   . ASN A 1 65  ? 25.374  75.659  -33.190 1.00 85.76  ? 62   ASN A CG   1 
ATOM   1040  O  OD1  . ASN A 1 65  ? 25.359  76.705  -32.536 1.00 81.71  ? 62   ASN A OD1  1 
ATOM   1041  N  ND2  . ASN A 1 65  ? 25.687  75.627  -34.484 1.00 99.26  ? 62   ASN A ND2  1 
ATOM   1042  H  H    . ASN A 1 65  ? 25.964  75.735  -30.070 1.00 79.58  ? 62   ASN A H    1 
ATOM   1043  H  HA   . ASN A 1 65  ? 25.654  73.250  -30.895 1.00 95.75  ? 62   ASN A HA   1 
ATOM   1044  H  HB2  . ASN A 1 65  ? 25.323  73.624  -33.150 1.00 89.78  ? 62   ASN A HB2  1 
ATOM   1045  H  HB3  . ASN A 1 65  ? 24.115  74.291  -32.359 1.00 89.78  ? 62   ASN A HB3  1 
ATOM   1046  H  HD21 . ASN A 1 65  ? 25.707  74.876  -34.903 1.00 119.11 ? 62   ASN A HD21 1 
ATOM   1047  H  HD22 . ASN A 1 65  ? 25.868  76.357  -34.901 1.00 119.11 ? 62   ASN A HD22 1 
ATOM   1048  N  N    . GLN A 1 66  ? 27.806  73.529  -32.449 1.00 64.76  ? 63   GLN A N    1 
ATOM   1049  C  CA   . GLN A 1 66  ? 29.231  73.460  -32.746 1.00 67.05  ? 63   GLN A CA   1 
ATOM   1050  C  C    . GLN A 1 66  ? 29.836  74.839  -33.033 1.00 72.90  ? 63   GLN A C    1 
ATOM   1051  O  O    . GLN A 1 66  ? 30.964  75.135  -32.634 1.00 84.67  ? 63   GLN A O    1 
ATOM   1052  C  CB   . GLN A 1 66  ? 29.445  72.523  -33.926 1.00 57.90  ? 63   GLN A CB   1 
ATOM   1053  C  CG   . GLN A 1 66  ? 30.828  72.568  -34.546 1.00 55.50  ? 63   GLN A CG   1 
ATOM   1054  C  CD   . GLN A 1 66  ? 31.013  71.452  -35.557 1.00 65.51  ? 63   GLN A CD   1 
ATOM   1055  O  OE1  . GLN A 1 66  ? 30.118  70.620  -35.745 1.00 62.71  ? 63   GLN A OE1  1 
ATOM   1056  N  NE2  . GLN A 1 66  ? 32.166  71.428  -36.219 1.00 64.34  ? 63   GLN A NE2  1 
ATOM   1057  H  H    . GLN A 1 66  ? 27.324  73.036  -32.962 1.00 77.71  ? 63   GLN A H    1 
ATOM   1058  H  HA   . GLN A 1 66  ? 29.694  73.085  -31.980 1.00 80.46  ? 63   GLN A HA   1 
ATOM   1059  H  HB2  . GLN A 1 66  ? 29.288  71.613  -33.629 1.00 69.48  ? 63   GLN A HB2  1 
ATOM   1060  H  HB3  . GLN A 1 66  ? 28.807  72.752  -34.620 1.00 69.48  ? 63   GLN A HB3  1 
ATOM   1061  H  HG2  . GLN A 1 66  ? 30.948  73.415  -35.002 1.00 66.60  ? 63   GLN A HG2  1 
ATOM   1062  H  HG3  . GLN A 1 66  ? 31.495  72.462  -33.850 1.00 66.60  ? 63   GLN A HG3  1 
ATOM   1063  H  HE21 . GLN A 1 66  ? 32.763  72.027  -36.064 1.00 77.21  ? 63   GLN A HE21 1 
ATOM   1064  H  HE22 . GLN A 1 66  ? 32.314  70.813  -36.802 1.00 77.21  ? 63   GLN A HE22 1 
ATOM   1065  N  N    . SER A 1 67  ? 29.089  75.683  -33.728 1.00 82.35  ? 64   SER A N    1 
ATOM   1066  C  CA   . SER A 1 67  ? 29.588  77.004  -34.083 1.00 88.39  ? 64   SER A CA   1 
ATOM   1067  C  C    . SER A 1 67  ? 29.826  77.824  -32.813 1.00 79.33  ? 64   SER A C    1 
ATOM   1068  O  O    . SER A 1 67  ? 30.880  78.448  -32.646 1.00 80.28  ? 64   SER A O    1 
ATOM   1069  C  CB   . SER A 1 67  ? 28.603  77.712  -35.011 1.00 90.68  ? 64   SER A CB   1 
ATOM   1070  O  OG   . SER A 1 67  ? 29.098  78.980  -35.405 1.00 91.79  ? 64   SER A OG   1 
ATOM   1071  H  H    . SER A 1 67  ? 28.293  75.517  -34.007 1.00 98.82  ? 64   SER A H    1 
ATOM   1072  H  HA   . SER A 1 67  ? 30.433  76.913  -34.549 1.00 106.07 ? 64   SER A HA   1 
ATOM   1073  H  HB2  . SER A 1 67  ? 28.467  77.167  -35.802 1.00 108.82 ? 64   SER A HB2  1 
ATOM   1074  H  HB3  . SER A 1 67  ? 27.761  77.834  -34.545 1.00 108.82 ? 64   SER A HB3  1 
ATOM   1075  H  HG   . SER A 1 67  ? 28.548  79.358  -35.915 1.00 110.15 ? 64   SER A HG   1 
ATOM   1076  N  N    . ASP A 1 68  ? 28.832  77.817  -31.927 1.00 74.08  ? 65   ASP A N    1 
ATOM   1077  C  CA   . ASP A 1 68  ? 28.895  78.560  -30.674 1.00 80.20  ? 65   ASP A CA   1 
ATOM   1078  C  C    . ASP A 1 68  ? 30.107  78.116  -29.858 1.00 93.40  ? 65   ASP A C    1 
ATOM   1079  O  O    . ASP A 1 68  ? 30.769  78.926  -29.183 1.00 99.87  ? 65   ASP A O    1 
ATOM   1080  C  CB   . ASP A 1 68  ? 27.607  78.338  -29.872 1.00 76.63  ? 65   ASP A CB   1 
ATOM   1081  C  CG   . ASP A 1 68  ? 27.430  79.344  -28.752 1.00 96.16  ? 65   ASP A CG   1 
ATOM   1082  O  OD1  . ASP A 1 68  ? 28.159  80.359  -28.731 1.00 110.10 ? 65   ASP A OD1  1 
ATOM   1083  O  OD2  . ASP A 1 68  ? 26.557  79.113  -27.883 1.00 96.79  ? 65   ASP A OD2  1 
ATOM   1084  H  H    . ASP A 1 68  ? 28.099  77.380  -32.033 1.00 88.90  ? 65   ASP A H    1 
ATOM   1085  H  HA   . ASP A 1 68  ? 28.981  79.507  -30.863 1.00 96.24  ? 65   ASP A HA   1 
ATOM   1086  H  HB2  . ASP A 1 68  ? 26.846  78.418  -30.469 1.00 91.96  ? 65   ASP A HB2  1 
ATOM   1087  H  HB3  . ASP A 1 68  ? 27.628  77.452  -29.479 1.00 91.96  ? 65   ASP A HB3  1 
ATOM   1088  N  N    . LEU A 1 69  ? 30.418  76.828  -29.980 1.00 82.46  ? 66   LEU A N    1 
ATOM   1089  C  CA   . LEU A 1 69  ? 31.530  76.229  -29.265 1.00 82.58  ? 66   LEU A CA   1 
ATOM   1090  C  C    . LEU A 1 69  ? 32.836  76.725  -29.869 1.00 84.33  ? 66   LEU A C    1 
ATOM   1091  O  O    . LEU A 1 69  ? 33.718  77.206  -29.143 1.00 85.96  ? 66   LEU A O    1 
ATOM   1092  C  CB   . LEU A 1 69  ? 31.433  74.707  -29.331 1.00 86.17  ? 66   LEU A CB   1 
ATOM   1093  C  CG   . LEU A 1 69  ? 32.600  73.905  -28.766 1.00 89.51  ? 66   LEU A CG   1 
ATOM   1094  C  CD1  . LEU A 1 69  ? 32.668  74.045  -27.235 1.00 77.19  ? 66   LEU A CD1  1 
ATOM   1095  C  CD2  . LEU A 1 69  ? 32.444  72.451  -29.188 1.00 70.13  ? 66   LEU A CD2  1 
ATOM   1096  H  H    . LEU A 1 69  ? 29.990  76.275  -30.480 1.00 98.95  ? 66   LEU A H    1 
ATOM   1097  H  HA   . LEU A 1 69  ? 31.500  76.499  -28.334 1.00 99.09  ? 66   LEU A HA   1 
ATOM   1098  H  HB2  . LEU A 1 69  ? 30.639  74.436  -28.844 1.00 103.40 ? 66   LEU A HB2  1 
ATOM   1099  H  HB3  . LEU A 1 69  ? 31.338  74.453  -30.262 1.00 103.40 ? 66   LEU A HB3  1 
ATOM   1100  H  HG   . LEU A 1 69  ? 33.430  74.242  -29.138 1.00 107.41 ? 66   LEU A HG   1 
ATOM   1101  H  HD11 . LEU A 1 69  ? 31.841  73.715  -26.851 1.00 92.63  ? 66   LEU A HD11 1 
ATOM   1102  H  HD12 . LEU A 1 69  ? 33.418  73.526  -26.904 1.00 92.63  ? 66   LEU A HD12 1 
ATOM   1103  H  HD13 . LEU A 1 69  ? 32.788  74.981  -27.010 1.00 92.63  ? 66   LEU A HD13 1 
ATOM   1104  H  HD21 . LEU A 1 69  ? 32.445  72.403  -30.157 1.00 84.16  ? 66   LEU A HD21 1 
ATOM   1105  H  HD22 . LEU A 1 69  ? 33.185  71.938  -28.830 1.00 84.16  ? 66   LEU A HD22 1 
ATOM   1106  H  HD23 . LEU A 1 69  ? 31.606  72.110  -28.840 1.00 84.16  ? 66   LEU A HD23 1 
ATOM   1107  N  N    . GLU A 1 70  ? 32.953  76.619  -31.194 1.00 81.75  ? 67   GLU A N    1 
ATOM   1108  C  CA   . GLU A 1 70  ? 34.152  77.089  -31.898 1.00 86.28  ? 67   GLU A CA   1 
ATOM   1109  C  C    . GLU A 1 70  ? 34.412  78.543  -31.516 1.00 87.11  ? 67   GLU A C    1 
ATOM   1110  O  O    . GLU A 1 70  ? 35.555  78.958  -31.234 1.00 75.27  ? 67   GLU A O    1 
ATOM   1111  C  CB   . GLU A 1 70  ? 33.994  76.955  -33.413 1.00 79.61  ? 67   GLU A CB   1 
ATOM   1112  C  CG   . GLU A 1 70  ? 33.853  75.519  -33.900 1.00 83.59  ? 67   GLU A CG   1 
ATOM   1113  C  CD   . GLU A 1 70  ? 33.959  75.365  -35.409 1.00 90.86  ? 67   GLU A CD   1 
ATOM   1114  O  OE1  . GLU A 1 70  ? 34.275  76.360  -36.102 1.00 100.44 ? 67   GLU A OE1  1 
ATOM   1115  O  OE2  . GLU A 1 70  ? 33.730  74.233  -35.897 1.00 70.82  ? 67   GLU A OE2  1 
ATOM   1116  H  H    . GLU A 1 70  ? 32.354  76.280  -31.709 1.00 98.10  ? 67   GLU A H    1 
ATOM   1117  H  HA   . GLU A 1 70  ? 34.916  76.558  -31.622 1.00 103.54 ? 67   GLU A HA   1 
ATOM   1118  H  HB2  . GLU A 1 70  ? 33.200  77.439  -33.687 1.00 95.53  ? 67   GLU A HB2  1 
ATOM   1119  H  HB3  . GLU A 1 70  ? 34.775  77.337  -33.842 1.00 95.53  ? 67   GLU A HB3  1 
ATOM   1120  H  HG2  . GLU A 1 70  ? 34.553  74.983  -33.497 1.00 100.30 ? 67   GLU A HG2  1 
ATOM   1121  H  HG3  . GLU A 1 70  ? 32.985  75.182  -33.629 1.00 100.30 ? 67   GLU A HG3  1 
ATOM   1122  N  N    . LYS A 1 71  ? 33.323  79.306  -31.479 1.00 91.96  ? 68   LYS A N    1 
ATOM   1123  C  CA   . LYS A 1 71  ? 33.416  80.723  -31.179 1.00 96.40  ? 68   LYS A CA   1 
ATOM   1124  C  C    . LYS A 1 71  ? 33.940  80.907  -29.771 1.00 80.96  ? 68   LYS A C    1 
ATOM   1125  O  O    . LYS A 1 71  ? 35.019  81.465  -29.591 1.00 86.40  ? 68   LYS A O    1 
ATOM   1126  C  CB   . LYS A 1 71  ? 32.054  81.415  -31.314 1.00 99.60  ? 68   LYS A CB   1 
ATOM   1127  C  CG   . LYS A 1 71  ? 32.048  82.877  -30.850 1.00 96.02  ? 68   LYS A CG   1 
ATOM   1128  C  CD   . LYS A 1 71  ? 30.673  83.298  -30.364 1.00 111.36 ? 68   LYS A CD   1 
ATOM   1129  C  CE   . LYS A 1 71  ? 30.702  84.706  -29.785 1.00 131.59 ? 68   LYS A CE   1 
ATOM   1130  N  NZ   . LYS A 1 71  ? 29.383  85.117  -29.229 1.00 127.41 ? 68   LYS A NZ   1 
ATOM   1131  H  H    . LYS A 1 71  ? 32.523  79.026  -31.625 1.00 110.35 ? 68   LYS A H    1 
ATOM   1132  H  HA   . LYS A 1 71  ? 34.036  81.144  -31.795 1.00 115.68 ? 68   LYS A HA   1 
ATOM   1133  H  HB2  . LYS A 1 71  ? 31.787  81.399  -32.246 1.00 119.52 ? 68   LYS A HB2  1 
ATOM   1134  H  HB3  . LYS A 1 71  ? 31.405  80.932  -30.779 1.00 119.52 ? 68   LYS A HB3  1 
ATOM   1135  H  HG2  . LYS A 1 71  ? 32.676  82.983  -30.118 1.00 115.22 ? 68   LYS A HG2  1 
ATOM   1136  H  HG3  . LYS A 1 71  ? 32.297  83.450  -31.592 1.00 115.22 ? 68   LYS A HG3  1 
ATOM   1137  H  HD2  . LYS A 1 71  ? 30.052  83.287  -31.109 1.00 133.63 ? 68   LYS A HD2  1 
ATOM   1138  H  HD3  . LYS A 1 71  ? 30.377  82.688  -29.670 1.00 133.63 ? 68   LYS A HD3  1 
ATOM   1139  H  HE2  . LYS A 1 71  ? 31.355  84.740  -29.068 1.00 157.90 ? 68   LYS A HE2  1 
ATOM   1140  H  HE3  . LYS A 1 71  ? 30.942  85.332  -30.485 1.00 157.90 ? 68   LYS A HE3  1 
ATOM   1141  H  HZ1  . LYS A 1 71  ? 29.141  84.561  -28.577 1.00 152.89 ? 68   LYS A HZ1  1 
ATOM   1142  H  HZ2  . LYS A 1 71  ? 29.436  85.942  -28.899 1.00 152.89 ? 68   LYS A HZ2  1 
ATOM   1143  H  HZ3  . LYS A 1 71  ? 28.764  85.100  -29.868 1.00 152.89 ? 68   LYS A HZ3  1 
ATOM   1144  N  N    . GLU A 1 72  ? 33.189  80.443  -28.774 1.00 87.94  ? 69   GLU A N    1 
ATOM   1145  C  CA   . GLU A 1 72  ? 33.557  80.744  -27.391 1.00 84.94  ? 69   GLU A CA   1 
ATOM   1146  C  C    . GLU A 1 72  ? 34.921  80.171  -27.026 1.00 80.08  ? 69   GLU A C    1 
ATOM   1147  O  O    . GLU A 1 72  ? 35.675  80.779  -26.252 1.00 80.05  ? 69   GLU A O    1 
ATOM   1148  C  CB   . GLU A 1 72  ? 32.490  80.220  -26.433 1.00 85.30  ? 69   GLU A CB   1 
ATOM   1149  C  CG   . GLU A 1 72  ? 31.258  81.113  -26.353 1.00 99.37  ? 69   GLU A CG   1 
ATOM   1150  C  CD   . GLU A 1 72  ? 31.562  82.478  -25.753 1.00 117.50 ? 69   GLU A CD   1 
ATOM   1151  O  OE1  . GLU A 1 72  ? 32.531  82.590  -24.963 1.00 105.56 ? 69   GLU A OE1  1 
ATOM   1152  O  OE2  . GLU A 1 72  ? 30.840  83.443  -26.087 1.00 127.04 ? 69   GLU A OE2  1 
ATOM   1153  H  H    . GLU A 1 72  ? 32.480  79.965  -28.866 1.00 105.53 ? 69   GLU A H    1 
ATOM   1154  H  HA   . GLU A 1 72  ? 33.603  81.707  -27.284 1.00 101.93 ? 69   GLU A HA   1 
ATOM   1155  H  HB2  . GLU A 1 72  ? 32.202  79.343  -26.733 1.00 102.36 ? 69   GLU A HB2  1 
ATOM   1156  H  HB3  . GLU A 1 72  ? 32.870  80.157  -25.543 1.00 102.36 ? 69   GLU A HB3  1 
ATOM   1157  H  HG2  . GLU A 1 72  ? 30.908  81.250  -27.247 1.00 119.24 ? 69   GLU A HG2  1 
ATOM   1158  H  HG3  . GLU A 1 72  ? 30.591  80.682  -25.796 1.00 119.24 ? 69   GLU A HG3  1 
ATOM   1159  N  N    . MET A 1 73  ? 35.278  79.043  -27.627 1.00 73.63  ? 70   MET A N    1 
ATOM   1160  C  CA   . MET A 1 73  ? 36.590  78.484  -27.355 1.00 78.30  ? 70   MET A CA   1 
ATOM   1161  C  C    . MET A 1 73  ? 37.676  79.350  -27.967 1.00 74.90  ? 70   MET A C    1 
ATOM   1162  O  O    . MET A 1 73  ? 38.638  79.709  -27.286 1.00 84.40  ? 70   MET A O    1 
ATOM   1163  C  CB   . MET A 1 73  ? 36.691  77.046  -27.859 1.00 79.50  ? 70   MET A CB   1 
ATOM   1164  C  CG   . MET A 1 73  ? 36.304  76.015  -26.796 1.00 71.61  ? 70   MET A CG   1 
ATOM   1165  S  SD   . MET A 1 73  ? 36.227  74.338  -27.441 1.00 71.31  ? 70   MET A SD   1 
ATOM   1166  C  CE   . MET A 1 73  ? 37.957  74.063  -27.870 1.00 60.36  ? 70   MET A CE   1 
ATOM   1167  H  H    . MET A 1 73  ? 34.795  78.594  -28.179 1.00 88.35  ? 70   MET A H    1 
ATOM   1168  H  HA   . MET A 1 73  ? 36.721  78.464  -26.394 1.00 93.96  ? 70   MET A HA   1 
ATOM   1169  H  HB2  . MET A 1 73  ? 36.095  76.934  -28.616 1.00 95.40  ? 70   MET A HB2  1 
ATOM   1170  H  HB3  . MET A 1 73  ? 37.606  76.869  -28.129 1.00 95.40  ? 70   MET A HB3  1 
ATOM   1171  H  HG2  . MET A 1 73  ? 36.964  76.033  -26.085 1.00 85.94  ? 70   MET A HG2  1 
ATOM   1172  H  HG3  . MET A 1 73  ? 35.430  76.240  -26.442 1.00 85.94  ? 70   MET A HG3  1 
ATOM   1173  H  HE1  . MET A 1 73  ? 38.498  74.151  -27.069 1.00 72.43  ? 70   MET A HE1  1 
ATOM   1174  H  HE2  . MET A 1 73  ? 38.052  73.171  -28.238 1.00 72.43  ? 70   MET A HE2  1 
ATOM   1175  H  HE3  . MET A 1 73  ? 38.227  74.724  -28.527 1.00 72.43  ? 70   MET A HE3  1 
ATOM   1176  N  N    . GLN A 1 74  ? 37.529  79.714  -29.236 1.00 94.27  ? 71   GLN A N    1 
ATOM   1177  C  CA   . GLN A 1 74  ? 38.530  80.574  -29.860 1.00 81.43  ? 71   GLN A CA   1 
ATOM   1178  C  C    . GLN A 1 74  ? 38.613  81.930  -29.162 1.00 79.76  ? 71   GLN A C    1 
ATOM   1179  O  O    . GLN A 1 74  ? 39.690  82.512  -29.035 1.00 85.48  ? 71   GLN A O    1 
ATOM   1180  C  CB   . GLN A 1 74  ? 38.205  80.742  -31.334 1.00 72.51  ? 71   GLN A CB   1 
ATOM   1181  C  CG   . GLN A 1 74  ? 38.400  79.452  -32.115 1.00 86.17  ? 71   GLN A CG   1 
ATOM   1182  C  CD   . GLN A 1 74  ? 37.584  79.396  -33.382 1.00 85.69  ? 71   GLN A CD   1 
ATOM   1183  O  OE1  . GLN A 1 74  ? 36.807  80.303  -33.676 1.00 101.88 ? 71   GLN A OE1  1 
ATOM   1184  N  NE2  . GLN A 1 74  ? 37.761  78.328  -34.150 1.00 91.62  ? 71   GLN A NE2  1 
ATOM   1185  H  H    . GLN A 1 74  ? 36.876  79.485  -29.747 1.00 113.13 ? 71   GLN A H    1 
ATOM   1186  H  HA   . GLN A 1 74  ? 39.399  80.148  -29.791 1.00 97.71  ? 71   GLN A HA   1 
ATOM   1187  H  HB2  . GLN A 1 74  ? 37.278  81.013  -31.426 1.00 87.02  ? 71   GLN A HB2  1 
ATOM   1188  H  HB3  . GLN A 1 74  ? 38.790  81.416  -31.714 1.00 87.02  ? 71   GLN A HB3  1 
ATOM   1189  H  HG2  . GLN A 1 74  ? 39.335  79.370  -32.358 1.00 103.40 ? 71   GLN A HG2  1 
ATOM   1190  H  HG3  . GLN A 1 74  ? 38.136  78.703  -31.557 1.00 103.40 ? 71   GLN A HG3  1 
ATOM   1191  H  HE21 . GLN A 1 74  ? 38.317  77.716  -33.914 1.00 109.94 ? 71   GLN A HE21 1 
ATOM   1192  H  HE22 . GLN A 1 74  ? 37.319  78.248  -34.884 1.00 109.94 ? 71   GLN A HE22 1 
ATOM   1193  N  N    . ALA A 1 75  ? 37.473  82.410  -28.681 1.00 71.79  ? 72   ALA A N    1 
ATOM   1194  C  CA   . ALA A 1 75  ? 37.419  83.683  -27.977 1.00 69.40  ? 72   ALA A CA   1 
ATOM   1195  C  C    . ALA A 1 75  ? 38.134  83.617  -26.639 1.00 87.47  ? 72   ALA A C    1 
ATOM   1196  O  O    . ALA A 1 75  ? 38.945  84.484  -26.315 1.00 95.80  ? 72   ALA A O    1 
ATOM   1197  C  CB   . ALA A 1 75  ? 35.967  84.108  -27.772 1.00 73.45  ? 72   ALA A CB   1 
ATOM   1198  H  H    . ALA A 1 75  ? 36.713  82.015  -28.750 1.00 86.15  ? 72   ALA A H    1 
ATOM   1199  H  HA   . ALA A 1 75  ? 37.856  84.360  -28.516 1.00 83.27  ? 72   ALA A HA   1 
ATOM   1200  H  HB1  . ALA A 1 75  ? 35.511  83.430  -27.249 1.00 88.14  ? 72   ALA A HB1  1 
ATOM   1201  H  HB2  . ALA A 1 75  ? 35.950  84.956  -27.302 1.00 88.14  ? 72   ALA A HB2  1 
ATOM   1202  H  HB3  . ALA A 1 75  ? 35.541  84.201  -28.639 1.00 88.14  ? 72   ALA A HB3  1 
ATOM   1203  N  N    . ALA A 1 76  ? 37.853  82.566  -25.874 1.00 91.37  ? 73   ALA A N    1 
ATOM   1204  C  CA   . ALA A 1 76  ? 38.442  82.434  -24.548 1.00 87.45  ? 73   ALA A CA   1 
ATOM   1205  C  C    . ALA A 1 76  ? 39.884  81.926  -24.592 1.00 90.29  ? 73   ALA A C    1 
ATOM   1206  O  O    . ALA A 1 76  ? 40.728  82.385  -23.815 1.00 89.46  ? 73   ALA A O    1 
ATOM   1207  C  CB   . ALA A 1 76  ? 37.589  81.507  -23.698 1.00 87.57  ? 73   ALA A CB   1 
ATOM   1208  H  H    . ALA A 1 76  ? 37.330  81.922  -26.098 1.00 109.65 ? 73   ALA A H    1 
ATOM   1209  H  HA   . ALA A 1 76  ? 38.448  83.305  -24.121 1.00 104.95 ? 73   ALA A HA   1 
ATOM   1210  H  HB1  . ALA A 1 76  ? 37.549  80.636  -24.124 1.00 105.08 ? 73   ALA A HB1  1 
ATOM   1211  H  HB2  . ALA A 1 76  ? 37.991  81.427  -22.818 1.00 105.08 ? 73   ALA A HB2  1 
ATOM   1212  H  HB3  . ALA A 1 76  ? 36.697  81.880  -23.622 1.00 105.08 ? 73   ALA A HB3  1 
ATOM   1213  N  N    . ASN A 1 77  ? 40.165  80.999  -25.507 1.00 84.06  ? 74   ASN A N    1 
ATOM   1214  C  CA   . ASN A 1 77  ? 41.477  80.355  -25.576 1.00 88.75  ? 74   ASN A CA   1 
ATOM   1215  C  C    . ASN A 1 77  ? 41.879  79.834  -24.200 1.00 94.03  ? 74   ASN A C    1 
ATOM   1216  O  O    . ASN A 1 77  ? 42.825  80.333  -23.589 1.00 87.27  ? 74   ASN A O    1 
ATOM   1217  C  CB   . ASN A 1 77  ? 42.539  81.321  -26.108 1.00 72.77  ? 74   ASN A CB   1 
ATOM   1218  C  CG   . ASN A 1 77  ? 42.361  81.628  -27.583 1.00 103.01 ? 74   ASN A CG   1 
ATOM   1219  O  OD1  . ASN A 1 77  ? 41.953  80.770  -28.370 1.00 95.72  ? 74   ASN A OD1  1 
ATOM   1220  N  ND2  . ASN A 1 77  ? 42.644  82.867  -27.962 1.00 119.66 ? 74   ASN A ND2  1 
ATOM   1221  H  H    . ASN A 1 77  ? 39.609  80.724  -26.103 1.00 100.87 ? 74   ASN A H    1 
ATOM   1222  H  HA   . ASN A 1 77  ? 41.428  79.599  -26.181 1.00 106.50 ? 74   ASN A HA   1 
ATOM   1223  H  HB2  . ASN A 1 77  ? 42.481  82.157  -25.619 1.00 87.33  ? 74   ASN A HB2  1 
ATOM   1224  H  HB3  . ASN A 1 77  ? 43.416  80.925  -25.987 1.00 87.33  ? 74   ASN A HB3  1 
ATOM   1225  H  HD21 . ASN A 1 77  ? 42.911  83.444  -27.383 1.00 143.59 ? 74   ASN A HD21 1 
ATOM   1226  H  HD22 . ASN A 1 77  ? 42.560  83.094  -28.788 1.00 143.59 ? 74   ASN A HD22 1 
ATOM   1227  N  N    . PRO A 1 78  ? 41.151  78.826  -23.702 1.00 85.68  ? 75   PRO A N    1 
ATOM   1228  C  CA   . PRO A 1 78  ? 41.378  78.319  -22.351 1.00 65.95  ? 75   PRO A CA   1 
ATOM   1229  C  C    . PRO A 1 78  ? 42.606  77.431  -22.257 1.00 69.58  ? 75   PRO A C    1 
ATOM   1230  O  O    . PRO A 1 78  ? 43.007  76.808  -23.236 1.00 62.39  ? 75   PRO A O    1 
ATOM   1231  C  CB   . PRO A 1 78  ? 40.102  77.529  -22.061 1.00 64.27  ? 75   PRO A CB   1 
ATOM   1232  C  CG   . PRO A 1 78  ? 39.667  77.045  -23.391 1.00 74.36  ? 75   PRO A CG   1 
ATOM   1233  C  CD   . PRO A 1 78  ? 39.990  78.178  -24.337 1.00 80.17  ? 75   PRO A CD   1 
ATOM   1234  H  HA   . PRO A 1 78  ? 41.456  79.052  -21.720 1.00 79.14  ? 75   PRO A HA   1 
ATOM   1235  H  HB2  . PRO A 1 78  ? 40.302  76.785  -21.471 1.00 77.12  ? 75   PRO A HB2  1 
ATOM   1236  H  HB3  . PRO A 1 78  ? 39.434  78.113  -21.670 1.00 77.12  ? 75   PRO A HB3  1 
ATOM   1237  H  HG2  . PRO A 1 78  ? 40.163  76.246  -23.628 1.00 89.24  ? 75   PRO A HG2  1 
ATOM   1238  H  HG3  . PRO A 1 78  ? 38.713  76.868  -23.379 1.00 89.24  ? 75   PRO A HG3  1 
ATOM   1239  H  HD2  . PRO A 1 78  ? 40.231  77.832  -25.211 1.00 96.20  ? 75   PRO A HD2  1 
ATOM   1240  H  HD3  . PRO A 1 78  ? 39.245  78.797  -24.392 1.00 96.20  ? 75   PRO A HD3  1 
ATOM   1241  N  N    . TYR A 1 79  ? 43.218  77.424  -21.079 1.00 75.42  ? 76   TYR A N    1 
ATOM   1242  C  CA   . TYR A 1 79  ? 44.363  76.573  -20.810 1.00 68.93  ? 76   TYR A CA   1 
ATOM   1243  C  C    . TYR A 1 79  ? 43.902  75.160  -20.502 1.00 65.59  ? 76   TYR A C    1 
ATOM   1244  O  O    . TYR A 1 79  ? 44.608  74.196  -20.796 1.00 65.39  ? 76   TYR A O    1 
ATOM   1245  C  CB   . TYR A 1 79  ? 45.175  77.125  -19.649 1.00 65.25  ? 76   TYR A CB   1 
ATOM   1246  C  CG   . TYR A 1 79  ? 46.077  78.273  -20.026 1.00 74.89  ? 76   TYR A CG   1 
ATOM   1247  C  CD1  . TYR A 1 79  ? 45.560  79.524  -20.321 1.00 80.82  ? 76   TYR A CD1  1 
ATOM   1248  C  CD2  . TYR A 1 79  ? 47.453  78.100  -20.088 1.00 71.85  ? 76   TYR A CD2  1 
ATOM   1249  C  CE1  . TYR A 1 79  ? 46.389  80.571  -20.667 1.00 85.04  ? 76   TYR A CE1  1 
ATOM   1250  C  CE2  . TYR A 1 79  ? 48.288  79.136  -20.432 1.00 73.30  ? 76   TYR A CE2  1 
ATOM   1251  C  CZ   . TYR A 1 79  ? 47.755  80.370  -20.719 1.00 88.47  ? 76   TYR A CZ   1 
ATOM   1252  O  OH   . TYR A 1 79  ? 48.595  81.404  -21.060 1.00 103.30 ? 76   TYR A OH   1 
ATOM   1253  H  H    . TYR A 1 79  ? 42.984  77.911  -20.410 1.00 90.50  ? 76   TYR A H    1 
ATOM   1254  H  HA   . TYR A 1 79  ? 44.933  76.544  -21.594 1.00 82.72  ? 76   TYR A HA   1 
ATOM   1255  H  HB2  . TYR A 1 79  ? 44.565  77.439  -18.963 1.00 78.30  ? 76   TYR A HB2  1 
ATOM   1256  H  HB3  . TYR A 1 79  ? 45.732  76.415  -19.292 1.00 78.30  ? 76   TYR A HB3  1 
ATOM   1257  H  HD1  . TYR A 1 79  ? 44.641  79.660  -20.286 1.00 96.98  ? 76   TYR A HD1  1 
ATOM   1258  H  HD2  . TYR A 1 79  ? 47.816  77.266  -19.893 1.00 86.22  ? 76   TYR A HD2  1 
ATOM   1259  H  HE1  . TYR A 1 79  ? 46.031  81.407  -20.862 1.00 102.04 ? 76   TYR A HE1  1 
ATOM   1260  H  HE2  . TYR A 1 79  ? 49.208  79.004  -20.467 1.00 87.96  ? 76   TYR A HE2  1 
ATOM   1261  H  HH   . TYR A 1 79  ? 49.392  81.142  -21.051 1.00 123.96 ? 76   TYR A HH   1 
ATOM   1262  N  N    . LYS A 1 80  ? 42.728  75.059  -19.881 1.00 58.14  ? 77   LYS A N    1 
ATOM   1263  C  CA   . LYS A 1 80  ? 42.138  73.775  -19.526 1.00 59.84  ? 77   LYS A CA   1 
ATOM   1264  C  C    . LYS A 1 80  ? 40.689  73.716  -19.957 1.00 66.29  ? 77   LYS A C    1 
ATOM   1265  O  O    . LYS A 1 80  ? 39.946  74.681  -19.778 1.00 66.17  ? 77   LYS A O    1 
ATOM   1266  C  CB   . LYS A 1 80  ? 42.188  73.547  -18.018 1.00 66.51  ? 77   LYS A CB   1 
ATOM   1267  C  CG   . LYS A 1 80  ? 43.561  73.648  -17.383 1.00 63.46  ? 77   LYS A CG   1 
ATOM   1268  C  CD   . LYS A 1 80  ? 43.444  73.382  -15.896 1.00 64.31  ? 77   LYS A CD   1 
ATOM   1269  C  CE   . LYS A 1 80  ? 44.703  73.763  -15.147 1.00 82.31  ? 77   LYS A CE   1 
ATOM   1270  N  NZ   . LYS A 1 80  ? 44.412  73.981  -13.702 1.00 74.71  ? 77   LYS A NZ   1 
ATOM   1271  H  H    . LYS A 1 80  ? 42.247  75.734  -19.651 1.00 69.77  ? 77   LYS A H    1 
ATOM   1272  H  HA   . LYS A 1 80  ? 42.623  73.059  -19.965 1.00 71.81  ? 77   LYS A HA   1 
ATOM   1273  H  HB2  . LYS A 1 80  ? 41.621  74.208  -17.590 1.00 79.81  ? 77   LYS A HB2  1 
ATOM   1274  H  HB3  . LYS A 1 80  ? 41.846  72.659  -17.831 1.00 79.81  ? 77   LYS A HB3  1 
ATOM   1275  H  HG2  . LYS A 1 80  ? 44.151  72.984  -17.772 1.00 76.16  ? 77   LYS A HG2  1 
ATOM   1276  H  HG3  . LYS A 1 80  ? 43.917  74.541  -17.513 1.00 76.16  ? 77   LYS A HG3  1 
ATOM   1277  H  HD2  . LYS A 1 80  ? 42.710  73.904  -15.536 1.00 77.17  ? 77   LYS A HD2  1 
ATOM   1278  H  HD3  . LYS A 1 80  ? 43.283  72.437  -15.753 1.00 77.17  ? 77   LYS A HD3  1 
ATOM   1279  H  HE2  . LYS A 1 80  ? 45.353  73.047  -15.223 1.00 98.77  ? 77   LYS A HE2  1 
ATOM   1280  H  HE3  . LYS A 1 80  ? 45.061  74.586  -15.515 1.00 98.77  ? 77   LYS A HE3  1 
ATOM   1281  H  HZ1  . LYS A 1 80  ? 44.082  73.237  -13.342 1.00 89.65  ? 77   LYS A HZ1  1 
ATOM   1282  H  HZ2  . LYS A 1 80  ? 45.158  74.204  -13.272 1.00 89.65  ? 77   LYS A HZ2  1 
ATOM   1283  H  HZ3  . LYS A 1 80  ? 43.816  74.636  -13.607 1.00 89.65  ? 77   LYS A HZ3  1 
ATOM   1284  N  N    . ILE A 1 81  ? 40.273  72.551  -20.443 1.00 70.68  ? 78   ILE A N    1 
ATOM   1285  C  CA   . ILE A 1 81  ? 38.876  72.293  -20.773 1.00 63.72  ? 78   ILE A CA   1 
ATOM   1286  C  C    . ILE A 1 81  ? 38.403  71.032  -20.068 1.00 52.99  ? 78   ILE A C    1 
ATOM   1287  O  O    . ILE A 1 81  ? 38.987  69.963  -20.242 1.00 47.28  ? 78   ILE A O    1 
ATOM   1288  C  CB   . ILE A 1 81  ? 38.665  72.127  -22.293 1.00 66.90  ? 78   ILE A CB   1 
ATOM   1289  C  CG1  . ILE A 1 81  ? 39.219  73.338  -23.045 1.00 70.86  ? 78   ILE A CG1  1 
ATOM   1290  C  CG2  . ILE A 1 81  ? 37.175  71.943  -22.603 1.00 66.15  ? 78   ILE A CG2  1 
ATOM   1291  C  CD1  . ILE A 1 81  ? 39.159  73.196  -24.570 1.00 76.09  ? 78   ILE A CD1  1 
ATOM   1292  H  H    . ILE A 1 81  ? 40.792  71.881  -20.594 1.00 84.82  ? 78   ILE A H    1 
ATOM   1293  H  HA   . ILE A 1 81  ? 38.331  73.036  -20.469 1.00 76.46  ? 78   ILE A HA   1 
ATOM   1294  H  HB   . ILE A 1 81  ? 39.142  71.336  -22.587 1.00 80.28  ? 78   ILE A HB   1 
ATOM   1295  H  HG12 . ILE A 1 81  ? 38.703  74.122  -22.800 1.00 85.03  ? 78   ILE A HG12 1 
ATOM   1296  H  HG13 . ILE A 1 81  ? 40.148  73.464  -22.795 1.00 85.03  ? 78   ILE A HG13 1 
ATOM   1297  H  HG21 . ILE A 1 81  ? 36.690  72.724  -22.294 1.00 79.38  ? 78   ILE A HG21 1 
ATOM   1298  H  HG22 . ILE A 1 81  ? 37.063  71.841  -23.561 1.00 79.38  ? 78   ILE A HG22 1 
ATOM   1299  H  HG23 . ILE A 1 81  ? 36.853  71.150  -22.145 1.00 79.38  ? 78   ILE A HG23 1 
ATOM   1300  H  HD11 . ILE A 1 81  ? 38.235  73.081  -24.840 1.00 91.31  ? 78   ILE A HD11 1 
ATOM   1301  H  HD12 . ILE A 1 81  ? 39.526  73.998  -24.976 1.00 91.31  ? 78   ILE A HD12 1 
ATOM   1302  H  HD13 . ILE A 1 81  ? 39.681  72.423  -24.836 1.00 91.31  ? 78   ILE A HD13 1 
ATOM   1303  N  N    . ASP A 1 82  ? 37.350  71.164  -19.271 1.00 53.15  ? 79   ASP A N    1 
ATOM   1304  C  CA   . ASP A 1 82  ? 36.761  70.014  -18.601 1.00 50.13  ? 79   ASP A CA   1 
ATOM   1305  C  C    . ASP A 1 82  ? 35.321  69.793  -19.043 1.00 58.06  ? 79   ASP A C    1 
ATOM   1306  O  O    . ASP A 1 82  ? 34.548  70.742  -19.206 1.00 71.77  ? 79   ASP A O    1 
ATOM   1307  C  CB   . ASP A 1 82  ? 36.823  70.190  -17.080 1.00 58.15  ? 79   ASP A CB   1 
ATOM   1308  C  CG   . ASP A 1 82  ? 38.258  70.300  -16.551 1.00 71.30  ? 79   ASP A CG   1 
ATOM   1309  O  OD1  . ASP A 1 82  ? 39.173  69.685  -17.146 1.00 62.84  ? 79   ASP A OD1  1 
ATOM   1310  O  OD2  . ASP A 1 82  ? 38.477  70.998  -15.532 1.00 81.21  ? 79   ASP A OD2  1 
ATOM   1311  H  H    . ASP A 1 82  ? 36.957  71.910  -19.102 1.00 63.77  ? 79   ASP A H    1 
ATOM   1312  H  HA   . ASP A 1 82  ? 37.270  69.221  -18.832 1.00 60.15  ? 79   ASP A HA   1 
ATOM   1313  H  HB2  . ASP A 1 82  ? 36.351  71.002  -16.836 1.00 69.78  ? 79   ASP A HB2  1 
ATOM   1314  H  HB3  . ASP A 1 82  ? 36.406  69.424  -16.657 1.00 69.78  ? 79   ASP A HB3  1 
ATOM   1315  N  N    . ILE A 1 83  ? 34.991  68.523  -19.252 1.00 60.31  ? 80   ILE A N    1 
ATOM   1316  C  CA   . ILE A 1 83  ? 33.651  68.077  -19.621 1.00 46.68  ? 80   ILE A CA   1 
ATOM   1317  C  C    . ILE A 1 83  ? 32.897  67.566  -18.416 1.00 51.09  ? 80   ILE A C    1 
ATOM   1318  O  O    . ILE A 1 83  ? 33.452  66.828  -17.603 1.00 66.60  ? 80   ILE A O    1 
ATOM   1319  C  CB   . ILE A 1 83  ? 33.702  66.956  -20.653 1.00 46.98  ? 80   ILE A CB   1 
ATOM   1320  C  CG1  . ILE A 1 83  ? 34.521  67.412  -21.874 1.00 49.02  ? 80   ILE A CG1  1 
ATOM   1321  C  CG2  . ILE A 1 83  ? 32.281  66.552  -21.043 1.00 46.06  ? 80   ILE A CG2  1 
ATOM   1322  C  CD1  . ILE A 1 83  ? 34.678  66.342  -22.974 1.00 49.96  ? 80   ILE A CD1  1 
ATOM   1323  H  H    . ILE A 1 83  ? 35.551  67.874  -19.182 1.00 72.37  ? 80   ILE A H    1 
ATOM   1324  H  HA   . ILE A 1 83  ? 33.157  68.821  -20.000 1.00 56.02  ? 80   ILE A HA   1 
ATOM   1325  H  HB   . ILE A 1 83  ? 34.142  66.189  -20.255 1.00 56.38  ? 80   ILE A HB   1 
ATOM   1326  H  HG12 . ILE A 1 83  ? 34.084  68.181  -22.271 1.00 58.82  ? 80   ILE A HG12 1 
ATOM   1327  H  HG13 . ILE A 1 83  ? 35.410  67.659  -21.575 1.00 58.82  ? 80   ILE A HG13 1 
ATOM   1328  H  HG21 . ILE A 1 83  ? 31.826  67.322  -21.420 1.00 55.27  ? 80   ILE A HG21 1 
ATOM   1329  H  HG22 . ILE A 1 83  ? 32.325  65.839  -21.700 1.00 55.27  ? 80   ILE A HG22 1 
ATOM   1330  H  HG23 . ILE A 1 83  ? 31.812  66.245  -20.251 1.00 55.27  ? 80   ILE A HG23 1 
ATOM   1331  H  HD11 . ILE A 1 83  ? 33.799  66.090  -23.297 1.00 59.96  ? 80   ILE A HD11 1 
ATOM   1332  H  HD12 . ILE A 1 83  ? 35.205  66.712  -23.700 1.00 59.96  ? 80   ILE A HD12 1 
ATOM   1333  H  HD13 . ILE A 1 83  ? 35.128  65.568  -22.600 1.00 59.96  ? 80   ILE A HD13 1 
ATOM   1334  N  N    . GLY A 1 84  ? 31.630  67.941  -18.316 1.00 51.97  ? 81   GLY A N    1 
ATOM   1335  C  CA   . GLY A 1 84  ? 30.811  67.558  -17.183 1.00 46.60  ? 81   GLY A CA   1 
ATOM   1336  C  C    . GLY A 1 84  ? 29.574  66.803  -17.614 1.00 47.32  ? 81   GLY A C    1 
ATOM   1337  O  O    . GLY A 1 84  ? 29.538  66.203  -18.688 1.00 58.68  ? 81   GLY A O    1 
ATOM   1338  H  H    . GLY A 1 84  ? 31.219  68.422  -18.898 1.00 62.36  ? 81   GLY A H    1 
ATOM   1339  H  HA2  . GLY A 1 84  ? 31.326  66.994  -16.585 1.00 55.92  ? 81   GLY A HA2  1 
ATOM   1340  H  HA3  . GLY A 1 84  ? 30.535  68.352  -16.698 1.00 55.92  ? 81   GLY A HA3  1 
ATOM   1341  N  N    . ALA A 1 85  ? 28.531  66.911  -16.801 1.00 45.85  ? 82   ALA A N    1 
ATOM   1342  C  CA   . ALA A 1 85  ? 27.281  66.187  -17.011 1.00 52.54  ? 82   ALA A CA   1 
ATOM   1343  C  C    . ALA A 1 85  ? 26.349  66.862  -18.011 1.00 59.93  ? 82   ALA A C    1 
ATOM   1344  O  O    . ALA A 1 85  ? 26.542  68.016  -18.401 1.00 61.62  ? 82   ALA A O    1 
ATOM   1345  C  CB   . ALA A 1 85  ? 26.549  66.032  -15.682 1.00 52.78  ? 82   ALA A CB   1 
ATOM   1346  H  H    . ALA A 1 85  ? 28.522  67.411  -16.101 1.00 55.02  ? 82   ALA A H    1 
ATOM   1347  H  HA   . ALA A 1 85  ? 27.484  65.299  -17.346 1.00 63.05  ? 82   ALA A HA   1 
ATOM   1348  H  HB1  . ALA A 1 85  ? 26.359  66.913  -15.323 1.00 63.33  ? 82   ALA A HB1  1 
ATOM   1349  H  HB2  . ALA A 1 85  ? 25.721  65.550  -15.833 1.00 63.33  ? 82   ALA A HB2  1 
ATOM   1350  H  HB3  . ALA A 1 85  ? 27.113  65.537  -15.068 1.00 63.33  ? 82   ALA A HB3  1 
ATOM   1351  N  N    . VAL A 1 86  ? 25.323  66.119  -18.404 1.00 61.46  ? 83   VAL A N    1 
ATOM   1352  C  CA   . VAL A 1 86  ? 24.184  66.666  -19.127 1.00 51.95  ? 83   VAL A CA   1 
ATOM   1353  C  C    . VAL A 1 86  ? 23.100  66.947  -18.095 1.00 61.71  ? 83   VAL A C    1 
ATOM   1354  O  O    . VAL A 1 86  ? 22.675  66.037  -17.376 1.00 64.05  ? 83   VAL A O    1 
ATOM   1355  C  CB   . VAL A 1 86  ? 23.682  65.705  -20.201 1.00 55.68  ? 83   VAL A CB   1 
ATOM   1356  C  CG1  . VAL A 1 86  ? 22.459  66.286  -20.918 1.00 69.50  ? 83   VAL A CG1  1 
ATOM   1357  C  CG2  . VAL A 1 86  ? 24.801  65.417  -21.198 1.00 63.08  ? 83   VAL A CG2  1 
ATOM   1358  H  H    . VAL A 1 86  ? 25.262  65.273  -18.260 1.00 73.75  ? 83   VAL A H    1 
ATOM   1359  H  HA   . VAL A 1 86  ? 24.436  67.502  -19.550 1.00 62.34  ? 83   VAL A HA   1 
ATOM   1360  H  HB   . VAL A 1 86  ? 23.422  64.868  -19.785 1.00 66.81  ? 83   VAL A HB   1 
ATOM   1361  H  HG11 . VAL A 1 86  ? 22.707  67.126  -21.335 1.00 83.39  ? 83   VAL A HG11 1 
ATOM   1362  H  HG12 . VAL A 1 86  ? 22.161  65.657  -21.594 1.00 83.39  ? 83   VAL A HG12 1 
ATOM   1363  H  HG13 . VAL A 1 86  ? 21.753  66.434  -20.269 1.00 83.39  ? 83   VAL A HG13 1 
ATOM   1364  H  HG21 . VAL A 1 86  ? 25.548  65.017  -20.727 1.00 75.70  ? 83   VAL A HG21 1 
ATOM   1365  H  HG22 . VAL A 1 86  ? 24.470  64.806  -21.875 1.00 75.70  ? 83   VAL A HG22 1 
ATOM   1366  H  HG23 . VAL A 1 86  ? 25.078  66.250  -21.611 1.00 75.70  ? 83   VAL A HG23 1 
ATOM   1367  N  N    . TYR A 1 87  ? 22.686  68.210  -17.990 1.00 72.45  ? 84   TYR A N    1 
ATOM   1368  C  CA   . TYR A 1 87  ? 21.815  68.646  -16.893 1.00 70.58  ? 84   TYR A CA   1 
ATOM   1369  C  C    . TYR A 1 87  ? 20.326  68.712  -17.262 1.00 76.88  ? 84   TYR A C    1 
ATOM   1370  O  O    . TYR A 1 87  ? 19.938  68.500  -18.410 1.00 70.98  ? 84   TYR A O    1 
ATOM   1371  C  CB   . TYR A 1 87  ? 22.268  70.022  -16.400 1.00 61.74  ? 84   TYR A CB   1 
ATOM   1372  C  CG   . TYR A 1 87  ? 23.475  69.964  -15.496 1.00 64.70  ? 84   TYR A CG   1 
ATOM   1373  C  CD1  . TYR A 1 87  ? 24.756  69.860  -16.022 1.00 59.89  ? 84   TYR A CD1  1 
ATOM   1374  C  CD2  . TYR A 1 87  ? 23.334  69.993  -14.116 1.00 70.41  ? 84   TYR A CD2  1 
ATOM   1375  C  CE1  . TYR A 1 87  ? 25.861  69.803  -15.199 1.00 66.07  ? 84   TYR A CE1  1 
ATOM   1376  C  CE2  . TYR A 1 87  ? 24.431  69.932  -13.285 1.00 69.08  ? 84   TYR A CE2  1 
ATOM   1377  C  CZ   . TYR A 1 87  ? 25.693  69.836  -13.828 1.00 70.04  ? 84   TYR A CZ   1 
ATOM   1378  O  OH   . TYR A 1 87  ? 26.785  69.771  -12.993 1.00 66.06  ? 84   TYR A OH   1 
ATOM   1379  H  H    . TYR A 1 87  ? 22.895  68.836  -18.541 1.00 86.93  ? 84   TYR A H    1 
ATOM   1380  H  HA   . TYR A 1 87  ? 21.909  68.022  -16.157 1.00 84.69  ? 84   TYR A HA   1 
ATOM   1381  H  HB2  . TYR A 1 87  ? 22.494  70.572  -17.166 1.00 74.09  ? 84   TYR A HB2  1 
ATOM   1382  H  HB3  . TYR A 1 87  ? 21.543  70.431  -15.902 1.00 74.09  ? 84   TYR A HB3  1 
ATOM   1383  H  HD1  . TYR A 1 87  ? 24.871  69.838  -16.944 1.00 71.87  ? 84   TYR A HD1  1 
ATOM   1384  H  HD2  . TYR A 1 87  ? 22.483  70.057  -13.746 1.00 84.50  ? 84   TYR A HD2  1 
ATOM   1385  H  HE1  . TYR A 1 87  ? 26.714  69.735  -15.565 1.00 79.29  ? 84   TYR A HE1  1 
ATOM   1386  H  HE2  . TYR A 1 87  ? 24.319  69.955  -12.362 1.00 82.90  ? 84   TYR A HE2  1 
ATOM   1387  H  HH   . TYR A 1 87  ? 27.490  69.715  -13.446 1.00 79.28  ? 84   TYR A HH   1 
ATOM   1388  N  N    . SER A 1 88  ? 19.503  69.026  -16.267 1.00 79.37  ? 85   SER A N    1 
ATOM   1389  C  CA   . SER A 1 88  ? 18.057  69.129  -16.434 1.00 75.20  ? 85   SER A CA   1 
ATOM   1390  C  C    . SER A 1 88  ? 17.694  70.358  -17.254 1.00 77.38  ? 85   SER A C    1 
ATOM   1391  O  O    . SER A 1 88  ? 16.688  70.382  -17.955 1.00 75.82  ? 85   SER A O    1 
ATOM   1392  C  CB   . SER A 1 88  ? 17.373  69.212  -15.074 1.00 74.81  ? 85   SER A CB   1 
ATOM   1393  O  OG   . SER A 1 88  ? 17.971  70.241  -14.298 1.00 65.76  ? 85   SER A OG   1 
ATOM   1394  H  H    . SER A 1 88  ? 19.766  69.189  -15.464 1.00 95.24  ? 85   SER A H    1 
ATOM   1395  H  HA   . SER A 1 88  ? 17.728  68.342  -16.896 1.00 90.24  ? 85   SER A HA   1 
ATOM   1396  H  HB2  . SER A 1 88  ? 16.433  69.413  -15.201 1.00 89.78  ? 85   SER A HB2  1 
ATOM   1397  H  HB3  . SER A 1 88  ? 17.476  68.364  -14.613 1.00 89.78  ? 85   SER A HB3  1 
ATOM   1398  H  HG   . SER A 1 88  ? 17.596  70.289  -13.547 1.00 78.91  ? 85   SER A HG   1 
ATOM   1399  N  N    . HIS A 1 89  ? 18.533  71.379  -17.142 1.00 84.09  ? 86   HIS A N    1 
ATOM   1400  C  CA   . HIS A 1 89  ? 18.390  72.611  -17.899 1.00 72.14  ? 86   HIS A CA   1 
ATOM   1401  C  C    . HIS A 1 89  ? 19.726  72.988  -18.519 1.00 76.97  ? 86   HIS A C    1 
ATOM   1402  O  O    . HIS A 1 89  ? 20.715  72.276  -18.371 1.00 87.17  ? 86   HIS A O    1 
ATOM   1403  C  CB   . HIS A 1 89  ? 17.904  73.750  -17.001 1.00 77.17  ? 86   HIS A CB   1 
ATOM   1404  C  CG   . HIS A 1 89  ? 16.681  73.421  -16.205 1.00 74.65  ? 86   HIS A CG   1 
ATOM   1405  N  ND1  . HIS A 1 89  ? 16.730  72.721  -15.019 1.00 84.08  ? 86   HIS A ND1  1 
ATOM   1406  C  CD2  . HIS A 1 89  ? 15.377  73.718  -16.414 1.00 79.84  ? 86   HIS A CD2  1 
ATOM   1407  C  CE1  . HIS A 1 89  ? 15.507  72.592  -14.536 1.00 81.11  ? 86   HIS A CE1  1 
ATOM   1408  N  NE2  . HIS A 1 89  ? 14.668  73.187  -15.364 1.00 89.53  ? 86   HIS A NE2  1 
ATOM   1409  H  H    . HIS A 1 89  ? 19.214  71.380  -16.616 1.00 100.90 ? 86   HIS A H    1 
ATOM   1410  H  HA   . HIS A 1 89  ? 17.744  72.482  -18.611 1.00 86.57  ? 86   HIS A HA   1 
ATOM   1411  H  HB2  . HIS A 1 89  ? 18.611  73.978  -16.377 1.00 92.60  ? 86   HIS A HB2  1 
ATOM   1412  H  HB3  . HIS A 1 89  ? 17.698  74.518  -17.557 1.00 92.60  ? 86   HIS A HB3  1 
ATOM   1413  H  HD1  . HIS A 1 89  ? 17.444  72.413  -14.652 1.00 100.89 ? 86   HIS A HD1  1 
ATOM   1414  H  HD2  . HIS A 1 89  ? 15.026  74.188  -17.135 1.00 95.81  ? 86   HIS A HD2  1 
ATOM   1415  H  HE1  . HIS A 1 89  ? 15.276  72.154  -13.749 1.00 97.34  ? 86   HIS A HE1  1 
ATOM   1416  H  HE2  . HIS A 1 89  ? 13.815  73.234  -15.263 1.00 107.43 ? 86   HIS A HE2  1 
ATOM   1417  N  N    . ARG A 1 90  ? 19.749  74.109  -19.223 1.00 82.38  ? 87   ARG A N    1 
ATOM   1418  C  CA   . ARG A 1 90  ? 20.987  74.623  -19.781 1.00 83.84  ? 87   ARG A CA   1 
ATOM   1419  C  C    . ARG A 1 90  ? 21.802  75.201  -18.620 1.00 89.21  ? 87   ARG A C    1 
ATOM   1420  O  O    . ARG A 1 90  ? 21.275  75.999  -17.847 1.00 88.97  ? 87   ARG A O    1 
ATOM   1421  C  CB   . ARG A 1 90  ? 20.697  75.685  -20.844 1.00 87.33  ? 87   ARG A CB   1 
ATOM   1422  C  CG   . ARG A 1 90  ? 19.690  75.231  -21.897 1.00 92.88  ? 87   ARG A CG   1 
ATOM   1423  C  CD   . ARG A 1 90  ? 19.105  76.399  -22.666 1.00 87.06  ? 87   ARG A CD   1 
ATOM   1424  N  NE   . ARG A 1 90  ? 20.062  76.987  -23.596 1.00 90.39  ? 87   ARG A NE   1 
ATOM   1425  C  CZ   . ARG A 1 90  ? 20.207  76.610  -24.865 1.00 103.71 ? 87   ARG A CZ   1 
ATOM   1426  N  NH1  . ARG A 1 90  ? 19.459  75.639  -25.377 1.00 94.91  ? 87   ARG A NH1  1 
ATOM   1427  N  NH2  . ARG A 1 90  ? 21.108  77.210  -25.630 1.00 98.67  ? 87   ARG A NH2  1 
ATOM   1428  H  H    . ARG A 1 90  ? 19.059  74.593  -19.392 1.00 98.86  ? 87   ARG A H    1 
ATOM   1429  H  HA   . ARG A 1 90  ? 21.490  73.901  -20.188 1.00 100.61 ? 87   ARG A HA   1 
ATOM   1430  H  HB2  . ARG A 1 90  ? 20.338  76.474  -20.409 1.00 104.79 ? 87   ARG A HB2  1 
ATOM   1431  H  HB3  . ARG A 1 90  ? 21.524  75.907  -21.300 1.00 104.79 ? 87   ARG A HB3  1 
ATOM   1432  H  HG2  . ARG A 1 90  ? 20.134  74.644  -22.529 1.00 111.46 ? 87   ARG A HG2  1 
ATOM   1433  H  HG3  . ARG A 1 90  ? 18.962  74.762  -21.460 1.00 111.46 ? 87   ARG A HG3  1 
ATOM   1434  H  HD2  . ARG A 1 90  ? 18.339  76.091  -23.177 1.00 104.48 ? 87   ARG A HD2  1 
ATOM   1435  H  HD3  . ARG A 1 90  ? 18.832  77.087  -22.039 1.00 104.48 ? 87   ARG A HD3  1 
ATOM   1436  H  HE   . ARG A 1 90  ? 20.567  77.619  -23.305 1.00 108.47 ? 87   ARG A HE   1 
ATOM   1437  H  HH11 . ARG A 1 90  ? 18.872  75.244  -24.888 1.00 113.89 ? 87   ARG A HH11 1 
ATOM   1438  H  HH12 . ARG A 1 90  ? 19.563  75.404  -26.199 1.00 113.89 ? 87   ARG A HH12 1 
ATOM   1439  H  HH21 . ARG A 1 90  ? 21.596  77.839  -25.307 1.00 118.40 ? 87   ARG A HH21 1 
ATOM   1440  H  HH22 . ARG A 1 90  ? 21.204  76.969  -26.450 1.00 118.40 ? 87   ARG A HH22 1 
ATOM   1441  N  N    . PRO A 1 91  ? 23.061  74.752  -18.448 1.00 91.77  ? 88   PRO A N    1 
ATOM   1442  C  CA   . PRO A 1 91  ? 23.945  75.275  -17.392 1.00 88.86  ? 88   PRO A CA   1 
ATOM   1443  C  C    . PRO A 1 91  ? 24.066  76.807  -17.376 1.00 84.04  ? 88   PRO A C    1 
ATOM   1444  O  O    . PRO A 1 91  ? 24.056  77.408  -16.292 1.00 76.37  ? 88   PRO A O    1 
ATOM   1445  C  CB   . PRO A 1 91  ? 25.293  74.634  -17.730 1.00 84.29  ? 88   PRO A CB   1 
ATOM   1446  C  CG   . PRO A 1 91  ? 24.934  73.344  -18.376 1.00 73.11  ? 88   PRO A CG   1 
ATOM   1447  C  CD   . PRO A 1 91  ? 23.683  73.627  -19.170 1.00 82.10  ? 88   PRO A CD   1 
ATOM   1448  H  HA   . PRO A 1 91  ? 23.651  74.965  -16.521 1.00 106.63 ? 88   PRO A HA   1 
ATOM   1449  H  HB2  . PRO A 1 91  ? 25.784  75.203  -18.343 1.00 101.15 ? 88   PRO A HB2  1 
ATOM   1450  H  HB3  . PRO A 1 91  ? 25.799  74.483  -16.916 1.00 101.15 ? 88   PRO A HB3  1 
ATOM   1451  H  HG2  . PRO A 1 91  ? 25.654  73.062  -18.962 1.00 87.73  ? 88   PRO A HG2  1 
ATOM   1452  H  HG3  . PRO A 1 91  ? 24.763  72.675  -17.695 1.00 87.73  ? 88   PRO A HG3  1 
ATOM   1453  H  HD2  . PRO A 1 91  ? 23.909  73.891  -20.076 1.00 98.52  ? 88   PRO A HD2  1 
ATOM   1454  H  HD3  . PRO A 1 91  ? 23.095  72.855  -19.162 1.00 98.52  ? 88   PRO A HD3  1 
ATOM   1455  N  N    . ASN A 1 92  ? 24.187  77.402  -18.566 1.00 82.61  ? 89   ASN A N    1 
ATOM   1456  C  CA   . ASN A 1 92  ? 24.141  78.855  -18.762 1.00 76.15  ? 89   ASN A CA   1 
ATOM   1457  C  C    . ASN A 1 92  ? 23.064  79.511  -17.915 1.00 78.26  ? 89   ASN A C    1 
ATOM   1458  O  O    . ASN A 1 92  ? 23.282  80.555  -17.293 1.00 80.47  ? 89   ASN A O    1 
ATOM   1459  C  CB   . ASN A 1 92  ? 23.878  79.188  -20.247 1.00 68.72  ? 89   ASN A CB   1 
ATOM   1460  C  CG   . ASN A 1 92  ? 25.138  79.125  -21.101 1.00 74.47  ? 89   ASN A CG   1 
ATOM   1461  O  OD1  . ASN A 1 92  ? 26.252  79.271  -20.600 1.00 86.25  ? 89   ASN A OD1  1 
ATOM   1462  N  ND2  . ASN A 1 92  ? 24.965  78.897  -22.399 1.00 71.09  ? 89   ASN A ND2  1 
ATOM   1463  H  H    . ASN A 1 92  ? 24.300  76.969  -19.300 1.00 99.13  ? 89   ASN A H    1 
ATOM   1464  H  HA   . ASN A 1 92  ? 24.997  79.237  -18.512 1.00 91.38  ? 89   ASN A HA   1 
ATOM   1465  H  HB2  . ASN A 1 92  ? 23.241  78.551  -20.606 1.00 82.47  ? 89   ASN A HB2  1 
ATOM   1466  H  HB3  . ASN A 1 92  ? 23.519  80.087  -20.310 1.00 82.47  ? 89   ASN A HB3  1 
ATOM   1467  H  HD21 . ASN A 1 92  ? 24.172  78.794  -22.716 1.00 85.31  ? 89   ASN A HD21 1 
ATOM   1468  H  HD22 . ASN A 1 92  ? 25.646  78.852  -22.922 1.00 85.31  ? 89   ASN A HD22 1 
ATOM   1469  N  N    . GLN A 1 93  ? 21.915  78.852  -17.851 1.00 74.47  ? 90   GLN A N    1 
ATOM   1470  C  CA   . GLN A 1 93  ? 20.727  79.428  -17.250 1.00 82.21  ? 90   GLN A CA   1 
ATOM   1471  C  C    . GLN A 1 93  ? 20.566  78.969  -15.820 1.00 80.70  ? 90   GLN A C    1 
ATOM   1472  O  O    . GLN A 1 93  ? 19.492  79.124  -15.253 1.00 92.24  ? 90   GLN A O    1 
ATOM   1473  C  CB   . GLN A 1 93  ? 19.472  79.046  -18.050 1.00 98.12  ? 90   GLN A CB   1 
ATOM   1474  C  CG   . GLN A 1 93  ? 19.586  79.235  -19.558 1.00 101.31 ? 90   GLN A CG   1 
ATOM   1475  C  CD   . GLN A 1 93  ? 19.871  80.669  -19.944 1.00 109.96 ? 90   GLN A CD   1 
ATOM   1476  O  OE1  . GLN A 1 93  ? 19.384  81.604  -19.302 1.00 107.01 ? 90   GLN A OE1  1 
ATOM   1477  N  NE2  . GLN A 1 93  ? 20.667  80.854  -20.995 1.00 108.75 ? 90   GLN A NE2  1 
ATOM   1478  H  H    . GLN A 1 93  ? 21.799  78.056  -18.154 1.00 89.37  ? 90   GLN A H    1 
ATOM   1479  H  HA   . GLN A 1 93  ? 20.806  80.395  -17.252 1.00 98.66  ? 90   GLN A HA   1 
ATOM   1480  H  HB2  . GLN A 1 93  ? 19.275  78.111  -17.886 1.00 117.75 ? 90   GLN A HB2  1 
ATOM   1481  H  HB3  . GLN A 1 93  ? 18.732  79.593  -17.742 1.00 117.75 ? 90   GLN A HB3  1 
ATOM   1482  H  HG2  . GLN A 1 93  ? 20.312  78.684  -19.892 1.00 121.57 ? 90   GLN A HG2  1 
ATOM   1483  H  HG3  . GLN A 1 93  ? 18.750  78.972  -19.974 1.00 121.57 ? 90   GLN A HG3  1 
ATOM   1484  H  HE21 . GLN A 1 93  ? 20.989  80.176  -21.416 1.00 130.50 ? 90   GLN A HE21 1 
ATOM   1485  H  HE22 . GLN A 1 93  ? 20.859  81.651  -21.254 1.00 130.50 ? 90   GLN A HE22 1 
ATOM   1486  N  N    . HIS A 1 94  ? 21.606  78.379  -15.236 1.00 87.18  ? 91   HIS A N    1 
ATOM   1487  C  CA   . HIS A 1 94  ? 21.453  77.800  -13.906 1.00 84.77  ? 91   HIS A CA   1 
ATOM   1488  C  C    . HIS A 1 94  ? 21.003  78.854  -12.890 1.00 90.71  ? 91   HIS A C    1 
ATOM   1489  O  O    . HIS A 1 94  ? 20.337  78.519  -11.909 1.00 90.55  ? 91   HIS A O    1 
ATOM   1490  C  CB   . HIS A 1 94  ? 22.759  77.134  -13.454 1.00 85.19  ? 91   HIS A CB   1 
ATOM   1491  C  CG   . HIS A 1 94  ? 23.785  78.088  -12.921 1.00 82.91  ? 91   HIS A CG   1 
ATOM   1492  N  ND1  . HIS A 1 94  ? 23.807  78.503  -11.604 1.00 84.81  ? 91   HIS A ND1  1 
ATOM   1493  C  CD2  . HIS A 1 94  ? 24.827  78.706  -13.528 1.00 77.92  ? 91   HIS A CD2  1 
ATOM   1494  C  CE1  . HIS A 1 94  ? 24.823  79.330  -11.422 1.00 87.27  ? 91   HIS A CE1  1 
ATOM   1495  N  NE2  . HIS A 1 94  ? 25.456  79.471  -12.574 1.00 85.57  ? 91   HIS A NE2  1 
ATOM   1496  H  H    . HIS A 1 94  ? 22.391  78.303  -15.578 1.00 104.61 ? 91   HIS A H    1 
ATOM   1497  H  HA   . HIS A 1 94  ? 20.768  77.113  -13.942 1.00 101.73 ? 91   HIS A HA   1 
ATOM   1498  H  HB2  . HIS A 1 94  ? 22.556  76.496  -12.752 1.00 102.23 ? 91   HIS A HB2  1 
ATOM   1499  H  HB3  . HIS A 1 94  ? 23.151  76.673  -14.212 1.00 102.23 ? 91   HIS A HB3  1 
ATOM   1500  H  HD1  . HIS A 1 94  ? 23.252  78.256  -10.995 1.00 101.77 ? 91   HIS A HD1  1 
ATOM   1501  H  HD2  . HIS A 1 94  ? 25.074  78.624  -14.421 1.00 93.51  ? 91   HIS A HD2  1 
ATOM   1502  H  HE1  . HIS A 1 94  ? 25.049  79.746  -10.622 1.00 104.72 ? 91   HIS A HE1  1 
ATOM   1503  H  HE2  . HIS A 1 94  ? 26.148  79.964  -12.706 1.00 102.68 ? 91   HIS A HE2  1 
ATOM   1504  N  N    . ASN A 1 95  ? 21.320  80.124  -13.156 1.00 92.43  ? 92   ASN A N    1 
ATOM   1505  C  CA   . ASN A 1 95  ? 20.887  81.223  -12.290 1.00 86.02  ? 92   ASN A CA   1 
ATOM   1506  C  C    . ASN A 1 95  ? 19.364  81.371  -12.286 1.00 93.40  ? 92   ASN A C    1 
ATOM   1507  O  O    . ASN A 1 95  ? 18.773  81.790  -11.293 1.00 92.76  ? 92   ASN A O    1 
ATOM   1508  C  CB   . ASN A 1 95  ? 21.532  82.537  -12.737 1.00 86.14  ? 92   ASN A CB   1 
ATOM   1509  C  CG   . ASN A 1 95  ? 23.052  82.509  -12.643 1.00 93.05  ? 92   ASN A CG   1 
ATOM   1510  O  OD1  . ASN A 1 95  ? 23.619  82.605  -11.552 1.00 89.35  ? 92   ASN A OD1  1 
ATOM   1511  N  ND2  . ASN A 1 95  ? 23.720  82.386  -13.789 1.00 91.52  ? 92   ASN A ND2  1 
ATOM   1512  H  H    . ASN A 1 95  ? 21.786  80.376  -13.833 1.00 110.92 ? 92   ASN A H    1 
ATOM   1513  H  HA   . ASN A 1 95  ? 21.173  81.042  -11.381 1.00 103.22 ? 92   ASN A HA   1 
ATOM   1514  H  HB2  . ASN A 1 95  ? 21.292  82.709  -13.661 1.00 103.37 ? 92   ASN A HB2  1 
ATOM   1515  H  HB3  . ASN A 1 95  ? 21.210  83.256  -12.172 1.00 103.37 ? 92   ASN A HB3  1 
ATOM   1516  H  HD21 . ASN A 1 95  ? 23.291  82.327  -14.532 1.00 109.83 ? 92   ASN A HD21 1 
ATOM   1517  H  HD22 . ASN A 1 95  ? 24.579  82.365  -13.786 1.00 109.83 ? 92   ASN A HD22 1 
ATOM   1518  N  N    . THR A 1 96  ? 18.746  80.979  -13.397 1.00 89.73  ? 93   THR A N    1 
ATOM   1519  C  CA   . THR A 1 96  ? 17.306  81.124  -13.619 1.00 83.44  ? 93   THR A CA   1 
ATOM   1520  C  C    . THR A 1 96  ? 16.499  79.959  -13.072 1.00 85.48  ? 93   THR A C    1 
ATOM   1521  O  O    . THR A 1 96  ? 15.273  80.026  -13.024 1.00 87.14  ? 93   THR A O    1 
ATOM   1522  C  CB   . THR A 1 96  ? 16.962  81.218  -15.114 1.00 87.26  ? 93   THR A CB   1 
ATOM   1523  O  OG1  . THR A 1 96  ? 16.801  79.898  -15.652 1.00 93.52  ? 93   THR A OG1  1 
ATOM   1524  C  CG2  . THR A 1 96  ? 18.040  81.974  -15.892 1.00 98.69  ? 93   THR A CG2  1 
ATOM   1525  H  H    . THR A 1 96  ? 19.153  80.613  -14.060 1.00 107.67 ? 93   THR A H    1 
ATOM   1526  H  HA   . THR A 1 96  ? 16.998  81.935  -13.186 1.00 100.12 ? 93   THR A HA   1 
ATOM   1527  H  HB   . THR A 1 96  ? 16.128  81.702  -15.214 1.00 104.72 ? 93   THR A HB   1 
ATOM   1528  H  HG1  . THR A 1 96  ? 17.512  79.461  -15.560 1.00 112.22 ? 93   THR A HG1  1 
ATOM   1529  H  HG21 . THR A 1 96  ? 18.892  81.519  -15.806 1.00 118.42 ? 93   THR A HG21 1 
ATOM   1530  H  HG22 . THR A 1 96  ? 17.800  82.020  -16.831 1.00 118.42 ? 93   THR A HG22 1 
ATOM   1531  H  HG23 . THR A 1 96  ? 18.128  82.876  -15.545 1.00 118.42 ? 93   THR A HG23 1 
ATOM   1532  N  N    . VAL A 1 97  ? 17.187  78.879  -12.708 1.00 93.89  ? 94   VAL A N    1 
ATOM   1533  C  CA   . VAL A 1 97  ? 16.529  77.651  -12.261 1.00 86.03  ? 94   VAL A CA   1 
ATOM   1534  C  C    . VAL A 1 97  ? 16.361  77.635  -10.752 1.00 74.08  ? 94   VAL A C    1 
ATOM   1535  O  O    . VAL A 1 97  ? 17.283  77.967  -10.007 1.00 78.39  ? 94   VAL A O    1 
ATOM   1536  C  CB   . VAL A 1 97  ? 17.304  76.395  -12.696 1.00 75.96  ? 94   VAL A CB   1 
ATOM   1537  C  CG1  . VAL A 1 97  ? 16.533  75.132  -12.309 1.00 77.70  ? 94   VAL A CG1  1 
ATOM   1538  C  CG2  . VAL A 1 97  ? 17.548  76.420  -14.203 1.00 71.40  ? 94   VAL A CG2  1 
ATOM   1539  H  H    . VAL A 1 97  ? 18.045  78.831  -12.711 1.00 112.66 ? 94   VAL A H    1 
ATOM   1540  H  HA   . VAL A 1 97  ? 15.646  77.607  -12.659 1.00 103.24 ? 94   VAL A HA   1 
ATOM   1541  H  HB   . VAL A 1 97  ? 18.165  76.377  -12.248 1.00 91.15  ? 94   VAL A HB   1 
ATOM   1542  H  HG11 . VAL A 1 97  ? 15.669  75.143  -12.749 1.00 93.24  ? 94   VAL A HG11 1 
ATOM   1543  H  HG12 . VAL A 1 97  ? 17.039  74.354  -12.592 1.00 93.24  ? 94   VAL A HG12 1 
ATOM   1544  H  HG13 . VAL A 1 97  ? 16.414  75.118  -11.346 1.00 93.24  ? 94   VAL A HG13 1 
ATOM   1545  H  HG21 . VAL A 1 97  ? 18.065  77.210  -14.426 1.00 85.68  ? 94   VAL A HG21 1 
ATOM   1546  H  HG22 . VAL A 1 97  ? 18.037  75.621  -14.456 1.00 85.68  ? 94   VAL A HG22 1 
ATOM   1547  H  HG23 . VAL A 1 97  ? 16.693  76.444  -14.660 1.00 85.68  ? 94   VAL A HG23 1 
ATOM   1548  N  N    . LYS A 1 98  ? 15.169  77.248  -10.310 1.00 74.89  ? 95   LYS A N    1 
ATOM   1549  C  CA   . LYS A 1 98  ? 14.847  77.255  -8.894  1.00 85.91  ? 95   LYS A CA   1 
ATOM   1550  C  C    . LYS A 1 98  ? 15.621  76.170  -8.162  1.00 91.25  ? 95   LYS A C    1 
ATOM   1551  O  O    . LYS A 1 98  ? 15.887  75.100  -8.714  1.00 94.49  ? 95   LYS A O    1 
ATOM   1552  C  CB   . LYS A 1 98  ? 13.343  77.058  -8.675  1.00 83.50  ? 95   LYS A CB   1 
ATOM   1553  C  CG   . LYS A 1 98  ? 12.965  77.030  -7.200  1.00 113.67 ? 95   LYS A CG   1 
ATOM   1554  C  CD   . LYS A 1 98  ? 11.475  77.198  -6.971  1.00 114.70 ? 95   LYS A CD   1 
ATOM   1555  C  CE   . LYS A 1 98  ? 11.172  77.350  -5.482  1.00 111.41 ? 95   LYS A CE   1 
ATOM   1556  N  NZ   . LYS A 1 98  ? 9.733   77.627  -5.228  1.00 116.37 ? 95   LYS A NZ   1 
ATOM   1557  H  H    . LYS A 1 98  ? 14.528  76.977  -10.815 1.00 89.87  ? 95   LYS A H    1 
ATOM   1558  H  HA   . LYS A 1 98  ? 15.098  78.112  -8.515  1.00 103.09 ? 95   LYS A HA   1 
ATOM   1559  H  HB2  . LYS A 1 98  ? 12.864  77.790  -9.094  1.00 100.20 ? 95   LYS A HB2  1 
ATOM   1560  H  HB3  . LYS A 1 98  ? 13.074  76.214  -9.071  1.00 100.20 ? 95   LYS A HB3  1 
ATOM   1561  H  HG2  . LYS A 1 98  ? 13.232  76.177  -6.822  1.00 136.41 ? 95   LYS A HG2  1 
ATOM   1562  H  HG3  . LYS A 1 98  ? 13.423  77.753  -6.743  1.00 136.41 ? 95   LYS A HG3  1 
ATOM   1563  H  HD2  . LYS A 1 98  ? 11.166  77.996  -7.429  1.00 137.64 ? 95   LYS A HD2  1 
ATOM   1564  H  HD3  . LYS A 1 98  ? 11.007  76.415  -7.301  1.00 137.64 ? 95   LYS A HD3  1 
ATOM   1565  H  HE2  . LYS A 1 98  ? 11.407  76.527  -5.025  1.00 133.69 ? 95   LYS A HE2  1 
ATOM   1566  H  HE3  . LYS A 1 98  ? 11.690  78.089  -5.126  1.00 133.69 ? 95   LYS A HE3  1 
ATOM   1567  H  HZ1  . LYS A 1 98  ? 9.235   76.959  -5.541  1.00 139.64 ? 95   LYS A HZ1  1 
ATOM   1568  H  HZ2  . LYS A 1 98  ? 9.589   77.710  -4.354  1.00 139.64 ? 95   LYS A HZ2  1 
ATOM   1569  H  HZ3  . LYS A 1 98  ? 9.492   78.382  -5.634  1.00 139.64 ? 95   LYS A HZ3  1 
ATOM   1570  N  N    . LEU A 1 99  ? 16.006  76.470  -6.928  1.00 84.68  ? 96   LEU A N    1 
ATOM   1571  C  CA   . LEU A 1 99  ? 16.753  75.527  -6.113  1.00 91.14  ? 96   LEU A CA   1 
ATOM   1572  C  C    . LEU A 1 99  ? 15.980  74.220  -5.958  1.00 94.55  ? 96   LEU A C    1 
ATOM   1573  O  O    . LEU A 1 99  ? 14.887  74.207  -5.391  1.00 98.98  ? 96   LEU A O    1 
ATOM   1574  C  CB   . LEU A 1 99  ? 17.041  76.132  -4.737  1.00 84.64  ? 96   LEU A CB   1 
ATOM   1575  C  CG   . LEU A 1 99  ? 18.207  75.533  -3.951  1.00 85.38  ? 96   LEU A CG   1 
ATOM   1576  C  CD1  . LEU A 1 99  ? 19.540  75.899  -4.599  1.00 80.51  ? 96   LEU A CD1  1 
ATOM   1577  C  CD2  . LEU A 1 99  ? 18.164  76.008  -2.511  1.00 81.98  ? 96   LEU A CD2  1 
ATOM   1578  H  H    . LEU A 1 99  ? 15.845  77.220  -6.537  1.00 101.61 ? 96   LEU A H    1 
ATOM   1579  H  HA   . LEU A 1 99  ? 17.600  75.331  -6.543  1.00 109.37 ? 96   LEU A HA   1 
ATOM   1580  H  HB2  . LEU A 1 99  ? 17.230  77.075  -4.856  1.00 101.56 ? 96   LEU A HB2  1 
ATOM   1581  H  HB3  . LEU A 1 99  ? 16.246  76.032  -4.191  1.00 101.56 ? 96   LEU A HB3  1 
ATOM   1582  H  HG   . LEU A 1 99  ? 18.127  74.566  -3.952  1.00 102.46 ? 96   LEU A HG   1 
ATOM   1583  H  HD11 . LEU A 1 99  ? 19.630  76.865  -4.613  1.00 96.61  ? 96   LEU A HD11 1 
ATOM   1584  H  HD12 . LEU A 1 99  ? 20.261  75.507  -4.081  1.00 96.61  ? 96   LEU A HD12 1 
ATOM   1585  H  HD13 . LEU A 1 99  ? 19.557  75.552  -5.505  1.00 96.61  ? 96   LEU A HD13 1 
ATOM   1586  H  HD21 . LEU A 1 99  ? 17.327  75.725  -2.110  1.00 98.38  ? 96   LEU A HD21 1 
ATOM   1587  H  HD22 . LEU A 1 99  ? 18.910  75.618  -2.028  1.00 98.38  ? 96   LEU A HD22 1 
ATOM   1588  H  HD23 . LEU A 1 99  ? 18.229  76.975  -2.496  1.00 98.38  ? 96   LEU A HD23 1 
ATOM   1589  N  N    . GLY A 1 100 ? 16.539  73.137  -6.493  1.00 89.43  ? 97   GLY A N    1 
ATOM   1590  C  CA   . GLY A 1 100 ? 15.949  71.814  -6.370  1.00 78.55  ? 97   GLY A CA   1 
ATOM   1591  C  C    . GLY A 1 100 ? 15.692  71.160  -7.712  1.00 87.43  ? 97   GLY A C    1 
ATOM   1592  O  O    . GLY A 1 100 ? 15.459  69.950  -7.785  1.00 87.28  ? 97   GLY A O    1 
ATOM   1593  H  H    . GLY A 1 100 ? 17.274  73.146  -6.940  1.00 107.32 ? 97   GLY A H    1 
ATOM   1594  H  HA2  . GLY A 1 100 ? 16.544  71.243  -5.859  1.00 94.25  ? 97   GLY A HA2  1 
ATOM   1595  H  HA3  . GLY A 1 100 ? 15.106  71.881  -5.895  1.00 94.25  ? 97   GLY A HA3  1 
ATOM   1596  N  N    . ALA A 1 101 ? 15.783  71.951  -8.779  1.00 81.91  ? 98   ALA A N    1 
ATOM   1597  C  CA   . ALA A 1 101 ? 15.448  71.482  -10.121 1.00 77.58  ? 98   ALA A CA   1 
ATOM   1598  C  C    . ALA A 1 101 ? 16.649  71.475  -11.057 1.00 84.49  ? 98   ALA A C    1 
ATOM   1599  O  O    . ALA A 1 101 ? 16.556  70.987  -12.184 1.00 82.96  ? 98   ALA A O    1 
ATOM   1600  C  CB   . ALA A 1 101 ? 14.347  72.339  -10.707 1.00 80.70  ? 98   ALA A CB   1 
ATOM   1601  H  H    . ALA A 1 101 ? 16.039  72.772  -8.751  1.00 98.30  ? 98   ALA A H    1 
ATOM   1602  H  HA   . ALA A 1 101 ? 15.116  70.573  -10.060 1.00 93.09  ? 98   ALA A HA   1 
ATOM   1603  H  HB1  . ALA A 1 101 ? 14.654  73.259  -10.752 1.00 96.84  ? 98   ALA A HB1  1 
ATOM   1604  H  HB2  . ALA A 1 101 ? 14.136  72.016  -11.597 1.00 96.84  ? 98   ALA A HB2  1 
ATOM   1605  H  HB3  . ALA A 1 101 ? 13.564  72.279  -10.138 1.00 96.84  ? 98   ALA A HB3  1 
ATOM   1606  N  N    . PHE A 1 102 ? 17.775  72.010  -10.597 1.00 76.48  ? 99   PHE A N    1 
ATOM   1607  C  CA   . PHE A 1 102 ? 18.992  71.967  -11.392 1.00 72.70  ? 99   PHE A CA   1 
ATOM   1608  C  C    . PHE A 1 102 ? 19.743  70.692  -11.039 1.00 78.34  ? 99   PHE A C    1 
ATOM   1609  O  O    . PHE A 1 102 ? 20.392  70.610  -9.992  1.00 77.86  ? 99   PHE A O    1 
ATOM   1610  C  CB   . PHE A 1 102 ? 19.861  73.196  -11.140 1.00 74.03  ? 99   PHE A CB   1 
ATOM   1611  C  CG   . PHE A 1 102 ? 21.009  73.323  -12.099 1.00 73.73  ? 99   PHE A CG   1 
ATOM   1612  C  CD1  . PHE A 1 102 ? 20.785  73.457  -13.456 1.00 71.85  ? 99   PHE A CD1  1 
ATOM   1613  C  CD2  . PHE A 1 102 ? 22.314  73.294  -11.640 1.00 77.87  ? 99   PHE A CD2  1 
ATOM   1614  C  CE1  . PHE A 1 102 ? 21.844  73.564  -14.343 1.00 81.92  ? 99   PHE A CE1  1 
ATOM   1615  C  CE2  . PHE A 1 102 ? 23.376  73.400  -12.517 1.00 71.71  ? 99   PHE A CE2  1 
ATOM   1616  C  CZ   . PHE A 1 102 ? 23.143  73.535  -13.871 1.00 67.76  ? 99   PHE A CZ   1 
ATOM   1617  H  H    . PHE A 1 102 ? 17.859  72.400  -9.835  1.00 91.78  ? 99   PHE A H    1 
ATOM   1618  H  HA   . PHE A 1 102 ? 18.763  71.939  -12.334 1.00 87.24  ? 99   PHE A HA   1 
ATOM   1619  H  HB2  . PHE A 1 102 ? 19.312  73.991  -11.227 1.00 88.83  ? 99   PHE A HB2  1 
ATOM   1620  H  HB3  . PHE A 1 102 ? 20.226  73.144  -10.243 1.00 88.83  ? 99   PHE A HB3  1 
ATOM   1621  H  HD1  . PHE A 1 102 ? 19.913  73.475  -13.778 1.00 86.22  ? 99   PHE A HD1  1 
ATOM   1622  H  HD2  . PHE A 1 102 ? 22.478  73.201  -10.729 1.00 93.44  ? 99   PHE A HD2  1 
ATOM   1623  H  HE1  . PHE A 1 102 ? 21.681  73.656  -15.254 1.00 98.31  ? 99   PHE A HE1  1 
ATOM   1624  H  HE2  . PHE A 1 102 ? 24.249  73.381  -12.195 1.00 86.06  ? 99   PHE A HE2  1 
ATOM   1625  H  HZ   . PHE A 1 102 ? 23.857  73.609  -14.463 1.00 81.31  ? 99   PHE A HZ   1 
ATOM   1626  N  N    . GLN A 1 103 ? 19.639  69.698  -11.918 1.00 67.81  ? 100  GLN A N    1 
ATOM   1627  C  CA   . GLN A 1 103 ? 20.131  68.360  -11.621 1.00 74.00  ? 100  GLN A CA   1 
ATOM   1628  C  C    . GLN A 1 103 ? 21.006  67.795  -12.732 1.00 77.08  ? 100  GLN A C    1 
ATOM   1629  O  O    . GLN A 1 103 ? 20.660  67.900  -13.918 1.00 65.83  ? 100  GLN A O    1 
ATOM   1630  C  CB   . GLN A 1 103 ? 18.947  67.424  -11.386 1.00 65.38  ? 100  GLN A CB   1 
ATOM   1631  C  CG   . GLN A 1 103 ? 18.167  67.757  -10.133 1.00 78.65  ? 100  GLN A CG   1 
ATOM   1632  C  CD   . GLN A 1 103 ? 16.936  66.899  -9.958  1.00 81.32  ? 100  GLN A CD   1 
ATOM   1633  O  OE1  . GLN A 1 103 ? 16.796  65.851  -10.589 1.00 93.04  ? 100  GLN A OE1  1 
ATOM   1634  N  NE2  . GLN A 1 103 ? 16.029  67.341  -9.100  1.00 78.96  ? 100  GLN A NE2  1 
ATOM   1635  H  H    . GLN A 1 103 ? 19.285  69.775  -12.698 1.00 81.37  ? 100  GLN A H    1 
ATOM   1636  H  HA   . GLN A 1 103 ? 20.659  68.389  -10.807 1.00 88.80  ? 100  GLN A HA   1 
ATOM   1637  H  HB2  . GLN A 1 103 ? 18.341  67.487  -12.141 1.00 78.45  ? 100  GLN A HB2  1 
ATOM   1638  H  HB3  . GLN A 1 103 ? 19.275  66.515  -11.301 1.00 78.45  ? 100  GLN A HB3  1 
ATOM   1639  H  HG2  . GLN A 1 103 ? 18.739  67.622  -9.361  1.00 94.38  ? 100  GLN A HG2  1 
ATOM   1640  H  HG3  . GLN A 1 103 ? 17.883  68.684  -10.176 1.00 94.38  ? 100  GLN A HG3  1 
ATOM   1641  H  HE21 . GLN A 1 103 ? 16.160  68.080  -8.679  1.00 94.75  ? 100  GLN A HE21 1 
ATOM   1642  H  HE22 . GLN A 1 103 ? 15.310  66.890  -8.964  1.00 94.75  ? 100  GLN A HE22 1 
ATOM   1643  N  N    . ALA A 1 104 ? 22.136  67.199  -12.344 1.00 68.53  ? 101  ALA A N    1 
ATOM   1644  C  CA   . ALA A 1 104 ? 22.951  66.424  -13.278 1.00 66.96  ? 101  ALA A CA   1 
ATOM   1645  C  C    . ALA A 1 104 ? 22.229  65.106  -13.541 1.00 66.32  ? 101  ALA A C    1 
ATOM   1646  O  O    . ALA A 1 104 ? 21.931  64.370  -12.598 1.00 78.56  ? 101  ALA A O    1 
ATOM   1647  C  CB   . ALA A 1 104 ? 24.331  66.186  -12.718 1.00 70.54  ? 101  ALA A CB   1 
ATOM   1648  H  H    . ALA A 1 104 ? 22.452  67.229  -11.545 1.00 82.24  ? 101  ALA A H    1 
ATOM   1649  H  HA   . ALA A 1 104 ? 23.035  66.905  -14.116 1.00 80.35  ? 101  ALA A HA   1 
ATOM   1650  H  HB1  . ALA A 1 104 ? 24.252  65.695  -11.884 1.00 84.65  ? 101  ALA A HB1  1 
ATOM   1651  H  HB2  . ALA A 1 104 ? 24.846  65.671  -13.358 1.00 84.65  ? 101  ALA A HB2  1 
ATOM   1652  H  HB3  . ALA A 1 104 ? 24.759  67.041  -12.559 1.00 84.65  ? 101  ALA A HB3  1 
ATOM   1653  N  N    . GLN A 1 105 ? 21.979  64.795  -14.809 1.00 62.68  ? 102  GLN A N    1 
ATOM   1654  C  CA   . GLN A 1 105 ? 21.085  63.694  -15.171 1.00 68.22  ? 102  GLN A CA   1 
ATOM   1655  C  C    . GLN A 1 105 ? 21.799  62.562  -15.879 1.00 61.05  ? 102  GLN A C    1 
ATOM   1656  O  O    . GLN A 1 105 ? 21.472  61.392  -15.686 1.00 64.52  ? 102  GLN A O    1 
ATOM   1657  C  CB   . GLN A 1 105 ? 19.932  64.209  -16.028 1.00 67.38  ? 102  GLN A CB   1 
ATOM   1658  C  CG   . GLN A 1 105 ? 18.888  64.979  -15.222 1.00 76.64  ? 102  GLN A CG   1 
ATOM   1659  C  CD   . GLN A 1 105 ? 17.700  65.423  -16.056 1.00 87.46  ? 102  GLN A CD   1 
ATOM   1660  O  OE1  . GLN A 1 105 ? 17.749  65.417  -17.289 1.00 86.78  ? 102  GLN A OE1  1 
ATOM   1661  N  NE2  . GLN A 1 105 ? 16.614  65.794  -15.383 1.00 80.67  ? 102  GLN A NE2  1 
ATOM   1662  H  H    . GLN A 1 105 ? 22.316  65.208  -15.484 1.00 75.21  ? 102  GLN A H    1 
ATOM   1663  H  HA   . GLN A 1 105 ? 20.702  63.331  -14.357 1.00 81.87  ? 102  GLN A HA   1 
ATOM   1664  H  HB2  . GLN A 1 105 ? 20.285  64.805  -16.707 1.00 80.86  ? 102  GLN A HB2  1 
ATOM   1665  H  HB3  . GLN A 1 105 ? 19.489  63.455  -16.448 1.00 80.86  ? 102  GLN A HB3  1 
ATOM   1666  H  HG2  . GLN A 1 105 ? 18.557  64.409  -14.510 1.00 91.97  ? 102  GLN A HG2  1 
ATOM   1667  H  HG3  . GLN A 1 105 ? 19.302  65.771  -14.846 1.00 91.97  ? 102  GLN A HG3  1 
ATOM   1668  H  HE21 . GLN A 1 105 ? 16.613  65.773  -14.523 1.00 96.80  ? 102  GLN A HE21 1 
ATOM   1669  H  HE22 . GLN A 1 105 ? 15.913  66.054  -15.808 1.00 96.80  ? 102  GLN A HE22 1 
ATOM   1670  N  N    . GLU A 1 106 ? 22.729  62.915  -16.748 1.00 54.78  ? 103  GLU A N    1 
ATOM   1671  C  CA   . GLU A 1 106 ? 23.464  61.912  -17.487 1.00 53.44  ? 103  GLU A CA   1 
ATOM   1672  C  C    . GLU A 1 106 ? 24.901  62.334  -17.699 1.00 55.89  ? 103  GLU A C    1 
ATOM   1673  O  O    . GLU A 1 106 ? 25.207  63.524  -17.854 1.00 52.41  ? 103  GLU A O    1 
ATOM   1674  C  CB   . GLU A 1 106 ? 22.798  61.653  -18.839 1.00 61.34  ? 103  GLU A CB   1 
ATOM   1675  C  CG   . GLU A 1 106 ? 21.472  60.937  -18.698 1.00 61.19  ? 103  GLU A CG   1 
ATOM   1676  C  CD   . GLU A 1 106 ? 20.936  60.398  -20.004 1.00 70.68  ? 103  GLU A CD   1 
ATOM   1677  O  OE1  . GLU A 1 106 ? 21.739  60.179  -20.948 1.00 61.00  ? 103  GLU A OE1  1 
ATOM   1678  O  OE2  . GLU A 1 106 ? 19.704  60.179  -20.070 1.00 73.00  ? 103  GLU A OE2  1 
ATOM   1679  H  H    . GLU A 1 106 ? 22.952  63.725  -16.928 1.00 65.73  ? 103  GLU A H    1 
ATOM   1680  H  HA   . GLU A 1 106 ? 23.463  61.082  -16.985 1.00 64.13  ? 103  GLU A HA   1 
ATOM   1681  H  HB2  . GLU A 1 106 ? 22.638  62.501  -19.281 1.00 73.60  ? 103  GLU A HB2  1 
ATOM   1682  H  HB3  . GLU A 1 106 ? 23.384  61.100  -19.380 1.00 73.60  ? 103  GLU A HB3  1 
ATOM   1683  H  HG2  . GLU A 1 106 ? 21.583  60.189  -18.090 1.00 73.43  ? 103  GLU A HG2  1 
ATOM   1684  H  HG3  . GLU A 1 106 ? 20.817  61.557  -18.341 1.00 73.43  ? 103  GLU A HG3  1 
ATOM   1685  N  N    . LYS A 1 107 ? 25.779  61.342  -17.694 1.00 51.38  ? 104  LYS A N    1 
ATOM   1686  C  CA   . LYS A 1 107 ? 27.181  61.542  -18.019 1.00 53.09  ? 104  LYS A CA   1 
ATOM   1687  C  C    . LYS A 1 107 ? 27.880  60.227  -18.288 1.00 50.89  ? 104  LYS A C    1 
ATOM   1688  O  O    . LYS A 1 107 ? 27.492  59.194  -17.749 1.00 54.50  ? 104  LYS A O    1 
ATOM   1689  C  CB   . LYS A 1 107 ? 27.908  62.287  -16.901 1.00 49.14  ? 104  LYS A CB   1 
ATOM   1690  C  CG   . LYS A 1 107 ? 29.302  62.754  -17.310 1.00 52.62  ? 104  LYS A CG   1 
ATOM   1691  C  CD   . LYS A 1 107 ? 30.012  63.484  -16.168 1.00 63.66  ? 104  LYS A CD   1 
ATOM   1692  C  CE   . LYS A 1 107 ? 30.738  62.485  -15.261 1.00 57.00  ? 104  LYS A CE   1 
ATOM   1693  N  NZ   . LYS A 1 107 ? 32.066  62.098  -15.811 1.00 54.83  ? 104  LYS A NZ   1 
ATOM   1694  H  H    . LYS A 1 107 ? 25.582  60.527  -17.502 1.00 61.66  ? 104  LYS A H    1 
ATOM   1695  H  HA   . LYS A 1 107 ? 27.242  62.081  -18.823 1.00 63.71  ? 104  LYS A HA   1 
ATOM   1696  H  HB2  . LYS A 1 107 ? 27.391  63.070  -16.654 1.00 58.97  ? 104  LYS A HB2  1 
ATOM   1697  H  HB3  . LYS A 1 107 ? 28.002  61.697  -16.137 1.00 58.97  ? 104  LYS A HB3  1 
ATOM   1698  H  HG2  . LYS A 1 107 ? 29.837  61.983  -17.557 1.00 63.14  ? 104  LYS A HG2  1 
ATOM   1699  H  HG3  . LYS A 1 107 ? 29.227  63.364  -18.060 1.00 63.14  ? 104  LYS A HG3  1 
ATOM   1700  H  HD2  . LYS A 1 107 ? 30.667  64.098  -16.535 1.00 76.39  ? 104  LYS A HD2  1 
ATOM   1701  H  HD3  . LYS A 1 107 ? 29.359  63.963  -15.635 1.00 76.39  ? 104  LYS A HD3  1 
ATOM   1702  H  HE2  . LYS A 1 107 ? 30.877  62.888  -14.390 1.00 68.41  ? 104  LYS A HE2  1 
ATOM   1703  H  HE3  . LYS A 1 107 ? 30.201  61.682  -15.177 1.00 68.41  ? 104  LYS A HE3  1 
ATOM   1704  H  HZ1  . LYS A 1 107 ? 32.582  62.819  -15.894 1.00 65.79  ? 104  LYS A HZ1  1 
ATOM   1705  H  HZ2  . LYS A 1 107 ? 32.464  61.519  -15.265 1.00 65.79  ? 104  LYS A HZ2  1 
ATOM   1706  H  HZ3  . LYS A 1 107 ? 31.966  61.720  -16.610 1.00 65.79  ? 104  LYS A HZ3  1 
ATOM   1707  N  N    . GLU A 1 108 ? 28.893  60.275  -19.146 1.00 43.24  ? 105  GLU A N    1 
ATOM   1708  C  CA   . GLU A 1 108 ? 29.740  59.119  -19.398 1.00 44.50  ? 105  GLU A CA   1 
ATOM   1709  C  C    . GLU A 1 108 ? 30.279  58.580  -18.070 1.00 58.55  ? 105  GLU A C    1 
ATOM   1710  O  O    . GLU A 1 108 ? 30.408  59.327  -17.086 1.00 54.57  ? 105  GLU A O    1 
ATOM   1711  C  CB   . GLU A 1 108 ? 30.913  59.487  -20.305 1.00 54.39  ? 105  GLU A CB   1 
ATOM   1712  C  CG   . GLU A 1 108 ? 30.539  59.899  -21.716 1.00 58.75  ? 105  GLU A CG   1 
ATOM   1713  C  CD   . GLU A 1 108 ? 29.998  61.300  -21.787 1.00 53.22  ? 105  GLU A CD   1 
ATOM   1714  O  OE1  . GLU A 1 108 ? 29.816  61.920  -20.718 1.00 58.99  ? 105  GLU A OE1  1 
ATOM   1715  O  OE2  . GLU A 1 108 ? 29.777  61.784  -22.914 1.00 64.02  ? 105  GLU A OE2  1 
ATOM   1716  H  H    . GLU A 1 108 ? 29.112  60.973  -19.598 1.00 51.88  ? 105  GLU A H    1 
ATOM   1717  H  HA   . GLU A 1 108 ? 29.222  58.421  -19.829 1.00 53.40  ? 105  GLU A HA   1 
ATOM   1718  H  HB2  . GLU A 1 108 ? 31.392  60.228  -19.902 1.00 65.27  ? 105  GLU A HB2  1 
ATOM   1719  H  HB3  . GLU A 1 108 ? 31.502  58.719  -20.372 1.00 65.27  ? 105  GLU A HB3  1 
ATOM   1720  H  HG2  . GLU A 1 108 ? 31.327  59.852  -22.278 1.00 70.50  ? 105  GLU A HG2  1 
ATOM   1721  H  HG3  . GLU A 1 108 ? 29.856  59.296  -22.050 1.00 70.50  ? 105  GLU A HG3  1 
ATOM   1722  N  N    . LEU A 1 109 ? 30.557  57.281  -18.035 1.00 53.09  ? 106  LEU A N    1 
ATOM   1723  C  CA   . LEU A 1 109 ? 31.194  56.660  -16.870 1.00 43.01  ? 106  LEU A CA   1 
ATOM   1724  C  C    . LEU A 1 109 ? 32.697  56.806  -17.034 1.00 47.32  ? 106  LEU A C    1 
ATOM   1725  O  O    . LEU A 1 109 ? 33.234  56.390  -18.054 1.00 42.92  ? 106  LEU A O    1 
ATOM   1726  C  CB   . LEU A 1 109 ? 30.810  55.191  -16.736 1.00 50.64  ? 106  LEU A CB   1 
ATOM   1727  C  CG   . LEU A 1 109 ? 31.673  54.355  -15.789 1.00 52.75  ? 106  LEU A CG   1 
ATOM   1728  C  CD1  . LEU A 1 109 ? 31.479  54.819  -14.339 1.00 51.88  ? 106  LEU A CD1  1 
ATOM   1729  C  CD2  . LEU A 1 109 ? 31.359  52.866  -15.936 1.00 41.04  ? 106  LEU A CD2  1 
ATOM   1730  H  H    . LEU A 1 109 ? 30.387  56.732  -18.675 1.00 63.71  ? 106  LEU A H    1 
ATOM   1731  H  HA   . LEU A 1 109 ? 30.923  57.125  -16.063 1.00 51.61  ? 106  LEU A HA   1 
ATOM   1732  H  HB2  . LEU A 1 109 ? 29.896  55.143  -16.413 1.00 60.76  ? 106  LEU A HB2  1 
ATOM   1733  H  HB3  . LEU A 1 109 ? 30.863  54.781  -17.614 1.00 60.76  ? 106  LEU A HB3  1 
ATOM   1734  H  HG   . LEU A 1 109 ? 32.607  54.486  -16.020 1.00 63.30  ? 106  LEU A HG   1 
ATOM   1735  H  HD11 . LEU A 1 109 ? 30.545  54.714  -14.097 1.00 62.25  ? 106  LEU A HD11 1 
ATOM   1736  H  HD12 . LEU A 1 109 ? 32.035  54.276  -13.758 1.00 62.25  ? 106  LEU A HD12 1 
ATOM   1737  H  HD13 . LEU A 1 109 ? 31.737  55.751  -14.269 1.00 62.25  ? 106  LEU A HD13 1 
ATOM   1738  H  HD21 . LEU A 1 109 ? 31.538  52.595  -16.850 1.00 49.25  ? 106  LEU A HD21 1 
ATOM   1739  H  HD22 . LEU A 1 109 ? 31.920  52.364  -15.325 1.00 49.25  ? 106  LEU A HD22 1 
ATOM   1740  H  HD23 . LEU A 1 109 ? 30.424  52.719  -15.725 1.00 49.25  ? 106  LEU A HD23 1 
ATOM   1741  N  N    . VAL A 1 110 ? 33.377  57.408  -16.065 1.00 38.97  ? 107  VAL A N    1 
ATOM   1742  C  CA   . VAL A 1 110 ? 34.770  57.795  -16.286 1.00 51.15  ? 107  VAL A CA   1 
ATOM   1743  C  C    . VAL A 1 110 ? 35.729  57.255  -15.243 1.00 49.90  ? 107  VAL A C    1 
ATOM   1744  O  O    . VAL A 1 110 ? 35.374  57.084  -14.075 1.00 43.40  ? 107  VAL A O    1 
ATOM   1745  C  CB   . VAL A 1 110 ? 34.942  59.316  -16.326 1.00 56.09  ? 107  VAL A CB   1 
ATOM   1746  C  CG1  . VAL A 1 110 ? 34.218  59.883  -17.541 1.00 46.72  ? 107  VAL A CG1  1 
ATOM   1747  C  CG2  . VAL A 1 110 ? 34.450  59.954  -15.020 1.00 47.23  ? 107  VAL A CG2  1 
ATOM   1748  H  H    . VAL A 1 110 ? 33.066  57.602  -15.287 1.00 46.77  ? 107  VAL A H    1 
ATOM   1749  H  HA   . VAL A 1 110 ? 35.051  57.447  -17.147 1.00 61.38  ? 107  VAL A HA   1 
ATOM   1750  H  HB   . VAL A 1 110 ? 35.886  59.522  -16.420 1.00 67.31  ? 107  VAL A HB   1 
ATOM   1751  H  HG11 . VAL A 1 110 ? 33.276  59.664  -17.477 1.00 56.06  ? 107  VAL A HG11 1 
ATOM   1752  H  HG12 . VAL A 1 110 ? 34.334  60.846  -17.556 1.00 56.06  ? 107  VAL A HG12 1 
ATOM   1753  H  HG13 . VAL A 1 110 ? 34.596  59.491  -18.344 1.00 56.06  ? 107  VAL A HG13 1 
ATOM   1754  H  HG21 . VAL A 1 110 ? 34.965  59.596  -14.280 1.00 56.67  ? 107  VAL A HG21 1 
ATOM   1755  H  HG22 . VAL A 1 110 ? 34.571  60.915  -15.073 1.00 56.67  ? 107  VAL A HG22 1 
ATOM   1756  H  HG23 . VAL A 1 110 ? 33.510  59.744  -14.901 1.00 56.67  ? 107  VAL A HG23 1 
ATOM   1757  N  N    . PHE A 1 111 ? 36.940  56.955  -15.701 1.00 48.38  ? 108  PHE A N    1 
ATOM   1758  C  CA   . PHE A 1 111 ? 38.003  56.501  -14.815 1.00 40.08  ? 108  PHE A CA   1 
ATOM   1759  C  C    . PHE A 1 111 ? 39.234  57.327  -15.023 1.00 49.99  ? 108  PHE A C    1 
ATOM   1760  O  O    . PHE A 1 111 ? 39.607  57.634  -16.163 1.00 45.28  ? 108  PHE A O    1 
ATOM   1761  C  CB   . PHE A 1 111 ? 38.335  55.021  -15.029 1.00 43.91  ? 108  PHE A CB   1 
ATOM   1762  C  CG   . PHE A 1 111 ? 37.171  54.105  -14.781 1.00 47.63  ? 108  PHE A CG   1 
ATOM   1763  C  CD1  . PHE A 1 111 ? 36.925  53.622  -13.518 1.00 35.28  ? 108  PHE A CD1  1 
ATOM   1764  C  CD2  . PHE A 1 111 ? 36.309  53.748  -15.806 1.00 47.63  ? 108  PHE A CD2  1 
ATOM   1765  C  CE1  . PHE A 1 111 ? 35.852  52.787  -13.269 1.00 43.56  ? 108  PHE A CE1  1 
ATOM   1766  C  CE2  . PHE A 1 111 ? 35.237  52.919  -15.566 1.00 37.54  ? 108  PHE A CE2  1 
ATOM   1767  C  CZ   . PHE A 1 111 ? 35.008  52.437  -14.287 1.00 40.37  ? 108  PHE A CZ   1 
ATOM   1768  H  H    . PHE A 1 111 ? 37.173  57.006  -16.528 1.00 58.06  ? 108  PHE A H    1 
ATOM   1769  H  HA   . PHE A 1 111 ? 37.717  56.614  -13.895 1.00 48.09  ? 108  PHE A HA   1 
ATOM   1770  H  HB2  . PHE A 1 111 ? 38.622  54.894  -15.947 1.00 52.69  ? 108  PHE A HB2  1 
ATOM   1771  H  HB3  . PHE A 1 111 ? 39.048  54.768  -14.422 1.00 52.69  ? 108  PHE A HB3  1 
ATOM   1772  H  HD1  . PHE A 1 111 ? 37.493  53.857  -12.821 1.00 42.33  ? 108  PHE A HD1  1 
ATOM   1773  H  HD2  . PHE A 1 111 ? 36.458  54.070  -16.666 1.00 57.16  ? 108  PHE A HD2  1 
ATOM   1774  H  HE1  . PHE A 1 111 ? 35.702  52.466  -12.409 1.00 52.27  ? 108  PHE A HE1  1 
ATOM   1775  H  HE2  . PHE A 1 111 ? 34.668  52.682  -16.262 1.00 45.04  ? 108  PHE A HE2  1 
ATOM   1776  H  HZ   . PHE A 1 111 ? 34.286  51.874  -14.123 1.00 48.44  ? 108  PHE A HZ   1 
ATOM   1777  N  N    . ASP A 1 112 ? 39.873  57.651  -13.901 1.00 54.44  ? 109  ASP A N    1 
ATOM   1778  C  CA   . ASP A 1 112 ? 41.132  58.362  -13.900 1.00 49.58  ? 109  ASP A CA   1 
ATOM   1779  C  C    . ASP A 1 112 ? 42.185  57.484  -13.252 1.00 55.66  ? 109  ASP A C    1 
ATOM   1780  O  O    . ASP A 1 112 ? 42.087  57.133  -12.076 1.00 66.88  ? 109  ASP A O    1 
ATOM   1781  C  CB   . ASP A 1 112 ? 41.010  59.701  -13.162 1.00 54.53  ? 109  ASP A CB   1 
ATOM   1782  C  CG   . ASP A 1 112 ? 42.269  60.564  -13.298 1.00 69.44  ? 109  ASP A CG   1 
ATOM   1783  O  OD1  . ASP A 1 112 ? 43.318  60.032  -13.723 1.00 57.78  ? 109  ASP A OD1  1 
ATOM   1784  O  OD2  . ASP A 1 112 ? 42.204  61.785  -13.009 1.00 76.79  ? 109  ASP A OD2  1 
ATOM   1785  H  H    . ASP A 1 112 ? 39.584  57.462  -13.113 1.00 65.33  ? 109  ASP A H    1 
ATOM   1786  H  HA   . ASP A 1 112 ? 41.402  58.540  -14.815 1.00 59.49  ? 109  ASP A HA   1 
ATOM   1787  H  HB2  . ASP A 1 112 ? 40.263  60.199  -13.530 1.00 65.43  ? 109  ASP A HB2  1 
ATOM   1788  H  HB3  . ASP A 1 112 ? 40.863  59.530  -12.218 1.00 65.43  ? 109  ASP A HB3  1 
ATOM   1789  N  N    A ILE A 1 113 ? 43.191  57.121  -14.035 0.23 50.66  ? 110  ILE A N    1 
ATOM   1790  N  N    B ILE A 1 113 ? 43.170  57.085  -14.054 0.77 49.60  ? 110  ILE A N    1 
ATOM   1791  C  CA   A ILE A 1 113 ? 44.300  56.342  -13.515 0.23 49.06  ? 110  ILE A CA   1 
ATOM   1792  C  CA   B ILE A 1 113 ? 44.316  56.327  -13.566 0.77 48.03  ? 110  ILE A CA   1 
ATOM   1793  C  C    A ILE A 1 113 ? 45.565  57.184  -13.554 0.23 50.32  ? 110  ILE A C    1 
ATOM   1794  C  C    B ILE A 1 113 ? 45.524  57.253  -13.528 0.77 49.67  ? 110  ILE A C    1 
ATOM   1795  O  O    A ILE A 1 113 ? 45.998  57.644  -14.626 0.23 51.62  ? 110  ILE A O    1 
ATOM   1796  O  O    B ILE A 1 113 ? 45.860  57.887  -14.521 0.77 51.51  ? 110  ILE A O    1 
ATOM   1797  C  CB   A ILE A 1 113 ? 44.486  55.039  -14.296 0.23 54.01  ? 110  ILE A CB   1 
ATOM   1798  C  CB   B ILE A 1 113 ? 44.640  55.092  -14.445 0.77 53.98  ? 110  ILE A CB   1 
ATOM   1799  C  CG1  A ILE A 1 113 ? 43.161  54.274  -14.314 0.23 56.66  ? 110  ILE A CG1  1 
ATOM   1800  C  CG1  B ILE A 1 113 ? 43.381  54.261  -14.719 0.77 58.03  ? 110  ILE A CG1  1 
ATOM   1801  C  CG2  A ILE A 1 113 ? 45.553  54.176  -13.628 0.23 55.98  ? 110  ILE A CG2  1 
ATOM   1802  C  CG2  B ILE A 1 113 ? 45.685  54.223  -13.759 0.77 56.31  ? 110  ILE A CG2  1 
ATOM   1803  C  CD1  A ILE A 1 113 ? 43.150  53.061  -15.206 0.23 50.70  ? 110  ILE A CD1  1 
ATOM   1804  C  CD1  B ILE A 1 113 ? 42.690  53.732  -13.454 0.77 52.97  ? 110  ILE A CD1  1 
ATOM   1805  H  H    A ILE A 1 113 ? 43.255  57.314  -14.871 0.23 60.79  ? 110  ILE A H    1 
ATOM   1806  H  H    B ILE A 1 113 ? 43.197  57.245  -14.898 0.77 59.53  ? 110  ILE A H    1 
ATOM   1807  H  HA   A ILE A 1 113 ? 44.119  56.114  -12.590 0.23 58.87  ? 110  ILE A HA   1 
ATOM   1808  H  HA   B ILE A 1 113 ? 44.137  56.020  -12.663 0.77 57.64  ? 110  ILE A HA   1 
ATOM   1809  H  HB   A ILE A 1 113 ? 44.756  55.242  -15.205 0.23 64.81  ? 110  ILE A HB   1 
ATOM   1810  H  HB   B ILE A 1 113 ? 44.999  55.400  -15.292 0.77 64.77  ? 110  ILE A HB   1 
ATOM   1811  H  HG12 A ILE A 1 113 ? 42.962  53.977  -13.413 0.23 68.00  ? 110  ILE A HG12 1 
ATOM   1812  H  HG12 B ILE A 1 113 ? 42.742  54.813  -15.196 0.77 69.64  ? 110  ILE A HG12 1 
ATOM   1813  H  HG13 A ILE A 1 113 ? 42.462  54.871  -14.623 0.23 68.00  ? 110  ILE A HG13 1 
ATOM   1814  H  HG13 B ILE A 1 113 ? 43.625  53.497  -15.263 0.77 69.64  ? 110  ILE A HG13 1 
ATOM   1815  H  HG21 A ILE A 1 113 ? 45.272  53.971  -12.722 0.23 67.17  ? 110  ILE A HG21 1 
ATOM   1816  H  HG21 B ILE A 1 113 ? 45.337  53.928  -12.903 0.77 67.57  ? 110  ILE A HG21 1 
ATOM   1817  H  HG22 A ILE A 1 113 ? 45.658  53.355  -14.135 0.23 67.17  ? 110  ILE A HG22 1 
ATOM   1818  H  HG22 B ILE A 1 113 ? 45.876  53.456  -14.322 0.77 67.57  ? 110  ILE A HG22 1 
ATOM   1819  H  HG23 A ILE A 1 113 ? 46.390  54.665  -13.613 0.23 67.17  ? 110  ILE A HG23 1 
ATOM   1820  H  HG23 B ILE A 1 113 ? 46.491  54.746  -13.626 0.77 67.57  ? 110  ILE A HG23 1 
ATOM   1821  H  HD11 A ILE A 1 113 ? 43.833  52.442  -14.905 0.23 60.83  ? 110  ILE A HD11 1 
ATOM   1822  H  HD11 B ILE A 1 113 ? 42.425  54.484  -12.901 0.77 63.56  ? 110  ILE A HD11 1 
ATOM   1823  H  HD12 A ILE A 1 113 ? 42.277  52.641  -15.156 0.23 60.83  ? 110  ILE A HD12 1 
ATOM   1824  H  HD12 B ILE A 1 113 ? 41.908  53.220  -13.713 0.77 63.56  ? 110  ILE A HD12 1 
ATOM   1825  H  HD13 A ILE A 1 113 ? 43.333  53.339  -16.117 0.23 60.83  ? 110  ILE A HD13 1 
ATOM   1826  H  HD13 B ILE A 1 113 ? 43.310  53.166  -12.969 0.77 63.56  ? 110  ILE A HD13 1 
ATOM   1827  N  N    . ASP A 1 114 ? 46.168  57.320  -12.369 1.00 54.46  ? 111  ASP A N    1 
ATOM   1828  C  CA   . ASP A 1 114 ? 47.244  58.276  -12.111 1.00 50.73  ? 111  ASP A CA   1 
ATOM   1829  C  C    . ASP A 1 114 ? 48.455  57.555  -11.556 1.00 46.15  ? 111  ASP A C    1 
ATOM   1830  O  O    . ASP A 1 114 ? 48.371  56.864  -10.539 1.00 50.11  ? 111  ASP A O    1 
ATOM   1831  C  CB   . ASP A 1 114 ? 46.739  59.355  -11.135 1.00 49.48  ? 111  ASP A CB   1 
ATOM   1832  C  CG   . ASP A 1 114 ? 47.757  60.448  -10.844 1.00 56.83  ? 111  ASP A CG   1 
ATOM   1833  O  OD1  . ASP A 1 114 ? 48.752  60.627  -11.589 1.00 56.95  ? 111  ASP A OD1  1 
ATOM   1834  O  OD2  . ASP A 1 114 ? 47.533  61.156  -9.839  1.00 60.56  ? 111  ASP A OD2  1 
ATOM   1835  H  H    A ASP A 1 114 ? 45.961  56.852  -11.678 0.23 65.35  ? 111  ASP A H    1 
ATOM   1836  H  H    B ASP A 1 114 ? 45.996  56.810  -11.698 0.77 65.35  ? 111  ASP A H    1 
ATOM   1837  H  HA   . ASP A 1 114 ? 47.498  58.708  -12.942 1.00 60.87  ? 111  ASP A HA   1 
ATOM   1838  H  HB2  . ASP A 1 114 ? 45.953  59.777  -11.515 1.00 59.38  ? 111  ASP A HB2  1 
ATOM   1839  H  HB3  . ASP A 1 114 ? 46.510  58.932  -10.293 1.00 59.38  ? 111  ASP A HB3  1 
ATOM   1840  N  N    . MET A 1 115 ? 49.584  57.742  -12.232 1.00 42.01  ? 112  MET A N    1 
ATOM   1841  C  CA   . MET A 1 115 ? 50.817  57.076  -11.868 1.00 44.68  ? 112  MET A CA   1 
ATOM   1842  C  C    . MET A 1 115 ? 51.221  57.394  -10.422 1.00 53.88  ? 112  MET A C    1 
ATOM   1843  O  O    . MET A 1 115 ? 51.820  56.570  -9.730  1.00 50.70  ? 112  MET A O    1 
ATOM   1844  C  CB   . MET A 1 115 ? 51.933  57.489  -12.823 1.00 53.69  ? 112  MET A CB   1 
ATOM   1845  C  CG   . MET A 1 115 ? 53.122  56.542  -12.814 1.00 78.19  ? 112  MET A CG   1 
ATOM   1846  S  SD   . MET A 1 115 ? 52.698  54.929  -13.512 1.00 67.07  ? 112  MET A SD   1 
ATOM   1847  C  CE   . MET A 1 115 ? 52.652  55.352  -15.221 1.00 68.40  ? 112  MET A CE   1 
ATOM   1848  H  H    . MET A 1 115 ? 49.658  58.259  -12.915 1.00 50.42  ? 112  MET A H    1 
ATOM   1849  H  HA   . MET A 1 115 ? 50.691  56.118  -11.954 1.00 53.62  ? 112  MET A HA   1 
ATOM   1850  H  HB2  . MET A 1 115 ? 51.580  57.513  -13.726 1.00 64.43  ? 112  MET A HB2  1 
ATOM   1851  H  HB3  . MET A 1 115 ? 52.252  58.369  -12.571 1.00 64.43  ? 112  MET A HB3  1 
ATOM   1852  H  HG2  . MET A 1 115 ? 53.838  56.924  -13.346 1.00 93.83  ? 112  MET A HG2  1 
ATOM   1853  H  HG3  . MET A 1 115 ? 53.417  56.409  -11.900 1.00 93.83  ? 112  MET A HG3  1 
ATOM   1854  H  HE1  . MET A 1 115 ? 53.523  55.686  -15.486 1.00 82.09  ? 112  MET A HE1  1 
ATOM   1855  H  HE2  . MET A 1 115 ? 52.430  54.561  -15.736 1.00 82.09  ? 112  MET A HE2  1 
ATOM   1856  H  HE3  . MET A 1 115 ? 51.979  56.037  -15.358 1.00 82.09  ? 112  MET A HE3  1 
ATOM   1857  N  N    . THR A 1 116 ? 50.880  58.598  -9.980  1.00 48.14  ? 113  THR A N    1 
ATOM   1858  C  CA   . THR A 1 116 ? 51.236  59.066  -8.647  1.00 51.76  ? 113  THR A CA   1 
ATOM   1859  C  C    . THR A 1 116 ? 50.705  58.120  -7.578  1.00 48.45  ? 113  THR A C    1 
ATOM   1860  O  O    . THR A 1 116 ? 51.275  58.019  -6.498  1.00 51.37  ? 113  THR A O    1 
ATOM   1861  C  CB   . THR A 1 116 ? 50.709  60.503  -8.399  1.00 53.49  ? 113  THR A CB   1 
ATOM   1862  O  OG1  . THR A 1 116 ? 51.363  61.409  -9.291  1.00 52.47  ? 113  THR A OG1  1 
ATOM   1863  C  CG2  . THR A 1 116 ? 50.986  60.967  -6.984  1.00 48.46  ? 113  THR A CG2  1 
ATOM   1864  H  H    . THR A 1 116 ? 50.434  59.171  -10.440 1.00 57.77  ? 113  THR A H    1 
ATOM   1865  H  HA   . THR A 1 116 ? 52.202  59.087  -8.571  1.00 62.11  ? 113  THR A HA   1 
ATOM   1866  H  HB   . THR A 1 116 ? 49.751  60.530  -8.551  1.00 64.19  ? 113  THR A HB   1 
ATOM   1867  H  HG1  . THR A 1 116 ? 52.193  61.392  -9.160  1.00 62.97  ? 113  THR A HG1  1 
ATOM   1868  H  HG21 . THR A 1 116 ? 51.941  60.963  -6.816  1.00 58.15  ? 113  THR A HG21 1 
ATOM   1869  H  HG22 . THR A 1 116 ? 50.647  61.866  -6.858  1.00 58.15  ? 113  THR A HG22 1 
ATOM   1870  H  HG23 . THR A 1 116 ? 50.552  60.374  -6.350  1.00 58.15  ? 113  THR A HG23 1 
ATOM   1871  N  N    . ASP A 1 117 ? 49.622  57.418  -7.887  1.00 49.50  ? 114  ASP A N    1 
ATOM   1872  C  CA   . ASP A 1 117 ? 49.011  56.499  -6.928  1.00 48.19  ? 114  ASP A CA   1 
ATOM   1873  C  C    . ASP A 1 117 ? 49.808  55.214  -6.767  1.00 42.91  ? 114  ASP A C    1 
ATOM   1874  O  O    . ASP A 1 117 ? 49.490  54.396  -5.915  1.00 56.46  ? 114  ASP A O    1 
ATOM   1875  C  CB   . ASP A 1 117 ? 47.574  56.169  -7.325  1.00 51.38  ? 114  ASP A CB   1 
ATOM   1876  C  CG   . ASP A 1 117 ? 46.663  57.367  -7.235  1.00 53.94  ? 114  ASP A CG   1 
ATOM   1877  O  OD1  . ASP A 1 117 ? 46.950  58.249  -6.388  1.00 57.70  ? 114  ASP A OD1  1 
ATOM   1878  O  OD2  . ASP A 1 117 ? 45.659  57.417  -7.988  1.00 55.41  ? 114  ASP A OD2  1 
ATOM   1879  H  H    . ASP A 1 117 ? 49.219  57.453  -8.646  1.00 59.41  ? 114  ASP A H    1 
ATOM   1880  H  HA   . ASP A 1 117 ? 48.982  56.935  -6.062  1.00 57.82  ? 114  ASP A HA   1 
ATOM   1881  H  HB2  . ASP A 1 117 ? 47.563  55.851  -8.241  1.00 61.65  ? 114  ASP A HB2  1 
ATOM   1882  H  HB3  . ASP A 1 117 ? 47.230  55.484  -6.730  1.00 61.65  ? 114  ASP A HB3  1 
ATOM   1883  N  N    . TYR A 1 118 ? 50.846  55.051  -7.574  1.00 47.54  ? 115  TYR A N    1 
ATOM   1884  C  CA   . TYR A 1 118 ? 51.685  53.864  -7.502  1.00 52.37  ? 115  TYR A CA   1 
ATOM   1885  C  C    . TYR A 1 118 ? 52.992  54.161  -6.776  1.00 44.47  ? 115  TYR A C    1 
ATOM   1886  O  O    . TYR A 1 118 ? 53.906  53.340  -6.804  1.00 46.10  ? 115  TYR A O    1 
ATOM   1887  C  CB   . TYR A 1 118 ? 52.033  53.345  -8.908  1.00 44.89  ? 115  TYR A CB   1 
ATOM   1888  C  CG   . TYR A 1 118 ? 50.886  52.801  -9.709  1.00 50.35  ? 115  TYR A CG   1 
ATOM   1889  C  CD1  . TYR A 1 118 ? 50.498  51.479  -9.588  1.00 53.41  ? 115  TYR A CD1  1 
ATOM   1890  C  CD2  . TYR A 1 118 ? 50.225  53.593  -10.631 1.00 58.59  ? 115  TYR A CD2  1 
ATOM   1891  C  CE1  . TYR A 1 118 ? 49.467  50.967  -10.340 1.00 58.64  ? 115  TYR A CE1  1 
ATOM   1892  C  CE2  . TYR A 1 118 ? 49.195  53.093  -11.388 1.00 55.58  ? 115  TYR A CE2  1 
ATOM   1893  C  CZ   . TYR A 1 118 ? 48.818  51.779  -11.244 1.00 61.69  ? 115  TYR A CZ   1 
ATOM   1894  O  OH   . TYR A 1 118 ? 47.783  51.291  -12.012 1.00 58.31  ? 115  TYR A OH   1 
ATOM   1895  H  H    . TYR A 1 118 ? 51.088  55.616  -8.176  1.00 57.05  ? 115  TYR A H    1 
ATOM   1896  H  HA   . TYR A 1 118 ? 51.217  53.164  -7.021  1.00 62.84  ? 115  TYR A HA   1 
ATOM   1897  H  HB2  . TYR A 1 118 ? 52.421  54.074  -9.416  1.00 53.87  ? 115  TYR A HB2  1 
ATOM   1898  H  HB3  . TYR A 1 118 ? 52.685  52.632  -8.817  1.00 53.87  ? 115  TYR A HB3  1 
ATOM   1899  H  HD1  . TYR A 1 118 ? 50.937  50.928  -8.980  1.00 64.10  ? 115  TYR A HD1  1 
ATOM   1900  H  HD2  . TYR A 1 118 ? 50.479  54.482  -10.734 1.00 70.31  ? 115  TYR A HD2  1 
ATOM   1901  H  HE1  . TYR A 1 118 ? 49.212  50.078  -10.242 1.00 70.36  ? 115  TYR A HE1  1 
ATOM   1902  H  HE2  . TYR A 1 118 ? 48.756  53.641  -11.998 1.00 66.70  ? 115  TYR A HE2  1 
ATOM   1903  H  HH   . TYR A 1 118 ? 47.486  51.896  -12.513 1.00 69.97  ? 115  TYR A HH   1 
ATOM   1904  N  N    . ASP A 1 119 ? 53.083  55.316  -6.122  1.00 51.24  ? 116  ASP A N    1 
ATOM   1905  C  CA   . ASP A 1 119 ? 54.374  55.798  -5.619  1.00 58.10  ? 116  ASP A CA   1 
ATOM   1906  C  C    . ASP A 1 119 ? 54.952  54.894  -4.526  1.00 50.16  ? 116  ASP A C    1 
ATOM   1907  O  O    . ASP A 1 119 ? 56.148  54.898  -4.280  1.00 54.10  ? 116  ASP A O    1 
ATOM   1908  C  CB   . ASP A 1 119 ? 54.243  57.228  -5.081  1.00 46.10  ? 116  ASP A CB   1 
ATOM   1909  C  CG   . ASP A 1 119 ? 54.560  58.288  -6.130  1.00 59.35  ? 116  ASP A CG   1 
ATOM   1910  O  OD1  . ASP A 1 119 ? 54.695  57.953  -7.331  1.00 49.73  ? 116  ASP A OD1  1 
ATOM   1911  O  OD2  . ASP A 1 119 ? 54.654  59.480  -5.741  1.00 58.44  ? 116  ASP A OD2  1 
ATOM   1912  H  H    . ASP A 1 119 ? 52.420  55.838  -5.956  1.00 61.49  ? 116  ASP A H    1 
ATOM   1913  H  HA   . ASP A 1 119 ? 55.007  55.815  -6.353  1.00 69.72  ? 116  ASP A HA   1 
ATOM   1914  H  HB2  . ASP A 1 119 ? 53.332  57.369  -4.779  1.00 55.32  ? 116  ASP A HB2  1 
ATOM   1915  H  HB3  . ASP A 1 119 ? 54.860  57.345  -4.341  1.00 55.32  ? 116  ASP A HB3  1 
ATOM   1916  N  N    A ASP A 1 120 ? 54.111  54.087  -3.895  0.46 50.96  ? 117  ASP A N    1 
ATOM   1917  N  N    B ASP A 1 120 ? 54.082  54.095  -3.924  0.54 50.93  ? 117  ASP A N    1 
ATOM   1918  C  CA   A ASP A 1 120 ? 54.581  53.219  -2.826  0.46 48.86  ? 117  ASP A CA   1 
ATOM   1919  C  CA   B ASP A 1 120 ? 54.455  53.199  -2.842  0.54 48.91  ? 117  ASP A CA   1 
ATOM   1920  C  C    A ASP A 1 120 ? 55.120  51.899  -3.356  0.46 49.95  ? 117  ASP A C    1 
ATOM   1921  C  C    B ASP A 1 120 ? 54.975  51.858  -3.343  0.54 50.03  ? 117  ASP A C    1 
ATOM   1922  O  O    A ASP A 1 120 ? 55.651  51.105  -2.583  0.46 53.79  ? 117  ASP A O    1 
ATOM   1923  O  O    B ASP A 1 120 ? 55.345  51.008  -2.535  0.54 53.54  ? 117  ASP A O    1 
ATOM   1924  C  CB   A ASP A 1 120 ? 53.445  52.939  -1.829  0.46 57.68  ? 117  ASP A CB   1 
ATOM   1925  C  CB   B ASP A 1 120 ? 53.252  52.968  -1.909  0.54 58.00  ? 117  ASP A CB   1 
ATOM   1926  C  CG   A ASP A 1 120 ? 53.062  54.164  -1.000  0.46 61.66  ? 117  ASP A CG   1 
ATOM   1927  C  CG   B ASP A 1 120 ? 51.956  52.621  -2.670  0.54 62.75  ? 117  ASP A CG   1 
ATOM   1928  O  OD1  A ASP A 1 120 ? 53.906  55.074  -0.821  0.46 58.70  ? 117  ASP A OD1  1 
ATOM   1929  O  OD1  B ASP A 1 120 ? 51.575  53.365  -3.607  0.54 51.74  ? 117  ASP A OD1  1 
ATOM   1930  O  OD2  A ASP A 1 120 ? 51.906  54.207  -0.518  0.46 61.89  ? 117  ASP A OD2  1 
ATOM   1931  O  OD2  B ASP A 1 120 ? 51.315  51.603  -2.326  0.54 63.20  ? 117  ASP A OD2  1 
ATOM   1932  H  H    A ASP A 1 120 ? 53.270  54.023  -4.064  0.46 61.15  ? 117  ASP A H    1 
ATOM   1933  H  H    B ASP A 1 120 ? 53.248  54.053  -4.131  0.54 61.11  ? 117  ASP A H    1 
ATOM   1934  H  HA   A ASP A 1 120 ? 55.297  53.665  -2.348  0.46 58.63  ? 117  ASP A HA   1 
ATOM   1935  H  HA   B ASP A 1 120 ? 55.160  53.615  -2.321  0.54 58.69  ? 117  ASP A HA   1 
ATOM   1936  H  HB2  A ASP A 1 120 ? 52.659  52.652  -2.319  0.46 69.22  ? 117  ASP A HB2  1 
ATOM   1937  H  HB2  B ASP A 1 120 ? 53.454  52.231  -1.311  0.54 69.60  ? 117  ASP A HB2  1 
ATOM   1938  H  HB3  A ASP A 1 120 ? 53.727  52.241  -1.218  0.46 69.22  ? 117  ASP A HB3  1 
ATOM   1939  H  HB3  B ASP A 1 120 ? 53.091  53.776  -1.397  0.54 69.60  ? 117  ASP A HB3  1 
ATOM   1940  N  N    . VAL A 1 121 ? 54.989  51.658  -4.662  1.00 56.40  ? 118  VAL A N    1 
ATOM   1941  C  CA   . VAL A 1 121 ? 55.427  50.378  -5.242  1.00 48.24  ? 118  VAL A CA   1 
ATOM   1942  C  C    . VAL A 1 121 ? 56.256  50.509  -6.513  1.00 44.93  ? 118  VAL A C    1 
ATOM   1943  O  O    . VAL A 1 121 ? 56.650  49.495  -7.094  1.00 58.90  ? 118  VAL A O    1 
ATOM   1944  C  CB   . VAL A 1 121 ? 54.222  49.471  -5.571  1.00 42.84  ? 118  VAL A CB   1 
ATOM   1945  C  CG1  . VAL A 1 121 ? 53.508  49.060  -4.296  1.00 46.98  ? 118  VAL A CG1  1 
ATOM   1946  C  CG2  . VAL A 1 121 ? 53.258  50.167  -6.534  1.00 55.44  ? 118  VAL A CG2  1 
ATOM   1947  H  H    A VAL A 1 121 ? 54.654  52.210  -5.231  0.46 67.68  ? 118  VAL A H    1 
ATOM   1948  H  H    B VAL A 1 121 ? 54.751  52.245  -5.245  0.54 67.68  ? 118  VAL A H    1 
ATOM   1949  H  HA   . VAL A 1 121 ? 55.971  49.915  -4.585  1.00 57.89  ? 118  VAL A HA   1 
ATOM   1950  H  HB   . VAL A 1 121 ? 54.546  48.665  -6.004  1.00 51.41  ? 118  VAL A HB   1 
ATOM   1951  H  HG11 . VAL A 1 121 ? 53.194  49.856  -3.840  1.00 56.37  ? 118  VAL A HG11 1 
ATOM   1952  H  HG12 . VAL A 1 121 ? 52.756  48.491  -4.525  1.00 56.37  ? 118  VAL A HG12 1 
ATOM   1953  H  HG13 . VAL A 1 121 ? 54.128  48.576  -3.728  1.00 56.37  ? 118  VAL A HG13 1 
ATOM   1954  H  HG21 . VAL A 1 121 ? 53.729  50.376  -7.356  1.00 66.52  ? 118  VAL A HG21 1 
ATOM   1955  H  HG22 . VAL A 1 121 ? 52.514  49.573  -6.720  1.00 66.52  ? 118  VAL A HG22 1 
ATOM   1956  H  HG23 . VAL A 1 121 ? 52.934  50.983  -6.121  1.00 66.52  ? 118  VAL A HG23 1 
ATOM   1957  N  N    . ARG A 1 122 ? 56.591  51.734  -6.906  1.00 39.75  ? 119  ARG A N    1 
ATOM   1958  C  CA   . ARG A 1 122 ? 57.533  51.946  -8.007  1.00 51.93  ? 119  ARG A CA   1 
ATOM   1959  C  C    . ARG A 1 122 ? 58.756  52.656  -7.461  1.00 53.26  ? 119  ARG A C    1 
ATOM   1960  O  O    . ARG A 1 122 ? 58.641  53.487  -6.554  1.00 57.30  ? 119  ARG A O    1 
ATOM   1961  C  CB   . ARG A 1 122 ? 56.906  52.741  -9.158  1.00 50.93  ? 119  ARG A CB   1 
ATOM   1962  C  CG   . ARG A 1 122 ? 56.339  54.086  -8.766  1.00 49.14  ? 119  ARG A CG   1 
ATOM   1963  C  CD   . ARG A 1 122 ? 56.131  54.940  -9.975  1.00 45.34  ? 119  ARG A CD   1 
ATOM   1964  N  NE   . ARG A 1 122 ? 55.551  56.241  -9.641  1.00 55.85  ? 119  ARG A NE   1 
ATOM   1965  C  CZ   . ARG A 1 122 ? 55.501  57.284  -10.466 1.00 47.34  ? 119  ARG A CZ   1 
ATOM   1966  N  NH1  . ARG A 1 122 ? 56.014  57.198  -11.686 1.00 57.21  ? 119  ARG A NH1  1 
ATOM   1967  N  NH2  . ARG A 1 122 ? 54.944  58.417  -10.063 1.00 47.87  ? 119  ARG A NH2  1 
ATOM   1968  H  H    . ARG A 1 122 ? 56.289  52.458  -6.555  1.00 47.70  ? 119  ARG A H    1 
ATOM   1969  H  HA   . ARG A 1 122 ? 57.814  51.085  -8.354  1.00 62.31  ? 119  ARG A HA   1 
ATOM   1970  H  HB2  . ARG A 1 122 ? 57.585  52.894  -9.833  1.00 61.12  ? 119  ARG A HB2  1 
ATOM   1971  H  HB3  . ARG A 1 122 ? 56.183  52.217  -9.537  1.00 61.12  ? 119  ARG A HB3  1 
ATOM   1972  H  HG2  . ARG A 1 122 ? 55.483  53.961  -8.328  1.00 58.97  ? 119  ARG A HG2  1 
ATOM   1973  H  HG3  . ARG A 1 122 ? 56.961  54.539  -8.175  1.00 58.97  ? 119  ARG A HG3  1 
ATOM   1974  H  HD2  . ARG A 1 122 ? 56.986  55.093  -10.407 1.00 54.41  ? 119  ARG A HD2  1 
ATOM   1975  H  HD3  . ARG A 1 122 ? 55.526  54.487  -10.583 1.00 54.41  ? 119  ARG A HD3  1 
ATOM   1976  H  HE   . ARG A 1 122 ? 55.218  56.339  -8.854  1.00 67.02  ? 119  ARG A HE   1 
ATOM   1977  H  HH11 . ARG A 1 122 ? 56.374  56.463  -11.950 1.00 68.65  ? 119  ARG A HH11 1 
ATOM   1978  H  HH12 . ARG A 1 122 ? 55.982  57.875  -12.215 1.00 68.65  ? 119  ARG A HH12 1 
ATOM   1979  H  HH21 . ARG A 1 122 ? 54.614  58.476  -9.271  1.00 57.45  ? 119  ARG A HH21 1 
ATOM   1980  H  HH22 . ARG A 1 122 ? 54.915  59.095  -10.592 1.00 57.45  ? 119  ARG A HH22 1 
ATOM   1981  N  N    . ARG A 1 123 ? 59.913  52.365  -8.050  1.00 50.25  ? 120  ARG A N    1 
ATOM   1982  C  CA   . ARG A 1 123 ? 61.187  52.817  -7.505  1.00 54.93  ? 120  ARG A CA   1 
ATOM   1983  C  C    . ARG A 1 123 ? 61.922  53.810  -8.395  1.00 59.21  ? 120  ARG A C    1 
ATOM   1984  O  O    . ARG A 1 123 ? 62.829  54.503  -7.937  1.00 65.80  ? 120  ARG A O    1 
ATOM   1985  C  CB   . ARG A 1 123 ? 62.085  51.598  -7.280  1.00 42.21  ? 120  ARG A CB   1 
ATOM   1986  C  CG   . ARG A 1 123 ? 61.525  50.582  -6.295  1.00 46.32  ? 120  ARG A CG   1 
ATOM   1987  C  CD   . ARG A 1 123 ? 62.462  49.385  -6.171  1.00 55.74  ? 120  ARG A CD   1 
ATOM   1988  N  NE   . ARG A 1 123 ? 63.693  49.708  -5.446  1.00 64.22  ? 120  ARG A NE   1 
ATOM   1989  C  CZ   . ARG A 1 123 ? 64.908  49.273  -5.776  1.00 57.21  ? 120  ARG A CZ   1 
ATOM   1990  N  NH1  . ARG A 1 123 ? 65.084  48.495  -6.826  1.00 57.88  ? 120  ARG A NH1  1 
ATOM   1991  N  NH2  . ARG A 1 123 ? 65.960  49.621  -5.051  1.00 75.23  ? 120  ARG A NH2  1 
ATOM   1992  H  H    . ARG A 1 123 ? 59.986  51.904  -8.773  1.00 60.30  ? 120  ARG A H    1 
ATOM   1993  H  HA   . ARG A 1 123 ? 61.032  53.240  -6.646  1.00 65.91  ? 120  ARG A HA   1 
ATOM   1994  H  HB2  . ARG A 1 123 ? 62.214  51.146  -8.129  1.00 50.65  ? 120  ARG A HB2  1 
ATOM   1995  H  HB3  . ARG A 1 123 ? 62.940  51.901  -6.937  1.00 50.65  ? 120  ARG A HB3  1 
ATOM   1996  H  HG2  . ARG A 1 123 ? 61.436  50.994  -5.421  1.00 55.58  ? 120  ARG A HG2  1 
ATOM   1997  H  HG3  . ARG A 1 123 ? 60.664  50.266  -6.611  1.00 55.58  ? 120  ARG A HG3  1 
ATOM   1998  H  HD2  . ARG A 1 123 ? 62.007  48.676  -5.690  1.00 66.89  ? 120  ARG A HD2  1 
ATOM   1999  H  HD3  . ARG A 1 123 ? 62.707  49.082  -7.059  1.00 66.89  ? 120  ARG A HD3  1 
ATOM   2000  H  HE   . ARG A 1 123 ? 63.626  50.216  -4.755  1.00 77.07  ? 120  ARG A HE   1 
ATOM   2001  H  HH11 . ARG A 1 123 ? 64.410  48.261  -7.305  1.00 69.46  ? 120  ARG A HH11 1 
ATOM   2002  H  HH12 . ARG A 1 123 ? 65.873  48.221  -7.030  1.00 69.46  ? 120  ARG A HH12 1 
ATOM   2003  H  HH21 . ARG A 1 123 ? 65.860  50.129  -4.364  1.00 90.28  ? 120  ARG A HH21 1 
ATOM   2004  H  HH22 . ARG A 1 123 ? 66.744  49.340  -5.268  1.00 90.28  ? 120  ARG A HH22 1 
ATOM   2005  N  N    . CYS A 1 124 ? 61.499  53.916  -9.648  1.00 62.67  ? 121  CYS A N    1 
ATOM   2006  C  CA   . CYS A 1 124 ? 62.200  54.746  -10.618 1.00 57.67  ? 121  CYS A CA   1 
ATOM   2007  C  C    . CYS A 1 124 ? 61.824  56.220  -10.480 1.00 55.62  ? 121  CYS A C    1 
ATOM   2008  O  O    . CYS A 1 124 ? 62.676  57.091  -10.603 1.00 73.10  ? 121  CYS A O    1 
ATOM   2009  C  CB   . CYS A 1 124 ? 61.894  54.263  -12.031 1.00 73.89  ? 121  CYS A CB   1 
ATOM   2010  S  SG   . CYS A 1 124 ? 60.135  54.004  -12.285 1.00 64.30  ? 121  CYS A SG   1 
ATOM   2011  H  H    . CYS A 1 124 ? 60.805  53.517  -9.962  1.00 75.20  ? 121  CYS A H    1 
ATOM   2012  H  HA   . CYS A 1 124 ? 63.156  54.664  -10.473 1.00 69.20  ? 121  CYS A HA   1 
ATOM   2013  H  HB2  . CYS A 1 124 ? 62.197  54.928  -12.668 1.00 88.67  ? 121  CYS A HB2  1 
ATOM   2014  H  HB3  . CYS A 1 124 ? 62.349  53.420  -12.186 1.00 88.67  ? 121  CYS A HB3  1 
ATOM   2015  N  N    . CYS A 1 125 ? 60.550  56.493  -10.207 1.00 58.25  ? 122  CYS A N    1 
ATOM   2016  C  CA   . CYS A 1 125 ? 60.053  57.868  -10.146 1.00 57.51  ? 122  CYS A CA   1 
ATOM   2017  C  C    . CYS A 1 125 ? 59.175  58.079  -8.936  1.00 47.56  ? 122  CYS A C    1 
ATOM   2018  O  O    . CYS A 1 125 ? 58.853  57.135  -8.219  1.00 67.63  ? 122  CYS A O    1 
ATOM   2019  C  CB   . CYS A 1 125 ? 59.215  58.214  -11.393 1.00 63.44  ? 122  CYS A CB   1 
ATOM   2020  S  SG   . CYS A 1 125 ? 59.981  57.866  -12.974 1.00 55.51  ? 122  CYS A SG   1 
ATOM   2021  H  H    . CYS A 1 125 ? 59.950  55.897  -10.053 1.00 69.90  ? 122  CYS A H    1 
ATOM   2022  H  HA   . CYS A 1 125 ? 60.801  58.483  -10.096 1.00 69.01  ? 122  CYS A HA   1 
ATOM   2023  H  HB2  . CYS A 1 125 ? 58.388  57.708  -11.354 1.00 76.13  ? 122  CYS A HB2  1 
ATOM   2024  H  HB3  . CYS A 1 125 ? 59.013  59.162  -11.372 1.00 76.13  ? 122  CYS A HB3  1 
ATOM   2025  N  N    . SER A 1 126 ? 58.724  59.316  -8.757  1.00 46.98  ? 123  SER A N    1 
ATOM   2026  C  CA   . SER A 1 126 ? 57.771  59.636  -7.703  1.00 57.47  ? 123  SER A CA   1 
ATOM   2027  C  C    . SER A 1 126 ? 56.933  60.804  -8.180  1.00 53.64  ? 123  SER A C    1 
ATOM   2028  O  O    . SER A 1 126 ? 57.317  61.507  -9.121  1.00 48.72  ? 123  SER A O    1 
ATOM   2029  C  CB   . SER A 1 126 ? 58.461  59.983  -6.368  1.00 55.76  ? 123  SER A CB   1 
ATOM   2030  O  OG   . SER A 1 126 ? 59.381  61.055  -6.492  1.00 54.83  ? 123  SER A OG   1 
ATOM   2031  H  H    . SER A 1 126 ? 58.957  59.991  -9.235  1.00 56.38  ? 123  SER A H    1 
ATOM   2032  H  HA   . SER A 1 126 ? 57.185  58.878  -7.556  1.00 68.97  ? 123  SER A HA   1 
ATOM   2033  H  HB2  . SER A 1 126 ? 57.781  60.231  -5.723  1.00 66.91  ? 123  SER A HB2  1 
ATOM   2034  H  HB3  . SER A 1 126 ? 58.939  59.199  -6.054  1.00 66.91  ? 123  SER A HB3  1 
ATOM   2035  H  HG   . SER A 1 126 ? 59.737  61.215  -5.748  1.00 65.80  ? 123  SER A HG   1 
ATOM   2036  N  N    . SER A 1 127 ? 55.783  60.985  -7.543  1.00 51.17  ? 124  SER A N    1 
ATOM   2037  C  CA   . SER A 1 127 ? 54.875  62.079  -7.855  1.00 54.06  ? 124  SER A CA   1 
ATOM   2038  C  C    . SER A 1 127 ? 54.513  62.127  -9.354  1.00 57.13  ? 124  SER A C    1 
ATOM   2039  O  O    . SER A 1 127 ? 53.956  61.161  -9.874  1.00 61.00  ? 124  SER A O    1 
ATOM   2040  C  CB   . SER A 1 127 ? 55.473  63.393  -7.347  1.00 55.56  ? 124  SER A CB   1 
ATOM   2041  O  OG   . SER A 1 127 ? 54.436  64.278  -6.952  1.00 61.21  ? 124  SER A OG   1 
ATOM   2042  H  H    . SER A 1 127 ? 55.500  60.475  -6.910  1.00 61.40  ? 124  SER A H    1 
ATOM   2043  H  HA   . SER A 1 127 ? 54.049  61.934  -7.368  1.00 64.87  ? 124  SER A HA   1 
ATOM   2044  H  HB2  . SER A 1 127 ? 56.042  63.209  -6.584  1.00 66.67  ? 124  SER A HB2  1 
ATOM   2045  H  HB3  . SER A 1 127 ? 55.989  63.804  -8.058  1.00 66.67  ? 124  SER A HB3  1 
ATOM   2046  H  HG   . SER A 1 127 ? 54.764  64.999  -6.674  1.00 73.45  ? 124  SER A HG   1 
ATOM   2047  N  N    . ALA A 1 128 ? 54.790  63.235  -10.038 1.00 58.34  ? 125  ALA A N    1 
ATOM   2048  C  CA   . ALA A 1 128 ? 54.348  63.408  -11.424 1.00 48.63  ? 125  ALA A CA   1 
ATOM   2049  C  C    . ALA A 1 128 ? 55.402  62.982  -12.437 1.00 57.72  ? 125  ALA A C    1 
ATOM   2050  O  O    . ALA A 1 128 ? 55.197  63.136  -13.644 1.00 68.97  ? 125  ALA A O    1 
ATOM   2051  C  CB   . ALA A 1 128 ? 53.972  64.866  -11.671 1.00 60.13  ? 125  ALA A CB   1 
ATOM   2052  H  H    . ALA A 1 128 ? 55.232  63.903  -9.724  1.00 70.01  ? 125  ALA A H    1 
ATOM   2053  H  HA   . ALA A 1 128 ? 53.557  62.866  -11.571 1.00 58.36  ? 125  ALA A HA   1 
ATOM   2054  H  HB1  . ALA A 1 128 ? 54.748  65.424  -11.507 1.00 72.15  ? 125  ALA A HB1  1 
ATOM   2055  H  HB2  . ALA A 1 128 ? 53.681  64.964  -12.591 1.00 72.15  ? 125  ALA A HB2  1 
ATOM   2056  H  HB3  . ALA A 1 128 ? 53.253  65.112  -11.068 1.00 72.15  ? 125  ALA A HB3  1 
ATOM   2057  N  N    . ASP A 1 129 ? 56.516  62.432  -11.967 1.00 43.21  ? 126  ASP A N    1 
ATOM   2058  C  CA   . ASP A 1 129 ? 57.533  61.928  -12.885 1.00 54.53  ? 126  ASP A CA   1 
ATOM   2059  C  C    . ASP A 1 129 ? 57.084  60.595  -13.435 1.00 58.02  ? 126  ASP A C    1 
ATOM   2060  O  O    . ASP A 1 129 ? 56.516  59.781  -12.706 1.00 59.29  ? 126  ASP A O    1 
ATOM   2061  C  CB   . ASP A 1 129 ? 58.895  61.761  -12.204 1.00 52.10  ? 126  ASP A CB   1 
ATOM   2062  C  CG   . ASP A 1 129 ? 59.758  62.990  -12.307 1.00 62.86  ? 126  ASP A CG   1 
ATOM   2063  O  OD1  . ASP A 1 129 ? 59.640  63.712  -13.318 1.00 67.10  ? 126  ASP A OD1  1 
ATOM   2064  O  OD2  . ASP A 1 129 ? 60.546  63.242  -11.363 1.00 73.23  ? 126  ASP A OD2  1 
ATOM   2065  H  H    . ASP A 1 129 ? 56.707  62.338  -11.133 1.00 51.85  ? 126  ASP A H    1 
ATOM   2066  H  HA   . ASP A 1 129 ? 57.635  62.547  -13.624 1.00 65.43  ? 126  ASP A HA   1 
ATOM   2067  H  HB2  . ASP A 1 129 ? 58.756  61.571  -11.263 1.00 62.52  ? 126  ASP A HB2  1 
ATOM   2068  H  HB3  . ASP A 1 129 ? 59.370  61.027  -12.623 1.00 62.52  ? 126  ASP A HB3  1 
ATOM   2069  N  N    . ILE A 1 130 ? 57.287  60.405  -14.736 1.00 54.06  ? 127  ILE A N    1 
ATOM   2070  C  CA   . ILE A 1 130 ? 57.065  59.111  -15.357 1.00 48.06  ? 127  ILE A CA   1 
ATOM   2071  C  C    . ILE A 1 130 ? 58.259  58.737  -16.227 1.00 60.62  ? 127  ILE A C    1 
ATOM   2072  O  O    . ILE A 1 130 ? 59.023  59.607  -16.660 1.00 66.43  ? 127  ILE A O    1 
ATOM   2073  C  CB   . ILE A 1 130 ? 55.785  59.098  -16.201 1.00 53.67  ? 127  ILE A CB   1 
ATOM   2074  C  CG1  . ILE A 1 130 ? 55.849  60.126  -17.340 1.00 54.77  ? 127  ILE A CG1  1 
ATOM   2075  C  CG2  . ILE A 1 130 ? 54.578  59.388  -15.323 1.00 49.98  ? 127  ILE A CG2  1 
ATOM   2076  C  CD1  . ILE A 1 130 ? 54.892  59.813  -18.484 1.00 51.89  ? 127  ILE A CD1  1 
ATOM   2077  H  H    . ILE A 1 130 ? 57.555  61.014  -15.280 1.00 64.87  ? 127  ILE A H    1 
ATOM   2078  H  HA   . ILE A 1 130 ? 56.975  58.438  -14.664 1.00 57.68  ? 127  ILE A HA   1 
ATOM   2079  H  HB   . ILE A 1 130 ? 55.680  58.215  -16.588 1.00 64.40  ? 127  ILE A HB   1 
ATOM   2080  H  HG12 . ILE A 1 130 ? 55.619  61.000  -16.989 1.00 65.73  ? 127  ILE A HG12 1 
ATOM   2081  H  HG13 . ILE A 1 130 ? 56.750  60.141  -17.701 1.00 65.73  ? 127  ILE A HG13 1 
ATOM   2082  H  HG21 . ILE A 1 130 ? 54.687  60.261  -14.916 1.00 59.97  ? 127  ILE A HG21 1 
ATOM   2083  H  HG22 . ILE A 1 130 ? 53.779  59.375  -15.872 1.00 59.97  ? 127  ILE A HG22 1 
ATOM   2084  H  HG23 . ILE A 1 130 ? 54.518  58.707  -14.635 1.00 59.97  ? 127  ILE A HG23 1 
ATOM   2085  H  HD11 . ILE A 1 130 ? 53.984  59.804  -18.142 1.00 62.27  ? 127  ILE A HD11 1 
ATOM   2086  H  HD12 . ILE A 1 130 ? 54.982  60.497  -19.166 1.00 62.27  ? 127  ILE A HD12 1 
ATOM   2087  H  HD13 . ILE A 1 130 ? 55.115  58.945  -18.854 1.00 62.27  ? 127  ILE A HD13 1 
ATOM   2088  N  N    . CYS A 1 131 ? 58.428  57.436  -16.447 1.00 55.40  ? 128  CYS A N    1 
ATOM   2089  C  CA   . CYS A 1 131 ? 59.542  56.916  -17.239 1.00 57.49  ? 128  CYS A CA   1 
ATOM   2090  C  C    . CYS A 1 131 ? 59.094  55.631  -17.928 1.00 54.47  ? 128  CYS A C    1 
ATOM   2091  O  O    . CYS A 1 131 ? 58.057  55.071  -17.584 1.00 56.08  ? 128  CYS A O    1 
ATOM   2092  C  CB   . CYS A 1 131 ? 60.776  56.666  -16.365 1.00 58.33  ? 128  CYS A CB   1 
ATOM   2093  S  SG   . CYS A 1 131 ? 60.673  55.163  -15.361 1.00 54.07  ? 128  CYS A SG   1 
ATOM   2094  H  H    . CYS A 1 131 ? 57.904  56.825  -16.144 1.00 66.48  ? 128  CYS A H    1 
ATOM   2095  H  HA   . CYS A 1 131 ? 59.779  57.562  -17.922 1.00 68.98  ? 128  CYS A HA   1 
ATOM   2096  H  HB2  . CYS A 1 131 ? 61.554  56.586  -16.939 1.00 70.00  ? 128  CYS A HB2  1 
ATOM   2097  H  HB3  . CYS A 1 131 ? 60.888  57.418  -15.762 1.00 70.00  ? 128  CYS A HB3  1 
ATOM   2098  N  N    . PRO A 1 132 ? 59.874  55.150  -18.896 1.00 57.25  ? 129  PRO A N    1 
ATOM   2099  C  CA   . PRO A 1 132 ? 59.503  53.912  -19.590 1.00 65.83  ? 129  PRO A CA   1 
ATOM   2100  C  C    . PRO A 1 132 ? 59.461  52.694  -18.658 1.00 60.57  ? 129  PRO A C    1 
ATOM   2101  O  O    . PRO A 1 132 ? 58.733  51.735  -18.924 1.00 65.30  ? 129  PRO A O    1 
ATOM   2102  C  CB   . PRO A 1 132 ? 60.616  53.757  -20.640 1.00 48.66  ? 129  PRO A CB   1 
ATOM   2103  C  CG   . PRO A 1 132 ? 61.113  55.151  -20.873 1.00 45.38  ? 129  PRO A CG   1 
ATOM   2104  C  CD   . PRO A 1 132 ? 61.025  55.817  -19.523 1.00 69.65  ? 129  PRO A CD   1 
ATOM   2105  H  HA   . PRO A 1 132 ? 58.647  54.012  -20.035 1.00 78.99  ? 129  PRO A HA   1 
ATOM   2106  H  HB2  . PRO A 1 132 ? 61.324  53.194  -20.289 1.00 58.40  ? 129  PRO A HB2  1 
ATOM   2107  H  HB3  . PRO A 1 132 ? 60.249  53.382  -21.456 1.00 58.40  ? 129  PRO A HB3  1 
ATOM   2108  H  HG2  . PRO A 1 132 ? 62.031  55.125  -21.186 1.00 54.46  ? 129  PRO A HG2  1 
ATOM   2109  H  HG3  . PRO A 1 132 ? 60.542  55.600  -21.516 1.00 54.46  ? 129  PRO A HG3  1 
ATOM   2110  H  HD2  . PRO A 1 132 ? 61.832  55.651  -19.010 1.00 83.58  ? 129  PRO A HD2  1 
ATOM   2111  H  HD3  . PRO A 1 132 ? 60.854  56.766  -19.623 1.00 83.58  ? 129  PRO A HD3  1 
ATOM   2112  N  N    . LYS A 1 133 ? 60.171  52.764  -17.539 1.00 57.80  ? 130  LYS A N    1 
ATOM   2113  C  CA   . LYS A 1 133 ? 60.231  51.632  -16.627 1.00 57.73  ? 130  LYS A CA   1 
ATOM   2114  C  C    . LYS A 1 133 ? 58.968  51.484  -15.772 1.00 52.85  ? 130  LYS A C    1 
ATOM   2115  O  O    . LYS A 1 133 ? 58.659  50.381  -15.329 1.00 70.93  ? 130  LYS A O    1 
ATOM   2116  C  CB   . LYS A 1 133 ? 61.465  51.752  -15.741 1.00 55.21  ? 130  LYS A CB   1 
ATOM   2117  C  CG   . LYS A 1 133 ? 62.772  51.688  -16.529 1.00 66.67  ? 130  LYS A CG   1 
ATOM   2118  C  CD   . LYS A 1 133 ? 63.951  51.279  -15.652 1.00 74.39  ? 130  LYS A CD   1 
ATOM   2119  C  CE   . LYS A 1 133 ? 64.423  52.423  -14.759 1.00 84.64  ? 130  LYS A CE   1 
ATOM   2120  N  NZ   . LYS A 1 133 ? 65.341  51.942  -13.680 1.00 100.48 ? 130  LYS A NZ   1 
ATOM   2121  H  H    . LYS A 1 133 ? 60.623  53.450  -17.287 1.00 69.36  ? 130  LYS A H    1 
ATOM   2122  H  HA   . LYS A 1 133 ? 60.325  50.821  -17.150 1.00 69.28  ? 130  LYS A HA   1 
ATOM   2123  H  HB2  . LYS A 1 133 ? 61.437  52.603  -15.276 1.00 66.26  ? 130  LYS A HB2  1 
ATOM   2124  H  HB3  . LYS A 1 133 ? 61.465  51.024  -15.100 1.00 66.26  ? 130  LYS A HB3  1 
ATOM   2125  H  HG2  . LYS A 1 133 ? 62.683  51.034  -17.240 1.00 80.00  ? 130  LYS A HG2  1 
ATOM   2126  H  HG3  . LYS A 1 133 ? 62.962  52.563  -16.901 1.00 80.00  ? 130  LYS A HG3  1 
ATOM   2127  H  HD2  . LYS A 1 133 ? 63.684  50.541  -15.083 1.00 89.27  ? 130  LYS A HD2  1 
ATOM   2128  H  HD3  . LYS A 1 133 ? 64.692  51.013  -16.219 1.00 89.27  ? 130  LYS A HD3  1 
ATOM   2129  H  HE2  . LYS A 1 133 ? 64.901  53.072  -15.298 1.00 101.57 ? 130  LYS A HE2  1 
ATOM   2130  H  HE3  . LYS A 1 133 ? 63.653  52.838  -14.340 1.00 101.57 ? 130  LYS A HE3  1 
ATOM   2131  H  HZ1  . LYS A 1 133 ? 66.060  51.560  -14.040 1.00 120.58 ? 130  LYS A HZ1  1 
ATOM   2132  H  HZ2  . LYS A 1 133 ? 65.601  52.627  -13.174 1.00 120.58 ? 130  LYS A HZ2  1 
ATOM   2133  H  HZ3  . LYS A 1 133 ? 64.923  51.347  -13.168 1.00 120.58 ? 130  LYS A HZ3  1 
ATOM   2134  N  N    . CYS A 1 134 ? 58.246  52.578  -15.530 1.00 54.79  ? 131  CYS A N    1 
ATOM   2135  C  CA   . CYS A 1 134 ? 57.020  52.521  -14.718 1.00 54.23  ? 131  CYS A CA   1 
ATOM   2136  C  C    . CYS A 1 134 ? 55.744  52.601  -15.567 1.00 53.00  ? 131  CYS A C    1 
ATOM   2137  O  O    . CYS A 1 134 ? 54.669  52.246  -15.086 1.00 48.83  ? 131  CYS A O    1 
ATOM   2138  C  CB   . CYS A 1 134 ? 56.990  53.622  -13.633 1.00 52.33  ? 131  CYS A CB   1 
ATOM   2139  S  SG   . CYS A 1 134 ? 57.477  55.304  -14.142 1.00 55.91  ? 131  CYS A SG   1 
ATOM   2140  H  H    . CYS A 1 134 ? 58.439  53.363  -15.822 1.00 65.75  ? 131  CYS A H    1 
ATOM   2141  H  HA   . CYS A 1 134 ? 57.004  51.667  -14.259 1.00 65.08  ? 131  CYS A HA   1 
ATOM   2142  H  HB2  . CYS A 1 134 ? 56.086  53.679  -13.287 1.00 62.80  ? 131  CYS A HB2  1 
ATOM   2143  H  HB3  . CYS A 1 134 ? 57.589  53.356  -12.918 1.00 62.80  ? 131  CYS A HB3  1 
ATOM   2144  N  N    . TRP A 1 135 ? 55.852  53.054  -16.816 1.00 58.70  ? 132  TRP A N    1 
ATOM   2145  C  CA   . TRP A 1 135 ? 54.658  53.243  -17.640 1.00 57.16  ? 132  TRP A CA   1 
ATOM   2146  C  C    . TRP A 1 135 ? 53.915  51.930  -17.880 1.00 53.45  ? 132  TRP A C    1 
ATOM   2147  O  O    . TRP A 1 135 ? 52.692  51.920  -18.066 1.00 50.35  ? 132  TRP A O    1 
ATOM   2148  C  CB   . TRP A 1 135 ? 55.026  53.873  -18.984 1.00 53.27  ? 132  TRP A CB   1 
ATOM   2149  C  CG   . TRP A 1 135 ? 53.813  54.181  -19.781 1.00 58.26  ? 132  TRP A CG   1 
ATOM   2150  C  CD1  . TRP A 1 135 ? 53.353  53.506  -20.868 1.00 55.85  ? 132  TRP A CD1  1 
ATOM   2151  C  CD2  . TRP A 1 135 ? 52.872  55.229  -19.526 1.00 56.52  ? 132  TRP A CD2  1 
ATOM   2152  N  NE1  . TRP A 1 135 ? 52.186  54.076  -21.317 1.00 61.02  ? 132  TRP A NE1  1 
ATOM   2153  C  CE2  . TRP A 1 135 ? 51.871  55.138  -20.511 1.00 49.88  ? 132  TRP A CE2  1 
ATOM   2154  C  CE3  . TRP A 1 135 ? 52.784  56.241  -18.565 1.00 48.44  ? 132  TRP A CE3  1 
ATOM   2155  C  CZ2  . TRP A 1 135 ? 50.795  56.017  -20.563 1.00 46.61  ? 132  TRP A CZ2  1 
ATOM   2156  C  CZ3  . TRP A 1 135 ? 51.716  57.119  -18.620 1.00 60.78  ? 132  TRP A CZ3  1 
ATOM   2157  C  CH2  . TRP A 1 135 ? 50.738  57.003  -19.615 1.00 66.03  ? 132  TRP A CH2  1 
ATOM   2158  H  H    . TRP A 1 135 ? 56.592  53.256  -17.205 1.00 70.44  ? 132  TRP A H    1 
ATOM   2159  H  HA   . TRP A 1 135 ? 54.054  53.848  -17.182 1.00 68.59  ? 132  TRP A HA   1 
ATOM   2160  H  HB2  . TRP A 1 135 ? 55.507  54.701  -18.829 1.00 63.92  ? 132  TRP A HB2  1 
ATOM   2161  H  HB3  . TRP A 1 135 ? 55.575  53.254  -19.490 1.00 63.92  ? 132  TRP A HB3  1 
ATOM   2162  H  HD1  . TRP A 1 135 ? 53.767  52.766  -21.251 1.00 67.02  ? 132  TRP A HD1  1 
ATOM   2163  H  HE1  . TRP A 1 135 ? 51.729  53.812  -21.996 1.00 73.22  ? 132  TRP A HE1  1 
ATOM   2164  H  HE3  . TRP A 1 135 ? 53.433  56.324  -17.904 1.00 58.12  ? 132  TRP A HE3  1 
ATOM   2165  H  HZ2  . TRP A 1 135 ? 50.144  55.944  -21.223 1.00 55.93  ? 132  TRP A HZ2  1 
ATOM   2166  H  HZ3  . TRP A 1 135 ? 51.648  57.796  -17.986 1.00 72.93  ? 132  TRP A HZ3  1 
ATOM   2167  H  HH2  . TRP A 1 135 ? 50.028  57.604  -19.627 1.00 79.23  ? 132  TRP A HH2  1 
ATOM   2168  N  N    . THR A 1 136 ? 54.643  50.824  -17.791 1.00 53.09  ? 133  THR A N    1 
ATOM   2169  C  CA   . THR A 1 136 ? 54.057  49.500  -17.948 1.00 46.89  ? 133  THR A CA   1 
ATOM   2170  C  C    . THR A 1 136 ? 52.869  49.301  -17.006 1.00 47.80  ? 133  THR A C    1 
ATOM   2171  O  O    . THR A 1 136 ? 51.947  48.539  -17.296 1.00 52.74  ? 133  THR A O    1 
ATOM   2172  C  CB   . THR A 1 136 ? 55.110  48.425  -17.676 1.00 42.84  ? 133  THR A CB   1 
ATOM   2173  O  OG1  . THR A 1 136 ? 56.297  48.742  -18.411 1.00 61.43  ? 133  THR A OG1  1 
ATOM   2174  C  CG2  . THR A 1 136 ? 54.632  47.063  -18.098 1.00 52.00  ? 133  THR A CG2  1 
ATOM   2175  H  H    . THR A 1 136 ? 55.489  50.814  -17.637 1.00 63.71  ? 133  THR A H    1 
ATOM   2176  H  HA   . THR A 1 136 ? 53.743  49.395  -18.860 1.00 56.27  ? 133  THR A HA   1 
ATOM   2177  H  HB   . THR A 1 136 ? 55.312  48.401  -16.728 1.00 51.40  ? 133  THR A HB   1 
ATOM   2178  H  HG1  . THR A 1 136 ? 56.886  48.159  -18.272 1.00 73.72  ? 133  THR A HG1  1 
ATOM   2179  H  HG21 . THR A 1 136 ? 54.436  47.060  -19.048 1.00 62.40  ? 133  THR A HG21 1 
ATOM   2180  H  HG22 . THR A 1 136 ? 55.316  46.400  -17.916 1.00 62.40  ? 133  THR A HG22 1 
ATOM   2181  H  HG23 . THR A 1 136 ? 53.827  46.828  -17.610 1.00 62.40  ? 133  THR A HG23 1 
ATOM   2182  N  N    . LEU A 1 137 ? 52.876  50.034  -15.900 1.00 47.94  ? 134  LEU A N    1 
ATOM   2183  C  CA   . LEU A 1 137 ? 51.780  50.006  -14.949 1.00 51.78  ? 134  LEU A CA   1 
ATOM   2184  C  C    . LEU A 1 137 ? 50.493  50.474  -15.612 1.00 46.16  ? 134  LEU A C    1 
ATOM   2185  O  O    . LEU A 1 137 ? 49.427  49.898  -15.372 1.00 49.22  ? 134  LEU A O    1 
ATOM   2186  C  CB   . LEU A 1 137 ? 52.105  50.873  -13.727 1.00 47.11  ? 134  LEU A CB   1 
ATOM   2187  C  CG   . LEU A 1 137 ? 53.109  50.296  -12.728 1.00 44.03  ? 134  LEU A CG   1 
ATOM   2188  C  CD1  . LEU A 1 137 ? 53.463  51.376  -11.719 1.00 45.78  ? 134  LEU A CD1  1 
ATOM   2189  C  CD2  . LEU A 1 137 ? 52.583  49.035  -12.006 1.00 37.93  ? 134  LEU A CD2  1 
ATOM   2190  H  H    . LEU A 1 137 ? 53.516  50.563  -15.677 1.00 57.53  ? 134  LEU A H    1 
ATOM   2191  H  HA   . LEU A 1 137 ? 51.647  49.094  -14.645 1.00 62.14  ? 134  LEU A HA   1 
ATOM   2192  H  HB2  . LEU A 1 137 ? 52.464  51.717  -14.041 1.00 56.53  ? 134  LEU A HB2  1 
ATOM   2193  H  HB3  . LEU A 1 137 ? 51.280  51.036  -13.243 1.00 56.53  ? 134  LEU A HB3  1 
ATOM   2194  H  HG   . LEU A 1 137 ? 53.920  50.052  -13.202 1.00 52.84  ? 134  LEU A HG   1 
ATOM   2195  H  HD11 . LEU A 1 137 ? 52.655  51.653  -11.259 1.00 54.93  ? 134  LEU A HD11 1 
ATOM   2196  H  HD12 . LEU A 1 137 ? 54.100  51.016  -11.083 1.00 54.93  ? 134  LEU A HD12 1 
ATOM   2197  H  HD13 . LEU A 1 137 ? 53.853  52.130  -12.188 1.00 54.93  ? 134  LEU A HD13 1 
ATOM   2198  H  HD21 . LEU A 1 137 ? 52.389  48.351  -12.666 1.00 45.51  ? 134  LEU A HD21 1 
ATOM   2199  H  HD22 . LEU A 1 137 ? 53.261  48.719  -11.389 1.00 45.51  ? 134  LEU A HD22 1 
ATOM   2200  H  HD23 . LEU A 1 137 ? 51.775  49.265  -11.520 1.00 45.51  ? 134  LEU A HD23 1 
ATOM   2201  N  N    . MET A 1 138 ? 50.580  51.508  -16.446 1.00 41.61  ? 135  MET A N    1 
ATOM   2202  C  CA   . MET A 1 138 ? 49.383  51.968  -17.156 1.00 55.08  ? 135  MET A CA   1 
ATOM   2203  C  C    . MET A 1 138 ? 48.886  50.895  -18.100 1.00 44.59  ? 135  MET A C    1 
ATOM   2204  O  O    . MET A 1 138 ? 47.704  50.543  -18.099 1.00 51.60  ? 135  MET A O    1 
ATOM   2205  C  CB   . MET A 1 138 ? 49.661  53.225  -17.969 1.00 47.89  ? 135  MET A CB   1 
ATOM   2206  C  CG   . MET A 1 138 ? 49.850  54.460  -17.138 1.00 59.13  ? 135  MET A CG   1 
ATOM   2207  S  SD   . MET A 1 138 ? 48.375  54.917  -16.202 1.00 64.88  ? 135  MET A SD   1 
ATOM   2208  C  CE   . MET A 1 138 ? 49.098  54.956  -14.568 1.00 61.81  ? 135  MET A CE   1 
ATOM   2209  H  H    . MET A 1 138 ? 51.298  51.951  -16.617 1.00 49.93  ? 135  MET A H    1 
ATOM   2210  H  HA   . MET A 1 138 ? 48.689  52.172  -16.511 1.00 66.09  ? 135  MET A HA   1 
ATOM   2211  H  HB2  . MET A 1 138 ? 50.471  53.089  -18.486 1.00 57.46  ? 135  MET A HB2  1 
ATOM   2212  H  HB3  . MET A 1 138 ? 48.914  53.381  -18.567 1.00 57.46  ? 135  MET A HB3  1 
ATOM   2213  H  HG2  . MET A 1 138 ? 50.569  54.307  -16.506 1.00 70.95  ? 135  MET A HG2  1 
ATOM   2214  H  HG3  . MET A 1 138 ? 50.074  55.201  -17.722 1.00 70.95  ? 135  MET A HG3  1 
ATOM   2215  H  HE1  . MET A 1 138 ? 49.810  55.615  -14.554 1.00 74.18  ? 135  MET A HE1  1 
ATOM   2216  H  HE2  . MET A 1 138 ? 48.412  55.195  -13.925 1.00 74.18  ? 135  MET A HE2  1 
ATOM   2217  H  HE3  . MET A 1 138 ? 49.456  54.079  -14.360 1.00 74.18  ? 135  MET A HE3  1 
ATOM   2218  N  N    . THR A 1 139 ? 49.834  50.294  -18.805 1.00 40.76  ? 136  THR A N    1 
ATOM   2219  C  CA   . THR A 1 139 ? 49.529  49.271  -19.775 1.00 47.58  ? 136  THR A CA   1 
ATOM   2220  C  C    . THR A 1 139 ? 48.751  48.146  -19.123 1.00 52.62  ? 136  THR A C    1 
ATOM   2221  O  O    . THR A 1 139 ? 47.746  47.689  -19.661 1.00 53.26  ? 136  THR A O    1 
ATOM   2222  C  CB   . THR A 1 139 ? 50.822  48.721  -20.388 1.00 47.59  ? 136  THR A CB   1 
ATOM   2223  O  OG1  . THR A 1 139 ? 51.504  49.782  -21.071 1.00 53.60  ? 136  THR A OG1  1 
ATOM   2224  C  CG2  . THR A 1 139 ? 50.535  47.585  -21.358 1.00 50.83  ? 136  THR A CG2  1 
ATOM   2225  H  H    . THR A 1 139 ? 50.673  50.468  -18.734 1.00 48.91  ? 136  THR A H    1 
ATOM   2226  H  HA   . THR A 1 139 ? 48.987  49.649  -20.485 1.00 57.09  ? 136  THR A HA   1 
ATOM   2227  H  HB   . THR A 1 139 ? 51.391  48.380  -19.680 1.00 57.11  ? 136  THR A HB   1 
ATOM   2228  H  HG1  . THR A 1 139 ? 52.215  49.494  -21.412 1.00 64.32  ? 136  THR A HG1  1 
ATOM   2229  H  HG21 . THR A 1 139 ? 49.967  47.901  -22.078 1.00 60.99  ? 136  THR A HG21 1 
ATOM   2230  H  HG22 . THR A 1 139 ? 51.365  47.253  -21.734 1.00 60.99  ? 136  THR A HG22 1 
ATOM   2231  H  HG23 . THR A 1 139 ? 50.085  46.861  -20.896 1.00 60.99  ? 136  THR A HG23 1 
ATOM   2232  N  N    . MET A 1 140 ? 49.173  47.740  -17.936 1.00 44.35  ? 137  MET A N    1 
ATOM   2233  C  CA   . MET A 1 140 ? 48.453  46.709  -17.222 1.00 49.51  ? 137  MET A CA   1 
ATOM   2234  C  C    . MET A 1 140 ? 47.101  47.257  -16.755 1.00 49.03  ? 137  MET A C    1 
ATOM   2235  O  O    . MET A 1 140 ? 46.110  46.523  -16.695 1.00 54.20  ? 137  MET A O    1 
ATOM   2236  C  CB   . MET A 1 140 ? 49.279  46.205  -16.042 1.00 49.20  ? 137  MET A CB   1 
ATOM   2237  C  CG   . MET A 1 140 ? 50.506  45.397  -16.456 1.00 47.34  ? 137  MET A CG   1 
ATOM   2238  S  SD   . MET A 1 140 ? 51.430  44.736  -15.045 1.00 52.31  ? 137  MET A SD   1 
ATOM   2239  C  CE   . MET A 1 140 ? 52.157  46.239  -14.431 1.00 61.05  ? 137  MET A CE   1 
ATOM   2240  H  H    . MET A 1 140 ? 49.866  48.044  -17.527 1.00 53.22  ? 137  MET A H    1 
ATOM   2241  H  HA   . MET A 1 140 ? 48.299  45.961  -17.821 1.00 59.41  ? 137  MET A HA   1 
ATOM   2242  H  HB2  . MET A 1 140 ? 49.585  46.967  -15.526 1.00 59.04  ? 137  MET A HB2  1 
ATOM   2243  H  HB3  . MET A 1 140 ? 48.721  45.636  -15.489 1.00 59.04  ? 137  MET A HB3  1 
ATOM   2244  H  HG2  . MET A 1 140 ? 50.221  44.648  -17.003 1.00 56.81  ? 137  MET A HG2  1 
ATOM   2245  H  HG3  . MET A 1 140 ? 51.104  45.968  -16.963 1.00 56.81  ? 137  MET A HG3  1 
ATOM   2246  H  HE1  . MET A 1 140 ? 51.448  46.856  -14.190 1.00 73.26  ? 137  MET A HE1  1 
ATOM   2247  H  HE2  . MET A 1 140 ? 52.696  46.033  -13.651 1.00 73.26  ? 137  MET A HE2  1 
ATOM   2248  H  HE3  . MET A 1 140 ? 52.713  46.627  -15.124 1.00 73.26  ? 137  MET A HE3  1 
ATOM   2249  N  N    . ALA A 1 141 ? 47.054  48.552  -16.449 1.00 42.63  ? 138  ALA A N    1 
ATOM   2250  C  CA   . ALA A 1 141 ? 45.827  49.131  -15.923 1.00 46.14  ? 138  ALA A CA   1 
ATOM   2251  C  C    . ALA A 1 141 ? 44.757  49.206  -17.010 1.00 53.10  ? 138  ALA A C    1 
ATOM   2252  O  O    . ALA A 1 141 ? 43.595  48.844  -16.790 1.00 49.04  ? 138  ALA A O    1 
ATOM   2253  C  CB   . ALA A 1 141 ? 46.098  50.492  -15.334 1.00 41.13  ? 138  ALA A CB   1 
ATOM   2254  H  H    . ALA A 1 141 ? 47.707  49.105  -16.535 1.00 51.15  ? 138  ALA A H    1 
ATOM   2255  H  HA   . ALA A 1 141 ? 45.490  48.561  -15.213 1.00 55.37  ? 138  ALA A HA   1 
ATOM   2256  H  HB1  . ALA A 1 141 ? 46.453  51.070  -16.027 1.00 49.35  ? 138  ALA A HB1  1 
ATOM   2257  H  HB2  . ALA A 1 141 ? 45.268  50.858  -14.990 1.00 49.35  ? 138  ALA A HB2  1 
ATOM   2258  H  HB3  . ALA A 1 141 ? 46.743  50.402  -14.615 1.00 49.35  ? 138  ALA A HB3  1 
ATOM   2259  N  N    . ILE A 1 142 ? 45.163  49.687  -18.182 1.00 48.75  ? 139  ILE A N    1 
ATOM   2260  C  CA   . ILE A 1 142 ? 44.275  49.781  -19.328 1.00 46.00  ? 139  ILE A CA   1 
ATOM   2261  C  C    . ILE A 1 142 ? 43.745  48.389  -19.712 1.00 56.41  ? 139  ILE A C    1 
ATOM   2262  O  O    . ILE A 1 142 ? 42.533  48.197  -19.858 1.00 52.08  ? 139  ILE A O    1 
ATOM   2263  C  CB   . ILE A 1 142 ? 44.998  50.420  -20.524 1.00 44.32  ? 139  ILE A CB   1 
ATOM   2264  C  CG1  . ILE A 1 142 ? 45.408  51.852  -20.182 1.00 45.58  ? 139  ILE A CG1  1 
ATOM   2265  C  CG2  . ILE A 1 142 ? 44.099  50.409  -21.773 1.00 48.03  ? 139  ILE A CG2  1 
ATOM   2266  C  CD1  . ILE A 1 142 ? 46.199  52.557  -21.266 1.00 50.19  ? 139  ILE A CD1  1 
ATOM   2267  H  H    . ILE A 1 142 ? 45.961  49.967  -18.337 1.00 58.50  ? 139  ILE A H    1 
ATOM   2268  H  HA   . ILE A 1 142 ? 43.516  50.341  -19.098 1.00 55.20  ? 139  ILE A HA   1 
ATOM   2269  H  HB   . ILE A 1 142 ? 45.798  49.905  -20.714 1.00 53.19  ? 139  ILE A HB   1 
ATOM   2270  H  HG12 . ILE A 1 142 ? 44.607  52.373  -20.017 1.00 54.69  ? 139  ILE A HG12 1 
ATOM   2271  H  HG13 . ILE A 1 142 ? 45.957  51.834  -19.383 1.00 54.69  ? 139  ILE A HG13 1 
ATOM   2272  H  HG21 . ILE A 1 142 ? 43.292  50.913  -21.585 1.00 57.63  ? 139  ILE A HG21 1 
ATOM   2273  H  HG22 . ILE A 1 142 ? 44.579  50.817  -22.511 1.00 57.63  ? 139  ILE A HG22 1 
ATOM   2274  H  HG23 . ILE A 1 142 ? 43.873  49.492  -21.992 1.00 57.63  ? 139  ILE A HG23 1 
ATOM   2275  H  HD11 . ILE A 1 142 ? 45.661  52.599  -22.072 1.00 60.23  ? 139  ILE A HD11 1 
ATOM   2276  H  HD12 . ILE A 1 142 ? 46.415  53.454  -20.965 1.00 60.23  ? 139  ILE A HD12 1 
ATOM   2277  H  HD13 . ILE A 1 142 ? 47.013  52.059  -21.437 1.00 60.23  ? 139  ILE A HD13 1 
ATOM   2278  N  N    . ARG A 1 143 ? 44.647  47.419  -19.849 1.00 39.42  ? 140  ARG A N    1 
ATOM   2279  C  CA   . ARG A 1 143 ? 44.252  46.067  -20.220 1.00 43.95  ? 140  ARG A CA   1 
ATOM   2280  C  C    . ARG A 1 143 ? 43.358  45.424  -19.171 1.00 44.03  ? 140  ARG A C    1 
ATOM   2281  O  O    . ARG A 1 143 ? 42.336  44.822  -19.501 1.00 55.44  ? 140  ARG A O    1 
ATOM   2282  C  CB   . ARG A 1 143 ? 45.489  45.204  -20.451 1.00 40.19  ? 140  ARG A CB   1 
ATOM   2283  C  CG   . ARG A 1 143 ? 46.251  45.575  -21.714 1.00 45.69  ? 140  ARG A CG   1 
ATOM   2284  C  CD   . ARG A 1 143 ? 47.527  44.781  -21.842 1.00 58.06  ? 140  ARG A CD   1 
ATOM   2285  N  NE   . ARG A 1 143 ? 47.272  43.355  -21.982 1.00 76.78  ? 140  ARG A NE   1 
ATOM   2286  C  CZ   . ARG A 1 143 ? 47.020  42.744  -23.130 1.00 93.15  ? 140  ARG A CZ   1 
ATOM   2287  N  NH1  . ARG A 1 143 ? 46.984  43.436  -24.271 1.00 79.08  ? 140  ARG A NH1  1 
ATOM   2288  N  NH2  . ARG A 1 143 ? 46.799  41.434  -23.124 1.00 88.04  ? 140  ARG A NH2  1 
ATOM   2289  H  H    . ARG A 1 143 ? 45.493  47.520  -19.732 1.00 47.31  ? 140  ARG A H    1 
ATOM   2290  H  HA   . ARG A 1 143 ? 43.754  46.104  -21.052 1.00 52.74  ? 140  ARG A HA   1 
ATOM   2291  H  HB2  . ARG A 1 143 ? 46.091  45.308  -19.698 1.00 48.23  ? 140  ARG A HB2  1 
ATOM   2292  H  HB3  . ARG A 1 143 ? 45.216  44.276  -20.530 1.00 48.23  ? 140  ARG A HB3  1 
ATOM   2293  H  HG2  . ARG A 1 143 ? 45.697  45.389  -22.488 1.00 54.82  ? 140  ARG A HG2  1 
ATOM   2294  H  HG3  . ARG A 1 143 ? 46.481  46.517  -21.684 1.00 54.82  ? 140  ARG A HG3  1 
ATOM   2295  H  HD2  . ARG A 1 143 ? 48.010  45.080  -22.628 1.00 69.67  ? 140  ARG A HD2  1 
ATOM   2296  H  HD3  . ARG A 1 143 ? 48.067  44.915  -21.047 1.00 69.67  ? 140  ARG A HD3  1 
ATOM   2297  H  HE   . ARG A 1 143 ? 47.286  42.875  -21.269 1.00 92.14  ? 140  ARG A HE   1 
ATOM   2298  H  HH11 . ARG A 1 143 ? 47.127  44.284  -24.265 1.00 94.90  ? 140  ARG A HH11 1 
ATOM   2299  H  HH12 . ARG A 1 143 ? 46.820  43.033  -25.013 1.00 94.90  ? 140  ARG A HH12 1 
ATOM   2300  H  HH21 . ARG A 1 143 ? 46.824  40.997  -22.383 1.00 105.65 ? 140  ARG A HH21 1 
ATOM   2301  H  HH22 . ARG A 1 143 ? 46.634  41.022  -23.860 1.00 105.65 ? 140  ARG A HH22 1 
ATOM   2302  N  N    . ILE A 1 144 ? 43.733  45.570  -17.908 1.00 47.70  ? 141  ILE A N    1 
ATOM   2303  C  CA   . ILE A 1 144 ? 42.992  44.949  -16.814 1.00 44.61  ? 141  ILE A CA   1 
ATOM   2304  C  C    . ILE A 1 144 ? 41.569  45.473  -16.730 1.00 49.12  ? 141  ILE A C    1 
ATOM   2305  O  O    . ILE A 1 144 ? 40.619  44.704  -16.603 1.00 47.01  ? 141  ILE A O    1 
ATOM   2306  C  CB   . ILE A 1 144 ? 43.701  45.196  -15.464 1.00 38.95  ? 141  ILE A CB   1 
ATOM   2307  C  CG1  . ILE A 1 144 ? 44.879  44.238  -15.321 1.00 49.91  ? 141  ILE A CG1  1 
ATOM   2308  C  CG2  . ILE A 1 144 ? 42.739  44.996  -14.261 1.00 38.80  ? 141  ILE A CG2  1 
ATOM   2309  C  CD1  . ILE A 1 144 ? 45.762  44.525  -14.142 1.00 44.69  ? 141  ILE A CD1  1 
ATOM   2310  H  H    . ILE A 1 144 ? 44.416  46.026  -17.654 1.00 57.24  ? 141  ILE A H    1 
ATOM   2311  H  HA   . ILE A 1 144 ? 42.952  43.991  -16.963 1.00 53.53  ? 141  ILE A HA   1 
ATOM   2312  H  HB   . ILE A 1 144 ? 44.035  46.106  -15.448 1.00 46.74  ? 141  ILE A HB   1 
ATOM   2313  H  HG12 . ILE A 1 144 ? 44.537  43.336  -15.221 1.00 59.89  ? 141  ILE A HG12 1 
ATOM   2314  H  HG13 . ILE A 1 144 ? 45.426  44.295  -16.120 1.00 59.89  ? 141  ILE A HG13 1 
ATOM   2315  H  HG21 . ILE A 1 144 ? 42.405  44.085  -14.272 1.00 46.57  ? 141  ILE A HG21 1 
ATOM   2316  H  HG22 . ILE A 1 144 ? 43.225  45.161  -13.438 1.00 46.57  ? 141  ILE A HG22 1 
ATOM   2317  H  HG23 . ILE A 1 144 ? 42.001  45.620  -14.341 1.00 46.57  ? 141  ILE A HG23 1 
ATOM   2318  H  HD11 . ILE A 1 144 ? 45.235  44.460  -13.330 1.00 53.63  ? 141  ILE A HD11 1 
ATOM   2319  H  HD12 . ILE A 1 144 ? 46.483  43.876  -14.123 1.00 53.63  ? 141  ILE A HD12 1 
ATOM   2320  H  HD13 . ILE A 1 144 ? 46.124  45.421  -14.231 1.00 53.63  ? 141  ILE A HD13 1 
ATOM   2321  N  N    A ILE A 1 145 ? 41.431  46.791  -16.800 0.31 46.97  ? 142  ILE A N    1 
ATOM   2322  N  N    B ILE A 1 145 ? 41.439  46.795  -16.776 0.69 47.47  ? 142  ILE A N    1 
ATOM   2323  C  CA   A ILE A 1 145 ? 40.143  47.429  -16.588 0.31 47.27  ? 142  ILE A CA   1 
ATOM   2324  C  CA   B ILE A 1 145 ? 40.158  47.461  -16.600 0.69 47.72  ? 142  ILE A CA   1 
ATOM   2325  C  C    A ILE A 1 145 ? 39.298  47.362  -17.860 0.31 51.26  ? 142  ILE A C    1 
ATOM   2326  C  C    B ILE A 1 145 ? 39.307  47.353  -17.863 0.69 51.48  ? 142  ILE A C    1 
ATOM   2327  O  O    A ILE A 1 145 ? 38.116  47.006  -17.806 0.31 50.73  ? 142  ILE A O    1 
ATOM   2328  O  O    B ILE A 1 145 ? 38.126  46.995  -17.805 0.69 50.66  ? 142  ILE A O    1 
ATOM   2329  C  CB   A ILE A 1 145 ? 40.337  48.889  -16.125 0.31 45.79  ? 142  ILE A CB   1 
ATOM   2330  C  CB   B ILE A 1 145 ? 40.363  48.953  -16.229 0.69 45.58  ? 142  ILE A CB   1 
ATOM   2331  C  CG1  A ILE A 1 145 ? 40.742  48.903  -14.650 0.31 50.40  ? 142  ILE A CG1  1 
ATOM   2332  C  CG1  B ILE A 1 145 ? 40.982  49.079  -14.833 0.69 50.71  ? 142  ILE A CG1  1 
ATOM   2333  C  CG2  A ILE A 1 145 ? 39.066  49.716  -16.308 0.31 45.10  ? 142  ILE A CG2  1 
ATOM   2334  C  CG2  B ILE A 1 145 ? 39.048  49.728  -16.281 0.69 45.62  ? 142  ILE A CG2  1 
ATOM   2335  C  CD1  A ILE A 1 145 ? 41.319  50.226  -14.172 0.31 47.53  ? 142  ILE A CD1  1 
ATOM   2336  C  CD1  B ILE A 1 145 ? 40.067  48.604  -13.672 0.69 49.81  ? 142  ILE A CD1  1 
ATOM   2337  H  H    A ILE A 1 145 ? 42.072  47.339  -16.969 0.31 56.36  ? 142  ILE A H    1 
ATOM   2338  H  H    B ILE A 1 145 ? 42.094  47.337  -16.910 0.69 56.96  ? 142  ILE A H    1 
ATOM   2339  H  HA   A ILE A 1 145 ? 39.668  46.954  -15.888 0.31 56.73  ? 142  ILE A HA   1 
ATOM   2340  H  HA   B ILE A 1 145 ? 39.676  47.034  -15.875 0.69 57.26  ? 142  ILE A HA   1 
ATOM   2341  H  HB   A ILE A 1 145 ? 41.049  49.290  -16.648 0.31 54.95  ? 142  ILE A HB   1 
ATOM   2342  H  HB   B ILE A 1 145 ? 40.974  49.346  -16.871 0.69 54.69  ? 142  ILE A HB   1 
ATOM   2343  H  HG12 A ILE A 1 145 ? 39.959  48.711  -14.111 0.31 60.48  ? 142  ILE A HG12 1 
ATOM   2344  H  HG12 B ILE A 1 145 ? 41.793  48.547  -14.805 0.69 60.86  ? 142  ILE A HG12 1 
ATOM   2345  H  HG13 A ILE A 1 145 ? 41.415  48.219  -14.506 0.31 60.48  ? 142  ILE A HG13 1 
ATOM   2346  H  HG13 B ILE A 1 145 ? 41.199  50.011  -14.674 0.69 60.86  ? 142  ILE A HG13 1 
ATOM   2347  H  HG21 A ILE A 1 145 ? 38.353  49.318  -15.785 0.31 54.12  ? 142  ILE A HG21 1 
ATOM   2348  H  HG21 B ILE A 1 145 ? 38.425  49.333  -15.651 0.69 54.75  ? 142  ILE A HG21 1 
ATOM   2349  H  HG22 A ILE A 1 145 ? 39.233  50.622  -16.006 0.31 54.12  ? 142  ILE A HG22 1 
ATOM   2350  H  HG22 B ILE A 1 145 ? 39.218  50.653  -16.043 0.69 54.75  ? 142  ILE A HG22 1 
ATOM   2351  H  HG23 A ILE A 1 145 ? 38.825  49.719  -17.248 0.31 54.12  ? 142  ILE A HG23 1 
ATOM   2352  H  HG23 B ILE A 1 145 ? 38.687  49.677  -17.180 0.69 54.75  ? 142  ILE A HG23 1 
ATOM   2353  H  HD11 A ILE A 1 145 ? 40.655  50.922  -14.295 0.31 57.04  ? 142  ILE A HD11 1 
ATOM   2354  H  HD11 B ILE A 1 145 ? 39.851  47.668  -13.804 0.69 59.77  ? 142  ILE A HD11 1 
ATOM   2355  H  HD12 A ILE A 1 145 ? 41.548  50.149  -13.233 0.31 57.04  ? 142  ILE A HD12 1 
ATOM   2356  H  HD12 B ILE A 1 145 ? 40.538  48.720  -12.832 0.69 59.77  ? 142  ILE A HD12 1 
ATOM   2357  H  HD13 A ILE A 1 145 ? 42.113  50.429  -14.691 0.31 57.04  ? 142  ILE A HD13 1 
ATOM   2358  H  HD13 B ILE A 1 145 ? 39.256  49.135  -13.673 0.69 59.77  ? 142  ILE A HD13 1 
ATOM   2359  N  N    . ASP A 1 146 ? 39.904  47.651  -19.007 1.00 45.24  ? 143  ASP A N    1 
ATOM   2360  C  CA   . ASP A 1 146 ? 39.157  47.622  -20.243 1.00 52.53  ? 143  ASP A CA   1 
ATOM   2361  C  C    . ASP A 1 146 ? 38.597  46.239  -20.502 1.00 56.86  ? 143  ASP A C    1 
ATOM   2362  O  O    . ASP A 1 146 ? 37.476  46.099  -20.984 1.00 59.48  ? 143  ASP A O    1 
ATOM   2363  C  CB   . ASP A 1 146 ? 40.016  48.046  -21.409 1.00 55.46  ? 143  ASP A CB   1 
ATOM   2364  C  CG   . ASP A 1 146 ? 39.231  48.114  -22.676 1.00 50.37  ? 143  ASP A CG   1 
ATOM   2365  O  OD1  . ASP A 1 146 ? 38.532  49.128  -22.873 1.00 54.55  ? 143  ASP A OD1  1 
ATOM   2366  O  OD2  . ASP A 1 146 ? 39.322  47.157  -23.477 1.00 74.47  ? 143  ASP A OD2  1 
ATOM   2367  H  H    A ASP A 1 146 ? 40.734  47.862  -19.090 0.31 54.28  ? 143  ASP A H    1 
ATOM   2368  H  H    B ASP A 1 146 ? 40.732  47.870  -19.091 0.69 54.28  ? 143  ASP A H    1 
ATOM   2369  H  HA   . ASP A 1 146 ? 38.412  48.241  -20.177 1.00 63.04  ? 143  ASP A HA   1 
ATOM   2370  H  HB2  . ASP A 1 146 ? 40.383  48.927  -21.232 1.00 66.55  ? 143  ASP A HB2  1 
ATOM   2371  H  HB3  . ASP A 1 146 ? 40.731  47.403  -21.529 1.00 66.55  ? 143  ASP A HB3  1 
ATOM   2372  N  N    . ARG A 1 147 ? 39.349  45.220  -20.111 1.00 41.75  ? 144  ARG A N    1 
ATOM   2373  C  CA   . ARG A 1 147 ? 38.863  43.870  -20.249 1.00 45.62  ? 144  ARG A CA   1 
ATOM   2374  C  C    . ARG A 1 147 ? 37.603  43.714  -19.410 1.00 51.31  ? 144  ARG A C    1 
ATOM   2375  O  O    . ARG A 1 147 ? 36.651  43.062  -19.831 1.00 62.02  ? 144  ARG A O    1 
ATOM   2376  C  CB   . ARG A 1 147 ? 39.913  42.854  -19.813 1.00 45.47  ? 144  ARG A CB   1 
ATOM   2377  C  CG   . ARG A 1 147 ? 39.498  41.403  -20.058 1.00 43.50  ? 144  ARG A CG   1 
ATOM   2378  C  CD   . ARG A 1 147 ? 39.991  40.455  -18.970 1.00 50.74  ? 144  ARG A CD   1 
ATOM   2379  N  NE   . ARG A 1 147 ? 39.449  40.790  -17.653 1.00 57.11  ? 144  ARG A NE   1 
ATOM   2380  C  CZ   . ARG A 1 147 ? 38.221  40.484  -17.240 1.00 57.88  ? 144  ARG A CZ   1 
ATOM   2381  N  NH1  . ARG A 1 147 ? 37.391  39.851  -18.050 1.00 51.88  ? 144  ARG A NH1  1 
ATOM   2382  N  NH2  . ARG A 1 147 ? 37.814  40.828  -16.023 1.00 50.12  ? 144  ARG A NH2  1 
ATOM   2383  H  H    . ARG A 1 147 ? 40.134  45.288  -19.767 1.00 50.10  ? 144  ARG A H    1 
ATOM   2384  H  HA   . ARG A 1 147 ? 38.637  43.701  -21.177 1.00 54.74  ? 144  ARG A HA   1 
ATOM   2385  H  HB2  . ARG A 1 147 ? 40.731  43.017  -20.308 1.00 54.56  ? 144  ARG A HB2  1 
ATOM   2386  H  HB3  . ARG A 1 147 ? 40.077  42.961  -18.863 1.00 54.56  ? 144  ARG A HB3  1 
ATOM   2387  H  HG2  . ARG A 1 147 ? 38.530  41.351  -20.084 1.00 52.20  ? 144  ARG A HG2  1 
ATOM   2388  H  HG3  . ARG A 1 147 ? 39.869  41.107  -20.904 1.00 52.20  ? 144  ARG A HG3  1 
ATOM   2389  H  HD2  . ARG A 1 147 ? 39.715  39.551  -19.189 1.00 60.89  ? 144  ARG A HD2  1 
ATOM   2390  H  HD3  . ARG A 1 147 ? 40.958  40.505  -18.920 1.00 60.89  ? 144  ARG A HD3  1 
ATOM   2391  H  HE   . ARG A 1 147 ? 39.960  41.215  -17.107 1.00 68.54  ? 144  ARG A HE   1 
ATOM   2392  H  HH11 . ARG A 1 147 ? 37.648  39.626  -18.839 1.00 62.26  ? 144  ARG A HH11 1 
ATOM   2393  H  HH12 . ARG A 1 147 ? 36.596  39.656  -17.784 1.00 62.26  ? 144  ARG A HH12 1 
ATOM   2394  H  HH21 . ARG A 1 147 ? 38.348  41.244  -15.492 1.00 60.15  ? 144  ARG A HH21 1 
ATOM   2395  H  HH22 . ARG A 1 147 ? 37.018  40.632  -15.764 1.00 60.15  ? 144  ARG A HH22 1 
ATOM   2396  N  N    . ALA A 1 148 ? 37.570  44.347  -18.244 1.00 44.82  ? 145  ALA A N    1 
ATOM   2397  C  CA   . ALA A 1 148 ? 36.439  44.136  -17.347 1.00 53.75  ? 145  ALA A CA   1 
ATOM   2398  C  C    . ALA A 1 148 ? 35.230  44.894  -17.889 1.00 49.48  ? 145  ALA A C    1 
ATOM   2399  O  O    . ALA A 1 148 ? 34.107  44.397  -17.875 1.00 49.79  ? 145  ALA A O    1 
ATOM   2400  C  CB   . ALA A 1 148 ? 36.776  44.574  -15.935 1.00 50.79  ? 145  ALA A CB   1 
ATOM   2401  H  H    . ALA A 1 148 ? 38.171  44.889  -17.953 1.00 53.79  ? 145  ALA A H    1 
ATOM   2402  H  HA   . ALA A 1 148 ? 36.219  43.191  -17.327 1.00 64.50  ? 145  ALA A HA   1 
ATOM   2403  H  HB1  . ALA A 1 148 ? 37.001  45.517  -15.942 1.00 60.95  ? 145  ALA A HB1  1 
ATOM   2404  H  HB2  . ALA A 1 148 ? 36.006  44.421  -15.365 1.00 60.95  ? 145  ALA A HB2  1 
ATOM   2405  H  HB3  . ALA A 1 148 ? 37.531  44.055  -15.616 1.00 60.95  ? 145  ALA A HB3  1 
ATOM   2406  N  N    . LEU A 1 149 ? 35.477  46.096  -18.392 1.00 49.52  ? 146  LEU A N    1 
ATOM   2407  C  CA   . LEU A 1 149 ? 34.413  46.924  -18.939 1.00 58.61  ? 146  LEU A CA   1 
ATOM   2408  C  C    . LEU A 1 149 ? 33.791  46.248  -20.164 1.00 53.47  ? 146  LEU A C    1 
ATOM   2409  O  O    . LEU A 1 149 ? 32.573  46.226  -20.318 1.00 46.74  ? 146  LEU A O    1 
ATOM   2410  C  CB   . LEU A 1 149 ? 34.975  48.300  -19.300 1.00 50.37  ? 146  LEU A CB   1 
ATOM   2411  C  CG   . LEU A 1 149 ? 35.485  49.134  -18.118 1.00 49.57  ? 146  LEU A CG   1 
ATOM   2412  C  CD1  . LEU A 1 149 ? 36.026  50.459  -18.616 1.00 44.24  ? 146  LEU A CD1  1 
ATOM   2413  C  CD2  . LEU A 1 149 ? 34.389  49.377  -17.063 1.00 45.43  ? 146  LEU A CD2  1 
ATOM   2414  H  H    . LEU A 1 149 ? 36.257  46.456  -18.428 1.00 59.42  ? 146  LEU A H    1 
ATOM   2415  H  HA   . LEU A 1 149 ? 33.721  47.043  -18.270 1.00 70.33  ? 146  LEU A HA   1 
ATOM   2416  H  HB2  . LEU A 1 149 ? 35.719  48.177  -19.911 1.00 60.44  ? 146  LEU A HB2  1 
ATOM   2417  H  HB3  . LEU A 1 149 ? 34.277  48.812  -19.738 1.00 60.44  ? 146  LEU A HB3  1 
ATOM   2418  H  HG   . LEU A 1 149 ? 36.212  48.657  -17.688 1.00 59.49  ? 146  LEU A HG   1 
ATOM   2419  H  HD11 . LEU A 1 149 ? 35.315  50.940  -19.069 1.00 53.09  ? 146  LEU A HD11 1 
ATOM   2420  H  HD12 . LEU A 1 149 ? 36.344  50.975  -17.859 1.00 53.09  ? 146  LEU A HD12 1 
ATOM   2421  H  HD13 . LEU A 1 149 ? 36.756  50.290  -19.232 1.00 53.09  ? 146  LEU A HD13 1 
ATOM   2422  H  HD21 . LEU A 1 149 ? 34.082  48.521  -16.724 1.00 54.52  ? 146  LEU A HD21 1 
ATOM   2423  H  HD22 . LEU A 1 149 ? 34.760  49.906  -16.340 1.00 54.52  ? 146  LEU A HD22 1 
ATOM   2424  H  HD23 . LEU A 1 149 ? 33.652  49.852  -17.477 1.00 54.52  ? 146  LEU A HD23 1 
ATOM   2425  N  N    . LYS A 1 150 ? 34.629  45.609  -20.972 1.00 53.93  ? 147  LYS A N    1 
ATOM   2426  C  CA   . LYS A 1 150 ? 34.168  44.968  -22.198 1.00 57.88  ? 147  LYS A CA   1 
ATOM   2427  C  C    . LYS A 1 150 ? 33.536  43.605  -21.944 1.00 53.80  ? 147  LYS A C    1 
ATOM   2428  O  O    . LYS A 1 150 ? 32.424  43.347  -22.395 1.00 61.11  ? 147  LYS A O    1 
ATOM   2429  C  CB   . LYS A 1 150 ? 35.331  44.797  -23.176 1.00 55.85  ? 147  LYS A CB   1 
ATOM   2430  C  CG   . LYS A 1 150 ? 34.998  43.934  -24.365 1.00 60.42  ? 147  LYS A CG   1 
ATOM   2431  C  CD   . LYS A 1 150 ? 36.095  43.960  -25.420 1.00 61.50  ? 147  LYS A CD   1 
ATOM   2432  C  CE   . LYS A 1 150 ? 36.830  42.633  -25.494 1.00 84.49  ? 147  LYS A CE   1 
ATOM   2433  N  NZ   . LYS A 1 150 ? 36.028  41.599  -26.217 1.00 84.59  ? 147  LYS A NZ   1 
ATOM   2434  H  H    . LYS A 1 150 ? 35.474  45.532  -20.833 1.00 64.72  ? 147  LYS A H    1 
ATOM   2435  H  HA   . LYS A 1 150 ? 33.502  45.534  -22.619 1.00 69.46  ? 147  LYS A HA   1 
ATOM   2436  H  HB2  . LYS A 1 150 ? 35.593  45.670  -23.507 1.00 67.02  ? 147  LYS A HB2  1 
ATOM   2437  H  HB3  . LYS A 1 150 ? 36.075  44.385  -22.709 1.00 67.02  ? 147  LYS A HB3  1 
ATOM   2438  H  HG2  . LYS A 1 150 ? 34.885  43.017  -24.070 1.00 72.50  ? 147  LYS A HG2  1 
ATOM   2439  H  HG3  . LYS A 1 150 ? 34.180  44.257  -24.773 1.00 72.50  ? 147  LYS A HG3  1 
ATOM   2440  H  HD2  . LYS A 1 150 ? 35.699  44.137  -26.288 1.00 73.80  ? 147  LYS A HD2  1 
ATOM   2441  H  HD3  . LYS A 1 150 ? 36.737  44.651  -25.196 1.00 73.80  ? 147  LYS A HD3  1 
ATOM   2442  H  HE2  . LYS A 1 150 ? 37.666  42.757  -25.971 1.00 101.39 ? 147  LYS A HE2  1 
ATOM   2443  H  HE3  . LYS A 1 150 ? 37.001  42.311  -24.595 1.00 101.39 ? 147  LYS A HE3  1 
ATOM   2444  H  HZ1  . LYS A 1 150 ? 35.861  41.871  -27.048 1.00 101.50 ? 147  LYS A HZ1  1 
ATOM   2445  H  HZ2  . LYS A 1 150 ? 36.478  40.832  -26.248 1.00 101.50 ? 147  LYS A HZ2  1 
ATOM   2446  H  HZ3  . LYS A 1 150 ? 35.256  41.465  -25.796 1.00 101.50 ? 147  LYS A HZ3  1 
ATOM   2447  N  N    . GLU A 1 151 ? 34.225  42.742  -21.208 1.00 50.03  ? 148  GLU A N    1 
ATOM   2448  C  CA   . GLU A 1 151 ? 33.775  41.362  -21.074 1.00 43.06  ? 148  GLU A CA   1 
ATOM   2449  C  C    . GLU A 1 151 ? 32.786  41.161  -19.943 1.00 44.39  ? 148  GLU A C    1 
ATOM   2450  O  O    . GLU A 1 151 ? 31.750  40.538  -20.134 1.00 62.21  ? 148  GLU A O    1 
ATOM   2451  C  CB   . GLU A 1 151 ? 34.967  40.430  -20.859 1.00 37.79  ? 148  GLU A CB   1 
ATOM   2452  C  CG   . GLU A 1 151 ? 35.955  40.436  -22.018 1.00 45.76  ? 148  GLU A CG   1 
ATOM   2453  C  CD   . GLU A 1 151 ? 37.088  39.454  -21.815 1.00 54.87  ? 148  GLU A CD   1 
ATOM   2454  O  OE1  . GLU A 1 151 ? 37.041  38.695  -20.819 1.00 59.31  ? 148  GLU A OE1  1 
ATOM   2455  O  OE2  . GLU A 1 151 ? 38.042  39.468  -22.630 1.00 58.57  ? 148  GLU A OE2  1 
ATOM   2456  H  H    . GLU A 1 151 ? 34.948  42.927  -20.781 1.00 60.03  ? 148  GLU A H    1 
ATOM   2457  H  HA   . GLU A 1 151 ? 33.337  41.097  -21.898 1.00 51.68  ? 148  GLU A HA   1 
ATOM   2458  H  HB2  . GLU A 1 151 ? 35.442  40.708  -20.061 1.00 45.35  ? 148  GLU A HB2  1 
ATOM   2459  H  HB3  . GLU A 1 151 ? 34.640  39.523  -20.751 1.00 45.35  ? 148  GLU A HB3  1 
ATOM   2460  H  HG2  . GLU A 1 151 ? 35.490  40.194  -22.834 1.00 54.91  ? 148  GLU A HG2  1 
ATOM   2461  H  HG3  . GLU A 1 151 ? 36.338  41.323  -22.104 1.00 54.91  ? 148  GLU A HG3  1 
ATOM   2462  N  N    . ASP A 1 152 ? 33.088  41.715  -18.775 1.00 48.13  ? 149  ASP A N    1 
ATOM   2463  C  CA   . ASP A 1 152 ? 32.240  41.507  -17.607 1.00 52.49  ? 149  ASP A CA   1 
ATOM   2464  C  C    . ASP A 1 152 ? 30.986  42.395  -17.646 1.00 49.27  ? 149  ASP A C    1 
ATOM   2465  O  O    . ASP A 1 152 ? 29.916  41.950  -17.255 1.00 46.17  ? 149  ASP A O    1 
ATOM   2466  C  CB   . ASP A 1 152 ? 33.018  41.769  -16.303 1.00 50.70  ? 149  ASP A CB   1 
ATOM   2467  C  CG   . ASP A 1 152 ? 34.286  40.912  -16.167 1.00 63.35  ? 149  ASP A CG   1 
ATOM   2468  O  OD1  . ASP A 1 152 ? 34.545  40.041  -17.037 1.00 50.36  ? 149  ASP A OD1  1 
ATOM   2469  O  OD2  . ASP A 1 152 ? 35.019  41.113  -15.161 1.00 56.73  ? 149  ASP A OD2  1 
ATOM   2470  H  H    . ASP A 1 152 ? 33.775  42.213  -18.632 1.00 57.76  ? 149  ASP A H    1 
ATOM   2471  H  HA   . ASP A 1 152 ? 31.948  40.582  -17.596 1.00 62.99  ? 149  ASP A HA   1 
ATOM   2472  H  HB2  . ASP A 1 152 ? 33.284  42.701  -16.278 1.00 60.84  ? 149  ASP A HB2  1 
ATOM   2473  H  HB3  . ASP A 1 152 ? 32.441  41.570  -15.548 1.00 60.84  ? 149  ASP A HB3  1 
ATOM   2474  N  N    . PHE A 1 153 ? 31.110  43.636  -18.117 1.00 46.09  ? 150  PHE A N    1 
ATOM   2475  C  CA   . PHE A 1 153 ? 29.994  44.586  -18.073 1.00 54.84  ? 150  PHE A CA   1 
ATOM   2476  C  C    . PHE A 1 153 ? 29.322  44.795  -19.440 1.00 63.60  ? 150  PHE A C    1 
ATOM   2477  O  O    . PHE A 1 153 ? 28.188  45.265  -19.518 1.00 59.97  ? 150  PHE A O    1 
ATOM   2478  C  CB   . PHE A 1 153 ? 30.480  45.928  -17.518 1.00 49.51  ? 150  PHE A CB   1 
ATOM   2479  C  CG   . PHE A 1 153 ? 30.748  45.905  -16.036 1.00 50.81  ? 150  PHE A CG   1 
ATOM   2480  C  CD1  . PHE A 1 153 ? 29.703  46.027  -15.133 1.00 49.43  ? 150  PHE A CD1  1 
ATOM   2481  C  CD2  . PHE A 1 153 ? 32.040  45.745  -15.542 1.00 50.05  ? 150  PHE A CD2  1 
ATOM   2482  C  CE1  . PHE A 1 153 ? 29.932  45.987  -13.763 1.00 44.05  ? 150  PHE A CE1  1 
ATOM   2483  C  CE2  . PHE A 1 153 ? 32.284  45.711  -14.173 1.00 39.17  ? 150  PHE A CE2  1 
ATOM   2484  C  CZ   . PHE A 1 153 ? 31.228  45.833  -13.280 1.00 45.94  ? 150  PHE A CZ   1 
ATOM   2485  H  H    . PHE A 1 153 ? 31.828  43.953  -18.467 1.00 55.31  ? 150  PHE A H    1 
ATOM   2486  H  HA   . PHE A 1 153 ? 29.321  44.243  -17.465 1.00 65.81  ? 150  PHE A HA   1 
ATOM   2487  H  HB2  . PHE A 1 153 ? 31.304  46.172  -17.966 1.00 59.41  ? 150  PHE A HB2  1 
ATOM   2488  H  HB3  . PHE A 1 153 ? 29.801  46.600  -17.687 1.00 59.41  ? 150  PHE A HB3  1 
ATOM   2489  H  HD1  . PHE A 1 153 ? 32.750  45.660  -16.136 1.00 60.05  ? 150  PHE A HD1  1 
ATOM   2490  H  HD2  . PHE A 1 153 ? 28.834  46.127  -15.450 1.00 59.32  ? 150  PHE A HD2  1 
ATOM   2491  H  HE1  . PHE A 1 153 ? 33.152  45.606  -13.857 1.00 47.00  ? 150  PHE A HE1  1 
ATOM   2492  H  HE2  . PHE A 1 153 ? 29.221  46.074  -13.170 1.00 52.86  ? 150  PHE A HE2  1 
ATOM   2493  H  HZ   . PHE A 1 153 ? 31.386  45.814  -12.364 1.00 55.13  ? 150  PHE A HZ   1 
ATOM   2494  N  N    . GLY A 1 154 ? 30.002  44.415  -20.513 1.00 59.24  ? 151  GLY A N    1 
ATOM   2495  C  CA   . GLY A 1 154 ? 29.423  44.503  -21.839 1.00 56.38  ? 151  GLY A CA   1 
ATOM   2496  C  C    . GLY A 1 154 ? 29.355  45.929  -22.357 1.00 56.08  ? 151  GLY A C    1 
ATOM   2497  O  O    . GLY A 1 154 ? 28.543  46.255  -23.222 1.00 54.05  ? 151  GLY A O    1 
ATOM   2498  H  H    . GLY A 1 154 ? 30.802  44.102  -20.497 1.00 71.09  ? 151  GLY A H    1 
ATOM   2499  H  HA2  . GLY A 1 154 ? 29.953  43.977  -22.457 1.00 67.65  ? 151  GLY A HA2  1 
ATOM   2500  H  HA3  . GLY A 1 154 ? 28.523  44.140  -21.822 1.00 67.65  ? 151  GLY A HA3  1 
ATOM   2501  N  N    . PHE A 1 155 ? 30.211  46.789  -21.826 1.00 53.66  ? 152  PHE A N    1 
ATOM   2502  C  CA   . PHE A 1 155 ? 30.312  48.146  -22.331 1.00 45.11  ? 152  PHE A CA   1 
ATOM   2503  C  C    . PHE A 1 155 ? 31.066  48.127  -23.648 1.00 52.27  ? 152  PHE A C    1 
ATOM   2504  O  O    . PHE A 1 155 ? 32.171  47.586  -23.724 1.00 52.40  ? 152  PHE A O    1 
ATOM   2505  C  CB   . PHE A 1 155 ? 31.003  49.053  -21.316 1.00 48.27  ? 152  PHE A CB   1 
ATOM   2506  C  CG   . PHE A 1 155 ? 30.312  49.107  -19.980 1.00 51.39  ? 152  PHE A CG   1 
ATOM   2507  C  CD1  . PHE A 1 155 ? 28.984  48.747  -19.856 1.00 36.28  ? 152  PHE A CD1  1 
ATOM   2508  C  CD2  . PHE A 1 155 ? 30.996  49.523  -18.849 1.00 55.51  ? 152  PHE A CD2  1 
ATOM   2509  C  CE1  . PHE A 1 155 ? 28.340  48.811  -18.639 1.00 60.00  ? 152  PHE A CE1  1 
ATOM   2510  C  CE2  . PHE A 1 155 ? 30.363  49.587  -17.617 1.00 49.64  ? 152  PHE A CE2  1 
ATOM   2511  C  CZ   . PHE A 1 155 ? 29.030  49.227  -17.508 1.00 55.57  ? 152  PHE A CZ   1 
ATOM   2512  H  H    . PHE A 1 155 ? 30.743  46.612  -21.173 1.00 64.39  ? 152  PHE A H    1 
ATOM   2513  H  HA   . PHE A 1 155 ? 29.422  48.494  -22.495 1.00 54.13  ? 152  PHE A HA   1 
ATOM   2514  H  HB2  . PHE A 1 155 ? 31.906  48.728  -21.170 1.00 57.92  ? 152  PHE A HB2  1 
ATOM   2515  H  HB3  . PHE A 1 155 ? 31.032  49.955  -21.672 1.00 57.92  ? 152  PHE A HB3  1 
ATOM   2516  H  HD1  . PHE A 1 155 ? 28.513  48.471  -20.609 1.00 43.53  ? 152  PHE A HD1  1 
ATOM   2517  H  HD2  . PHE A 1 155 ? 31.891  49.769  -18.919 1.00 66.61  ? 152  PHE A HD2  1 
ATOM   2518  H  HE1  . PHE A 1 155 ? 27.446  48.564  -18.572 1.00 72.00  ? 152  PHE A HE1  1 
ATOM   2519  H  HE2  . PHE A 1 155 ? 30.833  49.868  -16.866 1.00 59.57  ? 152  PHE A HE2  1 
ATOM   2520  H  HZ   . PHE A 1 155 ? 28.601  49.264  -16.684 1.00 66.68  ? 152  PHE A HZ   1 
ATOM   2521  N  N    . LYS A 1 156 ? 30.456  48.705  -24.683 1.00 57.94  ? 153  LYS A N    1 
ATOM   2522  C  CA   . LYS A 1 156 ? 30.941  48.548  -26.045 1.00 53.72  ? 153  LYS A CA   1 
ATOM   2523  C  C    . LYS A 1 156 ? 31.668  49.775  -26.570 1.00 56.76  ? 153  LYS A C    1 
ATOM   2524  O  O    . LYS A 1 156 ? 32.472  49.657  -27.491 1.00 56.96  ? 153  LYS A O    1 
ATOM   2525  C  CB   . LYS A 1 156 ? 29.778  48.234  -26.985 1.00 54.89  ? 153  LYS A CB   1 
ATOM   2526  C  CG   . LYS A 1 156 ? 29.285  46.805  -26.915 1.00 72.49  ? 153  LYS A CG   1 
ATOM   2527  C  CD   . LYS A 1 156 ? 27.818  46.719  -27.262 1.00 80.90  ? 153  LYS A CD   1 
ATOM   2528  C  CE   . LYS A 1 156 ? 27.206  45.402  -26.816 1.00 93.72  ? 153  LYS A CE   1 
ATOM   2529  N  NZ   . LYS A 1 156 ? 25.816  45.251  -27.339 1.00 121.96 ? 153  LYS A NZ   1 
ATOM   2530  H  H    . LYS A 1 156 ? 29.753  49.197  -24.617 1.00 69.53  ? 153  LYS A H    1 
ATOM   2531  H  HA   . LYS A 1 156 ? 31.558  47.800  -26.074 1.00 64.47  ? 153  LYS A HA   1 
ATOM   2532  H  HB2  . LYS A 1 156 ? 29.033  48.813  -26.761 1.00 65.86  ? 153  LYS A HB2  1 
ATOM   2533  H  HB3  . LYS A 1 156 ? 30.061  48.403  -27.897 1.00 65.86  ? 153  LYS A HB3  1 
ATOM   2534  H  HG2  . LYS A 1 156 ? 29.781  46.263  -27.548 1.00 86.99  ? 153  LYS A HG2  1 
ATOM   2535  H  HG3  . LYS A 1 156 ? 29.406  46.467  -26.013 1.00 86.99  ? 153  LYS A HG3  1 
ATOM   2536  H  HD2  . LYS A 1 156 ? 27.343  47.439  -26.819 1.00 97.08  ? 153  LYS A HD2  1 
ATOM   2537  H  HD3  . LYS A 1 156 ? 27.713  46.791  -28.224 1.00 97.08  ? 153  LYS A HD3  1 
ATOM   2538  H  HE2  . LYS A 1 156 ? 27.741  44.667  -27.155 1.00 112.46 ? 153  LYS A HE2  1 
ATOM   2539  H  HE3  . LYS A 1 156 ? 27.173  45.375  -25.847 1.00 112.46 ? 153  LYS A HE3  1 
ATOM   2540  H  HZ1  . LYS A 1 156 ? 25.821  45.270  -28.229 1.00 146.35 ? 153  LYS A HZ1  1 
ATOM   2541  H  HZ2  . LYS A 1 156 ? 25.472  44.475  -27.069 1.00 146.35 ? 153  LYS A HZ2  1 
ATOM   2542  H  HZ3  . LYS A 1 156 ? 25.304  45.914  -27.038 1.00 146.35 ? 153  LYS A HZ3  1 
ATOM   2543  N  N    . HIS A 1 157 ? 31.436  50.939  -25.969 1.00 49.66  ? 154  HIS A N    1 
ATOM   2544  C  CA   . HIS A 1 157 ? 32.068  52.163  -26.469 1.00 60.27  ? 154  HIS A CA   1 
ATOM   2545  C  C    . HIS A 1 157 ? 32.930  52.817  -25.398 1.00 63.79  ? 154  HIS A C    1 
ATOM   2546  O  O    . HIS A 1 157 ? 32.442  53.540  -24.517 1.00 59.99  ? 154  HIS A O    1 
ATOM   2547  C  CB   . HIS A 1 157 ? 30.998  53.128  -26.981 1.00 58.86  ? 154  HIS A CB   1 
ATOM   2548  C  CG   . HIS A 1 157 ? 29.956  52.458  -27.820 1.00 68.43  ? 154  HIS A CG   1 
ATOM   2549  N  ND1  . HIS A 1 157 ? 30.165  52.127  -29.141 1.00 61.57  ? 154  HIS A ND1  1 
ATOM   2550  C  CD2  . HIS A 1 157 ? 28.700  52.048  -27.519 1.00 60.88  ? 154  HIS A CD2  1 
ATOM   2551  C  CE1  . HIS A 1 157 ? 29.083  51.534  -29.615 1.00 71.00  ? 154  HIS A CE1  1 
ATOM   2552  N  NE2  . HIS A 1 157 ? 28.180  51.475  -28.651 1.00 59.72  ? 154  HIS A NE2  1 
ATOM   2553  H  H    . HIS A 1 157 ? 30.928  51.049  -25.283 1.00 59.59  ? 154  HIS A H    1 
ATOM   2554  H  HA   . HIS A 1 157 ? 32.645  51.935  -27.215 1.00 72.33  ? 154  HIS A HA   1 
ATOM   2555  H  HB2  . HIS A 1 157 ? 30.553  53.537  -26.222 1.00 70.63  ? 154  HIS A HB2  1 
ATOM   2556  H  HB3  . HIS A 1 157 ? 31.423  53.812  -27.523 1.00 70.63  ? 154  HIS A HB3  1 
ATOM   2557  H  HD1  . HIS A 1 157 ? 30.888  52.274  -29.584 1.00 73.88  ? 154  HIS A HD1  1 
ATOM   2558  H  HD2  . HIS A 1 157 ? 28.273  52.131  -26.697 1.00 73.05  ? 154  HIS A HD2  1 
ATOM   2559  H  HE1  . HIS A 1 157 ? 28.972  51.220  -30.483 1.00 85.19  ? 154  HIS A HE1  1 
ATOM   2560  H  HE2  . HIS A 1 157 ? 27.392  51.138  -28.725 1.00 71.66  ? 154  HIS A HE2  1 
ATOM   2561  N  N    . ARG A 1 158 ? 34.229  52.554  -25.506 1.00 55.67  ? 155  ARG A N    1 
ATOM   2562  C  CA   . ARG A 1 158 ? 35.185  52.931  -24.482 1.00 46.31  ? 155  ARG A CA   1 
ATOM   2563  C  C    . ARG A 1 158 ? 36.330  53.694  -25.108 1.00 55.74  ? 155  ARG A C    1 
ATOM   2564  O  O    . ARG A 1 158 ? 37.043  53.181  -25.972 1.00 68.40  ? 155  ARG A O    1 
ATOM   2565  C  CB   . ARG A 1 158 ? 35.696  51.694  -23.755 1.00 47.58  ? 155  ARG A CB   1 
ATOM   2566  C  CG   . ARG A 1 158 ? 34.574  50.763  -23.299 1.00 46.94  ? 155  ARG A CG   1 
ATOM   2567  C  CD   . ARG A 1 158 ? 35.130  49.514  -22.695 1.00 56.29  ? 155  ARG A CD   1 
ATOM   2568  N  NE   . ARG A 1 158 ? 36.069  48.856  -23.587 1.00 67.42  ? 155  ARG A NE   1 
ATOM   2569  C  CZ   . ARG A 1 158 ? 35.720  48.099  -24.616 1.00 54.37  ? 155  ARG A CZ   1 
ATOM   2570  N  NH1  . ARG A 1 158 ? 34.438  47.905  -24.893 1.00 57.38  ? 155  ARG A NH1  1 
ATOM   2571  N  NH2  . ARG A 1 158 ? 36.659  47.540  -25.359 1.00 50.31  ? 155  ARG A NH2  1 
ATOM   2572  H  H    . ARG A 1 158 ? 34.583  52.150  -26.177 1.00 66.80  ? 155  ARG A H    1 
ATOM   2573  H  HA   . ARG A 1 158 ? 34.751  53.509  -23.835 1.00 55.57  ? 155  ARG A HA   1 
ATOM   2574  H  HB2  . ARG A 1 158 ? 36.275  51.194  -24.351 1.00 57.10  ? 155  ARG A HB2  1 
ATOM   2575  H  HB3  . ARG A 1 158 ? 36.191  51.973  -22.968 1.00 57.10  ? 155  ARG A HB3  1 
ATOM   2576  H  HG2  . ARG A 1 158 ? 34.034  51.213  -22.630 1.00 56.33  ? 155  ARG A HG2  1 
ATOM   2577  H  HG3  . ARG A 1 158 ? 34.029  50.517  -24.063 1.00 56.33  ? 155  ARG A HG3  1 
ATOM   2578  H  HD2  . ARG A 1 158 ? 35.596  49.737  -21.874 1.00 67.55  ? 155  ARG A HD2  1 
ATOM   2579  H  HD3  . ARG A 1 158 ? 34.404  48.898  -22.511 1.00 67.55  ? 155  ARG A HD3  1 
ATOM   2580  H  HE   . ARG A 1 158 ? 36.909  48.965  -23.436 1.00 80.90  ? 155  ARG A HE   1 
ATOM   2581  H  HH11 . ARG A 1 158 ? 33.832  48.270  -24.403 1.00 68.85  ? 155  ARG A HH11 1 
ATOM   2582  H  HH12 . ARG A 1 158 ? 34.213  47.414  -25.562 1.00 68.85  ? 155  ARG A HH12 1 
ATOM   2583  H  HH21 . ARG A 1 158 ? 37.489  47.671  -25.175 1.00 60.37  ? 155  ARG A HH21 1 
ATOM   2584  H  HH22 . ARG A 1 158 ? 36.440  47.049  -26.031 1.00 60.37  ? 155  ARG A HH22 1 
ATOM   2585  N  N    . LEU A 1 159 ? 36.504  54.924  -24.654 1.00 51.12  ? 156  LEU A N    1 
ATOM   2586  C  CA   . LEU A 1 159 ? 37.526  55.797  -25.196 1.00 55.89  ? 156  LEU A CA   1 
ATOM   2587  C  C    . LEU A 1 159 ? 38.600  56.061  -24.146 1.00 57.17  ? 156  LEU A C    1 
ATOM   2588  O  O    . LEU A 1 159 ? 38.333  56.653  -23.102 1.00 54.26  ? 156  LEU A O    1 
ATOM   2589  C  CB   . LEU A 1 159 ? 36.896  57.102  -25.696 1.00 43.10  ? 156  LEU A CB   1 
ATOM   2590  C  CG   . LEU A 1 159 ? 37.907  58.107  -26.237 1.00 48.17  ? 156  LEU A CG   1 
ATOM   2591  C  CD1  . LEU A 1 159 ? 38.493  57.649  -27.567 1.00 61.28  ? 156  LEU A CD1  1 
ATOM   2592  C  CD2  . LEU A 1 159 ? 37.243  59.465  -26.371 1.00 47.76  ? 156  LEU A CD2  1 
ATOM   2593  H  H    . LEU A 1 159 ? 36.038  55.280  -24.025 1.00 61.34  ? 156  LEU A H    1 
ATOM   2594  H  HA   . LEU A 1 159 ? 37.947  55.359  -25.952 1.00 67.07  ? 156  LEU A HA   1 
ATOM   2595  H  HB2  . LEU A 1 159 ? 36.273  56.895  -26.410 1.00 51.72  ? 156  LEU A HB2  1 
ATOM   2596  H  HB3  . LEU A 1 159 ? 36.424  57.523  -24.960 1.00 51.72  ? 156  LEU A HB3  1 
ATOM   2597  H  HG   . LEU A 1 159 ? 38.636  58.193  -25.603 1.00 57.81  ? 156  LEU A HG   1 
ATOM   2598  H  HD11 . LEU A 1 159 ? 37.774  57.553  -28.211 1.00 73.54  ? 156  LEU A HD11 1 
ATOM   2599  H  HD12 . LEU A 1 159 ? 39.129  58.313  -27.877 1.00 73.54  ? 156  LEU A HD12 1 
ATOM   2600  H  HD13 . LEU A 1 159 ? 38.939  56.798  -27.438 1.00 73.54  ? 156  LEU A HD13 1 
ATOM   2601  H  HD21 . LEU A 1 159 ? 36.930  59.751  -25.499 1.00 57.32  ? 156  LEU A HD21 1 
ATOM   2602  H  HD22 . LEU A 1 159 ? 37.891  60.100  -26.715 1.00 57.32  ? 156  LEU A HD22 1 
ATOM   2603  H  HD23 . LEU A 1 159 ? 36.495  59.390  -26.983 1.00 57.32  ? 156  LEU A HD23 1 
ATOM   2604  N  N    . TRP A 1 160 ? 39.803  55.568  -24.423 1.00 50.72  ? 157  TRP A N    1 
ATOM   2605  C  CA   . TRP A 1 160 ? 40.936  55.771  -23.541 1.00 42.33  ? 157  TRP A CA   1 
ATOM   2606  C  C    . TRP A 1 160 ? 41.747  56.947  -24.037 1.00 51.99  ? 157  TRP A C    1 
ATOM   2607  O  O    . TRP A 1 160 ? 42.025  57.060  -25.229 1.00 55.89  ? 157  TRP A O    1 
ATOM   2608  C  CB   . TRP A 1 160 ? 41.798  54.509  -23.466 1.00 43.43  ? 157  TRP A CB   1 
ATOM   2609  C  CG   . TRP A 1 160 ? 41.137  53.417  -22.687 1.00 45.83  ? 157  TRP A CG   1 
ATOM   2610  C  CD1  . TRP A 1 160 ? 40.279  52.478  -23.162 1.00 52.33  ? 157  TRP A CD1  1 
ATOM   2611  C  CD2  . TRP A 1 160 ? 41.286  53.149  -21.284 1.00 55.20  ? 157  TRP A CD2  1 
ATOM   2612  N  NE1  . TRP A 1 160 ? 39.872  51.644  -22.148 1.00 49.23  ? 157  TRP A NE1  1 
ATOM   2613  C  CE2  . TRP A 1 160 ? 40.476  52.036  -20.984 1.00 56.05  ? 157  TRP A CE2  1 
ATOM   2614  C  CE3  . TRP A 1 160 ? 42.021  53.746  -20.255 1.00 52.24  ? 157  TRP A CE3  1 
ATOM   2615  C  CZ2  . TRP A 1 160 ? 40.382  51.508  -19.699 1.00 52.93  ? 157  TRP A CZ2  1 
ATOM   2616  C  CZ3  . TRP A 1 160 ? 41.930  53.219  -18.982 1.00 47.92  ? 157  TRP A CZ3  1 
ATOM   2617  C  CH2  . TRP A 1 160 ? 41.113  52.116  -18.712 1.00 51.81  ? 157  TRP A CH2  1 
ATOM   2618  H  H    . TRP A 1 160 ? 39.987  55.107  -25.125 1.00 60.86  ? 157  TRP A H    1 
ATOM   2619  H  HA   . TRP A 1 160 ? 40.616  55.976  -22.649 1.00 50.80  ? 157  TRP A HA   1 
ATOM   2620  H  HB2  . TRP A 1 160 ? 41.962  54.183  -24.364 1.00 52.11  ? 157  TRP A HB2  1 
ATOM   2621  H  HB3  . TRP A 1 160 ? 42.638  54.724  -23.031 1.00 52.11  ? 157  TRP A HB3  1 
ATOM   2622  H  HD1  . TRP A 1 160 ? 39.999  52.415  -24.047 1.00 62.79  ? 157  TRP A HD1  1 
ATOM   2623  H  HE1  . TRP A 1 160 ? 39.327  50.984  -22.231 1.00 59.08  ? 157  TRP A HE1  1 
ATOM   2624  H  HE3  . TRP A 1 160 ? 42.560  54.485  -20.424 1.00 62.69  ? 157  TRP A HE3  1 
ATOM   2625  H  HZ2  . TRP A 1 160 ? 39.847  50.769  -19.518 1.00 63.52  ? 157  TRP A HZ2  1 
ATOM   2626  H  HZ3  . TRP A 1 160 ? 42.411  53.611  -18.290 1.00 57.51  ? 157  TRP A HZ3  1 
ATOM   2627  H  HH2  . TRP A 1 160 ? 41.074  51.781  -17.845 1.00 62.17  ? 157  TRP A HH2  1 
ATOM   2628  N  N    . VAL A 1 161 ? 42.113  57.820  -23.104 1.00 53.52  ? 158  VAL A N    1 
ATOM   2629  C  CA   . VAL A 1 161 ? 42.784  59.070  -23.433 1.00 49.47  ? 158  VAL A CA   1 
ATOM   2630  C  C    . VAL A 1 161 ? 43.989  59.319  -22.524 1.00 62.13  ? 158  VAL A C    1 
ATOM   2631  O  O    . VAL A 1 161 ? 43.892  59.185  -21.302 1.00 60.10  ? 158  VAL A O    1 
ATOM   2632  C  CB   . VAL A 1 161 ? 41.832  60.258  -23.295 1.00 56.18  ? 158  VAL A CB   1 
ATOM   2633  C  CG1  . VAL A 1 161 ? 42.433  61.487  -23.977 1.00 54.37  ? 158  VAL A CG1  1 
ATOM   2634  C  CG2  . VAL A 1 161 ? 40.483  59.929  -23.899 1.00 54.11  ? 158  VAL A CG2  1 
ATOM   2635  H  H    . VAL A 1 161 ? 41.982  57.708  -22.261 1.00 64.22  ? 158  VAL A H    1 
ATOM   2636  H  HA   . VAL A 1 161 ? 43.097  59.034  -24.351 1.00 59.36  ? 158  VAL A HA   1 
ATOM   2637  H  HB   . VAL A 1 161 ? 41.705  60.462  -22.355 1.00 67.41  ? 158  VAL A HB   1 
ATOM   2638  H  HG11 . VAL A 1 161 ? 42.571  61.290  -24.917 1.00 65.24  ? 158  VAL A HG11 1 
ATOM   2639  H  HG12 . VAL A 1 161 ? 41.819  62.232  -23.882 1.00 65.24  ? 158  VAL A HG12 1 
ATOM   2640  H  HG13 . VAL A 1 161 ? 43.280  61.700  -23.555 1.00 65.24  ? 158  VAL A HG13 1 
ATOM   2641  H  HG21 . VAL A 1 161 ? 40.108  59.164  -23.435 1.00 64.93  ? 158  VAL A HG21 1 
ATOM   2642  H  HG22 . VAL A 1 161 ? 39.897  60.696  -23.800 1.00 64.93  ? 158  VAL A HG22 1 
ATOM   2643  H  HG23 . VAL A 1 161 ? 40.600  59.721  -24.839 1.00 64.93  ? 158  VAL A HG23 1 
ATOM   2644  N  N    . TYR A 1 162 ? 45.092  59.771  -23.106 1.00 52.47  ? 159  TYR A N    1 
ATOM   2645  C  CA   . TYR A 1 162 ? 46.260  60.155  -22.326 1.00 45.91  ? 159  TYR A CA   1 
ATOM   2646  C  C    . TYR A 1 162 ? 45.961  61.454  -21.566 1.00 55.19  ? 159  TYR A C    1 
ATOM   2647  O  O    . TYR A 1 162 ? 45.294  62.350  -22.104 1.00 42.28  ? 159  TYR A O    1 
ATOM   2648  C  CB   . TYR A 1 162 ? 47.464  60.301  -23.246 1.00 44.44  ? 159  TYR A CB   1 
ATOM   2649  C  CG   . TYR A 1 162 ? 48.723  60.757  -22.560 1.00 55.34  ? 159  TYR A CG   1 
ATOM   2650  C  CD1  . TYR A 1 162 ? 49.252  60.061  -21.483 1.00 59.52  ? 159  TYR A CD1  1 
ATOM   2651  C  CD2  . TYR A 1 162 ? 49.407  61.870  -23.019 1.00 61.65  ? 159  TYR A CD2  1 
ATOM   2652  C  CE1  . TYR A 1 162 ? 50.419  60.485  -20.865 1.00 57.70  ? 159  TYR A CE1  1 
ATOM   2653  C  CE2  . TYR A 1 162 ? 50.568  62.298  -22.415 1.00 67.11  ? 159  TYR A CE2  1 
ATOM   2654  C  CZ   . TYR A 1 162 ? 51.070  61.604  -21.338 1.00 60.44  ? 159  TYR A CZ   1 
ATOM   2655  O  OH   . TYR A 1 162 ? 52.224  62.046  -20.747 1.00 55.24  ? 159  TYR A OH   1 
ATOM   2656  H  H    . TYR A 1 162 ? 45.190  59.865  -23.955 1.00 62.96  ? 159  TYR A H    1 
ATOM   2657  H  HA   . TYR A 1 162 ? 46.455  59.461  -21.678 1.00 55.10  ? 159  TYR A HA   1 
ATOM   2658  H  HB2  . TYR A 1 162 ? 47.647  59.441  -23.655 1.00 53.33  ? 159  TYR A HB2  1 
ATOM   2659  H  HB3  . TYR A 1 162 ? 47.252  60.952  -23.933 1.00 53.33  ? 159  TYR A HB3  1 
ATOM   2660  H  HD1  . TYR A 1 162 ? 48.811  59.308  -21.162 1.00 71.42  ? 159  TYR A HD1  1 
ATOM   2661  H  HD2  . TYR A 1 162 ? 49.070  62.345  -23.745 1.00 73.98  ? 159  TYR A HD2  1 
ATOM   2662  H  HE1  . TYR A 1 162 ? 50.760  60.016  -20.137 1.00 69.24  ? 159  TYR A HE1  1 
ATOM   2663  H  HE2  . TYR A 1 162 ? 51.008  63.053  -22.731 1.00 80.53  ? 159  TYR A HE2  1 
ATOM   2664  H  HH   . TYR A 1 162 ? 52.428  61.545  -20.104 1.00 66.29  ? 159  TYR A HH   1 
ATOM   2665  N  N    . SER A 1 163 ? 46.383  61.523  -20.295 1.00 47.34  ? 160  SER A N    1 
ATOM   2666  C  CA   . SER A 1 163 ? 46.015  62.656  -19.431 1.00 41.31  ? 160  SER A CA   1 
ATOM   2667  C  C    . SER A 1 163 ? 46.919  63.856  -19.719 1.00 44.25  ? 160  SER A C    1 
ATOM   2668  O  O    . SER A 1 163 ? 46.629  64.975  -19.295 1.00 45.31  ? 160  SER A O    1 
ATOM   2669  C  CB   . SER A 1 163 ? 46.096  62.286  -17.943 1.00 50.44  ? 160  SER A CB   1 
ATOM   2670  O  OG   . SER A 1 163 ? 47.433  62.341  -17.464 1.00 60.64  ? 160  SER A OG   1 
ATOM   2671  H  H    . SER A 1 163 ? 46.878  60.934  -19.913 1.00 56.80  ? 160  SER A H    1 
ATOM   2672  H  HA   . SER A 1 163 ? 45.101  62.916  -19.625 1.00 49.57  ? 160  SER A HA   1 
ATOM   2673  H  HB2  . SER A 1 163 ? 45.555  62.911  -17.435 1.00 60.53  ? 160  SER A HB2  1 
ATOM   2674  H  HB3  . SER A 1 163 ? 45.757  61.385  -17.825 1.00 60.53  ? 160  SER A HB3  1 
ATOM   2675  H  HG   . SER A 1 163 ? 47.455  62.136  -16.650 1.00 72.77  ? 160  SER A HG   1 
ATOM   2676  N  N    . GLY A 1 164 ? 47.999  63.621  -20.463 1.00 44.27  ? 161  GLY A N    1 
ATOM   2677  C  CA   . GLY A 1 164 ? 48.923  64.679  -20.813 1.00 48.84  ? 161  GLY A CA   1 
ATOM   2678  C  C    . GLY A 1 164 ? 50.251  64.536  -20.118 1.00 53.44  ? 161  GLY A C    1 
ATOM   2679  O  O    . GLY A 1 164 ? 51.268  65.005  -20.626 1.00 55.88  ? 161  GLY A O    1 
ATOM   2680  H  H    . GLY A 1 164 ? 48.214  62.849  -20.776 1.00 53.12  ? 161  GLY A H    1 
ATOM   2681  H  HA2  . GLY A 1 164 ? 49.075  64.671  -21.771 1.00 58.61  ? 161  GLY A HA2  1 
ATOM   2682  H  HA3  . GLY A 1 164 ? 48.539  65.536  -20.570 1.00 58.61  ? 161  GLY A HA3  1 
ATOM   2683  N  N    . ARG A 1 165 ? 50.243  63.945  -18.930 1.00 63.78  ? 162  ARG A N    1 
ATOM   2684  C  CA   . ARG A 1 165 ? 51.473  63.803  -18.171 1.00 62.85  ? 162  ARG A CA   1 
ATOM   2685  C  C    . ARG A 1 165 ? 51.590  62.480  -17.413 1.00 63.84  ? 162  ARG A C    1 
ATOM   2686  O  O    . ARG A 1 165 ? 52.492  61.679  -17.687 1.00 51.66  ? 162  ARG A O    1 
ATOM   2687  C  CB   . ARG A 1 165 ? 51.615  64.989  -17.224 1.00 57.50  ? 162  ARG A CB   1 
ATOM   2688  C  CG   . ARG A 1 165 ? 53.011  65.138  -16.661 1.00 70.52  ? 162  ARG A CG   1 
ATOM   2689  C  CD   . ARG A 1 165 ? 53.016  66.031  -15.457 1.00 67.56  ? 162  ARG A CD   1 
ATOM   2690  N  NE   . ARG A 1 165 ? 54.360  66.526  -15.211 1.00 60.80  ? 162  ARG A NE   1 
ATOM   2691  C  CZ   . ARG A 1 165 ? 54.642  67.631  -14.531 1.00 68.29  ? 162  ARG A CZ   1 
ATOM   2692  N  NH1  . ARG A 1 165 ? 53.667  68.384  -14.030 1.00 59.73  ? 162  ARG A NH1  1 
ATOM   2693  N  NH2  . ARG A 1 165 ? 55.909  67.986  -14.373 1.00 54.94  ? 162  ARG A NH2  1 
ATOM   2694  H  H    . ARG A 1 165 ? 49.545  63.620  -18.545 1.00 76.54  ? 162  ARG A H    1 
ATOM   2695  H  HA   . ARG A 1 165 ? 52.217  63.842  -18.792 1.00 75.43  ? 162  ARG A HA   1 
ATOM   2696  H  HB2  . ARG A 1 165 ? 51.399  65.803  -17.705 1.00 69.00  ? 162  ARG A HB2  1 
ATOM   2697  H  HB3  . ARG A 1 165 ? 51.004  64.872  -16.480 1.00 69.00  ? 162  ARG A HB3  1 
ATOM   2698  H  HG2  . ARG A 1 165 ? 53.346  64.267  -16.396 1.00 84.62  ? 162  ARG A HG2  1 
ATOM   2699  H  HG3  . ARG A 1 165 ? 53.589  65.531  -17.334 1.00 84.62  ? 162  ARG A HG3  1 
ATOM   2700  H  HD2  . ARG A 1 165 ? 52.431  66.789  -15.613 1.00 81.07  ? 162  ARG A HD2  1 
ATOM   2701  H  HD3  . ARG A 1 165 ? 52.724  65.530  -14.680 1.00 81.07  ? 162  ARG A HD3  1 
ATOM   2702  H  HE   . ARG A 1 165 ? 55.018  66.072  -15.527 1.00 72.96  ? 162  ARG A HE   1 
ATOM   2703  H  HH11 . ARG A 1 165 ? 52.846  68.151  -14.137 1.00 71.67  ? 162  ARG A HH11 1 
ATOM   2704  H  HH12 . ARG A 1 165 ? 53.858  69.100  -13.593 1.00 71.67  ? 162  ARG A HH12 1 
ATOM   2705  H  HH21 . ARG A 1 165 ? 56.537  67.497  -14.701 1.00 65.93  ? 162  ARG A HH21 1 
ATOM   2706  H  HH22 . ARG A 1 165 ? 56.105  68.701  -13.936 1.00 65.93  ? 162  ARG A HH22 1 
ATOM   2707  N  N    . ARG A 1 166 ? 50.732  62.307  -16.408 1.00 64.61  ? 163  ARG A N    1 
ATOM   2708  C  CA   . ARG A 1 166 ? 50.891  61.252  -15.409 1.00 58.99  ? 163  ARG A CA   1 
ATOM   2709  C  C    . ARG A 1 166 ? 50.039  60.017  -15.578 1.00 59.08  ? 163  ARG A C    1 
ATOM   2710  O  O    . ARG A 1 166 ? 50.173  59.079  -14.796 1.00 67.48  ? 163  ARG A O    1 
ATOM   2711  C  CB   . ARG A 1 166 ? 50.548  61.791  -14.027 1.00 58.30  ? 163  ARG A CB   1 
ATOM   2712  C  CG   . ARG A 1 166 ? 51.589  62.600  -13.409 1.00 59.77  ? 163  ARG A CG   1 
ATOM   2713  C  CD   . ARG A 1 166 ? 50.963  63.677  -12.571 1.00 69.47  ? 163  ARG A CD   1 
ATOM   2714  N  NE   . ARG A 1 166 ? 49.842  63.227  -11.750 1.00 49.91  ? 163  ARG A NE   1 
ATOM   2715  C  CZ   . ARG A 1 166 ? 48.943  64.061  -11.233 1.00 59.62  ? 163  ARG A CZ   1 
ATOM   2716  N  NH1  . ARG A 1 166 ? 49.049  65.365  -11.454 1.00 57.12  ? 163  ARG A NH1  1 
ATOM   2717  N  NH2  . ARG A 1 166 ? 47.943  63.611  -10.491 1.00 57.80  ? 163  ARG A NH2  1 
ATOM   2718  H  H    . ARG A 1 166 ? 50.037  62.797  -16.282 1.00 77.53  ? 163  ARG A H    1 
ATOM   2719  H  HA   . ARG A 1 166 ? 51.819  60.971  -15.397 1.00 70.79  ? 163  ARG A HA   1 
ATOM   2720  H  HB2  . ARG A 1 166 ? 49.753  62.341  -14.099 1.00 69.96  ? 163  ARG A HB2  1 
ATOM   2721  H  HB3  . ARG A 1 166 ? 50.373  61.040  -13.438 1.00 69.96  ? 163  ARG A HB3  1 
ATOM   2722  H  HG2  . ARG A 1 166 ? 52.139  62.043  -12.837 1.00 71.72  ? 163  ARG A HG2  1 
ATOM   2723  H  HG3  . ARG A 1 166 ? 52.128  63.019  -14.098 1.00 71.72  ? 163  ARG A HG3  1 
ATOM   2724  H  HD2  . ARG A 1 166 ? 51.637  64.038  -11.976 1.00 83.36  ? 163  ARG A HD2  1 
ATOM   2725  H  HD3  . ARG A 1 166 ? 50.636  64.376  -13.158 1.00 83.36  ? 163  ARG A HD3  1 
ATOM   2726  H  HE   . ARG A 1 166 ? 49.662  62.386  -11.740 1.00 59.89  ? 163  ARG A HE   1 
ATOM   2727  H  HH11 . ARG A 1 166 ? 49.695  65.669  -11.933 1.00 68.54  ? 163  ARG A HH11 1 
ATOM   2728  H  HH12 . ARG A 1 166 ? 48.470  65.906  -11.120 1.00 68.54  ? 163  ARG A HH12 1 
ATOM   2729  H  HH21 . ARG A 1 166 ? 47.865  62.767  -10.341 1.00 69.36  ? 163  ARG A HH21 1 
ATOM   2730  H  HH22 . ARG A 1 166 ? 47.369  64.161  -10.163 1.00 69.36  ? 163  ARG A HH22 1 
ATOM   2731  N  N    . GLY A 1 167 ? 49.136  59.997  -16.542 1.00 57.84  ? 164  GLY A N    1 
ATOM   2732  C  CA   . GLY A 1 167 ? 48.234  58.867  -16.592 1.00 60.62  ? 164  GLY A CA   1 
ATOM   2733  C  C    . GLY A 1 167 ? 47.214  58.853  -17.702 1.00 53.89  ? 164  GLY A C    1 
ATOM   2734  O  O    . GLY A 1 167 ? 47.379  59.526  -18.725 1.00 46.82  ? 164  GLY A O    1 
ATOM   2735  H  H    . GLY A 1 167 ? 49.027  60.594  -17.152 1.00 69.40  ? 164  GLY A H    1 
ATOM   2736  H  HA2  . GLY A 1 167 ? 48.761  58.057  -16.671 1.00 72.74  ? 164  GLY A HA2  1 
ATOM   2737  H  HA3  . GLY A 1 167 ? 47.751  58.823  -15.752 1.00 72.74  ? 164  GLY A HA3  1 
ATOM   2738  N  N    . VAL A 1 168 ? 46.159  58.064  -17.490 1.00 52.30  ? 165  VAL A N    1 
ATOM   2739  C  CA   . VAL A 1 168 ? 45.167  57.841  -18.536 1.00 45.00  ? 165  VAL A CA   1 
ATOM   2740  C  C    . VAL A 1 168 ? 43.736  57.930  -18.011 1.00 54.23  ? 165  VAL A C    1 
ATOM   2741  O  O    . VAL A 1 168 ? 43.451  57.589  -16.854 1.00 47.68  ? 165  VAL A O    1 
ATOM   2742  C  CB   . VAL A 1 168 ? 45.374  56.474  -19.206 1.00 46.28  ? 165  VAL A CB   1 
ATOM   2743  C  CG1  . VAL A 1 168 ? 46.774  56.393  -19.811 1.00 51.01  ? 165  VAL A CG1  1 
ATOM   2744  C  CG2  . VAL A 1 168 ? 45.174  55.337  -18.216 1.00 56.42  ? 165  VAL A CG2  1 
ATOM   2745  H  H    . VAL A 1 168 ? 45.997  57.649  -16.754 1.00 62.76  ? 165  VAL A H    1 
ATOM   2746  H  HA   . VAL A 1 168 ? 45.275  58.523  -19.216 1.00 54.00  ? 165  VAL A HA   1 
ATOM   2747  H  HB   . VAL A 1 168 ? 44.728  56.369  -19.922 1.00 55.54  ? 165  VAL A HB   1 
ATOM   2748  H  HG11 . VAL A 1 168 ? 47.429  56.508  -19.105 1.00 61.22  ? 165  VAL A HG11 1 
ATOM   2749  H  HG12 . VAL A 1 168 ? 46.887  55.525  -20.229 1.00 61.22  ? 165  VAL A HG12 1 
ATOM   2750  H  HG13 . VAL A 1 168 ? 46.873  57.095  -20.473 1.00 61.22  ? 165  VAL A HG13 1 
ATOM   2751  H  HG21 . VAL A 1 168 ? 44.271  55.380  -17.864 1.00 67.71  ? 165  VAL A HG21 1 
ATOM   2752  H  HG22 . VAL A 1 168 ? 45.312  54.493  -18.674 1.00 67.71  ? 165  VAL A HG22 1 
ATOM   2753  H  HG23 . VAL A 1 168 ? 45.816  55.431  -17.495 1.00 67.71  ? 165  VAL A HG23 1 
ATOM   2754  N  N    . HIS A 1 169 ? 42.835  58.353  -18.896 1.00 48.72  ? 166  HIS A N    1 
ATOM   2755  C  CA   . HIS A 1 169 ? 41.418  58.409  -18.596 1.00 45.77  ? 166  HIS A CA   1 
ATOM   2756  C  C    . HIS A 1 169 ? 40.689  57.416  -19.457 1.00 50.63  ? 166  HIS A C    1 
ATOM   2757  O  O    . HIS A 1 169 ? 41.141  57.080  -20.544 1.00 48.91  ? 166  HIS A O    1 
ATOM   2758  C  CB   . HIS A 1 169 ? 40.861  59.799  -18.832 1.00 48.85  ? 166  HIS A CB   1 
ATOM   2759  C  CG   . HIS A 1 169 ? 41.493  60.849  -17.983 1.00 58.43  ? 166  HIS A CG   1 
ATOM   2760  N  ND1  . HIS A 1 169 ? 41.397  62.189  -18.274 1.00 54.86  ? 166  HIS A ND1  1 
ATOM   2761  C  CD2  . HIS A 1 169 ? 42.221  60.760  -16.845 1.00 58.18  ? 166  HIS A CD2  1 
ATOM   2762  C  CE1  . HIS A 1 169 ? 42.056  62.882  -17.364 1.00 55.37  ? 166  HIS A CE1  1 
ATOM   2763  N  NE2  . HIS A 1 169 ? 42.559  62.039  -16.482 1.00 65.99  ? 166  HIS A NE2  1 
ATOM   2764  H  H    . HIS A 1 169 ? 43.030  58.617  -19.691 1.00 58.46  ? 166  HIS A H    1 
ATOM   2765  H  HA   . HIS A 1 169 ? 41.274  58.174  -17.666 1.00 54.93  ? 166  HIS A HA   1 
ATOM   2766  H  HB2  . HIS A 1 169 ? 41.005  60.041  -19.760 1.00 58.62  ? 166  HIS A HB2  1 
ATOM   2767  H  HB3  . HIS A 1 169 ? 39.910  59.793  -18.638 1.00 58.62  ? 166  HIS A HB3  1 
ATOM   2768  H  HD1  . HIS A 1 169 ? 40.987  62.523  -18.953 1.00 65.83  ? 166  HIS A HD1  1 
ATOM   2769  H  HD2  . HIS A 1 169 ? 42.456  59.979  -16.399 1.00 69.82  ? 166  HIS A HD2  1 
ATOM   2770  H  HE1  . HIS A 1 169 ? 42.137  63.808  -17.339 1.00 66.45  ? 166  HIS A HE1  1 
ATOM   2771  H  HE2  . HIS A 1 169 ? 43.024  62.256  -15.792 1.00 79.19  ? 166  HIS A HE2  1 
ATOM   2772  N  N    . CYS A 1 170 ? 39.556  56.956  -18.952 1.00 44.88  ? 167  CYS A N    1 
ATOM   2773  C  CA   . CYS A 1 170 ? 38.646  56.150  -19.731 1.00 47.38  ? 167  CYS A CA   1 
ATOM   2774  C  C    . CYS A 1 170 ? 37.266  56.762  -19.672 1.00 52.28  ? 167  CYS A C    1 
ATOM   2775  O  O    . CYS A 1 170 ? 36.746  57.055  -18.581 1.00 49.42  ? 167  CYS A O    1 
ATOM   2776  C  CB   . CYS A 1 170 ? 38.600  54.713  -19.225 1.00 53.78  ? 167  CYS A CB   1 
ATOM   2777  S  SG   . CYS A 1 170 ? 37.443  53.673  -20.162 1.00 50.01  ? 167  CYS A SG   1 
ATOM   2778  H  H    . CYS A 1 170 ? 39.291  57.102  -18.147 1.00 53.86  ? 167  CYS A H    1 
ATOM   2779  H  HA   . CYS A 1 170 ? 38.937  56.139  -20.656 1.00 56.86  ? 167  CYS A HA   1 
ATOM   2780  H  HB2  . CYS A 1 170 ? 39.484  54.322  -19.302 1.00 64.53  ? 167  CYS A HB2  1 
ATOM   2781  H  HB3  . CYS A 1 170 ? 38.317  54.714  -18.297 1.00 64.53  ? 167  CYS A HB3  1 
ATOM   2782  H  HG   . CYS A 1 170 ? 37.783  53.650  -21.313 1.00 60.01  ? 167  CYS A HG   1 
ATOM   2783  N  N    . TRP A 1 171 ? 36.697  56.947  -20.860 1.00 49.28  ? 168  TRP A N    1 
ATOM   2784  C  CA   . TRP A 1 171 ? 35.329  57.414  -21.043 1.00 40.96  ? 168  TRP A CA   1 
ATOM   2785  C  C    . TRP A 1 171 ? 34.470  56.282  -21.575 1.00 53.69  ? 168  TRP A C    1 
ATOM   2786  O  O    . TRP A 1 171 ? 34.709  55.783  -22.688 1.00 50.08  ? 168  TRP A O    1 
ATOM   2787  C  CB   . TRP A 1 171 ? 35.288  58.577  -22.021 1.00 46.80  ? 168  TRP A CB   1 
ATOM   2788  C  CG   . TRP A 1 171 ? 36.046  59.779  -21.604 1.00 50.70  ? 168  TRP A CG   1 
ATOM   2789  C  CD1  . TRP A 1 171 ? 37.392  59.971  -21.676 1.00 42.16  ? 168  TRP A CD1  1 
ATOM   2790  C  CD2  . TRP A 1 171 ? 35.494  60.982  -21.059 1.00 46.83  ? 168  TRP A CD2  1 
ATOM   2791  N  NE1  . TRP A 1 171 ? 37.713  61.220  -21.201 1.00 47.46  ? 168  TRP A NE1  1 
ATOM   2792  C  CE2  . TRP A 1 171 ? 36.563  61.860  -20.819 1.00 39.98  ? 168  TRP A CE2  1 
ATOM   2793  C  CE3  . TRP A 1 171 ? 34.196  61.396  -20.748 1.00 39.11  ? 168  TRP A CE3  1 
ATOM   2794  C  CZ2  . TRP A 1 171 ? 36.377  63.124  -20.278 1.00 43.58  ? 168  TRP A CZ2  1 
ATOM   2795  C  CZ3  . TRP A 1 171 ? 34.014  62.642  -20.213 1.00 43.93  ? 168  TRP A CZ3  1 
ATOM   2796  C  CH2  . TRP A 1 171 ? 35.097  63.498  -19.986 1.00 48.52  ? 168  TRP A CH2  1 
ATOM   2797  H  H    . TRP A 1 171 ? 37.103  56.802  -21.604 1.00 59.13  ? 168  TRP A H    1 
ATOM   2798  H  HA   . TRP A 1 171 ? 34.967  57.708  -20.193 1.00 49.15  ? 168  TRP A HA   1 
ATOM   2799  H  HB2  . TRP A 1 171 ? 35.655  58.280  -22.869 1.00 56.17  ? 168  TRP A HB2  1 
ATOM   2800  H  HB3  . TRP A 1 171 ? 34.363  58.843  -22.144 1.00 56.17  ? 168  TRP A HB3  1 
ATOM   2801  H  HD1  . TRP A 1 171 ? 38.003  59.349  -22.000 1.00 50.59  ? 168  TRP A HD1  1 
ATOM   2802  H  HE1  . TRP A 1 171 ? 38.506  61.548  -21.155 1.00 56.96  ? 168  TRP A HE1  1 
ATOM   2803  H  HE3  . TRP A 1 171 ? 33.470  60.833  -20.896 1.00 46.93  ? 168  TRP A HE3  1 
ATOM   2804  H  HZ2  . TRP A 1 171 ? 37.095  63.694  -20.123 1.00 52.30  ? 168  TRP A HZ2  1 
ATOM   2805  H  HZ3  . TRP A 1 171 ? 33.154  62.928  -20.005 1.00 52.71  ? 168  TRP A HZ3  1 
ATOM   2806  H  HH2  . TRP A 1 171 ? 34.941  64.340  -19.623 1.00 58.23  ? 168  TRP A HH2  1 
ATOM   2807  N  N    . VAL A 1 172 ? 33.499  55.857  -20.771 1.00 46.68  ? 169  VAL A N    1 
ATOM   2808  C  CA   . VAL A 1 172 ? 32.555  54.813  -21.172 1.00 46.96  ? 169  VAL A CA   1 
ATOM   2809  C  C    . VAL A 1 172 ? 31.227  55.471  -21.522 1.00 57.53  ? 169  VAL A C    1 
ATOM   2810  O  O    . VAL A 1 172 ? 30.521  55.980  -20.623 1.00 55.60  ? 169  VAL A O    1 
ATOM   2811  C  CB   . VAL A 1 172 ? 32.365  53.775  -20.068 1.00 49.67  ? 169  VAL A CB   1 
ATOM   2812  C  CG1  . VAL A 1 172 ? 31.351  52.727  -20.471 1.00 52.85  ? 169  VAL A CG1  1 
ATOM   2813  C  CG2  . VAL A 1 172 ? 33.702  53.125  -19.731 1.00 52.89  ? 169  VAL A CG2  1 
ATOM   2814  H  H    . VAL A 1 172 ? 33.364  56.161  -19.978 1.00 56.02  ? 169  VAL A H    1 
ATOM   2815  H  HA   . VAL A 1 172 ? 32.890  54.361  -21.962 1.00 56.35  ? 169  VAL A HA   1 
ATOM   2816  H  HB   . VAL A 1 172 ? 32.038  54.219  -19.270 1.00 59.60  ? 169  VAL A HB   1 
ATOM   2817  H  HG11 . VAL A 1 172 ? 31.662  52.278  -21.273 1.00 63.41  ? 169  VAL A HG11 1 
ATOM   2818  H  HG12 . VAL A 1 172 ? 31.256  52.086  -19.749 1.00 63.41  ? 169  VAL A HG12 1 
ATOM   2819  H  HG13 . VAL A 1 172 ? 30.501  53.160  -20.643 1.00 63.41  ? 169  VAL A HG13 1 
ATOM   2820  H  HG21 . VAL A 1 172 ? 34.319  53.810  -19.428 1.00 63.47  ? 169  VAL A HG21 1 
ATOM   2821  H  HG22 . VAL A 1 172 ? 33.565  52.469  -19.029 1.00 63.47  ? 169  VAL A HG22 1 
ATOM   2822  H  HG23 . VAL A 1 172 ? 34.051  52.692  -20.525 1.00 63.47  ? 169  VAL A HG23 1 
ATOM   2823  N  N    . CYS A 1 173 ? 30.888  55.410  -22.817 1.00 50.91  ? 170  CYS A N    1 
ATOM   2824  C  CA   . CYS A 1 173 ? 29.862  56.263  -23.423 1.00 58.22  ? 170  CYS A CA   1 
ATOM   2825  C  C    . CYS A 1 173 ? 28.622  55.545  -23.978 1.00 59.86  ? 170  CYS A C    1 
ATOM   2826  O  O    . CYS A 1 173 ? 27.787  56.179  -24.618 1.00 69.06  ? 170  CYS A O    1 
ATOM   2827  C  CB   . CYS A 1 173 ? 30.490  57.024  -24.583 1.00 63.78  ? 170  CYS A CB   1 
ATOM   2828  S  SG   . CYS A 1 173 ? 32.012  57.895  -24.190 1.00 60.34  ? 170  CYS A SG   1 
ATOM   2829  H  H    . CYS A 1 173 ? 31.250  54.867  -23.377 1.00 61.09  ? 170  CYS A H    1 
ATOM   2830  H  HA   . CYS A 1 173 ? 29.563  56.911  -22.765 1.00 69.87  ? 170  CYS A HA   1 
ATOM   2831  H  HB2  . CYS A 1 173 ? 30.689  56.393  -25.293 1.00 76.53  ? 170  CYS A HB2  1 
ATOM   2832  H  HB3  . CYS A 1 173 ? 29.852  57.681  -24.903 1.00 76.53  ? 170  CYS A HB3  1 
ATOM   2833  H  HG   . CYS A 1 173 ? 32.829  57.102  -23.811 1.00 72.40  ? 170  CYS A HG   1 
ATOM   2834  N  N    . ASP A 1 174 ? 28.482  54.249  -23.708 1.00 64.42  ? 171  ASP A N    1 
ATOM   2835  C  CA   . ASP A 1 174 ? 27.287  53.494  -24.101 1.00 41.56  ? 171  ASP A CA   1 
ATOM   2836  C  C    . ASP A 1 174 ? 26.038  54.193  -23.564 1.00 59.85  ? 171  ASP A C    1 
ATOM   2837  O  O    . ASP A 1 174 ? 26.054  54.765  -22.476 1.00 65.46  ? 171  ASP A O    1 
ATOM   2838  C  CB   . ASP A 1 174 ? 27.334  52.057  -23.551 1.00 50.67  ? 171  ASP A CB   1 
ATOM   2839  C  CG   . ASP A 1 174 ? 28.508  51.241  -24.084 1.00 53.90  ? 171  ASP A CG   1 
ATOM   2840  O  OD1  . ASP A 1 174 ? 29.594  51.795  -24.371 1.00 55.05  ? 171  ASP A OD1  1 
ATOM   2841  O  OD2  . ASP A 1 174 ? 28.350  50.008  -24.174 1.00 57.23  ? 171  ASP A OD2  1 
ATOM   2842  H  H    . ASP A 1 174 ? 29.070  53.777  -23.295 1.00 77.31  ? 171  ASP A H    1 
ATOM   2843  H  HA   . ASP A 1 174 ? 27.229  53.454  -25.069 1.00 49.87  ? 171  ASP A HA   1 
ATOM   2844  H  HB2  . ASP A 1 174 ? 27.412  52.093  -22.585 1.00 60.80  ? 171  ASP A HB2  1 
ATOM   2845  H  HB3  . ASP A 1 174 ? 26.516  51.599  -23.799 1.00 60.80  ? 171  ASP A HB3  1 
ATOM   2846  N  N    . GLU A 1 175 ? 24.959  54.149  -24.333 1.00 72.25  ? 172  GLU A N    1 
ATOM   2847  C  CA   . GLU A 1 175 ? 23.728  54.830  -23.961 1.00 73.51  ? 172  GLU A CA   1 
ATOM   2848  C  C    . GLU A 1 175 ? 23.227  54.465  -22.553 1.00 58.12  ? 172  GLU A C    1 
ATOM   2849  O  O    . GLU A 1 175 ? 22.939  55.350  -21.748 1.00 60.01  ? 172  GLU A O    1 
ATOM   2850  C  CB   . GLU A 1 175 ? 22.652  54.512  -25.006 1.00 59.83  ? 172  GLU A CB   1 
ATOM   2851  C  CG   . GLU A 1 175 ? 21.215  54.768  -24.560 1.00 65.03  ? 172  GLU A CG   1 
ATOM   2852  C  CD   . GLU A 1 175 ? 20.280  55.045  -25.730 1.00 92.58  ? 172  GLU A CD   1 
ATOM   2853  O  OE1  . GLU A 1 175 ? 20.491  54.468  -26.820 1.00 94.35  ? 172  GLU A OE1  1 
ATOM   2854  O  OE2  . GLU A 1 175 ? 19.340  55.854  -25.564 1.00 102.45 ? 172  GLU A OE2  1 
ATOM   2855  H  H    . GLU A 1 175 ? 24.914  53.729  -25.082 1.00 86.70  ? 172  GLU A H    1 
ATOM   2856  H  HA   . GLU A 1 175 ? 23.885  55.787  -23.980 1.00 88.21  ? 172  GLU A HA   1 
ATOM   2857  H  HB2  . GLU A 1 175 ? 22.815  55.057  -25.791 1.00 71.79  ? 172  GLU A HB2  1 
ATOM   2858  H  HB3  . GLU A 1 175 ? 22.721  53.574  -25.243 1.00 71.79  ? 172  GLU A HB3  1 
ATOM   2859  H  HG2  . GLU A 1 175 ? 20.885  53.985  -24.091 1.00 78.04  ? 172  GLU A HG2  1 
ATOM   2860  H  HG3  . GLU A 1 175 ? 21.198  55.539  -23.972 1.00 78.04  ? 172  GLU A HG3  1 
ATOM   2861  N  N    . SER A 1 176 ? 23.184  53.175  -22.234 1.00 53.93  ? 173  SER A N    1 
ATOM   2862  C  CA   . SER A 1 176 ? 22.689  52.726  -20.929 1.00 56.97  ? 173  SER A CA   1 
ATOM   2863  C  C    . SER A 1 176 ? 23.621  53.147  -19.805 1.00 64.13  ? 173  SER A C    1 
ATOM   2864  O  O    . SER A 1 176 ? 23.196  53.288  -18.657 1.00 67.38  ? 173  SER A O    1 
ATOM   2865  C  CB   . SER A 1 176 ? 22.532  51.199  -20.887 1.00 51.00  ? 173  SER A CB   1 
ATOM   2866  O  OG   . SER A 1 176 ? 23.764  50.549  -21.156 1.00 59.84  ? 173  SER A OG   1 
ATOM   2867  H  H    . SER A 1 176 ? 23.435  52.537  -22.754 1.00 64.72  ? 173  SER A H    1 
ATOM   2868  H  HA   . SER A 1 176 ? 21.820  53.124  -20.765 1.00 68.37  ? 173  SER A HA   1 
ATOM   2869  H  HB2  . SER A 1 176 ? 22.225  50.939  -20.005 1.00 61.20  ? 173  SER A HB2  1 
ATOM   2870  H  HB3  . SER A 1 176 ? 21.883  50.932  -21.556 1.00 61.20  ? 173  SER A HB3  1 
ATOM   2871  H  HG   . SER A 1 176 ? 23.661  49.716  -21.130 1.00 71.81  ? 173  SER A HG   1 
ATOM   2872  N  N    . VAL A 1 177 ? 24.892  53.345  -20.139 1.00 58.33  ? 174  VAL A N    1 
ATOM   2873  C  CA   . VAL A 1 177 ? 25.888  53.683  -19.135 1.00 61.93  ? 174  VAL A CA   1 
ATOM   2874  C  C    . VAL A 1 177 ? 25.718  55.120  -18.674 1.00 59.14  ? 174  VAL A C    1 
ATOM   2875  O  O    . VAL A 1 177 ? 25.790  55.407  -17.471 1.00 56.89  ? 174  VAL A O    1 
ATOM   2876  C  CB   . VAL A 1 177 ? 27.318  53.478  -19.679 1.00 58.34  ? 174  VAL A CB   1 
ATOM   2877  C  CG1  . VAL A 1 177 ? 28.361  54.172  -18.786 1.00 49.45  ? 174  VAL A CG1  1 
ATOM   2878  C  CG2  . VAL A 1 177 ? 27.615  51.975  -19.782 1.00 54.83  ? 174  VAL A CG2  1 
ATOM   2879  H  H    . VAL A 1 177 ? 25.201  53.288  -20.939 1.00 70.00  ? 174  VAL A H    1 
ATOM   2880  H  HA   . VAL A 1 177 ? 25.773  53.104  -18.365 1.00 74.32  ? 174  VAL A HA   1 
ATOM   2881  H  HB   . VAL A 1 177 ? 27.378  53.860  -20.569 1.00 70.01  ? 174  VAL A HB   1 
ATOM   2882  H  HG11 . VAL A 1 177 ? 28.310  53.798  -17.893 1.00 59.33  ? 174  VAL A HG11 1 
ATOM   2883  H  HG12 . VAL A 1 177 ? 29.245  54.022  -19.158 1.00 59.33  ? 174  VAL A HG12 1 
ATOM   2884  H  HG13 . VAL A 1 177 ? 28.171  55.123  -18.759 1.00 59.33  ? 174  VAL A HG13 1 
ATOM   2885  H  HG21 . VAL A 1 177 ? 26.974  51.567  -20.384 1.00 65.80  ? 174  VAL A HG21 1 
ATOM   2886  H  HG22 . VAL A 1 177 ? 28.515  51.854  -20.125 1.00 65.80  ? 174  VAL A HG22 1 
ATOM   2887  H  HG23 . VAL A 1 177 ? 27.541  51.578  -18.900 1.00 65.80  ? 174  VAL A HG23 1 
ATOM   2888  N  N    . ARG A 1 178 ? 25.440  56.012  -19.619 1.00 48.98  ? 175  ARG A N    1 
ATOM   2889  C  CA   . ARG A 1 178 ? 25.301  57.427  -19.303 1.00 54.21  ? 175  ARG A CA   1 
ATOM   2890  C  C    . ARG A 1 178 ? 24.116  57.703  -18.382 1.00 55.16  ? 175  ARG A C    1 
ATOM   2891  O  O    . ARG A 1 178 ? 24.043  58.767  -17.768 1.00 61.30  ? 175  ARG A O    1 
ATOM   2892  C  CB   . ARG A 1 178 ? 25.193  58.250  -20.579 1.00 52.03  ? 175  ARG A CB   1 
ATOM   2893  C  CG   . ARG A 1 178 ? 26.365  58.032  -21.524 1.00 47.39  ? 175  ARG A CG   1 
ATOM   2894  C  CD   . ARG A 1 178 ? 26.432  59.086  -22.609 1.00 55.92  ? 175  ARG A CD   1 
ATOM   2895  N  NE   . ARG A 1 178 ? 26.272  58.488  -23.929 1.00 74.94  ? 175  ARG A NE   1 
ATOM   2896  C  CZ   . ARG A 1 178 ? 25.144  58.488  -24.628 1.00 62.59  ? 175  ARG A CZ   1 
ATOM   2897  N  NH1  . ARG A 1 178 ? 24.045  59.057  -24.147 1.00 67.47  ? 175  ARG A NH1  1 
ATOM   2898  N  NH2  . ARG A 1 178 ? 25.115  57.906  -25.813 1.00 65.22  ? 175  ARG A NH2  1 
ATOM   2899  H  H    . ARG A 1 178 ? 25.328  55.823  -20.451 1.00 58.78  ? 175  ARG A H    1 
ATOM   2900  H  HA   . ARG A 1 178 ? 26.102  57.716  -18.839 1.00 65.06  ? 175  ARG A HA   1 
ATOM   2901  H  HB2  . ARG A 1 178 ? 24.380  58.002  -21.047 1.00 62.43  ? 175  ARG A HB2  1 
ATOM   2902  H  HB3  . ARG A 1 178 ? 25.167  59.192  -20.346 1.00 62.43  ? 175  ARG A HB3  1 
ATOM   2903  H  HG2  . ARG A 1 178 ? 27.192  58.066  -21.018 1.00 56.87  ? 175  ARG A HG2  1 
ATOM   2904  H  HG3  . ARG A 1 178 ? 26.271  57.166  -21.951 1.00 56.87  ? 175  ARG A HG3  1 
ATOM   2905  H  HD2  . ARG A 1 178 ? 25.718  59.730  -22.476 1.00 67.11  ? 175  ARG A HD2  1 
ATOM   2906  H  HD3  . ARG A 1 178 ? 27.295  59.528  -22.576 1.00 67.11  ? 175  ARG A HD3  1 
ATOM   2907  H  HE   . ARG A 1 178 ? 26.959  58.108  -24.280 1.00 89.93  ? 175  ARG A HE   1 
ATOM   2908  H  HH11 . ARG A 1 178 ? 24.060  59.434  -23.374 1.00 80.96  ? 175  ARG A HH11 1 
ATOM   2909  H  HH12 . ARG A 1 178 ? 23.320  59.050  -24.609 1.00 80.96  ? 175  ARG A HH12 1 
ATOM   2910  H  HH21 . ARG A 1 178 ? 25.825  57.537  -26.128 1.00 78.27  ? 175  ARG A HH21 1 
ATOM   2911  H  HH22 . ARG A 1 178 ? 24.388  57.903  -26.273 1.00 78.27  ? 175  ARG A HH22 1 
ATOM   2912  N  N    . LYS A 1 179 ? 23.223  56.728  -18.248 1.00 57.48  ? 176  LYS A N    1 
ATOM   2913  C  CA   . LYS A 1 179 ? 22.047  56.872  -17.392 1.00 61.13  ? 176  LYS A CA   1 
ATOM   2914  C  C    . LYS A 1 179 ? 22.245  56.152  -16.055 1.00 57.27  ? 176  LYS A C    1 
ATOM   2915  O  O    . LYS A 1 179 ? 21.308  56.041  -15.255 1.00 58.39  ? 176  LYS A O    1 
ATOM   2916  C  CB   . LYS A 1 179 ? 20.809  56.318  -18.101 1.00 67.89  ? 176  LYS A CB   1 
ATOM   2917  C  CG   . LYS A 1 179 ? 20.503  56.999  -19.415 1.00 76.52  ? 176  LYS A CG   1 
ATOM   2918  C  CD   . LYS A 1 179 ? 19.309  56.373  -20.109 1.00 83.77  ? 176  LYS A CD   1 
ATOM   2919  C  CE   . LYS A 1 179 ? 19.056  57.046  -21.447 1.00 84.28  ? 176  LYS A CE   1 
ATOM   2920  N  NZ   . LYS A 1 179 ? 18.105  56.285  -22.296 1.00 97.52  ? 176  LYS A NZ   1 
ATOM   2921  H  H    . LYS A 1 179 ? 23.274  55.967  -18.645 1.00 68.97  ? 176  LYS A H    1 
ATOM   2922  H  HA   . LYS A 1 179 ? 21.898  57.813  -17.211 1.00 73.36  ? 176  LYS A HA   1 
ATOM   2923  H  HB2  . LYS A 1 179 ? 20.948  55.375  -18.282 1.00 81.47  ? 176  LYS A HB2  1 
ATOM   2924  H  HB3  . LYS A 1 179 ? 20.040  56.432  -17.521 1.00 81.47  ? 176  LYS A HB3  1 
ATOM   2925  H  HG2  . LYS A 1 179 ? 20.302  57.934  -19.250 1.00 91.82  ? 176  LYS A HG2  1 
ATOM   2926  H  HG3  . LYS A 1 179 ? 21.271  56.920  -20.002 1.00 91.82  ? 176  LYS A HG3  1 
ATOM   2927  H  HD2  . LYS A 1 179 ? 19.484  55.433  -20.267 1.00 100.53 ? 176  LYS A HD2  1 
ATOM   2928  H  HD3  . LYS A 1 179 ? 18.520  56.483  -19.556 1.00 100.53 ? 176  LYS A HD3  1 
ATOM   2929  H  HE2  . LYS A 1 179 ? 18.681  57.928  -21.292 1.00 101.13 ? 176  LYS A HE2  1 
ATOM   2930  H  HE3  . LYS A 1 179 ? 19.895  57.121  -21.928 1.00 101.13 ? 176  LYS A HE3  1 
ATOM   2931  H  HZ1  . LYS A 1 179 ? 17.322  56.207  -21.881 1.00 117.03 ? 176  LYS A HZ1  1 
ATOM   2932  H  HZ2  . LYS A 1 179 ? 17.982  56.708  -23.069 1.00 117.03 ? 176  LYS A HZ2  1 
ATOM   2933  H  HZ3  . LYS A 1 179 ? 18.428  55.472  -22.460 1.00 117.03 ? 176  LYS A HZ3  1 
ATOM   2934  N  N    . LEU A 1 180 ? 23.459  55.670  -15.798 1.00 55.36  ? 177  LEU A N    1 
ATOM   2935  C  CA   . LEU A 1 180 ? 23.714  54.915  -14.570 1.00 51.18  ? 177  LEU A CA   1 
ATOM   2936  C  C    . LEU A 1 180 ? 23.703  55.803  -13.339 1.00 46.03  ? 177  LEU A C    1 
ATOM   2937  O  O    . LEU A 1 180 ? 24.308  56.878  -13.320 1.00 47.16  ? 177  LEU A O    1 
ATOM   2938  C  CB   . LEU A 1 180 ? 25.054  54.187  -14.660 1.00 54.66  ? 177  LEU A CB   1 
ATOM   2939  C  CG   . LEU A 1 180 ? 25.094  53.018  -15.637 1.00 54.82  ? 177  LEU A CG   1 
ATOM   2940  C  CD1  . LEU A 1 180 ? 26.501  52.460  -15.728 1.00 56.19  ? 177  LEU A CD1  1 
ATOM   2941  C  CD2  . LEU A 1 180 ? 24.132  51.912  -15.201 1.00 43.68  ? 177  LEU A CD2  1 
ATOM   2942  H  H    . LEU A 1 180 ? 24.144  55.764  -16.310 1.00 66.44  ? 177  LEU A H    1 
ATOM   2943  H  HA   . LEU A 1 180 ? 23.018  54.248  -14.462 1.00 61.41  ? 177  LEU A HA   1 
ATOM   2944  H  HB2  . LEU A 1 180 ? 25.732  54.822  -14.939 1.00 65.59  ? 177  LEU A HB2  1 
ATOM   2945  H  HB3  . LEU A 1 180 ? 25.276  53.840  -13.782 1.00 65.59  ? 177  LEU A HB3  1 
ATOM   2946  H  HG   . LEU A 1 180 ? 24.829  53.325  -16.518 1.00 65.78  ? 177  LEU A HG   1 
ATOM   2947  H  HD11 . LEU A 1 180 ? 26.777  52.155  -14.849 1.00 67.43  ? 177  LEU A HD11 1 
ATOM   2948  H  HD12 . LEU A 1 180 ? 26.506  51.718  -16.353 1.00 67.43  ? 177  LEU A HD12 1 
ATOM   2949  H  HD13 . LEU A 1 180 ? 27.098  53.159  -16.038 1.00 67.43  ? 177  LEU A HD13 1 
ATOM   2950  H  HD21 . LEU A 1 180 ? 23.231  52.271  -15.174 1.00 52.42  ? 177  LEU A HD21 1 
ATOM   2951  H  HD22 . LEU A 1 180 ? 24.179  51.183  -15.840 1.00 52.42  ? 177  LEU A HD22 1 
ATOM   2952  H  HD23 . LEU A 1 180 ? 24.390  51.598  -14.321 1.00 52.42  ? 177  LEU A HD23 1 
ATOM   2953  N  N    . SER A 1 181 ? 23.037  55.329  -12.295 1.00 47.81  ? 178  SER A N    1 
ATOM   2954  C  CA   . SER A 1 181 ? 22.987  56.061  -11.039 1.00 41.77  ? 178  SER A CA   1 
ATOM   2955  C  C    . SER A 1 181 ? 24.374  56.103  -10.407 1.00 51.24  ? 178  SER A C    1 
ATOM   2956  O  O    . SER A 1 181 ? 25.277  55.358  -10.795 1.00 49.31  ? 178  SER A O    1 
ATOM   2957  C  CB   . SER A 1 181 ? 21.990  55.412  -10.082 1.00 44.20  ? 178  SER A CB   1 
ATOM   2958  O  OG   . SER A 1 181 ? 22.450  54.138  -9.649  1.00 61.15  ? 178  SER A OG   1 
ATOM   2959  H  H    . SER A 1 181 ? 22.604  54.586  -12.289 1.00 57.37  ? 178  SER A H    1 
ATOM   2960  H  HA   . SER A 1 181 ? 22.700  56.972  -11.208 1.00 50.13  ? 178  SER A HA   1 
ATOM   2961  H  HB2  . SER A 1 181 ? 21.877  55.986  -9.308  1.00 53.04  ? 178  SER A HB2  1 
ATOM   2962  H  HB3  . SER A 1 181 ? 21.141  55.302  -10.539 1.00 53.04  ? 178  SER A HB3  1 
ATOM   2963  H  HG   . SER A 1 181 ? 21.892  53.794  -9.124  1.00 73.38  ? 178  SER A HG   1 
ATOM   2964  N  N    . SER A 1 182 ? 24.543  56.996  -9.444  1.00 56.86  ? 179  SER A N    1 
ATOM   2965  C  CA   . SER A 1 182 ? 25.811  57.135  -8.752  1.00 58.70  ? 179  SER A CA   1 
ATOM   2966  C  C    . SER A 1 182 ? 26.140  55.846  -7.989  1.00 56.20  ? 179  SER A C    1 
ATOM   2967  O  O    . SER A 1 182 ? 27.306  55.457  -7.876  1.00 63.21  ? 179  SER A O    1 
ATOM   2968  C  CB   . SER A 1 182 ? 25.747  58.341  -7.815  1.00 48.47  ? 179  SER A CB   1 
ATOM   2969  O  OG   . SER A 1 182 ? 27.004  58.626  -7.240  1.00 69.95  ? 179  SER A OG   1 
ATOM   2970  H  H    . SER A 1 182 ? 23.933  57.538  -9.171  1.00 68.24  ? 179  SER A H    1 
ATOM   2971  H  HA   . SER A 1 182 ? 26.514  57.292  -9.402  1.00 70.44  ? 179  SER A HA   1 
ATOM   2972  H  HB2  . SER A 1 182 ? 25.452  59.115  -8.321  1.00 58.16  ? 179  SER A HB2  1 
ATOM   2973  H  HB3  . SER A 1 182 ? 25.114  58.153  -7.105  1.00 58.16  ? 179  SER A HB3  1 
ATOM   2974  H  HG   . SER A 1 182 ? 27.565  58.795  -7.843  1.00 83.94  ? 179  SER A HG   1 
ATOM   2975  N  N    . ALA A 1 183 ? 25.101  55.136  -7.564  1.00 51.31  ? 180  ALA A N    1 
ATOM   2976  C  CA   . ALA A 1 183 ? 25.275  53.935  -6.760  1.00 48.62  ? 180  ALA A CA   1 
ATOM   2977  C  C    . ALA A 1 183 ? 25.858  52.793  -7.589  1.00 62.03  ? 180  ALA A C    1 
ATOM   2978  O  O    . ALA A 1 183 ? 26.748  52.049  -7.126  1.00 62.64  ? 180  ALA A O    1 
ATOM   2979  C  CB   . ALA A 1 183 ? 23.939  53.525  -6.167  1.00 28.59  ? 180  ALA A CB   1 
ATOM   2980  H  H    . ALA A 1 183 ? 24.280  55.330  -7.730  1.00 61.57  ? 180  ALA A H    1 
ATOM   2981  H  HA   . ALA A 1 183 ? 25.886  54.125  -6.031  1.00 58.35  ? 180  ALA A HA   1 
ATOM   2982  H  HB1  . ALA A 1 183 ? 23.315  53.349  -6.888  1.00 34.30  ? 180  ALA A HB1  1 
ATOM   2983  H  HB2  . ALA A 1 183 ? 24.063  52.725  -5.633  1.00 34.30  ? 180  ALA A HB2  1 
ATOM   2984  H  HB3  . ALA A 1 183 ? 23.607  54.247  -5.610  1.00 34.30  ? 180  ALA A HB3  1 
ATOM   2985  N  N    . VAL A 1 184 ? 25.364  52.670  -8.818  1.00 49.29  ? 181  VAL A N    1 
ATOM   2986  C  CA   . VAL A 1 184 ? 25.820  51.620  -9.710  1.00 41.94  ? 181  VAL A CA   1 
ATOM   2987  C  C    . VAL A 1 184 ? 27.254  51.926  -10.111 1.00 49.11  ? 181  VAL A C    1 
ATOM   2988  O  O    . VAL A 1 184 ? 28.076  51.024  -10.209 1.00 60.97  ? 181  VAL A O    1 
ATOM   2989  C  CB   . VAL A 1 184 ? 24.931  51.508  -10.961 1.00 50.43  ? 181  VAL A CB   1 
ATOM   2990  C  CG1  . VAL A 1 184 ? 25.541  50.535  -11.981 1.00 48.24  ? 181  VAL A CG1  1 
ATOM   2991  C  CG2  . VAL A 1 184 ? 23.536  51.048  -10.565 1.00 46.04  ? 181  VAL A CG2  1 
ATOM   2992  H  H    . VAL A 1 184 ? 24.763  53.184  -9.156  1.00 59.15  ? 181  VAL A H    1 
ATOM   2993  H  HA   . VAL A 1 184 ? 25.805  50.770  -9.244  1.00 50.32  ? 181  VAL A HA   1 
ATOM   2994  H  HB   . VAL A 1 184 ? 24.857  52.380  -11.379 1.00 60.52  ? 181  VAL A HB   1 
ATOM   2995  H  HG11 . VAL A 1 184 ? 25.623  49.659  -11.572 1.00 57.88  ? 181  VAL A HG11 1 
ATOM   2996  H  HG12 . VAL A 1 184 ? 24.960  50.485  -12.756 1.00 57.88  ? 181  VAL A HG12 1 
ATOM   2997  H  HG13 . VAL A 1 184 ? 26.416  50.860  -12.244 1.00 57.88  ? 181  VAL A HG13 1 
ATOM   2998  H  HG21 . VAL A 1 184 ? 23.152  51.695  -9.953  1.00 55.24  ? 181  VAL A HG21 1 
ATOM   2999  H  HG22 . VAL A 1 184 ? 22.988  50.982  -11.363 1.00 55.24  ? 181  VAL A HG22 1 
ATOM   3000  H  HG23 . VAL A 1 184 ? 23.600  50.181  -10.134 1.00 55.24  ? 181  VAL A HG23 1 
ATOM   3001  N  N    . ARG A 1 185 ? 27.548  53.201  -10.349 1.00 53.03  ? 182  ARG A N    1 
ATOM   3002  C  CA   . ARG A 1 185 ? 28.899  53.629  -10.698 1.00 52.68  ? 182  ARG A CA   1 
ATOM   3003  C  C    . ARG A 1 185 ? 29.846  53.280  -9.551  1.00 57.01  ? 182  ARG A C    1 
ATOM   3004  O  O    . ARG A 1 185 ? 30.960  52.742  -9.745  1.00 51.65  ? 182  ARG A O    1 
ATOM   3005  C  CB   . ARG A 1 185 ? 28.926  55.131  -10.980 1.00 51.28  ? 182  ARG A CB   1 
ATOM   3006  C  CG   . ARG A 1 185 ? 28.257  55.536  -12.288 1.00 56.91  ? 182  ARG A CG   1 
ATOM   3007  C  CD   . ARG A 1 185 ? 27.982  57.044  -12.370 1.00 52.67  ? 182  ARG A CD   1 
ATOM   3008  N  NE   . ARG A 1 185 ? 26.890  57.326  -13.310 1.00 69.58  ? 182  ARG A NE   1 
ATOM   3009  C  CZ   . ARG A 1 185 ? 27.023  57.783  -14.555 1.00 55.41  ? 182  ARG A CZ   1 
ATOM   3010  N  NH1  . ARG A 1 185 ? 28.216  58.070  -15.058 1.00 51.75  ? 182  ARG A NH1  1 
ATOM   3011  N  NH2  . ARG A 1 185 ? 25.941  57.962  -15.300 1.00 42.71  ? 182  ARG A NH2  1 
ATOM   3012  H  H    . ARG A 1 185 ? 26.976  53.843  -10.315 1.00 63.64  ? 182  ARG A H    1 
ATOM   3013  H  HA   . ARG A 1 185 ? 29.193  53.160  -11.495 1.00 63.22  ? 182  ARG A HA   1 
ATOM   3014  H  HB2  . ARG A 1 185 ? 28.467  55.591  -10.260 1.00 61.54  ? 182  ARG A HB2  1 
ATOM   3015  H  HB3  . ARG A 1 185 ? 29.850  55.424  -11.018 1.00 61.54  ? 182  ARG A HB3  1 
ATOM   3016  H  HG2  . ARG A 1 185 ? 28.838  55.296  -13.027 1.00 68.30  ? 182  ARG A HG2  1 
ATOM   3017  H  HG3  . ARG A 1 185 ? 27.410  55.071  -12.367 1.00 68.30  ? 182  ARG A HG3  1 
ATOM   3018  H  HD2  . ARG A 1 185 ? 27.724  57.373  -11.495 1.00 63.20  ? 182  ARG A HD2  1 
ATOM   3019  H  HD3  . ARG A 1 185 ? 28.779  57.501  -12.681 1.00 63.20  ? 182  ARG A HD3  1 
ATOM   3020  H  HE   . ARG A 1 185 ? 26.089  57.182  -13.031 1.00 83.50  ? 182  ARG A HE   1 
ATOM   3021  H  HH11 . ARG A 1 185 ? 28.923  57.950  -14.583 1.00 62.11  ? 182  ARG A HH11 1 
ATOM   3022  H  HH12 . ARG A 1 185 ? 28.283  58.370  -15.861 1.00 62.11  ? 182  ARG A HH12 1 
ATOM   3023  H  HH21 . ARG A 1 185 ? 25.163  57.786  -14.979 1.00 51.26  ? 182  ARG A HH21 1 
ATOM   3024  H  HH22 . ARG A 1 185 ? 26.016  58.270  -16.100 1.00 51.26  ? 182  ARG A HH22 1 
ATOM   3025  N  N    . SER A 1 186 ? 29.395  53.603  -8.343  1.00 45.99  ? 183  SER A N    1 
ATOM   3026  C  CA   . SER A 1 186 ? 30.196  53.325  -7.167  1.00 54.69  ? 183  SER A CA   1 
ATOM   3027  C  C    . SER A 1 186 ? 30.379  51.806  -7.040  1.00 58.93  ? 183  SER A C    1 
ATOM   3028  O  O    . SER A 1 186 ? 31.485  51.324  -6.742  1.00 61.29  ? 183  SER A O    1 
ATOM   3029  C  CB   . SER A 1 186 ? 29.529  53.919  -5.919  1.00 44.37  ? 183  SER A CB   1 
ATOM   3030  O  OG   . SER A 1 186 ? 30.399  53.914  -4.807  1.00 78.03  ? 183  SER A OG   1 
ATOM   3031  H  H    . SER A 1 186 ? 28.638  53.978  -8.183  1.00 55.19  ? 183  SER A H    1 
ATOM   3032  H  HA   . SER A 1 186 ? 31.070  53.731  -7.269  1.00 65.63  ? 183  SER A HA   1 
ATOM   3033  H  HB2  . SER A 1 186 ? 29.270  54.834  -6.109  1.00 53.24  ? 183  SER A HB2  1 
ATOM   3034  H  HB3  . SER A 1 186 ? 28.744  53.392  -5.704  1.00 53.24  ? 183  SER A HB3  1 
ATOM   3035  H  HG   . SER A 1 186 ? 30.011  54.243  -4.138  1.00 93.63  ? 183  SER A HG   1 
ATOM   3036  N  N    . GLY A 1 187 ? 29.358  51.041  -7.431  1.00 44.88  ? 184  GLY A N    1 
ATOM   3037  C  CA   . GLY A 1 187 ? 29.482  49.595  -7.363  1.00 42.73  ? 184  GLY A CA   1 
ATOM   3038  C  C    . GLY A 1 187 ? 30.427  49.058  -8.419  1.00 45.86  ? 184  GLY A C    1 
ATOM   3039  O  O    . GLY A 1 187 ? 31.179  48.101  -8.174  1.00 52.98  ? 184  GLY A O    1 
ATOM   3040  H  H    . GLY A 1 187 ? 28.605  51.329  -7.732  1.00 53.86  ? 184  GLY A H    1 
ATOM   3041  H  HA2  . GLY A 1 187 ? 29.817  49.338  -6.489  1.00 51.28  ? 184  GLY A HA2  1 
ATOM   3042  H  HA3  . GLY A 1 187 ? 28.611  49.187  -7.492  1.00 51.28  ? 184  GLY A HA3  1 
ATOM   3043  N  N    . ILE A 1 188 ? 30.425  49.668  -9.594  1.00 46.10  ? 185  ILE A N    1 
ATOM   3044  C  CA   . ILE A 1 188 ? 31.367  49.258  -10.614 1.00 42.87  ? 185  ILE A CA   1 
ATOM   3045  C  C    . ILE A 1 188 ? 32.780  49.551  -10.117 1.00 43.05  ? 185  ILE A C    1 
ATOM   3046  O  O    . ILE A 1 188 ? 33.688  48.753  -10.318 1.00 42.74  ? 185  ILE A O    1 
ATOM   3047  C  CB   . ILE A 1 188 ? 31.127  49.978  -11.930 1.00 39.16  ? 185  ILE A CB   1 
ATOM   3048  C  CG1  . ILE A 1 188 ? 29.739  49.619  -12.471 1.00 48.09  ? 185  ILE A CG1  1 
ATOM   3049  C  CG2  . ILE A 1 188 ? 32.218  49.588  -12.947 1.00 43.11  ? 185  ILE A CG2  1 
ATOM   3050  C  CD1  . ILE A 1 188 ? 29.392  50.272  -13.807 1.00 46.49  ? 185  ILE A CD1  1 
ATOM   3051  H  H    . ILE A 1 188 ? 29.899  50.309  -9.821  1.00 55.32  ? 185  ILE A H    1 
ATOM   3052  H  HA   . ILE A 1 188 ? 31.286  48.303  -10.765 1.00 51.44  ? 185  ILE A HA   1 
ATOM   3053  H  HB   . ILE A 1 188 ? 31.168  50.935  -11.777 1.00 46.99  ? 185  ILE A HB   1 
ATOM   3054  H  HG12 . ILE A 1 188 ? 29.692  48.658  -12.592 1.00 57.70  ? 185  ILE A HG12 1 
ATOM   3055  H  HG13 . ILE A 1 188 ? 29.073  49.900  -11.824 1.00 57.70  ? 185  ILE A HG13 1 
ATOM   3056  H  HG21 . ILE A 1 188 ? 32.186  48.630  -13.092 1.00 51.73  ? 185  ILE A HG21 1 
ATOM   3057  H  HG22 . ILE A 1 188 ? 32.053  50.055  -13.781 1.00 51.73  ? 185  ILE A HG22 1 
ATOM   3058  H  HG23 . ILE A 1 188 ? 33.085  49.841  -12.592 1.00 51.73  ? 185  ILE A HG23 1 
ATOM   3059  H  HD11 . ILE A 1 188 ? 30.040  49.992  -14.472 1.00 55.79  ? 185  ILE A HD11 1 
ATOM   3060  H  HD12 . ILE A 1 188 ? 28.502  49.992  -14.072 1.00 55.79  ? 185  ILE A HD12 1 
ATOM   3061  H  HD13 . ILE A 1 188 ? 29.419  51.236  -13.703 1.00 55.79  ? 185  ILE A HD13 1 
ATOM   3062  N  N    . VAL A 1 189 ? 32.978  50.687  -9.455  1.00 46.31  ? 186  VAL A N    1 
ATOM   3063  C  CA   . VAL A 1 189 ? 34.307  50.960  -8.918  1.00 41.79  ? 186  VAL A CA   1 
ATOM   3064  C  C    . VAL A 1 189 ? 34.681  49.952  -7.824  1.00 45.61  ? 186  VAL A C    1 
ATOM   3065  O  O    . VAL A 1 189 ? 35.825  49.507  -7.772  1.00 42.47  ? 186  VAL A O    1 
ATOM   3066  C  CB   . VAL A 1 189 ? 34.416  52.386  -8.365  1.00 44.27  ? 186  VAL A CB   1 
ATOM   3067  C  CG1  . VAL A 1 189 ? 35.700  52.562  -7.542  1.00 44.43  ? 186  VAL A CG1  1 
ATOM   3068  C  CG2  . VAL A 1 189 ? 34.435  53.369  -9.497  1.00 42.36  ? 186  VAL A CG2  1 
ATOM   3069  H  H    . VAL A 1 189 ? 32.387  51.293  -9.306  1.00 55.57  ? 186  VAL A H    1 
ATOM   3070  H  HA   . VAL A 1 189 ? 34.955  50.872  -9.635  1.00 50.15  ? 186  VAL A HA   1 
ATOM   3071  H  HB   . VAL A 1 189 ? 33.653  52.577  -7.798  1.00 53.12  ? 186  VAL A HB   1 
ATOM   3072  H  HG11 . VAL A 1 189 ? 36.466  52.385  -8.111  1.00 53.31  ? 186  VAL A HG11 1 
ATOM   3073  H  HG12 . VAL A 1 189 ? 35.738  53.472  -7.208  1.00 53.31  ? 186  VAL A HG12 1 
ATOM   3074  H  HG13 . VAL A 1 189 ? 35.687  51.937  -6.801  1.00 53.31  ? 186  VAL A HG13 1 
ATOM   3075  H  HG21 . VAL A 1 189 ? 33.614  53.281  -10.006 1.00 50.83  ? 186  VAL A HG21 1 
ATOM   3076  H  HG22 . VAL A 1 189 ? 34.504  54.266  -9.134  1.00 50.83  ? 186  VAL A HG22 1 
ATOM   3077  H  HG23 . VAL A 1 189 ? 35.198  53.182  -10.065 1.00 50.83  ? 186  VAL A HG23 1 
ATOM   3078  N  N    . GLU A 1 190 ? 33.736  49.578  -6.962  1.00 41.40  ? 187  GLU A N    1 
ATOM   3079  C  CA   . GLU A 1 190 ? 34.042  48.592  -5.923  1.00 43.76  ? 187  GLU A CA   1 
ATOM   3080  C  C    . GLU A 1 190 ? 34.362  47.215  -6.521  1.00 51.39  ? 187  GLU A C    1 
ATOM   3081  O  O    . GLU A 1 190 ? 35.206  46.485  -6.000  1.00 52.63  ? 187  GLU A O    1 
ATOM   3082  C  CB   . GLU A 1 190 ? 32.877  48.443  -4.956  1.00 44.96  ? 187  GLU A CB   1 
ATOM   3083  C  CG   . GLU A 1 190 ? 32.528  49.671  -4.159  1.00 54.46  ? 187  GLU A CG   1 
ATOM   3084  C  CD   . GLU A 1 190 ? 31.266  49.447  -3.341  1.00 80.95  ? 187  GLU A CD   1 
ATOM   3085  O  OE1  . GLU A 1 190 ? 31.081  48.302  -2.852  1.00 69.86  ? 187  GLU A OE1  1 
ATOM   3086  O  OE2  . GLU A 1 190 ? 30.431  50.386  -3.254  1.00 72.88  ? 187  GLU A OE2  1 
ATOM   3087  H  H    . GLU A 1 190 ? 32.928  49.872  -6.954  1.00 49.68  ? 187  GLU A H    1 
ATOM   3088  H  HA   . GLU A 1 190 ? 34.816  48.890  -5.420  1.00 52.52  ? 187  GLU A HA   1 
ATOM   3089  H  HB2  . GLU A 1 190 ? 32.089  48.193  -5.464  1.00 53.95  ? 187  GLU A HB2  1 
ATOM   3090  H  HB3  . GLU A 1 190 ? 33.092  47.739  -4.325  1.00 53.95  ? 187  GLU A HB3  1 
ATOM   3091  H  HG2  . GLU A 1 190 ? 33.254  49.877  -3.550  1.00 65.36  ? 187  GLU A HG2  1 
ATOM   3092  H  HG3  . GLU A 1 190 ? 32.372  50.413  -4.763  1.00 65.36  ? 187  GLU A HG3  1 
ATOM   3093  N  N    . TYR A 1 191 ? 33.683  46.861  -7.609  1.00 52.00  ? 188  TYR A N    1 
ATOM   3094  C  CA   . TYR A 1 191 ? 33.948  45.592  -8.285  1.00 50.38  ? 188  TYR A CA   1 
ATOM   3095  C  C    . TYR A 1 191 ? 35.362  45.537  -8.846  1.00 47.89  ? 188  TYR A C    1 
ATOM   3096  O  O    . TYR A 1 191 ? 36.064  44.535  -8.718  1.00 46.74  ? 188  TYR A O    1 
ATOM   3097  C  CB   . TYR A 1 191 ? 32.930  45.409  -9.412  1.00 52.71  ? 188  TYR A CB   1 
ATOM   3098  C  CG   . TYR A 1 191 ? 33.148  44.233  -10.338 1.00 39.96  ? 188  TYR A CG   1 
ATOM   3099  C  CD1  . TYR A 1 191 ? 33.985  44.343  -11.440 1.00 40.64  ? 188  TYR A CD1  1 
ATOM   3100  C  CD2  . TYR A 1 191 ? 32.495  43.036  -10.137 1.00 45.31  ? 188  TYR A CD2  1 
ATOM   3101  C  CE1  . TYR A 1 191 ? 34.179  43.286  -12.310 1.00 44.40  ? 188  TYR A CE1  1 
ATOM   3102  C  CE2  . TYR A 1 191 ? 32.680  41.961  -11.007 1.00 49.17  ? 188  TYR A CE2  1 
ATOM   3103  C  CZ   . TYR A 1 191 ? 33.526  42.095  -12.093 1.00 48.58  ? 188  TYR A CZ   1 
ATOM   3104  O  OH   . TYR A 1 191 ? 33.731  41.044  -12.966 1.00 49.52  ? 188  TYR A OH   1 
ATOM   3105  H  H    . TYR A 1 191 ? 33.065  47.335  -7.975  1.00 62.40  ? 188  TYR A H    1 
ATOM   3106  H  HA   . TYR A 1 191 ? 33.841  44.863  -7.654  1.00 60.45  ? 188  TYR A HA   1 
ATOM   3107  H  HB2  . TYR A 1 191 ? 32.052  45.301  -9.013  1.00 63.25  ? 188  TYR A HB2  1 
ATOM   3108  H  HB3  . TYR A 1 191 ? 32.936  46.210  -9.959  1.00 63.25  ? 188  TYR A HB3  1 
ATOM   3109  H  HD1  . TYR A 1 191 ? 34.428  45.146  -11.595 1.00 48.76  ? 188  TYR A HD1  1 
ATOM   3110  H  HD2  . TYR A 1 191 ? 31.923  42.943  -9.409  1.00 54.37  ? 188  TYR A HD2  1 
ATOM   3111  H  HE1  . TYR A 1 191 ? 34.750  43.380  -13.039 1.00 53.28  ? 188  TYR A HE1  1 
ATOM   3112  H  HE2  . TYR A 1 191 ? 32.238  41.157  -10.855 1.00 59.00  ? 188  TYR A HE2  1 
ATOM   3113  H  HH   . TYR A 1 191 ? 34.269  41.272  -13.569 1.00 59.42  ? 188  TYR A HH   1 
ATOM   3114  N  N    . LEU A 1 192 ? 35.792  46.647  -9.420  1.00 48.24  ? 189  LEU A N    1 
ATOM   3115  C  CA   . LEU A 1 192 ? 37.095  46.731  -10.046 1.00 42.29  ? 189  LEU A CA   1 
ATOM   3116  C  C    . LEU A 1 192 ? 38.248  46.894  -9.078  1.00 46.68  ? 189  LEU A C    1 
ATOM   3117  O  O    . LEU A 1 192 ? 39.399  46.733  -9.478  1.00 52.28  ? 189  LEU A O    1 
ATOM   3118  C  CB   . LEU A 1 192 ? 37.104  47.916  -11.009 1.00 38.31  ? 189  LEU A CB   1 
ATOM   3119  C  CG   . LEU A 1 192 ? 36.095  47.855  -12.145 1.00 42.01  ? 189  LEU A CG   1 
ATOM   3120  C  CD1  . LEU A 1 192 ? 36.141  49.168  -12.942 1.00 43.26  ? 189  LEU A CD1  1 
ATOM   3121  C  CD2  . LEU A 1 192 ? 36.383  46.648  -13.076 1.00 41.86  ? 189  LEU A CD2  1 
ATOM   3122  H  H    . LEU A 1 192 ? 35.339  47.377  -9.459  1.00 57.89  ? 189  LEU A H    1 
ATOM   3123  H  HA   . LEU A 1 192 ? 37.249  45.924  -10.562 1.00 50.75  ? 189  LEU A HA   1 
ATOM   3124  H  HB2  . LEU A 1 192 ? 36.923  48.723  -10.503 1.00 45.97  ? 189  LEU A HB2  1 
ATOM   3125  H  HB3  . LEU A 1 192 ? 37.986  47.977  -11.409 1.00 45.97  ? 189  LEU A HB3  1 
ATOM   3126  H  HG   . LEU A 1 192 ? 35.203  47.752  -11.778 1.00 50.41  ? 189  LEU A HG   1 
ATOM   3127  H  HD11 . LEU A 1 192 ? 37.033  49.286  -13.304 1.00 51.92  ? 189  LEU A HD11 1 
ATOM   3128  H  HD12 . LEU A 1 192 ? 35.495  49.121  -13.664 1.00 51.92  ? 189  LEU A HD12 1 
ATOM   3129  H  HD13 . LEU A 1 192 ? 35.923  49.904  -12.350 1.00 51.92  ? 189  LEU A HD13 1 
ATOM   3130  H  HD21 . LEU A 1 192 ? 36.327  45.830  -12.558 1.00 50.23  ? 189  LEU A HD21 1 
ATOM   3131  H  HD22 . LEU A 1 192 ? 35.726  46.635  -13.789 1.00 50.23  ? 189  LEU A HD22 1 
ATOM   3132  H  HD23 . LEU A 1 192 ? 37.274  46.744  -13.448 1.00 50.23  ? 189  LEU A HD23 1 
ATOM   3133  N  N    . SER A 1 193 ? 37.948  47.153  -7.806  1.00 47.29  ? 190  SER A N    1 
ATOM   3134  C  CA   . SER A 1 193 ? 38.976  47.604  -6.859  1.00 44.55  ? 190  SER A CA   1 
ATOM   3135  C  C    . SER A 1 193 ? 39.502  46.525  -5.927  1.00 46.63  ? 190  SER A C    1 
ATOM   3136  O  O    . SER A 1 193 ? 38.731  45.907  -5.190  1.00 53.35  ? 190  SER A O    1 
ATOM   3137  C  CB   . SER A 1 193 ? 38.428  48.762  -6.013  1.00 46.80  ? 190  SER A CB   1 
ATOM   3138  O  OG   . SER A 1 193 ? 38.528  50.002  -6.695  1.00 51.76  ? 190  SER A OG   1 
ATOM   3139  H  H    . SER A 1 193 ? 37.162  47.078  -7.465  1.00 56.75  ? 190  SER A H    1 
ATOM   3140  H  HA   . SER A 1 193 ? 39.731  47.943  -7.365  1.00 53.47  ? 190  SER A HA   1 
ATOM   3141  H  HB2  . SER A 1 193 ? 37.495  48.589  -5.812  1.00 56.17  ? 190  SER A HB2  1 
ATOM   3142  H  HB3  . SER A 1 193 ? 38.937  48.815  -5.189  1.00 56.17  ? 190  SER A HB3  1 
ATOM   3143  H  HG   . SER A 1 193 ? 38.090  49.973  -7.411  1.00 62.11  ? 190  SER A HG   1 
ATOM   3144  N  N    . LEU A 1 194 ? 40.826  46.367  -5.899  1.00 41.94  ? 191  LEU A N    1 
ATOM   3145  C  CA   . LEU A 1 194 ? 41.449  45.334  -5.073  1.00 54.49  ? 191  LEU A CA   1 
ATOM   3146  C  C    . LEU A 1 194 ? 42.442  45.903  -4.040  1.00 49.84  ? 191  LEU A C    1 
ATOM   3147  O  O    . LEU A 1 194 ? 42.623  45.329  -2.970  1.00 53.05  ? 191  LEU A O    1 
ATOM   3148  C  CB   . LEU A 1 194 ? 42.179  44.347  -5.980  1.00 45.38  ? 191  LEU A CB   1 
ATOM   3149  C  CG   . LEU A 1 194 ? 41.301  43.375  -6.767  1.00 59.58  ? 191  LEU A CG   1 
ATOM   3150  C  CD1  . LEU A 1 194 ? 42.183  42.538  -7.700  1.00 53.66  ? 191  LEU A CD1  1 
ATOM   3151  C  CD2  . LEU A 1 194 ? 40.485  42.477  -5.846  1.00 51.37  ? 191  LEU A CD2  1 
ATOM   3152  H  H    . LEU A 1 194 ? 41.383  46.844  -6.348  1.00 50.33  ? 191  LEU A H    1 
ATOM   3153  H  HA   . LEU A 1 194 ? 40.759  44.850  -4.593  1.00 65.38  ? 191  LEU A HA   1 
ATOM   3154  H  HB2  . LEU A 1 194 ? 42.698  44.853  -6.624  1.00 54.46  ? 191  LEU A HB2  1 
ATOM   3155  H  HB3  . LEU A 1 194 ? 42.777  43.815  -5.432  1.00 54.46  ? 191  LEU A HB3  1 
ATOM   3156  H  HG   . LEU A 1 194 ? 40.682  43.883  -7.316  1.00 71.50  ? 191  LEU A HG   1 
ATOM   3157  H  HD11 . LEU A 1 194 ? 42.824  42.043  -7.167  1.00 64.39  ? 191  LEU A HD11 1 
ATOM   3158  H  HD12 . LEU A 1 194 ? 41.621  41.923  -8.198  1.00 64.39  ? 191  LEU A HD12 1 
ATOM   3159  H  HD13 . LEU A 1 194 ? 42.647  43.131  -8.311  1.00 64.39  ? 191  LEU A HD13 1 
ATOM   3160  H  HD21 . LEU A 1 194 ? 39.913  43.031  -5.291  1.00 61.65  ? 191  LEU A HD21 1 
ATOM   3161  H  HD22 . LEU A 1 194 ? 39.945  41.879  -6.385  1.00 61.65  ? 191  LEU A HD22 1 
ATOM   3162  H  HD23 . LEU A 1 194 ? 41.091  41.964  -5.288  1.00 61.65  ? 191  LEU A HD23 1 
ATOM   3163  N  N    . VAL A 1 195 ? 43.094  47.010  -4.389  1.00 45.17  ? 192  VAL A N    1 
ATOM   3164  C  CA   . VAL A 1 195 ? 44.079  47.671  -3.535  1.00 39.59  ? 192  VAL A CA   1 
ATOM   3165  C  C    . VAL A 1 195 ? 43.414  48.671  -2.604  1.00 44.24  ? 192  VAL A C    1 
ATOM   3166  O  O    . VAL A 1 195 ? 43.071  49.777  -3.028  1.00 56.12  ? 192  VAL A O    1 
ATOM   3167  C  CB   . VAL A 1 195 ? 45.144  48.394  -4.364  1.00 40.98  ? 192  VAL A CB   1 
ATOM   3168  C  CG1  . VAL A 1 195 ? 46.177  49.042  -3.461  1.00 37.45  ? 192  VAL A CG1  1 
ATOM   3169  C  CG2  . VAL A 1 195 ? 45.807  47.414  -5.322  1.00 43.51  ? 192  VAL A CG2  1 
ATOM   3170  H  H    . VAL A 1 195 ? 42.977  47.410  -5.142  1.00 54.20  ? 192  VAL A H    1 
ATOM   3171  H  HA   . VAL A 1 195 ? 44.525  47.003  -2.990  1.00 47.51  ? 192  VAL A HA   1 
ATOM   3172  H  HB   . VAL A 1 195 ? 44.720  49.091  -4.889  1.00 49.17  ? 192  VAL A HB   1 
ATOM   3173  H  HG11 . VAL A 1 195 ? 46.603  48.355  -2.926  1.00 44.95  ? 192  VAL A HG11 1 
ATOM   3174  H  HG12 . VAL A 1 195 ? 46.838  49.492  -4.010  1.00 44.95  ? 192  VAL A HG12 1 
ATOM   3175  H  HG13 . VAL A 1 195 ? 45.733  49.684  -2.884  1.00 44.95  ? 192  VAL A HG13 1 
ATOM   3176  H  HG21 . VAL A 1 195 ? 45.132  47.044  -5.913  1.00 52.21  ? 192  VAL A HG21 1 
ATOM   3177  H  HG22 . VAL A 1 195 ? 46.478  47.885  -5.841  1.00 52.21  ? 192  VAL A HG22 1 
ATOM   3178  H  HG23 . VAL A 1 195 ? 46.223  46.704  -4.809  1.00 52.21  ? 192  VAL A HG23 1 
ATOM   3179  N  N    . LYS A 1 196 ? 43.206  48.267  -1.358  1.00 50.33  ? 193  LYS A N    1 
ATOM   3180  C  CA   . LYS A 1 196 ? 42.512  49.083  -0.372  1.00 56.54  ? 193  LYS A CA   1 
ATOM   3181  C  C    . LYS A 1 196 ? 43.433  49.537  0.750   1.00 70.18  ? 193  LYS A C    1 
ATOM   3182  O  O    . LYS A 1 196 ? 44.134  48.717  1.341   1.00 64.17  ? 193  LYS A O    1 
ATOM   3183  C  CB   . LYS A 1 196 ? 41.334  48.320  0.222   1.00 69.63  ? 193  LYS A CB   1 
ATOM   3184  C  CG   . LYS A 1 196 ? 40.490  49.183  1.137   1.00 99.31  ? 193  LYS A CG   1 
ATOM   3185  C  CD   . LYS A 1 196 ? 39.317  48.429  1.709   1.00 107.40 ? 193  LYS A CD   1 
ATOM   3186  C  CE   . LYS A 1 196 ? 38.527  49.311  2.657   1.00 99.44  ? 193  LYS A CE   1 
ATOM   3187  N  NZ   . LYS A 1 196 ? 37.436  48.553  3.315   1.00 109.47 ? 193  LYS A NZ   1 
ATOM   3188  H  H    . LYS A 1 196 ? 43.464  47.506  -1.053  1.00 60.40  ? 193  LYS A H    1 
ATOM   3189  H  HA   . LYS A 1 196 ? 42.164  49.875  -0.810  1.00 67.85  ? 193  LYS A HA   1 
ATOM   3190  H  HB2  . LYS A 1 196 ? 40.767  48.001  -0.498  1.00 83.56  ? 193  LYS A HB2  1 
ATOM   3191  H  HB3  . LYS A 1 196 ? 41.669  47.571  0.739   1.00 83.56  ? 193  LYS A HB3  1 
ATOM   3192  H  HG2  . LYS A 1 196 ? 41.038  49.495  1.874   1.00 119.17 ? 193  LYS A HG2  1 
ATOM   3193  H  HG3  . LYS A 1 196 ? 40.147  49.939  0.634   1.00 119.17 ? 193  LYS A HG3  1 
ATOM   3194  H  HD2  . LYS A 1 196 ? 38.730  48.149  0.989   1.00 128.88 ? 193  LYS A HD2  1 
ATOM   3195  H  HD3  . LYS A 1 196 ? 39.638  47.659  2.203   1.00 128.88 ? 193  LYS A HD3  1 
ATOM   3196  H  HE2  . LYS A 1 196 ? 39.118  49.653  3.346   1.00 119.33 ? 193  LYS A HE2  1 
ATOM   3197  H  HE3  . LYS A 1 196 ? 38.131  50.044  2.159   1.00 119.33 ? 193  LYS A HE3  1 
ATOM   3198  H  HZ1  . LYS A 1 196 ? 37.775  47.876  3.781   1.00 131.37 ? 193  LYS A HZ1  1 
ATOM   3199  H  HZ2  . LYS A 1 196 ? 36.984  49.087  3.866   1.00 131.37 ? 193  LYS A HZ2  1 
ATOM   3200  H  HZ3  . LYS A 1 196 ? 36.877  48.231  2.701   1.00 131.37 ? 193  LYS A HZ3  1 
ATOM   3201  N  N    . GLY A 1 197 ? 43.382  50.831  1.071   1.00 88.59  ? 194  GLY A N    1 
ATOM   3202  C  CA   . GLY A 1 197 ? 44.144  51.395  2.180   1.00 87.73  ? 194  GLY A CA   1 
ATOM   3203  C  C    . GLY A 1 197 ? 44.878  52.682  1.841   1.00 92.02  ? 194  GLY A C    1 
ATOM   3204  O  O    . GLY A 1 197 ? 45.036  53.027  0.670   1.00 98.31  ? 194  GLY A O    1 
ATOM   3205  H  H    . GLY A 1 197 ? 42.904  51.410  0.652   1.00 106.31 ? 194  GLY A H    1 
ATOM   3206  H  HA2  . GLY A 1 197 ? 43.542  51.577  2.918   1.00 105.27 ? 194  GLY A HA2  1 
ATOM   3207  H  HA3  . GLY A 1 197 ? 44.799  50.744  2.478   1.00 105.27 ? 194  GLY A HA3  1 
ATOM   3208  N  N    . GLY A 1 198 ? 45.350  53.371  2.881   1.00 96.74  ? 195  GLY A N    1 
ATOM   3209  C  CA   . GLY A 1 198 ? 46.004  54.665  2.744   1.00 94.79  ? 195  GLY A CA   1 
ATOM   3210  C  C    . GLY A 1 198 ? 47.514  54.639  2.869   1.00 98.67  ? 195  GLY A C    1 
ATOM   3211  O  O    . GLY A 1 198 ? 48.217  54.332  1.906   1.00 113.24 ? 195  GLY A O    1 
ATOM   3212  H  H    . GLY A 1 198 ? 45.299  53.099  3.696   1.00 116.09 ? 195  GLY A H    1 
ATOM   3213  H  HA2  . GLY A 1 198 ? 45.783  55.037  1.876   1.00 113.75 ? 195  GLY A HA2  1 
ATOM   3214  H  HA3  . GLY A 1 198 ? 45.659  55.264  3.424   1.00 113.75 ? 195  GLY A HA3  1 
ATOM   3215  N  N    . GLN A 1 199 ? 48.018  54.984  4.050   1.00 108.70 ? 196  GLN A N    1 
ATOM   3216  C  CA   . GLN A 1 199 ? 49.457  54.958  4.294   1.00 108.00 ? 196  GLN A CA   1 
ATOM   3217  C  C    . GLN A 1 199 ? 49.779  54.238  5.594   1.00 98.61  ? 196  GLN A C    1 
ATOM   3218  O  O    . GLN A 1 199 ? 50.844  53.638  5.731   1.00 105.98 ? 196  GLN A O    1 
ATOM   3219  C  CB   . GLN A 1 199 ? 50.006  56.383  4.345   1.00 113.57 ? 196  GLN A CB   1 
ATOM   3220  C  CG   . GLN A 1 199 ? 50.008  57.096  3.002   1.00 122.54 ? 196  GLN A CG   1 
ATOM   3221  C  CD   . GLN A 1 199 ? 50.552  58.514  3.097   1.00 127.51 ? 196  GLN A CD   1 
ATOM   3222  O  OE1  . GLN A 1 199 ? 50.426  59.174  4.133   1.00 125.62 ? 196  GLN A OE1  1 
ATOM   3223  N  NE2  . GLN A 1 199 ? 51.144  58.995  2.007   1.00 105.10 ? 196  GLN A NE2  1 
ATOM   3224  H  H    . GLN A 1 199 ? 47.550  55.236  4.725   1.00 130.44 ? 196  GLN A H    1 
ATOM   3225  H  HA   . GLN A 1 199 ? 49.897  54.487  3.569   1.00 129.60 ? 196  GLN A HA   1 
ATOM   3226  H  HB2  . GLN A 1 199 ? 49.463  56.904  4.956   1.00 136.29 ? 196  GLN A HB2  1 
ATOM   3227  H  HB3  . GLN A 1 199 ? 50.921  56.352  4.665   1.00 136.29 ? 196  GLN A HB3  1 
ATOM   3228  H  HG2  . GLN A 1 199 ? 50.565  56.601  2.381   1.00 147.05 ? 196  GLN A HG2  1 
ATOM   3229  H  HG3  . GLN A 1 199 ? 49.099  57.145  2.668   1.00 147.05 ? 196  GLN A HG3  1 
ATOM   3230  H  HE21 . GLN A 1 199 ? 51.203  58.510  1.299   1.00 126.12 ? 196  GLN A HE21 1 
ATOM   3231  H  HE22 . GLN A 1 199 ? 51.468  59.792  2.010   1.00 126.12 ? 196  GLN A HE22 1 
ATOM   3232  N  N    . ASP A 1 200 ? 48.843  54.276  6.535   1.00 99.08  ? 197  ASP A N    1 
ATOM   3233  C  CA   . ASP A 1 200 ? 48.973  53.523  7.777   1.00 102.36 ? 197  ASP A CA   1 
ATOM   3234  C  C    . ASP A 1 200 ? 49.051  52.032  7.483   1.00 97.89  ? 197  ASP A C    1 
ATOM   3235  O  O    . ASP A 1 200 ? 49.752  51.287  8.168   1.00 94.82  ? 197  ASP A O    1 
ATOM   3236  C  CB   . ASP A 1 200 ? 47.798  53.812  8.717   1.00 113.93 ? 197  ASP A CB   1 
ATOM   3237  C  CG   . ASP A 1 200 ? 47.784  52.899  9.938   1.00 126.06 ? 197  ASP A CG   1 
ATOM   3238  O  OD1  . ASP A 1 200 ? 48.555  53.156  10.890  1.00 123.40 ? 197  ASP A OD1  1 
ATOM   3239  O  OD2  . ASP A 1 200 ? 46.999  51.923  9.944   1.00 122.09 ? 197  ASP A OD2  1 
ATOM   3240  H  H    . ASP A 1 200 ? 48.117  54.733  6.477   1.00 118.90 ? 197  ASP A H    1 
ATOM   3241  H  HA   . ASP A 1 200 ? 49.792  53.787  8.225   1.00 122.84 ? 197  ASP A HA   1 
ATOM   3242  H  HB2  . ASP A 1 200 ? 47.860  54.728  9.028   1.00 136.72 ? 197  ASP A HB2  1 
ATOM   3243  H  HB3  . ASP A 1 200 ? 46.967  53.681  8.234   1.00 136.72 ? 197  ASP A HB3  1 
ATOM   3244  N  N    . VAL A 1 201 ? 48.341  51.616  6.437   1.00 111.93 ? 198  VAL A N    1 
ATOM   3245  C  CA   . VAL A 1 201 ? 48.250  50.210  6.056   1.00 91.84  ? 198  VAL A CA   1 
ATOM   3246  C  C    . VAL A 1 201 ? 49.337  49.803  5.076   1.00 71.03  ? 198  VAL A C    1 
ATOM   3247  O  O    . VAL A 1 201 ? 49.407  50.319  3.960   1.00 73.04  ? 198  VAL A O    1 
ATOM   3248  C  CB   . VAL A 1 201 ? 46.883  49.909  5.406   1.00 81.55  ? 198  VAL A CB   1 
ATOM   3249  C  CG1  . VAL A 1 201 ? 46.636  48.402  5.359   1.00 76.35  ? 198  VAL A CG1  1 
ATOM   3250  C  CG2  . VAL A 1 201 ? 45.763  50.618  6.167   1.00 92.58  ? 198  VAL A CG2  1 
ATOM   3251  H  H    . VAL A 1 201 ? 47.894  52.141  5.923   1.00 134.32 ? 198  VAL A H    1 
ATOM   3252  H  HA   . VAL A 1 201 ? 48.336  49.659  6.850   1.00 110.21 ? 198  VAL A HA   1 
ATOM   3253  H  HB   . VAL A 1 201 ? 46.885  50.242  4.495   1.00 97.86  ? 198  VAL A HB   1 
ATOM   3254  H  HG11 . VAL A 1 201 ? 46.644  48.053  6.264   1.00 91.62  ? 198  VAL A HG11 1 
ATOM   3255  H  HG12 . VAL A 1 201 ? 45.773  48.237  4.947   1.00 91.62  ? 198  VAL A HG12 1 
ATOM   3256  H  HG13 . VAL A 1 201 ? 47.338  47.984  4.836   1.00 91.62  ? 198  VAL A HG13 1 
ATOM   3257  H  HG21 . VAL A 1 201 ? 45.923  51.574  6.146   1.00 111.10 ? 198  VAL A HG21 1 
ATOM   3258  H  HG22 . VAL A 1 201 ? 44.915  50.415  5.741   1.00 111.10 ? 198  VAL A HG22 1 
ATOM   3259  H  HG23 . VAL A 1 201 ? 45.757  50.303  7.084   1.00 111.10 ? 198  VAL A HG23 1 
ATOM   3260  N  N    . LYS A 1 202 ? 50.190  48.877  5.501   1.00 65.68  ? 199  LYS A N    1 
ATOM   3261  C  CA   . LYS A 1 202 ? 51.275  48.426  4.645   1.00 76.74  ? 199  LYS A CA   1 
ATOM   3262  C  C    . LYS A 1 202 ? 50.812  47.341  3.672   1.00 58.98  ? 199  LYS A C    1 
ATOM   3263  O  O    . LYS A 1 202 ? 51.254  47.313  2.524   1.00 56.14  ? 199  LYS A O    1 
ATOM   3264  C  CB   . LYS A 1 202 ? 52.453  47.925  5.483   1.00 52.72  ? 199  LYS A CB   1 
ATOM   3265  C  CG   . LYS A 1 202 ? 53.332  49.048  5.983   1.00 65.73  ? 199  LYS A CG   1 
ATOM   3266  C  CD   . LYS A 1 202 ? 54.689  48.542  6.461   1.00 106.40 ? 199  LYS A CD   1 
ATOM   3267  C  CE   . LYS A 1 202 ? 54.614  47.876  7.828   1.00 93.38  ? 199  LYS A CE   1 
ATOM   3268  N  NZ   . LYS A 1 202 ? 55.950  47.363  8.250   1.00 76.95  ? 199  LYS A NZ   1 
ATOM   3269  H  H    . LYS A 1 202 ? 50.162  48.499  6.273   1.00 78.82  ? 199  LYS A H    1 
ATOM   3270  H  HA   . LYS A 1 202 ? 51.588  49.179  4.118   1.00 92.09  ? 199  LYS A HA   1 
ATOM   3271  H  HB2  . LYS A 1 202 ? 52.111  47.445  6.253   1.00 63.27  ? 199  LYS A HB2  1 
ATOM   3272  H  HB3  . LYS A 1 202 ? 52.999  47.335  4.939   1.00 63.27  ? 199  LYS A HB3  1 
ATOM   3273  H  HG2  . LYS A 1 202 ? 53.482  49.680  5.263   1.00 78.88  ? 199  LYS A HG2  1 
ATOM   3274  H  HG3  . LYS A 1 202 ? 52.894  49.487  6.728   1.00 78.88  ? 199  LYS A HG3  1 
ATOM   3275  H  HD2  . LYS A 1 202 ? 55.026  47.890  5.827   1.00 127.68 ? 199  LYS A HD2  1 
ATOM   3276  H  HD3  . LYS A 1 202 ? 55.302  49.291  6.525   1.00 127.68 ? 199  LYS A HD3  1 
ATOM   3277  H  HE2  . LYS A 1 202 ? 54.314  48.523  8.485   1.00 112.06 ? 199  LYS A HE2  1 
ATOM   3278  H  HE3  . LYS A 1 202 ? 53.998  47.127  7.787   1.00 112.06 ? 199  LYS A HE3  1 
ATOM   3279  H  HZ1  . LYS A 1 202 ? 56.532  48.034  8.296   1.00 92.34  ? 199  LYS A HZ1  1 
ATOM   3280  H  HZ2  . LYS A 1 202 ? 55.889  46.977  9.049   1.00 92.34  ? 199  LYS A HZ2  1 
ATOM   3281  H  HZ3  . LYS A 1 202 ? 56.245  46.764  7.661   1.00 92.34  ? 199  LYS A HZ3  1 
ATOM   3282  N  N    . LYS A 1 203 ? 49.942  46.446  4.135   1.00 49.24  ? 200  LYS A N    1 
ATOM   3283  C  CA   . LYS A 1 203 ? 49.399  45.401  3.273   1.00 58.90  ? 200  LYS A CA   1 
ATOM   3284  C  C    . LYS A 1 203 ? 48.029  45.794  2.732   1.00 55.97  ? 200  LYS A C    1 
ATOM   3285  O  O    . LYS A 1 203 ? 47.037  45.795  3.464   1.00 51.96  ? 200  LYS A O    1 
ATOM   3286  C  CB   . LYS A 1 203 ? 49.292  44.079  4.028   1.00 46.97  ? 200  LYS A CB   1 
ATOM   3287  C  CG   . LYS A 1 203 ? 49.320  42.856  3.138   1.00 45.87  ? 200  LYS A CG   1 
ATOM   3288  C  CD   . LYS A 1 203 ? 48.457  41.732  3.682   1.00 43.40  ? 200  LYS A CD   1 
ATOM   3289  C  CE   . LYS A 1 203 ? 48.894  40.388  3.099   1.00 41.81  ? 200  LYS A CE   1 
ATOM   3290  N  NZ   . LYS A 1 203 ? 49.168  40.445  1.632   1.00 40.50  ? 200  LYS A NZ   1 
ATOM   3291  H  H    . LYS A 1 203 ? 49.650  46.422  4.944   1.00 59.09  ? 200  LYS A H    1 
ATOM   3292  H  HA   . LYS A 1 203 ? 49.995  45.271  2.518   1.00 70.68  ? 200  LYS A HA   1 
ATOM   3293  H  HB2  . LYS A 1 203 ? 50.036  44.012  4.646   1.00 56.36  ? 200  LYS A HB2  1 
ATOM   3294  H  HB3  . LYS A 1 203 ? 48.456  44.068  4.520   1.00 56.36  ? 200  LYS A HB3  1 
ATOM   3295  H  HG2  . LYS A 1 203 ? 48.986  43.095  2.260   1.00 55.04  ? 200  LYS A HG2  1 
ATOM   3296  H  HG3  . LYS A 1 203 ? 50.232  42.532  3.072   1.00 55.04  ? 200  LYS A HG3  1 
ATOM   3297  H  HD2  . LYS A 1 203 ? 48.548  41.692  4.647   1.00 52.08  ? 200  LYS A HD2  1 
ATOM   3298  H  HD3  . LYS A 1 203 ? 47.531  41.887  3.436   1.00 52.08  ? 200  LYS A HD3  1 
ATOM   3299  H  HE2  . LYS A 1 203 ? 49.707  40.102  3.544   1.00 50.18  ? 200  LYS A HE2  1 
ATOM   3300  H  HE3  . LYS A 1 203 ? 48.190  39.738  3.247   1.00 50.18  ? 200  LYS A HE3  1 
ATOM   3301  H  HZ1  . LYS A 1 203 ? 49.819  41.029  1.467   1.00 48.60  ? 200  LYS A HZ1  1 
ATOM   3302  H  HZ2  . LYS A 1 203 ? 49.418  39.643  1.339   1.00 48.60  ? 200  LYS A HZ2  1 
ATOM   3303  H  HZ3  . LYS A 1 203 ? 48.435  40.697  1.195   1.00 48.60  ? 200  LYS A HZ3  1 
ATOM   3304  N  N    . LYS A 1 204 ? 47.973  46.081  1.439   1.00 52.98  ? 201  LYS A N    1 
ATOM   3305  C  CA   . LYS A 1 204 ? 46.772  46.626  0.828   1.00 53.56  ? 201  LYS A CA   1 
ATOM   3306  C  C    . LYS A 1 204 ? 45.950  45.577  0.070   1.00 53.18  ? 201  LYS A C    1 
ATOM   3307  O  O    . LYS A 1 204 ? 44.861  45.889  -0.424  1.00 45.25  ? 201  LYS A O    1 
ATOM   3308  C  CB   . LYS A 1 204 ? 47.162  47.772  -0.103  1.00 56.99  ? 201  LYS A CB   1 
ATOM   3309  C  CG   . LYS A 1 204 ? 47.853  48.939  0.608   1.00 56.85  ? 201  LYS A CG   1 
ATOM   3310  C  CD   . LYS A 1 204 ? 48.478  49.889  -0.400  1.00 65.42  ? 201  LYS A CD   1 
ATOM   3311  C  CE   . LYS A 1 204 ? 48.761  51.259  0.191   1.00 69.78  ? 201  LYS A CE   1 
ATOM   3312  N  NZ   . LYS A 1 204 ? 49.864  51.230  1.183   1.00 94.76  ? 201  LYS A NZ   1 
ATOM   3313  H  H    . LYS A 1 204 ? 48.624  45.969  0.889   1.00 63.58  ? 201  LYS A H    1 
ATOM   3314  H  HA   . LYS A 1 204 ? 46.208  46.992  1.527   1.00 64.27  ? 201  LYS A HA   1 
ATOM   3315  H  HB2  . LYS A 1 204 ? 47.772  47.433  -0.777  1.00 68.38  ? 201  LYS A HB2  1 
ATOM   3316  H  HB3  . LYS A 1 204 ? 46.361  48.117  -0.527  1.00 68.38  ? 201  LYS A HB3  1 
ATOM   3317  H  HG2  . LYS A 1 204 ? 47.200  49.431  1.130   1.00 68.22  ? 201  LYS A HG2  1 
ATOM   3318  H  HG3  . LYS A 1 204 ? 48.556  48.596  1.182   1.00 68.22  ? 201  LYS A HG3  1 
ATOM   3319  H  HD2  . LYS A 1 204 ? 49.318  49.515  -0.709  1.00 78.51  ? 201  LYS A HD2  1 
ATOM   3320  H  HD3  . LYS A 1 204 ? 47.869  50.003  -1.147  1.00 78.51  ? 201  LYS A HD3  1 
ATOM   3321  H  HE2  . LYS A 1 204 ? 49.013  51.866  -0.522  1.00 83.74  ? 201  LYS A HE2  1 
ATOM   3322  H  HE3  . LYS A 1 204 ? 47.963  51.583  0.637   1.00 83.74  ? 201  LYS A HE3  1 
ATOM   3323  H  HZ1  . LYS A 1 204 ? 50.612  50.941  0.797   1.00 113.71 ? 201  LYS A HZ1  1 
ATOM   3324  H  HZ2  . LYS A 1 204 ? 50.002  52.047  1.507   1.00 113.71 ? 201  LYS A HZ2  1 
ATOM   3325  H  HZ3  . LYS A 1 204 ? 49.655  50.683  1.853   1.00 113.71 ? 201  LYS A HZ3  1 
ATOM   3326  N  N    . VAL A 1 205 ? 46.446  44.341  -0.022  1.00 48.89  ? 202  VAL A N    1 
ATOM   3327  C  CA   . VAL A 1 205 ? 45.687  43.300  -0.724  1.00 46.61  ? 202  VAL A CA   1 
ATOM   3328  C  C    . VAL A 1 205 ? 45.514  41.998  0.059   1.00 49.20  ? 202  VAL A C    1 
ATOM   3329  O  O    . VAL A 1 205 ? 46.484  41.317  0.388   1.00 47.56  ? 202  VAL A O    1 
ATOM   3330  C  CB   . VAL A 1 205 ? 46.349  42.974  -2.055  1.00 41.49  ? 202  VAL A CB   1 
ATOM   3331  C  CG1  . VAL A 1 205 ? 45.524  41.948  -2.815  1.00 44.69  ? 202  VAL A CG1  1 
ATOM   3332  C  CG2  . VAL A 1 205 ? 46.496  44.244  -2.889  1.00 44.90  ? 202  VAL A CG2  1 
ATOM   3333  H  H    . VAL A 1 205 ? 47.199  44.083  0.303   1.00 58.67  ? 202  VAL A H    1 
ATOM   3334  H  HA   . VAL A 1 205 ? 44.800  43.644  -0.915  1.00 55.93  ? 202  VAL A HA   1 
ATOM   3335  H  HB   . VAL A 1 205 ? 47.231  42.604  -1.898  1.00 49.79  ? 202  VAL A HB   1 
ATOM   3336  H  HG11 . VAL A 1 205 ? 44.639  42.312  -2.976  1.00 53.63  ? 202  VAL A HG11 1 
ATOM   3337  H  HG12 . VAL A 1 205 ? 45.961  41.754  -3.659  1.00 53.63  ? 202  VAL A HG12 1 
ATOM   3338  H  HG13 . VAL A 1 205 ? 45.457  41.140  -2.283  1.00 53.63  ? 202  VAL A HG13 1 
ATOM   3339  H  HG21 . VAL A 1 205 ? 47.044  44.879  -2.403  1.00 53.88  ? 202  VAL A HG21 1 
ATOM   3340  H  HG22 . VAL A 1 205 ? 46.918  44.020  -3.733  1.00 53.88  ? 202  VAL A HG22 1 
ATOM   3341  H  HG23 . VAL A 1 205 ? 45.616  44.620  -3.049  1.00 53.88  ? 202  VAL A HG23 1 
ATOM   3342  N  N    . HIS A 1 206 ? 44.257  41.622  0.266   1.00 51.36  ? 203  HIS A N    1 
ATOM   3343  C  CA   . HIS A 1 206 ? 43.909  40.361  0.900   1.00 45.12  ? 203  HIS A CA   1 
ATOM   3344  C  C    . HIS A 1 206 ? 42.965  39.559  0.017   1.00 59.06  ? 203  HIS A C    1 
ATOM   3345  O  O    . HIS A 1 206 ? 41.891  40.047  -0.352  1.00 58.76  ? 203  HIS A O    1 
ATOM   3346  C  CB   . HIS A 1 206 ? 43.233  40.611  2.240   1.00 50.70  ? 203  HIS A CB   1 
ATOM   3347  C  CG   . HIS A 1 206 ? 44.095  41.318  3.238   1.00 60.84  ? 203  HIS A CG   1 
ATOM   3348  N  ND1  . HIS A 1 206 ? 44.344  42.674  3.180   1.00 62.27  ? 203  HIS A ND1  1 
ATOM   3349  C  CD2  . HIS A 1 206 ? 44.755  40.860  4.327   1.00 52.70  ? 203  HIS A CD2  1 
ATOM   3350  C  CE1  . HIS A 1 206 ? 45.116  43.020  4.195   1.00 60.16  ? 203  HIS A CE1  1 
ATOM   3351  N  NE2  . HIS A 1 206 ? 45.383  41.937  4.903   1.00 64.23  ? 203  HIS A NE2  1 
ATOM   3352  H  H    . HIS A 1 206 ? 43.573  42.093  0.040   1.00 61.63  ? 203  HIS A H    1 
ATOM   3353  H  HA   . HIS A 1 206 ? 44.712  39.839  1.051   1.00 54.14  ? 203  HIS A HA   1 
ATOM   3354  H  HB2  . HIS A 1 206 ? 42.443  41.155  2.094   1.00 60.83  ? 203  HIS A HB2  1 
ATOM   3355  H  HB3  . HIS A 1 206 ? 42.976  39.758  2.624   1.00 60.83  ? 203  HIS A HB3  1 
ATOM   3356  H  HD1  . HIS A 1 206 ? 44.037  43.212  2.583   1.00 74.72  ? 203  HIS A HD1  1 
ATOM   3357  H  HD2  . HIS A 1 206 ? 44.776  39.981  4.630   1.00 63.24  ? 203  HIS A HD2  1 
ATOM   3358  H  HE1  . HIS A 1 206 ? 45.429  43.878  4.373   1.00 72.20  ? 203  HIS A HE1  1 
ATOM   3359  H  HE2  . HIS A 1 206 ? 45.873  41.910  5.610   1.00 77.08  ? 203  HIS A HE2  1 
ATOM   3360  N  N    . LEU A 1 207 ? 43.360  38.326  -0.304  1.00 51.88  ? 204  LEU A N    1 
ATOM   3361  C  CA   . LEU A 1 207 ? 42.544  37.456  -1.150  1.00 52.76  ? 204  LEU A CA   1 
ATOM   3362  C  C    . LEU A 1 207 ? 41.892  36.334  -0.349  1.00 45.64  ? 204  LEU A C    1 
ATOM   3363  O  O    . LEU A 1 207 ? 42.496  35.770  0.556   1.00 61.00  ? 204  LEU A O    1 
ATOM   3364  C  CB   . LEU A 1 207 ? 43.390  36.859  -2.281  1.00 48.90  ? 204  LEU A CB   1 
ATOM   3365  C  CG   . LEU A 1 207 ? 43.962  37.851  -3.297  1.00 53.17  ? 204  LEU A CG   1 
ATOM   3366  C  CD1  . LEU A 1 207 ? 44.905  37.155  -4.269  1.00 44.30  ? 204  LEU A CD1  1 
ATOM   3367  C  CD2  . LEU A 1 207 ? 42.848  38.541  -4.066  1.00 49.67  ? 204  LEU A CD2  1 
ATOM   3368  H  H    . LEU A 1 207 ? 44.099  37.970  -0.044  1.00 62.25  ? 204  LEU A H    1 
ATOM   3369  H  HA   . LEU A 1 207 ? 41.837  37.984  -1.553  1.00 63.31  ? 204  LEU A HA   1 
ATOM   3370  H  HB2  . LEU A 1 207 ? 44.140  36.390  -1.883  1.00 58.68  ? 204  LEU A HB2  1 
ATOM   3371  H  HB3  . LEU A 1 207 ? 42.840  36.229  -2.772  1.00 58.68  ? 204  LEU A HB3  1 
ATOM   3372  H  HG   . LEU A 1 207 ? 44.466  38.531  -2.824  1.00 63.80  ? 204  LEU A HG   1 
ATOM   3373  H  HD11 . LEU A 1 207 ? 44.417  36.465  -4.744  1.00 53.16  ? 204  LEU A HD11 1 
ATOM   3374  H  HD12 . LEU A 1 207 ? 45.249  37.809  -4.897  1.00 53.16  ? 204  LEU A HD12 1 
ATOM   3375  H  HD13 . LEU A 1 207 ? 45.637  36.759  -3.770  1.00 53.16  ? 204  LEU A HD13 1 
ATOM   3376  H  HD21 . LEU A 1 207 ? 42.282  39.021  -3.441  1.00 59.60  ? 204  LEU A HD21 1 
ATOM   3377  H  HD22 . LEU A 1 207 ? 43.240  39.161  -4.701  1.00 59.60  ? 204  LEU A HD22 1 
ATOM   3378  H  HD23 . LEU A 1 207 ? 42.327  37.871  -4.537  1.00 59.60  ? 204  LEU A HD23 1 
ATOM   3379  N  N    . SER A 1 208 ? 40.653  36.011  -0.712  1.00 61.19  ? 205  SER A N    1 
ATOM   3380  C  CA   . SER A 1 208 ? 39.915  34.922  -0.083  1.00 61.81  ? 205  SER A CA   1 
ATOM   3381  C  C    . SER A 1 208 ? 40.396  33.577  -0.619  1.00 65.83  ? 205  SER A C    1 
ATOM   3382  O  O    . SER A 1 208 ? 41.185  33.523  -1.564  1.00 66.46  ? 205  SER A O    1 
ATOM   3383  C  CB   . SER A 1 208 ? 38.420  35.079  -0.346  1.00 75.61  ? 205  SER A CB   1 
ATOM   3384  O  OG   . SER A 1 208 ? 37.985  36.396  -0.055  1.00 93.06  ? 205  SER A OG   1 
ATOM   3385  H  H    . SER A 1 208 ? 40.213  36.415  -1.330  1.00 73.42  ? 205  SER A H    1 
ATOM   3386  H  HA   . SER A 1 208 ? 40.063  34.943  0.876   1.00 74.17  ? 205  SER A HA   1 
ATOM   3387  H  HB2  . SER A 1 208 ? 38.243  34.888  -1.281  1.00 90.73  ? 205  SER A HB2  1 
ATOM   3388  H  HB3  . SER A 1 208 ? 37.934  34.455  0.217   1.00 90.73  ? 205  SER A HB3  1 
ATOM   3389  H  HG   . SER A 1 208 ? 37.162  36.467  -0.204  1.00 111.67 ? 205  SER A HG   1 
ATOM   3390  N  N    . GLU A 1 209 ? 39.910  32.492  -0.026  1.00 65.56  ? 206  GLU A N    1 
ATOM   3391  C  CA   . GLU A 1 209 ? 40.281  31.152  -0.473  1.00 64.07  ? 206  GLU A CA   1 
ATOM   3392  C  C    . GLU A 1 209 ? 39.820  30.903  -1.889  1.00 70.88  ? 206  GLU A C    1 
ATOM   3393  O  O    . GLU A 1 209 ? 40.482  30.201  -2.652  1.00 77.30  ? 206  GLU A O    1 
ATOM   3394  C  CB   . GLU A 1 209 ? 39.682  30.093  0.450   1.00 86.87  ? 206  GLU A CB   1 
ATOM   3395  C  CG   . GLU A 1 209 ? 39.948  30.344  1.927   1.00 110.02 ? 206  GLU A CG   1 
ATOM   3396  C  CD   . GLU A 1 209 ? 39.571  29.165  2.789   1.00 118.23 ? 206  GLU A CD   1 
ATOM   3397  O  OE1  . GLU A 1 209 ? 38.454  28.629  2.599   1.00 102.52 ? 206  GLU A OE1  1 
ATOM   3398  O  OE2  . GLU A 1 209 ? 40.386  28.784  3.660   1.00 123.72 ? 206  GLU A OE2  1 
ATOM   3399  H  H    . GLU A 1 209 ? 39.363  32.503  0.637   1.00 78.68  ? 206  GLU A H    1 
ATOM   3400  H  HA   . GLU A 1 209 ? 41.247  31.064  -0.449  1.00 76.88  ? 206  GLU A HA   1 
ATOM   3401  H  HB2  . GLU A 1 209 ? 38.720  30.075  0.321   1.00 104.25 ? 206  GLU A HB2  1 
ATOM   3402  H  HB3  . GLU A 1 209 ? 40.061  29.230  0.223   1.00 104.25 ? 206  GLU A HB3  1 
ATOM   3403  H  HG2  . GLU A 1 209 ? 40.893  30.519  2.054   1.00 132.02 ? 206  GLU A HG2  1 
ATOM   3404  H  HG3  . GLU A 1 209 ? 39.426  31.108  2.218   1.00 132.02 ? 206  GLU A HG3  1 
ATOM   3405  N  N    . LYS A 1 210 ? 38.699  31.528  -2.245  1.00 79.11  ? 207  LYS A N    1 
ATOM   3406  C  CA   . LYS A 1 210 ? 38.121  31.389  -3.576  1.00 67.35  ? 207  LYS A CA   1 
ATOM   3407  C  C    . LYS A 1 210 ? 38.361  32.662  -4.377  1.00 60.07  ? 207  LYS A C    1 
ATOM   3408  O  O    . LYS A 1 210 ? 38.025  33.754  -3.931  1.00 72.29  ? 207  LYS A O    1 
ATOM   3409  C  CB   . LYS A 1 210 ? 36.630  31.075  -3.472  1.00 68.42  ? 207  LYS A CB   1 
ATOM   3410  C  CG   . LYS A 1 210 ? 36.138  30.120  -4.528  1.00 67.77  ? 207  LYS A CG   1 
ATOM   3411  C  CD   . LYS A 1 210 ? 34.981  29.267  -4.029  1.00 73.30  ? 207  LYS A CD   1 
ATOM   3412  C  CE   . LYS A 1 210 ? 33.810  30.113  -3.538  1.00 84.32  ? 207  LYS A CE   1 
ATOM   3413  N  NZ   . LYS A 1 210 ? 32.598  29.275  -3.280  1.00 91.02  ? 207  LYS A NZ   1 
ATOM   3414  H  H    . LYS A 1 210 ? 38.250  32.045  -1.725  1.00 94.94  ? 207  LYS A H    1 
ATOM   3415  H  HA   . LYS A 1 210 ? 38.555  30.654  -4.038  1.00 80.82  ? 207  LYS A HA   1 
ATOM   3416  H  HB2  . LYS A 1 210 ? 36.454  30.675  -2.605  1.00 82.11  ? 207  LYS A HB2  1 
ATOM   3417  H  HB3  . LYS A 1 210 ? 36.129  31.900  -3.561  1.00 82.11  ? 207  LYS A HB3  1 
ATOM   3418  H  HG2  . LYS A 1 210 ? 35.831  30.626  -5.297  1.00 81.32  ? 207  LYS A HG2  1 
ATOM   3419  H  HG3  . LYS A 1 210 ? 36.862  29.528  -4.785  1.00 81.32  ? 207  LYS A HG3  1 
ATOM   3420  H  HD2  . LYS A 1 210 ? 34.665  28.705  -4.753  1.00 87.96  ? 207  LYS A HD2  1 
ATOM   3421  H  HD3  . LYS A 1 210 ? 35.287  28.718  -3.290  1.00 87.96  ? 207  LYS A HD3  1 
ATOM   3422  H  HE2  . LYS A 1 210 ? 34.057  30.552  -2.710  1.00 101.19 ? 207  LYS A HE2  1 
ATOM   3423  H  HE3  . LYS A 1 210 ? 33.586  30.772  -4.214  1.00 101.19 ? 207  LYS A HE3  1 
ATOM   3424  H  HZ1  . LYS A 1 210 ? 32.777  28.664  -2.659  1.00 109.22 ? 207  LYS A HZ1  1 
ATOM   3425  H  HZ2  . LYS A 1 210 ? 31.929  29.789  -2.996  1.00 109.22 ? 207  LYS A HZ2  1 
ATOM   3426  H  HZ3  . LYS A 1 210 ? 32.348  28.863  -4.029  1.00 109.22 ? 207  LYS A HZ3  1 
ATOM   3427  N  N    . ILE A 1 211 ? 38.918  32.511  -5.572  1.00 55.33  ? 208  ILE A N    1 
ATOM   3428  C  CA   . ILE A 1 211 ? 39.306  33.650  -6.399  1.00 50.93  ? 208  ILE A CA   1 
ATOM   3429  C  C    . ILE A 1 211 ? 38.288  33.971  -7.481  1.00 55.18  ? 208  ILE A C    1 
ATOM   3430  O  O    . ILE A 1 211 ? 38.098  33.200  -8.412  1.00 63.31  ? 208  ILE A O    1 
ATOM   3431  C  CB   . ILE A 1 211 ? 40.665  33.395  -7.081  1.00 50.48  ? 208  ILE A CB   1 
ATOM   3432  C  CG1  . ILE A 1 211 ? 41.752  33.155  -6.033  1.00 55.10  ? 208  ILE A CG1  1 
ATOM   3433  C  CG2  . ILE A 1 211 ? 41.057  34.554  -8.006  1.00 47.94  ? 208  ILE A CG2  1 
ATOM   3434  C  CD1  . ILE A 1 211 ? 42.048  34.351  -5.171  1.00 61.68  ? 208  ILE A CD1  1 
ATOM   3435  H  H    . ILE A 1 211 ? 39.086  31.748  -5.932  1.00 66.39  ? 208  ILE A H    1 
ATOM   3436  H  HA   . ILE A 1 211 ? 39.397  34.433  -5.833  1.00 61.12  ? 208  ILE A HA   1 
ATOM   3437  H  HB   . ILE A 1 211 ? 40.585  32.593  -7.621  1.00 60.57  ? 208  ILE A HB   1 
ATOM   3438  H  HG12 . ILE A 1 211 ? 41.469  32.434  -5.450  1.00 66.12  ? 208  ILE A HG12 1 
ATOM   3439  H  HG13 . ILE A 1 211 ? 42.573  32.908  -6.486  1.00 66.12  ? 208  ILE A HG13 1 
ATOM   3440  H  HG21 . ILE A 1 211 ? 41.119  35.368  -7.483  1.00 57.53  ? 208  ILE A HG21 1 
ATOM   3441  H  HG22 . ILE A 1 211 ? 41.914  34.355  -8.414  1.00 57.53  ? 208  ILE A HG22 1 
ATOM   3442  H  HG23 . ILE A 1 211 ? 40.378  34.652  -8.693  1.00 57.53  ? 208  ILE A HG23 1 
ATOM   3443  H  HD11 . ILE A 1 211 ? 41.240  34.606  -4.698  1.00 74.01  ? 208  ILE A HD11 1 
ATOM   3444  H  HD12 . ILE A 1 211 ? 42.744  34.118  -4.536  1.00 74.01  ? 208  ILE A HD12 1 
ATOM   3445  H  HD13 . ILE A 1 211 ? 42.346  35.081  -5.736  1.00 74.01  ? 208  ILE A HD13 1 
ATOM   3446  N  N    . HIS A 1 212 ? 37.675  35.142  -7.369  1.00 50.45  ? 209  HIS A N    1 
ATOM   3447  C  CA   . HIS A 1 212 ? 36.720  35.614  -8.361  1.00 50.43  ? 209  HIS A CA   1 
ATOM   3448  C  C    . HIS A 1 212 ? 37.391  35.799  -9.735  1.00 54.45  ? 209  HIS A C    1 
ATOM   3449  O  O    . HIS A 1 212 ? 38.512  36.311  -9.814  1.00 54.93  ? 209  HIS A O    1 
ATOM   3450  C  CB   . HIS A 1 212 ? 36.096  36.935  -7.887  1.00 51.72  ? 209  HIS A CB   1 
ATOM   3451  C  CG   . HIS A 1 212 ? 34.907  37.362  -8.687  1.00 53.78  ? 209  HIS A CG   1 
ATOM   3452  N  ND1  . HIS A 1 212 ? 35.017  37.880  -9.959  1.00 51.15  ? 209  HIS A ND1  1 
ATOM   3453  C  CD2  . HIS A 1 212 ? 33.584  37.341  -8.401  1.00 50.40  ? 209  HIS A CD2  1 
ATOM   3454  C  CE1  . HIS A 1 212 ? 33.813  38.172  -10.419 1.00 49.42  ? 209  HIS A CE1  1 
ATOM   3455  N  NE2  . HIS A 1 212 ? 32.926  37.850  -9.494  1.00 49.10  ? 209  HIS A NE2  1 
ATOM   3456  H  H    . HIS A 1 212 ? 37.797  35.690  -6.717  1.00 60.54  ? 209  HIS A H    1 
ATOM   3457  H  HA   . HIS A 1 212 ? 36.010  34.961  -8.456  1.00 60.51  ? 209  HIS A HA   1 
ATOM   3458  H  HB2  . HIS A 1 212 ? 35.813  36.833  -6.965  1.00 62.07  ? 209  HIS A HB2  1 
ATOM   3459  H  HB3  . HIS A 1 212 ? 36.764  37.636  -7.951  1.00 62.07  ? 209  HIS A HB3  1 
ATOM   3460  H  HD1  . HIS A 1 212 ? 35.755  38.004  -10.384 1.00 61.38  ? 209  HIS A HD1  1 
ATOM   3461  H  HD2  . HIS A 1 212 ? 33.194  37.042  -7.611  1.00 60.48  ? 209  HIS A HD2  1 
ATOM   3462  H  HE1  . HIS A 1 212 ? 33.622  38.533  -11.254 1.00 59.31  ? 209  HIS A HE1  1 
ATOM   3463  H  HE2  . HIS A 1 212 ? 32.074  37.945  -9.564  1.00 58.92  ? 209  HIS A HE2  1 
ATOM   3464  N  N    . PRO A 1 213 ? 36.715  35.373  -10.820 1.00 53.29  ? 210  PRO A N    1 
ATOM   3465  C  CA   . PRO A 1 213 ? 37.239  35.430  -12.197 1.00 54.23  ? 210  PRO A CA   1 
ATOM   3466  C  C    . PRO A 1 213 ? 37.909  36.740  -12.577 1.00 55.55  ? 210  PRO A C    1 
ATOM   3467  O  O    . PRO A 1 213 ? 38.893  36.711  -13.312 1.00 54.91  ? 210  PRO A O    1 
ATOM   3468  C  CB   . PRO A 1 213 ? 35.995  35.216  -13.050 1.00 53.59  ? 210  PRO A CB   1 
ATOM   3469  C  CG   . PRO A 1 213 ? 35.153  34.305  -12.217 1.00 58.83  ? 210  PRO A CG   1 
ATOM   3470  C  CD   . PRO A 1 213 ? 35.396  34.716  -10.778 1.00 58.96  ? 210  PRO A CD   1 
ATOM   3471  H  HA   . PRO A 1 213 ? 37.859  34.699  -12.349 1.00 65.08  ? 210  PRO A HA   1 
ATOM   3472  H  HB2  . PRO A 1 213 ? 35.547  36.063  -13.201 1.00 64.30  ? 210  PRO A HB2  1 
ATOM   3473  H  HB3  . PRO A 1 213 ? 36.237  34.795  -13.889 1.00 64.30  ? 210  PRO A HB3  1 
ATOM   3474  H  HG2  . PRO A 1 213 ? 34.219  34.422  -12.451 1.00 70.59  ? 210  PRO A HG2  1 
ATOM   3475  H  HG3  . PRO A 1 213 ? 35.428  33.386  -12.360 1.00 70.59  ? 210  PRO A HG3  1 
ATOM   3476  H  HD2  . PRO A 1 213 ? 34.717  35.344  -10.487 1.00 70.75  ? 210  PRO A HD2  1 
ATOM   3477  H  HD3  . PRO A 1 213 ? 35.427  33.935  -10.204 1.00 70.75  ? 210  PRO A HD3  1 
ATOM   3478  N  N    . PHE A 1 214 ? 37.357  37.864  -12.132 1.00 45.84  ? 211  PHE A N    1 
ATOM   3479  C  CA   . PHE A 1 214 ? 37.943  39.168  -12.428 1.00 41.17  ? 211  PHE A CA   1 
ATOM   3480  C  C    . PHE A 1 214 ? 39.378  39.224  -11.920 1.00 46.36  ? 211  PHE A C    1 
ATOM   3481  O  O    . PHE A 1 214 ? 40.296  39.699  -12.622 1.00 46.97  ? 211  PHE A O    1 
ATOM   3482  C  CB   . PHE A 1 214 ? 37.097  40.271  -11.779 1.00 46.48  ? 211  PHE A CB   1 
ATOM   3483  C  CG   . PHE A 1 214 ? 37.794  41.603  -11.695 1.00 46.97  ? 211  PHE A CG   1 
ATOM   3484  C  CD1  . PHE A 1 214 ? 37.853  42.440  -12.787 1.00 45.80  ? 211  PHE A CD1  1 
ATOM   3485  C  CD2  . PHE A 1 214 ? 38.388  42.012  -10.515 1.00 47.96  ? 211  PHE A CD2  1 
ATOM   3486  C  CE1  . PHE A 1 214 ? 38.495  43.653  -12.712 1.00 42.38  ? 211  PHE A CE1  1 
ATOM   3487  C  CE2  . PHE A 1 214 ? 39.032  43.229  -10.431 1.00 48.66  ? 211  PHE A CE2  1 
ATOM   3488  C  CZ   . PHE A 1 214 ? 39.089  44.049  -11.533 1.00 50.30  ? 211  PHE A CZ   1 
ATOM   3489  H  H    . PHE A 1 214 ? 36.642  37.899  -11.656 1.00 55.01  ? 211  PHE A H    1 
ATOM   3490  H  HA   . PHE A 1 214 ? 37.950  39.310  -13.388 1.00 49.40  ? 211  PHE A HA   1 
ATOM   3491  H  HB2  . PHE A 1 214 ? 36.289  40.393  -12.301 1.00 55.78  ? 211  PHE A HB2  1 
ATOM   3492  H  HB3  . PHE A 1 214 ? 36.868  39.999  -10.877 1.00 55.78  ? 211  PHE A HB3  1 
ATOM   3493  H  HD1  . PHE A 1 214 ? 37.460  42.177  -13.587 1.00 54.96  ? 211  PHE A HD1  1 
ATOM   3494  H  HD2  . PHE A 1 214 ? 38.356  41.458  -9.769  1.00 57.55  ? 211  PHE A HD2  1 
ATOM   3495  H  HE1  . PHE A 1 214 ? 38.529  44.207  -13.458 1.00 50.86  ? 211  PHE A HE1  1 
ATOM   3496  H  HE2  . PHE A 1 214 ? 39.430  43.492  -9.633  1.00 58.39  ? 211  PHE A HE2  1 
ATOM   3497  H  HZ   . PHE A 1 214 ? 39.519  44.873  -11.480 1.00 60.36  ? 211  PHE A HZ   1 
ATOM   3498  N  N    . ILE A 1 215 ? 39.574  38.662  -10.727 1.00 43.96  ? 212  ILE A N    1 
ATOM   3499  C  CA   . ILE A 1 215 ? 40.884  38.675  -10.104 1.00 51.22  ? 212  ILE A CA   1 
ATOM   3500  C  C    . ILE A 1 215 ? 41.812  37.750  -10.850 1.00 47.22  ? 212  ILE A C    1 
ATOM   3501  O  O    . ILE A 1 215 ? 42.908  38.157  -11.220 1.00 48.34  ? 212  ILE A O    1 
ATOM   3502  C  CB   . ILE A 1 215 ? 40.814  38.252  -8.634  1.00 54.71  ? 212  ILE A CB   1 
ATOM   3503  C  CG1  . ILE A 1 215 ? 39.815  39.148  -7.907  1.00 50.02  ? 212  ILE A CG1  1 
ATOM   3504  C  CG2  . ILE A 1 215 ? 42.208  38.337  -7.991  1.00 43.81  ? 212  ILE A CG2  1 
ATOM   3505  C  CD1  . ILE A 1 215 ? 39.709  38.892  -6.420  1.00 49.91  ? 212  ILE A CD1  1 
ATOM   3506  H  H    . ILE A 1 215 ? 38.965  38.270  -10.264 1.00 52.75  ? 212  ILE A H    1 
ATOM   3507  H  HA   . ILE A 1 215 ? 41.249  39.573  -10.145 1.00 61.46  ? 212  ILE A HA   1 
ATOM   3508  H  HB   . ILE A 1 215 ? 40.504  37.335  -8.588  1.00 65.65  ? 212  ILE A HB   1 
ATOM   3509  H  HG12 . ILE A 1 215 ? 40.082  40.073  -8.028  1.00 60.02  ? 212  ILE A HG12 1 
ATOM   3510  H  HG13 . ILE A 1 215 ? 38.936  39.009  -8.293  1.00 60.02  ? 212  ILE A HG13 1 
ATOM   3511  H  HG21 . ILE A 1 215 ? 42.527  39.251  -8.048  1.00 52.58  ? 212  ILE A HG21 1 
ATOM   3512  H  HG22 . ILE A 1 215 ? 42.144  38.066  -7.062  1.00 52.58  ? 212  ILE A HG22 1 
ATOM   3513  H  HG23 . ILE A 1 215 ? 42.812  37.746  -8.468  1.00 52.58  ? 212  ILE A HG23 1 
ATOM   3514  H  HD11 . ILE A 1 215 ? 40.576  39.041  -6.012  1.00 59.89  ? 212  ILE A HD11 1 
ATOM   3515  H  HD12 . ILE A 1 215 ? 39.056  39.501  -6.041  1.00 59.89  ? 212  ILE A HD12 1 
ATOM   3516  H  HD13 . ILE A 1 215 ? 39.428  37.975  -6.277  1.00 59.89  ? 212  ILE A HD13 1 
ATOM   3517  N  N    . ARG A 1 216 ? 41.324  36.550  -11.156 1.00 43.29  ? 213  ARG A N    1 
ATOM   3518  C  CA   . ARG A 1 216 ? 42.095  35.568  -11.926 1.00 46.27  ? 213  ARG A CA   1 
ATOM   3519  C  C    . ARG A 1 216 ? 42.565  36.157  -13.254 1.00 49.56  ? 213  ARG A C    1 
ATOM   3520  O  O    . ARG A 1 216 ? 43.758  36.125  -13.594 1.00 54.55  ? 213  ARG A O    1 
ATOM   3521  C  CB   . ARG A 1 216 ? 41.244  34.328  -12.197 1.00 46.61  ? 213  ARG A CB   1 
ATOM   3522  C  CG   . ARG A 1 216 ? 41.999  33.156  -12.794 1.00 53.14  ? 213  ARG A CG   1 
ATOM   3523  C  CD   . ARG A 1 216 ? 41.036  32.015  -13.162 1.00 66.63  ? 213  ARG A CD   1 
ATOM   3524  N  NE   . ARG A 1 216 ? 40.261  32.322  -14.374 1.00 77.34  ? 213  ARG A NE   1 
ATOM   3525  C  CZ   . ARG A 1 216 ? 38.930  32.314  -14.472 1.00 69.89  ? 213  ARG A CZ   1 
ATOM   3526  N  NH1  . ARG A 1 216 ? 38.160  32.013  -13.431 1.00 72.86  ? 213  ARG A NH1  1 
ATOM   3527  N  NH2  . ARG A 1 216 ? 38.359  32.619  -15.629 1.00 66.63  ? 213  ARG A NH2  1 
ATOM   3528  H  H    . ARG A 1 216 ? 40.542  36.275  -10.928 1.00 51.95  ? 213  ARG A H    1 
ATOM   3529  H  HA   . ARG A 1 216 ? 42.876  35.299  -11.417 1.00 55.52  ? 213  ARG A HA   1 
ATOM   3530  H  HB2  . ARG A 1 216 ? 40.857  34.030  -11.359 1.00 55.93  ? 213  ARG A HB2  1 
ATOM   3531  H  HB3  . ARG A 1 216 ? 40.537  34.567  -12.816 1.00 55.93  ? 213  ARG A HB3  1 
ATOM   3532  H  HG2  . ARG A 1 216 ? 42.454  33.444  -13.601 1.00 63.76  ? 213  ARG A HG2  1 
ATOM   3533  H  HG3  . ARG A 1 216 ? 42.638  32.821  -12.147 1.00 63.76  ? 213  ARG A HG3  1 
ATOM   3534  H  HD2  . ARG A 1 216 ? 41.547  31.207  -13.326 1.00 79.96  ? 213  ARG A HD2  1 
ATOM   3535  H  HD3  . ARG A 1 216 ? 40.414  31.875  -12.431 1.00 79.96  ? 213  ARG A HD3  1 
ATOM   3536  H  HE   . ARG A 1 216 ? 40.705  32.526  -15.082 1.00 92.81  ? 213  ARG A HE   1 
ATOM   3537  H  HH11 . ARG A 1 216 ? 38.518  31.816  -12.674 1.00 87.43  ? 213  ARG A HH11 1 
ATOM   3538  H  HH12 . ARG A 1 216 ? 37.304  32.014  -13.514 1.00 87.43  ? 213  ARG A HH12 1 
ATOM   3539  H  HH21 . ARG A 1 216 ? 38.846  32.815  -16.310 1.00 79.96  ? 213  ARG A HH21 1 
ATOM   3540  H  HH22 . ARG A 1 216 ? 37.502  32.614  -15.700 1.00 79.96  ? 213  ARG A HH22 1 
ATOM   3541  N  N    . LYS A 1 217 ? 41.613  36.678  -14.018 1.00 41.26  ? 214  LYS A N    1 
ATOM   3542  C  CA   . LYS A 1 217 ? 41.914  37.242  -15.319 1.00 49.44  ? 214  LYS A CA   1 
ATOM   3543  C  C    . LYS A 1 217 ? 42.806  38.483  -15.189 1.00 49.34  ? 214  LYS A C    1 
ATOM   3544  O  O    . LYS A 1 217 ? 43.659  38.710  -16.044 1.00 51.77  ? 214  LYS A O    1 
ATOM   3545  C  CB   . LYS A 1 217 ? 40.610  37.593  -16.027 1.00 51.64  ? 214  LYS A CB   1 
ATOM   3546  C  CG   . LYS A 1 217 ? 39.658  36.415  -16.204 1.00 54.62  ? 214  LYS A CG   1 
ATOM   3547  C  CD   . LYS A 1 217 ? 38.365  36.835  -16.876 1.00 58.57  ? 214  LYS A CD   1 
ATOM   3548  C  CE   . LYS A 1 217 ? 37.325  35.727  -16.818 1.00 55.92  ? 214  LYS A CE   1 
ATOM   3549  N  NZ   . LYS A 1 217 ? 36.027  36.119  -17.484 1.00 60.16  ? 214  LYS A NZ   1 
ATOM   3550  H  H    . LYS A 1 217 ? 40.781  36.715  -13.802 1.00 49.52  ? 214  LYS A H    1 
ATOM   3551  H  HA   . LYS A 1 217 ? 42.384  36.583  -15.853 1.00 59.32  ? 214  LYS A HA   1 
ATOM   3552  H  HB2  . LYS A 1 217 ? 40.148  38.271  -15.510 1.00 61.97  ? 214  LYS A HB2  1 
ATOM   3553  H  HB3  . LYS A 1 217 ? 40.819  37.939  -16.909 1.00 61.97  ? 214  LYS A HB3  1 
ATOM   3554  H  HG2  . LYS A 1 217 ? 40.083  35.741  -16.758 1.00 65.55  ? 214  LYS A HG2  1 
ATOM   3555  H  HG3  . LYS A 1 217 ? 39.442  36.045  -15.333 1.00 65.55  ? 214  LYS A HG3  1 
ATOM   3556  H  HD2  . LYS A 1 217 ? 38.006  37.614  -16.423 1.00 70.29  ? 214  LYS A HD2  1 
ATOM   3557  H  HD3  . LYS A 1 217 ? 38.540  37.039  -17.808 1.00 70.29  ? 214  LYS A HD3  1 
ATOM   3558  H  HE2  . LYS A 1 217 ? 37.671  34.943  -17.271 1.00 67.10  ? 214  LYS A HE2  1 
ATOM   3559  H  HE3  . LYS A 1 217 ? 37.135  35.519  -15.889 1.00 67.10  ? 214  LYS A HE3  1 
ATOM   3560  H  HZ1  . LYS A 1 217 ? 36.171  36.310  -18.341 1.00 72.19  ? 214  LYS A HZ1  1 
ATOM   3561  H  HZ2  . LYS A 1 217 ? 35.443  35.449  -17.431 1.00 72.19  ? 214  LYS A HZ2  1 
ATOM   3562  H  HZ3  . LYS A 1 217 ? 35.683  36.835  -17.082 1.00 72.19  ? 214  LYS A HZ3  1 
ATOM   3563  N  N    . SER A 1 218 ? 42.698  39.227  -14.080 1.00 52.13  ? 215  SER A N    1 
ATOM   3564  C  CA   . SER A 1 218 ? 43.609  40.367  -13.879 1.00 45.95  ? 215  SER A CA   1 
ATOM   3565  C  C    . SER A 1 218 ? 45.042  39.895  -13.569 1.00 50.47  ? 215  SER A C    1 
ATOM   3566  O  O    . SER A 1 218 ? 46.040  40.413  -14.128 1.00 47.04  ? 215  SER A O    1 
ATOM   3567  C  CB   . SER A 1 218 ? 43.108  41.246  -12.723 1.00 46.57  ? 215  SER A CB   1 
ATOM   3568  O  OG   . SER A 1 218 ? 41.836  41.828  -12.972 1.00 44.59  ? 215  SER A OG   1 
ATOM   3569  H  H    . SER A 1 218 ? 42.128  39.100  -13.449 1.00 62.55  ? 215  SER A H    1 
ATOM   3570  H  HA   . SER A 1 218 ? 43.632  40.905  -14.685 1.00 55.14  ? 215  SER A HA   1 
ATOM   3571  H  HB2  . SER A 1 218 ? 43.045  40.699  -11.924 1.00 55.88  ? 215  SER A HB2  1 
ATOM   3572  H  HB3  . SER A 1 218 ? 43.749  41.959  -12.578 1.00 55.88  ? 215  SER A HB3  1 
ATOM   3573  H  HG   . SER A 1 218 ? 41.263  41.226  -13.093 1.00 53.51  ? 215  SER A HG   1 
ATOM   3574  N  N    . ILE A 1 219 ? 45.142  38.908  -12.685 1.00 36.25  ? 216  ILE A N    1 
ATOM   3575  C  CA   . ILE A 1 219 ? 46.420  38.308  -12.343 1.00 43.57  ? 216  ILE A CA   1 
ATOM   3576  C  C    . ILE A 1 219 ? 47.089  37.775  -13.597 1.00 50.63  ? 216  ILE A C    1 
ATOM   3577  O  O    . ILE A 1 219 ? 48.249  38.080  -13.837 1.00 41.33  ? 216  ILE A O    1 
ATOM   3578  C  CB   . ILE A 1 219 ? 46.272  37.171  -11.308 1.00 40.68  ? 216  ILE A CB   1 
ATOM   3579  C  CG1  . ILE A 1 219 ? 45.873  37.746  -9.948  1.00 46.19  ? 216  ILE A CG1  1 
ATOM   3580  C  CG2  . ILE A 1 219 ? 47.587  36.410  -11.134 1.00 40.08  ? 216  ILE A CG2  1 
ATOM   3581  C  CD1  . ILE A 1 219 ? 45.333  36.720  -8.992  1.00 48.75  ? 216  ILE A CD1  1 
ATOM   3582  H  H    . ILE A 1 219 ? 44.474  38.565  -12.265 1.00 43.50  ? 216  ILE A H    1 
ATOM   3583  H  HA   . ILE A 1 219 ? 46.997  38.988  -11.961 1.00 52.28  ? 216  ILE A HA   1 
ATOM   3584  H  HB   . ILE A 1 219 ? 45.585  36.555  -11.607 1.00 48.81  ? 216  ILE A HB   1 
ATOM   3585  H  HG12 . ILE A 1 219 ? 46.654  38.152  -9.538  1.00 55.43  ? 216  ILE A HG12 1 
ATOM   3586  H  HG13 . ILE A 1 219 ? 45.186  38.418  -10.082 1.00 55.43  ? 216  ILE A HG13 1 
ATOM   3587  H  HG21 . ILE A 1 219 ? 48.270  37.028  -10.828 1.00 48.10  ? 216  ILE A HG21 1 
ATOM   3588  H  HG22 . ILE A 1 219 ? 47.460  35.706  -10.479 1.00 48.10  ? 216  ILE A HG22 1 
ATOM   3589  H  HG23 . ILE A 1 219 ? 47.845  36.027  -11.987 1.00 48.10  ? 216  ILE A HG23 1 
ATOM   3590  H  HD11 . ILE A 1 219 ? 46.013  36.045  -8.837  1.00 58.50  ? 216  ILE A HD11 1 
ATOM   3591  H  HD12 . ILE A 1 219 ? 45.103  37.156  -8.157  1.00 58.50  ? 216  ILE A HD12 1 
ATOM   3592  H  HD13 . ILE A 1 219 ? 44.544  36.311  -9.381  1.00 58.50  ? 216  ILE A HD13 1 
ATOM   3593  N  N    . ASN A 1 220 ? 46.341  37.037  -14.428 1.00 51.61  ? 217  ASN A N    1 
ATOM   3594  C  CA   . ASN A 1 220 ? 46.945  36.455  -15.633 1.00 46.83  ? 217  ASN A CA   1 
ATOM   3595  C  C    . ASN A 1 220 ? 47.464  37.516  -16.575 1.00 37.22  ? 217  ASN A C    1 
ATOM   3596  O  O    . ASN A 1 220 ? 48.493  37.325  -17.219 1.00 48.24  ? 217  ASN A O    1 
ATOM   3597  C  CB   . ASN A 1 220 ? 45.956  35.535  -16.353 1.00 47.82  ? 217  ASN A CB   1 
ATOM   3598  C  CG   . ASN A 1 220 ? 45.730  34.227  -15.606 1.00 50.62  ? 217  ASN A CG   1 
ATOM   3599  O  OD1  . ASN A 1 220 ? 46.533  33.840  -14.752 1.00 68.49  ? 217  ASN A OD1  1 
ATOM   3600  N  ND2  . ASN A 1 220 ? 44.622  33.558  -15.901 1.00 51.05  ? 217  ASN A ND2  1 
ATOM   3601  H  H    . ASN A 1 220 ? 45.506  36.862  -14.321 1.00 61.93  ? 217  ASN A H    1 
ATOM   3602  H  HA   . ASN A 1 220 ? 47.702  35.912  -15.363 1.00 56.19  ? 217  ASN A HA   1 
ATOM   3603  H  HB2  . ASN A 1 220 ? 45.102  35.987  -16.433 1.00 57.38  ? 217  ASN A HB2  1 
ATOM   3604  H  HB3  . ASN A 1 220 ? 46.304  35.322  -17.233 1.00 57.38  ? 217  ASN A HB3  1 
ATOM   3605  H  HD21 . ASN A 1 220 ? 44.075  33.868  -16.488 1.00 61.27  ? 217  ASN A HD21 1 
ATOM   3606  H  HD22 . ASN A 1 220 ? 44.451  32.814  -15.505 1.00 61.27  ? 217  ASN A HD22 1 
ATOM   3607  N  N    . ILE A 1 221 ? 46.830  38.675  -16.584 1.00 42.43  ? 218  ILE A N    1 
ATOM   3608  C  CA   . ILE A 1 221 ? 47.353  39.774  -17.375 1.00 46.09  ? 218  ILE A CA   1 
ATOM   3609  C  C    . ILE A 1 221 ? 48.635  40.279  -16.723 1.00 54.14  ? 218  ILE A C    1 
ATOM   3610  O  O    . ILE A 1 221 ? 49.629  40.524  -17.406 1.00 50.99  ? 218  ILE A O    1 
ATOM   3611  C  CB   . ILE A 1 221 ? 46.358  40.932  -17.473 1.00 46.98  ? 218  ILE A CB   1 
ATOM   3612  C  CG1  . ILE A 1 221 ? 45.136  40.500  -18.267 1.00 43.17  ? 218  ILE A CG1  1 
ATOM   3613  C  CG2  . ILE A 1 221 ? 47.015  42.146  -18.149 1.00 50.82  ? 218  ILE A CG2  1 
ATOM   3614  C  CD1  . ILE A 1 221 ? 44.018  41.536  -18.298 1.00 48.01  ? 218  ILE A CD1  1 
ATOM   3615  H  H    . ILE A 1 221 ? 46.108  38.850  -16.150 1.00 50.91  ? 218  ILE A H    1 
ATOM   3616  H  HA   . ILE A 1 221 ? 47.560  39.464  -18.270 1.00 55.31  ? 218  ILE A HA   1 
ATOM   3617  H  HB   . ILE A 1 221 ? 46.079  41.183  -16.579 1.00 56.38  ? 218  ILE A HB   1 
ATOM   3618  H  HG12 . ILE A 1 221 ? 45.404  40.327  -19.183 1.00 51.80  ? 218  ILE A HG12 1 
ATOM   3619  H  HG13 . ILE A 1 221 ? 44.777  39.690  -17.872 1.00 51.80  ? 218  ILE A HG13 1 
ATOM   3620  H  HG21 . ILE A 1 221 ? 47.302  41.894  -19.040 1.00 60.99  ? 218  ILE A HG21 1 
ATOM   3621  H  HG22 . ILE A 1 221 ? 46.368  42.866  -18.201 1.00 60.99  ? 218  ILE A HG22 1 
ATOM   3622  H  HG23 . ILE A 1 221 ? 47.780  42.425  -17.621 1.00 60.99  ? 218  ILE A HG23 1 
ATOM   3623  H  HD11 . ILE A 1 221 ? 44.355  42.351  -18.702 1.00 57.61  ? 218  ILE A HD11 1 
ATOM   3624  H  HD12 . ILE A 1 221 ? 43.279  41.188  -18.820 1.00 57.61  ? 218  ILE A HD12 1 
ATOM   3625  H  HD13 . ILE A 1 221 ? 43.728  41.713  -17.389 1.00 57.61  ? 218  ILE A HD13 1 
ATOM   3626  N  N    . ILE A 1 222 ? 48.630  40.408  -15.397 1.00 49.20  ? 219  ILE A N    1 
ATOM   3627  C  CA   . ILE A 1 222 ? 49.836  40.885  -14.721 1.00 46.72  ? 219  ILE A CA   1 
ATOM   3628  C  C    . ILE A 1 222 ? 51.013  39.917  -14.886 1.00 49.85  ? 219  ILE A C    1 
ATOM   3629  O  O    . ILE A 1 222 ? 52.139  40.350  -15.120 1.00 54.20  ? 219  ILE A O    1 
ATOM   3630  C  CB   . ILE A 1 222 ? 49.559  41.121  -13.234 1.00 56.40  ? 219  ILE A CB   1 
ATOM   3631  C  CG1  . ILE A 1 222 ? 48.618  42.319  -13.089 1.00 47.93  ? 219  ILE A CG1  1 
ATOM   3632  C  CG2  . ILE A 1 222 ? 50.856  41.400  -12.467 1.00 53.54  ? 219  ILE A CG2  1 
ATOM   3633  C  CD1  . ILE A 1 222 ? 48.201  42.596  -11.673 1.00 49.26  ? 219  ILE A CD1  1 
ATOM   3634  H  H    . ILE A 1 222 ? 47.965  40.233  -14.880 1.00 59.04  ? 219  ILE A H    1 
ATOM   3635  H  HA   . ILE A 1 222 ? 50.095  41.734  -15.112 1.00 56.06  ? 219  ILE A HA   1 
ATOM   3636  H  HB   . ILE A 1 222 ? 49.132  40.334  -12.861 1.00 67.68  ? 219  ILE A HB   1 
ATOM   3637  H  HG12 . ILE A 1 222 ? 49.066  43.110  -13.426 1.00 57.52  ? 219  ILE A HG12 1 
ATOM   3638  H  HG13 . ILE A 1 222 ? 47.816  42.150  -13.607 1.00 57.52  ? 219  ILE A HG13 1 
ATOM   3639  H  HG21 . ILE A 1 222 ? 51.277  42.191  -12.838 1.00 64.25  ? 219  ILE A HG21 1 
ATOM   3640  H  HG22 . ILE A 1 222 ? 50.645  41.544  -11.532 1.00 64.25  ? 219  ILE A HG22 1 
ATOM   3641  H  HG23 . ILE A 1 222 ? 51.447  40.636  -12.560 1.00 64.25  ? 219  ILE A HG23 1 
ATOM   3642  H  HD11 . ILE A 1 222 ? 48.991  42.779  -11.142 1.00 59.11  ? 219  ILE A HD11 1 
ATOM   3643  H  HD12 . ILE A 1 222 ? 47.609  43.364  -11.663 1.00 59.11  ? 219  ILE A HD12 1 
ATOM   3644  H  HD13 . ILE A 1 222 ? 47.739  41.818  -11.323 1.00 59.11  ? 219  ILE A HD13 1 
ATOM   3645  N  N    . LYS A 1 223 ? 50.733  38.618  -14.831 1.00 53.62  ? 220  LYS A N    1 
ATOM   3646  C  CA   . LYS A 1 223 ? 51.731  37.568  -15.024 1.00 44.14  ? 220  LYS A CA   1 
ATOM   3647  C  C    . LYS A 1 223 ? 52.554  37.801  -16.281 1.00 49.90  ? 220  LYS A C    1 
ATOM   3648  O  O    . LYS A 1 223 ? 53.769  37.606  -16.296 1.00 53.27  ? 220  LYS A O    1 
ATOM   3649  C  CB   . LYS A 1 223 ? 51.037  36.222  -15.112 1.00 46.21  ? 220  LYS A CB   1 
ATOM   3650  C  CG   . LYS A 1 223 ? 50.888  35.485  -13.798 1.00 55.49  ? 220  LYS A CG   1 
ATOM   3651  C  CD   . LYS A 1 223 ? 50.255  34.118  -14.053 1.00 65.24  ? 220  LYS A CD   1 
ATOM   3652  C  CE   . LYS A 1 223 ? 50.417  33.174  -12.890 1.00 83.46  ? 220  LYS A CE   1 
ATOM   3653  N  NZ   . LYS A 1 223 ? 49.711  31.880  -13.145 1.00 76.00  ? 220  LYS A NZ   1 
ATOM   3654  H  H    . LYS A 1 223 ? 49.945  38.310  -14.678 1.00 64.35  ? 220  LYS A H    1 
ATOM   3655  H  HA   . LYS A 1 223 ? 52.333  37.552  -14.264 1.00 52.97  ? 220  LYS A HA   1 
ATOM   3656  H  HB2  . LYS A 1 223 ? 50.147  36.358  -15.473 1.00 55.45  ? 220  LYS A HB2  1 
ATOM   3657  H  HB3  . LYS A 1 223 ? 51.545  35.652  -15.710 1.00 55.45  ? 220  LYS A HB3  1 
ATOM   3658  H  HG2  . LYS A 1 223 ? 51.761  35.353  -13.396 1.00 66.58  ? 220  LYS A HG2  1 
ATOM   3659  H  HG3  . LYS A 1 223 ? 50.310  35.989  -13.204 1.00 66.58  ? 220  LYS A HG3  1 
ATOM   3660  H  HD2  . LYS A 1 223 ? 49.305  34.234  -14.214 1.00 78.29  ? 220  LYS A HD2  1 
ATOM   3661  H  HD3  . LYS A 1 223 ? 50.676  33.714  -14.828 1.00 78.29  ? 220  LYS A HD3  1 
ATOM   3662  H  HE2  . LYS A 1 223 ? 51.359  32.986  -12.757 1.00 100.15 ? 220  LYS A HE2  1 
ATOM   3663  H  HE3  . LYS A 1 223 ? 50.037  33.577  -12.093 1.00 100.15 ? 220  LYS A HE3  1 
ATOM   3664  H  HZ1  . LYS A 1 223 ? 50.044  31.490  -13.872 1.00 91.20  ? 220  LYS A HZ1  1 
ATOM   3665  H  HZ2  . LYS A 1 223 ? 49.816  31.335  -12.450 1.00 91.20  ? 220  LYS A HZ2  1 
ATOM   3666  H  HZ3  . LYS A 1 223 ? 48.842  32.028  -13.268 1.00 91.20  ? 220  LYS A HZ3  1 
ATOM   3667  N  N    . LYS A 1 224 ? 51.869  38.226  -17.334 1.00 45.80  ? 221  LYS A N    1 
ATOM   3668  C  CA   . LYS A 1 224 ? 52.501  38.427  -18.628 1.00 52.06  ? 221  LYS A CA   1 
ATOM   3669  C  C    . LYS A 1 224 ? 53.550  39.541  -18.608 1.00 62.66  ? 221  LYS A C    1 
ATOM   3670  O  O    . LYS A 1 224 ? 54.428  39.577  -19.471 1.00 74.93  ? 221  LYS A O    1 
ATOM   3671  C  CB   . LYS A 1 224 ? 51.427  38.748  -19.673 1.00 51.90  ? 221  LYS A CB   1 
ATOM   3672  C  CG   . LYS A 1 224 ? 51.961  39.136  -21.041 1.00 69.83  ? 221  LYS A CG   1 
ATOM   3673  C  CD   . LYS A 1 224 ? 50.829  39.409  -22.019 1.00 84.32  ? 221  LYS A CD   1 
ATOM   3674  C  CE   . LYS A 1 224 ? 51.361  39.660  -23.426 1.00 87.25  ? 221  LYS A CE   1 
ATOM   3675  N  NZ   . LYS A 1 224 ? 52.123  40.944  -23.535 1.00 65.71  ? 221  LYS A NZ   1 
ATOM   3676  H  H    . LYS A 1 224 ? 51.029  38.408  -17.324 1.00 54.96  ? 221  LYS A H    1 
ATOM   3677  H  HA   . LYS A 1 224 ? 52.942  37.605  -18.894 1.00 62.47  ? 221  LYS A HA   1 
ATOM   3678  H  HB2  . LYS A 1 224 ? 50.865  37.965  -19.789 1.00 62.28  ? 221  LYS A HB2  1 
ATOM   3679  H  HB3  . LYS A 1 224 ? 50.891  39.488  -19.347 1.00 62.28  ? 221  LYS A HB3  1 
ATOM   3680  H  HG2  . LYS A 1 224 ? 52.495  39.941  -20.960 1.00 83.80  ? 221  LYS A HG2  1 
ATOM   3681  H  HG3  . LYS A 1 224 ? 52.499  38.409  -21.393 1.00 83.80  ? 221  LYS A HG3  1 
ATOM   3682  H  HD2  . LYS A 1 224 ? 50.238  38.640  -22.049 1.00 101.18 ? 221  LYS A HD2  1 
ATOM   3683  H  HD3  . LYS A 1 224 ? 50.341  40.197  -21.733 1.00 101.18 ? 221  LYS A HD3  1 
ATOM   3684  H  HE2  . LYS A 1 224 ? 51.957  38.936  -23.672 1.00 104.70 ? 221  LYS A HE2  1 
ATOM   3685  H  HE3  . LYS A 1 224 ? 50.614  39.701  -24.044 1.00 104.70 ? 221  LYS A HE3  1 
ATOM   3686  H  HZ1  . LYS A 1 224 ? 52.820  40.931  -22.982 1.00 78.86  ? 221  LYS A HZ1  1 
ATOM   3687  H  HZ2  . LYS A 1 224 ? 52.416  41.053  -24.368 1.00 78.86  ? 221  LYS A HZ2  1 
ATOM   3688  H  HZ3  . LYS A 1 224 ? 51.597  41.629  -23.321 1.00 78.86  ? 221  LYS A HZ3  1 
ATOM   3689  N  N    . TYR A 1 225 ? 53.470  40.426  -17.612 1.00 55.19  ? 222  TYR A N    1 
ATOM   3690  C  CA   . TYR A 1 225 ? 54.322  41.617  -17.548 1.00 52.80  ? 222  TYR A CA   1 
ATOM   3691  C  C    . TYR A 1 225 ? 55.222  41.623  -16.325 1.00 52.17  ? 222  TYR A C    1 
ATOM   3692  O  O    . TYR A 1 225 ? 56.219  42.353  -16.296 1.00 55.15  ? 222  TYR A O    1 
ATOM   3693  C  CB   . TYR A 1 225 ? 53.484  42.905  -17.526 1.00 49.73  ? 222  TYR A CB   1 
ATOM   3694  C  CG   . TYR A 1 225 ? 52.663  43.144  -18.766 1.00 43.61  ? 222  TYR A CG   1 
ATOM   3695  C  CD1  . TYR A 1 225 ? 51.386  42.621  -18.880 1.00 46.49  ? 222  TYR A CD1  1 
ATOM   3696  C  CD2  . TYR A 1 225 ? 53.164  43.883  -19.828 1.00 46.64  ? 222  TYR A CD2  1 
ATOM   3697  C  CE1  . TYR A 1 225 ? 50.626  42.831  -20.005 1.00 49.78  ? 222  TYR A CE1  1 
ATOM   3698  C  CE2  . TYR A 1 225 ? 52.410  44.093  -20.969 1.00 45.98  ? 222  TYR A CE2  1 
ATOM   3699  C  CZ   . TYR A 1 225 ? 51.141  43.563  -21.052 1.00 50.56  ? 222  TYR A CZ   1 
ATOM   3700  O  OH   . TYR A 1 225 ? 50.371  43.755  -22.182 1.00 65.47  ? 222  TYR A OH   1 
ATOM   3701  H  H    . TYR A 1 225 ? 52.922  40.358  -16.952 1.00 66.22  ? 222  TYR A H    1 
ATOM   3702  H  HA   . TYR A 1 225 ? 54.888  41.641  -18.335 1.00 63.36  ? 222  TYR A HA   1 
ATOM   3703  H  HB2  . TYR A 1 225 ? 52.874  42.865  -16.773 1.00 59.68  ? 222  TYR A HB2  1 
ATOM   3704  H  HB3  . TYR A 1 225 ? 54.083  43.661  -17.421 1.00 59.68  ? 222  TYR A HB3  1 
ATOM   3705  H  HD1  . TYR A 1 225 ? 54.021  44.239  -19.774 1.00 55.96  ? 222  TYR A HD1  1 
ATOM   3706  H  HD2  . TYR A 1 225 ? 51.033  42.124  -18.178 1.00 55.79  ? 222  TYR A HD2  1 
ATOM   3707  H  HE1  . TYR A 1 225 ? 52.758  44.590  -21.674 1.00 55.17  ? 222  TYR A HE1  1 
ATOM   3708  H  HE2  . TYR A 1 225 ? 49.771  42.469  -20.065 1.00 59.73  ? 222  TYR A HE2  1 
ATOM   3709  H  HH   . TYR A 1 225 ? 50.796  44.213  -22.744 1.00 78.57  ? 222  TYR A HH   1 
ATOM   3710  N  N    . PHE A 1 226 ? 54.869  40.823  -15.320 1.00 36.99  ? 223  PHE A N    1 
ATOM   3711  C  CA   . PHE A 1 226 ? 55.472  40.967  -13.995 1.00 54.61  ? 223  PHE A CA   1 
ATOM   3712  C  C    . PHE A 1 226 ? 57.002  40.833  -13.984 1.00 55.78  ? 223  PHE A C    1 
ATOM   3713  O  O    . PHE A 1 226 ? 57.678  41.637  -13.349 1.00 63.95  ? 223  PHE A O    1 
ATOM   3714  C  CB   . PHE A 1 226 ? 54.880  39.943  -13.036 1.00 47.06  ? 223  PHE A CB   1 
ATOM   3715  C  CG   . PHE A 1 226 ? 55.305  40.145  -11.604 1.00 64.43  ? 223  PHE A CG   1 
ATOM   3716  C  CD1  . PHE A 1 226 ? 54.747  41.158  -10.836 1.00 61.34  ? 223  PHE A CD1  1 
ATOM   3717  C  CD2  . PHE A 1 226 ? 56.271  39.336  -11.031 1.00 55.96  ? 223  PHE A CD2  1 
ATOM   3718  C  CE1  . PHE A 1 226 ? 55.134  41.351  -9.524  1.00 48.98  ? 223  PHE A CE1  1 
ATOM   3719  C  CE2  . PHE A 1 226 ? 56.664  39.520  -9.721  1.00 48.99  ? 223  PHE A CE2  1 
ATOM   3720  C  CZ   . PHE A 1 226 ? 56.092  40.535  -8.964  1.00 55.27  ? 223  PHE A CZ   1 
ATOM   3721  H  H    . PHE A 1 226 ? 54.288  40.193  -15.378 1.00 44.39  ? 223  PHE A H    1 
ATOM   3722  H  HA   . PHE A 1 226 ? 55.254  41.848  -13.653 1.00 65.53  ? 223  PHE A HA   1 
ATOM   3723  H  HB2  . PHE A 1 226 ? 53.912  40.003  -13.070 1.00 56.47  ? 223  PHE A HB2  1 
ATOM   3724  H  HB3  . PHE A 1 226 ? 55.165  39.057  -13.309 1.00 56.47  ? 223  PHE A HB3  1 
ATOM   3725  H  HD1  . PHE A 1 226 ? 54.099  41.711  -11.209 1.00 73.61  ? 223  PHE A HD1  1 
ATOM   3726  H  HD2  . PHE A 1 226 ? 56.655  38.654  -11.534 1.00 67.15  ? 223  PHE A HD2  1 
ATOM   3727  H  HE1  . PHE A 1 226 ? 54.749  42.032  -9.020  1.00 58.78  ? 223  PHE A HE1  1 
ATOM   3728  H  HE2  . PHE A 1 226 ? 57.312  38.967  -9.347  1.00 58.78  ? 223  PHE A HE2  1 
ATOM   3729  H  HZ   . PHE A 1 226 ? 56.356  40.663  -8.081  1.00 66.32  ? 223  PHE A HZ   1 
ATOM   3730  N  N    . GLU A 1 227 ? 57.541  39.829  -14.671 1.00 56.77  ? 224  GLU A N    1 
ATOM   3731  C  CA   . GLU A 1 227 ? 58.980  39.559  -14.647 1.00 51.41  ? 224  GLU A CA   1 
ATOM   3732  C  C    . GLU A 1 227 ? 59.786  40.743  -15.163 1.00 58.66  ? 224  GLU A C    1 
ATOM   3733  O  O    . GLU A 1 227 ? 60.746  41.171  -14.534 1.00 70.79  ? 224  GLU A O    1 
ATOM   3734  C  CB   . GLU A 1 227 ? 59.317  38.326  -15.466 1.00 70.53  ? 224  GLU A CB   1 
ATOM   3735  C  CG   . GLU A 1 227 ? 60.623  37.687  -15.064 1.00 76.23  ? 224  GLU A CG   1 
ATOM   3736  C  CD   . GLU A 1 227 ? 60.994  36.515  -15.947 1.00 83.87  ? 224  GLU A CD   1 
ATOM   3737  O  OE1  . GLU A 1 227 ? 61.590  36.751  -17.019 1.00 85.33  ? 224  GLU A OE1  1 
ATOM   3738  O  OE2  . GLU A 1 227 ? 60.701  35.363  -15.565 1.00 93.72  ? 224  GLU A OE2  1 
ATOM   3739  H  H    . GLU A 1 227 ? 57.092  39.285  -15.164 1.00 68.12  ? 224  GLU A H    1 
ATOM   3740  H  HA   . GLU A 1 227 ? 59.251  39.391  -13.731 1.00 61.69  ? 224  GLU A HA   1 
ATOM   3741  H  HB2  . GLU A 1 227 ? 58.614  37.668  -15.349 1.00 84.64  ? 224  GLU A HB2  1 
ATOM   3742  H  HB3  . GLU A 1 227 ? 59.383  38.577  -16.401 1.00 84.64  ? 224  GLU A HB3  1 
ATOM   3743  H  HG2  . GLU A 1 227 ? 61.331  38.347  -15.128 1.00 91.48  ? 224  GLU A HG2  1 
ATOM   3744  H  HG3  . GLU A 1 227 ? 60.550  37.364  -14.152 1.00 91.48  ? 224  GLU A HG3  1 
ATOM   3745  N  N    . GLU A 1 228 ? 59.419  41.256  -16.328 1.00 61.74  ? 225  GLU A N    1 
ATOM   3746  C  CA   . GLU A 1 228 ? 60.157  42.371  -16.897 1.00 66.64  ? 225  GLU A CA   1 
ATOM   3747  C  C    . GLU A 1 228 ? 59.925  43.685  -16.155 1.00 67.33  ? 225  GLU A C    1 
ATOM   3748  O  O    . GLU A 1 228 ? 60.866  44.456  -15.961 1.00 73.37  ? 225  GLU A O    1 
ATOM   3749  C  CB   . GLU A 1 228 ? 59.768  42.561  -18.365 1.00 74.89  ? 225  GLU A CB   1 
ATOM   3750  C  CG   . GLU A 1 228 ? 60.738  43.424  -19.162 1.00 78.08  ? 225  GLU A CG   1 
ATOM   3751  C  CD   . GLU A 1 228 ? 60.035  44.267  -20.208 1.00 111.37 ? 225  GLU A CD   1 
ATOM   3752  O  OE1  . GLU A 1 228 ? 59.143  43.734  -20.909 1.00 128.48 ? 225  GLU A OE1  1 
ATOM   3753  O  OE2  . GLU A 1 228 ? 60.363  45.472  -20.313 1.00 110.67 ? 225  GLU A OE2  1 
ATOM   3754  H  H    . GLU A 1 228 ? 58.756  40.982  -16.803 1.00 74.09  ? 225  GLU A H    1 
ATOM   3755  H  HA   . GLU A 1 228 ? 61.105  42.172  -16.862 1.00 79.97  ? 225  GLU A HA   1 
ATOM   3756  H  HB2  . GLU A 1 228 ? 59.727  41.691  -18.791 1.00 89.87  ? 225  GLU A HB2  1 
ATOM   3757  H  HB3  . GLU A 1 228 ? 58.896  42.985  -18.403 1.00 89.87  ? 225  GLU A HB3  1 
ATOM   3758  H  HG2  . GLU A 1 228 ? 61.203  44.021  -18.556 1.00 93.70  ? 225  GLU A HG2  1 
ATOM   3759  H  HG3  . GLU A 1 228 ? 61.374  42.849  -19.617 1.00 93.70  ? 225  GLU A HG3  1 
ATOM   3760  N  N    . TYR A 1 229 ? 58.693  43.933  -15.717 1.00 53.71  ? 226  TYR A N    1 
ATOM   3761  C  CA   . TYR A 1 229 ? 58.396  45.191  -15.043 1.00 55.84  ? 226  TYR A CA   1 
ATOM   3762  C  C    . TYR A 1 229 ? 58.965  45.244  -13.629 1.00 60.99  ? 226  TYR A C    1 
ATOM   3763  O  O    . TYR A 1 229 ? 59.640  46.204  -13.255 1.00 57.03  ? 226  TYR A O    1 
ATOM   3764  C  CB   . TYR A 1 229 ? 56.885  45.460  -14.979 1.00 56.73  ? 226  TYR A CB   1 
ATOM   3765  C  CG   . TYR A 1 229 ? 56.573  46.493  -13.914 1.00 57.34  ? 226  TYR A CG   1 
ATOM   3766  C  CD1  . TYR A 1 229 ? 56.842  47.840  -14.121 1.00 51.99  ? 226  TYR A CD1  1 
ATOM   3767  C  CD2  . TYR A 1 229 ? 56.057  46.114  -12.686 1.00 49.44  ? 226  TYR A CD2  1 
ATOM   3768  C  CE1  . TYR A 1 229 ? 56.596  48.777  -13.133 1.00 54.88  ? 226  TYR A CE1  1 
ATOM   3769  C  CE2  . TYR A 1 229 ? 55.809  47.042  -11.698 1.00 53.59  ? 226  TYR A CE2  1 
ATOM   3770  C  CZ   . TYR A 1 229 ? 56.074  48.370  -11.924 1.00 57.41  ? 226  TYR A CZ   1 
ATOM   3771  O  OH   . TYR A 1 229 ? 55.825  49.289  -10.930 1.00 57.80  ? 226  TYR A OH   1 
ATOM   3772  H  H    . TYR A 1 229 ? 58.023  43.399  -15.797 1.00 64.45  ? 226  TYR A H    1 
ATOM   3773  H  HA   . TYR A 1 229 ? 58.801  45.914  -15.548 1.00 67.00  ? 226  TYR A HA   1 
ATOM   3774  H  HB2  . TYR A 1 229 ? 56.581  45.800  -15.835 1.00 68.08  ? 226  TYR A HB2  1 
ATOM   3775  H  HB3  . TYR A 1 229 ? 56.420  44.639  -14.756 1.00 68.08  ? 226  TYR A HB3  1 
ATOM   3776  H  HD1  . TYR A 1 229 ? 57.200  48.115  -14.934 1.00 62.39  ? 226  TYR A HD1  1 
ATOM   3777  H  HD2  . TYR A 1 229 ? 55.881  45.215  -12.523 1.00 59.33  ? 226  TYR A HD2  1 
ATOM   3778  H  HE1  . TYR A 1 229 ? 56.775  49.677  -13.285 1.00 65.86  ? 226  TYR A HE1  1 
ATOM   3779  H  HE2  . TYR A 1 229 ? 55.458  46.769  -10.881 1.00 64.30  ? 226  TYR A HE2  1 
ATOM   3780  H  HH   . TYR A 1 229 ? 55.511  48.903  -10.254 1.00 69.36  ? 226  TYR A HH   1 
ATOM   3781  N  N    . ALA A 1 230 ? 58.677  44.213  -12.847 1.00 52.47  ? 227  ALA A N    1 
ATOM   3782  C  CA   . ALA A 1 230 ? 58.895  44.266  -11.411 1.00 53.65  ? 227  ALA A CA   1 
ATOM   3783  C  C    . ALA A 1 230 ? 60.248  43.715  -10.993 1.00 59.66  ? 227  ALA A C    1 
ATOM   3784  O  O    . ALA A 1 230 ? 60.893  44.257  -10.087 1.00 60.42  ? 227  ALA A O    1 
ATOM   3785  C  CB   . ALA A 1 230 ? 57.781  43.510  -10.695 1.00 53.72  ? 227  ALA A CB   1 
ATOM   3786  H  H    . ALA A 1 230 ? 58.352  43.467  -13.126 1.00 62.96  ? 227  ALA A H    1 
ATOM   3787  H  HA   . ALA A 1 230 ? 58.853  45.192  -11.126 1.00 64.38  ? 227  ALA A HA   1 
ATOM   3788  H  HB1  . ALA A 1 230 ? 57.785  42.586  -10.991 1.00 64.46  ? 227  ALA A HB1  1 
ATOM   3789  H  HB2  . ALA A 1 230 ? 57.936  43.552  -9.738  1.00 64.46  ? 227  ALA A HB2  1 
ATOM   3790  H  HB3  . ALA A 1 230 ? 56.930  43.923  -10.910 1.00 64.46  ? 227  ALA A HB3  1 
ATOM   3791  N  N    . LEU A 1 231 ? 60.684  42.648  -11.657 1.00 55.23  ? 228  LEU A N    1 
ATOM   3792  C  CA   . LEU A 1 231 ? 61.892  41.940  -11.235 1.00 54.78  ? 228  LEU A CA   1 
ATOM   3793  C  C    . LEU A 1 231 ? 63.140  42.443  -11.950 1.00 61.23  ? 228  LEU A C    1 
ATOM   3794  O  O    . LEU A 1 231 ? 64.236  42.391  -11.393 1.00 66.98  ? 228  LEU A O    1 
ATOM   3795  C  CB   . LEU A 1 231 ? 61.720  40.439  -11.464 1.00 50.65  ? 228  LEU A CB   1 
ATOM   3796  C  CG   . LEU A 1 231 ? 60.519  39.826  -10.737 1.00 61.90  ? 228  LEU A CG   1 
ATOM   3797  C  CD1  . LEU A 1 231 ? 60.428  38.340  -11.032 1.00 54.03  ? 228  LEU A CD1  1 
ATOM   3798  C  CD2  . LEU A 1 231 ? 60.585  40.063  -9.201  1.00 49.35  ? 228  LEU A CD2  1 
ATOM   3799  H  H    . LEU A 1 231 ? 60.301  42.315  -12.351 1.00 66.28  ? 228  LEU A H    1 
ATOM   3800  H  HA   . LEU A 1 231 ? 62.020  42.081  -10.284 1.00 65.73  ? 228  LEU A HA   1 
ATOM   3801  H  HB2  . LEU A 1 231 ? 61.603  40.280  -12.414 1.00 60.78  ? 228  LEU A HB2  1 
ATOM   3802  H  HB3  . LEU A 1 231 ? 62.518  39.983  -11.152 1.00 60.78  ? 228  LEU A HB3  1 
ATOM   3803  H  HG   . LEU A 1 231 ? 59.708  40.244  -11.067 1.00 74.28  ? 228  LEU A HG   1 
ATOM   3804  H  HD11 . LEU A 1 231 ? 61.241  37.908  -10.728 1.00 64.84  ? 228  LEU A HD11 1 
ATOM   3805  H  HD12 . LEU A 1 231 ? 59.662  37.972  -10.563 1.00 64.84  ? 228  LEU A HD12 1 
ATOM   3806  H  HD13 . LEU A 1 231 ? 60.322  38.214  -11.988 1.00 64.84  ? 228  LEU A HD13 1 
ATOM   3807  H  HD21 . LEU A 1 231 ? 60.594  41.017  -9.029  1.00 59.22  ? 228  LEU A HD21 1 
ATOM   3808  H  HD22 . LEU A 1 231 ? 59.807  39.659  -8.787  1.00 59.22  ? 228  LEU A HD22 1 
ATOM   3809  H  HD23 . LEU A 1 231 ? 61.394  39.656  -8.854  1.00 59.22  ? 228  LEU A HD23 1 
ATOM   3810  N  N    . VAL A 1 232 ? 62.968  42.966  -13.159 1.00 56.13  ? 229  VAL A N    1 
ATOM   3811  C  CA   . VAL A 1 232 ? 64.092  43.468  -13.940 1.00 59.00  ? 229  VAL A CA   1 
ATOM   3812  C  C    . VAL A 1 232 ? 64.199  44.996  -13.887 1.00 69.14  ? 229  VAL A C    1 
ATOM   3813  O  O    . VAL A 1 232 ? 65.167  45.537  -13.351 1.00 76.94  ? 229  VAL A O    1 
ATOM   3814  C  CB   . VAL A 1 232 ? 63.976  43.020  -15.409 1.00 69.13  ? 229  VAL A CB   1 
ATOM   3815  C  CG1  . VAL A 1 232 ? 65.063  43.664  -16.265 1.00 73.54  ? 229  VAL A CG1  1 
ATOM   3816  C  CG2  . VAL A 1 232 ? 64.075  41.506  -15.499 1.00 55.87  ? 229  VAL A CG2  1 
ATOM   3817  H  H    . VAL A 1 232 ? 62.206  43.042  -13.551 1.00 67.36  ? 229  VAL A H    1 
ATOM   3818  H  HA   . VAL A 1 232 ? 64.914  43.099  -13.580 1.00 70.80  ? 229  VAL A HA   1 
ATOM   3819  H  HB   . VAL A 1 232 ? 63.113  43.290  -15.759 1.00 82.96  ? 229  VAL A HB   1 
ATOM   3820  H  HG11 . VAL A 1 232 ? 65.932  43.400  -15.923 1.00 88.25  ? 229  VAL A HG11 1 
ATOM   3821  H  HG12 . VAL A 1 232 ? 64.963  43.362  -17.182 1.00 88.25  ? 229  VAL A HG12 1 
ATOM   3822  H  HG13 . VAL A 1 232 ? 64.969  44.628  -16.222 1.00 88.25  ? 229  VAL A HG13 1 
ATOM   3823  H  HG21 . VAL A 1 232 ? 63.354  41.112  -14.983 1.00 67.04  ? 229  VAL A HG21 1 
ATOM   3824  H  HG22 . VAL A 1 232 ? 64.000  41.240  -16.429 1.00 67.04  ? 229  VAL A HG22 1 
ATOM   3825  H  HG23 . VAL A 1 232 ? 64.931  41.224  -15.141 1.00 67.04  ? 229  VAL A HG23 1 
ATOM   3826  N  N    . ASN A 1 233 ? 63.206  45.683  -14.442 1.00 65.13  ? 230  ASN A N    1 
ATOM   3827  C  CA   . ASN A 1 233 ? 63.238  47.140  -14.527 1.00 69.14  ? 230  ASN A CA   1 
ATOM   3828  C  C    . ASN A 1 233 ? 63.099  47.841  -13.180 1.00 67.67  ? 230  ASN A C    1 
ATOM   3829  O  O    . ASN A 1 233 ? 63.834  48.784  -12.895 1.00 74.29  ? 230  ASN A O    1 
ATOM   3830  C  CB   . ASN A 1 233 ? 62.129  47.635  -15.457 1.00 67.04  ? 230  ASN A CB   1 
ATOM   3831  C  CG   . ASN A 1 233 ? 62.410  47.325  -16.907 1.00 76.88  ? 230  ASN A CG   1 
ATOM   3832  O  OD1  . ASN A 1 233 ? 63.560  47.126  -17.304 1.00 81.41  ? 230  ASN A OD1  1 
ATOM   3833  N  ND2  . ASN A 1 233 ? 61.358  47.287  -17.715 1.00 82.33  ? 230  ASN A ND2  1 
ATOM   3834  H  H    . ASN A 1 233 ? 62.499  45.328  -14.778 1.00 78.16  ? 230  ASN A H    1 
ATOM   3835  H  HA   . ASN A 1 233 ? 64.087  47.409  -14.911 1.00 82.97  ? 230  ASN A HA   1 
ATOM   3836  H  HB2  . ASN A 1 233 ? 61.295  47.204  -15.214 1.00 80.45  ? 230  ASN A HB2  1 
ATOM   3837  H  HB3  . ASN A 1 233 ? 62.045  48.597  -15.366 1.00 80.45  ? 230  ASN A HB3  1 
ATOM   3838  H  HD21 . ASN A 1 233 ? 60.570  47.436  -17.402 1.00 98.80  ? 230  ASN A HD21 1 
ATOM   3839  H  HD22 . ASN A 1 233 ? 61.463  47.115  -18.551 1.00 98.80  ? 230  ASN A HD22 1 
ATOM   3840  N  N    . GLN A 1 234 ? 62.151  47.386  -12.366 1.00 55.66  ? 231  GLN A N    1 
ATOM   3841  C  CA   . GLN A 1 234 ? 61.924  47.984  -11.055 1.00 64.41  ? 231  GLN A CA   1 
ATOM   3842  C  C    . GLN A 1 234 ? 62.838  47.360  -10.013 1.00 64.88  ? 231  GLN A C    1 
ATOM   3843  O  O    . GLN A 1 234 ? 63.263  48.031  -9.080  1.00 49.90  ? 231  GLN A O    1 
ATOM   3844  C  CB   . GLN A 1 234 ? 60.474  47.822  -10.622 1.00 55.12  ? 231  GLN A CB   1 
ATOM   3845  C  CG   . GLN A 1 234 ? 59.528  48.759  -11.344 1.00 62.61  ? 231  GLN A CG   1 
ATOM   3846  C  CD   . GLN A 1 234 ? 59.741  50.210  -10.969 1.00 66.03  ? 231  GLN A CD   1 
ATOM   3847  O  OE1  . GLN A 1 234 ? 59.930  50.538  -9.793  1.00 68.62  ? 231  GLN A OE1  1 
ATOM   3848  N  NE2  . GLN A 1 234 ? 59.698  51.094  -11.964 1.00 49.60  ? 231  GLN A NE2  1 
ATOM   3849  H  H    . GLN A 1 234 ? 61.625  46.731  -12.549 1.00 66.80  ? 231  GLN A H    1 
ATOM   3850  H  HA   . GLN A 1 234 ? 62.122  48.933  -11.100 1.00 77.29  ? 231  GLN A HA   1 
ATOM   3851  H  HB2  . GLN A 1 234 ? 60.191  46.913  -10.805 1.00 66.15  ? 231  GLN A HB2  1 
ATOM   3852  H  HB3  . GLN A 1 234 ? 60.408  48.005  -9.672  1.00 66.15  ? 231  GLN A HB3  1 
ATOM   3853  H  HG2  . GLN A 1 234 ? 59.666  48.673  -12.301 1.00 75.13  ? 231  GLN A HG2  1 
ATOM   3854  H  HG3  . GLN A 1 234 ? 58.615  48.522  -11.118 1.00 75.13  ? 231  GLN A HG3  1 
ATOM   3855  H  HE21 . GLN A 1 234 ? 59.554  50.828  -12.769 1.00 59.52  ? 231  GLN A HE21 1 
ATOM   3856  H  HE22 . GLN A 1 234 ? 59.813  51.930  -11.801 1.00 59.52  ? 231  GLN A HE22 1 
ATOM   3857  N  N    . ASP A 1 235 ? 63.111  46.068  -10.163 1.00 61.54  ? 232  ASP A N    1 
ATOM   3858  C  CA   . ASP A 1 235 ? 64.009  45.367  -9.258  1.00 60.09  ? 232  ASP A CA   1 
ATOM   3859  C  C    . ASP A 1 235 ? 63.546  45.499  -7.817  1.00 54.58  ? 232  ASP A C    1 
ATOM   3860  O  O    . ASP A 1 235 ? 64.288  45.981  -6.968  1.00 60.30  ? 232  ASP A O    1 
ATOM   3861  C  CB   . ASP A 1 235 ? 65.427  45.922  -9.404  1.00 65.39  ? 232  ASP A CB   1 
ATOM   3862  C  CG   . ASP A 1 235 ? 66.476  44.971  -8.907  1.00 76.23  ? 232  ASP A CG   1 
ATOM   3863  O  OD1  . ASP A 1 235 ? 66.139  44.060  -8.119  1.00 78.19  ? 232  ASP A OD1  1 
ATOM   3864  O  OD2  . ASP A 1 235 ? 67.650  45.151  -9.294  1.00 91.16  ? 232  ASP A OD2  1 
ATOM   3865  H  H    . ASP A 1 235 ? 62.785  45.573  -10.786 1.00 73.85  ? 232  ASP A H    1 
ATOM   3866  H  HA   . ASP A 1 235 ? 64.025  44.425  -9.488  1.00 72.11  ? 232  ASP A HA   1 
ATOM   3867  H  HB2  . ASP A 1 235 ? 65.602  46.100  -10.341 1.00 78.47  ? 232  ASP A HB2  1 
ATOM   3868  H  HB3  . ASP A 1 235 ? 65.500  46.743  -8.892  1.00 78.47  ? 232  ASP A HB3  1 
ATOM   3869  N  N    . ILE A 1 236 ? 62.320  45.061  -7.549  1.00 57.91  ? 233  ILE A N    1 
ATOM   3870  C  CA   . ILE A 1 236 ? 61.691  45.251  -6.243  1.00 59.13  ? 233  ILE A CA   1 
ATOM   3871  C  C    . ILE A 1 236 ? 62.312  44.395  -5.132  1.00 62.50  ? 233  ILE A C    1 
ATOM   3872  O  O    . ILE A 1 236 ? 61.901  44.482  -3.973  1.00 52.67  ? 233  ILE A O    1 
ATOM   3873  C  CB   . ILE A 1 236 ? 60.171  44.963  -6.320  1.00 54.97  ? 233  ILE A CB   1 
ATOM   3874  C  CG1  . ILE A 1 236 ? 59.916  43.540  -6.812  1.00 56.92  ? 233  ILE A CG1  1 
ATOM   3875  C  CG2  . ILE A 1 236 ? 59.498  45.956  -7.251  1.00 52.18  ? 233  ILE A CG2  1 
ATOM   3876  C  CD1  . ILE A 1 236 ? 58.464  43.115  -6.745  1.00 55.42  ? 233  ILE A CD1  1 
ATOM   3877  H  H    . ILE A 1 236 ? 61.823  44.645  -8.115  1.00 69.50  ? 233  ILE A H    1 
ATOM   3878  H  HA   . ILE A 1 236 ? 61.797  46.180  -5.986  1.00 70.96  ? 233  ILE A HA   1 
ATOM   3879  H  HB   . ILE A 1 236 ? 59.791  45.059  -5.433  1.00 65.96  ? 233  ILE A HB   1 
ATOM   3880  H  HG12 . ILE A 1 236 ? 60.200  43.474  -7.737  1.00 68.30  ? 233  ILE A HG12 1 
ATOM   3881  H  HG13 . ILE A 1 236 ? 60.429  42.924  -6.266  1.00 68.30  ? 233  ILE A HG13 1 
ATOM   3882  H  HG21 . ILE A 1 236 ? 59.887  45.873  -8.135  1.00 62.62  ? 233  ILE A HG21 1 
ATOM   3883  H  HG22 . ILE A 1 236 ? 58.549  45.761  -7.287  1.00 62.62  ? 233  ILE A HG22 1 
ATOM   3884  H  HG23 . ILE A 1 236 ? 59.639  46.853  -6.910  1.00 62.62  ? 233  ILE A HG23 1 
ATOM   3885  H  HD11 . ILE A 1 236 ? 57.935  43.713  -7.296  1.00 66.50  ? 233  ILE A HD11 1 
ATOM   3886  H  HD12 . ILE A 1 236 ? 58.386  42.206  -7.073  1.00 66.50  ? 233  ILE A HD12 1 
ATOM   3887  H  HD13 . ILE A 1 236 ? 58.164  43.162  -5.824  1.00 66.50  ? 233  ILE A HD13 1 
ATOM   3888  N  N    . LEU A 1 237 ? 63.294  43.572  -5.484  1.00 59.31  ? 234  LEU A N    1 
ATOM   3889  C  CA   . LEU A 1 237 ? 63.998  42.755  -4.500  1.00 62.85  ? 234  LEU A CA   1 
ATOM   3890  C  C    . LEU A 1 237 ? 65.502  42.963  -4.628  1.00 68.55  ? 234  LEU A C    1 
ATOM   3891  O  O    . LEU A 1 237 ? 66.293  42.060  -4.345  1.00 64.68  ? 234  LEU A O    1 
ATOM   3892  C  CB   . LEU A 1 237 ? 63.646  41.277  -4.672  1.00 58.08  ? 234  LEU A CB   1 
ATOM   3893  C  CG   . LEU A 1 237 ? 62.199  40.905  -4.370  1.00 56.27  ? 234  LEU A CG   1 
ATOM   3894  C  CD1  . LEU A 1 237 ? 61.872  39.545  -4.948  1.00 58.48  ? 234  LEU A CD1  1 
ATOM   3895  C  CD2  . LEU A 1 237 ? 61.955  40.895  -2.887  1.00 65.42  ? 234  LEU A CD2  1 
ATOM   3896  H  H    . LEU A 1 237 ? 63.574  43.467  -6.290  1.00 71.17  ? 234  LEU A H    1 
ATOM   3897  H  HA   . LEU A 1 237 ? 63.729  43.028  -3.609  1.00 75.42  ? 234  LEU A HA   1 
ATOM   3898  H  HB2  . LEU A 1 237 ? 63.825  41.024  -5.591  1.00 69.70  ? 234  LEU A HB2  1 
ATOM   3899  H  HB3  . LEU A 1 237 ? 64.209  40.757  -4.078  1.00 69.70  ? 234  LEU A HB3  1 
ATOM   3900  H  HG   . LEU A 1 237 ? 61.607  41.560  -4.773  1.00 67.53  ? 234  LEU A HG   1 
ATOM   3901  H  HD11 . LEU A 1 237 ? 62.461  38.884  -4.552  1.00 70.17  ? 234  LEU A HD11 1 
ATOM   3902  H  HD12 . LEU A 1 237 ? 60.948  39.330  -4.744  1.00 70.17  ? 234  LEU A HD12 1 
ATOM   3903  H  HD13 . LEU A 1 237 ? 62.002  39.571  -5.909  1.00 70.17  ? 234  LEU A HD13 1 
ATOM   3904  H  HD21 . LEU A 1 237 ? 62.137  41.778  -2.531  1.00 78.50  ? 234  LEU A HD21 1 
ATOM   3905  H  HD22 . LEU A 1 237 ? 61.029  40.656  -2.722  1.00 78.50  ? 234  LEU A HD22 1 
ATOM   3906  H  HD23 . LEU A 1 237 ? 62.544  40.243  -2.475  1.00 78.50  ? 234  LEU A HD23 1 
ATOM   3907  N  N    . GLU A 1 238 ? 65.890  44.179  -5.005  1.00 59.66  ? 235  GLU A N    1 
ATOM   3908  C  CA   . GLU A 1 238 ? 67.296  44.501  -5.207  1.00 65.62  ? 235  GLU A CA   1 
ATOM   3909  C  C    . GLU A 1 238 ? 68.059  44.383  -3.894  1.00 73.59  ? 235  GLU A C    1 
ATOM   3910  O  O    . GLU A 1 238 ? 69.066  43.680  -3.809  1.00 75.91  ? 235  GLU A O    1 
ATOM   3911  C  CB   . GLU A 1 238 ? 67.436  45.906  -5.771  1.00 73.15  ? 235  GLU A CB   1 
ATOM   3912  C  CG   . GLU A 1 238 ? 68.836  46.297  -6.170  1.00 76.52  ? 235  GLU A CG   1 
ATOM   3913  C  CD   . GLU A 1 238 ? 68.957  47.786  -6.366  1.00 80.14  ? 235  GLU A CD   1 
ATOM   3914  O  OE1  . GLU A 1 238 ? 67.973  48.396  -6.835  1.00 77.20  ? 235  GLU A OE1  1 
ATOM   3915  O  OE2  . GLU A 1 238 ? 70.041  48.341  -6.092  1.00 98.17  ? 235  GLU A OE2  1 
ATOM   3916  H  H    . GLU A 1 238 ? 65.355  44.836  -5.149  1.00 71.59  ? 235  GLU A H    1 
ATOM   3917  H  HA   . GLU A 1 238 ? 67.681  43.876  -5.842  1.00 78.74  ? 235  GLU A HA   1 
ATOM   3918  H  HB2  . GLU A 1 238 ? 66.876  45.979  -6.560  1.00 87.78  ? 235  GLU A HB2  1 
ATOM   3919  H  HB3  . GLU A 1 238 ? 67.136  46.539  -5.100  1.00 87.78  ? 235  GLU A HB3  1 
ATOM   3920  H  HG2  . GLU A 1 238 ? 69.454  46.030  -5.472  1.00 91.83  ? 235  GLU A HG2  1 
ATOM   3921  H  HG3  . GLU A 1 238 ? 69.064  45.860  -7.006  1.00 91.83  ? 235  GLU A HG3  1 
ATOM   3922  N  N    . ASN A 1 239 ? 67.557  45.067  -2.873  1.00 61.42  ? 236  ASN A N    1 
ATOM   3923  C  CA   . ASN A 1 239 ? 68.198  45.099  -1.569  1.00 53.55  ? 236  ASN A CA   1 
ATOM   3924  C  C    . ASN A 1 239 ? 67.186  45.005  -0.437  1.00 60.38  ? 236  ASN A C    1 
ATOM   3925  O  O    . ASN A 1 239 ? 65.982  44.936  -0.673  1.00 64.05  ? 236  ASN A O    1 
ATOM   3926  C  CB   . ASN A 1 239 ? 69.007  46.384  -1.421  1.00 54.39  ? 236  ASN A CB   1 
ATOM   3927  C  CG   . ASN A 1 239 ? 68.222  47.609  -1.844  1.00 61.49  ? 236  ASN A CG   1 
ATOM   3928  O  OD1  . ASN A 1 239 ? 67.164  47.903  -1.285  1.00 66.02  ? 236  ASN A OD1  1 
ATOM   3929  N  ND2  . ASN A 1 239 ? 68.736  48.334  -2.833  1.00 57.10  ? 236  ASN A ND2  1 
ATOM   3930  H  H    . ASN A 1 239 ? 66.833  45.529  -2.913  1.00 73.70  ? 236  ASN A H    1 
ATOM   3931  H  HA   . ASN A 1 239 ? 68.807  44.347  -1.494  1.00 64.26  ? 236  ASN A HA   1 
ATOM   3932  H  HB2  . ASN A 1 239 ? 69.259  46.495  -0.491  1.00 65.26  ? 236  ASN A HB2  1 
ATOM   3933  H  HB3  . ASN A 1 239 ? 69.799  46.327  -1.977  1.00 65.26  ? 236  ASN A HB3  1 
ATOM   3934  H  HD21 . ASN A 1 239 ? 69.479  48.098  -3.198  1.00 68.51  ? 236  ASN A HD21 1 
ATOM   3935  H  HD22 . ASN A 1 239 ? 68.326  49.038  -3.108  1.00 68.51  ? 236  ASN A HD22 1 
ATOM   3936  N  N    . LYS A 1 240 ? 67.687  45.049  0.792   1.00 55.30  ? 237  LYS A N    1 
ATOM   3937  C  CA   . LYS A 1 240 ? 66.877  44.800  1.971   1.00 55.05  ? 237  LYS A CA   1 
ATOM   3938  C  C    . LYS A 1 240 ? 65.831  45.881  2.187   1.00 55.83  ? 237  LYS A C    1 
ATOM   3939  O  O    . LYS A 1 240 ? 64.715  45.603  2.654   1.00 54.96  ? 237  LYS A O    1 
ATOM   3940  C  CB   . LYS A 1 240 ? 67.779  44.686  3.189   1.00 58.46  ? 237  LYS A CB   1 
ATOM   3941  C  CG   . LYS A 1 240 ? 67.060  44.313  4.458   1.00 67.80  ? 237  LYS A CG   1 
ATOM   3942  C  CD   . LYS A 1 240 ? 67.958  44.516  5.659   1.00 62.66  ? 237  LYS A CD   1 
ATOM   3943  C  CE   . LYS A 1 240 ? 67.139  44.615  6.925   1.00 52.51  ? 237  LYS A CE   1 
ATOM   3944  N  NZ   . LYS A 1 240 ? 66.421  43.335  7.195   1.00 65.81  ? 237  LYS A NZ   1 
ATOM   3945  H  H    . LYS A 1 240 ? 68.510  45.223  0.970   1.00 66.36  ? 237  LYS A H    1 
ATOM   3946  H  HA   . LYS A 1 240 ? 66.414  43.954  1.862   1.00 66.05  ? 237  LYS A HA   1 
ATOM   3947  H  HB2  . LYS A 1 240 ? 68.448  44.005  3.018   1.00 70.15  ? 237  LYS A HB2  1 
ATOM   3948  H  HB3  . LYS A 1 240 ? 68.212  45.542  3.336   1.00 70.15  ? 237  LYS A HB3  1 
ATOM   3949  H  HG2  . LYS A 1 240 ? 66.277  44.875  4.563   1.00 81.36  ? 237  LYS A HG2  1 
ATOM   3950  H  HG3  . LYS A 1 240 ? 66.804  43.378  4.421   1.00 81.36  ? 237  LYS A HG3  1 
ATOM   3951  H  HD2  . LYS A 1 240 ? 68.562  43.761  5.743   1.00 75.20  ? 237  LYS A HD2  1 
ATOM   3952  H  HD3  . LYS A 1 240 ? 68.460  45.339  5.553   1.00 75.20  ? 237  LYS A HD3  1 
ATOM   3953  H  HE2  . LYS A 1 240 ? 67.726  44.801  7.674   1.00 63.01  ? 237  LYS A HE2  1 
ATOM   3954  H  HE3  . LYS A 1 240 ? 66.481  45.321  6.828   1.00 63.01  ? 237  LYS A HE3  1 
ATOM   3955  H  HZ1  . LYS A 1 240 ? 67.007  42.672  7.289   1.00 78.97  ? 237  LYS A HZ1  1 
ATOM   3956  H  HZ2  . LYS A 1 240 ? 65.943  43.406  7.942   1.00 78.97  ? 237  LYS A HZ2  1 
ATOM   3957  H  HZ3  . LYS A 1 240 ? 65.875  43.144  6.519   1.00 78.97  ? 237  LYS A HZ3  1 
ATOM   3958  N  N    . GLU A 1 241 ? 66.206  47.113  1.861   1.00 51.78  ? 238  GLU A N    1 
ATOM   3959  C  CA   . GLU A 1 241 ? 65.315  48.249  2.011   1.00 62.09  ? 238  GLU A CA   1 
ATOM   3960  C  C    . GLU A 1 241 ? 64.062  48.018  1.164   1.00 66.97  ? 238  GLU A C    1 
ATOM   3961  O  O    . GLU A 1 241 ? 62.954  48.360  1.571   1.00 69.81  ? 238  GLU A O    1 
ATOM   3962  C  CB   . GLU A 1 241 ? 66.025  49.536  1.595   1.00 65.72  ? 238  GLU A CB   1 
ATOM   3963  C  CG   . GLU A 1 241 ? 65.143  50.784  1.595   1.00 82.31  ? 238  GLU A CG   1 
ATOM   3964  C  CD   . GLU A 1 241 ? 65.816  51.969  0.920   1.00 109.65 ? 238  GLU A CD   1 
ATOM   3965  O  OE1  . GLU A 1 241 ? 66.934  51.796  0.382   1.00 113.92 ? 238  GLU A OE1  1 
ATOM   3966  O  OE2  . GLU A 1 241 ? 65.222  53.071  0.918   1.00 108.00 ? 238  GLU A OE2  1 
ATOM   3967  H  H    . GLU A 1 241 ? 66.981  47.316  1.548   1.00 62.14  ? 238  GLU A H    1 
ATOM   3968  H  HA   . GLU A 1 241 ? 65.048  48.330  2.940   1.00 74.51  ? 238  GLU A HA   1 
ATOM   3969  H  HB2  . GLU A 1 241 ? 66.759  49.696  2.209   1.00 78.87  ? 238  GLU A HB2  1 
ATOM   3970  H  HB3  . GLU A 1 241 ? 66.371  49.422  0.696   1.00 78.87  ? 238  GLU A HB3  1 
ATOM   3971  H  HG2  . GLU A 1 241 ? 64.322  50.592  1.117   1.00 98.78  ? 238  GLU A HG2  1 
ATOM   3972  H  HG3  . GLU A 1 241 ? 64.945  51.033  2.512   1.00 98.78  ? 238  GLU A HG3  1 
ATOM   3973  N  N    . SER A 1 242 ? 64.248  47.439  -0.018  1.00 58.38  ? 239  SER A N    1 
ATOM   3974  C  CA   . SER A 1 242 ? 63.130  47.172  -0.914  1.00 68.49  ? 239  SER A CA   1 
ATOM   3975  C  C    . SER A 1 242 ? 62.426  45.866  -0.556  1.00 62.31  ? 239  SER A C    1 
ATOM   3976  O  O    . SER A 1 242 ? 61.196  45.826  -0.515  1.00 62.73  ? 239  SER A O    1 
ATOM   3977  C  CB   . SER A 1 242 ? 63.601  47.141  -2.376  1.00 61.43  ? 239  SER A CB   1 
ATOM   3978  O  OG   . SER A 1 242 ? 64.863  46.514  -2.488  1.00 79.36  ? 239  SER A OG   1 
ATOM   3979  H  H    . SER A 1 242 ? 65.013  47.190  -0.324  1.00 70.06  ? 239  SER A H    1 
ATOM   3980  H  HA   . SER A 1 242 ? 62.484  47.890  -0.827  1.00 82.18  ? 239  SER A HA   1 
ATOM   3981  H  HB2  . SER A 1 242 ? 62.955  46.648  -2.905  1.00 73.72  ? 239  SER A HB2  1 
ATOM   3982  H  HB3  . SER A 1 242 ? 63.672  48.052  -2.703  1.00 73.72  ? 239  SER A HB3  1 
ATOM   3983  H  HG   . SER A 1 242 ? 64.816  45.723  -2.207  1.00 95.23  ? 239  SER A HG   1 
ATOM   3984  N  N    . TRP A 1 243 ? 63.181  44.811  -0.255  1.00 51.89  ? 240  TRP A N    1 
ATOM   3985  C  CA   . TRP A 1 243 ? 62.543  43.520  -0.021  1.00 55.35  ? 240  TRP A CA   1 
ATOM   3986  C  C    . TRP A 1 243 ? 61.888  43.432  1.361   1.00 52.05  ? 240  TRP A C    1 
ATOM   3987  O  O    . TRP A 1 243 ? 61.023  42.581  1.584   1.00 59.78  ? 240  TRP A O    1 
ATOM   3988  C  CB   . TRP A 1 243 ? 63.540  42.367  -0.256  1.00 52.68  ? 240  TRP A CB   1 
ATOM   3989  C  CG   . TRP A 1 243 ? 64.592  42.067  0.783   1.00 61.43  ? 240  TRP A CG   1 
ATOM   3990  C  CD1  . TRP A 1 243 ? 64.446  42.023  2.149   1.00 69.01  ? 240  TRP A CD1  1 
ATOM   3991  C  CD2  . TRP A 1 243 ? 65.958  41.720  0.520   1.00 61.60  ? 240  TRP A CD2  1 
ATOM   3992  N  NE1  . TRP A 1 243 ? 65.640  41.682  2.744   1.00 59.36  ? 240  TRP A NE1  1 
ATOM   3993  C  CE2  . TRP A 1 243 ? 66.582  41.486  1.766   1.00 61.54  ? 240  TRP A CE2  1 
ATOM   3994  C  CE3  . TRP A 1 243 ? 66.715  41.588  -0.647  1.00 62.88  ? 240  TRP A CE3  1 
ATOM   3995  C  CZ2  . TRP A 1 243 ? 67.925  41.140  1.871   1.00 51.66  ? 240  TRP A CZ2  1 
ATOM   3996  C  CZ3  . TRP A 1 243 ? 68.047  41.241  -0.538  1.00 65.67  ? 240  TRP A CZ3  1 
ATOM   3997  C  CH2  . TRP A 1 243 ? 68.636  41.013  0.712   1.00 52.27  ? 240  TRP A CH2  1 
ATOM   3998  H  H    . TRP A 1 243 ? 64.038  44.815  -0.183  1.00 62.26  ? 240  TRP A H    1 
ATOM   3999  H  HA   . TRP A 1 243 ? 61.834  43.416  -0.674  1.00 66.42  ? 240  TRP A HA   1 
ATOM   4000  H  HB2  . TRP A 1 243 ? 63.024  41.554  -0.370  1.00 63.22  ? 240  TRP A HB2  1 
ATOM   4001  H  HB3  . TRP A 1 243 ? 64.013  42.555  -1.082  1.00 63.22  ? 240  TRP A HB3  1 
ATOM   4002  H  HD1  . TRP A 1 243 ? 63.655  42.197  2.605   1.00 82.81  ? 240  TRP A HD1  1 
ATOM   4003  H  HE1  . TRP A 1 243 ? 65.773  41.601  3.590   1.00 71.23  ? 240  TRP A HE1  1 
ATOM   4004  H  HE3  . TRP A 1 243 ? 66.329  41.730  -1.481  1.00 75.45  ? 240  TRP A HE3  1 
ATOM   4005  H  HZ2  . TRP A 1 243 ? 68.322  40.994  2.699   1.00 61.99  ? 240  TRP A HZ2  1 
ATOM   4006  H  HZ3  . TRP A 1 243 ? 68.559  41.147  -1.308  1.00 78.80  ? 240  TRP A HZ3  1 
ATOM   4007  H  HH2  . TRP A 1 243 ? 69.537  40.785  0.754   1.00 62.72  ? 240  TRP A HH2  1 
ATOM   4008  N  N    . ASP A 1 244 ? 62.238  44.324  2.279   1.00 48.28  ? 241  ASP A N    1 
ATOM   4009  C  CA   . ASP A 1 244 ? 61.527  44.331  3.549   1.00 55.49  ? 241  ASP A CA   1 
ATOM   4010  C  C    . ASP A 1 244 ? 60.079  44.762  3.328   1.00 52.56  ? 241  ASP A C    1 
ATOM   4011  O  O    . ASP A 1 244 ? 59.147  44.249  3.976   1.00 49.44  ? 241  ASP A O    1 
ATOM   4012  C  CB   . ASP A 1 244 ? 62.206  45.260  4.550   1.00 58.66  ? 241  ASP A CB   1 
ATOM   4013  C  CG   . ASP A 1 244 ? 63.410  44.617  5.219   1.00 67.14  ? 241  ASP A CG   1 
ATOM   4014  O  OD1  . ASP A 1 244 ? 63.527  43.369  5.186   1.00 76.28  ? 241  ASP A OD1  1 
ATOM   4015  O  OD2  . ASP A 1 244 ? 64.222  45.362  5.812   1.00 66.85  ? 241  ASP A OD2  1 
ATOM   4016  H  H    . ASP A 1 244 ? 62.858  44.913  2.198   1.00 57.94  ? 241  ASP A H    1 
ATOM   4017  H  HA   . ASP A 1 244 ? 61.525  43.435  3.919   1.00 66.59  ? 241  ASP A HA   1 
ATOM   4018  H  HB2  . ASP A 1 244 ? 62.510  46.057  4.088   1.00 70.39  ? 241  ASP A HB2  1 
ATOM   4019  H  HB3  . ASP A 1 244 ? 61.570  45.499  5.242   1.00 70.39  ? 241  ASP A HB3  1 
ATOM   4020  N  N    . LYS A 1 245 ? 59.888  45.666  2.373   1.00 52.73  ? 242  LYS A N    1 
ATOM   4021  C  CA   . LYS A 1 245 ? 58.554  46.132  2.024   1.00 57.44  ? 242  LYS A CA   1 
ATOM   4022  C  C    . LYS A 1 245 ? 57.701  44.965  1.543   1.00 56.09  ? 242  LYS A C    1 
ATOM   4023  O  O    . LYS A 1 245 ? 56.499  44.906  1.827   1.00 48.68  ? 242  LYS A O    1 
ATOM   4024  C  CB   . LYS A 1 245 ? 58.630  47.214  0.952   1.00 57.32  ? 242  LYS A CB   1 
ATOM   4025  C  CG   . LYS A 1 245 ? 59.347  48.464  1.406   1.00 57.60  ? 242  LYS A CG   1 
ATOM   4026  C  CD   . LYS A 1 245 ? 59.656  49.386  0.250   1.00 74.43  ? 242  LYS A CD   1 
ATOM   4027  C  CE   . LYS A 1 245 ? 60.440  50.607  0.718   1.00 75.60  ? 242  LYS A CE   1 
ATOM   4028  N  NZ   . LYS A 1 245 ? 60.765  51.534  -0.410  1.00 85.42  ? 242  LYS A NZ   1 
ATOM   4029  H  H    . LYS A 1 245 ? 60.518  46.025  1.910   1.00 63.28  ? 242  LYS A H    1 
ATOM   4030  H  HA   . LYS A 1 245 ? 58.133  46.513  2.811   1.00 68.93  ? 242  LYS A HA   1 
ATOM   4031  H  HB2  . LYS A 1 245 ? 59.105  46.861  0.184   1.00 68.79  ? 242  LYS A HB2  1 
ATOM   4032  H  HB3  . LYS A 1 245 ? 57.729  47.464  0.695   1.00 68.79  ? 242  LYS A HB3  1 
ATOM   4033  H  HG2  . LYS A 1 245 ? 58.785  48.944  2.034   1.00 69.12  ? 242  LYS A HG2  1 
ATOM   4034  H  HG3  . LYS A 1 245 ? 60.184  48.216  1.828   1.00 69.12  ? 242  LYS A HG3  1 
ATOM   4035  H  HD2  . LYS A 1 245 ? 60.191  48.912  -0.405  1.00 89.31  ? 242  LYS A HD2  1 
ATOM   4036  H  HD3  . LYS A 1 245 ? 58.826  49.690  -0.149  1.00 89.31  ? 242  LYS A HD3  1 
ATOM   4037  H  HE2  . LYS A 1 245 ? 59.910  51.095  1.367   1.00 90.72  ? 242  LYS A HE2  1 
ATOM   4038  H  HE3  . LYS A 1 245 ? 61.273  50.315  1.119   1.00 90.72  ? 242  LYS A HE3  1 
ATOM   4039  H  HZ1  . LYS A 1 245 ? 60.014  51.821  -0.793  1.00 102.50 ? 242  LYS A HZ1  1 
ATOM   4040  H  HZ2  . LYS A 1 245 ? 61.221  52.234  -0.106  1.00 102.50 ? 242  LYS A HZ2  1 
ATOM   4041  H  HZ3  . LYS A 1 245 ? 61.256  51.111  -1.019  1.00 102.50 ? 242  LYS A HZ3  1 
ATOM   4042  N  N    . ILE A 1 246 ? 58.325  44.038  0.819   1.00 45.23  ? 243  ILE A N    1 
ATOM   4043  C  CA   . ILE A 1 246 ? 57.628  42.836  0.375   1.00 42.58  ? 243  ILE A CA   1 
ATOM   4044  C  C    . ILE A 1 246 ? 57.441  41.878  1.526   1.00 47.28  ? 243  ILE A C    1 
ATOM   4045  O  O    . ILE A 1 246 ? 56.384  41.251  1.648   1.00 50.52  ? 243  ILE A O    1 
ATOM   4046  C  CB   . ILE A 1 246 ? 58.381  42.146  -0.767  1.00 58.92  ? 243  ILE A CB   1 
ATOM   4047  C  CG1  . ILE A 1 246 ? 58.148  42.924  -2.066  1.00 48.97  ? 243  ILE A CG1  1 
ATOM   4048  C  CG2  . ILE A 1 246 ? 57.889  40.702  -0.965  1.00 53.17  ? 243  ILE A CG2  1 
ATOM   4049  C  CD1  . ILE A 1 246 ? 59.070  42.526  -3.159  1.00 66.28  ? 243  ILE A CD1  1 
ATOM   4050  H  H    . ILE A 1 246 ? 59.148  44.082  0.574   1.00 54.28  ? 243  ILE A H    1 
ATOM   4051  H  HA   . ILE A 1 246 ? 56.750  43.085  0.046   1.00 51.10  ? 243  ILE A HA   1 
ATOM   4052  H  HB   . ILE A 1 246 ? 59.330  42.136  -0.565  1.00 70.71  ? 243  ILE A HB   1 
ATOM   4053  H  HG12 . ILE A 1 246 ? 57.240  42.766  -2.369  1.00 58.77  ? 243  ILE A HG12 1 
ATOM   4054  H  HG13 . ILE A 1 246 ? 58.280  43.870  -1.895  1.00 58.77  ? 243  ILE A HG13 1 
ATOM   4055  H  HG21 . ILE A 1 246 ? 56.943  40.717  -1.178  1.00 63.81  ? 243  ILE A HG21 1 
ATOM   4056  H  HG22 . ILE A 1 246 ? 58.386  40.296  -1.693  1.00 63.81  ? 243  ILE A HG22 1 
ATOM   4057  H  HG23 . ILE A 1 246 ? 58.036  40.203  -0.146  1.00 63.81  ? 243  ILE A HG23 1 
ATOM   4058  H  HD11 . ILE A 1 246 ? 58.944  41.583  -3.350  1.00 79.54  ? 243  ILE A HD11 1 
ATOM   4059  H  HD12 . ILE A 1 246 ? 58.870  43.053  -3.948  1.00 79.54  ? 243  ILE A HD12 1 
ATOM   4060  H  HD13 . ILE A 1 246 ? 59.983  42.687  -2.875  1.00 79.54  ? 243  ILE A HD13 1 
ATOM   4061  N  N    . LEU A 1 247 ? 58.439  41.780  2.399   1.00 53.73  ? 244  LEU A N    1 
ATOM   4062  C  CA   . LEU A 1 247 ? 58.292  40.910  3.561   1.00 46.20  ? 244  LEU A CA   1 
ATOM   4063  C  C    . LEU A 1 247 ? 57.197  41.425  4.492   1.00 43.98  ? 244  LEU A C    1 
ATOM   4064  O  O    . LEU A 1 247 ? 56.572  40.648  5.214   1.00 44.14  ? 244  LEU A O    1 
ATOM   4065  C  CB   . LEU A 1 247 ? 59.610  40.804  4.322   1.00 59.56  ? 244  LEU A CB   1 
ATOM   4066  C  CG   . LEU A 1 247 ? 60.711  39.953  3.693   1.00 60.14  ? 244  LEU A CG   1 
ATOM   4067  C  CD1  . LEU A 1 247 ? 61.878  39.894  4.656   1.00 56.54  ? 244  LEU A CD1  1 
ATOM   4068  C  CD2  . LEU A 1 247 ? 60.230  38.546  3.346   1.00 50.10  ? 244  LEU A CD2  1 
ATOM   4069  H  H    . LEU A 1 247 ? 59.191  42.193  2.346   1.00 64.47  ? 244  LEU A H    1 
ATOM   4070  H  HA   . LEU A 1 247 ? 58.043  40.021  3.264   1.00 55.44  ? 244  LEU A HA   1 
ATOM   4071  H  HB2  . LEU A 1 247 ? 59.969  41.699  4.430   1.00 71.47  ? 244  LEU A HB2  1 
ATOM   4072  H  HB3  . LEU A 1 247 ? 59.424  40.427  5.197   1.00 71.47  ? 244  LEU A HB3  1 
ATOM   4073  H  HG   . LEU A 1 247 ? 61.015  40.378  2.875   1.00 72.16  ? 244  LEU A HG   1 
ATOM   4074  H  HD11 . LEU A 1 247 ? 61.580  39.495  5.489   1.00 67.85  ? 244  LEU A HD11 1 
ATOM   4075  H  HD12 . LEU A 1 247 ? 62.583  39.355  4.265   1.00 67.85  ? 244  LEU A HD12 1 
ATOM   4076  H  HD13 . LEU A 1 247 ? 62.200  40.795  4.817   1.00 67.85  ? 244  LEU A HD13 1 
ATOM   4077  H  HD21 . LEU A 1 247 ? 59.496  38.611  2.715   1.00 60.12  ? 244  LEU A HD21 1 
ATOM   4078  H  HD22 . LEU A 1 247 ? 60.964  38.050  2.951   1.00 60.12  ? 244  LEU A HD22 1 
ATOM   4079  H  HD23 . LEU A 1 247 ? 59.931  38.106  4.157   1.00 60.12  ? 244  LEU A HD23 1 
ATOM   4080  N  N    . ALA A 1 248 ? 56.925  42.726  4.435   1.00 50.09  ? 245  ALA A N    1 
ATOM   4081  C  CA   . ALA A 1 248 ? 55.832  43.292  5.218   1.00 41.89  ? 245  ALA A CA   1 
ATOM   4082  C  C    . ALA A 1 248 ? 54.458  42.793  4.750   1.00 47.87  ? 245  ALA A C    1 
ATOM   4083  O  O    . ALA A 1 248 ? 53.464  42.957  5.460   1.00 47.74  ? 245  ALA A O    1 
ATOM   4084  C  CB   . ALA A 1 248 ? 55.879  44.786  5.152   1.00 53.64  ? 245  ALA A CB   1 
ATOM   4085  H  H    . ALA A 1 248 ? 57.353  43.297  3.955   1.00 60.11  ? 245  ALA A H    1 
ATOM   4086  H  HA   . ALA A 1 248 ? 55.943  43.031  6.146   1.00 50.26  ? 245  ALA A HA   1 
ATOM   4087  H  HB1  . ALA A 1 248 ? 55.792  45.064  4.227   1.00 64.36  ? 245  ALA A HB1  1 
ATOM   4088  H  HB2  . ALA A 1 248 ? 55.149  45.149  5.677   1.00 64.36  ? 245  ALA A HB2  1 
ATOM   4089  H  HB3  . ALA A 1 248 ? 56.728  45.091  5.511   1.00 64.36  ? 245  ALA A HB3  1 
ATOM   4090  N  N    . LEU A 1 249 ? 54.396  42.220  3.547   1.00 48.01  ? 246  LEU A N    1 
ATOM   4091  C  CA   . LEU A 1 249 ? 53.132  41.751  2.975   1.00 56.11  ? 246  LEU A CA   1 
ATOM   4092  C  C    . LEU A 1 249 ? 52.912  40.250  3.212   1.00 51.20  ? 246  LEU A C    1 
ATOM   4093  O  O    . LEU A 1 249 ? 51.887  39.699  2.810   1.00 57.98  ? 246  LEU A O    1 
ATOM   4094  C  CB   . LEU A 1 249 ? 53.091  42.046  1.470   1.00 50.72  ? 246  LEU A CB   1 
ATOM   4095  C  CG   . LEU A 1 249 ? 53.457  43.481  1.097   1.00 44.16  ? 246  LEU A CG   1 
ATOM   4096  C  CD1  . LEU A 1 249 ? 53.330  43.688  -0.391  1.00 47.71  ? 246  LEU A CD1  1 
ATOM   4097  C  CD2  . LEU A 1 249 ? 52.572  44.474  1.841   1.00 51.34  ? 246  LEU A CD2  1 
ATOM   4098  H  H    . LEU A 1 249 ? 55.077  42.090  3.038   1.00 57.61  ? 246  LEU A H    1 
ATOM   4099  H  HA   . LEU A 1 249 ? 52.401  42.230  3.394   1.00 67.33  ? 246  LEU A HA   1 
ATOM   4100  H  HB2  . LEU A 1 249 ? 53.716  41.456  1.021   1.00 60.86  ? 246  LEU A HB2  1 
ATOM   4101  H  HB3  . LEU A 1 249 ? 52.192  41.878  1.146   1.00 60.86  ? 246  LEU A HB3  1 
ATOM   4102  H  HG   . LEU A 1 249 ? 54.379  43.650  1.348   1.00 52.99  ? 246  LEU A HG   1 
ATOM   4103  H  HD11 . LEU A 1 249 ? 52.413  43.514  -0.656  1.00 57.25  ? 246  LEU A HD11 1 
ATOM   4104  H  HD12 . LEU A 1 249 ? 53.567  44.605  -0.603  1.00 57.25  ? 246  LEU A HD12 1 
ATOM   4105  H  HD13 . LEU A 1 249 ? 53.929  43.077  -0.847  1.00 57.25  ? 246  LEU A HD13 1 
ATOM   4106  H  HD21 . LEU A 1 249 ? 52.695  44.352  2.796   1.00 61.60  ? 246  LEU A HD21 1 
ATOM   4107  H  HD22 . LEU A 1 249 ? 52.824  45.375  1.587   1.00 61.60  ? 246  LEU A HD22 1 
ATOM   4108  H  HD23 . LEU A 1 249 ? 51.645  44.310  1.604   1.00 61.60  ? 246  LEU A HD23 1 
ATOM   4109  N  N    . VAL A 1 250 ? 53.862  39.599  3.876   1.00 50.97  ? 247  VAL A N    1 
ATOM   4110  C  CA   . VAL A 1 250 ? 53.762  38.167  4.146   1.00 53.26  ? 247  VAL A CA   1 
ATOM   4111  C  C    . VAL A 1 250 ? 53.918  37.917  5.635   1.00 48.66  ? 247  VAL A C    1 
ATOM   4112  O  O    . VAL A 1 250 ? 54.505  38.741  6.334   1.00 47.45  ? 247  VAL A O    1 
ATOM   4113  C  CB   . VAL A 1 250 ? 54.823  37.372  3.380   1.00 48.90  ? 247  VAL A CB   1 
ATOM   4114  C  CG1  . VAL A 1 250 ? 54.651  37.604  1.879   1.00 47.25  ? 247  VAL A CG1  1 
ATOM   4115  C  CG2  . VAL A 1 250 ? 56.224  37.786  3.823   1.00 51.94  ? 247  VAL A CG2  1 
ATOM   4116  H  H    . VAL A 1 250 ? 54.577  39.965  4.181   1.00 61.16  ? 247  VAL A H    1 
ATOM   4117  H  HA   . VAL A 1 250 ? 52.887  37.849  3.874   1.00 63.91  ? 247  VAL A HA   1 
ATOM   4118  H  HB   . VAL A 1 250 ? 54.711  36.426  3.560   1.00 58.68  ? 247  VAL A HB   1 
ATOM   4119  H  HG11 . VAL A 1 250 ? 54.754  38.550  1.692   1.00 56.70  ? 247  VAL A HG11 1 
ATOM   4120  H  HG12 . VAL A 1 250 ? 55.327  37.097  1.402   1.00 56.70  ? 247  VAL A HG12 1 
ATOM   4121  H  HG13 . VAL A 1 250 ? 53.767  37.308  1.614   1.00 56.70  ? 247  VAL A HG13 1 
ATOM   4122  H  HG21 . VAL A 1 250 ? 56.319  37.612  4.772   1.00 62.33  ? 247  VAL A HG21 1 
ATOM   4123  H  HG22 . VAL A 1 250 ? 56.878  37.270  3.325   1.00 62.33  ? 247  VAL A HG22 1 
ATOM   4124  H  HG23 . VAL A 1 250 ? 56.345  38.732  3.645   1.00 62.33  ? 247  VAL A HG23 1 
ATOM   4125  N  N    . PRO A 1 251 ? 53.422  36.767  6.121   1.00 56.35  ? 248  PRO A N    1 
ATOM   4126  C  CA   . PRO A 1 251 ? 53.499  36.396  7.543   1.00 41.37  ? 248  PRO A CA   1 
ATOM   4127  C  C    . PRO A 1 251 ? 54.924  36.383  8.058   1.00 48.61  ? 248  PRO A C    1 
ATOM   4128  O  O    . PRO A 1 251 ? 55.844  36.021  7.325   1.00 51.71  ? 248  PRO A O    1 
ATOM   4129  C  CB   . PRO A 1 251 ? 52.916  34.989  7.573   1.00 49.98  ? 248  PRO A CB   1 
ATOM   4130  C  CG   . PRO A 1 251 ? 52.051  34.906  6.371   1.00 57.83  ? 248  PRO A CG   1 
ATOM   4131  C  CD   . PRO A 1 251 ? 52.703  35.760  5.327   1.00 43.05  ? 248  PRO A CD   1 
ATOM   4132  H  HA   . PRO A 1 251 ? 52.956  36.989  8.085   1.00 49.64  ? 248  PRO A HA   1 
ATOM   4133  H  HB2  . PRO A 1 251 ? 53.633  34.337  7.526   1.00 59.98  ? 248  PRO A HB2  1 
ATOM   4134  H  HB3  . PRO A 1 251 ? 52.394  34.868  8.381   1.00 59.98  ? 248  PRO A HB3  1 
ATOM   4135  H  HG2  . PRO A 1 251 ? 51.999  33.985  6.073   1.00 69.39  ? 248  PRO A HG2  1 
ATOM   4136  H  HG3  . PRO A 1 251 ? 51.168  35.246  6.584   1.00 69.39  ? 248  PRO A HG3  1 
ATOM   4137  H  HD2  . PRO A 1 251 ? 53.327  35.235  4.801   1.00 51.66  ? 248  PRO A HD2  1 
ATOM   4138  H  HD3  . PRO A 1 251 ? 52.033  36.183  4.769   1.00 51.66  ? 248  PRO A HD3  1 
ATOM   4139  N  N    . GLU A 1 252 ? 55.088  36.721  9.329   1.00 57.61  ? 249  GLU A N    1 
ATOM   4140  C  CA   . GLU A 1 252 ? 56.408  36.836  9.927   1.00 58.07  ? 249  GLU A CA   1 
ATOM   4141  C  C    . GLU A 1 252 ? 57.160  35.506  9.942   1.00 56.32  ? 249  GLU A C    1 
ATOM   4142  O  O    . GLU A 1 252 ? 58.386  35.486  9.847   1.00 56.66  ? 249  GLU A O    1 
ATOM   4143  C  CB   . GLU A 1 252 ? 56.282  37.360  11.350  1.00 55.99  ? 249  GLU A CB   1 
ATOM   4144  C  CG   . GLU A 1 252 ? 57.615  37.634  12.015  1.00 66.82  ? 249  GLU A CG   1 
ATOM   4145  C  CD   . GLU A 1 252 ? 58.155  36.411  12.740  1.00 72.98  ? 249  GLU A CD   1 
ATOM   4146  O  OE1  . GLU A 1 252 ? 57.329  35.619  13.257  1.00 63.93  ? 249  GLU A OE1  1 
ATOM   4147  O  OE2  . GLU A 1 252 ? 59.402  36.252  12.805  1.00 61.17  ? 249  GLU A OE2  1 
ATOM   4148  H  H    . GLU A 1 252 ? 54.443  36.892  9.871   1.00 69.13  ? 249  GLU A H    1 
ATOM   4149  H  HA   . GLU A 1 252 ? 56.933  37.473  9.417   1.00 69.68  ? 249  GLU A HA   1 
ATOM   4150  H  HB2  . GLU A 1 252 ? 55.781  38.190  11.335  1.00 67.19  ? 249  GLU A HB2  1 
ATOM   4151  H  HB3  . GLU A 1 252 ? 55.812  36.702  11.885  1.00 67.19  ? 249  GLU A HB3  1 
ATOM   4152  H  HG2  . GLU A 1 252 ? 58.261  37.893  11.339  1.00 80.18  ? 249  GLU A HG2  1 
ATOM   4153  H  HG3  . GLU A 1 252 ? 57.507  38.346  12.664  1.00 80.18  ? 249  GLU A HG3  1 
ATOM   4154  N  N    . THR A 1 253 ? 56.419  34.400  10.016  1.00 55.71  ? 250  THR A N    1 
ATOM   4155  C  CA   . THR A 1 253 ? 57.016  33.081  10.215  1.00 50.67  ? 250  THR A CA   1 
ATOM   4156  C  C    . THR A 1 253 ? 57.869  32.641  9.030   1.00 46.67  ? 250  THR A C    1 
ATOM   4157  O  O    . THR A 1 253 ? 58.606  31.667  9.138   1.00 52.24  ? 250  THR A O    1 
ATOM   4158  C  CB   . THR A 1 253 ? 55.938  31.990  10.473  1.00 54.09  ? 250  THR A CB   1 
ATOM   4159  O  OG1  . THR A 1 253 ? 55.194  31.736  9.275   1.00 63.92  ? 250  THR A OG1  1 
ATOM   4160  C  CG2  . THR A 1 253 ? 54.994  32.412  11.589  1.00 54.40  ? 250  THR A CG2  1 
ATOM   4161  H  H    . THR A 1 253 ? 55.561  34.389  9.954   1.00 66.85  ? 250  THR A H    1 
ATOM   4162  H  HA   . THR A 1 253 ? 57.592  33.116  10.995  1.00 60.81  ? 250  THR A HA   1 
ATOM   4163  H  HB   . THR A 1 253 ? 56.378  31.171  10.748  1.00 64.91  ? 250  THR A HB   1 
ATOM   4164  H  HG1  . THR A 1 253 ? 54.612  31.147  9.418   1.00 76.70  ? 250  THR A HG1  1 
ATOM   4165  H  HG21 . THR A 1 253 ? 54.545  33.238  11.349  1.00 65.27  ? 250  THR A HG21 1 
ATOM   4166  H  HG22 . THR A 1 253 ? 54.328  31.723  11.738  1.00 65.27  ? 250  THR A HG22 1 
ATOM   4167  H  HG23 . THR A 1 253 ? 55.493  32.551  12.409  1.00 65.27  ? 250  THR A HG23 1 
ATOM   4168  N  N    . ILE A 1 254 ? 57.821  33.378  7.924   1.00 41.38  ? 251  ILE A N    1 
ATOM   4169  C  CA   . ILE A 1 254 ? 58.648  33.039  6.773   1.00 47.73  ? 251  ILE A CA   1 
ATOM   4170  C  C    . ILE A 1 254 ? 59.672  34.116  6.480   1.00 48.18  ? 251  ILE A C    1 
ATOM   4171  O  O    . ILE A 1 254 ? 60.417  34.032  5.494   1.00 45.21  ? 251  ILE A O    1 
ATOM   4172  C  CB   . ILE A 1 254 ? 57.799  32.798  5.501   1.00 44.94  ? 251  ILE A CB   1 
ATOM   4173  C  CG1  . ILE A 1 254 ? 57.214  34.106  4.953   1.00 42.19  ? 251  ILE A CG1  1 
ATOM   4174  C  CG2  . ILE A 1 254 ? 56.686  31.804  5.806   1.00 46.81  ? 251  ILE A CG2  1 
ATOM   4175  C  CD1  . ILE A 1 254 ? 56.631  33.974  3.547   1.00 42.91  ? 251  ILE A CD1  1 
ATOM   4176  H  H    . ILE A 1 254 ? 57.324  34.072  7.816   1.00 49.65  ? 251  ILE A H    1 
ATOM   4177  H  HA   . ILE A 1 254 ? 59.129  32.219  6.966   1.00 57.28  ? 251  ILE A HA   1 
ATOM   4178  H  HB   . ILE A 1 254 ? 58.373  32.414  4.820   1.00 53.92  ? 251  ILE A HB   1 
ATOM   4179  H  HG12 . ILE A 1 254 ? 56.503  34.402  5.543   1.00 50.63  ? 251  ILE A HG12 1 
ATOM   4180  H  HG13 . ILE A 1 254 ? 57.916  34.775  4.922   1.00 50.63  ? 251  ILE A HG13 1 
ATOM   4181  H  HG21 . ILE A 1 254 ? 56.123  32.166  6.509   1.00 56.17  ? 251  ILE A HG21 1 
ATOM   4182  H  HG22 . ILE A 1 254 ? 56.161  31.662  5.002   1.00 56.17  ? 251  ILE A HG22 1 
ATOM   4183  H  HG23 . ILE A 1 254 ? 57.081  30.967  6.096   1.00 56.17  ? 251  ILE A HG23 1 
ATOM   4184  H  HD11 . ILE A 1 254 ? 55.918  33.316  3.562   1.00 51.50  ? 251  ILE A HD11 1 
ATOM   4185  H  HD12 . ILE A 1 254 ? 56.282  34.834  3.269   1.00 51.50  ? 251  ILE A HD12 1 
ATOM   4186  H  HD13 . ILE A 1 254 ? 57.333  33.689  2.941   1.00 51.50  ? 251  ILE A HD13 1 
ATOM   4187  N  N    . HIS A 1 255 ? 59.739  35.106  7.359   1.00 45.01  ? 252  HIS A N    1 
ATOM   4188  C  CA   . HIS A 1 255 ? 60.667  36.206  7.163   1.00 57.43  ? 252  HIS A CA   1 
ATOM   4189  C  C    . HIS A 1 255 ? 62.137  35.788  7.184   1.00 57.27  ? 252  HIS A C    1 
ATOM   4190  O  O    . HIS A 1 255 ? 62.897  36.126  6.274   1.00 54.37  ? 252  HIS A O    1 
ATOM   4191  C  CB   . HIS A 1 255 ? 60.418  37.257  8.230   1.00 53.97  ? 252  HIS A CB   1 
ATOM   4192  C  CG   . HIS A 1 255 ? 59.226  38.109  7.948   1.00 58.61  ? 252  HIS A CG   1 
ATOM   4193  N  ND1  . HIS A 1 255 ? 58.973  39.281  8.622   1.00 60.82  ? 252  HIS A ND1  1 
ATOM   4194  C  CD2  . HIS A 1 255 ? 58.217  37.959  7.059   1.00 50.19  ? 252  HIS A CD2  1 
ATOM   4195  C  CE1  . HIS A 1 255 ? 57.856  39.814  8.165   1.00 45.50  ? 252  HIS A CE1  1 
ATOM   4196  N  NE2  . HIS A 1 255 ? 57.376  39.030  7.220   1.00 53.69  ? 252  HIS A NE2  1 
ATOM   4197  H  H    . HIS A 1 255 ? 59.262  35.164  8.072   1.00 54.01  ? 252  HIS A H    1 
ATOM   4198  H  HA   . HIS A 1 255 ? 60.489  36.612  6.300   1.00 68.91  ? 252  HIS A HA   1 
ATOM   4199  H  HB2  . HIS A 1 255 ? 60.274  36.814  9.081   1.00 64.76  ? 252  HIS A HB2  1 
ATOM   4200  H  HB3  . HIS A 1 255 ? 61.193  37.838  8.287   1.00 64.76  ? 252  HIS A HB3  1 
ATOM   4201  H  HD1  . HIS A 1 255 ? 59.463  39.612  9.246   1.00 72.99  ? 252  HIS A HD1  1 
ATOM   4202  H  HD2  . HIS A 1 255 ? 58.109  37.257  6.459   1.00 60.23  ? 252  HIS A HD2  1 
ATOM   4203  H  HE1  . HIS A 1 255 ? 57.471  40.608  8.461   1.00 54.60  ? 252  HIS A HE1  1 
ATOM   4204  H  HE2  . HIS A 1 255 ? 56.657  39.172  6.770   1.00 64.43  ? 252  HIS A HE2  1 
ATOM   4205  N  N    . ASP A 1 256 ? 62.540  35.064  8.220   1.00 52.50  ? 253  ASP A N    1 
ATOM   4206  C  CA   . ASP A 1 256 ? 63.938  34.714  8.367   1.00 56.23  ? 253  ASP A CA   1 
ATOM   4207  C  C    . ASP A 1 256 ? 64.427  33.848  7.224   1.00 56.96  ? 253  ASP A C    1 
ATOM   4208  O  O    . ASP A 1 256 ? 65.428  34.168  6.579   1.00 56.83  ? 253  ASP A O    1 
ATOM   4209  C  CB   . ASP A 1 256 ? 64.130  34.005  9.700   1.00 55.37  ? 253  ASP A CB   1 
ATOM   4210  C  CG   . ASP A 1 256 ? 63.739  34.885  10.870  1.00 69.03  ? 253  ASP A CG   1 
ATOM   4211  O  OD1  . ASP A 1 256 ? 63.915  36.119  10.763  1.00 69.54  ? 253  ASP A OD1  1 
ATOM   4212  O  OD2  . ASP A 1 256 ? 63.198  34.357  11.868  1.00 71.90  ? 253  ASP A OD2  1 
ATOM   4213  H  H    . ASP A 1 256 ? 62.027  34.767  8.843   1.00 63.00  ? 253  ASP A H    1 
ATOM   4214  H  HA   . ASP A 1 256 ? 64.468  35.526  8.378   1.00 67.48  ? 253  ASP A HA   1 
ATOM   4215  H  HB2  . ASP A 1 256 ? 63.576  33.209  9.721   1.00 66.44  ? 253  ASP A HB2  1 
ATOM   4216  H  HB3  . ASP A 1 256 ? 65.065  33.765  9.801   1.00 66.44  ? 253  ASP A HB3  1 
ATOM   4217  N  N    . GLU A 1 257 ? 63.636  32.842  6.878   1.00 57.41  ? 254  GLU A N    1 
ATOM   4218  C  CA   . GLU A 1 257 ? 63.992  31.953  5.786   1.00 56.97  ? 254  GLU A CA   1 
ATOM   4219  C  C    . GLU A 1 257 ? 64.212  32.764  4.516   1.00 54.71  ? 254  GLU A C    1 
ATOM   4220  O  O    . GLU A 1 257 ? 65.241  32.624  3.860   1.00 60.65  ? 254  GLU A O    1 
ATOM   4221  C  CB   . GLU A 1 257 ? 62.911  30.888  5.571   1.00 62.39  ? 254  GLU A CB   1 
ATOM   4222  C  CG   . GLU A 1 257 ? 63.160  30.002  4.346   1.00 61.50  ? 254  GLU A CG   1 
ATOM   4223  C  CD   . GLU A 1 257 ? 62.236  28.798  4.280   1.00 60.80  ? 254  GLU A CD   1 
ATOM   4224  O  OE1  . GLU A 1 257 ? 61.215  28.767  5.014   1.00 59.81  ? 254  GLU A OE1  1 
ATOM   4225  O  OE2  . GLU A 1 257 ? 62.547  27.872  3.499   1.00 58.71  ? 254  GLU A OE2  1 
ATOM   4226  H  H    . GLU A 1 257 ? 62.890  32.653  7.261   1.00 68.89  ? 254  GLU A H    1 
ATOM   4227  H  HA   . GLU A 1 257 ? 64.822  31.500  6.002   1.00 68.37  ? 254  GLU A HA   1 
ATOM   4228  H  HB2  . GLU A 1 257 ? 62.878  30.314  6.352   1.00 74.87  ? 254  GLU A HB2  1 
ATOM   4229  H  HB3  . GLU A 1 257 ? 62.056  31.330  5.450   1.00 74.87  ? 254  GLU A HB3  1 
ATOM   4230  H  HG2  . GLU A 1 257 ? 63.021  30.529  3.543   1.00 73.80  ? 254  GLU A HG2  1 
ATOM   4231  H  HG3  . GLU A 1 257 ? 64.073  29.676  4.374   1.00 73.80  ? 254  GLU A HG3  1 
ATOM   4232  N  N    . LEU A 1 258 ? 63.287  33.667  4.212   1.00 54.67  ? 255  LEU A N    1 
ATOM   4233  C  CA   . LEU A 1 258 ? 63.384  34.445  2.987   1.00 51.18  ? 255  LEU A CA   1 
ATOM   4234  C  C    . LEU A 1 258 ? 64.562  35.410  3.055   1.00 60.96  ? 255  LEU A C    1 
ATOM   4235  O  O    . LEU A 1 258 ? 65.242  35.645  2.051   1.00 52.73  ? 255  LEU A O    1 
ATOM   4236  C  CB   . LEU A 1 258 ? 62.085  35.209  2.750   1.00 51.67  ? 255  LEU A CB   1 
ATOM   4237  C  CG   . LEU A 1 258 ? 60.930  34.404  2.149   1.00 66.08  ? 255  LEU A CG   1 
ATOM   4238  C  CD1  . LEU A 1 258 ? 59.681  35.259  2.085   1.00 55.61  ? 255  LEU A CD1  1 
ATOM   4239  C  CD2  . LEU A 1 258 ? 61.278  33.890  0.749   1.00 59.13  ? 255  LEU A CD2  1 
ATOM   4240  H  H    . LEU A 1 258 ? 62.598  33.846  4.695   1.00 65.60  ? 255  LEU A H    1 
ATOM   4241  H  HA   . LEU A 1 258 ? 63.525  33.846  2.238   1.00 61.41  ? 255  LEU A HA   1 
ATOM   4242  H  HB2  . LEU A 1 258 ? 61.779  35.561  3.601   1.00 62.01  ? 255  LEU A HB2  1 
ATOM   4243  H  HB3  . LEU A 1 258 ? 62.270  35.944  2.145   1.00 62.01  ? 255  LEU A HB3  1 
ATOM   4244  H  HG   . LEU A 1 258 ? 60.745  33.639  2.716   1.00 79.30  ? 255  LEU A HG   1 
ATOM   4245  H  HD11 . LEU A 1 258 ? 59.858  36.034  1.531   1.00 66.73  ? 255  LEU A HD11 1 
ATOM   4246  H  HD12 . LEU A 1 258 ? 58.960  34.735  1.703   1.00 66.73  ? 255  LEU A HD12 1 
ATOM   4247  H  HD13 . LEU A 1 258 ? 59.446  35.540  2.983   1.00 66.73  ? 255  LEU A HD13 1 
ATOM   4248  H  HD21 . LEU A 1 258 ? 62.059  33.318  0.808   1.00 70.95  ? 255  LEU A HD21 1 
ATOM   4249  H  HD22 . LEU A 1 258 ? 60.525  33.386  0.402   1.00 70.95  ? 255  LEU A HD22 1 
ATOM   4250  H  HD23 . LEU A 1 258 ? 61.464  34.647  0.172   1.00 70.95  ? 255  LEU A HD23 1 
ATOM   4251  N  N    . GLN A 1 259 ? 64.807  35.956  4.240   1.00 61.27  ? 256  GLN A N    1 
ATOM   4252  C  CA   . GLN A 1 259 ? 65.869  36.927  4.421   1.00 56.84  ? 256  GLN A CA   1 
ATOM   4253  C  C    . GLN A 1 259 ? 67.213  36.304  4.016   1.00 66.22  ? 256  GLN A C    1 
ATOM   4254  O  O    . GLN A 1 259 ? 67.996  36.911  3.269   1.00 57.66  ? 256  GLN A O    1 
ATOM   4255  C  CB   . GLN A 1 259 ? 65.907  37.417  5.861   1.00 59.60  ? 256  GLN A CB   1 
ATOM   4256  C  CG   . GLN A 1 259 ? 66.793  38.631  6.062   1.00 76.61  ? 256  GLN A CG   1 
ATOM   4257  C  CD   . GLN A 1 259 ? 66.043  39.946  5.903   1.00 79.35  ? 256  GLN A CD   1 
ATOM   4258  O  OE1  . GLN A 1 259 ? 66.435  40.801  5.107   1.00 81.67  ? 256  GLN A OE1  1 
ATOM   4259  N  NE2  . GLN A 1 259 ? 64.980  40.128  6.685   1.00 72.39  ? 256  GLN A NE2  1 
ATOM   4260  H  H    . GLN A 1 259 ? 64.367  35.778  4.957   1.00 73.52  ? 256  GLN A H    1 
ATOM   4261  H  HA   . GLN A 1 259 ? 65.704  37.691  3.846   1.00 68.21  ? 256  GLN A HA   1 
ATOM   4262  H  HB2  . GLN A 1 259 ? 65.007  37.657  6.135   1.00 71.52  ? 256  GLN A HB2  1 
ATOM   4263  H  HB3  . GLN A 1 259 ? 66.245  36.705  6.426   1.00 71.52  ? 256  GLN A HB3  1 
ATOM   4264  H  HG2  . GLN A 1 259 ? 67.166  38.605  6.957   1.00 91.93  ? 256  GLN A HG2  1 
ATOM   4265  H  HG3  . GLN A 1 259 ? 67.507  38.612  5.405   1.00 91.93  ? 256  GLN A HG3  1 
ATOM   4266  H  HE21 . GLN A 1 259 ? 64.748  39.518  7.244   1.00 86.87  ? 256  GLN A HE21 1 
ATOM   4267  H  HE22 . GLN A 1 259 ? 64.525  40.856  6.630   1.00 86.87  ? 256  GLN A HE22 1 
ATOM   4268  N  N    . GLN A 1 260 ? 67.462  35.078  4.479   1.00 54.88  ? 257  GLN A N    1 
ATOM   4269  C  CA   . GLN A 1 260 ? 68.698  34.389  4.131   1.00 51.11  ? 257  GLN A CA   1 
ATOM   4270  C  C    . GLN A 1 260 ? 68.776  34.038  2.660   1.00 63.08  ? 257  GLN A C    1 
ATOM   4271  O  O    . GLN A 1 260 ? 69.789  34.298  2.009   1.00 68.57  ? 257  GLN A O    1 
ATOM   4272  C  CB   . GLN A 1 260 ? 68.827  33.097  4.934   1.00 72.33  ? 257  GLN A CB   1 
ATOM   4273  C  CG   . GLN A 1 260 ? 69.274  33.270  6.380   1.00 89.42  ? 257  GLN A CG   1 
ATOM   4274  C  CD   . GLN A 1 260 ? 69.653  31.946  7.019   1.00 106.74 ? 257  GLN A CD   1 
ATOM   4275  O  OE1  . GLN A 1 260 ? 70.203  31.062  6.359   1.00 114.78 ? 257  GLN A OE1  1 
ATOM   4276  N  NE2  . GLN A 1 260 ? 69.345  31.794  8.304   1.00 105.24 ? 257  GLN A NE2  1 
ATOM   4277  H  H    . GLN A 1 260 ? 66.935  34.630  4.991   1.00 65.86  ? 257  GLN A H    1 
ATOM   4278  H  HA   . GLN A 1 260 ? 69.453  34.958  4.348   1.00 61.33  ? 257  GLN A HA   1 
ATOM   4279  H  HB2  . GLN A 1 260 ? 67.964  32.655  4.947   1.00 86.79  ? 257  GLN A HB2  1 
ATOM   4280  H  HB3  . GLN A 1 260 ? 69.477  32.526  4.495   1.00 86.79  ? 257  GLN A HB3  1 
ATOM   4281  H  HG2  . GLN A 1 260 ? 70.049  33.852  6.407   1.00 107.30 ? 257  GLN A HG2  1 
ATOM   4282  H  HG3  . GLN A 1 260 ? 68.547  33.657  6.893   1.00 107.30 ? 257  GLN A HG3  1 
ATOM   4283  H  HE21 . GLN A 1 260 ? 68.951  32.429  8.730   1.00 126.29 ? 257  GLN A HE21 1 
ATOM   4284  H  HE22 . GLN A 1 260 ? 69.540  31.061  8.709   1.00 126.29 ? 257  GLN A HE22 1 
ATOM   4285  N  N    . SER A 1 261 ? 67.710  33.452  2.128   1.00 62.24  ? 258  SER A N    1 
ATOM   4286  C  CA   . SER A 1 261 ? 67.689  33.101  0.714   1.00 71.19  ? 258  SER A CA   1 
ATOM   4287  C  C    . SER A 1 261 ? 67.874  34.344  -0.163  1.00 67.02  ? 258  SER A C    1 
ATOM   4288  O  O    . SER A 1 261 ? 68.476  34.270  -1.231  1.00 73.06  ? 258  SER A O    1 
ATOM   4289  C  CB   . SER A 1 261 ? 66.391  32.371  0.356   1.00 78.84  ? 258  SER A CB   1 
ATOM   4290  O  OG   . SER A 1 261 ? 65.272  33.212  0.539   1.00 100.96 ? 258  SER A OG   1 
ATOM   4291  H  H    . SER A 1 261 ? 66.993  33.248  2.558   1.00 74.69  ? 258  SER A H    1 
ATOM   4292  H  HA   . SER A 1 261 ? 68.427  32.499  0.532   1.00 85.43  ? 258  SER A HA   1 
ATOM   4293  H  HB2  . SER A 1 261 ? 66.430  32.095  -0.573  1.00 94.61  ? 258  SER A HB2  1 
ATOM   4294  H  HB3  . SER A 1 261 ? 66.298  31.594  0.929   1.00 94.61  ? 258  SER A HB3  1 
ATOM   4295  H  HG   . SER A 1 261 ? 65.225  33.459  1.340   1.00 121.15 ? 258  SER A HG   1 
ATOM   4296  N  N    . PHE A 1 262 ? 67.423  35.497  0.327   1.00 62.98  ? 259  PHE A N    1 
ATOM   4297  C  CA   . PHE A 1 262 ? 67.608  36.748  -0.402  1.00 65.89  ? 259  PHE A CA   1 
ATOM   4298  C  C    . PHE A 1 262 ? 69.052  37.207  -0.346  1.00 73.17  ? 259  PHE A C    1 
ATOM   4299  O  O    . PHE A 1 262 ? 69.579  37.697  -1.347  1.00 73.13  ? 259  PHE A O    1 
ATOM   4300  C  CB   . PHE A 1 262 ? 66.706  37.859  0.172   1.00 67.16  ? 259  PHE A CB   1 
ATOM   4301  C  CG   . PHE A 1 262 ? 65.232  37.690  -0.125  1.00 67.02  ? 259  PHE A CG   1 
ATOM   4302  C  CD1  . PHE A 1 262 ? 64.791  36.855  -1.139  1.00 63.20  ? 259  PHE A CD1  1 
ATOM   4303  C  CD2  . PHE A 1 262 ? 64.284  38.374  0.625   1.00 64.19  ? 259  PHE A CD2  1 
ATOM   4304  C  CE1  . PHE A 1 262 ? 63.447  36.711  -1.398  1.00 56.90  ? 259  PHE A CE1  1 
ATOM   4305  C  CE2  . PHE A 1 262 ? 62.926  38.232  0.365   1.00 51.64  ? 259  PHE A CE2  1 
ATOM   4306  C  CZ   . PHE A 1 262 ? 62.511  37.400  -0.642  1.00 57.67  ? 259  PHE A CZ   1 
ATOM   4307  H  H    . PHE A 1 262 ? 67.008  35.581  1.076   1.00 75.57  ? 259  PHE A H    1 
ATOM   4308  H  HA   . PHE A 1 262 ? 67.369  36.613  -1.332  1.00 79.07  ? 259  PHE A HA   1 
ATOM   4309  H  HB2  . PHE A 1 262 ? 66.812  37.876  1.136   1.00 80.59  ? 259  PHE A HB2  1 
ATOM   4310  H  HB3  . PHE A 1 262 ? 66.986  38.709  -0.203  1.00 80.59  ? 259  PHE A HB3  1 
ATOM   4311  H  HD1  . PHE A 1 262 ? 65.411  36.388  -1.651  1.00 75.85  ? 259  PHE A HD1  1 
ATOM   4312  H  HD2  . PHE A 1 262 ? 64.562  38.939  1.309   1.00 77.03  ? 259  PHE A HD2  1 
ATOM   4313  H  HE1  . PHE A 1 262 ? 63.165  36.148  -2.082  1.00 68.28  ? 259  PHE A HE1  1 
ATOM   4314  H  HE2  . PHE A 1 262 ? 62.302  38.696  0.875   1.00 61.97  ? 259  PHE A HE2  1 
ATOM   4315  H  HZ   . PHE A 1 262 ? 61.603  37.301  -0.820  1.00 69.20  ? 259  PHE A HZ   1 
ATOM   4316  N  N    . GLN A 1 263 ? 69.708  37.022  0.799   1.00 68.42  ? 260  GLN A N    1 
ATOM   4317  C  CA   . GLN A 1 263 ? 71.097  37.450  0.926   1.00 71.98  ? 260  GLN A CA   1 
ATOM   4318  C  C    . GLN A 1 263 ? 72.003  36.596  0.041   1.00 87.13  ? 260  GLN A C    1 
ATOM   4319  O  O    . GLN A 1 263 ? 72.894  37.110  -0.638  1.00 95.27  ? 260  GLN A O    1 
ATOM   4320  C  CB   . GLN A 1 263 ? 71.552  37.377  2.378   1.00 67.00  ? 260  GLN A CB   1 
ATOM   4321  C  CG   . GLN A 1 263 ? 71.072  38.549  3.222   1.00 78.41  ? 260  GLN A CG   1 
ATOM   4322  C  CD   . GLN A 1 263 ? 71.047  38.248  4.708   1.00 85.72  ? 260  GLN A CD   1 
ATOM   4323  O  OE1  . GLN A 1 263 ? 71.413  37.152  5.143   1.00 97.50  ? 260  GLN A OE1  1 
ATOM   4324  N  NE2  . GLN A 1 263 ? 70.619  39.226  5.501   1.00 85.62  ? 260  GLN A NE2  1 
ATOM   4325  H  H    . GLN A 1 263 ? 69.378  36.657  1.504   1.00 82.10  ? 260  GLN A H    1 
ATOM   4326  H  HA   . GLN A 1 263 ? 71.173  38.371  0.633   1.00 86.38  ? 260  GLN A HA   1 
ATOM   4327  H  HB2  . GLN A 1 263 ? 71.206  36.563  2.775   1.00 80.40  ? 260  GLN A HB2  1 
ATOM   4328  H  HB3  . GLN A 1 263 ? 72.522  37.370  2.403   1.00 80.40  ? 260  GLN A HB3  1 
ATOM   4329  H  HG2  . GLN A 1 263 ? 71.666  39.303  3.080   1.00 94.09  ? 260  GLN A HG2  1 
ATOM   4330  H  HG3  . GLN A 1 263 ? 70.171  38.784  2.950   1.00 94.09  ? 260  GLN A HG3  1 
ATOM   4331  H  HE21 . GLN A 1 263 ? 70.375  39.978  5.162   1.00 102.74 ? 260  GLN A HE21 1 
ATOM   4332  H  HE22 . GLN A 1 263 ? 70.586  39.106  6.352   1.00 102.74 ? 260  GLN A HE22 1 
ATOM   4333  N  N    . LYS A 1 264 ? 71.746  35.295  0.029   1.00 77.00  ? 261  LYS A N    1 
ATOM   4334  C  CA   . LYS A 1 264 ? 72.533  34.368  -0.770  1.00 84.91  ? 261  LYS A CA   1 
ATOM   4335  C  C    . LYS A 1 264 ? 72.270  34.499  -2.279  1.00 92.25  ? 261  LYS A C    1 
ATOM   4336  O  O    . LYS A 1 264 ? 73.065  34.018  -3.088  1.00 109.13 ? 261  LYS A O    1 
ATOM   4337  C  CB   . LYS A 1 264 ? 72.271  32.934  -0.315  1.00 88.92  ? 261  LYS A CB   1 
ATOM   4338  C  CG   . LYS A 1 264 ? 72.555  32.703  1.162   1.00 91.96  ? 261  LYS A CG   1 
ATOM   4339  C  CD   . LYS A 1 264 ? 74.051  32.525  1.408   1.00 107.70 ? 261  LYS A CD   1 
ATOM   4340  C  CE   . LYS A 1 264 ? 74.343  31.946  2.786   1.00 114.32 ? 261  LYS A CE   1 
ATOM   4341  N  NZ   . LYS A 1 264 ? 75.810  31.757  3.018   1.00 99.26  ? 261  LYS A NZ   1 
ATOM   4342  H  H    . LYS A 1 264 ? 71.117  34.920  0.480   1.00 92.40  ? 261  LYS A H    1 
ATOM   4343  H  HA   . LYS A 1 264 ? 73.473  34.555  -0.620  1.00 101.89 ? 261  LYS A HA   1 
ATOM   4344  H  HB2  . LYS A 1 264 ? 71.339  32.719  -0.476  1.00 106.70 ? 261  LYS A HB2  1 
ATOM   4345  H  HB3  . LYS A 1 264 ? 72.840  32.335  -0.824  1.00 106.70 ? 261  LYS A HB3  1 
ATOM   4346  H  HG2  . LYS A 1 264 ? 72.250  33.470  1.672   1.00 110.35 ? 261  LYS A HG2  1 
ATOM   4347  H  HG3  . LYS A 1 264 ? 72.098  31.899  1.456   1.00 110.35 ? 261  LYS A HG3  1 
ATOM   4348  H  HD2  . LYS A 1 264 ? 74.412  31.917  0.743   1.00 129.24 ? 261  LYS A HD2  1 
ATOM   4349  H  HD3  . LYS A 1 264 ? 74.489  33.388  1.344   1.00 129.24 ? 261  LYS A HD3  1 
ATOM   4350  H  HE2  . LYS A 1 264 ? 74.006  32.553  3.464   1.00 137.19 ? 261  LYS A HE2  1 
ATOM   4351  H  HE3  . LYS A 1 264 ? 73.911  31.082  2.867   1.00 137.19 ? 261  LYS A HE3  1 
ATOM   4352  H  HZ1  . LYS A 1 264 ? 76.231  32.538  2.954   1.00 119.11 ? 261  LYS A HZ1  1 
ATOM   4353  H  HZ2  . LYS A 1 264 ? 75.948  31.418  3.829   1.00 119.11 ? 261  LYS A HZ2  1 
ATOM   4354  H  HZ3  . LYS A 1 264 ? 76.144  31.198  2.410   1.00 119.11 ? 261  LYS A HZ3  1 
ATOM   4355  N  N    . SER A 1 265 ? 71.172  35.147  -2.662  1.00 84.34  ? 262  SER A N    1 
ATOM   4356  C  CA   . SER A 1 265 ? 70.820  35.260  -4.083  1.00 84.53  ? 262  SER A CA   1 
ATOM   4357  C  C    . SER A 1 265 ? 71.475  36.493  -4.694  1.00 80.92  ? 262  SER A C    1 
ATOM   4358  O  O    . SER A 1 265 ? 72.020  37.331  -3.976  1.00 90.25  ? 262  SER A O    1 
ATOM   4359  C  CB   . SER A 1 265 ? 69.300  35.326  -4.278  1.00 73.99  ? 262  SER A CB   1 
ATOM   4360  O  OG   . SER A 1 265 ? 68.674  34.098  -3.949  1.00 82.79  ? 262  SER A OG   1 
ATOM   4361  H  H    . SER A 1 265 ? 70.616  35.528  -2.127  1.00 101.20 ? 262  SER A H    1 
ATOM   4362  H  HA   . SER A 1 265 ? 71.150  34.479  -4.554  1.00 101.44 ? 262  SER A HA   1 
ATOM   4363  H  HB2  . SER A 1 265 ? 68.942  36.023  -3.707  1.00 88.79  ? 262  SER A HB2  1 
ATOM   4364  H  HB3  . SER A 1 265 ? 69.113  35.533  -5.207  1.00 88.79  ? 262  SER A HB3  1 
ATOM   4365  H  HG   . SER A 1 265 ? 68.824  33.905  -3.146  1.00 99.35  ? 262  SER A HG   1 
ATOM   4366  N  N    . HIS A 1 266 ? 71.406  36.602  -6.017  1.00 79.48  ? 263  HIS A N    1 
ATOM   4367  C  CA   . HIS A 1 266 ? 72.153  37.628  -6.744  1.00 89.75  ? 263  HIS A CA   1 
ATOM   4368  C  C    . HIS A 1 266 ? 71.272  38.652  -7.452  1.00 83.83  ? 263  HIS A C    1 
ATOM   4369  O  O    . HIS A 1 266 ? 71.680  39.799  -7.623  1.00 83.82  ? 263  HIS A O    1 
ATOM   4370  C  CB   . HIS A 1 266 ? 73.087  36.959  -7.758  1.00 97.03  ? 263  HIS A CB   1 
ATOM   4371  C  CG   . HIS A 1 266 ? 73.963  35.902  -7.155  1.00 119.66 ? 263  HIS A CG   1 
ATOM   4372  N  ND1  . HIS A 1 266 ? 75.100  36.200  -6.432  1.00 114.64 ? 263  HIS A ND1  1 
ATOM   4373  C  CD2  . HIS A 1 266 ? 73.865  34.551  -7.161  1.00 115.54 ? 263  HIS A CD2  1 
ATOM   4374  C  CE1  . HIS A 1 266 ? 75.663  35.080  -6.018  1.00 103.64 ? 263  HIS A CE1  1 
ATOM   4375  N  NE2  . HIS A 1 266 ? 74.935  34.065  -6.448  1.00 116.28 ? 263  HIS A NE2  1 
ATOM   4376  H  H    . HIS A 1 266 ? 70.932  36.092  -6.521  1.00 95.38  ? 263  HIS A H    1 
ATOM   4377  H  HA   . HIS A 1 266 ? 72.708  38.111  -6.111  1.00 107.70 ? 263  HIS A HA   1 
ATOM   4378  H  HB2  . HIS A 1 266 ? 72.550  36.542  -8.451  1.00 116.44 ? 263  HIS A HB2  1 
ATOM   4379  H  HB3  . HIS A 1 266 ? 73.662  37.636  -8.149  1.00 116.44 ? 263  HIS A HB3  1 
ATOM   4380  H  HD1  . HIS A 1 266 ? 75.394  36.993  -6.273  1.00 137.57 ? 263  HIS A HD1  1 
ATOM   4381  H  HD2  . HIS A 1 266 ? 73.199  34.047  -7.569  1.00 138.65 ? 263  HIS A HD2  1 
ATOM   4382  H  HE1  . HIS A 1 266 ? 76.442  35.016  -5.514  1.00 124.37 ? 263  HIS A HE1  1 
ATOM   4383  H  HE2  . HIS A 1 266 ? 75.104  33.233  -6.306  1.00 139.53 ? 263  HIS A HE2  1 
ATOM   4384  N  N    . ASN A 1 267 ? 70.068  38.250  -7.852  1.00 79.87  ? 264  ASN A N    1 
ATOM   4385  C  CA   . ASN A 1 267 ? 69.129  39.185  -8.465  1.00 68.48  ? 264  ASN A CA   1 
ATOM   4386  C  C    . ASN A 1 267 ? 67.716  38.963  -7.954  1.00 71.43  ? 264  ASN A C    1 
ATOM   4387  O  O    . ASN A 1 267 ? 67.479  38.116  -7.092  1.00 77.56  ? 264  ASN A O    1 
ATOM   4388  C  CB   . ASN A 1 267 ? 69.143  39.074  -10.000 1.00 67.22  ? 264  ASN A CB   1 
ATOM   4389  C  CG   . ASN A 1 267 ? 68.793  37.677  -10.510 1.00 70.76  ? 264  ASN A CG   1 
ATOM   4390  O  OD1  . ASN A 1 267 ? 68.080  36.910  -9.860  1.00 78.78  ? 264  ASN A OD1  1 
ATOM   4391  N  ND2  . ASN A 1 267 ? 69.324  37.337  -11.677 1.00 74.91  ? 264  ASN A ND2  1 
ATOM   4392  H  H    . ASN A 1 267 ? 69.772  37.446  -7.780  1.00 95.85  ? 264  ASN A H    1 
ATOM   4393  H  HA   . ASN A 1 267 ? 69.391  40.089  -8.231  1.00 82.17  ? 264  ASN A HA   1 
ATOM   4394  H  HB2  . ASN A 1 267 ? 68.495  39.695  -10.366 1.00 80.67  ? 264  ASN A HB2  1 
ATOM   4395  H  HB3  . ASN A 1 267 ? 70.031  39.295  -10.322 1.00 80.67  ? 264  ASN A HB3  1 
ATOM   4396  H  HD21 . ASN A 1 267 ? 69.830  37.890  -12.097 1.00 89.89  ? 264  ASN A HD21 1 
ATOM   4397  H  HD22 . ASN A 1 267 ? 69.161  36.562  -12.014 1.00 89.89  ? 264  ASN A HD22 1 
ATOM   4398  N  N    . SER A 1 268 ? 66.790  39.765  -8.465  1.00 71.90  ? 265  SER A N    1 
ATOM   4399  C  CA   . SER A 1 268 ? 65.403  39.734  -8.024  1.00 72.24  ? 265  SER A CA   1 
ATOM   4400  C  C    . SER A 1 268 ? 64.657  38.514  -8.568  1.00 69.92  ? 265  SER A C    1 
ATOM   4401  O  O    . SER A 1 268 ? 63.698  38.058  -7.949  1.00 71.34  ? 265  SER A O    1 
ATOM   4402  C  CB   . SER A 1 268 ? 64.689  41.021  -8.419  1.00 64.66  ? 265  SER A CB   1 
ATOM   4403  O  OG   . SER A 1 268 ? 65.126  42.099  -7.607  1.00 65.46  ? 265  SER A OG   1 
ATOM   4404  H  H    . SER A 1 268 ? 66.944  40.347  -9.080  1.00 86.28  ? 265  SER A H    1 
ATOM   4405  H  HA   . SER A 1 268 ? 65.389  39.677  -7.055  1.00 86.69  ? 265  SER A HA   1 
ATOM   4406  H  HB2  . SER A 1 268 ? 64.888  41.222  -9.347  1.00 77.59  ? 265  SER A HB2  1 
ATOM   4407  H  HB3  . SER A 1 268 ? 63.734  40.903  -8.301  1.00 77.59  ? 265  SER A HB3  1 
ATOM   4408  H  HG   . SER A 1 268 ? 64.730  42.805  -7.829  1.00 78.56  ? 265  SER A HG   1 
ATOM   4409  N  N    . LEU A 1 269 ? 65.057  38.011  -9.734  1.00 65.57  ? 266  LEU A N    1 
ATOM   4410  C  CA   . LEU A 1 269 ? 64.399  36.834  -10.290 1.00 63.80  ? 266  LEU A CA   1 
ATOM   4411  C  C    . LEU A 1 269 ? 64.599  35.630  -9.365  1.00 64.92  ? 266  LEU A C    1 
ATOM   4412  O  O    . LEU A 1 269 ? 63.654  34.897  -9.040  1.00 65.04  ? 266  LEU A O    1 
ATOM   4413  C  CB   . LEU A 1 269 ? 64.963  36.519  -11.671 1.00 61.82  ? 266  LEU A CB   1 
ATOM   4414  C  CG   . LEU A 1 269 ? 64.728  37.554  -12.771 1.00 68.40  ? 266  LEU A CG   1 
ATOM   4415  C  CD1  . LEU A 1 269 ? 65.560  37.235  -14.004 1.00 80.38  ? 266  LEU A CD1  1 
ATOM   4416  C  CD2  . LEU A 1 269 ? 63.265  37.610  -13.142 1.00 85.60  ? 266  LEU A CD2  1 
ATOM   4417  H  H    . LEU A 1 269 ? 65.695  38.328  -10.215 1.00 78.69  ? 266  LEU A H    1 
ATOM   4418  H  HA   . LEU A 1 269 ? 63.448  37.003  -10.376 1.00 76.56  ? 266  LEU A HA   1 
ATOM   4419  H  HB2  . LEU A 1 269 ? 65.922  36.406  -11.585 1.00 74.19  ? 266  LEU A HB2  1 
ATOM   4420  H  HB3  . LEU A 1 269 ? 64.569  35.686  -11.974 1.00 74.19  ? 266  LEU A HB3  1 
ATOM   4421  H  HG   . LEU A 1 269 ? 64.992  38.429  -12.446 1.00 82.08  ? 266  LEU A HG   1 
ATOM   4422  H  HD11 . LEU A 1 269 ? 65.309  36.359  -14.336 1.00 96.46  ? 266  LEU A HD11 1 
ATOM   4423  H  HD12 . LEU A 1 269 ? 65.390  37.908  -14.682 1.00 96.46  ? 266  LEU A HD12 1 
ATOM   4424  H  HD13 . LEU A 1 269 ? 66.499  37.241  -13.760 1.00 96.46  ? 266  LEU A HD13 1 
ATOM   4425  H  HD21 . LEU A 1 269 ? 62.750  37.856  -12.357 1.00 102.71 ? 266  LEU A HD21 1 
ATOM   4426  H  HD22 . LEU A 1 269 ? 63.142  38.272  -13.840 1.00 102.71 ? 266  LEU A HD22 1 
ATOM   4427  H  HD23 . LEU A 1 269 ? 62.986  36.737  -13.460 1.00 102.71 ? 266  LEU A HD23 1 
ATOM   4428  N  N    . GLN A 1 270 ? 65.820  35.483  -8.870  1.00 69.72  ? 267  GLN A N    1 
ATOM   4429  C  CA   . GLN A 1 270 ? 66.153  34.375  -7.994  1.00 63.00  ? 267  GLN A CA   1 
ATOM   4430  C  C    . GLN A 1 270 ? 65.370  34.505  -6.708  1.00 61.40  ? 267  GLN A C    1 
ATOM   4431  O  O    . GLN A 1 270 ? 64.791  33.532  -6.186  1.00 61.76  ? 267  GLN A O    1 
ATOM   4432  C  CB   . GLN A 1 270 ? 67.646  34.369  -7.717  1.00 73.07  ? 267  GLN A CB   1 
ATOM   4433  C  CG   . GLN A 1 270 ? 68.475  33.743  -8.826  1.00 84.75  ? 267  GLN A CG   1 
ATOM   4434  C  CD   . GLN A 1 270 ? 69.967  33.946  -8.618  1.00 98.21  ? 267  GLN A CD   1 
ATOM   4435  O  OE1  . GLN A 1 270 ? 70.432  34.125  -7.490  1.00 98.79  ? 267  GLN A OE1  1 
ATOM   4436  N  NE2  . GLN A 1 270 ? 70.725  33.916  -9.707  1.00 104.19 ? 267  GLN A NE2  1 
ATOM   4437  H  H    . GLN A 1 270 ? 66.476  36.016  -9.028  1.00 83.67  ? 267  GLN A H    1 
ATOM   4438  H  HA   . GLN A 1 270 ? 65.913  33.537  -8.420  1.00 75.61  ? 267  GLN A HA   1 
ATOM   4439  H  HB2  . GLN A 1 270 ? 67.947  35.284  -7.602  1.00 87.69  ? 267  GLN A HB2  1 
ATOM   4440  H  HB3  . GLN A 1 270 ? 67.811  33.865  -6.904  1.00 87.69  ? 267  GLN A HB3  1 
ATOM   4441  H  HG2  . GLN A 1 270 ? 68.301  32.789  -8.853  1.00 101.70 ? 267  GLN A HG2  1 
ATOM   4442  H  HG3  . GLN A 1 270 ? 68.231  34.151  -9.672  1.00 101.70 ? 267  GLN A HG3  1 
ATOM   4443  H  HE21 . GLN A 1 270 ? 70.365  33.787  -10.477 1.00 125.02 ? 267  GLN A HE21 1 
ATOM   4444  H  HE22 . GLN A 1 270 ? 71.575  34.025  -9.642  1.00 125.02 ? 267  GLN A HE22 1 
ATOM   4445  N  N    . ARG A 1 271 ? 65.308  35.737  -6.221  1.00 57.25  ? 268  ARG A N    1 
ATOM   4446  C  CA   . ARG A 1 271 ? 64.687  35.979  -4.944  1.00 61.75  ? 268  ARG A CA   1 
ATOM   4447  C  C    . ARG A 1 271 ? 63.174  35.815  -5.046  1.00 60.30  ? 268  ARG A C    1 
ATOM   4448  O  O    . ARG A 1 271 ? 62.538  35.249  -4.145  1.00 47.58  ? 268  ARG A O    1 
ATOM   4449  C  CB   . ARG A 1 271 ? 65.071  37.362  -4.436  1.00 64.08  ? 268  ARG A CB   1 
ATOM   4450  C  CG   . ARG A 1 271 ? 66.539  37.442  -4.033  1.00 70.56  ? 268  ARG A CG   1 
ATOM   4451  C  CD   . ARG A 1 271 ? 66.896  38.777  -3.411  1.00 74.13  ? 268  ARG A CD   1 
ATOM   4452  N  NE   . ARG A 1 271 ? 67.601  39.682  -4.318  1.00 74.74  ? 268  ARG A NE   1 
ATOM   4453  C  CZ   . ARG A 1 271 ? 68.912  39.895  -4.315  1.00 65.17  ? 268  ARG A CZ   1 
ATOM   4454  N  NH1  . ARG A 1 271 ? 69.695  39.268  -3.452  1.00 66.18  ? 268  ARG A NH1  1 
ATOM   4455  N  NH2  . ARG A 1 271 ? 69.439  40.755  -5.176  1.00 64.08  ? 268  ARG A NH2  1 
ATOM   4456  H  H    . ARG A 1 271 ? 65.617  36.438  -6.611  1.00 68.70  ? 268  ARG A H    1 
ATOM   4457  H  HA   . ARG A 1 271 ? 65.014  35.326  -4.306  1.00 74.10  ? 268  ARG A HA   1 
ATOM   4458  H  HB2  . ARG A 1 271 ? 64.916  38.013  -5.138  1.00 76.89  ? 268  ARG A HB2  1 
ATOM   4459  H  HB3  . ARG A 1 271 ? 64.533  37.576  -3.658  1.00 76.89  ? 268  ARG A HB3  1 
ATOM   4460  H  HG2  . ARG A 1 271 ? 66.728  36.747  -3.383  1.00 84.68  ? 268  ARG A HG2  1 
ATOM   4461  H  HG3  . ARG A 1 271 ? 67.092  37.319  -4.821  1.00 84.68  ? 268  ARG A HG3  1 
ATOM   4462  H  HD2  . ARG A 1 271 ? 66.079  39.217  -3.129  1.00 88.96  ? 268  ARG A HD2  1 
ATOM   4463  H  HD3  . ARG A 1 271 ? 67.468  38.621  -2.644  1.00 88.96  ? 268  ARG A HD3  1 
ATOM   4464  H  HE   . ARG A 1 271 ? 67.130  40.109  -4.897  1.00 89.69  ? 268  ARG A HE   1 
ATOM   4465  H  HH11 . ARG A 1 271 ? 69.356  38.714  -2.888  1.00 79.42  ? 268  ARG A HH11 1 
ATOM   4466  H  HH12 . ARG A 1 271 ? 70.543  39.412  -3.457  1.00 79.42  ? 268  ARG A HH12 1 
ATOM   4467  H  HH21 . ARG A 1 271 ? 68.934  41.163  -5.739  1.00 76.90  ? 268  ARG A HH21 1 
ATOM   4468  H  HH22 . ARG A 1 271 ? 70.288  40.893  -5.181  1.00 76.90  ? 268  ARG A HH22 1 
ATOM   4469  N  N    . TRP A 1 272 ? 62.612  36.225  -6.178  1.00 52.87  ? 269  TRP A N    1 
ATOM   4470  C  CA   . TRP A 1 272 ? 61.189  36.047  -6.406  1.00 53.08  ? 269  TRP A CA   1 
ATOM   4471  C  C    . TRP A 1 272 ? 60.888  34.565  -6.499  1.00 58.91  ? 269  TRP A C    1 
ATOM   4472  O  O    . TRP A 1 272 ? 59.896  34.066  -5.936  1.00 62.04  ? 269  TRP A O    1 
ATOM   4473  C  CB   . TRP A 1 272 ? 60.749  36.763  -7.679  1.00 57.52  ? 269  TRP A CB   1 
ATOM   4474  C  CG   . TRP A 1 272 ? 59.282  36.668  -7.893  1.00 58.37  ? 269  TRP A CG   1 
ATOM   4475  C  CD1  . TRP A 1 272 ? 58.641  36.002  -8.888  1.00 56.64  ? 269  TRP A CD1  1 
ATOM   4476  C  CD2  . TRP A 1 272 ? 58.264  37.259  -7.081  1.00 55.80  ? 269  TRP A CD2  1 
ATOM   4477  N  NE1  . TRP A 1 272 ? 57.282  36.135  -8.747  1.00 57.57  ? 269  TRP A NE1  1 
ATOM   4478  C  CE2  . TRP A 1 272 ? 57.026  36.905  -7.643  1.00 56.42  ? 269  TRP A CE2  1 
ATOM   4479  C  CE3  . TRP A 1 272 ? 58.280  38.057  -5.937  1.00 54.23  ? 269  TRP A CE3  1 
ATOM   4480  C  CZ2  . TRP A 1 272 ? 55.818  37.318  -7.097  1.00 59.30  ? 269  TRP A CZ2  1 
ATOM   4481  C  CZ3  . TRP A 1 272 ? 57.083  38.465  -5.400  1.00 60.33  ? 269  TRP A CZ3  1 
ATOM   4482  C  CH2  . TRP A 1 272 ? 55.868  38.097  -5.978  1.00 51.70  ? 269  TRP A CH2  1 
ATOM   4483  H  H    . TRP A 1 272 ? 63.032  36.606  -6.824  1.00 63.44  ? 269  TRP A H    1 
ATOM   4484  H  HA   . TRP A 1 272 ? 60.693  36.416  -5.659  1.00 63.69  ? 269  TRP A HA   1 
ATOM   4485  H  HB2  . TRP A 1 272 ? 60.985  37.702  -7.615  1.00 69.02  ? 269  TRP A HB2  1 
ATOM   4486  H  HB3  . TRP A 1 272 ? 61.192  36.359  -8.441  1.00 69.02  ? 269  TRP A HB3  1 
ATOM   4487  H  HD1  . TRP A 1 272 ? 59.062  35.516  -9.561  1.00 67.96  ? 269  TRP A HD1  1 
ATOM   4488  H  HE1  . TRP A 1 272 ? 56.689  35.792  -9.266  1.00 69.09  ? 269  TRP A HE1  1 
ATOM   4489  H  HE3  . TRP A 1 272 ? 59.085  38.304  -5.542  1.00 65.07  ? 269  TRP A HE3  1 
ATOM   4490  H  HZ2  . TRP A 1 272 ? 55.006  37.079  -7.483  1.00 71.16  ? 269  TRP A HZ2  1 
ATOM   4491  H  HZ3  . TRP A 1 272 ? 57.082  38.994  -4.635  1.00 72.39  ? 269  TRP A HZ3  1 
ATOM   4492  H  HH2  . TRP A 1 272 ? 55.074  38.389  -5.592  1.00 62.04  ? 269  TRP A HH2  1 
ATOM   4493  N  N    . GLU A 1 273 ? 61.777  33.842  -7.168  1.00 55.57  ? 270  GLU A N    1 
ATOM   4494  C  CA   . GLU A 1 273 ? 61.568  32.417  -7.310  1.00 57.29  ? 270  GLU A CA   1 
ATOM   4495  C  C    . GLU A 1 273 ? 61.642  31.750  -5.938  1.00 57.74  ? 270  GLU A C    1 
ATOM   4496  O  O    . GLU A 1 273 ? 60.871  30.834  -5.648  1.00 64.09  ? 270  GLU A O    1 
ATOM   4497  C  CB   . GLU A 1 273 ? 62.594  31.826  -8.275  1.00 65.09  ? 270  GLU A CB   1 
ATOM   4498  C  CG   . GLU A 1 273 ? 62.109  30.562  -8.959  1.00 85.52  ? 270  GLU A CG   1 
ATOM   4499  C  CD   . GLU A 1 273 ? 60.974  30.850  -9.927  1.00 83.00  ? 270  GLU A CD   1 
ATOM   4500  O  OE1  . GLU A 1 273 ? 61.075  31.850  -10.675 1.00 72.31  ? 270  GLU A OE1  1 
ATOM   4501  O  OE2  . GLU A 1 273 ? 59.982  30.086  -9.933  1.00 80.82  ? 270  GLU A OE2  1 
ATOM   4502  H  H    . GLU A 1 273 ? 62.491  34.147  -7.538  1.00 66.68  ? 270  GLU A H    1 
ATOM   4503  H  HA   . GLU A 1 273 ? 60.683  32.259  -7.675  1.00 68.75  ? 270  GLU A HA   1 
ATOM   4504  H  HB2  . GLU A 1 273 ? 62.793  32.480  -8.962  1.00 78.11  ? 270  GLU A HB2  1 
ATOM   4505  H  HB3  . GLU A 1 273 ? 63.401  31.608  -7.782  1.00 78.11  ? 270  GLU A HB3  1 
ATOM   4506  H  HG2  . GLU A 1 273 ? 62.841  30.167  -9.458  1.00 102.62 ? 270  GLU A HG2  1 
ATOM   4507  H  HG3  . GLU A 1 273 ? 61.785  29.940  -8.289  1.00 102.62 ? 270  GLU A HG3  1 
ATOM   4508  N  N    . HIS A 1 274 ? 62.500  32.268  -5.058  1.00 55.66  ? 271  HIS A N    1 
ATOM   4509  C  CA   . HIS A 1 274 ? 62.554  31.762  -3.683  1.00 51.66  ? 271  HIS A CA   1 
ATOM   4510  C  C    . HIS A 1 274 ? 61.258  32.086  -2.910  1.00 61.35  ? 271  HIS A C    1 
ATOM   4511  O  O    . HIS A 1 274 ? 60.697  31.239  -2.163  1.00 50.17  ? 271  HIS A O    1 
ATOM   4512  C  CB   . HIS A 1 274 ? 63.756  32.376  -2.963  1.00 76.58  ? 271  HIS A CB   1 
ATOM   4513  C  CG   . HIS A 1 274 ? 65.022  31.600  -3.140  1.00 79.01  ? 271  HIS A CG   1 
ATOM   4514  N  ND1  . HIS A 1 274 ? 65.198  30.331  -2.631  1.00 80.38  ? 271  HIS A ND1  1 
ATOM   4515  C  CD2  . HIS A 1 274 ? 66.169  31.910  -3.791  1.00 76.34  ? 271  HIS A CD2  1 
ATOM   4516  C  CE1  . HIS A 1 274 ? 66.403  29.896  -2.956  1.00 99.05  ? 271  HIS A CE1  1 
ATOM   4517  N  NE2  . HIS A 1 274 ? 67.011  30.834  -3.663  1.00 79.90  ? 271  HIS A NE2  1 
ATOM   4518  H  H    . HIS A 1 274 ? 63.054  32.903  -5.227  1.00 66.80  ? 271  HIS A H    1 
ATOM   4519  H  HA   . HIS A 1 274 ? 62.667  30.799  -3.699  1.00 62.00  ? 271  HIS A HA   1 
ATOM   4520  H  HB2  . HIS A 1 274 ? 63.905  33.270  -3.310  1.00 91.90  ? 271  HIS A HB2  1 
ATOM   4521  H  HB3  . HIS A 1 274 ? 63.563  32.418  -2.014  1.00 91.90  ? 271  HIS A HB3  1 
ATOM   4522  H  HD1  . HIS A 1 274 ? 64.617  29.893  -2.173  1.00 96.45  ? 271  HIS A HD1  1 
ATOM   4523  H  HD2  . HIS A 1 274 ? 66.351  32.702  -4.243  1.00 91.61  ? 271  HIS A HD2  1 
ATOM   4524  H  HE1  . HIS A 1 274 ? 66.763  29.070  -2.727  1.00 118.87 ? 271  HIS A HE1  1 
ATOM   4525  H  HE2  . HIS A 1 274 ? 67.807  30.781  -3.983  1.00 95.88  ? 271  HIS A HE2  1 
ATOM   4526  N  N    . LEU A 1 275 ? 60.789  33.321  -3.091  1.00 53.19  ? 272  LEU A N    1 
ATOM   4527  C  CA   . LEU A 1 275 ? 59.560  33.764  -2.459  1.00 50.40  ? 272  LEU A CA   1 
ATOM   4528  C  C    . LEU A 1 275 ? 58.417  32.844  -2.847  1.00 54.25  ? 272  LEU A C    1 
ATOM   4529  O  O    . LEU A 1 275 ? 57.637  32.405  -1.984  1.00 52.39  ? 272  LEU A O    1 
ATOM   4530  C  CB   . LEU A 1 275 ? 59.239  35.201  -2.859  1.00 57.67  ? 272  LEU A CB   1 
ATOM   4531  C  CG   . LEU A 1 275 ? 58.066  35.855  -2.124  1.00 59.33  ? 272  LEU A CG   1 
ATOM   4532  C  CD1  . LEU A 1 275 ? 58.287  37.357  -2.060  1.00 70.22  ? 272  LEU A CD1  1 
ATOM   4533  C  CD2  . LEU A 1 275 ? 56.735  35.563  -2.813  1.00 64.39  ? 272  LEU A CD2  1 
ATOM   4534  H  H    . LEU A 1 275 ? 61.170  33.919  -3.577  1.00 63.83  ? 272  LEU A H    1 
ATOM   4535  H  HA   . LEU A 1 275 ? 59.664  33.732  -1.496  1.00 60.48  ? 272  LEU A HA   1 
ATOM   4536  H  HB2  . LEU A 1 275 ? 60.024  35.746  -2.694  1.00 69.21  ? 272  LEU A HB2  1 
ATOM   4537  H  HB3  . LEU A 1 275 ? 59.030  35.214  -3.806  1.00 69.21  ? 272  LEU A HB3  1 
ATOM   4538  H  HG   . LEU A 1 275 ? 58.023  35.513  -1.218  1.00 71.19  ? 272  LEU A HG   1 
ATOM   4539  H  HD11 . LEU A 1 275 ? 58.344  37.706  -2.963  1.00 84.26  ? 272  LEU A HD11 1 
ATOM   4540  H  HD12 . LEU A 1 275 ? 57.541  37.766  -1.593  1.00 84.26  ? 272  LEU A HD12 1 
ATOM   4541  H  HD13 . LEU A 1 275 ? 59.113  37.534  -1.583  1.00 84.26  ? 272  LEU A HD13 1 
ATOM   4542  H  HD21 . LEU A 1 275 ? 56.593  34.604  -2.831  1.00 77.27  ? 272  LEU A HD21 1 
ATOM   4543  H  HD22 . LEU A 1 275 ? 56.022  35.994  -2.317  1.00 77.27  ? 272  LEU A HD22 1 
ATOM   4544  H  HD23 . LEU A 1 275 ? 56.766  35.911  -3.718  1.00 77.27  ? 272  LEU A HD23 1 
ATOM   4545  N  N    . LYS A 1 276 ? 58.355  32.500  -4.134  1.00 48.65  ? 273  LYS A N    1 
ATOM   4546  C  CA   . LYS A 1 276 ? 57.304  31.605  -4.609  1.00 50.84  ? 273  LYS A CA   1 
ATOM   4547  C  C    . LYS A 1 276 ? 57.329  30.257  -3.898  1.00 50.92  ? 273  LYS A C    1 
ATOM   4548  O  O    . LYS A 1 276 ? 56.301  29.812  -3.384  1.00 48.22  ? 273  LYS A O    1 
ATOM   4549  C  CB   . LYS A 1 276 ? 57.433  31.384  -6.107  1.00 60.70  ? 273  LYS A CB   1 
ATOM   4550  C  CG   . LYS A 1 276 ? 56.823  32.485  -6.956  1.00 59.51  ? 273  LYS A CG   1 
ATOM   4551  C  CD   . LYS A 1 276 ? 57.626  32.692  -8.223  1.00 67.13  ? 273  LYS A CD   1 
ATOM   4552  C  CE   . LYS A 1 276 ? 57.072  31.898  -9.379  1.00 77.01  ? 273  LYS A CE   1 
ATOM   4553  N  NZ   . LYS A 1 276 ? 57.927  32.077  -10.590 1.00 67.97  ? 273  LYS A NZ   1 
ATOM   4554  H  H    . LYS A 1 276 ? 58.900  32.767  -4.743  1.00 58.38  ? 273  LYS A H    1 
ATOM   4555  H  HA   . LYS A 1 276 ? 56.442  32.016  -4.440  1.00 61.01  ? 273  LYS A HA   1 
ATOM   4556  H  HB2  . LYS A 1 276 ? 58.375  31.325  -6.333  1.00 72.84  ? 273  LYS A HB2  1 
ATOM   4557  H  HB3  . LYS A 1 276 ? 56.989  30.553  -6.338  1.00 72.84  ? 273  LYS A HB3  1 
ATOM   4558  H  HG2  . LYS A 1 276 ? 55.918  32.238  -7.203  1.00 71.41  ? 273  LYS A HG2  1 
ATOM   4559  H  HG3  . LYS A 1 276 ? 56.822  33.316  -6.455  1.00 71.41  ? 273  LYS A HG3  1 
ATOM   4560  H  HD2  . LYS A 1 276 ? 57.606  33.631  -8.463  1.00 80.56  ? 273  LYS A HD2  1 
ATOM   4561  H  HD3  . LYS A 1 276 ? 58.541  32.406  -8.070  1.00 80.56  ? 273  LYS A HD3  1 
ATOM   4562  H  HE2  . LYS A 1 276 ? 57.059  30.956  -9.149  1.00 92.41  ? 273  LYS A HE2  1 
ATOM   4563  H  HE3  . LYS A 1 276 ? 56.177  32.209  -9.586  1.00 92.41  ? 273  LYS A HE3  1 
ATOM   4564  H  HZ1  . LYS A 1 276 ? 58.755  31.798  -10.421 1.00 81.56  ? 273  LYS A HZ1  1 
ATOM   4565  H  HZ2  . LYS A 1 276 ? 57.595  31.607  -11.268 1.00 81.56  ? 273  LYS A HZ2  1 
ATOM   4566  H  HZ3  . LYS A 1 276 ? 57.953  32.937  -10.819 1.00 81.56  ? 273  LYS A HZ3  1 
ATOM   4567  N  N    . LYS A 1 277 ? 58.505  29.644  -3.796  1.00 54.52  ? 274  LYS A N    1 
ATOM   4568  C  CA   . LYS A 1 277 ? 58.608  28.330  -3.163  1.00 58.57  ? 274  LYS A CA   1 
ATOM   4569  C  C    . LYS A 1 277 ? 58.259  28.375  -1.676  1.00 55.06  ? 274  LYS A C    1 
ATOM   4570  O  O    . LYS A 1 277 ? 57.481  27.536  -1.187  1.00 54.93  ? 274  LYS A O    1 
ATOM   4571  C  CB   . LYS A 1 277 ? 60.025  27.774  -3.341  1.00 53.26  ? 274  LYS A CB   1 
ATOM   4572  C  CG   . LYS A 1 277 ? 60.355  27.439  -4.781  1.00 82.60  ? 274  LYS A CG   1 
ATOM   4573  C  CD   . LYS A 1 277 ? 61.839  27.188  -5.004  1.00 94.78  ? 274  LYS A CD   1 
ATOM   4574  C  CE   . LYS A 1 277 ? 62.129  26.885  -6.479  1.00 105.98 ? 274  LYS A CE   1 
ATOM   4575  N  NZ   . LYS A 1 277 ? 63.580  26.968  -6.798  1.00 110.64 ? 274  LYS A NZ   1 
ATOM   4576  H  H    . LYS A 1 277 ? 59.251  29.962  -4.082  1.00 65.42  ? 274  LYS A H    1 
ATOM   4577  H  HA   . LYS A 1 277 ? 57.990  27.722  -3.598  1.00 70.28  ? 274  LYS A HA   1 
ATOM   4578  H  HB2  . LYS A 1 277 ? 60.664  28.436  -3.034  1.00 63.91  ? 274  LYS A HB2  1 
ATOM   4579  H  HB3  . LYS A 1 277 ? 60.112  26.962  -2.818  1.00 63.91  ? 274  LYS A HB3  1 
ATOM   4580  H  HG2  . LYS A 1 277 ? 59.874  26.637  -5.037  1.00 99.12  ? 274  LYS A HG2  1 
ATOM   4581  H  HG3  . LYS A 1 277 ? 60.089  28.180  -5.347  1.00 99.12  ? 274  LYS A HG3  1 
ATOM   4582  H  HD2  . LYS A 1 277 ? 62.341  27.978  -4.749  1.00 113.74 ? 274  LYS A HD2  1 
ATOM   4583  H  HD3  . LYS A 1 277 ? 62.119  26.424  -4.474  1.00 113.74 ? 274  LYS A HD3  1 
ATOM   4584  H  HE2  . LYS A 1 277 ? 61.826  25.987  -6.684  1.00 127.18 ? 274  LYS A HE2  1 
ATOM   4585  H  HE3  . LYS A 1 277 ? 61.662  27.530  -7.033  1.00 127.18 ? 274  LYS A HE3  1 
ATOM   4586  H  HZ1  . LYS A 1 277 ? 64.033  26.381  -6.306  1.00 132.77 ? 274  LYS A HZ1  1 
ATOM   4587  H  HZ2  . LYS A 1 277 ? 63.712  26.787  -7.659  1.00 132.77 ? 274  LYS A HZ2  1 
ATOM   4588  H  HZ3  . LYS A 1 277 ? 63.883  27.786  -6.624  1.00 132.77 ? 274  LYS A HZ3  1 
ATOM   4589  N  N    . VAL A 1 278 ? 58.795  29.360  -0.954  1.00 47.47  ? 275  VAL A N    1 
ATOM   4590  C  CA   . VAL A 1 278 ? 58.489  29.435  0.479   1.00 57.55  ? 275  VAL A CA   1 
ATOM   4591  C  C    . VAL A 1 278 ? 56.996  29.702  0.721   1.00 54.13  ? 275  VAL A C    1 
ATOM   4592  O  O    . VAL A 1 278 ? 56.343  29.050  1.567   1.00 46.08  ? 275  VAL A O    1 
ATOM   4593  C  CB   . VAL A 1 278 ? 59.314  30.518  1.174   1.00 59.00  ? 275  VAL A CB   1 
ATOM   4594  C  CG1  . VAL A 1 278 ? 58.935  30.612  2.650   1.00 51.77  ? 275  VAL A CG1  1 
ATOM   4595  C  CG2  . VAL A 1 278 ? 60.793  30.207  1.037   1.00 51.54  ? 275  VAL A CG2  1 
ATOM   4596  H  H    . VAL A 1 278 ? 59.318  29.974  -1.253  1.00 56.97  ? 275  VAL A H    1 
ATOM   4597  H  HA   . VAL A 1 278 ? 58.709  28.585  0.890   1.00 69.06  ? 275  VAL A HA   1 
ATOM   4598  H  HB   . VAL A 1 278 ? 59.140  31.376  0.756   1.00 70.80  ? 275  VAL A HB   1 
ATOM   4599  H  HG11 . VAL A 1 278 ? 59.107  29.757  3.075   1.00 62.12  ? 275  VAL A HG11 1 
ATOM   4600  H  HG12 . VAL A 1 278 ? 59.470  31.304  3.069   1.00 62.12  ? 275  VAL A HG12 1 
ATOM   4601  H  HG13 . VAL A 1 278 ? 57.993  30.834  2.720   1.00 62.12  ? 275  VAL A HG13 1 
ATOM   4602  H  HG21 . VAL A 1 278 ? 61.023  30.179  0.095   1.00 61.85  ? 275  VAL A HG21 1 
ATOM   4603  H  HG22 . VAL A 1 278 ? 61.304  30.901  1.481   1.00 61.85  ? 275  VAL A HG22 1 
ATOM   4604  H  HG23 . VAL A 1 278 ? 60.974  29.347  1.448   1.00 61.85  ? 275  VAL A HG23 1 
ATOM   4605  N  N    . ALA A 1 279 ? 56.450  30.623  -0.073  1.00 51.51  ? 276  ALA A N    1 
ATOM   4606  C  CA   . ALA A 1 279 ? 55.040  30.980  0.034   1.00 57.69  ? 276  ALA A CA   1 
ATOM   4607  C  C    . ALA A 1 279 ? 54.166  29.776  -0.288  1.00 60.96  ? 276  ALA A C    1 
ATOM   4608  O  O    . ALA A 1 279 ? 53.213  29.471  0.441   1.00 55.82  ? 276  ALA A O    1 
ATOM   4609  C  CB   . ALA A 1 279 ? 54.708  32.160  -0.917  1.00 50.05  ? 276  ALA A CB   1 
ATOM   4610  H  H    . ALA A 1 279 ? 56.878  31.055  -0.682  1.00 61.82  ? 276  ALA A H    1 
ATOM   4611  H  HA   . ALA A 1 279 ? 54.849  31.259  0.943   1.00 69.23  ? 276  ALA A HA   1 
ATOM   4612  H  HB1  . ALA A 1 279 ? 54.903  31.894  -1.829  1.00 60.06  ? 276  ALA A HB1  1 
ATOM   4613  H  HB2  . ALA A 1 279 ? 53.768  32.380  -0.830  1.00 60.06  ? 276  ALA A HB2  1 
ATOM   4614  H  HB3  . ALA A 1 279 ? 55.252  32.925  -0.671  1.00 60.06  ? 276  ALA A HB3  1 
ATOM   4615  N  N    . SER A 1 280 ? 54.493  29.094  -1.384  1.00 48.91  ? 277  SER A N    1 
ATOM   4616  C  CA   . SER A 1 280 ? 53.743  27.916  -1.778  1.00 52.30  ? 277  SER A CA   1 
ATOM   4617  C  C    . SER A 1 280 ? 53.783  26.898  -0.651  1.00 58.80  ? 277  SER A C    1 
ATOM   4618  O  O    . SER A 1 280 ? 52.753  26.342  -0.275  1.00 64.44  ? 277  SER A O    1 
ATOM   4619  C  CB   . SER A 1 280 ? 54.307  27.324  -3.067  1.00 57.71  ? 277  SER A CB   1 
ATOM   4620  O  OG   . SER A 1 280 ? 54.113  28.208  -4.162  1.00 70.98  ? 277  SER A OG   1 
ATOM   4621  H  H    . SER A 1 280 ? 55.142  29.296  -1.912  1.00 58.70  ? 277  SER A H    1 
ATOM   4622  H  HA   . SER A 1 280 ? 52.818  28.162  -1.935  1.00 62.76  ? 277  SER A HA   1 
ATOM   4623  H  HB2  . SER A 1 280 ? 55.257  27.168  -2.952  1.00 69.26  ? 277  SER A HB2  1 
ATOM   4624  H  HB3  . SER A 1 280 ? 53.854  26.487  -3.253  1.00 69.26  ? 277  SER A HB3  1 
ATOM   4625  H  HG   . SER A 1 280 ? 54.500  28.939  -4.014  1.00 85.17  ? 277  SER A HG   1 
ATOM   4626  N  N    A ARG A 1 281 ? 54.964  26.687  -0.067  0.56 55.83  ? 278  ARG A N    1 
ATOM   4627  N  N    B ARG A 1 281 ? 54.970  26.686  -0.096  0.44 55.83  ? 278  ARG A N    1 
ATOM   4628  C  CA   A ARG A 1 281 ? 55.086  25.762  1.065   0.56 52.70  ? 278  ARG A CA   1 
ATOM   4629  C  CA   B ARG A 1 281 ? 55.130  25.774  1.026   0.44 52.84  ? 278  ARG A CA   1 
ATOM   4630  C  C    A ARG A 1 281 ? 54.279  26.219  2.265   0.56 57.59  ? 278  ARG A C    1 
ATOM   4631  C  C    B ARG A 1 281 ? 54.292  26.218  2.233   0.44 57.60  ? 278  ARG A C    1 
ATOM   4632  O  O    A ARG A 1 281 ? 53.729  25.406  3.004   0.56 58.60  ? 278  ARG A O    1 
ATOM   4633  O  O    B ARG A 1 281 ? 53.743  25.385  2.953   0.44 58.64  ? 278  ARG A O    1 
ATOM   4634  C  CB   A ARG A 1 281 ? 56.540  25.582  1.500   0.56 53.17  ? 278  ARG A CB   1 
ATOM   4635  C  CB   B ARG A 1 281 ? 56.609  25.673  1.403   0.44 53.18  ? 278  ARG A CB   1 
ATOM   4636  C  CG   A ARG A 1 281 ? 57.410  24.800  0.540   0.56 58.29  ? 278  ARG A CG   1 
ATOM   4637  C  CG   B ARG A 1 281 ? 56.916  24.710  2.537   0.44 49.11  ? 278  ARG A CG   1 
ATOM   4638  C  CD   A ARG A 1 281 ? 58.611  24.203  1.257   0.56 52.37  ? 278  ARG A CD   1 
ATOM   4639  C  CD   B ARG A 1 281 ? 56.615  23.274  2.164   0.44 46.11  ? 278  ARG A CD   1 
ATOM   4640  N  NE   A ARG A 1 281 ? 59.642  25.201  1.526   0.56 51.41  ? 278  ARG A NE   1 
ATOM   4641  N  NE   B ARG A 1 281 ? 56.784  22.401  3.313   0.44 48.87  ? 278  ARG A NE   1 
ATOM   4642  C  CZ   A ARG A 1 281 ? 60.512  25.641  0.625   0.56 54.61  ? 278  ARG A CZ   1 
ATOM   4643  C  CZ   B ARG A 1 281 ? 55.909  22.296  4.307   0.44 56.58  ? 278  ARG A CZ   1 
ATOM   4644  N  NH1  A ARG A 1 281 ? 60.478  25.180  -0.618  0.56 59.47  ? 278  ARG A NH1  1 
ATOM   4645  N  NH1  B ARG A 1 281 ? 54.788  22.999  4.287   0.44 59.00  ? 278  ARG A NH1  1 
ATOM   4646  N  NH2  A ARG A 1 281 ? 61.413  26.554  0.965   0.56 56.51  ? 278  ARG A NH2  1 
ATOM   4647  N  NH2  B ARG A 1 281 ? 56.159  21.487  5.328   0.44 63.26  ? 278  ARG A NH2  1 
ATOM   4648  H  H    A ARG A 1 281 ? 55.701  27.063  -0.301  0.56 67.00  ? 278  ARG A H    1 
ATOM   4649  H  H    B ARG A 1 281 ? 55.701  27.061  -0.352  0.44 67.00  ? 278  ARG A H    1 
ATOM   4650  H  HA   A ARG A 1 281 ? 54.748  24.893  0.795   0.56 63.24  ? 278  ARG A HA   1 
ATOM   4651  H  HA   B ARG A 1 281 ? 54.828  24.892  0.761   0.44 63.41  ? 278  ARG A HA   1 
ATOM   4652  H  HB2  A ARG A 1 281 ? 56.940  26.459  1.608   0.56 63.80  ? 278  ARG A HB2  1 
ATOM   4653  H  HB2  B ARG A 1 281 ? 57.106  25.377  0.624   0.44 63.82  ? 278  ARG A HB2  1 
ATOM   4654  H  HB3  A ARG A 1 281 ? 56.551  25.114  2.350   0.56 63.80  ? 278  ARG A HB3  1 
ATOM   4655  H  HB3  B ARG A 1 281 ? 56.920  26.552  1.672   0.44 63.82  ? 278  ARG A HB3  1 
ATOM   4656  H  HG2  A ARG A 1 281 ? 56.893  24.076  0.154   0.56 69.94  ? 278  ARG A HG2  1 
ATOM   4657  H  HG2  B ARG A 1 281 ? 57.857  24.773  2.761   0.44 58.93  ? 278  ARG A HG2  1 
ATOM   4658  H  HG3  A ARG A 1 281 ? 57.734  25.393  -0.156  0.56 69.94  ? 278  ARG A HG3  1 
ATOM   4659  H  HG3  B ARG A 1 281 ? 56.373  24.943  3.306   0.44 58.93  ? 278  ARG A HG3  1 
ATOM   4660  H  HD2  A ARG A 1 281 ? 58.322  23.831  2.105   0.56 62.84  ? 278  ARG A HD2  1 
ATOM   4661  H  HD2  B ARG A 1 281 ? 55.697  23.205  1.859   0.44 55.33  ? 278  ARG A HD2  1 
ATOM   4662  H  HD3  A ARG A 1 281 ? 59.000  23.509  0.702   0.56 62.84  ? 278  ARG A HD3  1 
ATOM   4663  H  HD3  B ARG A 1 281 ? 57.225  22.986  1.468   0.44 55.33  ? 278  ARG A HD3  1 
ATOM   4664  H  HE   A ARG A 1 281 ? 59.688  25.526  2.321   0.56 61.69  ? 278  ARG A HE   1 
ATOM   4665  H  HE   B ARG A 1 281 ? 57.497  21.922  3.352   0.44 58.64  ? 278  ARG A HE   1 
ATOM   4666  H  HH11 A ARG A 1 281 ? 59.894  24.589  -0.841  0.56 71.36  ? 278  ARG A HH11 1 
ATOM   4667  H  HH11 B ARG A 1 281 ? 54.625  23.530  3.630   0.44 70.80  ? 278  ARG A HH11 1 
ATOM   4668  H  HH12 A ARG A 1 281 ? 61.042  25.468  -1.199  0.56 71.36  ? 278  ARG A HH12 1 
ATOM   4669  H  HH12 B ARG A 1 281 ? 54.224  22.927  4.932   0.44 70.80  ? 278  ARG A HH12 1 
ATOM   4670  H  HH21 A ARG A 1 281 ? 61.436  26.856  1.770   0.56 67.81  ? 278  ARG A HH21 1 
ATOM   4671  H  HH21 B ARG A 1 281 ? 56.884  21.024  5.343   0.44 75.92  ? 278  ARG A HH21 1 
ATOM   4672  H  HH22 A ARG A 1 281 ? 61.976  26.840  0.382   0.56 67.81  ? 278  ARG A HH22 1 
ATOM   4673  H  HH22 B ARG A 1 281 ? 55.588  21.413  5.967   0.44 75.92  ? 278  ARG A HH22 1 
ATOM   4674  N  N    . TYR A 1 282 ? 54.192  27.528  2.449   1.00 58.70  ? 279  TYR A N    1 
ATOM   4675  C  CA   . TYR A 1 282 ? 53.418  28.060  3.562   1.00 54.24  ? 279  TYR A CA   1 
ATOM   4676  C  C    . TYR A 1 282 ? 51.924  27.712  3.459   1.00 60.55  ? 279  TYR A C    1 
ATOM   4677  O  O    . TYR A 1 282 ? 51.258  27.548  4.483   1.00 61.87  ? 279  TYR A O    1 
ATOM   4678  C  CB   . TYR A 1 282 ? 53.596  29.588  3.636   1.00 55.39  ? 279  TYR A CB   1 
ATOM   4679  C  CG   . TYR A 1 282 ? 52.868  30.222  4.799   1.00 51.92  ? 279  TYR A CG   1 
ATOM   4680  C  CD1  . TYR A 1 282 ? 53.423  30.232  6.072   1.00 52.82  ? 279  TYR A CD1  1 
ATOM   4681  C  CD2  . TYR A 1 282 ? 51.615  30.793  4.630   1.00 52.11  ? 279  TYR A CD2  1 
ATOM   4682  C  CE1  . TYR A 1 282 ? 52.749  30.805  7.146   1.00 56.94  ? 279  TYR A CE1  1 
ATOM   4683  C  CE2  . TYR A 1 282 ? 50.933  31.360  5.697   1.00 55.36  ? 279  TYR A CE2  1 
ATOM   4684  C  CZ   . TYR A 1 282 ? 51.502  31.368  6.948   1.00 61.39  ? 279  TYR A CZ   1 
ATOM   4685  O  OH   . TYR A 1 282 ? 50.813  31.940  7.993   1.00 62.32  ? 279  TYR A OH   1 
ATOM   4686  H  H    A TYR A 1 282 ? 54.564  28.123  1.952   0.56 70.44  ? 279  TYR A H    1 
ATOM   4687  H  H    B TYR A 1 282 ? 54.565  28.130  1.961   0.44 70.44  ? 279  TYR A H    1 
ATOM   4688  H  HA   . TYR A 1 282 ? 53.756  27.680  4.388   1.00 65.08  ? 279  TYR A HA   1 
ATOM   4689  H  HB2  . TYR A 1 282 ? 54.540  29.789  3.730   1.00 66.47  ? 279  TYR A HB2  1 
ATOM   4690  H  HB3  . TYR A 1 282 ? 53.254  29.983  2.819   1.00 66.47  ? 279  TYR A HB3  1 
ATOM   4691  H  HD1  . TYR A 1 282 ? 54.261  29.853  6.208   1.00 63.38  ? 279  TYR A HD1  1 
ATOM   4692  H  HD2  . TYR A 1 282 ? 51.222  30.790  3.787   1.00 62.54  ? 279  TYR A HD2  1 
ATOM   4693  H  HE1  . TYR A 1 282 ? 53.134  30.807  7.993   1.00 68.33  ? 279  TYR A HE1  1 
ATOM   4694  H  HE2  . TYR A 1 282 ? 50.095  31.742  5.565   1.00 66.43  ? 279  TYR A HE2  1 
ATOM   4695  H  HH   . TYR A 1 282 ? 50.076  32.238  7.723   1.00 74.78  ? 279  TYR A HH   1 
ATOM   4696  N  N    . GLN A 1 283 ? 51.416  27.551  2.235   1.00 76.91  ? 280  GLN A N    1 
ATOM   4697  C  CA   . GLN A 1 283 ? 49.982  27.323  1.995   1.00 75.50  ? 280  GLN A CA   1 
ATOM   4698  C  C    . GLN A 1 283 ? 49.450  25.987  2.516   1.00 85.58  ? 280  GLN A C    1 
ATOM   4699  O  O    . GLN A 1 283 ? 48.306  25.907  2.975   1.00 94.73  ? 280  GLN A O    1 
ATOM   4700  C  CB   . GLN A 1 283 ? 49.679  27.394  0.498   1.00 80.89  ? 280  GLN A CB   1 
ATOM   4701  C  CG   . GLN A 1 283 ? 49.928  28.745  -0.124  1.00 88.26  ? 280  GLN A CG   1 
ATOM   4702  C  CD   . GLN A 1 283 ? 49.244  28.888  -1.472  1.00 99.03  ? 280  GLN A CD   1 
ATOM   4703  O  OE1  . GLN A 1 283 ? 48.236  29.586  -1.593  1.00 99.56  ? 280  GLN A OE1  1 
ATOM   4704  N  NE2  . GLN A 1 283 ? 49.784  28.220  -2.491  1.00 93.14  ? 280  GLN A NE2  1 
ATOM   4705  H  H    . GLN A 1 283 ? 51.886  27.570  1.516   1.00 92.29  ? 280  GLN A H    1 
ATOM   4706  H  HA   . GLN A 1 283 ? 49.479  28.028  2.431   1.00 90.60  ? 280  GLN A HA   1 
ATOM   4707  H  HB2  . GLN A 1 283 ? 50.239  26.750  0.037   1.00 97.07  ? 280  GLN A HB2  1 
ATOM   4708  H  HB3  . GLN A 1 283 ? 48.745  27.173  0.359   1.00 97.07  ? 280  GLN A HB3  1 
ATOM   4709  H  HG2  . GLN A 1 283 ? 49.583  29.435  0.464   1.00 105.91 ? 280  GLN A HG2  1 
ATOM   4710  H  HG3  . GLN A 1 283 ? 50.882  28.864  -0.255  1.00 105.91 ? 280  GLN A HG3  1 
ATOM   4711  H  HE21 . GLN A 1 283 ? 50.485  27.738  -2.367  1.00 111.77 ? 280  GLN A HE21 1 
ATOM   4712  H  HE22 . GLN A 1 283 ? 49.430  28.271  -3.274  1.00 111.77 ? 280  GLN A HE22 1 
ATOM   4713  N  N    . ASN A 1 284 ? 50.271  24.942  2.414   1.00 84.87  ? 281  ASN A N    1 
ATOM   4714  C  CA   . ASN A 1 284 ? 49.851  23.583  2.765   1.00 86.19  ? 281  ASN A CA   1 
ATOM   4715  C  C    . ASN A 1 284 ? 49.371  23.458  4.211   1.00 97.96  ? 281  ASN A C    1 
ATOM   4716  O  O    . ASN A 1 284 ? 48.326  22.857  4.472   1.00 113.89 ? 281  ASN A O    1 
ATOM   4717  C  CB   . ASN A 1 284 ? 50.998  22.600  2.513   1.00 84.12  ? 281  ASN A CB   1 
ATOM   4718  C  CG   . ASN A 1 284 ? 51.431  22.571  1.051   1.00 97.00  ? 281  ASN A CG   1 
ATOM   4719  O  OD1  . ASN A 1 284 ? 50.774  23.157  0.185   1.00 104.34 ? 281  ASN A OD1  1 
ATOM   4720  N  ND2  . ASN A 1 284 ? 52.533  21.876  0.767   1.00 84.33  ? 281  ASN A ND2  1 
ATOM   4721  H  H    . ASN A 1 284 ? 51.085  24.993  2.141   1.00 101.85 ? 281  ASN A H    1 
ATOM   4722  H  HA   . ASN A 1 284 ? 49.114  23.328  2.188   1.00 103.43 ? 281  ASN A HA   1 
ATOM   4723  H  HB2  . ASN A 1 284 ? 51.763  22.862  3.048   1.00 100.94 ? 281  ASN A HB2  1 
ATOM   4724  H  HB3  . ASN A 1 284 ? 50.710  21.707  2.759   1.00 100.94 ? 281  ASN A HB3  1 
ATOM   4725  H  HD21 . ASN A 1 284 ? 52.961  21.473  1.395   1.00 101.20 ? 281  ASN A HD21 1 
ATOM   4726  H  HD22 . ASN A 1 284 ? 52.816  21.831  -0.044  1.00 101.20 ? 281  ASN A HD22 1 
ATOM   4727  N  N    . ASN A 1 285 ? 50.130  24.032  5.142   1.00 84.88  ? 282  ASN A N    1 
ATOM   4728  C  CA   . ASN A 1 285 ? 49.756  24.024  6.557   1.00 90.16  ? 282  ASN A CA   1 
ATOM   4729  C  C    . ASN A 1 285 ? 49.230  25.385  7.012   1.00 102.75 ? 282  ASN A C    1 
ATOM   4730  O  O    . ASN A 1 285 ? 48.030  25.660  6.922   1.00 104.00 ? 282  ASN A O    1 
ATOM   4731  C  CB   . ASN A 1 285 ? 50.946  23.609  7.424   1.00 79.23  ? 282  ASN A CB   1 
ATOM   4732  C  CG   . ASN A 1 285 ? 52.285  24.064  6.847   1.00 87.78  ? 282  ASN A CG   1 
ATOM   4733  O  OD1  . ASN A 1 285 ? 53.066  23.250  6.339   1.00 83.08  ? 282  ASN A OD1  1 
ATOM   4734  N  ND2  . ASN A 1 285 ? 52.556  25.368  6.927   1.00 85.76  ? 282  ASN A ND2  1 
ATOM   4735  H  H    . ASN A 1 285 ? 50.872  24.435  4.980   1.00 101.86 ? 282  ASN A H    1 
ATOM   4736  H  HA   . ASN A 1 285 ? 49.050  23.373  6.690   1.00 108.19 ? 282  ASN A HA   1 
ATOM   4737  H  HB2  . ASN A 1 285 ? 50.849  24.004  8.304   1.00 95.08  ? 282  ASN A HB2  1 
ATOM   4738  H  HB3  . ASN A 1 285 ? 50.963  22.642  7.494   1.00 95.08  ? 282  ASN A HB3  1 
ATOM   4739  H  HD21 . ASN A 1 285 ? 51.989  25.904  7.289   1.00 102.92 ? 282  ASN A HD21 1 
ATOM   4740  H  HD22 . ASN A 1 285 ? 53.297  25.673  6.615   1.00 102.92 ? 282  ASN A HD22 1 
ATOM   4741  N  N    . PRO A 1 293 ? 47.397  33.181  2.423   1.00 66.00  ? 290  PRO A N    1 
ATOM   4742  C  CA   . PRO A 1 293 ? 47.618  31.998  1.572   1.00 87.25  ? 290  PRO A CA   1 
ATOM   4743  C  C    . PRO A 1 293 ? 48.095  32.326  0.149   1.00 75.05  ? 290  PRO A C    1 
ATOM   4744  O  O    . PRO A 1 293 ? 49.144  31.812  -0.261  1.00 79.47  ? 290  PRO A O    1 
ATOM   4745  C  CB   . PRO A 1 293 ? 46.242  31.307  1.534   1.00 65.17  ? 290  PRO A CB   1 
ATOM   4746  C  CG   . PRO A 1 293 ? 45.256  32.350  1.967   1.00 78.71  ? 290  PRO A CG   1 
ATOM   4747  C  CD   . PRO A 1 293 ? 46.017  33.241  2.935   1.00 77.25  ? 290  PRO A CD   1 
ATOM   4748  H  HA   . PRO A 1 293 ? 48.259  31.403  1.990   1.00 104.70 ? 290  PRO A HA   1 
ATOM   4749  H  HB2  . PRO A 1 293 ? 46.051  31.010  0.630   1.00 78.21  ? 290  PRO A HB2  1 
ATOM   4750  H  HB3  . PRO A 1 293 ? 46.238  30.556  2.148   1.00 78.21  ? 290  PRO A HB3  1 
ATOM   4751  H  HG2  . PRO A 1 293 ? 44.957  32.857  1.196   1.00 94.45  ? 290  PRO A HG2  1 
ATOM   4752  H  HG3  . PRO A 1 293 ? 44.505  31.925  2.411   1.00 94.45  ? 290  PRO A HG3  1 
ATOM   4753  H  HD2  . PRO A 1 293 ? 45.680  34.150  2.897   1.00 92.70  ? 290  PRO A HD2  1 
ATOM   4754  H  HD3  . PRO A 1 293 ? 45.973  32.881  3.835   1.00 92.70  ? 290  PRO A HD3  1 
ATOM   4755  N  N    . TRP A 1 294 ? 47.359  33.157  -0.590  1.00 57.44  ? 291  TRP A N    1 
ATOM   4756  C  CA   . TRP A 1 294 ? 47.786  33.507  -1.945  1.00 63.42  ? 291  TRP A CA   1 
ATOM   4757  C  C    . TRP A 1 294 ? 48.781  34.661  -1.938  1.00 55.45  ? 291  TRP A C    1 
ATOM   4758  O  O    . TRP A 1 294 ? 48.568  35.675  -2.589  1.00 64.05  ? 291  TRP A O    1 
ATOM   4759  C  CB   . TRP A 1 294 ? 46.583  33.885  -2.819  1.00 57.91  ? 291  TRP A CB   1 
ATOM   4760  C  CG   . TRP A 1 294 ? 45.552  32.814  -2.885  1.00 59.30  ? 291  TRP A CG   1 
ATOM   4761  C  CD1  . TRP A 1 294 ? 44.299  32.849  -2.345  1.00 60.14  ? 291  TRP A CD1  1 
ATOM   4762  C  CD2  . TRP A 1 294 ? 45.697  31.522  -3.480  1.00 67.59  ? 291  TRP A CD2  1 
ATOM   4763  N  NE1  . TRP A 1 294 ? 43.643  31.669  -2.591  1.00 57.41  ? 291  TRP A NE1  1 
ATOM   4764  C  CE2  . TRP A 1 294 ? 44.480  30.833  -3.284  1.00 75.99  ? 291  TRP A CE2  1 
ATOM   4765  C  CE3  . TRP A 1 294 ? 46.732  30.882  -4.171  1.00 73.25  ? 291  TRP A CE3  1 
ATOM   4766  C  CZ2  . TRP A 1 294 ? 44.272  29.535  -3.757  1.00 69.41  ? 291  TRP A CZ2  1 
ATOM   4767  C  CZ3  . TRP A 1 294 ? 46.523  29.596  -4.637  1.00 76.31  ? 291  TRP A CZ3  1 
ATOM   4768  C  CH2  . TRP A 1 294 ? 45.303  28.937  -4.427  1.00 77.54  ? 291  TRP A CH2  1 
ATOM   4769  H  H    . TRP A 1 294 ? 46.624  33.524  -0.337  1.00 68.92  ? 291  TRP A H    1 
ATOM   4770  H  HA   . TRP A 1 294 ? 48.220  32.739  -2.348  1.00 76.10  ? 291  TRP A HA   1 
ATOM   4771  H  HB2  . TRP A 1 294 ? 46.165  34.681  -2.453  1.00 69.49  ? 291  TRP A HB2  1 
ATOM   4772  H  HB3  . TRP A 1 294 ? 46.892  34.059  -3.722  1.00 69.49  ? 291  TRP A HB3  1 
ATOM   4773  H  HD1  . TRP A 1 294 ? 43.936  33.574  -1.890  1.00 72.17  ? 291  TRP A HD1  1 
ATOM   4774  H  HE1  . TRP A 1 294 ? 42.840  31.482  -2.345  1.00 68.89  ? 291  TRP A HE1  1 
ATOM   4775  H  HE3  . TRP A 1 294 ? 47.543  31.313  -4.315  1.00 87.90  ? 291  TRP A HE3  1 
ATOM   4776  H  HZ2  . TRP A 1 294 ? 43.464  29.094  -3.620  1.00 83.29  ? 291  TRP A HZ2  1 
ATOM   4777  H  HZ3  . TRP A 1 294 ? 47.204  29.161  -5.099  1.00 91.57  ? 291  TRP A HZ3  1 
ATOM   4778  H  HH2  . TRP A 1 294 ? 45.192  28.073  -4.753  1.00 93.05  ? 291  TRP A HH2  1 
ATOM   4779  N  N    . LEU A 1 295 ? 49.862  34.503  -1.186  1.00 51.16  ? 292  LEU A N    1 
ATOM   4780  C  CA   . LEU A 1 295 ? 50.798  35.591  -0.964  1.00 50.79  ? 292  LEU A CA   1 
ATOM   4781  C  C    . LEU A 1 295 ? 51.369  36.191  -2.261  1.00 44.15  ? 292  LEU A C    1 
ATOM   4782  O  O    . LEU A 1 295 ? 51.484  37.412  -2.406  1.00 56.10  ? 292  LEU A O    1 
ATOM   4783  C  CB   . LEU A 1 295 ? 51.929  35.075  -0.081  1.00 48.75  ? 292  LEU A CB   1 
ATOM   4784  C  CG   . LEU A 1 295 ? 51.467  34.581  1.292   1.00 48.80  ? 292  LEU A CG   1 
ATOM   4785  C  CD1  . LEU A 1 295 ? 52.634  33.983  2.056   1.00 52.69  ? 292  LEU A CD1  1 
ATOM   4786  C  CD2  . LEU A 1 295 ? 50.830  35.704  2.115   1.00 48.32  ? 292  LEU A CD2  1 
ATOM   4787  H  H    . LEU A 1 295 ? 50.075  33.770  -0.790  1.00 61.40  ? 292  LEU A H    1 
ATOM   4788  H  HA   . LEU A 1 295 ? 50.345  36.301  -0.483  1.00 60.95  ? 292  LEU A HA   1 
ATOM   4789  H  HB2  . LEU A 1 295 ? 52.364  34.334  -0.531  1.00 58.50  ? 292  LEU A HB2  1 
ATOM   4790  H  HB3  . LEU A 1 295 ? 52.566  35.792  0.061   1.00 58.50  ? 292  LEU A HB3  1 
ATOM   4791  H  HG   . LEU A 1 295 ? 50.801  33.886  1.170   1.00 58.56  ? 292  LEU A HG   1 
ATOM   4792  H  HD11 . LEU A 1 295 ? 53.317  34.663  2.172   1.00 63.22  ? 292  LEU A HD11 1 
ATOM   4793  H  HD12 . LEU A 1 295 ? 52.321  33.677  2.922   1.00 63.22  ? 292  LEU A HD12 1 
ATOM   4794  H  HD13 . LEU A 1 295 ? 52.993  33.237  1.551   1.00 63.22  ? 292  LEU A HD13 1 
ATOM   4795  H  HD21 . LEU A 1 295 ? 50.061  36.049  1.635   1.00 57.98  ? 292  LEU A HD21 1 
ATOM   4796  H  HD22 . LEU A 1 295 ? 50.553  35.349  2.973   1.00 57.98  ? 292  LEU A HD22 1 
ATOM   4797  H  HD23 . LEU A 1 295 ? 51.484  36.410  2.243   1.00 57.98  ? 292  LEU A HD23 1 
ATOM   4798  N  N    . GLU A 1 296 ? 51.709  35.316  -3.197  1.00 40.34  ? 293  GLU A N    1 
ATOM   4799  C  CA   . GLU A 1 296 ? 52.362  35.713  -4.436  1.00 51.54  ? 293  GLU A CA   1 
ATOM   4800  C  C    . GLU A 1 296 ? 51.466  36.670  -5.199  1.00 52.33  ? 293  GLU A C    1 
ATOM   4801  O  O    . GLU A 1 296 ? 51.897  37.720  -5.710  1.00 46.69  ? 293  GLU A O    1 
ATOM   4802  C  CB   . GLU A 1 296 ? 52.687  34.482  -5.285  1.00 49.66  ? 293  GLU A CB   1 
ATOM   4803  C  CG   . GLU A 1 296 ? 53.391  34.778  -6.610  1.00 54.87  ? 293  GLU A CG   1 
ATOM   4804  C  CD   . GLU A 1 296 ? 53.347  33.606  -7.597  1.00 58.81  ? 293  GLU A CD   1 
ATOM   4805  O  OE1  . GLU A 1 296 ? 53.227  32.438  -7.165  1.00 55.23  ? 293  GLU A OE1  1 
ATOM   4806  O  OE2  . GLU A 1 296 ? 53.454  33.856  -8.815  1.00 66.18  ? 293  GLU A OE2  1 
ATOM   4807  H  H    . GLU A 1 296 ? 51.570  34.469  -3.137  1.00 48.41  ? 293  GLU A H    1 
ATOM   4808  H  HA   . GLU A 1 296 ? 53.192  36.171  -4.230  1.00 61.84  ? 293  GLU A HA   1 
ATOM   4809  H  HB2  . GLU A 1 296 ? 53.265  33.897  -4.771  1.00 59.59  ? 293  GLU A HB2  1 
ATOM   4810  H  HB3  . GLU A 1 296 ? 51.858  34.022  -5.491  1.00 59.59  ? 293  GLU A HB3  1 
ATOM   4811  H  HG2  . GLU A 1 296 ? 52.962  35.539  -7.031  1.00 65.85  ? 293  GLU A HG2  1 
ATOM   4812  H  HG3  . GLU A 1 296 ? 54.323  34.983  -6.431  1.00 65.85  ? 293  GLU A HG3  1 
ATOM   4813  N  N    . TRP A 1 297 ? 50.195  36.300  -5.254  1.00 42.93  ? 294  TRP A N    1 
ATOM   4814  C  CA   . TRP A 1 297 ? 49.248  37.056  -6.031  1.00 52.97  ? 294  TRP A CA   1 
ATOM   4815  C  C    . TRP A 1 297 ? 48.917  38.334  -5.310  1.00 38.26  ? 294  TRP A C    1 
ATOM   4816  O  O    . TRP A 1 297 ? 48.726  39.367  -5.941  1.00 48.94  ? 294  TRP A O    1 
ATOM   4817  C  CB   . TRP A 1 297 ? 47.996  36.222  -6.288  1.00 59.00  ? 294  TRP A CB   1 
ATOM   4818  C  CG   . TRP A 1 297 ? 48.225  35.093  -7.284  1.00 60.03  ? 294  TRP A CG   1 
ATOM   4819  C  CD1  . TRP A 1 297 ? 49.250  34.980  -8.190  1.00 58.94  ? 294  TRP A CD1  1 
ATOM   4820  C  CD2  . TRP A 1 297 ? 47.422  33.920  -7.448  1.00 52.63  ? 294  TRP A CD2  1 
ATOM   4821  N  NE1  . TRP A 1 297 ? 49.118  33.816  -8.912  1.00 59.04  ? 294  TRP A NE1  1 
ATOM   4822  C  CE2  . TRP A 1 297 ? 48.008  33.146  -8.470  1.00 54.73  ? 294  TRP A CE2  1 
ATOM   4823  C  CE3  . TRP A 1 297 ? 46.262  33.452  -6.831  1.00 61.43  ? 294  TRP A CE3  1 
ATOM   4824  C  CZ2  . TRP A 1 297 ? 47.463  31.934  -8.889  1.00 56.91  ? 294  TRP A CZ2  1 
ATOM   4825  C  CZ3  . TRP A 1 297 ? 45.731  32.246  -7.240  1.00 64.61  ? 294  TRP A CZ3  1 
ATOM   4826  C  CH2  . TRP A 1 297 ? 46.328  31.502  -8.261  1.00 54.47  ? 294  TRP A CH2  1 
ATOM   4827  H  H    . TRP A 1 297 ? 49.863  35.618  -4.850  1.00 51.52  ? 294  TRP A H    1 
ATOM   4828  H  HA   . TRP A 1 297 ? 49.643  37.283  -6.887  1.00 63.57  ? 294  TRP A HA   1 
ATOM   4829  H  HB2  . TRP A 1 297 ? 47.703  35.828  -5.452  1.00 70.80  ? 294  TRP A HB2  1 
ATOM   4830  H  HB3  . TRP A 1 297 ? 47.302  36.798  -6.644  1.00 70.80  ? 294  TRP A HB3  1 
ATOM   4831  H  HD1  . TRP A 1 297 ? 49.929  35.605  -8.307  1.00 70.73  ? 294  TRP A HD1  1 
ATOM   4832  H  HE1  . TRP A 1 297 ? 49.650  33.549  -9.533  1.00 70.85  ? 294  TRP A HE1  1 
ATOM   4833  H  HE3  . TRP A 1 297 ? 45.857  33.941  -6.152  1.00 73.71  ? 294  TRP A HE3  1 
ATOM   4834  H  HZ2  . TRP A 1 297 ? 47.861  31.434  -9.564  1.00 68.30  ? 294  TRP A HZ2  1 
ATOM   4835  H  HZ3  . TRP A 1 297 ? 44.956  31.928  -6.836  1.00 77.53  ? 294  TRP A HZ3  1 
ATOM   4836  H  HH2  . TRP A 1 297 ? 45.946  30.694  -8.518  1.00 65.37  ? 294  TRP A HH2  1 
ATOM   4837  N  N    . GLU A 1 298 ? 48.899  38.290  -3.989  1.00 40.24  ? 295  GLU A N    1 
ATOM   4838  C  CA   . GLU A 1 298 ? 48.631  39.496  -3.228  1.00 34.34  ? 295  GLU A CA   1 
ATOM   4839  C  C    . GLU A 1 298 ? 49.766  40.482  -3.445  1.00 43.64  ? 295  GLU A C    1 
ATOM   4840  O  O    . GLU A 1 298 ? 49.534  41.693  -3.566  1.00 49.48  ? 295  GLU A O    1 
ATOM   4841  C  CB   . GLU A 1 298 ? 48.463  39.168  -1.760  1.00 36.60  ? 295  GLU A CB   1 
ATOM   4842  C  CG   . GLU A 1 298 ? 47.241  38.306  -1.464  1.00 43.92  ? 295  GLU A CG   1 
ATOM   4843  C  CD   . GLU A 1 298 ? 47.103  37.954  0.007   1.00 59.09  ? 295  GLU A CD   1 
ATOM   4844  O  OE1  . GLU A 1 298 ? 48.087  38.133  0.770   1.00 52.78  ? 295  GLU A OE1  1 
ATOM   4845  O  OE2  . GLU A 1 298 ? 45.991  37.535  0.410   1.00 52.17  ? 295  GLU A OE2  1 
ATOM   4846  H  H    . GLU A 1 298 ? 49.036  37.586  -3.515  1.00 48.28  ? 295  GLU A H    1 
ATOM   4847  H  HA   . GLU A 1 298 ? 47.810  39.902  -3.547  1.00 41.21  ? 295  GLU A HA   1 
ATOM   4848  H  HB2  . GLU A 1 298 ? 49.247  38.686  -1.454  1.00 43.91  ? 295  GLU A HB2  1 
ATOM   4849  H  HB3  . GLU A 1 298 ? 48.369  39.995  -1.262  1.00 43.91  ? 295  GLU A HB3  1 
ATOM   4850  H  HG2  . GLU A 1 298 ? 46.444  38.788  -1.733  1.00 52.71  ? 295  GLU A HG2  1 
ATOM   4851  H  HG3  . GLU A 1 298 ? 47.312  37.478  -1.965  1.00 52.71  ? 295  GLU A HG3  1 
ATOM   4852  N  N    . ILE A 1 299 ? 50.989  39.964  -3.551  1.00 39.23  ? 296  ILE A N    1 
ATOM   4853  C  CA   . ILE A 1 299 ? 52.134  40.831  -3.808  1.00 42.40  ? 296  ILE A CA   1 
ATOM   4854  C  C    . ILE A 1 299 ? 52.100  41.381  -5.232  1.00 41.92  ? 296  ILE A C    1 
ATOM   4855  O  O    . ILE A 1 299 ? 52.293  42.596  -5.443  1.00 42.75  ? 296  ILE A O    1 
ATOM   4856  C  CB   . ILE A 1 299 ? 53.456  40.077  -3.571  1.00 45.08  ? 296  ILE A CB   1 
ATOM   4857  C  CG1  . ILE A 1 299 ? 53.571  39.708  -2.094  1.00 44.07  ? 296  ILE A CG1  1 
ATOM   4858  C  CG2  . ILE A 1 299 ? 54.662  40.943  -3.944  1.00 43.74  ? 296  ILE A CG2  1 
ATOM   4859  C  CD1  . ILE A 1 299 ? 54.626  38.663  -1.803  1.00 47.39  ? 296  ILE A CD1  1 
ATOM   4860  H  H    . ILE A 1 299 ? 51.179  39.128  -3.480  1.00 47.08  ? 296  ILE A H    1 
ATOM   4861  H  HA   . ILE A 1 299 ? 52.103  41.582  -3.195  1.00 50.88  ? 296  ILE A HA   1 
ATOM   4862  H  HB   . ILE A 1 299 ? 53.464  39.268  -4.105  1.00 54.10  ? 296  ILE A HB   1 
ATOM   4863  H  HG12 . ILE A 1 299 ? 53.796  40.505  -1.589  1.00 52.88  ? 296  ILE A HG12 1 
ATOM   4864  H  HG13 . ILE A 1 299 ? 52.718  39.358  -1.792  1.00 52.88  ? 296  ILE A HG13 1 
ATOM   4865  H  HG21 . ILE A 1 299 ? 54.656  41.745  -3.398  1.00 52.48  ? 296  ILE A HG21 1 
ATOM   4866  H  HG22 . ILE A 1 299 ? 55.474  40.438  -3.782  1.00 52.48  ? 296  ILE A HG22 1 
ATOM   4867  H  HG23 . ILE A 1 299 ? 54.601  41.181  -4.882  1.00 52.48  ? 296  ILE A HG23 1 
ATOM   4868  H  HD11 . ILE A 1 299 ? 55.491  39.000  -2.087  1.00 56.87  ? 296  ILE A HD11 1 
ATOM   4869  H  HD12 . ILE A 1 299 ? 54.638  38.483  -0.850  1.00 56.87  ? 296  ILE A HD12 1 
ATOM   4870  H  HD13 . ILE A 1 299 ? 54.411  37.852  -2.290  1.00 56.87  ? 296  ILE A HD13 1 
ATOM   4871  N  N    . MET A 1 300 ? 51.797  40.524  -6.206  1.00 47.73  ? 297  MET A N    1 
ATOM   4872  C  CA   . MET A 1 300 ? 51.746  40.993  -7.592  1.00 46.80  ? 297  MET A CA   1 
ATOM   4873  C  C    . MET A 1 300 ? 50.677  42.064  -7.735  1.00 42.65  ? 297  MET A C    1 
ATOM   4874  O  O    . MET A 1 300 ? 50.915  43.143  -8.316  1.00 43.51  ? 297  MET A O    1 
ATOM   4875  C  CB   . MET A 1 300 ? 51.479  39.846  -8.556  1.00 43.61  ? 297  MET A CB   1 
ATOM   4876  C  CG   . MET A 1 300 ? 52.621  38.850  -8.645  1.00 58.68  ? 297  MET A CG   1 
ATOM   4877  S  SD   . MET A 1 300 ? 52.136  37.299  -9.435  1.00 58.72  ? 297  MET A SD   1 
ATOM   4878  C  CE   . MET A 1 300 ? 52.012  37.824  -11.118 1.00 62.00  ? 297  MET A CE   1 
ATOM   4879  H  H    . MET A 1 300 ? 51.622  39.689  -6.097  1.00 57.28  ? 297  MET A H    1 
ATOM   4880  H  HA   . MET A 1 300 ? 52.606  41.378  -7.822  1.00 56.15  ? 297  MET A HA   1 
ATOM   4881  H  HB2  . MET A 1 300 ? 50.689  39.366  -8.261  1.00 52.33  ? 297  MET A HB2  1 
ATOM   4882  H  HB3  . MET A 1 300 ? 51.331  40.209  -9.443  1.00 52.33  ? 297  MET A HB3  1 
ATOM   4883  H  HG2  . MET A 1 300 ? 53.340  39.240  -9.166  1.00 70.42  ? 297  MET A HG2  1 
ATOM   4884  H  HG3  . MET A 1 300 ? 52.933  38.645  -7.750  1.00 70.42  ? 297  MET A HG3  1 
ATOM   4885  H  HE1  . MET A 1 300 ? 52.875  38.161  -11.408 1.00 74.40  ? 297  MET A HE1  1 
ATOM   4886  H  HE2  . MET A 1 300 ? 51.751  37.067  -11.666 1.00 74.40  ? 297  MET A HE2  1 
ATOM   4887  H  HE3  . MET A 1 300 ? 51.344  38.524  -11.182 1.00 74.40  ? 297  MET A HE3  1 
ATOM   4888  N  N    . LEU A 1 301 ? 49.505  41.775  -7.175  1.00 40.50  ? 298  LEU A N    1 
ATOM   4889  C  CA   . LEU A 1 301 ? 48.396  42.714  -7.221  1.00 42.16  ? 298  LEU A CA   1 
ATOM   4890  C  C    . LEU A 1 301 ? 48.753  44.000  -6.504  1.00 46.77  ? 298  LEU A C    1 
ATOM   4891  O  O    . LEU A 1 301 ? 48.546  45.090  -7.042  1.00 43.36  ? 298  LEU A O    1 
ATOM   4892  C  CB   . LEU A 1 301 ? 47.148  42.103  -6.590  1.00 38.09  ? 298  LEU A CB   1 
ATOM   4893  C  CG   . LEU A 1 301 ? 46.491  40.991  -7.404  1.00 41.98  ? 298  LEU A CG   1 
ATOM   4894  C  CD1  . LEU A 1 301 ? 45.468  40.264  -6.551  1.00 47.62  ? 298  LEU A CD1  1 
ATOM   4895  C  CD2  . LEU A 1 301 ? 45.830  41.550  -8.689  1.00 43.85  ? 298  LEU A CD2  1 
ATOM   4896  H  H    . LEU A 1 301 ? 49.329  41.040  -6.764  1.00 48.60  ? 298  LEU A H    1 
ATOM   4897  H  HA   . LEU A 1 301 ? 48.196  42.928  -8.146  1.00 50.59  ? 298  LEU A HA   1 
ATOM   4898  H  HB2  . LEU A 1 301 ? 47.389  41.730  -5.727  1.00 45.71  ? 298  LEU A HB2  1 
ATOM   4899  H  HB3  . LEU A 1 301 ? 46.489  42.804  -6.468  1.00 45.71  ? 298  LEU A HB3  1 
ATOM   4900  H  HG   . LEU A 1 301 ? 47.170  40.351  -7.670  1.00 50.37  ? 298  LEU A HG   1 
ATOM   4901  H  HD11 . LEU A 1 301 ? 44.793  40.897  -6.262  1.00 57.14  ? 298  LEU A HD11 1 
ATOM   4902  H  HD12 . LEU A 1 301 ? 45.059  39.561  -7.080  1.00 57.14  ? 298  LEU A HD12 1 
ATOM   4903  H  HD13 . LEU A 1 301 ? 45.916  39.881  -5.781  1.00 57.14  ? 298  LEU A HD13 1 
ATOM   4904  H  HD21 . LEU A 1 301 ? 46.509  41.977  -9.233  1.00 52.62  ? 298  LEU A HD21 1 
ATOM   4905  H  HD22 . LEU A 1 301 ? 45.424  40.818  -9.179  1.00 52.62  ? 298  LEU A HD22 1 
ATOM   4906  H  HD23 . LEU A 1 301 ? 45.151  42.197  -8.438  1.00 52.62  ? 298  LEU A HD23 1 
ATOM   4907  N  N    . GLN A 1 302 ? 49.345  43.886  -5.317  1.00 50.61  ? 299  GLN A N    1 
ATOM   4908  C  CA   . GLN A 1 302 ? 49.691  45.094  -4.575  1.00 42.25  ? 299  GLN A CA   1 
ATOM   4909  C  C    . GLN A 1 302 ? 50.713  45.907  -5.342  1.00 45.32  ? 299  GLN A C    1 
ATOM   4910  O  O    . GLN A 1 302 ? 50.661  47.138  -5.309  1.00 46.59  ? 299  GLN A O    1 
ATOM   4911  C  CB   . GLN A 1 302 ? 50.208  44.776  -3.170  1.00 49.00  ? 299  GLN A CB   1 
ATOM   4912  C  CG   . GLN A 1 302 ? 50.694  46.050  -2.424  1.00 44.83  ? 299  GLN A CG   1 
ATOM   4913  C  CD   . GLN A 1 302 ? 50.443  46.047  -0.921  1.00 44.86  ? 299  GLN A CD   1 
ATOM   4914  O  OE1  . GLN A 1 302 ? 49.789  45.154  -0.383  1.00 49.65  ? 299  GLN A OE1  1 
ATOM   4915  N  NE2  . GLN A 1 302 ? 50.959  47.062  -0.237  1.00 47.08  ? 299  GLN A NE2  1 
ATOM   4916  H  H    . GLN A 1 302 ? 49.552  43.146  -4.930  1.00 60.74  ? 299  GLN A H    1 
ATOM   4917  H  HA   . GLN A 1 302 ? 48.893  45.637  -4.479  1.00 50.70  ? 299  GLN A HA   1 
ATOM   4918  H  HB2  . GLN A 1 302 ? 49.494  44.376  -2.651  1.00 58.80  ? 299  GLN A HB2  1 
ATOM   4919  H  HB3  . GLN A 1 302 ? 50.956  44.163  -3.238  1.00 58.80  ? 299  GLN A HB3  1 
ATOM   4920  H  HG2  . GLN A 1 302 ? 51.649  46.143  -2.561  1.00 53.79  ? 299  GLN A HG2  1 
ATOM   4921  H  HG3  . GLN A 1 302 ? 50.235  46.820  -2.796  1.00 53.79  ? 299  GLN A HG3  1 
ATOM   4922  H  HE21 . GLN A 1 302 ? 51.405  47.673  -0.646  1.00 56.49  ? 299  GLN A HE21 1 
ATOM   4923  H  HE22 . GLN A 1 302 ? 50.847  47.109  0.614   1.00 56.49  ? 299  GLN A HE22 1 
ATOM   4924  N  N    . TYR A 1 303 ? 51.567  45.248  -6.123  1.00 39.87  ? 300  TYR A N    1 
ATOM   4925  C  CA   . TYR A 1 303 ? 52.592  45.996  -6.862  1.00 40.51  ? 300  TYR A CA   1 
ATOM   4926  C  C    . TYR A 1 303 ? 52.219  46.395  -8.286  1.00 44.92  ? 300  TYR A C    1 
ATOM   4927  O  O    . TYR A 1 303 ? 52.880  47.276  -8.841  1.00 53.28  ? 300  TYR A O    1 
ATOM   4928  C  CB   . TYR A 1 303 ? 53.894  45.182  -6.899  1.00 40.14  ? 300  TYR A CB   1 
ATOM   4929  C  CG   . TYR A 1 303 ? 54.783  45.502  -5.715  1.00 52.89  ? 300  TYR A CG   1 
ATOM   4930  C  CD1  . TYR A 1 303 ? 54.496  45.005  -4.456  1.00 44.73  ? 300  TYR A CD1  1 
ATOM   4931  C  CD2  . TYR A 1 303 ? 55.901  46.313  -5.859  1.00 44.70  ? 300  TYR A CD2  1 
ATOM   4932  C  CE1  . TYR A 1 303 ? 55.287  45.313  -3.370  1.00 53.26  ? 300  TYR A CE1  1 
ATOM   4933  C  CE2  . TYR A 1 303 ? 56.696  46.624  -4.787  1.00 46.78  ? 300  TYR A CE2  1 
ATOM   4934  C  CZ   . TYR A 1 303 ? 56.390  46.124  -3.541  1.00 56.73  ? 300  TYR A CZ   1 
ATOM   4935  O  OH   . TYR A 1 303 ? 57.189  46.435  -2.465  1.00 56.41  ? 300  TYR A OH   1 
ATOM   4936  H  H    . TYR A 1 303 ? 51.579  44.396  -6.243  1.00 47.85  ? 300  TYR A H    1 
ATOM   4937  H  HA   . TYR A 1 303 ? 52.778  46.814  -6.376  1.00 48.61  ? 300  TYR A HA   1 
ATOM   4938  H  HB2  . TYR A 1 303 ? 53.681  44.236  -6.872  1.00 48.17  ? 300  TYR A HB2  1 
ATOM   4939  H  HB3  . TYR A 1 303 ? 54.381  45.394  -7.711  1.00 48.17  ? 300  TYR A HB3  1 
ATOM   4940  H  HD1  . TYR A 1 303 ? 53.748  44.465  -4.337  1.00 53.67  ? 300  TYR A HD1  1 
ATOM   4941  H  HD2  . TYR A 1 303 ? 56.108  46.661  -6.696  1.00 53.64  ? 300  TYR A HD2  1 
ATOM   4942  H  HE1  . TYR A 1 303 ? 55.081  44.973  -2.529  1.00 63.91  ? 300  TYR A HE1  1 
ATOM   4943  H  HE2  . TYR A 1 303 ? 57.440  47.170  -4.900  1.00 56.14  ? 300  TYR A HE2  1 
ATOM   4944  H  HH   . TYR A 1 303 ? 57.820  46.933  -2.710  1.00 67.69  ? 300  TYR A HH   1 
ATOM   4945  N  N    . CYS A 1 304 ? 51.187  45.783  -8.882  1.00 48.69  ? 301  CYS A N    1 
ATOM   4946  C  CA   . CYS A 1 304 ? 50.868  46.056  -10.303 1.00 46.37  ? 301  CYS A CA   1 
ATOM   4947  C  C    . CYS A 1 304 ? 49.414  46.409  -10.637 1.00 42.96  ? 301  CYS A C    1 
ATOM   4948  O  O    . CYS A 1 304 ? 49.124  46.867  -11.735 1.00 52.70  ? 301  CYS A O    1 
ATOM   4949  C  CB   . CYS A 1 304 ? 51.281  44.867  -11.156 1.00 42.89  ? 301  CYS A CB   1 
ATOM   4950  S  SG   . CYS A 1 304 ? 53.038  44.557  -11.077 1.00 54.42  ? 301  CYS A SG   1 
ATOM   4951  H  H    . CYS A 1 304 ? 50.663  45.217  -8.500  1.00 58.43  ? 301  CYS A H    1 
ATOM   4952  H  HA   . CYS A 1 304 ? 51.410  46.809  -10.586 1.00 55.64  ? 301  CYS A HA   1 
ATOM   4953  H  HB2  . CYS A 1 304 ? 50.820  44.074  -10.841 1.00 51.46  ? 301  CYS A HB2  1 
ATOM   4954  H  HB3  . CYS A 1 304 ? 51.048  45.044  -12.081 1.00 51.46  ? 301  CYS A HB3  1 
ATOM   4955  H  HG   . CYS A 1 304 ? 53.624  45.527  -11.471 1.00 65.31  ? 301  CYS A HG   1 
ATOM   4956  N  N    . PHE A 1 305 ? 48.496  46.148  -9.726  1.00 45.96  ? 302  PHE A N    1 
ATOM   4957  C  CA   . PHE A 1 305 ? 47.083  46.393  -9.979  1.00 44.39  ? 302  PHE A CA   1 
ATOM   4958  C  C    . PHE A 1 305 ? 46.688  47.883  -9.835  1.00 55.58  ? 302  PHE A C    1 
ATOM   4959  O  O    . PHE A 1 305 ? 47.217  48.588  -8.981  1.00 53.32  ? 302  PHE A O    1 
ATOM   4960  C  CB   . PHE A 1 305 ? 46.249  45.551  -9.029  1.00 51.21  ? 302  PHE A CB   1 
ATOM   4961  C  CG   . PHE A 1 305 ? 44.799  45.506  -9.378  1.00 52.44  ? 302  PHE A CG   1 
ATOM   4962  C  CD1  . PHE A 1 305 ? 43.934  46.451  -8.873  1.00 55.45  ? 302  PHE A CD1  1 
ATOM   4963  C  CD2  . PHE A 1 305 ? 44.305  44.531  -10.225 1.00 50.97  ? 302  PHE A CD2  1 
ATOM   4964  C  CE1  . PHE A 1 305 ? 42.594  46.425  -9.195  1.00 60.00  ? 302  PHE A CE1  1 
ATOM   4965  C  CE2  . PHE A 1 305 ? 42.967  44.490  -10.547 1.00 50.40  ? 302  PHE A CE2  1 
ATOM   4966  C  CZ   . PHE A 1 305 ? 42.106  45.439  -10.033 1.00 49.18  ? 302  PHE A CZ   1 
ATOM   4967  H  H    . PHE A 1 305 ? 48.663  45.827  -8.946  1.00 55.15  ? 302  PHE A H    1 
ATOM   4968  H  HA   . PHE A 1 305 ? 46.873  46.116  -10.885 1.00 53.27  ? 302  PHE A HA   1 
ATOM   4969  H  HB2  . PHE A 1 305 ? 46.585  44.641  -9.041  1.00 61.45  ? 302  PHE A HB2  1 
ATOM   4970  H  HB3  . PHE A 1 305 ? 46.328  45.918  -8.135  1.00 61.45  ? 302  PHE A HB3  1 
ATOM   4971  H  HD1  . PHE A 1 305 ? 44.880  43.888  -10.571 1.00 61.17  ? 302  PHE A HD1  1 
ATOM   4972  H  HD2  . PHE A 1 305 ? 44.257  47.114  -8.307  1.00 66.55  ? 302  PHE A HD2  1 
ATOM   4973  H  HE1  . PHE A 1 305 ? 42.644  43.828  -11.114 1.00 60.48  ? 302  PHE A HE1  1 
ATOM   4974  H  HE2  . PHE A 1 305 ? 42.018  47.065  -8.844  1.00 72.00  ? 302  PHE A HE2  1 
ATOM   4975  H  HZ   . PHE A 1 305 ? 41.202  45.417  -10.252 1.00 59.01  ? 302  PHE A HZ   1 
ATOM   4976  N  N    . PRO A 1 306 ? 45.759  48.375  -10.674 1.00 68.02  ? 303  PRO A N    1 
ATOM   4977  C  CA   . PRO A 1 306 ? 45.366  49.796  -10.626 1.00 59.30  ? 303  PRO A CA   1 
ATOM   4978  C  C    . PRO A 1 306 ? 44.673  50.254  -9.333  1.00 54.96  ? 303  PRO A C    1 
ATOM   4979  O  O    . PRO A 1 306 ? 43.974  49.478  -8.674  1.00 44.91  ? 303  PRO A O    1 
ATOM   4980  C  CB   . PRO A 1 306 ? 44.408  49.941  -11.821 1.00 56.34  ? 303  PRO A CB   1 
ATOM   4981  C  CG   . PRO A 1 306 ? 43.965  48.542  -12.146 1.00 51.31  ? 303  PRO A CG   1 
ATOM   4982  C  CD   . PRO A 1 306 ? 45.158  47.689  -11.834 1.00 55.38  ? 303  PRO A CD   1 
ATOM   4983  H  HA   . PRO A 1 306 ? 46.143  50.357  -10.779 1.00 71.16  ? 303  PRO A HA   1 
ATOM   4984  H  HB2  . PRO A 1 306 ? 43.650  50.490  -11.567 1.00 67.61  ? 303  PRO A HB2  1 
ATOM   4985  H  HB3  . PRO A 1 306 ? 44.880  50.334  -12.572 1.00 67.61  ? 303  PRO A HB3  1 
ATOM   4986  H  HG2  . PRO A 1 306 ? 43.210  48.298  -11.588 1.00 61.58  ? 303  PRO A HG2  1 
ATOM   4987  H  HG3  . PRO A 1 306 ? 43.733  48.481  -13.086 1.00 61.58  ? 303  PRO A HG3  1 
ATOM   4988  H  HD2  . PRO A 1 306 ? 44.879  46.792  -11.592 1.00 66.46  ? 303  PRO A HD2  1 
ATOM   4989  H  HD3  . PRO A 1 306 ? 45.775  47.683  -12.582 1.00 66.46  ? 303  PRO A HD3  1 
ATOM   4990  N  N    . ARG A 1 307 ? 44.925  51.511  -8.967  1.00 41.86  ? 304  ARG A N    1 
ATOM   4991  C  CA   . ARG A 1 307 ? 44.249  52.171  -7.851  1.00 40.21  ? 304  ARG A CA   1 
ATOM   4992  C  C    . ARG A 1 307 ? 43.223  53.131  -8.410  1.00 45.28  ? 304  ARG A C    1 
ATOM   4993  O  O    . ARG A 1 307 ? 43.521  53.921  -9.305  1.00 41.43  ? 304  ARG A O    1 
ATOM   4994  C  CB   . ARG A 1 307 ? 45.254  52.919  -6.971  1.00 42.35  ? 304  ARG A CB   1 
ATOM   4995  C  CG   . ARG A 1 307 ? 46.125  51.983  -6.154  1.00 42.98  ? 304  ARG A CG   1 
ATOM   4996  C  CD   . ARG A 1 307 ? 47.489  51.785  -6.780  1.00 43.43  ? 304  ARG A CD   1 
ATOM   4997  N  NE   . ARG A 1 307 ? 48.480  51.400  -5.782  1.00 50.01  ? 304  ARG A NE   1 
ATOM   4998  C  CZ   . ARG A 1 307 ? 49.100  50.226  -5.714  1.00 52.73  ? 304  ARG A CZ   1 
ATOM   4999  N  NH1  . ARG A 1 307 ? 48.851  49.267  -6.590  1.00 48.54  ? 304  ARG A NH1  1 
ATOM   5000  N  NH2  . ARG A 1 307 ? 49.981  50.017  -4.743  1.00 63.81  ? 304  ARG A NH2  1 
ATOM   5001  H  H    . ARG A 1 307 ? 45.499  52.015  -9.362  1.00 50.24  ? 304  ARG A H    1 
ATOM   5002  H  HA   . ARG A 1 307 ? 43.793  51.510  -7.308  1.00 48.25  ? 304  ARG A HA   1 
ATOM   5003  H  HB2  . ARG A 1 307 ? 45.834  53.452  -7.536  1.00 50.82  ? 304  ARG A HB2  1 
ATOM   5004  H  HB3  . ARG A 1 307 ? 44.771  53.493  -6.356  1.00 50.82  ? 304  ARG A HB3  1 
ATOM   5005  H  HG2  . ARG A 1 307 ? 46.250  52.357  -5.268  1.00 51.58  ? 304  ARG A HG2  1 
ATOM   5006  H  HG3  . ARG A 1 307 ? 45.692  51.117  -6.093  1.00 51.58  ? 304  ARG A HG3  1 
ATOM   5007  H  HD2  . ARG A 1 307 ? 47.437  51.081  -7.446  1.00 52.11  ? 304  ARG A HD2  1 
ATOM   5008  H  HD3  . ARG A 1 307 ? 47.777  52.615  -7.191  1.00 52.11  ? 304  ARG A HD3  1 
ATOM   5009  H  HE   . ARG A 1 307 ? 48.681  51.984  -5.185  1.00 60.01  ? 304  ARG A HE   1 
ATOM   5010  H  HH11 . ARG A 1 307 ? 48.280  49.398  -7.220  1.00 58.24  ? 304  ARG A HH11 1 
ATOM   5011  H  HH12 . ARG A 1 307 ? 49.261  48.514  -6.531  1.00 58.24  ? 304  ARG A HH12 1 
ATOM   5012  H  HH21 . ARG A 1 307 ? 50.146  50.638  -4.171  1.00 76.57  ? 304  ARG A HH21 1 
ATOM   5013  H  HH22 . ARG A 1 307 ? 50.389  49.262  -4.688  1.00 76.57  ? 304  ARG A HH22 1 
ATOM   5014  N  N    . LEU A 1 308 ? 42.006  53.041  -7.890  1.00 40.69  ? 305  LEU A N    1 
ATOM   5015  C  CA   . LEU A 1 308 ? 40.893  53.795  -8.436  1.00 41.60  ? 305  LEU A CA   1 
ATOM   5016  C  C    . LEU A 1 308 ? 40.253  54.701  -7.394  1.00 46.35  ? 305  LEU A C    1 
ATOM   5017  O  O    . LEU A 1 308 ? 39.828  54.240  -6.328  1.00 53.09  ? 305  LEU A O    1 
ATOM   5018  C  CB   . LEU A 1 308 ? 39.842  52.832  -8.983  1.00 52.96  ? 305  LEU A CB   1 
ATOM   5019  C  CG   . LEU A 1 308 ? 40.251  51.976  -10.178 1.00 50.22  ? 305  LEU A CG   1 
ATOM   5020  C  CD1  . LEU A 1 308 ? 39.099  51.065  -10.571 1.00 61.29  ? 305  LEU A CD1  1 
ATOM   5021  C  CD2  . LEU A 1 308 ? 40.636  52.843  -11.355 1.00 52.73  ? 305  LEU A CD2  1 
ATOM   5022  H  H    . LEU A 1 308 ? 41.800  52.548  -7.217  1.00 48.83  ? 305  LEU A H    1 
ATOM   5023  H  HA   . LEU A 1 308 ? 41.209  54.348  -9.167  1.00 49.92  ? 305  LEU A HA   1 
ATOM   5024  H  HB2  . LEU A 1 308 ? 39.588  52.225  -8.271  1.00 63.55  ? 305  LEU A HB2  1 
ATOM   5025  H  HB3  . LEU A 1 308 ? 39.069  53.351  -9.254  1.00 63.55  ? 305  LEU A HB3  1 
ATOM   5026  H  HG   . LEU A 1 308 ? 41.012  51.426  -9.938  1.00 60.27  ? 305  LEU A HG   1 
ATOM   5027  H  HD11 . LEU A 1 308 ? 38.332  51.610  -10.807 1.00 73.55  ? 305  LEU A HD11 1 
ATOM   5028  H  HD12 . LEU A 1 308 ? 39.369  50.526  -11.331 1.00 73.55  ? 305  LEU A HD12 1 
ATOM   5029  H  HD13 . LEU A 1 308 ? 38.880  50.492  -9.820  1.00 73.55  ? 305  LEU A HD13 1 
ATOM   5030  H  HD21 . LEU A 1 308 ? 41.382  53.407  -11.100 1.00 63.27  ? 305  LEU A HD21 1 
ATOM   5031  H  HD22 . LEU A 1 308 ? 40.890  52.272  -12.097 1.00 63.27  ? 305  LEU A HD22 1 
ATOM   5032  H  HD23 . LEU A 1 308 ? 39.876  53.392  -11.604 1.00 63.27  ? 305  LEU A HD23 1 
ATOM   5033  N  N    . ASP A 1 309 ? 40.141  55.980  -7.744  1.00 44.52  ? 306  ASP A N    1 
ATOM   5034  C  CA   . ASP A 1 309 ? 39.464  56.968  -6.915  1.00 35.44  ? 306  ASP A CA   1 
ATOM   5035  C  C    . ASP A 1 309 ? 37.977  56.913  -7.180  1.00 46.29  ? 306  ASP A C    1 
ATOM   5036  O  O    . ASP A 1 309 ? 37.509  57.375  -8.225  1.00 50.82  ? 306  ASP A O    1 
ATOM   5037  C  CB   . ASP A 1 309 ? 39.990  58.377  -7.199  1.00 42.83  ? 306  ASP A CB   1 
ATOM   5038  C  CG   . ASP A 1 309 ? 39.469  59.418  -6.205  1.00 54.59  ? 306  ASP A CG   1 
ATOM   5039  O  OD1  . ASP A 1 309 ? 38.569  59.096  -5.399  1.00 60.45  ? 306  ASP A OD1  1 
ATOM   5040  O  OD2  . ASP A 1 309 ? 39.922  60.585  -6.273  1.00 65.04  ? 306  ASP A OD2  1 
ATOM   5041  H  H    . ASP A 1 309 ? 40.457  56.305  -8.475  1.00 53.42  ? 306  ASP A H    1 
ATOM   5042  H  HA   . ASP A 1 309 ? 39.618  56.765  -5.979  1.00 42.53  ? 306  ASP A HA   1 
ATOM   5043  H  HB2  . ASP A 1 309 ? 40.958  58.370  -7.145  1.00 51.39  ? 306  ASP A HB2  1 
ATOM   5044  H  HB3  . ASP A 1 309 ? 39.709  58.646  -8.088  1.00 51.39  ? 306  ASP A HB3  1 
ATOM   5045  N  N    . ILE A 1 310 ? 37.235  56.435  -6.188  1.00 38.29  ? 307  ILE A N    1 
ATOM   5046  C  CA   . ILE A 1 310 ? 35.796  56.252  -6.311  1.00 46.85  ? 307  ILE A CA   1 
ATOM   5047  C  C    . ILE A 1 310 ? 35.057  57.564  -6.591  1.00 57.34  ? 307  ILE A C    1 
ATOM   5048  O  O    . ILE A 1 310 ? 34.009  57.567  -7.251  1.00 61.12  ? 307  ILE A O    1 
ATOM   5049  C  CB   . ILE A 1 310 ? 35.247  55.613  -5.025  1.00 47.61  ? 307  ILE A CB   1 
ATOM   5050  C  CG1  . ILE A 1 310 ? 33.832  55.080  -5.226  1.00 59.88  ? 307  ILE A CG1  1 
ATOM   5051  C  CG2  . ILE A 1 310 ? 35.295  56.613  -3.855  1.00 52.12  ? 307  ILE A CG2  1 
ATOM   5052  C  CD1  . ILE A 1 310 ? 33.593  53.827  -4.400  1.00 69.79  ? 307  ILE A CD1  1 
ATOM   5053  H  H    . ILE A 1 310 ? 37.548  56.206  -5.421  1.00 45.95  ? 307  ILE A H    1 
ATOM   5054  H  HA   . ILE A 1 310 ? 35.618  55.645  -7.047  1.00 56.22  ? 307  ILE A HA   1 
ATOM   5055  H  HB   . ILE A 1 310 ? 35.818  54.863  -4.799  1.00 57.13  ? 307  ILE A HB   1 
ATOM   5056  H  HG12 . ILE A 1 310 ? 33.193  55.754  -4.949  1.00 71.86  ? 307  ILE A HG12 1 
ATOM   5057  H  HG13 . ILE A 1 310 ? 33.703  54.857  -6.161  1.00 71.86  ? 307  ILE A HG13 1 
ATOM   5058  H  HG21 . ILE A 1 310 ? 34.756  57.388  -4.080  1.00 62.54  ? 307  ILE A HG21 1 
ATOM   5059  H  HG22 . ILE A 1 310 ? 34.944  56.185  -3.059  1.00 62.54  ? 307  ILE A HG22 1 
ATOM   5060  H  HG23 . ILE A 1 310 ? 36.216  56.882  -3.708  1.00 62.54  ? 307  ILE A HG23 1 
ATOM   5061  H  HD11 . ILE A 1 310 ? 33.718  54.040  -3.461  1.00 83.75  ? 307  ILE A HD11 1 
ATOM   5062  H  HD12 . ILE A 1 310 ? 32.687  53.517  -4.552  1.00 83.75  ? 307  ILE A HD12 1 
ATOM   5063  H  HD13 . ILE A 1 310 ? 34.227  53.144  -4.671  1.00 83.75  ? 307  ILE A HD13 1 
ATOM   5064  N  N    . ASN A 1 311 ? 35.607  58.673  -6.104  1.00 53.65  ? 308  ASN A N    1 
ATOM   5065  C  CA   . ASN A 1 311 ? 34.960  59.975  -6.266  1.00 61.45  ? 308  ASN A CA   1 
ATOM   5066  C  C    . ASN A 1 311 ? 34.929  60.433  -7.717  1.00 59.57  ? 308  ASN A C    1 
ATOM   5067  O  O    . ASN A 1 311 ? 34.003  61.129  -8.147  1.00 72.83  ? 308  ASN A O    1 
ATOM   5068  C  CB   . ASN A 1 311 ? 35.655  61.019  -5.400  1.00 61.57  ? 308  ASN A CB   1 
ATOM   5069  C  CG   . ASN A 1 311 ? 35.336  60.847  -3.940  1.00 61.95  ? 308  ASN A CG   1 
ATOM   5070  O  OD1  . ASN A 1 311 ? 34.236  60.401  -3.581  1.00 55.81  ? 308  ASN A OD1  1 
ATOM   5071  N  ND2  . ASN A 1 311 ? 36.294  61.173  -3.083  1.00 58.52  ? 308  ASN A ND2  1 
ATOM   5072  H  H    . ASN A 1 311 ? 36.352  58.701  -5.676  1.00 64.38  ? 308  ASN A H    1 
ATOM   5073  H  HA   . ASN A 1 311 ? 34.042  59.904  -5.961  1.00 73.74  ? 308  ASN A HA   1 
ATOM   5074  H  HB2  . ASN A 1 311 ? 36.615  60.937  -5.511  1.00 73.89  ? 308  ASN A HB2  1 
ATOM   5075  H  HB3  . ASN A 1 311 ? 35.361  61.903  -5.671  1.00 73.89  ? 308  ASN A HB3  1 
ATOM   5076  H  HD21 . ASN A 1 311 ? 37.049  61.465  -3.373  1.00 70.22  ? 308  ASN A HD21 1 
ATOM   5077  H  HD22 . ASN A 1 311 ? 36.160  61.092  -2.237  1.00 70.22  ? 308  ASN A HD22 1 
ATOM   5078  N  N    . VAL A 1 312 ? 35.924  60.000  -8.481  1.00 53.73  ? 309  VAL A N    1 
ATOM   5079  C  CA   . VAL A 1 312 ? 35.984  60.326  -9.899  1.00 55.64  ? 309  VAL A CA   1 
ATOM   5080  C  C    . VAL A 1 312 ? 34.841  59.667  -10.662 1.00 48.74  ? 309  VAL A C    1 
ATOM   5081  O  O    . VAL A 1 312 ? 34.259  60.284  -11.548 1.00 59.49  ? 309  VAL A O    1 
ATOM   5082  C  CB   . VAL A 1 312 ? 37.311  59.877  -10.509 1.00 51.91  ? 309  VAL A CB   1 
ATOM   5083  C  CG1  . VAL A 1 312 ? 37.301  60.026  -12.030 1.00 52.73  ? 309  VAL A CG1  1 
ATOM   5084  C  CG2  . VAL A 1 312 ? 38.453  60.668  -9.902  1.00 47.30  ? 309  VAL A CG2  1 
ATOM   5085  H  H    . VAL A 1 312 ? 36.577  59.515  -8.202  1.00 64.47  ? 309  VAL A H    1 
ATOM   5086  H  HA   . VAL A 1 312 ? 35.909  61.287  -10.009 1.00 66.77  ? 309  VAL A HA   1 
ATOM   5087  H  HB   . VAL A 1 312 ? 37.453  58.940  -10.302 1.00 62.29  ? 309  VAL A HB   1 
ATOM   5088  H  HG11 . VAL A 1 312 ? 37.153  60.958  -12.254 1.00 63.27  ? 309  VAL A HG11 1 
ATOM   5089  H  HG12 . VAL A 1 312 ? 38.156  59.733  -12.381 1.00 63.27  ? 309  VAL A HG12 1 
ATOM   5090  H  HG13 . VAL A 1 312 ? 36.588  59.480  -12.395 1.00 63.27  ? 309  VAL A HG13 1 
ATOM   5091  H  HG21 . VAL A 1 312 ? 38.469  60.514  -8.944  1.00 56.76  ? 309  VAL A HG21 1 
ATOM   5092  H  HG22 . VAL A 1 312 ? 39.287  60.372  -10.299 1.00 56.76  ? 309  VAL A HG22 1 
ATOM   5093  H  HG23 . VAL A 1 312 ? 38.315  61.611  -10.084 1.00 56.76  ? 309  VAL A HG23 1 
ATOM   5094  N  N    . SER A 1 313 ? 34.514  58.425  -10.313 1.00 54.07  ? 310  SER A N    1 
ATOM   5095  C  CA   . SER A 1 313 ? 33.565  57.652  -11.111 1.00 53.85  ? 310  SER A CA   1 
ATOM   5096  C  C    . SER A 1 313 ? 32.189  57.668  -10.468 1.00 46.54  ? 310  SER A C    1 
ATOM   5097  O  O    . SER A 1 313 ? 31.192  57.460  -11.142 1.00 52.07  ? 310  SER A O    1 
ATOM   5098  C  CB   . SER A 1 313 ? 34.034  56.192  -11.265 1.00 49.35  ? 310  SER A CB   1 
ATOM   5099  O  OG   . SER A 1 313 ? 35.378  56.081  -11.720 1.00 48.95  ? 310  SER A OG   1 
ATOM   5100  H  H    . SER A 1 313 ? 34.823  58.010  -9.626  1.00 64.88  ? 310  SER A H    1 
ATOM   5101  H  HA   . SER A 1 313 ? 33.494  58.045  -11.995 1.00 64.62  ? 310  SER A HA   1 
ATOM   5102  H  HB2  . SER A 1 313 ? 33.964  55.753  -10.402 1.00 59.22  ? 310  SER A HB2  1 
ATOM   5103  H  HB3  . SER A 1 313 ? 33.454  55.747  -11.903 1.00 59.22  ? 310  SER A HB3  1 
ATOM   5104  H  HG   . SER A 1 313 ? 35.458  56.450  -12.471 1.00 58.74  ? 310  SER A HG   1 
ATOM   5105  N  N    . LYS A 1 314 ? 32.123  58.017  -9.190  1.00 54.88  ? 311  LYS A N    1 
ATOM   5106  C  CA   . LYS A 1 314 ? 30.852  57.974  -8.476  1.00 54.05  ? 311  LYS A CA   1 
ATOM   5107  C  C    . LYS A 1 314 ? 29.905  59.077  -8.930  1.00 58.28  ? 311  LYS A C    1 
ATOM   5108  O  O    . LYS A 1 314 ? 28.732  58.824  -9.213  1.00 51.82  ? 311  LYS A O    1 
ATOM   5109  C  CB   . LYS A 1 314 ? 31.102  58.105  -6.971  1.00 50.43  ? 311  LYS A CB   1 
ATOM   5110  C  CG   . LYS A 1 314 ? 29.876  58.024  -6.104  1.00 61.46  ? 311  LYS A CG   1 
ATOM   5111  C  CD   . LYS A 1 314 ? 30.239  58.245  -4.634  1.00 78.00  ? 311  LYS A CD   1 
ATOM   5112  C  CE   . LYS A 1 314 ? 29.001  58.276  -3.737  1.00 83.88  ? 311  LYS A CE   1 
ATOM   5113  N  NZ   . LYS A 1 314 ? 27.965  57.267  -4.147  1.00 99.97  ? 311  LYS A NZ   1 
ATOM   5114  H  H    . LYS A 1 314 ? 32.792  58.281  -8.717  1.00 65.86  ? 311  LYS A H    1 
ATOM   5115  H  HA   . LYS A 1 314 ? 30.423  57.120  -8.640  1.00 64.86  ? 311  LYS A HA   1 
ATOM   5116  H  HB2  . LYS A 1 314 ? 31.700  57.392  -6.696  1.00 60.52  ? 311  LYS A HB2  1 
ATOM   5117  H  HB3  . LYS A 1 314 ? 31.521  58.963  -6.803  1.00 60.52  ? 311  LYS A HB3  1 
ATOM   5118  H  HG2  . LYS A 1 314 ? 29.246  58.712  -6.371  1.00 73.76  ? 311  LYS A HG2  1 
ATOM   5119  H  HG3  . LYS A 1 314 ? 29.475  57.145  -6.193  1.00 73.76  ? 311  LYS A HG3  1 
ATOM   5120  H  HD2  . LYS A 1 314 ? 30.810  57.520  -4.334  1.00 93.60  ? 311  LYS A HD2  1 
ATOM   5121  H  HD3  . LYS A 1 314 ? 30.699  59.093  -4.543  1.00 93.60  ? 311  LYS A HD3  1 
ATOM   5122  H  HE2  . LYS A 1 314 ? 29.266  58.081  -2.825  1.00 100.66 ? 311  LYS A HE2  1 
ATOM   5123  H  HE3  . LYS A 1 314 ? 28.598  59.157  -3.785  1.00 100.66 ? 311  LYS A HE3  1 
ATOM   5124  H  HZ1  . LYS A 1 314 ? 28.307  56.447  -4.106  1.00 119.96 ? 311  LYS A HZ1  1 
ATOM   5125  H  HZ2  . LYS A 1 314 ? 27.262  57.316  -3.604  1.00 119.96 ? 311  LYS A HZ2  1 
ATOM   5126  H  HZ3  . LYS A 1 314 ? 27.698  57.428  -4.981  1.00 119.96 ? 311  LYS A HZ3  1 
ATOM   5127  N  N    . GLY A 1 315 ? 30.413  60.305  -8.980  1.00 59.57  ? 312  GLY A N    1 
ATOM   5128  C  CA   . GLY A 1 315 ? 29.568  61.462  -9.221  1.00 51.22  ? 312  GLY A CA   1 
ATOM   5129  C  C    . GLY A 1 315 ? 29.218  61.703  -10.670 1.00 63.73  ? 312  GLY A C    1 
ATOM   5130  O  O    . GLY A 1 315 ? 30.092  61.783  -11.541 1.00 57.61  ? 312  GLY A O    1 
ATOM   5131  H  H    . GLY A 1 315 ? 31.246  60.492  -8.878  1.00 71.48  ? 312  GLY A H    1 
ATOM   5132  H  HA2  . GLY A 1 315 ? 28.740  61.356  -8.727  1.00 61.46  ? 312  GLY A HA2  1 
ATOM   5133  H  HA3  . GLY A 1 315 ? 30.017  62.254  -8.887  1.00 61.46  ? 312  GLY A HA3  1 
ATOM   5134  N  N    . ILE A 1 316 ? 27.930  61.913  -10.909 1.00 61.04  ? 313  ILE A N    1 
ATOM   5135  C  CA   . ILE A 1 316 ? 27.449  62.202  -12.246 1.00 61.66  ? 313  ILE A CA   1 
ATOM   5136  C  C    . ILE A 1 316 ? 27.884  63.593  -12.657 1.00 65.40  ? 313  ILE A C    1 
ATOM   5137  O  O    . ILE A 1 316 ? 28.071  63.860  -13.839 1.00 57.22  ? 313  ILE A O    1 
ATOM   5138  C  CB   . ILE A 1 316 ? 25.915  62.090  -12.340 1.00 69.84  ? 313  ILE A CB   1 
ATOM   5139  C  CG1  . ILE A 1 316 ? 25.457  60.733  -11.805 1.00 66.80  ? 313  ILE A CG1  1 
ATOM   5140  C  CG2  . ILE A 1 316 ? 25.451  62.245  -13.800 1.00 59.48  ? 313  ILE A CG2  1 
ATOM   5141  C  CD1  . ILE A 1 316 ? 23.959  60.594  -11.699 1.00 75.90  ? 313  ILE A CD1  1 
ATOM   5142  H  H    . ILE A 1 316 ? 27.314  61.893  -10.309 1.00 73.24  ? 313  ILE A H    1 
ATOM   5143  H  HA   . ILE A 1 316 ? 27.837  61.567  -12.869 1.00 74.00  ? 313  ILE A HA   1 
ATOM   5144  H  HB   . ILE A 1 316 ? 25.514  62.793  -11.805 1.00 83.81  ? 313  ILE A HB   1 
ATOM   5145  H  HG12 . ILE A 1 316 ? 25.777  60.038  -12.401 1.00 80.16  ? 313  ILE A HG12 1 
ATOM   5146  H  HG13 . ILE A 1 316 ? 25.830  60.604  -10.919 1.00 80.16  ? 313  ILE A HG13 1 
ATOM   5147  H  HG21 . ILE A 1 316 ? 25.854  61.544  -14.335 1.00 71.38  ? 313  ILE A HG21 1 
ATOM   5148  H  HG22 . ILE A 1 316 ? 24.484  62.171  -13.833 1.00 71.38  ? 313  ILE A HG22 1 
ATOM   5149  H  HG23 . ILE A 1 316 ? 25.728  63.114  -14.129 1.00 71.38  ? 313  ILE A HG23 1 
ATOM   5150  H  HD11 . ILE A 1 316 ? 23.569  60.708  -12.580 1.00 91.09  ? 313  ILE A HD11 1 
ATOM   5151  H  HD12 . ILE A 1 316 ? 23.748  59.712  -11.355 1.00 91.09  ? 313  ILE A HD12 1 
ATOM   5152  H  HD13 . ILE A 1 316 ? 23.622  61.274  -11.096 1.00 91.09  ? 313  ILE A HD13 1 
ATOM   5153  N  N    . ASN A 1 317 ? 28.113  64.447  -11.664 1.00 58.73  ? 314  ASN A N    1 
ATOM   5154  C  CA   . ASN A 1 317 ? 28.456  65.841  -11.899 1.00 54.62  ? 314  ASN A CA   1 
ATOM   5155  C  C    . ASN A 1 317 ? 29.952  66.072  -11.929 1.00 67.83  ? 314  ASN A C    1 
ATOM   5156  O  O    . ASN A 1 317 ? 30.407  67.186  -11.687 1.00 72.72  ? 314  ASN A O    1 
ATOM   5157  C  CB   . ASN A 1 317 ? 27.849  66.714  -10.811 1.00 61.75  ? 314  ASN A CB   1 
ATOM   5158  C  CG   . ASN A 1 317 ? 28.442  66.429  -9.452  1.00 71.07  ? 314  ASN A CG   1 
ATOM   5159  O  OD1  . ASN A 1 317 ? 28.727  65.279  -9.124  1.00 87.98  ? 314  ASN A OD1  1 
ATOM   5160  N  ND2  . ASN A 1 317 ? 28.636  67.471  -8.652  1.00 72.71  ? 314  ASN A ND2  1 
ATOM   5161  H  H    . ASN A 1 317 ? 28.075  64.237  -10.831 1.00 70.47  ? 314  ASN A H    1 
ATOM   5162  H  HA   . ASN A 1 317 ? 28.089  66.120  -12.753 1.00 65.54  ? 314  ASN A HA   1 
ATOM   5163  H  HB2  . ASN A 1 317 ? 28.014  67.646  -11.022 1.00 74.10  ? 314  ASN A HB2  1 
ATOM   5164  H  HB3  . ASN A 1 317 ? 26.895  66.546  -10.765 1.00 74.10  ? 314  ASN A HB3  1 
ATOM   5165  H  HD21 . ASN A 1 317 ? 28.427  68.261  -8.917  1.00 87.26  ? 314  ASN A HD21 1 
ATOM   5166  H  HD22 . ASN A 1 317 ? 28.972  67.354  -7.868  1.00 87.26  ? 314  ASN A HD22 1 
ATOM   5167  N  N    . HIS A 1 318 ? 30.721  65.031  -12.231 1.00 68.71  ? 315  HIS A N    1 
ATOM   5168  C  CA   . HIS A 1 318 ? 32.173  65.140  -12.160 1.00 60.51  ? 315  HIS A CA   1 
ATOM   5169  C  C    . HIS A 1 318 ? 32.729  65.727  -13.449 1.00 59.30  ? 315  HIS A C    1 
ATOM   5170  O  O    . HIS A 1 318 ? 32.416  65.276  -14.550 1.00 58.30  ? 315  HIS A O    1 
ATOM   5171  C  CB   . HIS A 1 318 ? 32.828  63.777  -11.887 1.00 64.32  ? 315  HIS A CB   1 
ATOM   5172  C  CG   . HIS A 1 318 ? 34.318  63.853  -11.724 1.00 65.99  ? 315  HIS A CG   1 
ATOM   5173  N  ND1  . HIS A 1 318 ? 34.920  64.424  -10.619 1.00 55.39  ? 315  HIS A ND1  1 
ATOM   5174  C  CD2  . HIS A 1 318 ? 35.326  63.463  -12.544 1.00 55.12  ? 315  HIS A CD2  1 
ATOM   5175  C  CE1  . HIS A 1 318 ? 36.233  64.369  -10.762 1.00 57.19  ? 315  HIS A CE1  1 
ATOM   5176  N  NE2  . HIS A 1 318 ? 36.505  63.793  -11.920 1.00 61.36  ? 315  HIS A NE2  1 
ATOM   5177  H  H    . HIS A 1 318 ? 30.431  64.259  -12.477 1.00 82.46  ? 315  HIS A H    1 
ATOM   5178  H  HA   . HIS A 1 318 ? 32.408  65.737  -11.433 1.00 72.61  ? 315  HIS A HA   1 
ATOM   5179  H  HB2  . HIS A 1 318 ? 32.458  63.409  -11.069 1.00 77.18  ? 315  HIS A HB2  1 
ATOM   5180  H  HB3  . HIS A 1 318 ? 32.640  63.183  -12.630 1.00 77.18  ? 315  HIS A HB3  1 
ATOM   5181  H  HD1  . HIS A 1 318 ? 34.506  64.759  -9.944  1.00 66.47  ? 315  HIS A HD1  1 
ATOM   5182  H  HD2  . HIS A 1 318 ? 35.236  63.048  -13.371 1.00 66.15  ? 315  HIS A HD2  1 
ATOM   5183  H  HE1  . HIS A 1 318 ? 36.860  64.682  -10.150 1.00 68.62  ? 315  HIS A HE1  1 
ATOM   5184  H  HE2  . HIS A 1 318 ? 37.293  63.643  -12.230 1.00 73.64  ? 315  HIS A HE2  1 
ATOM   5185  N  N    . LEU A 1 319 ? 33.585  66.727  -13.283 1.00 55.37  ? 316  LEU A N    1 
ATOM   5186  C  CA   . LEU A 1 319 ? 34.223  67.400  -14.398 1.00 54.31  ? 316  LEU A CA   1 
ATOM   5187  C  C    . LEU A 1 319 ? 35.591  66.800  -14.662 1.00 52.63  ? 316  LEU A C    1 
ATOM   5188  O  O    . LEU A 1 319 ? 36.486  66.878  -13.814 1.00 55.02  ? 316  LEU A O    1 
ATOM   5189  C  CB   . LEU A 1 319 ? 34.354  68.900  -14.112 1.00 62.79  ? 316  LEU A CB   1 
ATOM   5190  C  CG   . LEU A 1 319 ? 33.068  69.713  -14.220 1.00 63.59  ? 316  LEU A CG   1 
ATOM   5191  C  CD1  . LEU A 1 319 ? 33.177  70.958  -13.370 1.00 58.33  ? 316  LEU A CD1  1 
ATOM   5192  C  CD2  . LEU A 1 319 ? 32.790  70.081  -15.690 1.00 65.07  ? 316  LEU A CD2  1 
ATOM   5193  H  H    . LEU A 1 319 ? 33.815  67.039  -12.515 1.00 66.44  ? 316  LEU A H    1 
ATOM   5194  H  HA   . LEU A 1 319 ? 33.681  67.287  -15.195 1.00 65.18  ? 316  LEU A HA   1 
ATOM   5195  H  HB2  . LEU A 1 319 ? 34.691  69.010  -13.209 1.00 75.35  ? 316  LEU A HB2  1 
ATOM   5196  H  HB3  . LEU A 1 319 ? 34.988  69.277  -14.741 1.00 75.35  ? 316  LEU A HB3  1 
ATOM   5197  H  HG   . LEU A 1 319 ? 32.324  69.184  -13.892 1.00 76.30  ? 316  LEU A HG   1 
ATOM   5198  H  HD11 . LEU A 1 319 ? 33.925  71.490  -13.684 1.00 70.00  ? 316  LEU A HD11 1 
ATOM   5199  H  HD12 . LEU A 1 319 ? 32.354  71.466  -13.447 1.00 70.00  ? 316  LEU A HD12 1 
ATOM   5200  H  HD13 . LEU A 1 319 ? 33.320  70.698  -12.446 1.00 70.00  ? 316  LEU A HD13 1 
ATOM   5201  H  HD21 . LEU A 1 319 ? 32.699  69.265  -16.207 1.00 78.08  ? 316  LEU A HD21 1 
ATOM   5202  H  HD22 . LEU A 1 319 ? 31.970  70.597  -15.737 1.00 78.08  ? 316  LEU A HD22 1 
ATOM   5203  H  HD23 . LEU A 1 319 ? 33.532  70.606  -16.029 1.00 78.08  ? 316  LEU A HD23 1 
ATOM   5204  N  N    . LEU A 1 320 ? 35.749  66.200  -15.839 1.00 48.42  ? 317  LEU A N    1 
ATOM   5205  C  CA   . LEU A 1 320 ? 37.017  65.578  -16.194 1.00 41.49  ? 317  LEU A CA   1 
ATOM   5206  C  C    . LEU A 1 320 ? 37.634  66.218  -17.428 1.00 57.76  ? 317  LEU A C    1 
ATOM   5207  O  O    . LEU A 1 320 ? 36.929  66.639  -18.357 1.00 57.67  ? 317  LEU A O    1 
ATOM   5208  C  CB   . LEU A 1 320 ? 36.817  64.075  -16.414 1.00 49.06  ? 317  LEU A CB   1 
ATOM   5209  C  CG   . LEU A 1 320 ? 38.047  63.241  -16.774 1.00 62.24  ? 317  LEU A CG   1 
ATOM   5210  C  CD1  . LEU A 1 320 ? 39.037  63.214  -15.607 1.00 58.43  ? 317  LEU A CD1  1 
ATOM   5211  C  CD2  . LEU A 1 320 ? 37.627  61.812  -17.148 1.00 58.12  ? 317  LEU A CD2  1 
ATOM   5212  H  H    . LEU A 1 320 ? 35.141  66.140  -16.444 1.00 58.11  ? 317  LEU A H    1 
ATOM   5213  H  HA   . LEU A 1 320 ? 37.639  65.691  -15.458 1.00 49.79  ? 317  LEU A HA   1 
ATOM   5214  H  HB2  . LEU A 1 320 ? 36.449  63.700  -15.598 1.00 58.88  ? 317  LEU A HB2  1 
ATOM   5215  H  HB3  . LEU A 1 320 ? 36.176  63.960  -17.133 1.00 58.88  ? 317  LEU A HB3  1 
ATOM   5216  H  HG   . LEU A 1 320 ? 38.490  63.638  -17.540 1.00 74.68  ? 317  LEU A HG   1 
ATOM   5217  H  HD11 . LEU A 1 320 ? 38.601  62.824  -14.834 1.00 70.11  ? 317  LEU A HD11 1 
ATOM   5218  H  HD12 . LEU A 1 320 ? 39.807  62.681  -15.859 1.00 70.11  ? 317  LEU A HD12 1 
ATOM   5219  H  HD13 . LEU A 1 320 ? 39.313  64.123  -15.408 1.00 70.11  ? 317  LEU A HD13 1 
ATOM   5220  H  HD21 . LEU A 1 320 ? 37.028  61.849  -17.910 1.00 69.75  ? 317  LEU A HD21 1 
ATOM   5221  H  HD22 . LEU A 1 320 ? 38.419  61.299  -17.373 1.00 69.75  ? 317  LEU A HD22 1 
ATOM   5222  H  HD23 . LEU A 1 320 ? 37.175  61.408  -16.391 1.00 69.75  ? 317  LEU A HD23 1 
ATOM   5223  N  N    . LYS A 1 321 ? 38.964  66.258  -17.424 1.00 49.93  ? 318  LYS A N    1 
ATOM   5224  C  CA   . LYS A 1 321 ? 39.744  66.780  -18.534 1.00 49.22  ? 318  LYS A CA   1 
ATOM   5225  C  C    . LYS A 1 321 ? 39.226  66.305  -19.884 1.00 56.91  ? 318  LYS A C    1 
ATOM   5226  O  O    . LYS A 1 321 ? 39.016  65.112  -20.093 1.00 58.37  ? 318  LYS A O    1 
ATOM   5227  C  CB   . LYS A 1 321 ? 41.208  66.376  -18.395 1.00 50.50  ? 318  LYS A CB   1 
ATOM   5228  C  CG   . LYS A 1 321 ? 42.103  67.003  -19.440 1.00 53.99  ? 318  LYS A CG   1 
ATOM   5229  C  CD   . LYS A 1 321 ? 43.568  66.664  -19.254 1.00 58.24  ? 318  LYS A CD   1 
ATOM   5230  C  CE   . LYS A 1 321 ? 44.206  67.497  -18.193 1.00 76.56  ? 318  LYS A CE   1 
ATOM   5231  N  NZ   . LYS A 1 321 ? 45.659  67.654  -18.484 1.00 89.19  ? 318  LYS A NZ   1 
ATOM   5232  H  H    . LYS A 1 321 ? 39.447  65.978  -16.770 1.00 59.92  ? 318  LYS A H    1 
ATOM   5233  H  HA   . LYS A 1 321 ? 39.699  67.749  -18.521 1.00 59.06  ? 318  LYS A HA   1 
ATOM   5234  H  HB2  . LYS A 1 321 ? 41.530  66.653  -17.523 1.00 60.60  ? 318  LYS A HB2  1 
ATOM   5235  H  HB3  . LYS A 1 321 ? 41.278  65.412  -18.482 1.00 60.60  ? 318  LYS A HB3  1 
ATOM   5236  H  HG2  . LYS A 1 321 ? 41.833  66.686  -20.316 1.00 64.79  ? 318  LYS A HG2  1 
ATOM   5237  H  HG3  . LYS A 1 321 ? 42.012  67.967  -19.394 1.00 64.79  ? 318  LYS A HG3  1 
ATOM   5238  H  HD2  . LYS A 1 321 ? 43.649  65.732  -18.996 1.00 69.89  ? 318  LYS A HD2  1 
ATOM   5239  H  HD3  . LYS A 1 321 ? 44.040  66.822  -20.087 1.00 69.89  ? 318  LYS A HD3  1 
ATOM   5240  H  HE2  . LYS A 1 321 ? 43.797  68.376  -18.179 1.00 91.87  ? 318  LYS A HE2  1 
ATOM   5241  H  HE3  . LYS A 1 321 ? 44.108  67.060  -17.333 1.00 91.87  ? 318  LYS A HE3  1 
ATOM   5242  H  HZ1  . LYS A 1 321 ? 45.770  68.051  -19.273 1.00 107.03 ? 318  LYS A HZ1  1 
ATOM   5243  H  HZ2  . LYS A 1 321 ? 46.044  68.150  -17.854 1.00 107.03 ? 318  LYS A HZ2  1 
ATOM   5244  H  HZ3  . LYS A 1 321 ? 46.053  66.856  -18.505 1.00 107.03 ? 318  LYS A HZ3  1 
ATOM   5245  N  N    . SER A 1 322 ? 38.996  67.253  -20.786 1.00 55.74  ? 319  SER A N    1 
ATOM   5246  C  CA   . SER A 1 322 ? 38.492  66.925  -22.114 1.00 61.66  ? 319  SER A CA   1 
ATOM   5247  C  C    . SER A 1 322 ? 39.589  66.274  -22.949 1.00 55.22  ? 319  SER A C    1 
ATOM   5248  O  O    . SER A 1 322 ? 40.759  66.648  -22.837 1.00 45.60  ? 319  SER A O    1 
ATOM   5249  C  CB   . SER A 1 322 ? 37.972  68.176  -22.839 1.00 60.73  ? 319  SER A CB   1 
ATOM   5250  O  OG   . SER A 1 322 ? 37.583  67.866  -24.169 1.00 60.58  ? 319  SER A OG   1 
ATOM   5251  H  H    . SER A 1 322 ? 39.123  68.094  -20.654 1.00 66.88  ? 319  SER A H    1 
ATOM   5252  H  HA   . SER A 1 322 ? 37.759  66.295  -22.031 1.00 73.99  ? 319  SER A HA   1 
ATOM   5253  H  HB2  . SER A 1 322 ? 37.205  68.523  -22.359 1.00 72.88  ? 319  SER A HB2  1 
ATOM   5254  H  HB3  . SER A 1 322 ? 38.677  68.842  -22.864 1.00 72.88  ? 319  SER A HB3  1 
ATOM   5255  H  HG   . SER A 1 322 ? 38.240  67.564  -24.597 1.00 72.69  ? 319  SER A HG   1 
ATOM   5256  N  N    . PRO A 1 323 ? 39.216  65.306  -23.801 1.00 50.61  ? 320  PRO A N    1 
ATOM   5257  C  CA   . PRO A 1 323 ? 40.150  64.833  -24.826 1.00 55.33  ? 320  PRO A CA   1 
ATOM   5258  C  C    . PRO A 1 323 ? 40.611  66.003  -25.692 1.00 60.60  ? 320  PRO A C    1 
ATOM   5259  O  O    . PRO A 1 323 ? 39.903  67.011  -25.779 1.00 56.05  ? 320  PRO A O    1 
ATOM   5260  C  CB   . PRO A 1 323 ? 39.325  63.832  -25.628 1.00 45.71  ? 320  PRO A CB   1 
ATOM   5261  C  CG   . PRO A 1 323 ? 38.324  63.305  -24.646 1.00 44.94  ? 320  PRO A CG   1 
ATOM   5262  C  CD   . PRO A 1 323 ? 37.983  64.500  -23.773 1.00 47.00  ? 320  PRO A CD   1 
ATOM   5263  H  HA   . PRO A 1 323 ? 40.915  64.391  -24.425 1.00 66.40  ? 320  PRO A HA   1 
ATOM   5264  H  HB2  . PRO A 1 323 ? 38.883  64.284  -26.364 1.00 54.86  ? 320  PRO A HB2  1 
ATOM   5265  H  HB3  . PRO A 1 323 ? 39.897  63.119  -25.954 1.00 54.86  ? 320  PRO A HB3  1 
ATOM   5266  H  HG2  . PRO A 1 323 ? 37.538  62.986  -25.116 1.00 53.93  ? 320  PRO A HG2  1 
ATOM   5267  H  HG3  . PRO A 1 323 ? 38.723  62.596  -24.118 1.00 53.93  ? 320  PRO A HG3  1 
ATOM   5268  H  HD2  . PRO A 1 323 ? 37.244  64.998  -24.156 1.00 56.40  ? 320  PRO A HD2  1 
ATOM   5269  H  HD3  . PRO A 1 323 ? 37.787  64.212  -22.868 1.00 56.40  ? 320  PRO A HD3  1 
ATOM   5270  N  N    . PHE A 1 324 ? 41.821  65.896  -26.232 1.00 56.16  ? 321  PHE A N    1 
ATOM   5271  C  CA   . PHE A 1 324 ? 42.424  66.931  -27.071 1.00 54.13  ? 321  PHE A CA   1 
ATOM   5272  C  C    . PHE A 1 324 ? 42.615  68.250  -26.325 1.00 57.90  ? 321  PHE A C    1 
ATOM   5273  O  O    . PHE A 1 324 ? 42.742  69.299  -26.956 1.00 67.12  ? 321  PHE A O    1 
ATOM   5274  C  CB   . PHE A 1 324 ? 41.572  67.144  -28.338 1.00 59.12  ? 321  PHE A CB   1 
ATOM   5275  C  CG   . PHE A 1 324 ? 41.479  65.910  -29.179 1.00 52.57  ? 321  PHE A CG   1 
ATOM   5276  C  CD1  . PHE A 1 324 ? 42.566  65.488  -29.935 1.00 37.48  ? 321  PHE A CD1  1 
ATOM   5277  C  CD2  . PHE A 1 324 ? 40.329  65.144  -29.172 1.00 42.29  ? 321  PHE A CD2  1 
ATOM   5278  C  CE1  . PHE A 1 324 ? 42.502  64.334  -30.667 1.00 47.28  ? 321  PHE A CE1  1 
ATOM   5279  C  CE2  . PHE A 1 324 ? 40.248  63.986  -29.920 1.00 45.60  ? 321  PHE A CE2  1 
ATOM   5280  C  CZ   . PHE A 1 324 ? 41.335  63.577  -30.669 1.00 51.83  ? 321  PHE A CZ   1 
ATOM   5281  H  H    . PHE A 1 324 ? 42.330  65.211  -26.123 1.00 67.39  ? 321  PHE A H    1 
ATOM   5282  H  HA   . PHE A 1 324 ? 43.300  66.626  -27.355 1.00 64.95  ? 321  PHE A HA   1 
ATOM   5283  H  HB2  . PHE A 1 324 ? 40.673  67.398  -28.076 1.00 70.95  ? 321  PHE A HB2  1 
ATOM   5284  H  HB3  . PHE A 1 324 ? 41.973  67.845  -28.875 1.00 70.95  ? 321  PHE A HB3  1 
ATOM   5285  H  HD1  . PHE A 1 324 ? 43.350  65.988  -29.932 1.00 44.97  ? 321  PHE A HD1  1 
ATOM   5286  H  HD2  . PHE A 1 324 ? 39.599  65.415  -28.664 1.00 50.75  ? 321  PHE A HD2  1 
ATOM   5287  H  HE1  . PHE A 1 324 ? 43.231  64.066  -31.179 1.00 56.74  ? 321  PHE A HE1  1 
ATOM   5288  H  HE2  . PHE A 1 324 ? 39.467  63.481  -29.915 1.00 54.71  ? 321  PHE A HE2  1 
ATOM   5289  H  HZ   . PHE A 1 324 ? 41.284  62.800  -31.178 1.00 62.20  ? 321  PHE A HZ   1 
ATOM   5290  N  N    . SER A 1 325 ? 42.696  68.190  -24.993 1.00 64.33  ? 322  SER A N    1 
ATOM   5291  C  CA   . SER A 1 325 ? 43.129  69.352  -24.210 1.00 52.42  ? 322  SER A CA   1 
ATOM   5292  C  C    . SER A 1 325 ? 44.627  69.451  -24.357 1.00 47.98  ? 322  SER A C    1 
ATOM   5293  O  O    . SER A 1 325 ? 45.273  68.488  -24.788 1.00 52.71  ? 322  SER A O    1 
ATOM   5294  C  CB   . SER A 1 325 ? 42.780  69.226  -22.721 1.00 48.55  ? 322  SER A CB   1 
ATOM   5295  O  OG   . SER A 1 325 ? 41.386  69.156  -22.482 1.00 66.66  ? 322  SER A OG   1 
ATOM   5296  H  H    . SER A 1 325 ? 42.507  67.495  -24.523 1.00 77.20  ? 322  SER A H    1 
ATOM   5297  H  HA   . SER A 1 325 ? 42.723  70.160  -24.562 1.00 62.91  ? 322  SER A HA   1 
ATOM   5298  H  HB2  . SER A 1 325 ? 43.194  68.420  -22.375 1.00 58.26  ? 322  SER A HB2  1 
ATOM   5299  H  HB3  . SER A 1 325 ? 43.135  69.999  -22.255 1.00 58.26  ? 322  SER A HB3  1 
ATOM   5300  H  HG   . SER A 1 325 ? 41.061  68.487  -22.873 1.00 79.99  ? 322  SER A HG   1 
ATOM   5301  N  N    . VAL A 1 326 ? 45.185  70.578  -23.932 1.00 54.38  ? 323  VAL A N    1 
ATOM   5302  C  CA   . VAL A 1 326 ? 46.632  70.784  -23.978 1.00 56.21  ? 323  VAL A CA   1 
ATOM   5303  C  C    . VAL A 1 326 ? 47.178  70.884  -22.568 1.00 67.49  ? 323  VAL A C    1 
ATOM   5304  O  O    . VAL A 1 326 ? 46.727  71.710  -21.768 1.00 68.55  ? 323  VAL A O    1 
ATOM   5305  C  CB   . VAL A 1 326 ? 47.002  72.056  -24.754 1.00 62.81  ? 323  VAL A CB   1 
ATOM   5306  C  CG1  . VAL A 1 326 ? 48.524  72.180  -24.879 1.00 61.96  ? 323  VAL A CG1  1 
ATOM   5307  C  CG2  . VAL A 1 326 ? 46.355  72.034  -26.148 1.00 75.64  ? 323  VAL A CG2  1 
ATOM   5308  H  H    . VAL A 1 326 ? 44.747  71.244  -23.610 1.00 65.25  ? 323  VAL A H    1 
ATOM   5309  H  HA   . VAL A 1 326 ? 47.051  70.027  -24.415 1.00 67.45  ? 323  VAL A HA   1 
ATOM   5310  H  HB   . VAL A 1 326 ? 46.671  72.832  -24.276 1.00 75.38  ? 323  VAL A HB   1 
ATOM   5311  H  HG11 . VAL A 1 326 ? 48.866  71.406  -25.353 1.00 74.36  ? 323  VAL A HG11 1 
ATOM   5312  H  HG12 . VAL A 1 326 ? 48.735  72.989  -25.372 1.00 74.36  ? 323  VAL A HG12 1 
ATOM   5313  H  HG13 . VAL A 1 326 ? 48.911  72.223  -23.991 1.00 74.36  ? 323  VAL A HG13 1 
ATOM   5314  H  HG21 . VAL A 1 326 ? 45.391  71.988  -26.048 1.00 90.77  ? 323  VAL A HG21 1 
ATOM   5315  H  HG22 . VAL A 1 326 ? 46.600  72.844  -26.622 1.00 90.77  ? 323  VAL A HG22 1 
ATOM   5316  H  HG23 . VAL A 1 326 ? 46.675  71.257  -26.633 1.00 90.77  ? 323  VAL A HG23 1 
ATOM   5317  N  N    . HIS A 1 327 ? 48.167  70.056  -22.260 1.00 67.26  ? 324  HIS A N    1 
ATOM   5318  C  CA   . HIS A 1 327 ? 48.725  70.067  -20.918 1.00 64.51  ? 324  HIS A CA   1 
ATOM   5319  C  C    . HIS A 1 327 ? 49.590  71.323  -20.725 1.00 66.17  ? 324  HIS A C    1 
ATOM   5320  O  O    . HIS A 1 327 ? 50.569  71.517  -21.448 1.00 55.47  ? 324  HIS A O    1 
ATOM   5321  C  CB   . HIS A 1 327 ? 49.535  68.795  -20.652 1.00 61.56  ? 324  HIS A CB   1 
ATOM   5322  C  CG   . HIS A 1 327 ? 49.765  68.535  -19.196 1.00 68.26  ? 324  HIS A CG   1 
ATOM   5323  N  ND1  . HIS A 1 327 ? 50.700  69.228  -18.455 1.00 59.41  ? 324  HIS A ND1  1 
ATOM   5324  C  CD2  . HIS A 1 327 ? 49.129  67.715  -18.326 1.00 71.95  ? 324  HIS A CD2  1 
ATOM   5325  C  CE1  . HIS A 1 327 ? 50.663  68.810  -17.203 1.00 62.03  ? 324  HIS A CE1  1 
ATOM   5326  N  NE2  . HIS A 1 327 ? 49.716  67.895  -17.096 1.00 65.52  ? 324  HIS A NE2  1 
ATOM   5327  H  H    . HIS A 1 327 ? 48.526  69.489  -22.798 1.00 80.71  ? 324  HIS A H    1 
ATOM   5328  H  HA   . HIS A 1 327 ? 48.000  70.101  -20.275 1.00 77.41  ? 324  HIS A HA   1 
ATOM   5329  H  HB2  . HIS A 1 327 ? 49.055  68.035  -21.019 1.00 73.87  ? 324  HIS A HB2  1 
ATOM   5330  H  HB3  . HIS A 1 327 ? 50.401  68.878  -21.082 1.00 73.87  ? 324  HIS A HB3  1 
ATOM   5331  H  HD1  . HIS A 1 327 ? 51.241  69.820  -18.765 1.00 71.29  ? 324  HIS A HD1  1 
ATOM   5332  H  HD2  . HIS A 1 327 ? 48.441  67.123  -18.528 1.00 86.33  ? 324  HIS A HD2  1 
ATOM   5333  H  HE1  . HIS A 1 327 ? 51.204  69.116  -16.511 1.00 74.43  ? 324  HIS A HE1  1 
ATOM   5334  H  HE2  . HIS A 1 327 ? 49.501  67.479  -16.375 1.00 78.62  ? 324  HIS A HE2  1 
ATOM   5335  N  N    . PRO A 1 328 ? 49.225  72.184  -19.751 1.00 71.09  ? 325  PRO A N    1 
ATOM   5336  C  CA   . PRO A 1 328 ? 49.910  73.464  -19.506 1.00 53.77  ? 325  PRO A CA   1 
ATOM   5337  C  C    . PRO A 1 328 ? 51.417  73.408  -19.308 1.00 58.70  ? 325  PRO A C    1 
ATOM   5338  O  O    . PRO A 1 328 ? 52.058  74.456  -19.451 1.00 72.75  ? 325  PRO A O    1 
ATOM   5339  C  CB   . PRO A 1 328 ? 49.257  73.959  -18.213 1.00 63.37  ? 325  PRO A CB   1 
ATOM   5340  C  CG   . PRO A 1 328 ? 47.922  73.335  -18.194 1.00 65.95  ? 325  PRO A CG   1 
ATOM   5341  C  CD   . PRO A 1 328 ? 48.105  71.984  -18.811 1.00 65.55  ? 325  PRO A CD   1 
ATOM   5342  H  HA   . PRO A 1 328 ? 49.709  74.089  -20.220 1.00 64.53  ? 325  PRO A HA   1 
ATOM   5343  H  HB2  . PRO A 1 328 ? 49.782  73.669  -17.450 1.00 76.05  ? 325  PRO A HB2  1 
ATOM   5344  H  HB3  . PRO A 1 328 ? 49.184  74.926  -18.233 1.00 76.05  ? 325  PRO A HB3  1 
ATOM   5345  H  HG2  . PRO A 1 328 ? 47.613  73.254  -17.278 1.00 79.14  ? 325  PRO A HG2  1 
ATOM   5346  H  HG3  . PRO A 1 328 ? 47.305  73.869  -18.717 1.00 79.14  ? 325  PRO A HG3  1 
ATOM   5347  H  HD2  . PRO A 1 328 ? 48.345  71.333  -18.133 1.00 78.66  ? 325  PRO A HD2  1 
ATOM   5348  H  HD3  . PRO A 1 328 ? 47.304  71.720  -19.290 1.00 78.66  ? 325  PRO A HD3  1 
ATOM   5349  N  N    . LYS A 1 329 ? 51.973  72.233  -19.023 1.00 52.44  ? 326  LYS A N    1 
ATOM   5350  C  CA   . LYS A 1 329 ? 53.402  72.114  -18.696 1.00 62.72  ? 326  LYS A CA   1 
ATOM   5351  C  C    . LYS A 1 329 ? 54.185  71.243  -19.672 1.00 57.81  ? 326  LYS A C    1 
ATOM   5352  O  O    . LYS A 1 329 ? 55.313  71.584  -20.028 1.00 62.08  ? 326  LYS A O    1 
ATOM   5353  C  CB   . LYS A 1 329 ? 53.575  71.581  -17.276 1.00 61.17  ? 326  LYS A CB   1 
ATOM   5354  C  CG   . LYS A 1 329 ? 53.119  72.564  -16.226 1.00 64.70  ? 326  LYS A CG   1 
ATOM   5355  C  CD   . LYS A 1 329 ? 53.340  72.012  -14.850 1.00 90.56  ? 326  LYS A CD   1 
ATOM   5356  C  CE   . LYS A 1 329 ? 52.795  72.919  -13.765 1.00 85.23  ? 326  LYS A CE   1 
ATOM   5357  N  NZ   . LYS A 1 329 ? 52.981  72.294  -12.407 1.00 70.16  ? 326  LYS A NZ   1 
ATOM   5358  H  H    . LYS A 1 329 ? 51.547  71.485  -19.010 1.00 62.93  ? 326  LYS A H    1 
ATOM   5359  H  HA   . LYS A 1 329 ? 53.794  73.001  -18.723 1.00 75.26  ? 326  LYS A HA   1 
ATOM   5360  H  HB2  . LYS A 1 329 ? 53.052  70.771  -17.177 1.00 73.41  ? 326  LYS A HB2  1 
ATOM   5361  H  HB3  . LYS A 1 329 ? 54.514  71.392  -17.123 1.00 73.41  ? 326  LYS A HB3  1 
ATOM   5362  H  HG2  . LYS A 1 329 ? 53.626  73.386  -16.311 1.00 77.63  ? 326  LYS A HG2  1 
ATOM   5363  H  HG3  . LYS A 1 329 ? 52.171  72.739  -16.337 1.00 77.63  ? 326  LYS A HG3  1 
ATOM   5364  H  HD2  . LYS A 1 329 ? 52.892  71.154  -14.778 1.00 108.67 ? 326  LYS A HD2  1 
ATOM   5365  H  HD3  . LYS A 1 329 ? 54.292  71.904  -14.702 1.00 108.67 ? 326  LYS A HD3  1 
ATOM   5366  H  HE2  . LYS A 1 329 ? 53.271  73.764  -13.782 1.00 102.28 ? 326  LYS A HE2  1 
ATOM   5367  H  HE3  . LYS A 1 329 ? 51.846  73.062  -13.909 1.00 102.28 ? 326  LYS A HE3  1 
ATOM   5368  H  HZ1  . LYS A 1 329 ? 53.847  72.154  -12.252 1.00 84.19  ? 326  LYS A HZ1  1 
ATOM   5369  H  HZ2  . LYS A 1 329 ? 52.658  72.833  -11.777 1.00 84.19  ? 326  LYS A HZ2  1 
ATOM   5370  H  HZ3  . LYS A 1 329 ? 52.551  71.515  -12.369 1.00 84.19  ? 326  LYS A HZ3  1 
ATOM   5371  N  N    . THR A 1 330 ? 53.667  70.059  -19.982 1.00 54.39  ? 327  THR A N    1 
ATOM   5372  C  CA   . THR A 1 330 ? 54.340  69.170  -20.930 1.00 70.18  ? 327  THR A CA   1 
ATOM   5373  C  C    . THR A 1 330 ? 54.036  69.619  -22.363 1.00 70.37  ? 327  THR A C    1 
ATOM   5374  O  O    . THR A 1 330 ? 54.834  69.400  -23.276 1.00 64.82  ? 327  THR A O    1 
ATOM   5375  C  CB   . THR A 1 330 ? 53.906  67.693  -20.772 1.00 61.87  ? 327  THR A CB   1 
ATOM   5376  O  OG1  . THR A 1 330 ? 52.561  67.527  -21.243 1.00 62.55  ? 327  THR A OG1  1 
ATOM   5377  C  CG2  . THR A 1 330 ? 53.972  67.265  -19.332 1.00 69.10  ? 327  THR A CG2  1 
ATOM   5378  H  H    . THR A 1 330 ? 52.933  69.747  -19.661 1.00 65.26  ? 327  THR A H    1 
ATOM   5379  H  HA   . THR A 1 330 ? 55.299  69.222  -20.791 1.00 84.21  ? 327  THR A HA   1 
ATOM   5380  H  HB   . THR A 1 330 ? 54.500  67.126  -21.288 1.00 74.24  ? 327  THR A HB   1 
ATOM   5381  H  HG1  . THR A 1 330 ? 52.323  66.726  -21.158 1.00 75.06  ? 327  THR A HG1  1 
ATOM   5382  H  HG21 . THR A 1 330 ? 53.383  67.818  -18.795 1.00 82.91  ? 327  THR A HG21 1 
ATOM   5383  H  HG22 . THR A 1 330 ? 53.697  66.339  -19.249 1.00 82.91  ? 327  THR A HG22 1 
ATOM   5384  H  HG23 . THR A 1 330 ? 54.879  67.356  -19.001 1.00 82.91  ? 327  THR A HG23 1 
ATOM   5385  N  N    . GLY A 1 331 ? 52.895  70.284  -22.536 1.00 50.03  ? 328  GLY A N    1 
ATOM   5386  C  CA   . GLY A 1 331 ? 52.451  70.719  -23.845 1.00 72.05  ? 328  GLY A CA   1 
ATOM   5387  C  C    . GLY A 1 331 ? 51.825  69.582  -24.644 1.00 74.17  ? 328  GLY A C    1 
ATOM   5388  O  O    . GLY A 1 331 ? 51.327  69.809  -25.747 1.00 73.61  ? 328  GLY A O    1 
ATOM   5389  H  H    . GLY A 1 331 ? 52.358  70.496  -21.899 1.00 60.04  ? 328  GLY A H    1 
ATOM   5390  H  HA2  . GLY A 1 331 ? 51.793  71.425  -23.746 1.00 86.46  ? 328  GLY A HA2  1 
ATOM   5391  H  HA3  . GLY A 1 331 ? 53.205  71.068  -24.344 1.00 86.46  ? 328  GLY A HA3  1 
ATOM   5392  N  N    . ARG A 1 332 ? 51.832  68.368  -24.087 1.00 64.64  ? 329  ARG A N    1 
ATOM   5393  C  CA   . ARG A 1 332 ? 51.284  67.194  -24.778 1.00 63.01  ? 329  ARG A CA   1 
ATOM   5394  C  C    . ARG A 1 332 ? 49.768  67.308  -24.956 1.00 69.42  ? 329  ARG A C    1 
ATOM   5395  O  O    . ARG A 1 332 ? 49.075  67.961  -24.163 1.00 61.88  ? 329  ARG A O    1 
ATOM   5396  C  CB   . ARG A 1 332 ? 51.623  65.902  -24.021 1.00 60.59  ? 329  ARG A CB   1 
ATOM   5397  C  CG   . ARG A 1 332 ? 53.097  65.781  -23.656 1.00 71.94  ? 329  ARG A CG   1 
ATOM   5398  C  CD   . ARG A 1 332 ? 53.879  65.005  -24.694 1.00 74.03  ? 329  ARG A CD   1 
ATOM   5399  N  NE   . ARG A 1 332 ? 55.282  64.862  -24.310 1.00 78.03  ? 329  ARG A NE   1 
ATOM   5400  C  CZ   . ARG A 1 332 ? 56.226  64.330  -25.083 1.00 82.83  ? 329  ARG A CZ   1 
ATOM   5401  N  NH1  . ARG A 1 332 ? 55.923  63.877  -26.291 1.00 75.76  ? 329  ARG A NH1  1 
ATOM   5402  N  NH2  . ARG A 1 332 ? 57.480  64.259  -24.651 1.00 91.42  ? 329  ARG A NH2  1 
ATOM   5403  H  H    . ARG A 1 332 ? 52.150  68.196  -23.306 1.00 77.57  ? 329  ARG A H    1 
ATOM   5404  H  HA   . ARG A 1 332 ? 51.684  67.135  -25.660 1.00 75.61  ? 329  ARG A HA   1 
ATOM   5405  H  HB2  . ARG A 1 332 ? 51.110  65.876  -23.199 1.00 72.71  ? 329  ARG A HB2  1 
ATOM   5406  H  HB3  . ARG A 1 332 ? 51.391  65.142  -24.578 1.00 72.71  ? 329  ARG A HB3  1 
ATOM   5407  H  HG2  . ARG A 1 332 ? 53.482  66.669  -23.589 1.00 86.33  ? 329  ARG A HG2  1 
ATOM   5408  H  HG3  . ARG A 1 332 ? 53.177  65.317  -22.808 1.00 86.33  ? 329  ARG A HG3  1 
ATOM   5409  H  HD2  . ARG A 1 332 ? 53.497  64.118  -24.786 1.00 88.83  ? 329  ARG A HD2  1 
ATOM   5410  H  HD3  . ARG A 1 332 ? 53.842  65.476  -25.541 1.00 88.83  ? 329  ARG A HD3  1 
ATOM   5411  H  HE   . ARG A 1 332 ? 55.514  65.141  -23.530 1.00 93.64  ? 329  ARG A HE   1 
ATOM   5412  H  HH11 . ARG A 1 332 ? 55.114  63.925  -26.578 1.00 90.91  ? 329  ARG A HH11 1 
ATOM   5413  H  HH12 . ARG A 1 332 ? 56.536  63.533  -26.787 1.00 90.91  ? 329  ARG A HH12 1 
ATOM   5414  H  HH21 . ARG A 1 332 ? 57.682  64.549  -23.867 1.00 109.70 ? 329  ARG A HH21 1 
ATOM   5415  H  HH22 . ARG A 1 332 ? 58.087  63.910  -25.149 1.00 109.70 ? 329  ARG A HH22 1 
ATOM   5416  N  N    . ILE A 1 333 ? 49.265  66.648  -25.996 1.00 52.91  ? 330  ILE A N    1 
ATOM   5417  C  CA   . ILE A 1 333 ? 47.839  66.623  -26.278 1.00 47.88  ? 330  ILE A CA   1 
ATOM   5418  C  C    . ILE A 1 333 ? 47.180  65.439  -25.592 1.00 51.84  ? 330  ILE A C    1 
ATOM   5419  O  O    . ILE A 1 333 ? 47.670  64.300  -25.669 1.00 44.25  ? 330  ILE A O    1 
ATOM   5420  C  CB   . ILE A 1 333 ? 47.557  66.530  -27.810 1.00 60.93  ? 330  ILE A CB   1 
ATOM   5421  C  CG1  . ILE A 1 333 ? 48.177  67.716  -28.560 1.00 58.02  ? 330  ILE A CG1  1 
ATOM   5422  C  CG2  . ILE A 1 333 ? 46.048  66.458  -28.080 1.00 53.34  ? 330  ILE A CG2  1 
ATOM   5423  C  CD1  . ILE A 1 333 ? 47.620  69.082  -28.149 1.00 65.63  ? 330  ILE A CD1  1 
ATOM   5424  H  H    . ILE A 1 333 ? 49.738  66.201  -26.558 1.00 63.49  ? 330  ILE A H    1 
ATOM   5425  H  HA   . ILE A 1 333 ? 47.431  67.436  -25.942 1.00 57.46  ? 330  ILE A HA   1 
ATOM   5426  H  HB   . ILE A 1 333 ? 47.964  65.715  -28.144 1.00 73.11  ? 330  ILE A HB   1 
ATOM   5427  H  HG12 . ILE A 1 333 ? 49.133  67.724  -28.393 1.00 69.62  ? 330  ILE A HG12 1 
ATOM   5428  H  HG13 . ILE A 1 333 ? 48.013  67.604  -29.509 1.00 69.62  ? 330  ILE A HG13 1 
ATOM   5429  H  HG21 . ILE A 1 333 ? 45.626  67.257  -27.726 1.00 64.01  ? 330  ILE A HG21 1 
ATOM   5430  H  HG22 . ILE A 1 333 ? 45.901  66.401  -29.037 1.00 64.01  ? 330  ILE A HG22 1 
ATOM   5431  H  HG23 . ILE A 1 333 ? 45.687  65.671  -27.642 1.00 64.01  ? 330  ILE A HG23 1 
ATOM   5432  H  HD11 . ILE A 1 333 ? 47.788  69.219  -27.203 1.00 78.76  ? 330  ILE A HD11 1 
ATOM   5433  H  HD12 . ILE A 1 333 ? 48.063  69.772  -28.667 1.00 78.76  ? 330  ILE A HD12 1 
ATOM   5434  H  HD13 . ILE A 1 333 ? 46.666  69.098  -28.322 1.00 78.76  ? 330  ILE A HD13 1 
ATOM   5435  N  N    . SER A 1 334 ? 46.049  65.696  -24.947 1.00 45.06  ? 331  SER A N    1 
ATOM   5436  C  CA   . SER A 1 334 ? 45.270  64.602  -24.401 1.00 46.90  ? 331  SER A CA   1 
ATOM   5437  C  C    . SER A 1 334 ? 44.735  63.750  -25.540 1.00 52.19  ? 331  SER A C    1 
ATOM   5438  O  O    . SER A 1 334 ? 43.610  63.940  -26.010 1.00 60.33  ? 331  SER A O    1 
ATOM   5439  C  CB   . SER A 1 334 ? 44.136  65.138  -23.538 1.00 50.34  ? 331  SER A CB   1 
ATOM   5440  O  OG   . SER A 1 334 ? 44.629  65.493  -22.259 1.00 63.71  ? 331  SER A OG   1 
ATOM   5441  H  H    . SER A 1 334 ? 45.718  66.479  -24.816 1.00 54.07  ? 331  SER A H    1 
ATOM   5442  H  HA   . SER A 1 334 ? 45.840  64.048  -23.846 1.00 56.28  ? 331  SER A HA   1 
ATOM   5443  H  HB2  . SER A 1 334 ? 43.756  65.924  -23.963 1.00 60.41  ? 331  SER A HB2  1 
ATOM   5444  H  HB3  . SER A 1 334 ? 43.458  64.451  -23.440 1.00 60.41  ? 331  SER A HB3  1 
ATOM   5445  H  HG   . SER A 1 334 ? 44.963  64.820  -21.884 1.00 76.46  ? 331  SER A HG   1 
ATOM   5446  N  N    . VAL A 1 335 ? 45.542  62.779  -25.956 1.00 52.55  ? 332  VAL A N    1 
ATOM   5447  C  CA   . VAL A 1 335 ? 45.257  62.036  -27.173 1.00 55.59  ? 332  VAL A CA   1 
ATOM   5448  C  C    . VAL A 1 335 ? 44.625  60.691  -26.869 1.00 61.54  ? 332  VAL A C    1 
ATOM   5449  O  O    . VAL A 1 335 ? 44.924  60.084  -25.843 1.00 62.03  ? 332  VAL A O    1 
ATOM   5450  C  CB   . VAL A 1 335 ? 46.512  61.775  -28.007 1.00 56.60  ? 332  VAL A CB   1 
ATOM   5451  C  CG1  . VAL A 1 335 ? 47.042  63.099  -28.591 1.00 52.58  ? 332  VAL A CG1  1 
ATOM   5452  C  CG2  . VAL A 1 335 ? 47.572  61.042  -27.192 1.00 50.58  ? 332  VAL A CG2  1 
ATOM   5453  H  H    . VAL A 1 335 ? 46.259  62.534  -25.551 1.00 63.06  ? 332  VAL A H    1 
ATOM   5454  H  HA   . VAL A 1 335 ? 44.635  62.544  -27.716 1.00 66.71  ? 332  VAL A HA   1 
ATOM   5455  H  HB   . VAL A 1 335 ? 46.271  61.204  -28.753 1.00 67.91  ? 332  VAL A HB   1 
ATOM   5456  H  HG11 . VAL A 1 335 ? 47.258  63.701  -27.862 1.00 63.10  ? 332  VAL A HG11 1 
ATOM   5457  H  HG12 . VAL A 1 335 ? 47.837  62.916  -29.117 1.00 63.10  ? 332  VAL A HG12 1 
ATOM   5458  H  HG13 . VAL A 1 335 ? 46.357  63.493  -29.154 1.00 63.10  ? 332  VAL A HG13 1 
ATOM   5459  H  HG21 . VAL A 1 335 ? 47.210  60.192  -26.896 1.00 60.70  ? 332  VAL A HG21 1 
ATOM   5460  H  HG22 . VAL A 1 335 ? 48.352  60.894  -27.750 1.00 60.70  ? 332  VAL A HG22 1 
ATOM   5461  H  HG23 . VAL A 1 335 ? 47.812  61.585  -26.425 1.00 60.70  ? 332  VAL A HG23 1 
ATOM   5462  N  N    . PRO A 1 336 ? 43.724  60.231  -27.750 1.00 60.06  ? 333  PRO A N    1 
ATOM   5463  C  CA   . PRO A 1 336 ? 43.130  58.901  -27.606 1.00 58.43  ? 333  PRO A CA   1 
ATOM   5464  C  C    . PRO A 1 336 ? 44.149  57.783  -27.773 1.00 56.39  ? 333  PRO A C    1 
ATOM   5465  O  O    . PRO A 1 336 ? 45.143  57.947  -28.481 1.00 57.66  ? 333  PRO A O    1 
ATOM   5466  C  CB   . PRO A 1 336 ? 42.086  58.864  -28.721 1.00 62.89  ? 333  PRO A CB   1 
ATOM   5467  C  CG   . PRO A 1 336 ? 41.713  60.284  -28.906 1.00 60.58  ? 333  PRO A CG   1 
ATOM   5468  C  CD   . PRO A 1 336 ? 42.991  61.035  -28.739 1.00 56.60  ? 333  PRO A CD   1 
ATOM   5469  H  HA   . PRO A 1 336 ? 42.690  58.815  -26.746 1.00 70.12  ? 333  PRO A HA   1 
ATOM   5470  H  HB2  . PRO A 1 336 ? 42.479  58.501  -29.530 1.00 75.47  ? 333  PRO A HB2  1 
ATOM   5471  H  HB3  . PRO A 1 336 ? 41.321  58.339  -28.439 1.00 75.47  ? 333  PRO A HB3  1 
ATOM   5472  H  HG2  . PRO A 1 336 ? 41.351  60.415  -29.796 1.00 72.69  ? 333  PRO A HG2  1 
ATOM   5473  H  HG3  . PRO A 1 336 ? 41.069  60.545  -28.229 1.00 72.69  ? 333  PRO A HG3  1 
ATOM   5474  H  HD2  . PRO A 1 336 ? 43.478  61.068  -29.577 1.00 67.92  ? 333  PRO A HD2  1 
ATOM   5475  H  HD3  . PRO A 1 336 ? 42.819  61.925  -28.391 1.00 67.92  ? 333  PRO A HD3  1 
ATOM   5476  N  N    . ILE A 1 337 ? 43.894  56.661  -27.112 1.00 50.56  ? 334  ILE A N    1 
ATOM   5477  C  CA   . ILE A 1 337 ? 44.804  55.525  -27.143 1.00 65.07  ? 334  ILE A CA   1 
ATOM   5478  C  C    . ILE A 1 337 ? 44.180  54.385  -27.914 1.00 59.11  ? 334  ILE A C    1 
ATOM   5479  O  O    . ILE A 1 337 ? 43.091  53.913  -27.568 1.00 60.97  ? 334  ILE A O    1 
ATOM   5480  C  CB   . ILE A 1 337 ? 45.147  55.026  -25.719 1.00 64.13  ? 334  ILE A CB   1 
ATOM   5481  C  CG1  . ILE A 1 337 ? 45.769  56.162  -24.906 1.00 63.17  ? 334  ILE A CG1  1 
ATOM   5482  C  CG2  . ILE A 1 337 ? 46.110  53.831  -25.791 1.00 56.44  ? 334  ILE A CG2  1 
ATOM   5483  C  CD1  . ILE A 1 337 ? 46.079  55.805  -23.449 1.00 67.13  ? 334  ILE A CD1  1 
ATOM   5484  H  H    . ILE A 1 337 ? 43.192  56.531  -26.632 1.00 60.67  ? 334  ILE A H    1 
ATOM   5485  H  HA   . ILE A 1 337 ? 45.628  55.782  -27.586 1.00 78.08  ? 334  ILE A HA   1 
ATOM   5486  H  HB   . ILE A 1 337 ? 44.329  54.742  -25.282 1.00 76.96  ? 334  ILE A HB   1 
ATOM   5487  H  HG12 . ILE A 1 337 ? 46.602  56.426  -25.328 1.00 75.81  ? 334  ILE A HG12 1 
ATOM   5488  H  HG13 . ILE A 1 337 ? 45.154  56.913  -24.900 1.00 75.81  ? 334  ILE A HG13 1 
ATOM   5489  H  HG21 . ILE A 1 337 ? 46.924  54.109  -26.239 1.00 67.73  ? 334  ILE A HG21 1 
ATOM   5490  H  HG22 . ILE A 1 337 ? 46.312  53.534  -24.891 1.00 67.73  ? 334  ILE A HG22 1 
ATOM   5491  H  HG23 . ILE A 1 337 ? 45.686  53.115  -26.289 1.00 67.73  ? 334  ILE A HG23 1 
ATOM   5492  H  HD11 . ILE A 1 337 ? 46.706  55.065  -23.432 1.00 80.55  ? 334  ILE A HD11 1 
ATOM   5493  H  HD12 . ILE A 1 337 ? 46.469  56.578  -23.011 1.00 80.55  ? 334  ILE A HD12 1 
ATOM   5494  H  HD13 . ILE A 1 337 ? 45.255  55.552  -23.004 1.00 80.55  ? 334  ILE A HD13 1 
ATOM   5495  N  N    . ASP A 1 338 ? 44.904  53.908  -28.922 1.00 56.79  ? 335  ASP A N    1 
ATOM   5496  C  CA   . ASP A 1 338 ? 44.452  52.764  -29.702 1.00 67.98  ? 335  ASP A CA   1 
ATOM   5497  C  C    . ASP A 1 338 ? 44.635  51.515  -28.870 1.00 61.88  ? 335  ASP A C    1 
ATOM   5498  O  O    . ASP A 1 338 ? 45.764  51.093  -28.603 1.00 62.28  ? 335  ASP A O    1 
ATOM   5499  C  CB   . ASP A 1 338 ? 45.230  52.660  -31.019 1.00 85.03  ? 335  ASP A CB   1 
ATOM   5500  C  CG   . ASP A 1 338 ? 44.812  51.469  -31.865 1.00 76.47  ? 335  ASP A CG   1 
ATOM   5501  O  OD1  . ASP A 1 338 ? 43.729  50.888  -31.629 1.00 77.69  ? 335  ASP A OD1  1 
ATOM   5502  O  OD2  . ASP A 1 338 ? 45.601  51.096  -32.756 1.00 81.55  ? 335  ASP A OD2  1 
ATOM   5503  H  H    . ASP A 1 338 ? 45.661  54.229  -29.174 1.00 68.15  ? 335  ASP A H    1 
ATOM   5504  H  HA   . ASP A 1 338 ? 43.509  52.863  -29.908 1.00 81.57  ? 335  ASP A HA   1 
ATOM   5505  H  HB2  . ASP A 1 338 ? 45.079  53.465  -31.539 1.00 102.04 ? 335  ASP A HB2  1 
ATOM   5506  H  HB3  . ASP A 1 338 ? 46.175  52.568  -30.819 1.00 102.04 ? 335  ASP A HB3  1 
ATOM   5507  N  N    . LEU A 1 339 ? 43.507  50.901  -28.524 1.00 54.00  ? 336  LEU A N    1 
ATOM   5508  C  CA   . LEU A 1 339 ? 43.487  49.717  -27.678 1.00 64.93  ? 336  LEU A CA   1 
ATOM   5509  C  C    . LEU A 1 339 ? 44.198  48.527  -28.299 1.00 71.50  ? 336  LEU A C    1 
ATOM   5510  O  O    . LEU A 1 339 ? 44.691  47.646  -27.593 1.00 71.62  ? 336  LEU A O    1 
ATOM   5511  C  CB   . LEU A 1 339 ? 42.034  49.354  -27.371 1.00 52.05  ? 336  LEU A CB   1 
ATOM   5512  C  CG   . LEU A 1 339 ? 41.383  50.214  -26.289 1.00 74.39  ? 336  LEU A CG   1 
ATOM   5513  C  CD1  . LEU A 1 339 ? 39.895  49.889  -26.152 1.00 59.82  ? 336  LEU A CD1  1 
ATOM   5514  C  CD2  . LEU A 1 339 ? 42.104  50.026  -24.934 1.00 67.37  ? 336  LEU A CD2  1 
ATOM   5515  H  H    . LEU A 1 339 ? 42.726  51.160  -28.772 1.00 64.80  ? 336  LEU A H    1 
ATOM   5516  H  HA   . LEU A 1 339 ? 43.927  49.923  -26.839 1.00 77.92  ? 336  LEU A HA   1 
ATOM   5517  H  HB2  . LEU A 1 339 ? 41.511  49.454  -28.182 1.00 62.46  ? 336  LEU A HB2  1 
ATOM   5518  H  HB3  . LEU A 1 339 ? 42.002  48.431  -27.074 1.00 62.46  ? 336  LEU A HB3  1 
ATOM   5519  H  HG   . LEU A 1 339 ? 41.462  51.147  -26.541 1.00 89.26  ? 336  LEU A HG   1 
ATOM   5520  H  HD11 . LEU A 1 339 ? 39.797  48.954  -25.912 1.00 71.78  ? 336  LEU A HD11 1 
ATOM   5521  H  HD12 . LEU A 1 339 ? 39.513  50.450  -25.459 1.00 71.78  ? 336  LEU A HD12 1 
ATOM   5522  H  HD13 . LEU A 1 339 ? 39.455  50.062  -26.998 1.00 71.78  ? 336  LEU A HD13 1 
ATOM   5523  H  HD21 . LEU A 1 339 ? 43.033  50.288  -25.032 1.00 80.85  ? 336  LEU A HD21 1 
ATOM   5524  H  HD22 . LEU A 1 339 ? 41.671  50.581  -24.267 1.00 80.85  ? 336  LEU A HD22 1 
ATOM   5525  H  HD23 . LEU A 1 339 ? 42.049  49.093  -24.674 1.00 80.85  ? 336  LEU A HD23 1 
ATOM   5526  N  N    . GLN A 1 340 ? 44.271  48.524  -29.624 1.00 79.08  ? 337  GLN A N    1 
ATOM   5527  C  CA   . GLN A 1 340 ? 44.916  47.446  -30.356 1.00 81.98  ? 337  GLN A CA   1 
ATOM   5528  C  C    . GLN A 1 340 ? 46.441  47.533  -30.274 1.00 80.35  ? 337  GLN A C    1 
ATOM   5529  O  O    . GLN A 1 340 ? 47.133  46.514  -30.365 1.00 75.78  ? 337  GLN A O    1 
ATOM   5530  C  CB   . GLN A 1 340 ? 44.458  47.470  -31.810 1.00 96.73  ? 337  GLN A CB   1 
ATOM   5531  C  CG   . GLN A 1 340 ? 42.943  47.345  -31.968 1.00 101.66 ? 337  GLN A CG   1 
ATOM   5532  C  CD   . GLN A 1 340 ? 42.512  45.994  -32.499 1.00 116.39 ? 337  GLN A CD   1 
ATOM   5533  O  OE1  . GLN A 1 340 ? 42.564  45.740  -33.705 1.00 123.34 ? 337  GLN A OE1  1 
ATOM   5534  N  NE2  . GLN A 1 340 ? 42.082  45.115  -31.599 1.00 119.47 ? 337  GLN A NE2  1 
ATOM   5535  H  H    . GLN A 1 340 ? 43.951  49.143  -30.128 1.00 94.90  ? 337  GLN A H    1 
ATOM   5536  H  HA   . GLN A 1 340 ? 44.645  46.598  -29.970 1.00 98.38  ? 337  GLN A HA   1 
ATOM   5537  H  HB2  . GLN A 1 340 ? 44.731  48.309  -32.212 1.00 116.08 ? 337  GLN A HB2  1 
ATOM   5538  H  HB3  . GLN A 1 340 ? 44.869  46.728  -32.281 1.00 116.08 ? 337  GLN A HB3  1 
ATOM   5539  H  HG2  . GLN A 1 340 ? 42.524  47.473  -31.103 1.00 121.99 ? 337  GLN A HG2  1 
ATOM   5540  H  HG3  . GLN A 1 340 ? 42.634  48.023  -32.589 1.00 121.99 ? 337  GLN A HG3  1 
ATOM   5541  H  HE21 . GLN A 1 340 ? 42.061  45.328  -30.766 1.00 143.37 ? 337  GLN A HE21 1 
ATOM   5542  H  HE22 . GLN A 1 340 ? 41.826  44.333  -31.849 1.00 143.37 ? 337  GLN A HE22 1 
ATOM   5543  N  N    . LYS A 1 341 ? 46.953  48.753  -30.119 1.00 75.60  ? 338  LYS A N    1 
ATOM   5544  C  CA   . LYS A 1 341 ? 48.393  48.988  -30.019 1.00 79.05  ? 338  LYS A CA   1 
ATOM   5545  C  C    . LYS A 1 341 ? 48.799  49.497  -28.627 1.00 73.96  ? 338  LYS A C    1 
ATOM   5546  O  O    . LYS A 1 341 ? 49.781  50.236  -28.488 1.00 69.82  ? 338  LYS A O    1 
ATOM   5547  C  CB   . LYS A 1 341 ? 48.837  49.983  -31.097 1.00 84.34  ? 338  LYS A CB   1 
ATOM   5548  C  CG   . LYS A 1 341 ? 48.845  49.400  -32.495 1.00 104.40 ? 338  LYS A CG   1 
ATOM   5549  C  CD   . LYS A 1 341 ? 49.596  50.291  -33.475 1.00 116.85 ? 338  LYS A CD   1 
ATOM   5550  C  CE   . LYS A 1 341 ? 49.792  49.597  -34.823 1.00 118.36 ? 338  LYS A CE   1 
ATOM   5551  N  NZ   . LYS A 1 341 ? 50.708  50.350  -35.734 1.00 104.71 ? 338  LYS A NZ   1 
ATOM   5552  H  H    . LYS A 1 341 ? 46.481  49.470  -30.068 1.00 90.72  ? 338  LYS A H    1 
ATOM   5553  H  HA   . LYS A 1 341 ? 48.859  48.152  -30.176 1.00 94.86  ? 338  LYS A HA   1 
ATOM   5554  H  HB2  . LYS A 1 341 ? 48.230  50.740  -31.094 1.00 101.21 ? 338  LYS A HB2  1 
ATOM   5555  H  HB3  . LYS A 1 341 ? 49.737  50.283  -30.895 1.00 101.21 ? 338  LYS A HB3  1 
ATOM   5556  H  HG2  . LYS A 1 341 ? 49.281  48.533  -32.478 1.00 125.28 ? 338  LYS A HG2  1 
ATOM   5557  H  HG3  . LYS A 1 341 ? 47.931  49.308  -32.808 1.00 125.28 ? 338  LYS A HG3  1 
ATOM   5558  H  HD2  . LYS A 1 341 ? 49.089  51.105  -33.622 1.00 140.22 ? 338  LYS A HD2  1 
ATOM   5559  H  HD3  . LYS A 1 341 ? 50.471  50.501  -33.111 1.00 140.22 ? 338  LYS A HD3  1 
ATOM   5560  H  HE2  . LYS A 1 341 ? 50.173  48.718  -34.673 1.00 142.03 ? 338  LYS A HE2  1 
ATOM   5561  H  HE3  . LYS A 1 341 ? 48.931  49.515  -35.264 1.00 142.03 ? 338  LYS A HE3  1 
ATOM   5562  H  HZ1  . LYS A 1 341 ? 51.510  50.433  -35.357 1.00 125.65 ? 338  LYS A HZ1  1 
ATOM   5563  H  HZ2  . LYS A 1 341 ? 50.795  49.914  -36.505 1.00 125.65 ? 338  LYS A HZ2  1 
ATOM   5564  H  HZ3  . LYS A 1 341 ? 50.379  51.160  -35.895 1.00 125.65 ? 338  LYS A HZ3  1 
ATOM   5565  N  N    . VAL A 1 342 ? 48.098  49.031  -27.594 1.00 73.71  ? 339  VAL A N    1 
ATOM   5566  C  CA   . VAL A 1 342 ? 48.248  49.608  -26.257 1.00 73.27  ? 339  VAL A CA   1 
ATOM   5567  C  C    . VAL A 1 342 ? 49.655  49.389  -25.697 1.00 64.15  ? 339  VAL A C    1 
ATOM   5568  O  O    . VAL A 1 342 ? 50.214  50.281  -25.066 1.00 62.46  ? 339  VAL A O    1 
ATOM   5569  C  CB   . VAL A 1 342 ? 47.212  49.014  -25.269 1.00 66.42  ? 339  VAL A CB   1 
ATOM   5570  C  CG1  . VAL A 1 342 ? 47.474  47.522  -25.022 1.00 75.08  ? 339  VAL A CG1  1 
ATOM   5571  C  CG2  . VAL A 1 342 ? 47.228  49.774  -23.953 1.00 72.13  ? 339  VAL A CG2  1 
ATOM   5572  H  H    . VAL A 1 342 ? 47.531  48.386  -27.640 1.00 88.46  ? 339  VAL A H    1 
ATOM   5573  H  HA   . VAL A 1 342 ? 48.094  50.564  -26.310 1.00 87.92  ? 339  VAL A HA   1 
ATOM   5574  H  HB   . VAL A 1 342 ? 46.325  49.101  -25.653 1.00 79.70  ? 339  VAL A HB   1 
ATOM   5575  H  HG11 . VAL A 1 342 ? 48.362  47.415  -24.647 1.00 90.09  ? 339  VAL A HG11 1 
ATOM   5576  H  HG12 . VAL A 1 342 ? 46.810  47.183  -24.401 1.00 90.09  ? 339  VAL A HG12 1 
ATOM   5577  H  HG13 . VAL A 1 342 ? 47.411  47.047  -25.866 1.00 90.09  ? 339  VAL A HG13 1 
ATOM   5578  H  HG21 . VAL A 1 342 ? 47.008  50.703  -24.123 1.00 86.56  ? 339  VAL A HG21 1 
ATOM   5579  H  HG22 . VAL A 1 342 ? 46.572  49.383  -23.355 1.00 86.56  ? 339  VAL A HG22 1 
ATOM   5580  H  HG23 . VAL A 1 342 ? 48.113  49.710  -23.562 1.00 86.56  ? 339  VAL A HG23 1 
ATOM   5581  N  N    . ASP A 1 343 ? 50.252  48.239  -25.992 1.00 63.40  ? 340  ASP A N    1 
ATOM   5582  C  CA   . ASP A 1 343 ? 51.599  47.932  -25.516 1.00 62.91  ? 340  ASP A CA   1 
ATOM   5583  C  C    . ASP A 1 343 ? 52.628  48.779  -26.251 1.00 52.59  ? 340  ASP A C    1 
ATOM   5584  O  O    . ASP A 1 343 ? 53.774  48.877  -25.810 1.00 81.47  ? 340  ASP A O    1 
ATOM   5585  C  CB   . ASP A 1 343 ? 51.926  46.442  -25.690 1.00 50.79  ? 340  ASP A CB   1 
ATOM   5586  C  CG   . ASP A 1 343 ? 51.181  45.551  -24.706 1.00 58.24  ? 340  ASP A CG   1 
ATOM   5587  O  OD1  . ASP A 1 343 ? 49.931  45.471  -24.748 1.00 78.21  ? 340  ASP A OD1  1 
ATOM   5588  O  OD2  . ASP A 1 343 ? 51.863  44.871  -23.918 1.00 65.56  ? 340  ASP A OD2  1 
ATOM   5589  H  H    . ASP A 1 343 ? 49.897  47.616  -26.467 1.00 76.08  ? 340  ASP A H    1 
ATOM   5590  H  HA   . ASP A 1 343 ? 51.656  48.143  -24.571 1.00 75.50  ? 340  ASP A HA   1 
ATOM   5591  H  HB2  . ASP A 1 343 ? 51.680  46.168  -26.587 1.00 60.95  ? 340  ASP A HB2  1 
ATOM   5592  H  HB3  . ASP A 1 343 ? 52.877  46.310  -25.552 1.00 60.95  ? 340  ASP A HB3  1 
ATOM   5593  N  N    . GLN A 1 344 ? 52.237  49.377  -27.372 1.00 64.91  ? 341  GLN A N    1 
ATOM   5594  C  CA   . GLN A 1 344 ? 53.184  50.159  -28.163 1.00 71.73  ? 341  GLN A CA   1 
ATOM   5595  C  C    . GLN A 1 344 ? 53.055  51.642  -27.865 1.00 70.37  ? 341  GLN A C    1 
ATOM   5596  O  O    . GLN A 1 344 ? 53.859  52.442  -28.339 1.00 82.61  ? 341  GLN A O    1 
ATOM   5597  C  CB   . GLN A 1 344 ? 52.993  49.901  -29.657 1.00 63.32  ? 341  GLN A CB   1 
ATOM   5598  C  CG   . GLN A 1 344 ? 53.539  48.549  -30.137 1.00 83.25  ? 341  GLN A CG   1 
ATOM   5599  C  CD   . GLN A 1 344 ? 52.850  47.340  -29.507 1.00 94.63  ? 341  GLN A CD   1 
ATOM   5600  O  OE1  . GLN A 1 344 ? 51.620  47.305  -29.377 1.00 81.64  ? 341  GLN A OE1  1 
ATOM   5601  N  NE2  . GLN A 1 344 ? 53.646  46.336  -29.116 1.00 77.57  ? 341  GLN A NE2  1 
ATOM   5602  H  H    . GLN A 1 344 ? 51.440  49.348  -27.693 1.00 77.90  ? 341  GLN A H    1 
ATOM   5603  H  HA   . GLN A 1 344 ? 54.085  49.888  -27.928 1.00 86.08  ? 341  GLN A HA   1 
ATOM   5604  H  HB2  . GLN A 1 344 ? 52.044  49.925  -29.858 1.00 75.99  ? 341  GLN A HB2  1 
ATOM   5605  H  HB3  . GLN A 1 344 ? 53.450  50.598  -30.154 1.00 75.99  ? 341  GLN A HB3  1 
ATOM   5606  H  HG2  . GLN A 1 344 ? 53.421  48.489  -31.098 1.00 99.89  ? 341  GLN A HG2  1 
ATOM   5607  H  HG3  . GLN A 1 344 ? 54.483  48.499  -29.919 1.00 99.89  ? 341  GLN A HG3  1 
ATOM   5608  H  HE21 . GLN A 1 344 ? 54.497  46.395  -29.226 1.00 93.08  ? 341  GLN A HE21 1 
ATOM   5609  H  HE22 . GLN A 1 344 ? 53.307  45.633  -28.755 1.00 93.08  ? 341  GLN A HE22 1 
ATOM   5610  N  N    . PHE A 1 345 ? 52.051  52.002  -27.067 1.00 69.44  ? 342  PHE A N    1 
ATOM   5611  C  CA   . PHE A 1 345 ? 51.797  53.404  -26.744 1.00 54.53  ? 342  PHE A CA   1 
ATOM   5612  C  C    . PHE A 1 345 ? 52.945  53.989  -25.932 1.00 75.04  ? 342  PHE A C    1 
ATOM   5613  O  O    . PHE A 1 345 ? 53.409  53.385  -24.957 1.00 69.04  ? 342  PHE A O    1 
ATOM   5614  C  CB   . PHE A 1 345 ? 50.481  53.548  -25.982 1.00 51.71  ? 342  PHE A CB   1 
ATOM   5615  C  CG   . PHE A 1 345 ? 50.147  54.968  -25.620 1.00 60.23  ? 342  PHE A CG   1 
ATOM   5616  C  CD1  . PHE A 1 345 ? 49.565  55.820  -26.541 1.00 57.62  ? 342  PHE A CD1  1 
ATOM   5617  C  CD2  . PHE A 1 345 ? 50.413  55.447  -24.341 1.00 65.81  ? 342  PHE A CD2  1 
ATOM   5618  C  CE1  . PHE A 1 345 ? 49.263  57.141  -26.208 1.00 55.11  ? 342  PHE A CE1  1 
ATOM   5619  C  CE2  . PHE A 1 345 ? 50.115  56.762  -23.988 1.00 62.82  ? 342  PHE A CE2  1 
ATOM   5620  C  CZ   . PHE A 1 345 ? 49.535  57.614  -24.924 1.00 72.33  ? 342  PHE A CZ   1 
ATOM   5621  H  H    . PHE A 1 345 ? 51.502  51.452  -26.698 1.00 83.32  ? 342  PHE A H    1 
ATOM   5622  H  HA   . PHE A 1 345 ? 51.724  53.910  -27.569 1.00 65.44  ? 342  PHE A HA   1 
ATOM   5623  H  HB2  . PHE A 1 345 ? 49.761  53.205  -26.533 1.00 62.05  ? 342  PHE A HB2  1 
ATOM   5624  H  HB3  . PHE A 1 345 ? 50.538  53.037  -25.160 1.00 62.05  ? 342  PHE A HB3  1 
ATOM   5625  H  HD1  . PHE A 1 345 ? 49.384  55.512  -27.399 1.00 69.15  ? 342  PHE A HD1  1 
ATOM   5626  H  HD2  . PHE A 1 345 ? 50.803  54.883  -23.714 1.00 78.97  ? 342  PHE A HD2  1 
ATOM   5627  H  HE1  . PHE A 1 345 ? 48.873  57.703  -26.839 1.00 66.14  ? 342  PHE A HE1  1 
ATOM   5628  H  HE2  . PHE A 1 345 ? 50.301  57.069  -23.130 1.00 75.39  ? 342  PHE A HE2  1 
ATOM   5629  H  HZ   . PHE A 1 345 ? 49.331  58.492  -24.695 1.00 86.80  ? 342  PHE A HZ   1 
ATOM   5630  N  N    . ASP A 1 346 ? 53.347  55.198  -26.311 1.00 74.41  ? 343  ASP A N    1 
ATOM   5631  C  CA   . ASP A 1 346 ? 54.512  55.865  -25.736 1.00 72.96  ? 343  ASP A CA   1 
ATOM   5632  C  C    . ASP A 1 346 ? 54.155  57.314  -25.420 1.00 77.57  ? 343  ASP A C    1 
ATOM   5633  O  O    . ASP A 1 346 ? 53.983  58.125  -26.331 1.00 74.37  ? 343  ASP A O    1 
ATOM   5634  C  CB   . ASP A 1 346 ? 55.691  55.800  -26.715 1.00 73.33  ? 343  ASP A CB   1 
ATOM   5635  C  CG   . ASP A 1 346 ? 56.985  56.302  -26.118 1.00 84.60  ? 343  ASP A CG   1 
ATOM   5636  O  OD1  . ASP A 1 346 ? 56.947  57.020  -25.091 1.00 88.82  ? 343  ASP A OD1  1 
ATOM   5637  O  OD2  . ASP A 1 346 ? 58.048  55.988  -26.698 1.00 93.25  ? 343  ASP A OD2  1 
ATOM   5638  H  H    . ASP A 1 346 ? 52.951  55.664  -26.915 1.00 89.29  ? 343  ASP A H    1 
ATOM   5639  H  HA   . ASP A 1 346 ? 54.768  55.422  -24.912 1.00 87.55  ? 343  ASP A HA   1 
ATOM   5640  H  HB2  . ASP A 1 346 ? 55.825  54.879  -26.986 1.00 88.00  ? 343  ASP A HB2  1 
ATOM   5641  H  HB3  . ASP A 1 346 ? 55.488  56.347  -27.490 1.00 88.00  ? 343  ASP A HB3  1 
ATOM   5642  N  N    . PRO A 1 347 ? 54.062  57.656  -24.125 1.00 69.92  ? 344  PRO A N    1 
ATOM   5643  C  CA   . PRO A 1 347 ? 53.628  59.013  -23.786 1.00 68.57  ? 344  PRO A CA   1 
ATOM   5644  C  C    . PRO A 1 347 ? 54.703  60.044  -24.099 1.00 65.22  ? 344  PRO A C    1 
ATOM   5645  O  O    . PRO A 1 347 ? 54.437  61.247  -24.012 1.00 68.27  ? 344  PRO A O    1 
ATOM   5646  C  CB   . PRO A 1 347 ? 53.353  58.928  -22.282 1.00 61.00  ? 344  PRO A CB   1 
ATOM   5647  C  CG   . PRO A 1 347 ? 54.268  57.843  -21.817 1.00 69.78  ? 344  PRO A CG   1 
ATOM   5648  C  CD   . PRO A 1 347 ? 54.323  56.845  -22.926 1.00 57.09  ? 344  PRO A CD   1 
ATOM   5649  H  HA   . PRO A 1 347 ? 52.810  59.239  -24.256 1.00 82.29  ? 344  PRO A HA   1 
ATOM   5650  H  HB2  . PRO A 1 347 ? 53.571  59.772  -21.857 1.00 73.20  ? 344  PRO A HB2  1 
ATOM   5651  H  HB3  . PRO A 1 347 ? 52.425  58.689  -22.129 1.00 73.20  ? 344  PRO A HB3  1 
ATOM   5652  H  HG2  . PRO A 1 347 ? 55.149  58.213  -21.648 1.00 83.74  ? 344  PRO A HG2  1 
ATOM   5653  H  HG3  . PRO A 1 347 ? 53.908  57.439  -21.012 1.00 83.74  ? 344  PRO A HG3  1 
ATOM   5654  H  HD2  . PRO A 1 347 ? 55.204  56.442  -22.975 1.00 68.50  ? 344  PRO A HD2  1 
ATOM   5655  H  HD3  . PRO A 1 347 ? 53.630  56.175  -22.813 1.00 68.50  ? 344  PRO A HD3  1 
ATOM   5656  N  N    . PHE A 1 348 ? 55.879  59.580  -24.517 1.00 64.65  ? 345  PHE A N    1 
ATOM   5657  C  CA   . PHE A 1 348 ? 57.000  60.482  -24.770 1.00 72.22  ? 345  PHE A CA   1 
ATOM   5658  C  C    . PHE A 1 348 ? 57.158  60.849  -26.250 1.00 79.82  ? 345  PHE A C    1 
ATOM   5659  O  O    . PHE A 1 348 ? 57.969  61.713  -26.592 1.00 81.10  ? 345  PHE A O    1 
ATOM   5660  C  CB   . PHE A 1 348 ? 58.283  59.847  -24.247 1.00 75.60  ? 345  PHE A CB   1 
ATOM   5661  C  CG   . PHE A 1 348 ? 58.229  59.538  -22.779 1.00 73.91  ? 345  PHE A CG   1 
ATOM   5662  C  CD1  . PHE A 1 348 ? 58.462  60.525  -21.842 1.00 64.28  ? 345  PHE A CD1  1 
ATOM   5663  C  CD2  . PHE A 1 348 ? 57.930  58.260  -22.338 1.00 74.97  ? 345  PHE A CD2  1 
ATOM   5664  C  CE1  . PHE A 1 348 ? 58.395  60.250  -20.501 1.00 66.87  ? 345  PHE A CE1  1 
ATOM   5665  C  CE2  . PHE A 1 348 ? 57.867  57.974  -20.991 1.00 60.26  ? 345  PHE A CE2  1 
ATOM   5666  C  CZ   . PHE A 1 348 ? 58.098  58.970  -20.071 1.00 71.14  ? 345  PHE A CZ   1 
ATOM   5667  H  H    . PHE A 1 348 ? 56.053  58.751  -24.662 1.00 77.58  ? 345  PHE A H    1 
ATOM   5668  H  HA   . PHE A 1 348 ? 56.855  61.304  -24.276 1.00 86.66  ? 345  PHE A HA   1 
ATOM   5669  H  HB2  . PHE A 1 348 ? 58.440  59.016  -24.722 1.00 90.72  ? 345  PHE A HB2  1 
ATOM   5670  H  HB3  . PHE A 1 348 ? 59.021  60.458  -24.397 1.00 90.72  ? 345  PHE A HB3  1 
ATOM   5671  H  HD1  . PHE A 1 348 ? 58.658  61.389  -22.125 1.00 77.13  ? 345  PHE A HD1  1 
ATOM   5672  H  HD2  . PHE A 1 348 ? 57.770  57.587  -22.959 1.00 89.96  ? 345  PHE A HD2  1 
ATOM   5673  H  HE1  . PHE A 1 348 ? 58.556  60.923  -19.880 1.00 80.24  ? 345  PHE A HE1  1 
ATOM   5674  H  HE2  . PHE A 1 348 ? 57.667  57.111  -20.706 1.00 72.31  ? 345  PHE A HE2  1 
ATOM   5675  H  HZ   . PHE A 1 348 ? 58.060  58.781  -19.161 1.00 85.37  ? 345  PHE A HZ   1 
ATOM   5676  N  N    . THR A 1 349 ? 56.401  60.174  -27.115 1.00 72.87  ? 346  THR A N    1 
ATOM   5677  C  CA   . THR A 1 349 ? 56.334  60.512  -28.535 1.00 68.67  ? 346  THR A CA   1 
ATOM   5678  C  C    . THR A 1 349 ? 54.946  61.065  -28.845 1.00 67.89  ? 346  THR A C    1 
ATOM   5679  O  O    . THR A 1 349 ? 54.601  61.285  -30.004 1.00 74.63  ? 346  THR A O    1 
ATOM   5680  C  CB   . THR A 1 349 ? 56.625  59.299  -29.445 1.00 69.31  ? 346  THR A CB   1 
ATOM   5681  O  OG1  . THR A 1 349 ? 55.433  58.517  -29.607 1.00 78.71  ? 346  THR A OG1  1 
ATOM   5682  C  CG2  . THR A 1 349 ? 57.714  58.430  -28.848 1.00 79.66  ? 346  THR A CG2  1 
ATOM   5683  H  H    . THR A 1 349 ? 55.908  59.504  -26.898 1.00 87.44  ? 346  THR A H    1 
ATOM   5684  H  HA   . THR A 1 349 ? 56.987  61.202  -28.731 1.00 82.41  ? 346  THR A HA   1 
ATOM   5685  H  HB   . THR A 1 349 ? 56.925  59.612  -30.313 1.00 83.18  ? 346  THR A HB   1 
ATOM   5686  H  HG1  . THR A 1 349 ? 55.588  57.856  -30.101 1.00 94.45  ? 346  THR A HG1  1 
ATOM   5687  H  HG21 . THR A 1 349 ? 57.438  58.104  -27.977 1.00 95.60  ? 346  THR A HG21 1 
ATOM   5688  H  HG22 . THR A 1 349 ? 57.888  57.672  -29.428 1.00 95.60  ? 346  THR A HG22 1 
ATOM   5689  H  HG23 . THR A 1 349 ? 58.530  58.944  -28.748 1.00 95.60  ? 346  THR A HG23 1 
ATOM   5690  N  N    . VAL A 1 350 ? 54.166  61.325  -27.802 1.00 60.12  ? 347  VAL A N    1 
ATOM   5691  C  CA   . VAL A 1 350 ? 52.862  61.954  -27.974 1.00 60.27  ? 347  VAL A CA   1 
ATOM   5692  C  C    . VAL A 1 350 ? 53.058  63.400  -28.427 1.00 70.22  ? 347  VAL A C    1 
ATOM   5693  O  O    . VAL A 1 350 ? 53.846  64.125  -27.834 1.00 75.77  ? 347  VAL A O    1 
ATOM   5694  C  CB   . VAL A 1 350 ? 52.042  61.930  -26.682 1.00 52.03  ? 347  VAL A CB   1 
ATOM   5695  C  CG1  . VAL A 1 350 ? 50.832  62.872  -26.769 1.00 53.02  ? 347  VAL A CG1  1 
ATOM   5696  C  CG2  . VAL A 1 350 ? 51.585  60.524  -26.397 1.00 57.53  ? 347  VAL A CG2  1 
ATOM   5697  H  H    . VAL A 1 350 ? 54.367  61.147  -26.985 1.00 72.14  ? 347  VAL A H    1 
ATOM   5698  H  HA   . VAL A 1 350 ? 52.365  61.483  -28.661 1.00 72.32  ? 347  VAL A HA   1 
ATOM   5699  H  HB   . VAL A 1 350 ? 52.601  62.222  -25.945 1.00 62.44  ? 347  VAL A HB   1 
ATOM   5700  H  HG11 . VAL A 1 350 ? 50.265  62.589  -27.504 1.00 63.63  ? 347  VAL A HG11 1 
ATOM   5701  H  HG12 . VAL A 1 350 ? 50.339  62.829  -25.935 1.00 63.63  ? 347  VAL A HG12 1 
ATOM   5702  H  HG13 . VAL A 1 350 ? 51.147  63.776  -26.922 1.00 63.63  ? 347  VAL A HG13 1 
ATOM   5703  H  HG21 . VAL A 1 350 ? 52.363  59.953  -26.299 1.00 69.03  ? 347  VAL A HG21 1 
ATOM   5704  H  HG22 . VAL A 1 350 ? 51.067  60.521  -25.577 1.00 69.03  ? 347  VAL A HG22 1 
ATOM   5705  H  HG23 . VAL A 1 350 ? 51.037  60.214  -27.135 1.00 69.03  ? 347  VAL A HG23 1 
ATOM   5706  N  N    . PRO A 1 351 ? 52.340  63.826  -29.479 1.00 81.79  ? 348  PRO A N    1 
ATOM   5707  C  CA   . PRO A 1 351 ? 52.499  65.192  -29.997 1.00 71.43  ? 348  PRO A CA   1 
ATOM   5708  C  C    . PRO A 1 351 ? 52.315  66.289  -28.964 1.00 72.76  ? 348  PRO A C    1 
ATOM   5709  O  O    . PRO A 1 351 ? 51.374  66.241  -28.163 1.00 67.91  ? 348  PRO A O    1 
ATOM   5710  C  CB   . PRO A 1 351 ? 51.382  65.302  -31.044 1.00 68.49  ? 348  PRO A CB   1 
ATOM   5711  C  CG   . PRO A 1 351 ? 51.141  63.907  -31.495 1.00 75.48  ? 348  PRO A CG   1 
ATOM   5712  C  CD   . PRO A 1 351 ? 51.382  63.042  -30.281 1.00 84.49  ? 348  PRO A CD   1 
ATOM   5713  H  HA   . PRO A 1 351 ? 53.361  65.294  -30.430 1.00 85.71  ? 348  PRO A HA   1 
ATOM   5714  H  HB2  . PRO A 1 351 ? 50.584  65.673  -30.634 1.00 82.18  ? 348  PRO A HB2  1 
ATOM   5715  H  HB3  . PRO A 1 351 ? 51.679  65.856  -31.783 1.00 82.18  ? 348  PRO A HB3  1 
ATOM   5716  H  HG2  . PRO A 1 351 ? 50.226  63.817  -31.803 1.00 90.57  ? 348  PRO A HG2  1 
ATOM   5717  H  HG3  . PRO A 1 351 ? 51.764  63.682  -32.204 1.00 90.57  ? 348  PRO A HG3  1 
ATOM   5718  H  HD2  . PRO A 1 351 ? 50.556  62.914  -29.789 1.00 101.39 ? 348  PRO A HD2  1 
ATOM   5719  H  HD3  . PRO A 1 351 ? 51.775  62.195  -30.543 1.00 101.39 ? 348  PRO A HD3  1 
ATOM   5720  N  N    . THR A 1 352 ? 53.220  67.265  -28.993 1.00 74.85  ? 349  THR A N    1 
ATOM   5721  C  CA   . THR A 1 352 ? 53.045  68.503  -28.246 1.00 69.33  ? 349  THR A CA   1 
ATOM   5722  C  C    . THR A 1 352 ? 52.399  69.522  -29.179 1.00 79.54  ? 349  THR A C    1 
ATOM   5723  O  O    . THR A 1 352 ? 52.414  69.353  -30.400 1.00 73.87  ? 349  THR A O    1 
ATOM   5724  C  CB   . THR A 1 352 ? 54.379  69.047  -27.705 1.00 70.66  ? 349  THR A CB   1 
ATOM   5725  O  OG1  . THR A 1 352 ? 55.264  69.329  -28.795 1.00 79.92  ? 349  THR A OG1  1 
ATOM   5726  C  CG2  . THR A 1 352 ? 55.033  68.030  -26.795 1.00 72.78  ? 349  THR A CG2  1 
ATOM   5727  H  H    . THR A 1 352 ? 53.951  67.232  -29.444 1.00 89.82  ? 349  THR A H    1 
ATOM   5728  H  HA   . THR A 1 352 ? 52.449  68.348  -27.497 1.00 83.19  ? 349  THR A HA   1 
ATOM   5729  H  HB   . THR A 1 352 ? 54.218  69.858  -27.198 1.00 84.79  ? 349  THR A HB   1 
ATOM   5730  H  HG1  . THR A 1 352 ? 55.994  69.626  -28.503 1.00 95.91  ? 349  THR A HG1  1 
ATOM   5731  H  HG21 . THR A 1 352 ? 55.206  67.211  -27.284 1.00 87.33  ? 349  THR A HG21 1 
ATOM   5732  H  HG22 . THR A 1 352 ? 55.872  68.379  -26.457 1.00 87.33  ? 349  THR A HG22 1 
ATOM   5733  H  HG23 . THR A 1 352 ? 54.449  67.833  -26.045 1.00 87.33  ? 349  THR A HG23 1 
ATOM   5734  N  N    . ILE A 1 353 ? 51.832  70.571  -28.597 1.00 81.21  ? 350  ILE A N    1 
ATOM   5735  C  CA   . ILE A 1 353 ? 51.157  71.611  -29.361 1.00 71.40  ? 350  ILE A CA   1 
ATOM   5736  C  C    . ILE A 1 353 ? 52.145  72.388  -30.234 1.00 75.99  ? 350  ILE A C    1 
ATOM   5737  O  O    . ILE A 1 353 ? 51.831  72.759  -31.374 1.00 80.76  ? 350  ILE A O    1 
ATOM   5738  C  CB   . ILE A 1 353 ? 50.413  72.570  -28.411 1.00 76.75  ? 350  ILE A CB   1 
ATOM   5739  C  CG1  . ILE A 1 353 ? 49.618  73.608  -29.207 1.00 68.15  ? 350  ILE A CG1  1 
ATOM   5740  C  CG2  . ILE A 1 353 ? 51.407  73.248  -27.449 1.00 72.42  ? 350  ILE A CG2  1 
ATOM   5741  C  CD1  . ILE A 1 353 ? 48.789  74.538  -28.328 1.00 80.98  ? 350  ILE A CD1  1 
ATOM   5742  H  H    . ILE A 1 353 ? 51.824  70.705  -27.748 1.00 97.45  ? 350  ILE A H    1 
ATOM   5743  H  HA   . ILE A 1 353 ? 50.502  71.199  -29.944 1.00 85.68  ? 350  ILE A HA   1 
ATOM   5744  H  HB   . ILE A 1 353 ? 49.788  72.049  -27.883 1.00 92.11  ? 350  ILE A HB   1 
ATOM   5745  H  HG12 . ILE A 1 353 ? 50.237  74.154  -29.718 1.00 81.78  ? 350  ILE A HG12 1 
ATOM   5746  H  HG13 . ILE A 1 353 ? 49.012  73.147  -29.808 1.00 81.78  ? 350  ILE A HG13 1 
ATOM   5747  H  HG21 . ILE A 1 353 ? 52.056  73.749  -27.968 1.00 86.90  ? 350  ILE A HG21 1 
ATOM   5748  H  HG22 . ILE A 1 353 ? 50.919  73.846  -26.861 1.00 86.90  ? 350  ILE A HG22 1 
ATOM   5749  H  HG23 . ILE A 1 353 ? 51.857  72.565  -26.927 1.00 86.90  ? 350  ILE A HG23 1 
ATOM   5750  H  HD11 . ILE A 1 353 ? 49.383  75.015  -27.727 1.00 97.17  ? 350  ILE A HD11 1 
ATOM   5751  H  HD12 . ILE A 1 353 ? 48.314  75.166  -28.894 1.00 97.17  ? 350  ILE A HD12 1 
ATOM   5752  H  HD13 . ILE A 1 353 ? 48.157  74.008  -27.817 1.00 97.17  ? 350  ILE A HD13 1 
ATOM   5753  N  N    . SER A 1 354 ? 53.361  72.571  -29.725 1.00 80.29  ? 351  SER A N    1 
ATOM   5754  C  CA   . SER A 1 354 ? 54.375  73.325  -30.452 1.00 87.78  ? 351  SER A CA   1 
ATOM   5755  C  C    . SER A 1 354 ? 54.803  72.552  -31.693 1.00 75.35  ? 351  SER A C    1 
ATOM   5756  O  O    . SER A 1 354 ? 55.134  73.132  -32.732 1.00 88.23  ? 351  SER A O    1 
ATOM   5757  C  CB   . SER A 1 354 ? 55.586  73.609  -29.557 1.00 80.01  ? 351  SER A CB   1 
ATOM   5758  O  OG   . SER A 1 354 ? 56.442  72.481  -29.487 1.00 78.62  ? 351  SER A OG   1 
ATOM   5759  H  H    . SER A 1 354 ? 53.622  72.269  -28.963 1.00 96.35  ? 351  SER A H    1 
ATOM   5760  H  HA   . SER A 1 354 ? 54.001  74.174  -30.736 1.00 105.33 ? 351  SER A HA   1 
ATOM   5761  H  HB2  . SER A 1 354 ? 56.081  74.358  -29.925 1.00 96.01  ? 351  SER A HB2  1 
ATOM   5762  H  HB3  . SER A 1 354 ? 55.274  73.824  -28.664 1.00 96.01  ? 351  SER A HB3  1 
ATOM   5763  H  HG   . SER A 1 354 ? 57.101  72.651  -28.994 1.00 94.35  ? 351  SER A HG   1 
ATOM   5764  N  N    . PHE A 1 355 ? 54.721  71.234  -31.600 1.00 69.00  ? 352  PHE A N    1 
ATOM   5765  C  CA   . PHE A 1 355 ? 55.145  70.377  -32.686 1.00 79.64  ? 352  PHE A CA   1 
ATOM   5766  C  C    . PHE A 1 355 ? 54.085  70.368  -33.777 1.00 79.56  ? 352  PHE A C    1 
ATOM   5767  O  O    . PHE A 1 355 ? 54.412  70.414  -34.966 1.00 84.35  ? 352  PHE A O    1 
ATOM   5768  C  CB   . PHE A 1 355 ? 55.395  68.961  -32.170 1.00 70.89  ? 352  PHE A CB   1 
ATOM   5769  C  CG   . PHE A 1 355 ? 56.203  68.110  -33.101 1.00 77.32  ? 352  PHE A CG   1 
ATOM   5770  C  CD1  . PHE A 1 355 ? 57.585  68.178  -33.096 1.00 78.53  ? 352  PHE A CD1  1 
ATOM   5771  C  CD2  . PHE A 1 355 ? 55.582  67.241  -33.981 1.00 82.07  ? 352  PHE A CD2  1 
ATOM   5772  C  CE1  . PHE A 1 355 ? 58.337  67.392  -33.950 1.00 90.34  ? 352  PHE A CE1  1 
ATOM   5773  C  CE2  . PHE A 1 355 ? 56.326  66.453  -34.842 1.00 85.49  ? 352  PHE A CE2  1 
ATOM   5774  C  CZ   . PHE A 1 355 ? 57.707  66.529  -34.826 1.00 92.86  ? 352  PHE A CZ   1 
ATOM   5775  H  H    . PHE A 1 355 ? 54.420  70.812  -30.914 1.00 82.80  ? 352  PHE A H    1 
ATOM   5776  H  HA   . PHE A 1 355 ? 55.971  70.717  -33.063 1.00 95.57  ? 352  PHE A HA   1 
ATOM   5777  H  HB2  . PHE A 1 355 ? 55.874  69.016  -31.328 1.00 85.07  ? 352  PHE A HB2  1 
ATOM   5778  H  HB3  . PHE A 1 355 ? 54.541  68.523  -32.034 1.00 85.07  ? 352  PHE A HB3  1 
ATOM   5779  H  HD1  . PHE A 1 355 ? 58.014  68.757  -32.508 1.00 94.24  ? 352  PHE A HD1  1 
ATOM   5780  H  HD2  . PHE A 1 355 ? 54.654  67.187  -33.994 1.00 98.48  ? 352  PHE A HD2  1 
ATOM   5781  H  HE1  . PHE A 1 355 ? 59.265  67.448  -33.937 1.00 108.40 ? 352  PHE A HE1  1 
ATOM   5782  H  HE2  . PHE A 1 355 ? 55.898  65.872  -35.429 1.00 102.59 ? 352  PHE A HE2  1 
ATOM   5783  H  HZ   . PHE A 1 355 ? 58.210  66.000  -35.403 1.00 111.44 ? 352  PHE A HZ   1 
ATOM   5784  N  N    . ILE A 1 356 ? 52.814  70.370  -33.382 1.00 75.76  ? 353  ILE A N    1 
ATOM   5785  C  CA   . ILE A 1 356 ? 51.751  70.265  -34.366 1.00 83.21  ? 353  ILE A CA   1 
ATOM   5786  C  C    . ILE A 1 356 ? 51.446  71.650  -34.928 1.00 90.18  ? 353  ILE A C    1 
ATOM   5787  O  O    . ILE A 1 356 ? 50.849  71.761  -36.004 1.00 85.03  ? 353  ILE A O    1 
ATOM   5788  C  CB   . ILE A 1 356 ? 50.463  69.635  -33.785 1.00 69.51  ? 353  ILE A CB   1 
ATOM   5789  C  CG1  . ILE A 1 356 ? 49.906  70.462  -32.623 1.00 72.59  ? 353  ILE A CG1  1 
ATOM   5790  C  CG2  . ILE A 1 356 ? 50.740  68.212  -33.359 1.00 71.53  ? 353  ILE A CG2  1 
ATOM   5791  C  CD1  . ILE A 1 356 ? 48.506  70.014  -32.141 1.00 65.39  ? 353  ILE A CD1  1 
ATOM   5792  H  H    . ILE A 1 356 ? 52.548  70.430  -32.566 1.00 90.91  ? 353  ILE A H    1 
ATOM   5793  H  HA   . ILE A 1 356 ? 52.054  69.705  -35.098 1.00 99.86  ? 353  ILE A HA   1 
ATOM   5794  H  HB   . ILE A 1 356 ? 49.794  69.614  -34.488 1.00 83.42  ? 353  ILE A HB   1 
ATOM   5795  H  HG12 . ILE A 1 356 ? 50.514  70.390  -31.871 1.00 87.10  ? 353  ILE A HG12 1 
ATOM   5796  H  HG13 . ILE A 1 356 ? 49.839  71.388  -32.904 1.00 87.10  ? 353  ILE A HG13 1 
ATOM   5797  H  HG21 . ILE A 1 356 ? 51.435  68.215  -32.682 1.00 85.84  ? 353  ILE A HG21 1 
ATOM   5798  H  HG22 . ILE A 1 356 ? 49.926  67.827  -32.997 1.00 85.84  ? 353  ILE A HG22 1 
ATOM   5799  H  HG23 . ILE A 1 356 ? 51.032  67.702  -34.131 1.00 85.84  ? 353  ILE A HG23 1 
ATOM   5800  H  HD11 . ILE A 1 356 ? 48.555  69.093  -31.843 1.00 78.46  ? 353  ILE A HD11 1 
ATOM   5801  H  HD12 . ILE A 1 356 ? 48.227  70.585  -31.408 1.00 78.46  ? 353  ILE A HD12 1 
ATOM   5802  H  HD13 . ILE A 1 356 ? 47.879  70.092  -32.877 1.00 78.46  ? 353  ILE A HD13 1 
ATOM   5803  N  N    . CYS A 1 357 ? 51.843  72.706  -34.217 1.00 75.29  ? 354  CYS A N    1 
ATOM   5804  C  CA   . CYS A 1 357 ? 51.774  74.034  -34.823 1.00 85.49  ? 354  CYS A CA   1 
ATOM   5805  C  C    . CYS A 1 357 ? 52.988  74.221  -35.746 1.00 88.59  ? 354  CYS A C    1 
ATOM   5806  O  O    . CYS A 1 357 ? 52.881  74.806  -36.837 1.00 83.82  ? 354  CYS A O    1 
ATOM   5807  C  CB   . CYS A 1 357 ? 51.724  75.120  -33.753 1.00 67.46  ? 354  CYS A CB   1 
ATOM   5808  S  SG   . CYS A 1 357 ? 50.115  75.221  -32.926 1.00 82.09  ? 354  CYS A SG   1 
ATOM   5809  H  H    . CYS A 1 357 ? 52.144  72.684  -33.411 1.00 90.35  ? 354  CYS A H    1 
ATOM   5810  H  HA   . CYS A 1 357 ? 50.970  74.099  -35.361 1.00 102.59 ? 354  CYS A HA   1 
ATOM   5811  H  HB2  . CYS A 1 357 ? 52.396  74.931  -33.079 1.00 80.95  ? 354  CYS A HB2  1 
ATOM   5812  H  HB3  . CYS A 1 357 ? 51.903  75.979  -34.166 1.00 80.95  ? 354  CYS A HB3  1 
ATOM   5813  H  HG   . CYS A 1 357 ? 49.881  74.169  -32.398 1.00 98.51  ? 354  CYS A HG   1 
ATOM   5814  N  N    . ARG A 1 358 ? 54.131  73.679  -35.326 1.00 84.99  ? 355  ARG A N    1 
ATOM   5815  C  CA   . ARG A 1 358 ? 55.306  73.642  -36.190 1.00 90.25  ? 355  ARG A CA   1 
ATOM   5816  C  C    . ARG A 1 358 ? 54.960  72.998  -37.529 1.00 85.25  ? 355  ARG A C    1 
ATOM   5817  O  O    . ARG A 1 358 ? 55.185  73.592  -38.584 1.00 92.48  ? 355  ARG A O    1 
ATOM   5818  C  CB   . ARG A 1 358 ? 56.434  72.871  -35.506 1.00 95.97  ? 355  ARG A CB   1 
ATOM   5819  C  CG   . ARG A 1 358 ? 57.646  72.563  -36.364 1.00 98.95  ? 355  ARG A CG   1 
ATOM   5820  C  CD   . ARG A 1 358 ? 58.589  71.682  -35.563 1.00 122.90 ? 355  ARG A CD   1 
ATOM   5821  N  NE   . ARG A 1 358 ? 59.676  71.110  -36.353 1.00 143.73 ? 355  ARG A NE   1 
ATOM   5822  C  CZ   . ARG A 1 358 ? 60.568  70.249  -35.871 1.00 135.90 ? 355  ARG A CZ   1 
ATOM   5823  N  NH1  . ARG A 1 358 ? 60.496  69.851  -34.605 1.00 113.10 ? 355  ARG A NH1  1 
ATOM   5824  N  NH2  . ARG A 1 358 ? 61.527  69.773  -36.656 1.00 141.38 ? 355  ARG A NH2  1 
ATOM   5825  H  H    . ARG A 1 358 ? 54.250  73.329  -34.550 1.00 101.99 ? 355  ARG A H    1 
ATOM   5826  H  HA   . ARG A 1 358 ? 55.612  74.547  -36.356 1.00 108.29 ? 355  ARG A HA   1 
ATOM   5827  H  HB2  . ARG A 1 358 ? 56.742  73.390  -34.747 1.00 115.17 ? 355  ARG A HB2  1 
ATOM   5828  H  HB3  . ARG A 1 358 ? 56.079  72.024  -35.194 1.00 115.17 ? 355  ARG A HB3  1 
ATOM   5829  H  HG2  . ARG A 1 358 ? 57.372  72.085  -37.162 1.00 118.74 ? 355  ARG A HG2  1 
ATOM   5830  H  HG3  . ARG A 1 358 ? 58.105  73.386  -36.594 1.00 118.74 ? 355  ARG A HG3  1 
ATOM   5831  H  HD2  . ARG A 1 358 ? 58.986  72.212  -34.854 1.00 147.48 ? 355  ARG A HD2  1 
ATOM   5832  H  HD3  . ARG A 1 358 ? 58.083  70.948  -35.181 1.00 147.48 ? 355  ARG A HD3  1 
ATOM   5833  H  HE   . ARG A 1 358 ? 59.685  71.268  -37.199 1.00 172.48 ? 355  ARG A HE   1 
ATOM   5834  H  HH11 . ARG A 1 358 ? 59.876  70.156  -34.094 1.00 135.72 ? 355  ARG A HH11 1 
ATOM   5835  H  HH12 . ARG A 1 358 ? 61.073  69.293  -34.296 1.00 135.72 ? 355  ARG A HH12 1 
ATOM   5836  H  HH21 . ARG A 1 358 ? 61.576  70.026  -37.476 1.00 169.66 ? 355  ARG A HH21 1 
ATOM   5837  H  HH22 . ARG A 1 358 ? 62.101  69.215  -36.343 1.00 169.66 ? 355  ARG A HH22 1 
ATOM   5838  N  N    . GLU A 1 359 ? 54.379  71.799  -37.478 1.00 84.52  ? 356  GLU A N    1 
ATOM   5839  C  CA   . GLU A 1 359 ? 53.982  71.088  -38.697 1.00 90.17  ? 356  GLU A CA   1 
ATOM   5840  C  C    . GLU A 1 359 ? 52.984  71.898  -39.531 1.00 91.87  ? 356  GLU A C    1 
ATOM   5841  O  O    . GLU A 1 359 ? 53.039  71.895  -40.763 1.00 80.85  ? 356  GLU A O    1 
ATOM   5842  C  CB   . GLU A 1 359 ? 53.391  69.716  -38.355 1.00 73.76  ? 356  GLU A CB   1 
ATOM   5843  C  CG   . GLU A 1 359 ? 54.380  68.747  -37.728 1.00 81.41  ? 356  GLU A CG   1 
ATOM   5844  C  CD   . GLU A 1 359 ? 53.748  67.411  -37.354 1.00 84.77  ? 356  GLU A CD   1 
ATOM   5845  O  OE1  . GLU A 1 359 ? 52.556  67.402  -36.977 1.00 85.15  ? 356  GLU A OE1  1 
ATOM   5846  O  OE2  . GLU A 1 359 ? 54.443  66.372  -37.443 1.00 76.02  ? 356  GLU A OE2  1 
ATOM   5847  H  H    . GLU A 1 359 ? 54.204  71.375  -36.750 1.00 101.43 ? 356  GLU A H    1 
ATOM   5848  H  HA   . GLU A 1 359 ? 54.771  70.941  -39.242 1.00 108.20 ? 356  GLU A HA   1 
ATOM   5849  H  HB2  . GLU A 1 359 ? 52.662  69.840  -37.728 1.00 88.52  ? 356  GLU A HB2  1 
ATOM   5850  H  HB3  . GLU A 1 359 ? 53.057  69.310  -39.170 1.00 88.52  ? 356  GLU A HB3  1 
ATOM   5851  H  HG2  . GLU A 1 359 ? 55.095  68.573  -38.360 1.00 97.69  ? 356  GLU A HG2  1 
ATOM   5852  H  HG3  . GLU A 1 359 ? 54.741  69.143  -36.919 1.00 97.69  ? 356  GLU A HG3  1 
ATOM   5853  N  N    . LEU A 1 360 ? 52.079  72.593  -38.854 1.00 83.33  ? 357  LEU A N    1 
ATOM   5854  C  CA   . LEU A 1 360 ? 51.042  73.354  -39.529 1.00 84.82  ? 357  LEU A CA   1 
ATOM   5855  C  C    . LEU A 1 360 ? 51.649  74.539  -40.276 1.00 99.01  ? 357  LEU A C    1 
ATOM   5856  O  O    . LEU A 1 360 ? 51.263  74.823  -41.411 1.00 104.60 ? 357  LEU A O    1 
ATOM   5857  C  CB   . LEU A 1 360 ? 49.998  73.837  -38.520 1.00 86.28  ? 357  LEU A CB   1 
ATOM   5858  C  CG   . LEU A 1 360 ? 48.757  74.532  -39.081 1.00 80.52  ? 357  LEU A CG   1 
ATOM   5859  C  CD1  . LEU A 1 360 ? 47.703  73.526  -39.475 1.00 84.81  ? 357  LEU A CD1  1 
ATOM   5860  C  CD2  . LEU A 1 360 ? 48.199  75.516  -38.064 1.00 92.36  ? 357  LEU A CD2  1 
ATOM   5861  H  H    . LEU A 1 360 ? 52.046  72.640  -37.996 1.00 100.00 ? 357  LEU A H    1 
ATOM   5862  H  HA   . LEU A 1 360 ? 50.598  72.784  -40.175 1.00 101.79 ? 357  LEU A HA   1 
ATOM   5863  H  HB2  . LEU A 1 360 ? 49.691  73.069  -38.014 1.00 103.53 ? 357  LEU A HB2  1 
ATOM   5864  H  HB3  . LEU A 1 360 ? 50.429  74.465  -37.918 1.00 103.53 ? 357  LEU A HB3  1 
ATOM   5865  H  HG   . LEU A 1 360 ? 49.006  75.031  -39.874 1.00 96.62  ? 357  LEU A HG   1 
ATOM   5866  H  HD11 . LEU A 1 360 ? 47.449  73.012  -38.692 1.00 101.77 ? 357  LEU A HD11 1 
ATOM   5867  H  HD12 . LEU A 1 360 ? 46.932  73.998  -39.826 1.00 101.77 ? 357  LEU A HD12 1 
ATOM   5868  H  HD13 . LEU A 1 360 ? 48.068  72.937  -40.154 1.00 101.77 ? 357  LEU A HD13 1 
ATOM   5869  H  HD21 . LEU A 1 360 ? 48.876  76.181  -37.864 1.00 110.83 ? 357  LEU A HD21 1 
ATOM   5870  H  HD22 . LEU A 1 360 ? 47.414  75.945  -38.438 1.00 110.83 ? 357  LEU A HD22 1 
ATOM   5871  H  HD23 . LEU A 1 360 ? 47.960  75.034  -37.257 1.00 110.83 ? 357  LEU A HD23 1 
ATOM   5872  N  N    . ASP A 1 361 ? 52.601  75.225  -39.645 1.00 98.29  ? 358  ASP A N    1 
ATOM   5873  C  CA   . ASP A 1 361 ? 53.255  76.375  -40.279 1.00 94.58  ? 358  ASP A CA   1 
ATOM   5874  C  C    . ASP A 1 361 ? 54.417  75.955  -41.182 1.00 98.38  ? 358  ASP A C    1 
ATOM   5875  O  O    . ASP A 1 361 ? 55.476  76.582  -41.175 1.00 110.57 ? 358  ASP A O    1 
ATOM   5876  C  CB   . ASP A 1 361 ? 53.748  77.362  -39.212 1.00 85.97  ? 358  ASP A CB   1 
ATOM   5877  C  CG   . ASP A 1 361 ? 52.605  78.083  -38.514 1.00 108.85 ? 358  ASP A CG   1 
ATOM   5878  O  OD1  . ASP A 1 361 ? 51.431  77.767  -38.813 1.00 106.91 ? 358  ASP A OD1  1 
ATOM   5879  O  OD2  . ASP A 1 361 ? 52.877  78.962  -37.662 1.00 102.19 ? 358  ASP A OD2  1 
ATOM   5880  H  H    . ASP A 1 361 ? 52.887  75.048  -38.853 1.00 117.94 ? 358  ASP A H    1 
ATOM   5881  H  HA   . ASP A 1 361 ? 52.605  76.837  -40.830 1.00 113.49 ? 358  ASP A HA   1 
ATOM   5882  H  HB2  . ASP A 1 361 ? 54.253  76.876  -38.540 1.00 103.16 ? 358  ASP A HB2  1 
ATOM   5883  H  HB3  . ASP A 1 361 ? 54.312  78.029  -39.634 1.00 103.16 ? 358  ASP A HB3  1 
ATOM   5884  N  N    . ALA A 1 362 ? 54.210  74.904  -41.970 1.00 85.51  ? 359  ALA A N    1 
ATOM   5885  C  CA   . ALA A 1 362 ? 55.236  74.419  -42.887 1.00 90.86  ? 359  ALA A CA   1 
ATOM   5886  C  C    . ALA A 1 362 ? 54.605  73.795  -44.130 1.00 106.57 ? 359  ALA A C    1 
ATOM   5887  O  O    . ALA A 1 362 ? 55.204  72.927  -44.773 1.00 105.91 ? 359  ALA A O    1 
ATOM   5888  C  CB   . ALA A 1 362 ? 56.143  73.408  -42.186 1.00 75.83  ? 359  ALA A CB   1 
ATOM   5889  H  H    . ALA A 1 362 ? 53.479  74.452  -41.993 1.00 102.61 ? 359  ALA A H    1 
ATOM   5890  H  HA   . ALA A 1 362 ? 55.784  75.167  -43.172 1.00 109.03 ? 359  ALA A HA   1 
ATOM   5891  H  HB1  . ALA A 1 362 ? 55.606  72.659  -41.883 1.00 91.00  ? 359  ALA A HB1  1 
ATOM   5892  H  HB2  . ALA A 1 362 ? 56.816  73.100  -42.813 1.00 91.00  ? 359  ALA A HB2  1 
ATOM   5893  H  HB3  . ALA A 1 362 ? 56.569  73.839  -41.428 1.00 91.00  ? 359  ALA A HB3  1 
ATOM   5894  N  N    . ILE A 1 363 ? 53.395  74.236  -44.464 1.00 103.65 ? 360  ILE A N    1 
ATOM   5895  C  CA   . ILE A 1 363 ? 52.691  73.724  -45.633 1.00 104.38 ? 360  ILE A CA   1 
ATOM   5896  C  C    . ILE A 1 363 ? 51.966  74.841  -46.379 1.00 108.64 ? 360  ILE A C    1 
ATOM   5897  O  O    . ILE A 1 363 ? 51.888  74.832  -47.612 1.00 124.18 ? 360  ILE A O    1 
ATOM   5898  C  CB   . ILE A 1 363 ? 51.682  72.626  -45.232 1.00 105.26 ? 360  ILE A CB   1 
ATOM   5899  C  CG1  . ILE A 1 363 ? 50.592  73.202  -44.324 1.00 107.40 ? 360  ILE A CG1  1 
ATOM   5900  C  CG2  . ILE A 1 363 ? 52.411  71.463  -44.543 1.00 99.80  ? 360  ILE A CG2  1 
ATOM   5901  C  CD1  . ILE A 1 363 ? 49.540  72.192  -43.887 1.00 101.04 ? 360  ILE A CD1  1 
ATOM   5902  H  H    . ILE A 1 363 ? 52.959  74.835  -44.027 1.00 124.38 ? 360  ILE A H    1 
ATOM   5903  H  HA   . ILE A 1 363 ? 53.336  73.329  -46.240 1.00 125.25 ? 360  ILE A HA   1 
ATOM   5904  H  HB   . ILE A 1 363 ? 51.261  72.288  -46.038 1.00 126.32 ? 360  ILE A HB   1 
ATOM   5905  H  HG12 . ILE A 1 363 ? 51.011  73.557  -43.524 1.00 128.88 ? 360  ILE A HG12 1 
ATOM   5906  H  HG13 . ILE A 1 363 ? 50.137  73.915  -44.798 1.00 128.88 ? 360  ILE A HG13 1 
ATOM   5907  H  HG21 . ILE A 1 363 ? 52.856  71.796  -43.749 1.00 119.76 ? 360  ILE A HG21 1 
ATOM   5908  H  HG22 . ILE A 1 363 ? 51.763  70.784  -44.299 1.00 119.76 ? 360  ILE A HG22 1 
ATOM   5909  H  HG23 . ILE A 1 363 ? 53.064  71.092  -45.158 1.00 119.76 ? 360  ILE A HG23 1 
ATOM   5910  H  HD11 . ILE A 1 363 ? 49.975  71.476  -43.397 1.00 121.25 ? 360  ILE A HD11 1 
ATOM   5911  H  HD12 . ILE A 1 363 ? 48.893  72.637  -43.318 1.00 121.25 ? 360  ILE A HD12 1 
ATOM   5912  H  HD13 . ILE A 1 363 ? 49.100  71.835  -44.674 1.00 121.25 ? 360  ILE A HD13 1 
ATOM   5913  N  N    . ARG A 1 382 ? 40.918  72.852  -45.936 1.00 110.74 ? 379  ARG A N    1 
ATOM   5914  C  CA   . ARG A 1 382 ? 40.690  73.624  -44.719 1.00 123.78 ? 379  ARG A CA   1 
ATOM   5915  C  C    . ARG A 1 382 ? 40.348  72.712  -43.538 1.00 119.74 ? 379  ARG A C    1 
ATOM   5916  O  O    . ARG A 1 382 ? 40.936  72.827  -42.464 1.00 108.20 ? 379  ARG A O    1 
ATOM   5917  C  CB   . ARG A 1 382 ? 39.567  74.641  -44.941 1.00 131.95 ? 379  ARG A CB   1 
ATOM   5918  C  CG   . ARG A 1 382 ? 39.331  75.570  -43.757 1.00 135.10 ? 379  ARG A CG   1 
ATOM   5919  C  CD   . ARG A 1 382 ? 38.491  76.786  -44.141 1.00 145.63 ? 379  ARG A CD   1 
ATOM   5920  N  NE   . ARG A 1 382 ? 37.050  76.533  -44.076 1.00 145.98 ? 379  ARG A NE   1 
ATOM   5921  C  CZ   . ARG A 1 382 ? 36.272  76.240  -45.117 1.00 127.18 ? 379  ARG A CZ   1 
ATOM   5922  N  NH1  . ARG A 1 382 ? 36.775  76.150  -46.342 1.00 123.92 ? 379  ARG A NH1  1 
ATOM   5923  N  NH2  . ARG A 1 382 ? 34.975  76.035  -44.925 1.00 105.63 ? 379  ARG A NH2  1 
ATOM   5924  H  HA   . ARG A 1 382 ? 41.499  74.112  -44.497 1.00 148.54 ? 379  ARG A HA   1 
ATOM   5925  H  HB2  . ARG A 1 382 ? 39.791  75.190  -45.708 1.00 158.34 ? 379  ARG A HB2  1 
ATOM   5926  H  HB3  . ARG A 1 382 ? 38.741  74.161  -45.110 1.00 158.34 ? 379  ARG A HB3  1 
ATOM   5927  H  HG2  . ARG A 1 382 ? 38.860  75.085  -43.061 1.00 162.13 ? 379  ARG A HG2  1 
ATOM   5928  H  HG3  . ARG A 1 382 ? 40.186  75.885  -43.425 1.00 162.13 ? 379  ARG A HG3  1 
ATOM   5929  H  HD2  . ARG A 1 382 ? 38.694  77.514  -43.532 1.00 174.76 ? 379  ARG A HD2  1 
ATOM   5930  H  HD3  . ARG A 1 382 ? 38.709  77.045  -45.050 1.00 174.76 ? 379  ARG A HD3  1 
ATOM   5931  H  HE   . ARG A 1 382 ? 36.676  76.578  -43.304 1.00 175.18 ? 379  ARG A HE   1 
ATOM   5932  H  HH11 . ARG A 1 382 ? 37.614  76.283  -46.474 1.00 148.70 ? 379  ARG A HH11 1 
ATOM   5933  H  HH12 . ARG A 1 382 ? 36.261  75.960  -47.005 1.00 148.70 ? 379  ARG A HH12 1 
ATOM   5934  H  HH21 . ARG A 1 382 ? 34.643  76.091  -44.134 1.00 126.75 ? 379  ARG A HH21 1 
ATOM   5935  H  HH22 . ARG A 1 382 ? 34.467  75.844  -45.592 1.00 126.75 ? 379  ARG A HH22 1 
ATOM   5936  N  N    . THR A 1 383 ? 39.399  71.804  -43.756 1.00 128.21 ? 380  THR A N    1 
ATOM   5937  C  CA   . THR A 1 383 ? 38.917  70.897  -42.714 1.00 113.89 ? 380  THR A CA   1 
ATOM   5938  C  C    . THR A 1 383 ? 39.822  69.683  -42.524 1.00 103.99 ? 380  THR A C    1 
ATOM   5939  O  O    . THR A 1 383 ? 39.493  68.774  -41.760 1.00 102.09 ? 380  THR A O    1 
ATOM   5940  C  CB   . THR A 1 383 ? 37.496  70.378  -43.038 1.00 116.56 ? 380  THR A CB   1 
ATOM   5941  O  OG1  . THR A 1 383 ? 37.557  69.457  -44.137 1.00 100.18 ? 380  THR A OG1  1 
ATOM   5942  C  CG2  . THR A 1 383 ? 36.558  71.531  -43.384 1.00 119.10 ? 380  THR A CG2  1 
ATOM   5943  H  H    . THR A 1 383 ? 39.011  71.691  -44.515 1.00 153.85 ? 380  THR A H    1 
ATOM   5944  H  HA   . THR A 1 383 ? 38.877  71.376  -41.872 1.00 136.67 ? 380  THR A HA   1 
ATOM   5945  H  HB   . THR A 1 383 ? 37.139  69.921  -42.260 1.00 139.87 ? 380  THR A HB   1 
ATOM   5946  H  HG1  . THR A 1 383 ? 36.787  69.173  -44.317 1.00 120.22 ? 380  THR A HG1  1 
ATOM   5947  H  HG21 . THR A 1 383 ? 36.893  72.010  -44.158 1.00 142.92 ? 380  THR A HG21 1 
ATOM   5948  H  HG22 . THR A 1 383 ? 35.672  71.189  -43.585 1.00 142.92 ? 380  THR A HG22 1 
ATOM   5949  H  HG23 . THR A 1 383 ? 36.497  72.144  -42.636 1.00 142.92 ? 380  THR A HG23 1 
ATOM   5950  N  N    . ARG A 1 384 ? 40.954  69.670  -43.222 1.00 101.14 ? 381  ARG A N    1 
ATOM   5951  C  CA   . ARG A 1 384 ? 41.825  68.499  -43.264 1.00 98.69  ? 381  ARG A CA   1 
ATOM   5952  C  C    . ARG A 1 384 ? 43.267  68.843  -42.894 1.00 99.29  ? 381  ARG A C    1 
ATOM   5953  O  O    . ARG A 1 384 ? 44.179  68.052  -43.134 1.00 89.65  ? 381  ARG A O    1 
ATOM   5954  C  CB   . ARG A 1 384 ? 41.784  67.873  -44.658 1.00 96.00  ? 381  ARG A CB   1 
ATOM   5955  C  CG   . ARG A 1 384 ? 40.404  67.398  -45.093 1.00 100.32 ? 381  ARG A CG   1 
ATOM   5956  C  CD   . ARG A 1 384 ? 40.437  66.895  -46.529 1.00 107.33 ? 381  ARG A CD   1 
ATOM   5957  N  NE   . ARG A 1 384 ? 40.976  67.914  -47.433 1.00 110.04 ? 381  ARG A NE   1 
ATOM   5958  C  CZ   . ARG A 1 384 ? 40.249  68.737  -48.186 1.00 98.49  ? 381  ARG A CZ   1 
ATOM   5959  N  NH1  . ARG A 1 384 ? 38.922  68.669  -48.185 1.00 87.52  ? 381  ARG A NH1  1 
ATOM   5960  N  NH2  . ARG A 1 384 ? 40.861  69.633  -48.954 1.00 80.11  ? 381  ARG A NH2  1 
ATOM   5961  H  H    . ARG A 1 384 ? 41.243  70.335  -43.685 1.00 121.37 ? 381  ARG A H    1 
ATOM   5962  H  HA   . ARG A 1 384 ? 41.501  67.841  -42.630 1.00 118.43 ? 381  ARG A HA   1 
ATOM   5963  H  HB2  . ARG A 1 384 ? 42.086  68.531  -45.304 1.00 115.20 ? 381  ARG A HB2  1 
ATOM   5964  H  HB3  . ARG A 1 384 ? 42.377  67.105  -44.672 1.00 115.20 ? 381  ARG A HB3  1 
ATOM   5965  H  HG2  . ARG A 1 384 ? 40.117  66.670  -44.520 1.00 120.38 ? 381  ARG A HG2  1 
ATOM   5966  H  HG3  . ARG A 1 384 ? 39.777  68.137  -45.041 1.00 120.38 ? 381  ARG A HG3  1 
ATOM   5967  H  HD2  . ARG A 1 384 ? 41.004  66.110  -46.582 1.00 128.80 ? 381  ARG A HD2  1 
ATOM   5968  H  HD3  . ARG A 1 384 ? 39.535  66.680  -46.815 1.00 128.80 ? 381  ARG A HD3  1 
ATOM   5969  H  HE   . ARG A 1 384 ? 41.831  67.987  -47.480 1.00 132.05 ? 381  ARG A HE   1 
ATOM   5970  H  HH11 . ARG A 1 384 ? 38.521  68.094  -47.687 1.00 105.03 ? 381  ARG A HH11 1 
ATOM   5971  H  HH12 . ARG A 1 384 ? 38.463  69.204  -48.679 1.00 105.03 ? 381  ARG A HH12 1 
ATOM   5972  H  HH21 . ARG A 1 384 ? 41.720  69.678  -48.962 1.00 96.13  ? 381  ARG A HH21 1 
ATOM   5973  H  HH22 . ARG A 1 384 ? 40.398  70.162  -49.450 1.00 96.13  ? 381  ARG A HH22 1 
ATOM   5974  N  N    . ASP A 1 385 ? 43.473  70.019  -42.309 1.00 100.41 ? 382  ASP A N    1 
ATOM   5975  C  CA   . ASP A 1 385 ? 44.817  70.460  -41.957 1.00 88.63  ? 382  ASP A CA   1 
ATOM   5976  C  C    . ASP A 1 385 ? 45.429  69.551  -40.895 1.00 91.75  ? 382  ASP A C    1 
ATOM   5977  O  O    . ASP A 1 385 ? 46.620  69.238  -40.947 1.00 92.33  ? 382  ASP A O    1 
ATOM   5978  C  CB   . ASP A 1 385 ? 44.800  71.910  -41.457 1.00 98.73  ? 382  ASP A CB   1 
ATOM   5979  C  CG   . ASP A 1 385 ? 44.939  72.929  -42.580 1.00 104.66 ? 382  ASP A CG   1 
ATOM   5980  O  OD1  . ASP A 1 385 ? 45.704  72.681  -43.540 1.00 108.30 ? 382  ASP A OD1  1 
ATOM   5981  O  OD2  . ASP A 1 385 ? 44.286  73.991  -42.494 1.00 107.85 ? 382  ASP A OD2  1 
ATOM   5982  H  H    . ASP A 1 385 ? 42.852  70.578  -42.106 1.00 120.49 ? 382  ASP A H    1 
ATOM   5983  H  HA   . ASP A 1 385 ? 45.379  70.421  -42.746 1.00 106.35 ? 382  ASP A HA   1 
ATOM   5984  H  HB2  . ASP A 1 385 ? 43.958  72.078  -41.004 1.00 118.48 ? 382  ASP A HB2  1 
ATOM   5985  H  HB3  . ASP A 1 385 ? 45.538  72.040  -40.842 1.00 118.48 ? 382  ASP A HB3  1 
ATOM   5986  N  N    . TYR A 1 386 ? 44.614  69.118  -39.936 1.00 93.45  ? 383  TYR A N    1 
ATOM   5987  C  CA   . TYR A 1 386 ? 45.122  68.305  -38.835 1.00 83.29  ? 383  TYR A CA   1 
ATOM   5988  C  C    . TYR A 1 386 ? 45.572  66.938  -39.339 1.00 77.52  ? 383  TYR A C    1 
ATOM   5989  O  O    . TYR A 1 386 ? 46.417  66.297  -38.722 1.00 76.64  ? 383  TYR A O    1 
ATOM   5990  C  CB   . TYR A 1 386 ? 44.063  68.144  -37.736 1.00 77.73  ? 383  TYR A CB   1 
ATOM   5991  C  CG   . TYR A 1 386 ? 42.901  67.264  -38.135 1.00 77.73  ? 383  TYR A CG   1 
ATOM   5992  C  CD1  . TYR A 1 386 ? 43.001  65.880  -38.081 1.00 77.05  ? 383  TYR A CD1  1 
ATOM   5993  C  CD2  . TYR A 1 386 ? 41.705  67.814  -38.569 1.00 87.31  ? 383  TYR A CD2  1 
ATOM   5994  C  CE1  . TYR A 1 386 ? 41.949  65.070  -38.453 1.00 87.50  ? 383  TYR A CE1  1 
ATOM   5995  C  CE2  . TYR A 1 386 ? 40.641  67.009  -38.941 1.00 93.01  ? 383  TYR A CE2  1 
ATOM   5996  C  CZ   . TYR A 1 386 ? 40.771  65.636  -38.882 1.00 88.18  ? 383  TYR A CZ   1 
ATOM   5997  O  OH   . TYR A 1 386 ? 39.730  64.815  -39.248 1.00 78.10  ? 383  TYR A OH   1 
ATOM   5998  H  H    . TYR A 1 386 ? 43.770  69.280  -39.900 1.00 112.14 ? 383  TYR A H    1 
ATOM   5999  H  HA   . TYR A 1 386 ? 45.891  68.749  -38.445 1.00 99.95  ? 383  TYR A HA   1 
ATOM   6000  H  HB2  . TYR A 1 386 ? 44.481  67.747  -36.955 1.00 93.27  ? 383  TYR A HB2  1 
ATOM   6001  H  HB3  . TYR A 1 386 ? 43.710  69.018  -37.511 1.00 93.27  ? 383  TYR A HB3  1 
ATOM   6002  H  HD1  . TYR A 1 386 ? 43.797  65.491  -37.796 1.00 92.46  ? 383  TYR A HD1  1 
ATOM   6003  H  HD2  . TYR A 1 386 ? 41.616  68.739  -38.613 1.00 104.78 ? 383  TYR A HD2  1 
ATOM   6004  H  HE1  . TYR A 1 386 ? 42.034  64.145  -38.412 1.00 105.00 ? 383  TYR A HE1  1 
ATOM   6005  H  HE2  . TYR A 1 386 ? 39.845  67.391  -39.232 1.00 111.62 ? 383  TYR A HE2  1 
ATOM   6006  H  HH   . TYR A 1 386 ? 39.954  64.010  -39.159 1.00 93.72  ? 383  TYR A HH   1 
ATOM   6007  N  N    . LYS A 1 387 ? 45.007  66.488  -40.455 1.00 82.36  ? 384  LYS A N    1 
ATOM   6008  C  CA   . LYS A 1 387 ? 45.405  65.210  -41.033 1.00 71.14  ? 384  LYS A CA   1 
ATOM   6009  C  C    . LYS A 1 387 ? 46.852  65.278  -41.496 1.00 69.75  ? 384  LYS A C    1 
ATOM   6010  O  O    . LYS A 1 387 ? 47.520  64.255  -41.632 1.00 70.28  ? 384  LYS A O    1 
ATOM   6011  C  CB   . LYS A 1 387 ? 44.492  64.825  -42.196 1.00 81.10  ? 384  LYS A CB   1 
ATOM   6012  C  CG   . LYS A 1 387 ? 43.159  64.250  -41.767 1.00 82.12  ? 384  LYS A CG   1 
ATOM   6013  C  CD   . LYS A 1 387 ? 42.458  63.564  -42.927 1.00 86.73  ? 384  LYS A CD   1 
ATOM   6014  C  CE   . LYS A 1 387 ? 41.221  62.813  -42.468 1.00 84.01  ? 384  LYS A CE   1 
ATOM   6015  N  NZ   . LYS A 1 387 ? 40.527  62.138  -43.602 1.00 90.89  ? 384  LYS A NZ   1 
ATOM   6016  H  H    . LYS A 1 387 ? 44.395  66.901  -40.894 1.00 98.83  ? 384  LYS A H    1 
ATOM   6017  H  HA   . LYS A 1 387 ? 45.337  64.520  -40.355 1.00 85.37  ? 384  LYS A HA   1 
ATOM   6018  H  HB2  . LYS A 1 387 ? 44.316  65.616  -42.729 1.00 97.32  ? 384  LYS A HB2  1 
ATOM   6019  H  HB3  . LYS A 1 387 ? 44.942  64.158  -42.738 1.00 97.32  ? 384  LYS A HB3  1 
ATOM   6020  H  HG2  . LYS A 1 387 ? 43.302  63.595  -41.067 1.00 98.55  ? 384  LYS A HG2  1 
ATOM   6021  H  HG3  . LYS A 1 387 ? 42.588  64.966  -41.447 1.00 98.55  ? 384  LYS A HG3  1 
ATOM   6022  H  HD2  . LYS A 1 387 ? 42.185  64.232  -43.575 1.00 104.07 ? 384  LYS A HD2  1 
ATOM   6023  H  HD3  . LYS A 1 387 ? 43.066  62.928  -43.336 1.00 104.07 ? 384  LYS A HD3  1 
ATOM   6024  H  HE2  . LYS A 1 387 ? 41.480  62.134  -41.825 1.00 100.81 ? 384  LYS A HE2  1 
ATOM   6025  H  HE3  . LYS A 1 387 ? 40.600  63.438  -42.062 1.00 100.81 ? 384  LYS A HE3  1 
ATOM   6026  H  HZ1  . LYS A 1 387 ? 41.075  61.554  -43.990 1.00 109.06 ? 384  LYS A HZ1  1 
ATOM   6027  H  HZ2  . LYS A 1 387 ? 39.807  61.707  -43.305 1.00 109.06 ? 384  LYS A HZ2  1 
ATOM   6028  H  HZ3  . LYS A 1 387 ? 40.274  62.742  -44.206 1.00 109.06 ? 384  LYS A HZ3  1 
ATOM   6029  N  N    . LYS A 1 388 ? 47.334  66.494  -41.728 1.00 76.81  ? 385  LYS A N    1 
ATOM   6030  C  CA   . LYS A 1 388 ? 48.690  66.698  -42.218 1.00 83.66  ? 385  LYS A CA   1 
ATOM   6031  C  C    . LYS A 1 388 ? 49.663  66.772  -41.056 1.00 79.74  ? 385  LYS A C    1 
ATOM   6032  O  O    . LYS A 1 388 ? 50.877  66.780  -41.253 1.00 89.59  ? 385  LYS A O    1 
ATOM   6033  C  CB   . LYS A 1 388 ? 48.771  67.974  -43.058 1.00 98.27  ? 385  LYS A CB   1 
ATOM   6034  C  CG   . LYS A 1 388 ? 47.827  67.987  -44.252 1.00 85.39  ? 385  LYS A CG   1 
ATOM   6035  C  CD   . LYS A 1 388 ? 47.858  69.320  -44.973 1.00 90.28  ? 385  LYS A CD   1 
ATOM   6036  C  CE   . LYS A 1 388 ? 46.903  69.324  -46.155 1.00 89.14  ? 385  LYS A CE   1 
ATOM   6037  N  NZ   . LYS A 1 388 ? 46.967  70.604  -46.905 1.00 83.60  ? 385  LYS A NZ   1 
ATOM   6038  H  H    . LYS A 1 388 ? 46.891  67.221  -41.609 1.00 92.17  ? 385  LYS A H    1 
ATOM   6039  H  HA   . LYS A 1 388 ? 48.944  65.949  -42.779 1.00 100.39 ? 385  LYS A HA   1 
ATOM   6040  H  HB2  . LYS A 1 388 ? 48.549  68.733  -42.496 1.00 117.93 ? 385  LYS A HB2  1 
ATOM   6041  H  HB3  . LYS A 1 388 ? 49.676  68.069  -43.395 1.00 117.93 ? 385  LYS A HB3  1 
ATOM   6042  H  HG2  . LYS A 1 388 ? 48.095  67.297  -44.879 1.00 102.47 ? 385  LYS A HG2  1 
ATOM   6043  H  HG3  . LYS A 1 388 ? 46.921  67.829  -43.945 1.00 102.47 ? 385  LYS A HG3  1 
ATOM   6044  H  HD2  . LYS A 1 388 ? 47.588  70.022  -44.360 1.00 108.33 ? 385  LYS A HD2  1 
ATOM   6045  H  HD3  . LYS A 1 388 ? 48.754  69.486  -45.304 1.00 108.33 ? 385  LYS A HD3  1 
ATOM   6046  H  HE2  . LYS A 1 388 ? 47.141  68.605  -46.761 1.00 106.97 ? 385  LYS A HE2  1 
ATOM   6047  H  HE3  . LYS A 1 388 ? 45.996  69.205  -45.834 1.00 106.97 ? 385  LYS A HE3  1 
ATOM   6048  H  HZ1  . LYS A 1 388 ? 47.791  70.734  -47.214 1.00 100.32 ? 385  LYS A HZ1  1 
ATOM   6049  H  HZ2  . LYS A 1 388 ? 46.400  70.582  -47.591 1.00 100.32 ? 385  LYS A HZ2  1 
ATOM   6050  H  HZ3  . LYS A 1 388 ? 46.748  71.280  -46.370 1.00 100.32 ? 385  LYS A HZ3  1 
ATOM   6051  N  N    . THR A 1 389 ? 49.115  66.829  -39.845 1.00 89.00  ? 386  THR A N    1 
ATOM   6052  C  CA   . THR A 1 389 ? 49.915  66.843  -38.623 1.00 77.15  ? 386  THR A CA   1 
ATOM   6053  C  C    . THR A 1 389 ? 50.073  65.436  -38.064 1.00 74.67  ? 386  THR A C    1 
ATOM   6054  O  O    . THR A 1 389 ? 49.448  64.488  -38.541 1.00 76.62  ? 386  THR A O    1 
ATOM   6055  C  CB   . THR A 1 389 ? 49.282  67.717  -37.530 1.00 72.97  ? 386  THR A CB   1 
ATOM   6056  O  OG1  . THR A 1 389 ? 47.983  67.214  -37.210 1.00 80.77  ? 386  THR A OG1  1 
ATOM   6057  C  CG2  . THR A 1 389 ? 49.167  69.166  -37.983 1.00 76.28  ? 386  THR A CG2  1 
ATOM   6058  H  H    . THR A 1 389 ? 48.267  66.862  -39.702 1.00 106.80 ? 386  THR A H    1 
ATOM   6059  H  HA   . THR A 1 389 ? 50.798  67.193  -38.821 1.00 92.58  ? 386  THR A HA   1 
ATOM   6060  H  HB   . THR A 1 389 ? 49.839  67.691  -36.737 1.00 87.56  ? 386  THR A HB   1 
ATOM   6061  H  HG1  . THR A 1 389 ? 47.493  67.227  -37.892 1.00 96.93  ? 386  THR A HG1  1 
ATOM   6062  H  HG21 . THR A 1 389 ? 48.614  69.222  -38.778 1.00 91.54  ? 386  THR A HG21 1 
ATOM   6063  H  HG22 . THR A 1 389 ? 48.766  69.702  -37.281 1.00 91.54  ? 386  THR A HG22 1 
ATOM   6064  H  HG23 . THR A 1 389 ? 50.047  69.520  -38.186 1.00 91.54  ? 386  THR A HG23 1 
ATOM   6065  N  N    . SER A 1 390 ? 50.869  65.326  -37.007 1.00 86.40  ? 387  SER A N    1 
ATOM   6066  C  CA   . SER A 1 390 ? 51.058  64.064  -36.293 1.00 91.28  ? 387  SER A CA   1 
ATOM   6067  C  C    . SER A 1 390 ? 49.866  63.765  -35.371 1.00 88.08  ? 387  SER A C    1 
ATOM   6068  O  O    . SER A 1 390 ? 49.817  62.727  -34.711 1.00 79.33  ? 387  SER A O    1 
ATOM   6069  C  CB   . SER A 1 390 ? 52.358  64.096  -35.502 1.00 74.10  ? 387  SER A CB   1 
ATOM   6070  O  OG   . SER A 1 390 ? 53.462  63.943  -36.371 1.00 85.59  ? 387  SER A OG   1 
ATOM   6071  H  H    . SER A 1 390 ? 51.321  65.979  -36.676 1.00 103.68 ? 387  SER A H    1 
ATOM   6072  H  HA   . SER A 1 390 ? 51.121  63.344  -36.940 1.00 109.54 ? 387  SER A HA   1 
ATOM   6073  H  HB2  . SER A 1 390 ? 52.430  64.948  -35.044 1.00 88.93  ? 387  SER A HB2  1 
ATOM   6074  H  HB3  . SER A 1 390 ? 52.356  63.370  -34.859 1.00 88.93  ? 387  SER A HB3  1 
ATOM   6075  H  HG   . SER A 1 390 ? 53.472  64.565  -36.935 1.00 102.71 ? 387  SER A HG   1 
ATOM   6076  N  N    . LEU A 1 391 ? 48.902  64.681  -35.360 1.00 79.48  ? 388  LEU A N    1 
ATOM   6077  C  CA   . LEU A 1 391 ? 47.677  64.529  -34.593 1.00 67.21  ? 388  LEU A CA   1 
ATOM   6078  C  C    . LEU A 1 391 ? 46.681  63.567  -35.259 1.00 78.65  ? 388  LEU A C    1 
ATOM   6079  O  O    . LEU A 1 391 ? 45.752  63.079  -34.605 1.00 72.14  ? 388  LEU A O    1 
ATOM   6080  C  CB   . LEU A 1 391 ? 47.025  65.904  -34.426 1.00 60.33  ? 388  LEU A CB   1 
ATOM   6081  C  CG   . LEU A 1 391 ? 45.886  66.065  -33.423 1.00 74.41  ? 388  LEU A CG   1 
ATOM   6082  C  CD1  . LEU A 1 391 ? 46.359  65.815  -31.997 1.00 72.33  ? 388  LEU A CD1  1 
ATOM   6083  C  CD2  . LEU A 1 391 ? 45.283  67.460  -33.543 1.00 66.76  ? 388  LEU A CD2  1 
ATOM   6084  H  H    . LEU A 1 391 ? 48.938  65.417  -35.803 1.00 95.38  ? 388  LEU A H    1 
ATOM   6085  H  HA   . LEU A 1 391 ? 47.891  64.184  -33.712 1.00 80.65  ? 388  LEU A HA   1 
ATOM   6086  H  HB2  . LEU A 1 391 ? 47.719  66.529  -34.162 1.00 72.40  ? 388  LEU A HB2  1 
ATOM   6087  H  HB3  . LEU A 1 391 ? 46.675  66.171  -35.290 1.00 72.40  ? 388  LEU A HB3  1 
ATOM   6088  H  HG   . LEU A 1 391 ? 45.191  65.420  -33.627 1.00 89.29  ? 388  LEU A HG   1 
ATOM   6089  H  HD11 . LEU A 1 391 ? 47.057  66.452  -31.780 1.00 86.80  ? 388  LEU A HD11 1 
ATOM   6090  H  HD12 . LEU A 1 391 ? 45.609  65.927  -31.392 1.00 86.80  ? 388  LEU A HD12 1 
ATOM   6091  H  HD13 . LEU A 1 391 ? 46.704  64.911  -31.934 1.00 86.80  ? 388  LEU A HD13 1 
ATOM   6092  H  HD21 . LEU A 1 391 ? 44.942  67.580  -34.443 1.00 80.11  ? 388  LEU A HD21 1 
ATOM   6093  H  HD22 . LEU A 1 391 ? 44.562  67.548  -32.901 1.00 80.11  ? 388  LEU A HD22 1 
ATOM   6094  H  HD23 . LEU A 1 391 ? 45.972  68.118  -33.359 1.00 80.11  ? 388  LEU A HD23 1 
ATOM   6095  N  N    . ALA A 1 392 ? 46.897  63.265  -36.540 1.00 83.61  ? 389  ALA A N    1 
ATOM   6096  C  CA   . ALA A 1 392 ? 45.892  62.567  -37.351 1.00 78.44  ? 389  ALA A CA   1 
ATOM   6097  C  C    . ALA A 1 392 ? 45.495  61.161  -36.856 1.00 76.78  ? 389  ALA A C    1 
ATOM   6098  O  O    . ALA A 1 392 ? 44.297  60.877  -36.703 1.00 64.92  ? 389  ALA A O    1 
ATOM   6099  C  CB   . ALA A 1 392 ? 46.393  62.478  -38.781 1.00 76.89  ? 389  ALA A CB   1 
ATOM   6100  H  H    . ALA A 1 392 ? 47.620  63.454  -36.966 1.00 100.33 ? 389  ALA A H    1 
ATOM   6101  H  HA   . ALA A 1 392 ? 45.085  63.105  -37.361 1.00 94.13  ? 389  ALA A HA   1 
ATOM   6102  H  HB1  . ALA A 1 392 ? 47.229  61.987  -38.792 1.00 92.27  ? 389  ALA A HB1  1 
ATOM   6103  H  HB2  . ALA A 1 392 ? 45.731  62.017  -39.319 1.00 92.27  ? 389  ALA A HB2  1 
ATOM   6104  H  HB3  . ALA A 1 392 ? 46.531  63.375  -39.123 1.00 92.27  ? 389  ALA A HB3  1 
ATOM   6105  N  N    . PRO A 1 393 ? 46.484  60.284  -36.580 1.00 75.11  ? 390  PRO A N    1 
ATOM   6106  C  CA   . PRO A 1 393 ? 46.118  58.911  -36.191 1.00 75.70  ? 390  PRO A CA   1 
ATOM   6107  C  C    . PRO A 1 393 ? 45.298  58.828  -34.895 1.00 70.96  ? 390  PRO A C    1 
ATOM   6108  O  O    . PRO A 1 393 ? 44.465  57.914  -34.735 1.00 72.94  ? 390  PRO A O    1 
ATOM   6109  C  CB   . PRO A 1 393 ? 47.481  58.217  -36.028 1.00 77.06  ? 390  PRO A CB   1 
ATOM   6110  C  CG   . PRO A 1 393 ? 48.475  59.317  -35.885 1.00 74.75  ? 390  PRO A CG   1 
ATOM   6111  C  CD   . PRO A 1 393 ? 47.942  60.452  -36.697 1.00 74.50  ? 390  PRO A CD   1 
ATOM   6112  H  HA   . PRO A 1 393 ? 45.626  58.481  -36.908 1.00 90.84  ? 390  PRO A HA   1 
ATOM   6113  H  HB2  . PRO A 1 393 ? 47.470  57.661  -35.233 1.00 92.48  ? 390  PRO A HB2  1 
ATOM   6114  H  HB3  . PRO A 1 393 ? 47.672  57.684  -36.815 1.00 92.48  ? 390  PRO A HB3  1 
ATOM   6115  H  HG2  . PRO A 1 393 ? 48.548  59.570  -34.951 1.00 89.70  ? 390  PRO A HG2  1 
ATOM   6116  H  HG3  . PRO A 1 393 ? 49.334  59.025  -36.228 1.00 89.70  ? 390  PRO A HG3  1 
ATOM   6117  H  HD2  . PRO A 1 393 ? 48.218  61.300  -36.318 1.00 89.40  ? 390  PRO A HD2  1 
ATOM   6118  H  HD3  . PRO A 1 393 ? 48.220  60.367  -37.623 1.00 89.40  ? 390  PRO A HD3  1 
ATOM   6119  N  N    . TYR A 1 394 ? 45.439  59.835  -34.035 1.00 64.86  ? 391  TYR A N    1 
ATOM   6120  C  CA   . TYR A 1 394 ? 44.716  59.835  -32.768 1.00 68.74  ? 391  TYR A CA   1 
ATOM   6121  C  C    . TYR A 1 394 ? 43.283  60.282  -33.037 1.00 64.05  ? 391  TYR A C    1 
ATOM   6122  O  O    . TYR A 1 394 ? 42.310  59.781  -32.432 1.00 56.50  ? 391  TYR A O    1 
ATOM   6123  C  CB   . TYR A 1 394 ? 45.404  60.751  -31.755 1.00 68.95  ? 391  TYR A CB   1 
ATOM   6124  C  CG   . TYR A 1 394 ? 46.871  60.420  -31.531 1.00 63.52  ? 391  TYR A CG   1 
ATOM   6125  C  CD1  . TYR A 1 394 ? 47.255  59.246  -30.903 1.00 64.32  ? 391  TYR A CD1  1 
ATOM   6126  C  CD2  . TYR A 1 394 ? 47.870  61.291  -31.945 1.00 68.79  ? 391  TYR A CD2  1 
ATOM   6127  C  CE1  . TYR A 1 394 ? 48.595  58.944  -30.699 1.00 72.16  ? 391  TYR A CE1  1 
ATOM   6128  C  CE2  . TYR A 1 394 ? 49.209  60.996  -31.749 1.00 71.32  ? 391  TYR A CE2  1 
ATOM   6129  C  CZ   . TYR A 1 394 ? 49.567  59.823  -31.124 1.00 68.88  ? 391  TYR A CZ   1 
ATOM   6130  O  OH   . TYR A 1 394 ? 50.901  59.532  -30.924 1.00 77.53  ? 391  TYR A OH   1 
ATOM   6131  H  H    . TYR A 1 394 ? 45.941  60.522  -34.160 1.00 77.83  ? 391  TYR A H    1 
ATOM   6132  H  HA   . TYR A 1 394 ? 44.695  58.935  -32.406 1.00 82.49  ? 391  TYR A HA   1 
ATOM   6133  H  HB2  . TYR A 1 394 ? 45.351  61.665  -32.073 1.00 82.74  ? 391  TYR A HB2  1 
ATOM   6134  H  HB3  . TYR A 1 394 ? 44.948  60.672  -30.902 1.00 82.74  ? 391  TYR A HB3  1 
ATOM   6135  H  HD1  . TYR A 1 394 ? 46.603  58.648  -30.616 1.00 77.18  ? 391  TYR A HD1  1 
ATOM   6136  H  HD2  . TYR A 1 394 ? 47.635  62.085  -32.370 1.00 82.55  ? 391  TYR A HD2  1 
ATOM   6137  H  HE1  . TYR A 1 394 ? 48.836  58.151  -30.278 1.00 86.59  ? 391  TYR A HE1  1 
ATOM   6138  H  HE2  . TYR A 1 394 ? 49.864  61.591  -32.034 1.00 85.59  ? 391  TYR A HE2  1 
ATOM   6139  H  HH   . TYR A 1 394 ? 51.379  60.150  -31.231 1.00 93.04  ? 391  TYR A HH   1 
ATOM   6140  N  N    . VAL A 1 395 ? 43.146  61.210  -33.978 1.00 71.86  ? 392  VAL A N    1 
ATOM   6141  C  CA   . VAL A 1 395 ? 41.818  61.617  -34.400 1.00 68.76  ? 392  VAL A CA   1 
ATOM   6142  C  C    . VAL A 1 395 ? 41.174  60.451  -35.144 1.00 60.64  ? 392  VAL A C    1 
ATOM   6143  O  O    . VAL A 1 395 ? 39.955  60.251  -35.076 1.00 59.41  ? 392  VAL A O    1 
ATOM   6144  C  CB   . VAL A 1 395 ? 41.854  62.852  -35.294 1.00 59.87  ? 392  VAL A CB   1 
ATOM   6145  C  CG1  . VAL A 1 395 ? 40.430  63.276  -35.664 1.00 67.25  ? 392  VAL A CG1  1 
ATOM   6146  C  CG2  . VAL A 1 395 ? 42.578  63.999  -34.579 1.00 63.20  ? 392  VAL A CG2  1 
ATOM   6147  H  H    . VAL A 1 395 ? 43.793  61.611  -34.379 1.00 86.23  ? 392  VAL A H    1 
ATOM   6148  H  HA   . VAL A 1 395 ? 41.279  61.819  -33.619 1.00 82.51  ? 392  VAL A HA   1 
ATOM   6149  H  HB   . VAL A 1 395 ? 42.335  62.646  -36.111 1.00 71.85  ? 392  VAL A HB   1 
ATOM   6150  H  HG11 . VAL A 1 395 ? 39.941  63.480  -34.851 1.00 80.70  ? 392  VAL A HG11 1 
ATOM   6151  H  HG12 . VAL A 1 395 ? 40.472  64.061  -36.231 1.00 80.70  ? 392  VAL A HG12 1 
ATOM   6152  H  HG13 . VAL A 1 395 ? 39.997  62.548  -36.137 1.00 80.70  ? 392  VAL A HG13 1 
ATOM   6153  H  HG21 . VAL A 1 395 ? 43.485  63.721  -34.376 1.00 75.84  ? 392  VAL A HG21 1 
ATOM   6154  H  HG22 . VAL A 1 395 ? 42.591  64.775  -35.161 1.00 75.84  ? 392  VAL A HG22 1 
ATOM   6155  H  HG23 . VAL A 1 395 ? 42.105  64.208  -33.759 1.00 75.84  ? 392  VAL A HG23 1 
ATOM   6156  N  N    . LYS A 1 396 ? 41.993  59.642  -35.812 1.00 48.02  ? 393  LYS A N    1 
ATOM   6157  C  CA   . LYS A 1 396 ? 41.450  58.468  -36.476 1.00 64.79  ? 393  LYS A CA   1 
ATOM   6158  C  C    . LYS A 1 396 ? 40.893  57.489  -35.444 1.00 69.64  ? 393  LYS A C    1 
ATOM   6159  O  O    . LYS A 1 396 ? 39.762  56.964  -35.601 1.00 67.30  ? 393  LYS A O    1 
ATOM   6160  C  CB   . LYS A 1 396 ? 42.501  57.787  -37.356 1.00 64.30  ? 393  LYS A CB   1 
ATOM   6161  C  CG   . LYS A 1 396 ? 41.856  56.892  -38.417 1.00 92.69  ? 393  LYS A CG   1 
ATOM   6162  C  CD   . LYS A 1 396 ? 42.855  56.091  -39.229 1.00 99.64  ? 393  LYS A CD   1 
ATOM   6163  C  CE   . LYS A 1 396 ? 42.154  55.269  -40.305 1.00 106.70 ? 393  LYS A CE   1 
ATOM   6164  N  NZ   . LYS A 1 396 ? 43.098  54.401  -41.064 1.00 113.67 ? 393  LYS A NZ   1 
ATOM   6165  H  H    . LYS A 1 396 ? 42.843  59.748  -35.893 1.00 57.62  ? 393  LYS A H    1 
ATOM   6166  H  HA   . LYS A 1 396 ? 40.717  58.744  -37.049 1.00 77.75  ? 393  LYS A HA   1 
ATOM   6167  H  HB2  . LYS A 1 396 ? 43.026  58.465  -37.809 1.00 77.16  ? 393  LYS A HB2  1 
ATOM   6168  H  HB3  . LYS A 1 396 ? 43.073  57.235  -36.800 1.00 77.16  ? 393  LYS A HB3  1 
ATOM   6169  H  HG2  . LYS A 1 396 ? 41.260  56.266  -37.978 1.00 111.22 ? 393  LYS A HG2  1 
ATOM   6170  H  HG3  . LYS A 1 396 ? 41.353  57.449  -39.032 1.00 111.22 ? 393  LYS A HG3  1 
ATOM   6171  H  HD2  . LYS A 1 396 ? 43.476  56.696  -39.664 1.00 119.57 ? 393  LYS A HD2  1 
ATOM   6172  H  HD3  . LYS A 1 396 ? 43.332  55.483  -38.643 1.00 119.57 ? 393  LYS A HD3  1 
ATOM   6173  H  HE2  . LYS A 1 396 ? 41.491  54.698  -39.886 1.00 128.04 ? 393  LYS A HE2  1 
ATOM   6174  H  HE3  . LYS A 1 396 ? 41.726  55.870  -40.935 1.00 128.04 ? 393  LYS A HE3  1 
ATOM   6175  H  HZ1  . LYS A 1 396 ? 43.501  53.833  -40.510 1.00 136.40 ? 393  LYS A HZ1  1 
ATOM   6176  H  HZ2  . LYS A 1 396 ? 42.655  53.937  -41.682 1.00 136.40 ? 393  LYS A HZ2  1 
ATOM   6177  H  HZ3  . LYS A 1 396 ? 43.715  54.901  -41.466 1.00 136.40 ? 393  LYS A HZ3  1 
ATOM   6178  N  N    . VAL A 1 397 ? 41.651  57.287  -34.359 1.00 68.26  ? 394  VAL A N    1 
ATOM   6179  C  CA   . VAL A 1 397 ? 41.169  56.405  -33.286 1.00 52.19  ? 394  VAL A CA   1 
ATOM   6180  C  C    . VAL A 1 397 ? 39.852  56.960  -32.744 1.00 57.11  ? 394  VAL A C    1 
ATOM   6181  O  O    . VAL A 1 397 ? 38.847  56.222  -32.540 1.00 56.11  ? 394  VAL A O    1 
ATOM   6182  C  CB   . VAL A 1 397 ? 42.193  56.283  -32.153 1.00 66.04  ? 394  VAL A CB   1 
ATOM   6183  C  CG1  . VAL A 1 397 ? 41.638  55.419  -31.027 1.00 68.80  ? 394  VAL A CG1  1 
ATOM   6184  C  CG2  . VAL A 1 397 ? 43.497  55.683  -32.672 1.00 67.65  ? 394  VAL A CG2  1 
ATOM   6185  H  H    . VAL A 1 397 ? 42.424  57.637  -34.222 1.00 81.91  ? 394  VAL A H    1 
ATOM   6186  H  HA   . VAL A 1 397 ? 41.003  55.520  -33.647 1.00 62.63  ? 394  VAL A HA   1 
ATOM   6187  H  HB   . VAL A 1 397 ? 42.383  57.164  -31.795 1.00 79.24  ? 394  VAL A HB   1 
ATOM   6188  H  HG11 . VAL A 1 397 ? 41.440  54.536  -31.376 1.00 82.57  ? 394  VAL A HG11 1 
ATOM   6189  H  HG12 . VAL A 1 397 ? 42.301  55.356  -30.322 1.00 82.57  ? 394  VAL A HG12 1 
ATOM   6190  H  HG13 . VAL A 1 397 ? 40.829  55.830  -30.684 1.00 82.57  ? 394  VAL A HG13 1 
ATOM   6191  H  HG21 . VAL A 1 397 ? 43.855  56.260  -33.365 1.00 81.18  ? 394  VAL A HG21 1 
ATOM   6192  H  HG22 . VAL A 1 397 ? 44.128  55.616  -31.939 1.00 81.18  ? 394  VAL A HG22 1 
ATOM   6193  H  HG23 . VAL A 1 397 ? 43.316  54.802  -33.036 1.00 81.18  ? 394  VAL A HG23 1 
ATOM   6194  N  N    . PHE A 1 398 ? 39.831  58.277  -32.560 1.00 59.69  ? 395  PHE A N    1 
ATOM   6195  C  CA   . PHE A 1 398 ? 38.609  58.916  -32.092 1.00 70.08  ? 395  PHE A CA   1 
ATOM   6196  C  C    . PHE A 1 398 ? 37.435  58.706  -33.091 1.00 68.72  ? 395  PHE A C    1 
ATOM   6197  O  O    . PHE A 1 398 ? 36.285  58.436  -32.689 1.00 61.18  ? 395  PHE A O    1 
ATOM   6198  C  CB   . PHE A 1 398 ? 38.885  60.405  -31.859 1.00 58.17  ? 395  PHE A CB   1 
ATOM   6199  C  CG   . PHE A 1 398 ? 37.790  61.124  -31.121 1.00 54.52  ? 395  PHE A CG   1 
ATOM   6200  C  CD1  . PHE A 1 398 ? 37.099  60.505  -30.098 1.00 53.62  ? 395  PHE A CD1  1 
ATOM   6201  C  CD2  . PHE A 1 398 ? 37.485  62.440  -31.426 1.00 52.88  ? 395  PHE A CD2  1 
ATOM   6202  C  CE1  . PHE A 1 398 ? 36.091  61.170  -29.414 1.00 67.02  ? 395  PHE A CE1  1 
ATOM   6203  C  CE2  . PHE A 1 398 ? 36.485  63.116  -30.743 1.00 57.50  ? 395  PHE A CE2  1 
ATOM   6204  C  CZ   . PHE A 1 398 ? 35.783  62.479  -29.736 1.00 59.99  ? 395  PHE A CZ   1 
ATOM   6205  H  H    . PHE A 1 398 ? 40.493  58.809  -32.696 1.00 71.63  ? 395  PHE A H    1 
ATOM   6206  H  HA   . PHE A 1 398 ? 38.353  58.523  -31.243 1.00 84.09  ? 395  PHE A HA   1 
ATOM   6207  H  HB2  . PHE A 1 398 ? 39.699  60.493  -31.339 1.00 69.81  ? 395  PHE A HB2  1 
ATOM   6208  H  HB3  . PHE A 1 398 ? 38.997  60.840  -32.719 1.00 69.81  ? 395  PHE A HB3  1 
ATOM   6209  H  HD1  . PHE A 1 398 ? 37.296  59.622  -29.881 1.00 64.35  ? 395  PHE A HD1  1 
ATOM   6210  H  HD2  . PHE A 1 398 ? 37.948  62.872  -32.108 1.00 63.46  ? 395  PHE A HD2  1 
ATOM   6211  H  HE1  . PHE A 1 398 ? 35.627  60.738  -28.733 1.00 80.43  ? 395  PHE A HE1  1 
ATOM   6212  H  HE2  . PHE A 1 398 ? 36.283  63.996  -30.967 1.00 69.00  ? 395  PHE A HE2  1 
ATOM   6213  H  HZ   . PHE A 1 398 ? 35.113  62.930  -29.275 1.00 71.99  ? 395  PHE A HZ   1 
ATOM   6214  N  N    . GLU A 1 399 ? 37.740  58.732  -34.389 1.00 68.31  ? 396  GLU A N    1 
ATOM   6215  C  CA   . GLU A 1 399 ? 36.704  58.564  -35.413 1.00 73.92  ? 396  GLU A CA   1 
ATOM   6216  C  C    . GLU A 1 399 ? 36.156  57.144  -35.418 1.00 73.03  ? 396  GLU A C    1 
ATOM   6217  O  O    . GLU A 1 399 ? 34.943  56.948  -35.559 1.00 60.11  ? 396  GLU A O    1 
ATOM   6218  C  CB   . GLU A 1 399 ? 37.250  58.926  -36.798 1.00 71.96  ? 396  GLU A CB   1 
ATOM   6219  C  CG   . GLU A 1 399 ? 37.148  60.418  -37.109 1.00 71.23  ? 396  GLU A CG   1 
ATOM   6220  C  CD   . GLU A 1 399 ? 38.092  60.861  -38.206 1.00 89.33  ? 396  GLU A CD   1 
ATOM   6221  O  OE1  . GLU A 1 399 ? 38.942  60.042  -38.636 1.00 79.68  ? 396  GLU A OE1  1 
ATOM   6222  O  OE2  . GLU A 1 399 ? 37.993  62.040  -38.622 1.00 89.63  ? 396  GLU A OE2  1 
ATOM   6223  H  H    . GLU A 1 399 ? 38.533  58.845  -34.702 1.00 81.98  ? 396  GLU A H    1 
ATOM   6224  H  HA   . GLU A 1 399 ? 35.969  59.166  -35.217 1.00 88.70  ? 396  GLU A HA   1 
ATOM   6225  H  HB2  . GLU A 1 399 ? 38.186  58.674  -36.844 1.00 86.35  ? 396  GLU A HB2  1 
ATOM   6226  H  HB3  . GLU A 1 399 ? 36.744  58.445  -37.472 1.00 86.35  ? 396  GLU A HB3  1 
ATOM   6227  H  HG2  . GLU A 1 399 ? 36.243  60.619  -37.395 1.00 85.48  ? 396  GLU A HG2  1 
ATOM   6228  H  HG3  . GLU A 1 399 ? 37.363  60.922  -36.309 1.00 85.48  ? 396  GLU A HG3  1 
ATOM   6229  N  N    A HIS A 1 400 ? 37.031  56.154  -35.257 0.51 67.51  ? 397  HIS A N    1 
ATOM   6230  N  N    B HIS A 1 400 ? 37.041  56.160  -35.270 0.49 67.50  ? 397  HIS A N    1 
ATOM   6231  C  CA   A HIS A 1 400 ? 36.560  54.772  -35.176 0.51 67.51  ? 397  HIS A CA   1 
ATOM   6232  C  CA   B HIS A 1 400 ? 36.609  54.768  -35.150 0.49 67.46  ? 397  HIS A CA   1 
ATOM   6233  C  C    A HIS A 1 400 ? 35.687  54.587  -33.935 0.51 67.26  ? 397  HIS A C    1 
ATOM   6234  C  C    B HIS A 1 400 ? 35.666  54.648  -33.961 0.49 67.26  ? 397  HIS A C    1 
ATOM   6235  O  O    A HIS A 1 400 ? 34.639  53.891  -33.968 0.51 68.70  ? 397  HIS A O    1 
ATOM   6236  O  O    B HIS A 1 400 ? 34.581  54.021  -34.039 0.49 68.79  ? 397  HIS A O    1 
ATOM   6237  C  CB   A HIS A 1 400 ? 37.742  53.805  -35.142 0.51 61.51  ? 397  HIS A CB   1 
ATOM   6238  C  CB   B HIS A 1 400 ? 37.815  53.839  -34.985 0.49 61.29  ? 397  HIS A CB   1 
ATOM   6239  C  CG   A HIS A 1 400 ? 38.573  53.820  -36.389 0.51 72.12  ? 397  HIS A CG   1 
ATOM   6240  C  CG   B HIS A 1 400 ? 37.472  52.378  -34.997 0.49 68.83  ? 397  HIS A CG   1 
ATOM   6241  N  ND1  A HIS A 1 400 ? 38.062  54.169  -37.623 0.51 73.59  ? 397  HIS A ND1  1 
ATOM   6242  N  ND1  B HIS A 1 400 ? 37.595  51.573  -33.884 0.49 67.71  ? 397  HIS A ND1  1 
ATOM   6243  C  CD2  A HIS A 1 400 ? 39.878  53.523  -36.593 0.51 69.63  ? 397  HIS A CD2  1 
ATOM   6244  C  CD2  B HIS A 1 400 ? 37.023  51.576  -35.993 0.49 71.44  ? 397  HIS A CD2  1 
ATOM   6245  C  CE1  A HIS A 1 400 ? 39.018  54.091  -38.531 0.51 71.21  ? 397  HIS A CE1  1 
ATOM   6246  C  CE1  B HIS A 1 400 ? 37.233  50.340  -34.192 0.49 59.21  ? 397  HIS A CE1  1 
ATOM   6247  N  NE2  A HIS A 1 400 ? 40.130  53.700  -37.932 0.51 74.06  ? 397  HIS A NE2  1 
ATOM   6248  N  NE2  B HIS A 1 400 ? 36.880  50.316  -35.465 0.49 71.21  ? 397  HIS A NE2  1 
ATOM   6249  H  H    A HIS A 1 400 ? 37.883  56.251  -35.194 0.51 81.01  ? 397  HIS A H    1 
ATOM   6250  H  H    B HIS A 1 400 ? 37.893  56.270  -35.237 0.49 81.01  ? 397  HIS A H    1 
ATOM   6251  H  HA   A HIS A 1 400 ? 36.024  54.569  -35.958 0.51 81.01  ? 397  HIS A HA   1 
ATOM   6252  H  HA   B HIS A 1 400 ? 36.128  54.508  -35.951 0.49 80.96  ? 397  HIS A HA   1 
ATOM   6253  H  HB2  A HIS A 1 400 ? 38.319  54.043  -34.398 0.51 73.82  ? 397  HIS A HB2  1 
ATOM   6254  H  HB2  B HIS A 1 400 ? 38.436  54.003  -35.712 0.49 73.54  ? 397  HIS A HB2  1 
ATOM   6255  H  HB3  A HIS A 1 400 ? 37.405  52.904  -35.021 0.51 73.82  ? 397  HIS A HB3  1 
ATOM   6256  H  HB3  B HIS A 1 400 ? 38.245  54.034  -34.137 0.49 73.54  ? 397  HIS A HB3  1 
ATOM   6257  H  HD1  A HIS A 1 400 ? 37.249  54.404  -37.776 0.51 88.30  ? 397  HIS A HD1  1 
ATOM   6258  H  HD1  B HIS A 1 400 ? 37.866  51.832  -33.110 0.49 81.25  ? 397  HIS A HD1  1 
ATOM   6259  H  HD2  A HIS A 1 400 ? 40.490  53.252  -35.947 0.51 83.56  ? 397  HIS A HD2  1 
ATOM   6260  H  HD2  B HIS A 1 400 ? 36.843  51.832  -36.868 0.49 85.73  ? 397  HIS A HD2  1 
ATOM   6261  H  HE1  A HIS A 1 400 ? 38.925  54.276  -39.437 0.51 85.45  ? 397  HIS A HE1  1 
ATOM   6262  H  HE1  B HIS A 1 400 ? 37.225  49.614  -33.611 0.49 71.05  ? 397  HIS A HE1  1 
ATOM   6263  H  HE2  A HIS A 1 400 ? 40.888  53.577  -38.318 0.51 88.87  ? 397  HIS A HE2  1 
ATOM   6264  H  HE2  B HIS A 1 400 ? 36.606  49.623  -35.894 0.49 85.45  ? 397  HIS A HE2  1 
ATOM   6265  N  N    . PHE A 1 401 ? 36.082  55.275  -32.862 1.00 67.02  ? 398  PHE A N    1 
ATOM   6266  C  CA   . PHE A 1 401 ? 35.278  55.279  -31.652 1.00 64.97  ? 398  PHE A CA   1 
ATOM   6267  C  C    . PHE A 1 401 ? 33.895  55.872  -31.975 1.00 62.26  ? 398  PHE A C    1 
ATOM   6268  O  O    . PHE A 1 401 ? 32.870  55.298  -31.595 1.00 59.21  ? 398  PHE A O    1 
ATOM   6269  C  CB   . PHE A 1 401 ? 35.986  56.065  -30.531 1.00 62.30  ? 398  PHE A CB   1 
ATOM   6270  C  CG   . PHE A 1 401 ? 35.058  56.536  -29.433 1.00 45.55  ? 398  PHE A CG   1 
ATOM   6271  C  CD1  . PHE A 1 401 ? 34.496  55.634  -28.552 1.00 44.27  ? 398  PHE A CD1  1 
ATOM   6272  C  CD2  . PHE A 1 401 ? 34.741  57.882  -29.298 1.00 47.04  ? 398  PHE A CD2  1 
ATOM   6273  C  CE1  . PHE A 1 401 ? 33.634  56.054  -27.547 1.00 37.41  ? 398  PHE A CE1  1 
ATOM   6274  C  CE2  . PHE A 1 401 ? 33.874  58.315  -28.302 1.00 48.10  ? 398  PHE A CE2  1 
ATOM   6275  C  CZ   . PHE A 1 401 ? 33.319  57.392  -27.422 1.00 46.69  ? 398  PHE A CZ   1 
ATOM   6276  H  H    A PHE A 1 401 ? 36.803  55.741  -32.814 0.51 80.42  ? 398  PHE A H    1 
ATOM   6277  H  H    B PHE A 1 401 ? 36.824  55.703  -32.795 0.49 80.42  ? 398  PHE A H    1 
ATOM   6278  H  HA   . PHE A 1 401 ? 35.153  54.366  -31.349 1.00 77.97  ? 398  PHE A HA   1 
ATOM   6279  H  HB2  . PHE A 1 401 ? 36.658  55.495  -30.126 1.00 74.76  ? 398  PHE A HB2  1 
ATOM   6280  H  HB3  . PHE A 1 401 ? 36.408  56.848  -30.917 1.00 74.76  ? 398  PHE A HB3  1 
ATOM   6281  H  HD1  . PHE A 1 401 ? 34.699  54.730  -28.632 1.00 53.13  ? 398  PHE A HD1  1 
ATOM   6282  H  HD2  . PHE A 1 401 ? 35.106  58.501  -29.888 1.00 56.44  ? 398  PHE A HD2  1 
ATOM   6283  H  HE1  . PHE A 1 401 ? 33.265  55.433  -26.961 1.00 44.89  ? 398  PHE A HE1  1 
ATOM   6284  H  HE2  . PHE A 1 401 ? 33.671  59.219  -28.219 1.00 57.72  ? 398  PHE A HE2  1 
ATOM   6285  H  HZ   . PHE A 1 401 ? 32.745  57.676  -26.747 1.00 56.02  ? 398  PHE A HZ   1 
ATOM   6286  N  N    . LEU A 1 402 ? 33.858  56.946  -32.763 1.00 63.84  ? 399  LEU A N    1 
ATOM   6287  C  CA   . LEU A 1 402 ? 32.573  57.553  -33.160 1.00 75.86  ? 399  LEU A CA   1 
ATOM   6288  C  C    . LEU A 1 402 ? 31.730  56.674  -34.109 1.00 71.80  ? 399  LEU A C    1 
ATOM   6289  O  O    . LEU A 1 402 ? 30.480  56.603  -34.010 1.00 65.66  ? 399  LEU A O    1 
ATOM   6290  C  CB   . LEU A 1 402 ? 32.847  58.906  -33.816 1.00 70.07  ? 399  LEU A CB   1 
ATOM   6291  C  CG   . LEU A 1 402 ? 33.355  60.001  -32.870 1.00 70.60  ? 399  LEU A CG   1 
ATOM   6292  C  CD1  . LEU A 1 402 ? 33.648  61.280  -33.642 1.00 72.28  ? 399  LEU A CD1  1 
ATOM   6293  C  CD2  . LEU A 1 402 ? 32.345  60.289  -31.759 1.00 67.06  ? 399  LEU A CD2  1 
ATOM   6294  H  H    . LEU A 1 402 ? 34.551  57.344  -33.080 1.00 76.60  ? 399  LEU A H    1 
ATOM   6295  H  HA   . LEU A 1 402 ? 32.046  57.713  -32.362 1.00 91.03  ? 399  LEU A HA   1 
ATOM   6296  H  HB2  . LEU A 1 402 ? 33.517  58.783  -34.506 1.00 84.08  ? 399  LEU A HB2  1 
ATOM   6297  H  HB3  . LEU A 1 402 ? 32.023  59.226  -34.216 1.00 84.08  ? 399  LEU A HB3  1 
ATOM   6298  H  HG   . LEU A 1 402 ? 34.180  59.704  -32.456 1.00 84.72  ? 399  LEU A HG   1 
ATOM   6299  H  HD11 . LEU A 1 402 ? 32.832  61.583  -34.071 1.00 86.74  ? 399  LEU A HD11 1 
ATOM   6300  H  HD12 . LEU A 1 402 ? 33.967  61.956  -33.024 1.00 86.74  ? 399  LEU A HD12 1 
ATOM   6301  H  HD13 . LEU A 1 402 ? 34.326  61.097  -34.311 1.00 86.74  ? 399  LEU A HD13 1 
ATOM   6302  H  HD21 . LEU A 1 402 ? 32.199  59.478  -31.248 1.00 80.47  ? 399  LEU A HD21 1 
ATOM   6303  H  HD22 . LEU A 1 402 ? 32.700  60.984  -31.183 1.00 80.47  ? 399  LEU A HD22 1 
ATOM   6304  H  HD23 . LEU A 1 402 ? 31.512  60.583  -32.159 1.00 80.47  ? 399  LEU A HD23 1 
ATOM   6305  N  N    . GLU A 1 403 ? 32.409  56.000  -35.026 1.00 69.75  ? 400  GLU A N    1 
ATOM   6306  C  CA   . GLU A 1 403 ? 31.735  55.154  -35.998 1.00 66.76  ? 400  GLU A CA   1 
ATOM   6307  C  C    . GLU A 1 403 ? 30.992  54.031  -35.304 1.00 69.99  ? 400  GLU A C    1 
ATOM   6308  O  O    . GLU A 1 403 ? 29.794  53.798  -35.582 1.00 70.83  ? 400  GLU A O    1 
ATOM   6309  C  CB   . GLU A 1 403 ? 32.750  54.592  -36.980 1.00 67.31  ? 400  GLU A CB   1 
ATOM   6310  C  CG   . GLU A 1 403 ? 32.880  55.405  -38.248 1.00 84.29  ? 400  GLU A CG   1 
ATOM   6311  C  CD   . GLU A 1 403 ? 34.293  55.383  -38.804 1.00 99.19  ? 400  GLU A CD   1 
ATOM   6312  O  OE1  . GLU A 1 403 ? 35.015  54.385  -38.563 1.00 95.82  ? 400  GLU A OE1  1 
ATOM   6313  O  OE2  . GLU A 1 403 ? 34.673  56.359  -39.497 1.00 94.06  ? 400  GLU A OE2  1 
ATOM   6314  H  H    . GLU A 1 403 ? 33.265  56.016  -35.107 1.00 83.70  ? 400  GLU A H    1 
ATOM   6315  H  HA   . GLU A 1 403 ? 31.092  55.685  -36.494 1.00 80.12  ? 400  GLU A HA   1 
ATOM   6316  H  HB2  . GLU A 1 403 ? 33.620  54.568  -36.552 1.00 80.77  ? 400  GLU A HB2  1 
ATOM   6317  H  HB3  . GLU A 1 403 ? 32.481  53.694  -37.229 1.00 80.77  ? 400  GLU A HB3  1 
ATOM   6318  H  HG2  . GLU A 1 403 ? 32.286  55.040  -38.922 1.00 101.14 ? 400  GLU A HG2  1 
ATOM   6319  H  HG3  . GLU A 1 403 ? 32.644  56.327  -38.060 1.00 101.14 ? 400  GLU A HG3  1 
ATOM   6320  N  N    . ASN A 1 404 ? 31.676  53.337  -34.387 1.00 71.86  ? 401  ASN A N    1 
ATOM   6321  C  CA   . ASN A 1 404 ? 30.969  52.260  -33.681 1.00 57.36  ? 401  ASN A CA   1 
ATOM   6322  C  C    . ASN A 1 404 ? 29.796  52.818  -32.877 1.00 57.01  ? 401  ASN A C    1 
ATOM   6323  O  O    . ASN A 1 404 ? 28.747  52.165  -32.694 1.00 65.15  ? 401  ASN A O    1 
ATOM   6324  C  CB   . ASN A 1 404 ? 31.913  51.496  -32.775 1.00 51.97  ? 401  ASN A CB   1 
ATOM   6325  C  CG   . ASN A 1 404 ? 32.736  50.483  -33.536 1.00 70.95  ? 401  ASN A CG   1 
ATOM   6326  O  OD1  . ASN A 1 404 ? 33.966  50.540  -33.543 1.00 72.37  ? 401  ASN A OD1  1 
ATOM   6327  N  ND2  . ASN A 1 404 ? 32.058  49.548  -34.197 1.00 89.83  ? 401  ASN A ND2  1 
ATOM   6328  H  H    . ASN A 1 404 ? 32.498  53.459  -34.164 1.00 86.24  ? 401  ASN A H    1 
ATOM   6329  H  HA   . ASN A 1 404 ? 30.614  51.638  -34.335 1.00 68.83  ? 401  ASN A HA   1 
ATOM   6330  H  HB2  . ASN A 1 404 ? 32.521  52.120  -32.350 1.00 62.37  ? 401  ASN A HB2  1 
ATOM   6331  H  HB3  . ASN A 1 404 ? 31.396  51.023  -32.104 1.00 62.37  ? 401  ASN A HB3  1 
ATOM   6332  H  HD21 . ASN A 1 404 ? 31.198  49.544  -34.176 1.00 107.79 ? 401  ASN A HD21 1 
ATOM   6333  H  HD22 . ASN A 1 404 ? 32.479  48.947  -34.646 1.00 107.79 ? 401  ASN A HD22 1 
ATOM   6334  N  N    . LEU A 1 405 ? 29.946  54.071  -32.467 1.00 62.45  ? 402  LEU A N    1 
ATOM   6335  C  CA   . LEU A 1 405 ? 28.913  54.732  -31.694 1.00 72.07  ? 402  LEU A CA   1 
ATOM   6336  C  C    . LEU A 1 405 ? 27.680  54.993  -32.545 1.00 80.59  ? 402  LEU A C    1 
ATOM   6337  O  O    . LEU A 1 405 ? 26.549  54.810  -32.081 1.00 75.31  ? 402  LEU A O    1 
ATOM   6338  C  CB   . LEU A 1 405 ? 29.458  56.041  -31.122 1.00 77.03  ? 402  LEU A CB   1 
ATOM   6339  C  CG   . LEU A 1 405 ? 28.972  56.554  -29.766 1.00 75.01  ? 402  LEU A CG   1 
ATOM   6340  C  CD1  . LEU A 1 405 ? 28.595  55.446  -28.787 1.00 57.96  ? 402  LEU A CD1  1 
ATOM   6341  C  CD2  . LEU A 1 405 ? 30.067  57.424  -29.167 1.00 61.40  ? 402  LEU A CD2  1 
ATOM   6342  H  H    . LEU A 1 405 ? 30.637  54.557  -32.625 1.00 74.94  ? 402  LEU A H    1 
ATOM   6343  H  HA   . LEU A 1 405 ? 28.655  54.161  -30.953 1.00 86.48  ? 402  LEU A HA   1 
ATOM   6344  H  HB2  . LEU A 1 405 ? 30.420  55.946  -31.050 1.00 92.44  ? 402  LEU A HB2  1 
ATOM   6345  H  HB3  . LEU A 1 405 ? 29.263  56.740  -31.765 1.00 92.44  ? 402  LEU A HB3  1 
ATOM   6346  H  HG   . LEU A 1 405 ? 28.189  57.111  -29.902 1.00 90.01  ? 402  LEU A HG   1 
ATOM   6347  H  HD11 . LEU A 1 405 ? 29.373  54.889  -28.627 1.00 69.56  ? 402  LEU A HD11 1 
ATOM   6348  H  HD12 . LEU A 1 405 ? 28.299  55.848  -27.955 1.00 69.56  ? 402  LEU A HD12 1 
ATOM   6349  H  HD13 . LEU A 1 405 ? 27.880  54.915  -29.171 1.00 69.56  ? 402  LEU A HD13 1 
ATOM   6350  H  HD21 . LEU A 1 405 ? 30.242  58.167  -29.766 1.00 73.68  ? 402  LEU A HD21 1 
ATOM   6351  H  HD22 . LEU A 1 405 ? 29.769  57.756  -28.306 1.00 73.68  ? 402  LEU A HD22 1 
ATOM   6352  H  HD23 . LEU A 1 405 ? 30.869  56.891  -29.058 1.00 73.68  ? 402  LEU A HD23 1 
ATOM   6353  N  N    . ASP A 1 406 ? 27.901  55.351  -33.812 1.00 84.39  ? 403  ASP A N    1 
ATOM   6354  C  CA   . ASP A 1 406 ? 26.782  55.492  -34.753 1.00 78.92  ? 403  ASP A CA   1 
ATOM   6355  C  C    . ASP A 1 406 ? 26.137  54.130  -35.019 1.00 82.28  ? 403  ASP A C    1 
ATOM   6356  O  O    . ASP A 1 406 ? 24.896  53.969  -34.913 1.00 80.94  ? 403  ASP A O    1 
ATOM   6357  C  CB   . ASP A 1 406 ? 27.249  56.089  -36.091 1.00 80.78  ? 403  ASP A CB   1 
ATOM   6358  C  CG   . ASP A 1 406 ? 27.663  57.548  -35.984 1.00 100.13 ? 403  ASP A CG   1 
ATOM   6359  O  OD1  . ASP A 1 406 ? 27.037  58.297  -35.200 1.00 101.56 ? 403  ASP A OD1  1 
ATOM   6360  O  OD2  . ASP A 1 406 ? 28.621  57.943  -36.695 1.00 94.57  ? 403  ASP A OD2  1 
ATOM   6361  H  H    . ASP A 1 406 ? 28.675  55.517  -34.148 1.00 101.27 ? 403  ASP A H    1 
ATOM   6362  H  HA   . ASP A 1 406 ? 26.111  56.080  -34.372 1.00 94.70  ? 403  ASP A HA   1 
ATOM   6363  H  HB2  . ASP A 1 406 ? 28.013  55.584  -36.410 1.00 96.93  ? 403  ASP A HB2  1 
ATOM   6364  H  HB3  . ASP A 1 406 ? 26.523  56.031  -36.731 1.00 96.93  ? 403  ASP A HB3  1 
ATOM   6365  N  N    . LYS A 1 407 ? 26.964  53.144  -35.365 1.00 68.02  ? 404  LYS A N    1 
ATOM   6366  C  CA   . LYS A 1 407 ? 26.417  51.824  -35.663 1.00 63.09  ? 404  LYS A CA   1 
ATOM   6367  C  C    . LYS A 1 407 ? 25.549  51.311  -34.523 1.00 78.90  ? 404  LYS A C    1 
ATOM   6368  O  O    . LYS A 1 407 ? 24.488  50.737  -34.764 1.00 86.37  ? 404  LYS A O    1 
ATOM   6369  C  CB   . LYS A 1 407 ? 27.509  50.804  -35.931 1.00 56.74  ? 404  LYS A CB   1 
ATOM   6370  C  CG   . LYS A 1 407 ? 28.440  51.144  -37.050 1.00 57.62  ? 404  LYS A CG   1 
ATOM   6371  C  CD   . LYS A 1 407 ? 29.273  49.932  -37.379 1.00 65.46  ? 404  LYS A CD   1 
ATOM   6372  C  CE   . LYS A 1 407 ? 30.349  50.250  -38.388 1.00 82.14  ? 404  LYS A CE   1 
ATOM   6373  N  NZ   . LYS A 1 407 ? 31.401  49.195  -38.376 1.00 90.85  ? 404  LYS A NZ   1 
ATOM   6374  H  H    . LYS A 1 407 ? 27.819  53.210  -35.434 1.00 81.63  ? 404  LYS A H    1 
ATOM   6375  H  HA   . LYS A 1 407 ? 25.863  51.884  -36.457 1.00 75.71  ? 404  LYS A HA   1 
ATOM   6376  H  HB2  . LYS A 1 407 ? 28.044  50.707  -35.127 1.00 68.09  ? 404  LYS A HB2  1 
ATOM   6377  H  HB3  . LYS A 1 407 ? 27.092  49.955  -36.146 1.00 68.09  ? 404  LYS A HB3  1 
ATOM   6378  H  HG2  . LYS A 1 407 ? 27.930  51.395  -37.837 1.00 69.15  ? 404  LYS A HG2  1 
ATOM   6379  H  HG3  . LYS A 1 407 ? 29.030  51.865  -36.779 1.00 69.15  ? 404  LYS A HG3  1 
ATOM   6380  H  HD2  . LYS A 1 407 ? 29.701  49.611  -36.570 1.00 78.55  ? 404  LYS A HD2  1 
ATOM   6381  H  HD3  . LYS A 1 407 ? 28.701  49.244  -37.752 1.00 78.55  ? 404  LYS A HD3  1 
ATOM   6382  H  HE2  . LYS A 1 407 ? 29.960  50.286  -39.276 1.00 98.57  ? 404  LYS A HE2  1 
ATOM   6383  H  HE3  . LYS A 1 407 ? 30.762  51.099  -38.164 1.00 98.57  ? 404  LYS A HE3  1 
ATOM   6384  H  HZ1  . LYS A 1 407 ? 31.043  48.406  -38.580 1.00 109.02 ? 404  LYS A HZ1  1 
ATOM   6385  H  HZ2  . LYS A 1 407 ? 32.032  49.389  -38.973 1.00 109.02 ? 404  LYS A HZ2  1 
ATOM   6386  H  HZ3  . LYS A 1 407 ? 31.772  49.145  -37.569 1.00 109.02 ? 404  LYS A HZ3  1 
ATOM   6387  N  N    . SER A 1 408 ? 25.968  51.532  -33.278 1.00 79.93  ? 405  SER A N    1 
ATOM   6388  C  CA   . SER A 1 408 ? 25.132  51.065  -32.173 1.00 82.44  ? 405  SER A CA   1 
ATOM   6389  C  C    . SER A 1 408 ? 23.781  51.784  -32.144 1.00 81.46  ? 405  SER A C    1 
ATOM   6390  O  O    . SER A 1 408 ? 22.749  51.162  -31.871 1.00 73.97  ? 405  SER A O    1 
ATOM   6391  C  CB   . SER A 1 408 ? 25.843  51.255  -30.831 1.00 72.43  ? 405  SER A CB   1 
ATOM   6392  O  OG   . SER A 1 408 ? 25.207  50.508  -29.807 1.00 79.40  ? 405  SER A OG   1 
ATOM   6393  H  H    . SER A 1 408 ? 26.697  51.930  -33.053 1.00 95.92  ? 405  SER A H    1 
ATOM   6394  H  HA   . SER A 1 408 ? 24.962  50.117  -32.288 1.00 98.93  ? 405  SER A HA   1 
ATOM   6395  H  HB2  . SER A 1 408 ? 26.762  50.956  -30.916 1.00 86.92  ? 405  SER A HB2  1 
ATOM   6396  H  HB3  . SER A 1 408 ? 25.822  52.196  -30.594 1.00 86.92  ? 405  SER A HB3  1 
ATOM   6397  H  HG   . SER A 1 408 ? 25.608  50.622  -29.077 1.00 95.28  ? 405  SER A HG   1 
ATOM   6398  N  N    . ARG A 1 409 ? 23.766  53.077  -32.456 1.00 78.39  ? 406  ARG A N    1 
ATOM   6399  C  CA   . ARG A 1 409 ? 22.508  53.815  -32.471 1.00 79.71  ? 406  ARG A CA   1 
ATOM   6400  C  C    . ARG A 1 409 ? 21.599  53.306  -33.571 1.00 96.51  ? 406  ARG A C    1 
ATOM   6401  O  O    . ARG A 1 409 ? 20.374  53.245  -33.403 1.00 92.90  ? 406  ARG A O    1 
ATOM   6402  C  CB   . ARG A 1 409 ? 22.745  55.312  -32.665 1.00 73.47  ? 406  ARG A CB   1 
ATOM   6403  C  CG   . ARG A 1 409 ? 23.055  56.062  -31.392 1.00 70.08  ? 406  ARG A CG   1 
ATOM   6404  C  CD   . ARG A 1 409 ? 23.035  57.562  -31.626 1.00 56.81  ? 406  ARG A CD   1 
ATOM   6405  N  NE   . ARG A 1 409 ? 24.078  57.971  -32.562 1.00 69.06  ? 406  ARG A NE   1 
ATOM   6406  C  CZ   . ARG A 1 409 ? 25.296  58.373  -32.219 1.00 72.48  ? 406  ARG A CZ   1 
ATOM   6407  N  NH1  . ARG A 1 409 ? 25.656  58.435  -30.944 1.00 74.93  ? 406  ARG A NH1  1 
ATOM   6408  N  NH2  . ARG A 1 409 ? 26.159  58.719  -33.163 1.00 73.51  ? 406  ARG A NH2  1 
ATOM   6409  H  H    . ARG A 1 409 ? 24.460  53.543  -32.660 1.00 94.07  ? 406  ARG A H    1 
ATOM   6410  H  HA   . ARG A 1 409 ? 22.055  53.688  -31.623 1.00 95.66  ? 406  ARG A HA   1 
ATOM   6411  H  HB2  . ARG A 1 409 ? 23.496  55.432  -33.268 1.00 88.17  ? 406  ARG A HB2  1 
ATOM   6412  H  HB3  . ARG A 1 409 ? 21.948  55.705  -33.052 1.00 88.17  ? 406  ARG A HB3  1 
ATOM   6413  H  HG2  . ARG A 1 409 ? 22.387  55.848  -30.722 1.00 84.10  ? 406  ARG A HG2  1 
ATOM   6414  H  HG3  . ARG A 1 409 ? 23.939  55.813  -31.079 1.00 84.10  ? 406  ARG A HG3  1 
ATOM   6415  H  HD2  . ARG A 1 409 ? 22.176  57.817  -31.997 1.00 68.17  ? 406  ARG A HD2  1 
ATOM   6416  H  HD3  . ARG A 1 409 ? 23.186  58.019  -30.784 1.00 68.17  ? 406  ARG A HD3  1 
ATOM   6417  H  HE   . ARG A 1 409 ? 23.889  57.950  -33.400 1.00 82.87  ? 406  ARG A HE   1 
ATOM   6418  H  HH11 . ARG A 1 409 ? 25.098  58.211  -30.328 1.00 89.91  ? 406  ARG A HH11 1 
ATOM   6419  H  HH12 . ARG A 1 409 ? 26.447  58.697  -30.732 1.00 89.91  ? 406  ARG A HH12 1 
ATOM   6420  H  HH21 . ARG A 1 409 ? 25.929  58.681  -33.990 1.00 88.21  ? 406  ARG A HH21 1 
ATOM   6421  H  HH22 . ARG A 1 409 ? 26.949  58.981  -32.948 1.00 88.21  ? 406  ARG A HH22 1 
ATOM   6422  N  N    . LYS A 1 410 ? 22.194  52.966  -34.710 1.00 97.24  ? 407  LYS A N    1 
ATOM   6423  C  CA   . LYS A 1 410 ? 21.397  52.434  -35.817 1.00 92.11  ? 407  LYS A CA   1 
ATOM   6424  C  C    . LYS A 1 410 ? 20.946  50.981  -35.593 1.00 93.25  ? 407  LYS A C    1 
ATOM   6425  O  O    . LYS A 1 410 ? 19.765  50.733  -35.357 1.00 101.18 ? 407  LYS A O    1 
ATOM   6426  C  CB   . LYS A 1 410 ? 22.185  52.560  -37.114 1.00 76.75  ? 407  LYS A CB   1 
ATOM   6427  C  CG   . LYS A 1 410 ? 22.354  54.010  -37.496 1.00 80.95  ? 407  LYS A CG   1 
ATOM   6428  C  CD   . LYS A 1 410 ? 23.456  54.242  -38.495 1.00 90.96  ? 407  LYS A CD   1 
ATOM   6429  C  CE   . LYS A 1 410 ? 23.597  55.735  -38.761 1.00 106.62 ? 407  LYS A CE   1 
ATOM   6430  N  NZ   . LYS A 1 410 ? 24.707  56.048  -39.697 1.00 130.91 ? 407  LYS A NZ   1 
ATOM   6431  H  H    . LYS A 1 410 ? 23.037  53.031  -34.869 1.00 116.68 ? 407  LYS A H    1 
ATOM   6432  H  HA   . LYS A 1 410 ? 20.598  52.975  -35.908 1.00 110.53 ? 407  LYS A HA   1 
ATOM   6433  H  HB2  . LYS A 1 410 ? 23.065  52.169  -36.996 1.00 92.10  ? 407  LYS A HB2  1 
ATOM   6434  H  HB3  . LYS A 1 410 ? 21.708  52.108  -37.827 1.00 92.10  ? 407  LYS A HB3  1 
ATOM   6435  H  HG2  . LYS A 1 410 ? 21.526  54.330  -37.888 1.00 97.14  ? 407  LYS A HG2  1 
ATOM   6436  H  HG3  . LYS A 1 410 ? 22.561  54.523  -36.699 1.00 97.14  ? 407  LYS A HG3  1 
ATOM   6437  H  HD2  . LYS A 1 410 ? 24.295  53.910  -38.138 1.00 109.16 ? 407  LYS A HD2  1 
ATOM   6438  H  HD3  . LYS A 1 410 ? 23.240  53.798  -39.329 1.00 109.16 ? 407  LYS A HD3  1 
ATOM   6439  H  HE2  . LYS A 1 410 ? 22.773  56.066  -39.151 1.00 127.94 ? 407  LYS A HE2  1 
ATOM   6440  H  HE3  . LYS A 1 410 ? 23.775  56.191  -37.923 1.00 127.94 ? 407  LYS A HE3  1 
ATOM   6441  H  HZ1  . LYS A 1 410 ? 24.566  55.648  -40.479 1.00 157.09 ? 407  LYS A HZ1  1 
ATOM   6442  H  HZ2  . LYS A 1 410 ? 24.756  56.927  -39.826 1.00 157.09 ? 407  LYS A HZ2  1 
ATOM   6443  H  HZ3  . LYS A 1 410 ? 25.479  55.761  -39.360 1.00 157.09 ? 407  LYS A HZ3  1 
ATOM   6444  N  N    . GLY A 1 411 ? 21.882  50.035  -35.610 1.00 91.51  ? 408  GLY A N    1 
ATOM   6445  C  CA   . GLY A 1 411 ? 21.542  48.636  -35.401 1.00 82.38  ? 408  GLY A CA   1 
ATOM   6446  C  C    . GLY A 1 411 ? 22.717  47.700  -35.605 1.00 88.40  ? 408  GLY A C    1 
ATOM   6447  O  O    . GLY A 1 411 ? 23.524  47.885  -36.519 1.00 88.12  ? 408  GLY A O    1 
ATOM   6448  H  H    . GLY A 1 411 ? 22.720  50.179  -35.741 1.00 109.81 ? 408  GLY A H    1 
ATOM   6449  H  HA2  . GLY A 1 411 ? 21.212  48.518  -34.496 1.00 98.85  ? 408  GLY A HA2  1 
ATOM   6450  H  HA3  . GLY A 1 411 ? 20.838  48.381  -36.018 1.00 98.85  ? 408  GLY A HA3  1 
ATOM   6451  N  N    . LYS B 2 10  ? -0.108  55.994  8.919   1.00 111.90 ? 10   LYS B N    1 
ATOM   6452  C  CA   . LYS B 2 10  ? -1.176  56.319  9.861   1.00 124.82 ? 10   LYS B CA   1 
ATOM   6453  C  C    . LYS B 2 10  ? -1.984  55.086  10.249  1.00 125.91 ? 10   LYS B C    1 
ATOM   6454  O  O    . LYS B 2 10  ? -2.841  54.638  9.485   1.00 125.29 ? 10   LYS B O    1 
ATOM   6455  C  CB   . LYS B 2 10  ? -2.120  57.366  9.268   1.00 125.01 ? 10   LYS B CB   1 
ATOM   6456  C  CG   . LYS B 2 10  ? -1.440  58.627  8.780   1.00 135.16 ? 10   LYS B CG   1 
ATOM   6457  C  CD   . LYS B 2 10  ? -2.430  59.503  8.037   1.00 142.10 ? 10   LYS B CD   1 
ATOM   6458  C  CE   . LYS B 2 10  ? -1.750  60.674  7.354   1.00 152.31 ? 10   LYS B CE   1 
ATOM   6459  N  NZ   . LYS B 2 10  ? -2.716  61.458  6.533   1.00 144.36 ? 10   LYS B NZ   1 
ATOM   6460  H  HA   . LYS B 2 10  ? -0.785  56.689  10.668  1.00 149.78 ? 10   LYS B HA   1 
ATOM   6461  H  HB2  . LYS B 2 10  ? -2.584  56.972  8.513   1.00 150.02 ? 10   LYS B HB2  1 
ATOM   6462  H  HB3  . LYS B 2 10  ? -2.762  57.623  9.947   1.00 150.02 ? 10   LYS B HB3  1 
ATOM   6463  H  HG2  . LYS B 2 10  ? -1.097  59.125  9.539   1.00 162.20 ? 10   LYS B HG2  1 
ATOM   6464  H  HG3  . LYS B 2 10  ? -0.720  58.393  8.173   1.00 162.20 ? 10   LYS B HG3  1 
ATOM   6465  H  HD2  . LYS B 2 10  ? -2.876  58.974  7.358   1.00 170.51 ? 10   LYS B HD2  1 
ATOM   6466  H  HD3  . LYS B 2 10  ? -3.078  59.855  8.667   1.00 170.51 ? 10   LYS B HD3  1 
ATOM   6467  H  HE2  . LYS B 2 10  ? -1.373  61.264  8.026   1.00 182.77 ? 10   LYS B HE2  1 
ATOM   6468  H  HE3  . LYS B 2 10  ? -1.051  60.343  6.768   1.00 182.77 ? 10   LYS B HE3  1 
ATOM   6469  H  HZ1  . LYS B 2 10  ? -3.366  61.775  7.051   1.00 173.23 ? 10   LYS B HZ1  1 
ATOM   6470  H  HZ2  . LYS B 2 10  ? -2.299  62.139  6.141   1.00 173.23 ? 10   LYS B HZ2  1 
ATOM   6471  H  HZ3  . LYS B 2 10  ? -3.073  60.937  5.906   1.00 173.23 ? 10   LYS B HZ3  1 
ATOM   6472  N  N    . LEU B 2 11  ? -1.715  54.549  11.436  1.00 122.20 ? 11   LEU B N    1 
ATOM   6473  C  CA   . LEU B 2 11  ? -2.486  53.426  11.960  1.00 113.21 ? 11   LEU B CA   1 
ATOM   6474  C  C    . LEU B 2 11  ? -3.556  53.947  12.910  1.00 112.40 ? 11   LEU B C    1 
ATOM   6475  O  O    . LEU B 2 11  ? -3.371  54.974  13.567  1.00 106.78 ? 11   LEU B O    1 
ATOM   6476  C  CB   . LEU B 2 11  ? -1.583  52.414  12.673  1.00 106.74 ? 11   LEU B CB   1 
ATOM   6477  C  CG   . LEU B 2 11  ? -2.242  51.059  12.963  1.00 102.14 ? 11   LEU B CG   1 
ATOM   6478  C  CD1  . LEU B 2 11  ? -1.254  49.930  12.740  1.00 98.60  ? 11   LEU B CD1  1 
ATOM   6479  C  CD2  . LEU B 2 11  ? -2.807  50.989  14.380  1.00 94.41  ? 11   LEU B CD2  1 
ATOM   6480  H  H    . LEU B 2 11  ? -1.089  54.819  11.960  1.00 146.64 ? 11   LEU B H    1 
ATOM   6481  H  HA   . LEU B 2 11  ? -2.928  52.973  11.225  1.00 135.85 ? 11   LEU B HA   1 
ATOM   6482  H  HB2  . LEU B 2 11  ? -0.804  52.249  12.119  1.00 128.08 ? 11   LEU B HB2  1 
ATOM   6483  H  HB3  . LEU B 2 11  ? -1.304  52.792  13.522  1.00 128.08 ? 11   LEU B HB3  1 
ATOM   6484  H  HG   . LEU B 2 11  ? -2.979  50.933  12.345  1.00 122.56 ? 11   LEU B HG   1 
ATOM   6485  H  HD11 . LEU B 2 11  ? -0.497  50.051  13.334  1.00 118.32 ? 11   LEU B HD11 1 
ATOM   6486  H  HD12 . LEU B 2 11  ? -1.692  49.085  12.928  1.00 118.32 ? 11   LEU B HD12 1 
ATOM   6487  H  HD13 . LEU B 2 11  ? -0.956  49.949  11.817  1.00 118.32 ? 11   LEU B HD13 1 
ATOM   6488  H  HD21 . LEU B 2 11  ? -3.475  51.685  14.488  1.00 113.29 ? 11   LEU B HD21 1 
ATOM   6489  H  HD22 . LEU B 2 11  ? -3.212  50.118  14.516  1.00 113.29 ? 11   LEU B HD22 1 
ATOM   6490  H  HD23 . LEU B 2 11  ? -2.085  51.122  15.014  1.00 113.29 ? 11   LEU B HD23 1 
ATOM   6491  N  N    . ARG B 2 12  ? -4.681  53.241  12.961  1.00 116.67 ? 12   ARG B N    1 
ATOM   6492  C  CA   . ARG B 2 12  ? -5.789  53.606  13.837  1.00 112.31 ? 12   ARG B CA   1 
ATOM   6493  C  C    . ARG B 2 12  ? -6.377  52.360  14.487  1.00 105.75 ? 12   ARG B C    1 
ATOM   6494  O  O    . ARG B 2 12  ? -6.475  51.309  13.853  1.00 111.67 ? 12   ARG B O    1 
ATOM   6495  C  CB   . ARG B 2 12  ? -6.862  54.358  13.047  1.00 105.01 ? 12   ARG B CB   1 
ATOM   6496  C  CG   . ARG B 2 12  ? -6.362  55.654  12.441  1.00 110.05 ? 12   ARG B CG   1 
ATOM   6497  C  CD   . ARG B 2 12  ? -7.257  56.126  11.328  1.00 114.54 ? 12   ARG B CD   1 
ATOM   6498  N  NE   . ARG B 2 12  ? -6.712  57.309  10.669  1.00 121.16 ? 12   ARG B NE   1 
ATOM   6499  C  CZ   . ARG B 2 12  ? -6.923  58.560  11.069  1.00 124.75 ? 12   ARG B CZ   1 
ATOM   6500  N  NH1  . ARG B 2 12  ? -7.667  58.810  12.141  1.00 122.59 ? 12   ARG B NH1  1 
ATOM   6501  N  NH2  . ARG B 2 12  ? -6.383  59.567  10.396  1.00 118.29 ? 12   ARG B NH2  1 
ATOM   6502  H  H    . ARG B 2 12  ? -4.829  52.536  12.492  1.00 140.01 ? 12   ARG B H    1 
ATOM   6503  H  HA   . ARG B 2 12  ? -5.463  54.191  14.539  1.00 134.77 ? 12   ARG B HA   1 
ATOM   6504  H  HB2  . ARG B 2 12  ? -7.175  53.792  12.324  1.00 126.01 ? 12   ARG B HB2  1 
ATOM   6505  H  HB3  . ARG B 2 12  ? -7.598  54.571  13.642  1.00 126.01 ? 12   ARG B HB3  1 
ATOM   6506  H  HG2  . ARG B 2 12  ? -6.342  56.340  13.126  1.00 132.05 ? 12   ARG B HG2  1 
ATOM   6507  H  HG3  . ARG B 2 12  ? -5.473  55.515  12.078  1.00 132.05 ? 12   ARG B HG3  1 
ATOM   6508  H  HD2  . ARG B 2 12  ? -7.344  55.422  10.667  1.00 137.44 ? 12   ARG B HD2  1 
ATOM   6509  H  HD3  . ARG B 2 12  ? -8.127  56.354  11.692  1.00 137.44 ? 12   ARG B HD3  1 
ATOM   6510  H  HE   . ARG B 2 12  ? -6.221  57.189  9.973   1.00 145.39 ? 12   ARG B HE   1 
ATOM   6511  H  HH11 . ARG B 2 12  ? -8.020  58.160  12.581  1.00 147.11 ? 12   ARG B HH11 1 
ATOM   6512  H  HH12 . ARG B 2 12  ? -7.798  59.621  12.395  1.00 147.11 ? 12   ARG B HH12 1 
ATOM   6513  H  HH21 . ARG B 2 12  ? -5.899  59.410  9.702   1.00 141.95 ? 12   ARG B HH21 1 
ATOM   6514  H  HH22 . ARG B 2 12  ? -6.515  60.377  10.653  1.00 141.95 ? 12   ARG B HH22 1 
ATOM   6515  N  N    . LEU B 2 13  ? -6.748  52.476  15.759  1.00 108.55 ? 13   LEU B N    1 
ATOM   6516  C  CA   . LEU B 2 13  ? -7.430  51.393  16.458  1.00 106.86 ? 13   LEU B CA   1 
ATOM   6517  C  C    . LEU B 2 13  ? -8.759  51.098  15.776  1.00 112.26 ? 13   LEU B C    1 
ATOM   6518  O  O    . LEU B 2 13  ? -9.258  49.974  15.823  1.00 108.95 ? 13   LEU B O    1 
ATOM   6519  C  CB   . LEU B 2 13  ? -7.664  51.745  17.930  1.00 97.84  ? 13   LEU B CB   1 
ATOM   6520  C  CG   . LEU B 2 13  ? -6.449  51.798  18.860  1.00 101.32 ? 13   LEU B CG   1 
ATOM   6521  C  CD1  . LEU B 2 13  ? -6.916  52.117  20.264  1.00 106.48 ? 13   LEU B CD1  1 
ATOM   6522  C  CD2  . LEU B 2 13  ? -5.663  50.491  18.851  1.00 100.12 ? 13   LEU B CD2  1 
ATOM   6523  H  H    . LEU B 2 13  ? -6.616  53.176  16.241  1.00 130.26 ? 13   LEU B H    1 
ATOM   6524  H  HA   . LEU B 2 13  ? -6.883  50.592  16.419  1.00 128.23 ? 13   LEU B HA   1 
ATOM   6525  H  HB2  . LEU B 2 13  ? -8.083  52.618  17.964  1.00 117.41 ? 13   LEU B HB2  1 
ATOM   6526  H  HB3  . LEU B 2 13  ? -8.273  51.087  18.300  1.00 117.41 ? 13   LEU B HB3  1 
ATOM   6527  H  HG   . LEU B 2 13  ? -5.857  52.509  18.569  1.00 121.59 ? 13   LEU B HG   1 
ATOM   6528  H  HD11 . LEU B 2 13  ? -7.527  51.424  20.558  1.00 127.78 ? 13   LEU B HD11 1 
ATOM   6529  H  HD12 . LEU B 2 13  ? -6.146  52.151  20.853  1.00 127.78 ? 13   LEU B HD12 1 
ATOM   6530  H  HD13 . LEU B 2 13  ? -7.367  52.976  20.259  1.00 127.78 ? 13   LEU B HD13 1 
ATOM   6531  H  HD21 . LEU B 2 13  ? -5.352  50.316  17.950  1.00 120.15 ? 13   LEU B HD21 1 
ATOM   6532  H  HD22 . LEU B 2 13  ? -4.907  50.575  19.453  1.00 120.15 ? 13   LEU B HD22 1 
ATOM   6533  H  HD23 . LEU B 2 13  ? -6.244  49.773  19.147  1.00 120.15 ? 13   LEU B HD23 1 
ATOM   6534  N  N    . ALA B 2 14  ? -9.323  52.122  15.143  1.00 108.17 ? 14   ALA B N    1 
ATOM   6535  C  CA   . ALA B 2 14  ? -10.581 51.987  14.428  1.00 109.62 ? 14   ALA B CA   1 
ATOM   6536  C  C    . ALA B 2 14  ? -10.651 53.009  13.287  1.00 115.60 ? 14   ALA B C    1 
ATOM   6537  O  O    . ALA B 2 14  ? -11.054 54.157  13.496  1.00 108.70 ? 14   ALA B O    1 
ATOM   6538  C  CB   . ALA B 2 14  ? -11.755 52.159  15.392  1.00 99.40  ? 14   ALA B CB   1 
ATOM   6539  H  H    . ALA B 2 14  ? -8.990  52.914  15.114  1.00 129.80 ? 14   ALA B H    1 
ATOM   6540  H  HA   . ALA B 2 14  ? -10.634 51.099  14.042  1.00 131.55 ? 14   ALA B HA   1 
ATOM   6541  H  HB1  . ALA B 2 14  ? -11.706 53.040  15.795  1.00 119.28 ? 14   ALA B HB1  1 
ATOM   6542  H  HB2  . ALA B 2 14  ? -12.585 52.067  14.898  1.00 119.28 ? 14   ALA B HB2  1 
ATOM   6543  H  HB3  . ALA B 2 14  ? -11.702 51.477  16.080  1.00 119.28 ? 14   ALA B HB3  1 
ATOM   6544  N  N    . GLY B 2 15  ? -10.243 52.592  12.089  1.00 104.36 ? 15   GLY B N    1 
ATOM   6545  C  CA   . GLY B 2 15  ? -10.245 53.471  10.930  1.00 97.90  ? 15   GLY B CA   1 
ATOM   6546  C  C    . GLY B 2 15  ? -11.641 53.960  10.578  1.00 102.05 ? 15   GLY B C    1 
ATOM   6547  O  O    . GLY B 2 15  ? -11.815 54.911  9.808   1.00 96.60  ? 15   GLY B O    1 
ATOM   6548  H  H    . GLY B 2 15  ? -9.958  51.797  11.924  1.00 125.23 ? 15   GLY B H    1 
ATOM   6549  H  HA2  . GLY B 2 15  ? -9.685  54.242  11.108  1.00 117.48 ? 15   GLY B HA2  1 
ATOM   6550  H  HA3  . GLY B 2 15  ? -9.883  52.998  10.165  1.00 117.48 ? 15   GLY B HA3  1 
ATOM   6551  N  N    . TYR B 2 29  ? 4.691   43.804  3.129   1.00 93.24  ? 29   TYR B N    1 
ATOM   6552  C  CA   . TYR B 2 29  ? 4.282   44.865  4.038   1.00 105.48 ? 29   TYR B CA   1 
ATOM   6553  C  C    . TYR B 2 29  ? 4.278   46.220  3.349   1.00 119.21 ? 29   TYR B C    1 
ATOM   6554  O  O    . TYR B 2 29  ? 5.110   47.079  3.641   1.00 124.70 ? 29   TYR B O    1 
ATOM   6555  C  CB   . TYR B 2 29  ? 5.202   44.914  5.256   1.00 126.01 ? 29   TYR B CB   1 
ATOM   6556  C  CG   . TYR B 2 29  ? 5.343   43.598  5.988   1.00 123.56 ? 29   TYR B CG   1 
ATOM   6557  C  CD1  . TYR B 2 29  ? 4.243   42.982  6.576   1.00 113.20 ? 29   TYR B CD1  1 
ATOM   6558  C  CD2  . TYR B 2 29  ? 6.579   42.978  6.103   1.00 107.75 ? 29   TYR B CD2  1 
ATOM   6559  C  CE1  . TYR B 2 29  ? 4.374   41.782  7.251   1.00 106.97 ? 29   TYR B CE1  1 
ATOM   6560  C  CE2  . TYR B 2 29  ? 6.720   41.784  6.769   1.00 109.40 ? 29   TYR B CE2  1 
ATOM   6561  C  CZ   . TYR B 2 29  ? 5.619   41.188  7.345   1.00 116.34 ? 29   TYR B CZ   1 
ATOM   6562  O  OH   . TYR B 2 29  ? 5.781   39.995  8.011   1.00 117.88 ? 29   TYR B OH   1 
ATOM   6563  H  HA   . TYR B 2 29  ? 3.381   44.684  4.349   1.00 126.58 ? 29   TYR B HA   1 
ATOM   6564  H  HB2  . TYR B 2 29  ? 6.087   45.186  4.966   1.00 151.22 ? 29   TYR B HB2  1 
ATOM   6565  H  HB3  . TYR B 2 29  ? 4.850   45.564  5.884   1.00 151.22 ? 29   TYR B HB3  1 
ATOM   6566  H  HD1  . TYR B 2 29  ? 3.406   43.383  6.513   1.00 135.84 ? 29   TYR B HD1  1 
ATOM   6567  H  HD2  . TYR B 2 29  ? 7.326   43.376  5.717   1.00 129.30 ? 29   TYR B HD2  1 
ATOM   6568  H  HE1  . TYR B 2 29  ? 3.631   41.378  7.639   1.00 128.36 ? 29   TYR B HE1  1 
ATOM   6569  H  HE2  . TYR B 2 29  ? 7.556   41.383  6.835   1.00 131.28 ? 29   TYR B HE2  1 
ATOM   6570  H  HH   . TYR B 2 29  ? 5.044   39.733  8.316   1.00 141.45 ? 29   TYR B HH   1 
ATOM   6571  N  N    . LEU B 2 30  ? 3.344   46.401  2.424   1.00 135.38 ? 30   LEU B N    1 
ATOM   6572  C  CA   . LEU B 2 30  ? 3.260   47.628  1.643   1.00 138.75 ? 30   LEU B CA   1 
ATOM   6573  C  C    . LEU B 2 30  ? 2.225   48.582  2.229   1.00 139.35 ? 30   LEU B C    1 
ATOM   6574  O  O    . LEU B 2 30  ? 2.546   49.696  2.648   1.00 131.23 ? 30   LEU B O    1 
ATOM   6575  C  CB   . LEU B 2 30  ? 2.904   47.303  0.190   1.00 129.26 ? 30   LEU B CB   1 
ATOM   6576  C  CG   . LEU B 2 30  ? 3.920   46.449  -0.569  1.00 123.96 ? 30   LEU B CG   1 
ATOM   6577  C  CD1  . LEU B 2 30  ? 3.379   46.072  -1.936  1.00 115.36 ? 30   LEU B CD1  1 
ATOM   6578  C  CD2  . LEU B 2 30  ? 5.249   47.186  -0.709  1.00 132.99 ? 30   LEU B CD2  1 
ATOM   6579  H  H    . LEU B 2 30  ? 2.740   45.821  2.227   1.00 162.45 ? 30   LEU B H    1 
ATOM   6580  H  HA   . LEU B 2 30  ? 4.122   48.073  1.652   1.00 166.51 ? 30   LEU B HA   1 
ATOM   6581  H  HB2  . LEU B 2 30  ? 2.060   46.826  0.181   1.00 155.11 ? 30   LEU B HB2  1 
ATOM   6582  H  HB3  . LEU B 2 30  ? 2.808   48.138  -0.295  1.00 155.11 ? 30   LEU B HB3  1 
ATOM   6583  H  HG   . LEU B 2 30  ? 4.080   45.631  -0.073  1.00 148.75 ? 30   LEU B HG   1 
ATOM   6584  H  HD11 . LEU B 2 30  ? 3.202   46.882  -2.439  1.00 138.43 ? 30   LEU B HD11 1 
ATOM   6585  H  HD12 . LEU B 2 30  ? 4.038   45.532  -2.398  1.00 138.43 ? 30   LEU B HD12 1 
ATOM   6586  H  HD13 . LEU B 2 30  ? 2.558   45.568  -1.822  1.00 138.43 ? 30   LEU B HD13 1 
ATOM   6587  H  HD21 . LEU B 2 30  ? 5.596   47.381  0.175   1.00 159.58 ? 30   LEU B HD21 1 
ATOM   6588  H  HD22 . LEU B 2 30  ? 5.873   46.622  -1.193  1.00 159.58 ? 30   LEU B HD22 1 
ATOM   6589  H  HD23 . LEU B 2 30  ? 5.102   48.011  -1.197  1.00 159.58 ? 30   LEU B HD23 1 
ATOM   6590  N  N    . GLN B 2 31  ? 0.988   48.105  2.294   1.00 140.87 ? 31   GLN B N    1 
ATOM   6591  C  CA   . GLN B 2 31  ? -0.153  48.933  2.661   1.00 134.14 ? 31   GLN B CA   1 
ATOM   6592  C  C    . GLN B 2 31  ? -0.516  48.799  4.145   1.00 127.13 ? 31   GLN B C    1 
ATOM   6593  O  O    . GLN B 2 31  ? -0.464  47.700  4.698   1.00 125.26 ? 31   GLN B O    1 
ATOM   6594  C  CB   . GLN B 2 31  ? -1.351  48.542  1.785   1.00 136.27 ? 31   GLN B CB   1 
ATOM   6595  C  CG   . GLN B 2 31  ? -2.674  49.216  2.132   1.00 141.29 ? 31   GLN B CG   1 
ATOM   6596  C  CD   . GLN B 2 31  ? -3.871  48.471  1.562   1.00 141.99 ? 31   GLN B CD   1 
ATOM   6597  O  OE1  . GLN B 2 31  ? -3.729  47.626  0.676   1.00 135.55 ? 31   GLN B OE1  1 
ATOM   6598  N  NE2  . GLN B 2 31  ? -5.057  48.769  2.086   1.00 141.25 ? 31   GLN B NE2  1 
ATOM   6599  H  H    . GLN B 2 31  ? 0.780   47.288  2.127   1.00 169.04 ? 31   GLN B H    1 
ATOM   6600  H  HA   . GLN B 2 31  ? 0.059   49.863  2.485   1.00 160.96 ? 31   GLN B HA   1 
ATOM   6601  H  HB2  . GLN B 2 31  ? -1.144  48.768  0.865   1.00 163.52 ? 31   GLN B HB2  1 
ATOM   6602  H  HB3  . GLN B 2 31  ? -1.485  47.584  1.860   1.00 163.52 ? 31   GLN B HB3  1 
ATOM   6603  H  HG2  . GLN B 2 31  ? -2.770  49.247  3.097   1.00 169.54 ? 31   GLN B HG2  1 
ATOM   6604  H  HG3  . GLN B 2 31  ? -2.677  50.115  1.768   1.00 169.54 ? 31   GLN B HG3  1 
ATOM   6605  H  HE21 . GLN B 2 31  ? -5.115  49.355  2.712   1.00 169.49 ? 31   GLN B HE21 1 
ATOM   6606  H  HE22 . GLN B 2 31  ? -5.765  48.375  1.798   1.00 169.49 ? 31   GLN B HE22 1 
ATOM   6607  N  N    . PRO B 2 32  ? -0.872  49.922  4.800   1.00 123.90 ? 32   PRO B N    1 
ATOM   6608  C  CA   . PRO B 2 32  ? -1.400  49.866  6.170   1.00 124.90 ? 32   PRO B CA   1 
ATOM   6609  C  C    . PRO B 2 32  ? -2.634  48.968  6.285   1.00 126.01 ? 32   PRO B C    1 
ATOM   6610  O  O    . PRO B 2 32  ? -3.485  49.004  5.400   1.00 130.85 ? 32   PRO B O    1 
ATOM   6611  C  CB   . PRO B 2 32  ? -1.762  51.325  6.465   1.00 123.23 ? 32   PRO B CB   1 
ATOM   6612  C  CG   . PRO B 2 32  ? -0.833  52.114  5.624   1.00 123.64 ? 32   PRO B CG   1 
ATOM   6613  C  CD   . PRO B 2 32  ? -0.642  51.312  4.363   1.00 128.36 ? 32   PRO B CD   1 
ATOM   6614  H  HA   . PRO B 2 32  ? -0.716  49.566  6.790   1.00 149.88 ? 32   PRO B HA   1 
ATOM   6615  H  HB2  . PRO B 2 32  ? -2.683  51.493  6.212   1.00 147.88 ? 32   PRO B HB2  1 
ATOM   6616  H  HB3  . PRO B 2 32  ? -1.621  51.515  7.406   1.00 147.88 ? 32   PRO B HB3  1 
ATOM   6617  H  HG2  . PRO B 2 32  ? -1.228  52.976  5.423   1.00 148.37 ? 32   PRO B HG2  1 
ATOM   6618  H  HG3  . PRO B 2 32  ? 0.012   52.225  6.089   1.00 148.37 ? 32   PRO B HG3  1 
ATOM   6619  H  HD2  . PRO B 2 32  ? -1.298  51.569  3.697   1.00 154.04 ? 32   PRO B HD2  1 
ATOM   6620  H  HD3  . PRO B 2 32  ? 0.263   51.416  4.030   1.00 154.04 ? 32   PRO B HD3  1 
ATOM   6621  N  N    . PRO B 2 33  ? -2.743  48.174  7.362   1.00 124.12 ? 33   PRO B N    1 
ATOM   6622  C  CA   . PRO B 2 33  ? -3.977  47.392  7.502   1.00 121.66 ? 33   PRO B CA   1 
ATOM   6623  C  C    . PRO B 2 33  ? -5.176  48.252  7.900   1.00 130.22 ? 33   PRO B C    1 
ATOM   6624  O  O    . PRO B 2 33  ? -5.122  48.966  8.903   1.00 130.89 ? 33   PRO B O    1 
ATOM   6625  C  CB   . PRO B 2 33  ? -3.631  46.389  8.608   1.00 123.74 ? 33   PRO B CB   1 
ATOM   6626  C  CG   . PRO B 2 33  ? -2.578  47.079  9.426   1.00 121.55 ? 33   PRO B CG   1 
ATOM   6627  C  CD   . PRO B 2 33  ? -1.784  47.909  8.450   1.00 123.12 ? 33   PRO B CD   1 
ATOM   6628  H  HA   . PRO B 2 33  ? -4.174  46.915  6.681   1.00 146.00 ? 33   PRO B HA   1 
ATOM   6629  H  HB2  . PRO B 2 33  ? -4.419  46.206  9.143   1.00 148.49 ? 33   PRO B HB2  1 
ATOM   6630  H  HB3  . PRO B 2 33  ? -3.283  45.573  8.214   1.00 148.49 ? 33   PRO B HB3  1 
ATOM   6631  H  HG2  . PRO B 2 33  ? -3.001  47.644  10.091  1.00 145.86 ? 33   PRO B HG2  1 
ATOM   6632  H  HG3  . PRO B 2 33  ? -2.010  46.417  9.851   1.00 145.86 ? 33   PRO B HG3  1 
ATOM   6633  H  HD2  . PRO B 2 33  ? -1.504  48.740  8.863   1.00 147.74 ? 33   PRO B HD2  1 
ATOM   6634  H  HD3  . PRO B 2 33  ? -1.026  47.405  8.116   1.00 147.74 ? 33   PRO B HD3  1 
ATOM   6635  N  N    . SER B 2 34  ? -6.240  48.177  7.103   1.00 131.41 ? 34   SER B N    1 
ATOM   6636  C  CA   . SER B 2 34  ? -7.478  48.904  7.366   1.00 123.76 ? 34   SER B CA   1 
ATOM   6637  C  C    . SER B 2 34  ? -8.428  48.017  8.162   1.00 114.51 ? 34   SER B C    1 
ATOM   6638  O  O    . SER B 2 34  ? -9.379  47.462  7.613   1.00 117.82 ? 34   SER B O    1 
ATOM   6639  C  CB   . SER B 2 34  ? -8.130  49.362  6.057   1.00 124.33 ? 34   SER B CB   1 
ATOM   6640  O  OG   . SER B 2 34  ? -8.472  48.260  5.235   1.00 126.32 ? 34   SER B OG   1 
ATOM   6641  H  H    . SER B 2 34  ? -6.268  47.701  6.387   1.00 157.70 ? 34   SER B H    1 
ATOM   6642  H  HA   . SER B 2 34  ? -7.280  49.691  7.898   1.00 148.51 ? 34   SER B HA   1 
ATOM   6643  H  HB2  . SER B 2 34  ? -8.936  49.860  6.265   1.00 149.20 ? 34   SER B HB2  1 
ATOM   6644  H  HB3  . SER B 2 34  ? -7.506  49.929  5.578   1.00 149.20 ? 34   SER B HB3  1 
ATOM   6645  H  HG   . SER B 2 34  ? -9.014  47.759  5.637   1.00 151.58 ? 34   SER B HG   1 
ATOM   6646  N  N    . GLU B 2 35  ? -8.158  47.883  9.455   1.00 109.94 ? 35   GLU B N    1 
ATOM   6647  C  CA   . GLU B 2 35  ? -8.950  47.020  10.322  1.00 109.53 ? 35   GLU B CA   1 
ATOM   6648  C  C    . GLU B 2 35  ? -9.043  47.556  11.743  1.00 118.70 ? 35   GLU B C    1 
ATOM   6649  O  O    . GLU B 2 35  ? -8.099  48.162  12.253  1.00 121.56 ? 35   GLU B O    1 
ATOM   6650  C  CB   . GLU B 2 35  ? -8.367  45.612  10.359  1.00 107.67 ? 35   GLU B CB   1 
ATOM   6651  C  CG   . GLU B 2 35  ? -9.177  44.682  11.233  1.00 111.72 ? 35   GLU B CG   1 
ATOM   6652  C  CD   . GLU B 2 35  ? -8.619  43.290  11.281  1.00 116.11 ? 35   GLU B CD   1 
ATOM   6653  O  OE1  . GLU B 2 35  ? -7.941  42.879  10.314  1.00 102.36 ? 35   GLU B OE1  1 
ATOM   6654  O  OE2  . GLU B 2 35  ? -8.846  42.621  12.311  1.00 124.73 ? 35   GLU B OE2  1 
ATOM   6655  H  H    . GLU B 2 35  ? -7.514  48.285  9.859   1.00 131.93 ? 35   GLU B H    1 
ATOM   6656  H  HA   . GLU B 2 35  ? -9.851  46.960  9.966   1.00 131.43 ? 35   GLU B HA   1 
ATOM   6657  H  HB2  . GLU B 2 35  ? -8.356  45.249  9.460   1.00 129.20 ? 35   GLU B HB2  1 
ATOM   6658  H  HB3  . GLU B 2 35  ? -7.465  45.651  10.714  1.00 129.20 ? 35   GLU B HB3  1 
ATOM   6659  H  HG2  . GLU B 2 35  ? -9.190  45.030  12.138  1.00 134.07 ? 35   GLU B HG2  1 
ATOM   6660  H  HG3  . GLU B 2 35  ? -10.081 44.630  10.885  1.00 134.07 ? 35   GLU B HG3  1 
ATOM   6661  N  N    . ASN B 2 36  ? -10.191 47.333  12.377  1.00 118.64 ? 36   ASN B N    1 
ATOM   6662  C  CA   . ASN B 2 36  ? -10.381 47.755  13.759  1.00 118.72 ? 36   ASN B CA   1 
ATOM   6663  C  C    . ASN B 2 36  ? -9.786  46.757  14.742  1.00 114.69 ? 36   ASN B C    1 
ATOM   6664  O  O    . ASN B 2 36  ? -9.994  45.546  14.631  1.00 109.68 ? 36   ASN B O    1 
ATOM   6665  C  CB   . ASN B 2 36  ? -11.868 47.946  14.072  1.00 107.30 ? 36   ASN B CB   1 
ATOM   6666  C  CG   . ASN B 2 36  ? -12.522 48.993  13.190  1.00 120.05 ? 36   ASN B CG   1 
ATOM   6667  O  OD1  . ASN B 2 36  ? -11.844 49.753  12.493  1.00 122.25 ? 36   ASN B OD1  1 
ATOM   6668  N  ND2  . ASN B 2 36  ? -13.848 49.040  13.216  1.00 115.85 ? 36   ASN B ND2  1 
ATOM   6669  H  H    . ASN B 2 36  ? -10.873 46.940  12.030  1.00 142.37 ? 36   ASN B H    1 
ATOM   6670  H  HA   . ASN B 2 36  ? -9.936  48.606  13.892  1.00 142.46 ? 36   ASN B HA   1 
ATOM   6671  H  HB2  . ASN B 2 36  ? -12.331 47.105  13.934  1.00 128.76 ? 36   ASN B HB2  1 
ATOM   6672  H  HB3  . ASN B 2 36  ? -11.963 48.230  14.995  1.00 128.76 ? 36   ASN B HB3  1 
ATOM   6673  H  HD21 . ASN B 2 36  ? -14.287 48.494  13.716  1.00 139.02 ? 36   ASN B HD21 1 
ATOM   6674  H  HD22 . ASN B 2 36  ? -14.268 49.615  12.734  1.00 139.02 ? 36   ASN B HD22 1 
ATOM   6675  N  N    . ILE B 2 37  ? -9.046  47.291  15.708  1.00 113.08 ? 37   ILE B N    1 
ATOM   6676  C  CA   . ILE B 2 37  ? -8.476  46.506  16.793  1.00 99.49  ? 37   ILE B CA   1 
ATOM   6677  C  C    . ILE B 2 37  ? -8.732  47.222  18.105  1.00 98.34  ? 37   ILE B C    1 
ATOM   6678  O  O    . ILE B 2 37  ? -8.801  48.450  18.149  1.00 103.69 ? 37   ILE B O    1 
ATOM   6679  C  CB   . ILE B 2 37  ? -6.959  46.282  16.609  1.00 105.51 ? 37   ILE B CB   1 
ATOM   6680  C  CG1  . ILE B 2 37  ? -6.254  47.624  16.357  1.00 108.68 ? 37   ILE B CG1  1 
ATOM   6681  C  CG2  . ILE B 2 37  ? -6.713  45.311  15.454  1.00 108.81 ? 37   ILE B CG2  1 
ATOM   6682  C  CD1  . ILE B 2 37  ? -4.753  47.530  16.119  1.00 98.30  ? 37   ILE B CD1  1 
ATOM   6683  H  H    . ILE B 2 37  ? -8.857  48.128  15.756  1.00 135.70 ? 37   ILE B H    1 
ATOM   6684  H  HA   . ILE B 2 37  ? -8.912  45.640  16.827  1.00 119.39 ? 37   ILE B HA   1 
ATOM   6685  H  HB   . ILE B 2 37  ? -6.603  45.893  17.422  1.00 126.61 ? 37   ILE B HB   1 
ATOM   6686  H  HG12 . ILE B 2 37  ? -6.648  48.038  15.573  1.00 130.41 ? 37   ILE B HG12 1 
ATOM   6687  H  HG13 . ILE B 2 37  ? -6.392  48.195  17.129  1.00 130.41 ? 37   ILE B HG13 1 
ATOM   6688  H  HG21 . ILE B 2 37  ? -7.087  45.686  14.641  1.00 130.57 ? 37   ILE B HG21 1 
ATOM   6689  H  HG22 . ILE B 2 37  ? -5.758  45.180  15.350  1.00 130.57 ? 37   ILE B HG22 1 
ATOM   6690  H  HG23 . ILE B 2 37  ? -7.143  44.465  15.657  1.00 130.57 ? 37   ILE B HG23 1 
ATOM   6691  H  HD11 . ILE B 2 37  ? -4.592  46.976  15.339  1.00 117.96 ? 37   ILE B HD11 1 
ATOM   6692  H  HD12 . ILE B 2 37  ? -4.401  48.421  15.971  1.00 117.96 ? 37   ILE B HD12 1 
ATOM   6693  H  HD13 . ILE B 2 37  ? -4.335  47.133  16.899  1.00 117.96 ? 37   ILE B HD13 1 
ATOM   6694  N  N    . SER B 2 38  ? -8.893  46.456  19.174  1.00 103.71 ? 38   SER B N    1 
ATOM   6695  C  CA   . SER B 2 38  ? -9.105  47.045  20.483  1.00 99.98  ? 38   SER B CA   1 
ATOM   6696  C  C    . SER B 2 38  ? -7.755  47.433  21.059  1.00 106.34 ? 38   SER B C    1 
ATOM   6697  O  O    . SER B 2 38  ? -6.716  46.971  20.585  1.00 103.70 ? 38   SER B O    1 
ATOM   6698  C  CB   . SER B 2 38  ? -9.825  46.072  21.410  1.00 105.55 ? 38   SER B CB   1 
ATOM   6699  O  OG   . SER B 2 38  ? -8.951  45.040  21.833  1.00 106.29 ? 38   SER B OG   1 
ATOM   6700  H  H    . SER B 2 38  ? -8.883  45.596  19.167  1.00 124.45 ? 38   SER B H    1 
ATOM   6701  H  HA   . SER B 2 38  ? -9.645  47.845  20.395  1.00 119.98 ? 38   SER B HA   1 
ATOM   6702  H  HB2  . SER B 2 38  ? -10.144 46.555  22.189  1.00 126.66 ? 38   SER B HB2  1 
ATOM   6703  H  HB3  . SER B 2 38  ? -10.573 45.677  20.935  1.00 126.66 ? 38   SER B HB3  1 
ATOM   6704  H  HG   . SER B 2 38  ? -9.357  44.511  22.343  1.00 127.54 ? 38   SER B HG   1 
ATOM   6705  N  N    . LEU B 2 39  ? -7.774  48.294  22.068  1.00 113.68 ? 39   LEU B N    1 
ATOM   6706  C  CA   . LEU B 2 39  ? -6.545  48.765  22.696  1.00 102.36 ? 39   LEU B CA   1 
ATOM   6707  C  C    . LEU B 2 39  ? -5.802  47.633  23.405  1.00 93.52  ? 39   LEU B C    1 
ATOM   6708  O  O    . LEU B 2 39  ? -4.560  47.607  23.439  1.00 102.74 ? 39   LEU B O    1 
ATOM   6709  C  CB   . LEU B 2 39  ? -6.867  49.885  23.681  1.00 99.28  ? 39   LEU B CB   1 
ATOM   6710  C  CG   . LEU B 2 39  ? -5.682  50.582  24.344  1.00 104.82 ? 39   LEU B CG   1 
ATOM   6711  C  CD1  . LEU B 2 39  ? -4.702  51.121  23.308  1.00 103.00 ? 39   LEU B CD1  1 
ATOM   6712  C  CD2  . LEU B 2 39  ? -6.196  51.706  25.231  1.00 101.20 ? 39   LEU B CD2  1 
ATOM   6713  H  H    . LEU B 2 39  ? -8.490  48.624  22.410  1.00 136.41 ? 39   LEU B H    1 
ATOM   6714  H  HA   . LEU B 2 39  ? -5.960  49.125  22.012  1.00 122.83 ? 39   LEU B HA   1 
ATOM   6715  H  HB2  . LEU B 2 39  ? -7.371  50.566  23.210  1.00 119.13 ? 39   LEU B HB2  1 
ATOM   6716  H  HB3  . LEU B 2 39  ? -7.415  49.515  24.391  1.00 119.13 ? 39   LEU B HB3  1 
ATOM   6717  H  HG   . LEU B 2 39  ? -5.211  49.945  24.904  1.00 125.78 ? 39   LEU B HG   1 
ATOM   6718  H  HD11 . LEU B 2 39  ? -5.162  51.760  22.741  1.00 123.60 ? 39   LEU B HD11 1 
ATOM   6719  H  HD12 . LEU B 2 39  ? -3.965  51.556  23.766  1.00 123.60 ? 39   LEU B HD12 1 
ATOM   6720  H  HD13 . LEU B 2 39  ? -4.370  50.383  22.773  1.00 123.60 ? 39   LEU B HD13 1 
ATOM   6721  H  HD21 . LEU B 2 39  ? -6.779  51.331  25.909  1.00 121.44 ? 39   LEU B HD21 1 
ATOM   6722  H  HD22 . LEU B 2 39  ? -5.440  52.146  25.651  1.00 121.44 ? 39   LEU B HD22 1 
ATOM   6723  H  HD23 . LEU B 2 39  ? -6.686  52.340  24.685  1.00 121.44 ? 39   LEU B HD23 1 
ATOM   6724  N  N    . ILE B 2 40  ? -6.566  46.678  23.931  1.00 88.05  ? 40   ILE B N    1 
ATOM   6725  C  CA   . ILE B 2 40  ? -5.984  45.555  24.659  1.00 106.24 ? 40   ILE B CA   1 
ATOM   6726  C  C    . ILE B 2 40  ? -5.255  44.659  23.666  1.00 106.07 ? 40   ILE B C    1 
ATOM   6727  O  O    . ILE B 2 40  ? -4.109  44.227  23.894  1.00 104.03 ? 40   ILE B O    1 
ATOM   6728  C  CB   . ILE B 2 40  ? -7.073  44.741  25.408  1.00 104.01 ? 40   ILE B CB   1 
ATOM   6729  C  CG1  . ILE B 2 40  ? -7.785  45.633  26.435  1.00 108.43 ? 40   ILE B CG1  1 
ATOM   6730  C  CG2  . ILE B 2 40  ? -6.459  43.489  26.061  1.00 103.67 ? 40   ILE B CG2  1 
ATOM   6731  C  CD1  . ILE B 2 40  ? -8.762  44.908  27.351  1.00 94.35  ? 40   ILE B CD1  1 
ATOM   6732  H  H    . ILE B 2 40  ? -7.424  46.657  23.881  1.00 105.66 ? 40   ILE B H    1 
ATOM   6733  H  HA   . ILE B 2 40  ? -5.342  45.885  25.307  1.00 127.49 ? 40   ILE B HA   1 
ATOM   6734  H  HB   . ILE B 2 40  ? -7.730  44.449  24.758  1.00 124.81 ? 40   ILE B HB   1 
ATOM   6735  H  HG12 . ILE B 2 40  ? -7.114  46.053  26.996  1.00 130.12 ? 40   ILE B HG12 1 
ATOM   6736  H  HG13 . ILE B 2 40  ? -8.283  46.316  25.958  1.00 130.12 ? 40   ILE B HG13 1 
ATOM   6737  H  HG21 . ILE B 2 40  ? -5.776  43.766  26.692  1.00 124.41 ? 40   ILE B HG21 1 
ATOM   6738  H  HG22 . ILE B 2 40  ? -7.157  42.999  26.522  1.00 124.41 ? 40   ILE B HG22 1 
ATOM   6739  H  HG23 . ILE B 2 40  ? -6.065  42.934  25.370  1.00 124.41 ? 40   ILE B HG23 1 
ATOM   6740  H  HD11 . ILE B 2 40  ? -8.281  44.230  27.852  1.00 113.22 ? 40   ILE B HD11 1 
ATOM   6741  H  HD12 . ILE B 2 40  ? -9.159  45.550  27.960  1.00 113.22 ? 40   ILE B HD12 1 
ATOM   6742  H  HD13 . ILE B 2 40  ? -9.452  44.493  26.811  1.00 113.22 ? 40   ILE B HD13 1 
ATOM   6743  N  N    . GLU B 2 41  ? -5.914  44.437  22.534  1.00 104.58 ? 41   GLU B N    1 
ATOM   6744  C  CA   . GLU B 2 41  ? -5.350  43.632  21.470  1.00 98.86  ? 41   GLU B CA   1 
ATOM   6745  C  C    . GLU B 2 41  ? -4.147  44.377  20.913  1.00 103.78 ? 41   GLU B C    1 
ATOM   6746  O  O    . GLU B 2 41  ? -3.116  43.780  20.656  1.00 110.59 ? 41   GLU B O    1 
ATOM   6747  C  CB   . GLU B 2 41  ? -6.383  43.349  20.381  1.00 106.07 ? 41   GLU B CB   1 
ATOM   6748  C  CG   . GLU B 2 41  ? -5.924  42.306  19.381  1.00 107.11 ? 41   GLU B CG   1 
ATOM   6749  C  CD   . GLU B 2 41  ? -6.870  42.159  18.213  1.00 107.75 ? 41   GLU B CD   1 
ATOM   6750  O  OE1  . GLU B 2 41  ? -7.831  42.952  18.122  1.00 111.61 ? 41   GLU B OE1  1 
ATOM   6751  O  OE2  . GLU B 2 41  ? -6.652  41.246  17.388  1.00 102.67 ? 41   GLU B OE2  1 
ATOM   6752  H  H    . GLU B 2 41  ? -6.697  44.746  22.361  1.00 125.49 ? 41   GLU B H    1 
ATOM   6753  H  HA   . GLU B 2 41  ? -5.046  42.785  21.832  1.00 118.63 ? 41   GLU B HA   1 
ATOM   6754  H  HB2  . GLU B 2 41  ? -7.198  43.027  20.796  1.00 127.28 ? 41   GLU B HB2  1 
ATOM   6755  H  HB3  . GLU B 2 41  ? -6.561  44.170  19.896  1.00 127.28 ? 41   GLU B HB3  1 
ATOM   6756  H  HG2  . GLU B 2 41  ? -5.055  42.562  19.033  1.00 128.53 ? 41   GLU B HG2  1 
ATOM   6757  H  HG3  . GLU B 2 41  ? -5.862  41.447  19.826  1.00 128.53 ? 41   GLU B HG3  1 
ATOM   6758  N  N    . PHE B 2 42  ? -4.294  45.686  20.732  1.00 98.73  ? 42   PHE B N    1 
ATOM   6759  C  CA   . PHE B 2 42  ? -3.208  46.540  20.254  1.00 90.95  ? 42   PHE B CA   1 
ATOM   6760  C  C    . PHE B 2 42  ? -1.925  46.337  21.054  1.00 95.58  ? 42   PHE B C    1 
ATOM   6761  O  O    . PHE B 2 42  ? -0.880  45.936  20.500  1.00 100.17 ? 42   PHE B O    1 
ATOM   6762  C  CB   . PHE B 2 42  ? -3.643  48.002  20.340  1.00 92.18  ? 42   PHE B CB   1 
ATOM   6763  C  CG   . PHE B 2 42  ? -2.614  48.977  19.860  1.00 99.31  ? 42   PHE B CG   1 
ATOM   6764  C  CD1  . PHE B 2 42  ? -2.545  49.338  18.529  1.00 91.66  ? 42   PHE B CD1  1 
ATOM   6765  C  CD2  . PHE B 2 42  ? -1.724  49.551  20.756  1.00 97.72  ? 42   PHE B CD2  1 
ATOM   6766  C  CE1  . PHE B 2 42  ? -1.598  50.247  18.093  1.00 95.41  ? 42   PHE B CE1  1 
ATOM   6767  C  CE2  . PHE B 2 42  ? -0.776  50.461  20.330  1.00 92.63  ? 42   PHE B CE2  1 
ATOM   6768  C  CZ   . PHE B 2 42  ? -0.712  50.813  18.995  1.00 92.62  ? 42   PHE B CZ   1 
ATOM   6769  H  H    . PHE B 2 42  ? -5.026  46.112  20.881  1.00 118.48 ? 42   PHE B H    1 
ATOM   6770  H  HA   . PHE B 2 42  ? -3.023  46.332  19.325  1.00 109.14 ? 42   PHE B HA   1 
ATOM   6771  H  HB2  . PHE B 2 42  ? -4.439  48.122  19.799  1.00 110.61 ? 42   PHE B HB2  1 
ATOM   6772  H  HB3  . PHE B 2 42  ? -3.841  48.213  21.265  1.00 110.61 ? 42   PHE B HB3  1 
ATOM   6773  H  HD1  . PHE B 2 42  ? -3.138  48.963  17.918  1.00 110.00 ? 42   PHE B HD1  1 
ATOM   6774  H  HD2  . PHE B 2 42  ? -1.765  49.318  21.655  1.00 117.27 ? 42   PHE B HD2  1 
ATOM   6775  H  HE1  . PHE B 2 42  ? -1.558  50.481  17.194  1.00 114.50 ? 42   PHE B HE1  1 
ATOM   6776  H  HE2  . PHE B 2 42  ? -0.183  50.836  20.940  1.00 111.16 ? 42   PHE B HE2  1 
ATOM   6777  H  HZ   . PHE B 2 42  ? -0.074  51.423  18.703  1.00 111.14 ? 42   PHE B HZ   1 
ATOM   6778  N  N    . GLU B 2 43  ? -1.999  46.588  22.359  1.00 102.73 ? 43   GLU B N    1 
ATOM   6779  C  CA   . GLU B 2 43  ? -0.793  46.487  23.178  1.00 108.22 ? 43   GLU B CA   1 
ATOM   6780  C  C    . GLU B 2 43  ? -0.309  45.028  23.250  1.00 106.70 ? 43   GLU B C    1 
ATOM   6781  O  O    . GLU B 2 43  ? 0.902   44.773  23.182  1.00 93.38  ? 43   GLU B O    1 
ATOM   6782  C  CB   . GLU B 2 43  ? -1.014  47.069  24.583  1.00 100.27 ? 43   GLU B CB   1 
ATOM   6783  C  CG   . GLU B 2 43  ? -2.204  46.543  25.366  1.00 110.92 ? 43   GLU B CG   1 
ATOM   6784  C  CD   . GLU B 2 43  ? -2.543  47.434  26.556  1.00 115.04 ? 43   GLU B CD   1 
ATOM   6785  O  OE1  . GLU B 2 43  ? -2.699  48.661  26.365  1.00 99.52  ? 43   GLU B OE1  1 
ATOM   6786  O  OE2  . GLU B 2 43  ? -2.653  46.908  27.683  1.00 127.05 ? 43   GLU B OE2  1 
ATOM   6787  H  H    . GLU B 2 43  ? -2.713  46.811  22.785  1.00 123.28 ? 43   GLU B H    1 
ATOM   6788  H  HA   . GLU B 2 43  ? -0.091  47.006  22.755  1.00 129.86 ? 43   GLU B HA   1 
ATOM   6789  H  HB2  . GLU B 2 43  ? -0.221  46.889  25.112  1.00 120.33 ? 43   GLU B HB2  1 
ATOM   6790  H  HB3  . GLU B 2 43  ? -1.129  48.028  24.497  1.00 120.33 ? 43   GLU B HB3  1 
ATOM   6791  H  HG2  . GLU B 2 43  ? -2.978  46.510  24.783  1.00 133.10 ? 43   GLU B HG2  1 
ATOM   6792  H  HG3  . GLU B 2 43  ? -1.998  45.657  25.701  1.00 133.10 ? 43   GLU B HG3  1 
ATOM   6793  N  N    . ASN B 2 44  ? -1.237  44.073  23.350  1.00 109.80 ? 44   ASN B N    1 
ATOM   6794  C  CA   . ASN B 2 44  ? -0.848  42.659  23.354  1.00 104.25 ? 44   ASN B CA   1 
ATOM   6795  C  C    . ASN B 2 44  ? -0.106  42.252  22.069  1.00 103.78 ? 44   ASN B C    1 
ATOM   6796  O  O    . ASN B 2 44  ? 0.910   41.545  22.112  1.00 103.53 ? 44   ASN B O    1 
ATOM   6797  C  CB   . ASN B 2 44  ? -2.085  41.773  23.537  1.00 99.04  ? 44   ASN B CB   1 
ATOM   6798  C  CG   . ASN B 2 44  ? -2.397  41.498  24.998  1.00 108.30 ? 44   ASN B CG   1 
ATOM   6799  O  OD1  . ASN B 2 44  ? -1.855  42.148  25.894  1.00 112.82 ? 44   ASN B OD1  1 
ATOM   6800  N  ND2  . ASN B 2 44  ? -3.279  40.532  25.247  1.00 104.96 ? 44   ASN B ND2  1 
ATOM   6801  H  H    . ASN B 2 44  ? -2.083  44.213  23.415  1.00 131.77 ? 44   ASN B H    1 
ATOM   6802  H  HA   . ASN B 2 44  ? -0.254  42.500  24.104  1.00 125.11 ? 44   ASN B HA   1 
ATOM   6803  H  HB2  . ASN B 2 44  ? -2.852  42.216  23.144  1.00 118.85 ? 44   ASN B HB2  1 
ATOM   6804  H  HB3  . ASN B 2 44  ? -1.931  40.922  23.098  1.00 118.85 ? 44   ASN B HB3  1 
ATOM   6805  H  HD21 . ASN B 2 44  ? -3.638  40.100  24.595  1.00 125.95 ? 44   ASN B HD21 1 
ATOM   6806  H  HD22 . ASN B 2 44  ? -3.488  40.339  26.058  1.00 125.95 ? 44   ASN B HD22 1 
ATOM   6807  N  N    . LEU B 2 45  ? -0.606  42.731  20.933  1.00 101.10 ? 45   LEU B N    1 
ATOM   6808  C  CA   . LEU B 2 45  ? -0.041  42.404  19.627  1.00 95.78  ? 45   LEU B CA   1 
ATOM   6809  C  C    . LEU B 2 45  ? 1.364   42.977  19.514  1.00 96.26  ? 45   LEU B C    1 
ATOM   6810  O  O    . LEU B 2 45  ? 2.319   42.293  19.090  1.00 98.82  ? 45   LEU B O    1 
ATOM   6811  C  CB   . LEU B 2 45  ? -0.932  42.972  18.513  1.00 103.88 ? 45   LEU B CB   1 
ATOM   6812  C  CG   . LEU B 2 45  ? -1.217  42.223  17.207  1.00 100.40 ? 45   LEU B CG   1 
ATOM   6813  C  CD1  . LEU B 2 45  ? -1.412  40.734  17.417  1.00 100.85 ? 45   LEU B CD1  1 
ATOM   6814  C  CD2  . LEU B 2 45  ? -2.453  42.829  16.539  1.00 87.29  ? 45   LEU B CD2  1 
ATOM   6815  H  H    . LEU B 2 45  ? -1.285  43.257  20.892  1.00 121.31 ? 45   LEU B H    1 
ATOM   6816  H  HA   . LEU B 2 45  ? 0.008   41.440  19.525  1.00 114.94 ? 45   LEU B HA   1 
ATOM   6817  H  HB2  . LEU B 2 45  ? -1.800  43.145  18.911  1.00 124.66 ? 45   LEU B HB2  1 
ATOM   6818  H  HB3  . LEU B 2 45  ? -0.545  43.821  18.251  1.00 124.66 ? 45   LEU B HB3  1 
ATOM   6819  H  HG   . LEU B 2 45  ? -0.464  42.343  16.607  1.00 120.48 ? 45   LEU B HG   1 
ATOM   6820  H  HD11 . LEU B 2 45  ? -2.164  40.595  18.014  1.00 121.02 ? 45   LEU B HD11 1 
ATOM   6821  H  HD12 . LEU B 2 45  ? -1.588  40.315  16.560  1.00 121.02 ? 45   LEU B HD12 1 
ATOM   6822  H  HD13 . LEU B 2 45  ? -0.606  40.362  17.809  1.00 121.02 ? 45   LEU B HD13 1 
ATOM   6823  H  HD21 . LEU B 2 45  ? -2.284  43.765  16.352  1.00 104.75 ? 45   LEU B HD21 1 
ATOM   6824  H  HD22 . LEU B 2 45  ? -2.630  42.352  15.713  1.00 104.75 ? 45   LEU B HD22 1 
ATOM   6825  H  HD23 . LEU B 2 45  ? -3.210  42.743  17.140  1.00 104.75 ? 45   LEU B HD23 1 
ATOM   6826  N  N    . ALA B 2 46  ? 1.490   44.232  19.941  1.00 105.28 ? 46   ALA B N    1 
ATOM   6827  C  CA   . ALA B 2 46  ? 2.782   44.906  19.906  1.00 99.03  ? 46   ALA B CA   1 
ATOM   6828  C  C    . ALA B 2 46  ? 3.778   44.168  20.795  1.00 95.38  ? 46   ALA B C    1 
ATOM   6829  O  O    . ALA B 2 46  ? 4.888   43.842  20.366  1.00 93.20  ? 46   ALA B O    1 
ATOM   6830  C  CB   . ALA B 2 46  ? 2.643   46.346  20.347  1.00 84.00  ? 46   ALA B CB   1 
ATOM   6831  H  H    . ALA B 2 46  ? 0.847   44.711  20.252  1.00 126.34 ? 46   ALA B H    1 
ATOM   6832  H  HA   . ALA B 2 46  ? 3.123   44.898  18.997  1.00 118.84 ? 46   ALA B HA   1 
ATOM   6833  H  HB1  . ALA B 2 46  ? 2.297   46.367  21.253  1.00 100.80 ? 46   ALA B HB1  1 
ATOM   6834  H  HB2  . ALA B 2 46  ? 3.514   46.772  20.316  1.00 100.80 ? 46   ALA B HB2  1 
ATOM   6835  H  HB3  . ALA B 2 46  ? 2.030   46.802  19.749  1.00 100.80 ? 46   ALA B HB3  1 
ATOM   6836  N  N    . ILE B 2 47  ? 3.368   43.888  22.028  1.00 98.55  ? 47   ILE B N    1 
ATOM   6837  C  CA   . ILE B 2 47  ? 4.229   43.196  22.983  1.00 106.47 ? 47   ILE B CA   1 
ATOM   6838  C  C    . ILE B 2 47  ? 4.680   41.842  22.410  1.00 102.98 ? 47   ILE B C    1 
ATOM   6839  O  O    . ILE B 2 47  ? 5.867   41.459  22.509  1.00 94.88  ? 47   ILE B O    1 
ATOM   6840  C  CB   . ILE B 2 47  ? 3.496   43.008  24.326  1.00 108.81 ? 47   ILE B CB   1 
ATOM   6841  C  CG1  . ILE B 2 47  ? 3.343   44.368  25.018  1.00 110.34 ? 47   ILE B CG1  1 
ATOM   6842  C  CG2  . ILE B 2 47  ? 4.246   42.028  25.231  1.00 108.24 ? 47   ILE B CG2  1 
ATOM   6843  C  CD1  . ILE B 2 47  ? 2.432   44.355  26.228  1.00 113.70 ? 47   ILE B CD1  1 
ATOM   6844  H  H    . ILE B 2 47  ? 2.591   44.089  22.339  1.00 118.26 ? 47   ILE B H    1 
ATOM   6845  H  HA   . ILE B 2 47  ? 5.020   43.734  23.144  1.00 127.77 ? 47   ILE B HA   1 
ATOM   6846  H  HB   . ILE B 2 47  ? 2.612   42.650  24.148  1.00 130.58 ? 47   ILE B HB   1 
ATOM   6847  H  HG12 . ILE B 2 47  ? 4.218   44.667  25.311  1.00 132.41 ? 47   ILE B HG12 1 
ATOM   6848  H  HG13 . ILE B 2 47  ? 2.977   45.001  24.381  1.00 132.41 ? 47   ILE B HG13 1 
ATOM   6849  H  HG21 . ILE B 2 47  ? 5.135   42.376  25.405  1.00 129.89 ? 47   ILE B HG21 1 
ATOM   6850  H  HG22 . ILE B 2 47  ? 3.759   41.933  26.065  1.00 129.89 ? 47   ILE B HG22 1 
ATOM   6851  H  HG23 . ILE B 2 47  ? 4.307   41.169  24.784  1.00 129.89 ? 47   ILE B HG23 1 
ATOM   6852  H  HD11 . ILE B 2 47  ? 2.789   43.737  26.885  1.00 136.44 ? 47   ILE B HD11 1 
ATOM   6853  H  HD12 . ILE B 2 47  ? 2.393   45.250  26.603  1.00 136.44 ? 47   ILE B HD12 1 
ATOM   6854  H  HD13 . ILE B 2 47  ? 1.546   44.072  25.954  1.00 136.44 ? 47   ILE B HD13 1 
ATOM   6855  N  N    . ASP B 2 48  ? 3.735   41.138  21.784  1.00 104.41 ? 48   ASP B N    1 
ATOM   6856  C  CA   . ASP B 2 48  ? 4.026   39.836  21.183  1.00 109.26 ? 48   ASP B CA   1 
ATOM   6857  C  C    . ASP B 2 48  ? 5.108   39.981  20.112  1.00 103.81 ? 48   ASP B C    1 
ATOM   6858  O  O    . ASP B 2 48  ? 6.095   39.228  20.102  1.00 100.11 ? 48   ASP B O    1 
ATOM   6859  C  CB   . ASP B 2 48  ? 2.761   39.213  20.571  1.00 115.42 ? 48   ASP B CB   1 
ATOM   6860  C  CG   . ASP B 2 48  ? 1.850   38.559  21.611  1.00 120.85 ? 48   ASP B CG   1 
ATOM   6861  O  OD1  . ASP B 2 48  ? 2.368   37.980  22.594  1.00 113.15 ? 48   ASP B OD1  1 
ATOM   6862  O  OD2  . ASP B 2 48  ? 0.610   38.614  21.432  1.00 114.58 ? 48   ASP B OD2  1 
ATOM   6863  H  H    . ASP B 2 48  ? 2.918   41.393  21.694  1.00 125.29 ? 48   ASP B H    1 
ATOM   6864  H  HA   . ASP B 2 48  ? 4.358   39.235  21.869  1.00 131.11 ? 48   ASP B HA   1 
ATOM   6865  H  HB2  . ASP B 2 48  ? 2.253   39.908  20.124  1.00 138.50 ? 48   ASP B HB2  1 
ATOM   6866  H  HB3  . ASP B 2 48  ? 3.023   38.532  19.932  1.00 138.50 ? 48   ASP B HB3  1 
ATOM   6867  N  N    . ARG B 2 49  ? 4.927   40.925  19.189  1.00 101.54 ? 49   ARG B N    1 
ATOM   6868  C  CA   . ARG B 2 49  ? 5.922   41.054  18.127  1.00 92.36  ? 49   ARG B CA   1 
ATOM   6869  C  C    . ARG B 2 49  ? 7.264   41.545  18.668  1.00 86.50  ? 49   ARG B C    1 
ATOM   6870  O  O    . ARG B 2 49  ? 8.313   41.190  18.130  1.00 85.39  ? 49   ARG B O    1 
ATOM   6871  C  CB   . ARG B 2 49  ? 5.460   41.986  17.020  1.00 86.34  ? 49   ARG B CB   1 
ATOM   6872  C  CG   . ARG B 2 49  ? 6.362   41.889  15.804  1.00 86.80  ? 49   ARG B CG   1 
ATOM   6873  C  CD   . ARG B 2 49  ? 5.915   42.772  14.677  1.00 84.77  ? 49   ARG B CD   1 
ATOM   6874  N  NE   . ARG B 2 49  ? 6.511   42.334  13.420  1.00 92.31  ? 49   ARG B NE   1 
ATOM   6875  C  CZ   . ARG B 2 49  ? 6.006   41.365  12.658  1.00 95.36  ? 49   ARG B CZ   1 
ATOM   6876  N  NH1  . ARG B 2 49  ? 4.914   40.717  13.038  1.00 91.47  ? 49   ARG B NH1  1 
ATOM   6877  N  NH2  . ARG B 2 49  ? 6.605   41.023  11.525  1.00 95.54  ? 49   ARG B NH2  1 
ATOM   6878  H  H    . ARG B 2 49  ? 4.269   41.478  19.153  1.00 121.85 ? 49   ARG B H    1 
ATOM   6879  H  HA   . ARG B 2 49  ? 6.067   40.180  17.732  1.00 110.83 ? 49   ARG B HA   1 
ATOM   6880  H  HB2  . ARG B 2 49  ? 4.560   41.744  16.752  1.00 103.61 ? 49   ARG B HB2  1 
ATOM   6881  H  HB3  . ARG B 2 49  ? 5.481   42.901  17.342  1.00 103.61 ? 49   ARG B HB3  1 
ATOM   6882  H  HG2  . ARG B 2 49  ? 7.260   42.154  16.055  1.00 104.16 ? 49   ARG B HG2  1 
ATOM   6883  H  HG3  . ARG B 2 49  ? 6.363   40.973  15.485  1.00 104.16 ? 49   ARG B HG3  1 
ATOM   6884  H  HD2  . ARG B 2 49  ? 4.950   42.725  14.593  1.00 101.73 ? 49   ARG B HD2  1 
ATOM   6885  H  HD3  . ARG B 2 49  ? 6.197   43.684  14.850  1.00 101.73 ? 49   ARG B HD3  1 
ATOM   6886  H  HE   . ARG B 2 49  ? 7.172   42.788  13.109  1.00 110.77 ? 49   ARG B HE   1 
ATOM   6887  H  HH11 . ARG B 2 49  ? 4.520   40.932  13.772  1.00 109.77 ? 49   ARG B HH11 1 
ATOM   6888  H  HH12 . ARG B 2 49  ? 4.594   40.089  12.546  1.00 109.77 ? 49   ARG B HH12 1 
ATOM   6889  H  HH21 . ARG B 2 49  ? 7.316   41.436  11.273  1.00 114.64 ? 49   ARG B HH21 1 
ATOM   6890  H  HH22 . ARG B 2 49  ? 6.279   40.393  11.040  1.00 114.64 ? 49   ARG B HH22 1 
ATOM   6891  N  N    . VAL B 2 50  ? 7.247   42.381  19.703  1.00 88.47  ? 50   VAL B N    1 
ATOM   6892  C  CA   . VAL B 2 50  ? 8.505   42.800  20.313  1.00 89.14  ? 50   VAL B CA   1 
ATOM   6893  C  C    . VAL B 2 50  ? 9.243   41.570  20.824  1.00 91.73  ? 50   VAL B C    1 
ATOM   6894  O  O    . VAL B 2 50  ? 10.460  41.425  20.608  1.00 92.47  ? 50   VAL B O    1 
ATOM   6895  C  CB   . VAL B 2 50  ? 8.288   43.796  21.467  1.00 90.96  ? 50   VAL B CB   1 
ATOM   6896  C  CG1  . VAL B 2 50  ? 9.578   44.012  22.253  1.00 91.73  ? 50   VAL B CG1  1 
ATOM   6897  C  CG2  . VAL B 2 50  ? 7.788   45.122  20.923  1.00 94.23  ? 50   VAL B CG2  1 
ATOM   6898  H  H    . VAL B 2 50  ? 6.539   42.713  20.062  1.00 106.16 ? 50   VAL B H    1 
ATOM   6899  H  HA   . VAL B 2 50  ? 9.058   43.229  19.642  1.00 106.97 ? 50   VAL B HA   1 
ATOM   6900  H  HB   . VAL B 2 50  ? 7.617   43.443  22.072  1.00 109.15 ? 50   VAL B HB   1 
ATOM   6901  H  HG11 . VAL B 2 50  ? 10.256  44.365  21.656  1.00 110.07 ? 50   VAL B HG11 1 
ATOM   6902  H  HG12 . VAL B 2 50  ? 9.408   44.642  22.971  1.00 110.07 ? 50   VAL B HG12 1 
ATOM   6903  H  HG13 . VAL B 2 50  ? 9.869   43.163  22.621  1.00 110.07 ? 50   VAL B HG13 1 
ATOM   6904  H  HG21 . VAL B 2 50  ? 6.949   44.976  20.460  1.00 113.07 ? 50   VAL B HG21 1 
ATOM   6905  H  HG22 . VAL B 2 50  ? 7.657   45.736  21.662  1.00 113.07 ? 50   VAL B HG22 1 
ATOM   6906  H  HG23 . VAL B 2 50  ? 8.448   45.479  20.309  1.00 113.07 ? 50   VAL B HG23 1 
ATOM   6907  N  N    . LYS B 2 51  ? 8.510   40.671  21.482  1.00 92.12  ? 51   LYS B N    1 
ATOM   6908  C  CA   . LYS B 2 51  ? 9.117   39.402  21.888  1.00 98.04  ? 51   LYS B CA   1 
ATOM   6909  C  C    . LYS B 2 51  ? 9.669   38.672  20.667  1.00 103.76 ? 51   LYS B C    1 
ATOM   6910  O  O    . LYS B 2 51  ? 10.815  38.209  20.691  1.00 104.17 ? 51   LYS B O    1 
ATOM   6911  C  CB   . LYS B 2 51  ? 8.140   38.507  22.645  1.00 99.13  ? 51   LYS B CB   1 
ATOM   6912  C  CG   . LYS B 2 51  ? 8.061   38.830  24.116  1.00 94.27  ? 51   LYS B CG   1 
ATOM   6913  C  CD   . LYS B 2 51  ? 7.159   37.863  24.842  1.00 103.72 ? 51   LYS B CD   1 
ATOM   6914  C  CE   . LYS B 2 51  ? 6.924   38.303  26.274  1.00 101.85 ? 51   LYS B CE   1 
ATOM   6915  N  NZ   . LYS B 2 51  ? 5.949   37.417  26.966  1.00 117.08 ? 51   LYS B NZ   1 
ATOM   6916  H  H    . LYS B 2 51  ? 7.684   40.766  21.700  1.00 110.54 ? 51   LYS B H    1 
ATOM   6917  H  HA   . LYS B 2 51  ? 9.862   39.591  22.480  1.00 117.65 ? 51   LYS B HA   1 
ATOM   6918  H  HB2  . LYS B 2 51  ? 7.254   38.618  22.267  1.00 118.96 ? 51   LYS B HB2  1 
ATOM   6919  H  HB3  . LYS B 2 51  ? 8.425   37.584  22.556  1.00 118.96 ? 51   LYS B HB3  1 
ATOM   6920  H  HG2  . LYS B 2 51  ? 8.948   38.771  24.505  1.00 113.12 ? 51   LYS B HG2  1 
ATOM   6921  H  HG3  . LYS B 2 51  ? 7.703   39.724  24.229  1.00 113.12 ? 51   LYS B HG3  1 
ATOM   6922  H  HD2  . LYS B 2 51  ? 6.302   37.822  24.391  1.00 124.46 ? 51   LYS B HD2  1 
ATOM   6923  H  HD3  . LYS B 2 51  ? 7.574   36.986  24.857  1.00 124.46 ? 51   LYS B HD3  1 
ATOM   6924  H  HE2  . LYS B 2 51  ? 7.763   38.270  26.761  1.00 122.22 ? 51   LYS B HE2  1 
ATOM   6925  H  HE3  . LYS B 2 51  ? 6.570   39.206  26.277  1.00 122.22 ? 51   LYS B HE3  1 
ATOM   6926  H  HZ1  . LYS B 2 51  ? 6.254   36.581  26.980  1.00 140.49 ? 51   LYS B HZ1  1 
ATOM   6927  H  HZ2  . LYS B 2 51  ? 5.828   37.695  27.803  1.00 140.49 ? 51   LYS B HZ2  1 
ATOM   6928  H  HZ3  . LYS B 2 51  ? 5.168   37.434  26.540  1.00 140.49 ? 51   LYS B HZ3  1 
ATOM   6929  N  N    . LEU B 2 52  ? 8.861   38.572  19.606  1.00 97.71  ? 52   LEU B N    1 
ATOM   6930  C  CA   . LEU B 2 52  ? 9.313   37.897  18.386  1.00 90.58  ? 52   LEU B CA   1 
ATOM   6931  C  C    . LEU B 2 52  ? 10.645  38.454  17.886  1.00 92.02  ? 52   LEU B C    1 
ATOM   6932  O  O    . LEU B 2 52  ? 11.601  37.705  17.697  1.00 96.67  ? 52   LEU B O    1 
ATOM   6933  C  CB   . LEU B 2 52  ? 8.274   38.028  17.268  1.00 91.26  ? 52   LEU B CB   1 
ATOM   6934  C  CG   . LEU B 2 52  ? 8.761   37.591  15.879  1.00 100.93 ? 52   LEU B CG   1 
ATOM   6935  C  CD1  . LEU B 2 52  ? 9.210   36.130  15.885  1.00 109.96 ? 52   LEU B CD1  1 
ATOM   6936  C  CD2  . LEU B 2 52  ? 7.686   37.822  14.827  1.00 96.25  ? 52   LEU B CD2  1 
ATOM   6937  H  H    . LEU B 2 52  ? 8.060   38.880  19.568  1.00 117.25 ? 52   LEU B H    1 
ATOM   6938  H  HA   . LEU B 2 52  ? 9.434   36.953  18.574  1.00 108.70 ? 52   LEU B HA   1 
ATOM   6939  H  HB2  . LEU B 2 52  ? 7.506   37.481  17.495  1.00 109.51 ? 52   LEU B HB2  1 
ATOM   6940  H  HB3  . LEU B 2 52  ? 8.004   38.958  17.205  1.00 109.51 ? 52   LEU B HB3  1 
ATOM   6941  H  HG   . LEU B 2 52  ? 9.528   38.132  15.636  1.00 121.12 ? 52   LEU B HG   1 
ATOM   6942  H  HD11 . LEU B 2 52  ? 8.461   35.571  16.145  1.00 131.95 ? 52   LEU B HD11 1 
ATOM   6943  H  HD12 . LEU B 2 52  ? 9.510   35.889  14.994  1.00 131.95 ? 52   LEU B HD12 1 
ATOM   6944  H  HD13 . LEU B 2 52  ? 9.937   36.026  16.518  1.00 131.95 ? 52   LEU B HD13 1 
ATOM   6945  H  HD21 . LEU B 2 52  ? 7.467   38.766  14.801  1.00 115.51 ? 52   LEU B HD21 1 
ATOM   6946  H  HD22 . LEU B 2 52  ? 8.023   37.536  13.963  1.00 115.51 ? 52   LEU B HD22 1 
ATOM   6947  H  HD23 . LEU B 2 52  ? 6.899   37.306  15.062  1.00 115.51 ? 52   LEU B HD23 1 
ATOM   6948  N  N    . LEU B 2 53  ? 10.710  39.762  17.674  1.00 89.92  ? 53   LEU B N    1 
ATOM   6949  C  CA   . LEU B 2 53  ? 11.920  40.381  17.143  1.00 93.74  ? 53   LEU B CA   1 
ATOM   6950  C  C    . LEU B 2 53  ? 13.095  40.175  18.097  1.00 103.44 ? 53   LEU B C    1 
ATOM   6951  O  O    . LEU B 2 53  ? 14.227  39.910  17.662  1.00 106.08 ? 53   LEU B O    1 
ATOM   6952  C  CB   . LEU B 2 53  ? 11.691  41.869  16.884  1.00 83.85  ? 53   LEU B CB   1 
ATOM   6953  C  CG   . LEU B 2 53  ? 10.555  42.209  15.918  1.00 91.50  ? 53   LEU B CG   1 
ATOM   6954  C  CD1  . LEU B 2 53  ? 10.626  43.677  15.545  1.00 91.91  ? 53   LEU B CD1  1 
ATOM   6955  C  CD2  . LEU B 2 53  ? 10.584  41.336  14.654  1.00 91.89  ? 53   LEU B CD2  1 
ATOM   6956  H  H    . LEU B 2 53  ? 10.069  40.315  17.828  1.00 107.91 ? 53   LEU B H    1 
ATOM   6957  H  HA   . LEU B 2 53  ? 12.144  39.961  16.298  1.00 112.49 ? 53   LEU B HA   1 
ATOM   6958  H  HB2  . LEU B 2 53  ? 11.490  42.299  17.730  1.00 100.62 ? 53   LEU B HB2  1 
ATOM   6959  H  HB3  . LEU B 2 53  ? 12.506  42.244  16.516  1.00 100.62 ? 53   LEU B HB3  1 
ATOM   6960  H  HG   . LEU B 2 53  ? 9.707   42.056  16.365  1.00 109.80 ? 53   LEU B HG   1 
ATOM   6961  H  HD11 . LEU B 2 53  ? 11.480  43.853  15.119  1.00 110.29 ? 53   LEU B HD11 1 
ATOM   6962  H  HD12 . LEU B 2 53  ? 9.902   43.883  14.932  1.00 110.29 ? 53   LEU B HD12 1 
ATOM   6963  H  HD13 . LEU B 2 53  ? 10.541  44.212  16.349  1.00 110.29 ? 53   LEU B HD13 1 
ATOM   6964  H  HD21 . LEU B 2 53  ? 10.497  40.405  14.912  1.00 110.27 ? 53   LEU B HD21 1 
ATOM   6965  H  HD22 . LEU B 2 53  ? 9.847   41.591  14.078  1.00 110.27 ? 53   LEU B HD22 1 
ATOM   6966  H  HD23 . LEU B 2 53  ? 11.427  41.475  14.195  1.00 110.27 ? 53   LEU B HD23 1 
ATOM   6967  N  N    . LYS B 2 54  ? 12.833  40.280  19.400  1.00 97.35  ? 54   LYS B N    1 
ATOM   6968  C  CA   . LYS B 2 54  ? 13.900  40.057  20.369  1.00 101.07 ? 54   LYS B CA   1 
ATOM   6969  C  C    . LYS B 2 54  ? 14.352  38.600  20.335  1.00 103.46 ? 54   LYS B C    1 
ATOM   6970  O  O    . LYS B 2 54  ? 15.525  38.300  20.572  1.00 109.28 ? 54   LYS B O    1 
ATOM   6971  C  CB   . LYS B 2 54  ? 13.437  40.441  21.772  1.00 98.95  ? 54   LYS B CB   1 
ATOM   6972  C  CG   . LYS B 2 54  ? 13.460  41.939  22.019  1.00 97.16  ? 54   LYS B CG   1 
ATOM   6973  C  CD   . LYS B 2 54  ? 13.175  42.281  23.465  1.00 99.30  ? 54   LYS B CD   1 
ATOM   6974  C  CE   . LYS B 2 54  ? 13.266  43.778  23.699  1.00 105.25 ? 54   LYS B CE   1 
ATOM   6975  N  NZ   . LYS B 2 54  ? 12.936  44.148  25.104  1.00 111.36 ? 54   LYS B NZ   1 
ATOM   6976  H  H    . LYS B 2 54  ? 12.067  40.473  19.740  1.00 116.82 ? 54   LYS B H    1 
ATOM   6977  H  HA   . LYS B 2 54  ? 14.660  40.614  20.139  1.00 121.28 ? 54   LYS B HA   1 
ATOM   6978  H  HB2  . LYS B 2 54  ? 12.526  40.131  21.899  1.00 118.74 ? 54   LYS B HB2  1 
ATOM   6979  H  HB3  . LYS B 2 54  ? 14.022  40.022  22.423  1.00 118.74 ? 54   LYS B HB3  1 
ATOM   6980  H  HG2  . LYS B 2 54  ? 14.337  42.285  21.794  1.00 116.59 ? 54   LYS B HG2  1 
ATOM   6981  H  HG3  . LYS B 2 54  ? 12.782  42.362  21.469  1.00 116.59 ? 54   LYS B HG3  1 
ATOM   6982  H  HD2  . LYS B 2 54  ? 12.278  41.989  23.693  1.00 119.16 ? 54   LYS B HD2  1 
ATOM   6983  H  HD3  . LYS B 2 54  ? 13.827  41.842  24.033  1.00 119.16 ? 54   LYS B HD3  1 
ATOM   6984  H  HE2  . LYS B 2 54  ? 14.170  44.075  23.513  1.00 126.30 ? 54   LYS B HE2  1 
ATOM   6985  H  HE3  . LYS B 2 54  ? 12.639  44.230  23.112  1.00 126.30 ? 54   LYS B HE3  1 
ATOM   6986  H  HZ1  . LYS B 2 54  ? 13.501  43.749  25.663  1.00 133.63 ? 54   LYS B HZ1  1 
ATOM   6987  H  HZ2  . LYS B 2 54  ? 12.998  45.029  25.208  1.00 133.63 ? 54   LYS B HZ2  1 
ATOM   6988  H  HZ3  . LYS B 2 54  ? 12.106  43.891  25.299  1.00 133.63 ? 54   LYS B HZ3  1 
ATOM   6989  N  N    . SER B 2 55  ? 13.431  37.699  20.003  1.00 105.24 ? 55   SER B N    1 
ATOM   6990  C  CA   . SER B 2 55  ? 13.784  36.293  19.833  1.00 101.27 ? 55   SER B CA   1 
ATOM   6991  C  C    . SER B 2 55  ? 14.626  36.129  18.567  1.00 105.50 ? 55   SER B C    1 
ATOM   6992  O  O    . SER B 2 55  ? 15.613  35.392  18.561  1.00 113.09 ? 55   SER B O    1 
ATOM   6993  C  CB   . SER B 2 55  ? 12.534  35.416  19.772  1.00 103.25 ? 55   SER B CB   1 
ATOM   6994  O  OG   . SER B 2 55  ? 11.830  35.451  21.001  1.00 105.82 ? 55   SER B OG   1 
ATOM   6995  H  H    . SER B 2 55  ? 12.600  37.875  19.871  1.00 126.29 ? 55   SER B H    1 
ATOM   6996  H  HA   . SER B 2 55  ? 14.318  36.006  20.590  1.00 121.53 ? 55   SER B HA   1 
ATOM   6997  H  HB2  . SER B 2 55  ? 11.954  35.742  19.067  1.00 123.91 ? 55   SER B HB2  1 
ATOM   6998  H  HB3  . SER B 2 55  ? 12.800  34.501  19.588  1.00 123.91 ? 55   SER B HB3  1 
ATOM   6999  H  HG   . SER B 2 55  ? 11.593  36.239  21.174  1.00 126.98 ? 55   SER B HG   1 
ATOM   7000  N  N    . VAL B 2 56  ? 14.242  36.828  17.499  1.00 103.32 ? 56   VAL B N    1 
ATOM   7001  C  CA   . VAL B 2 56  ? 15.021  36.796  16.266  1.00 99.70  ? 56   VAL B CA   1 
ATOM   7002  C  C    . VAL B 2 56  ? 16.414  37.290  16.600  1.00 101.19 ? 56   VAL B C    1 
ATOM   7003  O  O    . VAL B 2 56  ? 17.404  36.802  16.057  1.00 107.33 ? 56   VAL B O    1 
ATOM   7004  C  CB   . VAL B 2 56  ? 14.405  37.664  15.141  1.00 102.47 ? 56   VAL B CB   1 
ATOM   7005  C  CG1  . VAL B 2 56  ? 15.290  37.639  13.888  1.00 94.84  ? 56   VAL B CG1  1 
ATOM   7006  C  CG2  . VAL B 2 56  ? 13.010  37.174  14.788  1.00 105.96 ? 56   VAL B CG2  1 
ATOM   7007  H  H    . VAL B 2 56  ? 13.541  37.325  17.465  1.00 123.98 ? 56   VAL B H    1 
ATOM   7008  H  HA   . VAL B 2 56  ? 15.086  35.882  15.948  1.00 119.64 ? 56   VAL B HA   1 
ATOM   7009  H  HB   . VAL B 2 56  ? 14.336  38.582  15.446  1.00 122.96 ? 56   VAL B HB   1 
ATOM   7010  H  HG11 . VAL B 2 56  ? 15.369  36.724  13.575  1.00 113.81 ? 56   VAL B HG11 1 
ATOM   7011  H  HG12 . VAL B 2 56  ? 14.880  38.189  13.202  1.00 113.81 ? 56   VAL B HG12 1 
ATOM   7012  H  HG13 . VAL B 2 56  ? 16.166  37.989  14.114  1.00 113.81 ? 56   VAL B HG13 1 
ATOM   7013  H  HG21 . VAL B 2 56  ? 12.448  37.230  15.577  1.00 127.15 ? 56   VAL B HG21 1 
ATOM   7014  H  HG22 . VAL B 2 56  ? 12.648  37.733  14.083  1.00 127.15 ? 56   VAL B HG22 1 
ATOM   7015  H  HG23 . VAL B 2 56  ? 13.066  36.254  14.486  1.00 127.15 ? 56   VAL B HG23 1 
ATOM   7016  N  N    . GLU B 2 57  ? 16.485  38.252  17.514  1.00 109.69 ? 57   GLU B N    1 
ATOM   7017  C  CA   . GLU B 2 57  ? 17.772  38.744  17.982  1.00 118.96 ? 57   GLU B CA   1 
ATOM   7018  C  C    . GLU B 2 57  ? 18.467  37.685  18.845  1.00 121.12 ? 57   GLU B C    1 
ATOM   7019  O  O    . GLU B 2 57  ? 19.693  37.555  18.801  1.00 120.17 ? 57   GLU B O    1 
ATOM   7020  C  CB   . GLU B 2 57  ? 17.609  40.039  18.773  1.00 113.20 ? 57   GLU B CB   1 
ATOM   7021  C  CG   . GLU B 2 57  ? 18.919  40.778  18.982  1.00 111.32 ? 57   GLU B CG   1 
ATOM   7022  C  CD   . GLU B 2 57  ? 18.782  41.965  19.907  1.00 109.18 ? 57   GLU B CD   1 
ATOM   7023  O  OE1  . GLU B 2 57  ? 17.792  42.019  20.668  1.00 106.85 ? 57   GLU B OE1  1 
ATOM   7024  O  OE2  . GLU B 2 57  ? 19.655  42.858  19.855  1.00 110.92 ? 57   GLU B OE2  1 
ATOM   7025  H  H    . GLU B 2 57  ? 15.805  38.633  17.877  1.00 131.63 ? 57   GLU B H    1 
ATOM   7026  H  HA   . GLU B 2 57  ? 18.339  38.928  17.216  1.00 142.76 ? 57   GLU B HA   1 
ATOM   7027  H  HB2  . GLU B 2 57  ? 17.007  40.628  18.292  1.00 135.84 ? 57   GLU B HB2  1 
ATOM   7028  H  HB3  . GLU B 2 57  ? 17.241  39.830  19.646  1.00 135.84 ? 57   GLU B HB3  1 
ATOM   7029  H  HG2  . GLU B 2 57  ? 19.567  40.169  19.370  1.00 133.58 ? 57   GLU B HG2  1 
ATOM   7030  H  HG3  . GLU B 2 57  ? 19.239  41.101  18.125  1.00 133.58 ? 57   GLU B HG3  1 
ATOM   7031  N  N    . ASN B 2 58  ? 17.690  36.921  19.616  1.00 122.86 ? 58   ASN B N    1 
ATOM   7032  C  CA   . ASN B 2 58  ? 18.263  35.846  20.435  1.00 122.62 ? 58   ASN B CA   1 
ATOM   7033  C  C    . ASN B 2 58  ? 18.890  34.762  19.565  1.00 129.71 ? 58   ASN B C    1 
ATOM   7034  O  O    . ASN B 2 58  ? 19.936  34.213  19.913  1.00 133.28 ? 58   ASN B O    1 
ATOM   7035  C  CB   . ASN B 2 58  ? 17.200  35.201  21.338  1.00 122.40 ? 58   ASN B CB   1 
ATOM   7036  C  CG   . ASN B 2 58  ? 16.762  36.101  22.479  1.00 123.89 ? 58   ASN B CG   1 
ATOM   7037  O  OD1  . ASN B 2 58  ? 17.460  37.047  22.846  1.00 128.00 ? 58   ASN B OD1  1 
ATOM   7038  N  ND2  . ASN B 2 58  ? 15.598  35.802  23.051  1.00 112.94 ? 58   ASN B ND2  1 
ATOM   7039  H  H    . ASN B 2 58  ? 16.836  37.002  19.684  1.00 147.44 ? 58   ASN B H    1 
ATOM   7040  H  HA   . ASN B 2 58  ? 18.957  36.216  21.002  1.00 147.14 ? 58   ASN B HA   1 
ATOM   7041  H  HB2  . ASN B 2 58  ? 16.418  34.993  20.804  1.00 146.88 ? 58   ASN B HB2  1 
ATOM   7042  H  HB3  . ASN B 2 58  ? 17.565  34.388  21.722  1.00 146.88 ? 58   ASN B HB3  1 
ATOM   7043  H  HD21 . ASN B 2 58  ? 15.140  35.131  22.770  1.00 135.53 ? 58   ASN B HD21 1 
ATOM   7044  H  HD22 . ASN B 2 58  ? 15.304  36.281  23.702  1.00 135.53 ? 58   ASN B HD22 1 
ATOM   7045  N  N    . LEU B 2 59  ? 18.241  34.446  18.446  1.00 130.76 ? 59   LEU B N    1 
ATOM   7046  C  CA   . LEU B 2 59  ? 18.734  33.414  17.535  1.00 122.40 ? 59   LEU B CA   1 
ATOM   7047  C  C    . LEU B 2 59  ? 19.884  33.903  16.657  1.00 121.73 ? 59   LEU B C    1 
ATOM   7048  O  O    . LEU B 2 59  ? 20.514  33.110  15.962  1.00 136.26 ? 59   LEU B O    1 
ATOM   7049  C  CB   . LEU B 2 59  ? 17.596  32.899  16.656  1.00 106.70 ? 59   LEU B CB   1 
ATOM   7050  C  CG   . LEU B 2 59  ? 16.379  32.405  17.439  1.00 120.10 ? 59   LEU B CG   1 
ATOM   7051  C  CD1  . LEU B 2 59  ? 15.284  31.955  16.495  1.00 127.44 ? 59   LEU B CD1  1 
ATOM   7052  C  CD2  . LEU B 2 59  ? 16.758  31.276  18.391  1.00 124.18 ? 59   LEU B CD2  1 
ATOM   7053  H  H    . LEU B 2 59  ? 17.509  34.817  18.191  1.00 156.92 ? 59   LEU B H    1 
ATOM   7054  H  HA   . LEU B 2 59  ? 19.061  32.667  18.060  1.00 146.88 ? 59   LEU B HA   1 
ATOM   7055  H  HB2  . LEU B 2 59  ? 17.302  33.618  16.074  1.00 128.04 ? 59   LEU B HB2  1 
ATOM   7056  H  HB3  . LEU B 2 59  ? 17.925  32.159  16.122  1.00 128.04 ? 59   LEU B HB3  1 
ATOM   7057  H  HG   . LEU B 2 59  ? 16.030  33.137  17.970  1.00 144.11 ? 59   LEU B HG   1 
ATOM   7058  H  HD11 . LEU B 2 59  ? 15.622  31.233  15.942  1.00 152.92 ? 59   LEU B HD11 1 
ATOM   7059  H  HD12 . LEU B 2 59  ? 14.526  31.647  17.015  1.00 152.92 ? 59   LEU B HD12 1 
ATOM   7060  H  HD13 . LEU B 2 59  ? 15.021  32.704  15.937  1.00 152.92 ? 59   LEU B HD13 1 
ATOM   7061  H  HD21 . LEU B 2 59  ? 17.423  31.602  19.017  1.00 149.02 ? 59   LEU B HD21 1 
ATOM   7062  H  HD22 . LEU B 2 59  ? 15.965  30.988  18.869  1.00 149.02 ? 59   LEU B HD22 1 
ATOM   7063  H  HD23 . LEU B 2 59  ? 17.121  30.539  17.876  1.00 149.02 ? 59   LEU B HD23 1 
ATOM   7064  N  N    . GLY B 2 60  ? 20.154  35.203  16.679  1.00 117.25 ? 60   GLY B N    1 
ATOM   7065  C  CA   . GLY B 2 60  ? 21.257  35.747  15.908  1.00 128.20 ? 60   GLY B CA   1 
ATOM   7066  C  C    . GLY B 2 60  ? 22.582  35.624  16.634  1.00 134.29 ? 60   GLY B C    1 
ATOM   7067  O  O    . GLY B 2 60  ? 23.638  35.588  16.001  1.00 132.93 ? 60   GLY B O    1 
ATOM   7068  H  H    . GLY B 2 60  ? 19.715  35.787  17.132  1.00 140.71 ? 60   GLY B H    1 
ATOM   7069  H  HA2  . GLY B 2 60  ? 21.324  35.276  15.063  1.00 153.85 ? 60   GLY B HA2  1 
ATOM   7070  H  HA3  . GLY B 2 60  ? 21.092  36.685  15.726  1.00 153.85 ? 60   GLY B HA3  1 
ATOM   7071  N  N    . VAL B 2 61  ? 22.529  35.560  17.964  1.00 140.66 ? 61   VAL B N    1 
ATOM   7072  C  CA   . VAL B 2 61  ? 23.741  35.428  18.769  1.00 148.09 ? 61   VAL B CA   1 
ATOM   7073  C  C    . VAL B 2 61  ? 24.011  33.961  19.106  1.00 138.56 ? 61   VAL B C    1 
ATOM   7074  O  O    . VAL B 2 61  ? 25.162  33.529  19.172  1.00 139.23 ? 61   VAL B O    1 
ATOM   7075  C  CB   . VAL B 2 61  ? 23.627  36.232  20.089  1.00 140.70 ? 61   VAL B CB   1 
ATOM   7076  C  CG1  . VAL B 2 61  ? 24.925  36.149  20.895  1.00 140.67 ? 61   VAL B CG1  1 
ATOM   7077  C  CG2  . VAL B 2 61  ? 23.273  37.686  19.802  1.00 127.86 ? 61   VAL B CG2  1 
ATOM   7078  H  H    . VAL B 2 61  ? 21.803  35.591  18.423  1.00 168.79 ? 61   VAL B H    1 
ATOM   7079  H  HA   . VAL B 2 61  ? 24.498  35.770  18.268  1.00 177.71 ? 61   VAL B HA   1 
ATOM   7080  H  HB   . VAL B 2 61  ? 22.915  35.852  20.628  1.00 168.84 ? 61   VAL B HB   1 
ATOM   7081  H  HG11 . VAL B 2 61  ? 25.650  36.516  20.364  1.00 168.81 ? 61   VAL B HG11 1 
ATOM   7082  H  HG12 . VAL B 2 61  ? 24.822  36.660  21.713  1.00 168.81 ? 61   VAL B HG12 1 
ATOM   7083  H  HG13 . VAL B 2 61  ? 25.107  35.220  21.106  1.00 168.81 ? 61   VAL B HG13 1 
ATOM   7084  H  HG21 . VAL B 2 61  ? 22.424  37.717  19.335  1.00 153.43 ? 61   VAL B HG21 1 
ATOM   7085  H  HG22 . VAL B 2 61  ? 23.208  38.166  20.642  1.00 153.43 ? 61   VAL B HG22 1 
ATOM   7086  H  HG23 . VAL B 2 61  ? 23.969  38.076  19.251  1.00 153.43 ? 61   VAL B HG23 1 
ATOM   7087  N  N    . SER B 2 62  ? 22.939  33.203  19.319  1.00 133.07 ? 62   SER B N    1 
ATOM   7088  C  CA   . SER B 2 62  ? 23.040  31.773  19.592  1.00 140.72 ? 62   SER B CA   1 
ATOM   7089  C  C    . SER B 2 62  ? 23.406  30.923  18.377  1.00 147.78 ? 62   SER B C    1 
ATOM   7090  O  O    . SER B 2 62  ? 24.517  30.397  18.288  1.00 156.64 ? 62   SER B O    1 
ATOM   7091  C  CB   . SER B 2 62  ? 21.722  31.259  20.182  1.00 144.85 ? 62   SER B CB   1 
ATOM   7092  O  OG   . SER B 2 62  ? 21.468  31.837  21.452  1.00 144.36 ? 62   SER B OG   1 
ATOM   7093  H  H    . SER B 2 62  ? 22.131  33.498  19.310  1.00 159.68 ? 62   SER B H    1 
ATOM   7094  H  HA   . SER B 2 62  ? 23.731  31.637  20.260  1.00 168.87 ? 62   SER B HA   1 
ATOM   7095  H  HB2  . SER B 2 62  ? 20.998  31.490  19.580  1.00 173.82 ? 62   SER B HB2  1 
ATOM   7096  H  HB3  . SER B 2 62  ? 21.776  30.296  20.280  1.00 173.82 ? 62   SER B HB3  1 
ATOM   7097  H  HG   . SER B 2 62  ? 21.417  32.673  21.382  1.00 173.23 ? 62   SER B HG   1 
ATOM   7098  N  N    . TYR B 2 63  ? 22.463  30.798  17.443  1.00 144.16 ? 63   TYR B N    1 
ATOM   7099  C  CA   . TYR B 2 63  ? 22.635  29.903  16.299  1.00 144.25 ? 63   TYR B CA   1 
ATOM   7100  C  C    . TYR B 2 63  ? 23.123  30.586  15.022  1.00 136.07 ? 63   TYR B C    1 
ATOM   7101  O  O    . TYR B 2 63  ? 23.548  31.742  15.036  1.00 134.24 ? 63   TYR B O    1 
ATOM   7102  C  CB   . TYR B 2 63  ? 21.302  29.202  16.014  1.00 146.19 ? 63   TYR B CB   1 
ATOM   7103  C  CG   . TYR B 2 63  ? 20.647  28.612  17.248  1.00 150.65 ? 63   TYR B CG   1 
ATOM   7104  C  CD1  . TYR B 2 63  ? 21.407  28.148  18.316  1.00 143.30 ? 63   TYR B CD1  1 
ATOM   7105  C  CD2  . TYR B 2 63  ? 19.264  28.537  17.349  1.00 149.53 ? 63   TYR B CD2  1 
ATOM   7106  C  CE1  . TYR B 2 63  ? 20.806  27.618  19.443  1.00 140.06 ? 63   TYR B CE1  1 
ATOM   7107  C  CE2  . TYR B 2 63  ? 18.655  28.011  18.475  1.00 146.70 ? 63   TYR B CE2  1 
ATOM   7108  C  CZ   . TYR B 2 63  ? 19.430  27.550  19.516  1.00 142.86 ? 63   TYR B CZ   1 
ATOM   7109  O  OH   . TYR B 2 63  ? 18.824  27.024  20.634  1.00 146.87 ? 63   TYR B OH   1 
ATOM   7110  H  H    . TYR B 2 63  ? 21.715  31.220  17.449  1.00 172.99 ? 63   TYR B H    1 
ATOM   7111  H  HA   . TYR B 2 63  ? 23.283  29.220  16.533  1.00 173.09 ? 63   TYR B HA   1 
ATOM   7112  H  HB2  . TYR B 2 63  ? 20.687  29.846  15.630  1.00 175.43 ? 63   TYR B HB2  1 
ATOM   7113  H  HB3  . TYR B 2 63  ? 21.457  28.479  15.386  1.00 175.43 ? 63   TYR B HB3  1 
ATOM   7114  H  HD1  . TYR B 2 63  ? 22.335  28.191  18.269  1.00 171.96 ? 63   TYR B HD1  1 
ATOM   7115  H  HD2  . TYR B 2 63  ? 18.737  28.846  16.648  1.00 179.43 ? 63   TYR B HD2  1 
ATOM   7116  H  HE1  . TYR B 2 63  ? 21.328  27.307  20.148  1.00 168.07 ? 63   TYR B HE1  1 
ATOM   7117  H  HE2  . TYR B 2 63  ? 17.727  27.963  18.525  1.00 176.04 ? 63   TYR B HE2  1 
ATOM   7118  H  HH   . TYR B 2 63  ? 17.989  27.044  20.545  1.00 176.25 ? 63   TYR B HH   1 
ATOM   7119  N  N    . VAL B 2 64  ? 23.057  29.840  13.921  1.00 139.83 ? 64   VAL B N    1 
ATOM   7120  C  CA   . VAL B 2 64  ? 23.333  30.353  12.582  1.00 155.60 ? 64   VAL B CA   1 
ATOM   7121  C  C    . VAL B 2 64  ? 22.169  30.063  11.630  1.00 155.39 ? 64   VAL B C    1 
ATOM   7122  O  O    . VAL B 2 64  ? 21.403  29.126  11.857  1.00 153.82 ? 64   VAL B O    1 
ATOM   7123  C  CB   . VAL B 2 64  ? 24.620  29.729  12.005  1.00 156.41 ? 64   VAL B CB   1 
ATOM   7124  C  CG1  . VAL B 2 64  ? 25.014  30.410  10.695  1.00 147.97 ? 64   VAL B CG1  1 
ATOM   7125  C  CG2  . VAL B 2 64  ? 25.757  29.828  13.016  1.00 156.57 ? 64   VAL B CG2  1 
ATOM   7126  H  H    . VAL B 2 64  ? 22.847  29.006  13.927  1.00 167.80 ? 64   VAL B H    1 
ATOM   7127  H  HA   . VAL B 2 64  ? 23.456  31.314  12.627  1.00 186.72 ? 64   VAL B HA   1 
ATOM   7128  H  HB   . VAL B 2 64  ? 24.462  28.790  11.821  1.00 187.70 ? 64   VAL B HB   1 
ATOM   7129  H  HG11 . VAL B 2 64  ? 25.167  31.353  10.863  1.00 177.56 ? 64   VAL B HG11 1 
ATOM   7130  H  HG12 . VAL B 2 64  ? 25.825  29.998  10.357  1.00 177.56 ? 64   VAL B HG12 1 
ATOM   7131  H  HG13 . VAL B 2 64  ? 24.294  30.300  10.054  1.00 177.56 ? 64   VAL B HG13 1 
ATOM   7132  H  HG21 . VAL B 2 64  ? 25.504  29.352  13.822  1.00 187.88 ? 64   VAL B HG21 1 
ATOM   7133  H  HG22 . VAL B 2 64  ? 26.555  29.431  12.633  1.00 187.88 ? 64   VAL B HG22 1 
ATOM   7134  H  HG23 . VAL B 2 64  ? 25.917  30.763  13.219  1.00 187.88 ? 64   VAL B HG23 1 
ATOM   7135  N  N    . LYS B 2 65  ? 21.997  30.893  10.604  1.00 146.69 ? 65   LYS B N    1 
ATOM   7136  C  CA   . LYS B 2 65  ? 20.925  30.680  9.637   1.00 148.18 ? 65   LYS B CA   1 
ATOM   7137  C  C    . LYS B 2 65  ? 21.094  29.312  8.961   1.00 155.42 ? 65   LYS B C    1 
ATOM   7138  O  O    . LYS B 2 65  ? 22.208  28.938  8.586   1.00 150.88 ? 65   LYS B O    1 
ATOM   7139  C  CB   . LYS B 2 65  ? 20.925  31.789  8.582   1.00 149.14 ? 65   LYS B CB   1 
ATOM   7140  C  CG   . LYS B 2 65  ? 19.913  31.594  7.447   1.00 151.13 ? 65   LYS B CG   1 
ATOM   7141  C  CD   . LYS B 2 65  ? 20.420  32.160  6.127   1.00 142.39 ? 65   LYS B CD   1 
ATOM   7142  C  CE   . LYS B 2 65  ? 21.567  31.332  5.546   1.00 149.09 ? 65   LYS B CE   1 
ATOM   7143  N  NZ   . LYS B 2 65  ? 21.190  29.909  5.296   1.00 145.92 ? 65   LYS B NZ   1 
ATOM   7144  H  H    . LYS B 2 65  ? 22.486  31.582  10.446  1.00 176.03 ? 65   LYS B H    1 
ATOM   7145  H  HA   . LYS B 2 65  ? 20.070  30.693  10.095  1.00 177.82 ? 65   LYS B HA   1 
ATOM   7146  H  HB2  . LYS B 2 65  ? 20.718  32.631  9.018   1.00 178.97 ? 65   LYS B HB2  1 
ATOM   7147  H  HB3  . LYS B 2 65  ? 21.808  31.837  8.184   1.00 178.97 ? 65   LYS B HB3  1 
ATOM   7148  H  HG2  . LYS B 2 65  ? 19.749  30.646  7.326   1.00 181.36 ? 65   LYS B HG2  1 
ATOM   7149  H  HG3  . LYS B 2 65  ? 19.088  32.050  7.674   1.00 181.36 ? 65   LYS B HG3  1 
ATOM   7150  H  HD2  . LYS B 2 65  ? 19.695  32.164  5.483   1.00 170.87 ? 65   LYS B HD2  1 
ATOM   7151  H  HD3  . LYS B 2 65  ? 20.743  33.063  6.272   1.00 170.87 ? 65   LYS B HD3  1 
ATOM   7152  H  HE2  . LYS B 2 65  ? 21.841  31.722  4.701   1.00 178.91 ? 65   LYS B HE2  1 
ATOM   7153  H  HE3  . LYS B 2 65  ? 22.310  31.340  6.170   1.00 178.91 ? 65   LYS B HE3  1 
ATOM   7154  H  HZ1  . LYS B 2 65  ? 20.514  29.871  4.718   1.00 175.10 ? 65   LYS B HZ1  1 
ATOM   7155  H  HZ2  . LYS B 2 65  ? 21.884  29.465  4.959   1.00 175.10 ? 65   LYS B HZ2  1 
ATOM   7156  H  HZ3  . LYS B 2 65  ? 20.941  29.523  6.058   1.00 175.10 ? 65   LYS B HZ3  1 
ATOM   7157  N  N    . GLY B 2 66  ? 20.000  28.569  8.812   1.00 152.60 ? 66   GLY B N    1 
ATOM   7158  C  CA   . GLY B 2 66  ? 20.019  27.309  8.085   1.00 145.92 ? 66   GLY B CA   1 
ATOM   7159  C  C    . GLY B 2 66  ? 19.914  26.115  9.012   1.00 152.01 ? 66   GLY B C    1 
ATOM   7160  O  O    . GLY B 2 66  ? 19.267  25.114  8.697   1.00 155.56 ? 66   GLY B O    1 
ATOM   7161  H  H    . GLY B 2 66  ? 19.228  28.777  9.128   1.00 183.12 ? 66   GLY B H    1 
ATOM   7162  H  HA2  . GLY B 2 66  ? 19.275  27.283  7.462   1.00 175.10 ? 66   GLY B HA2  1 
ATOM   7163  H  HA3  . GLY B 2 66  ? 20.845  27.238  7.582   1.00 175.10 ? 66   GLY B HA3  1 
ATOM   7164  N  N    . THR B 2 67  ? 20.558  26.241  10.169  1.00 146.54 ? 67   THR B N    1 
ATOM   7165  C  CA   . THR B 2 67  ? 20.611  25.181  11.172  1.00 146.70 ? 67   THR B CA   1 
ATOM   7166  C  C    . THR B 2 67  ? 19.229  24.802  11.671  1.00 152.28 ? 67   THR B C    1 
ATOM   7167  O  O    . THR B 2 67  ? 18.325  25.637  11.697  1.00 151.45 ? 67   THR B O    1 
ATOM   7168  C  CB   . THR B 2 67  ? 21.479  25.580  12.397  1.00 146.52 ? 67   THR B CB   1 
ATOM   7169  O  OG1  . THR B 2 67  ? 20.733  26.460  13.248  1.00 146.66 ? 67   THR B OG1  1 
ATOM   7170  C  CG2  . THR B 2 67  ? 22.774  26.265  11.972  1.00 144.96 ? 67   THR B CG2  1 
ATOM   7171  H  H    . THR B 2 67  ? 20.983  26.951  10.402  1.00 175.84 ? 67   THR B H    1 
ATOM   7172  H  HA   . THR B 2 67  ? 21.009  24.392  10.771  1.00 176.04 ? 67   THR B HA   1 
ATOM   7173  H  HB   . THR B 2 67  ? 21.711  24.780  12.895  1.00 175.82 ? 67   THR B HB   1 
ATOM   7174  H  HG1  . THR B 2 67  ? 21.197  26.679  13.913  1.00 176.00 ? 67   THR B HG1  1 
ATOM   7175  H  HG21 . THR B 2 67  ? 22.573  27.070  11.470  1.00 173.95 ? 67   THR B HG21 1 
ATOM   7176  H  HG22 . THR B 2 67  ? 23.296  26.503  12.754  1.00 173.95 ? 67   THR B HG22 1 
ATOM   7177  H  HG23 . THR B 2 67  ? 23.297  25.668  11.414  1.00 173.95 ? 67   THR B HG23 1 
ATOM   7178  N  N    . GLU B 2 68  ? 19.059  23.529  12.023  1.00 161.17 ? 68   GLU B N    1 
ATOM   7179  C  CA   . GLU B 2 68  ? 17.777  23.048  12.520  1.00 161.18 ? 68   GLU B CA   1 
ATOM   7180  C  C    . GLU B 2 68  ? 17.311  23.908  13.675  1.00 162.24 ? 68   GLU B C    1 
ATOM   7181  O  O    . GLU B 2 68  ? 16.179  24.374  13.699  1.00 160.24 ? 68   GLU B O    1 
ATOM   7182  C  CB   . GLU B 2 68  ? 17.875  21.611  13.025  1.00 155.45 ? 68   GLU B CB   1 
ATOM   7183  C  CG   . GLU B 2 68  ? 17.950  20.531  11.983  1.00 150.57 ? 68   GLU B CG   1 
ATOM   7184  C  CD   . GLU B 2 68  ? 17.873  19.155  12.621  1.00 149.83 ? 68   GLU B CD   1 
ATOM   7185  O  OE1  . GLU B 2 68  ? 17.794  19.079  13.867  1.00 146.25 ? 68   GLU B OE1  1 
ATOM   7186  O  OE2  . GLU B 2 68  ? 17.881  18.149  11.889  1.00 150.76 ? 68   GLU B OE2  1 
ATOM   7187  H  H    . GLU B 2 68  ? 19.671  22.926  11.982  1.00 193.40 ? 68   GLU B H    1 
ATOM   7188  H  HA   . GLU B 2 68  ? 17.114  23.087  11.813  1.00 193.42 ? 68   GLU B HA   1 
ATOM   7189  H  HB2  . GLU B 2 68  ? 18.673  21.537  13.571  1.00 186.54 ? 68   GLU B HB2  1 
ATOM   7190  H  HB3  . GLU B 2 68  ? 17.095  21.429  13.571  1.00 186.54 ? 68   GLU B HB3  1 
ATOM   7191  H  HG2  . GLU B 2 68  ? 17.205  20.625  11.368  1.00 180.69 ? 68   GLU B HG2  1 
ATOM   7192  H  HG3  . GLU B 2 68  ? 18.792  20.601  11.507  1.00 180.69 ? 68   GLU B HG3  1 
ATOM   7193  N  N    . GLN B 2 69  ? 18.220  24.115  14.621  1.00 155.87 ? 69   GLN B N    1 
ATOM   7194  C  CA   . GLN B 2 69  ? 17.971  24.948  15.785  1.00 153.83 ? 69   GLN B CA   1 
ATOM   7195  C  C    . GLN B 2 69  ? 17.382  26.311  15.425  1.00 155.35 ? 69   GLN B C    1 
ATOM   7196  O  O    . GLN B 2 69  ? 16.358  26.708  15.972  1.00 149.68 ? 69   GLN B O    1 
ATOM   7197  C  CB   . GLN B 2 69  ? 19.277  25.133  16.557  1.00 155.32 ? 69   GLN B CB   1 
ATOM   7198  C  CG   . GLN B 2 69  ? 19.841  23.845  17.134  1.00 155.85 ? 69   GLN B CG   1 
ATOM   7199  C  CD   . GLN B 2 69  ? 21.118  24.068  17.925  1.00 158.17 ? 69   GLN B CD   1 
ATOM   7200  O  OE1  . GLN B 2 69  ? 21.816  25.065  17.736  1.00 156.69 ? 69   GLN B OE1  1 
ATOM   7201  N  NE2  . GLN B 2 69  ? 21.430  23.137  18.819  1.00 158.56 ? 69   GLN B NE2  1 
ATOM   7202  H  H    . GLN B 2 69  ? 19.009  23.773  14.608  1.00 187.04 ? 69   GLN B H    1 
ATOM   7203  H  HA   . GLN B 2 69  ? 17.341  24.495  16.367  1.00 184.60 ? 69   GLN B HA   1 
ATOM   7204  H  HB2  . GLN B 2 69  ? 19.943  25.506  15.959  1.00 186.39 ? 69   GLN B HB2  1 
ATOM   7205  H  HB3  . GLN B 2 69  ? 19.119  25.743  17.295  1.00 186.39 ? 69   GLN B HB3  1 
ATOM   7206  H  HG2  . GLN B 2 69  ? 19.184  23.450  17.729  1.00 187.02 ? 69   GLN B HG2  1 
ATOM   7207  H  HG3  . GLN B 2 69  ? 20.040  23.233  16.408  1.00 187.02 ? 69   GLN B HG3  1 
ATOM   7208  H  HE21 . GLN B 2 69  ? 20.918  22.453  18.924  1.00 190.27 ? 69   GLN B HE21 1 
ATOM   7209  H  HE22 . GLN B 2 69  ? 22.143  23.217  19.292  1.00 190.27 ? 69   GLN B HE22 1 
ATOM   7210  N  N    . TYR B 2 70  ? 18.029  27.020  14.504  1.00 156.96 ? 70   TYR B N    1 
ATOM   7211  C  CA   . TYR B 2 70  ? 17.477  28.261  13.972  1.00 152.89 ? 70   TYR B CA   1 
ATOM   7212  C  C    . TYR B 2 70  ? 16.065  28.063  13.421  1.00 146.93 ? 70   TYR B C    1 
ATOM   7213  O  O    . TYR B 2 70  ? 15.094  28.615  13.944  1.00 140.62 ? 70   TYR B O    1 
ATOM   7214  C  CB   . TYR B 2 70  ? 18.408  28.784  12.869  1.00 151.71 ? 70   TYR B CB   1 
ATOM   7215  C  CG   . TYR B 2 70  ? 18.200  30.221  12.430  1.00 150.82 ? 70   TYR B CG   1 
ATOM   7216  C  CD1  . TYR B 2 70  ? 17.232  30.551  11.490  1.00 153.25 ? 70   TYR B CD1  1 
ATOM   7217  C  CD2  . TYR B 2 70  ? 19.002  31.242  12.925  1.00 148.54 ? 70   TYR B CD2  1 
ATOM   7218  C  CE1  . TYR B 2 70  ? 17.050  31.863  11.073  1.00 150.55 ? 70   TYR B CE1  1 
ATOM   7219  C  CE2  . TYR B 2 70  ? 18.829  32.556  12.514  1.00 147.99 ? 70   TYR B CE2  1 
ATOM   7220  C  CZ   . TYR B 2 70  ? 17.851  32.861  11.587  1.00 143.35 ? 70   TYR B CZ   1 
ATOM   7221  O  OH   . TYR B 2 70  ? 17.669  34.161  11.170  1.00 111.30 ? 70   TYR B OH   1 
ATOM   7222  H  H    . TYR B 2 70  ? 18.791  26.803  14.170  1.00 188.35 ? 70   TYR B H    1 
ATOM   7223  H  HA   . TYR B 2 70  ? 17.438  28.924  14.679  1.00 183.47 ? 70   TYR B HA   1 
ATOM   7224  H  HB2  . TYR B 2 70  ? 19.322  28.710  13.183  1.00 182.06 ? 70   TYR B HB2  1 
ATOM   7225  H  HB3  . TYR B 2 70  ? 18.292  28.225  12.085  1.00 182.06 ? 70   TYR B HB3  1 
ATOM   7226  H  HD1  . TYR B 2 70  ? 19.661  31.042  13.550  1.00 178.25 ? 70   TYR B HD1  1 
ATOM   7227  H  HD2  . TYR B 2 70  ? 16.688  29.882  11.140  1.00 183.89 ? 70   TYR B HD2  1 
ATOM   7228  H  HE1  . TYR B 2 70  ? 19.369  33.229  12.861  1.00 177.58 ? 70   TYR B HE1  1 
ATOM   7229  H  HE2  . TYR B 2 70  ? 16.392  32.068  10.448  1.00 180.66 ? 70   TYR B HE2  1 
ATOM   7230  H  HH   . TYR B 2 70  ? 17.045  34.199  10.609  1.00 133.56 ? 70   TYR B HH   1 
ATOM   7231  N  N    . GLN B 2 71  ? 15.970  27.235  12.383  1.00 146.89 ? 71   GLN B N    1 
ATOM   7232  C  CA   . GLN B 2 71  ? 14.712  26.983  11.683  1.00 144.39 ? 71   GLN B CA   1 
ATOM   7233  C  C    . GLN B 2 71  ? 13.663  26.249  12.516  1.00 149.30 ? 71   GLN B C    1 
ATOM   7234  O  O    . GLN B 2 71  ? 12.498  26.187  12.126  1.00 148.27 ? 71   GLN B O    1 
ATOM   7235  C  CB   . GLN B 2 71  ? 14.981  26.194  10.396  1.00 148.09 ? 71   GLN B CB   1 
ATOM   7236  C  CG   . GLN B 2 71  ? 16.092  26.776  9.520   1.00 145.91 ? 71   GLN B CG   1 
ATOM   7237  C  CD   . GLN B 2 71  ? 15.645  27.997  8.740   1.00 141.49 ? 71   GLN B CD   1 
ATOM   7238  O  OE1  . GLN B 2 71  ? 14.517  28.056  8.253   1.00 148.58 ? 71   GLN B OE1  1 
ATOM   7239  N  NE2  . GLN B 2 71  ? 16.527  28.984  8.624   1.00 136.68 ? 71   GLN B NE2  1 
ATOM   7240  H  H    . GLN B 2 71  ? 16.636  26.798  12.058  1.00 176.27 ? 71   GLN B H    1 
ATOM   7241  H  HA   . GLN B 2 71  ? 14.331  27.837  11.425  1.00 173.27 ? 71   GLN B HA   1 
ATOM   7242  H  HB2  . GLN B 2 71  ? 15.236  25.289  10.634  1.00 177.70 ? 71   GLN B HB2  1 
ATOM   7243  H  HB3  . GLN B 2 71  ? 14.168  26.176  9.867   1.00 177.70 ? 71   GLN B HB3  1 
ATOM   7244  H  HG2  . GLN B 2 71  ? 16.836  27.037  10.086  1.00 175.09 ? 71   GLN B HG2  1 
ATOM   7245  H  HG3  . GLN B 2 71  ? 16.379  26.102  8.884   1.00 175.09 ? 71   GLN B HG3  1 
ATOM   7246  H  HE21 . GLN B 2 71  ? 17.305  28.909  8.982   1.00 164.02 ? 71   GLN B HE21 1 
ATOM   7247  H  HE22 . GLN B 2 71  ? 16.320  29.697  8.191   1.00 164.02 ? 71   GLN B HE22 1 
ATOM   7248  N  N    . SER B 2 72  ? 14.071  25.707  13.661  1.00 151.66 ? 72   SER B N    1 
ATOM   7249  C  CA   . SER B 2 72  ? 13.148  24.999  14.546  1.00 154.65 ? 72   SER B CA   1 
ATOM   7250  C  C    . SER B 2 72  ? 12.653  25.919  15.637  1.00 149.78 ? 72   SER B C    1 
ATOM   7251  O  O    . SER B 2 72  ? 11.451  26.076  15.829  1.00 145.97 ? 72   SER B O    1 
ATOM   7252  C  CB   . SER B 2 72  ? 13.814  23.769  15.175  1.00 158.26 ? 72   SER B CB   1 
ATOM   7253  O  OG   . SER B 2 72  ? 12.896  23.039  15.974  1.00 152.13 ? 72   SER B OG   1 
ATOM   7254  H  H    . SER B 2 72  ? 14.880  25.736  13.949  1.00 181.99 ? 72   SER B H    1 
ATOM   7255  H  HA   . SER B 2 72  ? 12.382  24.698  14.032  1.00 185.58 ? 72   SER B HA   1 
ATOM   7256  H  HB2  . SER B 2 72  ? 14.142  23.192  14.467  1.00 189.91 ? 72   SER B HB2  1 
ATOM   7257  H  HB3  . SER B 2 72  ? 14.553  24.061  15.732  1.00 189.91 ? 72   SER B HB3  1 
ATOM   7258  H  HG   . SER B 2 72  ? 13.276  22.370  16.311  1.00 182.56 ? 72   SER B HG   1 
ATOM   7259  N  N    . LYS B 2 73  ? 13.595  26.506  16.367  1.00 150.63 ? 73   LYS B N    1 
ATOM   7260  C  CA   . LYS B 2 73  ? 13.255  27.427  17.439  1.00 147.10 ? 73   LYS B CA   1 
ATOM   7261  C  C    . LYS B 2 73  ? 12.546  28.655  16.886  1.00 143.31 ? 73   LYS B C    1 
ATOM   7262  O  O    . LYS B 2 73  ? 11.610  29.136  17.499  1.00 136.72 ? 73   LYS B O    1 
ATOM   7263  C  CB   . LYS B 2 73  ? 14.494  27.841  18.241  1.00 149.26 ? 73   LYS B CB   1 
ATOM   7264  C  CG   . LYS B 2 73  ? 14.853  26.880  19.380  1.00 148.53 ? 73   LYS B CG   1 
ATOM   7265  C  CD   . LYS B 2 73  ? 13.742  26.764  20.424  1.00 149.08 ? 73   LYS B CD   1 
ATOM   7266  C  CE   . LYS B 2 73  ? 14.078  25.729  21.482  1.00 133.21 ? 73   LYS B CE   1 
ATOM   7267  N  NZ   . LYS B 2 73  ? 12.942  25.540  22.429  1.00 136.79 ? 73   LYS B NZ   1 
ATOM   7268  H  H    . LYS B 2 73  ? 14.439  26.386  16.259  1.00 180.75 ? 73   LYS B H    1 
ATOM   7269  H  HA   . LYS B 2 73  ? 12.645  26.984  18.048  1.00 176.52 ? 73   LYS B HA   1 
ATOM   7270  H  HB2  . LYS B 2 73  ? 15.254  27.884  17.641  1.00 179.11 ? 73   LYS B HB2  1 
ATOM   7271  H  HB3  . LYS B 2 73  ? 14.335  28.715  18.631  1.00 179.11 ? 73   LYS B HB3  1 
ATOM   7272  H  HG2  . LYS B 2 73  ? 15.011  25.997  19.011  1.00 178.23 ? 73   LYS B HG2  1 
ATOM   7273  H  HG3  . LYS B 2 73  ? 15.652  27.202  19.826  1.00 178.23 ? 73   LYS B HG3  1 
ATOM   7274  H  HD2  . LYS B 2 73  ? 13.625  27.621  20.863  1.00 178.89 ? 73   LYS B HD2  1 
ATOM   7275  H  HD3  . LYS B 2 73  ? 12.919  26.495  19.987  1.00 178.89 ? 73   LYS B HD3  1 
ATOM   7276  H  HE2  . LYS B 2 73  ? 14.262  24.879  21.053  1.00 159.85 ? 73   LYS B HE2  1 
ATOM   7277  H  HE3  . LYS B 2 73  ? 14.850  26.026  21.988  1.00 159.85 ? 73   LYS B HE3  1 
ATOM   7278  H  HZ1  . LYS B 2 73  ? 12.221  25.264  21.987  1.00 164.15 ? 73   LYS B HZ1  1 
ATOM   7279  H  HZ2  . LYS B 2 73  ? 13.156  24.931  23.042  1.00 164.15 ? 73   LYS B HZ2  1 
ATOM   7280  H  HZ3  . LYS B 2 73  ? 12.756  26.308  22.838  1.00 164.15 ? 73   LYS B HZ3  1 
ATOM   7281  N  N    . LEU B 2 74  ? 13.026  29.200  15.770  1.00 141.37 ? 74   LEU B N    1 
ATOM   7282  C  CA   . LEU B 2 74  ? 12.341  30.335  15.149  1.00 137.04 ? 74   LEU B CA   1 
ATOM   7283  C  C    . LEU B 2 74  ? 10.934  29.973  14.668  1.00 135.26 ? 74   LEU B C    1 
ATOM   7284  O  O    . LEU B 2 74  ? 9.988   30.743  14.861  1.00 135.56 ? 74   LEU B O    1 
ATOM   7285  C  CB   . LEU B 2 74  ? 13.168  30.882  13.981  1.00 131.34 ? 74   LEU B CB   1 
ATOM   7286  C  CG   . LEU B 2 74  ? 12.666  32.169  13.317  1.00 127.49 ? 74   LEU B CG   1 
ATOM   7287  C  CD1  . LEU B 2 74  ? 12.419  33.276  14.326  1.00 125.99 ? 74   LEU B CD1  1 
ATOM   7288  C  CD2  . LEU B 2 74  ? 13.680  32.639  12.287  1.00 119.75 ? 74   LEU B CD2  1 
ATOM   7289  H  H    . LEU B 2 74  ? 13.733  28.938  15.357  1.00 169.64 ? 74   LEU B H    1 
ATOM   7290  H  HA   . LEU B 2 74  ? 12.255  31.043  15.807  1.00 164.45 ? 74   LEU B HA   1 
ATOM   7291  H  HB2  . LEU B 2 74  ? 14.065  31.058  14.303  1.00 157.61 ? 74   LEU B HB2  1 
ATOM   7292  H  HB3  . LEU B 2 74  ? 13.204  30.200  13.292  1.00 157.61 ? 74   LEU B HB3  1 
ATOM   7293  H  HG   . LEU B 2 74  ? 11.831  31.986  12.858  1.00 152.98 ? 74   LEU B HG   1 
ATOM   7294  H  HD11 . LEU B 2 74  ? 13.249  33.474  14.787  1.00 151.18 ? 74   LEU B HD11 1 
ATOM   7295  H  HD12 . LEU B 2 74  ? 12.104  34.065  13.858  1.00 151.18 ? 74   LEU B HD12 1 
ATOM   7296  H  HD13 . LEU B 2 74  ? 11.749  32.979  14.962  1.00 151.18 ? 74   LEU B HD13 1 
ATOM   7297  H  HD21 . LEU B 2 74  ? 13.791  31.947  11.616  1.00 143.70 ? 74   LEU B HD21 1 
ATOM   7298  H  HD22 . LEU B 2 74  ? 13.354  33.453  11.872  1.00 143.70 ? 74   LEU B HD22 1 
ATOM   7299  H  HD23 . LEU B 2 74  ? 14.525  32.809  12.731  1.00 143.70 ? 74   LEU B HD23 1 
ATOM   7300  N  N    . GLU B 2 75  ? 10.799  28.803  14.048  1.00 133.17 ? 75   GLU B N    1 
ATOM   7301  C  CA   . GLU B 2 75  ? 9.490   28.308  13.639  1.00 134.27 ? 75   GLU B CA   1 
ATOM   7302  C  C    . GLU B 2 75  ? 8.631   28.081  14.881  1.00 139.78 ? 75   GLU B C    1 
ATOM   7303  O  O    . GLU B 2 75  ? 7.430   28.371  14.898  1.00 139.55 ? 75   GLU B O    1 
ATOM   7304  C  CB   . GLU B 2 75  ? 9.639   27.013  12.831  1.00 137.98 ? 75   GLU B CB   1 
ATOM   7305  C  CG   . GLU B 2 75  ? 8.335   26.297  12.499  1.00 140.98 ? 75   GLU B CG   1 
ATOM   7306  C  CD   . GLU B 2 75  ? 7.442   27.109  11.583  1.00 142.79 ? 75   GLU B CD   1 
ATOM   7307  O  OE1  . GLU B 2 75  ? 6.731   28.005  12.085  1.00 136.57 ? 75   GLU B OE1  1 
ATOM   7308  O  OE2  . GLU B 2 75  ? 7.454   26.851  10.360  1.00 153.55 ? 75   GLU B OE2  1 
ATOM   7309  H  H    . GLU B 2 75  ? 11.451  28.278  13.853  1.00 159.80 ? 75   GLU B H    1 
ATOM   7310  H  HA   . GLU B 2 75  ? 9.053   28.970  13.080  1.00 161.13 ? 75   GLU B HA   1 
ATOM   7311  H  HB2  . GLU B 2 75  ? 10.077  27.224  11.992  1.00 165.58 ? 75   GLU B HB2  1 
ATOM   7312  H  HB3  . GLU B 2 75  ? 10.190  26.396  13.338  1.00 165.58 ? 75   GLU B HB3  1 
ATOM   7313  H  HG2  . GLU B 2 75  ? 8.537   25.459  12.056  1.00 169.17 ? 75   GLU B HG2  1 
ATOM   7314  H  HG3  . GLU B 2 75  ? 7.848   26.129  13.321  1.00 169.17 ? 75   GLU B HG3  1 
ATOM   7315  N  N    . SER B 2 76  ? 9.291   27.623  15.941  1.00 144.94 ? 76   SER B N    1 
ATOM   7316  C  CA   . SER B 2 76  ? 8.644   27.312  17.211  1.00 143.67 ? 76   SER B CA   1 
ATOM   7317  C  C    . SER B 2 76  ? 8.180   28.592  17.883  1.00 141.47 ? 76   SER B C    1 
ATOM   7318  O  O    . SER B 2 76  ? 7.108   28.635  18.463  1.00 140.69 ? 76   SER B O    1 
ATOM   7319  C  CB   . SER B 2 76  ? 9.583   26.536  18.138  1.00 138.28 ? 76   SER B CB   1 
ATOM   7320  O  OG   . SER B 2 76  ? 8.960   26.283  19.387  1.00 125.12 ? 76   SER B OG   1 
ATOM   7321  H  H    . SER B 2 76  ? 10.140  27.480  15.947  1.00 173.92 ? 76   SER B H    1 
ATOM   7322  H  HA   . SER B 2 76  ? 7.864   26.761  17.042  1.00 172.41 ? 76   SER B HA   1 
ATOM   7323  H  HB2  . SER B 2 76  ? 9.810   25.690  17.721  1.00 165.94 ? 76   SER B HB2  1 
ATOM   7324  H  HB3  . SER B 2 76  ? 10.386  27.059  18.285  1.00 165.94 ? 76   SER B HB3  1 
ATOM   7325  H  HG   . SER B 2 76  ? 9.483   25.857  19.888  1.00 150.14 ? 76   SER B HG   1 
ATOM   7326  N  N    . GLU B 2 77  ? 9.049   29.596  17.871  1.00 138.02 ? 77   GLU B N    1 
ATOM   7327  C  CA   . GLU B 2 77  ? 8.780   30.889  18.481  1.00 129.27 ? 77   GLU B CA   1 
ATOM   7328  C  C    . GLU B 2 77  ? 7.693   31.607  17.704  1.00 125.32 ? 77   GLU B C    1 
ATOM   7329  O  O    . GLU B 2 77  ? 6.857   32.294  18.286  1.00 125.86 ? 77   GLU B O    1 
ATOM   7330  C  CB   . GLU B 2 77  ? 10.050  31.737  18.527  1.00 127.69 ? 77   GLU B CB   1 
ATOM   7331  C  CG   . GLU B 2 77  ? 10.082  32.736  19.666  1.00 130.32 ? 77   GLU B CG   1 
ATOM   7332  C  CD   . GLU B 2 77  ? 10.195  32.066  21.020  1.00 131.98 ? 77   GLU B CD   1 
ATOM   7333  O  OE1  . GLU B 2 77  ? 11.132  31.257  21.205  1.00 133.02 ? 77   GLU B OE1  1 
ATOM   7334  O  OE2  . GLU B 2 77  ? 9.349   32.346  21.897  1.00 133.06 ? 77   GLU B OE2  1 
ATOM   7335  H  H    . GLU B 2 77  ? 9.824   29.549  17.502  1.00 165.63 ? 77   GLU B H    1 
ATOM   7336  H  HA   . GLU B 2 77  ? 8.469   30.756  19.390  1.00 155.12 ? 77   GLU B HA   1 
ATOM   7337  H  HB2  . GLU B 2 77  ? 10.815  31.149  18.627  1.00 153.23 ? 77   GLU B HB2  1 
ATOM   7338  H  HB3  . GLU B 2 77  ? 10.124  32.233  17.697  1.00 153.23 ? 77   GLU B HB3  1 
ATOM   7339  H  HG2  . GLU B 2 77  ? 10.849  33.319  19.554  1.00 156.39 ? 77   GLU B HG2  1 
ATOM   7340  H  HG3  . GLU B 2 77  ? 9.263   33.256  19.655  1.00 156.39 ? 77   GLU B HG3  1 
ATOM   7341  N  N    . LEU B 2 78  ? 7.719   31.456  16.382  1.00 124.42 ? 78   LEU B N    1 
ATOM   7342  C  CA   . LEU B 2 78  ? 6.664   32.016  15.547  1.00 129.87 ? 78   LEU B CA   1 
ATOM   7343  C  C    . LEU B 2 78  ? 5.375   31.253  15.809  1.00 134.41 ? 78   LEU B C    1 
ATOM   7344  O  O    . LEU B 2 78  ? 4.277   31.811  15.726  1.00 124.97 ? 78   LEU B O    1 
ATOM   7345  C  CB   . LEU B 2 78  ? 7.035   31.943  14.064  1.00 127.48 ? 78   LEU B CB   1 
ATOM   7346  C  CG   . LEU B 2 78  ? 7.899   33.080  13.515  1.00 133.84 ? 78   LEU B CG   1 
ATOM   7347  C  CD1  . LEU B 2 78  ? 8.721   32.606  12.323  1.00 124.59 ? 78   LEU B CD1  1 
ATOM   7348  C  CD2  . LEU B 2 78  ? 7.031   34.274  13.122  1.00 120.92 ? 78   LEU B CD2  1 
ATOM   7349  H  H    . LEU B 2 78  ? 8.333   31.038  15.948  1.00 149.31 ? 78   LEU B H    1 
ATOM   7350  H  HA   . LEU B 2 78  ? 6.524   32.946  15.783  1.00 155.84 ? 78   LEU B HA   1 
ATOM   7351  H  HB2  . LEU B 2 78  ? 7.520   31.116  13.913  1.00 152.97 ? 78   LEU B HB2  1 
ATOM   7352  H  HB3  . LEU B 2 78  ? 6.215   31.931  13.547  1.00 152.97 ? 78   LEU B HB3  1 
ATOM   7353  H  HG   . LEU B 2 78  ? 8.514   33.372  14.207  1.00 160.61 ? 78   LEU B HG   1 
ATOM   7354  H  HD11 . LEU B 2 78  ? 8.120   32.300  11.627  1.00 149.51 ? 78   LEU B HD11 1 
ATOM   7355  H  HD12 . LEU B 2 78  ? 9.258   33.345  11.996  1.00 149.51 ? 78   LEU B HD12 1 
ATOM   7356  H  HD13 . LEU B 2 78  ? 9.297   31.878  12.607  1.00 149.51 ? 78   LEU B HD13 1 
ATOM   7357  H  HD21 . LEU B 2 78  ? 6.552   34.587  13.906  1.00 145.11 ? 78   LEU B HD21 1 
ATOM   7358  H  HD22 . LEU B 2 78  ? 7.601   34.979  12.779  1.00 145.11 ? 78   LEU B HD22 1 
ATOM   7359  H  HD23 . LEU B 2 78  ? 6.401   33.994  12.439  1.00 145.11 ? 78   LEU B HD23 1 
ATOM   7360  N  N    . ARG B 2 79  ? 5.521   29.968  16.127  1.00 137.43 ? 79   ARG B N    1 
ATOM   7361  C  CA   . ARG B 2 79  ? 4.378   29.146  16.489  1.00 135.28 ? 79   ARG B CA   1 
ATOM   7362  C  C    . ARG B 2 79  ? 3.909   29.542  17.895  1.00 128.92 ? 79   ARG B C    1 
ATOM   7363  O  O    . ARG B 2 79  ? 2.712   29.624  18.163  1.00 130.00 ? 79   ARG B O    1 
ATOM   7364  C  CB   . ARG B 2 79  ? 4.738   27.660  16.427  1.00 137.00 ? 79   ARG B CB   1 
ATOM   7365  C  CG   . ARG B 2 79  ? 3.539   26.743  16.363  1.00 142.56 ? 79   ARG B CG   1 
ATOM   7366  C  CD   . ARG B 2 79  ? 3.847   25.355  16.885  1.00 142.45 ? 79   ARG B CD   1 
ATOM   7367  N  NE   . ARG B 2 79  ? 2.720   24.452  16.661  1.00 152.03 ? 79   ARG B NE   1 
ATOM   7368  C  CZ   . ARG B 2 79  ? 1.604   24.445  17.383  1.00 153.86 ? 79   ARG B CZ   1 
ATOM   7369  N  NH1  . ARG B 2 79  ? 1.448   25.303  18.382  1.00 150.34 ? 79   ARG B NH1  1 
ATOM   7370  N  NH2  . ARG B 2 79  ? 0.636   23.584  17.098  1.00 150.46 ? 79   ARG B NH2  1 
ATOM   7371  H  H    . ARG B 2 79  ? 6.273   29.552  16.139  1.00 164.92 ? 79   ARG B H    1 
ATOM   7372  H  HA   . ARG B 2 79  ? 3.653   29.311  15.867  1.00 162.34 ? 79   ARG B HA   1 
ATOM   7373  H  HB2  . ARG B 2 79  ? 5.275   27.502  15.635  1.00 164.40 ? 79   ARG B HB2  1 
ATOM   7374  H  HB3  . ARG B 2 79  ? 5.246   27.429  17.221  1.00 164.40 ? 79   ARG B HB3  1 
ATOM   7375  H  HG2  . ARG B 2 79  ? 2.825   27.116  16.903  1.00 171.07 ? 79   ARG B HG2  1 
ATOM   7376  H  HG3  . ARG B 2 79  ? 3.251   26.661  15.441  1.00 171.07 ? 79   ARG B HG3  1 
ATOM   7377  H  HD2  . ARG B 2 79  ? 4.620   25.000  16.419  1.00 170.94 ? 79   ARG B HD2  1 
ATOM   7378  H  HD3  . ARG B 2 79  ? 4.018   25.400  17.839  1.00 170.94 ? 79   ARG B HD3  1 
ATOM   7379  H  HE   . ARG B 2 79  ? 2.783   23.885  16.018  1.00 182.44 ? 79   ARG B HE   1 
ATOM   7380  H  HH11 . ARG B 2 79  ? 2.073   25.864  18.569  1.00 180.41 ? 79   ARG B HH11 1 
ATOM   7381  H  HH12 . ARG B 2 79  ? 0.724   25.296  18.846  1.00 180.41 ? 79   ARG B HH12 1 
ATOM   7382  H  HH21 . ARG B 2 79  ? 0.734   23.027  16.450  1.00 180.55 ? 79   ARG B HH21 1 
ATOM   7383  H  HH22 . ARG B 2 79  ? -0.087  23.580  17.564  1.00 180.55 ? 79   ARG B HH22 1 
ATOM   7384  N  N    . LYS B 2 80  ? 4.876   29.786  18.779  1.00 130.39 ? 80   LYS B N    1 
ATOM   7385  C  CA   . LYS B 2 80  ? 4.621   30.095  20.187  1.00 132.37 ? 80   LYS B CA   1 
ATOM   7386  C  C    . LYS B 2 80  ? 3.947   31.445  20.317  1.00 130.92 ? 80   LYS B C    1 
ATOM   7387  O  O    . LYS B 2 80  ? 3.118   31.670  21.202  1.00 120.10 ? 80   LYS B O    1 
ATOM   7388  C  CB   . LYS B 2 80  ? 5.927   30.115  20.994  1.00 122.58 ? 80   LYS B CB   1 
ATOM   7389  C  CG   . LYS B 2 80  ? 5.718   30.149  22.507  1.00 128.34 ? 80   LYS B CG   1 
ATOM   7390  C  CD   . LYS B 2 80  ? 7.005   30.446  23.283  1.00 128.43 ? 80   LYS B CD   1 
ATOM   7391  C  CE   . LYS B 2 80  ? 8.131   29.467  22.993  1.00 131.93 ? 80   LYS B CE   1 
ATOM   7392  N  NZ   . LYS B 2 80  ? 9.375   29.837  23.732  1.00 107.96 ? 80   LYS B NZ   1 
ATOM   7393  H  H    . LYS B 2 80  ? 5.713   29.777  18.581  1.00 156.47 ? 80   LYS B H    1 
ATOM   7394  H  HA   . LYS B 2 80  ? 4.035   29.421  20.565  1.00 158.84 ? 80   LYS B HA   1 
ATOM   7395  H  HB2  . LYS B 2 80  ? 6.436   29.316  20.783  1.00 147.10 ? 80   LYS B HB2  1 
ATOM   7396  H  HB3  . LYS B 2 80  ? 6.435   30.903  20.747  1.00 147.10 ? 80   LYS B HB3  1 
ATOM   7397  H  HG2  . LYS B 2 80  ? 5.073   30.842  22.721  1.00 154.01 ? 80   LYS B HG2  1 
ATOM   7398  H  HG3  . LYS B 2 80  ? 5.385   29.286  22.800  1.00 154.01 ? 80   LYS B HG3  1 
ATOM   7399  H  HD2  . LYS B 2 80  ? 7.316   31.334  23.045  1.00 154.12 ? 80   LYS B HD2  1 
ATOM   7400  H  HD3  . LYS B 2 80  ? 6.815   30.407  24.233  1.00 154.12 ? 80   LYS B HD3  1 
ATOM   7401  H  HE2  . LYS B 2 80  ? 7.863   28.578  23.273  1.00 158.32 ? 80   LYS B HE2  1 
ATOM   7402  H  HE3  . LYS B 2 80  ? 8.327   29.476  22.043  1.00 158.32 ? 80   LYS B HE3  1 
ATOM   7403  H  HZ1  . LYS B 2 80  ? 9.220   29.833  24.609  1.00 129.55 ? 80   LYS B HZ1  1 
ATOM   7404  H  HZ2  . LYS B 2 80  ? 10.022  29.253  23.550  1.00 129.55 ? 80   LYS B HZ2  1 
ATOM   7405  H  HZ3  . LYS B 2 80  ? 9.643   30.650  23.489  1.00 129.55 ? 80   LYS B HZ3  1 
ATOM   7406  N  N    . LEU B 2 81  ? 4.309   32.338  19.403  1.00 136.22 ? 81   LEU B N    1 
ATOM   7407  C  CA   . LEU B 2 81  ? 3.817   33.700  19.438  1.00 124.23 ? 81   LEU B CA   1 
ATOM   7408  C  C    . LEU B 2 81  ? 2.640   33.863  18.493  1.00 123.18 ? 81   LEU B C    1 
ATOM   7409  O  O    . LEU B 2 81  ? 2.234   34.986  18.194  1.00 119.34 ? 81   LEU B O    1 
ATOM   7410  C  CB   . LEU B 2 81  ? 4.942   34.671  19.075  1.00 116.96 ? 81   LEU B CB   1 
ATOM   7411  C  CG   . LEU B 2 81  ? 6.074   34.697  20.104  1.00 114.00 ? 81   LEU B CG   1 
ATOM   7412  C  CD1  . LEU B 2 81  ? 7.318   35.349  19.529  1.00 114.09 ? 81   LEU B CD1  1 
ATOM   7413  C  CD2  . LEU B 2 81  ? 5.628   35.420  21.366  1.00 119.53 ? 81   LEU B CD2  1 
ATOM   7414  H  H    . LEU B 2 81  ? 4.842   32.175  18.748  1.00 163.47 ? 81   LEU B H    1 
ATOM   7415  H  HA   . LEU B 2 81  ? 3.516   33.908  20.336  1.00 149.07 ? 81   LEU B HA   1 
ATOM   7416  H  HB2  . LEU B 2 81  ? 5.321   34.408  18.222  1.00 140.35 ? 81   LEU B HB2  1 
ATOM   7417  H  HB3  . LEU B 2 81  ? 4.576   35.567  19.012  1.00 140.35 ? 81   LEU B HB3  1 
ATOM   7418  H  HG   . LEU B 2 81  ? 6.300   33.785  20.346  1.00 136.80 ? 81   LEU B HG   1 
ATOM   7419  H  HD11 . LEU B 2 81  ? 7.105   36.260  19.271  1.00 136.91 ? 81   LEU B HD11 1 
ATOM   7420  H  HD12 . LEU B 2 81  ? 8.014   35.350  20.205  1.00 136.91 ? 81   LEU B HD12 1 
ATOM   7421  H  HD13 . LEU B 2 81  ? 7.609   34.844  18.754  1.00 136.91 ? 81   LEU B HD13 1 
ATOM   7422  H  HD21 . LEU B 2 81  ? 4.865   34.955  21.743  1.00 143.44 ? 81   LEU B HD21 1 
ATOM   7423  H  HD22 . LEU B 2 81  ? 6.361   35.424  22.002  1.00 143.44 ? 81   LEU B HD22 1 
ATOM   7424  H  HD23 . LEU B 2 81  ? 5.382   36.330  21.138  1.00 143.44 ? 81   LEU B HD23 1 
ATOM   7425  N  N    . LYS B 2 82  ? 2.084   32.738  18.041  1.00 122.53 ? 82   LYS B N    1 
ATOM   7426  C  CA   . LYS B 2 82  ? 0.857   32.768  17.257  1.00 112.76 ? 82   LYS B CA   1 
ATOM   7427  C  C    . LYS B 2 82  ? 0.979   33.623  15.992  1.00 114.04 ? 82   LYS B C    1 
ATOM   7428  O  O    . LYS B 2 82  ? 0.037   34.322  15.615  1.00 109.34 ? 82   LYS B O    1 
ATOM   7429  C  CB   . LYS B 2 82  ? -0.269  33.267  18.166  1.00 121.26 ? 82   LYS B CB   1 
ATOM   7430  C  CG   . LYS B 2 82  ? -0.412  32.419  19.435  1.00 122.92 ? 82   LYS B CG   1 
ATOM   7431  C  CD   . LYS B 2 82  ? -1.116  33.159  20.556  1.00 125.95 ? 82   LYS B CD   1 
ATOM   7432  C  CE   . LYS B 2 82  ? -0.077  33.879  21.423  1.00 121.41 ? 82   LYS B CE   1 
ATOM   7433  N  NZ   . LYS B 2 82  ? -0.660  34.894  22.340  1.00 115.60 ? 82   LYS B NZ   1 
ATOM   7434  H  H    . LYS B 2 82  ? 2.398   31.950  18.177  1.00 147.03 ? 82   LYS B H    1 
ATOM   7435  H  HA   . LYS B 2 82  ? 0.640   31.863  16.983  1.00 135.31 ? 82   LYS B HA   1 
ATOM   7436  H  HB2  . LYS B 2 82  ? -0.079  34.180  18.434  1.00 145.51 ? 82   LYS B HB2  1 
ATOM   7437  H  HB3  . LYS B 2 82  ? -1.108  33.229  17.682  1.00 145.51 ? 82   LYS B HB3  1 
ATOM   7438  H  HG2  . LYS B 2 82  ? -0.930  31.625  19.228  1.00 147.50 ? 82   LYS B HG2  1 
ATOM   7439  H  HG3  . LYS B 2 82  ? 0.470   32.168  19.749  1.00 147.50 ? 82   LYS B HG3  1 
ATOM   7440  H  HD2  . LYS B 2 82  ? -1.720  33.820  20.182  1.00 151.13 ? 82   LYS B HD2  1 
ATOM   7441  H  HD3  . LYS B 2 82  ? -1.600  32.528  21.111  1.00 151.13 ? 82   LYS B HD3  1 
ATOM   7442  H  HE2  . LYS B 2 82  ? 0.387   33.221  21.964  1.00 145.70 ? 82   LYS B HE2  1 
ATOM   7443  H  HE3  . LYS B 2 82  ? 0.554   34.332  20.842  1.00 145.70 ? 82   LYS B HE3  1 
ATOM   7444  H  HZ1  . LYS B 2 82  ? -1.238  34.506  22.895  1.00 138.72 ? 82   LYS B HZ1  1 
ATOM   7445  H  HZ2  . LYS B 2 82  ? -0.015  35.279  22.818  1.00 138.72 ? 82   LYS B HZ2  1 
ATOM   7446  H  HZ3  . LYS B 2 82  ? -1.085  35.520  21.871  1.00 138.72 ? 82   LYS B HZ3  1 
ATOM   7447  N  N    . PHE B 2 83  ? 2.137   33.549  15.336  1.00 120.89 ? 83   PHE B N    1 
ATOM   7448  C  CA   . PHE B 2 83  ? 2.331   34.179  14.029  1.00 120.64 ? 83   PHE B CA   1 
ATOM   7449  C  C    . PHE B 2 83  ? 2.509   33.130  12.933  1.00 122.08 ? 83   PHE B C    1 
ATOM   7450  O  O    . PHE B 2 83  ? 3.094   32.071  13.161  1.00 125.81 ? 83   PHE B O    1 
ATOM   7451  C  CB   . PHE B 2 83  ? 3.560   35.096  14.055  1.00 119.17 ? 83   PHE B CB   1 
ATOM   7452  C  CG   . PHE B 2 83  ? 3.412   36.303  14.953  1.00 115.82 ? 83   PHE B CG   1 
ATOM   7453  C  CD1  . PHE B 2 83  ? 2.242   37.046  14.969  1.00 116.19 ? 83   PHE B CD1  1 
ATOM   7454  C  CD2  . PHE B 2 83  ? 4.455   36.693  15.782  1.00 108.43 ? 83   PHE B CD2  1 
ATOM   7455  C  CE1  . PHE B 2 83  ? 2.113   38.153  15.801  1.00 106.98 ? 83   PHE B CE1  1 
ATOM   7456  C  CE2  . PHE B 2 83  ? 4.335   37.798  16.612  1.00 102.35 ? 83   PHE B CE2  1 
ATOM   7457  C  CZ   . PHE B 2 83  ? 3.162   38.529  16.622  1.00 99.17  ? 83   PHE B CZ   1 
ATOM   7458  H  H    . PHE B 2 83  ? 2.832   33.136  15.629  1.00 145.07 ? 83   PHE B H    1 
ATOM   7459  H  HA   . PHE B 2 83  ? 1.553   34.717  13.813  1.00 144.77 ? 83   PHE B HA   1 
ATOM   7460  H  HB2  . PHE B 2 83  ? 4.323   34.585  14.369  1.00 143.01 ? 83   PHE B HB2  1 
ATOM   7461  H  HB3  . PHE B 2 83  ? 3.729   35.416  13.155  1.00 143.01 ? 83   PHE B HB3  1 
ATOM   7462  H  HD1  . PHE B 2 83  ? 1.533   36.798  14.421  1.00 139.43 ? 83   PHE B HD1  1 
ATOM   7463  H  HD2  . PHE B 2 83  ? 5.246   36.205  15.781  1.00 130.11 ? 83   PHE B HD2  1 
ATOM   7464  H  HE1  . PHE B 2 83  ? 1.323   38.643  15.803  1.00 128.37 ? 83   PHE B HE1  1 
ATOM   7465  H  HE2  . PHE B 2 83  ? 5.042   38.046  17.162  1.00 122.82 ? 83   PHE B HE2  1 
ATOM   7466  H  HZ   . PHE B 2 83  ? 3.078   39.271  17.177  1.00 119.00 ? 83   PHE B HZ   1 
ATOM   7467  N  N    . PRO B 2 95  ? -3.922  34.570  11.839  1.00 137.43 ? 95   PRO B N    1 
ATOM   7468  C  CA   . PRO B 2 95  ? -2.473  34.635  12.060  1.00 134.69 ? 95   PRO B CA   1 
ATOM   7469  C  C    . PRO B 2 95  ? -1.749  35.345  10.918  1.00 136.07 ? 95   PRO B C    1 
ATOM   7470  O  O    . PRO B 2 95  ? -0.610  35.788  11.090  1.00 121.39 ? 95   PRO B O    1 
ATOM   7471  C  CB   . PRO B 2 95  ? -2.070  33.163  12.137  1.00 121.87 ? 95   PRO B CB   1 
ATOM   7472  C  CG   . PRO B 2 95  ? -3.041  32.483  11.218  1.00 138.41 ? 95   PRO B CG   1 
ATOM   7473  C  CD   . PRO B 2 95  ? -4.340  33.258  11.314  1.00 138.13 ? 95   PRO B CD   1 
ATOM   7474  H  HA   . PRO B 2 95  ? -2.272  35.074  12.902  1.00 161.62 ? 95   PRO B HA   1 
ATOM   7475  H  HB2  . PRO B 2 95  ? -1.159  33.052  11.823  1.00 146.24 ? 95   PRO B HB2  1 
ATOM   7476  H  HB3  . PRO B 2 95  ? -2.167  32.840  13.046  1.00 146.24 ? 95   PRO B HB3  1 
ATOM   7477  H  HG2  . PRO B 2 95  ? -2.699  32.507  10.310  1.00 166.09 ? 95   PRO B HG2  1 
ATOM   7478  H  HG3  . PRO B 2 95  ? -3.171  31.566  11.507  1.00 166.09 ? 95   PRO B HG3  1 
ATOM   7479  H  HD2  . PRO B 2 95  ? -4.739  33.358  10.436  1.00 165.76 ? 95   PRO B HD2  1 
ATOM   7480  H  HD3  . PRO B 2 95  ? -4.946  32.824  11.934  1.00 165.76 ? 95   PRO B HD3  1 
ATOM   7481  N  N    . ARG B 2 96  ? -2.410  35.443  9.766   1.00 140.51 ? 96   ARG B N    1 
ATOM   7482  C  CA   . ARG B 2 96  ? -1.893  36.219  8.646   1.00 125.78 ? 96   ARG B CA   1 
ATOM   7483  C  C    . ARG B 2 96  ? -2.075  37.692  8.999   1.00 120.14 ? 96   ARG B C    1 
ATOM   7484  O  O    . ARG B 2 96  ? -1.284  38.557  8.628   1.00 117.71 ? 96   ARG B O    1 
ATOM   7485  C  CB   . ARG B 2 96  ? -2.667  35.881  7.365   1.00 139.95 ? 96   ARG B CB   1 
ATOM   7486  C  CG   . ARG B 2 96  ? -2.321  34.545  6.714   1.00 148.98 ? 96   ARG B CG   1 
ATOM   7487  C  CD   . ARG B 2 96  ? -3.352  34.190  5.636   1.00 153.66 ? 96   ARG B CD   1 
ATOM   7488  N  NE   . ARG B 2 96  ? -3.047  32.944  4.932   1.00 152.14 ? 96   ARG B NE   1 
ATOM   7489  C  CZ   . ARG B 2 96  ? -3.865  32.354  4.062   1.00 152.93 ? 96   ARG B CZ   1 
ATOM   7490  N  NH1  . ARG B 2 96  ? -5.045  32.891  3.779   1.00 141.60 ? 96   ARG B NH1  1 
ATOM   7491  N  NH2  . ARG B 2 96  ? -3.504  31.222  3.471   1.00 158.98 ? 96   ARG B NH2  1 
ATOM   7492  H  H    . ARG B 2 96  ? -3.166  35.066  9.609   1.00 168.61 ? 96   ARG B H    1 
ATOM   7493  H  HA   . ARG B 2 96  ? -0.951  36.034  8.512   1.00 150.93 ? 96   ARG B HA   1 
ATOM   7494  H  HB2  . ARG B 2 96  ? -3.614  35.865  7.574   1.00 167.94 ? 96   ARG B HB2  1 
ATOM   7495  H  HB3  . ARG B 2 96  ? -2.493  36.576  6.710   1.00 167.94 ? 96   ARG B HB3  1 
ATOM   7496  H  HG2  . ARG B 2 96  ? -1.447  34.605  6.297   1.00 178.78 ? 96   ARG B HG2  1 
ATOM   7497  H  HG3  . ARG B 2 96  ? -2.327  33.846  7.387   1.00 178.78 ? 96   ARG B HG3  1 
ATOM   7498  H  HD2  . ARG B 2 96  ? -4.222  34.092  6.053   1.00 184.39 ? 96   ARG B HD2  1 
ATOM   7499  H  HD3  . ARG B 2 96  ? -3.378  34.904  4.980   1.00 184.39 ? 96   ARG B HD3  1 
ATOM   7500  H  HE   . ARG B 2 96  ? -2.291  32.568  5.092   1.00 182.57 ? 96   ARG B HE   1 
ATOM   7501  H  HH11 . ARG B 2 96  ? -5.285  33.625  4.158   1.00 169.92 ? 96   ARG B HH11 1 
ATOM   7502  H  HH12 . ARG B 2 96  ? -5.568  32.506  3.216   1.00 169.92 ? 96   ARG B HH12 1 
ATOM   7503  H  HH21 . ARG B 2 96  ? -2.741  30.868  3.649   1.00 190.78 ? 96   ARG B HH21 1 
ATOM   7504  H  HH22 . ARG B 2 96  ? -4.034  30.843  2.909   1.00 190.78 ? 96   ARG B HH22 1 
ATOM   7505  N  N    . ARG B 2 97  ? -3.155  37.930  9.735   1.00 121.15 ? 97   ARG B N    1 
ATOM   7506  C  CA   . ARG B 2 97  ? -3.577  39.237  10.226  1.00 115.34 ? 97   ARG B CA   1 
ATOM   7507  C  C    . ARG B 2 97  ? -2.701  39.829  11.349  1.00 110.68 ? 97   ARG B C    1 
ATOM   7508  O  O    . ARG B 2 97  ? -2.294  41.005  11.315  1.00 102.42 ? 97   ARG B O    1 
ATOM   7509  C  CB   . ARG B 2 97  ? -5.024  39.088  10.695  1.00 105.74 ? 97   ARG B CB   1 
ATOM   7510  C  CG   . ARG B 2 97  ? -5.776  40.355  10.988  1.00 104.84 ? 97   ARG B CG   1 
ATOM   7511  C  CD   . ARG B 2 97  ? -7.062  40.013  11.724  1.00 105.66 ? 97   ARG B CD   1 
ATOM   7512  N  NE   . ARG B 2 97  ? -6.829  39.524  13.082  1.00 113.92 ? 97   ARG B NE   1 
ATOM   7513  C  CZ   . ARG B 2 97  ? -6.921  40.265  14.184  1.00 116.71 ? 97   ARG B CZ   1 
ATOM   7514  N  NH1  . ARG B 2 97  ? -7.250  41.549  14.109  1.00 108.73 ? 97   ARG B NH1  1 
ATOM   7515  N  NH2  . ARG B 2 97  ? -6.686  39.717  15.370  1.00 105.10 ? 97   ARG B NH2  1 
ATOM   7516  H  H    . ARG B 2 97  ? -3.693  37.305  9.978   1.00 145.38 ? 97   ARG B H    1 
ATOM   7517  H  HA   . ARG B 2 97  ? -3.569  39.865  9.486   1.00 138.41 ? 97   ARG B HA   1 
ATOM   7518  H  HB2  . ARG B 2 97  ? -5.517  38.615  10.007  1.00 126.89 ? 97   ARG B HB2  1 
ATOM   7519  H  HB3  . ARG B 2 97  ? -5.025  38.560  11.509  1.00 126.89 ? 97   ARG B HB3  1 
ATOM   7520  H  HG2  . ARG B 2 97  ? -5.238  40.932  11.553  1.00 125.81 ? 97   ARG B HG2  1 
ATOM   7521  H  HG3  . ARG B 2 97  ? -6.002  40.801  10.157  1.00 125.81 ? 97   ARG B HG3  1 
ATOM   7522  H  HD2  . ARG B 2 97  ? -7.613  40.810  11.783  1.00 126.79 ? 97   ARG B HD2  1 
ATOM   7523  H  HD3  . ARG B 2 97  ? -7.533  39.322  11.233  1.00 126.79 ? 97   ARG B HD3  1 
ATOM   7524  H  HE   . ARG B 2 97  ? -6.616  38.696  13.176  1.00 136.70 ? 97   ARG B HE   1 
ATOM   7525  H  HH11 . ARG B 2 97  ? -7.403  41.910  13.344  1.00 130.48 ? 97   ARG B HH11 1 
ATOM   7526  H  HH12 . ARG B 2 97  ? -7.308  42.021  14.826  1.00 130.48 ? 97   ARG B HH12 1 
ATOM   7527  H  HH21 . ARG B 2 97  ? -6.474  38.885  15.425  1.00 126.12 ? 97   ARG B HH21 1 
ATOM   7528  H  HH22 . ARG B 2 97  ? -6.746  40.193  16.083  1.00 126.12 ? 97   ARG B HH22 1 
ATOM   7529  N  N    . ARG B 2 98  ? -2.395  38.985  12.330  1.00 111.61 ? 98   ARG B N    1 
ATOM   7530  C  CA   . ARG B 2 98  ? -1.610  39.382  13.494  1.00 108.51 ? 98   ARG B CA   1 
ATOM   7531  C  C    . ARG B 2 98  ? -0.225  39.901  13.110  1.00 108.17 ? 98   ARG B C    1 
ATOM   7532  O  O    . ARG B 2 98  ? 0.223   40.948  13.599  1.00 106.82 ? 98   ARG B O    1 
ATOM   7533  C  CB   . ARG B 2 98  ? -1.477  38.187  14.441  1.00 110.34 ? 98   ARG B CB   1 
ATOM   7534  C  CG   . ARG B 2 98  ? -2.681  37.966  15.356  1.00 117.91 ? 98   ARG B CG   1 
ATOM   7535  C  CD   . ARG B 2 98  ? -2.574  36.652  16.134  1.00 118.97 ? 98   ARG B CD   1 
ATOM   7536  N  NE   . ARG B 2 98  ? -1.251  36.443  16.727  1.00 108.65 ? 98   ARG B NE   1 
ATOM   7537  C  CZ   . ARG B 2 98  ? -0.880  36.868  17.931  1.00 104.22 ? 98   ARG B CZ   1 
ATOM   7538  N  NH1  . ARG B 2 98  ? -1.727  37.535  18.702  1.00 116.01 ? 98   ARG B NH1  1 
ATOM   7539  N  NH2  . ARG B 2 98  ? 0.346   36.624  18.370  1.00 109.73 ? 98   ARG B NH2  1 
ATOM   7540  H  H    . ARG B 2 98  ? -2.635  38.159  12.344  1.00 133.94 ? 98   ARG B H    1 
ATOM   7541  H  HA   . ARG B 2 98  ? -2.077  40.090  13.965  1.00 130.22 ? 98   ARG B HA   1 
ATOM   7542  H  HB2  . ARG B 2 98  ? -1.358  37.383  13.911  1.00 132.41 ? 98   ARG B HB2  1 
ATOM   7543  H  HB3  . ARG B 2 98  ? -0.700  38.324  15.005  1.00 132.41 ? 98   ARG B HB3  1 
ATOM   7544  H  HG2  . ARG B 2 98  ? -2.734  38.693  15.995  1.00 141.49 ? 98   ARG B HG2  1 
ATOM   7545  H  HG3  . ARG B 2 98  ? -3.488  37.934  14.818  1.00 141.49 ? 98   ARG B HG3  1 
ATOM   7546  H  HD2  . ARG B 2 98  ? -3.226  36.657  16.852  1.00 142.76 ? 98   ARG B HD2  1 
ATOM   7547  H  HD3  . ARG B 2 98  ? -2.751  35.913  15.531  1.00 142.76 ? 98   ARG B HD3  1 
ATOM   7548  H  HE   . ARG B 2 98  ? -0.670  36.013  16.261  1.00 130.38 ? 98   ARG B HE   1 
ATOM   7549  H  HH11 . ARG B 2 98  ? -2.524  37.698  18.424  1.00 139.21 ? 98   ARG B HH11 1 
ATOM   7550  H  HH12 . ARG B 2 98  ? -1.478  37.806  19.479  1.00 139.21 ? 98   ARG B HH12 1 
ATOM   7551  H  HH21 . ARG B 2 98  ? 0.901   36.191  17.876  1.00 131.68 ? 98   ARG B HH21 1 
ATOM   7552  H  HH22 . ARG B 2 98  ? 0.586   36.898  19.149  1.00 131.68 ? 98   ARG B HH22 1 
ATOM   7553  N  N    . ASP B 2 99  ? 0.432   39.184  12.205  1.00 109.48 ? 99   ASP B N    1 
ATOM   7554  C  CA   . ASP B 2 99  ? 1.764   39.555  11.757  1.00 97.81  ? 99   ASP B CA   1 
ATOM   7555  C  C    . ASP B 2 99  ? 1.743   40.868  10.999  1.00 91.41  ? 99   ASP B C    1 
ATOM   7556  O  O    . ASP B 2 99  ? 2.699   41.641  11.048  1.00 99.44  ? 99   ASP B O    1 
ATOM   7557  C  CB   . ASP B 2 99  ? 2.348   38.466  10.861  1.00 97.32  ? 99   ASP B CB   1 
ATOM   7558  C  CG   . ASP B 2 99  ? 3.701   38.838  10.314  1.00 96.57  ? 99   ASP B CG   1 
ATOM   7559  O  OD1  . ASP B 2 99  ? 4.705   38.668  11.031  1.00 101.63 ? 99   ASP B OD1  1 
ATOM   7560  O  OD2  . ASP B 2 99  ? 3.760   39.331  9.170   1.00 108.57 ? 99   ASP B OD2  1 
ATOM   7561  H  H    . ASP B 2 99  ? 0.123   38.473  11.833  1.00 131.38 ? 99   ASP B H    1 
ATOM   7562  H  HA   . ASP B 2 99  ? 2.344   39.658  12.528  1.00 117.37 ? 99   ASP B HA   1 
ATOM   7563  H  HB2  . ASP B 2 99  ? 2.445   37.649  11.376  1.00 116.78 ? 99   ASP B HB2  1 
ATOM   7564  H  HB3  . ASP B 2 99  ? 1.750   38.317  10.111  1.00 116.78 ? 99   ASP B HB3  1 
ATOM   7565  N  N    . HIS B 2 100 ? 0.648   41.119  10.294  1.00 101.45 ? 100  HIS B N    1 
ATOM   7566  C  CA   . HIS B 2 100 ? 0.539   42.329  9.498   1.00 109.57 ? 100  HIS B CA   1 
ATOM   7567  C  C    . HIS B 2 100 ? 0.313   43.531  10.415  1.00 98.58  ? 100  HIS B C    1 
ATOM   7568  O  O    . HIS B 2 100 ? 0.996   44.548  10.288  1.00 93.09  ? 100  HIS B O    1 
ATOM   7569  C  CB   . HIS B 2 100 ? -0.590  42.214  8.470   1.00 101.64 ? 100  HIS B CB   1 
ATOM   7570  C  CG   . HIS B 2 100 ? -0.568  43.295  7.435   1.00 106.78 ? 100  HIS B CG   1 
ATOM   7571  N  ND1  . HIS B 2 100 ? -1.714  43.870  6.930   1.00 107.81 ? 100  HIS B ND1  1 
ATOM   7572  C  CD2  . HIS B 2 100 ? 0.467   43.912  6.815   1.00 114.84 ? 100  HIS B CD2  1 
ATOM   7573  C  CE1  . HIS B 2 100 ? -1.386  44.792  6.041   1.00 113.64 ? 100  HIS B CE1  1 
ATOM   7574  N  NE2  . HIS B 2 100 ? -0.069  44.838  5.953   1.00 114.26 ? 100  HIS B NE2  1 
ATOM   7575  H  H    . HIS B 2 100 ? -0.042  40.607  10.259  1.00 121.75 ? 100  HIS B H    1 
ATOM   7576  H  HA   . HIS B 2 100 ? 1.370   42.469  9.018   1.00 131.48 ? 100  HIS B HA   1 
ATOM   7577  H  HB2  . HIS B 2 100 ? -0.512  41.362  8.013   1.00 121.97 ? 100  HIS B HB2  1 
ATOM   7578  H  HB3  . HIS B 2 100 ? -1.442  42.263  8.933   1.00 121.97 ? 100  HIS B HB3  1 
ATOM   7579  H  HD1  . HIS B 2 100 ? -2.516  43.661  7.157   1.00 129.37 ? 100  HIS B HD1  1 
ATOM   7580  H  HD2  . HIS B 2 100 ? 1.372   43.740  6.948   1.00 137.81 ? 100  HIS B HD2  1 
ATOM   7581  H  HE1  . HIS B 2 100 ? -1.982  45.319  5.560   1.00 136.37 ? 100  HIS B HE1  1 
ATOM   7582  H  HE2  . HIS B 2 100 ? 0.380   45.361  5.439   1.00 137.11 ? 100  HIS B HE2  1 
ATOM   7583  N  N    . ILE B 2 101 ? -0.639  43.417  11.339  1.00 94.09  ? 101  ILE B N    1 
ATOM   7584  C  CA   . ILE B 2 101 ? -0.923  44.538  12.236  1.00 101.18 ? 101  ILE B CA   1 
ATOM   7585  C  C    . ILE B 2 101 ? 0.240   44.829  13.189  1.00 89.37  ? 101  ILE B C    1 
ATOM   7586  O  O    . ILE B 2 101 ? 0.619   45.993  13.385  1.00 86.39  ? 101  ILE B O    1 
ATOM   7587  C  CB   . ILE B 2 101 ? -2.188  44.271  13.071  1.00 101.98 ? 101  ILE B CB   1 
ATOM   7588  C  CG1  . ILE B 2 101 ? -3.384  44.038  12.143  1.00 104.41 ? 101  ILE B CG1  1 
ATOM   7589  C  CG2  . ILE B 2 101 ? -2.466  45.450  14.009  1.00 92.92  ? 101  ILE B CG2  1 
ATOM   7590  C  CD1  . ILE B 2 101 ? -4.685  43.733  12.864  1.00 108.52 ? 101  ILE B CD1  1 
ATOM   7591  H  H    . ILE B 2 101 ? -1.126  42.719  11.466  1.00 112.91 ? 101  ILE B H    1 
ATOM   7592  H  HA   . ILE B 2 101 ? -1.079  45.334  11.704  1.00 121.42 ? 101  ILE B HA   1 
ATOM   7593  H  HB   . ILE B 2 101 ? -2.047  43.474  13.606  1.00 122.37 ? 101  ILE B HB   1 
ATOM   7594  H  HG12 . ILE B 2 101 ? -3.523  44.835  11.609  1.00 125.29 ? 101  ILE B HG12 1 
ATOM   7595  H  HG13 . ILE B 2 101 ? -3.185  43.286  11.564  1.00 125.29 ? 101  ILE B HG13 1 
ATOM   7596  H  HG21 . ILE B 2 101 ? -2.596  46.252  13.478  1.00 111.50 ? 101  ILE B HG21 1 
ATOM   7597  H  HG22 . ILE B 2 101 ? -3.266  45.262  14.524  1.00 111.50 ? 101  ILE B HG22 1 
ATOM   7598  H  HG23 . ILE B 2 101 ? -1.709  45.566  14.604  1.00 111.50 ? 101  ILE B HG23 1 
ATOM   7599  H  HD11 . ILE B 2 101 ? -4.909  44.481  13.439  1.00 130.22 ? 101  ILE B HD11 1 
ATOM   7600  H  HD12 . ILE B 2 101 ? -5.386  43.600  12.206  1.00 130.22 ? 101  ILE B HD12 1 
ATOM   7601  H  HD13 . ILE B 2 101 ? -4.571  42.929  13.394  1.00 130.22 ? 101  ILE B HD13 1 
ATOM   7602  N  N    . SER B 2 102 ? 0.818   43.774  13.759  1.00 91.06  ? 102  SER B N    1 
ATOM   7603  C  CA   . SER B 2 102 ? 1.885   43.934  14.746  1.00 96.50  ? 102  SER B CA   1 
ATOM   7604  C  C    . SER B 2 102 ? 3.067   44.684  14.130  1.00 90.12  ? 102  SER B C    1 
ATOM   7605  O  O    . SER B 2 102 ? 3.730   45.515  14.783  1.00 81.43  ? 102  SER B O    1 
ATOM   7606  C  CB   . SER B 2 102 ? 2.330   42.575  15.280  1.00 92.41  ? 102  SER B CB   1 
ATOM   7607  O  OG   . SER B 2 102 ? 2.865   41.765  14.249  1.00 97.29  ? 102  SER B OG   1 
ATOM   7608  H  H    . SER B 2 102 ? 0.612   42.956  13.592  1.00 109.27 ? 102  SER B H    1 
ATOM   7609  H  HA   . SER B 2 102 ? 1.552   44.457  15.492  1.00 115.80 ? 102  SER B HA   1 
ATOM   7610  H  HB2  . SER B 2 102 ? 3.010   42.711  15.958  1.00 110.89 ? 102  SER B HB2  1 
ATOM   7611  H  HB3  . SER B 2 102 ? 1.563   42.124  15.667  1.00 110.89 ? 102  SER B HB3  1 
ATOM   7612  H  HG   . SER B 2 102 ? 2.286   41.638  13.654  1.00 116.75 ? 102  SER B HG   1 
ATOM   7613  N  N    . HIS B 2 103 ? 3.305   44.395  12.856  1.00 84.53  ? 103  HIS B N    1 
ATOM   7614  C  CA   . HIS B 2 103 ? 4.410   45.002  12.144  1.00 92.09  ? 103  HIS B CA   1 
ATOM   7615  C  C    . HIS B 2 103 ? 4.206   46.495  11.998  1.00 89.04  ? 103  HIS B C    1 
ATOM   7616  O  O    . HIS B 2 103 ? 5.147   47.271  12.159  1.00 87.68  ? 103  HIS B O    1 
ATOM   7617  C  CB   . HIS B 2 103 ? 4.566   44.374  10.759  1.00 93.87  ? 103  HIS B CB   1 
ATOM   7618  C  CG   . HIS B 2 103 ? 5.550   45.089  9.887   1.00 93.23  ? 103  HIS B CG   1 
ATOM   7619  N  ND1  . HIS B 2 103 ? 6.911   45.002  10.073  1.00 92.95  ? 103  HIS B ND1  1 
ATOM   7620  C  CD2  . HIS B 2 103 ? 5.368   45.911  8.827   1.00 88.97  ? 103  HIS B CD2  1 
ATOM   7621  C  CE1  . HIS B 2 103 ? 7.527   45.739  9.168   1.00 83.48  ? 103  HIS B CE1  1 
ATOM   7622  N  NE2  . HIS B 2 103 ? 6.614   46.298  8.398   1.00 93.47  ? 103  HIS B NE2  1 
ATOM   7623  H  H    . HIS B 2 103 ? 2.838   43.849  12.383  1.00 101.44 ? 103  HIS B H    1 
ATOM   7624  H  HA   . HIS B 2 103 ? 5.230   44.855  12.640  1.00 110.50 ? 103  HIS B HA   1 
ATOM   7625  H  HB2  . HIS B 2 103 ? 4.871   43.459  10.863  1.00 112.64 ? 103  HIS B HB2  1 
ATOM   7626  H  HB3  . HIS B 2 103 ? 3.707   44.386  10.310  1.00 112.64 ? 103  HIS B HB3  1 
ATOM   7627  H  HD1  . HIS B 2 103 ? 7.300   44.541  10.687  1.00 111.54 ? 103  HIS B HD1  1 
ATOM   7628  H  HD2  . HIS B 2 103 ? 4.553   46.165  8.459   1.00 106.77 ? 103  HIS B HD2  1 
ATOM   7629  H  HE1  . HIS B 2 103 ? 8.448   45.841  9.083   1.00 100.17 ? 103  HIS B HE1  1 
ATOM   7630  H  HE2  . HIS B 2 103 ? 6.772   46.823  7.735   1.00 112.17 ? 103  HIS B HE2  1 
ATOM   7631  N  N    . PHE B 2 104 ? 2.968   46.899  11.733  1.00 89.08  ? 104  PHE B N    1 
ATOM   7632  C  CA   . PHE B 2 104 ? 2.682   48.306  11.488  1.00 97.96  ? 104  PHE B CA   1 
ATOM   7633  C  C    . PHE B 2 104 ? 2.505   49.053  12.798  1.00 91.09  ? 104  PHE B C    1 
ATOM   7634  O  O    . PHE B 2 104 ? 2.668   50.276  12.852  1.00 86.34  ? 104  PHE B O    1 
ATOM   7635  C  CB   . PHE B 2 104 ? 1.440   48.456  10.610  1.00 83.82  ? 104  PHE B CB   1 
ATOM   7636  C  CG   . PHE B 2 104 ? 1.739   48.371  9.144   1.00 92.52  ? 104  PHE B CG   1 
ATOM   7637  C  CD1  . PHE B 2 104 ? 1.867   47.141  8.519   1.00 105.89 ? 104  PHE B CD1  1 
ATOM   7638  C  CD2  . PHE B 2 104 ? 1.932   49.520  8.397   1.00 96.68  ? 104  PHE B CD2  1 
ATOM   7639  C  CE1  . PHE B 2 104 ? 2.155   47.056  7.166   1.00 109.87 ? 104  PHE B CE1  1 
ATOM   7640  C  CE2  . PHE B 2 104 ? 2.223   49.446  7.046   1.00 104.60 ? 104  PHE B CE2  1 
ATOM   7641  C  CZ   . PHE B 2 104 ? 2.337   48.212  6.429   1.00 112.85 ? 104  PHE B CZ   1 
ATOM   7642  H  H    . PHE B 2 104 ? 2.282   46.382  11.689  1.00 106.90 ? 104  PHE B H    1 
ATOM   7643  H  HA   . PHE B 2 104 ? 3.432   48.702  11.017  1.00 117.55 ? 104  PHE B HA   1 
ATOM   7644  H  HB2  . PHE B 2 104 ? 0.813   47.748  10.828  1.00 100.58 ? 104  PHE B HB2  1 
ATOM   7645  H  HB3  . PHE B 2 104 ? 1.035   49.321  10.782  1.00 100.58 ? 104  PHE B HB3  1 
ATOM   7646  H  HD1  . PHE B 2 104 ? 1.745   46.361  9.011   1.00 127.07 ? 104  PHE B HD1  1 
ATOM   7647  H  HD2  . PHE B 2 104 ? 1.856   50.351  8.806   1.00 116.01 ? 104  PHE B HD2  1 
ATOM   7648  H  HE1  . PHE B 2 104 ? 2.232   46.225  6.756   1.00 131.85 ? 104  PHE B HE1  1 
ATOM   7649  H  HE2  . PHE B 2 104 ? 2.343   50.226  6.553   1.00 125.52 ? 104  PHE B HE2  1 
ATOM   7650  H  HZ   . PHE B 2 104 ? 2.531   48.161  5.521   1.00 135.42 ? 104  PHE B HZ   1 
ATOM   7651  N  N    . ILE B 2 105 ? 2.202   48.316  13.861  1.00 87.26  ? 105  ILE B N    1 
ATOM   7652  C  CA   . ILE B 2 105 ? 2.195   48.922  15.181  1.00 87.30  ? 105  ILE B CA   1 
ATOM   7653  C  C    . ILE B 2 105 ? 3.618   49.197  15.646  1.00 89.58  ? 105  ILE B C    1 
ATOM   7654  O  O    . ILE B 2 105 ? 3.904   50.291  16.142  1.00 87.74  ? 105  ILE B O    1 
ATOM   7655  C  CB   . ILE B 2 105 ? 1.491   48.033  16.221  1.00 91.77  ? 105  ILE B CB   1 
ATOM   7656  C  CG1  . ILE B 2 105 ? 0.002   47.938  15.892  1.00 93.45  ? 105  ILE B CG1  1 
ATOM   7657  C  CG2  . ILE B 2 105 ? 1.665   48.617  17.629  1.00 88.39  ? 105  ILE B CG2  1 
ATOM   7658  C  CD1  . ILE B 2 105 ? -0.782  47.014  16.803  1.00 91.90  ? 105  ILE B CD1  1 
ATOM   7659  H  H    . ILE B 2 105 ? 2.000   47.480  13.844  1.00 104.71 ? 105  ILE B H    1 
ATOM   7660  H  HA   . ILE B 2 105 ? 1.723   49.769  15.139  1.00 104.76 ? 105  ILE B HA   1 
ATOM   7661  H  HB   . ILE B 2 105 ? 1.880   47.144  16.194  1.00 110.13 ? 105  ILE B HB   1 
ATOM   7662  H  HG12 . ILE B 2 105 ? -0.389  48.823  15.963  1.00 112.13 ? 105  ILE B HG12 1 
ATOM   7663  H  HG13 . ILE B 2 105 ? -0.096  47.610  14.984  1.00 112.13 ? 105  ILE B HG13 1 
ATOM   7664  H  HG21 . ILE B 2 105 ? 1.276   49.505  17.652  1.00 106.07 ? 105  ILE B HG21 1 
ATOM   7665  H  HG22 . ILE B 2 105 ? 1.214   48.042  18.267  1.00 106.07 ? 105  ILE B HG22 1 
ATOM   7666  H  HG23 . ILE B 2 105 ? 2.611   48.664  17.836  1.00 106.07 ? 105  ILE B HG23 1 
ATOM   7667  H  HD11 . ILE B 2 105 ? -0.708  47.334  17.716  1.00 110.27 ? 105  ILE B HD11 1 
ATOM   7668  H  HD12 . ILE B 2 105 ? -1.712  47.013  16.527  1.00 110.27 ? 105  ILE B HD12 1 
ATOM   7669  H  HD13 . ILE B 2 105 ? -0.415  46.119  16.735  1.00 110.27 ? 105  ILE B HD13 1 
ATOM   7670  N  N    . LEU B 2 106 ? 4.520   48.228  15.474  1.00 85.47  ? 106  LEU B N    1 
ATOM   7671  C  CA   . LEU B 2 106 ? 5.895   48.446  15.925  1.00 85.78  ? 106  LEU B CA   1 
ATOM   7672  C  C    . LEU B 2 106 ? 6.616   49.528  15.111  1.00 81.68  ? 106  LEU B C    1 
ATOM   7673  O  O    . LEU B 2 106 ? 7.614   50.079  15.570  1.00 77.77  ? 106  LEU B O    1 
ATOM   7674  C  CB   . LEU B 2 106 ? 6.686   47.136  15.874  1.00 73.80  ? 106  LEU B CB   1 
ATOM   7675  C  CG   . LEU B 2 106 ? 6.329   46.055  16.903  1.00 79.44  ? 106  LEU B CG   1 
ATOM   7676  C  CD1  . LEU B 2 106 ? 7.492   45.092  17.077  1.00 76.04  ? 106  LEU B CD1  1 
ATOM   7677  C  CD2  . LEU B 2 106 ? 5.944   46.636  18.263  1.00 80.13  ? 106  LEU B CD2  1 
ATOM   7678  H  H    . LEU B 2 106 ? 4.369   47.463  15.113  1.00 102.57 ? 106  LEU B H    1 
ATOM   7679  H  HA   . LEU B 2 106 ? 5.874   48.740  16.849  1.00 102.93 ? 106  LEU B HA   1 
ATOM   7680  H  HB2  . LEU B 2 106 ? 6.562   46.744  14.995  1.00 88.56  ? 106  LEU B HB2  1 
ATOM   7681  H  HB3  . LEU B 2 106 ? 7.625   47.347  15.998  1.00 88.56  ? 106  LEU B HB3  1 
ATOM   7682  H  HG   . LEU B 2 106 ? 5.572   45.547  16.572  1.00 95.33  ? 106  LEU B HG   1 
ATOM   7683  H  HD11 . LEU B 2 106 ? 8.267   45.587  17.385  1.00 91.25  ? 106  LEU B HD11 1 
ATOM   7684  H  HD12 . LEU B 2 106 ? 7.247   44.418  17.729  1.00 91.25  ? 106  LEU B HD12 1 
ATOM   7685  H  HD13 . LEU B 2 106 ? 7.684   44.673  16.223  1.00 91.25  ? 106  LEU B HD13 1 
ATOM   7686  H  HD21 . LEU B 2 106 ? 5.171   47.212  18.152  1.00 96.16  ? 106  LEU B HD21 1 
ATOM   7687  H  HD22 . LEU B 2 106 ? 5.730   45.908  18.867  1.00 96.16  ? 106  LEU B HD22 1 
ATOM   7688  H  HD23 . LEU B 2 106 ? 6.691   47.147  18.611  1.00 96.16  ? 106  LEU B HD23 1 
ATOM   7689  N  N    . ARG B 2 107 ? 6.120   49.832  13.915  1.00 70.77  ? 107  ARG B N    1 
ATOM   7690  C  CA   . ARG B 2 107 ? 6.693   50.915  13.120  1.00 83.23  ? 107  ARG B CA   1 
ATOM   7691  C  C    . ARG B 2 107 ? 6.604   52.249  13.857  1.00 88.77  ? 107  ARG B C    1 
ATOM   7692  O  O    . ARG B 2 107 ? 7.507   53.078  13.781  1.00 95.27  ? 107  ARG B O    1 
ATOM   7693  C  CB   . ARG B 2 107 ? 5.985   51.043  11.771  1.00 87.80  ? 107  ARG B CB   1 
ATOM   7694  C  CG   . ARG B 2 107 ? 6.399   50.026  10.738  1.00 82.45  ? 107  ARG B CG   1 
ATOM   7695  C  CD   . ARG B 2 107 ? 5.858   50.417  9.384   1.00 93.77  ? 107  ARG B CD   1 
ATOM   7696  N  NE   . ARG B 2 107 ? 6.114   49.408  8.359   1.00 101.69 ? 107  ARG B NE   1 
ATOM   7697  C  CZ   . ARG B 2 107 ? 5.747   49.536  7.089   1.00 95.89  ? 107  ARG B CZ   1 
ATOM   7698  N  NH1  . ARG B 2 107 ? 5.098   50.621  6.696   1.00 102.43 ? 107  ARG B NH1  1 
ATOM   7699  N  NH2  . ARG B 2 107 ? 6.008   48.577  6.211   1.00 98.25  ? 107  ARG B NH2  1 
ATOM   7700  H  H    . ARG B 2 107 ? 5.457   49.431  13.542  1.00 84.92  ? 107  ARG B H    1 
ATOM   7701  H  HA   . ARG B 2 107 ? 7.629   50.725  12.953  1.00 99.87  ? 107  ARG B HA   1 
ATOM   7702  H  HB2  . ARG B 2 107 ? 5.031   50.944  11.912  1.00 105.36 ? 107  ARG B HB2  1 
ATOM   7703  H  HB3  . ARG B 2 107 ? 6.171   51.922  11.407  1.00 105.36 ? 107  ARG B HB3  1 
ATOM   7704  H  HG2  . ARG B 2 107 ? 7.367   49.991  10.685  1.00 98.94  ? 107  ARG B HG2  1 
ATOM   7705  H  HG3  . ARG B 2 107 ? 6.039   49.157  10.975  1.00 98.94  ? 107  ARG B HG3  1 
ATOM   7706  H  HD2  . ARG B 2 107 ? 4.899   50.539  9.451   1.00 112.52 ? 107  ARG B HD2  1 
ATOM   7707  H  HD3  . ARG B 2 107 ? 6.280   51.244  9.103   1.00 112.52 ? 107  ARG B HD3  1 
ATOM   7708  H  HE   . ARG B 2 107 ? 6.442   48.654  8.610   1.00 122.02 ? 107  ARG B HE   1 
ATOM   7709  H  HH11 . ARG B 2 107 ? 4.924   51.246  7.261   1.00 122.92 ? 107  ARG B HH11 1 
ATOM   7710  H  HH12 . ARG B 2 107 ? 4.858   50.705  5.874   1.00 122.92 ? 107  ARG B HH12 1 
ATOM   7711  H  HH21 . ARG B 2 107 ? 6.427   47.868  6.460   1.00 117.90 ? 107  ARG B HH21 1 
ATOM   7712  H  HH22 . ARG B 2 107 ? 5.765   48.666  5.391   1.00 117.90 ? 107  ARG B HH22 1 
ATOM   7713  N  N    . LEU B 2 108 ? 5.494   52.451  14.555  1.00 79.70  ? 108  LEU B N    1 
ATOM   7714  C  CA   . LEU B 2 108 ? 5.279   53.661  15.332  1.00 89.07  ? 108  LEU B CA   1 
ATOM   7715  C  C    . LEU B 2 108 ? 6.289   53.808  16.461  1.00 85.25  ? 108  LEU B C    1 
ATOM   7716  O  O    . LEU B 2 108 ? 6.775   54.900  16.734  1.00 88.33  ? 108  LEU B O    1 
ATOM   7717  C  CB   . LEU B 2 108 ? 3.865   53.661  15.900  1.00 91.37  ? 108  LEU B CB   1 
ATOM   7718  C  CG   . LEU B 2 108 ? 2.760   53.666  14.847  1.00 85.13  ? 108  LEU B CG   1 
ATOM   7719  C  CD1  . LEU B 2 108 ? 1.412   53.492  15.516  1.00 86.73  ? 108  LEU B CD1  1 
ATOM   7720  C  CD2  . LEU B 2 108 ? 2.788   54.956  14.027  1.00 89.28  ? 108  LEU B CD2  1 
ATOM   7721  H  H    . LEU B 2 108 ? 4.841   51.893  14.594  1.00 95.63  ? 108  LEU B H    1 
ATOM   7722  H  HA   . LEU B 2 108 ? 5.368   54.431  14.749  1.00 106.88 ? 108  LEU B HA   1 
ATOM   7723  H  HB2  . LEU B 2 108 ? 3.750   52.866  16.444  1.00 109.65 ? 108  LEU B HB2  1 
ATOM   7724  H  HB3  . LEU B 2 108 ? 3.752   54.452  16.450  1.00 109.65 ? 108  LEU B HB3  1 
ATOM   7725  H  HG   . LEU B 2 108 ? 2.895   52.921  14.242  1.00 102.15 ? 108  LEU B HG   1 
ATOM   7726  H  HD11 . LEU B 2 108 ? 1.272   54.223  16.138  1.00 104.08 ? 108  LEU B HD11 1 
ATOM   7727  H  HD12 . LEU B 2 108 ? 0.720   53.497  14.837  1.00 104.08 ? 108  LEU B HD12 1 
ATOM   7728  H  HD13 . LEU B 2 108 ? 1.404   52.646  15.992  1.00 104.08 ? 108  LEU B HD13 1 
ATOM   7729  H  HD21 . LEU B 2 108 ? 3.646   55.028  13.582  1.00 107.14 ? 108  LEU B HD21 1 
ATOM   7730  H  HD22 . LEU B 2 108 ? 2.075   54.927  13.369  1.00 107.14 ? 108  LEU B HD22 1 
ATOM   7731  H  HD23 . LEU B 2 108 ? 2.659   55.711  14.622  1.00 107.14 ? 108  LEU B HD23 1 
ATOM   7732  N  N    . ALA B 2 109 ? 6.583   52.698  17.125  1.00 73.97  ? 109  ALA B N    1 
ATOM   7733  C  CA   . ALA B 2 109 ? 7.469   52.704  18.284  1.00 87.26  ? 109  ALA B CA   1 
ATOM   7734  C  C    . ALA B 2 109 ? 8.920   52.905  17.869  1.00 90.31  ? 109  ALA B C    1 
ATOM   7735  O  O    . ALA B 2 109 ? 9.652   53.661  18.504  1.00 90.16  ? 109  ALA B O    1 
ATOM   7736  C  CB   . ALA B 2 109 ? 7.322   51.407  19.078  1.00 76.95  ? 109  ALA B CB   1 
ATOM   7737  H  H    . ALA B 2 109 ? 6.279   51.919  16.923  1.00 88.77  ? 109  ALA B H    1 
ATOM   7738  H  HA   . ALA B 2 109 ? 7.221   53.439  18.866  1.00 104.71 ? 109  ALA B HA   1 
ATOM   7739  H  HB1  . ALA B 2 109 ? 7.551   50.658  18.505  1.00 92.34  ? 109  ALA B HB1  1 
ATOM   7740  H  HB2  . ALA B 2 109 ? 7.919   51.435  19.842  1.00 92.34  ? 109  ALA B HB2  1 
ATOM   7741  H  HB3  . ALA B 2 109 ? 6.403   51.324  19.379  1.00 92.34  ? 109  ALA B HB3  1 
ATOM   7742  N  N    . TYR B 2 110 ? 9.320   52.225  16.797  1.00 87.77  ? 110  TYR B N    1 
ATOM   7743  C  CA   . TYR B 2 110 ? 10.729  52.108  16.423  1.00 87.17  ? 110  TYR B CA   1 
ATOM   7744  C  C    . TYR B 2 110 ? 11.186  53.106  15.354  1.00 92.16  ? 110  TYR B C    1 
ATOM   7745  O  O    . TYR B 2 110 ? 12.270  52.955  14.791  1.00 104.26 ? 110  TYR B O    1 
ATOM   7746  C  CB   . TYR B 2 110 ? 11.010  50.680  15.926  1.00 78.07  ? 110  TYR B CB   1 
ATOM   7747  C  CG   . TYR B 2 110 ? 11.039  49.639  17.025  1.00 78.31  ? 110  TYR B CG   1 
ATOM   7748  C  CD1  . TYR B 2 110 ? 12.202  49.389  17.732  1.00 80.46  ? 110  TYR B CD1  1 
ATOM   7749  C  CD2  . TYR B 2 110 ? 9.911   48.902  17.348  1.00 74.60  ? 110  TYR B CD2  1 
ATOM   7750  C  CE1  . TYR B 2 110 ? 12.241  48.448  18.735  1.00 87.62  ? 110  TYR B CE1  1 
ATOM   7751  C  CE2  . TYR B 2 110 ? 9.940   47.953  18.348  1.00 71.86  ? 110  TYR B CE2  1 
ATOM   7752  C  CZ   . TYR B 2 110 ? 11.111  47.727  19.040  1.00 89.84  ? 110  TYR B CZ   1 
ATOM   7753  O  OH   . TYR B 2 110 ? 11.158  46.787  20.051  1.00 88.38  ? 110  TYR B OH   1 
ATOM   7754  H  H    . TYR B 2 110 ? 8.786   51.815  16.261  1.00 105.32 ? 110  TYR B H    1 
ATOM   7755  H  HA   . TYR B 2 110 ? 11.271  52.257  17.213  1.00 104.61 ? 110  TYR B HA   1 
ATOM   7756  H  HB2  . TYR B 2 110 ? 10.316  50.427  15.297  1.00 93.68  ? 110  TYR B HB2  1 
ATOM   7757  H  HB3  . TYR B 2 110 ? 11.873  50.668  15.484  1.00 93.68  ? 110  TYR B HB3  1 
ATOM   7758  H  HD1  . TYR B 2 110 ? 12.970  49.874  17.531  1.00 96.55  ? 110  TYR B HD1  1 
ATOM   7759  H  HD2  . TYR B 2 110 ? 9.120   49.052  16.884  1.00 89.52  ? 110  TYR B HD2  1 
ATOM   7760  H  HE1  . TYR B 2 110 ? 13.031  48.296  19.201  1.00 105.14 ? 110  TYR B HE1  1 
ATOM   7761  H  HE2  . TYR B 2 110 ? 9.173   47.470  18.555  1.00 86.23  ? 110  TYR B HE2  1 
ATOM   7762  H  HH   . TYR B 2 110 ? 10.408  46.419  20.136  1.00 106.05 ? 110  TYR B HH   1 
ATOM   7763  N  N    . CYS B 2 111 ? 10.392  54.139  15.095  1.00 83.33  ? 111  CYS B N    1 
ATOM   7764  C  CA   . CYS B 2 111 ? 10.759  55.146  14.098  1.00 92.33  ? 111  CYS B CA   1 
ATOM   7765  C  C    . CYS B 2 111 ? 11.436  56.351  14.754  1.00 101.63 ? 111  CYS B C    1 
ATOM   7766  O  O    . CYS B 2 111 ? 11.993  57.212  14.073  1.00 105.19 ? 111  CYS B O    1 
ATOM   7767  C  CB   . CYS B 2 111 ? 9.530   55.613  13.322  1.00 100.93 ? 111  CYS B CB   1 
ATOM   7768  S  SG   . CYS B 2 111 ? 8.437   56.699  14.261  1.00 93.85  ? 111  CYS B SG   1 
ATOM   7769  H  H    . CYS B 2 111 ? 9.637   54.283  15.481  1.00 99.99  ? 111  CYS B H    1 
ATOM   7770  H  HA   . CYS B 2 111 ? 11.384  54.756  13.467  1.00 110.79 ? 111  CYS B HA   1 
ATOM   7771  H  HB2  . CYS B 2 111 ? 9.824   56.098  12.535  1.00 121.11 ? 111  CYS B HB2  1 
ATOM   7772  H  HB3  . CYS B 2 111 ? 9.016   54.835  13.055  1.00 121.11 ? 111  CYS B HB3  1 
ATOM   7773  H  HG   . CYS B 2 111 ? 8.047   56.115  15.234  1.00 112.62 ? 111  CYS B HG   1 
ATOM   7774  N  N    . GLN B 2 112 ? 11.377  56.403  16.081  1.00 103.17 ? 112  GLN B N    1 
ATOM   7775  C  CA   . GLN B 2 112 ? 11.758  57.586  16.845  1.00 106.13 ? 112  GLN B CA   1 
ATOM   7776  C  C    . GLN B 2 112 ? 13.226  57.992  16.705  1.00 110.61 ? 112  GLN B C    1 
ATOM   7777  O  O    . GLN B 2 112 ? 13.563  59.172  16.829  1.00 118.16 ? 112  GLN B O    1 
ATOM   7778  C  CB   . GLN B 2 112 ? 11.479  57.319  18.322  1.00 115.32 ? 112  GLN B CB   1 
ATOM   7779  C  CG   . GLN B 2 112 ? 10.037  56.972  18.648  1.00 116.56 ? 112  GLN B CG   1 
ATOM   7780  C  CD   . GLN B 2 112 ? 9.870   56.406  20.054  1.00 119.54 ? 112  GLN B CD   1 
ATOM   7781  O  OE1  . GLN B 2 112 ? 8.826   55.842  20.380  1.00 128.25 ? 112  GLN B OE1  1 
ATOM   7782  N  NE2  . GLN B 2 112 ? 10.897  56.546  20.888  1.00 108.92 ? 112  GLN B NE2  1 
ATOM   7783  H  H    . GLN B 2 112 ? 11.111  55.750  16.573  1.00 123.80 ? 112  GLN B H    1 
ATOM   7784  H  HA   . GLN B 2 112 ? 11.210  58.336  16.564  1.00 127.36 ? 112  GLN B HA   1 
ATOM   7785  H  HB2  . GLN B 2 112 ? 12.031  56.575  18.610  1.00 138.39 ? 112  GLN B HB2  1 
ATOM   7786  H  HB3  . GLN B 2 112 ? 11.711  58.112  18.829  1.00 138.39 ? 112  GLN B HB3  1 
ATOM   7787  H  HG2  . GLN B 2 112 ? 9.496   57.774  18.581  1.00 139.87 ? 112  GLN B HG2  1 
ATOM   7788  H  HG3  . GLN B 2 112 ? 9.722   56.306  18.017  1.00 139.87 ? 112  GLN B HG3  1 
ATOM   7789  H  HE21 . GLN B 2 112 ? 11.614  56.941  20.624  1.00 130.70 ? 112  GLN B HE21 1 
ATOM   7790  H  HE22 . GLN B 2 112 ? 10.844  56.240  21.690  1.00 130.70 ? 112  GLN B HE22 1 
ATOM   7791  N  N    . SER B 2 113 ? 14.095  57.020  16.447  1.00 106.79 ? 113  SER B N    1 
ATOM   7792  C  CA   . SER B 2 113 ? 15.532  57.275  16.387  1.00 100.06 ? 113  SER B CA   1 
ATOM   7793  C  C    . SER B 2 113 ? 16.235  56.372  15.377  1.00 104.78 ? 113  SER B C    1 
ATOM   7794  O  O    . SER B 2 113 ? 15.737  55.301  15.038  1.00 106.64 ? 113  SER B O    1 
ATOM   7795  C  CB   . SER B 2 113 ? 16.150  57.095  17.775  1.00 95.44  ? 113  SER B CB   1 
ATOM   7796  O  OG   . SER B 2 113 ? 16.192  55.731  18.151  1.00 102.37 ? 113  SER B OG   1 
ATOM   7797  H  H    . SER B 2 113 ? 13.877  56.201  16.302  1.00 128.15 ? 113  SER B H    1 
ATOM   7798  H  HA   . SER B 2 113 ? 15.675  58.195  16.114  1.00 120.08 ? 113  SER B HA   1 
ATOM   7799  H  HB2  . SER B 2 113 ? 17.055  57.444  17.763  1.00 114.53 ? 113  SER B HB2  1 
ATOM   7800  H  HB3  . SER B 2 113 ? 15.617  57.583  18.422  1.00 114.53 ? 113  SER B HB3  1 
ATOM   7801  H  HG   . SER B 2 113 ? 16.652  55.294  17.601  1.00 122.84 ? 113  SER B HG   1 
ATOM   7802  N  N    . GLU B 2 114 ? 17.403  56.810  14.917  1.00 108.28 ? 114  GLU B N    1 
ATOM   7803  C  CA   . GLU B 2 114 ? 18.189  56.080  13.926  1.00 101.37 ? 114  GLU B CA   1 
ATOM   7804  C  C    . GLU B 2 114 ? 18.544  54.674  14.410  1.00 97.65  ? 114  GLU B C    1 
ATOM   7805  O  O    . GLU B 2 114 ? 18.467  53.694  13.656  1.00 102.91 ? 114  GLU B O    1 
ATOM   7806  C  CB   . GLU B 2 114 ? 19.464  56.862  13.606  1.00 94.42  ? 114  GLU B CB   1 
ATOM   7807  C  CG   . GLU B 2 114 ? 19.228  58.141  12.809  1.00 102.46 ? 114  GLU B CG   1 
ATOM   7808  C  CD   . GLU B 2 114 ? 20.502  58.946  12.600  1.00 114.64 ? 114  GLU B CD   1 
ATOM   7809  O  OE1  . GLU B 2 114 ? 21.580  58.488  13.043  1.00 108.82 ? 114  GLU B OE1  1 
ATOM   7810  O  OE2  . GLU B 2 114 ? 20.424  60.042  12.000  1.00 112.02 ? 114  GLU B OE2  1 
ATOM   7811  H  H    . GLU B 2 114 ? 17.770  57.546  15.170  1.00 129.94 ? 114  GLU B H    1 
ATOM   7812  H  HA   . GLU B 2 114 ? 17.672  55.996  13.109  1.00 121.64 ? 114  GLU B HA   1 
ATOM   7813  H  HB2  . GLU B 2 114 ? 19.895  57.109  14.440  1.00 113.30 ? 114  GLU B HB2  1 
ATOM   7814  H  HB3  . GLU B 2 114 ? 20.055  56.295  13.087  1.00 113.30 ? 114  GLU B HB3  1 
ATOM   7815  H  HG2  . GLU B 2 114 ? 18.873  57.909  11.937  1.00 122.95 ? 114  GLU B HG2  1 
ATOM   7816  H  HG3  . GLU B 2 114 ? 18.595  58.699  13.288  1.00 122.95 ? 114  GLU B HG3  1 
ATOM   7817  N  N    . GLU B 2 115 ? 18.895  54.581  15.688  1.00 93.25  ? 115  GLU B N    1 
ATOM   7818  C  CA   . GLU B 2 115 ? 19.275  53.308  16.285  1.00 107.13 ? 115  GLU B CA   1 
ATOM   7819  C  C    . GLU B 2 115 ? 18.101  52.329  16.289  1.00 103.25 ? 115  GLU B C    1 
ATOM   7820  O  O    . GLU B 2 115 ? 18.248  51.141  15.951  1.00 107.67 ? 115  GLU B O    1 
ATOM   7821  C  CB   . GLU B 2 115 ? 19.783  53.551  17.711  1.00 101.32 ? 115  GLU B CB   1 
ATOM   7822  C  CG   . GLU B 2 115 ? 19.938  52.309  18.567  1.00 110.52 ? 115  GLU B CG   1 
ATOM   7823  C  CD   . GLU B 2 115 ? 20.853  51.280  17.942  1.00 125.61 ? 115  GLU B CD   1 
ATOM   7824  O  OE1  . GLU B 2 115 ? 21.762  51.674  17.179  1.00 121.73 ? 115  GLU B OE1  1 
ATOM   7825  O  OE2  . GLU B 2 115 ? 20.659  50.072  18.205  1.00 128.56 ? 115  GLU B OE2  1 
ATOM   7826  H  H    . GLU B 2 115 ? 18.922  55.246  16.233  1.00 111.90 ? 115  GLU B H    1 
ATOM   7827  H  HA   . GLU B 2 115 ? 19.995  52.915  15.768  1.00 128.55 ? 115  GLU B HA   1 
ATOM   7828  H  HB2  . GLU B 2 115 ? 20.653  53.978  17.658  1.00 121.58 ? 115  GLU B HB2  1 
ATOM   7829  H  HB3  . GLU B 2 115 ? 19.160  54.141  18.163  1.00 121.58 ? 115  GLU B HB3  1 
ATOM   7830  H  HG2  . GLU B 2 115 ? 20.312  52.561  19.425  1.00 132.62 ? 115  GLU B HG2  1 
ATOM   7831  H  HG3  . GLU B 2 115 ? 19.067  51.900  18.691  1.00 132.62 ? 115  GLU B HG3  1 
ATOM   7832  N  N    . LEU B 2 116 ? 16.927  52.855  16.619  1.00 95.43  ? 116  LEU B N    1 
ATOM   7833  C  CA   . LEU B 2 116 ? 15.727  52.045  16.729  1.00 98.32  ? 116  LEU B CA   1 
ATOM   7834  C  C    . LEU B 2 116 ? 15.282  51.577  15.346  1.00 91.76  ? 116  LEU B C    1 
ATOM   7835  O  O    . LEU B 2 116 ? 14.894  50.415  15.162  1.00 83.13  ? 116  LEU B O    1 
ATOM   7836  C  CB   . LEU B 2 116 ? 14.617  52.843  17.419  1.00 90.38  ? 116  LEU B CB   1 
ATOM   7837  C  CG   . LEU B 2 116 ? 14.762  52.985  18.939  1.00 92.44  ? 116  LEU B CG   1 
ATOM   7838  C  CD1  . LEU B 2 116 ? 13.664  53.891  19.495  1.00 94.08  ? 116  LEU B CD1  1 
ATOM   7839  C  CD2  . LEU B 2 116 ? 14.747  51.627  19.648  1.00 72.33  ? 116  LEU B CD2  1 
ATOM   7840  H  H    . LEU B 2 116 ? 16.801  53.689  16.786  1.00 114.52 ? 116  LEU B H    1 
ATOM   7841  H  HA   . LEU B 2 116 ? 15.918  51.262  17.268  1.00 117.99 ? 116  LEU B HA   1 
ATOM   7842  H  HB2  . LEU B 2 116 ? 14.602  53.737  17.043  1.00 108.46 ? 116  LEU B HB2  1 
ATOM   7843  H  HB3  . LEU B 2 116 ? 13.770  52.404  17.247  1.00 108.46 ? 116  LEU B HB3  1 
ATOM   7844  H  HG   . LEU B 2 116 ? 15.614  53.406  19.131  1.00 110.93 ? 116  LEU B HG   1 
ATOM   7845  H  HD11 . LEU B 2 116 ? 12.800  53.501  19.290  1.00 112.90 ? 116  LEU B HD11 1 
ATOM   7846  H  HD12 . LEU B 2 116 ? 13.774  53.966  20.456  1.00 112.90 ? 116  LEU B HD12 1 
ATOM   7847  H  HD13 . LEU B 2 116 ? 13.739  54.766  19.083  1.00 112.90 ? 116  LEU B HD13 1 
ATOM   7848  H  HD21 . LEU B 2 116 ? 15.486  51.092  19.319  1.00 86.80  ? 116  LEU B HD21 1 
ATOM   7849  H  HD22 . LEU B 2 116 ? 14.841  51.770  20.603  1.00 86.80  ? 116  LEU B HD22 1 
ATOM   7850  H  HD23 . LEU B 2 116 ? 13.906  51.182  19.461  1.00 86.80  ? 116  LEU B HD23 1 
ATOM   7851  N  N    . ARG B 2 117 ? 15.383  52.468  14.365  1.00 84.62  ? 117  ARG B N    1 
ATOM   7852  C  CA   . ARG B 2 117 ? 15.022  52.114  13.001  1.00 95.24  ? 117  ARG B CA   1 
ATOM   7853  C  C    . ARG B 2 117 ? 15.955  51.023  12.504  1.00 104.84 ? 117  ARG B C    1 
ATOM   7854  O  O    . ARG B 2 117 ? 15.508  50.007  11.964  1.00 102.29 ? 117  ARG B O    1 
ATOM   7855  C  CB   . ARG B 2 117 ? 15.098  53.320  12.066  1.00 93.46  ? 117  ARG B CB   1 
ATOM   7856  C  CG   . ARG B 2 117 ? 14.137  54.450  12.369  1.00 92.12  ? 117  ARG B CG   1 
ATOM   7857  C  CD   . ARG B 2 117 ? 14.126  55.455  11.223  1.00 104.28 ? 117  ARG B CD   1 
ATOM   7858  N  NE   . ARG B 2 117 ? 14.043  56.836  11.696  1.00 107.35 ? 117  ARG B NE   1 
ATOM   7859  C  CZ   . ARG B 2 117 ? 15.069  57.684  11.760  1.00 103.70 ? 117  ARG B CZ   1 
ATOM   7860  N  NH1  . ARG B 2 117 ? 16.284  57.325  11.371  1.00 99.26  ? 117  ARG B NH1  1 
ATOM   7861  N  NH2  . ARG B 2 117 ? 14.877  58.911  12.214  1.00 118.42 ? 117  ARG B NH2  1 
ATOM   7862  H  H    . ARG B 2 117 ? 15.656  53.278  14.463  1.00 101.54 ? 117  ARG B H    1 
ATOM   7863  H  HA   . ARG B 2 117 ? 14.115  51.772  12.987  1.00 114.29 ? 117  ARG B HA   1 
ATOM   7864  H  HB2  . ARG B 2 117 ? 15.996  53.684  12.108  1.00 112.15 ? 117  ARG B HB2  1 
ATOM   7865  H  HB3  . ARG B 2 117 ? 14.914  53.018  11.162  1.00 112.15 ? 117  ARG B HB3  1 
ATOM   7866  H  HG2  . ARG B 2 117 ? 13.241  54.094  12.475  1.00 110.55 ? 117  ARG B HG2  1 
ATOM   7867  H  HG3  . ARG B 2 117 ? 14.419  54.908  13.177  1.00 110.55 ? 117  ARG B HG3  1 
ATOM   7868  H  HD2  . ARG B 2 117 ? 14.944  55.361  10.710  1.00 125.14 ? 117  ARG B HD2  1 
ATOM   7869  H  HD3  . ARG B 2 117 ? 13.356  55.284  10.658  1.00 125.14 ? 117  ARG B HD3  1 
ATOM   7870  H  HE   . ARG B 2 117 ? 13.274  57.122  11.953  1.00 128.82 ? 117  ARG B HE   1 
ATOM   7871  H  HH11 . ARG B 2 117 ? 16.424  56.529  11.075  1.00 119.11 ? 117  ARG B HH11 1 
ATOM   7872  H  HH12 . ARG B 2 117 ? 16.934  57.886  11.417  1.00 119.11 ? 117  ARG B HH12 1 
ATOM   7873  H  HH21 . ARG B 2 117 ? 14.093  59.158  12.467  1.00 142.10 ? 117  ARG B HH21 1 
ATOM   7874  H  HH22 . ARG B 2 117 ? 15.535  59.463  12.252  1.00 142.10 ? 117  ARG B HH22 1 
ATOM   7875  N  N    . ARG B 2 118 ? 17.254  51.225  12.708  1.00 106.10 ? 118  ARG B N    1 
ATOM   7876  C  CA   . ARG B 2 118 ? 18.235  50.249  12.253  1.00 101.51 ? 118  ARG B CA   1 
ATOM   7877  C  C    . ARG B 2 118 ? 17.972  48.875  12.876  1.00 96.53  ? 118  ARG B C    1 
ATOM   7878  O  O    . ARG B 2 118 ? 17.903  47.855  12.165  1.00 101.92 ? 118  ARG B O    1 
ATOM   7879  C  CB   . ARG B 2 118 ? 19.644  50.737  12.595  1.00 105.16 ? 118  ARG B CB   1 
ATOM   7880  C  CG   . ARG B 2 118 ? 20.763  49.862  12.060  1.00 114.51 ? 118  ARG B CG   1 
ATOM   7881  C  CD   . ARG B 2 118 ? 22.090  50.191  12.716  1.00 118.53 ? 118  ARG B CD   1 
ATOM   7882  N  NE   . ARG B 2 118 ? 22.035  50.062  14.171  1.00 122.34 ? 118  ARG B NE   1 
ATOM   7883  C  CZ   . ARG B 2 118 ? 22.192  48.919  14.834  1.00 124.62 ? 118  ARG B CZ   1 
ATOM   7884  N  NH1  . ARG B 2 118 ? 22.396  47.781  14.183  1.00 121.76 ? 118  ARG B NH1  1 
ATOM   7885  N  NH2  . ARG B 2 118 ? 22.130  48.911  16.157  1.00 127.37 ? 118  ARG B NH2  1 
ATOM   7886  H  H    . ARG B 2 118 ? 17.589  51.911  13.104  1.00 127.32 ? 118  ARG B H    1 
ATOM   7887  H  HA   . ARG B 2 118 ? 18.171  50.160  11.289  1.00 121.82 ? 118  ARG B HA   1 
ATOM   7888  H  HB2  . ARG B 2 118 ? 19.762  51.625  12.225  1.00 126.20 ? 118  ARG B HB2  1 
ATOM   7889  H  HB3  . ARG B 2 118 ? 19.734  50.771  13.560  1.00 126.20 ? 118  ARG B HB3  1 
ATOM   7890  H  HG2  . ARG B 2 118 ? 20.556  48.931  12.241  1.00 137.41 ? 118  ARG B HG2  1 
ATOM   7891  H  HG3  . ARG B 2 118 ? 20.852  50.006  11.105  1.00 137.41 ? 118  ARG B HG3  1 
ATOM   7892  H  HD2  . ARG B 2 118 ? 22.768  49.581  12.385  1.00 142.23 ? 118  ARG B HD2  1 
ATOM   7893  H  HD3  . ARG B 2 118 ? 22.331  51.106  12.503  1.00 142.23 ? 118  ARG B HD3  1 
ATOM   7894  H  HE   . ARG B 2 118 ? 21.891  50.774  14.630  1.00 146.81 ? 118  ARG B HE   1 
ATOM   7895  H  HH11 . ARG B 2 118 ? 22.438  47.779  13.324  1.00 146.11 ? 118  ARG B HH11 1 
ATOM   7896  H  HH12 . ARG B 2 118 ? 22.493  47.047  14.620  1.00 146.11 ? 118  ARG B HH12 1 
ATOM   7897  H  HH21 . ARG B 2 118 ? 21.994  49.644  16.585  1.00 152.84 ? 118  ARG B HH21 1 
ATOM   7898  H  HH22 . ARG B 2 118 ? 22.225  48.173  16.587  1.00 152.84 ? 118  ARG B HH22 1 
ATOM   7899  N  N    . TRP B 2 119 ? 17.748  48.860  14.187  1.00 92.69  ? 119  TRP B N    1 
ATOM   7900  C  CA   . TRP B 2 119 ? 17.483  47.608  14.898  1.00 95.45  ? 119  TRP B CA   1 
ATOM   7901  C  C    . TRP B 2 119 ? 16.229  46.919  14.341  1.00 93.58  ? 119  TRP B C    1 
ATOM   7902  O  O    . TRP B 2 119 ? 16.244  45.716  13.992  1.00 94.89  ? 119  TRP B O    1 
ATOM   7903  C  CB   . TRP B 2 119 ? 17.315  47.888  16.388  1.00 84.32  ? 119  TRP B CB   1 
ATOM   7904  C  CG   . TRP B 2 119 ? 17.252  46.665  17.243  1.00 80.14  ? 119  TRP B CG   1 
ATOM   7905  C  CD1  . TRP B 2 119 ? 18.296  46.054  17.859  1.00 77.37  ? 119  TRP B CD1  1 
ATOM   7906  C  CD2  . TRP B 2 119 ? 16.084  45.902  17.582  1.00 88.22  ? 119  TRP B CD2  1 
ATOM   7907  N  NE1  . TRP B 2 119 ? 17.860  44.961  18.566  1.00 82.85  ? 119  TRP B NE1  1 
ATOM   7908  C  CE2  . TRP B 2 119 ? 16.505  44.843  18.411  1.00 81.96  ? 119  TRP B CE2  1 
ATOM   7909  C  CE3  . TRP B 2 119 ? 14.726  46.010  17.265  1.00 86.20  ? 119  TRP B CE3  1 
ATOM   7910  C  CZ2  . TRP B 2 119 ? 15.619  43.897  18.925  1.00 77.97  ? 119  TRP B CZ2  1 
ATOM   7911  C  CZ3  . TRP B 2 119 ? 13.848  45.069  17.780  1.00 84.41  ? 119  TRP B CZ3  1 
ATOM   7912  C  CH2  . TRP B 2 119 ? 14.299  44.029  18.601  1.00 77.06  ? 119  TRP B CH2  1 
ATOM   7913  H  H    . TRP B 2 119 ? 17.744  49.559  14.689  1.00 111.23 ? 119  TRP B H    1 
ATOM   7914  H  HA   . TRP B 2 119 ? 18.236  47.008  14.783  1.00 114.54 ? 119  TRP B HA   1 
ATOM   7915  H  HB2  . TRP B 2 119 ? 18.068  48.420  16.691  1.00 101.18 ? 119  TRP B HB2  1 
ATOM   7916  H  HB3  . TRP B 2 119 ? 16.492  48.382  16.521  1.00 101.18 ? 119  TRP B HB3  1 
ATOM   7917  H  HD1  . TRP B 2 119 ? 19.180  46.340  17.815  1.00 92.84  ? 119  TRP B HD1  1 
ATOM   7918  H  HE1  . TRP B 2 119 ? 18.358  44.433  19.027  1.00 99.42  ? 119  TRP B HE1  1 
ATOM   7919  H  HE3  . TRP B 2 119 ? 14.419  46.699  16.721  1.00 103.45 ? 119  TRP B HE3  1 
ATOM   7920  H  HZ2  . TRP B 2 119 ? 15.915  43.205  19.471  1.00 93.56  ? 119  TRP B HZ2  1 
ATOM   7921  H  HZ3  . TRP B 2 119 ? 12.942  45.131  17.577  1.00 101.29 ? 119  TRP B HZ3  1 
ATOM   7922  H  HH2  . TRP B 2 119 ? 13.686  43.412  18.931  1.00 92.48  ? 119  TRP B HH2  1 
ATOM   7923  N  N    . PHE B 2 120 ? 15.156  47.703  14.234  1.00 92.32  ? 120  PHE B N    1 
ATOM   7924  C  CA   . PHE B 2 120 ? 13.866  47.200  13.762  1.00 98.09  ? 120  PHE B CA   1 
ATOM   7925  C  C    . PHE B 2 120 ? 13.975  46.639  12.343  1.00 93.27  ? 120  PHE B C    1 
ATOM   7926  O  O    . PHE B 2 120 ? 13.421  45.570  12.026  1.00 90.30  ? 120  PHE B O    1 
ATOM   7927  C  CB   . PHE B 2 120 ? 12.827  48.324  13.813  1.00 82.85  ? 120  PHE B CB   1 
ATOM   7928  C  CG   . PHE B 2 120 ? 11.469  47.912  13.343  1.00 77.40  ? 120  PHE B CG   1 
ATOM   7929  C  CD1  . PHE B 2 120 ? 10.691  47.057  14.093  1.00 70.69  ? 120  PHE B CD1  1 
ATOM   7930  C  CD2  . PHE B 2 120 ? 10.970  48.388  12.143  1.00 83.32  ? 120  PHE B CD2  1 
ATOM   7931  C  CE1  . PHE B 2 120 ? 9.443   46.676  13.653  1.00 75.64  ? 120  PHE B CE1  1 
ATOM   7932  C  CE2  . PHE B 2 120 ? 9.720   48.016  11.701  1.00 78.54  ? 120  PHE B CE2  1 
ATOM   7933  C  CZ   . PHE B 2 120 ? 8.954   47.158  12.454  1.00 69.95  ? 120  PHE B CZ   1 
ATOM   7934  H  H    . PHE B 2 120 ? 15.149  48.540  14.432  1.00 110.78 ? 120  PHE B H    1 
ATOM   7935  H  HA   . PHE B 2 120 ? 13.569  46.487  14.347  1.00 117.71 ? 120  PHE B HA   1 
ATOM   7936  H  HB2  . PHE B 2 120 ? 12.743  48.631  14.730  1.00 99.42  ? 120  PHE B HB2  1 
ATOM   7937  H  HB3  . PHE B 2 120 ? 13.128  49.054  13.249  1.00 99.42  ? 120  PHE B HB3  1 
ATOM   7938  H  HD1  . PHE B 2 120 ? 11.015  46.728  14.900  1.00 84.83  ? 120  PHE B HD1  1 
ATOM   7939  H  HD2  . PHE B 2 120 ? 11.486  48.967  11.630  1.00 99.99  ? 120  PHE B HD2  1 
ATOM   7940  H  HE1  . PHE B 2 120 ? 8.926   46.098  14.167  1.00 90.76  ? 120  PHE B HE1  1 
ATOM   7941  H  HE2  . PHE B 2 120 ? 9.396   48.341  10.892  1.00 94.25  ? 120  PHE B HE2  1 
ATOM   7942  H  HZ   . PHE B 2 120 ? 8.110   46.903  12.159  1.00 83.94  ? 120  PHE B HZ   1 
ATOM   7943  N  N    . ILE B 2 121 ? 14.741  47.335  11.513  1.00 89.57  ? 121  ILE B N    1 
ATOM   7944  C  CA   . ILE B 2 121 ? 14.937  46.920  10.137  1.00 94.27  ? 121  ILE B CA   1 
ATOM   7945  C  C    . ILE B 2 121 ? 15.651  45.584  10.137  1.00 99.10  ? 121  ILE B C    1 
ATOM   7946  O  O    . ILE B 2 121 ? 15.196  44.630  9.504   1.00 101.65 ? 121  ILE B O    1 
ATOM   7947  C  CB   . ILE B 2 121 ? 15.757  47.948  9.344   1.00 96.69  ? 121  ILE B CB   1 
ATOM   7948  C  CG1  . ILE B 2 121 ? 14.897  49.175  9.041   1.00 95.80  ? 121  ILE B CG1  1 
ATOM   7949  C  CG2  . ILE B 2 121 ? 16.277  47.347  8.032   1.00 94.09  ? 121  ILE B CG2  1 
ATOM   7950  C  CD1  . ILE B 2 121 ? 15.691  50.374  8.573   1.00 94.73  ? 121  ILE B CD1  1 
ATOM   7951  H  H    . ILE B 2 121 ? 15.160  48.055  11.726  1.00 107.48 ? 121  ILE B H    1 
ATOM   7952  H  HA   . ILE B 2 121 ? 14.076  46.810  9.704   1.00 113.12 ? 121  ILE B HA   1 
ATOM   7953  H  HB   . ILE B 2 121 ? 16.515  48.225  9.882   1.00 116.03 ? 121  ILE B HB   1 
ATOM   7954  H  HG12 . ILE B 2 121 ? 14.263  48.948  8.343   1.00 114.96 ? 121  ILE B HG12 1 
ATOM   7955  H  HG13 . ILE B 2 121 ? 14.421  49.430  9.847   1.00 114.96 ? 121  ILE B HG13 1 
ATOM   7956  H  HG21 . ILE B 2 121 ? 15.522  47.063  7.494   1.00 112.91 ? 121  ILE B HG21 1 
ATOM   7957  H  HG22 . ILE B 2 121 ? 16.789  48.020  7.557   1.00 112.91 ? 121  ILE B HG22 1 
ATOM   7958  H  HG23 . ILE B 2 121 ? 16.842  46.585  8.237   1.00 112.91 ? 121  ILE B HG23 1 
ATOM   7959  H  HD11 . ILE B 2 121 ? 16.165  50.141  7.760   1.00 113.68 ? 121  ILE B HD11 1 
ATOM   7960  H  HD12 . ILE B 2 121 ? 15.081  51.109  8.402   1.00 113.68 ? 121  ILE B HD12 1 
ATOM   7961  H  HD13 . ILE B 2 121 ? 16.323  50.623  9.265   1.00 113.68 ? 121  ILE B HD13 1 
ATOM   7962  N  N    . GLN B 2 122 ? 16.758  45.505  10.869  1.00 93.07  ? 122  GLN B N    1 
ATOM   7963  C  CA   . GLN B 2 122 ? 17.542  44.283  10.861  1.00 93.85  ? 122  GLN B CA   1 
ATOM   7964  C  C    . GLN B 2 122 ? 16.716  43.078  11.297  1.00 97.47  ? 122  GLN B C    1 
ATOM   7965  O  O    . GLN B 2 122 ? 16.670  42.061  10.584  1.00 108.34 ? 122  GLN B O    1 
ATOM   7966  C  CB   . GLN B 2 122 ? 18.758  44.431  11.775  1.00 104.49 ? 122  GLN B CB   1 
ATOM   7967  C  CG   . GLN B 2 122 ? 19.661  43.212  11.820  1.00 108.25 ? 122  GLN B CG   1 
ATOM   7968  C  CD   . GLN B 2 122 ? 20.877  43.431  12.704  1.00 125.61 ? 122  GLN B CD   1 
ATOM   7969  O  OE1  . GLN B 2 122 ? 21.667  44.352  12.477  1.00 123.13 ? 122  GLN B OE1  1 
ATOM   7970  N  NE2  . GLN B 2 122 ? 21.030  42.587  13.723  1.00 109.60 ? 122  GLN B NE2  1 
ATOM   7971  H  H    . GLN B 2 122 ? 17.068  46.133  11.369  1.00 111.68 ? 122  GLN B H    1 
ATOM   7972  H  HA   . GLN B 2 122 ? 17.862  44.118  9.961   1.00 112.62 ? 122  GLN B HA   1 
ATOM   7973  H  HB2  . GLN B 2 122 ? 19.289  45.181  11.465  1.00 125.38 ? 122  GLN B HB2  1 
ATOM   7974  H  HB3  . GLN B 2 122 ? 18.448  44.601  12.679  1.00 125.38 ? 122  GLN B HB3  1 
ATOM   7975  H  HG2  . GLN B 2 122 ? 19.163  42.459  12.174  1.00 129.90 ? 122  GLN B HG2  1 
ATOM   7976  H  HG3  . GLN B 2 122 ? 19.973  43.014  10.923  1.00 129.90 ? 122  GLN B HG3  1 
ATOM   7977  H  HE21 . GLN B 2 122 ? 20.456  41.960  13.852  1.00 131.52 ? 122  GLN B HE21 1 
ATOM   7978  H  HE22 . GLN B 2 122 ? 21.703  42.669  14.253  1.00 131.52 ? 122  GLN B HE22 1 
ATOM   7979  N  N    . GLN B 2 123 ? 16.025  43.191  12.431  1.00 95.43  ? 123  GLN B N    1 
ATOM   7980  C  CA   . GLN B 2 123 ? 15.239  42.047  12.902  1.00 91.00  ? 123  GLN B CA   1 
ATOM   7981  C  C    . GLN B 2 123 ? 14.119  41.668  11.929  1.00 95.71  ? 123  GLN B C    1 
ATOM   7982  O  O    . GLN B 2 123 ? 13.949  40.482  11.552  1.00 99.82  ? 123  GLN B O    1 
ATOM   7983  C  CB   . GLN B 2 123 ? 14.635  42.361  14.272  1.00 91.98  ? 123  GLN B CB   1 
ATOM   7984  C  CG   . GLN B 2 123 ? 15.498  41.938  15.450  1.00 95.86  ? 123  GLN B CG   1 
ATOM   7985  C  CD   . GLN B 2 123 ? 16.919  42.463  15.350  1.00 102.62 ? 123  GLN B CD   1 
ATOM   7986  O  OE1  . GLN B 2 123 ? 17.882  41.697  15.422  1.00 112.12 ? 123  GLN B OE1  1 
ATOM   7987  N  NE2  . GLN B 2 123 ? 17.057  43.774  15.181  1.00 92.79  ? 123  GLN B NE2  1 
ATOM   7988  H  H    . GLN B 2 123 ? 15.992  43.890  12.931  1.00 114.52 ? 123  GLN B H    1 
ATOM   7989  H  HA   . GLN B 2 123 ? 15.825  41.280  12.999  1.00 109.20 ? 123  GLN B HA   1 
ATOM   7990  H  HB2  . GLN B 2 123 ? 14.495  43.318  14.339  1.00 110.37 ? 123  GLN B HB2  1 
ATOM   7991  H  HB3  . GLN B 2 123 ? 13.785  41.900  14.350  1.00 110.37 ? 123  GLN B HB3  1 
ATOM   7992  H  HG2  . GLN B 2 123 ? 15.107  42.282  16.269  1.00 115.04 ? 123  GLN B HG2  1 
ATOM   7993  H  HG3  . GLN B 2 123 ? 15.537  40.969  15.482  1.00 115.04 ? 123  GLN B HG3  1 
ATOM   7994  H  HE21 . GLN B 2 123 ? 16.361  44.277  15.133  1.00 111.35 ? 123  GLN B HE21 1 
ATOM   7995  H  HE22 . GLN B 2 123 ? 17.843  44.119  15.119  1.00 111.35 ? 123  GLN B HE22 1 
ATOM   7996  N  N    . GLU B 2 124 ? 13.416  42.689  11.445  1.00 100.51 ? 124  GLU B N    1 
ATOM   7997  C  CA   . GLU B 2 124 ? 12.295  42.448  10.550  1.00 95.82  ? 124  GLU B CA   1 
ATOM   7998  C  C    . GLU B 2 124 ? 12.742  41.979  9.174   1.00 98.10  ? 124  GLU B C    1 
ATOM   7999  O  O    . GLU B 2 124 ? 11.963  41.390  8.419   1.00 98.96  ? 124  GLU B O    1 
ATOM   8000  C  CB   . GLU B 2 124 ? 11.464  43.719  10.408  1.00 82.82  ? 124  GLU B CB   1 
ATOM   8001  C  CG   . GLU B 2 124 ? 9.997   43.456  10.166  1.00 89.74  ? 124  GLU B CG   1 
ATOM   8002  C  CD   . GLU B 2 124 ? 9.183   43.390  11.440  1.00 93.71  ? 124  GLU B CD   1 
ATOM   8003  O  OE1  . GLU B 2 124 ? 9.667   43.810  12.510  1.00 95.57  ? 124  GLU B OE1  1 
ATOM   8004  O  OE2  . GLU B 2 124 ? 8.028   42.929  11.361  1.00 105.08 ? 124  GLU B OE2  1 
ATOM   8005  H  H    . GLU B 2 124 ? 13.568  43.518  11.616  1.00 120.61 ? 124  GLU B H    1 
ATOM   8006  H  HA   . GLU B 2 124 ? 11.728  41.759  10.932  1.00 114.99 ? 124  GLU B HA   1 
ATOM   8007  H  HB2  . GLU B 2 124 ? 11.542  44.237  11.223  1.00 99.38  ? 124  GLU B HB2  1 
ATOM   8008  H  HB3  . GLU B 2 124 ? 11.802  44.232  9.657   1.00 99.38  ? 124  GLU B HB3  1 
ATOM   8009  H  HG2  . GLU B 2 124 ? 9.636   44.170  9.617   1.00 107.69 ? 124  GLU B HG2  1 
ATOM   8010  H  HG3  . GLU B 2 124 ? 9.902   42.606  9.707   1.00 107.69 ? 124  GLU B HG3  1 
ATOM   8011  N  N    . MET B 2 125 ? 13.999  42.257  8.850   1.00 108.72 ? 125  MET B N    1 
ATOM   8012  C  CA   . MET B 2 125 ? 14.580  41.830  7.584   1.00 104.85 ? 125  MET B CA   1 
ATOM   8013  C  C    . MET B 2 125 ? 14.964  40.345  7.687   1.00 103.01 ? 125  MET B C    1 
ATOM   8014  O  O    . MET B 2 125 ? 14.646  39.523  6.804   1.00 109.82 ? 125  MET B O    1 
ATOM   8015  C  CB   . MET B 2 125 ? 15.784  42.699  7.231   1.00 96.23  ? 125  MET B CB   1 
ATOM   8016  C  CG   . MET B 2 125 ? 16.204  42.567  5.802   1.00 113.64 ? 125  MET B CG   1 
ATOM   8017  S  SD   . MET B 2 125 ? 14.827  43.096  4.735   1.00 133.48 ? 125  MET B SD   1 
ATOM   8018  C  CE   . MET B 2 125 ? 14.244  44.614  5.499   1.00 103.97 ? 125  MET B CE   1 
ATOM   8019  H  H    . MET B 2 125 ? 14.542  42.697  9.352   1.00 130.46 ? 125  MET B H    1 
ATOM   8020  H  HA   . MET B 2 125 ? 13.918  41.936  6.882   1.00 125.82 ? 125  MET B HA   1 
ATOM   8021  H  HB2  . MET B 2 125 ? 15.560  43.629  7.391   1.00 115.48 ? 125  MET B HB2  1 
ATOM   8022  H  HB3  . MET B 2 125 ? 16.534  42.439  7.788   1.00 115.48 ? 125  MET B HB3  1 
ATOM   8023  H  HG2  . MET B 2 125 ? 16.969  43.138  5.630   1.00 136.37 ? 125  MET B HG2  1 
ATOM   8024  H  HG3  . MET B 2 125 ? 16.414  41.641  5.605   1.00 136.37 ? 125  MET B HG3  1 
ATOM   8025  H  HE1  . MET B 2 125 ? 14.969  45.259  5.512   1.00 124.76 ? 125  MET B HE1  1 
ATOM   8026  H  HE2  . MET B 2 125 ? 13.501  44.963  4.982   1.00 124.76 ? 125  MET B HE2  1 
ATOM   8027  H  HE3  . MET B 2 125 ? 13.956  44.421  6.404   1.00 124.76 ? 125  MET B HE3  1 
ATOM   8028  N  N    . ASP B 2 126 ? 15.662  40.007  8.771   1.00 95.10  ? 126  ASP B N    1 
ATOM   8029  C  CA   . ASP B 2 126 ? 16.085  38.625  8.999   1.00 97.66  ? 126  ASP B CA   1 
ATOM   8030  C  C    . ASP B 2 126 ? 14.862  37.713  9.036   1.00 95.86  ? 126  ASP B C    1 
ATOM   8031  O  O    . ASP B 2 126 ? 14.888  36.575  8.527   1.00 103.23 ? 126  ASP B O    1 
ATOM   8032  C  CB   . ASP B 2 126 ? 16.864  38.510  10.314  1.00 95.00  ? 126  ASP B CB   1 
ATOM   8033  C  CG   . ASP B 2 126 ? 18.277  39.052  10.209  1.00 86.65  ? 126  ASP B CG   1 
ATOM   8034  O  OD1  . ASP B 2 126 ? 18.614  39.651  9.167   1.00 100.10 ? 126  ASP B OD1  1 
ATOM   8035  O  OD2  . ASP B 2 126 ? 19.047  38.890  11.180  1.00 82.59  ? 126  ASP B OD2  1 
ATOM   8036  H  H    . ASP B 2 126 ? 15.903  40.557  9.386   1.00 114.12 ? 126  ASP B H    1 
ATOM   8037  H  HA   . ASP B 2 126 ? 16.662  38.339  8.274   1.00 117.20 ? 126  ASP B HA   1 
ATOM   8038  H  HB2  . ASP B 2 126 ? 16.401  39.014  11.001  1.00 113.99 ? 126  ASP B HB2  1 
ATOM   8039  H  HB3  . ASP B 2 126 ? 16.920  37.576  10.568  1.00 113.99 ? 126  ASP B HB3  1 
ATOM   8040  N  N    . LEU B 2 127 ? 13.773  38.228  9.599   1.00 99.95  ? 127  LEU B N    1 
ATOM   8041  C  CA   . LEU B 2 127 ? 12.538  37.451  9.646   1.00 94.90  ? 127  LEU B CA   1 
ATOM   8042  C  C    . LEU B 2 127 ? 12.039  37.165  8.218   1.00 100.55 ? 127  LEU B C    1 
ATOM   8043  O  O    . LEU B 2 127 ? 11.604  36.042  7.903   1.00 109.08 ? 127  LEU B O    1 
ATOM   8044  C  CB   . LEU B 2 127 ? 11.475  38.196  10.448  1.00 88.65  ? 127  LEU B CB   1 
ATOM   8045  C  CG   . LEU B 2 127 ? 10.121  37.510  10.593  1.00 90.14  ? 127  LEU B CG   1 
ATOM   8046  C  CD1  . LEU B 2 127 ? 10.253  36.214  11.375  1.00 93.75  ? 127  LEU B CD1  1 
ATOM   8047  C  CD2  . LEU B 2 127 ? 9.164   38.462  11.287  1.00 101.80 ? 127  LEU B CD2  1 
ATOM   8048  H  H    . LEU B 2 127 ? 13.722  39.009  9.955   1.00 119.94 ? 127  LEU B H    1 
ATOM   8049  H  HA   . LEU B 2 127 ? 12.710  36.603  10.084  1.00 113.88 ? 127  LEU B HA   1 
ATOM   8050  H  HB2  . LEU B 2 127 ? 11.820  38.343  11.343  1.00 106.37 ? 127  LEU B HB2  1 
ATOM   8051  H  HB3  . LEU B 2 127 ? 11.319  39.053  10.021  1.00 106.37 ? 127  LEU B HB3  1 
ATOM   8052  H  HG   . LEU B 2 127 ? 9.767   37.305  9.714   1.00 108.17 ? 127  LEU B HG   1 
ATOM   8053  H  HD11 . LEU B 2 127 ? 10.604  36.412  12.258  1.00 112.50 ? 127  LEU B HD11 1 
ATOM   8054  H  HD12 . LEU B 2 127 ? 9.379   35.801  11.451  1.00 112.50 ? 127  LEU B HD12 1 
ATOM   8055  H  HD13 . LEU B 2 127 ? 10.860  35.621  10.904  1.00 112.50 ? 127  LEU B HD13 1 
ATOM   8056  H  HD21 . LEU B 2 127 ? 9.074   39.266  10.751  1.00 122.16 ? 127  LEU B HD21 1 
ATOM   8057  H  HD22 . LEU B 2 127 ? 8.301   38.029  11.381  1.00 122.16 ? 127  LEU B HD22 1 
ATOM   8058  H  HD23 . LEU B 2 127 ? 9.519   38.685  12.162  1.00 122.16 ? 127  LEU B HD23 1 
ATOM   8059  N  N    . LEU B 2 128 ? 12.142  38.165  7.344   1.00 98.40  ? 128  LEU B N    1 
ATOM   8060  C  CA   . LEU B 2 128 ? 11.676  38.032  5.968   1.00 93.63  ? 128  LEU B CA   1 
ATOM   8061  C  C    . LEU B 2 128 ? 12.535  36.991  5.269   1.00 104.22 ? 128  LEU B C    1 
ATOM   8062  O  O    . LEU B 2 128 ? 12.038  36.195  4.465   1.00 99.67  ? 128  LEU B O    1 
ATOM   8063  C  CB   . LEU B 2 128 ? 11.759  39.369  5.239   1.00 90.92  ? 128  LEU B CB   1 
ATOM   8064  C  CG   . LEU B 2 128 ? 11.049  39.440  3.891   1.00 106.44 ? 128  LEU B CG   1 
ATOM   8065  C  CD1  . LEU B 2 128 ? 9.567   39.713  4.092   1.00 102.92 ? 128  LEU B CD1  1 
ATOM   8066  C  CD2  . LEU B 2 128 ? 11.681  40.499  2.999   1.00 100.27 ? 128  LEU B CD2  1 
ATOM   8067  H  H    . LEU B 2 128 ? 12.481  38.935  7.526   1.00 118.08 ? 128  LEU B H    1 
ATOM   8068  H  HA   . LEU B 2 128 ? 10.754  37.731  5.962   1.00 112.35 ? 128  LEU B HA   1 
ATOM   8069  H  HB2  . LEU B 2 128 ? 11.369  40.051  5.808   1.00 109.10 ? 128  LEU B HB2  1 
ATOM   8070  H  HB3  . LEU B 2 128 ? 12.694  39.575  5.085   1.00 109.10 ? 128  LEU B HB3  1 
ATOM   8071  H  HG   . LEU B 2 128 ? 11.136  38.583  3.445   1.00 127.73 ? 128  LEU B HG   1 
ATOM   8072  H  HD11 . LEU B 2 128 ? 9.463   40.559  4.556   1.00 123.51 ? 128  LEU B HD11 1 
ATOM   8073  H  HD12 . LEU B 2 128 ? 9.134   39.755  3.226   1.00 123.51 ? 128  LEU B HD12 1 
ATOM   8074  H  HD13 . LEU B 2 128 ? 9.183   38.997  4.621   1.00 123.51 ? 128  LEU B HD13 1 
ATOM   8075  H  HD21 . LEU B 2 128 ? 12.613  40.273  2.854   1.00 120.32 ? 128  LEU B HD21 1 
ATOM   8076  H  HD22 . LEU B 2 128 ? 11.209  40.519  2.152   1.00 120.32 ? 128  LEU B HD22 1 
ATOM   8077  H  HD23 . LEU B 2 128 ? 11.613  41.361  3.438   1.00 120.32 ? 128  LEU B HD23 1 
ATOM   8078  N  N    . ARG B 2 129 ? 13.833  37.012  5.569   1.00 113.89 ? 129  ARG B N    1 
ATOM   8079  C  CA   . ARG B 2 129 ? 14.749  36.014  5.015   1.00 107.37 ? 129  ARG B CA   1 
ATOM   8080  C  C    . ARG B 2 129 ? 14.310  34.612  5.438   1.00 104.16 ? 129  ARG B C    1 
ATOM   8081  O  O    . ARG B 2 129 ? 14.232  33.692  4.608   1.00 115.15 ? 129  ARG B O    1 
ATOM   8082  C  CB   . ARG B 2 129 ? 16.184  36.266  5.461   1.00 109.99 ? 129  ARG B CB   1 
ATOM   8083  C  CG   . ARG B 2 129 ? 17.201  35.460  4.674   1.00 126.82 ? 129  ARG B CG   1 
ATOM   8084  C  CD   . ARG B 2 129 ? 18.622  35.850  5.021   1.00 122.90 ? 129  ARG B CD   1 
ATOM   8085  N  NE   . ARG B 2 129 ? 19.588  35.115  4.210   1.00 132.46 ? 129  ARG B NE   1 
ATOM   8086  C  CZ   . ARG B 2 129 ? 20.808  35.551  3.911   1.00 140.28 ? 129  ARG B CZ   1 
ATOM   8087  N  NH1  . ARG B 2 129 ? 21.227  36.734  4.344   1.00 141.42 ? 129  ARG B NH1  1 
ATOM   8088  N  NH2  . ARG B 2 129 ? 21.609  34.806  3.163   1.00 142.72 ? 129  ARG B NH2  1 
ATOM   8089  H  H    . ARG B 2 129 ? 14.206  37.589  6.086   1.00 136.67 ? 129  ARG B H    1 
ATOM   8090  H  HA   . ARG B 2 129 ? 14.721  36.060  4.046   1.00 128.85 ? 129  ARG B HA   1 
ATOM   8091  H  HB2  . ARG B 2 129 ? 16.391  37.206  5.342   1.00 131.99 ? 129  ARG B HB2  1 
ATOM   8092  H  HB3  . ARG B 2 129 ? 16.270  36.024  6.397   1.00 131.99 ? 129  ARG B HB3  1 
ATOM   8093  H  HG2  . ARG B 2 129 ? 17.087  34.519  4.877   1.00 152.18 ? 129  ARG B HG2  1 
ATOM   8094  H  HG3  . ARG B 2 129 ? 17.067  35.617  3.726   1.00 152.18 ? 129  ARG B HG3  1 
ATOM   8095  H  HD2  . ARG B 2 129 ? 18.744  36.798  4.856   1.00 147.48 ? 129  ARG B HD2  1 
ATOM   8096  H  HD3  . ARG B 2 129 ? 18.791  35.647  5.955   1.00 147.48 ? 129  ARG B HD3  1 
ATOM   8097  H  HE   . ARG B 2 129 ? 19.352  34.347  3.904   1.00 158.95 ? 129  ARG B HE   1 
ATOM   8098  H  HH11 . ARG B 2 129 ? 20.710  37.222  4.829   1.00 169.70 ? 129  ARG B HH11 1 
ATOM   8099  H  HH12 . ARG B 2 129 ? 22.017  37.010  4.145   1.00 169.70 ? 129  ARG B HH12 1 
ATOM   8100  H  HH21 . ARG B 2 129 ? 21.342  34.040  2.878   1.00 171.26 ? 129  ARG B HH21 1 
ATOM   8101  H  HH22 . ARG B 2 129 ? 22.398  35.087  2.966   1.00 171.26 ? 129  ARG B HH22 1 
ATOM   8102  N  N    . PHE B 2 130 ? 13.979  34.455  6.719   1.00 103.13 ? 130  PHE B N    1 
ATOM   8103  C  CA   . PHE B 2 130 ? 13.499  33.156  7.196   1.00 108.97 ? 130  PHE B CA   1 
ATOM   8104  C  C    . PHE B 2 130 ? 12.257  32.725  6.427   1.00 117.44 ? 130  PHE B C    1 
ATOM   8105  O  O    . PHE B 2 130 ? 12.186  31.586  5.962   1.00 119.91 ? 130  PHE B O    1 
ATOM   8106  C  CB   . PHE B 2 130 ? 13.176  33.160  8.687   1.00 109.14 ? 130  PHE B CB   1 
ATOM   8107  C  CG   . PHE B 2 130 ? 12.392  31.949  9.125   1.00 117.42 ? 130  PHE B CG   1 
ATOM   8108  C  CD1  . PHE B 2 130 ? 13.041  30.768  9.444   1.00 122.71 ? 130  PHE B CD1  1 
ATOM   8109  C  CD2  . PHE B 2 130 ? 11.007  31.989  9.206   1.00 122.86 ? 130  PHE B CD2  1 
ATOM   8110  C  CE1  . PHE B 2 130 ? 12.327  29.648  9.841   1.00 132.79 ? 130  PHE B CE1  1 
ATOM   8111  C  CE2  . PHE B 2 130 ? 10.286  30.871  9.601   1.00 129.29 ? 130  PHE B CE2  1 
ATOM   8112  C  CZ   . PHE B 2 130 ? 10.948  29.700  9.919   1.00 128.95 ? 130  PHE B CZ   1 
ATOM   8113  H  H    . PHE B 2 130 ? 14.022  35.067  7.321   1.00 123.75 ? 130  PHE B H    1 
ATOM   8114  H  HA   . PHE B 2 130 ? 14.189  32.492  7.043   1.00 130.76 ? 130  PHE B HA   1 
ATOM   8115  H  HB2  . PHE B 2 130 ? 14.006  33.177  9.189   1.00 130.97 ? 130  PHE B HB2  1 
ATOM   8116  H  HB3  . PHE B 2 130 ? 12.649  33.948  8.893   1.00 130.97 ? 130  PHE B HB3  1 
ATOM   8117  H  HD1  . PHE B 2 130 ? 13.968  30.725  9.393   1.00 147.25 ? 130  PHE B HD1  1 
ATOM   8118  H  HD2  . PHE B 2 130 ? 10.557  32.774  8.992   1.00 147.44 ? 130  PHE B HD2  1 
ATOM   8119  H  HE1  . PHE B 2 130 ? 12.776  28.862  10.054  1.00 159.35 ? 130  PHE B HE1  1 
ATOM   8120  H  HE2  . PHE B 2 130 ? 9.358   30.910  9.653   1.00 155.15 ? 130  PHE B HE2  1 
ATOM   8121  H  HZ   . PHE B 2 130 ? 10.467  28.950  10.186  1.00 154.74 ? 130  PHE B HZ   1 
ATOM   8122  N  N    . ARG B 2 131 ? 11.270  33.608  6.306   1.00 117.11 ? 131  ARG B N    1 
ATOM   8123  C  CA   . ARG B 2 131 ? 10.027  33.216  5.637   1.00 112.58 ? 131  ARG B CA   1 
ATOM   8124  C  C    . ARG B 2 131 ? 10.273  32.777  4.202   1.00 115.52 ? 131  ARG B C    1 
ATOM   8125  O  O    . ARG B 2 131 ? 9.490   32.005  3.646   1.00 118.77 ? 131  ARG B O    1 
ATOM   8126  C  CB   . ARG B 2 131 ? 9.012   34.349  5.662   1.00 100.86 ? 131  ARG B CB   1 
ATOM   8127  C  CG   . ARG B 2 131 ? 8.732   34.802  7.049   1.00 101.65 ? 131  ARG B CG   1 
ATOM   8128  C  CD   . ARG B 2 131 ? 7.364   35.383  7.180   1.00 99.21  ? 131  ARG B CD   1 
ATOM   8129  N  NE   . ARG B 2 131 ? 7.213   35.954  8.507   1.00 106.37 ? 131  ARG B NE   1 
ATOM   8130  C  CZ   . ARG B 2 131 ? 6.083   36.441  8.994   1.00 110.58 ? 131  ARG B CZ   1 
ATOM   8131  N  NH1  . ARG B 2 131 ? 4.975   36.438  8.263   1.00 111.56 ? 131  ARG B NH1  1 
ATOM   8132  N  NH2  . ARG B 2 131 ? 6.073   36.925  10.224  1.00 114.56 ? 131  ARG B NH2  1 
ATOM   8133  H  H    . ARG B 2 131 ? 11.289  34.418  6.592   1.00 140.53 ? 131  ARG B H    1 
ATOM   8134  H  HA   . ARG B 2 131 ? 9.642   32.464  6.113   1.00 135.09 ? 131  ARG B HA   1 
ATOM   8135  H  HB2  . ARG B 2 131 ? 9.361   35.102  5.161   1.00 121.03 ? 131  ARG B HB2  1 
ATOM   8136  H  HB3  . ARG B 2 131 ? 8.180   34.041  5.270   1.00 121.03 ? 131  ARG B HB3  1 
ATOM   8137  H  HG2  . ARG B 2 131 ? 8.798   34.045  7.651   1.00 121.98 ? 131  ARG B HG2  1 
ATOM   8138  H  HG3  . ARG B 2 131 ? 9.376   35.484  7.297   1.00 121.98 ? 131  ARG B HG3  1 
ATOM   8139  H  HD2  . ARG B 2 131 ? 7.242   36.087  6.523   1.00 119.05 ? 131  ARG B HD2  1 
ATOM   8140  H  HD3  . ARG B 2 131 ? 6.699   34.686  7.063   1.00 119.05 ? 131  ARG B HD3  1 
ATOM   8141  H  HE   . ARG B 2 131 ? 7.908   35.978  9.013   1.00 127.65 ? 131  ARG B HE   1 
ATOM   8142  H  HH11 . ARG B 2 131 ? 4.988   36.118  7.465   1.00 133.87 ? 131  ARG B HH11 1 
ATOM   8143  H  HH12 . ARG B 2 131 ? 4.245   36.756  8.587   1.00 133.87 ? 131  ARG B HH12 1 
ATOM   8144  H  HH21 . ARG B 2 131 ? 6.795   36.925  10.692  1.00 137.47 ? 131  ARG B HH21 1 
ATOM   8145  H  HH22 . ARG B 2 131 ? 5.347   37.247  10.554  1.00 137.47 ? 131  ARG B HH22 1 
ATOM   8146  N  N    . PHE B 2 132 ? 11.341  33.280  3.593   1.00 116.73 ? 132  PHE B N    1 
ATOM   8147  C  CA   . PHE B 2 132 ? 11.705  32.835  2.256   1.00 114.36 ? 132  PHE B CA   1 
ATOM   8148  C  C    . PHE B 2 132 ? 12.565  31.576  2.347   1.00 121.55 ? 132  PHE B C    1 
ATOM   8149  O  O    . PHE B 2 132 ? 12.635  30.801  1.390   1.00 121.29 ? 132  PHE B O    1 
ATOM   8150  C  CB   . PHE B 2 132 ? 12.449  33.932  1.498   1.00 103.30 ? 132  PHE B CB   1 
ATOM   8151  C  CG   . PHE B 2 132 ? 11.550  34.959  0.861   1.00 108.24 ? 132  PHE B CG   1 
ATOM   8152  C  CD1  . PHE B 2 132 ? 10.175  34.934  1.043   1.00 115.79 ? 132  PHE B CD1  1 
ATOM   8153  C  CD2  . PHE B 2 132 ? 12.090  35.948  0.060   1.00 118.05 ? 132  PHE B CD2  1 
ATOM   8154  C  CE1  . PHE B 2 132 ? 9.364   35.882  0.442   1.00 119.55 ? 132  PHE B CE1  1 
ATOM   8155  C  CE2  . PHE B 2 132 ? 11.286  36.895  -0.542  1.00 124.77 ? 132  PHE B CE2  1 
ATOM   8156  C  CZ   . PHE B 2 132 ? 9.921   36.863  -0.351  1.00 123.04 ? 132  PHE B CZ   1 
ATOM   8157  H  H    . PHE B 2 132 ? 11.864  33.875  3.928   1.00 140.07 ? 132  PHE B H    1 
ATOM   8158  H  HA   . PHE B 2 132 ? 10.900  32.617  1.761   1.00 137.23 ? 132  PHE B HA   1 
ATOM   8159  H  HB2  . PHE B 2 132 ? 13.036  34.395  2.117   1.00 123.96 ? 132  PHE B HB2  1 
ATOM   8160  H  HB3  . PHE B 2 132 ? 12.975  33.522  0.793   1.00 123.96 ? 132  PHE B HB3  1 
ATOM   8161  H  HD1  . PHE B 2 132 ? 9.794   34.275  1.576   1.00 138.94 ? 132  PHE B HD1  1 
ATOM   8162  H  HD2  . PHE B 2 132 ? 13.010  35.976  -0.074  1.00 141.66 ? 132  PHE B HD2  1 
ATOM   8163  H  HE1  . PHE B 2 132 ? 8.443   35.857  0.574   1.00 143.46 ? 132  PHE B HE1  1 
ATOM   8164  H  HE2  . PHE B 2 132 ? 11.666  37.555  -1.076  1.00 149.73 ? 132  PHE B HE2  1 
ATOM   8165  H  HZ   . PHE B 2 132 ? 9.378   37.501  -0.755  1.00 147.64 ? 132  PHE B HZ   1 
ATOM   8166  N  N    . SER B 2 133 ? 13.206  31.353  3.495   1.00 122.11 ? 133  SER B N    1 
ATOM   8167  C  CA   . SER B 2 133 ? 13.984  30.126  3.664   1.00 123.87 ? 133  SER B CA   1 
ATOM   8168  C  C    . SER B 2 133 ? 13.087  28.884  3.762   1.00 129.91 ? 133  SER B C    1 
ATOM   8169  O  O    . SER B 2 133 ? 13.563  27.763  3.569   1.00 125.79 ? 133  SER B O    1 
ATOM   8170  C  CB   . SER B 2 133 ? 14.857  30.204  4.924   1.00 121.19 ? 133  SER B CB   1 
ATOM   8171  O  OG   . SER B 2 133 ? 15.839  31.220  4.828   1.00 132.50 ? 133  SER B OG   1 
ATOM   8172  H  H    . SER B 2 133 ? 13.207  31.881  4.174   1.00 146.54 ? 133  SER B H    1 
ATOM   8173  H  HA   . SER B 2 133 ? 14.570  30.015  2.899   1.00 148.64 ? 133  SER B HA   1 
ATOM   8174  H  HB2  . SER B 2 133 ? 14.288  30.391  5.687   1.00 145.43 ? 133  SER B HB2  1 
ATOM   8175  H  HB3  . SER B 2 133 ? 15.302  29.351  5.049   1.00 145.43 ? 133  SER B HB3  1 
ATOM   8176  H  HG   . SER B 2 133 ? 15.470  31.967  4.723   1.00 159.00 ? 133  SER B HG   1 
ATOM   8177  N  N    . ILE B 2 134 ? 11.801  29.086  4.060   1.00 133.25 ? 134  ILE B N    1 
ATOM   8178  C  CA   . ILE B 2 134 ? 10.841  27.983  4.193   1.00 127.78 ? 134  ILE B CA   1 
ATOM   8179  C  C    . ILE B 2 134 ? 9.769   28.031  3.107   1.00 123.32 ? 134  ILE B C    1 
ATOM   8180  O  O    . ILE B 2 134 ? 8.674   27.500  3.284   1.00 135.82 ? 134  ILE B O    1 
ATOM   8181  C  CB   . ILE B 2 134 ? 10.156  28.000  5.582   1.00 124.85 ? 134  ILE B CB   1 
ATOM   8182  C  CG1  . ILE B 2 134 ? 9.332   29.281  5.767   1.00 119.65 ? 134  ILE B CG1  1 
ATOM   8183  C  CG2  . ILE B 2 134 ? 11.205  27.885  6.685   1.00 115.24 ? 134  ILE B CG2  1 
ATOM   8184  C  CD1  . ILE B 2 134 ? 8.414   29.252  6.971   1.00 126.38 ? 134  ILE B CD1  1 
ATOM   8185  H  H    . ILE B 2 134 ? 11.455  29.862  4.192   1.00 159.90 ? 134  ILE B H    1 
ATOM   8186  H  HA   . ILE B 2 134 ? 11.316  27.142  4.106   1.00 153.33 ? 134  ILE B HA   1 
ATOM   8187  H  HB   . ILE B 2 134 ? 9.560   27.237  5.642   1.00 149.82 ? 134  ILE B HB   1 
ATOM   8188  H  HG12 . ILE B 2 134 ? 9.939   30.029  5.875   1.00 143.58 ? 134  ILE B HG12 1 
ATOM   8189  H  HG13 . ILE B 2 134 ? 8.783   29.415  4.979   1.00 143.58 ? 134  ILE B HG13 1 
ATOM   8190  H  HG21 . ILE B 2 134 ? 11.816  28.635  6.618   1.00 138.28 ? 134  ILE B HG21 1 
ATOM   8191  H  HG22 . ILE B 2 134 ? 10.759  27.897  7.546   1.00 138.28 ? 134  ILE B HG22 1 
ATOM   8192  H  HG23 . ILE B 2 134 ? 11.689  27.052  6.574   1.00 138.28 ? 134  ILE B HG23 1 
ATOM   8193  H  HD11 . ILE B 2 134 ? 8.948   29.131  7.772   1.00 151.65 ? 134  ILE B HD11 1 
ATOM   8194  H  HD12 . ILE B 2 134 ? 7.931   30.092  7.019   1.00 151.65 ? 134  ILE B HD12 1 
ATOM   8195  H  HD13 . ILE B 2 134 ? 7.790   28.516  6.874   1.00 151.65 ? 134  ILE B HD13 1 
ATOM   8196  N  N    . LEU B 2 135 ? 10.097  28.643  1.977   1.00 115.89 ? 135  LEU B N    1 
ATOM   8197  C  CA   . LEU B 2 135 ? 9.122   28.866  0.915   1.00 126.49 ? 135  LEU B CA   1 
ATOM   8198  C  C    . LEU B 2 135 ? 9.322   27.854  -0.206  1.00 138.81 ? 135  LEU B C    1 
ATOM   8199  O  O    . LEU B 2 135 ? 10.459  27.541  -0.560  1.00 140.63 ? 135  LEU B O    1 
ATOM   8200  C  CB   . LEU B 2 135 ? 9.223   30.296  0.385   1.00 125.11 ? 135  LEU B CB   1 
ATOM   8201  C  CG   . LEU B 2 135 ? 7.952   30.839  -0.267  1.00 129.06 ? 135  LEU B CG   1 
ATOM   8202  C  CD1  . LEU B 2 135 ? 6.811   30.988  0.739   1.00 128.69 ? 135  LEU B CD1  1 
ATOM   8203  C  CD2  . LEU B 2 135 ? 8.247   32.173  -0.919  1.00 121.84 ? 135  LEU B CD2  1 
ATOM   8204  H  H    . LEU B 2 135 ? 10.883  28.941  1.798   1.00 139.07 ? 135  LEU B H    1 
ATOM   8205  H  HA   . LEU B 2 135 ? 8.230   28.742  1.274   1.00 151.79 ? 135  LEU B HA   1 
ATOM   8206  H  HB2  . LEU B 2 135 ? 9.445   30.883  1.125   1.00 150.13 ? 135  LEU B HB2  1 
ATOM   8207  H  HB3  . LEU B 2 135 ? 9.930   30.330  -0.279  1.00 150.13 ? 135  LEU B HB3  1 
ATOM   8208  H  HG   . LEU B 2 135 ? 7.663   30.223  -0.959  1.00 154.87 ? 135  LEU B HG   1 
ATOM   8209  H  HD11 . LEU B 2 135 ? 7.085   31.604  1.437   1.00 154.43 ? 135  LEU B HD11 1 
ATOM   8210  H  HD12 . LEU B 2 135 ? 6.029   31.334  0.281   1.00 154.43 ? 135  LEU B HD12 1 
ATOM   8211  H  HD13 . LEU B 2 135 ? 6.613   30.120  1.123   1.00 154.43 ? 135  LEU B HD13 1 
ATOM   8212  H  HD21 . LEU B 2 135 ? 8.933   32.050  -1.593  1.00 146.20 ? 135  LEU B HD21 1 
ATOM   8213  H  HD22 . LEU B 2 135 ? 7.435   32.510  -1.330  1.00 146.20 ? 135  LEU B HD22 1 
ATOM   8214  H  HD23 . LEU B 2 135 ? 8.556   32.794  -0.241  1.00 146.20 ? 135  LEU B HD23 1 
ATOM   8215  N  N    . PRO B 2 136 ? 8.222   27.327  -0.770  1.00 149.64 ? 136  PRO B N    1 
ATOM   8216  C  CA   . PRO B 2 136 ? 8.447   26.416  -1.898  1.00 150.03 ? 136  PRO B CA   1 
ATOM   8217  C  C    . PRO B 2 136 ? 9.064   27.118  -3.101  1.00 140.51 ? 136  PRO B C    1 
ATOM   8218  O  O    . PRO B 2 136 ? 8.837   28.307  -3.317  1.00 131.68 ? 136  PRO B O    1 
ATOM   8219  C  CB   . PRO B 2 136 ? 7.034   25.915  -2.238  1.00 150.19 ? 136  PRO B CB   1 
ATOM   8220  C  CG   . PRO B 2 136 ? 6.174   26.282  -1.057  1.00 145.86 ? 136  PRO B CG   1 
ATOM   8221  C  CD   . PRO B 2 136 ? 6.791   27.506  -0.473  1.00 144.80 ? 136  PRO B CD   1 
ATOM   8222  H  HA   . PRO B 2 136 ? 9.004   25.668  -1.631  1.00 180.04 ? 136  PRO B HA   1 
ATOM   8223  H  HB2  . PRO B 2 136 ? 6.717   26.357  -3.041  1.00 180.23 ? 136  PRO B HB2  1 
ATOM   8224  H  HB3  . PRO B 2 136 ? 7.051   24.953  -2.362  1.00 180.23 ? 136  PRO B HB3  1 
ATOM   8225  H  HG2  . PRO B 2 136 ? 5.270   26.466  -1.358  1.00 175.03 ? 136  PRO B HG2  1 
ATOM   8226  H  HG3  . PRO B 2 136 ? 6.179   25.557  -0.413  1.00 175.03 ? 136  PRO B HG3  1 
ATOM   8227  H  HD2  . PRO B 2 136 ? 6.450   28.301  -0.912  1.00 173.76 ? 136  PRO B HD2  1 
ATOM   8228  H  HD3  . PRO B 2 136 ? 6.645   27.536  0.486   1.00 173.76 ? 136  PRO B HD3  1 
ATOM   8229  N  N    . LYS B 2 137 ? 9.824   26.362  -3.886  1.00 142.53 ? 137  LYS B N    1 
ATOM   8230  C  CA   . LYS B 2 137 ? 10.524  26.904  -5.041  1.00 139.98 ? 137  LYS B CA   1 
ATOM   8231  C  C    . LYS B 2 137 ? 9.568   27.485  -6.079  1.00 144.71 ? 137  LYS B C    1 
ATOM   8232  O  O    . LYS B 2 137 ? 9.915   28.421  -6.803  1.00 138.29 ? 137  LYS B O    1 
ATOM   8233  C  CB   . LYS B 2 137 ? 11.388  25.818  -5.681  1.00 137.87 ? 137  LYS B CB   1 
ATOM   8234  C  CG   . LYS B 2 137 ? 12.788  25.717  -5.098  1.00 138.15 ? 137  LYS B CG   1 
ATOM   8235  C  CD   . LYS B 2 137 ? 13.737  25.024  -6.062  1.00 136.18 ? 137  LYS B CD   1 
ATOM   8236  C  CE   . LYS B 2 137 ? 15.183  25.173  -5.627  1.00 130.12 ? 137  LYS B CE   1 
ATOM   8237  N  NZ   . LYS B 2 137 ? 16.128  24.746  -6.698  1.00 123.74 ? 137  LYS B NZ   1 
ATOM   8238  H  H    . LYS B 2 137 ? 9.951   25.520  -3.767  1.00 171.04 ? 137  LYS B H    1 
ATOM   8239  H  HA   . LYS B 2 137 ? 11.112  27.617  -4.746  1.00 167.97 ? 137  LYS B HA   1 
ATOM   8240  H  HB2  . LYS B 2 137 ? 10.953  24.960  -5.555  1.00 165.44 ? 137  LYS B HB2  1 
ATOM   8241  H  HB3  . LYS B 2 137 ? 11.475  26.006  -6.628  1.00 165.44 ? 137  LYS B HB3  1 
ATOM   8242  H  HG2  . LYS B 2 137 ? 13.129  26.609  -4.924  1.00 165.78 ? 137  LYS B HG2  1 
ATOM   8243  H  HG3  . LYS B 2 137 ? 12.758  25.202  -4.277  1.00 165.78 ? 137  LYS B HG3  1 
ATOM   8244  H  HD2  . LYS B 2 137 ? 13.525  24.078  -6.094  1.00 163.41 ? 137  LYS B HD2  1 
ATOM   8245  H  HD3  . LYS B 2 137 ? 13.642  25.419  -6.943  1.00 163.41 ? 137  LYS B HD3  1 
ATOM   8246  H  HE2  . LYS B 2 137 ? 15.360  26.104  -5.420  1.00 156.14 ? 137  LYS B HE2  1 
ATOM   8247  H  HE3  . LYS B 2 137 ? 15.340  24.620  -4.846  1.00 156.14 ? 137  LYS B HE3  1 
ATOM   8248  H  HZ1  . LYS B 2 137 ? 16.007  25.243  -7.426  1.00 148.49 ? 137  LYS B HZ1  1 
ATOM   8249  H  HZ2  . LYS B 2 137 ? 16.968  24.844  -6.418  1.00 148.49 ? 137  LYS B HZ2  1 
ATOM   8250  H  HZ3  . LYS B 2 137 ? 15.989  23.892  -6.903  1.00 148.49 ? 137  LYS B HZ3  1 
ATOM   8251  N  N    . ASP B 2 138 ? 8.375   26.904  -6.167  1.00 145.56 ? 138  ASP B N    1 
ATOM   8252  C  CA   . ASP B 2 138 ? 7.359   27.379  -7.102  1.00 148.92 ? 138  ASP B CA   1 
ATOM   8253  C  C    . ASP B 2 138 ? 6.941   28.825  -6.830  1.00 157.11 ? 138  ASP B C    1 
ATOM   8254  O  O    . ASP B 2 138 ? 7.013   29.691  -7.720  1.00 152.10 ? 138  ASP B O    1 
ATOM   8255  C  CB   . ASP B 2 138 ? 6.124   26.476  -7.040  1.00 149.21 ? 138  ASP B CB   1 
ATOM   8256  C  CG   . ASP B 2 138 ? 6.473   25.000  -7.088  1.00 150.91 ? 138  ASP B CG   1 
ATOM   8257  O  OD1  . ASP B 2 138 ? 7.627   24.672  -7.437  1.00 146.98 ? 138  ASP B OD1  1 
ATOM   8258  O  OD2  . ASP B 2 138 ? 5.592   24.169  -6.776  1.00 147.62 ? 138  ASP B OD2  1 
ATOM   8259  H  H    . ASP B 2 138 ? 8.128   26.230  -5.694  1.00 174.67 ? 138  ASP B H    1 
ATOM   8260  H  HA   . ASP B 2 138 ? 7.717   27.337  -8.003  1.00 178.70 ? 138  ASP B HA   1 
ATOM   8261  H  HB2  . ASP B 2 138 ? 5.649   26.645  -6.211  1.00 179.05 ? 138  ASP B HB2  1 
ATOM   8262  H  HB3  . ASP B 2 138 ? 5.550   26.673  -7.797  1.00 179.05 ? 138  ASP B HB3  1 
ATOM   8263  N  N    . LYS B 2 139 ? 6.532   29.088  -5.588  1.00 158.01 ? 139  LYS B N    1 
ATOM   8264  C  CA   . LYS B 2 139 ? 6.061   30.418  -5.218  1.00 148.87 ? 139  LYS B CA   1 
ATOM   8265  C  C    . LYS B 2 139 ? 7.128   31.480  -5.377  1.00 142.39 ? 139  LYS B C    1 
ATOM   8266  O  O    . LYS B 2 139 ? 6.818   32.628  -5.695  1.00 141.00 ? 139  LYS B O    1 
ATOM   8267  C  CB   . LYS B 2 139 ? 5.559   30.421  -3.772  1.00 136.35 ? 139  LYS B CB   1 
ATOM   8268  C  CG   . LYS B 2 139 ? 4.152   29.886  -3.593  1.00 143.60 ? 139  LYS B CG   1 
ATOM   8269  C  CD   . LYS B 2 139 ? 3.138   30.853  -4.194  1.00 138.74 ? 139  LYS B CD   1 
ATOM   8270  C  CE   . LYS B 2 139 ? 1.711   30.427  -3.922  1.00 132.59 ? 139  LYS B CE   1 
ATOM   8271  N  NZ   . LYS B 2 139 ? 0.743   31.415  -4.471  1.00 131.88 ? 139  LYS B NZ   1 
ATOM   8272  H  H    . LYS B 2 139 ? 6.519   28.516  -4.946  1.00 189.61 ? 139  LYS B H    1 
ATOM   8273  H  HA   . LYS B 2 139 ? 5.316   30.656  -5.793  1.00 178.64 ? 139  LYS B HA   1 
ATOM   8274  H  HB2  . LYS B 2 139 ? 6.152   29.872  -3.236  1.00 163.62 ? 139  LYS B HB2  1 
ATOM   8275  H  HB3  . LYS B 2 139 ? 5.571   31.333  -3.441  1.00 163.62 ? 139  LYS B HB3  1 
ATOM   8276  H  HG2  . LYS B 2 139 ? 4.069   29.033  -4.046  1.00 172.32 ? 139  LYS B HG2  1 
ATOM   8277  H  HG3  . LYS B 2 139 ? 3.960   29.789  -2.647  1.00 172.32 ? 139  LYS B HG3  1 
ATOM   8278  H  HD2  . LYS B 2 139 ? 3.270   31.733  -3.807  1.00 166.49 ? 139  LYS B HD2  1 
ATOM   8279  H  HD3  . LYS B 2 139 ? 3.264   30.889  -5.155  1.00 166.49 ? 139  LYS B HD3  1 
ATOM   8280  H  HE2  . LYS B 2 139 ? 1.545   29.570  -4.345  1.00 159.11 ? 139  LYS B HE2  1 
ATOM   8281  H  HE3  . LYS B 2 139 ? 1.571   30.363  -2.964  1.00 159.11 ? 139  LYS B HE3  1 
ATOM   8282  H  HZ1  . LYS B 2 139 ? 0.851   31.489  -5.352  1.00 158.26 ? 139  LYS B HZ1  1 
ATOM   8283  H  HZ2  . LYS B 2 139 ? -0.090  31.150  -4.303  1.00 158.26 ? 139  LYS B HZ2  1 
ATOM   8284  H  HZ3  . LYS B 2 139 ? 0.875   32.211  -4.096  1.00 158.26 ? 139  LYS B HZ3  1 
ATOM   8285  N  N    . ILE B 2 140 ? 8.379   31.109  -5.127  1.00 138.18 ? 140  ILE B N    1 
ATOM   8286  C  CA   . ILE B 2 140 ? 9.466   32.068  -5.234  1.00 140.92 ? 140  ILE B CA   1 
ATOM   8287  C  C    . ILE B 2 140 ? 9.513   32.602  -6.663  1.00 142.88 ? 140  ILE B C    1 
ATOM   8288  O  O    . ILE B 2 140 ? 9.347   33.803  -6.913  1.00 140.48 ? 140  ILE B O    1 
ATOM   8289  C  CB   . ILE B 2 140 ? 10.818  31.432  -4.852  1.00 130.04 ? 140  ILE B CB   1 
ATOM   8290  C  CG1  . ILE B 2 140 ? 10.805  31.036  -3.372  1.00 130.91 ? 140  ILE B CG1  1 
ATOM   8291  C  CG2  . ILE B 2 140 ? 11.961  32.403  -5.150  1.00 126.09 ? 140  ILE B CG2  1 
ATOM   8292  C  CD1  . ILE B 2 140 ? 12.098  30.428  -2.856  1.00 130.99 ? 140  ILE B CD1  1 
ATOM   8293  H  H    . ILE B 2 140 ? 8.621   30.317  -4.896  1.00 165.82 ? 140  ILE B H    1 
ATOM   8294  H  HA   . ILE B 2 140 ? 9.298   32.812  -4.635  1.00 169.10 ? 140  ILE B HA   1 
ATOM   8295  H  HB   . ILE B 2 140 ? 10.944  30.632  -5.385  1.00 156.05 ? 140  ILE B HB   1 
ATOM   8296  H  HG12 . ILE B 2 140 ? 10.624  31.828  -2.842  1.00 157.09 ? 140  ILE B HG12 1 
ATOM   8297  H  HG13 . ILE B 2 140 ? 10.100  30.384  -3.233  1.00 157.09 ? 140  ILE B HG13 1 
ATOM   8298  H  HG21 . ILE B 2 140 ? 11.830  33.213  -4.634  1.00 151.31 ? 140  ILE B HG21 1 
ATOM   8299  H  HG22 . ILE B 2 140 ? 12.801  31.986  -4.904  1.00 151.31 ? 140  ILE B HG22 1 
ATOM   8300  H  HG23 . ILE B 2 140 ? 11.960  32.610  -6.098  1.00 151.31 ? 140  ILE B HG23 1 
ATOM   8301  H  HD11 . ILE B 2 140 ? 12.816  31.070  -2.969  1.00 157.18 ? 140  ILE B HD11 1 
ATOM   8302  H  HD12 . ILE B 2 140 ? 11.992  30.212  -1.917  1.00 157.18 ? 140  ILE B HD12 1 
ATOM   8303  H  HD13 . ILE B 2 140 ? 12.291  29.623  -3.362  1.00 157.18 ? 140  ILE B HD13 1 
ATOM   8304  N  N    . GLN B 2 141 ? 9.727   31.674  -7.597  1.00 145.16 ? 141  GLN B N    1 
ATOM   8305  C  CA   . GLN B 2 141 ? 9.837   32.005  -9.013  1.00 148.31 ? 141  GLN B CA   1 
ATOM   8306  C  C    . GLN B 2 141 ? 8.564   32.664  -9.537  1.00 150.09 ? 141  GLN B C    1 
ATOM   8307  O  O    . GLN B 2 141 ? 8.621   33.532  -10.412 1.00 143.27 ? 141  GLN B O    1 
ATOM   8308  C  CB   . GLN B 2 141 ? 10.175  30.762  -9.840  1.00 139.53 ? 141  GLN B CB   1 
ATOM   8309  C  CG   . GLN B 2 141 ? 10.657  31.108  -11.244 1.00 132.34 ? 141  GLN B CG   1 
ATOM   8310  C  CD   . GLN B 2 141 ? 10.998  29.890  -12.080 1.00 132.13 ? 141  GLN B CD   1 
ATOM   8311  O  OE1  . GLN B 2 141 ? 10.686  28.757  -11.708 1.00 143.72 ? 141  GLN B OE1  1 
ATOM   8312  N  NE2  . GLN B 2 141 ? 11.665  30.116  -13.208 1.00 112.55 ? 141  GLN B NE2  1 
ATOM   8313  H  H    . GLN B 2 141 ? 9.813   30.835  -7.430  1.00 174.19 ? 141  GLN B H    1 
ATOM   8314  H  HA   . GLN B 2 141 ? 10.563  32.638  -9.127  1.00 177.97 ? 141  GLN B HA   1 
ATOM   8315  H  HB2  . GLN B 2 141 ? 10.880  30.267  -9.393  1.00 167.44 ? 141  GLN B HB2  1 
ATOM   8316  H  HB3  . GLN B 2 141 ? 9.381   30.211  -9.922  1.00 167.44 ? 141  GLN B HB3  1 
ATOM   8317  H  HG2  . GLN B 2 141 ? 9.959   31.599  -11.704 1.00 158.81 ? 141  GLN B HG2  1 
ATOM   8318  H  HG3  . GLN B 2 141 ? 11.455  31.655  -11.176 1.00 158.81 ? 141  GLN B HG3  1 
ATOM   8319  H  HE21 . GLN B 2 141 ? 11.878  30.919  -13.427 1.00 135.06 ? 141  GLN B HE21 1 
ATOM   8320  H  HE22 . GLN B 2 141 ? 11.882  29.458  -13.718 1.00 135.06 ? 141  GLN B HE22 1 
ATOM   8321  N  N    . ASP B 2 142 ? 7.415   32.252  -9.003  1.00 148.29 ? 142  ASP B N    1 
ATOM   8322  C  CA   . ASP B 2 142 ? 6.162   32.893  -9.386  1.00 147.42 ? 142  ASP B CA   1 
ATOM   8323  C  C    . ASP B 2 142 ? 6.105   34.318  -8.841  1.00 148.05 ? 142  ASP B C    1 
ATOM   8324  O  O    . ASP B 2 142 ? 5.596   35.220  -9.508  1.00 146.45 ? 142  ASP B O    1 
ATOM   8325  C  CB   . ASP B 2 142 ? 4.964   32.081  -8.886  1.00 153.47 ? 142  ASP B CB   1 
ATOM   8326  C  CG   . ASP B 2 142 ? 4.915   30.683  -9.481  1.00 159.22 ? 142  ASP B CG   1 
ATOM   8327  O  OD1  . ASP B 2 142 ? 5.460   30.486  -10.589 1.00 155.98 ? 142  ASP B OD1  1 
ATOM   8328  O  OD2  . ASP B 2 142 ? 4.338   29.779  -8.840  1.00 158.20 ? 142  ASP B OD2  1 
ATOM   8329  H  H    . ASP B 2 142 ? 7.335   31.616  -8.430  1.00 177.95 ? 142  ASP B H    1 
ATOM   8330  H  HA   . ASP B 2 142 ? 6.111   32.939  -10.353 1.00 176.91 ? 142  ASP B HA   1 
ATOM   8331  H  HB2  . ASP B 2 142 ? 5.020   31.995  -7.921  1.00 184.16 ? 142  ASP B HB2  1 
ATOM   8332  H  HB3  . ASP B 2 142 ? 4.145   32.541  -9.131  1.00 184.16 ? 142  ASP B HB3  1 
ATOM   8333  N  N    . PHE B 2 143 ? 6.641   34.521  -7.640  1.00 146.42 ? 143  PHE B N    1 
ATOM   8334  C  CA   . PHE B 2 143 ? 6.694   35.851  -7.038  1.00 147.24 ? 143  PHE B CA   1 
ATOM   8335  C  C    . PHE B 2 143 ? 7.691   36.729  -7.780  1.00 150.89 ? 143  PHE B C    1 
ATOM   8336  O  O    . PHE B 2 143 ? 7.527   37.950  -7.862  1.00 148.29 ? 143  PHE B O    1 
ATOM   8337  C  CB   . PHE B 2 143 ? 7.076   35.781  -5.559  1.00 145.28 ? 143  PHE B CB   1 
ATOM   8338  C  CG   . PHE B 2 143 ? 7.398   37.122  -4.962  1.00 147.82 ? 143  PHE B CG   1 
ATOM   8339  C  CD1  . PHE B 2 143 ? 6.431   38.112  -4.889  1.00 153.19 ? 143  PHE B CD1  1 
ATOM   8340  C  CD2  . PHE B 2 143 ? 8.671   37.402  -4.497  1.00 139.22 ? 143  PHE B CD2  1 
ATOM   8341  C  CE1  . PHE B 2 143 ? 6.723   39.351  -4.350  1.00 147.22 ? 143  PHE B CE1  1 
ATOM   8342  C  CE2  . PHE B 2 143 ? 8.970   38.640  -3.955  1.00 135.25 ? 143  PHE B CE2  1 
ATOM   8343  C  CZ   . PHE B 2 143 ? 7.995   39.615  -3.882  1.00 137.13 ? 143  PHE B CZ   1 
ATOM   8344  H  H    . PHE B 2 143 ? 6.984   33.902  -7.151  1.00 175.71 ? 143  PHE B H    1 
ATOM   8345  H  HA   . PHE B 2 143 ? 5.819   36.264  -7.105  1.00 176.69 ? 143  PHE B HA   1 
ATOM   8346  H  HB2  . PHE B 2 143 ? 6.334   35.404  -5.061  1.00 174.33 ? 143  PHE B HB2  1 
ATOM   8347  H  HB3  . PHE B 2 143 ? 7.859   35.216  -5.464  1.00 174.33 ? 143  PHE B HB3  1 
ATOM   8348  H  HD1  . PHE B 2 143 ? 5.573   37.938  -5.202  1.00 183.83 ? 143  PHE B HD1  1 
ATOM   8349  H  HD2  . PHE B 2 143 ? 9.331   36.749  -4.543  1.00 167.06 ? 143  PHE B HD2  1 
ATOM   8350  H  HE1  . PHE B 2 143 ? 6.064   40.005  -4.302  1.00 176.66 ? 143  PHE B HE1  1 
ATOM   8351  H  HE2  . PHE B 2 143 ? 9.827   38.815  -3.641  1.00 162.30 ? 143  PHE B HE2  1 
ATOM   8352  H  HZ   . PHE B 2 143 ? 8.194   40.448  -3.519  1.00 164.56 ? 143  PHE B HZ   1 
ATOM   8353  N  N    . LEU B 2 144 ? 8.730   36.095  -8.318  1.00 151.23 ? 144  LEU B N    1 
ATOM   8354  C  CA   . LEU B 2 144 ? 9.779   36.822  -9.023  1.00 146.68 ? 144  LEU B CA   1 
ATOM   8355  C  C    . LEU B 2 144 ? 9.286   37.533  -10.281 1.00 151.96 ? 144  LEU B C    1 
ATOM   8356  O  O    . LEU B 2 144 ? 9.562   38.715  -10.462 1.00 149.93 ? 144  LEU B O    1 
ATOM   8357  C  CB   . LEU B 2 144 ? 10.918  35.872  -9.408  1.00 141.98 ? 144  LEU B CB   1 
ATOM   8358  C  CG   . LEU B 2 144 ? 11.866  35.413  -8.299  1.00 146.08 ? 144  LEU B CG   1 
ATOM   8359  C  CD1  . LEU B 2 144 ? 12.888  34.429  -8.858  1.00 133.12 ? 144  LEU B CD1  1 
ATOM   8360  C  CD2  . LEU B 2 144 ? 12.570  36.593  -7.640  1.00 141.85 ? 144  LEU B CD2  1 
ATOM   8361  H  H    . LEU B 2 144 ? 8.850   35.244  -8.288  1.00 181.47 ? 144  LEU B H    1 
ATOM   8362  H  HA   . LEU B 2 144 ? 10.144  37.495  -8.428  1.00 176.02 ? 144  LEU B HA   1 
ATOM   8363  H  HB2  . LEU B 2 144 ? 10.524  35.073  -9.792  1.00 170.38 ? 144  LEU B HB2  1 
ATOM   8364  H  HB3  . LEU B 2 144 ? 11.460  36.312  -10.081 1.00 170.38 ? 144  LEU B HB3  1 
ATOM   8365  H  HG   . LEU B 2 144 ? 11.352  34.954  -7.616  1.00 175.30 ? 144  LEU B HG   1 
ATOM   8366  H  HD11 . LEU B 2 144 ? 13.397  34.866  -9.557  1.00 159.75 ? 144  LEU B HD11 1 
ATOM   8367  H  HD12 . LEU B 2 144 ? 13.480  34.149  -8.142  1.00 159.75 ? 144  LEU B HD12 1 
ATOM   8368  H  HD13 . LEU B 2 144 ? 12.419  33.660  -9.220  1.00 159.75 ? 144  LEU B HD13 1 
ATOM   8369  H  HD21 . LEU B 2 144 ? 11.903  37.183  -7.255  1.00 170.22 ? 144  LEU B HD21 1 
ATOM   8370  H  HD22 . LEU B 2 144 ? 13.160  36.261  -6.945  1.00 170.22 ? 144  LEU B HD22 1 
ATOM   8371  H  HD23 . LEU B 2 144 ? 13.084  37.069  -8.312  1.00 170.22 ? 144  LEU B HD23 1 
ATOM   8372  N  N    . LYS B 2 145 ? 8.547   36.836  -11.140 1.00 157.13 ? 145  LYS B N    1 
ATOM   8373  C  CA   . LYS B 2 145 ? 8.128   37.430  -12.409 1.00 157.93 ? 145  LYS B CA   1 
ATOM   8374  C  C    . LYS B 2 145 ? 7.186   38.616  -12.163 1.00 157.44 ? 145  LYS B C    1 
ATOM   8375  O  O    . LYS B 2 145 ? 7.052   39.508  -13.005 1.00 146.52 ? 145  LYS B O    1 
ATOM   8376  C  CB   . LYS B 2 145 ? 7.455   36.384  -13.301 1.00 147.41 ? 145  LYS B CB   1 
ATOM   8377  C  CG   . LYS B 2 145 ? 7.355   36.783  -14.773 1.00 145.36 ? 145  LYS B CG   1 
ATOM   8378  C  CD   . LYS B 2 145 ? 8.740   36.965  -15.404 1.00 142.66 ? 145  LYS B CD   1 
ATOM   8379  C  CE   . LYS B 2 145 ? 8.657   37.353  -16.874 1.00 140.29 ? 145  LYS B CE   1 
ATOM   8380  N  NZ   . LYS B 2 145 ? 7.944   36.332  -17.691 1.00 144.37 ? 145  LYS B NZ   1 
ATOM   8381  H  H    . LYS B 2 145 ? 8.277   36.029  -11.015 1.00 188.56 ? 145  LYS B H    1 
ATOM   8382  H  HA   . LYS B 2 145 ? 8.911   37.761  -12.875 1.00 189.52 ? 145  LYS B HA   1 
ATOM   8383  H  HB2  . LYS B 2 145 ? 7.964   35.560  -13.253 1.00 176.89 ? 145  LYS B HB2  1 
ATOM   8384  H  HB3  . LYS B 2 145 ? 6.554   36.231  -12.976 1.00 176.89 ? 145  LYS B HB3  1 
ATOM   8385  H  HG2  . LYS B 2 145 ? 6.888   36.087  -15.261 1.00 174.44 ? 145  LYS B HG2  1 
ATOM   8386  H  HG3  . LYS B 2 145 ? 6.876   37.623  -14.845 1.00 174.44 ? 145  LYS B HG3  1 
ATOM   8387  H  HD2  . LYS B 2 145 ? 9.214   37.668  -14.933 1.00 171.19 ? 145  LYS B HD2  1 
ATOM   8388  H  HD3  . LYS B 2 145 ? 9.231   36.131  -15.340 1.00 171.19 ? 145  LYS B HD3  1 
ATOM   8389  H  HE2  . LYS B 2 145 ? 8.177   38.192  -16.954 1.00 168.35 ? 145  LYS B HE2  1 
ATOM   8390  H  HE3  . LYS B 2 145 ? 9.555   37.448  -17.228 1.00 168.35 ? 145  LYS B HE3  1 
ATOM   8391  H  HZ1  . LYS B 2 145 ? 7.112   36.229  -17.391 1.00 173.24 ? 145  LYS B HZ1  1 
ATOM   8392  H  HZ2  . LYS B 2 145 ? 7.914   36.591  -18.542 1.00 173.24 ? 145  LYS B HZ2  1 
ATOM   8393  H  HZ3  . LYS B 2 145 ? 8.368   35.551  -17.641 1.00 173.24 ? 145  LYS B HZ3  1 
ATOM   8394  N  N    . ASP B 2 146 ? 6.547   38.611  -10.997 1.00 155.43 ? 146  ASP B N    1 
ATOM   8395  C  CA   . ASP B 2 146 ? 5.599   39.649  -10.599 1.00 154.86 ? 146  ASP B CA   1 
ATOM   8396  C  C    . ASP B 2 146 ? 6.330   40.925  -10.182 1.00 156.22 ? 146  ASP B C    1 
ATOM   8397  O  O    . ASP B 2 146 ? 5.733   41.997  -10.091 1.00 151.31 ? 146  ASP B O    1 
ATOM   8398  C  CB   . ASP B 2 146 ? 4.719   39.157  -9.450  1.00 154.84 ? 146  ASP B CB   1 
ATOM   8399  C  CG   . ASP B 2 146 ? 4.046   37.836  -9.757  1.00 152.97 ? 146  ASP B CG   1 
ATOM   8400  O  OD1  . ASP B 2 146 ? 3.945   37.478  -10.950 1.00 146.94 ? 146  ASP B OD1  1 
ATOM   8401  O  OD2  . ASP B 2 146 ? 3.622   37.154  -8.801  1.00 155.07 ? 146  ASP B OD2  1 
ATOM   8402  H  H    . ASP B 2 146 ? 6.649   37.999  -10.402 1.00 186.52 ? 146  ASP B H    1 
ATOM   8403  H  HA   . ASP B 2 146 ? 5.025   39.861  -11.351 1.00 185.84 ? 146  ASP B HA   1 
ATOM   8404  H  HB2  . ASP B 2 146 ? 5.268   39.038  -8.659  1.00 185.81 ? 146  ASP B HB2  1 
ATOM   8405  H  HB3  . ASP B 2 146 ? 4.027   39.814  -9.278  1.00 185.81 ? 146  ASP B HB3  1 
ATOM   8406  N  N    . SER B 2 147 ? 7.628   40.792  -9.933  1.00 156.33 ? 147  SER B N    1 
ATOM   8407  C  CA   . SER B 2 147 ? 8.468   41.906  -9.507  1.00 155.98 ? 147  SER B CA   1 
ATOM   8408  C  C    . SER B 2 147 ? 8.814   42.867  -10.649 1.00 155.38 ? 147  SER B C    1 
ATOM   8409  O  O    . SER B 2 147 ? 9.475   43.879  -10.410 1.00 148.59 ? 147  SER B O    1 
ATOM   8410  C  CB   . SER B 2 147 ? 9.761   41.390  -8.868  1.00 154.67 ? 147  SER B CB   1 
ATOM   8411  O  OG   . SER B 2 147 ? 10.613  40.805  -9.833  1.00 143.33 ? 147  SER B OG   1 
ATOM   8412  H  H    . SER B 2 147 ? 8.055   40.049  -10.005 1.00 187.60 ? 147  SER B H    1 
ATOM   8413  H  HA   . SER B 2 147 ? 7.989   42.413  -8.833  1.00 187.18 ? 147  SER B HA   1 
ATOM   8414  H  HB2  . SER B 2 147 ? 10.224  42.134  -8.451  1.00 185.60 ? 147  SER B HB2  1 
ATOM   8415  H  HB3  . SER B 2 147 ? 9.538   40.724  -8.200  1.00 185.60 ? 147  SER B HB3  1 
ATOM   8416  H  HG   . SER B 2 147 ? 10.226  40.157  -10.203 1.00 172.00 ? 147  SER B HG   1 
ATOM   8417  N  N    . GLN B 2 148 ? 8.396   42.551  -11.877 1.00 156.29 ? 148  GLN B N    1 
ATOM   8418  C  CA   . GLN B 2 148 ? 8.664   43.429  -13.025 1.00 160.88 ? 148  GLN B CA   1 
ATOM   8419  C  C    . GLN B 2 148 ? 10.163  43.544  -13.296 1.00 154.97 ? 148  GLN B C    1 
ATOM   8420  O  O    . GLN B 2 148 ? 10.634  44.527  -13.875 1.00 153.13 ? 148  GLN B O    1 
ATOM   8421  C  CB   . GLN B 2 148 ? 8.058   44.823  -12.812 1.00 168.56 ? 148  GLN B CB   1 
ATOM   8422  C  CG   . GLN B 2 148 ? 6.544   44.833  -12.670 1.00 163.56 ? 148  GLN B CG   1 
ATOM   8423  C  CD   . GLN B 2 148 ? 6.010   46.170  -12.184 1.00 157.55 ? 148  GLN B CD   1 
ATOM   8424  O  OE1  . GLN B 2 148 ? 6.609   46.818  -11.325 1.00 161.47 ? 148  GLN B OE1  1 
ATOM   8425  N  NE2  . GLN B 2 148 ? 4.887   46.597  -12.745 1.00 149.44 ? 148  GLN B NE2  1 
ATOM   8426  H  H    . GLN B 2 148 ? 7.957   41.838  -12.074 1.00 187.55 ? 148  GLN B H    1 
ATOM   8427  H  HA   . GLN B 2 148 ? 8.250   43.044  -13.814 1.00 193.05 ? 148  GLN B HA   1 
ATOM   8428  H  HB2  . GLN B 2 148 ? 8.432   45.204  -12.002 1.00 202.27 ? 148  GLN B HB2  1 
ATOM   8429  H  HB3  . GLN B 2 148 ? 8.286   45.380  -13.572 1.00 202.27 ? 148  GLN B HB3  1 
ATOM   8430  H  HG2  . GLN B 2 148 ? 6.144   44.646  -13.533 1.00 196.27 ? 148  GLN B HG2  1 
ATOM   8431  H  HG3  . GLN B 2 148 ? 6.282   44.154  -12.028 1.00 196.27 ? 148  GLN B HG3  1 
ATOM   8432  H  HE21 . GLN B 2 148 ? 4.502   46.123  -13.350 1.00 179.33 ? 148  GLN B HE21 1 
ATOM   8433  H  HE22 . GLN B 2 148 ? 4.544   47.348  -12.504 1.00 179.33 ? 148  GLN B HE22 1 
ATOM   8434  N  N    . LEU B 2 149 ? 10.896  42.515  -12.885 1.00 147.58 ? 149  LEU B N    1 
ATOM   8435  C  CA   . LEU B 2 149 ? 12.336  42.439  -13.091 1.00 134.35 ? 149  LEU B CA   1 
ATOM   8436  C  C    . LEU B 2 149 ? 12.692  41.339  -14.091 1.00 125.09 ? 149  LEU B C    1 
ATOM   8437  O  O    . LEU B 2 149 ? 12.049  40.293  -14.148 1.00 125.36 ? 149  LEU B O    1 
ATOM   8438  C  CB   . LEU B 2 149 ? 13.028  42.181  -11.748 1.00 130.34 ? 149  LEU B CB   1 
ATOM   8439  C  CG   . LEU B 2 149 ? 14.554  42.144  -11.671 1.00 123.56 ? 149  LEU B CG   1 
ATOM   8440  C  CD1  . LEU B 2 149 ? 15.166  43.369  -12.336 1.00 121.93 ? 149  LEU B CD1  1 
ATOM   8441  C  CD2  . LEU B 2 149 ? 14.998  42.034  -10.214 1.00 120.13 ? 149  LEU B CD2  1 
ATOM   8442  H  H    . LEU B 2 149 ? 10.573  41.832  -12.475 1.00 177.10 ? 149  LEU B H    1 
ATOM   8443  H  HA   . LEU B 2 149 ? 12.655  43.285  -13.442 1.00 161.23 ? 149  LEU B HA   1 
ATOM   8444  H  HB2  . LEU B 2 149 ? 12.738  42.873  -11.133 1.00 156.41 ? 149  LEU B HB2  1 
ATOM   8445  H  HB3  . LEU B 2 149 ? 12.715  41.323  -11.420 1.00 156.41 ? 149  LEU B HB3  1 
ATOM   8446  H  HG   . LEU B 2 149 ? 14.875  41.358  -12.141 1.00 148.27 ? 149  LEU B HG   1 
ATOM   8447  H  HD11 . LEU B 2 149 ? 14.848  44.166  -11.883 1.00 146.32 ? 149  LEU B HD11 1 
ATOM   8448  H  HD12 . LEU B 2 149 ? 16.132  43.314  -12.269 1.00 146.32 ? 149  LEU B HD12 1 
ATOM   8449  H  HD13 . LEU B 2 149 ? 14.899  43.389  -13.268 1.00 146.32 ? 149  LEU B HD13 1 
ATOM   8450  H  HD21 . LEU B 2 149 ? 14.634  41.218  -9.835  1.00 144.15 ? 149  LEU B HD21 1 
ATOM   8451  H  HD22 . LEU B 2 149 ? 15.967  42.012  -10.180 1.00 144.15 ? 149  LEU B HD22 1 
ATOM   8452  H  HD23 . LEU B 2 149 ? 14.666  42.803  -9.725  1.00 144.15 ? 149  LEU B HD23 1 
ATOM   8453  N  N    . GLN B 2 150 ? 13.693  41.629  -14.916 1.00 120.48 ? 150  GLN B N    1 
ATOM   8454  C  CA   . GLN B 2 150 ? 14.194  40.701  -15.927 1.00 111.78 ? 150  GLN B CA   1 
ATOM   8455  C  C    . GLN B 2 150 ? 14.760  39.447  -15.263 1.00 110.50 ? 150  GLN B C    1 
ATOM   8456  O  O    . GLN B 2 150 ? 15.784  39.511  -14.585 1.00 107.80 ? 150  GLN B O    1 
ATOM   8457  C  CB   . GLN B 2 150 ? 15.252  41.378  -16.799 1.00 107.45 ? 150  GLN B CB   1 
ATOM   8458  C  CG   . GLN B 2 150 ? 14.661  42.112  -18.004 1.00 120.98 ? 150  GLN B CG   1 
ATOM   8459  C  CD   . GLN B 2 150 ? 15.600  42.165  -19.197 1.00 127.16 ? 150  GLN B CD   1 
ATOM   8460  O  OE1  . GLN B 2 150 ? 16.816  42.284  -19.047 1.00 117.15 ? 150  GLN B OE1  1 
ATOM   8461  N  NE2  . GLN B 2 150 ? 15.031  42.095  -20.397 1.00 139.27 ? 150  GLN B NE2  1 
ATOM   8462  H  H    . GLN B 2 150 ? 14.112  42.380  -14.909 1.00 144.58 ? 150  GLN B H    1 
ATOM   8463  H  HA   . GLN B 2 150 ? 13.460  40.432  -16.500 1.00 134.13 ? 150  GLN B HA   1 
ATOM   8464  H  HB2  . GLN B 2 150 ? 15.735  42.026  -16.262 1.00 128.93 ? 150  GLN B HB2  1 
ATOM   8465  H  HB3  . GLN B 2 150 ? 15.864  40.703  -17.132 1.00 128.93 ? 150  GLN B HB3  1 
ATOM   8466  H  HG2  . GLN B 2 150 ? 13.851  41.658  -18.282 1.00 145.18 ? 150  GLN B HG2  1 
ATOM   8467  H  HG3  . GLN B 2 150 ? 14.456  43.025  -17.746 1.00 145.18 ? 150  GLN B HG3  1 
ATOM   8468  H  HE21 . GLN B 2 150 ? 14.176  42.024  -20.463 1.00 167.12 ? 150  GLN B HE21 1 
ATOM   8469  H  HE22 . GLN B 2 150 ? 15.517  42.120  -21.106 1.00 167.12 ? 150  GLN B HE22 1 
ATOM   8470  N  N    . PHE B 2 151 ? 14.103  38.308  -15.477 1.00 121.84 ? 151  PHE B N    1 
ATOM   8471  C  CA   . PHE B 2 151 ? 14.604  37.033  -14.980 1.00 96.72  ? 151  PHE B CA   1 
ATOM   8472  C  C    . PHE B 2 151 ? 14.628  35.988  -16.065 1.00 89.70  ? 151  PHE B C    1 
ATOM   8473  O  O    . PHE B 2 151 ? 13.612  35.737  -16.714 1.00 111.90 ? 151  PHE B O    1 
ATOM   8474  C  CB   . PHE B 2 151 ? 13.685  36.478  -13.892 1.00 99.95  ? 151  PHE B CB   1 
ATOM   8475  C  CG   . PHE B 2 151 ? 13.647  37.292  -12.653 1.00 123.64 ? 151  PHE B CG   1 
ATOM   8476  C  CD1  . PHE B 2 151 ? 14.685  37.290  -11.742 1.00 122.25 ? 151  PHE B CD1  1 
ATOM   8477  C  CD2  . PHE B 2 151 ? 12.537  38.068  -12.397 1.00 141.51 ? 151  PHE B CD2  1 
ATOM   8478  C  CE1  . PHE B 2 151 ? 14.610  38.072  -10.592 1.00 122.13 ? 151  PHE B CE1  1 
ATOM   8479  C  CE2  . PHE B 2 151 ? 12.457  38.835  -11.267 1.00 150.67 ? 151  PHE B CE2  1 
ATOM   8480  C  CZ   . PHE B 2 151 ? 13.493  38.842  -10.359 1.00 138.73 ? 151  PHE B CZ   1 
ATOM   8481  H  H    . PHE B 2 151 ? 13.362  38.249  -15.910 1.00 146.21 ? 151  PHE B H    1 
ATOM   8482  H  HA   . PHE B 2 151 ? 15.499  37.140  -14.619 1.00 116.07 ? 151  PHE B HA   1 
ATOM   8483  H  HB2  . PHE B 2 151 ? 12.782  36.431  -14.242 1.00 119.95 ? 151  PHE B HB2  1 
ATOM   8484  H  HB3  . PHE B 2 151 ? 13.990  35.589  -13.651 1.00 119.95 ? 151  PHE B HB3  1 
ATOM   8485  H  HD1  . PHE B 2 151 ? 15.441  36.772  -11.901 1.00 146.70 ? 151  PHE B HD1  1 
ATOM   8486  H  HD2  . PHE B 2 151 ? 11.833  38.074  -13.004 1.00 169.81 ? 151  PHE B HD2  1 
ATOM   8487  H  HE1  . PHE B 2 151 ? 15.311  38.071  -9.981  1.00 146.55 ? 151  PHE B HE1  1 
ATOM   8488  H  HE2  . PHE B 2 151 ? 11.702  39.354  -11.112 1.00 180.81 ? 151  PHE B HE2  1 
ATOM   8489  H  HZ   . PHE B 2 151 ? 13.437  39.362  -9.590  1.00 166.47 ? 151  PHE B HZ   1 
ATOM   8490  N  N    . GLU B 2 152 ? 15.789  35.389  -16.273 1.00 79.84  ? 152  GLU B N    1 
ATOM   8491  C  CA   . GLU B 2 152 ? 15.942  34.374  -17.303 1.00 90.79  ? 152  GLU B CA   1 
ATOM   8492  C  C    . GLU B 2 152 ? 16.647  33.187  -16.655 1.00 84.98  ? 152  GLU B C    1 
ATOM   8493  O  O    . GLU B 2 152 ? 17.833  33.265  -16.342 1.00 82.90  ? 152  GLU B O    1 
ATOM   8494  C  CB   . GLU B 2 152 ? 16.728  34.916  -18.498 1.00 83.76  ? 152  GLU B CB   1 
ATOM   8495  C  CG   . GLU B 2 152 ? 16.834  33.956  -19.669 1.00 86.18  ? 152  GLU B CG   1 
ATOM   8496  C  CD   . GLU B 2 152 ? 17.471  34.595  -20.892 1.00 97.72  ? 152  GLU B CD   1 
ATOM   8497  O  OE1  . GLU B 2 152 ? 17.404  35.835  -21.024 1.00 103.71 ? 152  GLU B OE1  1 
ATOM   8498  O  OE2  . GLU B 2 152 ? 18.040  33.854  -21.724 1.00 106.20 ? 152  GLU B OE2  1 
ATOM   8499  H  H    . GLU B 2 152 ? 16.508  35.552  -15.830 1.00 95.80  ? 152  GLU B H    1 
ATOM   8500  H  HA   . GLU B 2 152 ? 15.068  34.086  -17.611 1.00 108.95 ? 152  GLU B HA   1 
ATOM   8501  H  HB2  . GLU B 2 152 ? 16.291  35.721  -18.816 1.00 100.51 ? 152  GLU B HB2  1 
ATOM   8502  H  HB3  . GLU B 2 152 ? 17.629  35.126  -18.207 1.00 100.51 ? 152  GLU B HB3  1 
ATOM   8503  H  HG2  . GLU B 2 152 ? 17.379  33.197  -19.408 1.00 103.42 ? 152  GLU B HG2  1 
ATOM   8504  H  HG3  . GLU B 2 152 ? 15.945  33.658  -19.915 1.00 103.42 ? 152  GLU B HG3  1 
ATOM   8505  N  N    . ALA B 2 153 ? 15.926  32.089  -16.452 1.00 96.70  ? 153  ALA B N    1 
ATOM   8506  C  CA   . ALA B 2 153 ? 16.554  30.862  -15.969 1.00 79.80  ? 153  ALA B CA   1 
ATOM   8507  C  C    . ALA B 2 153 ? 17.522  30.341  -17.017 1.00 79.24  ? 153  ALA B C    1 
ATOM   8508  O  O    . ALA B 2 153 ? 17.140  30.101  -18.159 1.00 85.68  ? 153  ALA B O    1 
ATOM   8509  C  CB   . ALA B 2 153 ? 15.513  29.809  -15.644 1.00 76.90  ? 153  ALA B CB   1 
ATOM   8510  H  H    . ALA B 2 153 ? 15.079  32.027  -16.584 1.00 116.04 ? 153  ALA B H    1 
ATOM   8511  H  HA   . ALA B 2 153 ? 17.054  31.055  -15.161 1.00 95.76  ? 153  ALA B HA   1 
ATOM   8512  H  HB1  . ALA B 2 153 ? 15.006  29.608  -16.446 1.00 92.28  ? 153  ALA B HB1  1 
ATOM   8513  H  HB2  . ALA B 2 153 ? 15.961  29.009  -15.327 1.00 92.28  ? 153  ALA B HB2  1 
ATOM   8514  H  HB3  . ALA B 2 153 ? 14.922  30.152  -14.956 1.00 92.28  ? 153  ALA B HB3  1 
ATOM   8515  N  N    . ILE B 2 154 ? 18.783  30.191  -16.637 1.00 100.13 ? 154  ILE B N    1 
ATOM   8516  C  CA   . ILE B 2 154 ? 19.798  29.741  -17.575 1.00 97.12  ? 154  ILE B CA   1 
ATOM   8517  C  C    . ILE B 2 154 ? 19.551  28.266  -17.902 1.00 88.30  ? 154  ILE B C    1 
ATOM   8518  O  O    . ILE B 2 154 ? 18.951  27.544  -17.098 1.00 79.38  ? 154  ILE B O    1 
ATOM   8519  C  CB   . ILE B 2 154 ? 21.229  29.945  -16.999 1.00 86.20  ? 154  ILE B CB   1 
ATOM   8520  C  CG1  . ILE B 2 154 ? 22.261  29.880  -18.124 1.00 93.85  ? 154  ILE B CG1  1 
ATOM   8521  C  CG2  . ILE B 2 154 ? 21.546  28.900  -15.912 1.00 80.20  ? 154  ILE B CG2  1 
ATOM   8522  C  CD1  . ILE B 2 154 ? 23.691  30.002  -17.655 1.00 95.92  ? 154  ILE B CD1  1 
ATOM   8523  H  H    . ILE B 2 154 ? 19.076  30.344  -15.843 1.00 120.16 ? 154  ILE B H    1 
ATOM   8524  H  HA   . ILE B 2 154 ? 19.724  30.251  -18.397 1.00 116.54 ? 154  ILE B HA   1 
ATOM   8525  H  HB   . ILE B 2 154 ? 21.272  30.826  -16.596 1.00 103.44 ? 154  ILE B HB   1 
ATOM   8526  H  HG12 . ILE B 2 154 ? 22.171  29.028  -18.580 1.00 112.62 ? 154  ILE B HG12 1 
ATOM   8527  H  HG13 . ILE B 2 154 ? 22.090  30.604  -18.745 1.00 112.62 ? 154  ILE B HG13 1 
ATOM   8528  H  HG21 . ILE B 2 154 ? 21.488  28.013  -16.301 1.00 96.24  ? 154  ILE B HG21 1 
ATOM   8529  H  HG22 . ILE B 2 154 ? 22.442  29.056  -15.576 1.00 96.24  ? 154  ILE B HG22 1 
ATOM   8530  H  HG23 . ILE B 2 154 ? 20.902  28.988  -15.192 1.00 96.24  ? 154  ILE B HG23 1 
ATOM   8531  H  HD11 . ILE B 2 154 ? 23.885  29.277  -17.041 1.00 115.10 ? 154  ILE B HD11 1 
ATOM   8532  H  HD12 . ILE B 2 154 ? 24.280  29.951  -18.424 1.00 115.10 ? 154  ILE B HD12 1 
ATOM   8533  H  HD13 . ILE B 2 154 ? 23.804  30.855  -17.207 1.00 115.10 ? 154  ILE B HD13 1 
ATOM   8534  N  N    . SER B 2 155 ? 19.986  27.824  -19.080 1.00 78.19  ? 155  SER B N    1 
ATOM   8535  C  CA   . SER B 2 155 ? 19.852  26.419  -19.457 1.00 78.28  ? 155  SER B CA   1 
ATOM   8536  C  C    . SER B 2 155 ? 20.787  25.573  -18.594 1.00 84.27  ? 155  SER B C    1 
ATOM   8537  O  O    . SER B 2 155 ? 21.556  26.102  -17.803 1.00 95.63  ? 155  SER B O    1 
ATOM   8538  C  CB   . SER B 2 155 ? 20.178  26.208  -20.936 1.00 85.05  ? 155  SER B CB   1 
ATOM   8539  O  OG   . SER B 2 155 ? 21.577  26.225  -21.155 1.00 91.94  ? 155  SER B OG   1 
ATOM   8540  H  H    . SER B 2 155 ? 20.361  28.316  -19.678 1.00 93.83  ? 155  SER B H    1 
ATOM   8541  H  HA   . SER B 2 155 ? 18.940  26.128  -19.298 1.00 93.94  ? 155  SER B HA   1 
ATOM   8542  H  HB2  . SER B 2 155 ? 19.825  25.350  -21.218 1.00 102.06 ? 155  SER B HB2  1 
ATOM   8543  H  HB3  . SER B 2 155 ? 19.769  26.920  -21.454 1.00 102.06 ? 155  SER B HB3  1 
ATOM   8544  H  HG   . SER B 2 155 ? 21.742  26.108  -21.970 1.00 110.32 ? 155  SER B HG   1 
ATOM   8545  N  N    . ASP B 2 156 ? 20.737  24.259  -18.765 1.00 87.00  ? 156  ASP B N    1 
ATOM   8546  C  CA   . ASP B 2 156 ? 21.604  23.348  -18.026 1.00 84.42  ? 156  ASP B CA   1 
ATOM   8547  C  C    . ASP B 2 156 ? 22.943  23.294  -18.752 1.00 86.33  ? 156  ASP B C    1 
ATOM   8548  O  O    . ASP B 2 156 ? 23.996  23.109  -18.141 1.00 85.72  ? 156  ASP B O    1 
ATOM   8549  C  CB   . ASP B 2 156 ? 20.974  21.967  -17.896 1.00 87.56  ? 156  ASP B CB   1 
ATOM   8550  C  CG   . ASP B 2 156 ? 19.757  21.974  -16.997 1.00 107.21 ? 156  ASP B CG   1 
ATOM   8551  O  OD1  . ASP B 2 156 ? 19.695  22.844  -16.099 1.00 105.02 ? 156  ASP B OD1  1 
ATOM   8552  O  OD2  . ASP B 2 156 ? 18.860  21.126  -17.196 1.00 120.59 ? 156  ASP B OD2  1 
ATOM   8553  H  H    . ASP B 2 156 ? 20.202  23.864  -19.311 1.00 104.40 ? 156  ASP B H    1 
ATOM   8554  H  HA   . ASP B 2 156 ? 21.755  23.699  -17.135 1.00 101.31 ? 156  ASP B HA   1 
ATOM   8555  H  HB2  . ASP B 2 156 ? 20.698  21.660  -18.774 1.00 105.07 ? 156  ASP B HB2  1 
ATOM   8556  H  HB3  . ASP B 2 156 ? 21.624  21.355  -17.517 1.00 105.07 ? 156  ASP B HB3  1 
ATOM   8557  N  N    . GLU B 2 157 ? 22.877  23.440  -20.070 1.00 79.17  ? 157  GLU B N    1 
ATOM   8558  C  CA   . GLU B 2 157 ? 24.060  23.473  -20.916 1.00 95.64  ? 157  GLU B CA   1 
ATOM   8559  C  C    . GLU B 2 157 ? 24.884  24.721  -20.624 1.00 81.84  ? 157  GLU B C    1 
ATOM   8560  O  O    . GLU B 2 157 ? 26.104  24.657  -20.466 1.00 78.97  ? 157  GLU B O    1 
ATOM   8561  C  CB   . GLU B 2 157 ? 23.661  23.468  -22.393 1.00 94.74  ? 157  GLU B CB   1 
ATOM   8562  C  CG   . GLU B 2 157 ? 22.765  22.315  -22.806 1.00 102.43 ? 157  GLU B CG   1 
ATOM   8563  C  CD   . GLU B 2 157 ? 22.357  22.402  -24.264 1.00 142.07 ? 157  GLU B CD   1 
ATOM   8564  O  OE1  . GLU B 2 157 ? 23.253  22.506  -25.130 1.00 151.15 ? 157  GLU B OE1  1 
ATOM   8565  O  OE2  . GLU B 2 157 ? 21.139  22.384  -24.542 1.00 150.84 ? 157  GLU B OE2  1 
ATOM   8566  H  H    . GLU B 2 157 ? 22.141  23.524  -20.506 1.00 95.00  ? 157  GLU B H    1 
ATOM   8567  H  HA   . GLU B 2 157 ? 24.608  22.692  -20.741 1.00 114.76 ? 157  GLU B HA   1 
ATOM   8568  H  HB2  . GLU B 2 157 ? 23.187  24.292  -22.588 1.00 113.69 ? 157  GLU B HB2  1 
ATOM   8569  H  HB3  . GLU B 2 157 ? 24.466  23.421  -22.931 1.00 113.69 ? 157  GLU B HB3  1 
ATOM   8570  H  HG2  . GLU B 2 157 ? 23.241  21.480  -22.674 1.00 122.91 ? 157  GLU B HG2  1 
ATOM   8571  H  HG3  . GLU B 2 157 ? 21.960  22.329  -22.265 1.00 122.91 ? 157  GLU B HG3  1 
ATOM   8572  N  N    . GLU B 2 158 ? 24.209  25.863  -20.568 1.00 90.96  ? 158  GLU B N    1 
ATOM   8573  C  CA   . GLU B 2 158 ? 24.881  27.138  -20.359 1.00 93.58  ? 158  GLU B CA   1 
ATOM   8574  C  C    . GLU B 2 158 ? 25.336  27.249  -18.902 1.00 94.83  ? 158  GLU B C    1 
ATOM   8575  O  O    . GLU B 2 158 ? 26.295  27.954  -18.588 1.00 94.56  ? 158  GLU B O    1 
ATOM   8576  C  CB   . GLU B 2 158 ? 23.930  28.285  -20.716 1.00 84.47  ? 158  GLU B CB   1 
ATOM   8577  C  CG   . GLU B 2 158 ? 23.720  28.478  -22.217 1.00 108.62 ? 158  GLU B CG   1 
ATOM   8578  C  CD   . GLU B 2 158 ? 22.582  29.442  -22.545 1.00 122.90 ? 158  GLU B CD   1 
ATOM   8579  O  OE1  . GLU B 2 158 ? 21.722  29.692  -21.667 1.00 107.78 ? 158  GLU B OE1  1 
ATOM   8580  O  OE2  . GLU B 2 158 ? 22.537  29.934  -23.694 1.00 120.99 ? 158  GLU B OE2  1 
ATOM   8581  H  H    . GLU B 2 158 ? 23.355  25.927  -20.650 1.00 109.16 ? 158  GLU B H    1 
ATOM   8582  H  HA   . GLU B 2 158 ? 25.661  27.193  -20.932 1.00 112.30 ? 158  GLU B HA   1 
ATOM   8583  H  HB2  . GLU B 2 158 ? 23.064  28.108  -20.317 1.00 101.36 ? 158  GLU B HB2  1 
ATOM   8584  H  HB3  . GLU B 2 158 ? 24.291  29.112  -20.360 1.00 101.36 ? 158  GLU B HB3  1 
ATOM   8585  H  HG2  . GLU B 2 158 ? 24.534  28.833  -22.606 1.00 130.35 ? 158  GLU B HG2  1 
ATOM   8586  H  HG3  . GLU B 2 158 ? 23.509  27.620  -22.618 1.00 130.35 ? 158  GLU B HG3  1 
ATOM   8587  N  N    . LYS B 2 159 ? 24.636  26.535  -18.026 1.00 87.79  ? 159  LYS B N    1 
ATOM   8588  C  CA   . LYS B 2 159 ? 24.965  26.467  -16.607 1.00 73.12  ? 159  LYS B CA   1 
ATOM   8589  C  C    . LYS B 2 159 ? 26.289  25.755  -16.350 1.00 83.11  ? 159  LYS B C    1 
ATOM   8590  O  O    . LYS B 2 159 ? 27.124  26.232  -15.583 1.00 92.85  ? 159  LYS B O    1 
ATOM   8591  C  CB   . LYS B 2 159 ? 23.826  25.767  -15.865 1.00 74.37  ? 159  LYS B CB   1 
ATOM   8592  C  CG   . LYS B 2 159 ? 24.089  25.385  -14.419 1.00 73.11  ? 159  LYS B CG   1 
ATOM   8593  C  CD   . LYS B 2 159 ? 22.869  24.647  -13.886 1.00 80.24  ? 159  LYS B CD   1 
ATOM   8594  C  CE   . LYS B 2 159 ? 23.163  23.859  -12.632 1.00 94.90  ? 159  LYS B CE   1 
ATOM   8595  N  NZ   . LYS B 2 159 ? 23.178  24.735  -11.436 1.00 111.24 ? 159  LYS B NZ   1 
ATOM   8596  H  H    . LYS B 2 159 ? 23.946  26.068  -18.237 1.00 105.35 ? 159  LYS B H    1 
ATOM   8597  H  HA   . LYS B 2 159 ? 25.038  27.369  -16.259 1.00 87.75  ? 159  LYS B HA   1 
ATOM   8598  H  HB2  . LYS B 2 159 ? 23.055  26.355  -15.871 1.00 89.25  ? 159  LYS B HB2  1 
ATOM   8599  H  HB3  . LYS B 2 159 ? 23.611  24.951  -16.343 1.00 89.25  ? 159  LYS B HB3  1 
ATOM   8600  H  HG2  . LYS B 2 159 ? 24.858  24.796  -14.368 1.00 87.73  ? 159  LYS B HG2  1 
ATOM   8601  H  HG3  . LYS B 2 159 ? 24.229  26.184  -13.887 1.00 87.73  ? 159  LYS B HG3  1 
ATOM   8602  H  HD2  . LYS B 2 159 ? 22.176  25.293  -13.678 1.00 96.29  ? 159  LYS B HD2  1 
ATOM   8603  H  HD3  . LYS B 2 159 ? 22.554  24.028  -14.562 1.00 96.29  ? 159  LYS B HD3  1 
ATOM   8604  H  HE2  . LYS B 2 159 ? 22.476  23.186  -12.508 1.00 113.87 ? 159  LYS B HE2  1 
ATOM   8605  H  HE3  . LYS B 2 159 ? 24.034  23.440  -12.714 1.00 113.87 ? 159  LYS B HE3  1 
ATOM   8606  H  HZ1  . LYS B 2 159 ? 22.386  25.130  -11.339 1.00 133.49 ? 159  LYS B HZ1  1 
ATOM   8607  H  HZ2  . LYS B 2 159 ? 23.352  24.253  -10.709 1.00 133.49 ? 159  LYS B HZ2  1 
ATOM   8608  H  HZ3  . LYS B 2 159 ? 23.804  25.361  -11.526 1.00 133.49 ? 159  LYS B HZ3  1 
ATOM   8609  N  N    . THR B 2 160 ? 26.489  24.631  -17.030 1.00 86.80  ? 160  THR B N    1 
ATOM   8610  C  CA   . THR B 2 160 ? 27.683  23.810  -16.848 1.00 90.10  ? 160  THR B CA   1 
ATOM   8611  C  C    . THR B 2 160 ? 28.821  24.265  -17.747 1.00 86.04  ? 160  THR B C    1 
ATOM   8612  O  O    . THR B 2 160 ? 29.907  23.689  -17.730 1.00 107.51 ? 160  THR B O    1 
ATOM   8613  C  CB   . THR B 2 160 ? 27.391  22.322  -17.121 1.00 94.21  ? 160  THR B CB   1 
ATOM   8614  O  OG1  . THR B 2 160 ? 26.958  22.162  -18.475 1.00 85.91  ? 160  THR B OG1  1 
ATOM   8615  C  CG2  . THR B 2 160 ? 26.312  21.802  -16.174 1.00 96.62  ? 160  THR B CG2  1 
ATOM   8616  H  H    . THR B 2 160 ? 25.939  24.317  -17.612 1.00 104.16 ? 160  THR B H    1 
ATOM   8617  H  HA   . THR B 2 160 ? 27.981  23.891  -15.929 1.00 108.13 ? 160  THR B HA   1 
ATOM   8618  H  HB   . THR B 2 160 ? 28.199  21.804  -16.978 1.00 113.06 ? 160  THR B HB   1 
ATOM   8619  H  HG1  . THR B 2 160 ? 26.260  22.609  -18.609 1.00 103.09 ? 160  THR B HG1  1 
ATOM   8620  H  HG21 . THR B 2 160 ? 25.492  22.306  -16.297 1.00 115.94 ? 160  THR B HG21 1 
ATOM   8621  H  HG22 . THR B 2 160 ? 26.136  20.865  -16.354 1.00 115.94 ? 160  THR B HG22 1 
ATOM   8622  H  HG23 . THR B 2 160 ? 26.604  21.897  -15.254 1.00 115.94 ? 160  THR B HG23 1 
ATOM   8623  N  N    . LEU B 2 161 ? 28.575  25.322  -18.506 1.00 76.25  ? 161  LEU B N    1 
ATOM   8624  C  CA   . LEU B 2 161 ? 29.607  25.911  -19.339 1.00 80.14  ? 161  LEU B CA   1 
ATOM   8625  C  C    . LEU B 2 161 ? 30.319  26.956  -18.492 1.00 89.47  ? 161  LEU B C    1 
ATOM   8626  O  O    . LEU B 2 161 ? 31.464  27.318  -18.772 1.00 92.51  ? 161  LEU B O    1 
ATOM   8627  C  CB   . LEU B 2 161 ? 29.020  26.552  -20.597 1.00 82.59  ? 161  LEU B CB   1 
ATOM   8628  C  CG   . LEU B 2 161 ? 30.046  26.900  -21.681 1.00 89.30  ? 161  LEU B CG   1 
ATOM   8629  C  CD1  . LEU B 2 161 ? 30.192  25.748  -22.673 1.00 82.76  ? 161  LEU B CD1  1 
ATOM   8630  C  CD2  . LEU B 2 161 ? 29.685  28.193  -22.399 1.00 84.34  ? 161  LEU B CD2  1 
ATOM   8631  H  H    . LEU B 2 161 ? 27.814  25.718  -18.556 1.00 91.50  ? 161  LEU B H    1 
ATOM   8632  H  HA   . LEU B 2 161 ? 30.247  25.231  -19.602 1.00 96.16  ? 161  LEU B HA   1 
ATOM   8633  H  HB2  . LEU B 2 161 ? 28.379  25.936  -20.987 1.00 99.10  ? 161  LEU B HB2  1 
ATOM   8634  H  HB3  . LEU B 2 161 ? 28.570  27.373  -20.345 1.00 99.10  ? 161  LEU B HB3  1 
ATOM   8635  H  HG   . LEU B 2 161 ? 30.908  27.032  -21.258 1.00 107.16 ? 161  LEU B HG   1 
ATOM   8636  H  HD11 . LEU B 2 161 ? 29.332  25.580  -23.091 1.00 99.31  ? 161  LEU B HD11 1 
ATOM   8637  H  HD12 . LEU B 2 161 ? 30.845  25.993  -23.347 1.00 99.31  ? 161  LEU B HD12 1 
ATOM   8638  H  HD13 . LEU B 2 161 ? 30.488  24.957  -22.197 1.00 99.31  ? 161  LEU B HD13 1 
ATOM   8639  H  HD21 . LEU B 2 161 ? 29.659  28.916  -21.752 1.00 101.21 ? 161  LEU B HD21 1 
ATOM   8640  H  HD22 . LEU B 2 161 ? 30.356  28.377  -23.074 1.00 101.21 ? 161  LEU B HD22 1 
ATOM   8641  H  HD23 . LEU B 2 161 ? 28.815  28.090  -22.816 1.00 101.21 ? 161  LEU B HD23 1 
ATOM   8642  N  N    . ARG B 2 162 ? 29.633  27.420  -17.446 1.00 84.59  ? 162  ARG B N    1 
ATOM   8643  C  CA   . ARG B 2 162 ? 30.157  28.457  -16.564 1.00 82.88  ? 162  ARG B CA   1 
ATOM   8644  C  C    . ARG B 2 162 ? 30.136  27.992  -15.119 1.00 82.62  ? 162  ARG B C    1 
ATOM   8645  O  O    . ARG B 2 162 ? 30.112  28.811  -14.201 1.00 79.57  ? 162  ARG B O    1 
ATOM   8646  C  CB   . ARG B 2 162 ? 29.318  29.732  -16.682 1.00 75.66  ? 162  ARG B CB   1 
ATOM   8647  C  CG   . ARG B 2 162 ? 29.111  30.241  -18.087 1.00 77.01  ? 162  ARG B CG   1 
ATOM   8648  C  CD   . ARG B 2 162 ? 28.076  31.352  -18.093 1.00 77.00  ? 162  ARG B CD   1 
ATOM   8649  N  NE   . ARG B 2 162 ? 28.039  32.072  -19.364 1.00 89.32  ? 162  ARG B NE   1 
ATOM   8650  C  CZ   . ARG B 2 162 ? 27.286  31.737  -20.409 1.00 87.73  ? 162  ARG B CZ   1 
ATOM   8651  N  NH1  . ARG B 2 162 ? 26.482  30.681  -20.359 1.00 85.49  ? 162  ARG B NH1  1 
ATOM   8652  N  NH2  . ARG B 2 162 ? 27.338  32.467  -21.514 1.00 80.13  ? 162  ARG B NH2  1 
ATOM   8653  H  H    . ARG B 2 162 ? 28.849  27.144  -17.226 1.00 101.51 ? 162  ARG B H    1 
ATOM   8654  H  HA   . ARG B 2 162 ? 31.072  28.664  -16.811 1.00 99.46  ? 162  ARG B HA   1 
ATOM   8655  H  HB2  . ARG B 2 162 ? 28.442  29.559  -16.303 1.00 90.79  ? 162  ARG B HB2  1 
ATOM   8656  H  HB3  . ARG B 2 162 ? 29.756  30.435  -16.178 1.00 90.79  ? 162  ARG B HB3  1 
ATOM   8657  H  HG2  . ARG B 2 162 ? 29.947  30.596  -18.429 1.00 92.41  ? 162  ARG B HG2  1 
ATOM   8658  H  HG3  . ARG B 2 162 ? 28.792  29.519  -18.650 1.00 92.41  ? 162  ARG B HG3  1 
ATOM   8659  H  HD2  . ARG B 2 162 ? 27.198  30.968  -17.939 1.00 92.40  ? 162  ARG B HD2  1 
ATOM   8660  H  HD3  . ARG B 2 162 ? 28.289  31.988  -17.392 1.00 92.40  ? 162  ARG B HD3  1 
ATOM   8661  H  HE   . ARG B 2 162 ? 28.543  32.765  -19.443 1.00 107.18 ? 162  ARG B HE   1 
ATOM   8662  H  HH11 . ARG B 2 162 ? 26.445  30.204  -19.645 1.00 102.58 ? 162  ARG B HH11 1 
ATOM   8663  H  HH12 . ARG B 2 162 ? 26.000  30.475  -21.040 1.00 102.58 ? 162  ARG B HH12 1 
ATOM   8664  H  HH21 . ARG B 2 162 ? 27.856  33.153  -21.553 1.00 96.16  ? 162  ARG B HH21 1 
ATOM   8665  H  HH22 . ARG B 2 162 ? 26.853  32.256  -22.192 1.00 96.16  ? 162  ARG B HH22 1 
ATOM   8666  N  N    . GLU B 2 163 ? 30.177  26.680  -14.914 1.00 88.12  ? 163  GLU B N    1 
ATOM   8667  C  CA   . GLU B 2 163 ? 30.074  26.131  -13.570 1.00 77.47  ? 163  GLU B CA   1 
ATOM   8668  C  C    . GLU B 2 163 ? 31.205  26.634  -12.683 1.00 76.48  ? 163  GLU B C    1 
ATOM   8669  O  O    . GLU B 2 163 ? 30.978  27.124  -11.565 1.00 72.07  ? 163  GLU B O    1 
ATOM   8670  C  CB   . GLU B 2 163 ? 30.087  24.603  -13.651 1.00 86.61  ? 163  GLU B CB   1 
ATOM   8671  C  CG   . GLU B 2 163 ? 29.902  23.877  -12.322 1.00 103.45 ? 163  GLU B CG   1 
ATOM   8672  C  CD   . GLU B 2 163 ? 29.153  22.552  -12.462 1.00 116.60 ? 163  GLU B CD   1 
ATOM   8673  O  OE1  . GLU B 2 163 ? 28.711  22.215  -13.586 1.00 114.95 ? 163  GLU B OE1  1 
ATOM   8674  O  OE2  . GLU B 2 163 ? 29.006  21.843  -11.440 1.00 113.90 ? 163  GLU B OE2  1 
ATOM   8675  H  H    . GLU B 2 163 ? 30.262  26.090  -15.534 1.00 105.74 ? 163  GLU B H    1 
ATOM   8676  H  HA   . GLU B 2 163 ? 29.233  26.408  -13.175 1.00 92.96  ? 163  GLU B HA   1 
ATOM   8677  H  HB2  . GLU B 2 163 ? 29.370  24.320  -14.239 1.00 103.94 ? 163  GLU B HB2  1 
ATOM   8678  H  HB3  . GLU B 2 163 ? 30.939  24.322  -14.020 1.00 103.94 ? 163  GLU B HB3  1 
ATOM   8679  H  HG2  . GLU B 2 163 ? 30.774  23.689  -11.941 1.00 124.14 ? 163  GLU B HG2  1 
ATOM   8680  H  HG3  . GLU B 2 163 ? 29.394  24.445  -11.721 1.00 124.14 ? 163  GLU B HG3  1 
ATOM   8681  N  N    . GLN B 2 164 ? 32.422  26.565  -13.211 1.00 77.52  ? 164  GLN B N    1 
ATOM   8682  C  CA   . GLN B 2 164 ? 33.595  26.956  -12.446 1.00 77.25  ? 164  GLN B CA   1 
ATOM   8683  C  C    . GLN B 2 164 ? 33.552  28.439  -12.090 1.00 71.02  ? 164  GLN B C    1 
ATOM   8684  O  O    . GLN B 2 164 ? 33.805  28.827  -10.940 1.00 66.17  ? 164  GLN B O    1 
ATOM   8685  C  CB   . GLN B 2 164 ? 34.870  26.628  -13.219 1.00 87.78  ? 164  GLN B CB   1 
ATOM   8686  C  CG   . GLN B 2 164 ? 35.181  25.136  -13.269 1.00 94.34  ? 164  GLN B CG   1 
ATOM   8687  C  CD   . GLN B 2 164 ? 36.438  24.826  -14.064 1.00 109.28 ? 164  GLN B CD   1 
ATOM   8688  O  OE1  . GLN B 2 164 ? 36.849  25.603  -14.929 1.00 117.32 ? 164  GLN B OE1  1 
ATOM   8689  N  NE2  . GLN B 2 164 ? 37.063  23.692  -13.765 1.00 113.70 ? 164  GLN B NE2  1 
ATOM   8690  H  H    . GLN B 2 164 ? 32.593  26.296  -14.010 1.00 93.03  ? 164  GLN B H    1 
ATOM   8691  H  HA   . GLN B 2 164 ? 33.612  26.452  -11.617 1.00 92.70  ? 164  GLN B HA   1 
ATOM   8692  H  HB2  . GLN B 2 164 ? 34.773  26.942  -14.132 1.00 105.34 ? 164  GLN B HB2  1 
ATOM   8693  H  HB3  . GLN B 2 164 ? 35.619  27.074  -12.794 1.00 105.34 ? 164  GLN B HB3  1 
ATOM   8694  H  HG2  . GLN B 2 164 ? 35.310  24.809  -12.365 1.00 113.21 ? 164  GLN B HG2  1 
ATOM   8695  H  HG3  . GLN B 2 164 ? 34.439  24.672  -13.688 1.00 113.21 ? 164  GLN B HG3  1 
ATOM   8696  H  HE21 . GLN B 2 164 ? 36.751  23.179  -13.149 1.00 136.44 ? 164  GLN B HE21 1 
ATOM   8697  H  HE22 . GLN B 2 164 ? 37.779  23.472  -14.187 1.00 136.44 ? 164  GLN B HE22 1 
ATOM   8698  N  N    . GLU B 2 165 ? 33.176  29.245  -13.084 1.00 69.18  ? 165  GLU B N    1 
ATOM   8699  C  CA   . GLU B 2 165 ? 33.097  30.697  -12.951 1.00 57.67  ? 165  GLU B CA   1 
ATOM   8700  C  C    . GLU B 2 165 ? 32.080  31.061  -11.872 1.00 61.54  ? 165  GLU B C    1 
ATOM   8701  O  O    . GLU B 2 165 ? 32.351  31.870  -10.966 1.00 62.04  ? 165  GLU B O    1 
ATOM   8702  C  CB   . GLU B 2 165 ? 32.701  31.346  -14.277 1.00 64.32  ? 165  GLU B CB   1 
ATOM   8703  C  CG   . GLU B 2 165 ? 33.254  30.687  -15.567 1.00 76.78  ? 165  GLU B CG   1 
ATOM   8704  C  CD   . GLU B 2 165 ? 34.707  30.998  -15.850 1.00 94.35  ? 165  GLU B CD   1 
ATOM   8705  O  OE1  . GLU B 2 165 ? 35.159  32.118  -15.526 1.00 83.14  ? 165  GLU B OE1  1 
ATOM   8706  O  OE2  . GLU B 2 165 ? 35.391  30.121  -16.427 1.00 108.34 ? 165  GLU B OE2  1 
ATOM   8707  H  H    . GLU B 2 165 ? 32.955  28.964  -13.867 1.00 83.02  ? 165  GLU B H    1 
ATOM   8708  H  HA   . GLU B 2 165 ? 33.963  31.045  -12.686 1.00 69.21  ? 165  GLU B HA   1 
ATOM   8709  H  HB2  . GLU B 2 165 ? 31.733  31.335  -14.342 1.00 77.18  ? 165  GLU B HB2  1 
ATOM   8710  H  HB3  . GLU B 2 165 ? 33.011  32.265  -14.269 1.00 77.18  ? 165  GLU B HB3  1 
ATOM   8711  H  HG2  . GLU B 2 165 ? 33.169  29.724  -15.485 1.00 92.14  ? 165  GLU B HG2  1 
ATOM   8712  H  HG3  . GLU B 2 165 ? 32.733  30.998  -16.323 1.00 92.14  ? 165  GLU B HG3  1 
ATOM   8713  N  N    . ILE B 2 166 ? 30.911  30.438  -11.956 1.00 61.02  ? 166  ILE B N    1 
ATOM   8714  C  CA   . ILE B 2 166 ? 29.844  30.714  -11.004 1.00 65.76  ? 166  ILE B CA   1 
ATOM   8715  C  C    . ILE B 2 166 ? 30.225  30.277  -9.594  1.00 67.48  ? 166  ILE B C    1 
ATOM   8716  O  O    . ILE B 2 166 ? 29.908  30.965  -8.622  1.00 68.64  ? 166  ILE B O    1 
ATOM   8717  C  CB   . ILE B 2 166 ? 28.535  30.012  -11.416 1.00 55.98  ? 166  ILE B CB   1 
ATOM   8718  C  CG1  . ILE B 2 166 ? 28.029  30.615  -12.728 1.00 65.34  ? 166  ILE B CG1  1 
ATOM   8719  C  CG2  . ILE B 2 166 ? 27.462  30.186  -10.326 1.00 48.89  ? 166  ILE B CG2  1 
ATOM   8720  C  CD1  . ILE B 2 166 ? 26.780  29.957  -13.296 1.00 60.34  ? 166  ILE B CD1  1 
ATOM   8721  H  H    . ILE B 2 166 ? 30.711  29.853  -12.553 1.00 73.22  ? 166  ILE B H    1 
ATOM   8722  H  HA   . ILE B 2 166 ? 29.677  31.670  -10.986 1.00 78.91  ? 166  ILE B HA   1 
ATOM   8723  H  HB   . ILE B 2 166 ? 28.708  29.066  -11.545 1.00 67.18  ? 166  ILE B HB   1 
ATOM   8724  H  HG12 . ILE B 2 166 ? 27.825  31.551  -12.579 1.00 78.41  ? 166  ILE B HG12 1 
ATOM   8725  H  HG13 . ILE B 2 166 ? 28.730  30.537  -13.395 1.00 78.41  ? 166  ILE B HG13 1 
ATOM   8726  H  HG21 . ILE B 2 166 ? 27.290  31.132  -10.201 1.00 58.66  ? 166  ILE B HG21 1 
ATOM   8727  H  HG22 . ILE B 2 166 ? 26.650  29.736  -10.608 1.00 58.66  ? 166  ILE B HG22 1 
ATOM   8728  H  HG23 . ILE B 2 166 ? 27.786  29.796  -9.499  1.00 58.66  ? 166  ILE B HG23 1 
ATOM   8729  H  HD11 . ILE B 2 166 ? 26.060  30.038  -12.651 1.00 72.41  ? 166  ILE B HD11 1 
ATOM   8730  H  HD12 . ILE B 2 166 ? 26.537  30.403  -14.122 1.00 72.41  ? 166  ILE B HD12 1 
ATOM   8731  H  HD13 . ILE B 2 166 ? 26.968  29.021  -13.468 1.00 72.41  ? 166  ILE B HD13 1 
ATOM   8732  N  N    . VAL B 2 167 ? 30.891  29.129  -9.480  1.00 67.90  ? 167  VAL B N    1 
ATOM   8733  C  CA   . VAL B 2 167 ? 31.329  28.655  -8.171  1.00 69.13  ? 167  VAL B CA   1 
ATOM   8734  C  C    . VAL B 2 167 ? 32.425  29.532  -7.584  1.00 63.99  ? 167  VAL B C    1 
ATOM   8735  O  O    . VAL B 2 167 ? 32.423  29.826  -6.390  1.00 64.63  ? 167  VAL B O    1 
ATOM   8736  C  CB   . VAL B 2 167 ? 31.831  27.203  -8.256  1.00 71.07  ? 167  VAL B CB   1 
ATOM   8737  C  CG1  . VAL B 2 167 ? 32.547  26.781  -6.968  1.00 72.96  ? 167  VAL B CG1  1 
ATOM   8738  C  CG2  . VAL B 2 167 ? 30.656  26.276  -8.539  1.00 65.09  ? 167  VAL B CG2  1 
ATOM   8739  H  H    . VAL B 2 167 ? 31.098  28.613  -10.136 1.00 81.49  ? 167  VAL B H    1 
ATOM   8740  H  HA   . VAL B 2 167 ? 30.574  28.675  -7.562  1.00 82.96  ? 167  VAL B HA   1 
ATOM   8741  H  HB   . VAL B 2 167 ? 32.460  27.126  -8.990  1.00 85.29  ? 167  VAL B HB   1 
ATOM   8742  H  HG11 . VAL B 2 167 ? 31.928  26.854  -6.225  1.00 87.55  ? 167  VAL B HG11 1 
ATOM   8743  H  HG12 . VAL B 2 167 ? 32.847  25.863  -7.060  1.00 87.55  ? 167  VAL B HG12 1 
ATOM   8744  H  HG13 . VAL B 2 167 ? 33.307  27.365  -6.824  1.00 87.55  ? 167  VAL B HG13 1 
ATOM   8745  H  HG21 . VAL B 2 167 ? 30.249  26.531  -9.381  1.00 78.11  ? 167  VAL B HG21 1 
ATOM   8746  H  HG22 . VAL B 2 167 ? 30.980  25.363  -8.591  1.00 78.11  ? 167  VAL B HG22 1 
ATOM   8747  H  HG23 . VAL B 2 167 ? 30.010  26.357  -7.820  1.00 78.11  ? 167  VAL B HG23 1 
ATOM   8748  N  N    . ALA B 2 168 ? 33.342  29.975  -8.437  1.00 70.52  ? 168  ALA B N    1 
ATOM   8749  C  CA   . ALA B 2 168 ? 34.421  30.853  -8.006  1.00 68.34  ? 168  ALA B CA   1 
ATOM   8750  C  C    . ALA B 2 168 ? 33.896  32.225  -7.583  1.00 68.08  ? 168  ALA B C    1 
ATOM   8751  O  O    . ALA B 2 168 ? 34.417  32.846  -6.652  1.00 72.99  ? 168  ALA B O    1 
ATOM   8752  C  CB   . ALA B 2 168 ? 35.440  31.004  -9.127  1.00 64.29  ? 168  ALA B CB   1 
ATOM   8753  H  H    . ALA B 2 168 ? 33.360  29.780  -9.274  1.00 84.63  ? 168  ALA B H    1 
ATOM   8754  H  HA   . ALA B 2 168 ? 34.869  30.455  -7.243  1.00 82.01  ? 168  ALA B HA   1 
ATOM   8755  H  HB1  . ALA B 2 168 ? 35.001  31.385  -9.903  1.00 77.15  ? 168  ALA B HB1  1 
ATOM   8756  H  HB2  . ALA B 2 168 ? 36.153  31.590  -8.829  1.00 77.15  ? 168  ALA B HB2  1 
ATOM   8757  H  HB3  . ALA B 2 168 ? 35.800  30.130  -9.346  1.00 77.15  ? 168  ALA B HB3  1 
ATOM   8758  N  N    . SER B 2 169 ? 32.852  32.688  -8.263  1.00 70.41  ? 169  SER B N    1 
ATOM   8759  C  CA   . SER B 2 169 ? 32.307  34.016  -7.988  1.00 66.34  ? 169  SER B CA   1 
ATOM   8760  C  C    . SER B 2 169 ? 31.435  34.070  -6.736  1.00 55.17  ? 169  SER B C    1 
ATOM   8761  O  O    . SER B 2 169 ? 31.598  34.956  -5.910  1.00 75.46  ? 169  SER B O    1 
ATOM   8762  C  CB   . SER B 2 169 ? 31.493  34.503  -9.184  1.00 63.63  ? 169  SER B CB   1 
ATOM   8763  O  OG   . SER B 2 169 ? 32.199  34.264  -10.385 1.00 69.16  ? 169  SER B OG   1 
ATOM   8764  H  H    . SER B 2 169 ? 32.443  32.258  -8.885  1.00 84.49  ? 169  SER B H    1 
ATOM   8765  H  HA   . SER B 2 169 ? 33.044  34.634  -7.861  1.00 79.61  ? 169  SER B HA   1 
ATOM   8766  H  HB2  . SER B 2 169 ? 30.650  34.024  -9.211  1.00 76.36  ? 169  SER B HB2  1 
ATOM   8767  H  HB3  . SER B 2 169 ? 31.333  35.455  -9.093  1.00 76.36  ? 169  SER B HB3  1 
ATOM   8768  H  HG   . SER B 2 169 ? 32.346  33.442  -10.474 1.00 82.99  ? 169  SER B HG   1 
ATOM   8769  N  N    . SER B 2 170 ? 30.493  33.143  -6.613  1.00 63.25  ? 170  SER B N    1 
ATOM   8770  C  CA   . SER B 2 170 ? 29.545  33.154  -5.496  1.00 80.39  ? 170  SER B CA   1 
ATOM   8771  C  C    . SER B 2 170 ? 30.083  32.366  -4.297  1.00 87.37  ? 170  SER B C    1 
ATOM   8772  O  O    . SER B 2 170 ? 30.251  31.148  -4.390  1.00 92.65  ? 170  SER B O    1 
ATOM   8773  C  CB   . SER B 2 170 ? 28.186  32.579  -5.944  1.00 85.52  ? 170  SER B CB   1 
ATOM   8774  O  OG   . SER B 2 170 ? 27.606  33.349  -6.992  1.00 68.11  ? 170  SER B OG   1 
ATOM   8775  H  H    . SER B 2 170 ? 30.379  32.492  -7.163  1.00 75.90  ? 170  SER B H    1 
ATOM   8776  H  HA   . SER B 2 170 ? 29.403  34.071  -5.212  1.00 96.46  ? 170  SER B HA   1 
ATOM   8777  H  HB2  . SER B 2 170 ? 28.320  31.672  -6.260  1.00 102.62 ? 170  SER B HB2  1 
ATOM   8778  H  HB3  . SER B 2 170 ? 27.582  32.578  -5.185  1.00 102.62 ? 170  SER B HB3  1 
ATOM   8779  H  HG   . SER B 2 170 ? 26.868  33.017  -7.218  1.00 81.73  ? 170  SER B HG   1 
ATOM   8780  N  N    . PRO B 2 171 ? 30.378  33.047  -3.172  1.00 86.21  ? 171  PRO B N    1 
ATOM   8781  C  CA   . PRO B 2 171 ? 30.849  32.264  -2.022  1.00 93.08  ? 171  PRO B CA   1 
ATOM   8782  C  C    . PRO B 2 171 ? 29.723  31.570  -1.252  1.00 98.36  ? 171  PRO B C    1 
ATOM   8783  O  O    . PRO B 2 171 ? 29.986  30.991  -0.198  1.00 96.38  ? 171  PRO B O    1 
ATOM   8784  C  CB   . PRO B 2 171 ? 31.525  33.318  -1.130  1.00 88.72  ? 171  PRO B CB   1 
ATOM   8785  C  CG   . PRO B 2 171 ? 31.620  34.573  -1.977  1.00 87.77  ? 171  PRO B CG   1 
ATOM   8786  C  CD   . PRO B 2 171 ? 30.460  34.490  -2.907  1.00 78.60  ? 171  PRO B CD   1 
ATOM   8787  H  HA   . PRO B 2 171 ? 31.505  31.607  -2.302  1.00 111.70 ? 171  PRO B HA   1 
ATOM   8788  H  HB2  . PRO B 2 171 ? 30.979  33.477  -0.344  1.00 106.47 ? 171  PRO B HB2  1 
ATOM   8789  H  HB3  . PRO B 2 171 ? 32.409  33.010  -0.875  1.00 106.47 ? 171  PRO B HB3  1 
ATOM   8790  H  HG2  . PRO B 2 171 ? 31.553  35.357  -1.411  1.00 105.33 ? 171  PRO B HG2  1 
ATOM   8791  H  HG3  . PRO B 2 171 ? 32.456  34.574  -2.470  1.00 105.33 ? 171  PRO B HG3  1 
ATOM   8792  H  HD2  . PRO B 2 171 ? 29.652  34.805  -2.473  1.00 94.32  ? 171  PRO B HD2  1 
ATOM   8793  H  HD3  . PRO B 2 171 ? 30.643  34.978  -3.725  1.00 94.32  ? 171  PRO B HD3  1 
ATOM   8794  N  N    . SER B 2 172 ? 28.506  31.589  -1.789  1.00 103.84 ? 172  SER B N    1 
ATOM   8795  C  CA   . SER B 2 172 ? 27.366  30.956  -1.129  1.00 104.96 ? 172  SER B CA   1 
ATOM   8796  C  C    . SER B 2 172 ? 27.132  29.564  -1.722  1.00 110.32 ? 172  SER B C    1 
ATOM   8797  O  O    . SER B 2 172 ? 26.076  28.958  -1.521  1.00 115.92 ? 172  SER B O    1 
ATOM   8798  C  CB   . SER B 2 172 ? 26.106  31.819  -1.281  1.00 94.38  ? 172  SER B CB   1 
ATOM   8799  O  OG   . SER B 2 172 ? 25.717  31.922  -2.642  1.00 107.08 ? 172  SER B OG   1 
ATOM   8800  H  H    . SER B 2 172 ? 28.312  31.965  -2.538  1.00 124.61 ? 172  SER B H    1 
ATOM   8801  H  HA   . SER B 2 172 ? 27.556  30.857  -0.183  1.00 125.95 ? 172  SER B HA   1 
ATOM   8802  H  HB2  . SER B 2 172 ? 25.383  31.412  -0.778  1.00 113.25 ? 172  SER B HB2  1 
ATOM   8803  H  HB3  . SER B 2 172 ? 26.289  32.707  -0.938  1.00 113.25 ? 172  SER B HB3  1 
ATOM   8804  H  HG   . SER B 2 172 ? 25.027  32.397  -2.709  1.00 128.49 ? 172  SER B HG   1 
ATOM   8805  N  N    . LEU B 2 173 ? 28.129  29.073  -2.455  1.00 103.55 ? 173  LEU B N    1 
ATOM   8806  C  CA   . LEU B 2 173 ? 28.074  27.764  -3.092  1.00 91.30  ? 173  LEU B CA   1 
ATOM   8807  C  C    . LEU B 2 173 ? 29.227  26.893  -2.608  1.00 95.27  ? 173  LEU B C    1 
ATOM   8808  O  O    . LEU B 2 173 ? 29.761  27.109  -1.516  1.00 108.46 ? 173  LEU B O    1 
ATOM   8809  C  CB   . LEU B 2 173 ? 28.105  27.921  -4.616  1.00 94.40  ? 173  LEU B CB   1 
ATOM   8810  C  CG   . LEU B 2 173 ? 26.972  28.760  -5.236  1.00 92.66  ? 173  LEU B CG   1 
ATOM   8811  C  CD1  . LEU B 2 173 ? 27.019  28.680  -6.746  1.00 81.66  ? 173  LEU B CD1  1 
ATOM   8812  C  CD2  . LEU B 2 173 ? 25.585  28.321  -4.758  1.00 99.80  ? 173  LEU B CD2  1 
ATOM   8813  H  H    . LEU B 2 173 ? 28.866  29.492  -2.599  1.00 124.26 ? 173  LEU B H    1 
ATOM   8814  H  HA   . LEU B 2 173 ? 27.243  27.327  -2.850  1.00 109.56 ? 173  LEU B HA   1 
ATOM   8815  H  HB2  . LEU B 2 173 ? 28.943  28.343  -4.862  1.00 113.28 ? 173  LEU B HB2  1 
ATOM   8816  H  HB3  . LEU B 2 173 ? 28.060  27.038  -5.014  1.00 113.28 ? 173  LEU B HB3  1 
ATOM   8817  H  HG   . LEU B 2 173 ? 27.094  29.688  -4.983  1.00 111.19 ? 173  LEU B HG   1 
ATOM   8818  H  HD11 . LEU B 2 173 ? 26.915  27.754  -7.016  1.00 98.00  ? 173  LEU B HD11 1 
ATOM   8819  H  HD12 . LEU B 2 173 ? 26.297  29.215  -7.113  1.00 98.00  ? 173  LEU B HD12 1 
ATOM   8820  H  HD13 . LEU B 2 173 ? 27.873  29.021  -7.054  1.00 98.00  ? 173  LEU B HD13 1 
ATOM   8821  H  HD21 . LEU B 2 173 ? 25.539  28.417  -3.794  1.00 119.76 ? 173  LEU B HD21 1 
ATOM   8822  H  HD22 . LEU B 2 173 ? 24.915  28.881  -5.179  1.00 119.76 ? 173  LEU B HD22 1 
ATOM   8823  H  HD23 . LEU B 2 173 ? 25.445  27.394  -5.006  1.00 119.76 ? 173  LEU B HD23 1 
ATOM   8824  N  N    . LEU B 2 178 ? 27.200  21.922  -8.087  1.00 120.57 ? 178  LEU B N    1 
ATOM   8825  C  CA   . LEU B 2 178 ? 26.382  23.053  -8.517  1.00 121.00 ? 178  LEU B CA   1 
ATOM   8826  C  C    . LEU B 2 178 ? 25.050  22.619  -9.129  1.00 123.85 ? 178  LEU B C    1 
ATOM   8827  O  O    . LEU B 2 178 ? 24.045  23.310  -8.969  1.00 128.45 ? 178  LEU B O    1 
ATOM   8828  C  CB   . LEU B 2 178 ? 27.146  23.909  -9.534  1.00 118.41 ? 178  LEU B CB   1 
ATOM   8829  C  CG   . LEU B 2 178 ? 26.365  25.086  -10.130 1.00 105.79 ? 178  LEU B CG   1 
ATOM   8830  C  CD1  . LEU B 2 178 ? 25.952  26.058  -9.039  1.00 114.55 ? 178  LEU B CD1  1 
ATOM   8831  C  CD2  . LEU B 2 178 ? 27.168  25.804  -11.201 1.00 90.20  ? 178  LEU B CD2  1 
ATOM   8832  H  HA   . LEU B 2 178 ? 26.188  23.609  -7.746  1.00 145.19 ? 178  LEU B HA   1 
ATOM   8833  H  HB2  . LEU B 2 178 ? 27.932  24.273  -9.100  1.00 142.09 ? 178  LEU B HB2  1 
ATOM   8834  H  HB3  . LEU B 2 178 ? 27.418  23.339  -10.271 1.00 142.09 ? 178  LEU B HB3  1 
ATOM   8835  H  HG   . LEU B 2 178 ? 25.556  24.747  -10.545 1.00 126.95 ? 178  LEU B HG   1 
ATOM   8836  H  HD11 . LEU B 2 178 ? 26.748  26.394  -8.598  1.00 137.46 ? 178  LEU B HD11 1 
ATOM   8837  H  HD12 . LEU B 2 178 ? 25.461  26.793  -9.440  1.00 137.46 ? 178  LEU B HD12 1 
ATOM   8838  H  HD13 . LEU B 2 178 ? 25.389  25.594  -8.399  1.00 137.46 ? 178  LEU B HD13 1 
ATOM   8839  H  HD21 . LEU B 2 178 ? 27.375  25.178  -11.912 1.00 108.24 ? 178  LEU B HD21 1 
ATOM   8840  H  HD22 . LEU B 2 178 ? 26.640  26.539  -11.551 1.00 108.24 ? 178  LEU B HD22 1 
ATOM   8841  H  HD23 . LEU B 2 178 ? 27.987  26.142  -10.807 1.00 108.24 ? 178  LEU B HD23 1 
ATOM   8842  N  N    . GLY B 2 179 ? 25.055  21.485  -9.831  1.00 122.59 ? 179  GLY B N    1 
ATOM   8843  C  CA   . GLY B 2 179 ? 23.914  21.017  -10.613 1.00 116.00 ? 179  GLY B CA   1 
ATOM   8844  C  C    . GLY B 2 179 ? 22.545  21.127  -9.961  1.00 113.18 ? 179  GLY B C    1 
ATOM   8845  O  O    . GLY B 2 179 ? 21.526  21.181  -10.651 1.00 116.29 ? 179  GLY B O    1 
ATOM   8846  H  H    . GLY B 2 179 ? 25.731  20.954  -9.870  1.00 147.11 ? 179  GLY B H    1 
ATOM   8847  H  HA2  . GLY B 2 179 ? 23.884  21.519  -11.442 1.00 139.21 ? 179  GLY B HA2  1 
ATOM   8848  H  HA3  . GLY B 2 179 ? 24.057  20.084  -10.837 1.00 139.21 ? 179  GLY B HA3  1 
ATOM   8849  N  N    . PHE B 2 180 ? 22.526  21.153  -8.632  1.00 119.63 ? 180  PHE B N    1 
ATOM   8850  C  CA   . PHE B 2 180 ? 21.291  21.305  -7.866  1.00 119.94 ? 180  PHE B CA   1 
ATOM   8851  C  C    . PHE B 2 180 ? 20.610  22.646  -8.150  1.00 120.54 ? 180  PHE B C    1 
ATOM   8852  O  O    . PHE B 2 180 ? 19.415  22.700  -8.446  1.00 112.98 ? 180  PHE B O    1 
ATOM   8853  C  CB   . PHE B 2 180 ? 21.573  21.164  -6.354  1.00 124.68 ? 180  PHE B CB   1 
ATOM   8854  C  CG   . PHE B 2 180 ? 22.644  22.110  -5.824  1.00 141.98 ? 180  PHE B CG   1 
ATOM   8855  C  CD1  . PHE B 2 180 ? 23.996  21.800  -5.943  1.00 141.23 ? 180  PHE B CD1  1 
ATOM   8856  C  CD2  . PHE B 2 180 ? 22.296  23.297  -5.186  1.00 146.14 ? 180  PHE B CD2  1 
ATOM   8857  C  CE1  . PHE B 2 180 ? 24.977  22.659  -5.453  1.00 142.36 ? 180  PHE B CE1  1 
ATOM   8858  C  CE2  . PHE B 2 180 ? 23.276  24.161  -4.691  1.00 140.51 ? 180  PHE B CE2  1 
ATOM   8859  C  CZ   . PHE B 2 180 ? 24.614  23.840  -4.827  1.00 140.79 ? 180  PHE B CZ   1 
ATOM   8860  H  H    . PHE B 2 180 ? 23.229  21.084  -8.141  1.00 143.55 ? 180  PHE B H    1 
ATOM   8861  H  HA   . PHE B 2 180 ? 20.676  20.599  -8.121  1.00 143.93 ? 180  PHE B HA   1 
ATOM   8862  H  HB2  . PHE B 2 180 ? 20.754  21.345  -5.867  1.00 149.62 ? 180  PHE B HB2  1 
ATOM   8863  H  HB3  . PHE B 2 180 ? 21.866  20.257  -6.176  1.00 149.62 ? 180  PHE B HB3  1 
ATOM   8864  H  HD1  . PHE B 2 180 ? 21.398  23.520  -5.093  1.00 175.36 ? 180  PHE B HD1  1 
ATOM   8865  H  HD2  . PHE B 2 180 ? 24.249  21.010  -6.364  1.00 169.48 ? 180  PHE B HD2  1 
ATOM   8866  H  HE1  . PHE B 2 180 ? 23.028  24.953  -4.272  1.00 168.61 ? 180  PHE B HE1  1 
ATOM   8867  H  HE2  . PHE B 2 180 ? 25.875  22.439  -5.545  1.00 170.84 ? 180  PHE B HE2  1 
ATOM   8868  H  HZ   . PHE B 2 180 ? 25.268  24.414  -4.498  1.00 168.95 ? 180  PHE B HZ   1 
ATOM   8869  N  N    . GLU B 2 181 ? 21.390  23.720  -8.089  1.00 122.84 ? 181  GLU B N    1 
ATOM   8870  C  CA   . GLU B 2 181 ? 20.846  25.073  -8.057  1.00 114.15 ? 181  GLU B CA   1 
ATOM   8871  C  C    . GLU B 2 181 ? 20.399  25.580  -9.421  1.00 105.96 ? 181  GLU B C    1 
ATOM   8872  O  O    . GLU B 2 181 ? 21.011  25.280  -10.443 1.00 89.36  ? 181  GLU B O    1 
ATOM   8873  C  CB   . GLU B 2 181 ? 21.885  26.039  -7.480  1.00 110.84 ? 181  GLU B CB   1 
ATOM   8874  C  CG   . GLU B 2 181 ? 21.304  27.362  -7.013  1.00 106.98 ? 181  GLU B CG   1 
ATOM   8875  C  CD   . GLU B 2 181 ? 20.395  27.205  -5.812  1.00 115.54 ? 181  GLU B CD   1 
ATOM   8876  O  OE1  . GLU B 2 181 ? 20.303  26.083  -5.269  1.00 128.31 ? 181  GLU B OE1  1 
ATOM   8877  O  OE2  . GLU B 2 181 ? 19.772  28.205  -5.409  1.00 113.06 ? 181  GLU B OE2  1 
ATOM   8878  H  H    . GLU B 2 181 ? 22.249  23.692  -8.065  1.00 147.41 ? 181  GLU B H    1 
ATOM   8879  H  HA   . GLU B 2 181 ? 20.073  25.083  -7.471  1.00 136.98 ? 181  GLU B HA   1 
ATOM   8880  H  HB2  . GLU B 2 181 ? 22.313  25.618  -6.717  1.00 133.01 ? 181  GLU B HB2  1 
ATOM   8881  H  HB3  . GLU B 2 181 ? 22.547  26.230  -8.163  1.00 133.01 ? 181  GLU B HB3  1 
ATOM   8882  H  HG2  . GLU B 2 181 ? 22.029  27.957  -6.766  1.00 128.38 ? 181  GLU B HG2  1 
ATOM   8883  H  HG3  . GLU B 2 181 ? 20.785  27.751  -7.734  1.00 128.38 ? 181  GLU B HG3  1 
ATOM   8884  N  N    . SER B 2 182 ? 19.327  26.364  -9.417  1.00 106.32 ? 182  SER B N    1 
ATOM   8885  C  CA   . SER B 2 182 ? 18.884  27.064  -10.611 1.00 97.04  ? 182  SER B CA   1 
ATOM   8886  C  C    . SER B 2 182 ? 19.543  28.436  -10.654 1.00 85.92  ? 182  SER B C    1 
ATOM   8887  O  O    . SER B 2 182 ? 19.581  29.145  -9.648  1.00 84.33  ? 182  SER B O    1 
ATOM   8888  C  CB   . SER B 2 182 ? 17.363  27.190  -10.628 1.00 101.44 ? 182  SER B CB   1 
ATOM   8889  O  OG   . SER B 2 182 ? 16.756  25.917  -10.489 1.00 108.43 ? 182  SER B OG   1 
ATOM   8890  H  H    . SER B 2 182 ? 18.834  26.506  -8.727  1.00 127.59 ? 182  SER B H    1 
ATOM   8891  H  HA   . SER B 2 182 ? 19.159  26.567  -11.397 1.00 116.45 ? 182  SER B HA   1 
ATOM   8892  H  HB2  . SER B 2 182 ? 17.083  27.756  -9.892  1.00 121.73 ? 182  SER B HB2  1 
ATOM   8893  H  HB3  . SER B 2 182 ? 17.087  27.582  -11.472 1.00 121.73 ? 182  SER B HB3  1 
ATOM   8894  H  HG   . SER B 2 182 ? 15.920  25.995  -10.500 1.00 130.12 ? 182  SER B HG   1 
ATOM   8895  N  N    . ILE B 2 183 ? 20.068  28.793  -11.823 1.00 83.41  ? 183  ILE B N    1 
ATOM   8896  C  CA   . ILE B 2 183 ? 20.790  30.047  -12.006 1.00 73.30  ? 183  ILE B CA   1 
ATOM   8897  C  C    . ILE B 2 183 ? 20.035  30.979  -12.936 1.00 74.62  ? 183  ILE B C    1 
ATOM   8898  O  O    . ILE B 2 183 ? 19.740  30.636  -14.083 1.00 67.35  ? 183  ILE B O    1 
ATOM   8899  C  CB   . ILE B 2 183 ? 22.212  29.813  -12.566 1.00 72.80  ? 183  ILE B CB   1 
ATOM   8900  C  CG1  . ILE B 2 183 ? 23.142  29.328  -11.457 1.00 84.11  ? 183  ILE B CG1  1 
ATOM   8901  C  CG2  . ILE B 2 183 ? 22.811  31.095  -13.150 1.00 76.26  ? 183  ILE B CG2  1 
ATOM   8902  C  CD1  . ILE B 2 183 ? 23.062  27.847  -11.206 1.00 98.76  ? 183  ILE B CD1  1 
ATOM   8903  H  H    . ILE B 2 183 ? 20.018  28.316  -12.538 1.00 100.10 ? 183  ILE B H    1 
ATOM   8904  H  HA   . ILE B 2 183 ? 20.876  30.488  -11.147 1.00 87.96  ? 183  ILE B HA   1 
ATOM   8905  H  HB   . ILE B 2 183 ? 22.171  29.138  -13.261 1.00 87.37  ? 183  ILE B HB   1 
ATOM   8906  H  HG12 . ILE B 2 183 ? 24.057  29.539  -11.701 1.00 100.93 ? 183  ILE B HG12 1 
ATOM   8907  H  HG13 . ILE B 2 183 ? 22.908  29.782  -10.632 1.00 100.93 ? 183  ILE B HG13 1 
ATOM   8908  H  HG21 . ILE B 2 183 ? 22.860  31.767  -12.453 1.00 91.51  ? 183  ILE B HG21 1 
ATOM   8909  H  HG22 . ILE B 2 183 ? 23.700  30.902  -13.488 1.00 91.51  ? 183  ILE B HG22 1 
ATOM   8910  H  HG23 . ILE B 2 183 ? 22.243  31.407  -13.872 1.00 91.51  ? 183  ILE B HG23 1 
ATOM   8911  H  HD11 . ILE B 2 183 ? 23.304  27.376  -12.018 1.00 118.52 ? 183  ILE B HD11 1 
ATOM   8912  H  HD12 . ILE B 2 183 ? 23.677  27.615  -10.492 1.00 118.52 ? 183  ILE B HD12 1 
ATOM   8913  H  HD13 . ILE B 2 183 ? 22.155  27.619  -10.948 1.00 118.52 ? 183  ILE B HD13 1 
ATOM   8914  N  N    . TYR B 2 184 ? 19.756  32.177  -12.439 1.00 73.78  ? 184  TYR B N    1 
ATOM   8915  C  CA   . TYR B 2 184 ? 19.025  33.176  -13.200 1.00 74.94  ? 184  TYR B CA   1 
ATOM   8916  C  C    . TYR B 2 184 ? 19.974  34.239  -13.718 1.00 63.51  ? 184  TYR B C    1 
ATOM   8917  O  O    . TYR B 2 184 ? 20.842  34.720  -13.000 1.00 73.36  ? 184  TYR B O    1 
ATOM   8918  C  CB   . TYR B 2 184 ? 17.927  33.798  -12.339 1.00 69.81  ? 184  TYR B CB   1 
ATOM   8919  C  CG   . TYR B 2 184 ? 16.961  32.764  -11.809 1.00 76.49  ? 184  TYR B CG   1 
ATOM   8920  C  CD1  . TYR B 2 184 ? 15.888  32.338  -12.584 1.00 80.39  ? 184  TYR B CD1  1 
ATOM   8921  C  CD2  . TYR B 2 184 ? 17.131  32.194  -10.552 1.00 73.22  ? 184  TYR B CD2  1 
ATOM   8922  C  CE1  . TYR B 2 184 ? 15.004  31.389  -12.123 1.00 83.22  ? 184  TYR B CE1  1 
ATOM   8923  C  CE2  . TYR B 2 184 ? 16.246  31.242  -10.079 1.00 90.67  ? 184  TYR B CE2  1 
ATOM   8924  C  CZ   . TYR B 2 184 ? 15.184  30.842  -10.872 1.00 97.95  ? 184  TYR B CZ   1 
ATOM   8925  O  OH   . TYR B 2 184 ? 14.297  29.894  -10.418 1.00 107.95 ? 184  TYR B OH   1 
ATOM   8926  H  H    . TYR B 2 184 ? 19.985  32.438  -11.652 1.00 88.54  ? 184  TYR B H    1 
ATOM   8927  H  HA   . TYR B 2 184 ? 18.605  32.749  -13.963 1.00 89.92  ? 184  TYR B HA   1 
ATOM   8928  H  HB2  . TYR B 2 184 ? 18.333  34.247  -11.581 1.00 83.77  ? 184  TYR B HB2  1 
ATOM   8929  H  HB3  . TYR B 2 184 ? 17.425  34.433  -12.874 1.00 83.77  ? 184  TYR B HB3  1 
ATOM   8930  H  HD1  . TYR B 2 184 ? 15.762  32.706  -13.429 1.00 96.46  ? 184  TYR B HD1  1 
ATOM   8931  H  HD2  . TYR B 2 184 ? 17.844  32.463  -10.019 1.00 87.86  ? 184  TYR B HD2  1 
ATOM   8932  H  HE1  . TYR B 2 184 ? 14.289  31.119  -12.653 1.00 99.87  ? 184  TYR B HE1  1 
ATOM   8933  H  HE2  . TYR B 2 184 ? 16.366  30.869  -9.235  1.00 108.80 ? 184  TYR B HE2  1 
ATOM   8934  H  HH   . TYR B 2 184 ? 14.515  29.641  -9.647  1.00 129.54 ? 184  TYR B HH   1 
ATOM   8935  N  N    . LYS B 2 185 ? 19.794  34.581  -14.985 1.00 65.18  ? 185  LYS B N    1 
ATOM   8936  C  CA   . LYS B 2 185 ? 20.598  35.590  -15.647 1.00 69.03  ? 185  LYS B CA   1 
ATOM   8937  C  C    . LYS B 2 185 ? 19.867  36.917  -15.487 1.00 66.82  ? 185  LYS B C    1 
ATOM   8938  O  O    . LYS B 2 185 ? 18.708  37.044  -15.871 1.00 80.48  ? 185  LYS B O    1 
ATOM   8939  C  CB   . LYS B 2 185 ? 20.790  35.192  -17.109 1.00 62.32  ? 185  LYS B CB   1 
ATOM   8940  C  CG   . LYS B 2 185 ? 21.603  36.112  -17.964 1.00 69.20  ? 185  LYS B CG   1 
ATOM   8941  C  CD   . LYS B 2 185 ? 21.606  35.576  -19.398 1.00 62.82  ? 185  LYS B CD   1 
ATOM   8942  C  CE   . LYS B 2 185 ? 22.289  36.521  -20.370 1.00 69.09  ? 185  LYS B CE   1 
ATOM   8943  N  NZ   . LYS B 2 185 ? 22.365  35.953  -21.743 1.00 79.82  ? 185  LYS B NZ   1 
ATOM   8944  H  H    . LYS B 2 185 ? 19.196  34.232  -15.494 1.00 78.21  ? 185  LYS B H    1 
ATOM   8945  H  HA   . LYS B 2 185 ? 21.467  35.655  -15.220 1.00 82.84  ? 185  LYS B HA   1 
ATOM   8946  H  HB2  . LYS B 2 185 ? 21.225  34.325  -17.130 1.00 74.78  ? 185  LYS B HB2  1 
ATOM   8947  H  HB3  . LYS B 2 185 ? 19.914  35.120  -17.519 1.00 74.78  ? 185  LYS B HB3  1 
ATOM   8948  H  HG2  . LYS B 2 185 ? 21.206  36.998  -17.963 1.00 83.04  ? 185  LYS B HG2  1 
ATOM   8949  H  HG3  . LYS B 2 185 ? 22.516  36.143  -17.639 1.00 83.04  ? 185  LYS B HG3  1 
ATOM   8950  H  HD2  . LYS B 2 185 ? 22.080  34.730  -19.418 1.00 75.39  ? 185  LYS B HD2  1 
ATOM   8951  H  HD3  . LYS B 2 185 ? 20.690  35.452  -19.692 1.00 75.39  ? 185  LYS B HD3  1 
ATOM   8952  H  HE2  . LYS B 2 185 ? 21.787  37.350  -20.414 1.00 82.91  ? 185  LYS B HE2  1 
ATOM   8953  H  HE3  . LYS B 2 185 ? 23.193  36.694  -20.064 1.00 82.91  ? 185  LYS B HE3  1 
ATOM   8954  H  HZ1  . LYS B 2 185 ? 21.546  35.790  -22.051 1.00 95.79  ? 185  LYS B HZ1  1 
ATOM   8955  H  HZ2  . LYS B 2 185 ? 22.770  36.528  -22.288 1.00 95.79  ? 185  LYS B HZ2  1 
ATOM   8956  H  HZ3  . LYS B 2 185 ? 22.827  35.192  -21.732 1.00 95.79  ? 185  LYS B HZ3  1 
ATOM   8957  N  N    . ILE B 2 186 ? 20.589  37.927  -15.013 1.00 78.49  ? 186  ILE B N    1 
ATOM   8958  C  CA   . ILE B 2 186 ? 20.000  39.224  -14.656 1.00 65.56  ? 186  ILE B CA   1 
ATOM   8959  C  C    . ILE B 2 186 ? 20.910  40.353  -15.089 1.00 66.84  ? 186  ILE B C    1 
ATOM   8960  O  O    . ILE B 2 186 ? 22.123  40.229  -14.996 1.00 75.92  ? 186  ILE B O    1 
ATOM   8961  C  CB   . ILE B 2 186 ? 19.762  39.355  -13.134 1.00 75.28  ? 186  ILE B CB   1 
ATOM   8962  C  CG1  . ILE B 2 186 ? 18.988  38.147  -12.599 1.00 78.04  ? 186  ILE B CG1  1 
ATOM   8963  C  CG2  . ILE B 2 186 ? 18.999  40.647  -12.831 1.00 86.84  ? 186  ILE B CG2  1 
ATOM   8964  C  CD1  . ILE B 2 186 ? 18.736  38.188  -11.091 1.00 97.92  ? 186  ILE B CD1  1 
ATOM   8965  H  H    . ILE B 2 186 ? 21.439  37.889  -14.886 1.00 94.19  ? 186  ILE B H    1 
ATOM   8966  H  HA   . ILE B 2 186 ? 19.148  39.327  -15.109 1.00 78.68  ? 186  ILE B HA   1 
ATOM   8967  H  HB   . ILE B 2 186 ? 20.622  39.392  -12.689 1.00 90.34  ? 186  ILE B HB   1 
ATOM   8968  H  HG12 . ILE B 2 186 ? 18.126  38.107  -13.042 1.00 93.65  ? 186  ILE B HG12 1 
ATOM   8969  H  HG13 . ILE B 2 186 ? 19.494  37.342  -12.792 1.00 93.65  ? 186  ILE B HG13 1 
ATOM   8970  H  HG21 . ILE B 2 186 ? 18.145  40.624  -13.291 1.00 104.21 ? 186  ILE B HG21 1 
ATOM   8971  H  HG22 . ILE B 2 186 ? 18.858  40.713  -11.874 1.00 104.21 ? 186  ILE B HG22 1 
ATOM   8972  H  HG23 . ILE B 2 186 ? 19.522  41.402  -13.141 1.00 104.21 ? 186  ILE B HG23 1 
ATOM   8973  H  HD11 . ILE B 2 186 ? 18.220  38.982  -10.880 1.00 117.50 ? 186  ILE B HD11 1 
ATOM   8974  H  HD12 . ILE B 2 186 ? 18.244  37.394  -10.831 1.00 117.50 ? 186  ILE B HD12 1 
ATOM   8975  H  HD13 . ILE B 2 186 ? 19.589  38.216  -10.630 1.00 117.50 ? 186  ILE B HD13 1 
ATOM   8976  N  N    . PRO B 2 187 ? 20.335  41.448  -15.605 1.00 65.66  ? 187  PRO B N    1 
ATOM   8977  C  CA   . PRO B 2 187 ? 21.197  42.600  -15.893 1.00 68.64  ? 187  PRO B CA   1 
ATOM   8978  C  C    . PRO B 2 187 ? 21.955  43.062  -14.663 1.00 61.23  ? 187  PRO B C    1 
ATOM   8979  O  O    . PRO B 2 187 ? 21.382  43.117  -13.575 1.00 59.44  ? 187  PRO B O    1 
ATOM   8980  C  CB   . PRO B 2 187 ? 20.207  43.669  -16.349 1.00 69.77  ? 187  PRO B CB   1 
ATOM   8981  C  CG   . PRO B 2 187 ? 19.036  42.894  -16.869 1.00 58.53  ? 187  PRO B CG   1 
ATOM   8982  C  CD   . PRO B 2 187 ? 18.936  41.692  -15.990 1.00 69.19  ? 187  PRO B CD   1 
ATOM   8983  H  HA   . PRO B 2 187 ? 21.819  42.398  -16.610 1.00 82.37  ? 187  PRO B HA   1 
ATOM   8984  H  HB2  . PRO B 2 187 ? 19.949  44.221  -15.595 1.00 83.73  ? 187  PRO B HB2  1 
ATOM   8985  H  HB3  . PRO B 2 187 ? 20.604  44.207  -17.052 1.00 83.73  ? 187  PRO B HB3  1 
ATOM   8986  H  HG2  . PRO B 2 187 ? 18.232  43.434  -16.803 1.00 70.24  ? 187  PRO B HG2  1 
ATOM   8987  H  HG3  . PRO B 2 187 ? 19.199  42.633  -17.789 1.00 70.24  ? 187  PRO B HG3  1 
ATOM   8988  H  HD2  . PRO B 2 187 ? 18.397  41.887  -15.208 1.00 83.03  ? 187  PRO B HD2  1 
ATOM   8989  H  HD3  . PRO B 2 187 ? 18.584  40.936  -16.487 1.00 83.03  ? 187  PRO B HD3  1 
ATOM   8990  N  N    . PHE B 2 188 ? 23.232  43.383  -14.840 1.00 61.48  ? 188  PHE B N    1 
ATOM   8991  C  CA   . PHE B 2 188 ? 24.133  43.560  -13.704 1.00 62.66  ? 188  PHE B CA   1 
ATOM   8992  C  C    . PHE B 2 188 ? 23.685  44.679  -12.767 1.00 53.10  ? 188  PHE B C    1 
ATOM   8993  O  O    . PHE B 2 188 ? 23.828  44.560  -11.558 1.00 56.78  ? 188  PHE B O    1 
ATOM   8994  C  CB   . PHE B 2 188 ? 25.553  43.825  -14.208 1.00 50.69  ? 188  PHE B CB   1 
ATOM   8995  C  CG   . PHE B 2 188 ? 25.795  45.255  -14.621 1.00 51.20  ? 188  PHE B CG   1 
ATOM   8996  C  CD1  . PHE B 2 188 ? 26.250  46.200  -13.708 1.00 51.79  ? 188  PHE B CD1  1 
ATOM   8997  C  CD2  . PHE B 2 188 ? 25.558  45.655  -15.924 1.00 55.37  ? 188  PHE B CD2  1 
ATOM   8998  C  CE1  . PHE B 2 188 ? 26.471  47.515  -14.092 1.00 58.51  ? 188  PHE B CE1  1 
ATOM   8999  C  CE2  . PHE B 2 188 ? 25.775  46.971  -16.321 1.00 53.77  ? 188  PHE B CE2  1 
ATOM   9000  C  CZ   . PHE B 2 188 ? 26.232  47.904  -15.407 1.00 55.40  ? 188  PHE B CZ   1 
ATOM   9001  H  H    . PHE B 2 188 ? 23.602  43.503  -15.607 1.00 73.78  ? 188  PHE B H    1 
ATOM   9002  H  HA   . PHE B 2 188 ? 24.151  42.737  -13.192 1.00 75.19  ? 188  PHE B HA   1 
ATOM   9003  H  HB2  . PHE B 2 188 ? 26.181  43.611  -13.501 1.00 60.83  ? 188  PHE B HB2  1 
ATOM   9004  H  HB3  . PHE B 2 188 ? 25.722  43.262  -14.979 1.00 60.83  ? 188  PHE B HB3  1 
ATOM   9005  H  HD1  . PHE B 2 188 ? 26.413  45.946  -12.828 1.00 62.15  ? 188  PHE B HD1  1 
ATOM   9006  H  HD2  . PHE B 2 188 ? 25.252  45.034  -16.545 1.00 66.45  ? 188  PHE B HD2  1 
ATOM   9007  H  HE1  . PHE B 2 188 ? 26.777  48.136  -13.471 1.00 70.22  ? 188  PHE B HE1  1 
ATOM   9008  H  HE2  . PHE B 2 188 ? 25.613  47.224  -17.201 1.00 64.53  ? 188  PHE B HE2  1 
ATOM   9009  H  HZ   . PHE B 2 188 ? 26.377  48.784  -15.669 1.00 66.48  ? 188  PHE B HZ   1 
ATOM   9010  N  N    . ALA B 2 189 ? 23.097  45.729  -13.330 1.00 55.15  ? 189  ALA B N    1 
ATOM   9011  C  CA   . ALA B 2 189 ? 22.681  46.901  -12.560 1.00 59.06  ? 189  ALA B CA   1 
ATOM   9012  C  C    . ALA B 2 189 ? 21.634  46.540  -11.511 1.00 57.27  ? 189  ALA B C    1 
ATOM   9013  O  O    . ALA B 2 189 ? 21.440  47.270  -10.540 1.00 73.91  ? 189  ALA B O    1 
ATOM   9014  C  CB   . ALA B 2 189 ? 22.142  47.975  -13.489 1.00 54.29  ? 189  ALA B CB   1 
ATOM   9015  H  H    . ALA B 2 189 ? 22.925  45.790  -14.170 1.00 66.19  ? 189  ALA B H    1 
ATOM   9016  H  HA   . ALA B 2 189 ? 23.453  47.264  -12.098 1.00 70.88  ? 189  ALA B HA   1 
ATOM   9017  H  HB1  . ALA B 2 189 ? 21.380  47.620  -13.972 1.00 65.15  ? 189  ALA B HB1  1 
ATOM   9018  H  HB2  . ALA B 2 189 ? 21.872  48.742  -12.960 1.00 65.15  ? 189  ALA B HB2  1 
ATOM   9019  H  HB3  . ALA B 2 189 ? 22.839  48.231  -14.113 1.00 65.15  ? 189  ALA B HB3  1 
ATOM   9020  N  N    . ASP B 2 190 ? 20.949  45.422  -11.726 1.00 60.01  ? 190  ASP B N    1 
ATOM   9021  C  CA   . ASP B 2 190 ? 19.903  44.965  -10.818 1.00 65.48  ? 190  ASP B CA   1 
ATOM   9022  C  C    . ASP B 2 190 ? 20.454  44.002  -9.763  1.00 69.69  ? 190  ASP B C    1 
ATOM   9023  O  O    . ASP B 2 190 ? 19.720  43.562  -8.877  1.00 81.63  ? 190  ASP B O    1 
ATOM   9024  C  CB   . ASP B 2 190 ? 18.778  44.297  -11.624 1.00 62.04  ? 190  ASP B CB   1 
ATOM   9025  C  CG   . ASP B 2 190 ? 18.083  45.271  -12.577 1.00 82.81  ? 190  ASP B CG   1 
ATOM   9026  O  OD1  . ASP B 2 190 ? 17.782  46.412  -12.154 1.00 87.51  ? 190  ASP B OD1  1 
ATOM   9027  O  OD2  . ASP B 2 190 ? 17.865  44.912  -13.762 1.00 76.09  ? 190  ASP B OD2  1 
ATOM   9028  H  H    . ASP B 2 190 ? 21.073  44.903  -12.401 1.00 72.01  ? 190  ASP B H    1 
ATOM   9029  H  HA   . ASP B 2 190 ? 19.527  45.732  -10.357 1.00 78.57  ? 190  ASP B HA   1 
ATOM   9030  H  HB2  . ASP B 2 190 ? 19.153  43.575  -12.152 1.00 74.45  ? 190  ASP B HB2  1 
ATOM   9031  H  HB3  . ASP B 2 190 ? 18.112  43.950  -11.010 1.00 74.45  ? 190  ASP B HB3  1 
ATOM   9032  N  N    . ALA B 2 191 ? 21.744  43.687  -9.854  1.00 56.96  ? 191  ALA B N    1 
ATOM   9033  C  CA   . ALA B 2 191 ? 22.394  42.805  -8.886  1.00 66.23  ? 191  ALA B CA   1 
ATOM   9034  C  C    . ALA B 2 191 ? 23.486  43.575  -8.142  1.00 67.56  ? 191  ALA B C    1 
ATOM   9035  O  O    . ALA B 2 191 ? 24.495  43.001  -7.734  1.00 64.05  ? 191  ALA B O    1 
ATOM   9036  C  CB   . ALA B 2 191 ? 22.975  41.580  -9.579  1.00 59.66  ? 191  ALA B CB   1 
ATOM   9037  H  H    . ALA B 2 191 ? 22.269  43.973  -10.472 1.00 68.35  ? 191  ALA B H    1 
ATOM   9038  H  HA   . ALA B 2 191 ? 21.738  42.504  -8.238  1.00 79.47  ? 191  ALA B HA   1 
ATOM   9039  H  HB1  . ALA B 2 191 ? 23.629  41.869  -10.234 1.00 71.60  ? 191  ALA B HB1  1 
ATOM   9040  H  HB2  . ALA B 2 191 ? 23.398  41.014  -8.915  1.00 71.60  ? 191  ALA B HB2  1 
ATOM   9041  H  HB3  . ALA B 2 191 ? 22.257  41.096  -10.017 1.00 71.60  ? 191  ALA B HB3  1 
ATOM   9042  N  N    . LEU B 2 192 ? 23.266  44.880  -7.998  1.00 62.78  ? 192  LEU B N    1 
ATOM   9043  C  CA   . LEU B 2 192 ? 24.235  45.812  -7.423  1.00 66.35  ? 192  LEU B CA   1 
ATOM   9044  C  C    . LEU B 2 192 ? 24.917  45.319  -6.140  1.00 62.21  ? 192  LEU B C    1 
ATOM   9045  O  O    . LEU B 2 192 ? 26.157  45.301  -6.044  1.00 58.54  ? 192  LEU B O    1 
ATOM   9046  C  CB   . LEU B 2 192 ? 23.537  47.140  -7.147  1.00 69.72  ? 192  LEU B CB   1 
ATOM   9047  C  CG   . LEU B 2 192 ? 24.361  48.191  -6.417  1.00 56.80  ? 192  LEU B CG   1 
ATOM   9048  C  CD1  . LEU B 2 192 ? 25.475  48.669  -7.328  1.00 54.52  ? 192  LEU B CD1  1 
ATOM   9049  C  CD2  . LEU B 2 192 ? 23.472  49.341  -5.990  1.00 68.99  ? 192  LEU B CD2  1 
ATOM   9050  H  H    . LEU B 2 192 ? 22.533  45.263  -8.237  1.00 75.34  ? 192  LEU B H    1 
ATOM   9051  H  HA   . LEU B 2 192 ? 24.931  45.977  -8.079  1.00 79.61  ? 192  LEU B HA   1 
ATOM   9052  H  HB2  . LEU B 2 192 ? 23.266  47.523  -7.995  1.00 83.66  ? 192  LEU B HB2  1 
ATOM   9053  H  HB3  . LEU B 2 192 ? 22.751  46.964  -6.607  1.00 83.66  ? 192  LEU B HB3  1 
ATOM   9054  H  HG   . LEU B 2 192 ? 24.759  47.799  -5.624  1.00 68.16  ? 192  LEU B HG   1 
ATOM   9055  H  HD11 . LEU B 2 192 ? 25.084  49.052  -8.129  1.00 65.43  ? 192  LEU B HD11 1 
ATOM   9056  H  HD12 . LEU B 2 192 ? 25.999  49.339  -6.861  1.00 65.43  ? 192  LEU B HD12 1 
ATOM   9057  H  HD13 . LEU B 2 192 ? 26.036  47.913  -7.562  1.00 65.43  ? 192  LEU B HD13 1 
ATOM   9058  H  HD21 . LEU B 2 192 ? 22.782  49.003  -5.398  1.00 82.79  ? 192  LEU B HD21 1 
ATOM   9059  H  HD22 . LEU B 2 192 ? 24.011  50.002  -5.527  1.00 82.79  ? 192  LEU B HD22 1 
ATOM   9060  H  HD23 . LEU B 2 192 ? 23.068  49.737  -6.778  1.00 82.79  ? 192  LEU B HD23 1 
ATOM   9061  N  N    . ASP B 2 193 ? 24.106  44.919  -5.162  1.00 60.59  ? 193  ASP B N    1 
ATOM   9062  C  CA   . ASP B 2 193 ? 24.624  44.576  -3.836  1.00 74.36  ? 193  ASP B CA   1 
ATOM   9063  C  C    . ASP B 2 193 ? 25.465  43.318  -3.894  1.00 62.88  ? 193  ASP B C    1 
ATOM   9064  O  O    . ASP B 2 193 ? 26.303  43.081  -3.031  1.00 72.16  ? 193  ASP B O    1 
ATOM   9065  C  CB   . ASP B 2 193 ? 23.478  44.397  -2.836  1.00 87.01  ? 193  ASP B CB   1 
ATOM   9066  C  CG   . ASP B 2 193 ? 22.842  45.716  -2.434  1.00 108.72 ? 193  ASP B CG   1 
ATOM   9067  O  OD1  . ASP B 2 193 ? 23.587  46.664  -2.090  1.00 102.23 ? 193  ASP B OD1  1 
ATOM   9068  O  OD2  . ASP B 2 193 ? 21.595  45.812  -2.494  1.00 113.96 ? 193  ASP B OD2  1 
ATOM   9069  H  H    . ASP B 2 193 ? 23.253  44.838  -5.240  1.00 72.71  ? 193  ASP B H    1 
ATOM   9070  H  HA   . ASP B 2 193 ? 25.187  45.300  -3.520  1.00 89.23  ? 193  ASP B HA   1 
ATOM   9071  H  HB2  . ASP B 2 193 ? 22.792  43.842  -3.238  1.00 104.42 ? 193  ASP B HB2  1 
ATOM   9072  H  HB3  . ASP B 2 193 ? 23.822  43.972  -2.034  1.00 104.42 ? 193  ASP B HB3  1 
ATOM   9073  N  N    . LEU B 2 194 ? 25.253  42.527  -4.935  1.00 65.53  ? 194  LEU B N    1 
ATOM   9074  C  CA   . LEU B 2 194 ? 26.028  41.319  -5.147  1.00 60.48  ? 194  LEU B CA   1 
ATOM   9075  C  C    . LEU B 2 194 ? 27.336  41.641  -5.861  1.00 60.79  ? 194  LEU B C    1 
ATOM   9076  O  O    . LEU B 2 194 ? 28.415  41.362  -5.339  1.00 70.00  ? 194  LEU B O    1 
ATOM   9077  C  CB   . LEU B 2 194 ? 25.215  40.305  -5.946  1.00 55.54  ? 194  LEU B CB   1 
ATOM   9078  C  CG   . LEU B 2 194 ? 24.085  39.599  -5.190  1.00 66.05  ? 194  LEU B CG   1 
ATOM   9079  C  CD1  . LEU B 2 194 ? 23.453  38.559  -6.087  1.00 66.64  ? 194  LEU B CD1  1 
ATOM   9080  C  CD2  . LEU B 2 194 ? 24.547  38.945  -3.888  1.00 61.04  ? 194  LEU B CD2  1 
ATOM   9081  H  H    . LEU B 2 194 ? 24.658  42.671  -5.540  1.00 78.63  ? 194  LEU B H    1 
ATOM   9082  H  HA   . LEU B 2 194 ? 26.242  40.924  -4.287  1.00 72.58  ? 194  LEU B HA   1 
ATOM   9083  H  HB2  . LEU B 2 194 ? 24.816  40.762  -6.702  1.00 66.65  ? 194  LEU B HB2  1 
ATOM   9084  H  HB3  . LEU B 2 194 ? 25.819  39.617  -6.269  1.00 66.65  ? 194  LEU B HB3  1 
ATOM   9085  H  HG   . LEU B 2 194 ? 23.403  40.253  -4.967  1.00 79.27  ? 194  LEU B HG   1 
ATOM   9086  H  HD11 . LEU B 2 194 ? 24.128  37.912  -6.344  1.00 79.97  ? 194  LEU B HD11 1 
ATOM   9087  H  HD12 . LEU B 2 194 ? 22.738  38.117  -5.602  1.00 79.97  ? 194  LEU B HD12 1 
ATOM   9088  H  HD13 . LEU B 2 194 ? 23.096  38.997  -6.875  1.00 79.97  ? 194  LEU B HD13 1 
ATOM   9089  H  HD21 . LEU B 2 194 ? 24.914  39.628  -3.305  1.00 73.24  ? 194  LEU B HD21 1 
ATOM   9090  H  HD22 . LEU B 2 194 ? 23.786  38.520  -3.462  1.00 73.24  ? 194  LEU B HD22 1 
ATOM   9091  H  HD23 . LEU B 2 194 ? 25.226  38.284  -4.092  1.00 73.24  ? 194  LEU B HD23 1 
ATOM   9092  N  N    . PHE B 2 195 ? 27.253  42.230  -7.049  1.00 47.32  ? 195  PHE B N    1 
ATOM   9093  C  CA   . PHE B 2 195 ? 28.449  42.374  -7.859  1.00 54.76  ? 195  PHE B CA   1 
ATOM   9094  C  C    . PHE B 2 195 ? 29.383  43.453  -7.328  1.00 55.38  ? 195  PHE B C    1 
ATOM   9095  O  O    . PHE B 2 195 ? 30.584  43.410  -7.610  1.00 55.37  ? 195  PHE B O    1 
ATOM   9096  C  CB   . PHE B 2 195 ? 28.091  42.659  -9.330  1.00 54.91  ? 195  PHE B CB   1 
ATOM   9097  C  CG   . PHE B 2 195 ? 27.915  44.130  -9.659  1.00 54.66  ? 195  PHE B CG   1 
ATOM   9098  C  CD1  . PHE B 2 195 ? 29.016  44.943  -9.900  1.00 53.21  ? 195  PHE B CD1  1 
ATOM   9099  C  CD2  . PHE B 2 195 ? 26.655  44.688  -9.758  1.00 51.18  ? 195  PHE B CD2  1 
ATOM   9100  C  CE1  . PHE B 2 195 ? 28.861  46.287  -10.209 1.00 51.33  ? 195  PHE B CE1  1 
ATOM   9101  C  CE2  . PHE B 2 195 ? 26.493  46.032  -10.077 1.00 56.14  ? 195  PHE B CE2  1 
ATOM   9102  C  CZ   . PHE B 2 195 ? 27.594  46.829  -10.302 1.00 52.73  ? 195  PHE B CZ   1 
ATOM   9103  H  H    . PHE B 2 195 ? 26.534  42.547  -7.400  1.00 56.78  ? 195  PHE B H    1 
ATOM   9104  H  HA   . PHE B 2 195 ? 28.934  41.535  -7.837  1.00 65.72  ? 195  PHE B HA   1 
ATOM   9105  H  HB2  . PHE B 2 195 ? 28.801  42.315  -9.894  1.00 65.89  ? 195  PHE B HB2  1 
ATOM   9106  H  HB3  . PHE B 2 195 ? 27.259  42.209  -9.540  1.00 65.89  ? 195  PHE B HB3  1 
ATOM   9107  H  HD1  . PHE B 2 195 ? 29.872  44.584  -9.839  1.00 63.85  ? 195  PHE B HD1  1 
ATOM   9108  H  HD2  . PHE B 2 195 ? 25.906  44.158  -9.609  1.00 61.42  ? 195  PHE B HD2  1 
ATOM   9109  H  HE1  . PHE B 2 195 ? 29.608  46.819  -10.363 1.00 61.59  ? 195  PHE B HE1  1 
ATOM   9110  H  HE2  . PHE B 2 195 ? 25.639  46.395  -10.134 1.00 67.37  ? 195  PHE B HE2  1 
ATOM   9111  H  HZ   . PHE B 2 195 ? 27.484  47.729  -10.510 1.00 63.28  ? 195  PHE B HZ   1 
ATOM   9112  N  N    . ARG B 2 196 ? 28.881  44.388  -6.522  1.00 57.00  ? 196  ARG B N    1 
ATOM   9113  C  CA   . ARG B 2 196 ? 29.783  45.415  -6.000  1.00 54.65  ? 196  ARG B CA   1 
ATOM   9114  C  C    . ARG B 2 196 ? 30.710  44.852  -4.926  1.00 51.61  ? 196  ARG B C    1 
ATOM   9115  O  O    . ARG B 2 196 ? 31.717  45.466  -4.596  1.00 62.13  ? 196  ARG B O    1 
ATOM   9116  C  CB   . ARG B 2 196 ? 28.984  46.602  -5.443  1.00 58.91  ? 196  ARG B CB   1 
ATOM   9117  C  CG   . ARG B 2 196 ? 28.377  46.406  -4.056  1.00 53.04  ? 196  ARG B CG   1 
ATOM   9118  C  CD   . ARG B 2 196 ? 27.557  47.633  -3.649  1.00 57.03  ? 196  ARG B CD   1 
ATOM   9119  N  NE   . ARG B 2 196 ? 26.936  47.484  -2.332  1.00 76.10  ? 196  ARG B NE   1 
ATOM   9120  C  CZ   . ARG B 2 196 ? 27.492  47.862  -1.179  1.00 84.09  ? 196  ARG B CZ   1 
ATOM   9121  N  NH1  . ARG B 2 196 ? 28.702  48.404  -1.155  1.00 84.63  ? 196  ARG B NH1  1 
ATOM   9122  N  NH2  . ARG B 2 196 ? 26.843  47.680  -0.034  1.00 79.51  ? 196  ARG B NH2  1 
ATOM   9123  H  H    . ARG B 2 196 ? 28.060  44.451  -6.272  1.00 68.40  ? 196  ARG B H    1 
ATOM   9124  H  HA   . ARG B 2 196 ? 30.336  45.744  -6.726  1.00 65.58  ? 196  ARG B HA   1 
ATOM   9125  H  HB2  . ARG B 2 196 ? 29.573  47.371  -5.395  1.00 70.70  ? 196  ARG B HB2  1 
ATOM   9126  H  HB3  . ARG B 2 196 ? 28.254  46.792  -6.054  1.00 70.70  ? 196  ARG B HB3  1 
ATOM   9127  H  HG2  . ARG B 2 196 ? 27.790  45.634  -4.067  1.00 63.64  ? 196  ARG B HG2  1 
ATOM   9128  H  HG3  . ARG B 2 196 ? 29.088  46.282  -3.408  1.00 63.64  ? 196  ARG B HG3  1 
ATOM   9129  H  HD2  . ARG B 2 196 ? 28.140  48.407  -3.620  1.00 68.44  ? 196  ARG B HD2  1 
ATOM   9130  H  HD3  . ARG B 2 196 ? 26.851  47.772  -4.299  1.00 68.44  ? 196  ARG B HD3  1 
ATOM   9131  H  HE   . ARG B 2 196 ? 26.155  47.127  -2.299  1.00 91.32  ? 196  ARG B HE   1 
ATOM   9132  H  HH11 . ARG B 2 196 ? 29.133  48.526  -1.890  1.00 101.56 ? 196  ARG B HH11 1 
ATOM   9133  H  HH12 . ARG B 2 196 ? 29.052  48.642  -0.407  1.00 101.56 ? 196  ARG B HH12 1 
ATOM   9134  H  HH21 . ARG B 2 196 ? 26.059  47.327  -0.036  1.00 95.41  ? 196  ARG B HH21 1 
ATOM   9135  H  HH22 . ARG B 2 196 ? 27.204  47.921  0.708   1.00 95.41  ? 196  ARG B HH22 1 
ATOM   9136  N  N    . GLY B 2 197 ? 30.441  43.624  -4.500  1.00 53.32  ? 197  GLY B N    1 
ATOM   9137  C  CA   . GLY B 2 197 ? 31.272  42.927  -3.541  1.00 46.39  ? 197  GLY B CA   1 
ATOM   9138  C  C    . GLY B 2 197 ? 31.880  41.665  -4.126  1.00 52.97  ? 197  GLY B C    1 
ATOM   9139  O  O    . GLY B 2 197 ? 32.335  40.795  -3.384  1.00 55.86  ? 197  GLY B O    1 
ATOM   9140  H  H    . GLY B 2 197 ? 29.763  43.165  -4.763  1.00 63.98  ? 197  GLY B H    1 
ATOM   9141  H  HA2  . GLY B 2 197 ? 31.991  43.509  -3.250  1.00 55.67  ? 197  GLY B HA2  1 
ATOM   9142  H  HA3  . GLY B 2 197 ? 30.740  42.683  -2.767  1.00 55.67  ? 197  GLY B HA3  1 
ATOM   9143  N  N    . ARG B 2 198 ? 31.791  41.526  -5.448  1.00 58.56  ? 198  ARG B N    1 
ATOM   9144  C  CA   . ARG B 2 198 ? 32.293  40.352  -6.156  1.00 54.43  ? 198  ARG B CA   1 
ATOM   9145  C  C    . ARG B 2 198 ? 31.773  39.076  -5.509  1.00 58.38  ? 198  ARG B C    1 
ATOM   9146  O  O    . ARG B 2 198 ? 32.541  38.171  -5.184  1.00 67.97  ? 198  ARG B O    1 
ATOM   9147  C  CB   . ARG B 2 198 ? 33.825  40.356  -6.186  1.00 40.37  ? 198  ARG B CB   1 
ATOM   9148  C  CG   . ARG B 2 198 ? 34.402  41.376  -7.150  1.00 47.41  ? 198  ARG B CG   1 
ATOM   9149  C  CD   . ARG B 2 198 ? 35.905  41.250  -7.294  1.00 49.21  ? 198  ARG B CD   1 
ATOM   9150  N  NE   . ARG B 2 198 ? 36.592  41.385  -6.009  1.00 61.46  ? 198  ARG B NE   1 
ATOM   9151  C  CZ   . ARG B 2 198 ? 37.142  42.506  -5.555  1.00 55.61  ? 198  ARG B CZ   1 
ATOM   9152  N  NH1  . ARG B 2 198 ? 37.093  43.619  -6.271  1.00 55.42  ? 198  ARG B NH1  1 
ATOM   9153  N  NH2  . ARG B 2 198 ? 37.735  42.517  -4.374  1.00 60.93  ? 198  ARG B NH2  1 
ATOM   9154  H  H    . ARG B 2 198 ? 31.435  42.112  -5.967  1.00 70.28  ? 198  ARG B H    1 
ATOM   9155  H  HA   . ARG B 2 198 ? 31.975  40.375  -7.072  1.00 65.32  ? 198  ARG B HA   1 
ATOM   9156  H  HB2  . ARG B 2 198 ? 34.156  40.564  -5.298  1.00 48.44  ? 198  ARG B HB2  1 
ATOM   9157  H  HB3  . ARG B 2 198 ? 34.137  39.479  -6.458  1.00 48.44  ? 198  ARG B HB3  1 
ATOM   9158  H  HG2  . ARG B 2 198 ? 34.003  41.246  -8.024  1.00 56.90  ? 198  ARG B HG2  1 
ATOM   9159  H  HG3  . ARG B 2 198 ? 34.205  42.268  -6.823  1.00 56.90  ? 198  ARG B HG3  1 
ATOM   9160  H  HD2  . ARG B 2 198 ? 36.117  40.377  -7.660  1.00 59.05  ? 198  ARG B HD2  1 
ATOM   9161  H  HD3  . ARG B 2 198 ? 36.228  41.948  -7.885  1.00 59.05  ? 198  ARG B HD3  1 
ATOM   9162  H  HE   . ARG B 2 198 ? 36.642  40.687  -5.509  1.00 73.75  ? 198  ARG B HE   1 
ATOM   9163  H  HH11 . ARG B 2 198 ? 36.707  43.619  -7.039  1.00 66.50  ? 198  ARG B HH11 1 
ATOM   9164  H  HH12 . ARG B 2 198 ? 37.451  44.340  -5.969  1.00 66.50  ? 198  ARG B HH12 1 
ATOM   9165  H  HH21 . ARG B 2 198 ? 37.770  41.797  -3.904  1.00 73.11  ? 198  ARG B HH21 1 
ATOM   9166  H  HH22 . ARG B 2 198 ? 38.092  43.241  -4.078  1.00 73.11  ? 198  ARG B HH22 1 
ATOM   9167  N  N    . LYS B 2 199 ? 30.453  38.990  -5.404  1.00 61.71  ? 199  LYS B N    1 
ATOM   9168  C  CA   . LYS B 2 199 ? 29.775  37.843  -4.814  1.00 64.76  ? 199  LYS B CA   1 
ATOM   9169  C  C    . LYS B 2 199 ? 28.906  37.198  -5.862  1.00 63.94  ? 199  LYS B C    1 
ATOM   9170  O  O    . LYS B 2 199 ? 28.039  36.383  -5.552  1.00 72.02  ? 199  LYS B O    1 
ATOM   9171  C  CB   . LYS B 2 199 ? 28.921  38.251  -3.616  1.00 54.81  ? 199  LYS B CB   1 
ATOM   9172  C  CG   . LYS B 2 199 ? 29.691  38.795  -2.442  1.00 63.20  ? 199  LYS B CG   1 
ATOM   9173  C  CD   . LYS B 2 199 ? 28.728  39.380  -1.423  1.00 76.68  ? 199  LYS B CD   1 
ATOM   9174  C  CE   . LYS B 2 199 ? 29.439  39.937  -0.208  1.00 88.55  ? 199  LYS B CE   1 
ATOM   9175  N  NZ   . LYS B 2 199 ? 28.478  40.650  0.679   1.00 98.57  ? 199  LYS B NZ   1 
ATOM   9176  H  H    . LYS B 2 199 ? 29.913  39.602  -5.675  1.00 74.06  ? 199  LYS B H    1 
ATOM   9177  H  HA   . LYS B 2 199 ? 30.433  37.195  -4.517  1.00 77.71  ? 199  LYS B HA   1 
ATOM   9178  H  HB2  . LYS B 2 199 ? 28.299  38.938  -3.901  1.00 65.77  ? 199  LYS B HB2  1 
ATOM   9179  H  HB3  . LYS B 2 199 ? 28.429  37.474  -3.309  1.00 65.77  ? 199  LYS B HB3  1 
ATOM   9180  H  HG2  . LYS B 2 199 ? 30.190  38.078  -2.019  1.00 75.84  ? 199  LYS B HG2  1 
ATOM   9181  H  HG3  . LYS B 2 199 ? 30.289  39.497  -2.741  1.00 75.84  ? 199  LYS B HG3  1 
ATOM   9182  H  HD2  . LYS B 2 199 ? 28.229  40.102  -1.837  1.00 92.01  ? 199  LYS B HD2  1 
ATOM   9183  H  HD3  . LYS B 2 199 ? 28.121  38.685  -1.124  1.00 92.01  ? 199  LYS B HD3  1 
ATOM   9184  H  HE2  . LYS B 2 199 ? 29.838  39.210  0.295   1.00 106.25 ? 199  LYS B HE2  1 
ATOM   9185  H  HE3  . LYS B 2 199 ? 30.120  40.567  -0.492  1.00 106.25 ? 199  LYS B HE3  1 
ATOM   9186  H  HZ1  . LYS B 2 199 ? 27.842  40.090  0.952   1.00 118.28 ? 199  LYS B HZ1  1 
ATOM   9187  H  HZ2  . LYS B 2 199 ? 28.903  40.975  1.390   1.00 118.28 ? 199  LYS B HZ2  1 
ATOM   9188  H  HZ3  . LYS B 2 199 ? 28.099  41.324  0.237   1.00 118.28 ? 199  LYS B HZ3  1 
ATOM   9189  N  N    . VAL B 2 200 ? 29.144  37.575  -7.111  1.00 61.90  ? 200  VAL B N    1 
ATOM   9190  C  CA   . VAL B 2 200 ? 28.410  37.000  -8.210  1.00 51.56  ? 200  VAL B CA   1 
ATOM   9191  C  C    . VAL B 2 200 ? 29.240  37.132  -9.472  1.00 53.44  ? 200  VAL B C    1 
ATOM   9192  O  O    . VAL B 2 200 ? 30.146  37.964  -9.549  1.00 51.13  ? 200  VAL B O    1 
ATOM   9193  C  CB   . VAL B 2 200 ? 27.040  37.687  -8.378  1.00 54.27  ? 200  VAL B CB   1 
ATOM   9194  C  CG1  . VAL B 2 200 ? 27.162  39.009  -9.163  1.00 60.98  ? 200  VAL B CG1  1 
ATOM   9195  C  CG2  . VAL B 2 200 ? 26.067  36.760  -9.054  1.00 65.06  ? 200  VAL B CG2  1 
ATOM   9196  H  H    . VAL B 2 200 ? 29.728  38.162  -7.343  1.00 74.28  ? 200  VAL B H    1 
ATOM   9197  H  HA   . VAL B 2 200 ? 28.260  36.057  -8.039  1.00 61.88  ? 200  VAL B HA   1 
ATOM   9198  H  HB   . VAL B 2 200 ? 26.687  37.897  -7.499  1.00 65.13  ? 200  VAL B HB   1 
ATOM   9199  H  HG11 . VAL B 2 200 ? 27.526  38.821  -10.042 1.00 73.18  ? 200  VAL B HG11 1 
ATOM   9200  H  HG12 . VAL B 2 200 ? 26.282  39.408  -9.247  1.00 73.18  ? 200  VAL B HG12 1 
ATOM   9201  H  HG13 . VAL B 2 200 ? 27.753  39.608  -8.681  1.00 73.18  ? 200  VAL B HG13 1 
ATOM   9202  H  HG21 . VAL B 2 200 ? 25.960  35.964  -8.511  1.00 78.08  ? 200  VAL B HG21 1 
ATOM   9203  H  HG22 . VAL B 2 200 ? 25.214  37.213  -9.149  1.00 78.08  ? 200  VAL B HG22 1 
ATOM   9204  H  HG23 . VAL B 2 200 ? 26.414  36.521  -9.928  1.00 78.08  ? 200  VAL B HG23 1 
ATOM   9205  N  N    . TYR B 2 201 ? 28.928  36.298  -10.453 1.00 53.88  ? 201  TYR B N    1 
ATOM   9206  C  CA   . TYR B 2 201 ? 29.643  36.277  -11.723 1.00 54.72  ? 201  TYR B CA   1 
ATOM   9207  C  C    . TYR B 2 201 ? 29.002  37.205  -12.755 1.00 55.00  ? 201  TYR B C    1 
ATOM   9208  O  O    . TYR B 2 201 ? 27.791  37.198  -12.922 1.00 55.09  ? 201  TYR B O    1 
ATOM   9209  C  CB   . TYR B 2 201 ? 29.688  34.853  -12.272 1.00 41.83  ? 201  TYR B CB   1 
ATOM   9210  C  CG   . TYR B 2 201 ? 30.330  34.764  -13.623 1.00 46.86  ? 201  TYR B CG   1 
ATOM   9211  C  CD1  . TYR B 2 201 ? 31.676  35.032  -13.788 1.00 49.12  ? 201  TYR B CD1  1 
ATOM   9212  C  CD2  . TYR B 2 201 ? 29.596  34.371  -14.740 1.00 57.48  ? 201  TYR B CD2  1 
ATOM   9213  C  CE1  . TYR B 2 201 ? 32.275  34.946  -15.035 1.00 60.73  ? 201  TYR B CE1  1 
ATOM   9214  C  CE2  . TYR B 2 201 ? 30.186  34.274  -15.988 1.00 51.76  ? 201  TYR B CE2  1 
ATOM   9215  C  CZ   . TYR B 2 201 ? 31.526  34.561  -16.128 1.00 56.05  ? 201  TYR B CZ   1 
ATOM   9216  O  OH   . TYR B 2 201 ? 32.126  34.472  -17.358 1.00 64.60  ? 201  TYR B OH   1 
ATOM   9217  H  H    . TYR B 2 201 ? 28.292  35.721  -10.407 1.00 64.66  ? 201  TYR B H    1 
ATOM   9218  H  HA   . TYR B 2 201 ? 30.555  36.573  -11.577 1.00 65.66  ? 201  TYR B HA   1 
ATOM   9219  H  HB2  . TYR B 2 201 ? 30.196  34.296  -11.662 1.00 50.19  ? 201  TYR B HB2  1 
ATOM   9220  H  HB3  . TYR B 2 201 ? 28.781  34.517  -12.350 1.00 50.19  ? 201  TYR B HB3  1 
ATOM   9221  H  HD1  . TYR B 2 201 ? 32.184  35.293  -13.054 1.00 58.94  ? 201  TYR B HD1  1 
ATOM   9222  H  HD2  . TYR B 2 201 ? 28.690  34.179  -14.647 1.00 68.98  ? 201  TYR B HD2  1 
ATOM   9223  H  HE1  . TYR B 2 201 ? 33.180  35.135  -15.132 1.00 72.88  ? 201  TYR B HE1  1 
ATOM   9224  H  HE2  . TYR B 2 201 ? 29.682  34.019  -16.727 1.00 62.11  ? 201  TYR B HE2  1 
ATOM   9225  H  HH   . TYR B 2 201 ? 31.565  34.230  -17.934 1.00 77.52  ? 201  TYR B HH   1 
ATOM   9226  N  N    . LEU B 2 202 ? 29.819  38.032  -13.401 1.00 48.72  ? 202  LEU B N    1 
ATOM   9227  C  CA   . LEU B 2 202 ? 29.356  38.925  -14.461 1.00 49.73  ? 202  LEU B CA   1 
ATOM   9228  C  C    . LEU B 2 202 ? 29.870  38.519  -15.835 1.00 51.93  ? 202  LEU B C    1 
ATOM   9229  O  O    . LEU B 2 202 ? 31.024  38.101  -15.983 1.00 53.74  ? 202  LEU B O    1 
ATOM   9230  C  CB   . LEU B 2 202 ? 29.765  40.372  -14.193 1.00 45.61  ? 202  LEU B CB   1 
ATOM   9231  C  CG   . LEU B 2 202 ? 29.292  40.997  -12.897 1.00 46.93  ? 202  LEU B CG   1 
ATOM   9232  C  CD1  . LEU B 2 202 ? 29.625  42.484  -12.944 1.00 48.52  ? 202  LEU B CD1  1 
ATOM   9233  C  CD2  . LEU B 2 202 ? 27.793  40.784  -12.657 1.00 42.77  ? 202  LEU B CD2  1 
ATOM   9234  H  H    . LEU B 2 202 ? 30.661  38.096  -13.240 1.00 58.46  ? 202  LEU B H    1 
ATOM   9235  H  HA   . LEU B 2 202 ? 28.386  38.895  -14.489 1.00 59.68  ? 202  LEU B HA   1 
ATOM   9236  H  HB2  . LEU B 2 202 ? 30.734  40.415  -14.193 1.00 54.73  ? 202  LEU B HB2  1 
ATOM   9237  H  HB3  . LEU B 2 202 ? 29.422  40.920  -14.915 1.00 54.73  ? 202  LEU B HB3  1 
ATOM   9238  H  HG   . LEU B 2 202 ? 29.777  40.601  -12.156 1.00 56.31  ? 202  LEU B HG   1 
ATOM   9239  H  HD11 . LEU B 2 202 ? 29.170  42.885  -13.701 1.00 58.23  ? 202  LEU B HD11 1 
ATOM   9240  H  HD12 . LEU B 2 202 ? 29.329  42.900  -12.120 1.00 58.23  ? 202  LEU B HD12 1 
ATOM   9241  H  HD13 . LEU B 2 202 ? 30.585  42.589  -13.042 1.00 58.23  ? 202  LEU B HD13 1 
ATOM   9242  H  HD21 . LEU B 2 202 ? 27.612  39.832  -12.619 1.00 51.33  ? 202  LEU B HD21 1 
ATOM   9243  H  HD22 . LEU B 2 202 ? 27.545  41.202  -11.818 1.00 51.33  ? 202  LEU B HD22 1 
ATOM   9244  H  HD23 . LEU B 2 202 ? 27.297  41.186  -13.387 1.00 51.33  ? 202  LEU B HD23 1 
ATOM   9245  N  N    . GLU B 2 203 ? 29.020  38.683  -16.843 1.00 50.23  ? 203  GLU B N    1 
ATOM   9246  C  CA   . GLU B 2 203 ? 29.426  38.440  -18.222 1.00 50.42  ? 203  GLU B CA   1 
ATOM   9247  C  C    . GLU B 2 203 ? 28.543  39.235  -19.179 1.00 47.60  ? 203  GLU B C    1 
ATOM   9248  O  O    . GLU B 2 203 ? 27.320  39.190  -19.087 1.00 59.52  ? 203  GLU B O    1 
ATOM   9249  C  CB   . GLU B 2 203 ? 29.350  36.949  -18.547 1.00 49.82  ? 203  GLU B CB   1 
ATOM   9250  C  CG   . GLU B 2 203 ? 29.861  36.603  -19.932 1.00 70.62  ? 203  GLU B CG   1 
ATOM   9251  C  CD   . GLU B 2 203 ? 29.818  35.114  -20.225 1.00 79.53  ? 203  GLU B CD   1 
ATOM   9252  O  OE1  . GLU B 2 203 ? 30.254  34.314  -19.367 1.00 66.53  ? 203  GLU B OE1  1 
ATOM   9253  O  OE2  . GLU B 2 203 ? 29.329  34.755  -21.323 1.00 80.18  ? 203  GLU B OE2  1 
ATOM   9254  H  H    . GLU B 2 203 ? 28.202  38.934  -16.755 1.00 60.28  ? 203  GLU B H    1 
ATOM   9255  H  HA   . GLU B 2 203 ? 30.343  38.731  -18.341 1.00 60.51  ? 203  GLU B HA   1 
ATOM   9256  H  HB2  . GLU B 2 203 ? 29.885  36.460  -17.902 1.00 59.79  ? 203  GLU B HB2  1 
ATOM   9257  H  HB3  . GLU B 2 203 ? 28.425  36.663  -18.491 1.00 59.79  ? 203  GLU B HB3  1 
ATOM   9258  H  HG2  . GLU B 2 203 ? 29.311  37.054  -20.592 1.00 84.74  ? 203  GLU B HG2  1 
ATOM   9259  H  HG3  . GLU B 2 203 ? 30.782  36.897  -20.011 1.00 84.74  ? 203  GLU B HG3  1 
ATOM   9260  N  N    . ASP B 2 204 ? 29.178  40.012  -20.049 1.00 49.84  ? 204  ASP B N    1 
ATOM   9261  C  CA   . ASP B 2 204 ? 28.484  40.777  -21.080 1.00 55.47  ? 204  ASP B CA   1 
ATOM   9262  C  C    . ASP B 2 204 ? 27.291  41.555  -20.528 1.00 59.41  ? 204  ASP B C    1 
ATOM   9263  O  O    . ASP B 2 204 ? 26.236  41.628  -21.181 1.00 55.28  ? 204  ASP B O    1 
ATOM   9264  C  CB   . ASP B 2 204 ? 28.023  39.870  -22.227 1.00 54.85  ? 204  ASP B CB   1 
ATOM   9265  C  CG   . ASP B 2 204 ? 27.829  40.634  -23.531 1.00 69.12  ? 204  ASP B CG   1 
ATOM   9266  O  OD1  . ASP B 2 204 ? 28.581  41.605  -23.775 1.00 63.78  ? 204  ASP B OD1  1 
ATOM   9267  O  OD2  . ASP B 2 204 ? 26.917  40.271  -24.309 1.00 83.85  ? 204  ASP B OD2  1 
ATOM   9268  H  H    . ASP B 2 204 ? 30.032  40.115  -20.062 1.00 59.81  ? 204  ASP B H    1 
ATOM   9269  H  HA   . ASP B 2 204 ? 29.105  41.423  -21.451 1.00 66.57  ? 204  ASP B HA   1 
ATOM   9270  H  HB2  . ASP B 2 204 ? 28.692  39.184  -22.377 1.00 65.82  ? 204  ASP B HB2  1 
ATOM   9271  H  HB3  . ASP B 2 204 ? 27.176  39.462  -21.988 1.00 65.82  ? 204  ASP B HB3  1 
ATOM   9272  N  N    . GLY B 2 205 ? 27.418  42.044  -19.295 1.00 49.47  ? 205  GLY B N    1 
ATOM   9273  C  CA   . GLY B 2 205 ? 26.416  42.937  -18.735 1.00 43.38  ? 205  GLY B CA   1 
ATOM   9274  C  C    . GLY B 2 205 ? 25.403  42.226  -17.871 1.00 53.12  ? 205  GLY B C    1 
ATOM   9275  O  O    . GLY B 2 205 ? 24.497  42.858  -17.313 1.00 58.57  ? 205  GLY B O    1 
ATOM   9276  H  H    . GLY B 2 205 ? 28.074  41.873  -18.767 1.00 59.36  ? 205  GLY B H    1 
ATOM   9277  H  HA2  . GLY B 2 205 ? 26.855  43.613  -18.195 1.00 52.06  ? 205  GLY B HA2  1 
ATOM   9278  H  HA3  . GLY B 2 205 ? 25.943  43.382  -19.456 1.00 52.06  ? 205  GLY B HA3  1 
ATOM   9279  N  N    . PHE B 2 206 ? 25.568  40.914  -17.736 1.00 46.40  ? 206  PHE B N    1 
ATOM   9280  C  CA   . PHE B 2 206 ? 24.628  40.113  -16.965 1.00 54.52  ? 206  PHE B CA   1 
ATOM   9281  C  C    . PHE B 2 206 ? 25.294  39.390  -15.820 1.00 56.67  ? 206  PHE B C    1 
ATOM   9282  O  O    . PHE B 2 206 ? 26.384  38.827  -15.965 1.00 57.22  ? 206  PHE B O    1 
ATOM   9283  C  CB   . PHE B 2 206 ? 23.941  39.082  -17.880 1.00 61.90  ? 206  PHE B CB   1 
ATOM   9284  C  CG   . PHE B 2 206 ? 23.090  39.707  -18.951 1.00 61.25  ? 206  PHE B CG   1 
ATOM   9285  C  CD1  . PHE B 2 206 ? 21.818  40.177  -18.661 1.00 63.10  ? 206  PHE B CD1  1 
ATOM   9286  C  CD2  . PHE B 2 206 ? 23.576  39.858  -20.233 1.00 50.78  ? 206  PHE B CD2  1 
ATOM   9287  C  CE1  . PHE B 2 206 ? 21.047  40.770  -19.636 1.00 58.33  ? 206  PHE B CE1  1 
ATOM   9288  C  CE2  . PHE B 2 206 ? 22.806  40.447  -21.214 1.00 70.50  ? 206  PHE B CE2  1 
ATOM   9289  C  CZ   . PHE B 2 206 ? 21.539  40.904  -20.916 1.00 66.76  ? 206  PHE B CZ   1 
ATOM   9290  H  H    . PHE B 2 206 ? 26.216  40.466  -18.080 1.00 55.68  ? 206  PHE B H    1 
ATOM   9291  H  HA   . PHE B 2 206 ? 23.943  40.693  -16.597 1.00 65.43  ? 206  PHE B HA   1 
ATOM   9292  H  HB2  . PHE B 2 206 ? 24.622  38.547  -18.317 1.00 74.28  ? 206  PHE B HB2  1 
ATOM   9293  H  HB3  . PHE B 2 206 ? 23.370  38.514  -17.340 1.00 74.28  ? 206  PHE B HB3  1 
ATOM   9294  H  HD1  . PHE B 2 206 ? 21.481  40.090  -17.799 1.00 75.72  ? 206  PHE B HD1  1 
ATOM   9295  H  HD2  . PHE B 2 206 ? 24.429  39.552  -20.440 1.00 60.93  ? 206  PHE B HD2  1 
ATOM   9296  H  HE1  . PHE B 2 206 ? 20.193  41.074  -19.431 1.00 70.00  ? 206  PHE B HE1  1 
ATOM   9297  H  HE2  . PHE B 2 206 ? 23.141  40.537  -22.077 1.00 84.60  ? 206  PHE B HE2  1 
ATOM   9298  H  HZ   . PHE B 2 206 ? 21.018  41.300  -21.576 1.00 80.11  ? 206  PHE B HZ   1 
ATOM   9299  N  N    . ALA B 2 207 ? 24.611  39.407  -14.685 1.00 55.77  ? 207  ALA B N    1 
ATOM   9300  C  CA   . ALA B 2 207 ? 24.990  38.627  -13.529 1.00 52.73  ? 207  ALA B CA   1 
ATOM   9301  C  C    . ALA B 2 207 ? 24.332  37.252  -13.611 1.00 57.40  ? 207  ALA B C    1 
ATOM   9302  O  O    . ALA B 2 207 ? 23.203  37.128  -14.101 1.00 70.71  ? 207  ALA B O    1 
ATOM   9303  C  CB   . ALA B 2 207 ? 24.575  39.337  -12.262 1.00 51.14  ? 207  ALA B CB   1 
ATOM   9304  H  H    . ALA B 2 207 ? 23.903  39.879  -14.561 1.00 66.93  ? 207  ALA B H    1 
ATOM   9305  H  HA   . ALA B 2 207 ? 25.953  38.510  -13.517 1.00 63.27  ? 207  ALA B HA   1 
ATOM   9306  H  HB1  . ALA B 2 207 ? 23.613  39.456  -12.268 1.00 61.36  ? 207  ALA B HB1  1 
ATOM   9307  H  HB2  . ALA B 2 207 ? 24.838  38.800  -11.498 1.00 61.36  ? 207  ALA B HB2  1 
ATOM   9308  H  HB3  . ALA B 2 207 ? 25.015  40.201  -12.225 1.00 61.36  ? 207  ALA B HB3  1 
ATOM   9309  N  N    . TYR B 2 208 ? 25.017  36.248  -13.068 1.00 53.31  ? 208  TYR B N    1 
ATOM   9310  C  CA   . TYR B 2 208 ? 24.559  34.861  -13.065 1.00 51.88  ? 208  TYR B CA   1 
ATOM   9311  C  C    . TYR B 2 208 ? 24.319  34.420  -11.639 1.00 55.97  ? 208  TYR B C    1 
ATOM   9312  O  O    . TYR B 2 208 ? 25.243  34.046  -10.913 1.00 57.43  ? 208  TYR B O    1 
ATOM   9313  C  CB   . TYR B 2 208 ? 25.581  33.960  -13.761 1.00 52.56  ? 208  TYR B CB   1 
ATOM   9314  C  CG   . TYR B 2 208 ? 25.589  34.172  -15.265 1.00 59.11  ? 208  TYR B CG   1 
ATOM   9315  C  CD1  . TYR B 2 208 ? 26.175  35.289  -15.819 1.00 59.09  ? 208  TYR B CD1  1 
ATOM   9316  C  CD2  . TYR B 2 208 ? 25.002  33.253  -16.126 1.00 65.67  ? 208  TYR B CD2  1 
ATOM   9317  C  CE1  . TYR B 2 208 ? 26.174  35.500  -17.183 1.00 70.68  ? 208  TYR B CE1  1 
ATOM   9318  C  CE2  . TYR B 2 208 ? 24.999  33.457  -17.495 1.00 74.01  ? 208  TYR B CE2  1 
ATOM   9319  C  CZ   . TYR B 2 208 ? 25.588  34.583  -18.015 1.00 72.93  ? 208  TYR B CZ   1 
ATOM   9320  O  OH   . TYR B 2 208 ? 25.595  34.811  -19.373 1.00 76.17  ? 208  TYR B OH   1 
ATOM   9321  H  H    . TYR B 2 208 ? 25.778  36.351  -12.680 1.00 63.97  ? 208  TYR B H    1 
ATOM   9322  H  HA   . TYR B 2 208 ? 23.720  34.799  -13.548 1.00 62.26  ? 208  TYR B HA   1 
ATOM   9323  H  HB2  . TYR B 2 208 ? 26.467  34.162  -13.422 1.00 63.07  ? 208  TYR B HB2  1 
ATOM   9324  H  HB3  . TYR B 2 208 ? 25.360  33.032  -13.587 1.00 63.07  ? 208  TYR B HB3  1 
ATOM   9325  H  HD1  . TYR B 2 208 ? 26.571  35.919  -15.261 1.00 70.91  ? 208  TYR B HD1  1 
ATOM   9326  H  HD2  . TYR B 2 208 ? 24.598  32.492  -15.776 1.00 78.80  ? 208  TYR B HD2  1 
ATOM   9327  H  HE1  . TYR B 2 208 ? 26.573  36.262  -17.536 1.00 84.81  ? 208  TYR B HE1  1 
ATOM   9328  H  HE2  . TYR B 2 208 ? 24.600  32.835  -18.059 1.00 88.81  ? 208  TYR B HE2  1 
ATOM   9329  H  HH   . TYR B 2 208 ? 25.208  34.182  -19.772 1.00 91.40  ? 208  TYR B HH   1 
ATOM   9330  N  N    . VAL B 2 209 ? 23.065  34.533  -11.227 1.00 53.92  ? 209  VAL B N    1 
ATOM   9331  C  CA   . VAL B 2 209 ? 22.731  34.504  -9.816  1.00 65.81  ? 209  VAL B CA   1 
ATOM   9332  C  C    . VAL B 2 209 ? 22.058  33.186  -9.443  1.00 76.28  ? 209  VAL B C    1 
ATOM   9333  O  O    . VAL B 2 209 ? 21.142  32.744  -10.132 1.00 69.16  ? 209  VAL B O    1 
ATOM   9334  C  CB   . VAL B 2 209 ? 21.800  35.675  -9.443  1.00 67.85  ? 209  VAL B CB   1 
ATOM   9335  C  CG1  . VAL B 2 209 ? 21.779  35.867  -7.941  1.00 66.21  ? 209  VAL B CG1  1 
ATOM   9336  C  CG2  . VAL B 2 209 ? 22.257  36.958  -10.126 1.00 60.67  ? 209  VAL B CG2  1 
ATOM   9337  H  H    . VAL B 2 209 ? 22.388  34.628  -11.748 1.00 64.71  ? 209  VAL B H    1 
ATOM   9338  H  HA   . VAL B 2 209 ? 23.545  34.587  -9.295  1.00 78.97  ? 209  VAL B HA   1 
ATOM   9339  H  HB   . VAL B 2 209 ? 20.898  35.475  -9.739  1.00 81.41  ? 209  VAL B HB   1 
ATOM   9340  H  HG11 . VAL B 2 209 ? 22.679  36.062  -7.636  1.00 79.46  ? 209  VAL B HG11 1 
ATOM   9341  H  HG12 . VAL B 2 209 ? 21.189  36.607  -7.727  1.00 79.46  ? 209  VAL B HG12 1 
ATOM   9342  H  HG13 . VAL B 2 209 ? 21.456  35.054  -7.524  1.00 79.46  ? 209  VAL B HG13 1 
ATOM   9343  H  HG21 . VAL B 2 209 ? 22.237  36.829  -11.087 1.00 72.80  ? 209  VAL B HG21 1 
ATOM   9344  H  HG22 . VAL B 2 209 ? 21.657  37.679  -9.877  1.00 72.80  ? 209  VAL B HG22 1 
ATOM   9345  H  HG23 . VAL B 2 209 ? 23.160  37.165  -9.838  1.00 72.80  ? 209  VAL B HG23 1 
ATOM   9346  N  N    . PRO B 2 210 ? 22.504  32.554  -8.345  1.00 75.51  ? 210  PRO B N    1 
ATOM   9347  C  CA   . PRO B 2 210 ? 21.776  31.388  -7.840  1.00 79.99  ? 210  PRO B CA   1 
ATOM   9348  C  C    . PRO B 2 210 ? 20.447  31.823  -7.244  1.00 91.97  ? 210  PRO B C    1 
ATOM   9349  O  O    . PRO B 2 210 ? 20.254  33.017  -7.029  1.00 96.62  ? 210  PRO B O    1 
ATOM   9350  C  CB   . PRO B 2 210 ? 22.712  30.812  -6.778  1.00 85.68  ? 210  PRO B CB   1 
ATOM   9351  C  CG   . PRO B 2 210 ? 23.569  31.945  -6.376  1.00 86.16  ? 210  PRO B CG   1 
ATOM   9352  C  CD   . PRO B 2 210 ? 23.763  32.761  -7.616  1.00 71.58  ? 210  PRO B CD   1 
ATOM   9353  H  HA   . PRO B 2 210 ? 21.629  30.737  -8.544  1.00 95.99  ? 210  PRO B HA   1 
ATOM   9354  H  HB2  . PRO B 2 210 ? 22.193  30.489  -6.024  1.00 102.81 ? 210  PRO B HB2  1 
ATOM   9355  H  HB3  . PRO B 2 210 ? 23.243  30.097  -7.162  1.00 102.81 ? 210  PRO B HB3  1 
ATOM   9356  H  HG2  . PRO B 2 210 ? 23.120  32.465  -5.691  1.00 103.40 ? 210  PRO B HG2  1 
ATOM   9357  H  HG3  . PRO B 2 210 ? 24.419  31.610  -6.050  1.00 103.40 ? 210  PRO B HG3  1 
ATOM   9358  H  HD2  . PRO B 2 210 ? 23.876  33.698  -7.392  1.00 85.89  ? 210  PRO B HD2  1 
ATOM   9359  H  HD3  . PRO B 2 210 ? 24.513  32.424  -8.131  1.00 85.89  ? 210  PRO B HD3  1 
ATOM   9360  N  N    . LEU B 2 211 ? 19.562  30.878  -6.950  1.00 95.16  ? 211  LEU B N    1 
ATOM   9361  C  CA   . LEU B 2 211 ? 18.268  31.217  -6.375  1.00 91.07  ? 211  LEU B CA   1 
ATOM   9362  C  C    . LEU B 2 211 ? 18.423  31.670  -4.925  1.00 92.62  ? 211  LEU B C    1 
ATOM   9363  O  O    . LEU B 2 211 ? 17.629  32.473  -4.443  1.00 95.50  ? 211  LEU B O    1 
ATOM   9364  C  CB   . LEU B 2 211 ? 17.320  30.024  -6.456  1.00 94.69  ? 211  LEU B CB   1 
ATOM   9365  C  CG   . LEU B 2 211 ? 15.947  30.221  -5.820  1.00 93.99  ? 211  LEU B CG   1 
ATOM   9366  C  CD1  . LEU B 2 211 ? 15.165  31.249  -6.612  1.00 90.20  ? 211  LEU B CD1  1 
ATOM   9367  C  CD2  . LEU B 2 211 ? 15.210  28.895  -5.749  1.00 103.02 ? 211  LEU B CD2  1 
ATOM   9368  H  H    . LEU B 2 211 ? 19.686  30.036  -7.074  1.00 114.19 ? 211  LEU B H    1 
ATOM   9369  H  HA   . LEU B 2 211 ? 17.878  31.948  -6.880  1.00 109.29 ? 211  LEU B HA   1 
ATOM   9370  H  HB2  . LEU B 2 211 ? 17.178  29.809  -7.391  1.00 113.63 ? 211  LEU B HB2  1 
ATOM   9371  H  HB3  . LEU B 2 211 ? 17.739  29.270  -6.012  1.00 113.63 ? 211  LEU B HB3  1 
ATOM   9372  H  HG   . LEU B 2 211 ? 16.058  30.556  -4.917  1.00 112.79 ? 211  LEU B HG   1 
ATOM   9373  H  HD11 . LEU B 2 211 ? 15.061  30.933  -7.523  1.00 108.24 ? 211  LEU B HD11 1 
ATOM   9374  H  HD12 . LEU B 2 211 ? 14.294  31.368  -6.201  1.00 108.24 ? 211  LEU B HD12 1 
ATOM   9375  H  HD13 . LEU B 2 211 ? 15.651  32.089  -6.606  1.00 108.24 ? 211  LEU B HD13 1 
ATOM   9376  H  HD21 . LEU B 2 211 ? 15.728  28.275  -5.212  1.00 123.62 ? 211  LEU B HD21 1 
ATOM   9377  H  HD22 . LEU B 2 211 ? 14.340  29.039  -5.343  1.00 123.62 ? 211  LEU B HD22 1 
ATOM   9378  H  HD23 . LEU B 2 211 ? 15.102  28.545  -6.647  1.00 123.62 ? 211  LEU B HD23 1 
ATOM   9379  N  N    . LYS B 2 212 ? 19.429  31.147  -4.230  1.00 88.21  ? 212  LYS B N    1 
ATOM   9380  C  CA   . LYS B 2 212 ? 19.666  31.518  -2.835  1.00 97.14  ? 212  LYS B CA   1 
ATOM   9381  C  C    . LYS B 2 212 ? 19.951  33.013  -2.723  1.00 99.13  ? 212  LYS B C    1 
ATOM   9382  O  O    . LYS B 2 212 ? 19.499  33.674  -1.786  1.00 106.41 ? 212  LYS B O    1 
ATOM   9383  C  CB   . LYS B 2 212 ? 20.831  30.720  -2.226  1.00 93.67  ? 212  LYS B CB   1 
ATOM   9384  C  CG   . LYS B 2 212 ? 20.757  29.216  -2.444  1.00 113.05 ? 212  LYS B CG   1 
ATOM   9385  C  CD   . LYS B 2 212 ? 22.022  28.508  -1.983  1.00 127.87 ? 212  LYS B CD   1 
ATOM   9386  C  CE   . LYS B 2 212 ? 21.956  27.014  -2.286  1.00 141.02 ? 212  LYS B CE   1 
ATOM   9387  N  NZ   . LYS B 2 212 ? 23.203  26.289  -1.904  1.00 135.13 ? 212  LYS B NZ   1 
ATOM   9388  H  H    . LYS B 2 212 ? 19.990  30.575  -4.542  1.00 105.86 ? 212  LYS B H    1 
ATOM   9389  H  HA   . LYS B 2 212 ? 18.869  31.325  -2.317  1.00 116.56 ? 212  LYS B HA   1 
ATOM   9390  H  HB2  . LYS B 2 212 ? 21.660  31.032  -2.621  1.00 112.40 ? 212  LYS B HB2  1 
ATOM   9391  H  HB3  . LYS B 2 212 ? 20.847  30.876  -1.269  1.00 112.40 ? 212  LYS B HB3  1 
ATOM   9392  H  HG2  . LYS B 2 212 ? 20.009  28.858  -1.940  1.00 135.65 ? 212  LYS B HG2  1 
ATOM   9393  H  HG3  . LYS B 2 212 ? 20.638  29.038  -3.390  1.00 135.65 ? 212  LYS B HG3  1 
ATOM   9394  H  HD2  . LYS B 2 212 ? 22.787  28.880  -2.449  1.00 153.45 ? 212  LYS B HD2  1 
ATOM   9395  H  HD3  . LYS B 2 212 ? 22.123  28.621  -1.025  1.00 153.45 ? 212  LYS B HD3  1 
ATOM   9396  H  HE2  . LYS B 2 212 ? 21.219  26.624  -1.791  1.00 169.22 ? 212  LYS B HE2  1 
ATOM   9397  H  HE3  . LYS B 2 212 ? 21.818  26.891  -3.238  1.00 169.22 ? 212  LYS B HE3  1 
ATOM   9398  H  HZ1  . LYS B 2 212 ? 23.351  26.378  -1.031  1.00 162.15 ? 212  LYS B HZ1  1 
ATOM   9399  H  HZ2  . LYS B 2 212 ? 23.123  25.424  -2.097  1.00 162.15 ? 212  LYS B HZ2  1 
ATOM   9400  H  HZ3  . LYS B 2 212 ? 23.897  26.621  -2.351  1.00 162.15 ? 212  LYS B HZ3  1 
ATOM   9401  N  N    . ASP B 2 213 ? 20.657  33.550  -3.714  1.00 95.94  ? 213  ASP B N    1 
ATOM   9402  C  CA   . ASP B 2 213 ? 21.124  34.932  -3.663  1.00 95.28  ? 213  ASP B CA   1 
ATOM   9403  C  C    . ASP B 2 213 ? 20.184  35.906  -4.358  1.00 92.23  ? 213  ASP B C    1 
ATOM   9404  O  O    . ASP B 2 213 ? 20.295  37.118  -4.172  1.00 99.08  ? 213  ASP B O    1 
ATOM   9405  C  CB   . ASP B 2 213 ? 22.521  35.026  -4.278  1.00 76.14  ? 213  ASP B CB   1 
ATOM   9406  C  CG   . ASP B 2 213 ? 23.551  34.244  -3.490  1.00 95.60  ? 213  ASP B CG   1 
ATOM   9407  O  OD1  . ASP B 2 213 ? 23.400  34.139  -2.250  1.00 99.78  ? 213  ASP B OD1  1 
ATOM   9408  O  OD2  . ASP B 2 213 ? 24.509  33.728  -4.106  1.00 97.65  ? 213  ASP B OD2  1 
ATOM   9409  H  H    . ASP B 2 213 ? 20.880  33.132  -4.431  1.00 115.13 ? 213  ASP B H    1 
ATOM   9410  H  HA   . ASP B 2 213 ? 21.193  35.202  -2.734  1.00 114.33 ? 213  ASP B HA   1 
ATOM   9411  H  HB2  . ASP B 2 213 ? 22.495  34.668  -5.179  1.00 91.37  ? 213  ASP B HB2  1 
ATOM   9412  H  HB3  . ASP B 2 213 ? 22.797  35.956  -4.297  1.00 91.37  ? 213  ASP B HB3  1 
ATOM   9413  N  N    . ILE B 2 214 ? 19.277  35.399  -5.180  1.00 97.23  ? 214  ILE B N    1 
ATOM   9414  C  CA   . ILE B 2 214 ? 18.334  36.288  -5.833  1.00 97.08  ? 214  ILE B CA   1 
ATOM   9415  C  C    . ILE B 2 214 ? 17.360  36.804  -4.772  1.00 95.30  ? 214  ILE B C    1 
ATOM   9416  O  O    . ILE B 2 214 ? 16.660  37.792  -4.970  1.00 89.22  ? 214  ILE B O    1 
ATOM   9417  C  CB   . ILE B 2 214 ? 17.594  35.558  -6.962  1.00 89.67  ? 214  ILE B CB   1 
ATOM   9418  C  CG1  . ILE B 2 214 ? 17.236  36.526  -8.083  1.00 93.10  ? 214  ILE B CG1  1 
ATOM   9419  C  CG2  . ILE B 2 214 ? 16.350  34.831  -6.420  1.00 98.23  ? 214  ILE B CG2  1 
ATOM   9420  C  CD1  . ILE B 2 214 ? 16.648  35.831  -9.268  1.00 88.60  ? 214  ILE B CD1  1 
ATOM   9421  H  H    . ILE B 2 214 ? 19.188  34.566  -5.372  1.00 116.68 ? 214  ILE B H    1 
ATOM   9422  H  HA   . ILE B 2 214 ? 18.808  37.044  -6.213  1.00 116.49 ? 214  ILE B HA   1 
ATOM   9423  H  HB   . ILE B 2 214 ? 18.194  34.889  -7.326  1.00 107.60 ? 214  ILE B HB   1 
ATOM   9424  H  HG12 . ILE B 2 214 ? 16.585  37.166  -7.755  1.00 111.72 ? 214  ILE B HG12 1 
ATOM   9425  H  HG13 . ILE B 2 214 ? 18.039  36.987  -8.372  1.00 111.72 ? 214  ILE B HG13 1 
ATOM   9426  H  HG21 . ILE B 2 214 ? 15.753  35.482  -6.020  1.00 117.88 ? 214  ILE B HG21 1 
ATOM   9427  H  HG22 . ILE B 2 214 ? 15.904  34.379  -7.154  1.00 117.88 ? 214  ILE B HG22 1 
ATOM   9428  H  HG23 . ILE B 2 214 ? 16.628  34.183  -5.753  1.00 117.88 ? 214  ILE B HG23 1 
ATOM   9429  H  HD11 . ILE B 2 214 ? 15.839  35.371  -8.994  1.00 106.32 ? 214  ILE B HD11 1 
ATOM   9430  H  HD12 . ILE B 2 214 ? 16.439  36.490  -9.949  1.00 106.32 ? 214  ILE B HD12 1 
ATOM   9431  H  HD13 . ILE B 2 214 ? 17.292  35.193  -9.612  1.00 106.32 ? 214  ILE B HD13 1 
ATOM   9432  N  N    . VAL B 2 215 ? 17.363  36.122  -3.633  1.00 98.11  ? 215  VAL B N    1 
ATOM   9433  C  CA   . VAL B 2 215 ? 16.561  36.484  -2.476  1.00 108.47 ? 215  VAL B CA   1 
ATOM   9434  C  C    . VAL B 2 215 ? 17.008  37.839  -1.941  1.00 107.82 ? 215  VAL B C    1 
ATOM   9435  O  O    . VAL B 2 215 ? 16.199  38.742  -1.721  1.00 109.18 ? 215  VAL B O    1 
ATOM   9436  C  CB   . VAL B 2 215 ? 16.671  35.423  -1.366  1.00 112.30 ? 215  VAL B CB   1 
ATOM   9437  C  CG1  . VAL B 2 215 ? 15.823  35.806  -0.163  1.00 112.96 ? 215  VAL B CG1  1 
ATOM   9438  C  CG2  . VAL B 2 215 ? 16.255  34.062  -1.901  1.00 105.98 ? 215  VAL B CG2  1 
ATOM   9439  H  H    . VAL B 2 215 ? 17.840  35.418  -3.504  1.00 117.74 ? 215  VAL B H    1 
ATOM   9440  H  HA   . VAL B 2 215 ? 15.630  36.553  -2.740  1.00 130.17 ? 215  VAL B HA   1 
ATOM   9441  H  HB   . VAL B 2 215 ? 17.595  35.363  -1.076  1.00 134.76 ? 215  VAL B HB   1 
ATOM   9442  H  HG11 . VAL B 2 215 ? 14.896  35.877  -0.440  1.00 135.55 ? 215  VAL B HG11 1 
ATOM   9443  H  HG12 . VAL B 2 215 ? 15.913  35.120  0.517   1.00 135.55 ? 215  VAL B HG12 1 
ATOM   9444  H  HG13 . VAL B 2 215 ? 16.131  36.658  0.183   1.00 135.55 ? 215  VAL B HG13 1 
ATOM   9445  H  HG21 . VAL B 2 215 ? 16.838  33.821  -2.637  1.00 127.17 ? 215  VAL B HG21 1 
ATOM   9446  H  HG22 . VAL B 2 215 ? 16.330  33.407  -1.190  1.00 127.17 ? 215  VAL B HG22 1 
ATOM   9447  H  HG23 . VAL B 2 215 ? 15.336  34.112  -2.209  1.00 127.17 ? 215  VAL B HG23 1 
ATOM   9448  N  N    . ALA B 2 216 ? 18.321  37.967  -1.772  1.00 92.16  ? 216  ALA B N    1 
ATOM   9449  C  CA   . ALA B 2 216 ? 18.933  39.152  -1.188  1.00 93.73  ? 216  ALA B CA   1 
ATOM   9450  C  C    . ALA B 2 216 ? 18.573  40.437  -1.930  1.00 103.61 ? 216  ALA B C    1 
ATOM   9451  O  O    . ALA B 2 216 ? 18.482  41.507  -1.321  1.00 115.66 ? 216  ALA B O    1 
ATOM   9452  C  CB   . ALA B 2 216 ? 20.434  38.981  -1.164  1.00 95.01  ? 216  ALA B CB   1 
ATOM   9453  H  H    . ALA B 2 216 ? 18.892  37.364  -1.995  1.00 110.59 ? 216  ALA B H    1 
ATOM   9454  H  HA   . ALA B 2 216 ? 18.628  39.242  -0.271  1.00 112.47 ? 216  ALA B HA   1 
ATOM   9455  H  HB1  . ALA B 2 216 ? 20.753  38.862  -2.072  1.00 114.01 ? 216  ALA B HB1  1 
ATOM   9456  H  HB2  . ALA B 2 216 ? 20.835  39.773  -0.773  1.00 114.01 ? 216  ALA B HB2  1 
ATOM   9457  H  HB3  . ALA B 2 216 ? 20.654  38.201  -0.630  1.00 114.01 ? 216  ALA B HB3  1 
ATOM   9458  N  N    . ILE B 2 217 ? 18.352  40.331  -3.234  1.00 88.50  ? 217  ILE B N    1 
ATOM   9459  C  CA   . ILE B 2 217 ? 18.041  41.494  -4.052  1.00 91.66  ? 217  ILE B CA   1 
ATOM   9460  C  C    . ILE B 2 217 ? 16.740  42.146  -3.571  1.00 105.84 ? 217  ILE B C    1 
ATOM   9461  O  O    . ILE B 2 217 ? 16.715  43.324  -3.165  1.00 115.51 ? 217  ILE B O    1 
ATOM   9462  C  CB   . ILE B 2 217 ? 17.926  41.086  -5.524  1.00 84.85  ? 217  ILE B CB   1 
ATOM   9463  C  CG1  . ILE B 2 217 ? 19.302  40.636  -6.031  1.00 85.79  ? 217  ILE B CG1  1 
ATOM   9464  C  CG2  . ILE B 2 217 ? 17.360  42.232  -6.366  1.00 94.44  ? 217  ILE B CG2  1 
ATOM   9465  C  CD1  . ILE B 2 217 ? 19.336  40.216  -7.498  1.00 91.96  ? 217  ILE B CD1  1 
ATOM   9466  H  H    . ILE B 2 217 ? 18.377  39.591  -3.672  1.00 106.20 ? 217  ILE B H    1 
ATOM   9467  H  HA   . ILE B 2 217 ? 18.756  42.144  -3.971  1.00 109.99 ? 217  ILE B HA   1 
ATOM   9468  H  HB   . ILE B 2 217 ? 17.317  40.334  -5.585  1.00 101.82 ? 217  ILE B HB   1 
ATOM   9469  H  HG12 . ILE B 2 217 ? 19.927  41.369  -5.921  1.00 102.95 ? 217  ILE B HG12 1 
ATOM   9470  H  HG13 . ILE B 2 217 ? 19.593  39.877  -5.502  1.00 102.95 ? 217  ILE B HG13 1 
ATOM   9471  H  HG21 . ILE B 2 217 ? 17.952  42.997  -6.296  1.00 113.32 ? 217  ILE B HG21 1 
ATOM   9472  H  HG22 . ILE B 2 217 ? 17.299  41.944  -7.291  1.00 113.32 ? 217  ILE B HG22 1 
ATOM   9473  H  HG23 . ILE B 2 217 ? 16.479  42.464  -6.033  1.00 113.32 ? 217  ILE B HG23 1 
ATOM   9474  H  HD11 . ILE B 2 217 ? 19.063  40.967  -8.047  1.00 110.35 ? 217  ILE B HD11 1 
ATOM   9475  H  HD12 . ILE B 2 217 ? 20.240  39.949  -7.728  1.00 110.35 ? 217  ILE B HD12 1 
ATOM   9476  H  HD13 . ILE B 2 217 ? 18.728  39.472  -7.627  1.00 110.35 ? 217  ILE B HD13 1 
ATOM   9477  N  N    . ILE B 2 218 ? 15.669  41.358  -3.583  1.00 105.47 ? 218  ILE B N    1 
ATOM   9478  C  CA   . ILE B 2 218 ? 14.369  41.823  -3.117  1.00 107.07 ? 218  ILE B CA   1 
ATOM   9479  C  C    . ILE B 2 218 ? 14.423  42.048  -1.606  1.00 107.20 ? 218  ILE B C    1 
ATOM   9480  O  O    . ILE B 2 218 ? 13.765  42.949  -1.070  1.00 107.73 ? 218  ILE B O    1 
ATOM   9481  C  CB   . ILE B 2 218 ? 13.249  40.813  -3.456  1.00 99.88  ? 218  ILE B CB   1 
ATOM   9482  C  CG1  . ILE B 2 218 ? 13.641  39.399  -3.005  1.00 92.52  ? 218  ILE B CG1  1 
ATOM   9483  C  CG2  . ILE B 2 218 ? 12.941  40.858  -4.956  1.00 107.71 ? 218  ILE B CG2  1 
ATOM   9484  C  CD1  . ILE B 2 218 ? 12.604  38.336  -3.294  1.00 113.21 ? 218  ILE B CD1  1 
ATOM   9485  H  H    . ILE B 2 218 ? 15.670  40.543  -3.859  1.00 126.56 ? 218  ILE B H    1 
ATOM   9486  H  HA   . ILE B 2 218 ? 14.158  42.668  -3.545  1.00 128.49 ? 218  ILE B HA   1 
ATOM   9487  H  HB   . ILE B 2 218 ? 12.448  41.075  -2.974  1.00 119.85 ? 218  ILE B HB   1 
ATOM   9488  H  HG12 . ILE B 2 218 ? 14.458  39.144  -3.461  1.00 111.03 ? 218  ILE B HG12 1 
ATOM   9489  H  HG13 . ILE B 2 218 ? 13.791  39.410  -2.047  1.00 111.03 ? 218  ILE B HG13 1 
ATOM   9490  H  HG21 . ILE B 2 218 ? 13.744  40.628  -5.449  1.00 129.26 ? 218  ILE B HG21 1 
ATOM   9491  H  HG22 . ILE B 2 218 ? 12.237  40.220  -5.153  1.00 129.26 ? 218  ILE B HG22 1 
ATOM   9492  H  HG23 . ILE B 2 218 ? 12.652  41.753  -5.192  1.00 129.26 ? 218  ILE B HG23 1 
ATOM   9493  H  HD11 . ILE B 2 218 ? 12.449  38.298  -4.250  1.00 135.86 ? 218  ILE B HD11 1 
ATOM   9494  H  HD12 . ILE B 2 218 ? 12.934  37.481  -2.977  1.00 135.86 ? 218  ILE B HD12 1 
ATOM   9495  H  HD13 . ILE B 2 218 ? 11.781  38.565  -2.834  1.00 135.86 ? 218  ILE B HD13 1 
ATOM   9496  N  N    . LEU B 2 219 ? 15.252  41.257  -0.933  1.00 101.86 ? 219  LEU B N    1 
ATOM   9497  C  CA   . LEU B 2 219 ? 15.426  41.388  0.507   1.00 110.45 ? 219  LEU B CA   1 
ATOM   9498  C  C    . LEU B 2 219 ? 15.993  42.759  0.860   1.00 119.73 ? 219  LEU B C    1 
ATOM   9499  O  O    . LEU B 2 219 ? 15.597  43.362  1.855   1.00 121.85 ? 219  LEU B O    1 
ATOM   9500  C  CB   . LEU B 2 219 ? 16.347  40.281  1.028   1.00 113.35 ? 219  LEU B CB   1 
ATOM   9501  C  CG   . LEU B 2 219 ? 16.595  40.163  2.534   1.00 125.04 ? 219  LEU B CG   1 
ATOM   9502  C  CD1  . LEU B 2 219 ? 15.320  39.817  3.278   1.00 126.23 ? 219  LEU B CD1  1 
ATOM   9503  C  CD2  . LEU B 2 219 ? 17.666  39.112  2.803   1.00 115.39 ? 219  LEU B CD2  1 
ATOM   9504  H  H    . LEU B 2 219 ? 15.726  40.634  -1.289  1.00 122.24 ? 219  LEU B H    1 
ATOM   9505  H  HA   . LEU B 2 219 ? 14.564  41.295  0.942   1.00 132.54 ? 219  LEU B HA   1 
ATOM   9506  H  HB2  . LEU B 2 219 ? 15.978  39.431  0.739   1.00 136.02 ? 219  LEU B HB2  1 
ATOM   9507  H  HB3  . LEU B 2 219 ? 17.216  40.402  0.612   1.00 136.02 ? 219  LEU B HB3  1 
ATOM   9508  H  HG   . LEU B 2 219 ? 16.918  41.014  2.869   1.00 150.05 ? 219  LEU B HG   1 
ATOM   9509  H  HD11 . LEU B 2 219 ? 14.983  38.969  2.950   1.00 151.48 ? 219  LEU B HD11 1 
ATOM   9510  H  HD12 . LEU B 2 219 ? 15.516  39.751  4.226   1.00 151.48 ? 219  LEU B HD12 1 
ATOM   9511  H  HD13 . LEU B 2 219 ? 14.665  40.515  3.123   1.00 151.48 ? 219  LEU B HD13 1 
ATOM   9512  H  HD21 . LEU B 2 219 ? 18.487  39.377  2.360   1.00 138.47 ? 219  LEU B HD21 1 
ATOM   9513  H  HD22 . LEU B 2 219 ? 17.812  39.048  3.760   1.00 138.47 ? 219  LEU B HD22 1 
ATOM   9514  H  HD23 . LEU B 2 219 ? 17.364  38.258  2.457   1.00 138.47 ? 219  LEU B HD23 1 
ATOM   9515  N  N    . ASN B 2 220 ? 16.898  43.265  0.031   1.00 115.63 ? 220  ASN B N    1 
ATOM   9516  C  CA   . ASN B 2 220 ? 17.514  44.557  0.300   1.00 106.00 ? 220  ASN B CA   1 
ATOM   9517  C  C    . ASN B 2 220 ? 16.639  45.707  -0.214  1.00 106.85 ? 220  ASN B C    1 
ATOM   9518  O  O    . ASN B 2 220 ? 16.556  46.787  0.401   1.00 116.91 ? 220  ASN B O    1 
ATOM   9519  C  CB   . ASN B 2 220 ? 18.902  44.610  -0.333  1.00 114.66 ? 220  ASN B CB   1 
ATOM   9520  C  CG   . ASN B 2 220 ? 19.780  45.692  0.270   1.00 134.43 ? 220  ASN B CG   1 
ATOM   9521  O  OD1  . ASN B 2 220 ? 19.790  45.898  1.487   1.00 139.24 ? 220  ASN B OD1  1 
ATOM   9522  N  ND2  . ASN B 2 220 ? 20.514  46.397  -0.581  1.00 121.24 ? 220  ASN B ND2  1 
ATOM   9523  H  H    . ASN B 2 220 ? 17.172  42.884  -0.690  1.00 138.76 ? 220  ASN B H    1 
ATOM   9524  H  HA   . ASN B 2 220 ? 17.617  44.664  1.259   1.00 127.20 ? 220  ASN B HA   1 
ATOM   9525  H  HB2  . ASN B 2 220 ? 19.344  43.757  -0.200  1.00 137.59 ? 220  ASN B HB2  1 
ATOM   9526  H  HB3  . ASN B 2 220 ? 18.810  44.792  -1.281  1.00 137.59 ? 220  ASN B HB3  1 
ATOM   9527  H  HD21 . ASN B 2 220 ? 20.476  46.229  -1.424  1.00 145.48 ? 220  ASN B HD21 1 
ATOM   9528  H  HD22 . ASN B 2 220 ? 21.029  47.021  -0.290  1.00 145.48 ? 220  ASN B HD22 1 
ATOM   9529  N  N    . GLU B 2 221 ? 15.942  45.467  -1.321  1.00 103.45 ? 221  GLU B N    1 
ATOM   9530  C  CA   . GLU B 2 221 ? 15.040  46.492  -1.849  1.00 106.05 ? 221  GLU B CA   1 
ATOM   9531  C  C    . GLU B 2 221 ? 13.838  46.711  -0.915  1.00 111.51 ? 221  GLU B C    1 
ATOM   9532  O  O    . GLU B 2 221 ? 13.323  47.842  -0.775  1.00 116.23 ? 221  GLU B O    1 
ATOM   9533  C  CB   . GLU B 2 221 ? 14.573  46.107  -3.250  1.00 110.11 ? 221  GLU B CB   1 
ATOM   9534  C  CG   . GLU B 2 221 ? 13.753  47.180  -3.942  1.00 123.01 ? 221  GLU B CG   1 
ATOM   9535  C  CD   . GLU B 2 221 ? 13.200  46.726  -5.280  1.00 130.77 ? 221  GLU B CD   1 
ATOM   9536  O  OE1  . GLU B 2 221 ? 13.643  45.673  -5.794  1.00 119.99 ? 221  GLU B OE1  1 
ATOM   9537  O  OE2  . GLU B 2 221 ? 12.316  47.426  -5.817  1.00 139.30 ? 221  GLU B OE2  1 
ATOM   9538  H  H    . GLU B 2 221 ? 15.970  44.738  -1.777  1.00 124.15 ? 221  GLU B H    1 
ATOM   9539  H  HA   . GLU B 2 221 ? 15.522  47.331  -1.916  1.00 127.26 ? 221  GLU B HA   1 
ATOM   9540  H  HB2  . GLU B 2 221 ? 15.352  45.928  -3.800  1.00 132.13 ? 221  GLU B HB2  1 
ATOM   9541  H  HB3  . GLU B 2 221 ? 14.025  45.309  -3.187  1.00 132.13 ? 221  GLU B HB3  1 
ATOM   9542  H  HG2  . GLU B 2 221 ? 13.004  47.420  -3.375  1.00 147.61 ? 221  GLU B HG2  1 
ATOM   9543  H  HG3  . GLU B 2 221 ? 14.314  47.956  -4.097  1.00 147.61 ? 221  GLU B HG3  1 
ATOM   9544  N  N    . PHE B 2 222 ? 13.429  45.646  -0.229  1.00 109.32 ? 222  PHE B N    1 
ATOM   9545  C  CA   . PHE B 2 222 ? 12.372  45.765  0.765   1.00 111.82 ? 222  PHE B CA   1 
ATOM   9546  C  C    . PHE B 2 222 ? 12.915  46.631  1.910   1.00 108.34 ? 222  PHE B C    1 
ATOM   9547  O  O    . PHE B 2 222 ? 12.231  47.535  2.397   1.00 103.82 ? 222  PHE B O    1 
ATOM   9548  C  CB   . PHE B 2 222 ? 11.916  44.394  1.273   1.00 111.12 ? 222  PHE B CB   1 
ATOM   9549  C  CG   . PHE B 2 222 ? 10.919  44.472  2.402   1.00 127.92 ? 222  PHE B CG   1 
ATOM   9550  C  CD1  . PHE B 2 222 ? 9.587   44.761  2.140   1.00 119.95 ? 222  PHE B CD1  1 
ATOM   9551  C  CD2  . PHE B 2 222 ? 11.311  44.266  3.720   1.00 123.97 ? 222  PHE B CD2  1 
ATOM   9552  C  CE1  . PHE B 2 222 ? 8.660   44.842  3.171   1.00 127.59 ? 222  PHE B CE1  1 
ATOM   9553  C  CE2  . PHE B 2 222 ? 10.391  44.346  4.759   1.00 110.75 ? 222  PHE B CE2  1 
ATOM   9554  C  CZ   . PHE B 2 222 ? 9.064   44.635  4.484   1.00 116.39 ? 222  PHE B CZ   1 
ATOM   9555  H  H    . PHE B 2 222 ? 13.746  44.852  -0.320  1.00 131.18 ? 222  PHE B H    1 
ATOM   9556  H  HA   . PHE B 2 222 ? 11.609  46.217  0.373   1.00 134.19 ? 222  PHE B HA   1 
ATOM   9557  H  HB2  . PHE B 2 222 ? 11.500  43.912  0.542   1.00 133.35 ? 222  PHE B HB2  1 
ATOM   9558  H  HB3  . PHE B 2 222 ? 12.690  43.905  1.593   1.00 133.35 ? 222  PHE B HB3  1 
ATOM   9559  H  HD1  . PHE B 2 222 ? 9.312   44.902  1.263   1.00 143.94 ? 222  PHE B HD1  1 
ATOM   9560  H  HD2  . PHE B 2 222 ? 12.201  44.075  3.909   1.00 148.76 ? 222  PHE B HD2  1 
ATOM   9561  H  HE1  . PHE B 2 222 ? 7.770   45.035  2.983   1.00 153.10 ? 222  PHE B HE1  1 
ATOM   9562  H  HE2  . PHE B 2 222 ? 10.665  44.206  5.637   1.00 132.90 ? 222  PHE B HE2  1 
ATOM   9563  H  HZ   . PHE B 2 222 ? 8.445   44.686  5.176   1.00 139.67 ? 222  PHE B HZ   1 
ATOM   9564  N  N    . ARG B 2 223 ? 14.149  46.354  2.328   1.00 111.70 ? 223  ARG B N    1 
ATOM   9565  C  CA   . ARG B 2 223 ? 14.806  47.144  3.369   1.00 108.10 ? 223  ARG B CA   1 
ATOM   9566  C  C    . ARG B 2 223 ? 14.799  48.621  3.023   1.00 102.22 ? 223  ARG B C    1 
ATOM   9567  O  O    . ARG B 2 223 ? 14.468  49.456  3.866   1.00 103.61 ? 223  ARG B O    1 
ATOM   9568  C  CB   . ARG B 2 223 ? 16.248  46.682  3.577   1.00 106.99 ? 223  ARG B CB   1 
ATOM   9569  C  CG   . ARG B 2 223 ? 17.083  47.649  4.394   1.00 105.83 ? 223  ARG B CG   1 
ATOM   9570  C  CD   . ARG B 2 223 ? 18.456  47.098  4.658   1.00 103.68 ? 223  ARG B CD   1 
ATOM   9571  N  NE   . ARG B 2 223 ? 18.442  46.185  5.794   1.00 111.43 ? 223  ARG B NE   1 
ATOM   9572  C  CZ   . ARG B 2 223 ? 19.506  45.525  6.238   1.00 128.10 ? 223  ARG B CZ   1 
ATOM   9573  N  NH1  . ARG B 2 223 ? 20.678  45.666  5.636   1.00 141.13 ? 223  ARG B NH1  1 
ATOM   9574  N  NH2  . ARG B 2 223 ? 19.394  44.718  7.285   1.00 125.36 ? 223  ARG B NH2  1 
ATOM   9575  H  H    . ARG B 2 223 ? 14.630  45.709  2.023   1.00 134.04 ? 223  ARG B H    1 
ATOM   9576  H  HA   . ARG B 2 223 ? 14.328  47.027  4.205   1.00 129.72 ? 223  ARG B HA   1 
ATOM   9577  H  HB2  . ARG B 2 223 ? 16.240  45.830  4.042   1.00 128.38 ? 223  ARG B HB2  1 
ATOM   9578  H  HB3  . ARG B 2 223 ? 16.673  46.581  2.711   1.00 128.38 ? 223  ARG B HB3  1 
ATOM   9579  H  HG2  . ARG B 2 223 ? 17.178  48.482  3.906   1.00 127.00 ? 223  ARG B HG2  1 
ATOM   9580  H  HG3  . ARG B 2 223 ? 16.649  47.806  5.247   1.00 127.00 ? 223  ARG B HG3  1 
ATOM   9581  H  HD2  . ARG B 2 223 ? 18.763  46.611  3.877   1.00 124.41 ? 223  ARG B HD2  1 
ATOM   9582  H  HD3  . ARG B 2 223 ? 19.063  47.828  4.860   1.00 124.41 ? 223  ARG B HD3  1 
ATOM   9583  H  HE   . ARG B 2 223 ? 17.696  46.065  6.203   1.00 133.72 ? 223  ARG B HE   1 
ATOM   9584  H  HH11 . ARG B 2 223 ? 20.753  46.190  4.958   1.00 169.36 ? 223  ARG B HH11 1 
ATOM   9585  H  HH12 . ARG B 2 223 ? 21.365  45.237  5.925   1.00 169.36 ? 223  ARG B HH12 1 
ATOM   9586  H  HH21 . ARG B 2 223 ? 18.634  44.623  7.676   1.00 150.44 ? 223  ARG B HH21 1 
ATOM   9587  H  HH22 . ARG B 2 223 ? 20.082  44.288  7.571   1.00 150.44 ? 223  ARG B HH22 1 
ATOM   9588  N  N    . ALA B 2 224 ? 15.131  48.947  1.778   1.00 101.93 ? 224  ALA B N    1 
ATOM   9589  C  CA   . ALA B 2 224 ? 15.170  50.353  1.373   1.00 103.44 ? 224  ALA B CA   1 
ATOM   9590  C  C    . ALA B 2 224 ? 13.762  50.951  1.476   1.00 105.70 ? 224  ALA B C    1 
ATOM   9591  O  O    . ALA B 2 224 ? 13.557  52.043  2.082   1.00 108.44 ? 224  ALA B O    1 
ATOM   9592  C  CB   . ALA B 2 224 ? 15.707  50.487  -0.045  1.00 104.76 ? 224  ALA B CB   1 
ATOM   9593  H  H    . ALA B 2 224 ? 15.335  48.387  1.158   1.00 122.32 ? 224  ALA B H    1 
ATOM   9594  H  HA   . ALA B 2 224 ? 15.756  50.844  1.970   1.00 124.13 ? 224  ALA B HA   1 
ATOM   9595  H  HB1  . ALA B 2 224 ? 15.127  49.998  -0.649  1.00 125.72 ? 224  ALA B HB1  1 
ATOM   9596  H  HB2  . ALA B 2 224 ? 15.723  51.426  -0.289  1.00 125.72 ? 224  ALA B HB2  1 
ATOM   9597  H  HB3  . ALA B 2 224 ? 16.604  50.121  -0.079  1.00 125.72 ? 224  ALA B HB3  1 
ATOM   9598  N  N    . LYS B 2 225 ? 12.780  50.216  0.947   1.00 102.95 ? 225  LYS B N    1 
ATOM   9599  C  CA   . LYS B 2 225 ? 11.410  50.714  0.975   1.00 101.27 ? 225  LYS B CA   1 
ATOM   9600  C  C    . LYS B 2 225 ? 10.931  50.855  2.419   1.00 101.01 ? 225  LYS B C    1 
ATOM   9601  O  O    . LYS B 2 225 ? 10.109  51.721  2.726   1.00 91.96  ? 225  LYS B O    1 
ATOM   9602  C  CB   . LYS B 2 225 ? 10.465  49.782  0.221   1.00 102.28 ? 225  LYS B CB   1 
ATOM   9603  C  CG   . LYS B 2 225 ? 10.576  49.845  -1.285  1.00 116.02 ? 225  LYS B CG   1 
ATOM   9604  C  CD   . LYS B 2 225 ? 9.279   49.376  -1.913  1.00 117.97 ? 225  LYS B CD   1 
ATOM   9605  C  CE   . LYS B 2 225 ? 9.272   49.567  -3.413  1.00 122.77 ? 225  LYS B CE   1 
ATOM   9606  N  NZ   . LYS B 2 225 ? 7.959   49.170  -3.991  1.00 139.43 ? 225  LYS B NZ   1 
ATOM   9607  H  H    . LYS B 2 225 ? 12.880  49.446  0.577   1.00 123.54 ? 225  LYS B H    1 
ATOM   9608  H  HA   . LYS B 2 225 ? 11.377  51.588  0.555   1.00 121.53 ? 225  LYS B HA   1 
ATOM   9609  H  HB2  . LYS B 2 225 ? 10.652  48.869  0.491   1.00 122.74 ? 225  LYS B HB2  1 
ATOM   9610  H  HB3  . LYS B 2 225 ? 9.552   50.010  0.457   1.00 122.74 ? 225  LYS B HB3  1 
ATOM   9611  H  HG2  . LYS B 2 225 ? 10.741  50.760  -1.561  1.00 139.22 ? 225  LYS B HG2  1 
ATOM   9612  H  HG3  . LYS B 2 225 ? 11.293  49.263  -1.583  1.00 139.22 ? 225  LYS B HG3  1 
ATOM   9613  H  HD2  . LYS B 2 225 ? 9.159   48.432  -1.728  1.00 141.56 ? 225  LYS B HD2  1 
ATOM   9614  H  HD3  . LYS B 2 225 ? 8.543   49.886  -1.540  1.00 141.56 ? 225  LYS B HD3  1 
ATOM   9615  H  HE2  . LYS B 2 225 ? 9.427   50.502  -3.619  1.00 147.33 ? 225  LYS B HE2  1 
ATOM   9616  H  HE3  . LYS B 2 225 ? 9.961   49.013  -3.811  1.00 147.33 ? 225  LYS B HE3  1 
ATOM   9617  H  HZ1  . LYS B 2 225 ? 7.309   49.667  -3.640  1.00 167.31 ? 225  LYS B HZ1  1 
ATOM   9618  H  HZ2  . LYS B 2 225 ? 7.967   49.287  -4.873  1.00 167.31 ? 225  LYS B HZ2  1 
ATOM   9619  H  HZ3  . LYS B 2 225 ? 7.795   48.313  -3.814  1.00 167.31 ? 225  LYS B HZ3  1 
ATOM   9620  N  N    . LEU B 2 226 ? 11.446  50.013  3.309   1.00 104.00 ? 226  LEU B N    1 
ATOM   9621  C  CA   . LEU B 2 226 ? 11.052  50.100  4.703   1.00 97.36  ? 226  LEU B CA   1 
ATOM   9622  C  C    . LEU B 2 226 ? 11.687  51.296  5.400   1.00 102.46 ? 226  LEU B C    1 
ATOM   9623  O  O    . LEU B 2 226 ? 10.995  52.108  6.029   1.00 100.76 ? 226  LEU B O    1 
ATOM   9624  C  CB   . LEU B 2 226 ? 11.453  48.820  5.444   1.00 102.21 ? 226  LEU B CB   1 
ATOM   9625  C  CG   . LEU B 2 226 ? 11.053  48.727  6.922   1.00 100.86 ? 226  LEU B CG   1 
ATOM   9626  C  CD1  . LEU B 2 226 ? 9.538   48.719  7.091   1.00 97.36  ? 226  LEU B CD1  1 
ATOM   9627  C  CD2  . LEU B 2 226 ? 11.676  47.493  7.562   1.00 84.76  ? 226  LEU B CD2  1 
ATOM   9628  H  H    . LEU B 2 226 ? 12.016  49.393  3.132   1.00 124.80 ? 226  LEU B H    1 
ATOM   9629  H  HA   . LEU B 2 226 ? 10.088  50.193  4.758   1.00 116.84 ? 226  LEU B HA   1 
ATOM   9630  H  HB2  . LEU B 2 226 ? 11.046  48.067  4.988   1.00 122.65 ? 226  LEU B HB2  1 
ATOM   9631  H  HB3  . LEU B 2 226 ? 12.419  48.736  5.402   1.00 122.65 ? 226  LEU B HB3  1 
ATOM   9632  H  HG   . LEU B 2 226 ? 11.398  49.506  7.386   1.00 121.03 ? 226  LEU B HG   1 
ATOM   9633  H  HD11 . LEU B 2 226 ? 9.172   47.953  6.621   1.00 116.83 ? 226  LEU B HD11 1 
ATOM   9634  H  HD12 . LEU B 2 226 ? 9.327   48.659  8.036   1.00 116.83 ? 226  LEU B HD12 1 
ATOM   9635  H  HD13 . LEU B 2 226 ? 9.175   49.539  6.722   1.00 116.83 ? 226  LEU B HD13 1 
ATOM   9636  H  HD21 . LEU B 2 226 ? 12.641  47.555  7.495   1.00 101.71 ? 226  LEU B HD21 1 
ATOM   9637  H  HD22 . LEU B 2 226 ? 11.410  47.453  8.494   1.00 101.71 ? 226  LEU B HD22 1 
ATOM   9638  H  HD23 . LEU B 2 226 ? 11.362  46.703  7.095   1.00 101.71 ? 226  LEU B HD23 1 
ATOM   9639  N  N    . SER B 2 227 ? 13.003  51.423  5.262   1.00 95.16  ? 227  SER B N    1 
ATOM   9640  C  CA   . SER B 2 227 ? 13.716  52.490  5.948   1.00 97.77  ? 227  SER B CA   1 
ATOM   9641  C  C    . SER B 2 227 ? 13.267  53.886  5.529   1.00 105.11 ? 227  SER B C    1 
ATOM   9642  O  O    . SER B 2 227 ? 13.205  54.802  6.371   1.00 104.88 ? 227  SER B O    1 
ATOM   9643  C  CB   . SER B 2 227 ? 15.222  52.354  5.710   1.00 93.88  ? 227  SER B CB   1 
ATOM   9644  O  OG   . SER B 2 227 ? 15.543  52.585  4.352   1.00 111.68 ? 227  SER B OG   1 
ATOM   9645  H  H    . SER B 2 227 ? 13.500  50.910  4.783   1.00 114.19 ? 227  SER B H    1 
ATOM   9646  H  HA   . SER B 2 227 ? 13.559  52.404  6.901   1.00 117.32 ? 227  SER B HA   1 
ATOM   9647  H  HB2  . SER B 2 227 ? 15.688  53.003  6.259   1.00 112.66 ? 227  SER B HB2  1 
ATOM   9648  H  HB3  . SER B 2 227 ? 15.499  51.456  5.951   1.00 112.66 ? 227  SER B HB3  1 
ATOM   9649  H  HG   . SER B 2 227 ? 15.146  52.029  3.864   1.00 134.02 ? 227  SER B HG   1 
ATOM   9650  N  N    . LYS B 2 228 ? 12.854  54.053  4.271   1.00 102.72 ? 228  LYS B N    1 
ATOM   9651  C  CA   . LYS B 2 228 ? 12.396  55.389  3.904   1.00 107.11 ? 228  LYS B CA   1 
ATOM   9652  C  C    . LYS B 2 228 ? 11.004  55.713  4.475   1.00 111.42 ? 228  LYS B C    1 
ATOM   9653  O  O    . LYS B 2 228 ? 10.803  56.784  5.080   1.00 122.44 ? 228  LYS B O    1 
ATOM   9654  C  CB   . LYS B 2 228 ? 12.395  55.546  2.388   1.00 114.49 ? 228  LYS B CB   1 
ATOM   9655  C  CG   . LYS B 2 228 ? 11.922  56.909  1.924   1.00 124.40 ? 228  LYS B CG   1 
ATOM   9656  C  CD   . LYS B 2 228 ? 11.943  57.018  0.423   1.00 124.94 ? 228  LYS B CD   1 
ATOM   9657  C  CE   . LYS B 2 228 ? 11.382  58.350  -0.031  1.00 129.99 ? 228  LYS B CE   1 
ATOM   9658  N  NZ   . LYS B 2 228 ? 11.476  58.510  -1.507  1.00 148.13 ? 228  LYS B NZ   1 
ATOM   9659  H  H    . LYS B 2 228 ? 12.830  53.455  3.653   1.00 123.27 ? 228  LYS B H    1 
ATOM   9660  H  HA   . LYS B 2 228 ? 13.019  56.039  4.266   1.00 128.53 ? 228  LYS B HA   1 
ATOM   9661  H  HB2  . LYS B 2 228 ? 13.298  55.417  2.059   1.00 137.39 ? 228  LYS B HB2  1 
ATOM   9662  H  HB3  . LYS B 2 228 ? 11.805  54.879  2.003   1.00 137.39 ? 228  LYS B HB3  1 
ATOM   9663  H  HG2  . LYS B 2 228 ? 11.011  57.051  2.227   1.00 149.28 ? 228  LYS B HG2  1 
ATOM   9664  H  HG3  . LYS B 2 228 ? 12.507  57.592  2.287   1.00 149.28 ? 228  LYS B HG3  1 
ATOM   9665  H  HD2  . LYS B 2 228 ? 12.857  56.948  0.108   1.00 149.92 ? 228  LYS B HD2  1 
ATOM   9666  H  HD3  . LYS B 2 228 ? 11.399  56.312  0.041   1.00 149.92 ? 228  LYS B HD3  1 
ATOM   9667  H  HE2  . LYS B 2 228 ? 10.448  58.407  0.222   1.00 155.99 ? 228  LYS B HE2  1 
ATOM   9668  H  HE3  . LYS B 2 228 ? 11.886  59.067  0.384   1.00 155.99 ? 228  LYS B HE3  1 
ATOM   9669  H  HZ1  . LYS B 2 228 ? 11.016  57.865  -1.912  1.00 177.76 ? 228  LYS B HZ1  1 
ATOM   9670  H  HZ2  . LYS B 2 228 ? 11.141  59.299  -1.749  1.00 177.76 ? 228  LYS B HZ2  1 
ATOM   9671  H  HZ3  . LYS B 2 228 ? 12.326  58.466  -1.764  1.00 177.76 ? 228  LYS B HZ3  1 
ATOM   9672  N  N    . ALA B 2 229 ? 10.056  54.791  4.328   1.00 104.31 ? 229  ALA B N    1 
ATOM   9673  C  CA   . ALA B 2 229 ? 8.708   55.020  4.845   1.00 108.79 ? 229  ALA B CA   1 
ATOM   9674  C  C    . ALA B 2 229 ? 8.753   55.180  6.361   1.00 115.65 ? 229  ALA B C    1 
ATOM   9675  O  O    . ALA B 2 229 ? 7.991   55.961  6.956   1.00 110.04 ? 229  ALA B O    1 
ATOM   9676  C  CB   . ALA B 2 229 ? 7.790   53.880  4.460   1.00 107.26 ? 229  ALA B CB   1 
ATOM   9677  H  H    . ALA B 2 229 ? 10.164  54.032  3.938   1.00 125.18 ? 229  ALA B H    1 
ATOM   9678  H  HA   . ALA B 2 229 ? 8.353   55.838  4.463   1.00 130.55 ? 229  ALA B HA   1 
ATOM   9679  H  HB1  . ALA B 2 229 ? 8.139   53.055  4.833   1.00 128.71 ? 229  ALA B HB1  1 
ATOM   9680  H  HB2  . ALA B 2 229 ? 6.904   54.055  4.813   1.00 128.71 ? 229  ALA B HB2  1 
ATOM   9681  H  HB3  . ALA B 2 229 ? 7.754   53.817  3.493   1.00 128.71 ? 229  ALA B HB3  1 
ATOM   9682  N  N    . LEU B 2 230 ? 9.672   54.442  6.980   1.00 113.28 ? 230  LEU B N    1 
ATOM   9683  C  CA   . LEU B 2 230 ? 9.849   54.520  8.420   1.00 106.36 ? 230  LEU B CA   1 
ATOM   9684  C  C    . LEU B 2 230 ? 10.449  55.871  8.799   1.00 109.81 ? 230  LEU B C    1 
ATOM   9685  O  O    . LEU B 2 230 ? 10.079  56.443  9.824   1.00 109.51 ? 230  LEU B O    1 
ATOM   9686  C  CB   . LEU B 2 230 ? 10.734  53.371  8.911   1.00 98.11  ? 230  LEU B CB   1 
ATOM   9687  C  CG   . LEU B 2 230 ? 10.653  52.964  10.382  1.00 95.92  ? 230  LEU B CG   1 
ATOM   9688  C  CD1  . LEU B 2 230 ? 9.214   52.725  10.828  1.00 94.36  ? 230  LEU B CD1  1 
ATOM   9689  C  CD2  . LEU B 2 230 ? 11.479  51.705  10.597  1.00 90.48  ? 230  LEU B CD2  1 
ATOM   9690  H  H    . LEU B 2 230 ? 10.203  53.891  6.587   1.00 135.94 ? 230  LEU B H    1 
ATOM   9691  H  HA   . LEU B 2 230 ? 8.984   54.442  8.852   1.00 127.63 ? 230  LEU B HA   1 
ATOM   9692  H  HB2  . LEU B 2 230 ? 10.512  52.583  8.390   1.00 117.74 ? 230  LEU B HB2  1 
ATOM   9693  H  HB3  . LEU B 2 230 ? 11.657  53.613  8.738   1.00 117.74 ? 230  LEU B HB3  1 
ATOM   9694  H  HG   . LEU B 2 230 ? 11.027  53.671  10.930  1.00 115.11 ? 230  LEU B HG   1 
ATOM   9695  H  HD11 . LEU B 2 230 ? 8.831   52.013  10.290  1.00 113.23 ? 230  LEU B HD11 1 
ATOM   9696  H  HD12 . LEU B 2 230 ? 9.212   52.470  11.764  1.00 113.23 ? 230  LEU B HD12 1 
ATOM   9697  H  HD13 . LEU B 2 230 ? 8.706   53.542  10.706  1.00 113.23 ? 230  LEU B HD13 1 
ATOM   9698  H  HD21 . LEU B 2 230 ? 12.401  51.888  10.356  1.00 108.58 ? 230  LEU B HD21 1 
ATOM   9699  H  HD22 . LEU B 2 230 ? 11.426  51.449  11.531  1.00 108.58 ? 230  LEU B HD22 1 
ATOM   9700  H  HD23 . LEU B 2 230 ? 11.125  50.996  10.038  1.00 108.58 ? 230  LEU B HD23 1 
ATOM   9701  N  N    . ALA B 2 231 ? 11.385  56.376  7.994   1.00 112.38 ? 231  ALA B N    1 
ATOM   9702  C  CA   . ALA B 2 231 ? 11.958  57.696  8.271   1.00 113.68 ? 231  ALA B CA   1 
ATOM   9703  C  C    . ALA B 2 231 ? 10.905  58.797  8.077   1.00 114.52 ? 231  ALA B C    1 
ATOM   9704  O  O    . ALA B 2 231 ? 10.914  59.840  8.767   1.00 122.13 ? 231  ALA B O    1 
ATOM   9705  C  CB   . ALA B 2 231 ? 13.158  57.953  7.373   1.00 101.83 ? 231  ALA B CB   1 
ATOM   9706  H  H    . ALA B 2 231 ? 11.701  55.984  7.296   1.00 134.86 ? 231  ALA B H    1 
ATOM   9707  H  HA   . ALA B 2 231 ? 12.259  57.725  9.192   1.00 136.41 ? 231  ALA B HA   1 
ATOM   9708  H  HB1  . ALA B 2 231 ? 12.873  57.916  6.447   1.00 122.19 ? 231  ALA B HB1  1 
ATOM   9709  H  HB2  . ALA B 2 231 ? 13.520  58.831  7.574   1.00 122.19 ? 231  ALA B HB2  1 
ATOM   9710  H  HB3  . ALA B 2 231 ? 13.829  57.272  7.541   1.00 122.19 ? 231  ALA B HB3  1 
ATOM   9711  N  N    . LEU B 2 232 ? 9.961   58.535  7.174   1.00 108.69 ? 232  LEU B N    1 
ATOM   9712  C  CA   . LEU B 2 232 ? 8.900   59.501  6.918   1.00 117.03 ? 232  LEU B CA   1 
ATOM   9713  C  C    . LEU B 2 232 ? 7.841   59.528  8.017   1.00 123.60 ? 232  LEU B C    1 
ATOM   9714  O  O    . LEU B 2 232 ? 7.480   60.607  8.494   1.00 132.00 ? 232  LEU B O    1 
ATOM   9715  C  CB   . LEU B 2 232 ? 8.223   59.203  5.579   1.00 120.50 ? 232  LEU B CB   1 
ATOM   9716  C  CG   . LEU B 2 232 ? 7.511   60.401  4.950   1.00 127.99 ? 232  LEU B CG   1 
ATOM   9717  C  CD1  . LEU B 2 232 ? 8.512   61.467  4.498   1.00 111.97 ? 232  LEU B CD1  1 
ATOM   9718  C  CD2  . LEU B 2 232 ? 6.631   59.953  3.792   1.00 127.48 ? 232  LEU B CD2  1 
ATOM   9719  H  H    . LEU B 2 232 ? 9.913   57.816  6.705   1.00 130.43 ? 232  LEU B H    1 
ATOM   9720  H  HA   . LEU B 2 232 ? 9.291   60.387  6.862   1.00 140.43 ? 232  LEU B HA   1 
ATOM   9721  H  HB2  . LEU B 2 232 ? 8.897   58.899  4.951   1.00 144.60 ? 232  LEU B HB2  1 
ATOM   9722  H  HB3  . LEU B 2 232 ? 7.563   58.505  5.713   1.00 144.60 ? 232  LEU B HB3  1 
ATOM   9723  H  HG   . LEU B 2 232 ? 6.934   60.805  5.618   1.00 153.59 ? 232  LEU B HG   1 
ATOM   9724  H  HD11 . LEU B 2 232 ? 9.111   61.078  3.841   1.00 134.36 ? 232  LEU B HD11 1 
ATOM   9725  H  HD12 . LEU B 2 232 ? 8.026   62.209  4.105   1.00 134.36 ? 232  LEU B HD12 1 
ATOM   9726  H  HD13 . LEU B 2 232 ? 9.017   61.772  5.268   1.00 134.36 ? 232  LEU B HD13 1 
ATOM   9727  H  HD21 . LEU B 2 232 ? 5.969   59.326  4.123   1.00 152.98 ? 232  LEU B HD21 1 
ATOM   9728  H  HD22 . LEU B 2 232 ? 6.191   60.729  3.411   1.00 152.98 ? 232  LEU B HD22 1 
ATOM   9729  H  HD23 . LEU B 2 232 ? 7.186   59.524  3.121   1.00 152.98 ? 232  LEU B HD23 1 
ATOM   9730  N  N    . THR B 2 233 ? 7.350   58.364  8.437   1.00 128.50 ? 233  THR B N    1 
ATOM   9731  C  CA   . THR B 2 233 ? 6.379   58.334  9.532   1.00 129.66 ? 233  THR B CA   1 
ATOM   9732  C  C    . THR B 2 233 ? 7.029   58.895  10.793  1.00 126.33 ? 233  THR B C    1 
ATOM   9733  O  O    . THR B 2 233 ? 6.354   59.393  11.693  1.00 133.13 ? 233  THR B O    1 
ATOM   9734  C  CB   . THR B 2 233 ? 5.848   56.913  9.816   1.00 119.80 ? 233  THR B CB   1 
ATOM   9735  O  OG1  . THR B 2 233 ? 6.947   56.006  9.954   1.00 120.38 ? 233  THR B OG1  1 
ATOM   9736  C  CG2  . THR B 2 233 ? 4.940   56.445  8.690   1.00 113.15 ? 233  THR B CG2  1 
ATOM   9737  H  H    . THR B 2 233 ? 7.556   57.593  8.114   1.00 154.20 ? 233  THR B H    1 
ATOM   9738  H  HA   . THR B 2 233 ? 5.624   58.899  9.304   1.00 155.60 ? 233  THR B HA   1 
ATOM   9739  H  HB   . THR B 2 233 ? 5.334   56.921  10.638  1.00 143.76 ? 233  THR B HB   1 
ATOM   9740  H  HG1  . THR B 2 233 ? 6.663   55.231  10.108  1.00 144.45 ? 233  THR B HG1  1 
ATOM   9741  H  HG21 . THR B 2 233 ? 5.430   56.431  7.853   1.00 135.78 ? 233  THR B HG21 1 
ATOM   9742  H  HG22 . THR B 2 233 ? 4.613   55.552  8.879   1.00 135.78 ? 233  THR B HG22 1 
ATOM   9743  H  HG23 . THR B 2 233 ? 4.184   57.046  8.603   1.00 135.78 ? 233  THR B HG23 1 
ATOM   9744  N  N    . ALA B 2 234 ? 8.353   58.805  10.846  1.00 121.55 ? 234  ALA B N    1 
ATOM   9745  C  CA   . ALA B 2 234 ? 9.115   59.323  11.970  1.00 129.89 ? 234  ALA B CA   1 
ATOM   9746  C  C    . ALA B 2 234 ? 9.147   60.837  12.018  1.00 141.76 ? 234  ALA B C    1 
ATOM   9747  O  O    . ALA B 2 234 ? 8.550   61.455  12.903  1.00 148.56 ? 234  ALA B O    1 
ATOM   9748  C  CB   . ALA B 2 234 ? 10.548  58.800  11.930  1.00 124.19 ? 234  ALA B CB   1 
ATOM   9749  H  H    . ALA B 2 234 ? 8.837   58.443  10.234  1.00 145.85 ? 234  ALA B H    1 
ATOM   9750  H  HA   . ALA B 2 234 ? 8.708   59.009  12.793  1.00 155.86 ? 234  ALA B HA   1 
ATOM   9751  H  HB1  . ALA B 2 234 ? 10.965  59.086  11.103  1.00 149.03 ? 234  ALA B HB1  1 
ATOM   9752  H  HB2  . ALA B 2 234 ? 11.036  59.158  12.688  1.00 149.03 ? 234  ALA B HB2  1 
ATOM   9753  H  HB3  . ALA B 2 234 ? 10.531  57.831  11.975  1.00 149.03 ? 234  ALA B HB3  1 
ATOM   9754  N  N    . ARG B 2 235 ? 9.830   61.438  11.048  1.00 143.01 ? 235  ARG B N    1 
ATOM   9755  C  CA   . ARG B 2 235 ? 9.987   62.889  11.078  1.00 141.47 ? 235  ARG B CA   1 
ATOM   9756  C  C    . ARG B 2 235 ? 8.797   63.752  10.652  1.00 146.84 ? 235  ARG B C    1 
ATOM   9757  O  O    . ARG B 2 235 ? 8.536   64.764  11.305  1.00 150.93 ? 235  ARG B O    1 
ATOM   9758  C  CB   . ARG B 2 235 ? 11.207  63.281  10.242  1.00 132.97 ? 235  ARG B CB   1 
ATOM   9759  C  CG   . ARG B 2 235 ? 12.444  62.455  10.574  1.00 130.51 ? 235  ARG B CG   1 
ATOM   9760  C  CD   . ARG B 2 235 ? 12.892  62.718  12.011  1.00 126.12 ? 235  ARG B CD   1 
ATOM   9761  N  NE   . ARG B 2 235 ? 14.246  62.230  12.288  1.00 123.81 ? 235  ARG B NE   1 
ATOM   9762  C  CZ   . ARG B 2 235 ? 14.653  61.720  13.451  1.00 126.44 ? 235  ARG B CZ   1 
ATOM   9763  N  NH1  . ARG B 2 235 ? 13.813  61.602  14.474  1.00 122.48 ? 235  ARG B NH1  1 
ATOM   9764  N  NH2  . ARG B 2 235 ? 15.910  61.316  13.593  1.00 111.05 ? 235  ARG B NH2  1 
ATOM   9765  H  H    . ARG B 2 235 ? 10.202  61.044  10.381  1.00 171.61 ? 235  ARG B H    1 
ATOM   9766  H  HA   . ARG B 2 235 ? 10.188  63.138  11.994  1.00 169.77 ? 235  ARG B HA   1 
ATOM   9767  H  HB2  . ARG B 2 235 ? 11.002  63.148  9.304   1.00 159.56 ? 235  ARG B HB2  1 
ATOM   9768  H  HB3  . ARG B 2 235 ? 11.417  64.213  10.407  1.00 159.56 ? 235  ARG B HB3  1 
ATOM   9769  H  HG2  . ARG B 2 235 ? 12.237  61.512  10.484  1.00 156.61 ? 235  ARG B HG2  1 
ATOM   9770  H  HG3  . ARG B 2 235 ? 13.168  62.702  9.977   1.00 156.61 ? 235  ARG B HG3  1 
ATOM   9771  H  HD2  . ARG B 2 235 ? 12.879  63.674  12.176  1.00 151.35 ? 235  ARG B HD2  1 
ATOM   9772  H  HD3  . ARG B 2 235 ? 12.283  62.269  12.618  1.00 151.35 ? 235  ARG B HD3  1 
ATOM   9773  H  HE   . ARG B 2 235 ? 14.822  62.277  11.652  1.00 148.58 ? 235  ARG B HE   1 
ATOM   9774  H  HH11 . ARG B 2 235 ? 12.998  61.862  14.393  1.00 146.98 ? 235  ARG B HH11 1 
ATOM   9775  H  HH12 . ARG B 2 235 ? 14.087  61.269  15.218  1.00 146.98 ? 235  ARG B HH12 1 
ATOM   9776  H  HH21 . ARG B 2 235 ? 16.461  61.385  12.936  1.00 133.26 ? 235  ARG B HH21 1 
ATOM   9777  H  HH22 . ARG B 2 235 ? 16.173  60.982  14.341  1.00 133.26 ? 235  ARG B HH22 1 
ATOM   9778  N  N    . SER B 2 236 ? 8.055   63.388  9.608   1.00 137.67 ? 236  SER B N    1 
ATOM   9779  C  CA   . SER B 2 236 ? 7.013   64.308  9.159   1.00 148.77 ? 236  SER B CA   1 
ATOM   9780  C  C    . SER B 2 236 ? 5.803   64.274  10.085  1.00 153.29 ? 236  SER B C    1 
ATOM   9781  O  O    . SER B 2 236 ? 5.060   65.252  10.176  1.00 159.16 ? 236  SER B O    1 
ATOM   9782  C  CB   . SER B 2 236 ? 6.575   63.975  7.729   1.00 150.91 ? 236  SER B CB   1 
ATOM   9783  O  OG   . SER B 2 236 ? 7.585   64.290  6.786   1.00 145.16 ? 236  SER B OG   1 
ATOM   9784  H  H    . SER B 2 236 ? 8.128   62.656  9.163   1.00 165.20 ? 236  SER B H    1 
ATOM   9785  H  HA   . SER B 2 236 ? 7.366   65.211  9.162   1.00 178.52 ? 236  SER B HA   1 
ATOM   9786  H  HB2  . SER B 2 236 ? 6.380   63.026  7.674   1.00 181.09 ? 236  SER B HB2  1 
ATOM   9787  H  HB3  . SER B 2 236 ? 5.778   64.487  7.518   1.00 181.09 ? 236  SER B HB3  1 
ATOM   9788  H  HG   . SER B 2 236 ? 7.323   64.100  6.010   1.00 174.19 ? 236  SER B HG   1 
ATOM   9789  N  N    . LEU B 2 237 ? 5.600   63.150  10.764  1.00 147.66 ? 237  LEU B N    1 
ATOM   9790  C  CA   . LEU B 2 237 ? 4.464   63.013  11.671  1.00 153.10 ? 237  LEU B CA   1 
ATOM   9791  C  C    . LEU B 2 237 ? 4.742   63.919  12.879  1.00 159.19 ? 237  LEU B C    1 
ATOM   9792  O  O    . LEU B 2 237 ? 5.873   63.939  13.371  1.00 150.83 ? 237  LEU B O    1 
ATOM   9793  C  CB   . LEU B 2 237 ? 4.258   61.554  12.075  1.00 145.39 ? 237  LEU B CB   1 
ATOM   9794  C  CG   . LEU B 2 237 ? 2.870   61.139  12.567  1.00 141.79 ? 237  LEU B CG   1 
ATOM   9795  C  CD1  . LEU B 2 237 ? 1.770   61.538  11.582  1.00 145.99 ? 237  LEU B CD1  1 
ATOM   9796  C  CD2  . LEU B 2 237 ? 2.846   59.640  12.743  1.00 129.31 ? 237  LEU B CD2  1 
ATOM   9797  H  H    . LEU B 2 237 ? 6.102   62.454  10.719  1.00 177.20 ? 237  LEU B H    1 
ATOM   9798  H  HA   . LEU B 2 237 ? 3.659   63.326  11.231  1.00 183.72 ? 237  LEU B HA   1 
ATOM   9799  H  HB2  . LEU B 2 237 ? 4.463   60.999  11.306  1.00 174.46 ? 237  LEU B HB2  1 
ATOM   9800  H  HB3  . LEU B 2 237 ? 4.883   61.350  12.789  1.00 174.46 ? 237  LEU B HB3  1 
ATOM   9801  H  HG   . LEU B 2 237 ? 2.688   61.556  13.424  1.00 170.14 ? 237  LEU B HG   1 
ATOM   9802  H  HD11 . LEU B 2 237 ? 1.937   61.104  10.731  1.00 175.19 ? 237  LEU B HD11 1 
ATOM   9803  H  HD12 . LEU B 2 237 ? 0.913   61.256  11.936  1.00 175.19 ? 237  LEU B HD12 1 
ATOM   9804  H  HD13 . LEU B 2 237 ? 1.781   62.502  11.471  1.00 175.19 ? 237  LEU B HD13 1 
ATOM   9805  H  HD21 . LEU B 2 237 ? 3.519   59.388  13.394  1.00 155.17 ? 237  LEU B HD21 1 
ATOM   9806  H  HD22 . LEU B 2 237 ? 1.967   59.373  13.055  1.00 155.17 ? 237  LEU B HD22 1 
ATOM   9807  H  HD23 . LEU B 2 237 ? 3.036   59.219  11.890  1.00 155.17 ? 237  LEU B HD23 1 
ATOM   9808  N  N    . PRO B 2 238 ? 3.736   64.665  13.378  1.00 163.20 ? 238  PRO B N    1 
ATOM   9809  C  CA   . PRO B 2 238 ? 4.069   65.512  14.534  1.00 154.17 ? 238  PRO B CA   1 
ATOM   9810  C  C    . PRO B 2 238 ? 4.336   64.702  15.815  1.00 150.73 ? 238  PRO B C    1 
ATOM   9811  O  O    . PRO B 2 238 ? 3.632   64.881  16.807  1.00 149.68 ? 238  PRO B O    1 
ATOM   9812  C  CB   . PRO B 2 238 ? 2.826   66.409  14.677  1.00 151.29 ? 238  PRO B CB   1 
ATOM   9813  C  CG   . PRO B 2 238 ? 1.724   65.627  14.059  1.00 147.81 ? 238  PRO B CG   1 
ATOM   9814  C  CD   . PRO B 2 238 ? 2.355   64.888  12.916  1.00 152.58 ? 238  PRO B CD   1 
ATOM   9815  H  HA   . PRO B 2 238 ? 4.841   66.064  14.336  1.00 185.00 ? 238  PRO B HA   1 
ATOM   9816  H  HB2  . PRO B 2 238 ? 2.646   66.573  15.616  1.00 181.54 ? 238  PRO B HB2  1 
ATOM   9817  H  HB3  . PRO B 2 238 ? 2.965   67.242  14.201  1.00 181.54 ? 238  PRO B HB3  1 
ATOM   9818  H  HG2  . PRO B 2 238 ? 1.360   65.006  14.709  1.00 177.38 ? 238  PRO B HG2  1 
ATOM   9819  H  HG3  . PRO B 2 238 ? 1.036   66.230  13.739  1.00 177.38 ? 238  PRO B HG3  1 
ATOM   9820  H  HD2  . PRO B 2 238 ? 1.905   64.041  12.771  1.00 183.10 ? 238  PRO B HD2  1 
ATOM   9821  H  HD3  . PRO B 2 238 ? 2.350   65.436  12.115  1.00 183.10 ? 238  PRO B HD3  1 
ATOM   9822  N  N    . ALA B 2 239 ? 5.350   63.834  15.775  1.00 142.29 ? 239  ALA B N    1 
ATOM   9823  C  CA   . ALA B 2 239 ? 5.775   63.027  16.923  1.00 122.33 ? 239  ALA B CA   1 
ATOM   9824  C  C    . ALA B 2 239 ? 4.698   62.045  17.394  1.00 137.53 ? 239  ALA B C    1 
ATOM   9825  O  O    . ALA B 2 239 ? 3.558   62.431  17.653  1.00 139.71 ? 239  ALA B O    1 
ATOM   9826  C  CB   . ALA B 2 239 ? 6.196   63.928  18.073  1.00 104.62 ? 239  ALA B CB   1 
ATOM   9827  H  H    . ALA B 2 239 ? 5.822   63.691  15.071  1.00 170.75 ? 239  ALA B H    1 
ATOM   9828  H  HA   . ALA B 2 239 ? 6.550   62.506  16.662  1.00 146.79 ? 239  ALA B HA   1 
ATOM   9829  H  HB1  . ALA B 2 239 ? 5.442   64.482  18.331  1.00 125.54 ? 239  ALA B HB1  1 
ATOM   9830  H  HB2  . ALA B 2 239 ? 6.473   63.376  18.822  1.00 125.54 ? 239  ALA B HB2  1 
ATOM   9831  H  HB3  . ALA B 2 239 ? 6.934   64.487  17.783  1.00 125.54 ? 239  ALA B HB3  1 
ATOM   9832  N  N    . VAL B 2 240 ? 5.078   60.775  17.523  1.00 137.51 ? 240  VAL B N    1 
ATOM   9833  C  CA   . VAL B 2 240 ? 4.162   59.746  18.010  1.00 120.47 ? 240  VAL B CA   1 
ATOM   9834  C  C    . VAL B 2 240 ? 4.614   59.247  19.369  1.00 120.04 ? 240  VAL B C    1 
ATOM   9835  O  O    . VAL B 2 240 ? 3.967   58.394  19.973  1.00 116.57 ? 240  VAL B O    1 
ATOM   9836  C  CB   . VAL B 2 240 ? 4.075   58.555  17.046  1.00 125.03 ? 240  VAL B CB   1 
ATOM   9837  C  CG1  . VAL B 2 240 ? 3.250   58.934  15.844  1.00 118.25 ? 240  VAL B CG1  1 
ATOM   9838  C  CG2  . VAL B 2 240 ? 5.469   58.097  16.619  1.00 122.69 ? 240  VAL B CG2  1 
ATOM   9839  H  H    . VAL B 2 240 ? 5.864   60.483  17.333  1.00 165.02 ? 240  VAL B H    1 
ATOM   9840  H  HA   . VAL B 2 240 ? 3.275   60.126  18.105  1.00 144.56 ? 240  VAL B HA   1 
ATOM   9841  H  HB   . VAL B 2 240 ? 3.637   57.814  17.493  1.00 150.04 ? 240  VAL B HB   1 
ATOM   9842  H  HG11 . VAL B 2 240 ? 3.671   59.685  15.397  1.00 141.90 ? 240  VAL B HG11 1 
ATOM   9843  H  HG12 . VAL B 2 240 ? 3.202   58.175  15.242  1.00 141.90 ? 240  VAL B HG12 1 
ATOM   9844  H  HG13 . VAL B 2 240 ? 2.359   59.181  16.138  1.00 141.90 ? 240  VAL B HG13 1 
ATOM   9845  H  HG21 . VAL B 2 240 ? 5.968   57.830  17.407  1.00 147.23 ? 240  VAL B HG21 1 
ATOM   9846  H  HG22 . VAL B 2 240 ? 5.382   57.346  16.012  1.00 147.23 ? 240  VAL B HG22 1 
ATOM   9847  H  HG23 . VAL B 2 240 ? 5.920   58.832  16.175  1.00 147.23 ? 240  VAL B HG23 1 
ATOM   9848  N  N    . GLN B 2 241 ? 5.738   59.777  19.834  1.00 122.48 ? 241  GLN B N    1 
ATOM   9849  C  CA   . GLN B 2 241 ? 6.269   59.428  21.137  1.00 127.14 ? 241  GLN B CA   1 
ATOM   9850  C  C    . GLN B 2 241 ? 5.245   59.831  22.189  1.00 126.66 ? 241  GLN B C    1 
ATOM   9851  O  O    . GLN B 2 241 ? 5.060   59.162  23.210  1.00 114.72 ? 241  GLN B O    1 
ATOM   9852  C  CB   . GLN B 2 241 ? 7.598   60.136  21.402  1.00 140.99 ? 241  GLN B CB   1 
ATOM   9853  C  CG   . GLN B 2 241 ? 8.779   59.606  20.610  1.00 132.81 ? 241  GLN B CG   1 
ATOM   9854  C  CD   . GLN B 2 241 ? 10.091  60.317  20.936  1.00 138.58 ? 241  GLN B CD   1 
ATOM   9855  O  OE1  . GLN B 2 241 ? 11.168  59.803  20.635  1.00 128.75 ? 241  GLN B OE1  1 
ATOM   9856  N  NE2  . GLN B 2 241 ? 10.008  61.496  21.556  1.00 134.11 ? 241  GLN B NE2  1 
ATOM   9857  H  H    . GLN B 2 241 ? 6.217   60.348  19.404  1.00 146.98 ? 241  GLN B H    1 
ATOM   9858  H  HA   . GLN B 2 241 ? 6.410   58.469  21.189  1.00 152.57 ? 241  GLN B HA   1 
ATOM   9859  H  HB2  . GLN B 2 241 ? 7.496   61.075  21.183  1.00 169.19 ? 241  GLN B HB2  1 
ATOM   9860  H  HB3  . GLN B 2 241 ? 7.813   60.044  22.344  1.00 169.19 ? 241  GLN B HB3  1 
ATOM   9861  H  HG2  . GLN B 2 241 ? 8.893   58.664  20.807  1.00 159.37 ? 241  GLN B HG2  1 
ATOM   9862  H  HG3  . GLN B 2 241 ? 8.601   59.726  19.664  1.00 159.37 ? 241  GLN B HG3  1 
ATOM   9863  H  HE21 . GLN B 2 241 ? 9.238   61.824  21.754  1.00 160.93 ? 241  GLN B HE21 1 
ATOM   9864  H  HE22 . GLN B 2 241 ? 10.724  61.927  21.756  1.00 160.93 ? 241  GLN B HE22 1 
ATOM   9865  N  N    . SER B 2 242 ? 4.564   60.935  21.892  1.00 125.67 ? 242  SER B N    1 
ATOM   9866  C  CA   . SER B 2 242 ? 3.678   61.597  22.836  1.00 128.14 ? 242  SER B CA   1 
ATOM   9867  C  C    . SER B 2 242 ? 2.352   60.894  23.081  1.00 120.30 ? 242  SER B C    1 
ATOM   9868  O  O    . SER B 2 242 ? 1.650   61.231  24.034  1.00 114.57 ? 242  SER B O    1 
ATOM   9869  C  CB   . SER B 2 242 ? 3.393   63.012  22.334  1.00 127.00 ? 242  SER B CB   1 
ATOM   9870  O  OG   . SER B 2 242 ? 4.601   63.686  22.028  1.00 140.68 ? 242  SER B OG   1 
ATOM   9871  H  H    . SER B 2 242 ? 4.603   61.328  21.128  1.00 150.81 ? 242  SER B H    1 
ATOM   9872  H  HA   . SER B 2 242 ? 4.133   61.671  23.690  1.00 153.77 ? 242  SER B HA   1 
ATOM   9873  H  HB2  . SER B 2 242 ? 2.849   62.960  21.533  1.00 152.40 ? 242  SER B HB2  1 
ATOM   9874  H  HB3  . SER B 2 242 ? 2.922   63.504  23.025  1.00 152.40 ? 242  SER B HB3  1 
ATOM   9875  H  HG   . SER B 2 242 ? 4.435   64.462  21.753  1.00 168.82 ? 242  SER B HG   1 
ATOM   9876  N  N    . ASP B 2 243 ? 1.992   59.929  22.240  1.00 113.31 ? 243  ASP B N    1 
ATOM   9877  C  CA   . ASP B 2 243 ? 0.688   59.306  22.398  1.00 95.47  ? 243  ASP B CA   1 
ATOM   9878  C  C    . ASP B 2 243 ? 0.711   58.483  23.675  1.00 90.78  ? 243  ASP B C    1 
ATOM   9879  O  O    . ASP B 2 243 ? 1.547   57.597  23.841  1.00 97.89  ? 243  ASP B O    1 
ATOM   9880  C  CB   . ASP B 2 243 ? 0.325   58.441  21.195  1.00 103.63 ? 243  ASP B CB   1 
ATOM   9881  C  CG   . ASP B 2 243 ? -1.173  58.279  21.041  1.00 95.09  ? 243  ASP B CG   1 
ATOM   9882  O  OD1  . ASP B 2 243 ? -1.728  57.333  21.636  1.00 90.96  ? 243  ASP B OD1  1 
ATOM   9883  O  OD2  . ASP B 2 243 ? -1.797  59.120  20.352  1.00 86.58  ? 243  ASP B OD2  1 
ATOM   9884  H  H    . ASP B 2 243 ? 2.468   59.627  21.590  1.00 135.98 ? 243  ASP B H    1 
ATOM   9885  H  HA   . ASP B 2 243 ? 0.013   59.995  22.492  1.00 114.56 ? 243  ASP B HA   1 
ATOM   9886  H  HB2  . ASP B 2 243 ? 0.669   58.858  20.389  1.00 124.36 ? 243  ASP B HB2  1 
ATOM   9887  H  HB3  . ASP B 2 243 ? 0.715   57.560  21.308  1.00 124.36 ? 243  ASP B HB3  1 
ATOM   9888  N  N    . GLU B 2 244 ? -0.246  58.762  24.553  1.00 92.30  ? 244  GLU B N    1 
ATOM   9889  C  CA   . GLU B 2 244 ? -0.274  58.166  25.882  1.00 104.36 ? 244  GLU B CA   1 
ATOM   9890  C  C    . GLU B 2 244 ? -0.531  56.654  25.768  1.00 88.48  ? 244  GLU B C    1 
ATOM   9891  O  O    . GLU B 2 244 ? -0.162  55.874  26.645  1.00 101.22 ? 244  GLU B O    1 
ATOM   9892  C  CB   . GLU B 2 244 ? -1.327  58.878  26.750  1.00 95.95  ? 244  GLU B CB   1 
ATOM   9893  C  CG   . GLU B 2 244 ? -1.197  58.607  28.265  1.00 85.95  ? 244  GLU B CG   1 
ATOM   9894  C  CD   . GLU B 2 244 ? -1.906  57.363  28.729  1.00 101.55 ? 244  GLU B CD   1 
ATOM   9895  O  OE1  . GLU B 2 244 ? -2.769  56.848  27.981  1.00 109.09 ? 244  GLU B OE1  1 
ATOM   9896  O  OE2  . GLU B 2 244 ? -1.576  56.890  29.842  1.00 93.42  ? 244  GLU B OE2  1 
ATOM   9897  H  H    . GLU B 2 244 ? -0.899  59.301  24.400  1.00 110.77 ? 244  GLU B H    1 
ATOM   9898  H  HA   . GLU B 2 244 ? 0.591   58.290  26.301  1.00 125.23 ? 244  GLU B HA   1 
ATOM   9899  H  HB2  . GLU B 2 244 ? -1.245  59.835  26.614  1.00 115.14 ? 244  GLU B HB2  1 
ATOM   9900  H  HB3  . GLU B 2 244 ? -2.208  58.583  26.472  1.00 115.14 ? 244  GLU B HB3  1 
ATOM   9901  H  HG2  . GLU B 2 244 ? -0.257  58.511  28.485  1.00 103.13 ? 244  GLU B HG2  1 
ATOM   9902  H  HG3  . GLU B 2 244 ? -1.572  59.359  28.749  1.00 103.13 ? 244  GLU B HG3  1 
ATOM   9903  N  N    . ARG B 2 245 ? -1.155  56.251  24.670  1.00 85.30  ? 245  ARG B N    1 
ATOM   9904  C  CA   . ARG B 2 245 ? -1.552  54.862  24.451  1.00 98.65  ? 245  ARG B CA   1 
ATOM   9905  C  C    . ARG B 2 245 ? -0.379  53.955  24.078  1.00 95.65  ? 245  ARG B C    1 
ATOM   9906  O  O    . ARG B 2 245 ? -0.516  52.730  24.088  1.00 90.01  ? 245  ARG B O    1 
ATOM   9907  C  CB   . ARG B 2 245 ? -2.635  54.766  23.375  1.00 99.14  ? 245  ARG B CB   1 
ATOM   9908  C  CG   . ARG B 2 245 ? -3.922  55.484  23.746  1.00 94.17  ? 245  ARG B CG   1 
ATOM   9909  C  CD   . ARG B 2 245 ? -4.855  55.604  22.567  1.00 90.63  ? 245  ARG B CD   1 
ATOM   9910  N  NE   . ARG B 2 245 ? -4.343  56.493  21.533  1.00 98.62  ? 245  ARG B NE   1 
ATOM   9911  C  CZ   . ARG B 2 245 ? -5.012  56.811  20.430  1.00 87.39  ? 245  ARG B CZ   1 
ATOM   9912  N  NH1  . ARG B 2 245 ? -6.218  56.306  20.215  1.00 95.92  ? 245  ARG B NH1  1 
ATOM   9913  N  NH2  . ARG B 2 245 ? -4.474  57.627  19.536  1.00 97.41  ? 245  ARG B NH2  1 
ATOM   9914  H  H    . ARG B 2 245 ? -1.366  56.774  24.021  1.00 102.36 ? 245  ARG B H    1 
ATOM   9915  H  HA   . ARG B 2 245 ? -1.932  54.520  25.275  1.00 118.38 ? 245  ARG B HA   1 
ATOM   9916  H  HB2  . ARG B 2 245 ? -2.299  55.163  22.556  1.00 118.97 ? 245  ARG B HB2  1 
ATOM   9917  H  HB3  . ARG B 2 245 ? -2.847  53.832  23.226  1.00 118.97 ? 245  ARG B HB3  1 
ATOM   9918  H  HG2  . ARG B 2 245 ? -4.376  54.985  24.443  1.00 113.01 ? 245  ARG B HG2  1 
ATOM   9919  H  HG3  . ARG B 2 245 ? -3.710  56.378  24.058  1.00 113.01 ? 245  ARG B HG3  1 
ATOM   9920  H  HD2  . ARG B 2 245 ? -4.981  54.726  22.172  1.00 108.76 ? 245  ARG B HD2  1 
ATOM   9921  H  HD3  . ARG B 2 245 ? -5.706  55.956  22.871  1.00 108.76 ? 245  ARG B HD3  1 
ATOM   9922  H  HE   . ARG B 2 245 ? -3.596  56.892  21.679  1.00 118.34 ? 245  ARG B HE   1 
ATOM   9923  H  HH11 . ARG B 2 245 ? -6.571  55.775  20.792  1.00 115.10 ? 245  ARG B HH11 1 
ATOM   9924  H  HH12 . ARG B 2 245 ? -6.649  56.512  19.500  1.00 115.10 ? 245  ARG B HH12 1 
ATOM   9925  H  HH21 . ARG B 2 245 ? -3.690  57.956  19.671  1.00 116.89 ? 245  ARG B HH21 1 
ATOM   9926  H  HH22 . ARG B 2 245 ? -4.908  57.831  18.822  1.00 116.89 ? 245  ARG B HH22 1 
ATOM   9927  N  N    . LEU B 2 246 ? 0.754   54.555  23.717  1.00 102.99 ? 246  LEU B N    1 
ATOM   9928  C  CA   . LEU B 2 246 ? 1.945   53.786  23.349  1.00 104.21 ? 246  LEU B CA   1 
ATOM   9929  C  C    . LEU B 2 246 ? 2.945   53.614  24.492  1.00 97.52  ? 246  LEU B C    1 
ATOM   9930  O  O    . LEU B 2 246 ? 3.893   52.844  24.372  1.00 88.30  ? 246  LEU B O    1 
ATOM   9931  C  CB   . LEU B 2 246 ? 2.670   54.467  22.186  1.00 100.79 ? 246  LEU B CB   1 
ATOM   9932  C  CG   . LEU B 2 246 ? 2.137   54.328  20.764  1.00 93.01  ? 246  LEU B CG   1 
ATOM   9933  C  CD1  . LEU B 2 246 ? 3.126   54.986  19.814  1.00 92.32  ? 246  LEU B CD1  1 
ATOM   9934  C  CD2  . LEU B 2 246 ? 1.911   52.871  20.375  1.00 96.22  ? 246  LEU B CD2  1 
ATOM   9935  H  H    . LEU B 2 246 ? 0.860   55.407  23.677  1.00 123.58 ? 246  LEU B H    1 
ATOM   9936  H  HA   . LEU B 2 246 ? 1.671   52.903  23.055  1.00 125.05 ? 246  LEU B HA   1 
ATOM   9937  H  HB2  . LEU B 2 246 ? 2.696   55.418  22.377  1.00 120.95 ? 246  LEU B HB2  1 
ATOM   9938  H  HB3  . LEU B 2 246 ? 3.579   54.128  22.172  1.00 120.95 ? 246  LEU B HB3  1 
ATOM   9939  H  HG   . LEU B 2 246 ? 1.290   54.796  20.693  1.00 111.62 ? 246  LEU B HG   1 
ATOM   9940  H  HD11 . LEU B 2 246 ? 3.984   54.542  19.896  1.00 110.78 ? 246  LEU B HD11 1 
ATOM   9941  H  HD12 . LEU B 2 246 ? 2.795   54.903  18.906  1.00 110.78 ? 246  LEU B HD12 1 
ATOM   9942  H  HD13 . LEU B 2 246 ? 3.214   55.923  20.050  1.00 110.78 ? 246  LEU B HD13 1 
ATOM   9943  H  HD21 . LEU B 2 246 ? 1.266   52.479  20.984  1.00 115.47 ? 246  LEU B HD21 1 
ATOM   9944  H  HD22 . LEU B 2 246 ? 1.574   52.836  19.467  1.00 115.47 ? 246  LEU B HD22 1 
ATOM   9945  H  HD23 . LEU B 2 246 ? 2.755   52.395  20.434  1.00 115.47 ? 246  LEU B HD23 1 
ATOM   9946  N  N    . GLN B 2 247 ? 2.700   54.286  25.611  1.00 99.70  ? 247  GLN B N    1 
ATOM   9947  C  CA   . GLN B 2 247 ? 3.641   54.315  26.730  1.00 97.75  ? 247  GLN B CA   1 
ATOM   9948  C  C    . GLN B 2 247 ? 4.024   52.922  27.257  1.00 96.30  ? 247  GLN B C    1 
ATOM   9949  O  O    . GLN B 2 247 ? 5.209   52.649  27.452  1.00 107.97 ? 247  GLN B O    1 
ATOM   9950  C  CB   . GLN B 2 247 ? 3.068   55.170  27.858  1.00 84.21  ? 247  GLN B CB   1 
ATOM   9951  C  CG   . GLN B 2 247 ? 2.812   56.615  27.434  1.00 92.59  ? 247  GLN B CG   1 
ATOM   9952  C  CD   . GLN B 2 247 ? 4.073   57.312  26.950  1.00 105.22 ? 247  GLN B CD   1 
ATOM   9953  O  OE1  . GLN B 2 247 ? 5.157   57.100  27.495  1.00 111.01 ? 247  GLN B OE1  1 
ATOM   9954  N  NE2  . GLN B 2 247 ? 3.939   58.141  25.918  1.00 99.62  ? 247  GLN B NE2  1 
ATOM   9955  H  H    . GLN B 2 247 ? 1.984   54.741  25.750  1.00 119.64 ? 247  GLN B H    1 
ATOM   9956  H  HA   . GLN B 2 247 ? 4.458   54.744  26.429  1.00 117.30 ? 247  GLN B HA   1 
ATOM   9957  H  HB2  . GLN B 2 247 ? 2.224   54.789  28.146  1.00 101.06 ? 247  GLN B HB2  1 
ATOM   9958  H  HB3  . GLN B 2 247 ? 3.696   55.181  28.597  1.00 101.06 ? 247  GLN B HB3  1 
ATOM   9959  H  HG2  . GLN B 2 247 ? 2.167   56.623  26.710  1.00 111.11 ? 247  GLN B HG2  1 
ATOM   9960  H  HG3  . GLN B 2 247 ? 2.467   57.111  28.193  1.00 111.11 ? 247  GLN B HG3  1 
ATOM   9961  H  HE21 . GLN B 2 247 ? 3.167   58.260  25.559  1.00 119.55 ? 247  GLN B HE21 1 
ATOM   9962  H  HE22 . GLN B 2 247 ? 4.625   58.558  25.610  1.00 119.55 ? 247  GLN B HE22 1 
ATOM   9963  N  N    . PRO B 2 248 ? 3.040   52.030  27.479  1.00 93.94  ? 248  PRO B N    1 
ATOM   9964  C  CA   . PRO B 2 248 ? 3.380   50.683  27.974  1.00 100.83 ? 248  PRO B CA   1 
ATOM   9965  C  C    . PRO B 2 248 ? 4.165   49.858  26.944  1.00 109.65 ? 248  PRO B C    1 
ATOM   9966  O  O    . PRO B 2 248 ? 4.806   48.867  27.289  1.00 114.95 ? 248  PRO B O    1 
ATOM   9967  C  CB   . PRO B 2 248 ? 2.010   50.056  28.267  1.00 103.84 ? 248  PRO B CB   1 
ATOM   9968  C  CG   . PRO B 2 248 ? 1.046   50.825  27.431  1.00 104.79 ? 248  PRO B CG   1 
ATOM   9969  C  CD   . PRO B 2 248 ? 1.580   52.224  27.391  1.00 96.61  ? 248  PRO B CD   1 
ATOM   9970  H  HA   . PRO B 2 248 ? 3.890   50.743  28.797  1.00 121.00 ? 248  PRO B HA   1 
ATOM   9971  H  HB2  . PRO B 2 248 ? 2.016   49.121  28.011  1.00 124.61 ? 248  PRO B HB2  1 
ATOM   9972  H  HB3  . PRO B 2 248 ? 1.800   50.153  29.209  1.00 124.61 ? 248  PRO B HB3  1 
ATOM   9973  H  HG2  . PRO B 2 248 ? 1.013   50.445  26.539  1.00 125.74 ? 248  PRO B HG2  1 
ATOM   9974  H  HG3  . PRO B 2 248 ? 0.168   50.805  27.845  1.00 125.74 ? 248  PRO B HG3  1 
ATOM   9975  H  HD2  . PRO B 2 248 ? 1.345   52.652  26.553  1.00 115.94 ? 248  PRO B HD2  1 
ATOM   9976  H  HD3  . PRO B 2 248 ? 1.259   52.731  28.153  1.00 115.94 ? 248  PRO B HD3  1 
ATOM   9977  N  N    . LEU B 2 249 ? 4.093   50.286  25.689  1.00 109.74 ? 249  LEU B N    1 
ATOM   9978  C  CA   . LEU B 2 249 ? 4.807   49.670  24.570  1.00 106.67 ? 249  LEU B CA   1 
ATOM   9979  C  C    . LEU B 2 249 ? 6.238   50.219  24.536  1.00 114.11 ? 249  LEU B C    1 
ATOM   9980  O  O    . LEU B 2 249 ? 7.183   49.514  24.181  1.00 120.45 ? 249  LEU B O    1 
ATOM   9981  C  CB   . LEU B 2 249 ? 4.099   49.906  23.236  1.00 102.54 ? 249  LEU B CB   1 
ATOM   9982  C  CG   . LEU B 2 249 ? 4.936   49.480  22.030  1.00 104.07 ? 249  LEU B CG   1 
ATOM   9983  C  CD1  . LEU B 2 249 ? 5.197   47.981  22.083  1.00 97.69  ? 249  LEU B CD1  1 
ATOM   9984  C  CD2  . LEU B 2 249 ? 4.240   49.863  20.736  1.00 100.38 ? 249  LEU B CD2  1 
ATOM   9985  H  H    . LEU B 2 249 ? 3.616   50.960  25.449  1.00 131.69 ? 249  LEU B H    1 
ATOM   9986  H  HA   . LEU B 2 249 ? 4.857   48.713  24.716  1.00 128.00 ? 249  LEU B HA   1 
ATOM   9987  H  HB2  . LEU B 2 249 ? 3.274   49.397  23.223  1.00 123.05 ? 249  LEU B HB2  1 
ATOM   9988  H  HB3  . LEU B 2 249 ? 3.905   50.853  23.146  1.00 123.05 ? 249  LEU B HB3  1 
ATOM   9989  H  HG   . LEU B 2 249 ? 5.792   49.936  22.059  1.00 124.89 ? 249  LEU B HG   1 
ATOM   9990  H  HD11 . LEU B 2 249 ? 4.347   47.513  22.069  1.00 117.23 ? 249  LEU B HD11 1 
ATOM   9991  H  HD12 . LEU B 2 249 ? 5.728   47.726  21.312  1.00 117.23 ? 249  LEU B HD12 1 
ATOM   9992  H  HD13 . LEU B 2 249 ? 5.677   47.773  22.899  1.00 117.23 ? 249  LEU B HD13 1 
ATOM   9993  H  HD21 . LEU B 2 249 ? 4.119   50.825  20.715  1.00 120.45 ? 249  LEU B HD21 1 
ATOM   9994  H  HD22 . LEU B 2 249 ? 4.789   49.582  19.987  1.00 120.45 ? 249  LEU B HD22 1 
ATOM   9995  H  HD23 . LEU B 2 249 ? 3.378   49.420  20.698  1.00 120.45 ? 249  LEU B HD23 1 
ATOM   9996  N  N    . LEU B 2 250 ? 6.373   51.484  24.918  1.00 111.16 ? 250  LEU B N    1 
ATOM   9997  C  CA   . LEU B 2 250 ? 7.628   52.238  24.883  1.00 113.51 ? 250  LEU B CA   1 
ATOM   9998  C  C    . LEU B 2 250 ? 8.583   51.780  25.989  1.00 114.38 ? 250  LEU B C    1 
ATOM   9999  O  O    . LEU B 2 250 ? 9.722   52.245  26.065  1.00 110.39 ? 250  LEU B O    1 
ATOM   10000 C  CB   . LEU B 2 250 ? 7.372   53.749  24.981  1.00 106.11 ? 250  LEU B CB   1 
ATOM   10001 C  CG   . LEU B 2 250 ? 6.595   54.391  23.821  1.00 106.35 ? 250  LEU B CG   1 
ATOM   10002 C  CD1  . LEU B 2 250 ? 6.481   55.896  24.005  1.00 106.51 ? 250  LEU B CD1  1 
ATOM   10003 C  CD2  . LEU B 2 250 ? 7.231   54.075  22.471  1.00 96.91  ? 250  LEU B CD2  1 
ATOM   10004 H  H    . LEU B 2 250 ? 5.717   51.952  25.218  1.00 133.39 ? 250  LEU B H    1 
ATOM   10005 H  HA   . LEU B 2 250 ? 8.064   52.071  24.033  1.00 136.21 ? 250  LEU B HA   1 
ATOM   10006 H  HB2  . LEU B 2 250 ? 6.868   53.919  25.793  1.00 127.33 ? 250  LEU B HB2  1 
ATOM   10007 H  HB3  . LEU B 2 250 ? 8.230   54.199  25.036  1.00 127.33 ? 250  LEU B HB3  1 
ATOM   10008 H  HG   . LEU B 2 250 ? 5.696   54.028  23.814  1.00 127.62 ? 250  LEU B HG   1 
ATOM   10009 H  HD11 . LEU B 2 250 ? 7.371   56.278  24.036  1.00 127.81 ? 250  LEU B HD11 1 
ATOM   10010 H  HD12 . LEU B 2 250 ? 5.987   56.268  23.258  1.00 127.81 ? 250  LEU B HD12 1 
ATOM   10011 H  HD13 . LEU B 2 250 ? 6.013   56.077  24.835  1.00 127.81 ? 250  LEU B HD13 1 
ATOM   10012 H  HD21 . LEU B 2 250 ? 7.238   53.113  22.343  1.00 116.29 ? 250  LEU B HD21 1 
ATOM   10013 H  HD22 . LEU B 2 250 ? 6.711   54.498  21.770  1.00 116.29 ? 250  LEU B HD22 1 
ATOM   10014 H  HD23 . LEU B 2 250 ? 8.139   54.417  22.462  1.00 116.29 ? 250  LEU B HD23 1 
ATOM   10015 N  N    . ASN B 2 251 ? 8.118   50.865  26.835  1.00 115.92 ? 251  ASN B N    1 
ATOM   10016 C  CA   . ASN B 2 251 ? 8.911   50.363  27.951  1.00 123.07 ? 251  ASN B CA   1 
ATOM   10017 C  C    . ASN B 2 251 ? 9.492   49.004  27.561  1.00 124.40 ? 251  ASN B C    1 
ATOM   10018 O  O    . ASN B 2 251 ? 10.694  48.788  27.734  1.00 119.01 ? 251  ASN B O    1 
ATOM   10019 C  CB   . ASN B 2 251 ? 8.058   50.236  29.213  1.00 126.87 ? 251  ASN B CB   1 
ATOM   10020 C  CG   . ASN B 2 251 ? 7.682   51.584  29.802  1.00 141.46 ? 251  ASN B CG   1 
ATOM   10021 O  OD1  . ASN B 2 251 ? 8.357   52.588  29.564  1.00 133.87 ? 251  ASN B OD1  1 
ATOM   10022 N  ND2  . ASN B 2 251 ? 6.582   51.620  30.550  1.00 149.49 ? 251  ASN B ND2  1 
ATOM   10023 H  H    . ASN B 2 251 ? 7.335   50.514  26.781  1.00 139.11 ? 251  ASN B H    1 
ATOM   10024 H  HA   . ASN B 2 251 ? 9.643   50.973  28.132  1.00 147.68 ? 251  ASN B HA   1 
ATOM   10025 H  HB2  . ASN B 2 251 ? 7.239   49.764  28.995  1.00 152.25 ? 251  ASN B HB2  1 
ATOM   10026 H  HB3  . ASN B 2 251 ? 8.556   49.743  29.883  1.00 152.25 ? 251  ASN B HB3  1 
ATOM   10027 H  HD21 . ASN B 2 251 ? 6.126   50.902  30.678  1.00 179.39 ? 251  ASN B HD21 1 
ATOM   10028 H  HD22 . ASN B 2 251 ? 6.327   52.360  30.906  1.00 179.39 ? 251  ASN B HD22 1 
ATOM   10029 N  N    . HIS B 2 252 ? 8.678   48.086  27.041  1.00 122.68 ? 252  HIS B N    1 
ATOM   10030 C  CA   . HIS B 2 252 ? 9.177   46.739  26.752  1.00 122.95 ? 252  HIS B CA   1 
ATOM   10031 C  C    . HIS B 2 252 ? 10.020  46.700  25.474  1.00 111.50 ? 252  HIS B C    1 
ATOM   10032 O  O    . HIS B 2 252 ? 10.315  45.619  24.970  1.00 121.77 ? 252  HIS B O    1 
ATOM   10033 C  CB   . HIS B 2 252 ? 8.036   45.723  26.609  1.00 121.62 ? 252  HIS B CB   1 
ATOM   10034 C  CG   . HIS B 2 252 ? 7.226   45.531  27.851  1.00 140.49 ? 252  HIS B CG   1 
ATOM   10035 N  ND1  . HIS B 2 252 ? 5.997   44.907  27.849  1.00 151.15 ? 252  HIS B ND1  1 
ATOM   10036 C  CD2  . HIS B 2 252 ? 7.445   45.927  29.128  1.00 136.75 ? 252  HIS B CD2  1 
ATOM   10037 C  CE1  . HIS B 2 252 ? 5.506   44.901  29.075  1.00 156.76 ? 252  HIS B CE1  1 
ATOM   10038 N  NE2  . HIS B 2 252 ? 6.365   45.514  29.870  1.00 158.96 ? 252  HIS B NE2  1 
ATOM   10039 H  H    . HIS B 2 252 ? 7.850   48.213  26.849  1.00 147.21 ? 252  HIS B H    1 
ATOM   10040 H  HA   . HIS B 2 252 ? 9.740   46.451  27.487  1.00 147.54 ? 252  HIS B HA   1 
ATOM   10041 H  HB2  . HIS B 2 252 ? 7.436   46.025  25.909  1.00 145.94 ? 252  HIS B HB2  1 
ATOM   10042 H  HB3  . HIS B 2 252 ? 8.414   44.863  26.368  1.00 145.94 ? 252  HIS B HB3  1 
ATOM   10043 H  HD1  . HIS B 2 252 ? 5.615   44.563  27.159  1.00 181.38 ? 252  HIS B HD1  1 
ATOM   10044 H  HD2  . HIS B 2 252 ? 8.192   46.380  29.446  1.00 164.10 ? 252  HIS B HD2  1 
ATOM   10045 H  HE1  . HIS B 2 252 ? 4.693   44.531  29.335  1.00 188.11 ? 252  HIS B HE1  1 
ATOM   10046 H  HE2  . HIS B 2 252 ? 6.264   45.636  30.716  1.00 190.75 ? 252  HIS B HE2  1 
ATOM   10047 N  N    . LEU B 2 253 ? 10.416  47.859  24.954  1.00 103.06 ? 253  LEU B N    1 
ATOM   10048 C  CA   . LEU B 2 253 ? 11.227  47.904  23.735  1.00 112.43 ? 253  LEU B CA   1 
ATOM   10049 C  C    . LEU B 2 253 ? 12.592  47.250  23.926  1.00 116.00 ? 253  LEU B C    1 
ATOM   10050 O  O    . LEU B 2 253 ? 13.328  47.050  22.958  1.00 117.53 ? 253  LEU B O    1 
ATOM   10051 C  CB   . LEU B 2 253 ? 11.421  49.348  23.263  1.00 103.14 ? 253  LEU B CB   1 
ATOM   10052 C  CG   . LEU B 2 253 ? 10.189  50.102  22.769  1.00 101.28 ? 253  LEU B CG   1 
ATOM   10053 C  CD1  . LEU B 2 253 ? 10.609  51.448  22.192  1.00 96.19  ? 253  LEU B CD1  1 
ATOM   10054 C  CD2  . LEU B 2 253 ? 9.418   49.301  21.739  1.00 85.72  ? 253  LEU B CD2  1 
ATOM   10055 O  OXT  . LEU B 2 253 ? 12.993  46.909  25.038  1.00 126.03 ? 253  LEU B OXT  1 
ATOM   10056 H  H    . LEU B 2 253 ? 10.230  48.631  25.284  1.00 123.67 ? 253  LEU B H    1 
ATOM   10057 H  HA   . LEU B 2 253 ? 10.762  47.422  23.033  1.00 134.92 ? 253  LEU B HA   1 
ATOM   10058 H  HB2  . LEU B 2 253 ? 11.788  49.857  24.003  1.00 123.77 ? 253  LEU B HB2  1 
ATOM   10059 H  HB3  . LEU B 2 253 ? 12.061  49.341  22.534  1.00 123.77 ? 253  LEU B HB3  1 
ATOM   10060 H  HG   . LEU B 2 253 ? 9.599   50.270  23.520  1.00 121.54 ? 253  LEU B HG   1 
ATOM   10061 H  HD11 . LEU B 2 253 ? 11.217  51.298  21.452  1.00 115.43 ? 253  LEU B HD11 1 
ATOM   10062 H  HD12 . LEU B 2 253 ? 9.819   51.918  21.882  1.00 115.43 ? 253  LEU B HD12 1 
ATOM   10063 H  HD13 . LEU B 2 253 ? 11.050  51.964  22.885  1.00 115.43 ? 253  LEU B HD13 1 
ATOM   10064 H  HD21 . LEU B 2 253 ? 9.130   48.467  22.141  1.00 102.86 ? 253  LEU B HD21 1 
ATOM   10065 H  HD22 . LEU B 2 253 ? 8.647   49.815  21.453  1.00 102.86 ? 253  LEU B HD22 1 
ATOM   10066 H  HD23 . LEU B 2 253 ? 9.996   49.122  20.982  1.00 102.86 ? 253  LEU B HD23 1 
ATOM   10067 N  N    . PHE C 1 7   ? -15.662 49.035  61.059  1.00 138.62 ? 4    PHE C N    1 
ATOM   10068 C  CA   . PHE C 1 7   ? -16.151 49.198  59.694  1.00 129.86 ? 4    PHE C CA   1 
ATOM   10069 C  C    . PHE C 1 7   ? -16.170 47.841  58.989  1.00 125.09 ? 4    PHE C C    1 
ATOM   10070 O  O    . PHE C 1 7   ? -15.219 47.068  59.100  1.00 118.88 ? 4    PHE C O    1 
ATOM   10071 C  CB   . PHE C 1 7   ? -15.268 50.192  58.935  1.00 135.65 ? 4    PHE C CB   1 
ATOM   10072 C  CG   . PHE C 1 7   ? -15.608 50.327  57.473  1.00 130.17 ? 4    PHE C CG   1 
ATOM   10073 C  CD1  . PHE C 1 7   ? -16.710 51.066  57.068  1.00 131.73 ? 4    PHE C CD1  1 
ATOM   10074 C  CD2  . PHE C 1 7   ? -14.826 49.715  56.505  1.00 119.45 ? 4    PHE C CD2  1 
ATOM   10075 C  CE1  . PHE C 1 7   ? -17.023 51.196  55.726  1.00 120.29 ? 4    PHE C CE1  1 
ATOM   10076 C  CE2  . PHE C 1 7   ? -15.135 49.839  55.164  1.00 116.78 ? 4    PHE C CE2  1 
ATOM   10077 C  CZ   . PHE C 1 7   ? -16.236 50.581  54.774  1.00 114.66 ? 4    PHE C CZ   1 
ATOM   10078 H  HA   . PHE C 1 7   ? -17.057 49.545  59.715  1.00 155.83 ? 4    PHE C HA   1 
ATOM   10079 H  HB2  . PHE C 1 7   ? -15.363 51.067  59.343  1.00 162.78 ? 4    PHE C HB2  1 
ATOM   10080 H  HB3  . PHE C 1 7   ? -14.345 49.899  58.999  1.00 162.78 ? 4    PHE C HB3  1 
ATOM   10081 H  HD1  . PHE C 1 7   ? -17.242 51.483  57.706  1.00 158.08 ? 4    PHE C HD1  1 
ATOM   10082 H  HD2  . PHE C 1 7   ? -14.084 49.216  56.762  1.00 143.34 ? 4    PHE C HD2  1 
ATOM   10083 H  HE1  . PHE C 1 7   ? -17.764 51.694  55.466  1.00 144.35 ? 4    PHE C HE1  1 
ATOM   10084 H  HE2  . PHE C 1 7   ? -14.603 49.424  54.524  1.00 140.14 ? 4    PHE C HE2  1 
ATOM   10085 H  HZ   . PHE C 1 7   ? -16.445 50.665  53.872  1.00 137.59 ? 4    PHE C HZ   1 
ATOM   10086 N  N    . ASP C 1 8   ? -17.242 47.569  58.248  1.00 130.96 ? 5    ASP C N    1 
ATOM   10087 C  CA   . ASP C 1 8   ? -17.426 46.271  57.597  1.00 137.92 ? 5    ASP C CA   1 
ATOM   10088 C  C    . ASP C 1 8   ? -17.351 46.411  56.072  1.00 137.34 ? 5    ASP C C    1 
ATOM   10089 O  O    . ASP C 1 8   ? -18.199 47.071  55.474  1.00 134.81 ? 5    ASP C O    1 
ATOM   10090 C  CB   . ASP C 1 8   ? -18.766 45.654  58.010  1.00 141.93 ? 5    ASP C CB   1 
ATOM   10091 C  CG   . ASP C 1 8   ? -19.067 44.364  57.272  1.00 142.90 ? 5    ASP C CG   1 
ATOM   10092 O  OD1  . ASP C 1 8   ? -18.122 43.588  57.017  1.00 137.20 ? 5    ASP C OD1  1 
ATOM   10093 O  OD2  . ASP C 1 8   ? -20.249 44.113  56.957  1.00 145.43 ? 5    ASP C OD2  1 
ATOM   10094 H  H    . ASP C 1 8   ? -17.884 48.123  58.106  1.00 157.16 ? 5    ASP C H    1 
ATOM   10095 H  HA   . ASP C 1 8   ? -16.718 45.671  57.880  1.00 165.51 ? 5    ASP C HA   1 
ATOM   10096 H  HB2  . ASP C 1 8   ? -18.746 45.459  58.960  1.00 170.31 ? 5    ASP C HB2  1 
ATOM   10097 H  HB3  . ASP C 1 8   ? -19.478 46.284  57.816  1.00 170.31 ? 5    ASP C HB3  1 
ATOM   10098 N  N    . PRO C 1 9   ? -16.332 45.802  55.434  1.00 134.05 ? 6    PRO C N    1 
ATOM   10099 C  CA   . PRO C 1 9   ? -16.191 45.966  53.978  1.00 141.90 ? 6    PRO C CA   1 
ATOM   10100 C  C    . PRO C 1 9   ? -17.248 45.257  53.120  1.00 142.31 ? 6    PRO C C    1 
ATOM   10101 O  O    . PRO C 1 9   ? -17.142 45.318  51.894  1.00 136.51 ? 6    PRO C O    1 
ATOM   10102 C  CB   . PRO C 1 9   ? -14.812 45.354  53.692  1.00 139.28 ? 6    PRO C CB   1 
ATOM   10103 C  CG   . PRO C 1 9   ? -14.100 45.355  55.000  1.00 127.74 ? 6    PRO C CG   1 
ATOM   10104 C  CD   . PRO C 1 9   ? -15.158 45.136  56.024  1.00 122.48 ? 6    PRO C CD   1 
ATOM   10105 H  HA   . PRO C 1 9   ? -16.175 46.909  53.748  1.00 170.28 ? 6    PRO C HA   1 
ATOM   10106 H  HB2  . PRO C 1 9   ? -14.919 44.449  53.361  1.00 167.14 ? 6    PRO C HB2  1 
ATOM   10107 H  HB3  . PRO C 1 9   ? -14.340 45.902  53.045  1.00 167.14 ? 6    PRO C HB3  1 
ATOM   10108 H  HG2  . PRO C 1 9   ? -13.451 44.635  55.019  1.00 153.29 ? 6    PRO C HG2  1 
ATOM   10109 H  HG3  . PRO C 1 9   ? -13.665 46.212  55.135  1.00 153.29 ? 6    PRO C HG3  1 
ATOM   10110 H  HD2  . PRO C 1 9   ? -15.328 44.188  56.139  1.00 146.98 ? 6    PRO C HD2  1 
ATOM   10111 H  HD3  . PRO C 1 9   ? -14.913 45.559  56.862  1.00 146.98 ? 6    PRO C HD3  1 
ATOM   10112 N  N    . THR C 1 10  ? -18.243 44.621  53.734  1.00 140.90 ? 7    THR C N    1 
ATOM   10113 C  CA   . THR C 1 10  ? -19.290 43.932  52.977  1.00 133.66 ? 7    THR C CA   1 
ATOM   10114 C  C    . THR C 1 10  ? -20.526 44.815  52.834  1.00 135.42 ? 7    THR C C    1 
ATOM   10115 O  O    . THR C 1 10  ? -21.339 44.616  51.930  1.00 129.02 ? 7    THR C O    1 
ATOM   10116 C  CB   . THR C 1 10  ? -19.691 42.600  53.638  1.00 139.73 ? 7    THR C CB   1 
ATOM   10117 O  OG1  . THR C 1 10  ? -19.898 42.797  55.041  1.00 147.43 ? 7    THR C OG1  1 
ATOM   10118 C  CG2  . THR C 1 10  ? -18.608 41.549  53.425  1.00 128.38 ? 7    THR C CG2  1 
ATOM   10119 H  H    . THR C 1 10  ? -18.337 44.572  54.587  1.00 169.08 ? 7    THR C H    1 
ATOM   10120 H  HA   . THR C 1 10  ? -18.957 43.736  52.087  1.00 160.39 ? 7    THR C HA   1 
ATOM   10121 H  HB   . THR C 1 10  ? -20.512 42.277  53.235  1.00 167.67 ? 7    THR C HB   1 
ATOM   10122 H  HG1  . THR C 1 10  ? -20.510 43.360  55.164  1.00 176.92 ? 7    THR C HG1  1 
ATOM   10123 H  HG21 . THR C 1 10  ? -17.772 41.850  53.815  1.00 154.05 ? 7    THR C HG21 1 
ATOM   10124 H  HG22 . THR C 1 10  ? -18.869 40.714  53.844  1.00 154.05 ? 7    THR C HG22 1 
ATOM   10125 H  HG23 . THR C 1 10  ? -18.475 41.397  52.476  1.00 154.05 ? 7    THR C HG23 1 
ATOM   10126 N  N    . GLU C 1 11  ? -20.661 45.789  53.731  1.00 136.13 ? 8    GLU C N    1 
ATOM   10127 C  CA   . GLU C 1 11  ? -21.714 46.796  53.625  1.00 141.88 ? 8    GLU C CA   1 
ATOM   10128 C  C    . GLU C 1 11  ? -21.392 47.818  52.538  1.00 140.41 ? 8    GLU C C    1 
ATOM   10129 O  O    . GLU C 1 11  ? -22.231 48.646  52.179  1.00 137.06 ? 8    GLU C O    1 
ATOM   10130 C  CB   . GLU C 1 11  ? -21.902 47.519  54.961  1.00 143.49 ? 8    GLU C CB   1 
ATOM   10131 C  CG   . GLU C 1 11  ? -22.344 46.629  56.111  1.00 148.11 ? 8    GLU C CG   1 
ATOM   10132 C  CD   . GLU C 1 11  ? -22.464 47.384  57.426  1.00 152.40 ? 8    GLU C CD   1 
ATOM   10133 O  OE1  . GLU C 1 11  ? -21.914 48.502  57.528  1.00 152.88 ? 8    GLU C OE1  1 
ATOM   10134 O  OE2  . GLU C 1 11  ? -23.107 46.861  58.361  1.00 149.87 ? 8    GLU C OE2  1 
ATOM   10135 H  H    . GLU C 1 11  ? -20.151 45.890  54.416  1.00 163.36 ? 8    GLU C H    1 
ATOM   10136 H  HA   . GLU C 1 11  ? -22.550 46.362  53.394  1.00 170.26 ? 8    GLU C HA   1 
ATOM   10137 H  HB2  . GLU C 1 11  ? -21.059 47.926  55.214  1.00 172.18 ? 8    GLU C HB2  1 
ATOM   10138 H  HB3  . GLU C 1 11  ? -22.575 48.208  54.848  1.00 172.18 ? 8    GLU C HB3  1 
ATOM   10139 H  HG2  . GLU C 1 11  ? -23.213 46.250  55.902  1.00 177.74 ? 8    GLU C HG2  1 
ATOM   10140 H  HG3  . GLU C 1 11  ? -21.693 45.920  56.230  1.00 177.74 ? 8    GLU C HG3  1 
ATOM   10141 N  N    . LEU C 1 12  ? -20.165 47.759  52.030  1.00 138.01 ? 9    LEU C N    1 
ATOM   10142 C  CA   . LEU C 1 12  ? -19.644 48.797  51.148  1.00 137.29 ? 9    LEU C CA   1 
ATOM   10143 C  C    . LEU C 1 12  ? -20.464 49.043  49.880  1.00 133.91 ? 9    LEU C C    1 
ATOM   10144 O  O    . LEU C 1 12  ? -20.837 50.183  49.604  1.00 131.39 ? 9    LEU C O    1 
ATOM   10145 C  CB   . LEU C 1 12  ? -18.201 48.458  50.761  1.00 131.44 ? 9    LEU C CB   1 
ATOM   10146 C  CG   . LEU C 1 12  ? -17.354 49.589  50.173  1.00 128.40 ? 9    LEU C CG   1 
ATOM   10147 C  CD1  . LEU C 1 12  ? -17.449 50.891  50.968  1.00 117.56 ? 9    LEU C CD1  1 
ATOM   10148 C  CD2  . LEU C 1 12  ? -15.910 49.121  50.093  1.00 118.57 ? 9    LEU C CD2  1 
ATOM   10149 H  H    . LEU C 1 12  ? -19.609 47.120  52.182  1.00 165.61 ? 9    LEU C H    1 
ATOM   10150 H  HA   . LEU C 1 12  ? -19.622 49.631  51.642  1.00 164.75 ? 9    LEU C HA   1 
ATOM   10151 H  HB2  . LEU C 1 12  ? -17.742 48.142  51.555  1.00 157.73 ? 9    LEU C HB2  1 
ATOM   10152 H  HB3  . LEU C 1 12  ? -18.224 47.747  50.102  1.00 157.73 ? 9    LEU C HB3  1 
ATOM   10153 H  HG   . LEU C 1 12  ? -17.658 49.770  49.269  1.00 154.08 ? 9    LEU C HG   1 
ATOM   10154 H  HD11 . LEU C 1 12  ? -17.142 50.731  51.873  1.00 141.07 ? 9    LEU C HD11 1 
ATOM   10155 H  HD12 . LEU C 1 12  ? -16.892 51.562  50.542  1.00 141.07 ? 9    LEU C HD12 1 
ATOM   10156 H  HD13 . LEU C 1 12  ? -18.373 51.187  50.979  1.00 141.07 ? 9    LEU C HD13 1 
ATOM   10157 H  HD21 . LEU C 1 12  ? -15.863 48.337  49.523  1.00 142.28 ? 9    LEU C HD21 1 
ATOM   10158 H  HD22 . LEU C 1 12  ? -15.368 49.834  49.720  1.00 142.28 ? 9    LEU C HD22 1 
ATOM   10159 H  HD23 . LEU C 1 12  ? -15.600 48.901  50.985  1.00 142.28 ? 9    LEU C HD23 1 
ATOM   10160 N  N    . PRO C 1 13  ? -20.777 47.981  49.118  1.00 130.32 ? 10   PRO C N    1 
ATOM   10161 C  CA   . PRO C 1 13  ? -21.492 48.224  47.860  1.00 128.78 ? 10   PRO C CA   1 
ATOM   10162 C  C    . PRO C 1 13  ? -22.866 48.854  48.063  1.00 130.93 ? 10   PRO C C    1 
ATOM   10163 O  O    . PRO C 1 13  ? -23.374 49.507  47.153  1.00 131.00 ? 10   PRO C O    1 
ATOM   10164 C  CB   . PRO C 1 13  ? -21.617 46.823  47.248  1.00 125.52 ? 10   PRO C CB   1 
ATOM   10165 C  CG   . PRO C 1 13  ? -21.438 45.882  48.381  1.00 129.77 ? 10   PRO C CG   1 
ATOM   10166 C  CD   . PRO C 1 13  ? -20.486 46.551  49.314  1.00 131.53 ? 10   PRO C CD   1 
ATOM   10167 H  HA   . PRO C 1 13  ? -20.963 48.786  47.273  1.00 154.53 ? 10   PRO C HA   1 
ATOM   10168 H  HB2  . PRO C 1 13  ? -22.496 46.718  46.851  1.00 150.63 ? 10   PRO C HB2  1 
ATOM   10169 H  HB3  . PRO C 1 13  ? -20.923 46.694  46.583  1.00 150.63 ? 10   PRO C HB3  1 
ATOM   10170 H  HG2  . PRO C 1 13  ? -22.292 45.730  48.816  1.00 155.72 ? 10   PRO C HG2  1 
ATOM   10171 H  HG3  . PRO C 1 13  ? -21.067 45.047  48.055  1.00 155.72 ? 10   PRO C HG3  1 
ATOM   10172 H  HD2  . PRO C 1 13  ? -20.670 46.290  50.230  1.00 157.83 ? 10   PRO C HD2  1 
ATOM   10173 H  HD3  . PRO C 1 13  ? -19.571 46.353  49.063  1.00 157.83 ? 10   PRO C HD3  1 
ATOM   10174 N  N    . GLU C 1 14  ? -23.448 48.673  49.243  1.00 135.82 ? 11   GLU C N    1 
ATOM   10175 C  CA   . GLU C 1 14  ? -24.734 49.287  49.550  1.00 142.02 ? 11   GLU C CA   1 
ATOM   10176 C  C    . GLU C 1 14  ? -24.559 50.749  49.971  1.00 140.31 ? 11   GLU C C    1 
ATOM   10177 O  O    . GLU C 1 14  ? -25.328 51.625  49.566  1.00 129.30 ? 11   GLU C O    1 
ATOM   10178 C  CB   . GLU C 1 14  ? -25.439 48.492  50.652  1.00 135.95 ? 11   GLU C CB   1 
ATOM   10179 C  CG   . GLU C 1 14  ? -25.693 47.035  50.279  1.00 140.93 ? 11   GLU C CG   1 
ATOM   10180 C  CD   . GLU C 1 14  ? -26.487 46.879  48.990  1.00 151.66 ? 11   GLU C CD   1 
ATOM   10181 O  OE1  . GLU C 1 14  ? -27.359 47.732  48.709  1.00 149.16 ? 11   GLU C OE1  1 
ATOM   10182 O  OE2  . GLU C 1 14  ? -26.231 45.904  48.250  1.00 145.46 ? 11   GLU C OE2  1 
ATOM   10183 H  H    . GLU C 1 14  ? -23.120 48.200  49.882  1.00 162.98 ? 11   GLU C H    1 
ATOM   10184 H  HA   . GLU C 1 14  ? -25.293 49.266  48.758  1.00 170.42 ? 11   GLU C HA   1 
ATOM   10185 H  HB2  . GLU C 1 14  ? -24.887 48.504  51.450  1.00 163.13 ? 11   GLU C HB2  1 
ATOM   10186 H  HB3  . GLU C 1 14  ? -26.296 48.906  50.838  1.00 163.13 ? 11   GLU C HB3  1 
ATOM   10187 H  HG2  . GLU C 1 14  ? -24.841 46.587  50.161  1.00 169.12 ? 11   GLU C HG2  1 
ATOM   10188 H  HG3  . GLU C 1 14  ? -26.195 46.610  50.992  1.00 169.12 ? 11   GLU C HG3  1 
ATOM   10189 N  N    . LEU C 1 15  ? -23.540 51.000  50.786  1.00 135.17 ? 12   LEU C N    1 
ATOM   10190 C  CA   . LEU C 1 15  ? -23.221 52.348  51.243  1.00 132.97 ? 12   LEU C CA   1 
ATOM   10191 C  C    . LEU C 1 15  ? -22.804 53.250  50.081  1.00 133.28 ? 12   LEU C C    1 
ATOM   10192 O  O    . LEU C 1 15  ? -23.150 54.436  50.034  1.00 124.19 ? 12   LEU C O    1 
ATOM   10193 C  CB   . LEU C 1 15  ? -22.113 52.287  52.295  1.00 130.94 ? 12   LEU C CB   1 
ATOM   10194 C  CG   . LEU C 1 15  ? -22.563 51.718  53.640  1.00 131.84 ? 12   LEU C CG   1 
ATOM   10195 C  CD1  . LEU C 1 15  ? -21.387 51.216  54.460  1.00 134.46 ? 12   LEU C CD1  1 
ATOM   10196 C  CD2  . LEU C 1 15  ? -23.323 52.794  54.404  1.00 123.08 ? 12   LEU C CD2  1 
ATOM   10197 H  H    . LEU C 1 15  ? -23.010 50.397  51.093  1.00 162.20 ? 12   LEU C H    1 
ATOM   10198 H  HA   . LEU C 1 15  ? -24.007 52.736  51.657  1.00 159.56 ? 12   LEU C HA   1 
ATOM   10199 H  HB2  . LEU C 1 15  ? -21.397 51.724  51.961  1.00 157.12 ? 12   LEU C HB2  1 
ATOM   10200 H  HB3  . LEU C 1 15  ? -21.779 53.184  52.449  1.00 157.12 ? 12   LEU C HB3  1 
ATOM   10201 H  HG   . LEU C 1 15  ? -23.166 50.974  53.486  1.00 158.21 ? 12   LEU C HG   1 
ATOM   10202 H  HD11 . LEU C 1 15  ? -20.778 51.954  54.624  1.00 161.35 ? 12   LEU C HD11 1 
ATOM   10203 H  HD12 . LEU C 1 15  ? -21.716 50.865  55.302  1.00 161.35 ? 12   LEU C HD12 1 
ATOM   10204 H  HD13 . LEU C 1 15  ? -20.933 50.516  53.965  1.00 161.35 ? 12   LEU C HD13 1 
ATOM   10205 H  HD21 . LEU C 1 15  ? -24.095 53.065  53.883  1.00 147.69 ? 12   LEU C HD21 1 
ATOM   10206 H  HD22 . LEU C 1 15  ? -23.608 52.433  55.257  1.00 147.69 ? 12   LEU C HD22 1 
ATOM   10207 H  HD23 . LEU C 1 15  ? -22.736 53.554  54.545  1.00 147.69 ? 12   LEU C HD23 1 
ATOM   10208 N  N    . LEU C 1 16  ? -22.078 52.658  49.136  1.00 135.56 ? 13   LEU C N    1 
ATOM   10209 C  CA   . LEU C 1 16  ? -21.609 53.364  47.950  1.00 121.79 ? 13   LEU C CA   1 
ATOM   10210 C  C    . LEU C 1 16  ? -22.775 53.911  47.137  1.00 125.90 ? 13   LEU C C    1 
ATOM   10211 O  O    . LEU C 1 16  ? -22.744 55.065  46.708  1.00 128.25 ? 13   LEU C O    1 
ATOM   10212 C  CB   . LEU C 1 16  ? -20.753 52.427  47.090  1.00 116.47 ? 13   LEU C CB   1 
ATOM   10213 C  CG   . LEU C 1 16  ? -19.335 52.105  47.579  1.00 117.95 ? 13   LEU C CG   1 
ATOM   10214 C  CD1  . LEU C 1 16  ? -18.593 51.273  46.539  1.00 111.95 ? 13   LEU C CD1  1 
ATOM   10215 C  CD2  . LEU C 1 16  ? -18.543 53.372  47.904  1.00 109.33 ? 13   LEU C CD2  1 
ATOM   10216 H  H    . LEU C 1 16  ? -21.839 51.832  49.162  1.00 162.67 ? 13   LEU C H    1 
ATOM   10217 H  HA   . LEU C 1 16  ? -21.055 54.111  48.223  1.00 146.15 ? 13   LEU C HA   1 
ATOM   10218 H  HB2  . LEU C 1 16  ? -21.223 51.582  47.010  1.00 139.77 ? 13   LEU C HB2  1 
ATOM   10219 H  HB3  . LEU C 1 16  ? -20.666 52.825  46.210  1.00 139.77 ? 13   LEU C HB3  1 
ATOM   10220 H  HG   . LEU C 1 16  ? -19.396 51.578  48.391  1.00 141.54 ? 13   LEU C HG   1 
ATOM   10221 H  HD11 . LEU C 1 16  ? -18.540 51.775  45.711  1.00 134.35 ? 13   LEU C HD11 1 
ATOM   10222 H  HD12 . LEU C 1 16  ? -17.700 51.081  46.867  1.00 134.35 ? 13   LEU C HD12 1 
ATOM   10223 H  HD13 . LEU C 1 16  ? -19.077 50.445  46.394  1.00 134.35 ? 13   LEU C HD13 1 
ATOM   10224 H  HD21 . LEU C 1 16  ? -19.005 53.862  48.602  1.00 131.20 ? 13   LEU C HD21 1 
ATOM   10225 H  HD22 . LEU C 1 16  ? -17.656 53.120  48.208  1.00 131.20 ? 13   LEU C HD22 1 
ATOM   10226 H  HD23 . LEU C 1 16  ? -18.477 53.916  47.104  1.00 131.20 ? 13   LEU C HD23 1 
ATOM   10227 N  N    . LYS C 1 17  ? -23.793 53.083  46.924  1.00 125.97 ? 14   LYS C N    1 
ATOM   10228 C  CA   . LYS C 1 17  ? -25.003 53.509  46.222  1.00 129.71 ? 14   LYS C CA   1 
ATOM   10229 C  C    . LYS C 1 17  ? -25.564 54.812  46.802  1.00 128.72 ? 14   LYS C C    1 
ATOM   10230 O  O    . LYS C 1 17  ? -25.824 55.769  46.069  1.00 122.80 ? 14   LYS C O    1 
ATOM   10231 C  CB   . LYS C 1 17  ? -26.068 52.408  46.255  1.00 128.69 ? 14   LYS C CB   1 
ATOM   10232 C  CG   . LYS C 1 17  ? -25.716 51.186  45.417  1.00 137.45 ? 14   LYS C CG   1 
ATOM   10233 C  CD   . LYS C 1 17  ? -26.842 50.158  45.373  1.00 134.60 ? 14   LYS C CD   1 
ATOM   10234 C  CE   . LYS C 1 17  ? -26.424 48.906  44.609  1.00 128.49 ? 14   LYS C CE   1 
ATOM   10235 N  NZ   . LYS C 1 17  ? -27.462 47.836  44.643  1.00 112.38 ? 14   LYS C NZ   1 
ATOM   10236 H  H    . LYS C 1 17  ? -23.809 52.261  47.178  1.00 151.16 ? 14   LYS C H    1 
ATOM   10237 H  HA   . LYS C 1 17  ? -24.780 53.673  45.293  1.00 155.65 ? 14   LYS C HA   1 
ATOM   10238 H  HB2  . LYS C 1 17  ? -26.186 52.115  47.172  1.00 154.43 ? 14   LYS C HB2  1 
ATOM   10239 H  HB3  . LYS C 1 17  ? -26.902 52.770  45.917  1.00 154.43 ? 14   LYS C HB3  1 
ATOM   10240 H  HG2  . LYS C 1 17  ? -25.532 51.468  44.507  1.00 164.94 ? 14   LYS C HG2  1 
ATOM   10241 H  HG3  . LYS C 1 17  ? -24.933 50.757  45.796  1.00 164.94 ? 14   LYS C HG3  1 
ATOM   10242 H  HD2  . LYS C 1 17  ? -27.074 49.899  46.279  1.00 161.52 ? 14   LYS C HD2  1 
ATOM   10243 H  HD3  . LYS C 1 17  ? -27.611 50.545  44.926  1.00 161.52 ? 14   LYS C HD3  1 
ATOM   10244 H  HE2  . LYS C 1 17  ? -26.264 49.140  43.682  1.00 154.19 ? 14   LYS C HE2  1 
ATOM   10245 H  HE3  . LYS C 1 17  ? -25.613 48.550  45.006  1.00 154.19 ? 14   LYS C HE3  1 
ATOM   10246 H  HZ1  . LYS C 1 17  ? -28.217 48.133  44.277  1.00 134.86 ? 14   LYS C HZ1  1 
ATOM   10247 H  HZ2  . LYS C 1 17  ? -27.180 47.125  44.188  1.00 134.86 ? 14   LYS C HZ2  1 
ATOM   10248 H  HZ3  . LYS C 1 17  ? -27.623 47.595  45.485  1.00 134.86 ? 14   LYS C HZ3  1 
ATOM   10249 N  N    . LEU C 1 18  ? -25.751 54.833  48.120  1.00 128.22 ? 15   LEU C N    1 
ATOM   10250 C  CA   . LEU C 1 18  ? -26.310 55.994  48.813  1.00 131.23 ? 15   LEU C CA   1 
ATOM   10251 C  C    . LEU C 1 18  ? -25.365 57.192  48.751  1.00 130.38 ? 15   LEU C C    1 
ATOM   10252 O  O    . LEU C 1 18  ? -25.778 58.327  48.440  1.00 123.61 ? 15   LEU C O    1 
ATOM   10253 C  CB   . LEU C 1 18  ? -26.602 55.629  50.273  1.00 139.75 ? 15   LEU C CB   1 
ATOM   10254 C  CG   . LEU C 1 18  ? -27.421 56.606  51.121  1.00 139.21 ? 15   LEU C CG   1 
ATOM   10255 C  CD1  . LEU C 1 18  ? -28.794 56.862  50.512  1.00 137.55 ? 15   LEU C CD1  1 
ATOM   10256 C  CD2  . LEU C 1 18  ? -27.558 56.062  52.536  1.00 135.17 ? 15   LEU C CD2  1 
ATOM   10257 H  H    . LEU C 1 18  ? -25.560 54.178  48.643  1.00 153.86 ? 15   LEU C H    1 
ATOM   10258 H  HA   . LEU C 1 18  ? -27.146 56.246  48.391  1.00 157.48 ? 15   LEU C HA   1 
ATOM   10259 H  HB2  . LEU C 1 18  ? -27.081 54.785  50.277  1.00 167.69 ? 15   LEU C HB2  1 
ATOM   10260 H  HB3  . LEU C 1 18  ? -25.752 55.510  50.725  1.00 167.69 ? 15   LEU C HB3  1 
ATOM   10261 H  HG   . LEU C 1 18  ? -26.951 57.453  51.169  1.00 167.05 ? 15   LEU C HG   1 
ATOM   10262 H  HD11 . LEU C 1 18  ? -29.276 56.022  50.455  1.00 165.06 ? 15   LEU C HD11 1 
ATOM   10263 H  HD12 . LEU C 1 18  ? -29.279 57.484  51.078  1.00 165.06 ? 15   LEU C HD12 1 
ATOM   10264 H  HD13 . LEU C 1 18  ? -28.681 57.240  49.626  1.00 165.06 ? 15   LEU C HD13 1 
ATOM   10265 H  HD21 . LEU C 1 18  ? -26.674 55.957  52.920  1.00 162.21 ? 15   LEU C HD21 1 
ATOM   10266 H  HD22 . LEU C 1 18  ? -28.078 56.687  53.065  1.00 162.21 ? 15   LEU C HD22 1 
ATOM   10267 H  HD23 . LEU C 1 18  ? -28.008 55.203  52.501  1.00 162.21 ? 15   LEU C HD23 1 
ATOM   10268 N  N    . TYR C 1 19  ? -24.093 56.922  49.034  1.00 128.97 ? 16   TYR C N    1 
ATOM   10269 C  CA   . TYR C 1 19  ? -23.073 57.959  49.067  1.00 125.69 ? 16   TYR C CA   1 
ATOM   10270 C  C    . TYR C 1 19  ? -22.975 58.671  47.724  1.00 125.95 ? 16   TYR C C    1 
ATOM   10271 O  O    . TYR C 1 19  ? -22.974 59.901  47.657  1.00 121.37 ? 16   TYR C O    1 
ATOM   10272 C  CB   . TYR C 1 19  ? -21.715 57.364  49.445  1.00 122.28 ? 16   TYR C CB   1 
ATOM   10273 C  CG   . TYR C 1 19  ? -20.589 58.368  49.363  1.00 125.55 ? 16   TYR C CG   1 
ATOM   10274 C  CD1  . TYR C 1 19  ? -20.435 59.348  50.331  1.00 124.44 ? 16   TYR C CD1  1 
ATOM   10275 C  CD2  . TYR C 1 19  ? -19.677 58.332  48.315  1.00 125.63 ? 16   TYR C CD2  1 
ATOM   10276 C  CE1  . TYR C 1 19  ? -19.413 60.271  50.256  1.00 125.72 ? 16   TYR C CE1  1 
ATOM   10277 C  CE2  . TYR C 1 19  ? -18.649 59.251  48.231  1.00 121.75 ? 16   TYR C CE2  1 
ATOM   10278 C  CZ   . TYR C 1 19  ? -18.522 60.218  49.206  1.00 125.19 ? 16   TYR C CZ   1 
ATOM   10279 O  OH   . TYR C 1 19  ? -17.502 61.138  49.137  1.00 119.81 ? 16   TYR C OH   1 
ATOM   10280 H  H    . TYR C 1 19  ? -23.794 56.135  49.212  1.00 154.76 ? 16   TYR C H    1 
ATOM   10281 H  HA   . TYR C 1 19  ? -23.311 58.616  49.740  1.00 150.83 ? 16   TYR C HA   1 
ATOM   10282 H  HB2  . TYR C 1 19  ? -21.757 57.036  50.357  1.00 146.74 ? 16   TYR C HB2  1 
ATOM   10283 H  HB3  . TYR C 1 19  ? -21.511 56.635  48.839  1.00 146.74 ? 16   TYR C HB3  1 
ATOM   10284 H  HD1  . TYR C 1 19  ? -21.036 59.389  51.040  1.00 149.33 ? 16   TYR C HD1  1 
ATOM   10285 H  HD2  . TYR C 1 19  ? -19.764 57.683  47.655  1.00 150.75 ? 16   TYR C HD2  1 
ATOM   10286 H  HE1  . TYR C 1 19  ? -19.323 60.923  50.913  1.00 150.87 ? 16   TYR C HE1  1 
ATOM   10287 H  HE2  . TYR C 1 19  ? -18.046 59.217  47.523  1.00 146.10 ? 16   TYR C HE2  1 
ATOM   10288 H  HH   . TYR C 1 19  ? -17.033 60.997  48.455  1.00 143.77 ? 16   TYR C HH   1 
ATOM   10289 N  N    . TYR C 1 20  ? -22.908 57.888  46.656  1.00 118.04 ? 17   TYR C N    1 
ATOM   10290 C  CA   . TYR C 1 20  ? -22.765 58.437  45.317  1.00 118.02 ? 17   TYR C CA   1 
ATOM   10291 C  C    . TYR C 1 20  ? -24.020 59.174  44.866  1.00 126.19 ? 17   TYR C C    1 
ATOM   10292 O  O    . TYR C 1 20  ? -23.976 59.932  43.897  1.00 121.80 ? 17   TYR C O    1 
ATOM   10293 C  CB   . TYR C 1 20  ? -22.425 57.325  44.323  1.00 118.94 ? 17   TYR C CB   1 
ATOM   10294 C  CG   . TYR C 1 20  ? -20.984 56.861  44.384  1.00 112.97 ? 17   TYR C CG   1 
ATOM   10295 C  CD1  . TYR C 1 20  ? -19.942 57.770  44.521  1.00 109.52 ? 17   TYR C CD1  1 
ATOM   10296 C  CD2  . TYR C 1 20  ? -20.666 55.512  44.305  1.00 110.78 ? 17   TYR C CD2  1 
ATOM   10297 C  CE1  . TYR C 1 20  ? -18.630 57.350  44.577  1.00 106.13 ? 17   TYR C CE1  1 
ATOM   10298 C  CE2  . TYR C 1 20  ? -19.355 55.082  44.361  1.00 109.34 ? 17   TYR C CE2  1 
ATOM   10299 C  CZ   . TYR C 1 20  ? -18.341 56.005  44.496  1.00 101.24 ? 17   TYR C CZ   1 
ATOM   10300 O  OH   . TYR C 1 20  ? -17.033 55.582  44.552  1.00 91.93  ? 17   TYR C OH   1 
ATOM   10301 H  H    . TYR C 1 20  ? -22.942 57.029  46.680  1.00 141.65 ? 17   TYR C H    1 
ATOM   10302 H  HA   . TYR C 1 20  ? -22.031 59.072  45.316  1.00 141.63 ? 17   TYR C HA   1 
ATOM   10303 H  HB2  . TYR C 1 20  ? -22.990 56.559  44.508  1.00 142.73 ? 17   TYR C HB2  1 
ATOM   10304 H  HB3  . TYR C 1 20  ? -22.594 57.648  43.424  1.00 142.73 ? 17   TYR C HB3  1 
ATOM   10305 H  HD1  . TYR C 1 20  ? -20.133 58.679  44.575  1.00 131.43 ? 17   TYR C HD1  1 
ATOM   10306 H  HD2  . TYR C 1 20  ? -21.348 54.887  44.214  1.00 132.94 ? 17   TYR C HD2  1 
ATOM   10307 H  HE1  . TYR C 1 20  ? -17.943 57.971  44.668  1.00 127.35 ? 17   TYR C HE1  1 
ATOM   10308 H  HE2  . TYR C 1 20  ? -19.158 54.175  44.307  1.00 131.20 ? 17   TYR C HE2  1 
ATOM   10309 H  HH   . TYR C 1 20  ? -17.000 54.745  44.492  1.00 110.32 ? 17   TYR C HH   1 
ATOM   10310 N  N    . ARG C 1 21  ? -25.136 58.964  45.561  1.00 135.05 ? 18   ARG C N    1 
ATOM   10311 C  CA   . ARG C 1 21  ? -26.387 59.613  45.174  1.00 134.80 ? 18   ARG C CA   1 
ATOM   10312 C  C    . ARG C 1 21  ? -26.634 60.887  45.986  1.00 136.86 ? 18   ARG C C    1 
ATOM   10313 O  O    . ARG C 1 21  ? -27.088 61.893  45.427  1.00 120.07 ? 18   ARG C O    1 
ATOM   10314 C  CB   . ARG C 1 21  ? -27.579 58.656  45.331  1.00 128.15 ? 18   ARG C CB   1 
ATOM   10315 C  CG   . ARG C 1 21  ? -28.933 59.290  44.961  1.00 131.99 ? 18   ARG C CG   1 
ATOM   10316 C  CD   . ARG C 1 21  ? -29.025 59.616  43.470  1.00 141.48 ? 18   ARG C CD   1 
ATOM   10317 N  NE   . ARG C 1 21  ? -30.101 60.559  43.155  1.00 139.60 ? 18   ARG C NE   1 
ATOM   10318 C  CZ   . ARG C 1 21  ? -30.234 61.183  41.985  1.00 137.39 ? 18   ARG C CZ   1 
ATOM   10319 N  NH1  . ARG C 1 21  ? -29.366 60.966  41.007  1.00 130.22 ? 18   ARG C NH1  1 
ATOM   10320 N  NH2  . ARG C 1 21  ? -31.237 62.028  41.789  1.00 138.33 ? 18   ARG C NH2  1 
ATOM   10321 H  H    . ARG C 1 21  ? -25.196 58.457  46.253  1.00 162.06 ? 18   ARG C H    1 
ATOM   10322 H  HA   . ARG C 1 21  ? -26.331 59.865  44.239  1.00 161.75 ? 18   ARG C HA   1 
ATOM   10323 H  HB2  . ARG C 1 21  ? -27.443 57.889  44.753  1.00 153.78 ? 18   ARG C HB2  1 
ATOM   10324 H  HB3  . ARG C 1 21  ? -27.629 58.368  46.255  1.00 153.78 ? 18   ARG C HB3  1 
ATOM   10325 H  HG2  . ARG C 1 21  ? -29.646 58.668  45.179  1.00 158.38 ? 18   ARG C HG2  1 
ATOM   10326 H  HG3  . ARG C 1 21  ? -29.046 60.115  45.459  1.00 158.38 ? 18   ARG C HG3  1 
ATOM   10327 H  HD2  . ARG C 1 21  ? -28.188 60.011  43.181  1.00 169.77 ? 18   ARG C HD2  1 
ATOM   10328 H  HD3  . ARG C 1 21  ? -29.192 58.797  42.978  1.00 169.77 ? 18   ARG C HD3  1 
ATOM   10329 H  HE   . ARG C 1 21  ? -30.686 60.719  43.765  1.00 167.52 ? 18   ARG C HE   1 
ATOM   10330 H  HH11 . ARG C 1 21  ? -28.711 60.421  41.126  1.00 156.27 ? 18   ARG C HH11 1 
ATOM   10331 H  HH12 . ARG C 1 21  ? -29.457 61.371  40.253  1.00 156.27 ? 18   ARG C HH12 1 
ATOM   10332 H  HH21 . ARG C 1 21  ? -31.806 62.174  42.417  1.00 166.00 ? 18   ARG C HH21 1 
ATOM   10333 H  HH22 . ARG C 1 21  ? -31.321 62.426  41.031  1.00 166.00 ? 18   ARG C HH22 1 
ATOM   10334 N  N    . ARG C 1 22  ? -26.323 60.862  47.284  1.00 131.84 ? 19   ARG C N    1 
ATOM   10335 C  CA   . ARG C 1 22  ? -26.708 61.981  48.157  1.00 131.24 ? 19   ARG C CA   1 
ATOM   10336 C  C    . ARG C 1 22  ? -25.603 62.610  49.009  1.00 128.88 ? 19   ARG C C    1 
ATOM   10337 O  O    . ARG C 1 22  ? -25.900 63.479  49.832  1.00 122.19 ? 19   ARG C O    1 
ATOM   10338 C  CB   . ARG C 1 22  ? -27.837 61.545  49.095  1.00 138.91 ? 19   ARG C CB   1 
ATOM   10339 C  CG   . ARG C 1 22  ? -29.161 61.283  48.400  1.00 144.36 ? 19   ARG C CG   1 
ATOM   10340 C  CD   . ARG C 1 22  ? -30.240 60.940  49.413  1.00 153.10 ? 19   ARG C CD   1 
ATOM   10341 N  NE   . ARG C 1 22  ? -30.540 62.083  50.277  1.00 154.83 ? 19   ARG C NE   1 
ATOM   10342 C  CZ   . ARG C 1 22  ? -31.101 61.998  51.480  1.00 148.05 ? 19   ARG C CZ   1 
ATOM   10343 N  NH1  . ARG C 1 22  ? -31.435 60.818  51.985  1.00 143.18 ? 19   ARG C NH1  1 
ATOM   10344 N  NH2  . ARG C 1 22  ? -31.328 63.100  52.183  1.00 145.80 ? 19   ARG C NH2  1 
ATOM   10345 H  H    . ARG C 1 22  ? -25.900 60.226  47.679  1.00 158.21 ? 19   ARG C H    1 
ATOM   10346 H  HA   . ARG C 1 22  ? -27.064 62.686  47.594  1.00 157.48 ? 19   ARG C HA   1 
ATOM   10347 H  HB2  . ARG C 1 22  ? -27.572 60.725  49.541  1.00 166.69 ? 19   ARG C HB2  1 
ATOM   10348 H  HB3  . ARG C 1 22  ? -27.983 62.243  49.753  1.00 166.69 ? 19   ARG C HB3  1 
ATOM   10349 H  HG2  . ARG C 1 22  ? -29.435 62.079  47.918  1.00 173.24 ? 19   ARG C HG2  1 
ATOM   10350 H  HG3  . ARG C 1 22  ? -29.063 60.535  47.790  1.00 173.24 ? 19   ARG C HG3  1 
ATOM   10351 H  HD2  . ARG C 1 22  ? -31.052 60.690  48.946  1.00 183.72 ? 19   ARG C HD2  1 
ATOM   10352 H  HD3  . ARG C 1 22  ? -29.935 60.208  49.972  1.00 183.72 ? 19   ARG C HD3  1 
ATOM   10353 H  HE   . ARG C 1 22  ? -30.338 62.866  49.986  1.00 185.80 ? 19   ARG C HE   1 
ATOM   10354 H  HH11 . ARG C 1 22  ? -31.290 60.101  51.534  1.00 171.81 ? 19   ARG C HH11 1 
ATOM   10355 H  HH12 . ARG C 1 22  ? -31.798 60.771  52.764  1.00 171.81 ? 19   ARG C HH12 1 
ATOM   10356 H  HH21 . ARG C 1 22  ? -31.114 63.868  51.861  1.00 174.96 ? 19   ARG C HH21 1 
ATOM   10357 H  HH22 . ARG C 1 22  ? -31.691 63.047  52.961  1.00 174.96 ? 19   ARG C HH22 1 
ATOM   10358 N  N    . LEU C 1 23  ? -24.345 62.226  48.810  1.00 132.54 ? 20   LEU C N    1 
ATOM   10359 C  CA   . LEU C 1 23  ? -23.274 62.757  49.658  1.00 127.14 ? 20   LEU C CA   1 
ATOM   10360 C  C    . LEU C 1 23  ? -22.056 63.273  48.900  1.00 117.74 ? 20   LEU C C    1 
ATOM   10361 O  O    . LEU C 1 23  ? -21.543 64.345  49.226  1.00 109.28 ? 20   LEU C O    1 
ATOM   10362 C  CB   . LEU C 1 23  ? -22.843 61.673  50.647  1.00 121.41 ? 20   LEU C CB   1 
ATOM   10363 C  CG   . LEU C 1 23  ? -23.787 61.501  51.838  1.00 121.16 ? 20   LEU C CG   1 
ATOM   10364 C  CD1  . LEU C 1 23  ? -23.363 60.322  52.691  1.00 127.39 ? 20   LEU C CD1  1 
ATOM   10365 C  CD2  . LEU C 1 23  ? -23.845 62.769  52.697  1.00 111.54 ? 20   LEU C CD2  1 
ATOM   10366 H  H    . LEU C 1 23  ? -24.086 61.672  48.205  1.00 159.04 ? 20   LEU C H    1 
ATOM   10367 H  HA   . LEU C 1 23  ? -23.630 63.498  50.173  1.00 152.57 ? 20   LEU C HA   1 
ATOM   10368 H  HB2  . LEU C 1 23  ? -22.799 60.824  50.179  1.00 145.69 ? 20   LEU C HB2  1 
ATOM   10369 H  HB3  . LEU C 1 23  ? -21.966 61.900  50.996  1.00 145.69 ? 20   LEU C HB3  1 
ATOM   10370 H  HG   . LEU C 1 23  ? -24.682 61.324  51.507  1.00 145.39 ? 20   LEU C HG   1 
ATOM   10371 H  HD11 . LEU C 1 23  ? -22.464 60.477  53.019  1.00 152.86 ? 20   LEU C HD11 1 
ATOM   10372 H  HD12 . LEU C 1 23  ? -23.977 60.235  53.437  1.00 152.86 ? 20   LEU C HD12 1 
ATOM   10373 H  HD13 . LEU C 1 23  ? -23.385 59.517  52.149  1.00 152.86 ? 20   LEU C HD13 1 
ATOM   10374 H  HD21 . LEU C 1 23  ? -24.164 63.505  52.151  1.00 133.85 ? 20   LEU C HD21 1 
ATOM   10375 H  HD22 . LEU C 1 23  ? -24.452 62.620  53.439  1.00 133.85 ? 20   LEU C HD22 1 
ATOM   10376 H  HD23 . LEU C 1 23  ? -22.956 62.965  53.031  1.00 133.85 ? 20   LEU C HD23 1 
ATOM   10377 N  N    . PHE C 1 24  ? -21.614 62.543  47.882  1.00 118.59 ? 21   PHE C N    1 
ATOM   10378 C  CA   . PHE C 1 24  ? -20.486 62.993  47.071  1.00 111.23 ? 21   PHE C CA   1 
ATOM   10379 C  C    . PHE C 1 24  ? -20.754 64.411  46.540  1.00 102.22 ? 21   PHE C C    1 
ATOM   10380 O  O    . PHE C 1 24  ? -21.707 64.613  45.793  1.00 102.59 ? 21   PHE C O    1 
ATOM   10381 C  CB   . PHE C 1 24  ? -20.241 62.026  45.911  1.00 114.42 ? 21   PHE C CB   1 
ATOM   10382 C  CG   . PHE C 1 24  ? -18.987 62.319  45.145  1.00 111.68 ? 21   PHE C CG   1 
ATOM   10383 C  CD1  . PHE C 1 24  ? -18.986 63.261  44.130  1.00 100.34 ? 21   PHE C CD1  1 
ATOM   10384 C  CD2  . PHE C 1 24  ? -17.805 61.667  45.452  1.00 107.44 ? 21   PHE C CD2  1 
ATOM   10385 C  CE1  . PHE C 1 24  ? -17.832 63.544  43.433  1.00 95.87  ? 21   PHE C CE1  1 
ATOM   10386 C  CE2  . PHE C 1 24  ? -16.647 61.943  44.754  1.00 94.35  ? 21   PHE C CE2  1 
ATOM   10387 C  CZ   . PHE C 1 24  ? -16.659 62.886  43.745  1.00 93.48  ? 21   PHE C CZ   1 
ATOM   10388 H  H    . PHE C 1 24  ? -21.947 61.788  47.640  1.00 142.30 ? 21   PHE C H    1 
ATOM   10389 H  HA   . PHE C 1 24  ? -19.687 63.019  47.620  1.00 133.48 ? 21   PHE C HA   1 
ATOM   10390 H  HB2  . PHE C 1 24  ? -20.171 61.125  46.263  1.00 137.30 ? 21   PHE C HB2  1 
ATOM   10391 H  HB3  . PHE C 1 24  ? -20.987 62.081  45.294  1.00 137.30 ? 21   PHE C HB3  1 
ATOM   10392 H  HD1  . PHE C 1 24  ? -17.792 61.034  46.133  1.00 128.93 ? 21   PHE C HD1  1 
ATOM   10393 H  HD2  . PHE C 1 24  ? -19.772 63.710  43.918  1.00 120.41 ? 21   PHE C HD2  1 
ATOM   10394 H  HE1  . PHE C 1 24  ? -15.858 61.499  44.966  1.00 113.22 ? 21   PHE C HE1  1 
ATOM   10395 H  HE2  . PHE C 1 24  ? -17.843 64.177  42.751  1.00 115.05 ? 21   PHE C HE2  1 
ATOM   10396 H  HZ   . PHE C 1 24  ? -15.881 63.072  43.272  1.00 112.17 ? 21   PHE C HZ   1 
ATOM   10397 N  N    . PRO C 1 25  ? -19.914 65.396  46.915  1.00 96.51  ? 22   PRO C N    1 
ATOM   10398 C  CA   . PRO C 1 25  ? -20.170 66.804  46.566  1.00 103.89 ? 22   PRO C CA   1 
ATOM   10399 C  C    . PRO C 1 25  ? -19.888 67.134  45.093  1.00 102.02 ? 22   PRO C C    1 
ATOM   10400 O  O    . PRO C 1 25  ? -18.942 67.860  44.783  1.00 99.20  ? 22   PRO C O    1 
ATOM   10401 C  CB   . PRO C 1 25  ? -19.225 67.570  47.501  1.00 99.93  ? 22   PRO C CB   1 
ATOM   10402 C  CG   . PRO C 1 25  ? -18.098 66.630  47.745  1.00 99.99  ? 22   PRO C CG   1 
ATOM   10403 C  CD   . PRO C 1 25  ? -18.667 65.237  47.686  1.00 96.03  ? 22   PRO C CD   1 
ATOM   10404 H  HA   . PRO C 1 25  ? -21.087 67.040  46.776  1.00 124.66 ? 22   PRO C HA   1 
ATOM   10405 H  HB2  . PRO C 1 25  ? -18.912 68.377  47.063  1.00 119.92 ? 22   PRO C HB2  1 
ATOM   10406 H  HB3  . PRO C 1 25  ? -19.682 67.781  48.329  1.00 119.92 ? 22   PRO C HB3  1 
ATOM   10407 H  HG2  . PRO C 1 25  ? -17.426 66.749  47.056  1.00 119.99 ? 22   PRO C HG2  1 
ATOM   10408 H  HG3  . PRO C 1 25  ? -17.719 66.803  48.620  1.00 119.99 ? 22   PRO C HG3  1 
ATOM   10409 H  HD2  . PRO C 1 25  ? -18.057 64.643  47.222  1.00 115.23 ? 22   PRO C HD2  1 
ATOM   10410 H  HD3  . PRO C 1 25  ? -18.863 64.916  48.580  1.00 115.23 ? 22   PRO C HD3  1 
ATOM   10411 N  N    . TYR C 1 26  ? -20.738 66.614  44.208  1.00 102.07 ? 23   TYR C N    1 
ATOM   10412 C  CA   . TYR C 1 26  ? -20.616 66.833  42.765  1.00 99.60  ? 23   TYR C CA   1 
ATOM   10413 C  C    . TYR C 1 26  ? -20.505 68.306  42.354  1.00 106.89 ? 23   TYR C C    1 
ATOM   10414 O  O    . TYR C 1 26  ? -19.811 68.644  41.378  1.00 109.24 ? 23   TYR C O    1 
ATOM   10415 C  CB   . TYR C 1 26  ? -21.817 66.214  42.043  1.00 88.64  ? 23   TYR C CB   1 
ATOM   10416 C  CG   . TYR C 1 26  ? -21.899 64.705  42.127  1.00 94.72  ? 23   TYR C CG   1 
ATOM   10417 C  CD1  . TYR C 1 26  ? -21.201 63.903  41.235  1.00 103.35 ? 23   TYR C CD1  1 
ATOM   10418 C  CD2  . TYR C 1 26  ? -22.704 64.082  43.068  1.00 98.75  ? 23   TYR C CD2  1 
ATOM   10419 C  CE1  . TYR C 1 26  ? -21.280 62.526  41.297  1.00 102.34 ? 23   TYR C CE1  1 
ATOM   10420 C  CE2  . TYR C 1 26  ? -22.790 62.705  43.139  1.00 96.87  ? 23   TYR C CE2  1 
ATOM   10421 C  CZ   . TYR C 1 26  ? -22.078 61.932  42.247  1.00 103.53 ? 23   TYR C CZ   1 
ATOM   10422 O  OH   . TYR C 1 26  ? -22.153 60.560  42.301  1.00 110.88 ? 23   TYR C OH   1 
ATOM   10423 H  H    . TYR C 1 26  ? -21.408 66.120  44.422  1.00 122.48 ? 23   TYR C H    1 
ATOM   10424 H  HA   . TYR C 1 26  ? -19.818 66.380  42.451  1.00 119.52 ? 23   TYR C HA   1 
ATOM   10425 H  HB2  . TYR C 1 26  ? -22.630 66.574  42.431  1.00 106.37 ? 23   TYR C HB2  1 
ATOM   10426 H  HB3  . TYR C 1 26  ? -21.770 66.453  41.104  1.00 106.37 ? 23   TYR C HB3  1 
ATOM   10427 H  HD1  . TYR C 1 26  ? -20.660 64.300  40.591  1.00 124.02 ? 23   TYR C HD1  1 
ATOM   10428 H  HD2  . TYR C 1 26  ? -23.185 64.601  43.672  1.00 118.50 ? 23   TYR C HD2  1 
ATOM   10429 H  HE1  . TYR C 1 26  ? -20.801 62.003  40.696  1.00 122.81 ? 23   TYR C HE1  1 
ATOM   10430 H  HE2  . TYR C 1 26  ? -23.329 62.302  43.781  1.00 116.24 ? 23   TYR C HE2  1 
ATOM   10431 H  HH   . TYR C 1 26  ? -22.670 60.325  42.921  1.00 133.06 ? 23   TYR C HH   1 
ATOM   10432 N  N    . SER C 1 27  ? -21.173 69.181  43.098  1.00 97.90  ? 24   SER C N    1 
ATOM   10433 C  CA   . SER C 1 27  ? -21.203 70.592  42.740  1.00 104.34 ? 24   SER C CA   1 
ATOM   10434 C  C    . SER C 1 27  ? -19.804 71.194  42.815  1.00 104.54 ? 24   SER C C    1 
ATOM   10435 O  O    . SER C 1 27  ? -19.291 71.746  41.835  1.00 103.54 ? 24   SER C O    1 
ATOM   10436 C  CB   . SER C 1 27  ? -22.155 71.352  43.664  1.00 115.05 ? 24   SER C CB   1 
ATOM   10437 O  OG   . SER C 1 27  ? -23.484 70.875  43.534  1.00 128.88 ? 24   SER C OG   1 
ATOM   10438 H  H    . SER C 1 27  ? -21.613 68.985  43.810  1.00 117.48 ? 24   SER C H    1 
ATOM   10439 H  HA   . SER C 1 27  ? -21.525 70.684  41.830  1.00 125.21 ? 24   SER C HA   1 
ATOM   10440 H  HB2  . SER C 1 27  ? -21.866 71.232  44.582  1.00 138.06 ? 24   SER C HB2  1 
ATOM   10441 H  HB3  . SER C 1 27  ? -22.135 72.294  43.431  1.00 138.06 ? 24   SER C HB3  1 
ATOM   10442 H  HG   . SER C 1 27  ? -23.994 71.301  44.047  1.00 154.65 ? 24   SER C HG   1 
ATOM   10443 N  N    . GLN C 1 28  ? -19.189 71.055  43.985  1.00 112.38 ? 25   GLN C N    1 
ATOM   10444 C  CA   . GLN C 1 28  ? -17.852 71.579  44.235  1.00 106.21 ? 25   GLN C CA   1 
ATOM   10445 C  C    . GLN C 1 28  ? -16.843 70.867  43.345  1.00 101.90 ? 25   GLN C C    1 
ATOM   10446 O  O    . GLN C 1 28  ? -15.844 71.447  42.925  1.00 99.07  ? 25   GLN C O    1 
ATOM   10447 C  CB   . GLN C 1 28  ? -17.476 71.418  45.710  1.00 111.68 ? 25   GLN C CB   1 
ATOM   10448 C  CG   . GLN C 1 28  ? -18.372 72.197  46.662  1.00 111.17 ? 25   GLN C CG   1 
ATOM   10449 C  CD   . GLN C 1 28  ? -19.644 71.445  47.017  1.00 120.98 ? 25   GLN C CD   1 
ATOM   10450 O  OE1  . GLN C 1 28  ? -20.031 70.492  46.335  1.00 109.82 ? 25   GLN C OE1  1 
ATOM   10451 N  NE2  . GLN C 1 28  ? -20.304 71.874  48.087  1.00 130.73 ? 25   GLN C NE2  1 
ATOM   10452 H  H    . GLN C 1 28  ? -19.533 70.652  44.662  1.00 134.86 ? 25   GLN C H    1 
ATOM   10453 H  HA   . GLN C 1 28  ? -17.834 72.525  44.019  1.00 127.45 ? 25   GLN C HA   1 
ATOM   10454 H  HB2  . GLN C 1 28  ? -17.538 70.479  45.947  1.00 134.02 ? 25   GLN C HB2  1 
ATOM   10455 H  HB3  . GLN C 1 28  ? -16.567 71.730  45.836  1.00 134.02 ? 25   GLN C HB3  1 
ATOM   10456 H  HG2  . GLN C 1 28  ? -17.886 72.369  47.483  1.00 133.41 ? 25   GLN C HG2  1 
ATOM   10457 H  HG3  . GLN C 1 28  ? -18.625 73.035  46.243  1.00 133.41 ? 25   GLN C HG3  1 
ATOM   10458 H  HE21 . GLN C 1 28  ? -20.005 72.544  48.537  1.00 156.87 ? 25   GLN C HE21 1 
ATOM   10459 H  HE22 . GLN C 1 28  ? -21.030 71.483  48.331  1.00 156.87 ? 25   GLN C HE22 1 
ATOM   10460 N  N    . TYR C 1 29  ? -17.114 69.594  43.081  1.00 99.67  ? 26   TYR C N    1 
ATOM   10461 C  CA   . TYR C 1 29  ? -16.269 68.776  42.224  1.00 91.89  ? 26   TYR C CA   1 
ATOM   10462 C  C    . TYR C 1 29  ? -16.201 69.364  40.818  1.00 95.94  ? 26   TYR C C    1 
ATOM   10463 O  O    . TYR C 1 29  ? -15.109 69.609  40.285  1.00 101.83 ? 26   TYR C O    1 
ATOM   10464 C  CB   . TYR C 1 29  ? -16.828 67.359  42.184  1.00 75.96  ? 26   TYR C CB   1 
ATOM   10465 C  CG   . TYR C 1 29  ? -15.840 66.275  41.838  1.00 89.09  ? 26   TYR C CG   1 
ATOM   10466 C  CD1  . TYR C 1 29  ? -14.903 65.848  42.769  1.00 98.53  ? 26   TYR C CD1  1 
ATOM   10467 C  CD2  . TYR C 1 29  ? -15.875 65.640  40.608  1.00 97.31  ? 26   TYR C CD2  1 
ATOM   10468 C  CE1  . TYR C 1 29  ? -14.004 64.839  42.475  1.00 88.32  ? 26   TYR C CE1  1 
ATOM   10469 C  CE2  . TYR C 1 29  ? -14.981 64.624  40.301  1.00 97.03  ? 26   TYR C CE2  1 
ATOM   10470 C  CZ   . TYR C 1 29  ? -14.050 64.226  41.238  1.00 91.22  ? 26   TYR C CZ   1 
ATOM   10471 O  OH   . TYR C 1 29  ? -13.162 63.218  40.932  1.00 87.30  ? 26   TYR C OH   1 
ATOM   10472 H  H    . TYR C 1 29  ? -17.796 69.175  43.394  1.00 119.61 ? 26   TYR C H    1 
ATOM   10473 H  HA   . TYR C 1 29  ? -15.371 68.743  42.589  1.00 110.26 ? 26   TYR C HA   1 
ATOM   10474 H  HB2  . TYR C 1 29  ? -17.194 67.150  43.057  1.00 91.15  ? 26   TYR C HB2  1 
ATOM   10475 H  HB3  . TYR C 1 29  ? -17.536 67.328  41.521  1.00 91.15  ? 26   TYR C HB3  1 
ATOM   10476 H  HD1  . TYR C 1 29  ? -14.871 66.258  43.604  1.00 118.24 ? 26   TYR C HD1  1 
ATOM   10477 H  HD2  . TYR C 1 29  ? -16.502 65.904  39.974  1.00 116.77 ? 26   TYR C HD2  1 
ATOM   10478 H  HE1  . TYR C 1 29  ? -13.378 64.571  43.107  1.00 105.98 ? 26   TYR C HE1  1 
ATOM   10479 H  HE2  . TYR C 1 29  ? -15.010 64.213  39.467  1.00 116.44 ? 26   TYR C HE2  1 
ATOM   10480 H  HH   . TYR C 1 29  ? -13.302 62.938  40.152  1.00 104.76 ? 26   TYR C HH   1 
ATOM   10481 N  N    . TYR C 1 30  ? -17.369 69.628  40.230  1.00 100.43 ? 27   TYR C N    1 
ATOM   10482 C  CA   . TYR C 1 30  ? -17.413 70.211  38.886  1.00 101.81 ? 27   TYR C CA   1 
ATOM   10483 C  C    . TYR C 1 30  ? -16.887 71.647  38.913  1.00 104.72 ? 27   TYR C C    1 
ATOM   10484 O  O    . TYR C 1 30  ? -16.198 72.078  37.979  1.00 101.84 ? 27   TYR C O    1 
ATOM   10485 C  CB   . TYR C 1 30  ? -18.832 70.176  38.318  1.00 111.16 ? 27   TYR C CB   1 
ATOM   10486 C  CG   . TYR C 1 30  ? -18.934 70.660  36.882  1.00 112.81 ? 27   TYR C CG   1 
ATOM   10487 C  CD1  . TYR C 1 30  ? -18.664 69.805  35.821  1.00 107.97 ? 27   TYR C CD1  1 
ATOM   10488 C  CD2  . TYR C 1 30  ? -19.310 71.966  36.588  1.00 113.77 ? 27   TYR C CD2  1 
ATOM   10489 C  CE1  . TYR C 1 30  ? -18.758 70.238  34.506  1.00 110.92 ? 27   TYR C CE1  1 
ATOM   10490 C  CE2  . TYR C 1 30  ? -19.407 72.409  35.274  1.00 113.14 ? 27   TYR C CE2  1 
ATOM   10491 C  CZ   . TYR C 1 30  ? -19.131 71.541  34.236  1.00 117.03 ? 27   TYR C CZ   1 
ATOM   10492 O  OH   . TYR C 1 30  ? -19.225 71.973  32.926  1.00 114.68 ? 27   TYR C OH   1 
ATOM   10493 H  H    . TYR C 1 30  ? -18.140 69.481  40.581  1.00 120.52 ? 27   TYR C H    1 
ATOM   10494 H  HA   . TYR C 1 30  ? -16.841 69.693  38.298  1.00 122.17 ? 27   TYR C HA   1 
ATOM   10495 H  HB2  . TYR C 1 30  ? -19.157 69.262  38.346  1.00 133.39 ? 27   TYR C HB2  1 
ATOM   10496 H  HB3  . TYR C 1 30  ? -19.401 70.743  38.863  1.00 133.39 ? 27   TYR C HB3  1 
ATOM   10497 H  HD1  . TYR C 1 30  ? -18.413 68.927  35.995  1.00 129.57 ? 27   TYR C HD1  1 
ATOM   10498 H  HD2  . TYR C 1 30  ? -19.497 72.555  37.283  1.00 136.52 ? 27   TYR C HD2  1 
ATOM   10499 H  HE1  . TYR C 1 30  ? -18.572 69.652  33.808  1.00 133.11 ? 27   TYR C HE1  1 
ATOM   10500 H  HE2  . TYR C 1 30  ? -19.657 73.286  35.095  1.00 135.77 ? 27   TYR C HE2  1 
ATOM   10501 H  HH   . TYR C 1 30  ? -19.459 72.779  32.905  1.00 137.61 ? 27   TYR C HH   1 
ATOM   10502 N  N    . ARG C 1 31  ? -17.209 72.377  39.984  1.00 101.15 ? 28   ARG C N    1 
ATOM   10503 C  CA   . ARG C 1 31  ? -16.666 73.721  40.194  1.00 96.18  ? 28   ARG C CA   1 
ATOM   10504 C  C    . ARG C 1 31  ? -15.144 73.678  40.133  1.00 102.12 ? 28   ARG C C    1 
ATOM   10505 O  O    . ARG C 1 31  ? -14.506 74.530  39.515  1.00 111.44 ? 28   ARG C O    1 
ATOM   10506 C  CB   . ARG C 1 31  ? -17.106 74.292  41.543  1.00 104.59 ? 28   ARG C CB   1 
ATOM   10507 C  CG   . ARG C 1 31  ? -18.518 74.845  41.587  1.00 107.90 ? 28   ARG C CG   1 
ATOM   10508 C  CD   . ARG C 1 31  ? -18.855 75.357  42.986  1.00 105.43 ? 28   ARG C CD   1 
ATOM   10509 N  NE   . ARG C 1 31  ? -18.025 76.499  43.377  1.00 104.07 ? 28   ARG C NE   1 
ATOM   10510 C  CZ   . ARG C 1 31  ? -17.986 77.022  44.602  1.00 110.49 ? 28   ARG C CZ   1 
ATOM   10511 N  NH1  . ARG C 1 31  ? -18.723 76.502  45.575  1.00 116.16 ? 28   ARG C NH1  1 
ATOM   10512 N  NH2  . ARG C 1 31  ? -17.200 78.060  44.859  1.00 102.79 ? 28   ARG C NH2  1 
ATOM   10513 H  H    . ARG C 1 31  ? -17.743 72.115  40.605  1.00 121.38 ? 28   ARG C H    1 
ATOM   10514 H  HA   . ARG C 1 31  ? -16.985 74.311  39.493  1.00 115.41 ? 28   ARG C HA   1 
ATOM   10515 H  HB2  . ARG C 1 31  ? -17.048 73.589  42.208  1.00 125.51 ? 28   ARG C HB2  1 
ATOM   10516 H  HB3  . ARG C 1 31  ? -16.503 75.014  41.781  1.00 125.51 ? 28   ARG C HB3  1 
ATOM   10517 H  HG2  . ARG C 1 31  ? -18.594 75.585  40.963  1.00 129.47 ? 28   ARG C HG2  1 
ATOM   10518 H  HG3  . ARG C 1 31  ? -19.146 74.143  41.357  1.00 129.47 ? 28   ARG C HG3  1 
ATOM   10519 H  HD2  . ARG C 1 31  ? -19.783 75.638  43.006  1.00 126.51 ? 28   ARG C HD2  1 
ATOM   10520 H  HD3  . ARG C 1 31  ? -18.709 74.645  43.628  1.00 126.51 ? 28   ARG C HD3  1 
ATOM   10521 H  HE   . ARG C 1 31  ? -17.528 76.858  42.774  1.00 124.89 ? 28   ARG C HE   1 
ATOM   10522 H  HH11 . ARG C 1 31  ? -19.234 75.829  45.416  1.00 139.39 ? 28   ARG C HH11 1 
ATOM   10523 H  HH12 . ARG C 1 31  ? -18.694 76.842  46.365  1.00 139.39 ? 28   ARG C HH12 1 
ATOM   10524 H  HH21 . ARG C 1 31  ? -16.718 78.400  44.232  1.00 123.35 ? 28   ARG C HH21 1 
ATOM   10525 H  HH22 . ARG C 1 31  ? -17.174 78.395  45.651  1.00 123.35 ? 28   ARG C HH22 1 
ATOM   10526 N  N    . TRP C 1 32  ? -14.573 72.691  40.819  1.00 97.72  ? 29   TRP C N    1 
ATOM   10527 C  CA   . TRP C 1 32  ? -13.134 72.478  40.823  1.00 97.89  ? 29   TRP C CA   1 
ATOM   10528 C  C    . TRP C 1 32  ? -12.628 72.174  39.421  1.00 89.06  ? 29   TRP C C    1 
ATOM   10529 O  O    . TRP C 1 32  ? -11.885 72.956  38.824  1.00 84.92  ? 29   TRP C O    1 
ATOM   10530 C  CB   . TRP C 1 32  ? -12.766 71.322  41.763  1.00 96.02  ? 29   TRP C CB   1 
ATOM   10531 C  CG   . TRP C 1 32  ? -11.297 71.015  41.807  1.00 91.89  ? 29   TRP C CG   1 
ATOM   10532 C  CD1  . TRP C 1 32  ? -10.269 71.882  41.576  1.00 87.71  ? 29   TRP C CD1  1 
ATOM   10533 C  CD2  . TRP C 1 32  ? -10.697 69.740  42.057  1.00 82.84  ? 29   TRP C CD2  1 
ATOM   10534 N  NE1  . TRP C 1 32  ? -9.066  71.230  41.682  1.00 86.05  ? 29   TRP C NE1  1 
ATOM   10535 C  CE2  . TRP C 1 32  ? -9.301  69.912  41.976  1.00 84.46  ? 29   TRP C CE2  1 
ATOM   10536 C  CE3  . TRP C 1 32  ? -11.205 68.471  42.348  1.00 85.13  ? 29   TRP C CE3  1 
ATOM   10537 C  CZ2  . TRP C 1 32  ? -8.405  68.862  42.182  1.00 80.17  ? 29   TRP C CZ2  1 
ATOM   10538 C  CZ3  . TRP C 1 32  ? -10.314 67.429  42.551  1.00 87.28  ? 29   TRP C CZ3  1 
ATOM   10539 C  CH2  . TRP C 1 32  ? -8.931  67.631  42.468  1.00 78.24  ? 29   TRP C CH2  1 
ATOM   10540 H  H    . TRP C 1 32  ? -15.008 72.123  41.297  1.00 117.27 ? 29   TRP C H    1 
ATOM   10541 H  HA   . TRP C 1 32  ? -12.692 73.281  41.139  1.00 117.47 ? 29   TRP C HA   1 
ATOM   10542 H  HB2  . TRP C 1 32  ? -13.047 71.551  42.663  1.00 115.22 ? 29   TRP C HB2  1 
ATOM   10543 H  HB3  . TRP C 1 32  ? -13.227 70.521  41.469  1.00 115.22 ? 29   TRP C HB3  1 
ATOM   10544 H  HD1  . TRP C 1 32  ? -10.368 72.786  41.378  1.00 105.25 ? 29   TRP C HD1  1 
ATOM   10545 H  HE1  . TRP C 1 32  ? -8.292  71.590  41.581  1.00 103.26 ? 29   TRP C HE1  1 
ATOM   10546 H  HE3  . TRP C 1 32  ? -12.122 68.330  42.407  1.00 102.16 ? 29   TRP C HE3  1 
ATOM   10547 H  HZ2  . TRP C 1 32  ? -7.486  68.993  42.127  1.00 96.21  ? 29   TRP C HZ2  1 
ATOM   10548 H  HZ3  . TRP C 1 32  ? -10.641 66.580  42.747  1.00 104.74 ? 29   TRP C HZ3  1 
ATOM   10549 H  HH2  . TRP C 1 32  ? -8.357  66.912  42.608  1.00 93.89  ? 29   TRP C HH2  1 
ATOM   10550 N  N    . LEU C 1 33  ? -13.060 71.038  38.887  1.00 86.50  ? 30   LEU C N    1 
ATOM   10551 C  CA   . LEU C 1 33  ? -12.450 70.505  37.674  1.00 97.43  ? 30   LEU C CA   1 
ATOM   10552 C  C    . LEU C 1 33  ? -12.830 71.260  36.401  1.00 99.90  ? 30   LEU C C    1 
ATOM   10553 O  O    . LEU C 1 33  ? -12.162 71.106  35.378  1.00 95.27  ? 30   LEU C O    1 
ATOM   10554 C  CB   . LEU C 1 33  ? -12.812 69.028  37.525  1.00 90.11  ? 30   LEU C CB   1 
ATOM   10555 C  CG   . LEU C 1 33  ? -12.357 68.155  38.696  1.00 90.81  ? 30   LEU C CG   1 
ATOM   10556 C  CD1  . LEU C 1 33  ? -12.764 66.707  38.465  1.00 90.50  ? 30   LEU C CD1  1 
ATOM   10557 C  CD2  . LEU C 1 33  ? -10.848 68.261  38.927  1.00 88.93  ? 30   LEU C CD2  1 
ATOM   10558 H  H    . LEU C 1 33  ? -13.700 70.559  39.205  1.00 103.81 ? 30   LEU C H    1 
ATOM   10559 H  HA   . LEU C 1 33  ? -11.486 70.560  37.767  1.00 116.92 ? 30   LEU C HA   1 
ATOM   10560 H  HB2  . LEU C 1 33  ? -13.776 68.949  37.453  1.00 108.13 ? 30   LEU C HB2  1 
ATOM   10561 H  HB3  . LEU C 1 33  ? -12.394 68.684  36.720  1.00 108.13 ? 30   LEU C HB3  1 
ATOM   10562 H  HG   . LEU C 1 33  ? -12.801 68.461  39.502  1.00 108.97 ? 30   LEU C HG   1 
ATOM   10563 H  HD11 . LEU C 1 33  ? -12.349 66.390  37.648  1.00 108.60 ? 30   LEU C HD11 1 
ATOM   10564 H  HD12 . LEU C 1 33  ? -12.467 66.173  39.218  1.00 108.60 ? 30   LEU C HD12 1 
ATOM   10565 H  HD13 . LEU C 1 33  ? -13.730 66.660  38.386  1.00 108.60 ? 30   LEU C HD13 1 
ATOM   10566 H  HD21 . LEU C 1 33  ? -10.623 69.184  39.123  1.00 106.72 ? 30   LEU C HD21 1 
ATOM   10567 H  HD22 . LEU C 1 33  ? -10.603 67.695  39.675  1.00 106.72 ? 30   LEU C HD22 1 
ATOM   10568 H  HD23 . LEU C 1 33  ? -10.385 67.970  38.126  1.00 106.72 ? 30   LEU C HD23 1 
ATOM   10569 N  N    . ASN C 1 34  ? -13.876 72.083  36.455  1.00 98.18  ? 31   ASN C N    1 
ATOM   10570 C  CA   . ASN C 1 34  ? -14.254 72.871  35.283  1.00 106.42 ? 31   ASN C CA   1 
ATOM   10571 C  C    . ASN C 1 34  ? -13.492 74.198  35.237  1.00 105.60 ? 31   ASN C C    1 
ATOM   10572 O  O    . ASN C 1 34  ? -13.352 74.802  34.172  1.00 109.89 ? 31   ASN C O    1 
ATOM   10573 C  CB   . ASN C 1 34  ? -15.763 73.133  35.268  1.00 112.86 ? 31   ASN C CB   1 
ATOM   10574 C  CG   . ASN C 1 34  ? -16.237 73.775  33.969  1.00 113.11 ? 31   ASN C CG   1 
ATOM   10575 O  OD1  . ASN C 1 34  ? -15.846 73.360  32.874  1.00 106.04 ? 31   ASN C OD1  1 
ATOM   10576 N  ND2  . ASN C 1 34  ? -17.076 74.800  34.087  1.00 109.79 ? 31   ASN C ND2  1 
ATOM   10577 H  H    . ASN C 1 34  ? -14.376 72.202  37.145  1.00 117.82 ? 31   ASN C H    1 
ATOM   10578 H  HA   . ASN C 1 34  ? -14.031 72.371  34.483  1.00 127.70 ? 31   ASN C HA   1 
ATOM   10579 H  HB2  . ASN C 1 34  ? -16.231 72.290  35.375  1.00 135.43 ? 31   ASN C HB2  1 
ATOM   10580 H  HB3  . ASN C 1 34  ? -15.988 73.732  35.998  1.00 135.43 ? 31   ASN C HB3  1 
ATOM   10581 H  HD21 . ASN C 1 34  ? -17.323 75.066  34.867  1.00 131.75 ? 31   ASN C HD21 1 
ATOM   10582 H  HD22 . ASN C 1 34  ? -17.373 75.197  33.384  1.00 131.75 ? 31   ASN C HD22 1 
ATOM   10583 N  N    . TYR C 1 35  ? -12.988 74.632  36.390  1.00 104.35 ? 32   TYR C N    1 
ATOM   10584 C  CA   . TYR C 1 35  ? -12.143 75.826  36.481  1.00 113.18 ? 32   TYR C CA   1 
ATOM   10585 C  C    . TYR C 1 35  ? -12.765 77.058  35.816  1.00 115.88 ? 32   TYR C C    1 
ATOM   10586 O  O    . TYR C 1 35  ? -12.133 77.722  34.994  1.00 112.35 ? 32   TYR C O    1 
ATOM   10587 C  CB   . TYR C 1 35  ? -10.763 75.536  35.875  1.00 107.69 ? 32   TYR C CB   1 
ATOM   10588 C  CG   . TYR C 1 35  ? -9.908  74.662  36.763  1.00 98.41  ? 32   TYR C CG   1 
ATOM   10589 C  CD1  . TYR C 1 35  ? -9.287  75.188  37.888  1.00 94.62  ? 32   TYR C CD1  1 
ATOM   10590 C  CD2  . TYR C 1 35  ? -9.736  73.312  36.490  1.00 95.16  ? 32   TYR C CD2  1 
ATOM   10591 C  CE1  . TYR C 1 35  ? -8.508  74.395  38.717  1.00 89.78  ? 32   TYR C CE1  1 
ATOM   10592 C  CE2  . TYR C 1 35  ? -8.958  72.509  37.310  1.00 95.38  ? 32   TYR C CE2  1 
ATOM   10593 C  CZ   . TYR C 1 35  ? -8.346  73.057  38.424  1.00 96.16  ? 32   TYR C CZ   1 
ATOM   10594 O  OH   . TYR C 1 35  ? -7.575  72.264  39.245  1.00 80.89  ? 32   TYR C OH   1 
ATOM   10595 H  H    . TYR C 1 35  ? -13.122 74.247  37.147  1.00 125.22 ? 32   TYR C H    1 
ATOM   10596 H  HA   . TYR C 1 35  ? -12.012 76.037  37.418  1.00 135.82 ? 32   TYR C HA   1 
ATOM   10597 H  HB2  . TYR C 1 35  ? -10.880 75.079  35.027  1.00 129.23 ? 32   TYR C HB2  1 
ATOM   10598 H  HB3  . TYR C 1 35  ? -10.296 76.375  35.739  1.00 129.23 ? 32   TYR C HB3  1 
ATOM   10599 H  HD1  . TYR C 1 35  ? -9.394  76.090  38.089  1.00 113.55 ? 32   TYR C HD1  1 
ATOM   10600 H  HD2  . TYR C 1 35  ? -10.146 72.941  35.742  1.00 114.19 ? 32   TYR C HD2  1 
ATOM   10601 H  HE1  . TYR C 1 35  ? -8.096  74.764  39.466  1.00 107.74 ? 32   TYR C HE1  1 
ATOM   10602 H  HE2  . TYR C 1 35  ? -8.850  71.607  37.113  1.00 114.45 ? 32   TYR C HE2  1 
ATOM   10603 H  HH   . TYR C 1 35  ? -7.560  71.477  38.954  1.00 97.07  ? 32   TYR C HH   1 
ATOM   10604 N  N    . GLY C 1 36  ? -14.004 77.362  36.191  1.00 118.46 ? 33   GLY C N    1 
ATOM   10605 C  CA   . GLY C 1 36  ? -14.664 78.576  35.740  1.00 126.47 ? 33   GLY C CA   1 
ATOM   10606 C  C    . GLY C 1 36  ? -14.886 78.700  34.240  1.00 114.58 ? 33   GLY C C    1 
ATOM   10607 O  O    . GLY C 1 36  ? -14.971 79.815  33.724  1.00 117.68 ? 33   GLY C O    1 
ATOM   10608 H  H    . GLY C 1 36  ? -14.486 76.875  36.711  1.00 142.16 ? 33   GLY C H    1 
ATOM   10609 H  HA2  . GLY C 1 36  ? -15.530 78.637  36.172  1.00 151.76 ? 33   GLY C HA2  1 
ATOM   10610 H  HA3  . GLY C 1 36  ? -14.136 79.339  36.024  1.00 151.76 ? 33   GLY C HA3  1 
ATOM   10611 N  N    . GLY C 1 37  ? -14.955 77.570  33.538  1.00 113.58 ? 34   GLY C N    1 
ATOM   10612 C  CA   . GLY C 1 37  ? -15.286 77.557  32.118  1.00 107.26 ? 34   GLY C CA   1 
ATOM   10613 C  C    . GLY C 1 37  ? -14.385 78.350  31.183  1.00 98.90  ? 34   GLY C C    1 
ATOM   10614 O  O    . GLY C 1 37  ? -14.623 78.381  29.975  1.00 107.35 ? 34   GLY C O    1 
ATOM   10615 H  H    . GLY C 1 37  ? -14.813 76.788  33.867  1.00 136.30 ? 34   GLY C H    1 
ATOM   10616 H  HA2  . GLY C 1 37  ? -15.284 76.636  31.812  1.00 128.71 ? 34   GLY C HA2  1 
ATOM   10617 H  HA3  . GLY C 1 37  ? -16.188 77.899  32.011  1.00 128.71 ? 34   GLY C HA3  1 
ATOM   10618 N  N    . VAL C 1 38  ? -13.353 78.983  31.736  1.00 111.36 ? 35   VAL C N    1 
ATOM   10619 C  CA   . VAL C 1 38  ? -12.430 79.828  30.976  1.00 112.80 ? 35   VAL C CA   1 
ATOM   10620 C  C    . VAL C 1 38  ? -11.910 79.142  29.707  1.00 97.80  ? 35   VAL C C    1 
ATOM   10621 O  O    . VAL C 1 38  ? -11.746 79.783  28.669  1.00 101.23 ? 35   VAL C O    1 
ATOM   10622 C  CB   . VAL C 1 38  ? -11.225 80.259  31.853  1.00 113.11 ? 35   VAL C CB   1 
ATOM   10623 C  CG1  . VAL C 1 38  ? -11.703 81.116  33.022  1.00 102.41 ? 35   VAL C CG1  1 
ATOM   10624 C  CG2  . VAL C 1 38  ? -10.456 79.041  32.370  1.00 114.51 ? 35   VAL C CG2  1 
ATOM   10625 H  H    . VAL C 1 38  ? -13.161 78.937  32.573  1.00 133.63 ? 35   VAL C H    1 
ATOM   10626 H  HA   . VAL C 1 38  ? -12.899 80.633  30.704  1.00 135.37 ? 35   VAL C HA   1 
ATOM   10627 H  HB   . VAL C 1 38  ? -10.617 80.793  31.318  1.00 135.73 ? 35   VAL C HB   1 
ATOM   10628 H  HG11 . VAL C 1 38  ? -12.324 80.599  33.559  1.00 122.89 ? 35   VAL C HG11 1 
ATOM   10629 H  HG12 . VAL C 1 38  ? -10.937 81.375  33.558  1.00 122.89 ? 35   VAL C HG12 1 
ATOM   10630 H  HG13 . VAL C 1 38  ? -12.146 81.906  32.674  1.00 122.89 ? 35   VAL C HG13 1 
ATOM   10631 H  HG21 . VAL C 1 38  ? -10.127 78.532  31.613  1.00 137.42 ? 35   VAL C HG21 1 
ATOM   10632 H  HG22 . VAL C 1 38  ? -9.712  79.346  32.913  1.00 137.42 ? 35   VAL C HG22 1 
ATOM   10633 H  HG23 . VAL C 1 38  ? -11.053 78.494  32.903  1.00 137.42 ? 35   VAL C HG23 1 
ATOM   10634 N  N    . ILE C 1 39  ? -11.646 77.844  29.808  1.00 96.46  ? 36   ILE C N    1 
ATOM   10635 C  CA   . ILE C 1 39  ? -11.162 77.046  28.684  1.00 96.74  ? 36   ILE C CA   1 
ATOM   10636 C  C    . ILE C 1 39  ? -12.173 75.960  28.330  1.00 104.08 ? 36   ILE C C    1 
ATOM   10637 O  O    . ILE C 1 39  ? -12.630 75.214  29.200  1.00 102.72 ? 36   ILE C O    1 
ATOM   10638 C  CB   . ILE C 1 39  ? -9.786  76.415  28.999  1.00 93.02  ? 36   ILE C CB   1 
ATOM   10639 C  CG1  . ILE C 1 39  ? -8.684  77.452  28.748  1.00 94.63  ? 36   ILE C CG1  1 
ATOM   10640 C  CG2  . ILE C 1 39  ? -9.542  75.163  28.